data_1FSX
# 
_entry.id   1FSX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1FSX         
RCSB  RCSB011873   
WWPDB D_1000011873 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1FSX 
_pdbx_database_status.recvd_initial_deposition_date   2000-09-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Safo, M.K.'    1 
'Abraham, D.J.' 2 
# 
_citation.id                        primary 
_citation.title                     
;The X-ray structure determination of bovine carbonmonoxy hemoglobin at 2.1 A resoultion and its relationship to the quaternary structures of other hemoglobin crystal froms.
;
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            10 
_citation.page_first                1091 
_citation.page_last                 1099 
_citation.year                      2001 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11369847 
_citation.pdbx_database_id_DOI      10.1110/ps.48301 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Safo, M.K.'    1 
primary 'Abraham, D.J.' 2 
# 
_cell.entry_id           1FSX 
_cell.length_a           79.41 
_cell.length_b           110.63 
_cell.length_c           65.40 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1FSX 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'HEMOGLOBIN ALPHA CHAIN'          15077.171 2   ? ? ? ? 
2 polymer     nat 'HEMOGLOBIN BETA CHAIN'           15977.382 2   ? ? ? ? 
3 non-polymer syn 'CARBON MONOXIDE'                 28.010    4   ? ? ? ? 
4 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   4   ? ? ? ? 
5 water       nat water                             18.015    136 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGAKVAAALTKAVEHLDDLPGAL
SELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR
;
;VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGAKVAAALTKAVEHLDDLPGAL
SELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR
;
A,C ? 
2 'polypeptide(L)' no no 
;MLTAEEKAAVTAFWGKVKVDEVGGEALGRLLVVYPWTQRFFESFGDLSTADAVMNNPKVKAHGKKVLDSFSNGMKHLDDL
KGTFAALSELHCDKLHVDPENFKLLGNVLVVVLARNFGKEFTPVLQADFQKVVAGVANALAHRYH
;
;MLTAEEKAAVTAFWGKVKVDEVGGEALGRLLVVYPWTQRFFESFGDLSTADAVMNNPKVKAHGKKVLDSFSNGMKHLDDL
KGTFAALSELHCDKLHVDPENFKLLGNVLVVVLARNFGKEFTPVLQADFQKVVAGVANALAHRYH
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   LEU n 
1 3   SER n 
1 4   ALA n 
1 5   ALA n 
1 6   ASP n 
1 7   LYS n 
1 8   GLY n 
1 9   ASN n 
1 10  VAL n 
1 11  LYS n 
1 12  ALA n 
1 13  ALA n 
1 14  TRP n 
1 15  GLY n 
1 16  LYS n 
1 17  VAL n 
1 18  GLY n 
1 19  GLY n 
1 20  HIS n 
1 21  ALA n 
1 22  ALA n 
1 23  GLU n 
1 24  TYR n 
1 25  GLY n 
1 26  ALA n 
1 27  GLU n 
1 28  ALA n 
1 29  LEU n 
1 30  GLU n 
1 31  ARG n 
1 32  MET n 
1 33  PHE n 
1 34  LEU n 
1 35  SER n 
1 36  PHE n 
1 37  PRO n 
1 38  THR n 
1 39  THR n 
1 40  LYS n 
1 41  THR n 
1 42  TYR n 
1 43  PHE n 
1 44  PRO n 
1 45  HIS n 
1 46  PHE n 
1 47  ASP n 
1 48  LEU n 
1 49  SER n 
1 50  HIS n 
1 51  GLY n 
1 52  SER n 
1 53  ALA n 
1 54  GLN n 
1 55  VAL n 
1 56  LYS n 
1 57  GLY n 
1 58  HIS n 
1 59  GLY n 
1 60  ALA n 
1 61  LYS n 
1 62  VAL n 
1 63  ALA n 
1 64  ALA n 
1 65  ALA n 
1 66  LEU n 
1 67  THR n 
1 68  LYS n 
1 69  ALA n 
1 70  VAL n 
1 71  GLU n 
1 72  HIS n 
1 73  LEU n 
1 74  ASP n 
1 75  ASP n 
1 76  LEU n 
1 77  PRO n 
1 78  GLY n 
1 79  ALA n 
1 80  LEU n 
1 81  SER n 
1 82  GLU n 
1 83  LEU n 
1 84  SER n 
1 85  ASP n 
1 86  LEU n 
1 87  HIS n 
1 88  ALA n 
1 89  HIS n 
1 90  LYS n 
1 91  LEU n 
1 92  ARG n 
1 93  VAL n 
1 94  ASP n 
1 95  PRO n 
1 96  VAL n 
1 97  ASN n 
1 98  PHE n 
1 99  LYS n 
1 100 LEU n 
1 101 LEU n 
1 102 SER n 
1 103 HIS n 
1 104 SER n 
1 105 LEU n 
1 106 LEU n 
1 107 VAL n 
1 108 THR n 
1 109 LEU n 
1 110 ALA n 
1 111 SER n 
1 112 HIS n 
1 113 LEU n 
1 114 PRO n 
1 115 SER n 
1 116 ASP n 
1 117 PHE n 
1 118 THR n 
1 119 PRO n 
1 120 ALA n 
1 121 VAL n 
1 122 HIS n 
1 123 ALA n 
1 124 SER n 
1 125 LEU n 
1 126 ASP n 
1 127 LYS n 
1 128 PHE n 
1 129 LEU n 
1 130 ALA n 
1 131 ASN n 
1 132 VAL n 
1 133 SER n 
1 134 THR n 
1 135 VAL n 
1 136 LEU n 
1 137 THR n 
1 138 SER n 
1 139 LYS n 
1 140 TYR n 
1 141 ARG n 
2 1   MET n 
2 2   LEU n 
2 3   THR n 
2 4   ALA n 
2 5   GLU n 
2 6   GLU n 
2 7   LYS n 
2 8   ALA n 
2 9   ALA n 
2 10  VAL n 
2 11  THR n 
2 12  ALA n 
2 13  PHE n 
2 14  TRP n 
2 15  GLY n 
2 16  LYS n 
2 17  VAL n 
2 18  LYS n 
2 19  VAL n 
2 20  ASP n 
2 21  GLU n 
2 22  VAL n 
2 23  GLY n 
2 24  GLY n 
2 25  GLU n 
2 26  ALA n 
2 27  LEU n 
2 28  GLY n 
2 29  ARG n 
2 30  LEU n 
2 31  LEU n 
2 32  VAL n 
2 33  VAL n 
2 34  TYR n 
2 35  PRO n 
2 36  TRP n 
2 37  THR n 
2 38  GLN n 
2 39  ARG n 
2 40  PHE n 
2 41  PHE n 
2 42  GLU n 
2 43  SER n 
2 44  PHE n 
2 45  GLY n 
2 46  ASP n 
2 47  LEU n 
2 48  SER n 
2 49  THR n 
2 50  ALA n 
2 51  ASP n 
2 52  ALA n 
2 53  VAL n 
2 54  MET n 
2 55  ASN n 
2 56  ASN n 
2 57  PRO n 
2 58  LYS n 
2 59  VAL n 
2 60  LYS n 
2 61  ALA n 
2 62  HIS n 
2 63  GLY n 
2 64  LYS n 
2 65  LYS n 
2 66  VAL n 
2 67  LEU n 
2 68  ASP n 
2 69  SER n 
2 70  PHE n 
2 71  SER n 
2 72  ASN n 
2 73  GLY n 
2 74  MET n 
2 75  LYS n 
2 76  HIS n 
2 77  LEU n 
2 78  ASP n 
2 79  ASP n 
2 80  LEU n 
2 81  LYS n 
2 82  GLY n 
2 83  THR n 
2 84  PHE n 
2 85  ALA n 
2 86  ALA n 
2 87  LEU n 
2 88  SER n 
2 89  GLU n 
2 90  LEU n 
2 91  HIS n 
2 92  CYS n 
2 93  ASP n 
2 94  LYS n 
2 95  LEU n 
2 96  HIS n 
2 97  VAL n 
2 98  ASP n 
2 99  PRO n 
2 100 GLU n 
2 101 ASN n 
2 102 PHE n 
2 103 LYS n 
2 104 LEU n 
2 105 LEU n 
2 106 GLY n 
2 107 ASN n 
2 108 VAL n 
2 109 LEU n 
2 110 VAL n 
2 111 VAL n 
2 112 VAL n 
2 113 LEU n 
2 114 ALA n 
2 115 ARG n 
2 116 ASN n 
2 117 PHE n 
2 118 GLY n 
2 119 LYS n 
2 120 GLU n 
2 121 PHE n 
2 122 THR n 
2 123 PRO n 
2 124 VAL n 
2 125 LEU n 
2 126 GLN n 
2 127 ALA n 
2 128 ASP n 
2 129 PHE n 
2 130 GLN n 
2 131 LYS n 
2 132 VAL n 
2 133 VAL n 
2 134 ALA n 
2 135 GLY n 
2 136 VAL n 
2 137 ALA n 
2 138 ASN n 
2 139 ALA n 
2 140 LEU n 
2 141 ALA n 
2 142 HIS n 
2 143 ARG n 
2 144 TYR n 
2 145 HIS n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? BLOOD ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? BLOOD ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP HBA_BOVIN P01966 1 
;VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGAKVAAALTKAVEHLDDLPGAL
SELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR
;
1 ? 
2 UNP HBB_BOVIN P02070 2 
;MLTAEEKAAVTAFWGKVKVDEVGGEALGRLLVVYPWTQRFFESFGDLSTADAVMNNPKVKAHGKKVLDSFSNGMKHLDDL
KGTFAALSELHCDKLHVDPENFKLLGNVLVVVLARNFGKEFTPVLQADFQKVVAGVANALAHRYH
;
1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1FSX A 1 ? 141 ? P01966 1 ? 141 ? 1   141 
2 1 1FSX C 1 ? 141 ? P01966 1 ? 141 ? 401 541 
3 2 1FSX B 1 ? 145 ? P02070 1 ? 145 ? 202 346 
4 2 1FSX D 1 ? 145 ? P02070 1 ? 145 ? 602 746 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?    'C4 H7 N O4'       133.103 
CMO non-polymer         . 'CARBON MONOXIDE'                 ?    'C O'              28.010  
CYS 'L-peptide linking' y CYSTEINE                          ?    'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?    'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?    'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?    'H2 O'             18.015  
LEU 'L-peptide linking' y LEUCINE                           ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?    'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?    'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1FSX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   46.80 
_exptl_crystal.density_Matthews      2.31 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'LIQUID DIFFUSION' 
_exptl_crystal_grow.pH              7.3 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'Potassium phosphate, sodium phosphate, pyridine, benzene, pH 7.3, LIQUID DIFFUSION, temperature 298.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS II' 
_diffrn_detector.pdbx_collection_date   1993-04-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1FSX 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             64.5 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   32949 
_reflns.number_all                   122102 
_reflns.percent_possible_obs         96.2 
_reflns.pdbx_Rmerge_I_obs            0.1030000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        5.7 
_reflns.B_iso_Wilson_estimate        33.4 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.15 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   92.7 
_reflns_shell.Rmerge_I_obs           0.4200000 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.number_unique_all      2301 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1FSX 
_refine.ls_number_reflns_obs                     32949 
_refine.ls_number_reflns_all                     32949 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             64.5 
_refine.ls_d_res_high                            2.1 
_refine.ls_percent_reflns_obs                    100 
_refine.ls_R_factor_obs                          0.2080000 
_refine.ls_R_factor_all                          0.2080000 
_refine.ls_R_factor_R_work                       0.2050000 
_refine.ls_R_factor_R_free                       0.2540000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1647 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;1. Anomalous data used for refinement.  
2. Bulk Solvent Correction during refinement
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh and Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4386 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         180 
_refine_hist.number_atoms_solvent             136 
_refine_hist.number_atoms_total               4702 
_refine_hist.d_res_high                       2.1 
_refine_hist.d_res_low                        64.5 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d   0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d  1.73  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral 19.49 ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper 1.38  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1FSX 
_struct.title                     
;THE X-RAY STRUCTURE DETERMINATION OF BOVINE CARBONMONOXY HB AT 2.1 A RESOLUTION AND ITS RELATIONSHIP TO THE QUATERNARY STRUCTURE OF OTHER HB CRYSTAL FORMS
;
_struct.pdbx_descriptor           'CARBONMONOXY HB' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1FSX 
_struct_keywords.pdbx_keywords   'OXYGEN STORAGE/TRANSPORT' 
_struct_keywords.text            'Hemoglobin Tetramer, R-State, Quaternary Structure, OXYGEN STORAGE-TRANSPORT COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 4 ? 
I N N 3 ? 
J N N 4 ? 
K N N 3 ? 
L N N 4 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'Biological assembly is a tetramer in the asymmetric unit.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 3   ? GLY A 18  ? SER A 3   GLY A 18  1 ? 16 
HELX_P HELX_P2  2  HIS A 20  ? PHE A 36  ? HIS A 20  PHE A 36  1 ? 17 
HELX_P HELX_P3  3  PRO A 37  ? PHE A 43  ? PRO A 37  PHE A 43  5 ? 7  
HELX_P HELX_P4  4  SER A 52  ? HIS A 72  ? SER A 52  HIS A 72  1 ? 21 
HELX_P HELX_P5  5  ASP A 75  ? LEU A 80  ? ASP A 75  LEU A 80  1 ? 6  
HELX_P HELX_P6  6  LEU A 80  ? HIS A 89  ? LEU A 80  HIS A 89  1 ? 10 
HELX_P HELX_P7  7  PRO A 95  ? LEU A 113 ? PRO A 95  LEU A 113 1 ? 19 
HELX_P HELX_P8  8  THR A 118 ? THR A 137 ? THR A 118 THR A 137 1 ? 20 
HELX_P HELX_P9  9  THR B 3   ? GLY B 15  ? THR B 204 GLY B 216 1 ? 13 
HELX_P HELX_P10 10 LYS B 18  ? TYR B 34  ? LYS B 219 TYR B 235 1 ? 17 
HELX_P HELX_P11 11 PRO B 35  ? PHE B 41  ? PRO B 236 PHE B 242 5 ? 7  
HELX_P HELX_P12 12 PHE B 41  ? GLY B 45  ? PHE B 242 GLY B 246 5 ? 5  
HELX_P HELX_P13 13 THR B 49  ? ASN B 55  ? THR B 250 ASN B 256 1 ? 7  
HELX_P HELX_P14 14 ASN B 56  ? LYS B 75  ? ASN B 257 LYS B 276 1 ? 20 
HELX_P HELX_P15 15 ASP B 79  ? PHE B 84  ? ASP B 280 PHE B 285 1 ? 6  
HELX_P HELX_P16 16 PHE B 84  ? ASP B 93  ? PHE B 285 ASP B 294 1 ? 10 
HELX_P HELX_P17 17 PRO B 99  ? GLY B 118 ? PRO B 300 GLY B 319 1 ? 20 
HELX_P HELX_P18 18 LYS B 119 ? PHE B 121 ? LYS B 320 PHE B 322 5 ? 3  
HELX_P HELX_P19 19 THR B 122 ? HIS B 142 ? THR B 323 HIS B 343 1 ? 21 
HELX_P HELX_P20 20 SER C 3   ? GLY C 18  ? SER C 403 GLY C 418 1 ? 16 
HELX_P HELX_P21 21 HIS C 20  ? PHE C 36  ? HIS C 420 PHE C 436 1 ? 17 
HELX_P HELX_P22 22 PRO C 37  ? PHE C 43  ? PRO C 437 PHE C 443 5 ? 7  
HELX_P HELX_P23 23 SER C 52  ? GLU C 71  ? SER C 452 GLU C 471 1 ? 20 
HELX_P HELX_P24 24 ASP C 75  ? LEU C 80  ? ASP C 475 LEU C 480 1 ? 6  
HELX_P HELX_P25 25 LEU C 80  ? HIS C 89  ? LEU C 480 HIS C 489 1 ? 10 
HELX_P HELX_P26 26 PRO C 95  ? LEU C 113 ? PRO C 495 LEU C 513 1 ? 19 
HELX_P HELX_P27 27 THR C 118 ? THR C 137 ? THR C 518 THR C 537 1 ? 20 
HELX_P HELX_P28 28 THR D 3   ? GLY D 15  ? THR D 604 GLY D 616 1 ? 13 
HELX_P HELX_P29 29 LYS D 18  ? TYR D 34  ? LYS D 619 TYR D 635 1 ? 17 
HELX_P HELX_P30 30 PRO D 35  ? GLU D 42  ? PRO D 636 GLU D 643 5 ? 8  
HELX_P HELX_P31 31 PHE D 41  ? GLY D 45  ? PHE D 642 GLY D 646 5 ? 5  
HELX_P HELX_P32 32 THR D 49  ? ASN D 55  ? THR D 650 ASN D 656 1 ? 7  
HELX_P HELX_P33 33 ASN D 56  ? MET D 74  ? ASN D 657 MET D 675 1 ? 19 
HELX_P HELX_P34 34 ASP D 79  ? PHE D 84  ? ASP D 680 PHE D 685 1 ? 6  
HELX_P HELX_P35 35 PHE D 84  ? LYS D 94  ? PHE D 685 LYS D 695 1 ? 11 
HELX_P HELX_P36 36 PRO D 99  ? GLY D 118 ? PRO D 700 GLY D 719 1 ? 20 
HELX_P HELX_P37 37 LYS D 119 ? PHE D 121 ? LYS D 720 PHE D 722 5 ? 3  
HELX_P HELX_P38 38 THR D 122 ? HIS D 142 ? THR D 723 HIS D 743 1 ? 21 
HELX_P HELX_P39 39 ARG D 143 ? HIS D 145 ? ARG D 744 HIS D 746 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 87 NE2 ? ? ? 1_555 F HEM .  FE  ? ? A HIS 87  A HEM 143 1_555 ? ? ? ? ? ? ? 2.043 ? 
metalc2  metalc ? ? E CMO .  C   ? ? ? 1_555 F HEM .  FE  ? ? A CMO 142 A HEM 143 1_555 ? ? ? ? ? ? ? 1.799 ? 
metalc3  metalc ? ? F HEM .  FE  ? ? ? 1_555 E CMO .  O   ? ? A HEM 143 A CMO 142 1_555 ? ? ? ? ? ? ? 2.918 ? 
metalc4  metalc ? ? G CMO .  C   ? ? ? 1_555 H HEM .  FE  ? ? B CMO 347 B HEM 348 1_555 ? ? ? ? ? ? ? 1.803 ? 
metalc5  metalc ? ? H HEM .  FE  ? ? ? 1_555 B HIS 91 NE2 ? ? B HEM 348 B HIS 292 1_555 ? ? ? ? ? ? ? 2.143 ? 
metalc6  metalc ? ? H HEM .  FE  ? ? ? 1_555 G CMO .  O   ? ? B HEM 348 B CMO 347 1_555 ? ? ? ? ? ? ? 2.915 ? 
metalc7  metalc ? ? I CMO .  C   ? ? ? 1_555 J HEM .  FE  ? ? C CMO 542 C HEM 543 1_555 ? ? ? ? ? ? ? 1.815 ? 
metalc8  metalc ? ? J HEM .  FE  ? ? ? 1_555 C HIS 87 NE2 ? ? C HEM 543 C HIS 487 1_555 ? ? ? ? ? ? ? 2.107 ? 
metalc9  metalc ? ? J HEM .  FE  ? ? ? 1_555 I CMO .  O   ? ? C HEM 543 C CMO 542 1_555 ? ? ? ? ? ? ? 2.929 ? 
metalc10 metalc ? ? K CMO .  C   ? ? ? 1_555 L HEM .  FE  ? ? D CMO 747 D HEM 748 1_555 ? ? ? ? ? ? ? 1.745 ? 
metalc11 metalc ? ? L HEM .  FE  ? ? ? 1_555 K CMO .  O   ? ? D HEM 748 D CMO 747 1_555 ? ? ? ? ? ? ? 2.837 ? 
metalc12 metalc ? ? L HEM .  FE  ? ? ? 1_555 D HIS 91 NE2 ? ? D HEM 748 D HIS 692 1_555 ? ? ? ? ? ? ? 2.056 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CMO A 142' 
AC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE HEM A 143' 
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CMO B 347' 
AC4 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE HEM B 348' 
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CMO C 542' 
AC6 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE HEM C 543' 
AC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CMO D 747' 
AC8 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE HEM D 748' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  HIS A 58  ? HIS A 58  . ? 1_555 ? 
2  AC1 3  VAL A 62  ? VAL A 62  . ? 1_555 ? 
3  AC1 3  HEM F .   ? HEM A 143 . ? 1_555 ? 
4  AC2 16 TYR A 42  ? TYR A 42  . ? 1_555 ? 
5  AC2 16 HIS A 45  ? HIS A 45  . ? 1_555 ? 
6  AC2 16 HIS A 58  ? HIS A 58  . ? 1_555 ? 
7  AC2 16 LYS A 61  ? LYS A 61  . ? 1_555 ? 
8  AC2 16 LEU A 66  ? LEU A 66  . ? 1_555 ? 
9  AC2 16 HIS A 87  ? HIS A 87  . ? 1_555 ? 
10 AC2 16 LEU A 91  ? LEU A 91  . ? 1_555 ? 
11 AC2 16 VAL A 93  ? VAL A 93  . ? 1_555 ? 
12 AC2 16 ASN A 97  ? ASN A 97  . ? 1_555 ? 
13 AC2 16 PHE A 98  ? PHE A 98  . ? 1_555 ? 
14 AC2 16 LEU A 101 ? LEU A 101 . ? 1_555 ? 
15 AC2 16 VAL A 132 ? VAL A 132 . ? 1_555 ? 
16 AC2 16 LEU A 136 ? LEU A 136 . ? 1_555 ? 
17 AC2 16 CMO E .   ? CMO A 142 . ? 1_555 ? 
18 AC2 16 HOH M .   ? HOH A 830 . ? 1_555 ? 
19 AC2 16 HOH M .   ? HOH A 854 . ? 1_555 ? 
20 AC3 3  HIS B 62  ? HIS B 263 . ? 1_555 ? 
21 AC3 3  VAL B 66  ? VAL B 267 . ? 1_555 ? 
22 AC3 3  HEM H .   ? HEM B 348 . ? 1_555 ? 
23 AC4 15 THR B 37  ? THR B 238 . ? 1_555 ? 
24 AC4 15 PHE B 40  ? PHE B 241 . ? 1_555 ? 
25 AC4 15 PHE B 41  ? PHE B 242 . ? 1_555 ? 
26 AC4 15 HIS B 62  ? HIS B 263 . ? 1_555 ? 
27 AC4 15 LYS B 65  ? LYS B 266 . ? 1_555 ? 
28 AC4 15 SER B 69  ? SER B 270 . ? 1_555 ? 
29 AC4 15 LEU B 90  ? LEU B 291 . ? 1_555 ? 
30 AC4 15 HIS B 91  ? HIS B 292 . ? 1_555 ? 
31 AC4 15 LEU B 95  ? LEU B 296 . ? 1_555 ? 
32 AC4 15 VAL B 97  ? VAL B 298 . ? 1_555 ? 
33 AC4 15 ASN B 101 ? ASN B 302 . ? 1_555 ? 
34 AC4 15 PHE B 102 ? PHE B 303 . ? 1_555 ? 
35 AC4 15 CMO G .   ? CMO B 347 . ? 1_555 ? 
36 AC4 15 HOH N .   ? HOH B 930 . ? 1_555 ? 
37 AC4 15 LYS D 7   ? LYS D 608 . ? 2_554 ? 
38 AC5 3  HIS C 58  ? HIS C 458 . ? 1_555 ? 
39 AC5 3  VAL C 62  ? VAL C 462 . ? 1_555 ? 
40 AC5 3  HEM J .   ? HEM C 543 . ? 1_555 ? 
41 AC6 15 TYR C 42  ? TYR C 442 . ? 1_555 ? 
42 AC6 15 PHE C 43  ? PHE C 443 . ? 1_555 ? 
43 AC6 15 HIS C 45  ? HIS C 445 . ? 1_555 ? 
44 AC6 15 HIS C 58  ? HIS C 458 . ? 1_555 ? 
45 AC6 15 LYS C 61  ? LYS C 461 . ? 1_555 ? 
46 AC6 15 GLU C 82  ? GLU C 482 . ? 1_555 ? 
47 AC6 15 HIS C 87  ? HIS C 487 . ? 1_555 ? 
48 AC6 15 LEU C 91  ? LEU C 491 . ? 1_555 ? 
49 AC6 15 VAL C 93  ? VAL C 493 . ? 1_555 ? 
50 AC6 15 ASN C 97  ? ASN C 497 . ? 1_555 ? 
51 AC6 15 PHE C 98  ? PHE C 498 . ? 1_555 ? 
52 AC6 15 LEU C 101 ? LEU C 501 . ? 1_555 ? 
53 AC6 15 LEU C 136 ? LEU C 536 . ? 1_555 ? 
54 AC6 15 CMO I .   ? CMO C 542 . ? 1_555 ? 
55 AC6 15 HOH O .   ? HOH C 877 . ? 1_555 ? 
56 AC7 3  HIS D 62  ? HIS D 663 . ? 1_555 ? 
57 AC7 3  VAL D 66  ? VAL D 667 . ? 1_555 ? 
58 AC7 3  HEM L .   ? HEM D 748 . ? 1_555 ? 
59 AC8 16 ALA C 4   ? ALA C 404 . ? 4_456 ? 
60 AC8 16 PHE D 40  ? PHE D 641 . ? 1_555 ? 
61 AC8 16 PHE D 41  ? PHE D 642 . ? 1_555 ? 
62 AC8 16 HIS D 62  ? HIS D 663 . ? 1_555 ? 
63 AC8 16 LYS D 65  ? LYS D 666 . ? 1_555 ? 
64 AC8 16 VAL D 66  ? VAL D 667 . ? 1_555 ? 
65 AC8 16 SER D 69  ? SER D 670 . ? 1_555 ? 
66 AC8 16 LEU D 87  ? LEU D 688 . ? 1_555 ? 
67 AC8 16 HIS D 91  ? HIS D 692 . ? 1_555 ? 
68 AC8 16 LEU D 95  ? LEU D 696 . ? 1_555 ? 
69 AC8 16 VAL D 97  ? VAL D 698 . ? 1_555 ? 
70 AC8 16 ASN D 101 ? ASN D 702 . ? 1_555 ? 
71 AC8 16 PHE D 102 ? PHE D 703 . ? 1_555 ? 
72 AC8 16 LEU D 105 ? LEU D 706 . ? 1_555 ? 
73 AC8 16 LEU D 140 ? LEU D 741 . ? 1_555 ? 
74 AC8 16 CMO K .   ? CMO D 747 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1FSX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1FSX 
_atom_sites.fract_transf_matrix[1][1]   0.012593 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009039 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015291 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . VAL A 1 1   ? 54.571 10.500  14.135  1.00 59.48 ? 1   VAL A N   1 
ATOM   2    C  CA  . VAL A 1 1   ? 55.962 10.615  13.601  1.00 56.51 ? 1   VAL A CA  1 
ATOM   3    C  C   . VAL A 1 1   ? 55.802 10.139  12.160  1.00 56.04 ? 1   VAL A C   1 
ATOM   4    O  O   . VAL A 1 1   ? 54.902 9.324   11.891  1.00 54.62 ? 1   VAL A O   1 
ATOM   5    C  CB  . VAL A 1 1   ? 56.958 9.705   14.408  1.00 55.64 ? 1   VAL A CB  1 
ATOM   6    C  CG1 . VAL A 1 1   ? 56.570 8.223   14.289  1.00 50.17 ? 1   VAL A CG1 1 
ATOM   7    C  CG2 . VAL A 1 1   ? 58.406 9.960   13.973  1.00 53.84 ? 1   VAL A CG2 1 
ATOM   8    N  N   . LEU A 1 2   ? 56.577 10.701  11.228  1.00 49.03 ? 2   LEU A N   1 
ATOM   9    C  CA  . LEU A 1 2   ? 56.450 10.277  9.831   1.00 45.52 ? 2   LEU A CA  1 
ATOM   10   C  C   . LEU A 1 2   ? 57.526 9.313   9.321   1.00 42.59 ? 2   LEU A C   1 
ATOM   11   O  O   . LEU A 1 2   ? 58.732 9.564   9.422   1.00 43.04 ? 2   LEU A O   1 
ATOM   12   C  CB  . LEU A 1 2   ? 56.319 11.476  8.878   1.00 43.12 ? 2   LEU A CB  1 
ATOM   13   C  CG  . LEU A 1 2   ? 55.100 12.406  8.923   1.00 41.08 ? 2   LEU A CG  1 
ATOM   14   C  CD1 . LEU A 1 2   ? 55.273 13.403  10.057  1.00 47.62 ? 2   LEU A CD1 1 
ATOM   15   C  CD2 . LEU A 1 2   ? 55.004 13.164  7.606   1.00 38.99 ? 2   LEU A CD2 1 
ATOM   16   N  N   . SER A 1 3   ? 57.060 8.204   8.769   1.00 39.65 ? 3   SER A N   1 
ATOM   17   C  CA  . SER A 1 3   ? 57.943 7.192   8.228   1.00 40.06 ? 3   SER A CA  1 
ATOM   18   C  C   . SER A 1 3   ? 58.409 7.693   6.873   1.00 38.68 ? 3   SER A C   1 
ATOM   19   O  O   . SER A 1 3   ? 57.888 8.688   6.363   1.00 40.60 ? 3   SER A O   1 
ATOM   20   C  CB  . SER A 1 3   ? 57.186 5.880   8.042   1.00 35.69 ? 3   SER A CB  1 
ATOM   21   O  OG  . SER A 1 3   ? 56.225 5.978   6.998   1.00 33.11 ? 3   SER A OG  1 
ATOM   22   N  N   . ALA A 1 4   ? 59.346 6.976   6.268   1.00 36.38 ? 4   ALA A N   1 
ATOM   23   C  CA  . ALA A 1 4   ? 59.849 7.359   4.968   1.00 35.60 ? 4   ALA A CA  1 
ATOM   24   C  C   . ALA A 1 4   ? 58.758 7.224   3.898   1.00 33.63 ? 4   ALA A C   1 
ATOM   25   O  O   . ALA A 1 4   ? 58.730 8.017   2.947   1.00 33.23 ? 4   ALA A O   1 
ATOM   26   C  CB  . ALA A 1 4   ? 61.082 6.520   4.607   1.00 38.12 ? 4   ALA A CB  1 
ATOM   27   N  N   . ALA A 1 5   ? 57.903 6.196   4.028   1.00 32.61 ? 5   ALA A N   1 
ATOM   28   C  CA  . ALA A 1 5   ? 56.795 5.954   3.084   1.00 31.91 ? 5   ALA A CA  1 
ATOM   29   C  C   . ALA A 1 5   ? 55.801 7.111   3.140   1.00 29.94 ? 5   ALA A C   1 
ATOM   30   O  O   . ALA A 1 5   ? 55.266 7.527   2.107   1.00 27.41 ? 5   ALA A O   1 
ATOM   31   C  CB  . ALA A 1 5   ? 56.091 4.647   3.413   1.00 34.18 ? 5   ALA A CB  1 
ATOM   32   N  N   . ASP A 1 6   ? 55.546 7.594   4.360   1.00 30.55 ? 6   ASP A N   1 
ATOM   33   C  CA  . ASP A 1 6   ? 54.670 8.742   4.610   1.00 28.80 ? 6   ASP A CA  1 
ATOM   34   C  C   . ASP A 1 6   ? 55.277 9.996   4.006   1.00 27.36 ? 6   ASP A C   1 
ATOM   35   O  O   . ASP A 1 6   ? 54.629 10.681  3.223   1.00 32.87 ? 6   ASP A O   1 
ATOM   36   C  CB  . ASP A 1 6   ? 54.464 8.955   6.103   1.00 25.93 ? 6   ASP A CB  1 
ATOM   37   C  CG  . ASP A 1 6   ? 53.569 7.915   6.714   1.00 26.63 ? 6   ASP A CG  1 
ATOM   38   O  OD1 . ASP A 1 6   ? 53.826 7.510   7.869   1.00 30.15 ? 6   ASP A OD1 1 
ATOM   39   O  OD2 . ASP A 1 6   ? 52.603 7.495   6.041   1.00 27.69 ? 6   ASP A OD2 1 
ATOM   40   N  N   . LYS A 1 7   ? 56.527 10.291  4.343   1.00 28.95 ? 7   LYS A N   1 
ATOM   41   C  CA  . LYS A 1 7   ? 57.174 11.468  3.784   1.00 28.33 ? 7   LYS A CA  1 
ATOM   42   C  C   . LYS A 1 7   ? 57.095 11.419  2.261   1.00 32.85 ? 7   LYS A C   1 
ATOM   43   O  O   . LYS A 1 7   ? 56.890 12.442  1.601   1.00 35.32 ? 7   LYS A O   1 
ATOM   44   C  CB  . LYS A 1 7   ? 58.620 11.559  4.261   1.00 27.11 ? 7   LYS A CB  1 
ATOM   45   C  CG  . LYS A 1 7   ? 58.709 11.699  5.739   1.00 27.81 ? 7   LYS A CG  1 
ATOM   46   C  CD  . LYS A 1 7   ? 60.123 11.652  6.238   1.00 31.98 ? 7   LYS A CD  1 
ATOM   47   C  CE  . LYS A 1 7   ? 60.127 11.785  7.756   1.00 38.18 ? 7   LYS A CE  1 
ATOM   48   N  NZ  . LYS A 1 7   ? 61.468 11.547  8.332   1.00 45.72 ? 7   LYS A NZ  1 
ATOM   49   N  N   . GLY A 1 8   ? 57.183 10.213  1.711   1.00 34.59 ? 8   GLY A N   1 
ATOM   50   C  CA  . GLY A 1 8   ? 57.104 10.038  0.270   1.00 35.33 ? 8   GLY A CA  1 
ATOM   51   C  C   . GLY A 1 8   ? 55.728 10.342  -0.298  1.00 38.13 ? 8   GLY A C   1 
ATOM   52   O  O   . GLY A 1 8   ? 55.614 10.950  -1.368  1.00 38.60 ? 8   GLY A O   1 
ATOM   53   N  N   . ASN A 1 9   ? 54.681 9.913   0.402   1.00 36.66 ? 9   ASN A N   1 
ATOM   54   C  CA  . ASN A 1 9   ? 53.311 10.166  -0.055  1.00 36.96 ? 9   ASN A CA  1 
ATOM   55   C  C   . ASN A 1 9   ? 52.922 11.629  0.102   1.00 34.65 ? 9   ASN A C   1 
ATOM   56   O  O   . ASN A 1 9   ? 52.216 12.180  -0.734  1.00 36.58 ? 9   ASN A O   1 
ATOM   57   C  CB  . ASN A 1 9   ? 52.300 9.319   0.715   1.00 35.02 ? 9   ASN A CB  1 
ATOM   58   C  CG  . ASN A 1 9   ? 52.444 7.856   0.438   1.00 29.15 ? 9   ASN A CG  1 
ATOM   59   O  OD1 . ASN A 1 9   ? 52.728 7.442   -0.677  1.00 37.39 ? 9   ASN A OD1 1 
ATOM   60   N  ND2 . ASN A 1 9   ? 52.229 7.054   1.451   1.00 34.68 ? 9   ASN A ND2 1 
ATOM   61   N  N   . VAL A 1 10  ? 53.376 12.258  1.175   1.00 29.53 ? 10  VAL A N   1 
ATOM   62   C  CA  . VAL A 1 10  ? 53.047 13.648  1.407   1.00 32.27 ? 10  VAL A CA  1 
ATOM   63   C  C   . VAL A 1 10  ? 53.711 14.546  0.357   1.00 33.92 ? 10  VAL A C   1 
ATOM   64   O  O   . VAL A 1 10  ? 53.094 15.494  -0.141  1.00 32.37 ? 10  VAL A O   1 
ATOM   65   C  CB  . VAL A 1 10  ? 53.469 14.067  2.812   1.00 30.82 ? 10  VAL A CB  1 
ATOM   66   C  CG1 . VAL A 1 10  ? 53.264 15.567  3.007   1.00 31.48 ? 10  VAL A CG1 1 
ATOM   67   C  CG2 . VAL A 1 10  ? 52.690 13.266  3.842   1.00 30.49 ? 10  VAL A CG2 1 
ATOM   68   N  N   . LYS A 1 11  ? 54.960 14.240  0.012   1.00 33.10 ? 11  LYS A N   1 
ATOM   69   C  CA  . LYS A 1 11  ? 55.687 15.027  -0.980  1.00 34.60 ? 11  LYS A CA  1 
ATOM   70   C  C   . LYS A 1 11  ? 55.093 14.844  -2.364  1.00 35.18 ? 11  LYS A C   1 
ATOM   71   O  O   . LYS A 1 11  ? 54.988 15.804  -3.141  1.00 34.96 ? 11  LYS A O   1 
ATOM   72   C  CB  . LYS A 1 11  ? 57.178 14.696  -0.964  1.00 29.30 ? 11  LYS A CB  1 
ATOM   73   C  CG  . LYS A 1 11  ? 57.931 15.427  0.119   1.00 37.78 ? 11  LYS A CG  1 
ATOM   74   C  CD  . LYS A 1 11  ? 59.431 15.182  0.056   1.00 44.11 ? 11  LYS A CD  1 
ATOM   75   C  CE  . LYS A 1 11  ? 60.195 16.323  0.742   1.00 48.13 ? 11  LYS A CE  1 
ATOM   76   N  NZ  . LYS A 1 11  ? 59.985 17.675  0.096   1.00 52.86 ? 11  LYS A NZ  1 
ATOM   77   N  N   . ALA A 1 12  ? 54.667 13.613  -2.653  1.00 35.18 ? 12  ALA A N   1 
ATOM   78   C  CA  . ALA A 1 12  ? 54.051 13.295  -3.937  1.00 35.00 ? 12  ALA A CA  1 
ATOM   79   C  C   . ALA A 1 12  ? 52.730 14.057  -4.110  1.00 35.45 ? 12  ALA A C   1 
ATOM   80   O  O   . ALA A 1 12  ? 52.510 14.699  -5.133  1.00 37.44 ? 12  ALA A O   1 
ATOM   81   C  CB  . ALA A 1 12  ? 53.824 11.778  -4.062  1.00 31.74 ? 12  ALA A CB  1 
ATOM   82   N  N   . ALA A 1 13  ? 51.873 14.008  -3.093  1.00 36.51 ? 13  ALA A N   1 
ATOM   83   C  CA  . ALA A 1 13  ? 50.572 14.677  -3.126  1.00 32.20 ? 13  ALA A CA  1 
ATOM   84   C  C   . ALA A 1 13  ? 50.673 16.196  -3.185  1.00 33.47 ? 13  ALA A C   1 
ATOM   85   O  O   . ALA A 1 13  ? 49.970 16.833  -3.971  1.00 32.03 ? 13  ALA A O   1 
ATOM   86   C  CB  . ALA A 1 13  ? 49.728 14.249  -1.933  1.00 28.50 ? 13  ALA A CB  1 
ATOM   87   N  N   . TRP A 1 14  ? 51.562 16.777  -2.385  1.00 33.84 ? 14  TRP A N   1 
ATOM   88   C  CA  . TRP A 1 14  ? 51.710 18.223  -2.388  1.00 36.20 ? 14  TRP A CA  1 
ATOM   89   C  C   . TRP A 1 14  ? 52.275 18.703  -3.719  1.00 40.58 ? 14  TRP A C   1 
ATOM   90   O  O   . TRP A 1 14  ? 52.007 19.834  -4.140  1.00 39.31 ? 14  TRP A O   1 
ATOM   91   C  CB  . TRP A 1 14  ? 52.584 18.697  -1.240  1.00 38.27 ? 14  TRP A CB  1 
ATOM   92   C  CG  . TRP A 1 14  ? 52.249 20.090  -0.813  1.00 38.24 ? 14  TRP A CG  1 
ATOM   93   C  CD1 . TRP A 1 14  ? 53.020 21.209  -0.953  1.00 37.11 ? 14  TRP A CD1 1 
ATOM   94   C  CD2 . TRP A 1 14  ? 51.056 20.507  -0.141  1.00 41.57 ? 14  TRP A CD2 1 
ATOM   95   N  NE1 . TRP A 1 14  ? 52.387 22.294  -0.399  1.00 37.31 ? 14  TRP A NE1 1 
ATOM   96   C  CE2 . TRP A 1 14  ? 51.178 21.894  0.106   1.00 41.23 ? 14  TRP A CE2 1 
ATOM   97   C  CE3 . TRP A 1 14  ? 49.895 19.842  0.279   1.00 41.41 ? 14  TRP A CE3 1 
ATOM   98   C  CZ2 . TRP A 1 14  ? 50.183 22.631  0.753   1.00 43.57 ? 14  TRP A CZ2 1 
ATOM   99   C  CZ3 . TRP A 1 14  ? 48.906 20.567  0.919   1.00 39.64 ? 14  TRP A CZ3 1 
ATOM   100  C  CH2 . TRP A 1 14  ? 49.056 21.952  1.152   1.00 43.52 ? 14  TRP A CH2 1 
ATOM   101  N  N   . GLY A 1 15  ? 53.053 17.846  -4.380  1.00 39.95 ? 15  GLY A N   1 
ATOM   102  C  CA  . GLY A 1 15  ? 53.594 18.190  -5.685  1.00 39.01 ? 15  GLY A CA  1 
ATOM   103  C  C   . GLY A 1 15  ? 52.471 18.300  -6.712  1.00 38.67 ? 15  GLY A C   1 
ATOM   104  O  O   . GLY A 1 15  ? 52.539 19.112  -7.638  1.00 43.41 ? 15  GLY A O   1 
ATOM   105  N  N   . LYS A 1 16  ? 51.440 17.471  -6.560  1.00 37.22 ? 16  LYS A N   1 
ATOM   106  C  CA  . LYS A 1 16  ? 50.287 17.499  -7.452  1.00 37.97 ? 16  LYS A CA  1 
ATOM   107  C  C   . LYS A 1 16  ? 49.477 18.788  -7.253  1.00 39.43 ? 16  LYS A C   1 
ATOM   108  O  O   . LYS A 1 16  ? 48.983 19.375  -8.219  1.00 44.86 ? 16  LYS A O   1 
ATOM   109  C  CB  . LYS A 1 16  ? 49.406 16.273  -7.214  1.00 38.40 ? 16  LYS A CB  1 
ATOM   110  C  CG  . LYS A 1 16  ? 49.956 14.986  -7.797  1.00 40.92 ? 16  LYS A CG  1 
ATOM   111  C  CD  . LYS A 1 16  ? 50.088 15.115  -9.302  1.00 49.42 ? 16  LYS A CD  1 
ATOM   112  C  CE  . LYS A 1 16  ? 50.798 13.922  -9.922  1.00 56.16 ? 16  LYS A CE  1 
ATOM   113  N  NZ  . LYS A 1 16  ? 51.166 14.210  -11.348 1.00 63.53 ? 16  LYS A NZ  1 
ATOM   114  N  N   . VAL A 1 17  ? 49.362 19.223  -5.996  1.00 39.08 ? 17  VAL A N   1 
ATOM   115  C  CA  . VAL A 1 17  ? 48.632 20.441  -5.605  1.00 36.44 ? 17  VAL A CA  1 
ATOM   116  C  C   . VAL A 1 17  ? 49.223 21.657  -6.307  1.00 37.02 ? 17  VAL A C   1 
ATOM   117  O  O   . VAL A 1 17  ? 48.501 22.544  -6.764  1.00 38.87 ? 17  VAL A O   1 
ATOM   118  C  CB  . VAL A 1 17  ? 48.703 20.645  -4.061  1.00 34.62 ? 17  VAL A CB  1 
ATOM   119  C  CG1 . VAL A 1 17  ? 48.302 22.036  -3.674  1.00 29.90 ? 17  VAL A CG1 1 
ATOM   120  C  CG2 . VAL A 1 17  ? 47.815 19.623  -3.361  1.00 32.89 ? 17  VAL A CG2 1 
ATOM   121  N  N   . GLY A 1 18  ? 50.546 21.715  -6.319  1.00 38.19 ? 18  GLY A N   1 
ATOM   122  C  CA  . GLY A 1 18  ? 51.256 22.792  -6.979  1.00 42.12 ? 18  GLY A CA  1 
ATOM   123  C  C   . GLY A 1 18  ? 50.778 24.204  -6.731  1.00 42.81 ? 18  GLY A C   1 
ATOM   124  O  O   . GLY A 1 18  ? 50.671 24.651  -5.586  1.00 44.92 ? 18  GLY A O   1 
ATOM   125  N  N   . GLY A 1 19  ? 50.489 24.900  -7.827  1.00 44.82 ? 19  GLY A N   1 
ATOM   126  C  CA  . GLY A 1 19  ? 50.030 26.275  -7.770  1.00 46.24 ? 19  GLY A CA  1 
ATOM   127  C  C   . GLY A 1 19  ? 48.607 26.428  -7.273  1.00 44.54 ? 19  GLY A C   1 
ATOM   128  O  O   . GLY A 1 19  ? 48.124 27.550  -7.106  1.00 47.20 ? 19  GLY A O   1 
ATOM   129  N  N   . HIS A 1 20  ? 47.925 25.311  -7.044  1.00 41.81 ? 20  HIS A N   1 
ATOM   130  C  CA  . HIS A 1 20  ? 46.562 25.364  -6.545  1.00 39.76 ? 20  HIS A CA  1 
ATOM   131  C  C   . HIS A 1 20  ? 46.514 25.505  -5.035  1.00 35.51 ? 20  HIS A C   1 
ATOM   132  O  O   . HIS A 1 20  ? 45.446 25.738  -4.468  1.00 39.79 ? 20  HIS A O   1 
ATOM   133  C  CB  . HIS A 1 20  ? 45.783 24.140  -6.981  1.00 41.41 ? 20  HIS A CB  1 
ATOM   134  C  CG  . HIS A 1 20  ? 45.339 24.202  -8.401  1.00 47.11 ? 20  HIS A CG  1 
ATOM   135  N  ND1 . HIS A 1 20  ? 44.454 25.153  -8.860  1.00 48.26 ? 20  HIS A ND1 1 
ATOM   136  C  CD2 . HIS A 1 20  ? 45.682 23.456  -9.475  1.00 50.86 ? 20  HIS A CD2 1 
ATOM   137  C  CE1 . HIS A 1 20  ? 44.274 24.991  -10.158 1.00 54.80 ? 20  HIS A CE1 1 
ATOM   138  N  NE2 . HIS A 1 20  ? 45.007 23.968  -10.556 1.00 54.99 ? 20  HIS A NE2 1 
ATOM   139  N  N   . ALA A 1 21  ? 47.676 25.407  -4.400  1.00 33.67 ? 21  ALA A N   1 
ATOM   140  C  CA  . ALA A 1 21  ? 47.800 25.519  -2.956  1.00 32.99 ? 21  ALA A CA  1 
ATOM   141  C  C   . ALA A 1 21  ? 46.991 26.648  -2.331  1.00 33.09 ? 21  ALA A C   1 
ATOM   142  O  O   . ALA A 1 21  ? 46.137 26.407  -1.486  1.00 39.22 ? 21  ALA A O   1 
ATOM   143  C  CB  . ALA A 1 21  ? 49.255 25.633  -2.571  1.00 33.97 ? 21  ALA A CB  1 
ATOM   144  N  N   . ALA A 1 22  ? 47.248 27.881  -2.744  1.00 34.52 ? 22  ALA A N   1 
ATOM   145  C  CA  . ALA A 1 22  ? 46.530 29.021  -2.201  1.00 30.51 ? 22  ALA A CA  1 
ATOM   146  C  C   . ALA A 1 22  ? 45.026 28.809  -2.273  1.00 31.78 ? 22  ALA A C   1 
ATOM   147  O  O   . ALA A 1 22  ? 44.319 29.052  -1.297  1.00 29.85 ? 22  ALA A O   1 
ATOM   148  C  CB  . ALA A 1 22  ? 46.905 30.264  -2.937  1.00 29.67 ? 22  ALA A CB  1 
ATOM   149  N  N   . GLU A 1 23  ? 44.553 28.332  -3.420  1.00 31.24 ? 23  GLU A N   1 
ATOM   150  C  CA  . GLU A 1 23  ? 43.134 28.099  -3.610  1.00 33.83 ? 23  GLU A CA  1 
ATOM   151  C  C   . GLU A 1 23  ? 42.570 27.075  -2.665  1.00 32.13 ? 23  GLU A C   1 
ATOM   152  O  O   . GLU A 1 23  ? 41.461 27.245  -2.141  1.00 31.65 ? 23  GLU A O   1 
ATOM   153  C  CB  . GLU A 1 23  ? 42.850 27.642  -5.019  1.00 36.72 ? 23  GLU A CB  1 
ATOM   154  C  CG  . GLU A 1 23  ? 43.010 28.713  -6.046  1.00 52.34 ? 23  GLU A CG  1 
ATOM   155  C  CD  . GLU A 1 23  ? 42.949 28.135  -7.442  1.00 60.34 ? 23  GLU A CD  1 
ATOM   156  O  OE1 . GLU A 1 23  ? 43.964 28.266  -8.178  1.00 64.07 ? 23  GLU A OE1 1 
ATOM   157  O  OE2 . GLU A 1 23  ? 41.901 27.521  -7.777  1.00 61.89 ? 23  GLU A OE2 1 
ATOM   158  N  N   . TYR A 1 24  ? 43.310 25.991  -2.469  1.00 30.08 ? 24  TYR A N   1 
ATOM   159  C  CA  . TYR A 1 24  ? 42.830 24.942  -1.589  1.00 28.66 ? 24  TYR A CA  1 
ATOM   160  C  C   . TYR A 1 24  ? 42.881 25.402  -0.121  1.00 25.31 ? 24  TYR A C   1 
ATOM   161  O  O   . TYR A 1 24  ? 42.093 24.947  0.693   1.00 27.11 ? 24  TYR A O   1 
ATOM   162  C  CB  . TYR A 1 24  ? 43.587 23.623  -1.827  1.00 28.07 ? 24  TYR A CB  1 
ATOM   163  C  CG  . TYR A 1 24  ? 43.488 23.067  -3.246  1.00 28.31 ? 24  TYR A CG  1 
ATOM   164  C  CD1 . TYR A 1 24  ? 44.303 22.004  -3.656  1.00 32.68 ? 24  TYR A CD1 1 
ATOM   165  C  CD2 . TYR A 1 24  ? 42.617 23.622  -4.191  1.00 31.61 ? 24  TYR A CD2 1 
ATOM   166  C  CE1 . TYR A 1 24  ? 44.262 21.510  -4.972  1.00 33.96 ? 24  TYR A CE1 1 
ATOM   167  C  CE2 . TYR A 1 24  ? 42.566 23.137  -5.514  1.00 30.43 ? 24  TYR A CE2 1 
ATOM   168  C  CZ  . TYR A 1 24  ? 43.397 22.082  -5.896  1.00 36.12 ? 24  TYR A CZ  1 
ATOM   169  O  OH  . TYR A 1 24  ? 43.405 21.629  -7.208  1.00 38.45 ? 24  TYR A OH  1 
ATOM   170  N  N   . GLY A 1 25  ? 43.828 26.282  0.201   1.00 26.84 ? 25  GLY A N   1 
ATOM   171  C  CA  . GLY A 1 25  ? 43.929 26.833  1.540   1.00 23.74 ? 25  GLY A CA  1 
ATOM   172  C  C   . GLY A 1 25  ? 42.696 27.682  1.831   1.00 26.67 ? 25  GLY A C   1 
ATOM   173  O  O   . GLY A 1 25  ? 42.228 27.731  2.965   1.00 29.74 ? 25  GLY A O   1 
ATOM   174  N  N   . ALA A 1 26  ? 42.210 28.413  0.829   1.00 27.34 ? 26  ALA A N   1 
ATOM   175  C  CA  . ALA A 1 26  ? 40.992 29.211  0.965   1.00 27.61 ? 26  ALA A CA  1 
ATOM   176  C  C   . ALA A 1 26  ? 39.752 28.315  1.082   1.00 27.23 ? 26  ALA A C   1 
ATOM   177  O  O   . ALA A 1 26  ? 38.913 28.533  1.953   1.00 31.73 ? 26  ALA A O   1 
ATOM   178  C  CB  . ALA A 1 26  ? 40.834 30.149  -0.203  1.00 20.81 ? 26  ALA A CB  1 
ATOM   179  N  N   . GLU A 1 27  ? 39.625 27.320  0.203   1.00 28.95 ? 27  GLU A N   1 
ATOM   180  C  CA  . GLU A 1 27  ? 38.483 26.411  0.252   1.00 27.87 ? 27  GLU A CA  1 
ATOM   181  C  C   . GLU A 1 27  ? 38.371 25.632  1.582   1.00 25.94 ? 27  GLU A C   1 
ATOM   182  O  O   . GLU A 1 27  ? 37.268 25.463  2.124   1.00 25.07 ? 27  GLU A O   1 
ATOM   183  C  CB  . GLU A 1 27  ? 38.498 25.455  -0.936  1.00 28.64 ? 27  GLU A CB  1 
ATOM   184  C  CG  . GLU A 1 27  ? 37.250 24.571  -0.984  1.00 33.85 ? 27  GLU A CG  1 
ATOM   185  C  CD  . GLU A 1 27  ? 37.227 23.634  -2.174  1.00 36.71 ? 27  GLU A CD  1 
ATOM   186  O  OE1 . GLU A 1 27  ? 37.740 24.039  -3.239  1.00 42.98 ? 27  GLU A OE1 1 
ATOM   187  O  OE2 . GLU A 1 27  ? 36.710 22.496  -2.051  1.00 38.30 ? 27  GLU A OE2 1 
ATOM   188  N  N   . ALA A 1 28  ? 39.508 25.156  2.089   1.00 23.52 ? 28  ALA A N   1 
ATOM   189  C  CA  . ALA A 1 28  ? 39.563 24.436  3.355   1.00 21.59 ? 28  ALA A CA  1 
ATOM   190  C  C   . ALA A 1 28  ? 39.006 25.306  4.491   1.00 26.70 ? 28  ALA A C   1 
ATOM   191  O  O   . ALA A 1 28  ? 38.237 24.823  5.334   1.00 28.42 ? 28  ALA A O   1 
ATOM   192  C  CB  . ALA A 1 28  ? 40.999 24.042  3.670   1.00 14.26 ? 28  ALA A CB  1 
ATOM   193  N  N   . LEU A 1 29  ? 39.374 26.592  4.494   1.00 28.39 ? 29  LEU A N   1 
ATOM   194  C  CA  . LEU A 1 29  ? 38.918 27.527  5.525   1.00 28.46 ? 29  LEU A CA  1 
ATOM   195  C  C   . LEU A 1 29  ? 37.418 27.767  5.421   1.00 28.14 ? 29  LEU A C   1 
ATOM   196  O  O   . LEU A 1 29  ? 36.710 27.699  6.416   1.00 25.41 ? 29  LEU A O   1 
ATOM   197  C  CB  . LEU A 1 29  ? 39.676 28.857  5.444   1.00 27.92 ? 29  LEU A CB  1 
ATOM   198  C  CG  . LEU A 1 29  ? 41.152 28.889  5.855   1.00 23.96 ? 29  LEU A CG  1 
ATOM   199  C  CD1 . LEU A 1 29  ? 41.665 30.257  5.552   1.00 24.71 ? 29  LEU A CD1 1 
ATOM   200  C  CD2 . LEU A 1 29  ? 41.356 28.574  7.337   1.00 24.10 ? 29  LEU A CD2 1 
ATOM   201  N  N   . GLU A 1 30  ? 36.939 27.980  4.202   1.00 29.46 ? 30  GLU A N   1 
ATOM   202  C  CA  . GLU A 1 30  ? 35.526 28.205  3.956   1.00 29.45 ? 30  GLU A CA  1 
ATOM   203  C  C   . GLU A 1 30  ? 34.720 27.004  4.451   1.00 30.98 ? 30  GLU A C   1 
ATOM   204  O  O   . GLU A 1 30  ? 33.700 27.162  5.120   1.00 33.21 ? 30  GLU A O   1 
ATOM   205  C  CB  . GLU A 1 30  ? 35.282 28.424  2.464   1.00 30.04 ? 30  GLU A CB  1 
ATOM   206  C  CG  . GLU A 1 30  ? 33.872 28.913  2.167   1.00 42.67 ? 30  GLU A CG  1 
ATOM   207  C  CD  . GLU A 1 30  ? 33.556 29.022  0.687   1.00 46.77 ? 30  GLU A CD  1 
ATOM   208  O  OE1 . GLU A 1 30  ? 32.377 29.282  0.376   1.00 50.76 ? 30  GLU A OE1 1 
ATOM   209  O  OE2 . GLU A 1 30  ? 34.461 28.834  -0.160  1.00 49.46 ? 30  GLU A OE2 1 
ATOM   210  N  N   . ARG A 1 31  ? 35.200 25.803  4.156   1.00 32.80 ? 31  ARG A N   1 
ATOM   211  C  CA  . ARG A 1 31  ? 34.528 24.586  4.594   1.00 28.58 ? 31  ARG A CA  1 
ATOM   212  C  C   . ARG A 1 31  ? 34.518 24.494  6.107   1.00 29.75 ? 31  ARG A C   1 
ATOM   213  O  O   . ARG A 1 31  ? 33.515 24.090  6.693   1.00 31.96 ? 31  ARG A O   1 
ATOM   214  C  CB  . ARG A 1 31  ? 35.198 23.345  4.014   1.00 29.64 ? 31  ARG A CB  1 
ATOM   215  C  CG  . ARG A 1 31  ? 34.928 23.173  2.533   1.00 32.00 ? 31  ARG A CG  1 
ATOM   216  C  CD  . ARG A 1 31  ? 35.576 21.923  1.981   1.00 27.39 ? 31  ARG A CD  1 
ATOM   217  N  NE  . ARG A 1 31  ? 35.363 21.827  0.541   1.00 29.97 ? 31  ARG A NE  1 
ATOM   218  C  CZ  . ARG A 1 31  ? 34.268 21.333  -0.026  1.00 31.67 ? 31  ARG A CZ  1 
ATOM   219  N  NH1 . ARG A 1 31  ? 33.264 20.903  0.718   1.00 27.64 ? 31  ARG A NH1 1 
ATOM   220  N  NH2 . ARG A 1 31  ? 34.204 21.188  -1.343  1.00 35.40 ? 31  ARG A NH2 1 
ATOM   221  N  N   . MET A 1 32  ? 35.645 24.828  6.739   1.00 30.66 ? 32  MET A N   1 
ATOM   222  C  CA  . MET A 1 32  ? 35.744 24.817  8.204   1.00 28.70 ? 32  MET A CA  1 
ATOM   223  C  C   . MET A 1 32  ? 34.739 25.774  8.896   1.00 30.07 ? 32  MET A C   1 
ATOM   224  O  O   . MET A 1 32  ? 34.061 25.382  9.863   1.00 29.60 ? 32  MET A O   1 
ATOM   225  C  CB  . MET A 1 32  ? 37.175 25.136  8.662   1.00 25.09 ? 32  MET A CB  1 
ATOM   226  C  CG  . MET A 1 32  ? 37.350 25.037  10.174  1.00 26.41 ? 32  MET A CG  1 
ATOM   227  S  SD  . MET A 1 32  ? 38.932 25.594  10.821  1.00 33.41 ? 32  MET A SD  1 
ATOM   228  C  CE  . MET A 1 32  ? 38.799 27.362  10.801  1.00 29.56 ? 32  MET A CE  1 
ATOM   229  N  N   . PHE A 1 33  ? 34.657 27.015  8.420   1.00 28.07 ? 33  PHE A N   1 
ATOM   230  C  CA  . PHE A 1 33  ? 33.741 28.001  8.993   1.00 26.52 ? 33  PHE A CA  1 
ATOM   231  C  C   . PHE A 1 33  ? 32.290 27.596  8.844   1.00 26.95 ? 33  PHE A C   1 
ATOM   232  O  O   . PHE A 1 33  ? 31.491 27.810  9.756   1.00 30.71 ? 33  PHE A O   1 
ATOM   233  C  CB  . PHE A 1 33  ? 33.963 29.382  8.378   1.00 27.97 ? 33  PHE A CB  1 
ATOM   234  C  CG  . PHE A 1 33  ? 35.290 29.998  8.726   1.00 24.64 ? 33  PHE A CG  1 
ATOM   235  C  CD1 . PHE A 1 33  ? 35.745 30.013  10.037  1.00 27.02 ? 33  PHE A CD1 1 
ATOM   236  C  CD2 . PHE A 1 33  ? 36.079 30.587  7.741   1.00 27.70 ? 33  PHE A CD2 1 
ATOM   237  C  CE1 . PHE A 1 33  ? 36.968 30.605  10.359  1.00 23.22 ? 33  PHE A CE1 1 
ATOM   238  C  CE2 . PHE A 1 33  ? 37.299 31.176  8.057   1.00 25.89 ? 33  PHE A CE2 1 
ATOM   239  C  CZ  . PHE A 1 33  ? 37.742 31.187  9.361   1.00 24.55 ? 33  PHE A CZ  1 
ATOM   240  N  N   . LEU A 1 34  ? 31.952 27.023  7.687   1.00 31.31 ? 34  LEU A N   1 
ATOM   241  C  CA  . LEU A 1 34  ? 30.586 26.558  7.409   1.00 29.91 ? 34  LEU A CA  1 
ATOM   242  C  C   . LEU A 1 34  ? 30.240 25.312  8.201   1.00 32.47 ? 34  LEU A C   1 
ATOM   243  O  O   . LEU A 1 34  ? 29.168 25.244  8.798   1.00 40.65 ? 34  LEU A O   1 
ATOM   244  C  CB  . LEU A 1 34  ? 30.374 26.270  5.924   1.00 27.41 ? 34  LEU A CB  1 
ATOM   245  C  CG  . LEU A 1 34  ? 30.390 27.486  5.008   1.00 30.55 ? 34  LEU A CG  1 
ATOM   246  C  CD1 . LEU A 1 34  ? 29.905 27.106  3.631   1.00 30.29 ? 34  LEU A CD1 1 
ATOM   247  C  CD2 . LEU A 1 34  ? 29.489 28.550  5.586   1.00 33.91 ? 34  LEU A CD2 1 
ATOM   248  N  N   . SER A 1 35  ? 31.131 24.321  8.189   1.00 33.54 ? 35  SER A N   1 
ATOM   249  C  CA  . SER A 1 35  ? 30.905 23.069  8.923   1.00 29.63 ? 35  SER A CA  1 
ATOM   250  C  C   . SER A 1 35  ? 31.002 23.187  10.452  1.00 28.24 ? 35  SER A C   1 
ATOM   251  O  O   . SER A 1 35  ? 30.244 22.556  11.189  1.00 29.57 ? 35  SER A O   1 
ATOM   252  C  CB  . SER A 1 35  ? 31.887 21.974  8.462   1.00 27.14 ? 35  SER A CB  1 
ATOM   253  O  OG  . SER A 1 35  ? 31.622 21.503  7.155   1.00 26.77 ? 35  SER A OG  1 
ATOM   254  N  N   . PHE A 1 36  ? 31.942 23.980  10.939  1.00 26.00 ? 36  PHE A N   1 
ATOM   255  C  CA  . PHE A 1 36  ? 32.127 24.086  12.369  1.00 23.85 ? 36  PHE A CA  1 
ATOM   256  C  C   . PHE A 1 36  ? 32.192 25.559  12.720  1.00 27.51 ? 36  PHE A C   1 
ATOM   257  O  O   . PHE A 1 36  ? 33.252 26.109  13.006  1.00 30.30 ? 36  PHE A O   1 
ATOM   258  C  CB  . PHE A 1 36  ? 33.402 23.336  12.753  1.00 25.08 ? 36  PHE A CB  1 
ATOM   259  C  CG  . PHE A 1 36  ? 33.490 21.932  12.167  1.00 26.80 ? 36  PHE A CG  1 
ATOM   260  C  CD1 . PHE A 1 36  ? 34.262 21.681  11.040  1.00 29.04 ? 36  PHE A CD1 1 
ATOM   261  C  CD2 . PHE A 1 36  ? 32.815 20.864  12.756  1.00 27.06 ? 36  PHE A CD2 1 
ATOM   262  C  CE1 . PHE A 1 36  ? 34.360 20.398  10.518  1.00 31.67 ? 36  PHE A CE1 1 
ATOM   263  C  CE2 . PHE A 1 36  ? 32.909 19.575  12.236  1.00 29.32 ? 36  PHE A CE2 1 
ATOM   264  C  CZ  . PHE A 1 36  ? 33.682 19.346  11.121  1.00 30.80 ? 36  PHE A CZ  1 
ATOM   265  N  N   . PRO A 1 37  ? 31.028 26.203  12.785  1.00 27.99 ? 37  PRO A N   1 
ATOM   266  C  CA  . PRO A 1 37  ? 30.829 27.619  13.088  1.00 31.63 ? 37  PRO A CA  1 
ATOM   267  C  C   . PRO A 1 37  ? 31.597 28.172  14.283  1.00 33.98 ? 37  PRO A C   1 
ATOM   268  O  O   . PRO A 1 37  ? 32.011 29.326  14.266  1.00 32.99 ? 37  PRO A O   1 
ATOM   269  C  CB  . PRO A 1 37  ? 29.326 27.701  13.306  1.00 30.25 ? 37  PRO A CB  1 
ATOM   270  C  CG  . PRO A 1 37  ? 28.809 26.618  12.421  1.00 29.95 ? 37  PRO A CG  1 
ATOM   271  C  CD  . PRO A 1 37  ? 29.729 25.503  12.761  1.00 28.11 ? 37  PRO A CD  1 
ATOM   272  N  N   . THR A 1 38  ? 31.822 27.339  15.295  1.00 31.86 ? 38  THR A N   1 
ATOM   273  C  CA  . THR A 1 38  ? 32.518 27.754  16.506  1.00 32.63 ? 38  THR A CA  1 
ATOM   274  C  C   . THR A 1 38  ? 33.911 28.310  16.220  1.00 31.68 ? 38  THR A C   1 
ATOM   275  O  O   . THR A 1 38  ? 34.393 29.203  16.929  1.00 32.70 ? 38  THR A O   1 
ATOM   276  C  CB  . THR A 1 38  ? 32.637 26.558  17.484  1.00 38.85 ? 38  THR A CB  1 
ATOM   277  O  OG1 . THR A 1 38  ? 31.380 25.868  17.532  1.00 45.00 ? 38  THR A OG1 1 
ATOM   278  C  CG2 . THR A 1 38  ? 32.976 27.033  18.901  1.00 42.14 ? 38  THR A CG2 1 
ATOM   279  N  N   . THR A 1 39  ? 34.534 27.810  15.156  1.00 30.79 ? 39  THR A N   1 
ATOM   280  C  CA  . THR A 1 39  ? 35.873 28.241  14.787  1.00 29.77 ? 39  THR A CA  1 
ATOM   281  C  C   . THR A 1 39  ? 35.913 29.684  14.318  1.00 28.13 ? 39  THR A C   1 
ATOM   282  O  O   . THR A 1 39  ? 36.971 30.284  14.262  1.00 28.71 ? 39  THR A O   1 
ATOM   283  C  CB  . THR A 1 39  ? 36.449 27.356  13.711  1.00 30.29 ? 39  THR A CB  1 
ATOM   284  O  OG1 . THR A 1 39  ? 35.641 27.466  12.540  1.00 41.93 ? 39  THR A OG1 1 
ATOM   285  C  CG2 . THR A 1 39  ? 36.440 25.907  14.177  1.00 35.78 ? 39  THR A CG2 1 
ATOM   286  N  N   . LYS A 1 40  ? 34.755 30.237  13.974  1.00 33.00 ? 40  LYS A N   1 
ATOM   287  C  CA  . LYS A 1 40  ? 34.649 31.626  13.531  1.00 29.81 ? 40  LYS A CA  1 
ATOM   288  C  C   . LYS A 1 40  ? 34.967 32.611  14.658  1.00 30.22 ? 40  LYS A C   1 
ATOM   289  O  O   . LYS A 1 40  ? 35.367 33.744  14.399  1.00 31.81 ? 40  LYS A O   1 
ATOM   290  C  CB  . LYS A 1 40  ? 33.235 31.916  13.037  1.00 30.93 ? 40  LYS A CB  1 
ATOM   291  C  CG  . LYS A 1 40  ? 32.793 31.138  11.823  1.00 29.70 ? 40  LYS A CG  1 
ATOM   292  C  CD  . LYS A 1 40  ? 31.370 31.526  11.476  1.00 34.18 ? 40  LYS A CD  1 
ATOM   293  C  CE  . LYS A 1 40  ? 30.932 30.912  10.162  1.00 43.02 ? 40  LYS A CE  1 
ATOM   294  N  NZ  . LYS A 1 40  ? 29.628 31.449  9.690   1.00 40.24 ? 40  LYS A NZ  1 
ATOM   295  N  N   . THR A 1 41  ? 34.808 32.180  15.908  1.00 31.96 ? 41  THR A N   1 
ATOM   296  C  CA  . THR A 1 41  ? 35.064 33.051  17.053  1.00 32.48 ? 41  THR A CA  1 
ATOM   297  C  C   . THR A 1 41  ? 36.533 33.452  17.173  1.00 33.74 ? 41  THR A C   1 
ATOM   298  O  O   . THR A 1 41  ? 36.882 34.375  17.904  1.00 35.75 ? 41  THR A O   1 
ATOM   299  C  CB  . THR A 1 41  ? 34.568 32.402  18.362  1.00 34.58 ? 41  THR A CB  1 
ATOM   300  O  OG1 . THR A 1 41  ? 35.375 31.266  18.680  1.00 40.10 ? 41  THR A OG1 1 
ATOM   301  C  CG2 . THR A 1 41  ? 33.128 31.945  18.210  1.00 37.78 ? 41  THR A CG2 1 
ATOM   302  N  N   . TYR A 1 42  ? 37.385 32.770  16.421  1.00 32.02 ? 42  TYR A N   1 
ATOM   303  C  CA  . TYR A 1 42  ? 38.808 33.052  16.425  1.00 30.03 ? 42  TYR A CA  1 
ATOM   304  C  C   . TYR A 1 42  ? 39.128 34.151  15.412  1.00 30.38 ? 42  TYR A C   1 
ATOM   305  O  O   . TYR A 1 42  ? 40.217 34.722  15.423  1.00 30.08 ? 42  TYR A O   1 
ATOM   306  C  CB  . TYR A 1 42  ? 39.584 31.781  16.090  1.00 29.59 ? 42  TYR A CB  1 
ATOM   307  C  CG  . TYR A 1 42  ? 39.697 30.822  17.247  1.00 27.27 ? 42  TYR A CG  1 
ATOM   308  C  CD1 . TYR A 1 42  ? 40.689 30.995  18.220  1.00 26.48 ? 42  TYR A CD1 1 
ATOM   309  C  CD2 . TYR A 1 42  ? 38.822 29.742  17.379  1.00 26.43 ? 42  TYR A CD2 1 
ATOM   310  C  CE1 . TYR A 1 42  ? 40.809 30.122  19.290  1.00 27.34 ? 42  TYR A CE1 1 
ATOM   311  C  CE2 . TYR A 1 42  ? 38.930 28.862  18.446  1.00 24.91 ? 42  TYR A CE2 1 
ATOM   312  C  CZ  . TYR A 1 42  ? 39.924 29.057  19.401  1.00 25.91 ? 42  TYR A CZ  1 
ATOM   313  O  OH  . TYR A 1 42  ? 40.037 28.197  20.476  1.00 34.23 ? 42  TYR A OH  1 
ATOM   314  N  N   . PHE A 1 43  ? 38.158 34.445  14.547  1.00 29.51 ? 43  PHE A N   1 
ATOM   315  C  CA  . PHE A 1 43  ? 38.298 35.462  13.511  1.00 32.61 ? 43  PHE A CA  1 
ATOM   316  C  C   . PHE A 1 43  ? 37.208 36.540  13.558  1.00 33.25 ? 43  PHE A C   1 
ATOM   317  O  O   . PHE A 1 43  ? 36.509 36.752  12.564  1.00 35.70 ? 43  PHE A O   1 
ATOM   318  C  CB  . PHE A 1 43  ? 38.233 34.799  12.138  1.00 29.32 ? 43  PHE A CB  1 
ATOM   319  C  CG  . PHE A 1 43  ? 39.315 33.805  11.895  1.00 31.53 ? 43  PHE A CG  1 
ATOM   320  C  CD1 . PHE A 1 43  ? 39.135 32.471  12.238  1.00 28.05 ? 43  PHE A CD1 1 
ATOM   321  C  CD2 . PHE A 1 43  ? 40.497 34.192  11.275  1.00 27.89 ? 43  PHE A CD2 1 
ATOM   322  C  CE1 . PHE A 1 43  ? 40.104 31.539  11.964  1.00 27.74 ? 43  PHE A CE1 1 
ATOM   323  C  CE2 . PHE A 1 43  ? 41.477 33.266  10.995  1.00 29.62 ? 43  PHE A CE2 1 
ATOM   324  C  CZ  . PHE A 1 43  ? 41.281 31.932  11.338  1.00 29.76 ? 43  PHE A CZ  1 
ATOM   325  N  N   . PRO A 1 44  ? 37.086 37.281  14.683  1.00 33.36 ? 44  PRO A N   1 
ATOM   326  C  CA  . PRO A 1 44  ? 36.053 38.321  14.773  1.00 36.80 ? 44  PRO A CA  1 
ATOM   327  C  C   . PRO A 1 44  ? 36.275 39.504  13.830  1.00 39.88 ? 44  PRO A C   1 
ATOM   328  O  O   . PRO A 1 44  ? 35.327 40.185  13.426  1.00 41.64 ? 44  PRO A O   1 
ATOM   329  C  CB  . PRO A 1 44  ? 36.122 38.728  16.247  1.00 33.09 ? 44  PRO A CB  1 
ATOM   330  C  CG  . PRO A 1 44  ? 37.528 38.523  16.590  1.00 36.63 ? 44  PRO A CG  1 
ATOM   331  C  CD  . PRO A 1 44  ? 37.861 37.212  15.930  1.00 35.08 ? 44  PRO A CD  1 
ATOM   332  N  N   . HIS A 1 45  ? 37.521 39.670  13.397  1.00 41.34 ? 45  HIS A N   1 
ATOM   333  C  CA  . HIS A 1 45  ? 37.905 40.761  12.513  1.00 42.66 ? 45  HIS A CA  1 
ATOM   334  C  C   . HIS A 1 45  ? 37.879 40.433  11.017  1.00 42.25 ? 45  HIS A C   1 
ATOM   335  O  O   . HIS A 1 45  ? 38.353 41.227  10.193  1.00 45.96 ? 45  HIS A O   1 
ATOM   336  C  CB  . HIS A 1 45  ? 39.295 41.247  12.898  1.00 47.22 ? 45  HIS A CB  1 
ATOM   337  C  CG  . HIS A 1 45  ? 40.329 40.168  12.883  1.00 50.87 ? 45  HIS A CG  1 
ATOM   338  N  ND1 . HIS A 1 45  ? 40.258 39.060  13.700  1.00 52.38 ? 45  HIS A ND1 1 
ATOM   339  C  CD2 . HIS A 1 45  ? 41.448 40.014  12.136  1.00 55.91 ? 45  HIS A CD2 1 
ATOM   340  C  CE1 . HIS A 1 45  ? 41.287 38.268  13.455  1.00 53.21 ? 45  HIS A CE1 1 
ATOM   341  N  NE2 . HIS A 1 45  ? 42.025 38.824  12.512  1.00 57.49 ? 45  HIS A NE2 1 
ATOM   342  N  N   . PHE A 1 46  ? 37.354 39.264  10.669  1.00 41.46 ? 46  PHE A N   1 
ATOM   343  C  CA  . PHE A 1 46  ? 37.263 38.834  9.273   1.00 41.35 ? 46  PHE A CA  1 
ATOM   344  C  C   . PHE A 1 46  ? 35.814 38.906  8.827   1.00 39.77 ? 46  PHE A C   1 
ATOM   345  O  O   . PHE A 1 46  ? 34.908 38.775  9.646   1.00 40.98 ? 46  PHE A O   1 
ATOM   346  C  CB  . PHE A 1 46  ? 37.647 37.348  9.116   1.00 41.94 ? 46  PHE A CB  1 
ATOM   347  C  CG  . PHE A 1 46  ? 39.117 37.083  8.955   1.00 41.92 ? 46  PHE A CG  1 
ATOM   348  C  CD1 . PHE A 1 46  ? 39.557 36.204  7.973   1.00 41.38 ? 46  PHE A CD1 1 
ATOM   349  C  CD2 . PHE A 1 46  ? 40.047 37.628  9.823   1.00 41.34 ? 46  PHE A CD2 1 
ATOM   350  C  CE1 . PHE A 1 46  ? 40.892 35.873  7.860   1.00 38.48 ? 46  PHE A CE1 1 
ATOM   351  C  CE2 . PHE A 1 46  ? 41.387 37.299  9.716   1.00 42.54 ? 46  PHE A CE2 1 
ATOM   352  C  CZ  . PHE A 1 46  ? 41.809 36.416  8.735   1.00 38.62 ? 46  PHE A CZ  1 
ATOM   353  N  N   . ASP A 1 47  ? 35.601 39.101  7.534   1.00 38.71 ? 47  ASP A N   1 
ATOM   354  C  CA  . ASP A 1 47  ? 34.259 39.061  6.984   1.00 38.32 ? 47  ASP A CA  1 
ATOM   355  C  C   . ASP A 1 47  ? 34.311 37.612  6.544   1.00 35.63 ? 47  ASP A C   1 
ATOM   356  O  O   . ASP A 1 47  ? 35.156 37.257  5.733   1.00 36.70 ? 47  ASP A O   1 
ATOM   357  C  CB  . ASP A 1 47  ? 34.129 39.970  5.766   1.00 41.84 ? 47  ASP A CB  1 
ATOM   358  C  CG  . ASP A 1 47  ? 32.841 39.743  5.008   1.00 42.59 ? 47  ASP A CG  1 
ATOM   359  O  OD1 . ASP A 1 47  ? 32.862 39.766  3.761   1.00 43.66 ? 47  ASP A OD1 1 
ATOM   360  O  OD2 . ASP A 1 47  ? 31.801 39.546  5.656   1.00 48.57 ? 47  ASP A OD2 1 
ATOM   361  N  N   . LEU A 1 48  ? 33.491 36.763  7.147   1.00 38.98 ? 48  LEU A N   1 
ATOM   362  C  CA  . LEU A 1 48  ? 33.513 35.338  6.829   1.00 42.20 ? 48  LEU A CA  1 
ATOM   363  C  C   . LEU A 1 48  ? 32.554 34.905  5.723   1.00 43.09 ? 48  LEU A C   1 
ATOM   364  O  O   . LEU A 1 48  ? 32.473 33.713  5.398   1.00 45.39 ? 48  LEU A O   1 
ATOM   365  C  CB  . LEU A 1 48  ? 33.300 34.484  8.102   1.00 39.92 ? 48  LEU A CB  1 
ATOM   366  C  CG  . LEU A 1 48  ? 34.430 34.065  9.070   1.00 39.18 ? 48  LEU A CG  1 
ATOM   367  C  CD1 . LEU A 1 48  ? 35.803 34.461  8.600   1.00 36.54 ? 48  LEU A CD1 1 
ATOM   368  C  CD2 . LEU A 1 48  ? 34.191 34.636  10.424  1.00 37.95 ? 48  LEU A CD2 1 
ATOM   369  N  N   . SER A 1 49  ? 31.848 35.865  5.133   1.00 42.62 ? 49  SER A N   1 
ATOM   370  C  CA  . SER A 1 49  ? 30.906 35.570  4.063   1.00 45.56 ? 49  SER A CA  1 
ATOM   371  C  C   . SER A 1 49  ? 31.657 34.992  2.876   1.00 48.52 ? 49  SER A C   1 
ATOM   372  O  O   . SER A 1 49  ? 32.858 35.222  2.733   1.00 55.03 ? 49  SER A O   1 
ATOM   373  C  CB  . SER A 1 49  ? 30.197 36.849  3.639   1.00 45.25 ? 49  SER A CB  1 
ATOM   374  O  OG  . SER A 1 49  ? 31.139 37.835  3.270   1.00 45.67 ? 49  SER A OG  1 
ATOM   375  N  N   . HIS A 1 50  ? 30.955 34.267  2.011   1.00 51.41 ? 50  HIS A N   1 
ATOM   376  C  CA  . HIS A 1 50  ? 31.578 33.652  0.834   1.00 50.73 ? 50  HIS A CA  1 
ATOM   377  C  C   . HIS A 1 50  ? 32.296 34.655  -0.096  1.00 48.97 ? 50  HIS A C   1 
ATOM   378  O  O   . HIS A 1 50  ? 31.731 35.683  -0.475  1.00 49.28 ? 50  HIS A O   1 
ATOM   379  C  CB  . HIS A 1 50  ? 30.532 32.840  0.048   1.00 51.37 ? 50  HIS A CB  1 
ATOM   380  C  CG  . HIS A 1 50  ? 31.063 32.231  -1.215  1.00 50.06 ? 50  HIS A CG  1 
ATOM   381  N  ND1 . HIS A 1 50  ? 32.220 31.480  -1.255  1.00 47.74 ? 50  HIS A ND1 1 
ATOM   382  C  CD2 . HIS A 1 50  ? 30.608 32.286  -2.488  1.00 48.98 ? 50  HIS A CD2 1 
ATOM   383  C  CE1 . HIS A 1 50  ? 32.455 31.098  -2.497  1.00 45.02 ? 50  HIS A CE1 1 
ATOM   384  N  NE2 . HIS A 1 50  ? 31.492 31.575  -3.266  1.00 50.18 ? 50  HIS A NE2 1 
ATOM   385  N  N   . GLY A 1 51  ? 33.535 34.333  -0.468  1.00 47.94 ? 51  GLY A N   1 
ATOM   386  C  CA  . GLY A 1 51  ? 34.307 35.194  -1.352  1.00 44.78 ? 51  GLY A CA  1 
ATOM   387  C  C   . GLY A 1 51  ? 35.049 36.363  -0.714  1.00 44.59 ? 51  GLY A C   1 
ATOM   388  O  O   . GLY A 1 51  ? 35.640 37.179  -1.423  1.00 50.27 ? 51  GLY A O   1 
ATOM   389  N  N   . SER A 1 52  ? 35.031 36.451  0.611   1.00 40.38 ? 52  SER A N   1 
ATOM   390  C  CA  . SER A 1 52  ? 35.723 37.525  1.313   1.00 37.73 ? 52  SER A CA  1 
ATOM   391  C  C   . SER A 1 52  ? 37.188 37.508  0.926   1.00 38.19 ? 52  SER A C   1 
ATOM   392  O  O   . SER A 1 52  ? 37.789 36.431  0.838   1.00 39.73 ? 52  SER A O   1 
ATOM   393  C  CB  . SER A 1 52  ? 35.596 37.314  2.822   1.00 36.69 ? 52  SER A CB  1 
ATOM   394  O  OG  . SER A 1 52  ? 36.563 38.049  3.548   1.00 34.97 ? 52  SER A OG  1 
ATOM   395  N  N   . ALA A 1 53  ? 37.765 38.686  0.682   1.00 38.11 ? 53  ALA A N   1 
ATOM   396  C  CA  . ALA A 1 53  ? 39.179 38.777  0.328   1.00 33.86 ? 53  ALA A CA  1 
ATOM   397  C  C   . ALA A 1 53  ? 40.081 38.407  1.527   1.00 33.41 ? 53  ALA A C   1 
ATOM   398  O  O   . ALA A 1 53  ? 41.239 38.007  1.351   1.00 33.69 ? 53  ALA A O   1 
ATOM   399  C  CB  . ALA A 1 53  ? 39.496 40.157  -0.179  1.00 32.51 ? 53  ALA A CB  1 
ATOM   400  N  N   . GLN A 1 54  ? 39.527 38.471  2.737   1.00 32.77 ? 54  GLN A N   1 
ATOM   401  C  CA  . GLN A 1 54  ? 40.270 38.114  3.949   1.00 35.13 ? 54  GLN A CA  1 
ATOM   402  C  C   . GLN A 1 54  ? 40.471 36.594  4.108   1.00 35.72 ? 54  GLN A C   1 
ATOM   403  O  O   . GLN A 1 54  ? 41.455 36.154  4.710   1.00 36.78 ? 54  GLN A O   1 
ATOM   404  C  CB  . GLN A 1 54  ? 39.569 38.657  5.194   1.00 32.46 ? 54  GLN A CB  1 
ATOM   405  C  CG  . GLN A 1 54  ? 39.634 40.161  5.319   1.00 32.08 ? 54  GLN A CG  1 
ATOM   406  C  CD  . GLN A 1 54  ? 38.853 40.678  6.501   1.00 30.99 ? 54  GLN A CD  1 
ATOM   407  O  OE1 . GLN A 1 54  ? 37.614 40.711  6.489   1.00 32.34 ? 54  GLN A OE1 1 
ATOM   408  N  NE2 . GLN A 1 54  ? 39.570 41.122  7.522   1.00 33.70 ? 54  GLN A NE2 1 
ATOM   409  N  N   . VAL A 1 55  ? 39.520 35.803  3.606   1.00 34.81 ? 55  VAL A N   1 
ATOM   410  C  CA  . VAL A 1 55  ? 39.601 34.345  3.673   1.00 32.74 ? 55  VAL A CA  1 
ATOM   411  C  C   . VAL A 1 55  ? 40.589 33.826  2.621   1.00 30.38 ? 55  VAL A C   1 
ATOM   412  O  O   . VAL A 1 55  ? 41.389 32.932  2.901   1.00 30.00 ? 55  VAL A O   1 
ATOM   413  C  CB  . VAL A 1 55  ? 38.217 33.692  3.485   1.00 33.73 ? 55  VAL A CB  1 
ATOM   414  C  CG1 . VAL A 1 55  ? 38.326 32.185  3.674   1.00 36.38 ? 55  VAL A CG1 1 
ATOM   415  C  CG2 . VAL A 1 55  ? 37.228 34.250  4.487   1.00 31.83 ? 55  VAL A CG2 1 
ATOM   416  N  N   . LYS A 1 56  ? 40.546 34.408  1.423   1.00 31.85 ? 56  LYS A N   1 
ATOM   417  C  CA  . LYS A 1 56  ? 41.459 34.045  0.336   1.00 33.48 ? 56  LYS A CA  1 
ATOM   418  C  C   . LYS A 1 56  ? 42.871 34.327  0.790   1.00 32.48 ? 56  LYS A C   1 
ATOM   419  O  O   . LYS A 1 56  ? 43.742 33.473  0.711   1.00 38.84 ? 56  LYS A O   1 
ATOM   420  C  CB  . LYS A 1 56  ? 41.224 34.907  -0.914  1.00 37.93 ? 56  LYS A CB  1 
ATOM   421  C  CG  . LYS A 1 56  ? 39.908 34.697  -1.601  1.00 44.66 ? 56  LYS A CG  1 
ATOM   422  C  CD  . LYS A 1 56  ? 39.859 35.418  -2.937  1.00 49.91 ? 56  LYS A CD  1 
ATOM   423  C  CE  . LYS A 1 56  ? 38.572 35.058  -3.657  1.00 52.72 ? 56  LYS A CE  1 
ATOM   424  N  NZ  . LYS A 1 56  ? 38.436 33.558  -3.715  1.00 62.93 ? 56  LYS A NZ  1 
ATOM   425  N  N   . GLY A 1 57  ? 43.099 35.571  1.196   1.00 31.50 ? 57  GLY A N   1 
ATOM   426  C  CA  . GLY A 1 57  ? 44.408 35.967  1.651   1.00 30.48 ? 57  GLY A CA  1 
ATOM   427  C  C   . GLY A 1 57  ? 44.923 35.051  2.732   1.00 31.02 ? 57  GLY A C   1 
ATOM   428  O  O   . GLY A 1 57  ? 46.062 34.569  2.676   1.00 32.14 ? 57  GLY A O   1 
ATOM   429  N  N   . HIS A 1 58  ? 44.056 34.734  3.683   1.00 29.10 ? 58  HIS A N   1 
ATOM   430  C  CA  . HIS A 1 58  ? 44.463 33.897  4.792   1.00 28.64 ? 58  HIS A CA  1 
ATOM   431  C  C   . HIS A 1 58  ? 44.725 32.440  4.421   1.00 31.02 ? 58  HIS A C   1 
ATOM   432  O  O   . HIS A 1 58  ? 45.573 31.779  5.036   1.00 28.51 ? 58  HIS A O   1 
ATOM   433  C  CB  . HIS A 1 58  ? 43.457 33.986  5.919   1.00 30.22 ? 58  HIS A CB  1 
ATOM   434  C  CG  . HIS A 1 58  ? 43.965 33.429  7.208   1.00 35.51 ? 58  HIS A CG  1 
ATOM   435  N  ND1 . HIS A 1 58  ? 44.991 34.016  7.918   1.00 33.57 ? 58  HIS A ND1 1 
ATOM   436  C  CD2 . HIS A 1 58  ? 43.600 32.332  7.913   1.00 32.73 ? 58  HIS A CD2 1 
ATOM   437  C  CE1 . HIS A 1 58  ? 45.232 33.311  9.005   1.00 33.69 ? 58  HIS A CE1 1 
ATOM   438  N  NE2 . HIS A 1 58  ? 44.403 32.282  9.026   1.00 36.14 ? 58  HIS A NE2 1 
ATOM   439  N  N   . GLY A 1 59  ? 43.951 31.933  3.465   1.00 30.47 ? 59  GLY A N   1 
ATOM   440  C  CA  . GLY A 1 59  ? 44.118 30.572  3.003   1.00 28.73 ? 59  GLY A CA  1 
ATOM   441  C  C   . GLY A 1 59  ? 45.434 30.448  2.275   1.00 28.59 ? 59  GLY A C   1 
ATOM   442  O  O   . GLY A 1 59  ? 46.098 29.421  2.328   1.00 29.66 ? 59  GLY A O   1 
ATOM   443  N  N   . ALA A 1 60  ? 45.830 31.531  1.621   1.00 29.34 ? 60  ALA A N   1 
ATOM   444  C  CA  . ALA A 1 60  ? 47.079 31.570  0.889   1.00 29.44 ? 60  ALA A CA  1 
ATOM   445  C  C   . ALA A 1 60  ? 48.225 31.482  1.910   1.00 32.50 ? 60  ALA A C   1 
ATOM   446  O  O   . ALA A 1 60  ? 49.231 30.794  1.680   1.00 38.13 ? 60  ALA A O   1 
ATOM   447  C  CB  . ALA A 1 60  ? 47.164 32.861  0.076   1.00 29.19 ? 60  ALA A CB  1 
ATOM   448  N  N   . LYS A 1 61  ? 48.057 32.127  3.062   1.00 32.91 ? 61  LYS A N   1 
ATOM   449  C  CA  . LYS A 1 61  ? 49.084 32.080  4.099   1.00 33.91 ? 61  LYS A CA  1 
ATOM   450  C  C   . LYS A 1 61  ? 49.168 30.692  4.741   1.00 36.03 ? 61  LYS A C   1 
ATOM   451  O  O   . LYS A 1 61  ? 50.262 30.207  5.051   1.00 36.53 ? 61  LYS A O   1 
ATOM   452  C  CB  . LYS A 1 61  ? 48.834 33.158  5.147   1.00 35.42 ? 61  LYS A CB  1 
ATOM   453  C  CG  . LYS A 1 61  ? 49.043 34.559  4.629   1.00 36.18 ? 61  LYS A CG  1 
ATOM   454  C  CD  . LYS A 1 61  ? 48.676 35.552  5.687   1.00 44.13 ? 61  LYS A CD  1 
ATOM   455  C  CE  . LYS A 1 61  ? 48.713 36.975  5.153   1.00 49.81 ? 61  LYS A CE  1 
ATOM   456  N  NZ  . LYS A 1 61  ? 48.208 37.935  6.178   1.00 52.88 ? 61  LYS A NZ  1 
ATOM   457  N  N   . VAL A 1 62  ? 48.017 30.051  4.938   1.00 36.20 ? 62  VAL A N   1 
ATOM   458  C  CA  . VAL A 1 62  ? 47.978 28.703  5.511   1.00 35.24 ? 62  VAL A CA  1 
ATOM   459  C  C   . VAL A 1 62  ? 48.629 27.697  4.532   1.00 33.20 ? 62  VAL A C   1 
ATOM   460  O  O   . VAL A 1 62  ? 49.432 26.837  4.926   1.00 29.90 ? 62  VAL A O   1 
ATOM   461  C  CB  . VAL A 1 62  ? 46.522 28.303  5.880   1.00 31.23 ? 62  VAL A CB  1 
ATOM   462  C  CG1 . VAL A 1 62  ? 46.438 26.846  6.281   1.00 22.14 ? 62  VAL A CG1 1 
ATOM   463  C  CG2 . VAL A 1 62  ? 46.042 29.175  7.031   1.00 28.12 ? 62  VAL A CG2 1 
ATOM   464  N  N   . ALA A 1 63  ? 48.304 27.836  3.251   1.00 32.84 ? 63  ALA A N   1 
ATOM   465  C  CA  . ALA A 1 63  ? 48.880 26.984  2.227   1.00 32.80 ? 63  ALA A CA  1 
ATOM   466  C  C   . ALA A 1 63  ? 50.404 27.153  2.168   1.00 31.53 ? 63  ALA A C   1 
ATOM   467  O  O   . ALA A 1 63  ? 51.119 26.185  1.919   1.00 31.58 ? 63  ALA A O   1 
ATOM   468  C  CB  . ALA A 1 63  ? 48.261 27.288  0.886   1.00 31.21 ? 63  ALA A CB  1 
ATOM   469  N  N   . ALA A 1 64  ? 50.900 28.367  2.425   1.00 34.77 ? 64  ALA A N   1 
ATOM   470  C  CA  . ALA A 1 64  ? 52.347 28.634  2.396   1.00 33.36 ? 64  ALA A CA  1 
ATOM   471  C  C   . ALA A 1 64  ? 53.049 27.993  3.576   1.00 32.89 ? 64  ALA A C   1 
ATOM   472  O  O   . ALA A 1 64  ? 54.166 27.497  3.444   1.00 37.52 ? 64  ALA A O   1 
ATOM   473  C  CB  . ALA A 1 64  ? 52.631 30.134  2.373   1.00 33.31 ? 64  ALA A CB  1 
ATOM   474  N  N   . ALA A 1 65  ? 52.393 27.993  4.728   1.00 30.45 ? 65  ALA A N   1 
ATOM   475  C  CA  . ALA A 1 65  ? 52.968 27.395  5.917   1.00 28.33 ? 65  ALA A CA  1 
ATOM   476  C  C   . ALA A 1 65  ? 53.128 25.896  5.681   1.00 32.36 ? 65  ALA A C   1 
ATOM   477  O  O   . ALA A 1 65  ? 54.156 25.313  6.032   1.00 32.19 ? 65  ALA A O   1 
ATOM   478  C  CB  . ALA A 1 65  ? 52.073 27.654  7.111   1.00 27.03 ? 65  ALA A CB  1 
ATOM   479  N  N   . LEU A 1 66  ? 52.117 25.281  5.068   1.00 33.19 ? 66  LEU A N   1 
ATOM   480  C  CA  . LEU A 1 66  ? 52.141 23.846  4.777   1.00 34.62 ? 66  LEU A CA  1 
ATOM   481  C  C   . LEU A 1 66  ? 53.196 23.456  3.742   1.00 33.79 ? 66  LEU A C   1 
ATOM   482  O  O   . LEU A 1 66  ? 53.807 22.396  3.857   1.00 34.50 ? 66  LEU A O   1 
ATOM   483  C  CB  . LEU A 1 66  ? 50.761 23.349  4.353   1.00 30.71 ? 66  LEU A CB  1 
ATOM   484  C  CG  . LEU A 1 66  ? 49.833 22.777  5.427   1.00 34.74 ? 66  LEU A CG  1 
ATOM   485  C  CD1 . LEU A 1 66  ? 50.135 23.264  6.816   1.00 33.11 ? 66  LEU A CD1 1 
ATOM   486  C  CD2 . LEU A 1 66  ? 48.427 23.134  5.053   1.00 38.11 ? 66  LEU A CD2 1 
ATOM   487  N  N   . THR A 1 67  ? 53.396 24.283  2.719   1.00 36.29 ? 67  THR A N   1 
ATOM   488  C  CA  . THR A 1 67  ? 54.426 23.992  1.721   1.00 32.91 ? 67  THR A CA  1 
ATOM   489  C  C   . THR A 1 67  ? 55.789 23.931  2.426   1.00 36.01 ? 67  THR A C   1 
ATOM   490  O  O   . THR A 1 67  ? 56.600 23.038  2.179   1.00 38.24 ? 67  THR A O   1 
ATOM   491  C  CB  . THR A 1 67  ? 54.484 25.076  0.635   1.00 30.61 ? 67  THR A CB  1 
ATOM   492  O  OG1 . THR A 1 67  ? 53.251 25.093  -0.096  1.00 32.79 ? 67  THR A OG1 1 
ATOM   493  C  CG2 . THR A 1 67  ? 55.647 24.817  -0.313  1.00 30.01 ? 67  THR A CG2 1 
ATOM   494  N  N   . LYS A 1 68  ? 56.012 24.883  3.327   1.00 36.53 ? 68  LYS A N   1 
ATOM   495  C  CA  . LYS A 1 68  ? 57.244 24.979  4.090   1.00 37.11 ? 68  LYS A CA  1 
ATOM   496  C  C   . LYS A 1 68  ? 57.446 23.725  4.922   1.00 36.69 ? 68  LYS A C   1 
ATOM   497  O  O   . LYS A 1 68  ? 58.554 23.197  5.013   1.00 41.77 ? 68  LYS A O   1 
ATOM   498  C  CB  . LYS A 1 68  ? 57.199 26.209  5.008   1.00 41.05 ? 68  LYS A CB  1 
ATOM   499  C  CG  . LYS A 1 68  ? 58.553 26.651  5.528   1.00 47.04 ? 68  LYS A CG  1 
ATOM   500  C  CD  . LYS A 1 68  ? 58.424 27.711  6.612   1.00 52.88 ? 68  LYS A CD  1 
ATOM   501  C  CE  . LYS A 1 68  ? 59.776 28.361  6.908   1.00 58.76 ? 68  LYS A CE  1 
ATOM   502  N  NZ  . LYS A 1 68  ? 60.840 27.358  7.274   1.00 61.61 ? 68  LYS A NZ  1 
ATOM   503  N  N   . ALA A 1 69  ? 56.384 23.257  5.552   1.00 34.38 ? 69  ALA A N   1 
ATOM   504  C  CA  . ALA A 1 69  ? 56.487 22.069  6.362   1.00 31.31 ? 69  ALA A CA  1 
ATOM   505  C  C   . ALA A 1 69  ? 56.834 20.873  5.468   1.00 35.18 ? 69  ALA A C   1 
ATOM   506  O  O   . ALA A 1 69  ? 57.692 20.070  5.818   1.00 36.68 ? 69  ALA A O   1 
ATOM   507  C  CB  . ALA A 1 69  ? 55.199 21.841  7.114   1.00 27.60 ? 69  ALA A CB  1 
ATOM   508  N  N   . VAL A 1 70  ? 56.247 20.804  4.274   1.00 37.43 ? 70  VAL A N   1 
ATOM   509  C  CA  . VAL A 1 70  ? 56.503 19.690  3.349   1.00 38.81 ? 70  VAL A CA  1 
ATOM   510  C  C   . VAL A 1 70  ? 57.984 19.631  2.927   1.00 41.15 ? 70  VAL A C   1 
ATOM   511  O  O   . VAL A 1 70  ? 58.561 18.556  2.817   1.00 42.71 ? 70  VAL A O   1 
ATOM   512  C  CB  . VAL A 1 70  ? 55.539 19.754  2.115   1.00 36.29 ? 70  VAL A CB  1 
ATOM   513  C  CG1 . VAL A 1 70  ? 55.998 18.847  0.991   1.00 30.91 ? 70  VAL A CG1 1 
ATOM   514  C  CG2 . VAL A 1 70  ? 54.128 19.369  2.542   1.00 33.46 ? 70  VAL A CG2 1 
ATOM   515  N  N   . GLU A 1 71  ? 58.608 20.793  2.758   1.00 45.47 ? 71  GLU A N   1 
ATOM   516  C  CA  . GLU A 1 71  ? 60.017 20.867  2.380   1.00 46.14 ? 71  GLU A CA  1 
ATOM   517  C  C   . GLU A 1 71  ? 60.914 20.579  3.574   1.00 44.47 ? 71  GLU A C   1 
ATOM   518  O  O   . GLU A 1 71  ? 62.078 20.267  3.391   1.00 50.79 ? 71  GLU A O   1 
ATOM   519  C  CB  . GLU A 1 71  ? 60.375 22.261  1.859   1.00 48.14 ? 71  GLU A CB  1 
ATOM   520  C  CG  . GLU A 1 71  ? 59.551 22.737  0.680   1.00 55.03 ? 71  GLU A CG  1 
ATOM   521  C  CD  . GLU A 1 71  ? 60.021 24.087  0.147   1.00 60.29 ? 71  GLU A CD  1 
ATOM   522  O  OE1 . GLU A 1 71  ? 61.110 24.127  -0.465  1.00 65.89 ? 71  GLU A OE1 1 
ATOM   523  O  OE2 . GLU A 1 71  ? 59.316 25.105  0.336   1.00 59.27 ? 71  GLU A OE2 1 
ATOM   524  N  N   . HIS A 1 72  ? 60.402 20.752  4.791   1.00 40.67 ? 72  HIS A N   1 
ATOM   525  C  CA  . HIS A 1 72  ? 61.193 20.516  5.999   1.00 39.34 ? 72  HIS A CA  1 
ATOM   526  C  C   . HIS A 1 72  ? 60.547 19.473  6.923   1.00 40.90 ? 72  HIS A C   1 
ATOM   527  O  O   . HIS A 1 72  ? 60.515 19.638  8.145   1.00 38.76 ? 72  HIS A O   1 
ATOM   528  C  CB  . HIS A 1 72  ? 61.420 21.839  6.748   1.00 42.99 ? 72  HIS A CB  1 
ATOM   529  C  CG  . HIS A 1 72  ? 62.076 22.908  5.918   1.00 48.22 ? 72  HIS A CG  1 
ATOM   530  N  ND1 . HIS A 1 72  ? 61.370 23.729  5.061   1.00 50.40 ? 72  HIS A ND1 1 
ATOM   531  C  CD2 . HIS A 1 72  ? 63.370 23.292  5.816   1.00 47.25 ? 72  HIS A CD2 1 
ATOM   532  C  CE1 . HIS A 1 72  ? 62.196 24.572  4.468   1.00 45.76 ? 72  HIS A CE1 1 
ATOM   533  N  NE2 . HIS A 1 72  ? 63.417 24.327  4.910   1.00 51.96 ? 72  HIS A NE2 1 
ATOM   534  N  N   . LEU A 1 73  ? 60.111 18.364  6.325   1.00 43.08 ? 73  LEU A N   1 
ATOM   535  C  CA  . LEU A 1 73  ? 59.446 17.248  7.018   1.00 48.21 ? 73  LEU A CA  1 
ATOM   536  C  C   . LEU A 1 73  ? 60.215 16.591  8.183   1.00 49.93 ? 73  LEU A C   1 
ATOM   537  O  O   . LEU A 1 73  ? 59.616 16.026  9.111   1.00 45.51 ? 73  LEU A O   1 
ATOM   538  C  CB  . LEU A 1 73  ? 59.070 16.189  5.976   1.00 49.07 ? 73  LEU A CB  1 
ATOM   539  C  CG  . LEU A 1 73  ? 57.609 15.778  5.729   1.00 50.68 ? 73  LEU A CG  1 
ATOM   540  C  CD1 . LEU A 1 73  ? 56.624 16.887  6.080   1.00 45.61 ? 73  LEU A CD1 1 
ATOM   541  C  CD2 . LEU A 1 73  ? 57.453 15.344  4.270   1.00 46.01 ? 73  LEU A CD2 1 
ATOM   542  N  N   . ASP A 1 74  ? 61.542 16.661  8.121   1.00 55.24 ? 74  ASP A N   1 
ATOM   543  C  CA  . ASP A 1 74  ? 62.412 16.081  9.146   1.00 55.44 ? 74  ASP A CA  1 
ATOM   544  C  C   . ASP A 1 74  ? 62.600 16.975  10.355  1.00 54.34 ? 74  ASP A C   1 
ATOM   545  O  O   . ASP A 1 74  ? 62.984 16.506  11.436  1.00 51.92 ? 74  ASP A O   1 
ATOM   546  C  CB  . ASP A 1 74  ? 63.778 15.771  8.545   1.00 56.99 ? 74  ASP A CB  1 
ATOM   547  C  CG  . ASP A 1 74  ? 63.741 14.574  7.635   1.00 60.10 ? 74  ASP A CG  1 
ATOM   548  O  OD1 . ASP A 1 74  ? 63.807 14.771  6.405   1.00 60.68 ? 74  ASP A OD1 1 
ATOM   549  O  OD2 . ASP A 1 74  ? 63.622 13.441  8.155   1.00 58.06 ? 74  ASP A OD2 1 
ATOM   550  N  N   . ASP A 1 75  ? 62.353 18.267  10.157  1.00 53.35 ? 75  ASP A N   1 
ATOM   551  C  CA  . ASP A 1 75  ? 62.505 19.246  11.220  1.00 51.89 ? 75  ASP A CA  1 
ATOM   552  C  C   . ASP A 1 75  ? 61.284 20.141  11.329  1.00 50.95 ? 75  ASP A C   1 
ATOM   553  O  O   . ASP A 1 75  ? 61.389 21.373  11.248  1.00 54.36 ? 75  ASP A O   1 
ATOM   554  C  CB  . ASP A 1 75  ? 63.759 20.102  10.983  1.00 51.03 ? 75  ASP A CB  1 
ATOM   555  C  CG  . ASP A 1 75  ? 64.056 21.044  12.145  1.00 49.17 ? 75  ASP A CG  1 
ATOM   556  O  OD1 . ASP A 1 75  ? 64.688 22.094  11.892  1.00 48.80 ? 75  ASP A OD1 1 
ATOM   557  O  OD2 . ASP A 1 75  ? 63.653 20.732  13.298  1.00 48.23 ? 75  ASP A OD2 1 
ATOM   558  N  N   . LEU A 1 76  ? 60.119 19.533  11.514  1.00 49.22 ? 76  LEU A N   1 
ATOM   559  C  CA  . LEU A 1 76  ? 58.906 20.331  11.651  1.00 45.90 ? 76  LEU A CA  1 
ATOM   560  C  C   . LEU A 1 76  ? 59.013 21.309  12.830  1.00 44.56 ? 76  LEU A C   1 
ATOM   561  O  O   . LEU A 1 76  ? 58.623 22.471  12.699  1.00 43.30 ? 76  LEU A O   1 
ATOM   562  C  CB  . LEU A 1 76  ? 57.664 19.451  11.772  1.00 39.58 ? 76  LEU A CB  1 
ATOM   563  C  CG  . LEU A 1 76  ? 57.174 18.806  10.478  1.00 36.12 ? 76  LEU A CG  1 
ATOM   564  C  CD1 . LEU A 1 76  ? 55.902 18.034  10.797  1.00 41.04 ? 76  LEU A CD1 1 
ATOM   565  C  CD2 . LEU A 1 76  ? 56.925 19.846  9.396   1.00 30.96 ? 76  LEU A CD2 1 
ATOM   566  N  N   . PRO A 1 77  ? 59.586 20.870  13.977  1.00 45.98 ? 77  PRO A N   1 
ATOM   567  C  CA  . PRO A 1 77  ? 59.704 21.793  15.114  1.00 44.16 ? 77  PRO A CA  1 
ATOM   568  C  C   . PRO A 1 77  ? 60.480 23.075  14.771  1.00 45.06 ? 77  PRO A C   1 
ATOM   569  O  O   . PRO A 1 77  ? 60.100 24.171  15.185  1.00 44.06 ? 77  PRO A O   1 
ATOM   570  C  CB  . PRO A 1 77  ? 60.438 20.947  16.157  1.00 44.01 ? 77  PRO A CB  1 
ATOM   571  C  CG  . PRO A 1 77  ? 59.912 19.575  15.879  1.00 39.78 ? 77  PRO A CG  1 
ATOM   572  C  CD  . PRO A 1 77  ? 60.004 19.510  14.377  1.00 42.37 ? 77  PRO A CD  1 
ATOM   573  N  N   . GLY A 1 78  ? 61.556 22.943  14.007  1.00 43.37 ? 78  GLY A N   1 
ATOM   574  C  CA  . GLY A 1 78  ? 62.321 24.117  13.653  1.00 42.16 ? 78  GLY A CA  1 
ATOM   575  C  C   . GLY A 1 78  ? 61.594 24.983  12.645  1.00 43.88 ? 78  GLY A C   1 
ATOM   576  O  O   . GLY A 1 78  ? 61.548 26.203  12.783  1.00 49.85 ? 78  GLY A O   1 
ATOM   577  N  N   . ALA A 1 79  ? 60.978 24.352  11.652  1.00 45.03 ? 79  ALA A N   1 
ATOM   578  C  CA  . ALA A 1 79  ? 60.269 25.082  10.602  1.00 46.02 ? 79  ALA A CA  1 
ATOM   579  C  C   . ALA A 1 79  ? 58.988 25.863  10.988  1.00 48.12 ? 79  ALA A C   1 
ATOM   580  O  O   . ALA A 1 79  ? 58.697 26.896  10.378  1.00 50.12 ? 79  ALA A O   1 
ATOM   581  C  CB  . ALA A 1 79  ? 59.970 24.138  9.443   1.00 41.98 ? 79  ALA A CB  1 
ATOM   582  N  N   . LEU A 1 80  ? 58.233 25.378  11.980  1.00 47.68 ? 80  LEU A N   1 
ATOM   583  C  CA  . LEU A 1 80  ? 56.966 26.006  12.393  1.00 44.15 ? 80  LEU A CA  1 
ATOM   584  C  C   . LEU A 1 80  ? 56.964 26.718  13.749  1.00 45.45 ? 80  LEU A C   1 
ATOM   585  O  O   . LEU A 1 80  ? 55.904 27.078  14.254  1.00 47.19 ? 80  LEU A O   1 
ATOM   586  C  CB  . LEU A 1 80  ? 55.852 24.949  12.390  1.00 39.91 ? 80  LEU A CB  1 
ATOM   587  C  CG  . LEU A 1 80  ? 55.752 24.044  11.156  1.00 36.04 ? 80  LEU A CG  1 
ATOM   588  C  CD1 . LEU A 1 80  ? 54.711 22.989  11.388  1.00 34.49 ? 80  LEU A CD1 1 
ATOM   589  C  CD2 . LEU A 1 80  ? 55.439 24.855  9.928   1.00 32.54 ? 80  LEU A CD2 1 
ATOM   590  N  N   . SER A 1 81  ? 58.152 26.962  14.295  1.00 51.01 ? 81  SER A N   1 
ATOM   591  C  CA  . SER A 1 81  ? 58.371 27.612  15.602  1.00 49.04 ? 81  SER A CA  1 
ATOM   592  C  C   . SER A 1 81  ? 57.563 28.879  15.893  1.00 45.74 ? 81  SER A C   1 
ATOM   593  O  O   . SER A 1 81  ? 56.899 29.007  16.935  1.00 45.27 ? 81  SER A O   1 
ATOM   594  C  CB  . SER A 1 81  ? 59.865 27.937  15.742  1.00 56.59 ? 81  SER A CB  1 
ATOM   595  O  OG  . SER A 1 81  ? 60.334 28.679  14.617  1.00 57.85 ? 81  SER A OG  1 
ATOM   596  N  N   . GLU A 1 82  ? 57.752 29.855  15.017  1.00 43.22 ? 82  GLU A N   1 
ATOM   597  C  CA  . GLU A 1 82  ? 57.084 31.141  15.080  1.00 41.67 ? 82  GLU A CA  1 
ATOM   598  C  C   . GLU A 1 82  ? 55.582 30.894  15.178  1.00 38.44 ? 82  GLU A C   1 
ATOM   599  O  O   . GLU A 1 82  ? 54.914 31.436  16.054  1.00 35.27 ? 82  GLU A O   1 
ATOM   600  C  CB  . GLU A 1 82  ? 57.409 31.961  13.829  1.00 47.42 ? 82  GLU A CB  1 
ATOM   601  C  CG  . GLU A 1 82  ? 58.737 31.587  13.140  1.00 56.07 ? 82  GLU A CG  1 
ATOM   602  C  CD  . GLU A 1 82  ? 58.683 30.235  12.384  1.00 63.45 ? 82  GLU A CD  1 
ATOM   603  O  OE1 . GLU A 1 82  ? 57.576 29.825  11.946  1.00 66.52 ? 82  GLU A OE1 1 
ATOM   604  O  OE2 . GLU A 1 82  ? 59.747 29.577  12.242  1.00 61.76 ? 82  GLU A OE2 1 
ATOM   605  N  N   . LEU A 1 83  ? 55.062 30.045  14.298  1.00 39.03 ? 83  LEU A N   1 
ATOM   606  C  CA  . LEU A 1 83  ? 53.639 29.720  14.297  1.00 36.38 ? 83  LEU A CA  1 
ATOM   607  C  C   . LEU A 1 83  ? 53.182 28.991  15.558  1.00 37.15 ? 83  LEU A C   1 
ATOM   608  O  O   . LEU A 1 83  ? 52.031 29.119  15.958  1.00 38.10 ? 83  LEU A O   1 
ATOM   609  C  CB  . LEU A 1 83  ? 53.273 28.896  13.071  1.00 33.11 ? 83  LEU A CB  1 
ATOM   610  C  CG  . LEU A 1 83  ? 53.319 29.646  11.755  1.00 32.32 ? 83  LEU A CG  1 
ATOM   611  C  CD1 . LEU A 1 83  ? 52.944 28.706  10.629  1.00 33.18 ? 83  LEU A CD1 1 
ATOM   612  C  CD2 . LEU A 1 83  ? 52.364 30.807  11.824  1.00 35.03 ? 83  LEU A CD2 1 
ATOM   613  N  N   . SER A 1 84  ? 54.051 28.183  16.152  1.00 37.90 ? 84  SER A N   1 
ATOM   614  C  CA  . SER A 1 84  ? 53.693 27.479  17.375  1.00 38.87 ? 84  SER A CA  1 
ATOM   615  C  C   . SER A 1 84  ? 53.511 28.518  18.487  1.00 42.51 ? 84  SER A C   1 
ATOM   616  O  O   . SER A 1 84  ? 52.527 28.494  19.235  1.00 41.11 ? 84  SER A O   1 
ATOM   617  C  CB  . SER A 1 84  ? 54.785 26.474  17.756  1.00 40.83 ? 84  SER A CB  1 
ATOM   618  O  OG  . SER A 1 84  ? 54.552 25.924  19.053  1.00 46.30 ? 84  SER A OG  1 
ATOM   619  N  N   . ASP A 1 85  ? 54.451 29.455  18.563  1.00 44.10 ? 85  ASP A N   1 
ATOM   620  C  CA  . ASP A 1 85  ? 54.414 30.516  19.557  1.00 44.51 ? 85  ASP A CA  1 
ATOM   621  C  C   . ASP A 1 85  ? 53.074 31.276  19.416  1.00 41.83 ? 85  ASP A C   1 
ATOM   622  O  O   . ASP A 1 85  ? 52.357 31.473  20.408  1.00 40.93 ? 85  ASP A O   1 
ATOM   623  C  CB  . ASP A 1 85  ? 55.612 31.452  19.309  1.00 51.66 ? 85  ASP A CB  1 
ATOM   624  C  CG  . ASP A 1 85  ? 56.121 32.119  20.572  1.00 54.07 ? 85  ASP A CG  1 
ATOM   625  O  OD1 . ASP A 1 85  ? 55.588 33.186  20.953  1.00 53.24 ? 85  ASP A OD1 1 
ATOM   626  O  OD2 . ASP A 1 85  ? 57.081 31.585  21.165  1.00 59.39 ? 85  ASP A OD2 1 
ATOM   627  N  N   . LEU A 1 86  ? 52.720 31.620  18.170  1.00 36.90 ? 86  LEU A N   1 
ATOM   628  C  CA  . LEU A 1 86  ? 51.500 32.363  17.823  1.00 31.85 ? 86  LEU A CA  1 
ATOM   629  C  C   . LEU A 1 86  ? 50.180 31.677  18.160  1.00 32.08 ? 86  LEU A C   1 
ATOM   630  O  O   . LEU A 1 86  ? 49.342 32.270  18.825  1.00 35.61 ? 86  LEU A O   1 
ATOM   631  C  CB  . LEU A 1 86  ? 51.497 32.742  16.328  1.00 29.77 ? 86  LEU A CB  1 
ATOM   632  C  CG  . LEU A 1 86  ? 50.225 33.416  15.767  1.00 31.34 ? 86  LEU A CG  1 
ATOM   633  C  CD1 . LEU A 1 86  ? 50.056 34.849  16.286  1.00 34.01 ? 86  LEU A CD1 1 
ATOM   634  C  CD2 . LEU A 1 86  ? 50.227 33.411  14.261  1.00 23.76 ? 86  LEU A CD2 1 
ATOM   635  N  N   . HIS A 1 87  ? 49.997 30.436  17.710  1.00 32.32 ? 87  HIS A N   1 
ATOM   636  C  CA  . HIS A 1 87  ? 48.755 29.688  17.947  1.00 32.89 ? 87  HIS A CA  1 
ATOM   637  C  C   . HIS A 1 87  ? 48.517 29.220  19.375  1.00 33.00 ? 87  HIS A C   1 
ATOM   638  O  O   . HIS A 1 87  ? 47.371 29.156  19.825  1.00 33.79 ? 87  HIS A O   1 
ATOM   639  C  CB  . HIS A 1 87  ? 48.655 28.479  17.006  1.00 27.41 ? 87  HIS A CB  1 
ATOM   640  C  CG  . HIS A 1 87  ? 48.458 28.845  15.565  1.00 22.91 ? 87  HIS A CG  1 
ATOM   641  N  ND1 . HIS A 1 87  ? 49.485 29.133  14.692  1.00 28.49 ? 87  HIS A ND1 1 
ATOM   642  C  CD2 . HIS A 1 87  ? 47.320 28.995  14.845  1.00 26.48 ? 87  HIS A CD2 1 
ATOM   643  C  CE1 . HIS A 1 87  ? 48.960 29.444  13.501  1.00 25.14 ? 87  HIS A CE1 1 
ATOM   644  N  NE2 . HIS A 1 87  ? 47.647 29.376  13.537  1.00 29.13 ? 87  HIS A NE2 1 
ATOM   645  N  N   . ALA A 1 88  ? 49.602 28.870  20.063  1.00 37.05 ? 88  ALA A N   1 
ATOM   646  C  CA  . ALA A 1 88  ? 49.566 28.380  21.444  1.00 35.53 ? 88  ALA A CA  1 
ATOM   647  C  C   . ALA A 1 88  ? 49.715 29.437  22.537  1.00 35.12 ? 88  ALA A C   1 
ATOM   648  O  O   . ALA A 1 88  ? 48.924 29.474  23.474  1.00 35.59 ? 88  ALA A O   1 
ATOM   649  C  CB  . ALA A 1 88  ? 50.632 27.298  21.639  1.00 34.90 ? 88  ALA A CB  1 
ATOM   650  N  N   . HIS A 1 89  ? 50.748 30.265  22.440  1.00 35.47 ? 89  HIS A N   1 
ATOM   651  C  CA  . HIS A 1 89  ? 50.981 31.281  23.454  1.00 40.03 ? 89  HIS A CA  1 
ATOM   652  C  C   . HIS A 1 89  ? 50.059 32.487  23.299  1.00 39.90 ? 89  HIS A C   1 
ATOM   653  O  O   . HIS A 1 89  ? 49.339 32.853  24.221  1.00 43.35 ? 89  HIS A O   1 
ATOM   654  C  CB  . HIS A 1 89  ? 52.448 31.716  23.425  1.00 45.93 ? 89  HIS A CB  1 
ATOM   655  C  CG  . HIS A 1 89  ? 52.848 32.624  24.553  1.00 56.46 ? 89  HIS A CG  1 
ATOM   656  N  ND1 . HIS A 1 89  ? 52.842 34.002  24.445  1.00 63.65 ? 89  HIS A ND1 1 
ATOM   657  C  CD2 . HIS A 1 89  ? 53.339 32.349  25.787  1.00 58.73 ? 89  HIS A CD2 1 
ATOM   658  C  CE1 . HIS A 1 89  ? 53.314 34.535  25.560  1.00 63.39 ? 89  HIS A CE1 1 
ATOM   659  N  NE2 . HIS A 1 89  ? 53.624 33.552  26.389  1.00 65.21 ? 89  HIS A NE2 1 
ATOM   660  N  N   . LYS A 1 90  ? 50.065 33.080  22.115  1.00 38.09 ? 90  LYS A N   1 
ATOM   661  C  CA  . LYS A 1 90  ? 49.265 34.257  21.830  1.00 34.14 ? 90  LYS A CA  1 
ATOM   662  C  C   . LYS A 1 90  ? 47.761 34.033  21.650  1.00 35.47 ? 90  LYS A C   1 
ATOM   663  O  O   . LYS A 1 90  ? 46.973 34.543  22.431  1.00 35.32 ? 90  LYS A O   1 
ATOM   664  C  CB  . LYS A 1 90  ? 49.839 34.969  20.599  1.00 36.20 ? 90  LYS A CB  1 
ATOM   665  C  CG  . LYS A 1 90  ? 49.252 36.337  20.330  1.00 40.12 ? 90  LYS A CG  1 
ATOM   666  C  CD  . LYS A 1 90  ? 49.976 37.028  19.187  1.00 45.70 ? 90  LYS A CD  1 
ATOM   667  C  CE  . LYS A 1 90  ? 49.620 38.516  19.112  1.00 50.17 ? 90  LYS A CE  1 
ATOM   668  N  NZ  . LYS A 1 90  ? 48.191 38.783  18.752  1.00 54.90 ? 90  LYS A NZ  1 
ATOM   669  N  N   . LEU A 1 91  ? 47.371 33.265  20.633  1.00 34.90 ? 91  LEU A N   1 
ATOM   670  C  CA  . LEU A 1 91  ? 45.956 33.012  20.320  1.00 33.28 ? 91  LEU A CA  1 
ATOM   671  C  C   . LEU A 1 91  ? 45.185 32.103  21.263  1.00 29.95 ? 91  LEU A C   1 
ATOM   672  O  O   . LEU A 1 91  ? 43.974 32.246  21.399  1.00 32.49 ? 91  LEU A O   1 
ATOM   673  C  CB  . LEU A 1 91  ? 45.822 32.464  18.894  1.00 32.31 ? 91  LEU A CB  1 
ATOM   674  C  CG  . LEU A 1 91  ? 46.378 33.393  17.815  1.00 31.52 ? 91  LEU A CG  1 
ATOM   675  C  CD1 . LEU A 1 91  ? 46.342 32.694  16.483  1.00 32.51 ? 91  LEU A CD1 1 
ATOM   676  C  CD2 . LEU A 1 91  ? 45.597 34.698  17.777  1.00 27.16 ? 91  LEU A CD2 1 
ATOM   677  N  N   . ARG A 1 92  ? 45.880 31.128  21.841  1.00 31.23 ? 92  ARG A N   1 
ATOM   678  C  CA  . ARG A 1 92  ? 45.306 30.158  22.773  1.00 30.17 ? 92  ARG A CA  1 
ATOM   679  C  C   . ARG A 1 92  ? 44.311 29.258  22.079  1.00 27.21 ? 92  ARG A C   1 
ATOM   680  O  O   . ARG A 1 92  ? 43.277 28.942  22.657  1.00 30.33 ? 92  ARG A O   1 
ATOM   681  C  CB  . ARG A 1 92  ? 44.585 30.847  23.942  1.00 33.90 ? 92  ARG A CB  1 
ATOM   682  C  CG  . ARG A 1 92  ? 45.454 31.611  24.911  1.00 41.31 ? 92  ARG A CG  1 
ATOM   683  C  CD  . ARG A 1 92  ? 46.433 30.690  25.580  1.00 47.76 ? 92  ARG A CD  1 
ATOM   684  N  NE  . ARG A 1 92  ? 47.033 31.312  26.754  1.00 54.83 ? 92  ARG A NE  1 
ATOM   685  C  CZ  . ARG A 1 92  ? 48.122 30.853  27.365  1.00 59.03 ? 92  ARG A CZ  1 
ATOM   686  N  NH1 . ARG A 1 92  ? 48.743 29.770  26.912  1.00 60.94 ? 92  ARG A NH1 1 
ATOM   687  N  NH2 . ARG A 1 92  ? 48.583 31.468  28.443  1.00 63.67 ? 92  ARG A NH2 1 
ATOM   688  N  N   . VAL A 1 93  ? 44.599 28.847  20.849  1.00 28.62 ? 93  VAL A N   1 
ATOM   689  C  CA  . VAL A 1 93  ? 43.667 27.982  20.106  1.00 29.84 ? 93  VAL A CA  1 
ATOM   690  C  C   . VAL A 1 93  ? 43.447 26.602  20.722  1.00 28.96 ? 93  VAL A C   1 
ATOM   691  O  O   . VAL A 1 93  ? 44.394 25.842  20.901  1.00 25.43 ? 93  VAL A O   1 
ATOM   692  C  CB  . VAL A 1 93  ? 44.084 27.774  18.635  1.00 29.05 ? 93  VAL A CB  1 
ATOM   693  C  CG1 . VAL A 1 93  ? 43.015 26.950  17.896  1.00 24.55 ? 93  VAL A CG1 1 
ATOM   694  C  CG2 . VAL A 1 93  ? 44.318 29.124  17.954  1.00 25.53 ? 93  VAL A CG2 1 
ATOM   695  N  N   . ASP A 1 94  ? 42.184 26.273  20.990  1.00 28.42 ? 94  ASP A N   1 
ATOM   696  C  CA  . ASP A 1 94  ? 41.822 24.992  21.570  1.00 27.26 ? 94  ASP A CA  1 
ATOM   697  C  C   . ASP A 1 94  ? 42.271 23.947  20.576  1.00 27.51 ? 94  ASP A C   1 
ATOM   698  O  O   . ASP A 1 94  ? 41.873 23.977  19.419  1.00 28.69 ? 94  ASP A O   1 
ATOM   699  C  CB  . ASP A 1 94  ? 40.312 24.920  21.753  1.00 29.37 ? 94  ASP A CB  1 
ATOM   700  C  CG  . ASP A 1 94  ? 39.874 23.702  22.536  1.00 32.67 ? 94  ASP A CG  1 
ATOM   701  O  OD1 . ASP A 1 94  ? 40.388 22.587  22.301  1.00 32.62 ? 94  ASP A OD1 1 
ATOM   702  O  OD2 . ASP A 1 94  ? 39.003 23.866  23.405  1.00 35.51 ? 94  ASP A OD2 1 
ATOM   703  N  N   . PRO A 1 95  ? 43.081 22.981  21.020  1.00 29.26 ? 95  PRO A N   1 
ATOM   704  C  CA  . PRO A 1 95  ? 43.571 21.935  20.128  1.00 27.88 ? 95  PRO A CA  1 
ATOM   705  C  C   . PRO A 1 95  ? 42.535 21.116  19.372  1.00 27.62 ? 95  PRO A C   1 
ATOM   706  O  O   . PRO A 1 95  ? 42.872 20.484  18.381  1.00 28.81 ? 95  PRO A O   1 
ATOM   707  C  CB  . PRO A 1 95  ? 44.472 21.096  21.032  1.00 28.51 ? 95  PRO A CB  1 
ATOM   708  C  CG  . PRO A 1 95  ? 43.952 21.345  22.371  1.00 32.26 ? 95  PRO A CG  1 
ATOM   709  C  CD  . PRO A 1 95  ? 43.658 22.818  22.353  1.00 28.05 ? 95  PRO A CD  1 
ATOM   710  N  N   . VAL A 1 96  ? 41.268 21.205  19.757  1.00 28.05 ? 96  VAL A N   1 
ATOM   711  C  CA  . VAL A 1 96  ? 40.229 20.468  19.037  1.00 27.93 ? 96  VAL A CA  1 
ATOM   712  C  C   . VAL A 1 96  ? 40.084 21.047  17.613  1.00 26.69 ? 96  VAL A C   1 
ATOM   713  O  O   . VAL A 1 96  ? 39.872 20.311  16.642  1.00 25.87 ? 96  VAL A O   1 
ATOM   714  C  CB  . VAL A 1 96  ? 38.850 20.542  19.769  1.00 31.26 ? 96  VAL A CB  1 
ATOM   715  C  CG1 . VAL A 1 96  ? 37.757 19.813  18.950  1.00 31.18 ? 96  VAL A CG1 1 
ATOM   716  C  CG2 . VAL A 1 96  ? 38.961 19.932  21.175  1.00 34.22 ? 96  VAL A CG2 1 
ATOM   717  N  N   . ASN A 1 97  ? 40.274 22.361  17.498  1.00 25.79 ? 97  ASN A N   1 
ATOM   718  C  CA  . ASN A 1 97  ? 40.144 23.061  16.235  1.00 22.25 ? 97  ASN A CA  1 
ATOM   719  C  C   . ASN A 1 97  ? 41.100 22.633  15.131  1.00 22.39 ? 97  ASN A C   1 
ATOM   720  O  O   . ASN A 1 97  ? 40.775 22.723  13.946  1.00 23.69 ? 97  ASN A O   1 
ATOM   721  C  CB  . ASN A 1 97  ? 40.237 24.558  16.474  1.00 26.84 ? 97  ASN A CB  1 
ATOM   722  C  CG  . ASN A 1 97  ? 39.138 25.074  17.384  1.00 30.51 ? 97  ASN A CG  1 
ATOM   723  O  OD1 . ASN A 1 97  ? 37.991 25.191  16.972  1.00 32.65 ? 97  ASN A OD1 1 
ATOM   724  N  ND2 . ASN A 1 97  ? 39.481 25.364  18.627  1.00 29.65 ? 97  ASN A ND2 1 
ATOM   725  N  N   . PHE A 1 98  ? 42.255 22.107  15.515  1.00 24.65 ? 98  PHE A N   1 
ATOM   726  C  CA  . PHE A 1 98  ? 43.235 21.667  14.545  1.00 24.50 ? 98  PHE A CA  1 
ATOM   727  C  C   . PHE A 1 98  ? 42.749 20.409  13.824  1.00 24.67 ? 98  PHE A C   1 
ATOM   728  O  O   . PHE A 1 98  ? 43.033 20.210  12.646  1.00 26.14 ? 98  PHE A O   1 
ATOM   729  C  CB  . PHE A 1 98  ? 44.580 21.455  15.214  1.00 23.63 ? 98  PHE A CB  1 
ATOM   730  C  CG  . PHE A 1 98  ? 45.204 22.716  15.706  1.00 29.30 ? 98  PHE A CG  1 
ATOM   731  C  CD1 . PHE A 1 98  ? 45.895 23.551  14.834  1.00 33.21 ? 98  PHE A CD1 1 
ATOM   732  C  CD2 . PHE A 1 98  ? 45.128 23.068  17.050  1.00 31.09 ? 98  PHE A CD2 1 
ATOM   733  C  CE1 . PHE A 1 98  ? 46.507 24.728  15.295  1.00 36.17 ? 98  PHE A CE1 1 
ATOM   734  C  CE2 . PHE A 1 98  ? 45.733 24.232  17.519  1.00 32.13 ? 98  PHE A CE2 1 
ATOM   735  C  CZ  . PHE A 1 98  ? 46.425 25.065  16.638  1.00 32.90 ? 98  PHE A CZ  1 
ATOM   736  N  N   . LYS A 1 99  ? 41.997 19.573  14.538  1.00 26.99 ? 99  LYS A N   1 
ATOM   737  C  CA  . LYS A 1 99  ? 41.406 18.356  13.999  1.00 22.55 ? 99  LYS A CA  1 
ATOM   738  C  C   . LYS A 1 99  ? 40.368 18.754  12.961  1.00 24.62 ? 99  LYS A C   1 
ATOM   739  O  O   . LYS A 1 99  ? 40.242 18.139  11.900  1.00 24.47 ? 99  LYS A O   1 
ATOM   740  C  CB  . LYS A 1 99  ? 40.748 17.563  15.119  1.00 25.01 ? 99  LYS A CB  1 
ATOM   741  C  CG  . LYS A 1 99  ? 41.739 17.084  16.170  1.00 35.53 ? 99  LYS A CG  1 
ATOM   742  C  CD  . LYS A 1 99  ? 41.114 16.114  17.141  1.00 37.74 ? 99  LYS A CD  1 
ATOM   743  C  CE  . LYS A 1 99  ? 42.165 15.143  17.666  1.00 44.04 ? 99  LYS A CE  1 
ATOM   744  N  NZ  . LYS A 1 99  ? 41.552 14.121  18.583  1.00 48.62 ? 99  LYS A NZ  1 
ATOM   745  N  N   . LEU A 1 100 ? 39.661 19.837  13.254  1.00 27.56 ? 100 LEU A N   1 
ATOM   746  C  CA  . LEU A 1 100 ? 38.624 20.341  12.369  1.00 26.57 ? 100 LEU A CA  1 
ATOM   747  C  C   . LEU A 1 100 ? 39.155 20.951  11.075  1.00 20.72 ? 100 LEU A C   1 
ATOM   748  O  O   . LEU A 1 100 ? 38.573 20.771  10.018  1.00 20.04 ? 100 LEU A O   1 
ATOM   749  C  CB  . LEU A 1 100 ? 37.707 21.319  13.130  1.00 23.53 ? 100 LEU A CB  1 
ATOM   750  C  CG  . LEU A 1 100 ? 37.150 20.798  14.468  1.00 21.52 ? 100 LEU A CG  1 
ATOM   751  C  CD1 . LEU A 1 100 ? 36.409 21.898  15.151  1.00 20.24 ? 100 LEU A CD1 1 
ATOM   752  C  CD2 . LEU A 1 100 ? 36.233 19.596  14.267  1.00 20.02 ? 100 LEU A CD2 1 
ATOM   753  N  N   . LEU A 1 101 ? 40.342 21.537  11.127  1.00 22.56 ? 101 LEU A N   1 
ATOM   754  C  CA  . LEU A 1 101 ? 40.917 22.164  9.946   1.00 21.93 ? 101 LEU A CA  1 
ATOM   755  C  C   . LEU A 1 101 ? 41.526 21.085  9.084   1.00 20.84 ? 101 LEU A C   1 
ATOM   756  O  O   . LEU A 1 101 ? 41.436 21.137  7.864   1.00 26.72 ? 101 LEU A O   1 
ATOM   757  C  CB  . LEU A 1 101 ? 41.999 23.173  10.312  1.00 24.84 ? 101 LEU A CB  1 
ATOM   758  C  CG  . LEU A 1 101 ? 42.669 23.908  9.150   1.00 26.07 ? 101 LEU A CG  1 
ATOM   759  C  CD1 . LEU A 1 101 ? 41.658 24.643  8.293   1.00 24.27 ? 101 LEU A CD1 1 
ATOM   760  C  CD2 . LEU A 1 101 ? 43.671 24.879  9.699   1.00 30.25 ? 101 LEU A CD2 1 
ATOM   761  N  N   . SER A 1 102 ? 42.134 20.097  9.738   1.00 27.09 ? 102 SER A N   1 
ATOM   762  C  CA  . SER A 1 102 ? 42.774 18.979  9.057   1.00 24.73 ? 102 SER A CA  1 
ATOM   763  C  C   . SER A 1 102 ? 41.739 18.191  8.300   1.00 23.94 ? 102 SER A C   1 
ATOM   764  O  O   . SER A 1 102 ? 41.971 17.813  7.153   1.00 22.59 ? 102 SER A O   1 
ATOM   765  C  CB  . SER A 1 102 ? 43.475 18.061  10.058  1.00 27.05 ? 102 SER A CB  1 
ATOM   766  O  OG  . SER A 1 102 ? 44.484 18.775  10.762  1.00 34.29 ? 102 SER A OG  1 
ATOM   767  N  N   . HIS A 1 103 ? 40.559 18.034  8.901   1.00 23.49 ? 103 HIS A N   1 
ATOM   768  C  CA  . HIS A 1 103 ? 39.496 17.290  8.240   1.00 21.38 ? 103 HIS A CA  1 
ATOM   769  C  C   . HIS A 1 103 ? 39.029 18.068  6.997   1.00 23.69 ? 103 HIS A C   1 
ATOM   770  O  O   . HIS A 1 103 ? 38.931 17.503  5.899   1.00 22.38 ? 103 HIS A O   1 
ATOM   771  C  CB  . HIS A 1 103 ? 38.332 17.007  9.200   1.00 18.90 ? 103 HIS A CB  1 
ATOM   772  C  CG  . HIS A 1 103 ? 37.131 16.445  8.526   1.00 24.41 ? 103 HIS A CG  1 
ATOM   773  N  ND1 . HIS A 1 103 ? 35.971 17.164  8.341   1.00 26.80 ? 103 HIS A ND1 1 
ATOM   774  C  CD2 . HIS A 1 103 ? 36.945 15.269  7.883   1.00 22.91 ? 103 HIS A CD2 1 
ATOM   775  C  CE1 . HIS A 1 103 ? 35.135 16.466  7.600   1.00 20.87 ? 103 HIS A CE1 1 
ATOM   776  N  NE2 . HIS A 1 103 ? 35.701 15.310  7.313   1.00 26.46 ? 103 HIS A NE2 1 
ATOM   777  N  N   . SER A 1 104 ? 38.924 19.390  7.130   1.00 22.51 ? 104 SER A N   1 
ATOM   778  C  CA  . SER A 1 104 ? 38.486 20.259  6.032   1.00 25.01 ? 104 SER A CA  1 
ATOM   779  C  C   . SER A 1 104 ? 39.480 20.232  4.881   1.00 24.95 ? 104 SER A C   1 
ATOM   780  O  O   . SER A 1 104 ? 39.091 20.291  3.717   1.00 25.58 ? 104 SER A O   1 
ATOM   781  C  CB  . SER A 1 104 ? 38.314 21.694  6.526   1.00 25.66 ? 104 SER A CB  1 
ATOM   782  O  OG  . SER A 1 104 ? 37.631 21.723  7.771   1.00 27.19 ? 104 SER A OG  1 
ATOM   783  N  N   . LEU A 1 105 ? 40.767 20.227  5.209   1.00 24.52 ? 105 LEU A N   1 
ATOM   784  C  CA  . LEU A 1 105 ? 41.815 20.154  4.209   1.00 24.93 ? 105 LEU A CA  1 
ATOM   785  C  C   . LEU A 1 105 ? 41.718 18.836  3.464   1.00 24.07 ? 105 LEU A C   1 
ATOM   786  O  O   . LEU A 1 105 ? 41.711 18.817  2.239   1.00 24.98 ? 105 LEU A O   1 
ATOM   787  C  CB  . LEU A 1 105 ? 43.175 20.254  4.876   1.00 25.55 ? 105 LEU A CB  1 
ATOM   788  C  CG  . LEU A 1 105 ? 43.888 21.589  4.656   1.00 39.88 ? 105 LEU A CG  1 
ATOM   789  C  CD1 . LEU A 1 105 ? 45.045 21.672  5.615   1.00 39.58 ? 105 LEU A CD1 1 
ATOM   790  C  CD2 . LEU A 1 105 ? 44.355 21.744  3.190   1.00 35.83 ? 105 LEU A CD2 1 
ATOM   791  N  N   . LEU A 1 106 ? 41.583 17.738  4.207   1.00 26.77 ? 106 LEU A N   1 
ATOM   792  C  CA  . LEU A 1 106 ? 41.482 16.411  3.602   1.00 26.09 ? 106 LEU A CA  1 
ATOM   793  C  C   . LEU A 1 106 ? 40.286 16.383  2.683   1.00 22.63 ? 106 LEU A C   1 
ATOM   794  O  O   . LEU A 1 106 ? 40.396 15.881  1.579   1.00 18.98 ? 106 LEU A O   1 
ATOM   795  C  CB  . LEU A 1 106 ? 41.387 15.291  4.659   1.00 25.20 ? 106 LEU A CB  1 
ATOM   796  C  CG  . LEU A 1 106 ? 42.734 14.983  5.335   1.00 22.99 ? 106 LEU A CG  1 
ATOM   797  C  CD1 . LEU A 1 106 ? 42.572 13.967  6.418   1.00 21.34 ? 106 LEU A CD1 1 
ATOM   798  C  CD2 . LEU A 1 106 ? 43.715 14.479  4.296   1.00 28.25 ? 106 LEU A CD2 1 
ATOM   799  N  N   . VAL A 1 107 ? 39.167 16.959  3.112   1.00 24.20 ? 107 VAL A N   1 
ATOM   800  C  CA  . VAL A 1 107 ? 37.973 17.011  2.255   1.00 24.63 ? 107 VAL A CA  1 
ATOM   801  C  C   . VAL A 1 107 ? 38.232 17.801  0.971   1.00 25.48 ? 107 VAL A C   1 
ATOM   802  O  O   . VAL A 1 107 ? 37.805 17.376  -0.097  1.00 28.05 ? 107 VAL A O   1 
ATOM   803  C  CB  . VAL A 1 107 ? 36.740 17.606  2.987   1.00 25.02 ? 107 VAL A CB  1 
ATOM   804  C  CG1 . VAL A 1 107 ? 35.624 17.905  2.005   1.00 20.37 ? 107 VAL A CG1 1 
ATOM   805  C  CG2 . VAL A 1 107 ? 36.241 16.625  4.034   1.00 22.83 ? 107 VAL A CG2 1 
ATOM   806  N  N   . THR A 1 108 ? 38.904 18.952  1.082   1.00 28.96 ? 108 THR A N   1 
ATOM   807  C  CA  . THR A 1 108 ? 39.226 19.815  -0.063  1.00 26.71 ? 108 THR A CA  1 
ATOM   808  C  C   . THR A 1 108 ? 40.102 19.072  -1.086  1.00 25.51 ? 108 THR A C   1 
ATOM   809  O  O   . THR A 1 108 ? 39.822 19.070  -2.292  1.00 26.93 ? 108 THR A O   1 
ATOM   810  C  CB  . THR A 1 108 ? 39.942 21.137  0.409   1.00 27.21 ? 108 THR A CB  1 
ATOM   811  O  OG1 . THR A 1 108 ? 39.070 21.891  1.263   1.00 23.91 ? 108 THR A OG1 1 
ATOM   812  C  CG2 . THR A 1 108 ? 40.309 21.997  -0.775  1.00 27.38 ? 108 THR A CG2 1 
ATOM   813  N  N   . LEU A 1 109 ? 41.146 18.409  -0.586  1.00 23.98 ? 109 LEU A N   1 
ATOM   814  C  CA  . LEU A 1 109 ? 42.086 17.647  -1.412  1.00 25.58 ? 109 LEU A CA  1 
ATOM   815  C  C   . LEU A 1 109 ? 41.404 16.494  -2.145  1.00 27.45 ? 109 LEU A C   1 
ATOM   816  O  O   . LEU A 1 109 ? 41.615 16.279  -3.334  1.00 29.09 ? 109 LEU A O   1 
ATOM   817  C  CB  . LEU A 1 109 ? 43.191 17.080  -0.514  1.00 26.59 ? 109 LEU A CB  1 
ATOM   818  C  CG  . LEU A 1 109 ? 44.537 17.785  -0.383  1.00 27.50 ? 109 LEU A CG  1 
ATOM   819  C  CD1 . LEU A 1 109 ? 44.445 19.254  -0.723  1.00 24.41 ? 109 LEU A CD1 1 
ATOM   820  C  CD2 . LEU A 1 109 ? 45.082 17.519  1.030   1.00 25.05 ? 109 LEU A CD2 1 
ATOM   821  N  N   . ALA A 1 110 ? 40.596 15.747  -1.413  1.00 24.37 ? 110 ALA A N   1 
ATOM   822  C  CA  . ALA A 1 110 ? 39.859 14.630  -1.963  1.00 23.25 ? 110 ALA A CA  1 
ATOM   823  C  C   . ALA A 1 110 ? 39.024 15.041  -3.176  1.00 27.90 ? 110 ALA A C   1 
ATOM   824  O  O   . ALA A 1 110 ? 39.015 14.328  -4.186  1.00 29.84 ? 110 ALA A O   1 
ATOM   825  C  CB  . ALA A 1 110 ? 38.968 14.015  -0.881  1.00 19.80 ? 110 ALA A CB  1 
ATOM   826  N  N   . SER A 1 111 ? 38.372 16.202  -3.112  1.00 28.45 ? 111 SER A N   1 
ATOM   827  C  CA  . SER A 1 111 ? 37.521 16.664  -4.211  1.00 32.82 ? 111 SER A CA  1 
ATOM   828  C  C   . SER A 1 111 ? 38.250 17.283  -5.412  1.00 32.40 ? 111 SER A C   1 
ATOM   829  O  O   . SER A 1 111 ? 37.634 17.556  -6.443  1.00 36.65 ? 111 SER A O   1 
ATOM   830  C  CB  . SER A 1 111 ? 36.467 17.643  -3.693  1.00 27.46 ? 111 SER A CB  1 
ATOM   831  O  OG  . SER A 1 111 ? 37.084 18.759  -3.104  1.00 35.13 ? 111 SER A OG  1 
ATOM   832  N  N   . HIS A 1 112 ? 39.547 17.539  -5.285  1.00 35.65 ? 112 HIS A N   1 
ATOM   833  C  CA  . HIS A 1 112 ? 40.291 18.128  -6.397  1.00 33.71 ? 112 HIS A CA  1 
ATOM   834  C  C   . HIS A 1 112 ? 41.314 17.173  -6.967  1.00 34.49 ? 112 HIS A C   1 
ATOM   835  O  O   . HIS A 1 112 ? 41.770 17.348  -8.100  1.00 34.93 ? 112 HIS A O   1 
ATOM   836  C  CB  . HIS A 1 112 ? 40.976 19.424  -5.974  1.00 30.91 ? 112 HIS A CB  1 
ATOM   837  C  CG  . HIS A 1 112 ? 40.025 20.539  -5.692  1.00 30.85 ? 112 HIS A CG  1 
ATOM   838  N  ND1 . HIS A 1 112 ? 39.514 21.352  -6.680  1.00 32.86 ? 112 HIS A ND1 1 
ATOM   839  C  CD2 . HIS A 1 112 ? 39.474 20.967  -4.532  1.00 30.29 ? 112 HIS A CD2 1 
ATOM   840  C  CE1 . HIS A 1 112 ? 38.687 22.229  -6.142  1.00 31.24 ? 112 HIS A CE1 1 
ATOM   841  N  NE2 . HIS A 1 112 ? 38.646 22.014  -4.841  1.00 27.84 ? 112 HIS A NE2 1 
ATOM   842  N  N   . LEU A 1 113 ? 41.679 16.170  -6.168  1.00 36.44 ? 113 LEU A N   1 
ATOM   843  C  CA  . LEU A 1 113 ? 42.654 15.158  -6.566  1.00 33.74 ? 113 LEU A CA  1 
ATOM   844  C  C   . LEU A 1 113 ? 42.130 13.757  -6.290  1.00 31.11 ? 113 LEU A C   1 
ATOM   845  O  O   . LEU A 1 113 ? 42.785 12.971  -5.613  1.00 33.67 ? 113 LEU A O   1 
ATOM   846  C  CB  . LEU A 1 113 ? 43.970 15.354  -5.801  1.00 39.07 ? 113 LEU A CB  1 
ATOM   847  C  CG  . LEU A 1 113 ? 44.610 16.746  -5.756  1.00 40.77 ? 113 LEU A CG  1 
ATOM   848  C  CD1 . LEU A 1 113 ? 45.636 16.789  -4.631  1.00 34.02 ? 113 LEU A CD1 1 
ATOM   849  C  CD2 . LEU A 1 113 ? 45.222 17.118  -7.118  1.00 39.15 ? 113 LEU A CD2 1 
ATOM   850  N  N   . PRO A 1 114 ? 40.961 13.405  -6.848  1.00 31.65 ? 114 PRO A N   1 
ATOM   851  C  CA  . PRO A 1 114 ? 40.389 12.069  -6.628  1.00 30.52 ? 114 PRO A CA  1 
ATOM   852  C  C   . PRO A 1 114 ? 41.265 10.858  -7.030  1.00 31.88 ? 114 PRO A C   1 
ATOM   853  O  O   . PRO A 1 114 ? 41.336 9.884   -6.284  1.00 33.50 ? 114 PRO A O   1 
ATOM   854  C  CB  . PRO A 1 114 ? 39.089 12.128  -7.411  1.00 29.75 ? 114 PRO A CB  1 
ATOM   855  C  CG  . PRO A 1 114 ? 39.379 13.116  -8.479  1.00 33.18 ? 114 PRO A CG  1 
ATOM   856  C  CD  . PRO A 1 114 ? 40.114 14.191  -7.753  1.00 27.37 ? 114 PRO A CD  1 
ATOM   857  N  N   . SER A 1 115 ? 41.932 10.913  -8.187  1.00 31.27 ? 115 SER A N   1 
ATOM   858  C  CA  . SER A 1 115 ? 42.785 9.811   -8.642  1.00 32.30 ? 115 SER A CA  1 
ATOM   859  C  C   . SER A 1 115 ? 43.988 9.658   -7.746  1.00 32.13 ? 115 SER A C   1 
ATOM   860  O  O   . SER A 1 115 ? 44.421 8.552   -7.455  1.00 38.97 ? 115 SER A O   1 
ATOM   861  C  CB  . SER A 1 115 ? 43.289 10.042  -10.067 1.00 32.28 ? 115 SER A CB  1 
ATOM   862  O  OG  . SER A 1 115 ? 42.329 9.624   -11.015 1.00 39.70 ? 115 SER A OG  1 
ATOM   863  N  N   . ASP A 1 116 ? 44.561 10.781  -7.352  1.00 34.08 ? 116 ASP A N   1 
ATOM   864  C  CA  . ASP A 1 116 ? 45.730 10.783  -6.491  1.00 34.96 ? 116 ASP A CA  1 
ATOM   865  C  C   . ASP A 1 116 ? 45.371 10.510  -5.026  1.00 34.02 ? 116 ASP A C   1 
ATOM   866  O  O   . ASP A 1 116 ? 46.191 9.998   -4.274  1.00 33.27 ? 116 ASP A O   1 
ATOM   867  C  CB  . ASP A 1 116 ? 46.469 12.129  -6.613  1.00 41.03 ? 116 ASP A CB  1 
ATOM   868  C  CG  . ASP A 1 116 ? 46.853 12.474  -8.056  1.00 44.80 ? 116 ASP A CG  1 
ATOM   869  O  OD1 . ASP A 1 116 ? 47.826 11.885  -8.568  1.00 51.94 ? 116 ASP A OD1 1 
ATOM   870  O  OD2 . ASP A 1 116 ? 46.200 13.351  -8.671  1.00 48.53 ? 116 ASP A OD2 1 
ATOM   871  N  N   . PHE A 1 117 ? 44.145 10.831  -4.622  1.00 33.69 ? 117 PHE A N   1 
ATOM   872  C  CA  . PHE A 1 117 ? 43.736 10.630  -3.241  1.00 30.31 ? 117 PHE A CA  1 
ATOM   873  C  C   . PHE A 1 117 ? 43.387 9.179   -2.916  1.00 31.00 ? 117 PHE A C   1 
ATOM   874  O  O   . PHE A 1 117 ? 42.225 8.841   -2.723  1.00 32.06 ? 117 PHE A O   1 
ATOM   875  C  CB  . PHE A 1 117 ? 42.575 11.559  -2.891  1.00 24.16 ? 117 PHE A CB  1 
ATOM   876  C  CG  . PHE A 1 117 ? 42.548 11.946  -1.448  1.00 29.05 ? 117 PHE A CG  1 
ATOM   877  C  CD1 . PHE A 1 117 ? 43.419 12.917  -0.962  1.00 28.92 ? 117 PHE A CD1 1 
ATOM   878  C  CD2 . PHE A 1 117 ? 41.693 11.303  -0.556  1.00 29.86 ? 117 PHE A CD2 1 
ATOM   879  C  CE1 . PHE A 1 117 ? 43.447 13.241  0.394   1.00 28.29 ? 117 PHE A CE1 1 
ATOM   880  C  CE2 . PHE A 1 117 ? 41.708 11.615  0.806   1.00 28.59 ? 117 PHE A CE2 1 
ATOM   881  C  CZ  . PHE A 1 117 ? 42.591 12.588  1.284   1.00 24.64 ? 117 PHE A CZ  1 
ATOM   882  N  N   . THR A 1 118 ? 44.411 8.327   -2.833  1.00 33.14 ? 118 THR A N   1 
ATOM   883  C  CA  . THR A 1 118 ? 44.222 6.902   -2.534  1.00 30.61 ? 118 THR A CA  1 
ATOM   884  C  C   . THR A 1 118 ? 44.199 6.669   -1.029  1.00 31.03 ? 118 THR A C   1 
ATOM   885  O  O   . THR A 1 118 ? 44.591 7.556   -0.266  1.00 34.28 ? 118 THR A O   1 
ATOM   886  C  CB  . THR A 1 118 ? 45.384 6.044   -3.125  1.00 31.46 ? 118 THR A CB  1 
ATOM   887  O  OG1 . THR A 1 118 ? 46.643 6.557   -2.659  1.00 30.63 ? 118 THR A OG1 1 
ATOM   888  C  CG2 . THR A 1 118 ? 45.351 6.051   -4.647  1.00 24.63 ? 118 THR A CG2 1 
ATOM   889  N  N   . PRO A 1 119 ? 43.770 5.475   -0.574  1.00 30.14 ? 119 PRO A N   1 
ATOM   890  C  CA  . PRO A 1 119 ? 43.725 5.159   0.863   1.00 31.10 ? 119 PRO A CA  1 
ATOM   891  C  C   . PRO A 1 119 ? 45.062 5.392   1.621   1.00 30.27 ? 119 PRO A C   1 
ATOM   892  O  O   . PRO A 1 119 ? 45.064 5.956   2.719   1.00 32.42 ? 119 PRO A O   1 
ATOM   893  C  CB  . PRO A 1 119 ? 43.326 3.687   0.882   1.00 28.71 ? 119 PRO A CB  1 
ATOM   894  C  CG  . PRO A 1 119 ? 42.405 3.578   -0.323  1.00 27.63 ? 119 PRO A CG  1 
ATOM   895  C  CD  . PRO A 1 119 ? 43.174 4.370   -1.370  1.00 26.87 ? 119 PRO A CD  1 
ATOM   896  N  N   . ALA A 1 120 ? 46.188 4.992   1.021   1.00 28.05 ? 120 ALA A N   1 
ATOM   897  C  CA  . ALA A 1 120 ? 47.512 5.153   1.643   1.00 26.70 ? 120 ALA A CA  1 
ATOM   898  C  C   . ALA A 1 120 ? 47.925 6.609   1.748   1.00 26.12 ? 120 ALA A C   1 
ATOM   899  O  O   . ALA A 1 120 ? 48.599 7.027   2.708   1.00 25.52 ? 120 ALA A O   1 
ATOM   900  C  CB  . ALA A 1 120 ? 48.564 4.364   0.856   1.00 27.38 ? 120 ALA A CB  1 
ATOM   901  N  N   . VAL A 1 121 ? 47.533 7.385   0.742   1.00 30.93 ? 121 VAL A N   1 
ATOM   902  C  CA  . VAL A 1 121 ? 47.840 8.808   0.707   1.00 31.57 ? 121 VAL A CA  1 
ATOM   903  C  C   . VAL A 1 121 ? 47.012 9.523   1.759   1.00 26.99 ? 121 VAL A C   1 
ATOM   904  O  O   . VAL A 1 121 ? 47.527 10.331  2.508   1.00 29.53 ? 121 VAL A O   1 
ATOM   905  C  CB  . VAL A 1 121 ? 47.591 9.373   -0.680  1.00 31.86 ? 121 VAL A CB  1 
ATOM   906  C  CG1 . VAL A 1 121 ? 47.816 10.868  -0.689  1.00 34.95 ? 121 VAL A CG1 1 
ATOM   907  C  CG2 . VAL A 1 121 ? 48.535 8.713   -1.655  1.00 30.63 ? 121 VAL A CG2 1 
ATOM   908  N  N   . HIS A 1 122 ? 45.736 9.178   1.829   1.00 23.41 ? 122 HIS A N   1 
ATOM   909  C  CA  . HIS A 1 122 ? 44.821 9.726   2.794   1.00 21.46 ? 122 HIS A CA  1 
ATOM   910  C  C   . HIS A 1 122 ? 45.394 9.483   4.186   1.00 23.94 ? 122 HIS A C   1 
ATOM   911  O  O   . HIS A 1 122 ? 45.320 10.343  5.065   1.00 25.51 ? 122 HIS A O   1 
ATOM   912  C  CB  . HIS A 1 122 ? 43.462 9.015   2.610   1.00 24.83 ? 122 HIS A CB  1 
ATOM   913  C  CG  . HIS A 1 122 ? 42.394 9.397   3.596   1.00 22.57 ? 122 HIS A CG  1 
ATOM   914  N  ND1 . HIS A 1 122 ? 41.087 8.986   3.465   1.00 20.76 ? 122 HIS A ND1 1 
ATOM   915  C  CD2 . HIS A 1 122 ? 42.444 10.102  4.759   1.00 18.85 ? 122 HIS A CD2 1 
ATOM   916  C  CE1 . HIS A 1 122 ? 40.379 9.404   4.495   1.00 19.12 ? 122 HIS A CE1 1 
ATOM   917  N  NE2 . HIS A 1 122 ? 41.185 10.080  5.296   1.00 18.47 ? 122 HIS A NE2 1 
ATOM   918  N  N   . ALA A 1 123 ? 45.922 8.284   4.398   1.00 24.71 ? 123 ALA A N   1 
ATOM   919  C  CA  . ALA A 1 123 ? 46.484 7.924   5.699   1.00 24.37 ? 123 ALA A CA  1 
ATOM   920  C  C   . ALA A 1 123 ? 47.761 8.706   6.047   1.00 26.19 ? 123 ALA A C   1 
ATOM   921  O  O   . ALA A 1 123 ? 47.971 9.070   7.202   1.00 28.44 ? 123 ALA A O   1 
ATOM   922  C  CB  . ALA A 1 123 ? 46.740 6.434   5.767   1.00 22.19 ? 123 ALA A CB  1 
ATOM   923  N  N   . SER A 1 124 ? 48.645 8.903   5.065   1.00 28.63 ? 124 SER A N   1 
ATOM   924  C  CA  . SER A 1 124 ? 49.877 9.673   5.270   1.00 27.73 ? 124 SER A CA  1 
ATOM   925  C  C   . SER A 1 124 ? 49.575 11.158  5.505   1.00 25.56 ? 124 SER A C   1 
ATOM   926  O  O   . SER A 1 124 ? 50.169 11.782  6.382   1.00 22.22 ? 124 SER A O   1 
ATOM   927  C  CB  . SER A 1 124 ? 50.817 9.512   4.077   1.00 25.64 ? 124 SER A CB  1 
ATOM   928  O  OG  . SER A 1 124 ? 51.136 8.154   3.883   1.00 27.82 ? 124 SER A OG  1 
ATOM   929  N  N   . LEU A 1 125 ? 48.704 11.722  4.665   1.00 25.31 ? 125 LEU A N   1 
ATOM   930  C  CA  . LEU A 1 125 ? 48.264 13.111  4.804   1.00 27.37 ? 125 LEU A CA  1 
ATOM   931  C  C   . LEU A 1 125 ? 47.659 13.326  6.176   1.00 26.94 ? 125 LEU A C   1 
ATOM   932  O  O   . LEU A 1 125 ? 47.896 14.341  6.808   1.00 26.70 ? 125 LEU A O   1 
ATOM   933  C  CB  . LEU A 1 125 ? 47.215 13.466  3.761   1.00 28.80 ? 125 LEU A CB  1 
ATOM   934  C  CG  . LEU A 1 125 ? 47.677 14.413  2.655   1.00 35.29 ? 125 LEU A CG  1 
ATOM   935  C  CD1 . LEU A 1 125 ? 48.933 15.176  3.064   1.00 36.55 ? 125 LEU A CD1 1 
ATOM   936  C  CD2 . LEU A 1 125 ? 47.915 13.666  1.385   1.00 40.56 ? 125 LEU A CD2 1 
ATOM   937  N  N   . ASP A 1 126 ? 46.864 12.366  6.621   1.00 25.15 ? 126 ASP A N   1 
ATOM   938  C  CA  . ASP A 1 126 ? 46.262 12.442  7.932   1.00 25.61 ? 126 ASP A CA  1 
ATOM   939  C  C   . ASP A 1 126 ? 47.355 12.502  9.016   1.00 27.07 ? 126 ASP A C   1 
ATOM   940  O  O   . ASP A 1 126 ? 47.213 13.255  9.984   1.00 28.21 ? 126 ASP A O   1 
ATOM   941  C  CB  . ASP A 1 126 ? 45.328 11.255  8.168   1.00 23.85 ? 126 ASP A CB  1 
ATOM   942  C  CG  . ASP A 1 126 ? 44.763 11.250  9.565   1.00 27.78 ? 126 ASP A CG  1 
ATOM   943  O  OD1 . ASP A 1 126 ? 45.292 10.527  10.443  1.00 33.25 ? 126 ASP A OD1 1 
ATOM   944  O  OD2 . ASP A 1 126 ? 43.808 12.003  9.799   1.00 28.00 ? 126 ASP A OD2 1 
ATOM   945  N  N   . LYS A 1 127 ? 48.409 11.688  8.882   1.00 28.31 ? 127 LYS A N   1 
ATOM   946  C  CA  . LYS A 1 127 ? 49.532 11.684  9.832   1.00 30.30 ? 127 LYS A CA  1 
ATOM   947  C  C   . LYS A 1 127 ? 50.359 12.976  9.760   1.00 27.54 ? 127 LYS A C   1 
ATOM   948  O  O   . LYS A 1 127 ? 50.793 13.500  10.786  1.00 30.58 ? 127 LYS A O   1 
ATOM   949  C  CB  . LYS A 1 127 ? 50.449 10.489  9.602   1.00 29.01 ? 127 LYS A CB  1 
ATOM   950  C  CG  . LYS A 1 127 ? 49.821 9.178   9.924   1.00 34.33 ? 127 LYS A CG  1 
ATOM   951  C  CD  . LYS A 1 127 ? 50.713 8.031   9.510   1.00 42.87 ? 127 LYS A CD  1 
ATOM   952  C  CE  . LYS A 1 127 ? 50.054 6.693   9.819   1.00 52.44 ? 127 LYS A CE  1 
ATOM   953  N  NZ  . LYS A 1 127 ? 48.634 6.591   9.336   1.00 59.57 ? 127 LYS A NZ  1 
ATOM   954  N  N   . PHE A 1 128 ? 50.580 13.487  8.553   1.00 25.27 ? 128 PHE A N   1 
ATOM   955  C  CA  . PHE A 1 128 ? 51.318 14.730  8.373   1.00 26.03 ? 128 PHE A CA  1 
ATOM   956  C  C   . PHE A 1 128 ? 50.572 15.880  9.105   1.00 27.30 ? 128 PHE A C   1 
ATOM   957  O  O   . PHE A 1 128 ? 51.129 16.526  9.997   1.00 27.20 ? 128 PHE A O   1 
ATOM   958  C  CB  . PHE A 1 128 ? 51.478 14.998  6.869   1.00 26.77 ? 128 PHE A CB  1 
ATOM   959  C  CG  . PHE A 1 128 ? 51.887 16.409  6.517   1.00 30.14 ? 128 PHE A CG  1 
ATOM   960  C  CD1 . PHE A 1 128 ? 53.093 16.934  6.950   1.00 31.34 ? 128 PHE A CD1 1 
ATOM   961  C  CD2 . PHE A 1 128 ? 51.057 17.208  5.729   1.00 32.51 ? 128 PHE A CD2 1 
ATOM   962  C  CE1 . PHE A 1 128 ? 53.464 18.225  6.609   1.00 29.38 ? 128 PHE A CE1 1 
ATOM   963  C  CE2 . PHE A 1 128 ? 51.427 18.504  5.385   1.00 30.42 ? 128 PHE A CE2 1 
ATOM   964  C  CZ  . PHE A 1 128 ? 52.628 19.008  5.828   1.00 31.38 ? 128 PHE A CZ  1 
ATOM   965  N  N   . LEU A 1 129 ? 49.290 16.076  8.789   1.00 26.02 ? 129 LEU A N   1 
ATOM   966  C  CA  . LEU A 1 129 ? 48.489 17.118  9.421   1.00 25.39 ? 129 LEU A CA  1 
ATOM   967  C  C   . LEU A 1 129 ? 48.376 17.004  10.940  1.00 25.03 ? 129 LEU A C   1 
ATOM   968  O  O   . LEU A 1 129 ? 48.286 18.013  11.630  1.00 26.15 ? 129 LEU A O   1 
ATOM   969  C  CB  . LEU A 1 129 ? 47.114 17.202  8.774   1.00 25.49 ? 129 LEU A CB  1 
ATOM   970  C  CG  . LEU A 1 129 ? 47.197 17.718  7.334   1.00 29.29 ? 129 LEU A CG  1 
ATOM   971  C  CD1 . LEU A 1 129 ? 45.820 17.792  6.711   1.00 29.38 ? 129 LEU A CD1 1 
ATOM   972  C  CD2 . LEU A 1 129 ? 47.879 19.074  7.278   1.00 26.21 ? 129 LEU A CD2 1 
ATOM   973  N  N   . ALA A 1 130 ? 48.436 15.787  11.462  1.00 26.11 ? 130 ALA A N   1 
ATOM   974  C  CA  . ALA A 1 130 ? 48.382 15.569  12.903  1.00 25.43 ? 130 ALA A CA  1 
ATOM   975  C  C   . ALA A 1 130 ? 49.736 15.939  13.506  1.00 28.11 ? 130 ALA A C   1 
ATOM   976  O  O   . ALA A 1 130 ? 49.811 16.474  14.608  1.00 28.38 ? 130 ALA A O   1 
ATOM   977  C  CB  . ALA A 1 130 ? 48.067 14.139  13.207  1.00 28.60 ? 130 ALA A CB  1 
ATOM   978  N  N   . ASN A 1 131 ? 50.811 15.629  12.793  1.00 28.41 ? 131 ASN A N   1 
ATOM   979  C  CA  . ASN A 1 131 ? 52.145 15.956  13.266  1.00 32.93 ? 131 ASN A CA  1 
ATOM   980  C  C   . ASN A 1 131 ? 52.324 17.472  13.246  1.00 30.58 ? 131 ASN A C   1 
ATOM   981  O  O   . ASN A 1 131 ? 52.894 18.041  14.163  1.00 33.09 ? 131 ASN A O   1 
ATOM   982  C  CB  . ASN A 1 131 ? 53.202 15.241  12.421  1.00 38.31 ? 131 ASN A CB  1 
ATOM   983  C  CG  . ASN A 1 131 ? 53.835 14.061  13.155  1.00 48.78 ? 131 ASN A CG  1 
ATOM   984  O  OD1 . ASN A 1 131 ? 53.280 12.943  13.216  1.00 47.08 ? 131 ASN A OD1 1 
ATOM   985  N  ND2 . ASN A 1 131 ? 55.015 14.309  13.722  1.00 55.78 ? 131 ASN A ND2 1 
ATOM   986  N  N   . VAL A 1 132 ? 51.804 18.122  12.212  1.00 29.72 ? 132 VAL A N   1 
ATOM   987  C  CA  . VAL A 1 132 ? 51.864 19.572  12.107  1.00 25.89 ? 132 VAL A CA  1 
ATOM   988  C  C   . VAL A 1 132 ? 51.048 20.141  13.279  1.00 27.67 ? 132 VAL A C   1 
ATOM   989  O  O   . VAL A 1 132 ? 51.503 21.024  13.994  1.00 29.26 ? 132 VAL A O   1 
ATOM   990  C  CB  . VAL A 1 132 ? 51.256 20.075  10.753  1.00 25.56 ? 132 VAL A CB  1 
ATOM   991  C  CG1 . VAL A 1 132 ? 50.956 21.582  10.816  1.00 20.34 ? 132 VAL A CG1 1 
ATOM   992  C  CG2 . VAL A 1 132 ? 52.202 19.786  9.589   1.00 26.57 ? 132 VAL A CG2 1 
ATOM   993  N  N   . SER A 1 133 ? 49.851 19.604  13.488  1.00 27.20 ? 133 SER A N   1 
ATOM   994  C  CA  . SER A 1 133 ? 48.993 20.053  14.572  1.00 30.73 ? 133 SER A CA  1 
ATOM   995  C  C   . SER A 1 133 ? 49.687 19.962  15.918  1.00 29.93 ? 133 SER A C   1 
ATOM   996  O  O   . SER A 1 133 ? 49.625 20.894  16.711  1.00 31.44 ? 133 SER A O   1 
ATOM   997  C  CB  . SER A 1 133 ? 47.684 19.257  14.609  1.00 26.34 ? 133 SER A CB  1 
ATOM   998  O  OG  . SER A 1 133 ? 46.807 19.672  13.575  1.00 23.49 ? 133 SER A OG  1 
ATOM   999  N  N   . THR A 1 134 ? 50.375 18.852  16.150  1.00 32.41 ? 134 THR A N   1 
ATOM   1000 C  CA  . THR A 1 134 ? 51.099 18.629  17.398  1.00 34.96 ? 134 THR A CA  1 
ATOM   1001 C  C   . THR A 1 134 ? 52.187 19.669  17.643  1.00 35.49 ? 134 THR A C   1 
ATOM   1002 O  O   . THR A 1 134 ? 52.494 19.972  18.789  1.00 37.21 ? 134 THR A O   1 
ATOM   1003 C  CB  . THR A 1 134 ? 51.746 17.223  17.413  1.00 36.36 ? 134 THR A CB  1 
ATOM   1004 O  OG1 . THR A 1 134 ? 50.718 16.223  17.470  1.00 37.55 ? 134 THR A OG1 1 
ATOM   1005 C  CG2 . THR A 1 134 ? 52.702 17.058  18.614  1.00 34.60 ? 134 THR A CG2 1 
ATOM   1006 N  N   . VAL A 1 135 ? 52.773 20.197  16.568  1.00 40.67 ? 135 VAL A N   1 
ATOM   1007 C  CA  . VAL A 1 135 ? 53.836 21.205  16.664  1.00 40.90 ? 135 VAL A CA  1 
ATOM   1008 C  C   . VAL A 1 135 ? 53.265 22.586  16.982  1.00 39.18 ? 135 VAL A C   1 
ATOM   1009 O  O   . VAL A 1 135 ? 53.785 23.295  17.833  1.00 39.51 ? 135 VAL A O   1 
ATOM   1010 C  CB  . VAL A 1 135 ? 54.686 21.281  15.368  1.00 40.95 ? 135 VAL A CB  1 
ATOM   1011 C  CG1 . VAL A 1 135 ? 55.697 22.398  15.472  1.00 37.64 ? 135 VAL A CG1 1 
ATOM   1012 C  CG2 . VAL A 1 135 ? 55.400 19.955  15.122  1.00 35.29 ? 135 VAL A CG2 1 
ATOM   1013 N  N   . LEU A 1 136 ? 52.188 22.978  16.311  1.00 38.24 ? 136 LEU A N   1 
ATOM   1014 C  CA  . LEU A 1 136 ? 51.589 24.280  16.598  1.00 39.07 ? 136 LEU A CA  1 
ATOM   1015 C  C   . LEU A 1 136 ? 51.019 24.216  18.038  1.00 39.65 ? 136 LEU A C   1 
ATOM   1016 O  O   . LEU A 1 136 ? 50.870 25.225  18.727  1.00 40.94 ? 136 LEU A O   1 
ATOM   1017 C  CB  . LEU A 1 136 ? 50.510 24.640  15.544  1.00 34.34 ? 136 LEU A CB  1 
ATOM   1018 C  CG  . LEU A 1 136 ? 50.957 24.660  14.071  1.00 26.32 ? 136 LEU A CG  1 
ATOM   1019 C  CD1 . LEU A 1 136 ? 49.869 25.140  13.164  1.00 27.43 ? 136 LEU A CD1 1 
ATOM   1020 C  CD2 . LEU A 1 136 ? 52.120 25.561  13.924  1.00 23.33 ? 136 LEU A CD2 1 
ATOM   1021 N  N   . THR A 1 137 ? 50.743 23.002  18.487  1.00 39.29 ? 137 THR A N   1 
ATOM   1022 C  CA  . THR A 1 137 ? 50.235 22.740  19.824  1.00 41.07 ? 137 THR A CA  1 
ATOM   1023 C  C   . THR A 1 137 ? 51.392 22.620  20.844  1.00 44.61 ? 137 THR A C   1 
ATOM   1024 O  O   . THR A 1 137 ? 51.151 22.607  22.037  1.00 48.02 ? 137 THR A O   1 
ATOM   1025 C  CB  . THR A 1 137 ? 49.386 21.433  19.774  1.00 39.14 ? 137 THR A CB  1 
ATOM   1026 O  OG1 . THR A 1 137 ? 48.138 21.711  19.136  1.00 40.59 ? 137 THR A OG1 1 
ATOM   1027 C  CG2 . THR A 1 137 ? 49.138 20.846  21.137  1.00 46.91 ? 137 THR A CG2 1 
ATOM   1028 N  N   . SER A 1 138 ? 52.641 22.615  20.367  1.00 47.79 ? 138 SER A N   1 
ATOM   1029 C  CA  . SER A 1 138 ? 53.854 22.469  21.202  1.00 48.44 ? 138 SER A CA  1 
ATOM   1030 C  C   . SER A 1 138 ? 53.995 23.235  22.514  1.00 52.46 ? 138 SER A C   1 
ATOM   1031 O  O   . SER A 1 138 ? 54.516 22.672  23.477  1.00 53.89 ? 138 SER A O   1 
ATOM   1032 C  CB  . SER A 1 138 ? 55.128 22.727  20.386  1.00 46.57 ? 138 SER A CB  1 
ATOM   1033 O  OG  . SER A 1 138 ? 55.401 21.679  19.477  1.00 51.68 ? 138 SER A OG  1 
ATOM   1034 N  N   . LYS A 1 139 ? 53.627 24.521  22.549  1.00 56.57 ? 139 LYS A N   1 
ATOM   1035 C  CA  . LYS A 1 139 ? 53.746 25.307  23.790  1.00 62.29 ? 139 LYS A CA  1 
ATOM   1036 C  C   . LYS A 1 139 ? 52.895 24.744  24.957  1.00 67.06 ? 139 LYS A C   1 
ATOM   1037 O  O   . LYS A 1 139 ? 52.931 25.274  26.076  1.00 71.42 ? 139 LYS A O   1 
ATOM   1038 C  CB  . LYS A 1 139 ? 53.436 26.789  23.530  1.00 65.26 ? 139 LYS A CB  1 
ATOM   1039 C  CG  . LYS A 1 139 ? 54.261 27.802  24.364  1.00 69.30 ? 139 LYS A CG  1 
ATOM   1040 C  CD  . LYS A 1 139 ? 53.656 28.119  25.750  1.00 67.46 ? 139 LYS A CD  1 
ATOM   1041 C  CE  . LYS A 1 139 ? 54.560 29.067  26.550  1.00 65.47 ? 139 LYS A CE  1 
ATOM   1042 N  NZ  . LYS A 1 139 ? 54.006 29.429  27.889  1.00 64.35 ? 139 LYS A NZ  1 
ATOM   1043 N  N   . TYR A 1 140 ? 52.113 23.695  24.674  1.00 67.81 ? 140 TYR A N   1 
ATOM   1044 C  CA  . TYR A 1 140 ? 51.283 22.988  25.663  1.00 67.80 ? 140 TYR A CA  1 
ATOM   1045 C  C   . TYR A 1 140 ? 51.026 21.538  25.224  1.00 71.98 ? 140 TYR A C   1 
ATOM   1046 O  O   . TYR A 1 140 ? 50.681 21.284  24.061  1.00 74.43 ? 140 TYR A O   1 
ATOM   1047 C  CB  . TYR A 1 140 ? 49.949 23.717  25.992  1.00 65.26 ? 140 TYR A CB  1 
ATOM   1048 C  CG  . TYR A 1 140 ? 49.111 24.314  24.849  1.00 59.01 ? 140 TYR A CG  1 
ATOM   1049 C  CD1 . TYR A 1 140 ? 48.640 23.531  23.780  1.00 54.37 ? 140 TYR A CD1 1 
ATOM   1050 C  CD2 . TYR A 1 140 ? 48.743 25.664  24.880  1.00 54.48 ? 140 TYR A CD2 1 
ATOM   1051 C  CE1 . TYR A 1 140 ? 47.831 24.086  22.780  1.00 50.30 ? 140 TYR A CE1 1 
ATOM   1052 C  CE2 . TYR A 1 140 ? 47.940 26.216  23.895  1.00 53.10 ? 140 TYR A CE2 1 
ATOM   1053 C  CZ  . TYR A 1 140 ? 47.494 25.428  22.850  1.00 51.09 ? 140 TYR A CZ  1 
ATOM   1054 O  OH  . TYR A 1 140 ? 46.749 26.030  21.868  1.00 56.67 ? 140 TYR A OH  1 
ATOM   1055 N  N   . ARG A 1 141 ? 51.248 20.587  26.135  1.00 74.10 ? 141 ARG A N   1 
ATOM   1056 C  CA  . ARG A 1 141 ? 51.048 19.156  25.833  1.00 74.33 ? 141 ARG A CA  1 
ATOM   1057 C  C   . ARG A 1 141 ? 50.115 18.463  26.849  1.00 75.43 ? 141 ARG A C   1 
ATOM   1058 O  O   . ARG A 1 141 ? 49.889 17.236  26.687  1.00 71.90 ? 141 ARG A O   1 
ATOM   1059 C  CB  . ARG A 1 141 ? 52.400 18.401  25.769  1.00 71.42 ? 141 ARG A CB  1 
ATOM   1060 C  CG  . ARG A 1 141 ? 53.368 18.805  24.645  1.00 66.47 ? 141 ARG A CG  1 
ATOM   1061 C  CD  . ARG A 1 141 ? 54.152 20.080  24.961  1.00 64.18 ? 141 ARG A CD  1 
ATOM   1062 N  NE  . ARG A 1 141 ? 55.109 19.952  26.067  1.00 66.94 ? 141 ARG A NE  1 
ATOM   1063 C  CZ  . ARG A 1 141 ? 56.433 20.090  25.942  1.00 67.38 ? 141 ARG A CZ  1 
ATOM   1064 N  NH1 . ARG A 1 141 ? 56.974 20.344  24.754  1.00 66.21 ? 141 ARG A NH1 1 
ATOM   1065 N  NH2 . ARG A 1 141 ? 57.219 20.058  27.017  1.00 67.84 ? 141 ARG A NH2 1 
ATOM   1066 O  OXT . ARG A 1 141 ? 49.635 19.148  27.797  1.00 78.70 ? 141 ARG A OXT 1 
ATOM   1067 N  N   . MET B 2 1   ? 19.234 16.477  12.591  1.00 70.80 ? 202 MET B N   1 
ATOM   1068 C  CA  . MET B 2 1   ? 18.262 17.561  12.946  1.00 73.89 ? 202 MET B CA  1 
ATOM   1069 C  C   . MET B 2 1   ? 18.646 18.829  12.178  1.00 72.77 ? 202 MET B C   1 
ATOM   1070 O  O   . MET B 2 1   ? 19.736 19.381  12.381  1.00 72.97 ? 202 MET B O   1 
ATOM   1071 C  CB  . MET B 2 1   ? 18.277 17.796  14.469  1.00 77.15 ? 202 MET B CB  1 
ATOM   1072 C  CG  . MET B 2 1   ? 17.506 19.023  14.973  1.00 79.34 ? 202 MET B CG  1 
ATOM   1073 S  SD  . MET B 2 1   ? 18.566 20.497  15.199  1.00 92.07 ? 202 MET B SD  1 
ATOM   1074 C  CE  . MET B 2 1   ? 17.888 21.658  13.931  1.00 81.40 ? 202 MET B CE  1 
ATOM   1075 N  N   . LEU B 2 2   ? 17.767 19.255  11.269  1.00 69.36 ? 203 LEU B N   1 
ATOM   1076 C  CA  . LEU B 2 2   ? 18.008 20.435  10.437  1.00 63.79 ? 203 LEU B CA  1 
ATOM   1077 C  C   . LEU B 2 2   ? 16.706 20.935  9.817   1.00 61.20 ? 203 LEU B C   1 
ATOM   1078 O  O   . LEU B 2 2   ? 15.686 20.246  9.864   1.00 64.47 ? 203 LEU B O   1 
ATOM   1079 C  CB  . LEU B 2 2   ? 19.029 20.112  9.332   1.00 63.43 ? 203 LEU B CB  1 
ATOM   1080 C  CG  . LEU B 2 2   ? 18.857 18.918  8.378   1.00 59.46 ? 203 LEU B CG  1 
ATOM   1081 C  CD1 . LEU B 2 2   ? 19.834 19.044  7.239   1.00 54.07 ? 203 LEU B CD1 1 
ATOM   1082 C  CD2 . LEU B 2 2   ? 19.102 17.606  9.083   1.00 59.46 ? 203 LEU B CD2 1 
ATOM   1083 N  N   . THR B 2 3   ? 16.749 22.129  9.236   1.00 57.45 ? 204 THR B N   1 
ATOM   1084 C  CA  . THR B 2 3   ? 15.577 22.727  8.605   1.00 54.96 ? 204 THR B CA  1 
ATOM   1085 C  C   . THR B 2 3   ? 15.062 21.806  7.501   1.00 56.07 ? 204 THR B C   1 
ATOM   1086 O  O   . THR B 2 3   ? 15.785 20.915  7.042   1.00 56.52 ? 204 THR B O   1 
ATOM   1087 C  CB  . THR B 2 3   ? 15.899 24.118  7.992   1.00 54.02 ? 204 THR B CB  1 
ATOM   1088 O  OG1 . THR B 2 3   ? 16.465 23.962  6.682   1.00 49.59 ? 204 THR B OG1 1 
ATOM   1089 C  CG2 . THR B 2 3   ? 16.876 24.885  8.882   1.00 52.87 ? 204 THR B CG2 1 
ATOM   1090 N  N   . ALA B 2 4   ? 13.827 22.039  7.063   1.00 56.13 ? 205 ALA B N   1 
ATOM   1091 C  CA  . ALA B 2 4   ? 13.211 21.227  6.014   1.00 58.06 ? 205 ALA B CA  1 
ATOM   1092 C  C   . ALA B 2 4   ? 13.811 21.373  4.591   1.00 60.13 ? 205 ALA B C   1 
ATOM   1093 O  O   . ALA B 2 4   ? 13.715 20.430  3.783   1.00 58.94 ? 205 ALA B O   1 
ATOM   1094 C  CB  . ALA B 2 4   ? 11.692 21.460  5.993   1.00 57.97 ? 205 ALA B CB  1 
ATOM   1095 N  N   . GLU B 2 5   ? 14.413 22.535  4.284   1.00 61.45 ? 206 GLU B N   1 
ATOM   1096 C  CA  . GLU B 2 5   ? 15.028 22.796  2.961   1.00 60.07 ? 206 GLU B CA  1 
ATOM   1097 C  C   . GLU B 2 5   ? 16.432 22.182  2.852   1.00 58.11 ? 206 GLU B C   1 
ATOM   1098 O  O   . GLU B 2 5   ? 16.917 21.857  1.752   1.00 55.00 ? 206 GLU B O   1 
ATOM   1099 C  CB  . GLU B 2 5   ? 15.084 24.301  2.662   1.00 62.16 ? 206 GLU B CB  1 
ATOM   1100 C  CG  . GLU B 2 5   ? 15.992 25.106  3.589   1.00 66.19 ? 206 GLU B CG  1 
ATOM   1101 C  CD  . GLU B 2 5   ? 15.977 26.598  3.274   1.00 67.85 ? 206 GLU B CD  1 
ATOM   1102 O  OE1 . GLU B 2 5   ? 15.758 26.956  2.094   1.00 66.28 ? 206 GLU B OE1 1 
ATOM   1103 O  OE2 . GLU B 2 5   ? 16.179 27.415  4.202   1.00 66.88 ? 206 GLU B OE2 1 
ATOM   1104 N  N   . GLU B 2 6   ? 17.092 22.088  4.005   1.00 54.19 ? 207 GLU B N   1 
ATOM   1105 C  CA  . GLU B 2 6   ? 18.403 21.479  4.110   1.00 50.71 ? 207 GLU B CA  1 
ATOM   1106 C  C   . GLU B 2 6   ? 18.131 19.991  3.929   1.00 51.65 ? 207 GLU B C   1 
ATOM   1107 O  O   . GLU B 2 6   ? 18.697 19.339  3.058   1.00 54.46 ? 207 GLU B O   1 
ATOM   1108 C  CB  . GLU B 2 6   ? 18.995 21.736  5.500   1.00 46.51 ? 207 GLU B CB  1 
ATOM   1109 C  CG  . GLU B 2 6   ? 19.288 23.198  5.787   1.00 50.66 ? 207 GLU B CG  1 
ATOM   1110 C  CD  . GLU B 2 6   ? 20.047 23.412  7.088   1.00 54.80 ? 207 GLU B CD  1 
ATOM   1111 O  OE1 . GLU B 2 6   ? 21.015 24.209  7.079   1.00 57.39 ? 207 GLU B OE1 1 
ATOM   1112 O  OE2 . GLU B 2 6   ? 19.682 22.799  8.116   1.00 51.48 ? 207 GLU B OE2 1 
ATOM   1113 N  N   . LYS B 2 7   ? 17.201 19.485  4.730   1.00 50.71 ? 208 LYS B N   1 
ATOM   1114 C  CA  . LYS B 2 7   ? 16.782 18.092  4.697   1.00 49.62 ? 208 LYS B CA  1 
ATOM   1115 C  C   . LYS B 2 7   ? 16.509 17.642  3.261   1.00 46.46 ? 208 LYS B C   1 
ATOM   1116 O  O   . LYS B 2 7   ? 16.820 16.513  2.887   1.00 45.18 ? 208 LYS B O   1 
ATOM   1117 C  CB  . LYS B 2 7   ? 15.521 17.943  5.559   1.00 53.16 ? 208 LYS B CB  1 
ATOM   1118 C  CG  . LYS B 2 7   ? 15.014 16.521  5.805   1.00 56.28 ? 208 LYS B CG  1 
ATOM   1119 C  CD  . LYS B 2 7   ? 13.954 16.539  6.915   1.00 58.63 ? 208 LYS B CD  1 
ATOM   1120 C  CE  . LYS B 2 7   ? 14.547 17.100  8.211   1.00 56.52 ? 208 LYS B CE  1 
ATOM   1121 N  NZ  . LYS B 2 7   ? 13.549 17.806  9.060   1.00 54.27 ? 208 LYS B NZ  1 
ATOM   1122 N  N   . ALA B 2 8   ? 15.935 18.534  2.462   1.00 46.58 ? 209 ALA B N   1 
ATOM   1123 C  CA  . ALA B 2 8   ? 15.630 18.227  1.070   1.00 48.28 ? 209 ALA B CA  1 
ATOM   1124 C  C   . ALA B 2 8   ? 16.900 18.260  0.207   1.00 49.49 ? 209 ALA B C   1 
ATOM   1125 O  O   . ALA B 2 8   ? 17.049 17.453  -0.719  1.00 52.10 ? 209 ALA B O   1 
ATOM   1126 C  CB  . ALA B 2 8   ? 14.575 19.199  0.534   1.00 44.63 ? 209 ALA B CB  1 
ATOM   1127 N  N   . ALA B 2 9   ? 17.794 19.206  0.499   1.00 47.04 ? 210 ALA B N   1 
ATOM   1128 C  CA  . ALA B 2 9   ? 19.071 19.344  -0.220  1.00 45.36 ? 210 ALA B CA  1 
ATOM   1129 C  C   . ALA B 2 9   ? 19.910 18.072  -0.047  1.00 44.52 ? 210 ALA B C   1 
ATOM   1130 O  O   . ALA B 2 9   ? 20.498 17.555  -1.007  1.00 44.45 ? 210 ALA B O   1 
ATOM   1131 C  CB  . ALA B 2 9   ? 19.846 20.561  0.301   1.00 43.97 ? 210 ALA B CB  1 
ATOM   1132 N  N   . VAL B 2 10  ? 19.931 17.567  1.182   1.00 42.30 ? 211 VAL B N   1 
ATOM   1133 C  CA  . VAL B 2 10  ? 20.647 16.348  1.553   1.00 41.14 ? 211 VAL B CA  1 
ATOM   1134 C  C   . VAL B 2 10  ? 20.028 15.086  0.919   1.00 43.85 ? 211 VAL B C   1 
ATOM   1135 O  O   . VAL B 2 10  ? 20.698 14.353  0.182   1.00 44.77 ? 211 VAL B O   1 
ATOM   1136 C  CB  . VAL B 2 10  ? 20.682 16.224  3.105   1.00 41.09 ? 211 VAL B CB  1 
ATOM   1137 C  CG1 . VAL B 2 10  ? 20.560 14.782  3.565   1.00 37.26 ? 211 VAL B CG1 1 
ATOM   1138 C  CG2 . VAL B 2 10  ? 21.947 16.846  3.632   1.00 35.21 ? 211 VAL B CG2 1 
ATOM   1139 N  N   . THR B 2 11  ? 18.739 14.865  1.168   1.00 46.35 ? 212 THR B N   1 
ATOM   1140 C  CA  . THR B 2 11  ? 18.048 13.691  0.642   1.00 44.93 ? 212 THR B CA  1 
ATOM   1141 C  C   . THR B 2 11  ? 18.124 13.624  -0.874  1.00 41.57 ? 212 THR B C   1 
ATOM   1142 O  O   . THR B 2 11  ? 18.194 12.532  -1.437  1.00 43.62 ? 212 THR B O   1 
ATOM   1143 C  CB  . THR B 2 11  ? 16.563 13.625  1.113   1.00 45.26 ? 212 THR B CB  1 
ATOM   1144 O  OG1 . THR B 2 11  ? 15.910 14.865  0.820   1.00 49.84 ? 212 THR B OG1 1 
ATOM   1145 C  CG2 . THR B 2 11  ? 16.482 13.368  2.630   1.00 45.41 ? 212 THR B CG2 1 
ATOM   1146 N  N   . ALA B 2 12  ? 18.196 14.791  -1.514  1.00 40.49 ? 213 ALA B N   1 
ATOM   1147 C  CA  . ALA B 2 12  ? 18.261 14.897  -2.975  1.00 42.60 ? 213 ALA B CA  1 
ATOM   1148 C  C   . ALA B 2 12  ? 19.607 14.424  -3.518  1.00 43.04 ? 213 ALA B C   1 
ATOM   1149 O  O   . ALA B 2 12  ? 19.688 13.768  -4.569  1.00 42.43 ? 213 ALA B O   1 
ATOM   1150 C  CB  . ALA B 2 12  ? 18.000 16.341  -3.407  1.00 39.11 ? 213 ALA B CB  1 
ATOM   1151 N  N   . PHE B 2 13  ? 20.665 14.774  -2.794  1.00 45.83 ? 214 PHE B N   1 
ATOM   1152 C  CA  . PHE B 2 13  ? 22.022 14.403  -3.165  1.00 40.88 ? 214 PHE B CA  1 
ATOM   1153 C  C   . PHE B 2 13  ? 22.271 12.935  -2.815  1.00 39.73 ? 214 PHE B C   1 
ATOM   1154 O  O   . PHE B 2 13  ? 23.025 12.238  -3.501  1.00 38.55 ? 214 PHE B O   1 
ATOM   1155 C  CB  . PHE B 2 13  ? 23.016 15.321  -2.452  1.00 38.66 ? 214 PHE B CB  1 
ATOM   1156 C  CG  . PHE B 2 13  ? 24.452 14.907  -2.608  1.00 37.99 ? 214 PHE B CG  1 
ATOM   1157 C  CD1 . PHE B 2 13  ? 25.224 15.408  -3.648  1.00 40.66 ? 214 PHE B CD1 1 
ATOM   1158 C  CD2 . PHE B 2 13  ? 25.047 14.056  -1.684  1.00 36.37 ? 214 PHE B CD2 1 
ATOM   1159 C  CE1 . PHE B 2 13  ? 26.561 15.074  -3.758  1.00 35.96 ? 214 PHE B CE1 1 
ATOM   1160 C  CE2 . PHE B 2 13  ? 26.381 13.717  -1.788  1.00 32.98 ? 214 PHE B CE2 1 
ATOM   1161 C  CZ  . PHE B 2 13  ? 27.140 14.226  -2.824  1.00 38.12 ? 214 PHE B CZ  1 
ATOM   1162 N  N   . TRP B 2 14  ? 21.618 12.460  -1.760  1.00 38.87 ? 215 TRP B N   1 
ATOM   1163 C  CA  . TRP B 2 14  ? 21.776 11.076  -1.355  1.00 37.34 ? 215 TRP B CA  1 
ATOM   1164 C  C   . TRP B 2 14  ? 21.239 10.141  -2.428  1.00 37.63 ? 215 TRP B C   1 
ATOM   1165 O  O   . TRP B 2 14  ? 21.614 8.974   -2.481  1.00 39.64 ? 215 TRP B O   1 
ATOM   1166 C  CB  . TRP B 2 14  ? 21.076 10.808  -0.033  1.00 37.18 ? 215 TRP B CB  1 
ATOM   1167 C  CG  . TRP B 2 14  ? 21.523 9.530   0.562   1.00 35.88 ? 215 TRP B CG  1 
ATOM   1168 C  CD1 . TRP B 2 14  ? 20.807 8.372   0.663   1.00 42.68 ? 215 TRP B CD1 1 
ATOM   1169 C  CD2 . TRP B 2 14  ? 22.803 9.261   1.132   1.00 34.51 ? 215 TRP B CD2 1 
ATOM   1170 N  NE1 . TRP B 2 14  ? 21.565 7.398   1.263   1.00 39.47 ? 215 TRP B NE1 1 
ATOM   1171 C  CE2 . TRP B 2 14  ? 22.795 7.919   1.564   1.00 35.29 ? 215 TRP B CE2 1 
ATOM   1172 C  CE3 . TRP B 2 14  ? 23.958 10.024  1.323   1.00 31.20 ? 215 TRP B CE3 1 
ATOM   1173 C  CZ2 . TRP B 2 14  ? 23.902 7.323   2.183   1.00 36.48 ? 215 TRP B CZ2 1 
ATOM   1174 C  CZ3 . TRP B 2 14  ? 25.055 9.430   1.938   1.00 33.46 ? 215 TRP B CZ3 1 
ATOM   1175 C  CH2 . TRP B 2 14  ? 25.018 8.096   2.362   1.00 29.55 ? 215 TRP B CH2 1 
ATOM   1176 N  N   . GLY B 2 15  ? 20.364 10.653  -3.286  1.00 39.15 ? 216 GLY B N   1 
ATOM   1177 C  CA  . GLY B 2 15  ? 19.825 9.837   -4.355  1.00 41.14 ? 216 GLY B CA  1 
ATOM   1178 C  C   . GLY B 2 15  ? 20.895 9.389   -5.339  1.00 42.50 ? 216 GLY B C   1 
ATOM   1179 O  O   . GLY B 2 15  ? 20.866 8.258   -5.826  1.00 42.59 ? 216 GLY B O   1 
ATOM   1180 N  N   . LYS B 2 16  ? 21.852 10.267  -5.629  1.00 42.83 ? 217 LYS B N   1 
ATOM   1181 C  CA  . LYS B 2 16  ? 22.920 9.937   -6.570  1.00 42.13 ? 217 LYS B CA  1 
ATOM   1182 C  C   . LYS B 2 16  ? 24.105 9.135   -6.012  1.00 40.59 ? 217 LYS B C   1 
ATOM   1183 O  O   . LYS B 2 16  ? 25.049 8.823   -6.751  1.00 41.17 ? 217 LYS B O   1 
ATOM   1184 C  CB  . LYS B 2 16  ? 23.407 11.201  -7.278  1.00 39.65 ? 217 LYS B CB  1 
ATOM   1185 C  CG  . LYS B 2 16  ? 23.729 12.357  -6.365  1.00 46.03 ? 217 LYS B CG  1 
ATOM   1186 C  CD  . LYS B 2 16  ? 24.238 13.549  -7.156  1.00 47.23 ? 217 LYS B CD  1 
ATOM   1187 C  CE  . LYS B 2 16  ? 23.149 14.139  -8.026  1.00 47.01 ? 217 LYS B CE  1 
ATOM   1188 N  NZ  . LYS B 2 16  ? 23.762 15.097  -8.973  1.00 47.62 ? 217 LYS B NZ  1 
ATOM   1189 N  N   . VAL B 2 17  ? 24.007 8.714   -4.750  1.00 39.05 ? 218 VAL B N   1 
ATOM   1190 C  CA  . VAL B 2 17  ? 25.073 7.955   -4.085  1.00 37.76 ? 218 VAL B CA  1 
ATOM   1191 C  C   . VAL B 2 17  ? 25.005 6.426   -4.290  1.00 41.13 ? 218 VAL B C   1 
ATOM   1192 O  O   . VAL B 2 17  ? 24.026 5.781   -3.906  1.00 42.09 ? 218 VAL B O   1 
ATOM   1193 C  CB  . VAL B 2 17  ? 25.114 8.284   -2.553  1.00 35.72 ? 218 VAL B CB  1 
ATOM   1194 C  CG1 . VAL B 2 17  ? 26.252 7.538   -1.866  1.00 33.75 ? 218 VAL B CG1 1 
ATOM   1195 C  CG2 . VAL B 2 17  ? 25.248 9.797   -2.332  1.00 34.11 ? 218 VAL B CG2 1 
ATOM   1196 N  N   . LYS B 2 18  ? 26.061 5.845   -4.863  1.00 42.97 ? 219 LYS B N   1 
ATOM   1197 C  CA  . LYS B 2 18  ? 26.114 4.398   -5.099  1.00 46.25 ? 219 LYS B CA  1 
ATOM   1198 C  C   . LYS B 2 18  ? 26.617 3.761   -3.813  1.00 46.52 ? 219 LYS B C   1 
ATOM   1199 O  O   . LYS B 2 18  ? 27.823 3.702   -3.582  1.00 48.73 ? 219 LYS B O   1 
ATOM   1200 C  CB  . LYS B 2 18  ? 27.080 4.070   -6.237  1.00 48.16 ? 219 LYS B CB  1 
ATOM   1201 C  CG  . LYS B 2 18  ? 26.894 4.929   -7.466  1.00 51.66 ? 219 LYS B CG  1 
ATOM   1202 C  CD  . LYS B 2 18  ? 25.735 4.460   -8.325  1.00 59.66 ? 219 LYS B CD  1 
ATOM   1203 C  CE  . LYS B 2 18  ? 26.228 3.572   -9.464  1.00 64.15 ? 219 LYS B CE  1 
ATOM   1204 N  NZ  . LYS B 2 18  ? 27.170 4.286   -10.385 1.00 61.54 ? 219 LYS B NZ  1 
ATOM   1205 N  N   . VAL B 2 19  ? 25.689 3.294   -2.984  1.00 48.84 ? 220 VAL B N   1 
ATOM   1206 C  CA  . VAL B 2 19  ? 25.984 2.677   -1.684  1.00 46.09 ? 220 VAL B CA  1 
ATOM   1207 C  C   . VAL B 2 19  ? 26.888 1.440   -1.708  1.00 42.57 ? 220 VAL B C   1 
ATOM   1208 O  O   . VAL B 2 19  ? 27.556 1.134   -0.720  1.00 40.76 ? 220 VAL B O   1 
ATOM   1209 C  CB  . VAL B 2 19  ? 24.658 2.408   -0.896  1.00 48.89 ? 220 VAL B CB  1 
ATOM   1210 C  CG1 . VAL B 2 19  ? 24.879 1.441   0.268   1.00 54.19 ? 220 VAL B CG1 1 
ATOM   1211 C  CG2 . VAL B 2 19  ? 24.087 3.729   -0.369  1.00 46.61 ? 220 VAL B CG2 1 
ATOM   1212 N  N   . ASP B 2 20  ? 26.927 0.735   -2.831  1.00 44.36 ? 221 ASP B N   1 
ATOM   1213 C  CA  . ASP B 2 20  ? 27.793 -0.437  -2.947  1.00 45.27 ? 221 ASP B CA  1 
ATOM   1214 C  C   . ASP B 2 20  ? 29.248 0.042   -2.976  1.00 45.31 ? 221 ASP B C   1 
ATOM   1215 O  O   . ASP B 2 20  ? 30.075 -0.395  -2.187  1.00 48.57 ? 221 ASP B O   1 
ATOM   1216 C  CB  . ASP B 2 20  ? 27.472 -1.233  -4.220  1.00 48.46 ? 221 ASP B CB  1 
ATOM   1217 C  CG  . ASP B 2 20  ? 26.571 -0.468  -5.181  1.00 56.31 ? 221 ASP B CG  1 
ATOM   1218 O  OD1 . ASP B 2 20  ? 27.034 -0.098  -6.281  1.00 61.60 ? 221 ASP B OD1 1 
ATOM   1219 O  OD2 . ASP B 2 20  ? 25.387 -0.240  -4.835  1.00 59.87 ? 221 ASP B OD2 1 
ATOM   1220 N  N   . GLU B 2 21  ? 29.526 1.013   -3.835  1.00 42.60 ? 222 GLU B N   1 
ATOM   1221 C  CA  . GLU B 2 21  ? 30.863 1.556   -3.981  1.00 43.14 ? 222 GLU B CA  1 
ATOM   1222 C  C   . GLU B 2 21  ? 31.331 2.416   -2.805  1.00 41.13 ? 222 GLU B C   1 
ATOM   1223 O  O   . GLU B 2 21  ? 32.342 2.123   -2.176  1.00 42.40 ? 222 GLU B O   1 
ATOM   1224 C  CB  . GLU B 2 21  ? 30.947 2.341   -5.292  1.00 47.04 ? 222 GLU B CB  1 
ATOM   1225 C  CG  . GLU B 2 21  ? 30.878 1.427   -6.523  1.00 55.80 ? 222 GLU B CG  1 
ATOM   1226 C  CD  . GLU B 2 21  ? 30.561 2.158   -7.824  1.00 58.76 ? 222 GLU B CD  1 
ATOM   1227 O  OE1 . GLU B 2 21  ? 29.862 1.565   -8.681  1.00 62.42 ? 222 GLU B OE1 1 
ATOM   1228 O  OE2 . GLU B 2 21  ? 31.001 3.317   -7.991  1.00 64.59 ? 222 GLU B OE2 1 
ATOM   1229 N  N   . VAL B 2 22  ? 30.599 3.479   -2.519  1.00 39.39 ? 223 VAL B N   1 
ATOM   1230 C  CA  . VAL B 2 22  ? 30.943 4.387   -1.438  1.00 38.74 ? 223 VAL B CA  1 
ATOM   1231 C  C   . VAL B 2 22  ? 31.084 3.688   -0.064  1.00 37.03 ? 223 VAL B C   1 
ATOM   1232 O  O   . VAL B 2 22  ? 32.044 3.936   0.672   1.00 38.35 ? 223 VAL B O   1 
ATOM   1233 C  CB  . VAL B 2 22  ? 29.911 5.537   -1.386  1.00 35.44 ? 223 VAL B CB  1 
ATOM   1234 C  CG1 . VAL B 2 22  ? 30.197 6.469   -0.229  1.00 39.50 ? 223 VAL B CG1 1 
ATOM   1235 C  CG2 . VAL B 2 22  ? 29.930 6.305   -2.701  1.00 34.22 ? 223 VAL B CG2 1 
ATOM   1236 N  N   . GLY B 2 23  ? 30.137 2.812   0.268   1.00 37.04 ? 224 GLY B N   1 
ATOM   1237 C  CA  . GLY B 2 23  ? 30.173 2.104   1.536   1.00 30.22 ? 224 GLY B CA  1 
ATOM   1238 C  C   . GLY B 2 23  ? 31.454 1.332   1.786   1.00 32.40 ? 224 GLY B C   1 
ATOM   1239 O  O   . GLY B 2 23  ? 32.052 1.469   2.851   1.00 31.85 ? 224 GLY B O   1 
ATOM   1240 N  N   . GLY B 2 24  ? 31.832 0.469   0.846   1.00 30.33 ? 225 GLY B N   1 
ATOM   1241 C  CA  . GLY B 2 24  ? 33.053 -0.301  0.977   1.00 27.92 ? 225 GLY B CA  1 
ATOM   1242 C  C   . GLY B 2 24  ? 34.321 0.540   0.988   1.00 27.17 ? 225 GLY B C   1 
ATOM   1243 O  O   . GLY B 2 24  ? 35.306 0.152   1.622   1.00 31.59 ? 225 GLY B O   1 
ATOM   1244 N  N   . GLU B 2 25  ? 34.311 1.683   0.299   1.00 25.15 ? 226 GLU B N   1 
ATOM   1245 C  CA  . GLU B 2 25  ? 35.485 2.569   0.249   1.00 25.92 ? 226 GLU B CA  1 
ATOM   1246 C  C   . GLU B 2 25  ? 35.671 3.244   1.599   1.00 27.32 ? 226 GLU B C   1 
ATOM   1247 O  O   . GLU B 2 25  ? 36.792 3.370   2.102   1.00 25.56 ? 226 GLU B O   1 
ATOM   1248 C  CB  . GLU B 2 25  ? 35.349 3.636   -0.833  1.00 25.30 ? 226 GLU B CB  1 
ATOM   1249 C  CG  . GLU B 2 25  ? 36.592 4.514   -0.910  1.00 23.24 ? 226 GLU B CG  1 
ATOM   1250 C  CD  . GLU B 2 25  ? 36.489 5.645   -1.913  1.00 25.60 ? 226 GLU B CD  1 
ATOM   1251 O  OE1 . GLU B 2 25  ? 35.722 5.537   -2.891  1.00 31.55 ? 226 GLU B OE1 1 
ATOM   1252 O  OE2 . GLU B 2 25  ? 37.191 6.654   -1.724  1.00 26.08 ? 226 GLU B OE2 1 
ATOM   1253 N  N   . ALA B 2 26  ? 34.558 3.716   2.150   1.00 30.25 ? 227 ALA B N   1 
ATOM   1254 C  CA  . ALA B 2 26  ? 34.533 4.352   3.454   1.00 31.32 ? 227 ALA B CA  1 
ATOM   1255 C  C   . ALA B 2 26  ? 34.980 3.401   4.585   1.00 30.14 ? 227 ALA B C   1 
ATOM   1256 O  O   . ALA B 2 26  ? 35.869 3.748   5.368   1.00 30.51 ? 227 ALA B O   1 
ATOM   1257 C  CB  . ALA B 2 26  ? 33.143 4.921   3.731   1.00 28.58 ? 227 ALA B CB  1 
ATOM   1258 N  N   . LEU B 2 27  ? 34.411 2.196   4.664   1.00 26.02 ? 228 LEU B N   1 
ATOM   1259 C  CA  . LEU B 2 27  ? 34.807 1.271   5.734   1.00 27.65 ? 228 LEU B CA  1 
ATOM   1260 C  C   . LEU B 2 27  ? 36.274 0.873   5.561   1.00 27.36 ? 228 LEU B C   1 
ATOM   1261 O  O   . LEU B 2 27  ? 37.034 0.796   6.533   1.00 28.45 ? 228 LEU B O   1 
ATOM   1262 C  CB  . LEU B 2 27  ? 33.937 0.015   5.770   1.00 28.98 ? 228 LEU B CB  1 
ATOM   1263 C  CG  . LEU B 2 27  ? 34.273 -0.864  6.977   1.00 29.43 ? 228 LEU B CG  1 
ATOM   1264 C  CD1 . LEU B 2 27  ? 33.904 -0.150  8.256   1.00 33.41 ? 228 LEU B CD1 1 
ATOM   1265 C  CD2 . LEU B 2 27  ? 33.557 -2.187  6.908   1.00 31.24 ? 228 LEU B CD2 1 
ATOM   1266 N  N   . GLY B 2 28  ? 36.649 0.620   4.313   1.00 26.41 ? 229 GLY B N   1 
ATOM   1267 C  CA  . GLY B 2 28  ? 38.008 0.252   4.008   1.00 28.23 ? 229 GLY B CA  1 
ATOM   1268 C  C   . GLY B 2 28  ? 38.964 1.335   4.446   1.00 29.76 ? 229 GLY B C   1 
ATOM   1269 O  O   . GLY B 2 28  ? 39.984 1.039   5.082   1.00 30.83 ? 229 GLY B O   1 
ATOM   1270 N  N   . ARG B 2 29  ? 38.668 2.580   4.061   1.00 28.62 ? 230 ARG B N   1 
ATOM   1271 C  CA  . ARG B 2 29  ? 39.500 3.724   4.443   1.00 28.32 ? 230 ARG B CA  1 
ATOM   1272 C  C   . ARG B 2 29  ? 39.515 3.923   5.959   1.00 25.48 ? 230 ARG B C   1 
ATOM   1273 O  O   . ARG B 2 29  ? 40.495 4.413   6.502   1.00 25.43 ? 230 ARG B O   1 
ATOM   1274 C  CB  . ARG B 2 29  ? 39.031 4.999   3.756   1.00 24.22 ? 230 ARG B CB  1 
ATOM   1275 C  CG  . ARG B 2 29  ? 39.344 5.030   2.313   1.00 22.68 ? 230 ARG B CG  1 
ATOM   1276 C  CD  . ARG B 2 29  ? 39.007 6.395   1.761   1.00 22.22 ? 230 ARG B CD  1 
ATOM   1277 N  NE  . ARG B 2 29  ? 39.318 6.476   0.343   1.00 23.90 ? 230 ARG B NE  1 
ATOM   1278 C  CZ  . ARG B 2 29  ? 40.371 7.102   -0.156  1.00 25.61 ? 230 ARG B CZ  1 
ATOM   1279 N  NH1 . ARG B 2 29  ? 41.216 7.722   0.646   1.00 25.39 ? 230 ARG B NH1 1 
ATOM   1280 N  NH2 . ARG B 2 29  ? 40.612 7.058   -1.455  1.00 24.49 ? 230 ARG B NH2 1 
ATOM   1281 N  N   . LEU B 2 30  ? 38.422 3.585   6.638   1.00 25.47 ? 231 LEU B N   1 
ATOM   1282 C  CA  . LEU B 2 30  ? 38.381 3.706   8.084   1.00 26.13 ? 231 LEU B CA  1 
ATOM   1283 C  C   . LEU B 2 30  ? 39.469 2.780   8.651   1.00 26.37 ? 231 LEU B C   1 
ATOM   1284 O  O   . LEU B 2 30  ? 40.291 3.199   9.453   1.00 24.11 ? 231 LEU B O   1 
ATOM   1285 C  CB  . LEU B 2 30  ? 37.010 3.298   8.633   1.00 21.89 ? 231 LEU B CB  1 
ATOM   1286 C  CG  . LEU B 2 30  ? 37.014 3.257   10.171  1.00 25.13 ? 231 LEU B CG  1 
ATOM   1287 C  CD1 . LEU B 2 30  ? 37.086 4.658   10.723  1.00 20.38 ? 231 LEU B CD1 1 
ATOM   1288 C  CD2 . LEU B 2 30  ? 35.794 2.541   10.678  1.00 25.86 ? 231 LEU B CD2 1 
ATOM   1289 N  N   . LEU B 2 31  ? 39.470 1.524   8.210   1.00 25.27 ? 232 LEU B N   1 
ATOM   1290 C  CA  . LEU B 2 31  ? 40.436 0.517   8.646   1.00 25.26 ? 232 LEU B CA  1 
ATOM   1291 C  C   . LEU B 2 31  ? 41.910 0.833   8.330   1.00 27.95 ? 232 LEU B C   1 
ATOM   1292 O  O   . LEU B 2 31  ? 42.823 0.392   9.041   1.00 24.92 ? 232 LEU B O   1 
ATOM   1293 C  CB  . LEU B 2 31  ? 40.082 -0.820  8.013   1.00 24.64 ? 232 LEU B CB  1 
ATOM   1294 C  CG  . LEU B 2 31  ? 38.775 -1.474  8.423   1.00 26.38 ? 232 LEU B CG  1 
ATOM   1295 C  CD1 . LEU B 2 31  ? 38.628 -2.777  7.674   1.00 32.41 ? 232 LEU B CD1 1 
ATOM   1296 C  CD2 . LEU B 2 31  ? 38.782 -1.736  9.912   1.00 25.64 ? 232 LEU B CD2 1 
ATOM   1297 N  N   . VAL B 2 32  ? 42.139 1.516   7.218   1.00 26.98 ? 233 VAL B N   1 
ATOM   1298 C  CA  . VAL B 2 32  ? 43.496 1.876   6.824   1.00 27.26 ? 233 VAL B CA  1 
ATOM   1299 C  C   . VAL B 2 32  ? 44.045 3.078   7.573   1.00 28.01 ? 233 VAL B C   1 
ATOM   1300 O  O   . VAL B 2 32  ? 45.119 2.991   8.178   1.00 30.28 ? 233 VAL B O   1 
ATOM   1301 C  CB  . VAL B 2 32  ? 43.569 2.156   5.322   1.00 30.39 ? 233 VAL B CB  1 
ATOM   1302 C  CG1 . VAL B 2 32  ? 44.961 2.664   4.952   1.00 30.20 ? 233 VAL B CG1 1 
ATOM   1303 C  CG2 . VAL B 2 32  ? 43.239 0.900   4.550   1.00 28.34 ? 233 VAL B CG2 1 
ATOM   1304 N  N   . VAL B 2 33  ? 43.295 4.183   7.544   1.00 24.76 ? 234 VAL B N   1 
ATOM   1305 C  CA  . VAL B 2 33  ? 43.682 5.451   8.178   1.00 26.55 ? 234 VAL B CA  1 
ATOM   1306 C  C   . VAL B 2 33  ? 43.714 5.432   9.703   1.00 26.76 ? 234 VAL B C   1 
ATOM   1307 O  O   . VAL B 2 33  ? 44.503 6.132   10.311  1.00 29.50 ? 234 VAL B O   1 
ATOM   1308 C  CB  . VAL B 2 33  ? 42.777 6.614   7.710   1.00 25.63 ? 234 VAL B CB  1 
ATOM   1309 C  CG1 . VAL B 2 33  ? 43.356 7.955   8.156   1.00 23.76 ? 234 VAL B CG1 1 
ATOM   1310 C  CG2 . VAL B 2 33  ? 42.612 6.566   6.204   1.00 25.78 ? 234 VAL B CG2 1 
ATOM   1311 N  N   . TYR B 2 34  ? 42.877 4.609   10.317  1.00 25.68 ? 235 TYR B N   1 
ATOM   1312 C  CA  . TYR B 2 34  ? 42.817 4.502   11.779  1.00 21.87 ? 235 TYR B CA  1 
ATOM   1313 C  C   . TYR B 2 34  ? 42.881 3.010   12.095  1.00 22.58 ? 235 TYR B C   1 
ATOM   1314 O  O   . TYR B 2 34  ? 41.920 2.433   12.605  1.00 27.45 ? 235 TYR B O   1 
ATOM   1315 C  CB  . TYR B 2 34  ? 41.500 5.105   12.287  1.00 24.46 ? 235 TYR B CB  1 
ATOM   1316 C  CG  . TYR B 2 34  ? 41.214 6.499   11.752  1.00 24.44 ? 235 TYR B CG  1 
ATOM   1317 C  CD1 . TYR B 2 34  ? 41.929 7.604   12.212  1.00 27.38 ? 235 TYR B CD1 1 
ATOM   1318 C  CD2 . TYR B 2 34  ? 40.258 6.702   10.773  1.00 18.90 ? 235 TYR B CD2 1 
ATOM   1319 C  CE1 . TYR B 2 34  ? 41.698 8.860   11.718  1.00 28.47 ? 235 TYR B CE1 1 
ATOM   1320 C  CE2 . TYR B 2 34  ? 40.021 7.956   10.276  1.00 20.85 ? 235 TYR B CE2 1 
ATOM   1321 C  CZ  . TYR B 2 34  ? 40.740 9.020   10.748  1.00 28.74 ? 235 TYR B CZ  1 
ATOM   1322 O  OH  . TYR B 2 34  ? 40.494 10.296  10.253  1.00 31.25 ? 235 TYR B OH  1 
ATOM   1323 N  N   . PRO B 2 35  ? 44.060 2.399   11.914  1.00 22.72 ? 236 PRO B N   1 
ATOM   1324 C  CA  . PRO B 2 35  ? 44.370 0.985   12.117  1.00 24.85 ? 236 PRO B CA  1 
ATOM   1325 C  C   . PRO B 2 35  ? 43.899 0.295   13.400  1.00 29.83 ? 236 PRO B C   1 
ATOM   1326 O  O   . PRO B 2 35  ? 43.753 -0.942  13.416  1.00 31.44 ? 236 PRO B O   1 
ATOM   1327 C  CB  . PRO B 2 35  ? 45.887 0.952   11.979  1.00 23.73 ? 236 PRO B CB  1 
ATOM   1328 C  CG  . PRO B 2 35  ? 46.185 2.095   11.098  1.00 27.00 ? 236 PRO B CG  1 
ATOM   1329 C  CD  . PRO B 2 35  ? 45.301 3.153   11.677  1.00 22.12 ? 236 PRO B CD  1 
ATOM   1330 N  N   . TRP B 2 36  ? 43.681 1.031   14.489  1.00 27.66 ? 237 TRP B N   1 
ATOM   1331 C  CA  . TRP B 2 36  ? 43.222 0.380   15.715  1.00 24.86 ? 237 TRP B CA  1 
ATOM   1332 C  C   . TRP B 2 36  ? 41.785 -0.156  15.543  1.00 25.29 ? 237 TRP B C   1 
ATOM   1333 O  O   . TRP B 2 36  ? 41.357 -1.041  16.277  1.00 24.09 ? 237 TRP B O   1 
ATOM   1334 C  CB  . TRP B 2 36  ? 43.331 1.311   16.938  1.00 18.95 ? 237 TRP B CB  1 
ATOM   1335 C  CG  . TRP B 2 36  ? 42.563 2.581   16.825  1.00 19.44 ? 237 TRP B CG  1 
ATOM   1336 C  CD1 . TRP B 2 36  ? 41.268 2.782   17.174  1.00 19.53 ? 237 TRP B CD1 1 
ATOM   1337 C  CD2 . TRP B 2 36  ? 43.032 3.830   16.277  1.00 23.18 ? 237 TRP B CD2 1 
ATOM   1338 N  NE1 . TRP B 2 36  ? 40.885 4.058   16.887  1.00 19.57 ? 237 TRP B NE1 1 
ATOM   1339 C  CE2 . TRP B 2 36  ? 41.954 4.723   16.329  1.00 20.82 ? 237 TRP B CE2 1 
ATOM   1340 C  CE3 . TRP B 2 36  ? 44.262 4.267   15.754  1.00 21.54 ? 237 TRP B CE3 1 
ATOM   1341 C  CZ2 . TRP B 2 36  ? 42.044 6.041   15.880  1.00 24.00 ? 237 TRP B CZ2 1 
ATOM   1342 C  CZ3 . TRP B 2 36  ? 44.360 5.576   15.311  1.00 16.16 ? 237 TRP B CZ3 1 
ATOM   1343 C  CH2 . TRP B 2 36  ? 43.280 6.445   15.365  1.00 19.82 ? 237 TRP B CH2 1 
ATOM   1344 N  N   . THR B 2 37  ? 41.075 0.331   14.523  1.00 26.03 ? 238 THR B N   1 
ATOM   1345 C  CA  . THR B 2 37  ? 39.700 -0.095  14.266  1.00 25.99 ? 238 THR B CA  1 
ATOM   1346 C  C   . THR B 2 37  ? 39.635 -1.516  13.698  1.00 28.55 ? 238 THR B C   1 
ATOM   1347 O  O   . THR B 2 37  ? 38.573 -2.134  13.647  1.00 26.32 ? 238 THR B O   1 
ATOM   1348 C  CB  . THR B 2 37  ? 38.902 0.918   13.388  1.00 22.84 ? 238 THR B CB  1 
ATOM   1349 O  OG1 . THR B 2 37  ? 39.398 0.927   12.053  1.00 27.64 ? 238 THR B OG1 1 
ATOM   1350 C  CG2 . THR B 2 37  ? 38.990 2.305   13.949  1.00 22.37 ? 238 THR B CG2 1 
ATOM   1351 N  N   . GLN B 2 38  ? 40.792 -2.061  13.348  1.00 30.02 ? 239 GLN B N   1 
ATOM   1352 C  CA  . GLN B 2 38  ? 40.875 -3.406  12.806  1.00 31.41 ? 239 GLN B CA  1 
ATOM   1353 C  C   . GLN B 2 38  ? 40.635 -4.509  13.833  1.00 30.25 ? 239 GLN B C   1 
ATOM   1354 O  O   . GLN B 2 38  ? 40.141 -5.571  13.474  1.00 31.20 ? 239 GLN B O   1 
ATOM   1355 C  CB  . GLN B 2 38  ? 42.232 -3.631  12.146  1.00 27.61 ? 239 GLN B CB  1 
ATOM   1356 C  CG  . GLN B 2 38  ? 42.490 -2.765  10.936  1.00 30.66 ? 239 GLN B CG  1 
ATOM   1357 C  CD  . GLN B 2 38  ? 43.857 -3.036  10.359  1.00 36.25 ? 239 GLN B CD  1 
ATOM   1358 O  OE1 . GLN B 2 38  ? 44.504 -4.026  10.715  1.00 37.21 ? 239 GLN B OE1 1 
ATOM   1359 N  NE2 . GLN B 2 38  ? 44.319 -2.160  9.475   1.00 36.86 ? 239 GLN B NE2 1 
ATOM   1360 N  N   . ARG B 2 39  ? 40.935 -4.274  15.110  1.00 32.44 ? 240 ARG B N   1 
ATOM   1361 C  CA  . ARG B 2 39  ? 40.730 -5.329  16.101  1.00 35.84 ? 240 ARG B CA  1 
ATOM   1362 C  C   . ARG B 2 39  ? 39.276 -5.796  16.205  1.00 35.91 ? 240 ARG B C   1 
ATOM   1363 O  O   . ARG B 2 39  ? 38.991 -6.848  16.771  1.00 38.65 ? 240 ARG B O   1 
ATOM   1364 C  CB  . ARG B 2 39  ? 41.243 -4.913  17.475  1.00 35.16 ? 240 ARG B CB  1 
ATOM   1365 C  CG  . ARG B 2 39  ? 40.344 -3.975  18.215  1.00 41.24 ? 240 ARG B CG  1 
ATOM   1366 C  CD  . ARG B 2 39  ? 40.945 -3.649  19.558  1.00 45.99 ? 240 ARG B CD  1 
ATOM   1367 N  NE  . ARG B 2 39  ? 40.841 -4.737  20.520  1.00 45.64 ? 240 ARG B NE  1 
ATOM   1368 C  CZ  . ARG B 2 39  ? 39.903 -4.796  21.461  1.00 49.52 ? 240 ARG B CZ  1 
ATOM   1369 N  NH1 . ARG B 2 39  ? 38.984 -3.836  21.558  1.00 47.39 ? 240 ARG B NH1 1 
ATOM   1370 N  NH2 . ARG B 2 39  ? 39.914 -5.783  22.344  1.00 54.62 ? 240 ARG B NH2 1 
ATOM   1371 N  N   . PHE B 2 40  ? 38.363 -5.003  15.663  1.00 34.73 ? 241 PHE B N   1 
ATOM   1372 C  CA  . PHE B 2 40  ? 36.953 -5.341  15.690  1.00 34.34 ? 241 PHE B CA  1 
ATOM   1373 C  C   . PHE B 2 40  ? 36.559 -6.204  14.497  1.00 34.17 ? 241 PHE B C   1 
ATOM   1374 O  O   . PHE B 2 40  ? 35.537 -6.884  14.518  1.00 36.45 ? 241 PHE B O   1 
ATOM   1375 C  CB  . PHE B 2 40  ? 36.109 -4.069  15.718  1.00 33.80 ? 241 PHE B CB  1 
ATOM   1376 C  CG  . PHE B 2 40  ? 36.244 -3.285  16.993  1.00 35.84 ? 241 PHE B CG  1 
ATOM   1377 C  CD1 . PHE B 2 40  ? 37.129 -2.210  17.075  1.00 33.13 ? 241 PHE B CD1 1 
ATOM   1378 C  CD2 . PHE B 2 40  ? 35.478 -3.615  18.106  1.00 34.39 ? 241 PHE B CD2 1 
ATOM   1379 C  CE1 . PHE B 2 40  ? 37.252 -1.481  18.235  1.00 37.30 ? 241 PHE B CE1 1 
ATOM   1380 C  CE2 . PHE B 2 40  ? 35.594 -2.890  19.277  1.00 38.35 ? 241 PHE B CE2 1 
ATOM   1381 C  CZ  . PHE B 2 40  ? 36.483 -1.814  19.344  1.00 42.04 ? 241 PHE B CZ  1 
ATOM   1382 N  N   . PHE B 2 41  ? 37.400 -6.200  13.473  1.00 35.50 ? 242 PHE B N   1 
ATOM   1383 C  CA  . PHE B 2 41  ? 37.148 -6.971  12.264  1.00 35.25 ? 242 PHE B CA  1 
ATOM   1384 C  C   . PHE B 2 41  ? 38.190 -8.056  12.032  1.00 36.68 ? 242 PHE B C   1 
ATOM   1385 O  O   . PHE B 2 41  ? 38.412 -8.447  10.894  1.00 35.44 ? 242 PHE B O   1 
ATOM   1386 C  CB  . PHE B 2 41  ? 37.122 -6.027  11.066  1.00 31.99 ? 242 PHE B CB  1 
ATOM   1387 C  CG  . PHE B 2 41  ? 36.204 -4.863  11.253  1.00 35.62 ? 242 PHE B CG  1 
ATOM   1388 C  CD1 . PHE B 2 41  ? 36.630 -3.729  11.943  1.00 34.20 ? 242 PHE B CD1 1 
ATOM   1389 C  CD2 . PHE B 2 41  ? 34.898 -4.916  10.783  1.00 33.29 ? 242 PHE B CD2 1 
ATOM   1390 C  CE1 . PHE B 2 41  ? 35.773 -2.667  12.162  1.00 33.66 ? 242 PHE B CE1 1 
ATOM   1391 C  CE2 . PHE B 2 41  ? 34.031 -3.865  10.994  1.00 31.80 ? 242 PHE B CE2 1 
ATOM   1392 C  CZ  . PHE B 2 41  ? 34.471 -2.734  11.688  1.00 34.32 ? 242 PHE B CZ  1 
ATOM   1393 N  N   . GLU B 2 42  ? 38.761 -8.611  13.102  1.00 43.85 ? 243 GLU B N   1 
ATOM   1394 C  CA  . GLU B 2 42  ? 39.801 -9.631  12.945  1.00 49.74 ? 243 GLU B CA  1 
ATOM   1395 C  C   . GLU B 2 42  ? 39.332 -10.899 12.211  1.00 51.24 ? 243 GLU B C   1 
ATOM   1396 O  O   . GLU B 2 42  ? 40.151 -11.646 11.653  1.00 52.48 ? 243 GLU B O   1 
ATOM   1397 C  CB  . GLU B 2 42  ? 40.517 -9.952  14.290  1.00 55.16 ? 243 GLU B CB  1 
ATOM   1398 C  CG  . GLU B 2 42  ? 39.685 -10.650 15.407  1.00 64.28 ? 243 GLU B CG  1 
ATOM   1399 C  CD  . GLU B 2 42  ? 40.524 -11.037 16.657  1.00 66.00 ? 243 GLU B CD  1 
ATOM   1400 O  OE1 . GLU B 2 42  ? 40.478 -10.296 17.669  1.00 63.06 ? 243 GLU B OE1 1 
ATOM   1401 O  OE2 . GLU B 2 42  ? 41.219 -12.084 16.631  1.00 62.54 ? 243 GLU B OE2 1 
ATOM   1402 N  N   . SER B 2 43  ? 38.014 -11.097 12.151  1.00 53.89 ? 244 SER B N   1 
ATOM   1403 C  CA  . SER B 2 43  ? 37.417 -12.255 11.472  1.00 51.35 ? 244 SER B CA  1 
ATOM   1404 C  C   . SER B 2 43  ? 37.114 -12.003 9.988   1.00 47.10 ? 244 SER B C   1 
ATOM   1405 O  O   . SER B 2 43  ? 36.664 -12.908 9.282   1.00 47.71 ? 244 SER B O   1 
ATOM   1406 C  CB  . SER B 2 43  ? 36.131 -12.687 12.191  1.00 53.14 ? 244 SER B CB  1 
ATOM   1407 O  OG  . SER B 2 43  ? 35.089 -11.726 12.048  1.00 55.84 ? 244 SER B OG  1 
ATOM   1408 N  N   . PHE B 2 44  ? 37.338 -10.775 9.525   1.00 41.85 ? 245 PHE B N   1 
ATOM   1409 C  CA  . PHE B 2 44  ? 37.090 -10.435 8.131   1.00 39.23 ? 245 PHE B CA  1 
ATOM   1410 C  C   . PHE B 2 44  ? 38.212 -10.910 7.232   1.00 38.99 ? 245 PHE B C   1 
ATOM   1411 O  O   . PHE B 2 44  ? 38.199 -10.667 6.029   1.00 41.55 ? 245 PHE B O   1 
ATOM   1412 C  CB  . PHE B 2 44  ? 36.886 -8.936  7.949   1.00 35.17 ? 245 PHE B CB  1 
ATOM   1413 C  CG  . PHE B 2 44  ? 35.492 -8.474  8.234   1.00 35.16 ? 245 PHE B CG  1 
ATOM   1414 C  CD1 . PHE B 2 44  ? 34.991 -7.342  7.609   1.00 36.58 ? 245 PHE B CD1 1 
ATOM   1415 C  CD2 . PHE B 2 44  ? 34.685 -9.154  9.130   1.00 33.39 ? 245 PHE B CD2 1 
ATOM   1416 C  CE1 . PHE B 2 44  ? 33.710 -6.897  7.869   1.00 32.72 ? 245 PHE B CE1 1 
ATOM   1417 C  CE2 . PHE B 2 44  ? 33.396 -8.711  9.396   1.00 35.05 ? 245 PHE B CE2 1 
ATOM   1418 C  CZ  . PHE B 2 44  ? 32.910 -7.582  8.764   1.00 32.52 ? 245 PHE B CZ  1 
ATOM   1419 N  N   . GLY B 2 45  ? 39.207 -11.557 7.820   1.00 40.28 ? 246 GLY B N   1 
ATOM   1420 C  CA  . GLY B 2 45  ? 40.292 -12.066 7.016   1.00 42.69 ? 246 GLY B CA  1 
ATOM   1421 C  C   . GLY B 2 45  ? 41.552 -11.236 7.021   1.00 46.53 ? 246 GLY B C   1 
ATOM   1422 O  O   . GLY B 2 45  ? 41.924 -10.670 8.052   1.00 47.84 ? 246 GLY B O   1 
ATOM   1423 N  N   . ASP B 2 46  ? 42.204 -11.178 5.860   1.00 48.21 ? 247 ASP B N   1 
ATOM   1424 C  CA  . ASP B 2 46  ? 43.458 -10.451 5.666   1.00 47.75 ? 247 ASP B CA  1 
ATOM   1425 C  C   . ASP B 2 46  ? 43.311 -8.927  5.538   1.00 47.46 ? 247 ASP B C   1 
ATOM   1426 O  O   . ASP B 2 46  ? 42.789 -8.421  4.536   1.00 45.99 ? 247 ASP B O   1 
ATOM   1427 C  CB  . ASP B 2 46  ? 44.164 -11.004 4.426   1.00 51.63 ? 247 ASP B CB  1 
ATOM   1428 C  CG  . ASP B 2 46  ? 45.580 -10.501 4.284   1.00 55.91 ? 247 ASP B CG  1 
ATOM   1429 O  OD1 . ASP B 2 46  ? 46.194 -10.158 5.322   1.00 56.99 ? 247 ASP B OD1 1 
ATOM   1430 O  OD2 . ASP B 2 46  ? 46.078 -10.464 3.133   1.00 57.02 ? 247 ASP B OD2 1 
ATOM   1431 N  N   . LEU B 2 47  ? 43.792 -8.211  6.553   1.00 44.31 ? 248 LEU B N   1 
ATOM   1432 C  CA  . LEU B 2 47  ? 43.744 -6.753  6.583   1.00 42.87 ? 248 LEU B CA  1 
ATOM   1433 C  C   . LEU B 2 47  ? 45.176 -6.288  6.834   1.00 43.36 ? 248 LEU B C   1 
ATOM   1434 O  O   . LEU B 2 47  ? 45.419 -5.452  7.693   1.00 44.25 ? 248 LEU B O   1 
ATOM   1435 C  CB  . LEU B 2 47  ? 42.858 -6.277  7.742   1.00 35.98 ? 248 LEU B CB  1 
ATOM   1436 C  CG  . LEU B 2 47  ? 41.452 -6.839  7.990   1.00 30.66 ? 248 LEU B CG  1 
ATOM   1437 C  CD1 . LEU B 2 47  ? 40.998 -6.383  9.353   1.00 27.56 ? 248 LEU B CD1 1 
ATOM   1438 C  CD2 . LEU B 2 47  ? 40.471 -6.396  6.919   1.00 26.19 ? 248 LEU B CD2 1 
ATOM   1439 N  N   . SER B 2 48  ? 46.129 -6.848  6.099   1.00 46.11 ? 249 SER B N   1 
ATOM   1440 C  CA  . SER B 2 48  ? 47.534 -6.503  6.295   1.00 46.74 ? 249 SER B CA  1 
ATOM   1441 C  C   . SER B 2 48  ? 48.069 -5.398  5.391   1.00 47.23 ? 249 SER B C   1 
ATOM   1442 O  O   . SER B 2 48  ? 49.134 -4.827  5.654   1.00 49.11 ? 249 SER B O   1 
ATOM   1443 C  CB  . SER B 2 48  ? 48.414 -7.757  6.151   1.00 50.14 ? 249 SER B CB  1 
ATOM   1444 O  OG  . SER B 2 48  ? 48.312 -8.330  4.849   1.00 45.19 ? 249 SER B OG  1 
ATOM   1445 N  N   . THR B 2 49  ? 47.329 -5.087  4.340   1.00 43.87 ? 250 THR B N   1 
ATOM   1446 C  CA  . THR B 2 49  ? 47.771 -4.073  3.398   1.00 43.95 ? 250 THR B CA  1 
ATOM   1447 C  C   . THR B 2 49  ? 46.572 -3.224  3.023   1.00 42.56 ? 250 THR B C   1 
ATOM   1448 O  O   . THR B 2 49  ? 45.431 -3.663  3.187   1.00 41.91 ? 250 THR B O   1 
ATOM   1449 C  CB  . THR B 2 49  ? 48.331 -4.753  2.113   1.00 43.34 ? 250 THR B CB  1 
ATOM   1450 O  OG1 . THR B 2 49  ? 49.318 -5.719  2.484   1.00 45.22 ? 250 THR B OG1 1 
ATOM   1451 C  CG2 . THR B 2 49  ? 48.955 -3.736  1.166   1.00 44.64 ? 250 THR B CG2 1 
ATOM   1452 N  N   . ALA B 2 50  ? 46.827 -2.017  2.523   1.00 39.77 ? 251 ALA B N   1 
ATOM   1453 C  CA  . ALA B 2 50  ? 45.753 -1.137  2.095   1.00 39.04 ? 251 ALA B CA  1 
ATOM   1454 C  C   . ALA B 2 50  ? 45.024 -1.855  0.965   1.00 39.07 ? 251 ALA B C   1 
ATOM   1455 O  O   . ALA B 2 50  ? 43.792 -1.832  0.886   1.00 42.07 ? 251 ALA B O   1 
ATOM   1456 C  CB  . ALA B 2 50  ? 46.313 0.202   1.598   1.00 33.76 ? 251 ALA B CB  1 
ATOM   1457 N  N   . ASP B 2 51  ? 45.800 -2.546  0.132   1.00 41.51 ? 252 ASP B N   1 
ATOM   1458 C  CA  . ASP B 2 51  ? 45.272 -3.286  -1.010  1.00 41.96 ? 252 ASP B CA  1 
ATOM   1459 C  C   . ASP B 2 51  ? 44.428 -4.474  -0.544  1.00 37.57 ? 252 ASP B C   1 
ATOM   1460 O  O   . ASP B 2 51  ? 43.372 -4.738  -1.104  1.00 38.23 ? 252 ASP B O   1 
ATOM   1461 C  CB  . ASP B 2 51  ? 46.422 -3.718  -1.936  1.00 50.66 ? 252 ASP B CB  1 
ATOM   1462 C  CG  . ASP B 2 51  ? 47.232 -2.517  -2.477  1.00 59.61 ? 252 ASP B CG  1 
ATOM   1463 O  OD1 . ASP B 2 51  ? 48.348 -2.251  -1.957  1.00 62.20 ? 252 ASP B OD1 1 
ATOM   1464 O  OD2 . ASP B 2 51  ? 46.746 -1.835  -3.413  1.00 62.92 ? 252 ASP B OD2 1 
ATOM   1465 N  N   . ALA B 2 52  ? 44.866 -5.150  0.517   1.00 36.52 ? 253 ALA B N   1 
ATOM   1466 C  CA  . ALA B 2 52  ? 44.121 -6.286  1.075   1.00 36.38 ? 253 ALA B CA  1 
ATOM   1467 C  C   . ALA B 2 52  ? 42.786 -5.825  1.648   1.00 34.81 ? 253 ALA B C   1 
ATOM   1468 O  O   . ALA B 2 52  ? 41.757 -6.465  1.439   1.00 38.50 ? 253 ALA B O   1 
ATOM   1469 C  CB  . ALA B 2 52  ? 44.932 -6.979  2.156   1.00 32.61 ? 253 ALA B CB  1 
ATOM   1470 N  N   . VAL B 2 53  ? 42.809 -4.706  2.367   1.00 37.02 ? 254 VAL B N   1 
ATOM   1471 C  CA  . VAL B 2 53  ? 41.598 -4.152  2.967   1.00 35.64 ? 254 VAL B CA  1 
ATOM   1472 C  C   . VAL B 2 53  ? 40.615 -3.691  1.898   1.00 34.83 ? 254 VAL B C   1 
ATOM   1473 O  O   . VAL B 2 53  ? 39.444 -4.067  1.927   1.00 38.09 ? 254 VAL B O   1 
ATOM   1474 C  CB  . VAL B 2 53  ? 41.904 -2.953  3.898   1.00 31.35 ? 254 VAL B CB  1 
ATOM   1475 C  CG1 . VAL B 2 53  ? 40.619 -2.377  4.450   1.00 31.53 ? 254 VAL B CG1 1 
ATOM   1476 C  CG2 . VAL B 2 53  ? 42.785 -3.386  5.037   1.00 31.36 ? 254 VAL B CG2 1 
ATOM   1477 N  N   . MET B 2 54  ? 41.094 -2.896  0.945   1.00 34.21 ? 255 MET B N   1 
ATOM   1478 C  CA  . MET B 2 54  ? 40.230 -2.371  -0.111  1.00 40.58 ? 255 MET B CA  1 
ATOM   1479 C  C   . MET B 2 54  ? 39.616 -3.439  -0.998  1.00 42.47 ? 255 MET B C   1 
ATOM   1480 O  O   . MET B 2 54  ? 38.522 -3.242  -1.549  1.00 44.63 ? 255 MET B O   1 
ATOM   1481 C  CB  . MET B 2 54  ? 40.978 -1.362  -0.982  1.00 35.88 ? 255 MET B CB  1 
ATOM   1482 C  CG  . MET B 2 54  ? 41.498 -0.141  -0.241  1.00 39.91 ? 255 MET B CG  1 
ATOM   1483 S  SD  . MET B 2 54  ? 40.266 0.832   0.707   1.00 43.34 ? 255 MET B SD  1 
ATOM   1484 C  CE  . MET B 2 54  ? 40.845 0.519   2.186   1.00 35.56 ? 255 MET B CE  1 
ATOM   1485 N  N   . ASN B 2 55  ? 40.317 -4.566  -1.118  1.00 42.42 ? 256 ASN B N   1 
ATOM   1486 C  CA  . ASN B 2 55  ? 39.870 -5.678  -1.951  1.00 45.48 ? 256 ASN B CA  1 
ATOM   1487 C  C   . ASN B 2 55  ? 39.198 -6.799  -1.164  1.00 45.94 ? 256 ASN B C   1 
ATOM   1488 O  O   . ASN B 2 55  ? 38.794 -7.811  -1.744  1.00 46.23 ? 256 ASN B O   1 
ATOM   1489 C  CB  . ASN B 2 55  ? 41.051 -6.244  -2.748  1.00 48.56 ? 256 ASN B CB  1 
ATOM   1490 C  CG  . ASN B 2 55  ? 41.615 -5.245  -3.750  1.00 55.59 ? 256 ASN B CG  1 
ATOM   1491 O  OD1 . ASN B 2 55  ? 41.340 -4.044  -3.694  1.00 56.58 ? 256 ASN B OD1 1 
ATOM   1492 N  ND2 . ASN B 2 55  ? 42.424 -5.743  -4.669  1.00 60.45 ? 256 ASN B ND2 1 
ATOM   1493 N  N   . ASN B 2 56  ? 39.099 -6.633  0.151   1.00 45.10 ? 257 ASN B N   1 
ATOM   1494 C  CA  . ASN B 2 56  ? 38.482 -7.641  1.016   1.00 44.52 ? 257 ASN B CA  1 
ATOM   1495 C  C   . ASN B 2 56  ? 36.963 -7.661  0.817   1.00 45.50 ? 257 ASN B C   1 
ATOM   1496 O  O   . ASN B 2 56  ? 36.302 -6.637  0.994   1.00 44.33 ? 257 ASN B O   1 
ATOM   1497 C  CB  . ASN B 2 56  ? 38.840 -7.364  2.483   1.00 43.58 ? 257 ASN B CB  1 
ATOM   1498 C  CG  . ASN B 2 56  ? 38.430 -8.486  3.409   1.00 40.72 ? 257 ASN B CG  1 
ATOM   1499 O  OD1 . ASN B 2 56  ? 37.248 -8.808  3.517   1.00 46.56 ? 257 ASN B OD1 1 
ATOM   1500 N  ND2 . ASN B 2 56  ? 39.398 -9.074  4.100   1.00 38.71 ? 257 ASN B ND2 1 
ATOM   1501 N  N   . PRO B 2 57  ? 36.395 -8.839  0.442   1.00 47.29 ? 258 PRO B N   1 
ATOM   1502 C  CA  . PRO B 2 57  ? 34.955 -9.036  0.203   1.00 44.74 ? 258 PRO B CA  1 
ATOM   1503 C  C   . PRO B 2 57  ? 34.069 -8.756  1.424   1.00 41.60 ? 258 PRO B C   1 
ATOM   1504 O  O   . PRO B 2 57  ? 32.952 -8.248  1.297   1.00 42.18 ? 258 PRO B O   1 
ATOM   1505 C  CB  . PRO B 2 57  ? 34.881 -10.515 -0.206  1.00 40.89 ? 258 PRO B CB  1 
ATOM   1506 C  CG  . PRO B 2 57  ? 36.210 -10.778 -0.795  1.00 41.58 ? 258 PRO B CG  1 
ATOM   1507 C  CD  . PRO B 2 57  ? 37.119 -10.100 0.185   1.00 44.16 ? 258 PRO B CD  1 
ATOM   1508 N  N   . LYS B 2 58  ? 34.551 -9.122  2.600   1.00 38.61 ? 259 LYS B N   1 
ATOM   1509 C  CA  . LYS B 2 58  ? 33.787 -8.903  3.807   1.00 39.91 ? 259 LYS B CA  1 
ATOM   1510 C  C   . LYS B 2 58  ? 33.729 -7.404  4.104   1.00 41.68 ? 259 LYS B C   1 
ATOM   1511 O  O   . LYS B 2 58  ? 32.697 -6.900  4.570   1.00 46.02 ? 259 LYS B O   1 
ATOM   1512 C  CB  . LYS B 2 58  ? 34.383 -9.714  4.956   1.00 35.99 ? 259 LYS B CB  1 
ATOM   1513 C  CG  . LYS B 2 58  ? 34.411 -11.196 4.633   1.00 38.19 ? 259 LYS B CG  1 
ATOM   1514 C  CD  . LYS B 2 58  ? 35.108 -12.016 5.689   1.00 43.60 ? 259 LYS B CD  1 
ATOM   1515 C  CE  . LYS B 2 58  ? 35.463 -13.399 5.155   1.00 49.51 ? 259 LYS B CE  1 
ATOM   1516 N  NZ  . LYS B 2 58  ? 36.388 -13.316 3.964   1.00 56.68 ? 259 LYS B NZ  1 
ATOM   1517 N  N   . VAL B 2 59  ? 34.810 -6.685  3.789   1.00 41.89 ? 260 VAL B N   1 
ATOM   1518 C  CA  . VAL B 2 59  ? 34.863 -5.233  3.993   1.00 36.42 ? 260 VAL B CA  1 
ATOM   1519 C  C   . VAL B 2 59  ? 33.870 -4.554  3.043   1.00 36.57 ? 260 VAL B C   1 
ATOM   1520 O  O   . VAL B 2 59  ? 33.037 -3.762  3.495   1.00 35.28 ? 260 VAL B O   1 
ATOM   1521 C  CB  . VAL B 2 59  ? 36.320 -4.653  3.823   1.00 31.12 ? 260 VAL B CB  1 
ATOM   1522 C  CG1 . VAL B 2 59  ? 36.313 -3.139  3.902   1.00 24.88 ? 260 VAL B CG1 1 
ATOM   1523 C  CG2 . VAL B 2 59  ? 37.225 -5.192  4.908   1.00 26.72 ? 260 VAL B CG2 1 
ATOM   1524 N  N   . LYS B 2 60  ? 33.925 -4.897  1.750   1.00 36.99 ? 261 LYS B N   1 
ATOM   1525 C  CA  . LYS B 2 60  ? 33.006 -4.327  0.751   1.00 39.74 ? 261 LYS B CA  1 
ATOM   1526 C  C   . LYS B 2 60  ? 31.554 -4.627  1.102   1.00 39.24 ? 261 LYS B C   1 
ATOM   1527 O  O   . LYS B 2 60  ? 30.690 -3.751  1.003   1.00 38.80 ? 261 LYS B O   1 
ATOM   1528 C  CB  . LYS B 2 60  ? 33.257 -4.885  -0.647  1.00 39.44 ? 261 LYS B CB  1 
ATOM   1529 C  CG  . LYS B 2 60  ? 34.586 -4.565  -1.285  1.00 46.58 ? 261 LYS B CG  1 
ATOM   1530 C  CD  . LYS B 2 60  ? 34.451 -4.685  -2.816  1.00 51.42 ? 261 LYS B CD  1 
ATOM   1531 C  CE  . LYS B 2 60  ? 35.718 -5.216  -3.481  1.00 55.00 ? 261 LYS B CE  1 
ATOM   1532 N  NZ  . LYS B 2 60  ? 35.873 -6.699  -3.270  1.00 57.21 ? 261 LYS B NZ  1 
ATOM   1533 N  N   . ALA B 2 61  ? 31.282 -5.883  1.452   1.00 39.33 ? 262 ALA B N   1 
ATOM   1534 C  CA  . ALA B 2 61  ? 29.930 -6.306  1.816   1.00 38.94 ? 262 ALA B CA  1 
ATOM   1535 C  C   . ALA B 2 61  ? 29.463 -5.616  3.091   1.00 40.10 ? 262 ALA B C   1 
ATOM   1536 O  O   . ALA B 2 61  ? 28.321 -5.160  3.162   1.00 44.56 ? 262 ALA B O   1 
ATOM   1537 C  CB  . ALA B 2 61  ? 29.862 -7.826  1.977   1.00 38.00 ? 262 ALA B CB  1 
ATOM   1538 N  N   . HIS B 2 62  ? 30.341 -5.510  4.088   1.00 38.11 ? 263 HIS B N   1 
ATOM   1539 C  CA  . HIS B 2 62  ? 29.957 -4.860  5.336   1.00 36.09 ? 263 HIS B CA  1 
ATOM   1540 C  C   . HIS B 2 62  ? 29.797 -3.347  5.178   1.00 34.77 ? 263 HIS B C   1 
ATOM   1541 O  O   . HIS B 2 62  ? 28.957 -2.724  5.835   1.00 33.75 ? 263 HIS B O   1 
ATOM   1542 C  CB  . HIS B 2 62  ? 30.942 -5.175  6.459   1.00 33.85 ? 263 HIS B CB  1 
ATOM   1543 C  CG  . HIS B 2 62  ? 30.439 -4.782  7.814   1.00 39.22 ? 263 HIS B CG  1 
ATOM   1544 N  ND1 . HIS B 2 62  ? 29.493 -5.513  8.496   1.00 42.11 ? 263 HIS B ND1 1 
ATOM   1545 C  CD2 . HIS B 2 62  ? 30.725 -3.715  8.602   1.00 41.52 ? 263 HIS B CD2 1 
ATOM   1546 C  CE1 . HIS B 2 62  ? 29.213 -4.915  9.642   1.00 40.04 ? 263 HIS B CE1 1 
ATOM   1547 N  NE2 . HIS B 2 62  ? 29.950 -3.825  9.732   1.00 36.12 ? 263 HIS B NE2 1 
ATOM   1548 N  N   . GLY B 2 63  ? 30.591 -2.762  4.293   1.00 32.73 ? 264 GLY B N   1 
ATOM   1549 C  CA  . GLY B 2 63  ? 30.502 -1.341  4.061   1.00 34.83 ? 264 GLY B CA  1 
ATOM   1550 C  C   . GLY B 2 63  ? 29.159 -0.946  3.480   1.00 35.25 ? 264 GLY B C   1 
ATOM   1551 O  O   . GLY B 2 63  ? 28.666 0.154   3.738   1.00 33.66 ? 264 GLY B O   1 
ATOM   1552 N  N   . LYS B 2 64  ? 28.568 -1.848  2.698   1.00 37.71 ? 265 LYS B N   1 
ATOM   1553 C  CA  . LYS B 2 64  ? 27.274 -1.600  2.080   1.00 36.06 ? 265 LYS B CA  1 
ATOM   1554 C  C   . LYS B 2 64  ? 26.170 -1.540  3.142   1.00 34.49 ? 265 LYS B C   1 
ATOM   1555 O  O   . LYS B 2 64  ? 25.303 -0.659  3.098   1.00 36.15 ? 265 LYS B O   1 
ATOM   1556 C  CB  . LYS B 2 64  ? 26.960 -2.687  1.051   1.00 41.32 ? 265 LYS B CB  1 
ATOM   1557 C  CG  . LYS B 2 64  ? 25.679 -2.422  0.272   1.00 48.97 ? 265 LYS B CG  1 
ATOM   1558 C  CD  . LYS B 2 64  ? 25.186 -3.664  -0.469  1.00 51.57 ? 265 LYS B CD  1 
ATOM   1559 C  CE  . LYS B 2 64  ? 23.832 -3.419  -1.161  1.00 56.75 ? 265 LYS B CE  1 
ATOM   1560 N  NZ  . LYS B 2 64  ? 22.709 -3.180  -0.193  1.00 59.17 ? 265 LYS B NZ  1 
ATOM   1561 N  N   . LYS B 2 65  ? 26.241 -2.438  4.125   1.00 33.68 ? 266 LYS B N   1 
ATOM   1562 C  CA  . LYS B 2 65  ? 25.251 -2.505  5.208   1.00 33.27 ? 266 LYS B CA  1 
ATOM   1563 C  C   . LYS B 2 65  ? 25.279 -1.254  6.052   1.00 33.00 ? 266 LYS B C   1 
ATOM   1564 O  O   . LYS B 2 65  ? 24.244 -0.775  6.499   1.00 38.00 ? 266 LYS B O   1 
ATOM   1565 C  CB  . LYS B 2 65  ? 25.504 -3.714  6.105   1.00 36.93 ? 266 LYS B CB  1 
ATOM   1566 C  CG  . LYS B 2 65  ? 25.548 -5.031  5.364   1.00 42.10 ? 266 LYS B CG  1 
ATOM   1567 C  CD  . LYS B 2 65  ? 25.975 -6.176  6.275   1.00 47.98 ? 266 LYS B CD  1 
ATOM   1568 C  CE  . LYS B 2 65  ? 24.903 -6.513  7.310   1.00 53.66 ? 266 LYS B CE  1 
ATOM   1569 N  NZ  . LYS B 2 65  ? 25.355 -7.599  8.243   1.00 54.76 ? 266 LYS B NZ  1 
ATOM   1570 N  N   . VAL B 2 66  ? 26.473 -0.739  6.296   1.00 34.25 ? 267 VAL B N   1 
ATOM   1571 C  CA  . VAL B 2 66  ? 26.628 0.470   7.078   1.00 35.08 ? 267 VAL B CA  1 
ATOM   1572 C  C   . VAL B 2 66  ? 25.927 1.636   6.378   1.00 32.04 ? 267 VAL B C   1 
ATOM   1573 O  O   . VAL B 2 66  ? 25.191 2.402   7.002   1.00 35.12 ? 267 VAL B O   1 
ATOM   1574 C  CB  . VAL B 2 66  ? 28.125 0.793   7.277   1.00 35.32 ? 267 VAL B CB  1 
ATOM   1575 C  CG1 . VAL B 2 66  ? 28.297 2.168   7.907   1.00 32.67 ? 267 VAL B CG1 1 
ATOM   1576 C  CG2 . VAL B 2 66  ? 28.773 -0.283  8.122   1.00 29.27 ? 267 VAL B CG2 1 
ATOM   1577 N  N   . LEU B 2 67  ? 26.127 1.748   5.073   1.00 32.85 ? 268 LEU B N   1 
ATOM   1578 C  CA  . LEU B 2 67  ? 25.509 2.826   4.310   1.00 35.48 ? 268 LEU B CA  1 
ATOM   1579 C  C   . LEU B 2 67  ? 24.002 2.630   4.176   1.00 36.56 ? 268 LEU B C   1 
ATOM   1580 O  O   . LEU B 2 67  ? 23.273 3.620   4.090   1.00 37.65 ? 268 LEU B O   1 
ATOM   1581 C  CB  . LEU B 2 67  ? 26.177 2.990   2.941   1.00 32.99 ? 268 LEU B CB  1 
ATOM   1582 C  CG  . LEU B 2 67  ? 27.293 4.029   2.781   1.00 31.14 ? 268 LEU B CG  1 
ATOM   1583 C  CD1 . LEU B 2 67  ? 26.722 5.264   2.146   1.00 29.91 ? 268 LEU B CD1 1 
ATOM   1584 C  CD2 . LEU B 2 67  ? 27.983 4.337   4.105   1.00 27.63 ? 268 LEU B CD2 1 
ATOM   1585 N  N   . ASP B 2 68  ? 23.527 1.378   4.177   1.00 38.75 ? 269 ASP B N   1 
ATOM   1586 C  CA  . ASP B 2 68  ? 22.078 1.112   4.106   1.00 38.67 ? 269 ASP B CA  1 
ATOM   1587 C  C   . ASP B 2 68  ? 21.519 1.659   5.396   1.00 36.94 ? 269 ASP B C   1 
ATOM   1588 O  O   . ASP B 2 68  ? 20.462 2.280   5.400   1.00 40.00 ? 269 ASP B O   1 
ATOM   1589 C  CB  . ASP B 2 68  ? 21.746 -0.385  4.028   1.00 43.14 ? 269 ASP B CB  1 
ATOM   1590 C  CG  . ASP B 2 68  ? 22.000 -0.980  2.650   1.00 49.19 ? 269 ASP B CG  1 
ATOM   1591 O  OD1 . ASP B 2 68  ? 22.168 -2.225  2.569   1.00 46.80 ? 269 ASP B OD1 1 
ATOM   1592 O  OD2 . ASP B 2 68  ? 22.019 -0.214  1.655   1.00 56.18 ? 269 ASP B OD2 1 
ATOM   1593 N  N   . SER B 2 69  ? 22.258 1.428   6.481   1.00 35.42 ? 270 SER B N   1 
ATOM   1594 C  CA  . SER B 2 69  ? 21.916 1.913   7.809   1.00 34.32 ? 270 SER B CA  1 
ATOM   1595 C  C   . SER B 2 69  ? 21.903 3.449   7.750   1.00 35.98 ? 270 SER B C   1 
ATOM   1596 O  O   . SER B 2 69  ? 21.070 4.126   8.374   1.00 34.44 ? 270 SER B O   1 
ATOM   1597 C  CB  . SER B 2 69  ? 22.965 1.412   8.792   1.00 35.27 ? 270 SER B CB  1 
ATOM   1598 O  OG  . SER B 2 69  ? 22.807 2.011   10.055  1.00 47.24 ? 270 SER B OG  1 
ATOM   1599 N  N   . PHE B 2 70  ? 22.807 3.988   6.940   1.00 38.82 ? 271 PHE B N   1 
ATOM   1600 C  CA  . PHE B 2 70  ? 22.889 5.415   6.740   1.00 42.01 ? 271 PHE B CA  1 
ATOM   1601 C  C   . PHE B 2 70  ? 21.714 5.937   5.901   1.00 44.18 ? 271 PHE B C   1 
ATOM   1602 O  O   . PHE B 2 70  ? 21.192 7.017   6.183   1.00 44.21 ? 271 PHE B O   1 
ATOM   1603 C  CB  . PHE B 2 70  ? 24.223 5.784   6.107   1.00 42.60 ? 271 PHE B CB  1 
ATOM   1604 C  CG  . PHE B 2 70  ? 24.960 6.841   6.873   1.00 46.70 ? 271 PHE B CG  1 
ATOM   1605 C  CD1 . PHE B 2 70  ? 26.021 6.495   7.718   1.00 49.95 ? 271 PHE B CD1 1 
ATOM   1606 C  CD2 . PHE B 2 70  ? 24.554 8.180   6.805   1.00 47.38 ? 271 PHE B CD2 1 
ATOM   1607 C  CE1 . PHE B 2 70  ? 26.668 7.467   8.501   1.00 50.40 ? 271 PHE B CE1 1 
ATOM   1608 C  CE2 . PHE B 2 70  ? 25.186 9.161   7.578   1.00 48.13 ? 271 PHE B CE2 1 
ATOM   1609 C  CZ  . PHE B 2 70  ? 26.248 8.803   8.430   1.00 51.64 ? 271 PHE B CZ  1 
ATOM   1610 N  N   . SER B 2 71  ? 21.287 5.157   4.896   1.00 47.15 ? 272 SER B N   1 
ATOM   1611 C  CA  . SER B 2 71  ? 20.145 5.494   4.020   1.00 43.80 ? 272 SER B CA  1 
ATOM   1612 C  C   . SER B 2 71  ? 18.871 5.438   4.855   1.00 46.06 ? 272 SER B C   1 
ATOM   1613 O  O   . SER B 2 71  ? 17.937 6.211   4.649   1.00 46.81 ? 272 SER B O   1 
ATOM   1614 C  CB  . SER B 2 71  ? 20.010 4.483   2.882   1.00 39.96 ? 272 SER B CB  1 
ATOM   1615 O  OG  . SER B 2 71  ? 20.974 4.701   1.871   1.00 43.25 ? 272 SER B OG  1 
ATOM   1616 N  N   . ASN B 2 72  ? 18.853 4.506   5.803   1.00 47.07 ? 273 ASN B N   1 
ATOM   1617 C  CA  . ASN B 2 72  ? 17.724 4.332   6.700   1.00 46.88 ? 273 ASN B CA  1 
ATOM   1618 C  C   . ASN B 2 72  ? 17.600 5.604   7.531   1.00 47.32 ? 273 ASN B C   1 
ATOM   1619 O  O   . ASN B 2 72  ? 16.519 6.183   7.611   1.00 50.81 ? 273 ASN B O   1 
ATOM   1620 C  CB  . ASN B 2 72  ? 17.956 3.130   7.614   1.00 47.04 ? 273 ASN B CB  1 
ATOM   1621 C  CG  . ASN B 2 72  ? 16.702 2.689   8.317   1.00 49.51 ? 273 ASN B CG  1 
ATOM   1622 O  OD1 . ASN B 2 72  ? 16.728 2.365   9.509   1.00 53.26 ? 273 ASN B OD1 1 
ATOM   1623 N  ND2 . ASN B 2 72  ? 15.586 2.655   7.581   1.00 49.69 ? 273 ASN B ND2 1 
ATOM   1624 N  N   . GLY B 2 73  ? 18.714 6.046   8.117   1.00 45.10 ? 274 GLY B N   1 
ATOM   1625 C  CA  . GLY B 2 73  ? 18.718 7.258   8.917   1.00 39.48 ? 274 GLY B CA  1 
ATOM   1626 C  C   . GLY B 2 73  ? 18.280 8.510   8.171   1.00 42.54 ? 274 GLY B C   1 
ATOM   1627 O  O   . GLY B 2 73  ? 17.714 9.417   8.788   1.00 43.68 ? 274 GLY B O   1 
ATOM   1628 N  N   . MET B 2 74  ? 18.534 8.573   6.860   1.00 46.56 ? 275 MET B N   1 
ATOM   1629 C  CA  . MET B 2 74  ? 18.143 9.735   6.030   1.00 51.73 ? 275 MET B CA  1 
ATOM   1630 C  C   . MET B 2 74  ? 16.630 9.924   6.101   1.00 52.34 ? 275 MET B C   1 
ATOM   1631 O  O   . MET B 2 74  ? 16.122 11.047  6.221   1.00 56.75 ? 275 MET B O   1 
ATOM   1632 C  CB  . MET B 2 74  ? 18.519 9.522   4.549   1.00 52.24 ? 275 MET B CB  1 
ATOM   1633 C  CG  . MET B 2 74  ? 20.012 9.520   4.217   1.00 55.38 ? 275 MET B CG  1 
ATOM   1634 S  SD  . MET B 2 74  ? 20.738 11.162  3.991   1.00 55.62 ? 275 MET B SD  1 
ATOM   1635 C  CE  . MET B 2 74  ? 21.264 11.522  5.674   1.00 53.98 ? 275 MET B CE  1 
ATOM   1636 N  N   . LYS B 2 75  ? 15.929 8.798   6.004   1.00 50.57 ? 276 LYS B N   1 
ATOM   1637 C  CA  . LYS B 2 75  ? 14.479 8.749   6.046   1.00 50.15 ? 276 LYS B CA  1 
ATOM   1638 C  C   . LYS B 2 75  ? 13.875 8.989   7.430   1.00 50.75 ? 276 LYS B C   1 
ATOM   1639 O  O   . LYS B 2 75  ? 12.660 9.143   7.553   1.00 55.66 ? 276 LYS B O   1 
ATOM   1640 C  CB  . LYS B 2 75  ? 14.014 7.403   5.502   1.00 47.05 ? 276 LYS B CB  1 
ATOM   1641 C  CG  . LYS B 2 75  ? 14.496 7.160   4.089   1.00 51.36 ? 276 LYS B CG  1 
ATOM   1642 C  CD  . LYS B 2 75  ? 14.211 5.751   3.606   1.00 54.84 ? 276 LYS B CD  1 
ATOM   1643 C  CE  . LYS B 2 75  ? 14.683 5.572   2.157   1.00 60.13 ? 276 LYS B CE  1 
ATOM   1644 N  NZ  . LYS B 2 75  ? 16.152 5.824   1.977   1.00 61.64 ? 276 LYS B NZ  1 
ATOM   1645 N  N   . HIS B 2 76  ? 14.705 9.038   8.470   1.00 50.70 ? 277 HIS B N   1 
ATOM   1646 C  CA  . HIS B 2 76  ? 14.212 9.250   9.830   1.00 48.64 ? 277 HIS B CA  1 
ATOM   1647 C  C   . HIS B 2 76  ? 14.978 10.358  10.539  1.00 46.65 ? 277 HIS B C   1 
ATOM   1648 O  O   . HIS B 2 76  ? 15.199 10.303  11.750  1.00 45.21 ? 277 HIS B O   1 
ATOM   1649 C  CB  . HIS B 2 76  ? 14.309 7.946   10.615  1.00 50.59 ? 277 HIS B CB  1 
ATOM   1650 C  CG  . HIS B 2 76  ? 13.455 6.844   10.066  1.00 53.59 ? 277 HIS B CG  1 
ATOM   1651 N  ND1 . HIS B 2 76  ? 13.935 5.575   9.826   1.00 57.78 ? 277 HIS B ND1 1 
ATOM   1652 C  CD2 . HIS B 2 76  ? 12.146 6.820   9.706   1.00 55.28 ? 277 HIS B CD2 1 
ATOM   1653 C  CE1 . HIS B 2 76  ? 12.968 4.817   9.342   1.00 56.79 ? 277 HIS B CE1 1 
ATOM   1654 N  NE2 . HIS B 2 76  ? 11.872 5.551   9.259   1.00 58.16 ? 277 HIS B NE2 1 
ATOM   1655 N  N   . LEU B 2 77  ? 15.262 11.416  9.788   1.00 48.34 ? 278 LEU B N   1 
ATOM   1656 C  CA  . LEU B 2 77  ? 16.031 12.565  10.261  1.00 52.58 ? 278 LEU B CA  1 
ATOM   1657 C  C   . LEU B 2 77  ? 15.616 13.324  11.526  1.00 55.70 ? 278 LEU B C   1 
ATOM   1658 O  O   . LEU B 2 77  ? 16.273 14.308  11.895  1.00 60.00 ? 278 LEU B O   1 
ATOM   1659 C  CB  . LEU B 2 77  ? 16.267 13.543  9.109   1.00 47.84 ? 278 LEU B CB  1 
ATOM   1660 C  CG  . LEU B 2 77  ? 17.735 13.824  8.768   1.00 46.62 ? 278 LEU B CG  1 
ATOM   1661 C  CD1 . LEU B 2 77  ? 18.596 12.569  8.933   1.00 47.34 ? 278 LEU B CD1 1 
ATOM   1662 C  CD2 . LEU B 2 77  ? 17.828 14.349  7.349   1.00 44.92 ? 278 LEU B CD2 1 
ATOM   1663 N  N   . ASP B 2 78  ? 14.542 12.894  12.189  1.00 61.04 ? 279 ASP B N   1 
ATOM   1664 C  CA  . ASP B 2 78  ? 14.099 13.551  13.428  1.00 61.88 ? 279 ASP B CA  1 
ATOM   1665 C  C   . ASP B 2 78  ? 14.422 12.611  14.571  1.00 61.85 ? 279 ASP B C   1 
ATOM   1666 O  O   . ASP B 2 78  ? 15.289 12.905  15.408  1.00 64.40 ? 279 ASP B O   1 
ATOM   1667 C  CB  . ASP B 2 78  ? 12.600 13.866  13.396  1.00 63.14 ? 279 ASP B CB  1 
ATOM   1668 C  CG  . ASP B 2 78  ? 12.232 14.828  12.272  1.00 68.87 ? 279 ASP B CG  1 
ATOM   1669 O  OD1 . ASP B 2 78  ? 12.756 15.975  12.273  1.00 65.52 ? 279 ASP B OD1 1 
ATOM   1670 O  OD2 . ASP B 2 78  ? 11.432 14.424  11.385  1.00 67.36 ? 279 ASP B OD2 1 
ATOM   1671 N  N   . ASP B 2 79  ? 13.779 11.445  14.567  1.00 58.79 ? 280 ASP B N   1 
ATOM   1672 C  CA  . ASP B 2 79  ? 14.039 10.459  15.602  1.00 57.27 ? 280 ASP B CA  1 
ATOM   1673 C  C   . ASP B 2 79  ? 15.217 9.570   15.193  1.00 55.54 ? 280 ASP B C   1 
ATOM   1674 O  O   . ASP B 2 79  ? 15.078 8.360   14.969  1.00 53.25 ? 280 ASP B O   1 
ATOM   1675 C  CB  . ASP B 2 79  ? 12.791 9.626   15.923  1.00 55.72 ? 280 ASP B CB  1 
ATOM   1676 C  CG  . ASP B 2 79  ? 13.006 8.670   17.100  1.00 56.94 ? 280 ASP B CG  1 
ATOM   1677 O  OD1 . ASP B 2 79  ? 12.375 7.591   17.100  1.00 54.33 ? 280 ASP B OD1 1 
ATOM   1678 O  OD2 . ASP B 2 79  ? 13.804 8.990   18.016  1.00 54.87 ? 280 ASP B OD2 1 
ATOM   1679 N  N   . LEU B 2 80  ? 16.382 10.192  15.072  1.00 53.10 ? 281 LEU B N   1 
ATOM   1680 C  CA  . LEU B 2 80  ? 17.583 9.458   14.732  1.00 49.66 ? 281 LEU B CA  1 
ATOM   1681 C  C   . LEU B 2 80  ? 17.849 8.438   15.857  1.00 51.62 ? 281 LEU B C   1 
ATOM   1682 O  O   . LEU B 2 80  ? 18.243 7.299   15.586  1.00 50.42 ? 281 LEU B O   1 
ATOM   1683 C  CB  . LEU B 2 80  ? 18.753 10.435  14.571  1.00 47.79 ? 281 LEU B CB  1 
ATOM   1684 C  CG  . LEU B 2 80  ? 19.467 10.539  13.211  1.00 46.02 ? 281 LEU B CG  1 
ATOM   1685 C  CD1 . LEU B 2 80  ? 18.685 9.861   12.083  1.00 45.32 ? 281 LEU B CD1 1 
ATOM   1686 C  CD2 . LEU B 2 80  ? 19.743 12.001  12.890  1.00 43.83 ? 281 LEU B CD2 1 
ATOM   1687 N  N   . LYS B 2 81  ? 17.523 8.810   17.101  1.00 53.21 ? 282 LYS B N   1 
ATOM   1688 C  CA  . LYS B 2 81  ? 17.740 7.938   18.267  1.00 52.36 ? 282 LYS B CA  1 
ATOM   1689 C  C   . LYS B 2 81  ? 16.978 6.616   18.238  1.00 54.75 ? 282 LYS B C   1 
ATOM   1690 O  O   . LYS B 2 81  ? 17.550 5.559   18.539  1.00 56.81 ? 282 LYS B O   1 
ATOM   1691 C  CB  . LYS B 2 81  ? 17.427 8.669   19.568  1.00 50.42 ? 282 LYS B CB  1 
ATOM   1692 C  CG  . LYS B 2 81  ? 18.254 9.913   19.762  1.00 54.86 ? 282 LYS B CG  1 
ATOM   1693 C  CD  . LYS B 2 81  ? 17.956 10.578  21.098  1.00 62.70 ? 282 LYS B CD  1 
ATOM   1694 C  CE  . LYS B 2 81  ? 18.477 12.013  21.114  1.00 65.91 ? 282 LYS B CE  1 
ATOM   1695 N  NZ  . LYS B 2 81  ? 17.772 12.849  20.085  1.00 67.21 ? 282 LYS B NZ  1 
ATOM   1696 N  N   . GLY B 2 82  ? 15.686 6.675   17.919  1.00 52.54 ? 283 GLY B N   1 
ATOM   1697 C  CA  . GLY B 2 82  ? 14.890 5.460   17.858  1.00 44.76 ? 283 GLY B CA  1 
ATOM   1698 C  C   . GLY B 2 82  ? 15.306 4.531   16.731  1.00 41.58 ? 283 GLY B C   1 
ATOM   1699 O  O   . GLY B 2 82  ? 15.249 3.309   16.885  1.00 43.03 ? 283 GLY B O   1 
ATOM   1700 N  N   . THR B 2 83  ? 15.729 5.105   15.604  1.00 41.89 ? 284 THR B N   1 
ATOM   1701 C  CA  . THR B 2 83  ? 16.160 4.329   14.431  1.00 43.39 ? 284 THR B CA  1 
ATOM   1702 C  C   . THR B 2 83  ? 17.390 3.478   14.735  1.00 45.23 ? 284 THR B C   1 
ATOM   1703 O  O   . THR B 2 83  ? 17.448 2.286   14.404  1.00 46.73 ? 284 THR B O   1 
ATOM   1704 C  CB  . THR B 2 83  ? 16.558 5.247   13.242  1.00 42.90 ? 284 THR B CB  1 
ATOM   1705 O  OG1 . THR B 2 83  ? 15.560 6.253   13.028  1.00 45.56 ? 284 THR B OG1 1 
ATOM   1706 C  CG2 . THR B 2 83  ? 16.722 4.424   11.973  1.00 44.70 ? 284 THR B CG2 1 
ATOM   1707 N  N   . PHE B 2 84  ? 18.387 4.122   15.336  1.00 46.37 ? 285 PHE B N   1 
ATOM   1708 C  CA  . PHE B 2 84  ? 19.646 3.476   15.666  1.00 43.72 ? 285 PHE B CA  1 
ATOM   1709 C  C   . PHE B 2 84  ? 19.711 2.905   17.058  1.00 44.40 ? 285 PHE B C   1 
ATOM   1710 O  O   . PHE B 2 84  ? 20.799 2.599   17.537  1.00 49.33 ? 285 PHE B O   1 
ATOM   1711 C  CB  . PHE B 2 84  ? 20.812 4.451   15.452  1.00 41.23 ? 285 PHE B CB  1 
ATOM   1712 C  CG  . PHE B 2 84  ? 20.990 4.871   14.020  1.00 38.00 ? 285 PHE B CG  1 
ATOM   1713 C  CD1 . PHE B 2 84  ? 20.648 6.154   13.609  1.00 36.05 ? 285 PHE B CD1 1 
ATOM   1714 C  CD2 . PHE B 2 84  ? 21.451 3.968   13.073  1.00 39.16 ? 285 PHE B CD2 1 
ATOM   1715 C  CE1 . PHE B 2 84  ? 20.754 6.529   12.278  1.00 35.05 ? 285 PHE B CE1 1 
ATOM   1716 C  CE2 . PHE B 2 84  ? 21.560 4.333   11.736  1.00 41.15 ? 285 PHE B CE2 1 
ATOM   1717 C  CZ  . PHE B 2 84  ? 21.209 5.618   11.338  1.00 35.72 ? 285 PHE B CZ  1 
ATOM   1718 N  N   . ALA B 2 85  ? 18.566 2.715   17.705  1.00 44.25 ? 286 ALA B N   1 
ATOM   1719 C  CA  . ALA B 2 85  ? 18.569 2.158   19.053  1.00 40.69 ? 286 ALA B CA  1 
ATOM   1720 C  C   . ALA B 2 85  ? 19.037 0.698   19.069  1.00 40.16 ? 286 ALA B C   1 
ATOM   1721 O  O   . ALA B 2 85  ? 19.722 0.293   20.010  1.00 39.35 ? 286 ALA B O   1 
ATOM   1722 C  CB  . ALA B 2 85  ? 17.202 2.315   19.723  1.00 41.89 ? 286 ALA B CB  1 
ATOM   1723 N  N   . ALA B 2 86  ? 18.711 -0.075  18.028  1.00 42.54 ? 287 ALA B N   1 
ATOM   1724 C  CA  . ALA B 2 86  ? 19.141 -1.485  17.942  1.00 44.43 ? 287 ALA B CA  1 
ATOM   1725 C  C   . ALA B 2 86  ? 20.651 -1.600  17.662  1.00 44.71 ? 287 ALA B C   1 
ATOM   1726 O  O   . ALA B 2 86  ? 21.310 -2.555  18.088  1.00 44.64 ? 287 ALA B O   1 
ATOM   1727 C  CB  . ALA B 2 86  ? 18.351 -2.237  16.868  1.00 42.52 ? 287 ALA B CB  1 
ATOM   1728 N  N   . LEU B 2 87  ? 21.188 -0.624  16.934  1.00 45.47 ? 288 LEU B N   1 
ATOM   1729 C  CA  . LEU B 2 87  ? 22.612 -0.589  16.607  1.00 42.25 ? 288 LEU B CA  1 
ATOM   1730 C  C   . LEU B 2 87  ? 23.409 -0.036  17.789  1.00 40.25 ? 288 LEU B C   1 
ATOM   1731 O  O   . LEU B 2 87  ? 24.550 -0.431  18.022  1.00 40.22 ? 288 LEU B O   1 
ATOM   1732 C  CB  . LEU B 2 87  ? 22.845 0.270   15.366  1.00 41.43 ? 288 LEU B CB  1 
ATOM   1733 C  CG  . LEU B 2 87  ? 22.363 -0.368  14.067  1.00 42.29 ? 288 LEU B CG  1 
ATOM   1734 C  CD1 . LEU B 2 87  ? 22.559 0.609   12.927  1.00 37.07 ? 288 LEU B CD1 1 
ATOM   1735 C  CD2 . LEU B 2 87  ? 23.120 -1.676  13.830  1.00 34.18 ? 288 LEU B CD2 1 
ATOM   1736 N  N   . SER B 2 88  ? 22.800 0.895   18.515  1.00 37.64 ? 289 SER B N   1 
ATOM   1737 C  CA  . SER B 2 88  ? 23.414 1.494   19.687  1.00 36.89 ? 289 SER B CA  1 
ATOM   1738 C  C   . SER B 2 88  ? 23.699 0.395   20.729  1.00 42.53 ? 289 SER B C   1 
ATOM   1739 O  O   . SER B 2 88  ? 24.776 0.386   21.332  1.00 46.21 ? 289 SER B O   1 
ATOM   1740 C  CB  . SER B 2 88  ? 22.495 2.579   20.247  1.00 35.90 ? 289 SER B CB  1 
ATOM   1741 O  OG  . SER B 2 88  ? 23.138 3.324   21.252  1.00 32.68 ? 289 SER B OG  1 
ATOM   1742 N  N   . GLU B 2 89  ? 22.770 -0.554  20.903  1.00 41.68 ? 290 GLU B N   1 
ATOM   1743 C  CA  . GLU B 2 89  ? 22.951 -1.660  21.855  1.00 40.40 ? 290 GLU B CA  1 
ATOM   1744 C  C   . GLU B 2 89  ? 24.040 -2.587  21.340  1.00 39.52 ? 290 GLU B C   1 
ATOM   1745 O  O   . GLU B 2 89  ? 24.799 -3.161  22.126  1.00 37.88 ? 290 GLU B O   1 
ATOM   1746 C  CB  . GLU B 2 89  ? 21.674 -2.483  22.013  1.00 42.78 ? 290 GLU B CB  1 
ATOM   1747 C  CG  . GLU B 2 89  ? 20.545 -1.812  22.774  1.00 56.20 ? 290 GLU B CG  1 
ATOM   1748 C  CD  . GLU B 2 89  ? 19.249 -2.652  22.810  1.00 61.62 ? 290 GLU B CD  1 
ATOM   1749 O  OE1 . GLU B 2 89  ? 18.203 -2.094  23.232  1.00 66.91 ? 290 GLU B OE1 1 
ATOM   1750 O  OE2 . GLU B 2 89  ? 19.269 -3.853  22.424  1.00 56.65 ? 290 GLU B OE2 1 
ATOM   1751 N  N   . LEU B 2 90  ? 24.073 -2.770  20.019  1.00 38.43 ? 291 LEU B N   1 
ATOM   1752 C  CA  . LEU B 2 90  ? 25.071 -3.621  19.366  1.00 39.95 ? 291 LEU B CA  1 
ATOM   1753 C  C   . LEU B 2 90  ? 26.493 -3.051  19.528  1.00 38.67 ? 291 LEU B C   1 
ATOM   1754 O  O   . LEU B 2 90  ? 27.398 -3.726  20.013  1.00 36.48 ? 291 LEU B O   1 
ATOM   1755 C  CB  . LEU B 2 90  ? 24.742 -3.790  17.870  1.00 38.47 ? 291 LEU B CB  1 
ATOM   1756 C  CG  . LEU B 2 90  ? 25.807 -4.522  17.039  1.00 41.90 ? 291 LEU B CG  1 
ATOM   1757 C  CD1 . LEU B 2 90  ? 25.870 -5.972  17.473  1.00 41.53 ? 291 LEU B CD1 1 
ATOM   1758 C  CD2 . LEU B 2 90  ? 25.532 -4.413  15.541  1.00 41.64 ? 291 LEU B CD2 1 
ATOM   1759 N  N   . HIS B 2 91  ? 26.670 -1.784  19.188  1.00 36.57 ? 292 HIS B N   1 
ATOM   1760 C  CA  . HIS B 2 91  ? 27.980 -1.174  19.286  1.00 33.41 ? 292 HIS B CA  1 
ATOM   1761 C  C   . HIS B 2 91  ? 28.455 -0.895  20.716  1.00 36.02 ? 292 HIS B C   1 
ATOM   1762 O  O   . HIS B 2 91  ? 29.593 -1.224  21.062  1.00 33.31 ? 292 HIS B O   1 
ATOM   1763 C  CB  . HIS B 2 91  ? 28.022 0.088   18.435  1.00 31.40 ? 292 HIS B CB  1 
ATOM   1764 C  CG  . HIS B 2 91  ? 27.886 -0.178  16.972  1.00 30.94 ? 292 HIS B CG  1 
ATOM   1765 N  ND1 . HIS B 2 91  ? 26.682 -0.346  16.332  1.00 31.20 ? 292 HIS B ND1 1 
ATOM   1766 C  CD2 . HIS B 2 91  ? 28.836 -0.341  16.019  1.00 33.71 ? 292 HIS B CD2 1 
ATOM   1767 C  CE1 . HIS B 2 91  ? 26.932 -0.608  15.040  1.00 33.95 ? 292 HIS B CE1 1 
ATOM   1768 N  NE2 . HIS B 2 91  ? 28.230 -0.616  14.797  1.00 32.39 ? 292 HIS B NE2 1 
ATOM   1769 N  N   . CYS B 2 92  ? 27.568 -0.367  21.560  1.00 40.05 ? 293 CYS B N   1 
ATOM   1770 C  CA  . CYS B 2 92  ? 27.918 -0.010  22.933  1.00 41.78 ? 293 CYS B CA  1 
ATOM   1771 C  C   . CYS B 2 92  ? 28.022 -1.114  23.965  1.00 45.52 ? 293 CYS B C   1 
ATOM   1772 O  O   . CYS B 2 92  ? 29.051 -1.254  24.627  1.00 46.99 ? 293 CYS B O   1 
ATOM   1773 C  CB  . CYS B 2 92  ? 26.994 1.092   23.449  1.00 41.99 ? 293 CYS B CB  1 
ATOM   1774 S  SG  . CYS B 2 92  ? 27.079 2.619   22.461  1.00 42.41 ? 293 CYS B SG  1 
ATOM   1775 N  N   . ASP B 2 93  ? 26.967 -1.898  24.129  1.00 50.40 ? 294 ASP B N   1 
ATOM   1776 C  CA  . ASP B 2 93  ? 27.004 -2.957  25.131  1.00 50.80 ? 294 ASP B CA  1 
ATOM   1777 C  C   . ASP B 2 93  ? 27.608 -4.270  24.666  1.00 46.14 ? 294 ASP B C   1 
ATOM   1778 O  O   . ASP B 2 93  ? 28.183 -4.993  25.473  1.00 48.12 ? 294 ASP B O   1 
ATOM   1779 C  CB  . ASP B 2 93  ? 25.618 -3.181  25.746  1.00 57.03 ? 294 ASP B CB  1 
ATOM   1780 C  CG  . ASP B 2 93  ? 25.076 -1.934  26.432  1.00 63.16 ? 294 ASP B CG  1 
ATOM   1781 O  OD1 . ASP B 2 93  ? 24.163 -1.318  25.854  1.00 62.71 ? 294 ASP B OD1 1 
ATOM   1782 O  OD2 . ASP B 2 93  ? 25.563 -1.559  27.529  1.00 67.18 ? 294 ASP B OD2 1 
ATOM   1783 N  N   . LYS B 2 94  ? 27.512 -4.571  23.375  1.00 44.36 ? 295 LYS B N   1 
ATOM   1784 C  CA  . LYS B 2 94  ? 28.064 -5.823  22.857  1.00 44.01 ? 295 LYS B CA  1 
ATOM   1785 C  C   . LYS B 2 94  ? 29.507 -5.748  22.328  1.00 42.23 ? 295 LYS B C   1 
ATOM   1786 O  O   . LYS B 2 94  ? 30.380 -6.487  22.787  1.00 40.01 ? 295 LYS B O   1 
ATOM   1787 C  CB  . LYS B 2 94  ? 27.119 -6.441  21.802  1.00 49.46 ? 295 LYS B CB  1 
ATOM   1788 C  CG  . LYS B 2 94  ? 26.287 -7.639  22.302  1.00 52.06 ? 295 LYS B CG  1 
ATOM   1789 C  CD  . LYS B 2 94  ? 24.900 -7.731  21.636  1.00 62.01 ? 295 LYS B CD  1 
ATOM   1790 C  CE  . LYS B 2 94  ? 23.950 -6.615  22.120  1.00 63.96 ? 295 LYS B CE  1 
ATOM   1791 N  NZ  . LYS B 2 94  ? 22.629 -6.568  21.401  1.00 67.43 ? 295 LYS B NZ  1 
ATOM   1792 N  N   . LEU B 2 95  ? 29.762 -4.870  21.363  1.00 41.92 ? 296 LEU B N   1 
ATOM   1793 C  CA  . LEU B 2 95  ? 31.097 -4.752  20.790  1.00 36.16 ? 296 LEU B CA  1 
ATOM   1794 C  C   . LEU B 2 95  ? 32.028 -3.899  21.633  1.00 36.71 ? 296 LEU B C   1 
ATOM   1795 O  O   . LEU B 2 95  ? 33.227 -4.140  21.656  1.00 37.80 ? 296 LEU B O   1 
ATOM   1796 C  CB  . LEU B 2 95  ? 31.015 -4.214  19.373  1.00 34.43 ? 296 LEU B CB  1 
ATOM   1797 C  CG  . LEU B 2 95  ? 30.273 -5.104  18.382  1.00 38.05 ? 296 LEU B CG  1 
ATOM   1798 C  CD1 . LEU B 2 95  ? 30.009 -4.313  17.133  1.00 39.58 ? 296 LEU B CD1 1 
ATOM   1799 C  CD2 . LEU B 2 95  ? 31.065 -6.362  18.074  1.00 35.88 ? 296 LEU B CD2 1 
ATOM   1800 N  N   . HIS B 2 96  ? 31.479 -2.918  22.345  1.00 38.92 ? 297 HIS B N   1 
ATOM   1801 C  CA  . HIS B 2 96  ? 32.283 -2.037  23.207  1.00 42.21 ? 297 HIS B CA  1 
ATOM   1802 C  C   . HIS B 2 96  ? 33.202 -1.072  22.437  1.00 43.35 ? 297 HIS B C   1 
ATOM   1803 O  O   . HIS B 2 96  ? 34.342 -0.804  22.841  1.00 43.42 ? 297 HIS B O   1 
ATOM   1804 C  CB  . HIS B 2 96  ? 33.109 -2.862  24.200  1.00 44.32 ? 297 HIS B CB  1 
ATOM   1805 C  CG  . HIS B 2 96  ? 32.285 -3.607  25.205  1.00 46.26 ? 297 HIS B CG  1 
ATOM   1806 N  ND1 . HIS B 2 96  ? 31.393 -2.979  26.053  1.00 47.29 ? 297 HIS B ND1 1 
ATOM   1807 C  CD2 . HIS B 2 96  ? 32.221 -4.925  25.502  1.00 42.51 ? 297 HIS B CD2 1 
ATOM   1808 C  CE1 . HIS B 2 96  ? 30.819 -3.879  26.829  1.00 48.66 ? 297 HIS B CE1 1 
ATOM   1809 N  NE2 . HIS B 2 96  ? 31.301 -5.068  26.514  1.00 47.65 ? 297 HIS B NE2 1 
ATOM   1810 N  N   . VAL B 2 97  ? 32.670 -0.517  21.355  1.00 42.90 ? 298 VAL B N   1 
ATOM   1811 C  CA  . VAL B 2 97  ? 33.397 0.418   20.512  1.00 37.23 ? 298 VAL B CA  1 
ATOM   1812 C  C   . VAL B 2 97  ? 33.340 1.787   21.164  1.00 36.81 ? 298 VAL B C   1 
ATOM   1813 O  O   . VAL B 2 97  ? 32.304 2.167   21.702  1.00 36.65 ? 298 VAL B O   1 
ATOM   1814 C  CB  . VAL B 2 97  ? 32.749 0.507   19.119  1.00 34.60 ? 298 VAL B CB  1 
ATOM   1815 C  CG1 . VAL B 2 97  ? 33.369 1.655   18.311  1.00 38.12 ? 298 VAL B CG1 1 
ATOM   1816 C  CG2 . VAL B 2 97  ? 32.898 -0.816  18.395  1.00 28.37 ? 298 VAL B CG2 1 
ATOM   1817 N  N   . ASP B 2 98  ? 34.459 2.504   21.175  1.00 35.65 ? 299 ASP B N   1 
ATOM   1818 C  CA  . ASP B 2 98  ? 34.445 3.823   21.764  1.00 32.91 ? 299 ASP B CA  1 
ATOM   1819 C  C   . ASP B 2 98  ? 33.669 4.746   20.832  1.00 35.51 ? 299 ASP B C   1 
ATOM   1820 O  O   . ASP B 2 98  ? 33.777 4.645   19.605  1.00 35.35 ? 299 ASP B O   1 
ATOM   1821 C  CB  . ASP B 2 98  ? 35.857 4.355   21.992  1.00 32.70 ? 299 ASP B CB  1 
ATOM   1822 C  CG  . ASP B 2 98  ? 35.891 5.487   23.004  1.00 32.26 ? 299 ASP B CG  1 
ATOM   1823 O  OD1 . ASP B 2 98  ? 36.024 5.177   24.206  1.00 42.43 ? 299 ASP B OD1 1 
ATOM   1824 O  OD2 . ASP B 2 98  ? 35.775 6.675   22.621  1.00 31.08 ? 299 ASP B OD2 1 
ATOM   1825 N  N   . PRO B 2 99  ? 32.846 5.641   21.406  1.00 38.74 ? 300 PRO B N   1 
ATOM   1826 C  CA  . PRO B 2 99  ? 32.024 6.606   20.671  1.00 34.37 ? 300 PRO B CA  1 
ATOM   1827 C  C   . PRO B 2 99  ? 32.823 7.459   19.695  1.00 33.55 ? 300 PRO B C   1 
ATOM   1828 O  O   . PRO B 2 99  ? 32.307 7.851   18.662  1.00 35.32 ? 300 PRO B O   1 
ATOM   1829 C  CB  . PRO B 2 99  ? 31.430 7.458   21.785  1.00 35.17 ? 300 PRO B CB  1 
ATOM   1830 C  CG  . PRO B 2 99  ? 31.280 6.497   22.885  1.00 36.18 ? 300 PRO B CG  1 
ATOM   1831 C  CD  . PRO B 2 99  ? 32.579 5.746   22.855  1.00 37.43 ? 300 PRO B CD  1 
ATOM   1832 N  N   . GLU B 2 100 ? 34.068 7.779   20.039  1.00 36.14 ? 301 GLU B N   1 
ATOM   1833 C  CA  . GLU B 2 100 ? 34.929 8.584   19.165  1.00 35.87 ? 301 GLU B CA  1 
ATOM   1834 C  C   . GLU B 2 100 ? 35.055 7.988   17.759  1.00 31.83 ? 301 GLU B C   1 
ATOM   1835 O  O   . GLU B 2 100 ? 35.239 8.713   16.785  1.00 28.50 ? 301 GLU B O   1 
ATOM   1836 C  CB  . GLU B 2 100 ? 36.332 8.739   19.768  1.00 42.28 ? 301 GLU B CB  1 
ATOM   1837 C  CG  . GLU B 2 100 ? 36.692 10.160  20.213  1.00 52.21 ? 301 GLU B CG  1 
ATOM   1838 C  CD  . GLU B 2 100 ? 36.957 11.108  19.050  1.00 55.30 ? 301 GLU B CD  1 
ATOM   1839 O  OE1 . GLU B 2 100 ? 36.126 12.023  18.827  1.00 55.35 ? 301 GLU B OE1 1 
ATOM   1840 O  OE2 . GLU B 2 100 ? 38.007 10.953  18.378  1.00 59.59 ? 301 GLU B OE2 1 
ATOM   1841 N  N   . ASN B 2 101 ? 34.995 6.663   17.665  1.00 28.25 ? 302 ASN B N   1 
ATOM   1842 C  CA  . ASN B 2 101 ? 35.088 6.001   16.375  1.00 26.28 ? 302 ASN B CA  1 
ATOM   1843 C  C   . ASN B 2 101 ? 33.902 6.229   15.422  1.00 27.38 ? 302 ASN B C   1 
ATOM   1844 O  O   . ASN B 2 101 ? 34.102 6.229   14.209  1.00 27.12 ? 302 ASN B O   1 
ATOM   1845 C  CB  . ASN B 2 101 ? 35.356 4.518   16.575  1.00 29.52 ? 302 ASN B CB  1 
ATOM   1846 C  CG  . ASN B 2 101 ? 36.658 4.268   17.292  1.00 31.65 ? 302 ASN B CG  1 
ATOM   1847 O  OD1 . ASN B 2 101 ? 36.686 3.808   18.429  1.00 32.91 ? 302 ASN B OD1 1 
ATOM   1848 N  ND2 . ASN B 2 101 ? 37.746 4.612   16.649  1.00 29.91 ? 302 ASN B ND2 1 
ATOM   1849 N  N   . PHE B 2 102 ? 32.684 6.429   15.944  1.00 29.38 ? 303 PHE B N   1 
ATOM   1850 C  CA  . PHE B 2 102 ? 31.496 6.683   15.094  1.00 25.85 ? 303 PHE B CA  1 
ATOM   1851 C  C   . PHE B 2 102 ? 31.717 8.007   14.358  1.00 23.90 ? 303 PHE B C   1 
ATOM   1852 O  O   . PHE B 2 102 ? 31.305 8.174   13.225  1.00 26.48 ? 303 PHE B O   1 
ATOM   1853 C  CB  . PHE B 2 102 ? 30.190 6.812   15.921  1.00 27.16 ? 303 PHE B CB  1 
ATOM   1854 C  CG  . PHE B 2 102 ? 29.961 5.706   16.931  1.00 24.48 ? 303 PHE B CG  1 
ATOM   1855 C  CD1 . PHE B 2 102 ? 30.143 4.373   16.605  1.00 29.42 ? 303 PHE B CD1 1 
ATOM   1856 C  CD2 . PHE B 2 102 ? 29.562 6.015   18.224  1.00 25.24 ? 303 PHE B CD2 1 
ATOM   1857 C  CE1 . PHE B 2 102 ? 29.928 3.363   17.564  1.00 33.25 ? 303 PHE B CE1 1 
ATOM   1858 C  CE2 . PHE B 2 102 ? 29.345 5.018   19.188  1.00 27.34 ? 303 PHE B CE2 1 
ATOM   1859 C  CZ  . PHE B 2 102 ? 29.528 3.695   18.859  1.00 26.60 ? 303 PHE B CZ  1 
ATOM   1860 N  N   . LYS B 2 103 ? 32.366 8.945   15.035  1.00 25.27 ? 304 LYS B N   1 
ATOM   1861 C  CA  . LYS B 2 103 ? 32.703 10.265  14.501  1.00 27.80 ? 304 LYS B CA  1 
ATOM   1862 C  C   . LYS B 2 103 ? 33.753 10.144  13.384  1.00 24.14 ? 304 LYS B C   1 
ATOM   1863 O  O   . LYS B 2 103 ? 33.654 10.808  12.353  1.00 23.20 ? 304 LYS B O   1 
ATOM   1864 C  CB  . LYS B 2 103 ? 33.282 11.098  15.642  1.00 34.53 ? 304 LYS B CB  1 
ATOM   1865 C  CG  . LYS B 2 103 ? 32.882 12.557  15.679  1.00 44.79 ? 304 LYS B CG  1 
ATOM   1866 C  CD  . LYS B 2 103 ? 32.616 12.956  17.130  1.00 51.53 ? 304 LYS B CD  1 
ATOM   1867 C  CE  . LYS B 2 103 ? 31.442 12.148  17.702  1.00 54.48 ? 304 LYS B CE  1 
ATOM   1868 N  NZ  . LYS B 2 103 ? 31.254 12.333  19.172  1.00 59.14 ? 304 LYS B NZ  1 
ATOM   1869 N  N   . LEU B 2 104 ? 34.752 9.283   13.592  1.00 25.51 ? 305 LEU B N   1 
ATOM   1870 C  CA  . LEU B 2 104 ? 35.801 9.076   12.595  1.00 23.47 ? 305 LEU B CA  1 
ATOM   1871 C  C   . LEU B 2 104 ? 35.217 8.477   11.323  1.00 24.29 ? 305 LEU B C   1 
ATOM   1872 O  O   . LEU B 2 104 ? 35.569 8.907   10.225  1.00 25.53 ? 305 LEU B O   1 
ATOM   1873 C  CB  . LEU B 2 104 ? 36.919 8.181   13.132  1.00 19.29 ? 305 LEU B CB  1 
ATOM   1874 C  CG  . LEU B 2 104 ? 37.780 8.696   14.290  1.00 22.15 ? 305 LEU B CG  1 
ATOM   1875 C  CD1 . LEU B 2 104 ? 38.900 7.686   14.589  1.00 21.38 ? 305 LEU B CD1 1 
ATOM   1876 C  CD2 . LEU B 2 104 ? 38.365 10.065  13.943  1.00 20.34 ? 305 LEU B CD2 1 
ATOM   1877 N  N   . LEU B 2 105 ? 34.325 7.489   11.472  1.00 25.71 ? 306 LEU B N   1 
ATOM   1878 C  CA  . LEU B 2 105 ? 33.658 6.843   10.331  1.00 25.28 ? 306 LEU B CA  1 
ATOM   1879 C  C   . LEU B 2 105 ? 32.788 7.853   9.597   1.00 25.08 ? 306 LEU B C   1 
ATOM   1880 O  O   . LEU B 2 105 ? 32.716 7.852   8.372   1.00 29.15 ? 306 LEU B O   1 
ATOM   1881 C  CB  . LEU B 2 105 ? 32.811 5.644   10.794  1.00 25.38 ? 306 LEU B CB  1 
ATOM   1882 C  CG  . LEU B 2 105 ? 32.218 4.641   9.768   1.00 28.17 ? 306 LEU B CG  1 
ATOM   1883 C  CD1 . LEU B 2 105 ? 30.931 5.151   9.194   1.00 34.88 ? 306 LEU B CD1 1 
ATOM   1884 C  CD2 . LEU B 2 105 ? 33.184 4.323   8.638   1.00 25.55 ? 306 LEU B CD2 1 
ATOM   1885 N  N   . GLY B 2 106 ? 32.111 8.709   10.351  1.00 27.88 ? 307 GLY B N   1 
ATOM   1886 C  CA  . GLY B 2 106 ? 31.283 9.723   9.736   1.00 30.17 ? 307 GLY B CA  1 
ATOM   1887 C  C   . GLY B 2 106 ? 32.178 10.685  8.964   1.00 32.17 ? 307 GLY B C   1 
ATOM   1888 O  O   . GLY B 2 106 ? 31.828 11.112  7.859   1.00 32.56 ? 307 GLY B O   1 
ATOM   1889 N  N   . ASN B 2 107 ? 33.319 11.056  9.552   1.00 29.72 ? 308 ASN B N   1 
ATOM   1890 C  CA  . ASN B 2 107 ? 34.254 11.949  8.880   1.00 27.35 ? 308 ASN B CA  1 
ATOM   1891 C  C   . ASN B 2 107 ? 34.891 11.296  7.665   1.00 25.79 ? 308 ASN B C   1 
ATOM   1892 O  O   . ASN B 2 107 ? 35.108 11.947  6.649   1.00 26.82 ? 308 ASN B O   1 
ATOM   1893 C  CB  . ASN B 2 107 ? 35.321 12.461  9.836   1.00 27.53 ? 308 ASN B CB  1 
ATOM   1894 C  CG  . ASN B 2 107 ? 34.832 13.622  10.698  1.00 29.81 ? 308 ASN B CG  1 
ATOM   1895 O  OD1 . ASN B 2 107 ? 33.844 14.301  10.375  1.00 28.47 ? 308 ASN B OD1 1 
ATOM   1896 N  ND2 . ASN B 2 107 ? 35.550 13.880  11.782  1.00 34.14 ? 308 ASN B ND2 1 
ATOM   1897 N  N   . VAL B 2 108 ? 35.165 10.003  7.750   1.00 25.21 ? 309 VAL B N   1 
ATOM   1898 C  CA  . VAL B 2 108 ? 35.740 9.302   6.613   1.00 27.04 ? 309 VAL B CA  1 
ATOM   1899 C  C   . VAL B 2 108 ? 34.735 9.249   5.458   1.00 28.46 ? 309 VAL B C   1 
ATOM   1900 O  O   . VAL B 2 108 ? 35.127 9.355   4.291   1.00 31.36 ? 309 VAL B O   1 
ATOM   1901 C  CB  . VAL B 2 108 ? 36.240 7.906   7.000   1.00 25.47 ? 309 VAL B CB  1 
ATOM   1902 C  CG1 . VAL B 2 108 ? 36.581 7.096   5.783   1.00 26.02 ? 309 VAL B CG1 1 
ATOM   1903 C  CG2 . VAL B 2 108 ? 37.463 8.064   7.853   1.00 27.00 ? 309 VAL B CG2 1 
ATOM   1904 N  N   . LEU B 2 109 ? 33.444 9.163   5.784   1.00 28.07 ? 310 LEU B N   1 
ATOM   1905 C  CA  . LEU B 2 109 ? 32.385 9.146   4.774   1.00 26.89 ? 310 LEU B CA  1 
ATOM   1906 C  C   . LEU B 2 109 ? 32.317 10.501  4.044   1.00 24.63 ? 310 LEU B C   1 
ATOM   1907 O  O   . LEU B 2 109 ? 32.122 10.566  2.825   1.00 30.22 ? 310 LEU B O   1 
ATOM   1908 C  CB  . LEU B 2 109 ? 31.019 8.825   5.406   1.00 29.08 ? 310 LEU B CB  1 
ATOM   1909 C  CG  . LEU B 2 109 ? 29.835 8.891   4.420   1.00 28.36 ? 310 LEU B CG  1 
ATOM   1910 C  CD1 . LEU B 2 109 ? 29.991 7.852   3.333   1.00 27.20 ? 310 LEU B CD1 1 
ATOM   1911 C  CD2 . LEU B 2 109 ? 28.539 8.707   5.139   1.00 33.05 ? 310 LEU B CD2 1 
ATOM   1912 N  N   . VAL B 2 110 ? 32.468 11.585  4.785   1.00 23.82 ? 311 VAL B N   1 
ATOM   1913 C  CA  . VAL B 2 110 ? 32.439 12.909  4.180   1.00 24.64 ? 311 VAL B CA  1 
ATOM   1914 C  C   . VAL B 2 110 ? 33.596 13.022  3.186   1.00 24.94 ? 311 VAL B C   1 
ATOM   1915 O  O   . VAL B 2 110 ? 33.420 13.552  2.089   1.00 25.04 ? 311 VAL B O   1 
ATOM   1916 C  CB  . VAL B 2 110 ? 32.485 14.024  5.267   1.00 22.51 ? 311 VAL B CB  1 
ATOM   1917 C  CG1 . VAL B 2 110 ? 32.622 15.394  4.652   1.00 21.12 ? 311 VAL B CG1 1 
ATOM   1918 C  CG2 . VAL B 2 110 ? 31.214 13.967  6.102   1.00 20.71 ? 311 VAL B CG2 1 
ATOM   1919 N  N   . VAL B 2 111 ? 34.762 12.481  3.546   1.00 26.32 ? 312 VAL B N   1 
ATOM   1920 C  CA  . VAL B 2 111 ? 35.926 12.508  2.662   1.00 24.67 ? 312 VAL B CA  1 
ATOM   1921 C  C   . VAL B 2 111 ? 35.645 11.662  1.426   1.00 24.53 ? 312 VAL B C   1 
ATOM   1922 O  O   . VAL B 2 111 ? 35.900 12.089  0.313   1.00 26.39 ? 312 VAL B O   1 
ATOM   1923 C  CB  . VAL B 2 111 ? 37.207 12.020  3.381   1.00 23.85 ? 312 VAL B CB  1 
ATOM   1924 C  CG1 . VAL B 2 111 ? 38.287 11.685  2.368   1.00 27.80 ? 312 VAL B CG1 1 
ATOM   1925 C  CG2 . VAL B 2 111 ? 37.726 13.103  4.350   1.00 19.35 ? 312 VAL B CG2 1 
ATOM   1926 N  N   . VAL B 2 112 ? 35.051 10.491  1.617   1.00 27.11 ? 313 VAL B N   1 
ATOM   1927 C  CA  . VAL B 2 112 ? 34.710 9.605   0.505   1.00 28.31 ? 313 VAL B CA  1 
ATOM   1928 C  C   . VAL B 2 112 ? 33.699 10.253  -0.456  1.00 30.55 ? 313 VAL B C   1 
ATOM   1929 O  O   . VAL B 2 112 ? 33.818 10.125  -1.680  1.00 31.90 ? 313 VAL B O   1 
ATOM   1930 C  CB  . VAL B 2 112 ? 34.161 8.240   1.022   1.00 34.21 ? 313 VAL B CB  1 
ATOM   1931 C  CG1 . VAL B 2 112 ? 33.642 7.378   -0.139  1.00 29.11 ? 313 VAL B CG1 1 
ATOM   1932 C  CG2 . VAL B 2 112 ? 35.263 7.494   1.782   1.00 33.50 ? 313 VAL B CG2 1 
ATOM   1933 N  N   . LEU B 2 113 ? 32.719 10.966  0.090   1.00 31.71 ? 314 LEU B N   1 
ATOM   1934 C  CA  . LEU B 2 113 ? 31.718 11.630  -0.733  1.00 31.45 ? 314 LEU B CA  1 
ATOM   1935 C  C   . LEU B 2 113 ? 32.389 12.711  -1.560  1.00 31.50 ? 314 LEU B C   1 
ATOM   1936 O  O   . LEU B 2 113 ? 32.140 12.828  -2.758  1.00 33.37 ? 314 LEU B O   1 
ATOM   1937 C  CB  . LEU B 2 113 ? 30.600 12.239  0.135   1.00 30.32 ? 314 LEU B CB  1 
ATOM   1938 C  CG  . LEU B 2 113 ? 29.675 11.289  0.920   1.00 26.65 ? 314 LEU B CG  1 
ATOM   1939 C  CD1 . LEU B 2 113 ? 28.706 12.079  1.770   1.00 25.03 ? 314 LEU B CD1 1 
ATOM   1940 C  CD2 . LEU B 2 113 ? 28.895 10.416  -0.026  1.00 25.10 ? 314 LEU B CD2 1 
ATOM   1941 N  N   . ALA B 2 114 ? 33.269 13.480  -0.929  1.00 31.09 ? 315 ALA B N   1 
ATOM   1942 C  CA  . ALA B 2 114 ? 33.981 14.543  -1.619  1.00 31.66 ? 315 ALA B CA  1 
ATOM   1943 C  C   . ALA B 2 114 ? 34.863 14.002  -2.758  1.00 33.53 ? 315 ALA B C   1 
ATOM   1944 O  O   . ALA B 2 114 ? 34.939 14.616  -3.826  1.00 35.62 ? 315 ALA B O   1 
ATOM   1945 C  CB  . ALA B 2 114 ? 34.828 15.333  -0.623  1.00 29.44 ? 315 ALA B CB  1 
ATOM   1946 N  N   . ARG B 2 115 ? 35.465 12.826  -2.557  1.00 31.48 ? 316 ARG B N   1 
ATOM   1947 C  CA  . ARG B 2 115 ? 36.354 12.233  -3.555  1.00 29.22 ? 316 ARG B CA  1 
ATOM   1948 C  C   . ARG B 2 115 ? 35.576 11.781  -4.765  1.00 27.08 ? 316 ARG B C   1 
ATOM   1949 O  O   . ARG B 2 115 ? 35.988 12.006  -5.900  1.00 28.46 ? 316 ARG B O   1 
ATOM   1950 C  CB  . ARG B 2 115 ? 37.153 11.045  -2.981  1.00 26.58 ? 316 ARG B CB  1 
ATOM   1951 C  CG  . ARG B 2 115 ? 38.458 10.770  -3.749  1.00 27.02 ? 316 ARG B CG  1 
ATOM   1952 C  CD  . ARG B 2 115 ? 39.129 9.447   -3.361  1.00 30.22 ? 316 ARG B CD  1 
ATOM   1953 N  NE  . ARG B 2 115 ? 38.341 8.306   -3.802  1.00 27.26 ? 316 ARG B NE  1 
ATOM   1954 C  CZ  . ARG B 2 115 ? 38.132 7.988   -5.075  1.00 33.83 ? 316 ARG B CZ  1 
ATOM   1955 N  NH1 . ARG B 2 115 ? 38.659 8.712   -6.058  1.00 34.61 ? 316 ARG B NH1 1 
ATOM   1956 N  NH2 . ARG B 2 115 ? 37.323 6.988   -5.367  1.00 34.28 ? 316 ARG B NH2 1 
ATOM   1957 N  N   . ASN B 2 116 ? 34.409 11.202  -4.507  1.00 31.17 ? 317 ASN B N   1 
ATOM   1958 C  CA  . ASN B 2 116 ? 33.555 10.688  -5.561  1.00 31.08 ? 317 ASN B CA  1 
ATOM   1959 C  C   . ASN B 2 116 ? 32.748 11.746  -6.291  1.00 33.70 ? 317 ASN B C   1 
ATOM   1960 O  O   . ASN B 2 116 ? 32.526 11.611  -7.489  1.00 35.47 ? 317 ASN B O   1 
ATOM   1961 C  CB  . ASN B 2 116 ? 32.613 9.608   -5.017  1.00 28.65 ? 317 ASN B CB  1 
ATOM   1962 C  CG  . ASN B 2 116 ? 33.279 8.251   -4.903  1.00 30.30 ? 317 ASN B CG  1 
ATOM   1963 O  OD1 . ASN B 2 116 ? 33.250 7.446   -5.834  1.00 38.60 ? 317 ASN B OD1 1 
ATOM   1964 N  ND2 . ASN B 2 116 ? 33.868 7.981   -3.753  1.00 34.63 ? 317 ASN B ND2 1 
ATOM   1965 N  N   . PHE B 2 117 ? 32.326 12.803  -5.595  1.00 32.20 ? 318 PHE B N   1 
ATOM   1966 C  CA  . PHE B 2 117 ? 31.504 13.827  -6.233  1.00 30.24 ? 318 PHE B CA  1 
ATOM   1967 C  C   . PHE B 2 117 ? 32.148 15.102  -6.720  1.00 31.24 ? 318 PHE B C   1 
ATOM   1968 O  O   . PHE B 2 117 ? 31.522 15.885  -7.438  1.00 34.35 ? 318 PHE B O   1 
ATOM   1969 C  CB  . PHE B 2 117 ? 30.257 14.108  -5.394  1.00 31.14 ? 318 PHE B CB  1 
ATOM   1970 C  CG  . PHE B 2 117 ? 29.283 12.969  -5.407  1.00 33.63 ? 318 PHE B CG  1 
ATOM   1971 C  CD1 . PHE B 2 117 ? 29.439 11.887  -4.541  1.00 36.62 ? 318 PHE B CD1 1 
ATOM   1972 C  CD2 . PHE B 2 117 ? 28.282 12.913  -6.362  1.00 36.60 ? 318 PHE B CD2 1 
ATOM   1973 C  CE1 . PHE B 2 117 ? 28.618 10.758  -4.640  1.00 38.25 ? 318 PHE B CE1 1 
ATOM   1974 C  CE2 . PHE B 2 117 ? 27.456 11.789  -6.470  1.00 36.94 ? 318 PHE B CE2 1 
ATOM   1975 C  CZ  . PHE B 2 117 ? 27.627 10.715  -5.611  1.00 38.98 ? 318 PHE B CZ  1 
ATOM   1976 N  N   . GLY B 2 118 ? 33.394 15.326  -6.341  1.00 30.06 ? 319 GLY B N   1 
ATOM   1977 C  CA  . GLY B 2 118 ? 34.067 16.512  -6.820  1.00 31.36 ? 319 GLY B CA  1 
ATOM   1978 C  C   . GLY B 2 118 ? 33.419 17.805  -6.391  1.00 34.22 ? 319 GLY B C   1 
ATOM   1979 O  O   . GLY B 2 118 ? 32.905 17.926  -5.269  1.00 34.79 ? 319 GLY B O   1 
ATOM   1980 N  N   . LYS B 2 119 ? 33.401 18.767  -7.304  1.00 36.28 ? 320 LYS B N   1 
ATOM   1981 C  CA  . LYS B 2 119 ? 32.850 20.085  -6.998  1.00 39.99 ? 320 LYS B CA  1 
ATOM   1982 C  C   . LYS B 2 119 ? 31.345 20.118  -6.703  1.00 38.43 ? 320 LYS B C   1 
ATOM   1983 O  O   . LYS B 2 119 ? 30.813 21.159  -6.312  1.00 36.50 ? 320 LYS B O   1 
ATOM   1984 C  CB  . LYS B 2 119 ? 33.199 21.071  -8.103  1.00 41.27 ? 320 LYS B CB  1 
ATOM   1985 C  CG  . LYS B 2 119 ? 32.658 20.658  -9.443  1.00 50.43 ? 320 LYS B CG  1 
ATOM   1986 C  CD  . LYS B 2 119 ? 32.502 21.873  -10.320 1.00 62.16 ? 320 LYS B CD  1 
ATOM   1987 C  CE  . LYS B 2 119 ? 31.825 21.544  -11.637 1.00 63.01 ? 320 LYS B CE  1 
ATOM   1988 N  NZ  . LYS B 2 119 ? 30.436 21.032  -11.448 1.00 66.54 ? 320 LYS B NZ  1 
ATOM   1989 N  N   . GLU B 2 120 ? 30.653 18.997  -6.911  1.00 39.05 ? 321 GLU B N   1 
ATOM   1990 C  CA  . GLU B 2 120 ? 29.224 18.931  -6.613  1.00 37.93 ? 321 GLU B CA  1 
ATOM   1991 C  C   . GLU B 2 120 ? 29.031 18.923  -5.098  1.00 38.04 ? 321 GLU B C   1 
ATOM   1992 O  O   . GLU B 2 120 ? 27.960 19.269  -4.590  1.00 36.11 ? 321 GLU B O   1 
ATOM   1993 C  CB  . GLU B 2 120 ? 28.585 17.678  -7.207  1.00 43.29 ? 321 GLU B CB  1 
ATOM   1994 C  CG  . GLU B 2 120 ? 28.541 17.638  -8.719  1.00 53.47 ? 321 GLU B CG  1 
ATOM   1995 C  CD  . GLU B 2 120 ? 27.515 16.651  -9.248  1.00 56.66 ? 321 GLU B CD  1 
ATOM   1996 O  OE1 . GLU B 2 120 ? 27.868 15.472  -9.527  1.00 57.93 ? 321 GLU B OE1 1 
ATOM   1997 O  OE2 . GLU B 2 120 ? 26.346 17.073  -9.379  1.00 61.39 ? 321 GLU B OE2 1 
ATOM   1998 N  N   . PHE B 2 121 ? 30.075 18.497  -4.388  1.00 39.05 ? 322 PHE B N   1 
ATOM   1999 C  CA  . PHE B 2 121 ? 30.071 18.434  -2.930  1.00 39.01 ? 322 PHE B CA  1 
ATOM   2000 C  C   . PHE B 2 121 ? 30.583 19.786  -2.421  1.00 38.76 ? 322 PHE B C   1 
ATOM   2001 O  O   . PHE B 2 121 ? 31.694 19.912  -1.910  1.00 38.02 ? 322 PHE B O   1 
ATOM   2002 C  CB  . PHE B 2 121 ? 30.962 17.273  -2.451  1.00 41.36 ? 322 PHE B CB  1 
ATOM   2003 C  CG  . PHE B 2 121 ? 30.618 16.766  -1.074  1.00 41.92 ? 322 PHE B CG  1 
ATOM   2004 C  CD1 . PHE B 2 121 ? 29.337 16.296  -0.784  1.00 40.94 ? 322 PHE B CD1 1 
ATOM   2005 C  CD2 . PHE B 2 121 ? 31.567 16.775  -0.059  1.00 40.76 ? 322 PHE B CD2 1 
ATOM   2006 C  CE1 . PHE B 2 121 ? 29.011 15.850  0.502   1.00 39.70 ? 322 PHE B CE1 1 
ATOM   2007 C  CE2 . PHE B 2 121 ? 31.243 16.329  1.232   1.00 38.20 ? 322 PHE B CE2 1 
ATOM   2008 C  CZ  . PHE B 2 121 ? 29.967 15.868  1.506   1.00 39.10 ? 322 PHE B CZ  1 
ATOM   2009 N  N   . THR B 2 122 ? 29.760 20.808  -2.623  1.00 40.27 ? 323 THR B N   1 
ATOM   2010 C  CA  . THR B 2 122 ? 30.081 22.179  -2.240  1.00 35.51 ? 323 THR B CA  1 
ATOM   2011 C  C   . THR B 2 122 ? 30.245 22.355  -0.745  1.00 31.36 ? 323 THR B C   1 
ATOM   2012 O  O   . THR B 2 122 ? 29.766 21.533  0.046   1.00 29.77 ? 323 THR B O   1 
ATOM   2013 C  CB  . THR B 2 122 ? 28.983 23.150  -2.730  1.00 35.76 ? 323 THR B CB  1 
ATOM   2014 O  OG1 . THR B 2 122 ? 27.714 22.762  -2.190  1.00 40.15 ? 323 THR B OG1 1 
ATOM   2015 C  CG2 . THR B 2 122 ? 28.894 23.122  -4.241  1.00 41.12 ? 323 THR B CG2 1 
ATOM   2016 N  N   . PRO B 2 123 ? 30.905 23.451  -0.332  1.00 32.25 ? 324 PRO B N   1 
ATOM   2017 C  CA  . PRO B 2 123 ? 31.106 23.708  1.093   1.00 33.27 ? 324 PRO B CA  1 
ATOM   2018 C  C   . PRO B 2 123 ? 29.794 23.733  1.877   1.00 35.49 ? 324 PRO B C   1 
ATOM   2019 O  O   . PRO B 2 123 ? 29.689 23.093  2.917   1.00 35.09 ? 324 PRO B O   1 
ATOM   2020 C  CB  . PRO B 2 123 ? 31.787 25.076  1.093   1.00 29.91 ? 324 PRO B CB  1 
ATOM   2021 C  CG  . PRO B 2 123 ? 32.623 25.018  -0.147  1.00 31.57 ? 324 PRO B CG  1 
ATOM   2022 C  CD  . PRO B 2 123 ? 31.631 24.444  -1.146  1.00 29.88 ? 324 PRO B CD  1 
ATOM   2023 N  N   . VAL B 2 124 ? 28.788 24.439  1.362   1.00 37.92 ? 325 VAL B N   1 
ATOM   2024 C  CA  . VAL B 2 124 ? 27.500 24.545  2.042   1.00 35.53 ? 325 VAL B CA  1 
ATOM   2025 C  C   . VAL B 2 124 ? 26.748 23.208  2.127   1.00 34.48 ? 325 VAL B C   1 
ATOM   2026 O  O   . VAL B 2 124 ? 26.034 22.950  3.100   1.00 36.72 ? 325 VAL B O   1 
ATOM   2027 C  CB  . VAL B 2 124 ? 26.623 25.679  1.419   1.00 36.80 ? 325 VAL B CB  1 
ATOM   2028 C  CG1 . VAL B 2 124 ? 26.116 25.292  0.049   1.00 36.21 ? 325 VAL B CG1 1 
ATOM   2029 C  CG2 . VAL B 2 124 ? 25.478 26.024  2.346   1.00 40.65 ? 325 VAL B CG2 1 
ATOM   2030 N  N   . LEU B 2 125 ? 26.979 22.328  1.158   1.00 32.00 ? 326 LEU B N   1 
ATOM   2031 C  CA  . LEU B 2 125 ? 26.332 21.023  1.140   1.00 29.74 ? 326 LEU B CA  1 
ATOM   2032 C  C   . LEU B 2 125 ? 27.038 20.083  2.119   1.00 33.05 ? 326 LEU B C   1 
ATOM   2033 O  O   . LEU B 2 125 ? 26.418 19.204  2.728   1.00 30.22 ? 326 LEU B O   1 
ATOM   2034 C  CB  . LEU B 2 125 ? 26.374 20.453  -0.273  1.00 32.64 ? 326 LEU B CB  1 
ATOM   2035 C  CG  . LEU B 2 125 ? 25.737 19.091  -0.533  1.00 31.69 ? 326 LEU B CG  1 
ATOM   2036 C  CD1 . LEU B 2 125 ? 24.284 19.069  -0.071  1.00 37.92 ? 326 LEU B CD1 1 
ATOM   2037 C  CD2 . LEU B 2 125 ? 25.822 18.808  -2.016  1.00 34.77 ? 326 LEU B CD2 1 
ATOM   2038 N  N   . GLN B 2 126 ? 28.351 20.253  2.244   1.00 33.50 ? 327 GLN B N   1 
ATOM   2039 C  CA  . GLN B 2 126 ? 29.125 19.439  3.166   1.00 33.10 ? 327 GLN B CA  1 
ATOM   2040 C  C   . GLN B 2 126 ? 28.685 19.757  4.594   1.00 31.21 ? 327 GLN B C   1 
ATOM   2041 O  O   . GLN B 2 126 ? 28.564 18.862  5.427   1.00 32.31 ? 327 GLN B O   1 
ATOM   2042 C  CB  . GLN B 2 126 ? 30.630 19.729  3.028   1.00 40.03 ? 327 GLN B CB  1 
ATOM   2043 C  CG  . GLN B 2 126 ? 31.519 18.861  3.960   1.00 40.46 ? 327 GLN B CG  1 
ATOM   2044 C  CD  . GLN B 2 126 ? 32.858 19.490  4.303   1.00 34.39 ? 327 GLN B CD  1 
ATOM   2045 O  OE1 . GLN B 2 126 ? 33.462 20.187  3.497   1.00 37.87 ? 327 GLN B OE1 1 
ATOM   2046 N  NE2 . GLN B 2 126 ? 33.328 19.231  5.504   1.00 37.83 ? 327 GLN B NE2 1 
ATOM   2047 N  N   . ALA B 2 127 ? 28.435 21.040  4.856   1.00 35.03 ? 328 ALA B N   1 
ATOM   2048 C  CA  . ALA B 2 127 ? 28.024 21.537  6.173   1.00 33.12 ? 328 ALA B CA  1 
ATOM   2049 C  C   . ALA B 2 127 ? 26.787 20.832  6.683   1.00 35.82 ? 328 ALA B C   1 
ATOM   2050 O  O   . ALA B 2 127 ? 26.705 20.498  7.865   1.00 38.71 ? 328 ALA B O   1 
ATOM   2051 C  CB  . ALA B 2 127 ? 27.805 23.044  6.132   1.00 29.36 ? 328 ALA B CB  1 
ATOM   2052 N  N   . ASP B 2 128 ? 25.816 20.623  5.799   1.00 37.61 ? 329 ASP B N   1 
ATOM   2053 C  CA  . ASP B 2 128 ? 24.592 19.921  6.173   1.00 37.96 ? 329 ASP B CA  1 
ATOM   2054 C  C   . ASP B 2 128 ? 24.941 18.472  6.502   1.00 36.89 ? 329 ASP B C   1 
ATOM   2055 O  O   . ASP B 2 128 ? 24.492 17.932  7.508   1.00 39.40 ? 329 ASP B O   1 
ATOM   2056 C  CB  . ASP B 2 128 ? 23.563 19.960  5.041   1.00 37.99 ? 329 ASP B CB  1 
ATOM   2057 C  CG  . ASP B 2 128 ? 23.064 21.348  4.751   1.00 38.66 ? 329 ASP B CG  1 
ATOM   2058 O  OD1 . ASP B 2 128 ? 22.614 21.570  3.600   1.00 42.31 ? 329 ASP B OD1 1 
ATOM   2059 O  OD2 . ASP B 2 128 ? 23.119 22.208  5.663   1.00 44.18 ? 329 ASP B OD2 1 
ATOM   2060 N  N   . PHE B 2 129 ? 25.729 17.834  5.647   1.00 35.32 ? 330 PHE B N   1 
ATOM   2061 C  CA  . PHE B 2 129 ? 26.122 16.456  5.899   1.00 32.88 ? 330 PHE B CA  1 
ATOM   2062 C  C   . PHE B 2 129 ? 26.873 16.286  7.191   1.00 31.53 ? 330 PHE B C   1 
ATOM   2063 O  O   . PHE B 2 129 ? 26.756 15.264  7.858   1.00 35.43 ? 330 PHE B O   1 
ATOM   2064 C  CB  . PHE B 2 129 ? 26.956 15.912  4.759   1.00 35.67 ? 330 PHE B CB  1 
ATOM   2065 C  CG  . PHE B 2 129 ? 26.167 15.109  3.816   1.00 32.72 ? 330 PHE B CG  1 
ATOM   2066 C  CD1 . PHE B 2 129 ? 25.886 13.784  4.103   1.00 35.59 ? 330 PHE B CD1 1 
ATOM   2067 C  CD2 . PHE B 2 129 ? 25.635 15.692  2.673   1.00 36.04 ? 330 PHE B CD2 1 
ATOM   2068 C  CE1 . PHE B 2 129 ? 25.077 13.048  3.275   1.00 37.51 ? 330 PHE B CE1 1 
ATOM   2069 C  CE2 . PHE B 2 129 ? 24.819 14.970  1.827   1.00 36.60 ? 330 PHE B CE2 1 
ATOM   2070 C  CZ  . PHE B 2 129 ? 24.538 13.643  2.124   1.00 42.20 ? 330 PHE B CZ  1 
ATOM   2071 N  N   . GLN B 2 130 ? 27.667 17.282  7.535   1.00 31.26 ? 331 GLN B N   1 
ATOM   2072 C  CA  . GLN B 2 130 ? 28.425 17.225  8.759   1.00 33.72 ? 331 GLN B CA  1 
ATOM   2073 C  C   . GLN B 2 130 ? 27.437 17.191  9.946   1.00 34.76 ? 331 GLN B C   1 
ATOM   2074 O  O   . GLN B 2 130 ? 27.738 16.621  10.996  1.00 38.13 ? 331 GLN B O   1 
ATOM   2075 C  CB  . GLN B 2 130 ? 29.411 18.404  8.806   1.00 32.91 ? 331 GLN B CB  1 
ATOM   2076 C  CG  . GLN B 2 130 ? 30.779 18.100  9.461   1.00 38.66 ? 331 GLN B CG  1 
ATOM   2077 C  CD  . GLN B 2 130 ? 31.637 17.072  8.718   1.00 26.74 ? 331 GLN B CD  1 
ATOM   2078 O  OE1 . GLN B 2 130 ? 32.053 17.294  7.581   1.00 24.46 ? 331 GLN B OE1 1 
ATOM   2079 N  NE2 . GLN B 2 130 ? 31.947 15.968  9.388   1.00 29.71 ? 331 GLN B NE2 1 
ATOM   2080 N  N   . LYS B 2 131 ? 26.234 17.729  9.751   1.00 35.35 ? 332 LYS B N   1 
ATOM   2081 C  CA  . LYS B 2 131 ? 25.206 17.713  10.799  1.00 37.02 ? 332 LYS B CA  1 
ATOM   2082 C  C   . LYS B 2 131 ? 24.543 16.322  10.935  1.00 35.53 ? 332 LYS B C   1 
ATOM   2083 O  O   . LYS B 2 131 ? 24.234 15.882  12.051  1.00 32.97 ? 332 LYS B O   1 
ATOM   2084 C  CB  . LYS B 2 131 ? 24.120 18.772  10.527  1.00 37.30 ? 332 LYS B CB  1 
ATOM   2085 C  CG  . LYS B 2 131 ? 24.601 20.219  10.527  1.00 39.71 ? 332 LYS B CG  1 
ATOM   2086 C  CD  . LYS B 2 131 ? 23.506 21.198  10.034  1.00 42.62 ? 332 LYS B CD  1 
ATOM   2087 C  CE  . LYS B 2 131 ? 24.129 22.502  9.490   1.00 47.80 ? 332 LYS B CE  1 
ATOM   2088 N  NZ  . LYS B 2 131 ? 23.211 23.308  8.616   1.00 49.23 ? 332 LYS B NZ  1 
ATOM   2089 N  N   . VAL B 2 132 ? 24.319 15.631  9.816   1.00 34.93 ? 333 VAL B N   1 
ATOM   2090 C  CA  . VAL B 2 132 ? 23.675 14.317  9.872   1.00 34.62 ? 333 VAL B CA  1 
ATOM   2091 C  C   . VAL B 2 132 ? 24.664 13.309  10.424  1.00 32.79 ? 333 VAL B C   1 
ATOM   2092 O  O   . VAL B 2 132 ? 24.296 12.389  11.146  1.00 35.15 ? 333 VAL B O   1 
ATOM   2093 C  CB  . VAL B 2 132 ? 23.051 13.854  8.501   1.00 31.68 ? 333 VAL B CB  1 
ATOM   2094 C  CG1 . VAL B 2 132 ? 22.698 15.035  7.621   1.00 31.64 ? 333 VAL B CG1 1 
ATOM   2095 C  CG2 . VAL B 2 132 ? 23.929 12.884  7.788   1.00 37.91 ? 333 VAL B CG2 1 
ATOM   2096 N  N   . VAL B 2 133 ? 25.936 13.537  10.136  1.00 31.37 ? 334 VAL B N   1 
ATOM   2097 C  CA  . VAL B 2 133 ? 26.999 12.669  10.620  1.00 32.43 ? 334 VAL B CA  1 
ATOM   2098 C  C   . VAL B 2 133 ? 27.106 12.715  12.143  1.00 30.93 ? 334 VAL B C   1 
ATOM   2099 O  O   . VAL B 2 133 ? 27.224 11.678  12.783  1.00 33.44 ? 334 VAL B O   1 
ATOM   2100 C  CB  . VAL B 2 133 ? 28.344 13.052  9.973   1.00 35.02 ? 334 VAL B CB  1 
ATOM   2101 C  CG1 . VAL B 2 133 ? 29.502 12.530  10.778  1.00 35.52 ? 334 VAL B CG1 1 
ATOM   2102 C  CG2 . VAL B 2 133 ? 28.394 12.504  8.565   1.00 37.47 ? 334 VAL B CG2 1 
ATOM   2103 N  N   . ALA B 2 134 ? 27.069 13.910  12.723  1.00 34.90 ? 335 ALA B N   1 
ATOM   2104 C  CA  . ALA B 2 134 ? 27.146 14.053  14.176  1.00 32.51 ? 335 ALA B CA  1 
ATOM   2105 C  C   . ALA B 2 134 ? 25.871 13.503  14.779  1.00 30.58 ? 335 ALA B C   1 
ATOM   2106 O  O   . ALA B 2 134 ? 25.889 12.906  15.850  1.00 35.95 ? 335 ALA B O   1 
ATOM   2107 C  CB  . ALA B 2 134 ? 27.338 15.506  14.571  1.00 34.93 ? 335 ALA B CB  1 
ATOM   2108 N  N   . GLY B 2 135 ? 24.765 13.693  14.070  1.00 32.60 ? 336 GLY B N   1 
ATOM   2109 C  CA  . GLY B 2 135 ? 23.493 13.178  14.527  1.00 32.28 ? 336 GLY B CA  1 
ATOM   2110 C  C   . GLY B 2 135 ? 23.587 11.674  14.659  1.00 31.37 ? 336 GLY B C   1 
ATOM   2111 O  O   . GLY B 2 135 ? 23.354 11.134  15.740  1.00 35.79 ? 336 GLY B O   1 
ATOM   2112 N  N   . VAL B 2 136 ? 23.959 11.002  13.573  1.00 29.93 ? 337 VAL B N   1 
ATOM   2113 C  CA  . VAL B 2 136 ? 24.090 9.548   13.582  1.00 31.18 ? 337 VAL B CA  1 
ATOM   2114 C  C   . VAL B 2 136 ? 25.068 9.103   14.655  1.00 31.47 ? 337 VAL B C   1 
ATOM   2115 O  O   . VAL B 2 136 ? 24.816 8.130   15.361  1.00 32.40 ? 337 VAL B O   1 
ATOM   2116 C  CB  . VAL B 2 136 ? 24.564 8.997   12.227  1.00 29.34 ? 337 VAL B CB  1 
ATOM   2117 C  CG1 . VAL B 2 136 ? 24.726 7.482   12.303  1.00 30.44 ? 337 VAL B CG1 1 
ATOM   2118 C  CG2 . VAL B 2 136 ? 23.577 9.364   11.142  1.00 28.21 ? 337 VAL B CG2 1 
ATOM   2119 N  N   . ALA B 2 137 ? 26.199 9.789   14.752  1.00 32.98 ? 338 ALA B N   1 
ATOM   2120 C  CA  . ALA B 2 137 ? 27.199 9.451   15.762  1.00 35.60 ? 338 ALA B CA  1 
ATOM   2121 C  C   . ALA B 2 137 ? 26.633 9.580   17.176  1.00 36.39 ? 338 ALA B C   1 
ATOM   2122 O  O   . ALA B 2 137 ? 26.843 8.700   18.006  1.00 35.24 ? 338 ALA B O   1 
ATOM   2123 C  CB  . ALA B 2 137 ? 28.443 10.329  15.603  1.00 34.01 ? 338 ALA B CB  1 
ATOM   2124 N  N   . ASN B 2 138 ? 25.897 10.662  17.440  1.00 36.08 ? 339 ASN B N   1 
ATOM   2125 C  CA  . ASN B 2 138 ? 25.314 10.876  18.753  1.00 37.98 ? 339 ASN B CA  1 
ATOM   2126 C  C   . ASN B 2 138 ? 24.250 9.877   19.116  1.00 38.63 ? 339 ASN B C   1 
ATOM   2127 O  O   . ASN B 2 138 ? 24.234 9.373   20.237  1.00 39.21 ? 339 ASN B O   1 
ATOM   2128 C  CB  . ASN B 2 138 ? 24.814 12.300  18.908  1.00 41.96 ? 339 ASN B CB  1 
ATOM   2129 C  CG  . ASN B 2 138 ? 25.938 13.259  19.268  1.00 48.73 ? 339 ASN B CG  1 
ATOM   2130 O  OD1 . ASN B 2 138 ? 25.894 14.440  18.923  1.00 52.67 ? 339 ASN B OD1 1 
ATOM   2131 N  ND2 . ASN B 2 138 ? 26.958 12.755  19.978  1.00 51.34 ? 339 ASN B ND2 1 
ATOM   2132 N  N   . ALA B 2 139 ? 23.369 9.570   18.170  1.00 39.35 ? 340 ALA B N   1 
ATOM   2133 C  CA  . ALA B 2 139 ? 22.316 8.581   18.394  1.00 41.29 ? 340 ALA B CA  1 
ATOM   2134 C  C   . ALA B 2 139 ? 22.963 7.208   18.665  1.00 41.50 ? 340 ALA B C   1 
ATOM   2135 O  O   . ALA B 2 139 ? 22.605 6.503   19.613  1.00 42.35 ? 340 ALA B O   1 
ATOM   2136 C  CB  . ALA B 2 139 ? 21.404 8.514   17.182  1.00 39.06 ? 340 ALA B CB  1 
ATOM   2137 N  N   . LEU B 2 140 ? 23.925 6.840   17.822  1.00 42.50 ? 341 LEU B N   1 
ATOM   2138 C  CA  . LEU B 2 140 ? 24.649 5.586   17.968  1.00 36.34 ? 341 LEU B CA  1 
ATOM   2139 C  C   . LEU B 2 140 ? 25.287 5.527   19.342  1.00 36.45 ? 341 LEU B C   1 
ATOM   2140 O  O   . LEU B 2 140 ? 25.454 4.452   19.901  1.00 38.46 ? 341 LEU B O   1 
ATOM   2141 C  CB  . LEU B 2 140 ? 25.748 5.482   16.914  1.00 35.45 ? 341 LEU B CB  1 
ATOM   2142 C  CG  . LEU B 2 140 ? 25.572 4.406   15.852  1.00 35.64 ? 341 LEU B CG  1 
ATOM   2143 C  CD1 . LEU B 2 140 ? 25.466 3.060   16.497  1.00 36.97 ? 341 LEU B CD1 1 
ATOM   2144 C  CD2 . LEU B 2 140 ? 24.323 4.682   15.067  1.00 45.23 ? 341 LEU B CD2 1 
ATOM   2145 N  N   . ALA B 2 141 ? 25.615 6.684   19.901  1.00 37.00 ? 342 ALA B N   1 
ATOM   2146 C  CA  . ALA B 2 141 ? 26.255 6.721   21.205  1.00 38.62 ? 342 ALA B CA  1 
ATOM   2147 C  C   . ALA B 2 141 ? 25.350 6.864   22.436  1.00 41.96 ? 342 ALA B C   1 
ATOM   2148 O  O   . ALA B 2 141 ? 25.826 6.641   23.550  1.00 43.22 ? 342 ALA B O   1 
ATOM   2149 C  CB  . ALA B 2 141 ? 27.347 7.797   21.222  1.00 30.31 ? 342 ALA B CB  1 
ATOM   2150 N  N   . HIS B 2 142 ? 24.058 7.169   22.258  1.00 45.58 ? 343 HIS B N   1 
ATOM   2151 C  CA  . HIS B 2 142 ? 23.143 7.375   23.405  1.00 51.89 ? 343 HIS B CA  1 
ATOM   2152 C  C   . HIS B 2 142 ? 22.960 6.217   24.420  1.00 52.56 ? 343 HIS B C   1 
ATOM   2153 O  O   . HIS B 2 142 ? 22.538 6.440   25.554  1.00 53.42 ? 343 HIS B O   1 
ATOM   2154 C  CB  . HIS B 2 142 ? 21.779 7.935   22.938  1.00 55.79 ? 343 HIS B CB  1 
ATOM   2155 C  CG  . HIS B 2 142 ? 20.699 6.901   22.811  1.00 60.91 ? 343 HIS B CG  1 
ATOM   2156 N  ND1 . HIS B 2 142 ? 19.610 6.855   23.658  1.00 63.47 ? 343 HIS B ND1 1 
ATOM   2157 C  CD2 . HIS B 2 142 ? 20.549 5.862   21.954  1.00 65.49 ? 343 HIS B CD2 1 
ATOM   2158 C  CE1 . HIS B 2 142 ? 18.842 5.829   23.333  1.00 63.27 ? 343 HIS B CE1 1 
ATOM   2159 N  NE2 . HIS B 2 142 ? 19.389 5.210   22.302  1.00 66.39 ? 343 HIS B NE2 1 
ATOM   2160 N  N   . ARG B 2 143 ? 23.289 4.989   24.023  1.00 53.60 ? 344 ARG B N   1 
ATOM   2161 C  CA  . ARG B 2 143 ? 23.189 3.820   24.906  1.00 52.85 ? 344 ARG B CA  1 
ATOM   2162 C  C   . ARG B 2 143 ? 24.445 3.761   25.811  1.00 52.30 ? 344 ARG B C   1 
ATOM   2163 O  O   . ARG B 2 143 ? 24.687 2.766   26.501  1.00 50.95 ? 344 ARG B O   1 
ATOM   2164 C  CB  . ARG B 2 143 ? 23.092 2.554   24.044  1.00 54.89 ? 344 ARG B CB  1 
ATOM   2165 C  CG  . ARG B 2 143 ? 22.851 1.240   24.768  1.00 62.17 ? 344 ARG B CG  1 
ATOM   2166 C  CD  . ARG B 2 143 ? 21.383 1.042   25.131  1.00 66.85 ? 344 ARG B CD  1 
ATOM   2167 N  NE  . ARG B 2 143 ? 21.102 -0.292  25.673  1.00 69.48 ? 344 ARG B NE  1 
ATOM   2168 C  CZ  . ARG B 2 143 ? 21.437 -0.708  26.895  1.00 69.42 ? 344 ARG B CZ  1 
ATOM   2169 N  NH1 . ARG B 2 143 ? 22.085 0.099   27.738  1.00 67.40 ? 344 ARG B NH1 1 
ATOM   2170 N  NH2 . ARG B 2 143 ? 21.094 -1.930  27.287  1.00 70.35 ? 344 ARG B NH2 1 
ATOM   2171 N  N   . TYR B 2 144 ? 25.244 4.831   25.777  1.00 54.35 ? 345 TYR B N   1 
ATOM   2172 C  CA  . TYR B 2 144 ? 26.484 4.968   26.561  1.00 59.19 ? 345 TYR B CA  1 
ATOM   2173 C  C   . TYR B 2 144 ? 26.416 6.194   27.472  1.00 62.58 ? 345 TYR B C   1 
ATOM   2174 O  O   . TYR B 2 144 ? 27.245 6.355   28.386  1.00 61.10 ? 345 TYR B O   1 
ATOM   2175 C  CB  . TYR B 2 144 ? 27.699 5.134   25.629  1.00 57.27 ? 345 TYR B CB  1 
ATOM   2176 C  CG  . TYR B 2 144 ? 28.663 3.968   25.644  1.00 60.26 ? 345 TYR B CG  1 
ATOM   2177 C  CD1 . TYR B 2 144 ? 28.771 3.134   26.773  1.00 60.71 ? 345 TYR B CD1 1 
ATOM   2178 C  CD2 . TYR B 2 144 ? 29.451 3.679   24.526  1.00 55.89 ? 345 TYR B CD2 1 
ATOM   2179 C  CE1 . TYR B 2 144 ? 29.630 2.041   26.784  1.00 60.04 ? 345 TYR B CE1 1 
ATOM   2180 C  CE2 . TYR B 2 144 ? 30.320 2.590   24.527  1.00 58.37 ? 345 TYR B CE2 1 
ATOM   2181 C  CZ  . TYR B 2 144 ? 30.402 1.774   25.659  1.00 62.49 ? 345 TYR B CZ  1 
ATOM   2182 O  OH  . TYR B 2 144 ? 31.250 0.684   25.651  1.00 68.78 ? 345 TYR B OH  1 
ATOM   2183 N  N   . HIS B 2 145 ? 25.494 7.100   27.133  1.00 65.31 ? 346 HIS B N   1 
ATOM   2184 C  CA  . HIS B 2 145 ? 25.263 8.336   27.876  1.00 67.53 ? 346 HIS B CA  1 
ATOM   2185 C  C   . HIS B 2 145 ? 24.005 9.059   27.377  1.00 69.78 ? 346 HIS B C   1 
ATOM   2186 O  O   . HIS B 2 145 ? 23.829 9.195   26.137  1.00 71.72 ? 346 HIS B O   1 
ATOM   2187 C  CB  . HIS B 2 145 ? 26.520 9.264   27.902  1.00 66.14 ? 346 HIS B CB  1 
ATOM   2188 C  CG  . HIS B 2 145 ? 26.886 9.914   26.588  1.00 63.67 ? 346 HIS B CG  1 
ATOM   2189 N  ND1 . HIS B 2 145 ? 26.030 10.769  25.922  1.00 60.69 ? 346 HIS B ND1 1 
ATOM   2190 C  CD2 . HIS B 2 145 ? 27.952 9.741   25.765  1.00 63.33 ? 346 HIS B CD2 1 
ATOM   2191 C  CE1 . HIS B 2 145 ? 26.548 11.088  24.747  1.00 62.32 ? 346 HIS B CE1 1 
ATOM   2192 N  NE2 . HIS B 2 145 ? 27.715 10.479  24.627  1.00 61.29 ? 346 HIS B NE2 1 
ATOM   2193 O  OXT . HIS B 2 145 ? 23.180 9.426   28.247  1.00 74.44 ? 346 HIS B OXT 1 
ATOM   2194 N  N   . VAL C 1 1   ? 59.633 15.383  23.434  1.00 63.04 ? 401 VAL C N   1 
ATOM   2195 C  CA  . VAL C 1 1   ? 60.658 15.932  24.376  1.00 62.27 ? 401 VAL C CA  1 
ATOM   2196 C  C   . VAL C 1 1   ? 59.965 16.938  25.312  1.00 59.46 ? 401 VAL C C   1 
ATOM   2197 O  O   . VAL C 1 1   ? 59.071 17.679  24.893  1.00 60.49 ? 401 VAL C O   1 
ATOM   2198 C  CB  . VAL C 1 1   ? 61.884 16.587  23.601  1.00 63.49 ? 401 VAL C CB  1 
ATOM   2199 C  CG1 . VAL C 1 1   ? 61.591 18.039  23.193  1.00 60.99 ? 401 VAL C CG1 1 
ATOM   2200 C  CG2 . VAL C 1 1   ? 63.177 16.487  24.430  1.00 65.28 ? 401 VAL C CG2 1 
ATOM   2201 N  N   . LEU C 1 2   ? 60.311 16.879  26.592  1.00 54.81 ? 402 LEU C N   1 
ATOM   2202 C  CA  . LEU C 1 2   ? 59.742 17.774  27.583  1.00 49.85 ? 402 LEU C CA  1 
ATOM   2203 C  C   . LEU C 1 2   ? 60.799 18.848  27.802  1.00 48.42 ? 402 LEU C C   1 
ATOM   2204 O  O   . LEU C 1 2   ? 61.958 18.654  27.419  1.00 52.43 ? 402 LEU C O   1 
ATOM   2205 C  CB  . LEU C 1 2   ? 59.521 17.034  28.909  1.00 48.40 ? 402 LEU C CB  1 
ATOM   2206 C  CG  . LEU C 1 2   ? 58.640 15.790  29.081  1.00 47.11 ? 402 LEU C CG  1 
ATOM   2207 C  CD1 . LEU C 1 2   ? 59.260 14.601  28.363  1.00 51.49 ? 402 LEU C CD1 1 
ATOM   2208 C  CD2 . LEU C 1 2   ? 58.515 15.475  30.572  1.00 48.55 ? 402 LEU C CD2 1 
ATOM   2209 N  N   . SER C 1 3   ? 60.407 19.970  28.404  1.00 45.90 ? 403 SER C N   1 
ATOM   2210 C  CA  . SER C 1 3   ? 61.345 21.047  28.696  1.00 43.02 ? 403 SER C CA  1 
ATOM   2211 C  C   . SER C 1 3   ? 62.217 20.546  29.857  1.00 42.36 ? 403 SER C C   1 
ATOM   2212 O  O   . SER C 1 3   ? 61.842 19.591  30.543  1.00 39.67 ? 403 SER C O   1 
ATOM   2213 C  CB  . SER C 1 3   ? 60.583 22.292  29.129  1.00 40.42 ? 403 SER C CB  1 
ATOM   2214 O  OG  . SER C 1 3   ? 60.201 22.188  30.493  1.00 43.42 ? 403 SER C OG  1 
ATOM   2215 N  N   . ALA C 1 4   ? 63.379 21.159  30.070  1.00 41.47 ? 404 ALA C N   1 
ATOM   2216 C  CA  . ALA C 1 4   ? 64.254 20.735  31.169  1.00 38.79 ? 404 ALA C CA  1 
ATOM   2217 C  C   . ALA C 1 4   ? 63.575 20.889  32.532  1.00 35.91 ? 404 ALA C C   1 
ATOM   2218 O  O   . ALA C 1 4   ? 63.841 20.104  33.449  1.00 31.82 ? 404 ALA C O   1 
ATOM   2219 C  CB  . ALA C 1 4   ? 65.579 21.500  31.136  1.00 46.43 ? 404 ALA C CB  1 
ATOM   2220 N  N   . ALA C 1 5   ? 62.713 21.902  32.664  1.00 35.16 ? 405 ALA C N   1 
ATOM   2221 C  CA  . ALA C 1 5   ? 61.977 22.119  33.914  1.00 36.62 ? 405 ALA C CA  1 
ATOM   2222 C  C   . ALA C 1 5   ? 61.021 20.932  34.134  1.00 37.12 ? 405 ALA C C   1 
ATOM   2223 O  O   . ALA C 1 5   ? 60.981 20.345  35.231  1.00 36.04 ? 405 ALA C O   1 
ATOM   2224 C  CB  . ALA C 1 5   ? 61.209 23.443  33.870  1.00 37.01 ? 405 ALA C CB  1 
ATOM   2225 N  N   . ASP C 1 6   ? 60.300 20.559  33.072  1.00 33.53 ? 406 ASP C N   1 
ATOM   2226 C  CA  . ASP C 1 6   ? 59.371 19.426  33.114  1.00 33.64 ? 406 ASP C CA  1 
ATOM   2227 C  C   . ASP C 1 6   ? 60.103 18.149  33.496  1.00 33.08 ? 406 ASP C C   1 
ATOM   2228 O  O   . ASP C 1 6   ? 59.685 17.445  34.416  1.00 33.83 ? 406 ASP C O   1 
ATOM   2229 C  CB  . ASP C 1 6   ? 58.686 19.216  31.761  1.00 29.50 ? 406 ASP C CB  1 
ATOM   2230 C  CG  . ASP C 1 6   ? 57.614 20.252  31.476  1.00 29.48 ? 406 ASP C CG  1 
ATOM   2231 O  OD1 . ASP C 1 6   ? 57.397 20.567  30.281  1.00 31.07 ? 406 ASP C OD1 1 
ATOM   2232 O  OD2 . ASP C 1 6   ? 56.983 20.745  32.439  1.00 29.55 ? 406 ASP C OD2 1 
ATOM   2233 N  N   . LYS C 1 7   ? 61.216 17.870  32.817  1.00 35.20 ? 407 LYS C N   1 
ATOM   2234 C  CA  . LYS C 1 7   ? 62.001 16.672  33.100  1.00 31.81 ? 407 LYS C CA  1 
ATOM   2235 C  C   . LYS C 1 7   ? 62.364 16.686  34.569  1.00 30.57 ? 407 LYS C C   1 
ATOM   2236 O  O   . LYS C 1 7   ? 62.213 15.678  35.247  1.00 32.09 ? 407 LYS C O   1 
ATOM   2237 C  CB  . LYS C 1 7   ? 63.272 16.629  32.256  1.00 33.55 ? 407 LYS C CB  1 
ATOM   2238 C  CG  . LYS C 1 7   ? 63.072 16.727  30.750  1.00 36.56 ? 407 LYS C CG  1 
ATOM   2239 C  CD  . LYS C 1 7   ? 64.404 16.468  30.047  1.00 44.40 ? 407 LYS C CD  1 
ATOM   2240 C  CE  . LYS C 1 7   ? 64.439 16.983  28.617  1.00 48.27 ? 407 LYS C CE  1 
ATOM   2241 N  NZ  . LYS C 1 7   ? 63.506 16.256  27.719  1.00 53.48 ? 407 LYS C NZ  1 
ATOM   2242 N  N   . GLY C 1 8   ? 62.746 17.859  35.076  1.00 34.15 ? 408 GLY C N   1 
ATOM   2243 C  CA  . GLY C 1 8   ? 63.112 17.995  36.480  1.00 33.96 ? 408 GLY C CA  1 
ATOM   2244 C  C   . GLY C 1 8   ? 61.984 17.604  37.428  1.00 36.39 ? 408 GLY C C   1 
ATOM   2245 O  O   . GLY C 1 8   ? 62.193 16.876  38.406  1.00 37.39 ? 408 GLY C O   1 
ATOM   2246 N  N   . ASN C 1 9   ? 60.768 18.042  37.114  1.00 35.05 ? 409 ASN C N   1 
ATOM   2247 C  CA  . ASN C 1 9   ? 59.597 17.739  37.946  1.00 35.85 ? 409 ASN C CA  1 
ATOM   2248 C  C   . ASN C 1 9   ? 59.205 16.261  37.929  1.00 32.31 ? 409 ASN C C   1 
ATOM   2249 O  O   . ASN C 1 9   ? 58.871 15.698  38.971  1.00 33.14 ? 409 ASN C O   1 
ATOM   2250 C  CB  . ASN C 1 9   ? 58.392 18.623  37.555  1.00 37.69 ? 409 ASN C CB  1 
ATOM   2251 C  CG  . ASN C 1 9   ? 58.540 20.072  38.020  1.00 30.87 ? 409 ASN C CG  1 
ATOM   2252 O  OD1 . ASN C 1 9   ? 58.180 21.003  37.311  1.00 33.22 ? 409 ASN C OD1 1 
ATOM   2253 N  ND2 . ASN C 1 9   ? 59.061 20.258  39.220  1.00 35.58 ? 409 ASN C ND2 1 
ATOM   2254 N  N   . VAL C 1 10  ? 59.239 15.642  36.750  1.00 34.85 ? 410 VAL C N   1 
ATOM   2255 C  CA  . VAL C 1 10  ? 58.911 14.213  36.595  1.00 33.95 ? 410 VAL C CA  1 
ATOM   2256 C  C   . VAL C 1 10  ? 59.856 13.370  37.446  1.00 34.40 ? 410 VAL C C   1 
ATOM   2257 O  O   . VAL C 1 10  ? 59.417 12.502  38.197  1.00 32.86 ? 410 VAL C O   1 
ATOM   2258 C  CB  . VAL C 1 10  ? 59.047 13.746  35.110  1.00 28.80 ? 410 VAL C CB  1 
ATOM   2259 C  CG1 . VAL C 1 10  ? 58.894 12.241  34.996  1.00 28.81 ? 410 VAL C CG1 1 
ATOM   2260 C  CG2 . VAL C 1 10  ? 58.021 14.441  34.243  1.00 26.49 ? 410 VAL C CG2 1 
ATOM   2261 N  N   . LYS C 1 11  ? 61.154 13.654  37.328  1.00 37.98 ? 411 LYS C N   1 
ATOM   2262 C  CA  . LYS C 1 11  ? 62.179 12.933  38.075  1.00 39.73 ? 411 LYS C CA  1 
ATOM   2263 C  C   . LYS C 1 11  ? 62.058 13.161  39.562  1.00 37.87 ? 411 LYS C C   1 
ATOM   2264 O  O   . LYS C 1 11  ? 62.273 12.242  40.350  1.00 39.21 ? 411 LYS C O   1 
ATOM   2265 C  CB  . LYS C 1 11  ? 63.586 13.286  37.579  1.00 42.41 ? 411 LYS C CB  1 
ATOM   2266 C  CG  . LYS C 1 11  ? 64.000 12.525  36.314  1.00 47.43 ? 411 LYS C CG  1 
ATOM   2267 C  CD  . LYS C 1 11  ? 65.258 13.095  35.653  1.00 52.19 ? 411 LYS C CD  1 
ATOM   2268 C  CE  . LYS C 1 11  ? 64.996 14.467  35.035  1.00 58.02 ? 411 LYS C CE  1 
ATOM   2269 N  NZ  . LYS C 1 11  ? 66.199 15.103  34.426  1.00 58.46 ? 411 LYS C NZ  1 
ATOM   2270 N  N   . ALA C 1 12  ? 61.713 14.378  39.959  1.00 38.07 ? 412 ALA C N   1 
ATOM   2271 C  CA  . ALA C 1 12  ? 61.550 14.657  41.381  1.00 38.48 ? 412 ALA C CA  1 
ATOM   2272 C  C   . ALA C 1 12  ? 60.347 13.842  41.905  1.00 40.22 ? 412 ALA C C   1 
ATOM   2273 O  O   . ALA C 1 12  ? 60.449 13.140  42.925  1.00 39.45 ? 412 ALA C O   1 
ATOM   2274 C  CB  . ALA C 1 12  ? 61.339 16.155  41.608  1.00 35.81 ? 412 ALA C CB  1 
ATOM   2275 N  N   . ALA C 1 13  ? 59.249 13.864  41.144  1.00 39.76 ? 413 ALA C N   1 
ATOM   2276 C  CA  . ALA C 1 13  ? 58.007 13.166  41.496  1.00 36.09 ? 413 ALA C CA  1 
ATOM   2277 C  C   . ALA C 1 13  ? 58.172 11.646  41.577  1.00 35.03 ? 413 ALA C C   1 
ATOM   2278 O  O   . ALA C 1 13  ? 57.783 11.014  42.564  1.00 31.81 ? 413 ALA C O   1 
ATOM   2279 C  CB  . ALA C 1 13  ? 56.918 13.526  40.498  1.00 34.35 ? 413 ALA C CB  1 
ATOM   2280 N  N   . TRP C 1 14  ? 58.796 11.065  40.561  1.00 37.76 ? 414 TRP C N   1 
ATOM   2281 C  CA  . TRP C 1 14  ? 59.006 9.624   40.543  1.00 39.39 ? 414 TRP C CA  1 
ATOM   2282 C  C   . TRP C 1 14  ? 59.949 9.166   41.669  1.00 42.28 ? 414 TRP C C   1 
ATOM   2283 O  O   . TRP C 1 14  ? 59.893 8.009   42.103  1.00 47.65 ? 414 TRP C O   1 
ATOM   2284 C  CB  . TRP C 1 14  ? 59.525 9.182   39.172  1.00 35.41 ? 414 TRP C CB  1 
ATOM   2285 C  CG  . TRP C 1 14  ? 59.087 7.804   38.807  1.00 39.76 ? 414 TRP C CG  1 
ATOM   2286 C  CD1 . TRP C 1 14  ? 59.868 6.693   38.720  1.00 39.35 ? 414 TRP C CD1 1 
ATOM   2287 C  CD2 . TRP C 1 14  ? 57.742 7.370   38.537  1.00 43.60 ? 414 TRP C CD2 1 
ATOM   2288 N  NE1 . TRP C 1 14  ? 59.099 5.591   38.426  1.00 38.67 ? 414 TRP C NE1 1 
ATOM   2289 C  CE2 . TRP C 1 14  ? 57.791 5.975   38.308  1.00 43.60 ? 414 TRP C CE2 1 
ATOM   2290 C  CE3 . TRP C 1 14  ? 56.501 8.024   38.469  1.00 41.60 ? 414 TRP C CE3 1 
ATOM   2291 C  CZ2 . TRP C 1 14  ? 56.643 5.215   38.018  1.00 41.99 ? 414 TRP C CZ2 1 
ATOM   2292 C  CZ3 . TRP C 1 14  ? 55.361 7.271   38.180  1.00 43.54 ? 414 TRP C CZ3 1 
ATOM   2293 C  CH2 . TRP C 1 14  ? 55.445 5.877   37.960  1.00 42.03 ? 414 TRP C CH2 1 
ATOM   2294 N  N   . GLY C 1 15  ? 60.757 10.092  42.188  1.00 43.04 ? 415 GLY C N   1 
ATOM   2295 C  CA  . GLY C 1 15  ? 61.687 9.770   43.257  1.00 40.59 ? 415 GLY C CA  1 
ATOM   2296 C  C   . GLY C 1 15  ? 60.949 9.563   44.560  1.00 42.14 ? 415 GLY C C   1 
ATOM   2297 O  O   . GLY C 1 15  ? 61.288 8.678   45.348  1.00 44.06 ? 415 GLY C O   1 
ATOM   2298 N  N   . LYS C 1 16  ? 59.929 10.388  44.776  1.00 40.12 ? 416 LYS C N   1 
ATOM   2299 C  CA  . LYS C 1 16  ? 59.098 10.314  45.971  1.00 38.90 ? 416 LYS C CA  1 
ATOM   2300 C  C   . LYS C 1 16  ? 58.256 9.035   45.930  1.00 39.27 ? 416 LYS C C   1 
ATOM   2301 O  O   . LYS C 1 16  ? 57.837 8.521   46.973  1.00 43.76 ? 416 LYS C O   1 
ATOM   2302 C  CB  . LYS C 1 16  ? 58.175 11.537  46.045  1.00 42.94 ? 416 LYS C CB  1 
ATOM   2303 C  CG  . LYS C 1 16  ? 58.851 12.863  46.396  1.00 49.71 ? 416 LYS C CG  1 
ATOM   2304 C  CD  . LYS C 1 16  ? 59.083 12.994  47.910  1.00 53.69 ? 416 LYS C CD  1 
ATOM   2305 C  CE  . LYS C 1 16  ? 59.723 14.336  48.271  1.00 54.02 ? 416 LYS C CE  1 
ATOM   2306 N  NZ  . LYS C 1 16  ? 59.775 14.565  49.750  1.00 54.67 ? 416 LYS C NZ  1 
ATOM   2307 N  N   . VAL C 1 17  ? 57.938 8.565   44.722  1.00 39.43 ? 417 VAL C N   1 
ATOM   2308 C  CA  . VAL C 1 17  ? 57.158 7.331   44.563  1.00 40.81 ? 417 VAL C CA  1 
ATOM   2309 C  C   . VAL C 1 17  ? 58.036 6.218   45.146  1.00 41.82 ? 417 VAL C C   1 
ATOM   2310 O  O   . VAL C 1 17  ? 57.593 5.429   45.993  1.00 39.53 ? 417 VAL C O   1 
ATOM   2311 C  CB  . VAL C 1 17  ? 56.824 7.043   43.056  1.00 39.66 ? 417 VAL C CB  1 
ATOM   2312 C  CG1 . VAL C 1 17  ? 56.121 5.718   42.906  1.00 38.83 ? 417 VAL C CG1 1 
ATOM   2313 C  CG2 . VAL C 1 17  ? 55.943 8.146   42.476  1.00 38.08 ? 417 VAL C CG2 1 
ATOM   2314 N  N   . GLY C 1 18  ? 59.288 6.187   44.685  1.00 45.66 ? 418 GLY C N   1 
ATOM   2315 C  CA  . GLY C 1 18  ? 60.270 5.232   45.160  1.00 45.26 ? 418 GLY C CA  1 
ATOM   2316 C  C   . GLY C 1 18  ? 59.849 3.781   45.153  1.00 47.15 ? 418 GLY C C   1 
ATOM   2317 O  O   . GLY C 1 18  ? 59.487 3.236   44.106  1.00 48.41 ? 418 GLY C O   1 
ATOM   2318 N  N   . GLY C 1 19  ? 59.878 3.156   46.328  1.00 46.44 ? 419 GLY C N   1 
ATOM   2319 C  CA  . GLY C 1 19  ? 59.522 1.752   46.439  1.00 47.35 ? 419 GLY C CA  1 
ATOM   2320 C  C   . GLY C 1 19  ? 58.034 1.511   46.568  1.00 49.58 ? 419 GLY C C   1 
ATOM   2321 O  O   . GLY C 1 19  ? 57.604 0.628   47.320  1.00 51.99 ? 419 GLY C O   1 
ATOM   2322 N  N   . HIS C 1 20  ? 57.243 2.350   45.906  1.00 47.00 ? 420 HIS C N   1 
ATOM   2323 C  CA  . HIS C 1 20  ? 55.788 2.220   45.920  1.00 43.91 ? 420 HIS C CA  1 
ATOM   2324 C  C   . HIS C 1 20  ? 55.254 2.145   44.492  1.00 39.12 ? 420 HIS C C   1 
ATOM   2325 O  O   . HIS C 1 20  ? 54.085 1.828   44.280  1.00 39.67 ? 420 HIS C O   1 
ATOM   2326 C  CB  . HIS C 1 20  ? 55.136 3.392   46.669  1.00 45.94 ? 420 HIS C CB  1 
ATOM   2327 C  CG  . HIS C 1 20  ? 55.394 3.389   48.144  1.00 47.14 ? 420 HIS C CG  1 
ATOM   2328 N  ND1 . HIS C 1 20  ? 54.943 2.387   48.976  1.00 49.60 ? 420 HIS C ND1 1 
ATOM   2329 C  CD2 . HIS C 1 20  ? 56.092 4.243   48.931  1.00 48.39 ? 420 HIS C CD2 1 
ATOM   2330 C  CE1 . HIS C 1 20  ? 55.358 2.616   50.208  1.00 50.39 ? 420 HIS C CE1 1 
ATOM   2331 N  NE2 . HIS C 1 20  ? 56.057 3.737   50.208  1.00 48.70 ? 420 HIS C NE2 1 
ATOM   2332 N  N   . ALA C 1 21  ? 56.133 2.386   43.521  1.00 34.96 ? 421 ALA C N   1 
ATOM   2333 C  CA  . ALA C 1 21  ? 55.796 2.365   42.098  1.00 35.93 ? 421 ALA C CA  1 
ATOM   2334 C  C   . ALA C 1 21  ? 54.917 1.203   41.625  1.00 33.86 ? 421 ALA C C   1 
ATOM   2335 O  O   . ALA C 1 21  ? 53.999 1.390   40.837  1.00 36.62 ? 421 ALA C O   1 
ATOM   2336 C  CB  . ALA C 1 21  ? 57.077 2.444   41.262  1.00 32.97 ? 421 ALA C CB  1 
ATOM   2337 N  N   . ALA C 1 22  ? 55.197 0.001   42.097  1.00 33.97 ? 422 ALA C N   1 
ATOM   2338 C  CA  . ALA C 1 22  ? 54.416 -1.155  41.698  1.00 31.96 ? 422 ALA C CA  1 
ATOM   2339 C  C   . ALA C 1 22  ? 53.065 -1.142  42.374  1.00 33.58 ? 422 ALA C C   1 
ATOM   2340 O  O   . ALA C 1 22  ? 52.106 -1.625  41.783  1.00 37.63 ? 422 ALA C O   1 
ATOM   2341 C  CB  . ALA C 1 22  ? 55.146 -2.433  42.021  1.00 23.86 ? 422 ALA C CB  1 
ATOM   2342 N  N   . GLU C 1 23  ? 52.982 -0.618  43.606  1.00 34.03 ? 423 GLU C N   1 
ATOM   2343 C  CA  . GLU C 1 23  ? 51.693 -0.553  44.318  1.00 35.82 ? 423 GLU C CA  1 
ATOM   2344 C  C   . GLU C 1 23  ? 50.811 0.490   43.655  1.00 32.04 ? 423 GLU C C   1 
ATOM   2345 O  O   . GLU C 1 23  ? 49.602 0.324   43.589  1.00 29.04 ? 423 GLU C O   1 
ATOM   2346 C  CB  . GLU C 1 23  ? 51.833 -0.160  45.796  1.00 39.69 ? 423 GLU C CB  1 
ATOM   2347 C  CG  . GLU C 1 23  ? 52.544 -1.156  46.690  1.00 54.37 ? 423 GLU C CG  1 
ATOM   2348 C  CD  . GLU C 1 23  ? 53.990 -0.746  46.999  1.00 62.72 ? 423 GLU C CD  1 
ATOM   2349 O  OE1 . GLU C 1 23  ? 54.218 -0.157  48.083  1.00 62.79 ? 423 GLU C OE1 1 
ATOM   2350 O  OE2 . GLU C 1 23  ? 54.894 -1.008  46.158  1.00 61.31 ? 423 GLU C OE2 1 
ATOM   2351 N  N   . TYR C 1 24  ? 51.427 1.570   43.172  1.00 33.05 ? 424 TYR C N   1 
ATOM   2352 C  CA  . TYR C 1 24  ? 50.697 2.663   42.527  1.00 32.64 ? 424 TYR C CA  1 
ATOM   2353 C  C   . TYR C 1 24  ? 50.253 2.304   41.104  1.00 29.41 ? 424 TYR C C   1 
ATOM   2354 O  O   . TYR C 1 24  ? 49.164 2.677   40.700  1.00 32.37 ? 424 TYR C O   1 
ATOM   2355 C  CB  . TYR C 1 24  ? 51.499 3.983   42.571  1.00 30.72 ? 424 TYR C CB  1 
ATOM   2356 C  CG  . TYR C 1 24  ? 51.789 4.532   43.979  1.00 32.42 ? 424 TYR C CG  1 
ATOM   2357 C  CD1 . TYR C 1 24  ? 52.588 5.668   44.164  1.00 35.64 ? 424 TYR C CD1 1 
ATOM   2358 C  CD2 . TYR C 1 24  ? 51.310 3.884   45.122  1.00 33.98 ? 424 TYR C CD2 1 
ATOM   2359 C  CE1 . TYR C 1 24  ? 52.904 6.136   45.454  1.00 36.73 ? 424 TYR C CE1 1 
ATOM   2360 C  CE2 . TYR C 1 24  ? 51.624 4.336   46.408  1.00 27.31 ? 424 TYR C CE2 1 
ATOM   2361 C  CZ  . TYR C 1 24  ? 52.416 5.458   46.568  1.00 33.12 ? 424 TYR C CZ  1 
ATOM   2362 O  OH  . TYR C 1 24  ? 52.715 5.897   47.842  1.00 35.09 ? 424 TYR C OH  1 
ATOM   2363 N  N   . GLY C 1 25  ? 51.079 1.562   40.366  1.00 27.64 ? 425 GLY C N   1 
ATOM   2364 C  CA  . GLY C 1 25  ? 50.714 1.140   39.021  1.00 27.50 ? 425 GLY C CA  1 
ATOM   2365 C  C   . GLY C 1 25  ? 49.560 0.142   39.040  1.00 24.19 ? 425 GLY C C   1 
ATOM   2366 O  O   . GLY C 1 25  ? 48.758 0.083   38.113  1.00 25.18 ? 425 GLY C O   1 
ATOM   2367 N  N   . ALA C 1 26  ? 49.552 -0.725  40.041  1.00 23.81 ? 426 ALA C N   1 
ATOM   2368 C  CA  . ALA C 1 26  ? 48.479 -1.696  40.201  1.00 27.30 ? 426 ALA C CA  1 
ATOM   2369 C  C   . ALA C 1 26  ? 47.187 -0.979  40.628  1.00 26.65 ? 426 ALA C C   1 
ATOM   2370 O  O   . ALA C 1 26  ? 46.092 -1.350  40.224  1.00 29.37 ? 426 ALA C O   1 
ATOM   2371 C  CB  . ALA C 1 26  ? 48.874 -2.773  41.229  1.00 26.20 ? 426 ALA C CB  1 
ATOM   2372 N  N   . GLU C 1 27  ? 47.306 0.052   41.444  1.00 25.66 ? 427 GLU C N   1 
ATOM   2373 C  CA  . GLU C 1 27  ? 46.140 0.809   41.885  1.00 23.74 ? 427 GLU C CA  1 
ATOM   2374 C  C   . GLU C 1 27  ? 45.570 1.609   40.719  1.00 23.04 ? 427 GLU C C   1 
ATOM   2375 O  O   . GLU C 1 27  ? 44.354 1.688   40.549  1.00 24.91 ? 427 GLU C O   1 
ATOM   2376 C  CB  . GLU C 1 27  ? 46.525 1.765   43.007  1.00 29.47 ? 427 GLU C CB  1 
ATOM   2377 C  CG  . GLU C 1 27  ? 45.357 2.471   43.659  1.00 30.59 ? 427 GLU C CG  1 
ATOM   2378 C  CD  . GLU C 1 27  ? 45.800 3.464   44.697  1.00 31.27 ? 427 GLU C CD  1 
ATOM   2379 O  OE1 . GLU C 1 27  ? 46.662 3.116   45.540  1.00 35.28 ? 427 GLU C OE1 1 
ATOM   2380 O  OE2 . GLU C 1 27  ? 45.277 4.600   44.673  1.00 28.48 ? 427 GLU C OE2 1 
ATOM   2381 N  N   . ALA C 1 28  ? 46.454 2.181   39.905  1.00 20.95 ? 428 ALA C N   1 
ATOM   2382 C  CA  . ALA C 1 28  ? 46.046 2.965   38.748  1.00 18.35 ? 428 ALA C CA  1 
ATOM   2383 C  C   . ALA C 1 28  ? 45.223 2.075   37.840  1.00 21.28 ? 428 ALA C C   1 
ATOM   2384 O  O   . ALA C 1 28  ? 44.240 2.522   37.266  1.00 24.06 ? 428 ALA C O   1 
ATOM   2385 C  CB  . ALA C 1 28  ? 47.276 3.502   38.001  1.00 18.37 ? 428 ALA C CB  1 
ATOM   2386 N  N   . LEU C 1 29  ? 45.616 0.816   37.722  1.00 24.32 ? 429 LEU C N   1 
ATOM   2387 C  CA  . LEU C 1 29  ? 44.874 -0.144  36.904  1.00 27.68 ? 429 LEU C CA  1 
ATOM   2388 C  C   . LEU C 1 29  ? 43.497 -0.484  37.514  1.00 25.41 ? 429 LEU C C   1 
ATOM   2389 O  O   . LEU C 1 29  ? 42.496 -0.540  36.809  1.00 26.66 ? 429 LEU C O   1 
ATOM   2390 C  CB  . LEU C 1 29  ? 45.704 -1.423  36.685  1.00 29.36 ? 429 LEU C CB  1 
ATOM   2391 C  CG  . LEU C 1 29  ? 46.882 -1.356  35.714  1.00 31.73 ? 429 LEU C CG  1 
ATOM   2392 C  CD1 . LEU C 1 29  ? 47.626 -2.677  35.758  1.00 31.03 ? 429 LEU C CD1 1 
ATOM   2393 C  CD2 . LEU C 1 29  ? 46.404 -1.085  34.296  1.00 32.33 ? 429 LEU C CD2 1 
ATOM   2394 N  N   . GLU C 1 30  ? 43.432 -0.692  38.827  1.00 28.38 ? 430 GLU C N   1 
ATOM   2395 C  CA  . GLU C 1 30  ? 42.153 -1.007  39.467  1.00 32.11 ? 430 GLU C CA  1 
ATOM   2396 C  C   . GLU C 1 30  ? 41.172 0.154   39.263  1.00 32.69 ? 430 GLU C C   1 
ATOM   2397 O  O   . GLU C 1 30  ? 40.034 -0.048  38.838  1.00 31.40 ? 430 GLU C O   1 
ATOM   2398 C  CB  . GLU C 1 30  ? 42.343 -1.316  40.956  1.00 31.62 ? 430 GLU C CB  1 
ATOM   2399 C  CG  . GLU C 1 30  ? 41.109 -1.938  41.578  1.00 43.13 ? 430 GLU C CG  1 
ATOM   2400 C  CD  . GLU C 1 30  ? 41.267 -2.286  43.049  1.00 49.43 ? 430 GLU C CD  1 
ATOM   2401 O  OE1 . GLU C 1 30  ? 40.256 -2.206  43.783  1.00 54.65 ? 430 GLU C OE1 1 
ATOM   2402 O  OE2 . GLU C 1 30  ? 42.382 -2.656  43.480  1.00 58.28 ? 430 GLU C OE2 1 
ATOM   2403 N  N   . ARG C 1 31  ? 41.669 1.371   39.455  1.00 29.44 ? 431 ARG C N   1 
ATOM   2404 C  CA  . ARG C 1 31  ? 40.861 2.572   39.298  1.00 26.57 ? 431 ARG C CA  1 
ATOM   2405 C  C   . ARG C 1 31  ? 40.399 2.753   37.837  1.00 26.31 ? 431 ARG C C   1 
ATOM   2406 O  O   . ARG C 1 31  ? 39.331 3.319   37.571  1.00 25.20 ? 431 ARG C O   1 
ATOM   2407 C  CB  . ARG C 1 31  ? 41.674 3.797   39.714  1.00 24.45 ? 431 ARG C CB  1 
ATOM   2408 C  CG  . ARG C 1 31  ? 42.071 3.856   41.155  1.00 26.79 ? 431 ARG C CG  1 
ATOM   2409 C  CD  . ARG C 1 31  ? 42.789 5.172   41.458  1.00 26.74 ? 431 ARG C CD  1 
ATOM   2410 N  NE  . ARG C 1 31  ? 43.029 5.308   42.886  1.00 30.00 ? 431 ARG C NE  1 
ATOM   2411 C  CZ  . ARG C 1 31  ? 42.155 5.834   43.737  1.00 25.91 ? 431 ARG C CZ  1 
ATOM   2412 N  NH1 . ARG C 1 31  ? 40.986 6.277   43.313  1.00 27.64 ? 431 ARG C NH1 1 
ATOM   2413 N  NH2 . ARG C 1 31  ? 42.449 5.912   45.023  1.00 23.46 ? 431 ARG C NH2 1 
ATOM   2414 N  N   . MET C 1 32  ? 41.195 2.289   36.889  1.00 23.80 ? 432 MET C N   1 
ATOM   2415 C  CA  . MET C 1 32  ? 40.854 2.453   35.490  1.00 23.93 ? 432 MET C CA  1 
ATOM   2416 C  C   . MET C 1 32  ? 39.779 1.441   35.114  1.00 22.75 ? 432 MET C C   1 
ATOM   2417 O  O   . MET C 1 32  ? 38.836 1.747   34.373  1.00 23.53 ? 432 MET C O   1 
ATOM   2418 C  CB  . MET C 1 32  ? 42.099 2.262   34.615  1.00 20.94 ? 432 MET C CB  1 
ATOM   2419 C  CG  . MET C 1 32  ? 41.843 2.548   33.160  1.00 18.74 ? 432 MET C CG  1 
ATOM   2420 S  SD  . MET C 1 32  ? 43.064 1.817   32.057  1.00 28.55 ? 432 MET C SD  1 
ATOM   2421 C  CE  . MET C 1 32  ? 43.175 0.133   32.742  1.00 21.43 ? 432 MET C CE  1 
ATOM   2422 N  N   . PHE C 1 33  ? 39.866 0.262   35.731  1.00 26.69 ? 433 PHE C N   1 
ATOM   2423 C  CA  . PHE C 1 33  ? 38.945 -0.822  35.442  1.00 26.17 ? 433 PHE C CA  1 
ATOM   2424 C  C   . PHE C 1 33  ? 37.572 -0.502  35.997  1.00 26.54 ? 433 PHE C C   1 
ATOM   2425 O  O   . PHE C 1 33  ? 36.556 -0.717  35.322  1.00 28.95 ? 433 PHE C O   1 
ATOM   2426 C  CB  . PHE C 1 33  ? 39.457 -2.164  36.027  1.00 26.11 ? 433 PHE C CB  1 
ATOM   2427 C  CG  . PHE C 1 33  ? 40.624 -2.775  35.260  1.00 22.75 ? 433 PHE C CG  1 
ATOM   2428 C  CD1 . PHE C 1 33  ? 40.730 -2.605  33.865  1.00 26.84 ? 433 PHE C CD1 1 
ATOM   2429 C  CD2 . PHE C 1 33  ? 41.613 -3.492  35.940  1.00 23.91 ? 433 PHE C CD2 1 
ATOM   2430 C  CE1 . PHE C 1 33  ? 41.809 -3.142  33.154  1.00 26.66 ? 433 PHE C CE1 1 
ATOM   2431 C  CE2 . PHE C 1 33  ? 42.693 -4.040  35.273  1.00 20.50 ? 433 PHE C CE2 1 
ATOM   2432 C  CZ  . PHE C 1 33  ? 42.813 -3.874  33.866  1.00 24.60 ? 433 PHE C CZ  1 
ATOM   2433 N  N   . LEU C 1 34  ? 37.556 0.061   37.207  1.00 29.17 ? 434 LEU C N   1 
ATOM   2434 C  CA  . LEU C 1 34  ? 36.324 0.439   37.904  1.00 27.69 ? 434 LEU C CA  1 
ATOM   2435 C  C   . LEU C 1 34  ? 35.652 1.658   37.288  1.00 28.50 ? 434 LEU C C   1 
ATOM   2436 O  O   . LEU C 1 34  ? 34.459 1.640   37.020  1.00 34.79 ? 434 LEU C O   1 
ATOM   2437 C  CB  . LEU C 1 34  ? 36.609 0.690   39.400  1.00 25.74 ? 434 LEU C CB  1 
ATOM   2438 C  CG  . LEU C 1 34  ? 36.740 -0.517  40.343  1.00 28.11 ? 434 LEU C CG  1 
ATOM   2439 C  CD1 . LEU C 1 34  ? 37.294 -0.121  41.677  1.00 26.45 ? 434 LEU C CD1 1 
ATOM   2440 C  CD2 . LEU C 1 34  ? 35.396 -1.159  40.533  1.00 34.35 ? 434 LEU C CD2 1 
ATOM   2441 N  N   . SER C 1 35  ? 36.432 2.700   37.049  1.00 27.27 ? 435 SER C N   1 
ATOM   2442 C  CA  . SER C 1 35  ? 35.913 3.939   36.491  1.00 24.27 ? 435 SER C CA  1 
ATOM   2443 C  C   . SER C 1 35  ? 35.558 3.838   35.032  1.00 27.62 ? 435 SER C C   1 
ATOM   2444 O  O   . SER C 1 35  ? 34.580 4.437   34.595  1.00 32.11 ? 435 SER C O   1 
ATOM   2445 C  CB  . SER C 1 35  ? 36.903 5.085   36.701  1.00 23.07 ? 435 SER C CB  1 
ATOM   2446 O  OG  . SER C 1 35  ? 37.203 5.270   38.066  1.00 23.34 ? 435 SER C OG  1 
ATOM   2447 N  N   . PHE C 1 36  ? 36.358 3.102   34.267  1.00 29.35 ? 436 PHE C N   1 
ATOM   2448 C  CA  . PHE C 1 36  ? 36.107 2.982   32.839  1.00 27.54 ? 436 PHE C CA  1 
ATOM   2449 C  C   . PHE C 1 36  ? 36.098 1.509   32.445  1.00 29.98 ? 436 PHE C C   1 
ATOM   2450 O  O   . PHE C 1 36  ? 37.073 1.000   31.900  1.00 33.03 ? 436 PHE C O   1 
ATOM   2451 C  CB  . PHE C 1 36  ? 37.191 3.738   32.061  1.00 22.16 ? 436 PHE C CB  1 
ATOM   2452 C  CG  . PHE C 1 36  ? 37.464 5.117   32.583  1.00 24.05 ? 436 PHE C CG  1 
ATOM   2453 C  CD1 . PHE C 1 36  ? 38.597 5.376   33.348  1.00 24.00 ? 436 PHE C CD1 1 
ATOM   2454 C  CD2 . PHE C 1 36  ? 36.585 6.151   32.339  1.00 25.40 ? 436 PHE C CD2 1 
ATOM   2455 C  CE1 . PHE C 1 36  ? 38.850 6.644   33.869  1.00 24.59 ? 436 PHE C CE1 1 
ATOM   2456 C  CE2 . PHE C 1 36  ? 36.830 7.435   32.856  1.00 24.87 ? 436 PHE C CE2 1 
ATOM   2457 C  CZ  . PHE C 1 36  ? 37.968 7.674   33.623  1.00 23.99 ? 436 PHE C CZ  1 
ATOM   2458 N  N   . PRO C 1 37  ? 34.971 0.814   32.686  1.00 32.57 ? 437 PRO C N   1 
ATOM   2459 C  CA  . PRO C 1 37  ? 34.733 -0.607  32.405  1.00 30.48 ? 437 PRO C CA  1 
ATOM   2460 C  C   . PRO C 1 37  ? 35.070 -1.112  31.012  1.00 28.07 ? 437 PRO C C   1 
ATOM   2461 O  O   . PRO C 1 37  ? 35.381 -2.284  30.842  1.00 32.40 ? 437 PRO C O   1 
ATOM   2462 C  CB  . PRO C 1 37  ? 33.251 -0.760  32.732  1.00 29.91 ? 437 PRO C CB  1 
ATOM   2463 C  CG  . PRO C 1 37  ? 33.085 0.168   33.874  1.00 28.49 ? 437 PRO C CG  1 
ATOM   2464 C  CD  . PRO C 1 37  ? 33.775 1.395   33.332  1.00 31.20 ? 437 PRO C CD  1 
ATOM   2465 N  N   . THR C 1 38  ? 35.035 -0.233  30.019  1.00 31.99 ? 438 THR C N   1 
ATOM   2466 C  CA  . THR C 1 38  ? 35.351 -0.602  28.631  1.00 37.52 ? 438 THR C CA  1 
ATOM   2467 C  C   . THR C 1 38  ? 36.777 -1.138  28.506  1.00 34.26 ? 438 THR C C   1 
ATOM   2468 O  O   . THR C 1 38  ? 37.085 -1.952  27.628  1.00 33.45 ? 438 THR C O   1 
ATOM   2469 C  CB  . THR C 1 38  ? 35.224 0.620   27.676  1.00 39.67 ? 438 THR C CB  1 
ATOM   2470 O  OG1 . THR C 1 38  ? 33.889 1.126   27.719  1.00 49.25 ? 438 THR C OG1 1 
ATOM   2471 C  CG2 . THR C 1 38  ? 35.552 0.228   26.233  1.00 49.83 ? 438 THR C CG2 1 
ATOM   2472 N  N   . THR C 1 39  ? 37.660 -0.611  29.343  1.00 36.03 ? 439 THR C N   1 
ATOM   2473 C  CA  . THR C 1 39  ? 39.055 -1.014  29.345  1.00 28.11 ? 439 THR C CA  1 
ATOM   2474 C  C   . THR C 1 39  ? 39.219 -2.480  29.697  1.00 26.09 ? 439 THR C C   1 
ATOM   2475 O  O   . THR C 1 39  ? 40.152 -3.101  29.241  1.00 27.07 ? 439 THR C O   1 
ATOM   2476 C  CB  . THR C 1 39  ? 39.895 -0.104  30.252  1.00 27.09 ? 439 THR C CB  1 
ATOM   2477 O  OG1 . THR C 1 39  ? 39.440 -0.205  31.605  1.00 23.91 ? 439 THR C OG1 1 
ATOM   2478 C  CG2 . THR C 1 39  ? 39.804 1.365   29.776  1.00 19.51 ? 439 THR C CG2 1 
ATOM   2479 N  N   . LYS C 1 40  ? 38.280 -3.047  30.459  1.00 24.51 ? 440 LYS C N   1 
ATOM   2480 C  CA  . LYS C 1 40  ? 38.319 -4.470  30.830  1.00 29.17 ? 440 LYS C CA  1 
ATOM   2481 C  C   . LYS C 1 40  ? 38.320 -5.344  29.571  1.00 25.77 ? 440 LYS C C   1 
ATOM   2482 O  O   . LYS C 1 40  ? 38.835 -6.444  29.558  1.00 29.64 ? 440 LYS C O   1 
ATOM   2483 C  CB  . LYS C 1 40  ? 37.096 -4.845  31.687  1.00 33.31 ? 440 LYS C CB  1 
ATOM   2484 C  CG  . LYS C 1 40  ? 37.036 -4.245  33.093  1.00 36.45 ? 440 LYS C CG  1 
ATOM   2485 C  CD  . LYS C 1 40  ? 35.719 -4.614  33.774  1.00 35.52 ? 440 LYS C CD  1 
ATOM   2486 C  CE  . LYS C 1 40  ? 35.691 -4.100  35.193  1.00 41.31 ? 440 LYS C CE  1 
ATOM   2487 N  NZ  . LYS C 1 40  ? 34.356 -4.207  35.837  1.00 45.19 ? 440 LYS C NZ  1 
ATOM   2488 N  N   . THR C 1 41  ? 37.791 -4.795  28.497  1.00 27.15 ? 441 THR C N   1 
ATOM   2489 C  CA  . THR C 1 41  ? 37.682 -5.456  27.219  1.00 25.64 ? 441 THR C CA  1 
ATOM   2490 C  C   . THR C 1 41  ? 39.024 -5.948  26.690  1.00 25.39 ? 441 THR C C   1 
ATOM   2491 O  O   . THR C 1 41  ? 39.073 -6.865  25.872  1.00 27.83 ? 441 THR C O   1 
ATOM   2492 C  CB  . THR C 1 41  ? 37.060 -4.449  26.255  1.00 27.88 ? 441 THR C CB  1 
ATOM   2493 O  OG1 . THR C 1 41  ? 35.649 -4.394  26.513  1.00 36.68 ? 441 THR C OG1 1 
ATOM   2494 C  CG2 . THR C 1 41  ? 37.383 -4.735  24.812  1.00 29.96 ? 441 THR C CG2 1 
ATOM   2495 N  N   . TYR C 1 42  ? 40.106 -5.339  27.158  1.00 27.52 ? 442 TYR C N   1 
ATOM   2496 C  CA  . TYR C 1 42  ? 41.442 -5.680  26.696  1.00 23.40 ? 442 TYR C CA  1 
ATOM   2497 C  C   . TYR C 1 42  ? 42.103 -6.769  27.502  1.00 26.95 ? 442 TYR C C   1 
ATOM   2498 O  O   . TYR C 1 42  ? 43.124 -7.335  27.097  1.00 30.40 ? 442 TYR C O   1 
ATOM   2499 C  CB  . TYR C 1 42  ? 42.319 -4.430  26.701  1.00 21.16 ? 442 TYR C CB  1 
ATOM   2500 C  CG  . TYR C 1 42  ? 41.997 -3.484  25.579  1.00 24.23 ? 442 TYR C CG  1 
ATOM   2501 C  CD1 . TYR C 1 42  ? 42.595 -3.643  24.327  1.00 24.88 ? 442 TYR C CD1 1 
ATOM   2502 C  CD2 . TYR C 1 42  ? 41.097 -2.440  25.757  1.00 21.02 ? 442 TYR C CD2 1 
ATOM   2503 C  CE1 . TYR C 1 42  ? 42.304 -2.780  23.283  1.00 21.65 ? 442 TYR C CE1 1 
ATOM   2504 C  CE2 . TYR C 1 42  ? 40.798 -1.579  24.724  1.00 19.75 ? 442 TYR C CE2 1 
ATOM   2505 C  CZ  . TYR C 1 42  ? 41.407 -1.753  23.498  1.00 23.68 ? 442 TYR C CZ  1 
ATOM   2506 O  OH  . TYR C 1 42  ? 41.146 -0.882  22.461  1.00 29.55 ? 442 TYR C OH  1 
ATOM   2507 N  N   . PHE C 1 43  ? 41.485 -7.115  28.623  1.00 27.94 ? 443 PHE C N   1 
ATOM   2508 C  CA  . PHE C 1 43  ? 42.041 -8.138  29.499  1.00 26.78 ? 443 PHE C CA  1 
ATOM   2509 C  C   . PHE C 1 43  ? 41.037 -9.247  29.795  1.00 27.81 ? 443 PHE C C   1 
ATOM   2510 O  O   . PHE C 1 43  ? 40.842 -9.599  30.961  1.00 25.91 ? 443 PHE C O   1 
ATOM   2511 C  CB  . PHE C 1 43  ? 42.516 -7.501  30.815  1.00 29.28 ? 443 PHE C CB  1 
ATOM   2512 C  CG  . PHE C 1 43  ? 43.538 -6.411  30.631  1.00 32.54 ? 443 PHE C CG  1 
ATOM   2513 C  CD1 . PHE C 1 43  ? 43.141 -5.100  30.357  1.00 31.41 ? 443 PHE C CD1 1 
ATOM   2514 C  CD2 . PHE C 1 43  ? 44.895 -6.693  30.773  1.00 29.48 ? 443 PHE C CD2 1 
ATOM   2515 C  CE1 . PHE C 1 43  ? 44.091 -4.077  30.241  1.00 36.62 ? 443 PHE C CE1 1 
ATOM   2516 C  CE2 . PHE C 1 43  ? 45.854 -5.700  30.660  1.00 26.37 ? 443 PHE C CE2 1 
ATOM   2517 C  CZ  . PHE C 1 43  ? 45.462 -4.379  30.392  1.00 31.40 ? 443 PHE C CZ  1 
ATOM   2518 N  N   . PRO C 1 44  ? 40.406 -9.832  28.757  1.00 28.41 ? 444 PRO C N   1 
ATOM   2519 C  CA  . PRO C 1 44  ? 39.440 -10.894 29.021  1.00 29.66 ? 444 PRO C CA  1 
ATOM   2520 C  C   . PRO C 1 44  ? 40.066 -12.150 29.647  1.00 29.48 ? 444 PRO C C   1 
ATOM   2521 O  O   . PRO C 1 44  ? 39.370 -12.963 30.251  1.00 35.20 ? 444 PRO C O   1 
ATOM   2522 C  CB  . PRO C 1 44  ? 38.829 -11.155 27.640  1.00 21.69 ? 444 PRO C CB  1 
ATOM   2523 C  CG  . PRO C 1 44  ? 39.903 -10.804 26.716  1.00 25.93 ? 444 PRO C CG  1 
ATOM   2524 C  CD  . PRO C 1 44  ? 40.476 -9.558  27.306  1.00 26.90 ? 444 PRO C CD  1 
ATOM   2525 N  N   . HIS C 1 45  ? 41.381 -12.280 29.528  1.00 28.32 ? 445 HIS C N   1 
ATOM   2526 C  CA  . HIS C 1 45  ? 42.104 -13.419 30.073  1.00 31.14 ? 445 HIS C CA  1 
ATOM   2527 C  C   . HIS C 1 45  ? 42.552 -13.203 31.511  1.00 32.61 ? 445 HIS C C   1 
ATOM   2528 O  O   . HIS C 1 45  ? 43.221 -14.059 32.091  1.00 36.31 ? 445 HIS C O   1 
ATOM   2529 C  CB  . HIS C 1 45  ? 43.310 -13.750 29.191  1.00 28.74 ? 445 HIS C CB  1 
ATOM   2530 C  CG  . HIS C 1 45  ? 44.271 -12.616 29.018  1.00 32.54 ? 445 HIS C CG  1 
ATOM   2531 N  ND1 . HIS C 1 45  ? 43.936 -11.433 28.390  1.00 34.03 ? 445 HIS C ND1 1 
ATOM   2532 C  CD2 . HIS C 1 45  ? 45.568 -12.488 29.386  1.00 29.98 ? 445 HIS C CD2 1 
ATOM   2533 C  CE1 . HIS C 1 45  ? 44.982 -10.624 28.385  1.00 29.68 ? 445 HIS C CE1 1 
ATOM   2534 N  NE2 . HIS C 1 45  ? 45.986 -11.245 28.979  1.00 27.51 ? 445 HIS C NE2 1 
ATOM   2535 N  N   . PHE C 1 46  ? 42.189 -12.067 32.088  1.00 29.12 ? 446 PHE C N   1 
ATOM   2536 C  CA  . PHE C 1 46  ? 42.576 -11.755 33.456  1.00 29.46 ? 446 PHE C CA  1 
ATOM   2537 C  C   . PHE C 1 46  ? 41.468 -11.969 34.454  1.00 29.86 ? 446 PHE C C   1 
ATOM   2538 O  O   . PHE C 1 46  ? 40.294 -11.870 34.132  1.00 30.21 ? 446 PHE C O   1 
ATOM   2539 C  CB  . PHE C 1 46  ? 42.936 -10.271 33.590  1.00 28.94 ? 446 PHE C CB  1 
ATOM   2540 C  CG  . PHE C 1 46  ? 44.365 -9.959  33.336  1.00 28.01 ? 446 PHE C CG  1 
ATOM   2541 C  CD1 . PHE C 1 46  ? 44.970 -8.918  34.009  1.00 30.90 ? 446 PHE C CD1 1 
ATOM   2542 C  CD2 . PHE C 1 46  ? 45.104 -10.676 32.404  1.00 28.57 ? 446 PHE C CD2 1 
ATOM   2543 C  CE1 . PHE C 1 46  ? 46.314 -8.588  33.761  1.00 34.15 ? 446 PHE C CE1 1 
ATOM   2544 C  CE2 . PHE C 1 46  ? 46.445 -10.359 32.146  1.00 30.89 ? 446 PHE C CE2 1 
ATOM   2545 C  CZ  . PHE C 1 46  ? 47.049 -9.313  32.822  1.00 31.08 ? 446 PHE C CZ  1 
ATOM   2546 N  N   . ASP C 1 47  ? 41.862 -12.220 35.690  1.00 31.50 ? 447 ASP C N   1 
ATOM   2547 C  CA  . ASP C 1 47  ? 40.917 -12.306 36.778  1.00 37.94 ? 447 ASP C CA  1 
ATOM   2548 C  C   . ASP C 1 47  ? 40.940 -10.821 37.179  1.00 38.93 ? 447 ASP C C   1 
ATOM   2549 O  O   . ASP C 1 47  ? 42.000 -10.308 37.536  1.00 39.65 ? 447 ASP C O   1 
ATOM   2550 C  CB  . ASP C 1 47  ? 41.481 -13.156 37.918  1.00 41.35 ? 447 ASP C CB  1 
ATOM   2551 C  CG  . ASP C 1 47  ? 40.640 -13.064 39.174  1.00 43.94 ? 447 ASP C CG  1 
ATOM   2552 O  OD1 . ASP C 1 47  ? 41.218 -12.919 40.272  1.00 49.64 ? 447 ASP C OD1 1 
ATOM   2553 O  OD2 . ASP C 1 47  ? 39.396 -13.123 39.060  1.00 54.85 ? 447 ASP C OD2 1 
ATOM   2554 N  N   . LEU C 1 48  ? 39.818 -10.115 37.063  1.00 38.39 ? 448 LEU C N   1 
ATOM   2555 C  CA  . LEU C 1 48  ? 39.800 -8.685  37.386  1.00 42.27 ? 448 LEU C CA  1 
ATOM   2556 C  C   . LEU C 1 48  ? 39.236 -8.296  38.756  1.00 45.76 ? 448 LEU C C   1 
ATOM   2557 O  O   . LEU C 1 48  ? 39.078 -7.100  39.069  1.00 48.55 ? 448 LEU C O   1 
ATOM   2558 C  CB  . LEU C 1 48  ? 39.109 -7.899  36.260  1.00 40.29 ? 448 LEU C CB  1 
ATOM   2559 C  CG  . LEU C 1 48  ? 39.954 -7.242  35.149  1.00 36.03 ? 448 LEU C CG  1 
ATOM   2560 C  CD1 . LEU C 1 48  ? 41.408 -7.636  35.211  1.00 32.49 ? 448 LEU C CD1 1 
ATOM   2561 C  CD2 . LEU C 1 48  ? 39.383 -7.599  33.800  1.00 35.44 ? 448 LEU C CD2 1 
ATOM   2562 N  N   . SER C 1 49  ? 38.947 -9.310  39.571  1.00 49.37 ? 449 SER C N   1 
ATOM   2563 C  CA  . SER C 1 49  ? 38.410 -9.117  40.915  1.00 51.09 ? 449 SER C CA  1 
ATOM   2564 C  C   . SER C 1 49  ? 39.332 -8.256  41.749  1.00 52.70 ? 449 SER C C   1 
ATOM   2565 O  O   . SER C 1 49  ? 40.547 -8.236  41.531  1.00 55.05 ? 449 SER C O   1 
ATOM   2566 C  CB  . SER C 1 49  ? 38.211 -10.460 41.617  1.00 53.37 ? 449 SER C CB  1 
ATOM   2567 O  OG  . SER C 1 49  ? 37.205 -11.231 40.972  1.00 60.01 ? 449 SER C OG  1 
ATOM   2568 N  N   . HIS C 1 50  ? 38.754 -7.557  42.719  1.00 54.41 ? 450 HIS C N   1 
ATOM   2569 C  CA  . HIS C 1 50  ? 39.543 -6.695  43.574  1.00 55.38 ? 450 HIS C CA  1 
ATOM   2570 C  C   . HIS C 1 50  ? 40.538 -7.544  44.348  1.00 55.07 ? 450 HIS C C   1 
ATOM   2571 O  O   . HIS C 1 50  ? 40.148 -8.391  45.156  1.00 56.85 ? 450 HIS C O   1 
ATOM   2572 C  CB  . HIS C 1 50  ? 38.662 -5.896  44.545  1.00 56.31 ? 450 HIS C CB  1 
ATOM   2573 C  CG  . HIS C 1 50  ? 39.424 -5.330  45.706  1.00 58.36 ? 450 HIS C CG  1 
ATOM   2574 N  ND1 . HIS C 1 50  ? 40.520 -4.504  45.551  1.00 60.45 ? 450 HIS C ND1 1 
ATOM   2575 C  CD2 . HIS C 1 50  ? 39.302 -5.547  47.038  1.00 59.07 ? 450 HIS C CD2 1 
ATOM   2576 C  CE1 . HIS C 1 50  ? 41.044 -4.242  46.737  1.00 61.96 ? 450 HIS C CE1 1 
ATOM   2577 N  NE2 . HIS C 1 50  ? 40.323 -4.863  47.655  1.00 62.21 ? 450 HIS C NE2 1 
ATOM   2578 N  N   . GLY C 1 51  ? 41.819 -7.287  44.108  1.00 51.15 ? 451 GLY C N   1 
ATOM   2579 C  CA  . GLY C 1 51  ? 42.867 -8.020  44.792  1.00 50.27 ? 451 GLY C CA  1 
ATOM   2580 C  C   . GLY C 1 51  ? 43.544 -9.071  43.935  1.00 47.85 ? 451 GLY C C   1 
ATOM   2581 O  O   . GLY C 1 51  ? 44.444 -9.773  44.400  1.00 49.33 ? 451 GLY C O   1 
ATOM   2582 N  N   . SER C 1 52  ? 43.127 -9.155  42.677  1.00 46.58 ? 452 SER C N   1 
ATOM   2583 C  CA  . SER C 1 52  ? 43.676 -10.115 41.738  1.00 41.83 ? 452 SER C CA  1 
ATOM   2584 C  C   . SER C 1 52  ? 45.205 -10.069 41.691  1.00 43.44 ? 452 SER C C   1 
ATOM   2585 O  O   . SER C 1 52  ? 45.813 -8.995  41.649  1.00 45.39 ? 452 SER C O   1 
ATOM   2586 C  CB  . SER C 1 52  ? 43.090 -9.852  40.356  1.00 35.07 ? 452 SER C CB  1 
ATOM   2587 O  OG  . SER C 1 52  ? 43.835 -10.515 39.348  1.00 45.55 ? 452 SER C OG  1 
ATOM   2588 N  N   . ALA C 1 53  ? 45.830 -11.240 41.723  1.00 43.90 ? 453 ALA C N   1 
ATOM   2589 C  CA  . ALA C 1 53  ? 47.280 -11.313 41.663  1.00 39.99 ? 453 ALA C CA  1 
ATOM   2590 C  C   . ALA C 1 53  ? 47.728 -10.983 40.247  1.00 40.05 ? 453 ALA C C   1 
ATOM   2591 O  O   . ALA C 1 53  ? 48.874 -10.605 40.029  1.00 40.73 ? 453 ALA C O   1 
ATOM   2592 C  CB  . ALA C 1 53  ? 47.758 -12.696 42.066  1.00 42.22 ? 453 ALA C CB  1 
ATOM   2593 N  N   . GLN C 1 54  ? 46.830 -11.136 39.277  1.00 39.66 ? 454 GLN C N   1 
ATOM   2594 C  CA  . GLN C 1 54  ? 47.165 -10.820 37.891  1.00 36.61 ? 454 GLN C CA  1 
ATOM   2595 C  C   . GLN C 1 54  ? 47.273 -9.315  37.719  1.00 34.76 ? 454 GLN C C   1 
ATOM   2596 O  O   . GLN C 1 54  ? 48.212 -8.809  37.101  1.00 36.13 ? 454 GLN C O   1 
ATOM   2597 C  CB  . GLN C 1 54  ? 46.114 -11.350 36.935  1.00 36.04 ? 454 GLN C CB  1 
ATOM   2598 C  CG  . GLN C 1 54  ? 46.012 -12.847 36.914  1.00 40.67 ? 454 GLN C CG  1 
ATOM   2599 C  CD  . GLN C 1 54  ? 45.307 -13.326 35.675  1.00 41.56 ? 454 GLN C CD  1 
ATOM   2600 O  OE1 . GLN C 1 54  ? 44.164 -13.775 35.729  1.00 45.85 ? 454 GLN C OE1 1 
ATOM   2601 N  NE2 . GLN C 1 54  ? 45.978 -13.204 34.536  1.00 41.69 ? 454 GLN C NE2 1 
ATOM   2602 N  N   . VAL C 1 55  ? 46.298 -8.604  38.265  1.00 32.33 ? 455 VAL C N   1 
ATOM   2603 C  CA  . VAL C 1 55  ? 46.281 -7.157  38.203  1.00 31.15 ? 455 VAL C CA  1 
ATOM   2604 C  C   . VAL C 1 55  ? 47.524 -6.587  38.924  1.00 29.88 ? 455 VAL C C   1 
ATOM   2605 O  O   . VAL C 1 55  ? 48.213 -5.719  38.390  1.00 30.92 ? 455 VAL C O   1 
ATOM   2606 C  CB  . VAL C 1 55  ? 44.961 -6.618  38.786  1.00 27.96 ? 455 VAL C CB  1 
ATOM   2607 C  CG1 . VAL C 1 55  ? 44.921 -5.102  38.728  1.00 27.47 ? 455 VAL C CG1 1 
ATOM   2608 C  CG2 . VAL C 1 55  ? 43.805 -7.211  38.023  1.00 27.76 ? 455 VAL C CG2 1 
ATOM   2609 N  N   . LYS C 1 56  ? 47.820 -7.099  40.114  1.00 32.15 ? 456 LYS C N   1 
ATOM   2610 C  CA  . LYS C 1 56  ? 48.990 -6.672  40.884  1.00 34.91 ? 456 LYS C CA  1 
ATOM   2611 C  C   . LYS C 1 56  ? 50.249 -6.870  40.043  1.00 31.19 ? 456 LYS C C   1 
ATOM   2612 O  O   . LYS C 1 56  ? 51.061 -5.966  39.879  1.00 33.11 ? 456 LYS C O   1 
ATOM   2613 C  CB  . LYS C 1 56  ? 49.118 -7.513  42.168  1.00 39.79 ? 456 LYS C CB  1 
ATOM   2614 C  CG  . LYS C 1 56  ? 48.216 -7.087  43.316  1.00 44.22 ? 456 LYS C CG  1 
ATOM   2615 C  CD  . LYS C 1 56  ? 48.772 -5.826  43.937  1.00 52.90 ? 456 LYS C CD  1 
ATOM   2616 C  CE  . LYS C 1 56  ? 47.973 -5.378  45.147  1.00 56.25 ? 456 LYS C CE  1 
ATOM   2617 N  NZ  . LYS C 1 56  ? 48.638 -4.195  45.786  1.00 59.60 ? 456 LYS C NZ  1 
ATOM   2618 N  N   . GLY C 1 57  ? 50.408 -8.075  39.526  1.00 30.26 ? 457 GLY C N   1 
ATOM   2619 C  CA  . GLY C 1 57  ? 51.562 -8.374  38.714  1.00 28.41 ? 457 GLY C CA  1 
ATOM   2620 C  C   . GLY C 1 57  ? 51.752 -7.456  37.525  1.00 31.66 ? 457 GLY C C   1 
ATOM   2621 O  O   . GLY C 1 57  ? 52.860 -6.961  37.268  1.00 32.79 ? 457 GLY C O   1 
ATOM   2622 N  N   . HIS C 1 58  ? 50.673 -7.228  36.788  1.00 29.73 ? 458 HIS C N   1 
ATOM   2623 C  CA  . HIS C 1 58  ? 50.741 -6.372  35.610  1.00 27.49 ? 458 HIS C CA  1 
ATOM   2624 C  C   . HIS C 1 58  ? 51.022 -4.913  35.986  1.00 24.65 ? 458 HIS C C   1 
ATOM   2625 O  O   . HIS C 1 58  ? 51.681 -4.200  35.244  1.00 25.20 ? 458 HIS C O   1 
ATOM   2626 C  CB  . HIS C 1 58  ? 49.453 -6.502  34.797  1.00 28.93 ? 458 HIS C CB  1 
ATOM   2627 C  CG  . HIS C 1 58  ? 49.562 -5.947  33.414  1.00 27.50 ? 458 HIS C CG  1 
ATOM   2628 N  ND1 . HIS C 1 58  ? 50.247 -6.591  32.411  1.00 27.21 ? 458 HIS C ND1 1 
ATOM   2629 C  CD2 . HIS C 1 58  ? 49.093 -4.796  32.871  1.00 25.71 ? 458 HIS C CD2 1 
ATOM   2630 C  CE1 . HIS C 1 58  ? 50.204 -5.864  31.309  1.00 28.13 ? 458 HIS C CE1 1 
ATOM   2631 N  NE2 . HIS C 1 58  ? 49.510 -4.770  31.565  1.00 24.96 ? 458 HIS C NE2 1 
ATOM   2632 N  N   . GLY C 1 59  ? 50.471 -4.467  37.110  1.00 22.97 ? 459 GLY C N   1 
ATOM   2633 C  CA  . GLY C 1 59  ? 50.704 -3.115  37.585  1.00 27.57 ? 459 GLY C CA  1 
ATOM   2634 C  C   . GLY C 1 59  ? 52.183 -2.888  37.868  1.00 31.94 ? 459 GLY C C   1 
ATOM   2635 O  O   . GLY C 1 59  ? 52.689 -1.778  37.704  1.00 33.17 ? 459 GLY C O   1 
ATOM   2636 N  N   . ALA C 1 60  ? 52.876 -3.940  38.305  1.00 34.08 ? 460 ALA C N   1 
ATOM   2637 C  CA  . ALA C 1 60  ? 54.314 -3.870  38.581  1.00 31.74 ? 460 ALA C CA  1 
ATOM   2638 C  C   . ALA C 1 60  ? 55.046 -3.642  37.264  1.00 31.27 ? 460 ALA C C   1 
ATOM   2639 O  O   . ALA C 1 60  ? 55.927 -2.787  37.181  1.00 37.52 ? 460 ALA C O   1 
ATOM   2640 C  CB  . ALA C 1 60  ? 54.796 -5.148  39.243  1.00 33.10 ? 460 ALA C CB  1 
ATOM   2641 N  N   . LYS C 1 61  ? 54.670 -4.406  36.242  1.00 29.82 ? 461 LYS C N   1 
ATOM   2642 C  CA  . LYS C 1 61  ? 55.242 -4.272  34.907  1.00 28.31 ? 461 LYS C CA  1 
ATOM   2643 C  C   . LYS C 1 61  ? 54.970 -2.897  34.268  1.00 32.48 ? 461 LYS C C   1 
ATOM   2644 O  O   . LYS C 1 61  ? 55.806 -2.377  33.528  1.00 31.83 ? 461 LYS C O   1 
ATOM   2645 C  CB  . LYS C 1 61  ? 54.682 -5.352  33.987  1.00 30.81 ? 461 LYS C CB  1 
ATOM   2646 C  CG  . LYS C 1 61  ? 54.871 -6.762  34.465  1.00 31.83 ? 461 LYS C CG  1 
ATOM   2647 C  CD  . LYS C 1 61  ? 54.609 -7.736  33.328  1.00 31.95 ? 461 LYS C CD  1 
ATOM   2648 C  CE  . LYS C 1 61  ? 54.478 -9.162  33.849  1.00 37.78 ? 461 LYS C CE  1 
ATOM   2649 N  NZ  . LYS C 1 61  ? 54.419 -10.169 32.751  1.00 41.22 ? 461 LYS C NZ  1 
ATOM   2650 N  N   . VAL C 1 62  ? 53.788 -2.332  34.516  1.00 29.73 ? 462 VAL C N   1 
ATOM   2651 C  CA  . VAL C 1 62  ? 53.423 -1.024  33.963  1.00 29.21 ? 462 VAL C CA  1 
ATOM   2652 C  C   . VAL C 1 62  ? 54.308 0.039   34.610  1.00 26.83 ? 462 VAL C C   1 
ATOM   2653 O  O   . VAL C 1 62  ? 54.833 0.924   33.929  1.00 26.71 ? 462 VAL C O   1 
ATOM   2654 C  CB  . VAL C 1 62  ? 51.905 -0.683  34.202  1.00 33.45 ? 462 VAL C CB  1 
ATOM   2655 C  CG1 . VAL C 1 62  ? 51.600 0.742   33.787  1.00 30.33 ? 462 VAL C CG1 1 
ATOM   2656 C  CG2 . VAL C 1 62  ? 51.014 -1.617  33.392  1.00 34.05 ? 462 VAL C CG2 1 
ATOM   2657 N  N   . ALA C 1 63  ? 54.430 -0.030  35.935  1.00 25.98 ? 463 ALA C N   1 
ATOM   2658 C  CA  . ALA C 1 63  ? 55.275 0.890   36.699  1.00 25.91 ? 463 ALA C CA  1 
ATOM   2659 C  C   . ALA C 1 63  ? 56.755 0.773   36.300  1.00 30.20 ? 463 ALA C C   1 
ATOM   2660 O  O   . ALA C 1 63  ? 57.484 1.775   36.305  1.00 32.43 ? 463 ALA C O   1 
ATOM   2661 C  CB  . ALA C 1 63  ? 55.117 0.622   38.185  1.00 27.83 ? 463 ALA C CB  1 
ATOM   2662 N  N   . ALA C 1 64  ? 57.188 -0.448  35.962  1.00 34.07 ? 464 ALA C N   1 
ATOM   2663 C  CA  . ALA C 1 64  ? 58.565 -0.730  35.534  1.00 29.63 ? 464 ALA C CA  1 
ATOM   2664 C  C   . ALA C 1 64  ? 58.886 0.008   34.250  1.00 31.51 ? 464 ALA C C   1 
ATOM   2665 O  O   . ALA C 1 64  ? 59.963 0.605   34.119  1.00 36.57 ? 464 ALA C O   1 
ATOM   2666 C  CB  . ALA C 1 64  ? 58.768 -2.211  35.343  1.00 28.11 ? 464 ALA C CB  1 
ATOM   2667 N  N   . ALA C 1 65  ? 57.955 -0.021  33.302  1.00 31.14 ? 465 ALA C N   1 
ATOM   2668 C  CA  . ALA C 1 65  ? 58.133 0.678   32.033  1.00 26.18 ? 465 ALA C CA  1 
ATOM   2669 C  C   . ALA C 1 65  ? 58.089 2.208   32.187  1.00 27.02 ? 465 ALA C C   1 
ATOM   2670 O  O   . ALA C 1 65  ? 58.651 2.929   31.367  1.00 30.81 ? 465 ALA C O   1 
ATOM   2671 C  CB  . ALA C 1 65  ? 57.092 0.211   31.029  1.00 25.09 ? 465 ALA C CB  1 
ATOM   2672 N  N   . LEU C 1 66  ? 57.390 2.714   33.200  1.00 29.44 ? 466 LEU C N   1 
ATOM   2673 C  CA  . LEU C 1 66  ? 57.316 4.164   33.413  1.00 31.59 ? 466 LEU C CA  1 
ATOM   2674 C  C   . LEU C 1 66  ? 58.626 4.629   34.034  1.00 31.36 ? 466 LEU C C   1 
ATOM   2675 O  O   . LEU C 1 66  ? 59.130 5.708   33.723  1.00 30.05 ? 466 LEU C O   1 
ATOM   2676 C  CB  . LEU C 1 66  ? 56.116 4.551   34.297  1.00 28.65 ? 466 LEU C CB  1 
ATOM   2677 C  CG  . LEU C 1 66  ? 54.700 4.395   33.716  1.00 23.62 ? 466 LEU C CG  1 
ATOM   2678 C  CD1 . LEU C 1 66  ? 53.680 4.554   34.799  1.00 20.61 ? 466 LEU C CD1 1 
ATOM   2679 C  CD2 . LEU C 1 66  ? 54.467 5.410   32.635  1.00 25.53 ? 466 LEU C CD2 1 
ATOM   2680 N  N   . THR C 1 67  ? 59.162 3.802   34.927  1.00 36.14 ? 467 THR C N   1 
ATOM   2681 C  CA  . THR C 1 67  ? 60.446 4.076   35.574  1.00 40.11 ? 467 THR C CA  1 
ATOM   2682 C  C   . THR C 1 67  ? 61.535 4.136   34.483  1.00 38.43 ? 467 THR C C   1 
ATOM   2683 O  O   . THR C 1 67  ? 62.325 5.071   34.442  1.00 40.79 ? 467 THR C O   1 
ATOM   2684 C  CB  . THR C 1 67  ? 60.789 2.970   36.623  1.00 45.45 ? 467 THR C CB  1 
ATOM   2685 O  OG1 . THR C 1 67  ? 59.779 2.945   37.646  1.00 46.50 ? 467 THR C OG1 1 
ATOM   2686 C  CG2 . THR C 1 67  ? 62.171 3.211   37.263  1.00 45.79 ? 467 THR C CG2 1 
ATOM   2687 N  N   . LYS C 1 68  ? 61.550 3.151   33.584  1.00 38.50 ? 468 LYS C N   1 
ATOM   2688 C  CA  . LYS C 1 68  ? 62.516 3.096   32.482  1.00 35.42 ? 468 LYS C CA  1 
ATOM   2689 C  C   . LYS C 1 68  ? 62.353 4.288   31.529  1.00 35.71 ? 468 LYS C C   1 
ATOM   2690 O  O   . LYS C 1 68  ? 63.338 4.793   30.981  1.00 40.96 ? 468 LYS C O   1 
ATOM   2691 C  CB  . LYS C 1 68  ? 62.375 1.765   31.731  1.00 34.30 ? 468 LYS C CB  1 
ATOM   2692 C  CG  . LYS C 1 68  ? 63.283 1.602   30.535  1.00 32.79 ? 468 LYS C CG  1 
ATOM   2693 C  CD  . LYS C 1 68  ? 63.014 0.281   29.868  1.00 39.34 ? 468 LYS C CD  1 
ATOM   2694 C  CE  . LYS C 1 68  ? 63.556 0.262   28.456  1.00 41.34 ? 468 LYS C CE  1 
ATOM   2695 N  NZ  . LYS C 1 68  ? 63.038 -0.930  27.725  1.00 42.31 ? 468 LYS C NZ  1 
ATOM   2696 N  N   . ALA C 1 69  ? 61.113 4.721   31.312  1.00 36.52 ? 469 ALA C N   1 
ATOM   2697 C  CA  . ALA C 1 69  ? 60.832 5.872   30.460  1.00 34.61 ? 469 ALA C CA  1 
ATOM   2698 C  C   . ALA C 1 69  ? 61.376 7.158   31.124  1.00 31.63 ? 469 ALA C C   1 
ATOM   2699 O  O   . ALA C 1 69  ? 61.816 8.062   30.432  1.00 33.25 ? 469 ALA C O   1 
ATOM   2700 C  CB  . ALA C 1 69  ? 59.321 5.990   30.215  1.00 34.65 ? 469 ALA C CB  1 
ATOM   2701 N  N   . VAL C 1 70  ? 61.377 7.208   32.460  1.00 31.04 ? 470 VAL C N   1 
ATOM   2702 C  CA  . VAL C 1 70  ? 61.865 8.360   33.244  1.00 35.20 ? 470 VAL C CA  1 
ATOM   2703 C  C   . VAL C 1 70  ? 63.398 8.446   33.219  1.00 37.81 ? 470 VAL C C   1 
ATOM   2704 O  O   . VAL C 1 70  ? 63.989 9.532   33.127  1.00 37.61 ? 470 VAL C O   1 
ATOM   2705 C  CB  . VAL C 1 70  ? 61.357 8.287   34.728  1.00 34.64 ? 470 VAL C CB  1 
ATOM   2706 C  CG1 . VAL C 1 70  ? 62.139 9.221   35.625  1.00 31.05 ? 470 VAL C CG1 1 
ATOM   2707 C  CG2 . VAL C 1 70  ? 59.882 8.665   34.796  1.00 38.18 ? 470 VAL C CG2 1 
ATOM   2708 N  N   . GLU C 1 71  ? 64.040 7.290   33.325  1.00 43.58 ? 471 GLU C N   1 
ATOM   2709 C  CA  . GLU C 1 71  ? 65.492 7.204   33.279  1.00 42.16 ? 471 GLU C CA  1 
ATOM   2710 C  C   . GLU C 1 71  ? 66.005 7.385   31.857  1.00 44.41 ? 471 GLU C C   1 
ATOM   2711 O  O   . GLU C 1 71  ? 67.210 7.347   31.637  1.00 50.17 ? 471 GLU C O   1 
ATOM   2712 C  CB  . GLU C 1 71  ? 65.944 5.859   33.813  1.00 35.96 ? 471 GLU C CB  1 
ATOM   2713 C  CG  . GLU C 1 71  ? 65.651 5.690   35.281  1.00 38.96 ? 471 GLU C CG  1 
ATOM   2714 C  CD  . GLU C 1 71  ? 65.795 4.250   35.754  1.00 43.19 ? 471 GLU C CD  1 
ATOM   2715 O  OE1 . GLU C 1 71  ? 65.668 4.024   36.985  1.00 46.93 ? 471 GLU C OE1 1 
ATOM   2716 O  OE2 . GLU C 1 71  ? 66.020 3.345   34.908  1.00 42.55 ? 471 GLU C OE2 1 
ATOM   2717 N  N   . HIS C 1 72  ? 65.096 7.538   30.891  1.00 44.78 ? 472 HIS C N   1 
ATOM   2718 C  CA  . HIS C 1 72  ? 65.463 7.731   29.483  1.00 43.02 ? 472 HIS C CA  1 
ATOM   2719 C  C   . HIS C 1 72  ? 64.628 8.843   28.855  1.00 40.62 ? 472 HIS C C   1 
ATOM   2720 O  O   . HIS C 1 72  ? 64.381 8.847   27.652  1.00 41.39 ? 472 HIS C O   1 
ATOM   2721 C  CB  . HIS C 1 72  ? 65.291 6.431   28.687  1.00 44.83 ? 472 HIS C CB  1 
ATOM   2722 C  CG  . HIS C 1 72  ? 66.221 5.337   29.110  1.00 48.75 ? 472 HIS C CG  1 
ATOM   2723 N  ND1 . HIS C 1 72  ? 67.479 5.178   28.568  1.00 50.67 ? 472 HIS C ND1 1 
ATOM   2724 C  CD2 . HIS C 1 72  ? 66.085 4.362   30.040  1.00 51.11 ? 472 HIS C CD2 1 
ATOM   2725 C  CE1 . HIS C 1 72  ? 68.079 4.153   29.150  1.00 52.75 ? 472 HIS C CE1 1 
ATOM   2726 N  NE2 . HIS C 1 72  ? 67.256 3.639   30.047  1.00 51.19 ? 472 HIS C NE2 1 
ATOM   2727 N  N   . LEU C 1 73  ? 64.301 9.842   29.666  1.00 40.50 ? 473 LEU C N   1 
ATOM   2728 C  CA  . LEU C 1 73  ? 63.491 10.982  29.251  1.00 41.21 ? 473 LEU C CA  1 
ATOM   2729 C  C   . LEU C 1 73  ? 63.916 11.679  27.970  1.00 42.83 ? 473 LEU C C   1 
ATOM   2730 O  O   . LEU C 1 73  ? 63.103 12.311  27.304  1.00 43.41 ? 473 LEU C O   1 
ATOM   2731 C  CB  . LEU C 1 73  ? 63.445 11.998  30.387  1.00 39.39 ? 473 LEU C CB  1 
ATOM   2732 C  CG  . LEU C 1 73  ? 62.109 12.367  31.029  1.00 37.82 ? 473 LEU C CG  1 
ATOM   2733 C  CD1 . LEU C 1 73  ? 61.126 11.232  30.962  1.00 38.82 ? 473 LEU C CD1 1 
ATOM   2734 C  CD2 . LEU C 1 73  ? 62.356 12.765  32.465  1.00 32.19 ? 473 LEU C CD2 1 
ATOM   2735 N  N   . ASP C 1 74  ? 65.187 11.578  27.611  1.00 49.82 ? 474 ASP C N   1 
ATOM   2736 C  CA  . ASP C 1 74  ? 65.637 12.248  26.402  1.00 53.18 ? 474 ASP C CA  1 
ATOM   2737 C  C   . ASP C 1 74  ? 65.585 11.406  25.148  1.00 53.02 ? 474 ASP C C   1 
ATOM   2738 O  O   . ASP C 1 74  ? 66.042 11.821  24.089  1.00 56.28 ? 474 ASP C O   1 
ATOM   2739 C  CB  . ASP C 1 74  ? 67.013 12.856  26.624  1.00 56.99 ? 474 ASP C CB  1 
ATOM   2740 C  CG  . ASP C 1 74  ? 66.945 14.091  27.495  1.00 61.12 ? 474 ASP C CG  1 
ATOM   2741 O  OD1 . ASP C 1 74  ? 67.298 14.009  28.698  1.00 60.41 ? 474 ASP C OD1 1 
ATOM   2742 O  OD2 . ASP C 1 74  ? 66.477 15.133  26.979  1.00 64.48 ? 474 ASP C OD2 1 
ATOM   2743 N  N   . ASP C 1 75  ? 64.965 10.244  25.262  1.00 54.01 ? 475 ASP C N   1 
ATOM   2744 C  CA  . ASP C 1 75  ? 64.834 9.338   24.144  1.00 54.99 ? 475 ASP C CA  1 
ATOM   2745 C  C   . ASP C 1 75  ? 63.708 8.359   24.459  1.00 54.98 ? 475 ASP C C   1 
ATOM   2746 O  O   . ASP C 1 75  ? 63.929 7.154   24.651  1.00 55.01 ? 475 ASP C O   1 
ATOM   2747 C  CB  . ASP C 1 75  ? 66.154 8.598   23.909  1.00 59.00 ? 475 ASP C CB  1 
ATOM   2748 C  CG  . ASP C 1 75  ? 66.055 7.547   22.810  1.00 63.16 ? 475 ASP C CG  1 
ATOM   2749 O  OD1 . ASP C 1 75  ? 66.720 6.495   22.952  1.00 65.14 ? 475 ASP C OD1 1 
ATOM   2750 O  OD2 . ASP C 1 75  ? 65.307 7.762   21.821  1.00 62.46 ? 475 ASP C OD2 1 
ATOM   2751 N  N   . LEU C 1 76  ? 62.492 8.888   24.530  1.00 53.99 ? 476 LEU C N   1 
ATOM   2752 C  CA  . LEU C 1 76  ? 61.326 8.058   24.813  1.00 51.38 ? 476 LEU C CA  1 
ATOM   2753 C  C   . LEU C 1 76  ? 61.046 7.071   23.661  1.00 49.77 ? 476 LEU C C   1 
ATOM   2754 O  O   . LEU C 1 76  ? 60.836 5.873   23.908  1.00 47.38 ? 476 LEU C O   1 
ATOM   2755 C  CB  . LEU C 1 76  ? 60.108 8.940   25.144  1.00 46.85 ? 476 LEU C CB  1 
ATOM   2756 C  CG  . LEU C 1 76  ? 59.548 8.892   26.577  1.00 43.25 ? 476 LEU C CG  1 
ATOM   2757 C  CD1 . LEU C 1 76  ? 60.573 8.413   27.606  1.00 39.39 ? 476 LEU C CD1 1 
ATOM   2758 C  CD2 . LEU C 1 76  ? 58.994 10.255  26.944  1.00 41.51 ? 476 LEU C CD2 1 
ATOM   2759 N  N   . PRO C 1 77  ? 61.103 7.540   22.389  1.00 47.83 ? 477 PRO C N   1 
ATOM   2760 C  CA  . PRO C 1 77  ? 60.851 6.650   21.251  1.00 49.18 ? 477 PRO C CA  1 
ATOM   2761 C  C   . PRO C 1 77  ? 61.758 5.422   21.252  1.00 48.43 ? 477 PRO C C   1 
ATOM   2762 O  O   . PRO C 1 77  ? 61.321 4.316   20.937  1.00 51.71 ? 477 PRO C O   1 
ATOM   2763 C  CB  . PRO C 1 77  ? 61.152 7.547   20.056  1.00 45.57 ? 477 PRO C CB  1 
ATOM   2764 C  CG  . PRO C 1 77  ? 60.696 8.864   20.529  1.00 46.22 ? 477 PRO C CG  1 
ATOM   2765 C  CD  . PRO C 1 77  ? 61.298 8.918   21.908  1.00 48.37 ? 477 PRO C CD  1 
ATOM   2766 N  N   . GLY C 1 78  ? 63.006 5.610   21.665  1.00 47.60 ? 478 GLY C N   1 
ATOM   2767 C  CA  . GLY C 1 78  ? 63.945 4.506   21.682  1.00 41.85 ? 478 GLY C CA  1 
ATOM   2768 C  C   . GLY C 1 78  ? 63.728 3.532   22.812  1.00 38.35 ? 478 GLY C C   1 
ATOM   2769 O  O   . GLY C 1 78  ? 63.707 2.322   22.596  1.00 42.80 ? 478 GLY C O   1 
ATOM   2770 N  N   . ALA C 1 79  ? 63.562 4.060   24.017  1.00 38.06 ? 479 ALA C N   1 
ATOM   2771 C  CA  . ALA C 1 79  ? 63.367 3.235   25.201  1.00 41.83 ? 479 ALA C CA  1 
ATOM   2772 C  C   . ALA C 1 79  ? 62.112 2.348   25.179  1.00 44.08 ? 479 ALA C C   1 
ATOM   2773 O  O   . ALA C 1 79  ? 62.142 1.224   25.696  1.00 46.73 ? 479 ALA C O   1 
ATOM   2774 C  CB  . ALA C 1 79  ? 63.374 4.113   26.470  1.00 41.09 ? 479 ALA C CB  1 
ATOM   2775 N  N   . LEU C 1 80  ? 61.033 2.820   24.551  1.00 43.44 ? 480 LEU C N   1 
ATOM   2776 C  CA  . LEU C 1 80  ? 59.782 2.068   24.514  1.00 38.80 ? 480 LEU C CA  1 
ATOM   2777 C  C   . LEU C 1 80  ? 59.419 1.512   23.151  1.00 38.37 ? 480 LEU C C   1 
ATOM   2778 O  O   . LEU C 1 80  ? 58.246 1.319   22.876  1.00 40.37 ? 480 LEU C O   1 
ATOM   2779 C  CB  . LEU C 1 80  ? 58.643 2.959   25.004  1.00 38.38 ? 480 LEU C CB  1 
ATOM   2780 C  CG  . LEU C 1 80  ? 58.868 3.703   26.321  1.00 36.89 ? 480 LEU C CG  1 
ATOM   2781 C  CD1 . LEU C 1 80  ? 57.891 4.856   26.431  1.00 42.34 ? 480 LEU C CD1 1 
ATOM   2782 C  CD2 . LEU C 1 80  ? 58.761 2.768   27.515  1.00 40.48 ? 480 LEU C CD2 1 
ATOM   2783 N  N   . SER C 1 81  ? 60.409 1.204   22.317  1.00 40.38 ? 481 SER C N   1 
ATOM   2784 C  CA  . SER C 1 81  ? 60.149 0.674   20.971  1.00 42.13 ? 481 SER C CA  1 
ATOM   2785 C  C   . SER C 1 81  ? 59.393 -0.668  20.953  1.00 42.42 ? 481 SER C C   1 
ATOM   2786 O  O   . SER C 1 81  ? 58.448 -0.853  20.172  1.00 39.16 ? 481 SER C O   1 
ATOM   2787 C  CB  . SER C 1 81  ? 61.456 0.548   20.180  1.00 42.98 ? 481 SER C CB  1 
ATOM   2788 O  OG  . SER C 1 81  ? 62.403 -0.229  20.894  1.00 52.89 ? 481 SER C OG  1 
ATOM   2789 N  N   . GLU C 1 82  ? 59.827 -1.604  21.792  1.00 41.03 ? 482 GLU C N   1 
ATOM   2790 C  CA  . GLU C 1 82  ? 59.198 -2.920  21.891  1.00 41.56 ? 482 GLU C CA  1 
ATOM   2791 C  C   . GLU C 1 82  ? 57.758 -2.761  22.393  1.00 38.83 ? 482 GLU C C   1 
ATOM   2792 O  O   . GLU C 1 82  ? 56.839 -3.430  21.918  1.00 35.26 ? 482 GLU C O   1 
ATOM   2793 C  CB  . GLU C 1 82  ? 60.007 -3.816  22.848  1.00 49.26 ? 482 GLU C CB  1 
ATOM   2794 C  CG  . GLU C 1 82  ? 59.415 -5.221  23.117  1.00 61.52 ? 482 GLU C CG  1 
ATOM   2795 C  CD  . GLU C 1 82  ? 58.871 -5.414  24.556  1.00 68.63 ? 482 GLU C CD  1 
ATOM   2796 O  OE1 . GLU C 1 82  ? 57.708 -5.863  24.705  1.00 69.12 ? 482 GLU C OE1 1 
ATOM   2797 O  OE2 . GLU C 1 82  ? 59.609 -5.141  25.537  1.00 70.55 ? 482 GLU C OE2 1 
ATOM   2798 N  N   . LEU C 1 83  ? 57.571 -1.856  23.346  1.00 35.56 ? 483 LEU C N   1 
ATOM   2799 C  CA  . LEU C 1 83  ? 56.257 -1.604  23.908  1.00 35.37 ? 483 LEU C CA  1 
ATOM   2800 C  C   . LEU C 1 83  ? 55.342 -0.903  22.915  1.00 33.74 ? 483 LEU C C   1 
ATOM   2801 O  O   . LEU C 1 83  ? 54.130 -1.096  22.930  1.00 32.42 ? 483 LEU C O   1 
ATOM   2802 C  CB  . LEU C 1 83  ? 56.375 -0.774  25.179  1.00 36.45 ? 483 LEU C CB  1 
ATOM   2803 C  CG  . LEU C 1 83  ? 56.858 -1.551  26.392  1.00 40.60 ? 483 LEU C CG  1 
ATOM   2804 C  CD1 . LEU C 1 83  ? 56.777 -0.629  27.597  1.00 44.20 ? 483 LEU C CD1 1 
ATOM   2805 C  CD2 . LEU C 1 83  ? 56.001 -2.806  26.593  1.00 39.72 ? 483 LEU C CD2 1 
ATOM   2806 N  N   . SER C 1 84  ? 55.934 -0.065  22.077  1.00 34.06 ? 484 SER C N   1 
ATOM   2807 C  CA  . SER C 1 84  ? 55.212 0.666   21.053  1.00 34.61 ? 484 SER C CA  1 
ATOM   2808 C  C   . SER C 1 84  ? 54.579 -0.348  20.095  1.00 36.85 ? 484 SER C C   1 
ATOM   2809 O  O   . SER C 1 84  ? 53.379 -0.307  19.821  1.00 34.83 ? 484 SER C O   1 
ATOM   2810 C  CB  . SER C 1 84  ? 56.195 1.559   20.305  1.00 34.86 ? 484 SER C CB  1 
ATOM   2811 O  OG  . SER C 1 84  ? 55.525 2.432   19.425  1.00 46.78 ? 484 SER C OG  1 
ATOM   2812 N  N   . ASP C 1 85  ? 55.389 -1.296  19.632  1.00 39.35 ? 485 ASP C N   1 
ATOM   2813 C  CA  . ASP C 1 85  ? 54.924 -2.325  18.710  1.00 38.96 ? 485 ASP C CA  1 
ATOM   2814 C  C   . ASP C 1 85  ? 53.906 -3.282  19.300  1.00 33.23 ? 485 ASP C C   1 
ATOM   2815 O  O   . ASP C 1 85  ? 53.015 -3.733  18.597  1.00 33.44 ? 485 ASP C O   1 
ATOM   2816 C  CB  . ASP C 1 85  ? 56.110 -3.091  18.109  1.00 46.82 ? 485 ASP C CB  1 
ATOM   2817 C  CG  . ASP C 1 85  ? 57.012 -2.191  17.279  1.00 56.53 ? 485 ASP C CG  1 
ATOM   2818 O  OD1 . ASP C 1 85  ? 58.134 -1.860  17.748  1.00 59.47 ? 485 ASP C OD1 1 
ATOM   2819 O  OD2 . ASP C 1 85  ? 56.571 -1.780  16.175  1.00 59.57 ? 485 ASP C OD2 1 
ATOM   2820 N  N   . LEU C 1 86  ? 54.024 -3.596  20.580  1.00 29.04 ? 486 LEU C N   1 
ATOM   2821 C  CA  . LEU C 1 86  ? 53.061 -4.492  21.206  1.00 26.93 ? 486 LEU C CA  1 
ATOM   2822 C  C   . LEU C 1 86  ? 51.684 -3.819  21.281  1.00 30.80 ? 486 LEU C C   1 
ATOM   2823 O  O   . LEU C 1 86  ? 50.677 -4.394  20.844  1.00 30.00 ? 486 LEU C O   1 
ATOM   2824 C  CB  . LEU C 1 86  ? 53.513 -4.886  22.614  1.00 23.81 ? 486 LEU C CB  1 
ATOM   2825 C  CG  . LEU C 1 86  ? 52.476 -5.578  23.505  1.00 25.09 ? 486 LEU C CG  1 
ATOM   2826 C  CD1 . LEU C 1 86  ? 52.146 -6.946  22.961  1.00 27.75 ? 486 LEU C CD1 1 
ATOM   2827 C  CD2 . LEU C 1 86  ? 52.984 -5.691  24.922  1.00 23.70 ? 486 LEU C CD2 1 
ATOM   2828 N  N   . HIS C 1 87  ? 51.644 -2.587  21.794  1.00 30.65 ? 487 HIS C N   1 
ATOM   2829 C  CA  . HIS C 1 87  ? 50.385 -1.866  21.947  1.00 27.13 ? 487 HIS C CA  1 
ATOM   2830 C  C   . HIS C 1 87  ? 49.738 -1.424  20.652  1.00 26.36 ? 487 HIS C C   1 
ATOM   2831 O  O   . HIS C 1 87  ? 48.537 -1.602  20.481  1.00 30.36 ? 487 HIS C O   1 
ATOM   2832 C  CB  . HIS C 1 87  ? 50.555 -0.685  22.890  1.00 21.29 ? 487 HIS C CB  1 
ATOM   2833 C  CG  . HIS C 1 87  ? 50.835 -1.088  24.303  1.00 21.17 ? 487 HIS C CG  1 
ATOM   2834 N  ND1 . HIS C 1 87  ? 52.083 -1.414  24.785  1.00 20.57 ? 487 HIS C ND1 1 
ATOM   2835 C  CD2 . HIS C 1 87  ? 49.993 -1.249  25.352  1.00 24.20 ? 487 HIS C CD2 1 
ATOM   2836 C  CE1 . HIS C 1 87  ? 51.967 -1.760  26.064  1.00 20.29 ? 487 HIS C CE1 1 
ATOM   2837 N  NE2 . HIS C 1 87  ? 50.715 -1.674  26.468  1.00 29.12 ? 487 HIS C NE2 1 
ATOM   2838 N  N   . ALA C 1 88  ? 50.529 -0.900  19.724  1.00 29.59 ? 488 ALA C N   1 
ATOM   2839 C  CA  . ALA C 1 88  ? 50.002 -0.436  18.447  1.00 30.66 ? 488 ALA C CA  1 
ATOM   2840 C  C   . ALA C 1 88  ? 49.759 -1.505  17.386  1.00 31.92 ? 488 ALA C C   1 
ATOM   2841 O  O   . ALA C 1 88  ? 48.691 -1.548  16.796  1.00 36.99 ? 488 ALA C O   1 
ATOM   2842 C  CB  . ALA C 1 88  ? 50.877 0.688   17.885  1.00 28.21 ? 488 ALA C CB  1 
ATOM   2843 N  N   . HIS C 1 89  ? 50.718 -2.397  17.168  1.00 37.35 ? 489 HIS C N   1 
ATOM   2844 C  CA  . HIS C 1 89  ? 50.581 -3.425  16.130  1.00 35.58 ? 489 HIS C CA  1 
ATOM   2845 C  C   . HIS C 1 89  ? 49.877 -4.742  16.522  1.00 32.49 ? 489 HIS C C   1 
ATOM   2846 O  O   . HIS C 1 89  ? 49.009 -5.201  15.784  1.00 34.77 ? 489 HIS C O   1 
ATOM   2847 C  CB  . HIS C 1 89  ? 51.953 -3.669  15.454  1.00 39.62 ? 489 HIS C CB  1 
ATOM   2848 C  CG  . HIS C 1 89  ? 51.878 -4.411  14.151  1.00 49.90 ? 489 HIS C CG  1 
ATOM   2849 N  ND1 . HIS C 1 89  ? 51.776 -3.772  12.932  1.00 55.34 ? 489 HIS C ND1 1 
ATOM   2850 C  CD2 . HIS C 1 89  ? 51.864 -5.740  13.879  1.00 52.51 ? 489 HIS C CD2 1 
ATOM   2851 C  CE1 . HIS C 1 89  ? 51.693 -4.673  11.968  1.00 56.90 ? 489 HIS C CE1 1 
ATOM   2852 N  NE2 . HIS C 1 89  ? 51.744 -5.875  12.517  1.00 55.54 ? 489 HIS C NE2 1 
ATOM   2853 N  N   . LYS C 1 90  ? 50.210 -5.343  17.666  1.00 33.62 ? 490 LYS C N   1 
ATOM   2854 C  CA  . LYS C 1 90  ? 49.573 -6.611  18.061  1.00 37.47 ? 490 LYS C CA  1 
ATOM   2855 C  C   . LYS C 1 90  ? 48.307 -6.484  18.902  1.00 36.47 ? 490 LYS C C   1 
ATOM   2856 O  O   . LYS C 1 90  ? 47.376 -7.276  18.771  1.00 37.97 ? 490 LYS C O   1 
ATOM   2857 C  CB  . LYS C 1 90  ? 50.566 -7.548  18.767  1.00 39.21 ? 490 LYS C CB  1 
ATOM   2858 C  CG  . LYS C 1 90  ? 51.639 -8.110  17.835  1.00 47.85 ? 490 LYS C CG  1 
ATOM   2859 C  CD  . LYS C 1 90  ? 52.639 -8.984  18.598  1.00 54.74 ? 490 LYS C CD  1 
ATOM   2860 C  CE  . LYS C 1 90  ? 53.972 -9.133  17.840  1.00 54.30 ? 490 LYS C CE  1 
ATOM   2861 N  NZ  . LYS C 1 90  ? 54.645 -7.810  17.627  1.00 48.90 ? 490 LYS C NZ  1 
ATOM   2862 N  N   . LEU C 1 91  ? 48.266 -5.491  19.773  1.00 35.42 ? 491 LEU C N   1 
ATOM   2863 C  CA  . LEU C 1 91  ? 47.099 -5.323  20.605  1.00 32.49 ? 491 LEU C CA  1 
ATOM   2864 C  C   . LEU C 1 91  ? 46.064 -4.387  19.997  1.00 32.85 ? 491 LEU C C   1 
ATOM   2865 O  O   . LEU C 1 91  ? 44.886 -4.487  20.336  1.00 38.33 ? 491 LEU C O   1 
ATOM   2866 C  CB  . LEU C 1 91  ? 47.497 -4.845  21.998  1.00 32.78 ? 491 LEU C CB  1 
ATOM   2867 C  CG  . LEU C 1 91  ? 48.390 -5.770  22.828  1.00 34.97 ? 491 LEU C CG  1 
ATOM   2868 C  CD1 . LEU C 1 91  ? 48.912 -5.038  24.067  1.00 31.96 ? 491 LEU C CD1 1 
ATOM   2869 C  CD2 . LEU C 1 91  ? 47.632 -7.014  23.211  1.00 35.82 ? 491 LEU C CD2 1 
ATOM   2870 N  N   . ARG C 1 92  ? 46.485 -3.487  19.109  1.00 27.84 ? 492 ARG C N   1 
ATOM   2871 C  CA  . ARG C 1 92  ? 45.567 -2.531  18.476  1.00 29.88 ? 492 ARG C CA  1 
ATOM   2872 C  C   . ARG C 1 92  ? 44.774 -1.683  19.500  1.00 30.56 ? 492 ARG C C   1 
ATOM   2873 O  O   . ARG C 1 92  ? 43.580 -1.452  19.322  1.00 30.66 ? 492 ARG C O   1 
ATOM   2874 C  CB  . ARG C 1 92  ? 44.577 -3.269  17.564  1.00 29.71 ? 492 ARG C CB  1 
ATOM   2875 C  CG  . ARG C 1 92  ? 45.187 -4.026  16.413  1.00 33.31 ? 492 ARG C CG  1 
ATOM   2876 C  CD  . ARG C 1 92  ? 45.521 -3.117  15.256  1.00 41.09 ? 492 ARG C CD  1 
ATOM   2877 N  NE  . ARG C 1 92  ? 45.989 -3.872  14.094  1.00 48.44 ? 492 ARG C NE  1 
ATOM   2878 C  CZ  . ARG C 1 92  ? 46.951 -3.468  13.267  1.00 54.52 ? 492 ARG C CZ  1 
ATOM   2879 N  NH1 . ARG C 1 92  ? 47.564 -2.298  13.448  1.00 58.34 ? 492 ARG C NH1 1 
ATOM   2880 N  NH2 . ARG C 1 92  ? 47.338 -4.262  12.279  1.00 58.53 ? 492 ARG C NH2 1 
ATOM   2881 N  N   . VAL C 1 93  ? 45.421 -1.260  20.585  1.00 30.52 ? 493 VAL C N   1 
ATOM   2882 C  CA  . VAL C 1 93  ? 44.752 -0.462  21.614  1.00 29.10 ? 493 VAL C CA  1 
ATOM   2883 C  C   . VAL C 1 93  ? 44.346 0.912   21.090  1.00 31.25 ? 493 VAL C C   1 
ATOM   2884 O  O   . VAL C 1 93  ? 45.176 1.665   20.589  1.00 31.63 ? 493 VAL C O   1 
ATOM   2885 C  CB  . VAL C 1 93  ? 45.627 -0.267  22.889  1.00 27.19 ? 493 VAL C CB  1 
ATOM   2886 C  CG1 . VAL C 1 93  ? 44.850 0.516   23.942  1.00 25.09 ? 493 VAL C CG1 1 
ATOM   2887 C  CG2 . VAL C 1 93  ? 46.058 -1.624  23.463  1.00 21.17 ? 493 VAL C CG2 1 
ATOM   2888 N  N   . ASP C 1 94  ? 43.063 1.225   21.245  1.00 27.82 ? 494 ASP C N   1 
ATOM   2889 C  CA  . ASP C 1 94  ? 42.477 2.482   20.827  1.00 25.52 ? 494 ASP C CA  1 
ATOM   2890 C  C   . ASP C 1 94  ? 43.124 3.553   21.684  1.00 20.82 ? 494 ASP C C   1 
ATOM   2891 O  O   . ASP C 1 94  ? 43.143 3.437   22.896  1.00 22.61 ? 494 ASP C O   1 
ATOM   2892 C  CB  . ASP C 1 94  ? 40.974 2.420   21.116  1.00 26.91 ? 494 ASP C CB  1 
ATOM   2893 C  CG  . ASP C 1 94  ? 40.197 3.552   20.504  1.00 22.70 ? 494 ASP C CG  1 
ATOM   2894 O  OD1 . ASP C 1 94  ? 40.586 4.720   20.642  1.00 29.09 ? 494 ASP C OD1 1 
ATOM   2895 O  OD2 . ASP C 1 94  ? 39.143 3.272   19.917  1.00 30.25 ? 494 ASP C OD2 1 
ATOM   2896 N  N   . PRO C 1 95  ? 43.628 4.630   21.065  1.00 26.46 ? 495 PRO C N   1 
ATOM   2897 C  CA  . PRO C 1 95  ? 44.292 5.772   21.703  1.00 27.10 ? 495 PRO C CA  1 
ATOM   2898 C  C   . PRO C 1 95  ? 43.523 6.383   22.866  1.00 24.07 ? 495 PRO C C   1 
ATOM   2899 O  O   . PRO C 1 95  ? 44.110 6.847   23.831  1.00 27.08 ? 495 PRO C O   1 
ATOM   2900 C  CB  . PRO C 1 95  ? 44.441 6.749   20.549  1.00 27.32 ? 495 PRO C CB  1 
ATOM   2901 C  CG  . PRO C 1 95  ? 44.694 5.832   19.404  1.00 30.10 ? 495 PRO C CG  1 
ATOM   2902 C  CD  . PRO C 1 95  ? 43.627 4.801   19.602  1.00 24.50 ? 495 PRO C CD  1 
ATOM   2903 N  N   . VAL C 1 96  ? 42.208 6.347   22.779  1.00 22.90 ? 496 VAL C N   1 
ATOM   2904 C  CA  . VAL C 1 96  ? 41.367 6.885   23.833  1.00 28.04 ? 496 VAL C CA  1 
ATOM   2905 C  C   . VAL C 1 96  ? 41.731 6.299   25.189  1.00 24.97 ? 496 VAL C C   1 
ATOM   2906 O  O   . VAL C 1 96  ? 41.756 7.016   26.178  1.00 28.62 ? 496 VAL C O   1 
ATOM   2907 C  CB  . VAL C 1 96  ? 39.862 6.598   23.549  1.00 33.92 ? 496 VAL C CB  1 
ATOM   2908 C  CG1 . VAL C 1 96  ? 39.002 6.962   24.756  1.00 36.17 ? 496 VAL C CG1 1 
ATOM   2909 C  CG2 . VAL C 1 96  ? 39.399 7.395   22.322  1.00 33.08 ? 496 VAL C CG2 1 
ATOM   2910 N  N   . ASN C 1 97  ? 42.052 5.015   25.222  1.00 23.54 ? 497 ASN C N   1 
ATOM   2911 C  CA  . ASN C 1 97  ? 42.382 4.346   26.475  1.00 25.28 ? 497 ASN C CA  1 
ATOM   2912 C  C   . ASN C 1 97  ? 43.625 4.860   27.197  1.00 22.99 ? 497 ASN C C   1 
ATOM   2913 O  O   . ASN C 1 97  ? 43.730 4.747   28.416  1.00 25.12 ? 497 ASN C O   1 
ATOM   2914 C  CB  . ASN C 1 97  ? 42.458 2.836   26.260  1.00 24.11 ? 497 ASN C CB  1 
ATOM   2915 C  CG  . ASN C 1 97  ? 41.109 2.235   25.931  1.00 26.82 ? 497 ASN C CG  1 
ATOM   2916 O  OD1 . ASN C 1 97  ? 40.248 2.112   26.797  1.00 33.80 ? 497 ASN C OD1 1 
ATOM   2917 N  ND2 . ASN C 1 97  ? 40.903 1.885   24.686  1.00 29.97 ? 497 ASN C ND2 1 
ATOM   2918 N  N   . PHE C 1 98  ? 44.594 5.376   26.458  1.00 23.56 ? 498 PHE C N   1 
ATOM   2919 C  CA  . PHE C 1 98  ? 45.803 5.904   27.080  1.00 25.55 ? 498 PHE C CA  1 
ATOM   2920 C  C   . PHE C 1 98  ? 45.521 7.113   27.951  1.00 23.32 ? 498 PHE C C   1 
ATOM   2921 O  O   . PHE C 1 98  ? 46.189 7.303   28.968  1.00 26.93 ? 498 PHE C O   1 
ATOM   2922 C  CB  . PHE C 1 98  ? 46.871 6.217   26.039  1.00 24.46 ? 498 PHE C CB  1 
ATOM   2923 C  CG  . PHE C 1 98  ? 47.406 4.996   25.360  1.00 24.41 ? 498 PHE C CG  1 
ATOM   2924 C  CD1 . PHE C 1 98  ? 48.512 4.338   25.856  1.00 23.66 ? 498 PHE C CD1 1 
ATOM   2925 C  CD2 . PHE C 1 98  ? 46.795 4.493   24.226  1.00 23.30 ? 498 PHE C CD2 1 
ATOM   2926 C  CE1 . PHE C 1 98  ? 49.004 3.190   25.227  1.00 29.47 ? 498 PHE C CE1 1 
ATOM   2927 C  CE2 . PHE C 1 98  ? 47.278 3.358   23.601  1.00 28.96 ? 498 PHE C CE2 1 
ATOM   2928 C  CZ  . PHE C 1 98  ? 48.388 2.703   24.102  1.00 28.25 ? 498 PHE C CZ  1 
ATOM   2929 N  N   . LYS C 1 99  ? 44.513 7.893   27.572  1.00 24.72 ? 499 LYS C N   1 
ATOM   2930 C  CA  . LYS C 1 99  ? 44.084 9.080   28.316  1.00 25.54 ? 499 LYS C CA  1 
ATOM   2931 C  C   . LYS C 1 99  ? 43.385 8.660   29.617  1.00 23.18 ? 499 LYS C C   1 
ATOM   2932 O  O   . LYS C 1 99  ? 43.487 9.306   30.658  1.00 22.55 ? 499 LYS C O   1 
ATOM   2933 C  CB  . LYS C 1 99  ? 43.143 9.923   27.428  1.00 28.45 ? 499 LYS C CB  1 
ATOM   2934 C  CG  . LYS C 1 99  ? 43.850 10.466  26.186  1.00 35.49 ? 499 LYS C CG  1 
ATOM   2935 C  CD  . LYS C 1 99  ? 42.905 10.839  25.048  1.00 42.43 ? 499 LYS C CD  1 
ATOM   2936 C  CE  . LYS C 1 99  ? 42.101 12.105  25.321  1.00 49.55 ? 499 LYS C CE  1 
ATOM   2937 N  NZ  . LYS C 1 99  ? 41.263 12.552  24.132  1.00 50.12 ? 499 LYS C NZ  1 
ATOM   2938 N  N   . LEU C 1 100 ? 42.719 7.517   29.569  1.00 24.09 ? 500 LEU C N   1 
ATOM   2939 C  CA  . LEU C 1 100 ? 42.029 7.003   30.732  1.00 22.77 ? 500 LEU C CA  1 
ATOM   2940 C  C   . LEU C 1 100 ? 43.038 6.424   31.722  1.00 21.29 ? 500 LEU C C   1 
ATOM   2941 O  O   . LEU C 1 100 ? 42.876 6.551   32.930  1.00 23.61 ? 500 LEU C O   1 
ATOM   2942 C  CB  . LEU C 1 100 ? 40.988 5.967   30.317  1.00 21.99 ? 500 LEU C CB  1 
ATOM   2943 C  CG  . LEU C 1 100 ? 39.999 6.436   29.255  1.00 23.91 ? 500 LEU C CG  1 
ATOM   2944 C  CD1 . LEU C 1 100 ? 39.028 5.318   28.903  1.00 22.39 ? 500 LEU C CD1 1 
ATOM   2945 C  CD2 . LEU C 1 100 ? 39.260 7.652   29.733  1.00 24.38 ? 500 LEU C CD2 1 
ATOM   2946 N  N   . LEU C 1 101 ? 44.069 5.751   31.212  1.00 23.55 ? 501 LEU C N   1 
ATOM   2947 C  CA  . LEU C 1 101 ? 45.082 5.201   32.100  1.00 23.69 ? 501 LEU C CA  1 
ATOM   2948 C  C   . LEU C 1 101 ? 45.947 6.349   32.682  1.00 22.59 ? 501 LEU C C   1 
ATOM   2949 O  O   . LEU C 1 101 ? 46.252 6.357   33.875  1.00 23.10 ? 501 LEU C O   1 
ATOM   2950 C  CB  . LEU C 1 101 ? 45.934 4.159   31.374  1.00 20.85 ? 501 LEU C CB  1 
ATOM   2951 C  CG  . LEU C 1 101 ? 47.075 3.515   32.186  1.00 25.39 ? 501 LEU C CG  1 
ATOM   2952 C  CD1 . LEU C 1 101 ? 46.599 2.997   33.528  1.00 23.14 ? 501 LEU C CD1 1 
ATOM   2953 C  CD2 . LEU C 1 101 ? 47.704 2.403   31.397  1.00 28.00 ? 501 LEU C CD2 1 
ATOM   2954 N  N   . SER C 1 102 ? 46.220 7.376   31.878  1.00 19.78 ? 502 SER C N   1 
ATOM   2955 C  CA  . SER C 1 102 ? 47.018 8.513   32.330  1.00 22.10 ? 502 SER C CA  1 
ATOM   2956 C  C   . SER C 1 102 ? 46.265 9.196   33.451  1.00 19.54 ? 502 SER C C   1 
ATOM   2957 O  O   . SER C 1 102 ? 46.836 9.493   34.495  1.00 23.00 ? 502 SER C O   1 
ATOM   2958 C  CB  . SER C 1 102 ? 47.278 9.529   31.198  1.00 20.28 ? 502 SER C CB  1 
ATOM   2959 O  OG  . SER C 1 102 ? 48.025 8.964   30.148  1.00 27.75 ? 502 SER C OG  1 
ATOM   2960 N  N   . HIS C 1 103 ? 44.969 9.400   33.246  1.00 21.90 ? 503 HIS C N   1 
ATOM   2961 C  CA  . HIS C 1 103 ? 44.128 10.008  34.265  1.00 21.27 ? 503 HIS C CA  1 
ATOM   2962 C  C   . HIS C 1 103 ? 44.087 9.178   35.559  1.00 20.34 ? 503 HIS C C   1 
ATOM   2963 O  O   . HIS C 1 103 ? 44.150 9.740   36.651  1.00 21.86 ? 503 HIS C O   1 
ATOM   2964 C  CB  . HIS C 1 103 ? 42.697 10.262  33.726  1.00 20.46 ? 503 HIS C CB  1 
ATOM   2965 C  CG  . HIS C 1 103 ? 41.730 10.755  34.759  1.00 20.48 ? 503 HIS C CG  1 
ATOM   2966 N  ND1 . HIS C 1 103 ? 40.766 9.942   35.318  1.00 20.39 ? 503 HIS C ND1 1 
ATOM   2967 C  CD2 . HIS C 1 103 ? 41.613 11.952  35.392  1.00 21.56 ? 503 HIS C CD2 1 
ATOM   2968 C  CE1 . HIS C 1 103 ? 40.110 10.605  36.253  1.00 18.44 ? 503 HIS C CE1 1 
ATOM   2969 N  NE2 . HIS C 1 103 ? 40.599 11.827  36.318  1.00 20.41 ? 503 HIS C NE2 1 
ATOM   2970 N  N   . SER C 1 104 ? 44.066 7.854   35.457  1.00 16.76 ? 504 SER C N   1 
ATOM   2971 C  CA  . SER C 1 104 ? 43.983 7.042   36.651  1.00 18.27 ? 504 SER C CA  1 
ATOM   2972 C  C   . SER C 1 104 ? 45.274 7.087   37.404  1.00 18.49 ? 504 SER C C   1 
ATOM   2973 O  O   . SER C 1 104 ? 45.297 6.898   38.606  1.00 22.25 ? 504 SER C O   1 
ATOM   2974 C  CB  . SER C 1 104 ? 43.645 5.606   36.292  1.00 18.23 ? 504 SER C CB  1 
ATOM   2975 O  OG  . SER C 1 104 ? 42.546 5.589   35.395  1.00 24.46 ? 504 SER C OG  1 
ATOM   2976 N  N   . LEU C 1 105 ? 46.357 7.234   36.660  1.00 24.52 ? 505 LEU C N   1 
ATOM   2977 C  CA  . LEU C 1 105 ? 47.695 7.377   37.236  1.00 26.05 ? 505 LEU C CA  1 
ATOM   2978 C  C   . LEU C 1 105 ? 47.794 8.694   38.030  1.00 26.57 ? 505 LEU C C   1 
ATOM   2979 O  O   . LEU C 1 105 ? 48.205 8.711   39.194  1.00 28.05 ? 505 LEU C O   1 
ATOM   2980 C  CB  . LEU C 1 105 ? 48.747 7.347   36.137  1.00 33.15 ? 505 LEU C CB  1 
ATOM   2981 C  CG  . LEU C 1 105 ? 49.552 6.045   36.070  1.00 36.95 ? 505 LEU C CG  1 
ATOM   2982 C  CD1 . LEU C 1 105 ? 50.098 5.799   34.677  1.00 37.24 ? 505 LEU C CD1 1 
ATOM   2983 C  CD2 . LEU C 1 105 ? 50.669 6.095   37.107  1.00 38.17 ? 505 LEU C CD2 1 
ATOM   2984 N  N   . LEU C 1 106 ? 47.377 9.796   37.411  1.00 27.44 ? 506 LEU C N   1 
ATOM   2985 C  CA  . LEU C 1 106 ? 47.390 11.090  38.081  1.00 26.60 ? 506 LEU C CA  1 
ATOM   2986 C  C   . LEU C 1 106 ? 46.547 11.098  39.371  1.00 26.68 ? 506 LEU C C   1 
ATOM   2987 O  O   . LEU C 1 106 ? 46.930 11.712  40.361  1.00 23.81 ? 506 LEU C O   1 
ATOM   2988 C  CB  . LEU C 1 106 ? 46.937 12.171  37.117  1.00 25.34 ? 506 LEU C CB  1 
ATOM   2989 C  CG  . LEU C 1 106 ? 47.971 12.391  36.011  1.00 24.99 ? 506 LEU C CG  1 
ATOM   2990 C  CD1 . LEU C 1 106 ? 47.438 13.361  34.972  1.00 23.82 ? 506 LEU C CD1 1 
ATOM   2991 C  CD2 . LEU C 1 106 ? 49.257 12.919  36.614  1.00 24.37 ? 506 LEU C CD2 1 
ATOM   2992 N  N   . VAL C 1 107 ? 45.431 10.376  39.381  1.00 26.01 ? 507 VAL C N   1 
ATOM   2993 C  CA  . VAL C 1 107 ? 44.571 10.314  40.562  1.00 26.68 ? 507 VAL C CA  1 
ATOM   2994 C  C   . VAL C 1 107 ? 45.271 9.499   41.669  1.00 24.86 ? 507 VAL C C   1 
ATOM   2995 O  O   . VAL C 1 107 ? 45.181 9.822   42.857  1.00 22.57 ? 507 VAL C O   1 
ATOM   2996 C  CB  . VAL C 1 107 ? 43.177 9.706   40.218  1.00 25.72 ? 507 VAL C CB  1 
ATOM   2997 C  CG1 . VAL C 1 107 ? 42.389 9.365   41.492  1.00 20.54 ? 507 VAL C CG1 1 
ATOM   2998 C  CG2 . VAL C 1 107 ? 42.385 10.681  39.402  1.00 24.92 ? 507 VAL C CG2 1 
ATOM   2999 N  N   . THR C 1 108 ? 45.956 8.436   41.269  1.00 22.29 ? 508 THR C N   1 
ATOM   3000 C  CA  . THR C 1 108 ? 46.686 7.601   42.198  1.00 25.56 ? 508 THR C CA  1 
ATOM   3001 C  C   . THR C 1 108 ? 47.833 8.386   42.813  1.00 24.50 ? 508 THR C C   1 
ATOM   3002 O  O   . THR C 1 108 ? 48.045 8.357   44.023  1.00 24.96 ? 508 THR C O   1 
ATOM   3003 C  CB  . THR C 1 108 ? 47.224 6.365   41.478  1.00 23.74 ? 508 THR C CB  1 
ATOM   3004 O  OG1 . THR C 1 108 ? 46.118 5.636   40.959  1.00 28.05 ? 508 THR C OG1 1 
ATOM   3005 C  CG2 . THR C 1 108 ? 47.997 5.476   42.412  1.00 24.21 ? 508 THR C CG2 1 
ATOM   3006 N  N   . LEU C 1 109 ? 48.565 9.102   41.969  1.00 22.86 ? 509 LEU C N   1 
ATOM   3007 C  CA  . LEU C 1 109 ? 49.685 9.900   42.430  1.00 26.48 ? 509 LEU C CA  1 
ATOM   3008 C  C   . LEU C 1 109 ? 49.196 11.007  43.346  1.00 27.27 ? 509 LEU C C   1 
ATOM   3009 O  O   . LEU C 1 109 ? 49.758 11.216  44.418  1.00 31.46 ? 509 LEU C O   1 
ATOM   3010 C  CB  . LEU C 1 109 ? 50.451 10.489  41.250  1.00 24.72 ? 509 LEU C CB  1 
ATOM   3011 C  CG  . LEU C 1 109 ? 51.669 9.745   40.704  1.00 28.84 ? 509 LEU C CG  1 
ATOM   3012 C  CD1 . LEU C 1 109 ? 51.475 8.247   40.729  1.00 36.60 ? 509 LEU C CD1 1 
ATOM   3013 C  CD2 . LEU C 1 109 ? 51.922 10.217  39.298  1.00 34.90 ? 509 LEU C CD2 1 
ATOM   3014 N  N   . ALA C 1 110 ? 48.091 11.645  42.960  1.00 28.37 ? 510 ALA C N   1 
ATOM   3015 C  CA  . ALA C 1 110 ? 47.534 12.747  43.730  1.00 22.48 ? 510 ALA C CA  1 
ATOM   3016 C  C   . ALA C 1 110 ? 47.097 12.340  45.121  1.00 25.26 ? 510 ALA C C   1 
ATOM   3017 O  O   . ALA C 1 110 ? 47.243 13.111  46.057  1.00 24.44 ? 510 ALA C O   1 
ATOM   3018 C  CB  . ALA C 1 110 ? 46.377 13.409  42.982  1.00 21.64 ? 510 ALA C CB  1 
ATOM   3019 N  N   . SER C 1 111 ? 46.633 11.105  45.290  1.00 24.56 ? 511 SER C N   1 
ATOM   3020 C  CA  . SER C 1 111 ? 46.169 10.683  46.598  1.00 26.29 ? 511 SER C CA  1 
ATOM   3021 C  C   . SER C 1 111 ? 47.284 10.229  47.544  1.00 28.38 ? 511 SER C C   1 
ATOM   3022 O  O   . SER C 1 111 ? 47.142 10.266  48.770  1.00 30.22 ? 511 SER C O   1 
ATOM   3023 C  CB  . SER C 1 111 ? 45.091 9.605   46.472  1.00 27.61 ? 511 SER C CB  1 
ATOM   3024 O  OG  . SER C 1 111 ? 45.644 8.316   46.318  1.00 32.43 ? 511 SER C OG  1 
ATOM   3025 N  N   . HIS C 1 112 ? 48.405 9.813   46.971  1.00 29.75 ? 512 HIS C N   1 
ATOM   3026 C  CA  . HIS C 1 112 ? 49.522 9.341   47.766  1.00 28.96 ? 512 HIS C CA  1 
ATOM   3027 C  C   . HIS C 1 112 ? 50.575 10.407  48.008  1.00 29.88 ? 512 HIS C C   1 
ATOM   3028 O  O   . HIS C 1 112 ? 51.308 10.327  48.987  1.00 32.78 ? 512 HIS C O   1 
ATOM   3029 C  CB  . HIS C 1 112 ? 50.137 8.107   47.122  1.00 24.56 ? 512 HIS C CB  1 
ATOM   3030 C  CG  . HIS C 1 112 ? 49.240 6.914   47.168  1.00 28.18 ? 512 HIS C CG  1 
ATOM   3031 N  ND1 . HIS C 1 112 ? 49.046 6.169   48.315  1.00 28.15 ? 512 HIS C ND1 1 
ATOM   3032 C  CD2 . HIS C 1 112 ? 48.475 6.340   46.212  1.00 24.63 ? 512 HIS C CD2 1 
ATOM   3033 C  CE1 . HIS C 1 112 ? 48.206 5.182   48.060  1.00 29.59 ? 512 HIS C CE1 1 
ATOM   3034 N  NE2 . HIS C 1 112 ? 47.841 5.266   46.794  1.00 29.43 ? 512 HIS C NE2 1 
ATOM   3035 N  N   . LEU C 1 113 ? 50.624 11.423  47.160  1.00 29.47 ? 513 LEU C N   1 
ATOM   3036 C  CA  . LEU C 1 113 ? 51.590 12.502  47.329  1.00 32.30 ? 513 LEU C CA  1 
ATOM   3037 C  C   . LEU C 1 113 ? 50.908 13.875  47.395  1.00 33.51 ? 513 LEU C C   1 
ATOM   3038 O  O   . LEU C 1 113 ? 51.230 14.778  46.616  1.00 37.49 ? 513 LEU C O   1 
ATOM   3039 C  CB  . LEU C 1 113 ? 52.609 12.498  46.177  1.00 32.66 ? 513 LEU C CB  1 
ATOM   3040 C  CG  . LEU C 1 113 ? 53.410 11.236  45.847  1.00 33.13 ? 513 LEU C CG  1 
ATOM   3041 C  CD1 . LEU C 1 113 ? 54.353 11.536  44.690  1.00 33.66 ? 513 LEU C CD1 1 
ATOM   3042 C  CD2 . LEU C 1 113 ? 54.183 10.754  47.066  1.00 36.30 ? 513 LEU C CD2 1 
ATOM   3043 N  N   . PRO C 1 114 ? 50.024 14.082  48.375  1.00 34.50 ? 514 PRO C N   1 
ATOM   3044 C  CA  . PRO C 1 114 ? 49.307 15.354  48.536  1.00 38.15 ? 514 PRO C CA  1 
ATOM   3045 C  C   . PRO C 1 114 ? 50.116 16.655  48.431  1.00 37.84 ? 514 PRO C C   1 
ATOM   3046 O  O   . PRO C 1 114 ? 49.735 17.567  47.701  1.00 39.29 ? 514 PRO C O   1 
ATOM   3047 C  CB  . PRO C 1 114 ? 48.699 15.210  49.930  1.00 40.83 ? 514 PRO C CB  1 
ATOM   3048 C  CG  . PRO C 1 114 ? 48.443 13.755  50.028  1.00 37.04 ? 514 PRO C CG  1 
ATOM   3049 C  CD  . PRO C 1 114 ? 49.719 13.176  49.491  1.00 36.42 ? 514 PRO C CD  1 
ATOM   3050 N  N   . SER C 1 115 ? 51.223 16.747  49.162  1.00 41.55 ? 515 SER C N   1 
ATOM   3051 C  CA  . SER C 1 115 ? 52.044 17.963  49.160  1.00 42.29 ? 515 SER C CA  1 
ATOM   3052 C  C   . SER C 1 115 ? 52.961 18.098  47.977  1.00 42.05 ? 515 SER C C   1 
ATOM   3053 O  O   . SER C 1 115 ? 53.356 19.205  47.621  1.00 42.56 ? 515 SER C O   1 
ATOM   3054 C  CB  . SER C 1 115 ? 52.870 18.052  50.435  1.00 42.33 ? 515 SER C CB  1 
ATOM   3055 O  OG  . SER C 1 115 ? 52.003 18.118  51.550  1.00 49.19 ? 515 SER C OG  1 
ATOM   3056 N  N   . ASP C 1 116 ? 53.337 16.968  47.394  1.00 36.88 ? 516 ASP C N   1 
ATOM   3057 C  CA  . ASP C 1 116 ? 54.216 16.990  46.244  1.00 34.86 ? 516 ASP C CA  1 
ATOM   3058 C  C   . ASP C 1 116 ? 53.475 17.217  44.945  1.00 33.24 ? 516 ASP C C   1 
ATOM   3059 O  O   . ASP C 1 116 ? 54.082 17.639  43.958  1.00 31.60 ? 516 ASP C O   1 
ATOM   3060 C  CB  . ASP C 1 116 ? 55.022 15.701  46.171  1.00 38.49 ? 516 ASP C CB  1 
ATOM   3061 C  CG  . ASP C 1 116 ? 55.880 15.498  47.392  1.00 42.88 ? 516 ASP C CG  1 
ATOM   3062 O  OD1 . ASP C 1 116 ? 55.569 14.599  48.201  1.00 50.57 ? 516 ASP C OD1 1 
ATOM   3063 O  OD2 . ASP C 1 116 ? 56.847 16.263  47.557  1.00 41.98 ? 516 ASP C OD2 1 
ATOM   3064 N  N   . PHE C 1 117 ? 52.174 16.930  44.937  1.00 32.82 ? 517 PHE C N   1 
ATOM   3065 C  CA  . PHE C 1 117 ? 51.366 17.093  43.739  1.00 31.34 ? 517 PHE C CA  1 
ATOM   3066 C  C   . PHE C 1 117 ? 50.887 18.530  43.572  1.00 31.12 ? 517 PHE C C   1 
ATOM   3067 O  O   . PHE C 1 117 ? 49.695 18.830  43.663  1.00 33.29 ? 517 PHE C O   1 
ATOM   3068 C  CB  . PHE C 1 117 ? 50.190 16.113  43.746  1.00 30.01 ? 517 PHE C CB  1 
ATOM   3069 C  CG  . PHE C 1 117 ? 49.684 15.749  42.362  1.00 31.07 ? 517 PHE C CG  1 
ATOM   3070 C  CD1 . PHE C 1 117 ? 50.320 14.757  41.612  1.00 31.59 ? 517 PHE C CD1 1 
ATOM   3071 C  CD2 . PHE C 1 117 ? 48.537 16.349  41.833  1.00 28.58 ? 517 PHE C CD2 1 
ATOM   3072 C  CE1 . PHE C 1 117 ? 49.817 14.371  40.354  1.00 31.12 ? 517 PHE C CE1 1 
ATOM   3073 C  CE2 . PHE C 1 117 ? 48.032 15.972  40.583  1.00 29.54 ? 517 PHE C CE2 1 
ATOM   3074 C  CZ  . PHE C 1 117 ? 48.664 14.982  39.848  1.00 28.18 ? 517 PHE C CZ  1 
ATOM   3075 N  N   . THR C 1 118 ? 51.844 19.422  43.355  1.00 31.72 ? 518 THR C N   1 
ATOM   3076 C  CA  . THR C 1 118 ? 51.573 20.830  43.158  1.00 29.49 ? 518 THR C CA  1 
ATOM   3077 C  C   . THR C 1 118 ? 51.056 21.020  41.735  1.00 25.70 ? 518 THR C C   1 
ATOM   3078 O  O   . THR C 1 118 ? 51.149 20.113  40.912  1.00 27.03 ? 518 THR C O   1 
ATOM   3079 C  CB  . THR C 1 118 ? 52.859 21.651  43.324  1.00 27.85 ? 518 THR C CB  1 
ATOM   3080 O  OG1 . THR C 1 118 ? 53.756 21.358  42.247  1.00 31.42 ? 518 THR C OG1 1 
ATOM   3081 C  CG2 . THR C 1 118 ? 53.520 21.309  44.629  1.00 27.09 ? 518 THR C CG2 1 
ATOM   3082 N  N   . PRO C 1 119 ? 50.488 22.201  41.427  1.00 27.50 ? 519 PRO C N   1 
ATOM   3083 C  CA  . PRO C 1 119 ? 49.977 22.458  40.077  1.00 28.69 ? 519 PRO C CA  1 
ATOM   3084 C  C   . PRO C 1 119 ? 51.048 22.264  38.972  1.00 32.75 ? 519 PRO C C   1 
ATOM   3085 O  O   . PRO C 1 119 ? 50.761 21.667  37.929  1.00 33.52 ? 519 PRO C O   1 
ATOM   3086 C  CB  . PRO C 1 119 ? 49.488 23.901  40.181  1.00 26.14 ? 519 PRO C CB  1 
ATOM   3087 C  CG  . PRO C 1 119 ? 48.988 23.974  41.561  1.00 23.88 ? 519 PRO C CG  1 
ATOM   3088 C  CD  . PRO C 1 119 ? 50.067 23.271  42.351  1.00 24.80 ? 519 PRO C CD  1 
ATOM   3089 N  N   . ALA C 1 120 ? 52.282 22.707  39.232  1.00 30.69 ? 520 ALA C N   1 
ATOM   3090 C  CA  . ALA C 1 120 ? 53.396 22.570  38.287  1.00 28.22 ? 520 ALA C CA  1 
ATOM   3091 C  C   . ALA C 1 120 ? 53.792 21.099  38.077  1.00 25.76 ? 520 ALA C C   1 
ATOM   3092 O  O   . ALA C 1 120 ? 54.063 20.667  36.960  1.00 28.27 ? 520 ALA C O   1 
ATOM   3093 C  CB  . ALA C 1 120 ? 54.600 23.385  38.773  1.00 30.80 ? 520 ALA C CB  1 
ATOM   3094 N  N   . VAL C 1 121 ? 53.814 20.323  39.146  1.00 27.18 ? 521 VAL C N   1 
ATOM   3095 C  CA  . VAL C 1 121 ? 54.148 18.912  39.032  1.00 29.43 ? 521 VAL C CA  1 
ATOM   3096 C  C   . VAL C 1 121 ? 53.041 18.221  38.223  1.00 30.64 ? 521 VAL C C   1 
ATOM   3097 O  O   . VAL C 1 121 ? 53.314 17.434  37.322  1.00 33.30 ? 521 VAL C O   1 
ATOM   3098 C  CB  . VAL C 1 121 ? 54.302 18.282  40.423  1.00 23.83 ? 521 VAL C CB  1 
ATOM   3099 C  CG1 . VAL C 1 121 ? 54.373 16.786  40.321  1.00 26.83 ? 521 VAL C CG1 1 
ATOM   3100 C  CG2 . VAL C 1 121 ? 55.566 18.800  41.053  1.00 32.31 ? 521 VAL C CG2 1 
ATOM   3101 N  N   . HIS C 1 122 ? 51.794 18.538  38.552  1.00 30.39 ? 522 HIS C N   1 
ATOM   3102 C  CA  . HIS C 1 122 ? 50.624 18.009  37.860  1.00 27.48 ? 522 HIS C CA  1 
ATOM   3103 C  C   . HIS C 1 122 ? 50.800 18.240  36.356  1.00 24.80 ? 522 HIS C C   1 
ATOM   3104 O  O   . HIS C 1 122 ? 50.734 17.295  35.575  1.00 26.99 ? 522 HIS C O   1 
ATOM   3105 C  CB  . HIS C 1 122 ? 49.372 18.736  38.396  1.00 28.74 ? 522 HIS C CB  1 
ATOM   3106 C  CG  . HIS C 1 122 ? 48.054 18.263  37.838  1.00 29.23 ? 522 HIS C CG  1 
ATOM   3107 N  ND1 . HIS C 1 122 ? 46.849 18.642  38.392  1.00 24.56 ? 522 HIS C ND1 1 
ATOM   3108 C  CD2 . HIS C 1 122 ? 47.744 17.480  36.774  1.00 22.84 ? 522 HIS C CD2 1 
ATOM   3109 C  CE1 . HIS C 1 122 ? 45.859 18.123  37.690  1.00 25.05 ? 522 HIS C CE1 1 
ATOM   3110 N  NE2 . HIS C 1 122 ? 46.377 17.407  36.709  1.00 22.42 ? 522 HIS C NE2 1 
ATOM   3111 N  N   . ALA C 1 123 ? 51.043 19.484  35.953  1.00 24.60 ? 523 ALA C N   1 
ATOM   3112 C  CA  . ALA C 1 123 ? 51.198 19.803  34.537  1.00 23.27 ? 523 ALA C CA  1 
ATOM   3113 C  C   . ALA C 1 123 ? 52.363 19.083  33.872  1.00 25.52 ? 523 ALA C C   1 
ATOM   3114 O  O   . ALA C 1 123 ? 52.272 18.709  32.706  1.00 26.81 ? 523 ALA C O   1 
ATOM   3115 C  CB  . ALA C 1 123 ? 51.334 21.308  34.343  1.00 25.24 ? 523 ALA C CB  1 
ATOM   3116 N  N   . SER C 1 124 ? 53.459 18.923  34.602  1.00 27.54 ? 524 SER C N   1 
ATOM   3117 C  CA  . SER C 1 124 ? 54.632 18.240  34.095  1.00 25.27 ? 524 SER C CA  1 
ATOM   3118 C  C   . SER C 1 124 ? 54.371 16.750  33.881  1.00 25.88 ? 524 SER C C   1 
ATOM   3119 O  O   . SER C 1 124 ? 54.754 16.194  32.852  1.00 26.81 ? 524 SER C O   1 
ATOM   3120 C  CB  . SER C 1 124 ? 55.816 18.466  35.044  1.00 29.85 ? 524 SER C CB  1 
ATOM   3121 O  OG  . SER C 1 124 ? 56.299 19.809  34.951  1.00 29.73 ? 524 SER C OG  1 
ATOM   3122 N  N   . LEU C 1 125 ? 53.686 16.120  34.833  1.00 28.84 ? 525 LEU C N   1 
ATOM   3123 C  CA  . LEU C 1 125 ? 53.345 14.693  34.754  1.00 28.86 ? 525 LEU C CA  1 
ATOM   3124 C  C   . LEU C 1 125 ? 52.361 14.419  33.607  1.00 32.44 ? 525 LEU C C   1 
ATOM   3125 O  O   . LEU C 1 125 ? 52.460 13.411  32.919  1.00 32.27 ? 525 LEU C O   1 
ATOM   3126 C  CB  . LEU C 1 125 ? 52.719 14.219  36.063  1.00 28.94 ? 525 LEU C CB  1 
ATOM   3127 C  CG  . LEU C 1 125 ? 53.504 13.444  37.118  1.00 34.67 ? 525 LEU C CG  1 
ATOM   3128 C  CD1 . LEU C 1 125 ? 54.699 12.726  36.492  1.00 33.83 ? 525 LEU C CD1 1 
ATOM   3129 C  CD2 . LEU C 1 125 ? 53.925 14.373  38.203  1.00 33.02 ? 525 LEU C CD2 1 
ATOM   3130 N  N   . ASP C 1 126 ? 51.381 15.301  33.440  1.00 32.81 ? 526 ASP C N   1 
ATOM   3131 C  CA  . ASP C 1 126 ? 50.401 15.181  32.379  1.00 28.30 ? 526 ASP C CA  1 
ATOM   3132 C  C   . ASP C 1 126 ? 51.104 15.185  31.024  1.00 26.88 ? 526 ASP C C   1 
ATOM   3133 O  O   . ASP C 1 126 ? 50.793 14.362  30.176  1.00 30.96 ? 526 ASP C O   1 
ATOM   3134 C  CB  . ASP C 1 126 ? 49.398 16.336  32.461  1.00 34.09 ? 526 ASP C CB  1 
ATOM   3135 C  CG  . ASP C 1 126 ? 48.339 16.273  31.366  1.00 34.99 ? 526 ASP C CG  1 
ATOM   3136 O  OD1 . ASP C 1 126 ? 48.432 17.041  30.370  1.00 33.84 ? 526 ASP C OD1 1 
ATOM   3137 O  OD2 . ASP C 1 126 ? 47.411 15.448  31.516  1.00 38.68 ? 526 ASP C OD2 1 
ATOM   3138 N  N   . LYS C 1 127 ? 52.049 16.107  30.822  1.00 27.95 ? 527 LYS C N   1 
ATOM   3139 C  CA  . LYS C 1 127 ? 52.810 16.201  29.561  1.00 27.40 ? 527 LYS C CA  1 
ATOM   3140 C  C   . LYS C 1 127 ? 53.612 14.928  29.341  1.00 26.92 ? 527 LYS C C   1 
ATOM   3141 O  O   . LYS C 1 127 ? 53.728 14.427  28.224  1.00 24.80 ? 527 LYS C O   1 
ATOM   3142 C  CB  . LYS C 1 127 ? 53.769 17.393  29.582  1.00 28.17 ? 527 LYS C CB  1 
ATOM   3143 C  CG  . LYS C 1 127 ? 53.107 18.749  29.406  1.00 33.02 ? 527 LYS C CG  1 
ATOM   3144 C  CD  . LYS C 1 127 ? 54.132 19.860  29.263  1.00 37.07 ? 527 LYS C CD  1 
ATOM   3145 C  CE  . LYS C 1 127 ? 53.474 21.204  29.021  1.00 43.52 ? 527 LYS C CE  1 
ATOM   3146 N  NZ  . LYS C 1 127 ? 52.512 21.543  30.107  1.00 53.37 ? 527 LYS C NZ  1 
ATOM   3147 N  N   . PHE C 1 128 ? 54.193 14.430  30.416  1.00 26.34 ? 528 PHE C N   1 
ATOM   3148 C  CA  . PHE C 1 128 ? 54.974 13.209  30.374  1.00 25.61 ? 528 PHE C CA  1 
ATOM   3149 C  C   . PHE C 1 128 ? 54.118 12.008  29.945  1.00 25.37 ? 528 PHE C C   1 
ATOM   3150 O  O   . PHE C 1 128 ? 54.451 11.344  28.960  1.00 28.87 ? 528 PHE C O   1 
ATOM   3151 C  CB  . PHE C 1 128 ? 55.639 13.025  31.741  1.00 23.34 ? 528 PHE C CB  1 
ATOM   3152 C  CG  . PHE C 1 128 ? 56.160 11.656  32.005  1.00 27.11 ? 528 PHE C CG  1 
ATOM   3153 C  CD1 . PHE C 1 128 ? 57.196 11.128  31.249  1.00 23.52 ? 528 PHE C CD1 1 
ATOM   3154 C  CD2 . PHE C 1 128 ? 55.639 10.903  33.052  1.00 25.12 ? 528 PHE C CD2 1 
ATOM   3155 C  CE1 . PHE C 1 128 ? 57.717 9.875   31.549  1.00 27.33 ? 528 PHE C CE1 1 
ATOM   3156 C  CE2 . PHE C 1 128 ? 56.148 9.662   33.358  1.00 21.00 ? 528 PHE C CE2 1 
ATOM   3157 C  CZ  . PHE C 1 128 ? 57.189 9.140   32.600  1.00 29.18 ? 528 PHE C CZ  1 
ATOM   3158 N  N   . LEU C 1 129 ? 52.984 11.786  30.614  1.00 25.46 ? 529 LEU C N   1 
ATOM   3159 C  CA  . LEU C 1 129 ? 52.109 10.669  30.288  1.00 20.90 ? 529 LEU C CA  1 
ATOM   3160 C  C   . LEU C 1 129 ? 51.566 10.826  28.892  1.00 22.96 ? 529 LEU C C   1 
ATOM   3161 O  O   . LEU C 1 129 ? 51.323 9.834   28.219  1.00 25.60 ? 529 LEU C O   1 
ATOM   3162 C  CB  . LEU C 1 129 ? 50.985 10.546  31.303  1.00 18.76 ? 529 LEU C CB  1 
ATOM   3163 C  CG  . LEU C 1 129 ? 51.513 10.116  32.675  1.00 24.80 ? 529 LEU C CG  1 
ATOM   3164 C  CD1 . LEU C 1 129 ? 50.487 10.268  33.782  1.00 27.34 ? 529 LEU C CD1 1 
ATOM   3165 C  CD2 . LEU C 1 129 ? 52.005 8.675   32.590  1.00 31.07 ? 529 LEU C CD2 1 
ATOM   3166 N  N   . ALA C 1 130 ? 51.466 12.066  28.420  1.00 23.79 ? 530 ALA C N   1 
ATOM   3167 C  CA  . ALA C 1 130 ? 50.977 12.331  27.074  1.00 24.41 ? 530 ALA C CA  1 
ATOM   3168 C  C   . ALA C 1 130 ? 52.040 11.963  26.055  1.00 27.91 ? 530 ALA C C   1 
ATOM   3169 O  O   . ALA C 1 130 ? 51.724 11.453  24.982  1.00 30.76 ? 530 ALA C O   1 
ATOM   3170 C  CB  . ALA C 1 130 ? 50.599 13.770  26.923  1.00 22.84 ? 530 ALA C CB  1 
ATOM   3171 N  N   . ASN C 1 131 ? 53.304 12.219  26.399  1.00 32.28 ? 531 ASN C N   1 
ATOM   3172 C  CA  . ASN C 1 131 ? 54.446 11.907  25.528  1.00 33.01 ? 531 ASN C CA  1 
ATOM   3173 C  C   . ASN C 1 131 ? 54.554 10.397  25.426  1.00 29.74 ? 531 ASN C C   1 
ATOM   3174 O  O   . ASN C 1 131 ? 54.783 9.853   24.354  1.00 33.51 ? 531 ASN C O   1 
ATOM   3175 C  CB  . ASN C 1 131 ? 55.760 12.469  26.110  1.00 40.77 ? 531 ASN C CB  1 
ATOM   3176 C  CG  . ASN C 1 131 ? 56.265 13.713  25.364  1.00 50.49 ? 531 ASN C CG  1 
ATOM   3177 O  OD1 . ASN C 1 131 ? 57.384 13.732  24.814  1.00 54.01 ? 531 ASN C OD1 1 
ATOM   3178 N  ND2 . ASN C 1 131 ? 55.464 14.777  25.387  1.00 54.67 ? 531 ASN C ND2 1 
ATOM   3179 N  N   . VAL C 1 132 ? 54.446 9.726   26.568  1.00 28.76 ? 532 VAL C N   1 
ATOM   3180 C  CA  . VAL C 1 132 ? 54.496 8.268   26.608  1.00 29.47 ? 532 VAL C CA  1 
ATOM   3181 C  C   . VAL C 1 132 ? 53.364 7.717   25.736  1.00 29.20 ? 532 VAL C C   1 
ATOM   3182 O  O   . VAL C 1 132 ? 53.613 6.889   24.870  1.00 32.50 ? 532 VAL C O   1 
ATOM   3183 C  CB  . VAL C 1 132 ? 54.373 7.742   28.047  1.00 27.27 ? 532 VAL C CB  1 
ATOM   3184 C  CG1 . VAL C 1 132 ? 54.232 6.226   28.052  1.00 25.39 ? 532 VAL C CG1 1 
ATOM   3185 C  CG2 . VAL C 1 132 ? 55.588 8.155   28.842  1.00 26.18 ? 532 VAL C CG2 1 
ATOM   3186 N  N   . SER C 1 133 ? 52.140 8.214   25.929  1.00 29.46 ? 533 SER C N   1 
ATOM   3187 C  CA  . SER C 1 133 ? 50.994 7.795   25.128  1.00 23.15 ? 533 SER C CA  1 
ATOM   3188 C  C   . SER C 1 133 ? 51.271 7.961   23.649  1.00 24.20 ? 533 SER C C   1 
ATOM   3189 O  O   . SER C 1 133 ? 51.031 7.047   22.859  1.00 27.67 ? 533 SER C O   1 
ATOM   3190 C  CB  . SER C 1 133 ? 49.776 8.616   25.497  1.00 21.90 ? 533 SER C CB  1 
ATOM   3191 O  OG  . SER C 1 133 ? 49.404 8.314   26.817  1.00 26.95 ? 533 SER C OG  1 
ATOM   3192 N  N   . THR C 1 134 ? 51.764 9.138   23.285  1.00 29.42 ? 534 THR C N   1 
ATOM   3193 C  CA  . THR C 1 134 ? 52.083 9.460   21.904  1.00 31.03 ? 534 THR C CA  1 
ATOM   3194 C  C   . THR C 1 134 ? 53.068 8.457   21.315  1.00 32.21 ? 534 THR C C   1 
ATOM   3195 O  O   . THR C 1 134 ? 52.914 8.027   20.167  1.00 32.48 ? 534 THR C O   1 
ATOM   3196 C  CB  . THR C 1 134 ? 52.643 10.894  21.797  1.00 34.80 ? 534 THR C CB  1 
ATOM   3197 O  OG1 . THR C 1 134 ? 51.578 11.829  22.014  1.00 39.36 ? 534 THR C OG1 1 
ATOM   3198 C  CG2 . THR C 1 134 ? 53.285 11.142  20.427  1.00 37.92 ? 534 THR C CG2 1 
ATOM   3199 N  N   . VAL C 1 135 ? 54.051 8.048   22.117  1.00 31.77 ? 535 VAL C N   1 
ATOM   3200 C  CA  . VAL C 1 135 ? 55.058 7.083   21.673  1.00 33.62 ? 535 VAL C CA  1 
ATOM   3201 C  C   . VAL C 1 135 ? 54.446 5.696   21.457  1.00 31.30 ? 535 VAL C C   1 
ATOM   3202 O  O   . VAL C 1 135 ? 54.658 5.075   20.418  1.00 33.53 ? 535 VAL C O   1 
ATOM   3203 C  CB  . VAL C 1 135 ? 56.235 6.998   22.687  1.00 31.64 ? 535 VAL C CB  1 
ATOM   3204 C  CG1 . VAL C 1 135 ? 57.066 5.744   22.460  1.00 32.43 ? 535 VAL C CG1 1 
ATOM   3205 C  CG2 . VAL C 1 135 ? 57.113 8.216   22.556  1.00 25.20 ? 535 VAL C CG2 1 
ATOM   3206 N  N   . LEU C 1 136 ? 53.692 5.214   22.443  1.00 32.02 ? 536 LEU C N   1 
ATOM   3207 C  CA  . LEU C 1 136 ? 53.054 3.907   22.366  1.00 33.22 ? 536 LEU C CA  1 
ATOM   3208 C  C   . LEU C 1 136 ? 52.020 3.708   21.246  1.00 36.25 ? 536 LEU C C   1 
ATOM   3209 O  O   . LEU C 1 136 ? 51.671 2.578   20.900  1.00 39.44 ? 536 LEU C O   1 
ATOM   3210 C  CB  . LEU C 1 136 ? 52.471 3.529   23.727  1.00 33.87 ? 536 LEU C CB  1 
ATOM   3211 C  CG  . LEU C 1 136 ? 53.473 3.407   24.890  1.00 37.13 ? 536 LEU C CG  1 
ATOM   3212 C  CD1 . LEU C 1 136 ? 52.751 2.882   26.106  1.00 37.01 ? 536 LEU C CD1 1 
ATOM   3213 C  CD2 . LEU C 1 136 ? 54.632 2.487   24.558  1.00 32.16 ? 536 LEU C CD2 1 
ATOM   3214 N  N   . THR C 1 137 ? 51.525 4.794   20.676  1.00 37.98 ? 537 THR C N   1 
ATOM   3215 C  CA  . THR C 1 137 ? 50.565 4.694   19.588  1.00 38.37 ? 537 THR C CA  1 
ATOM   3216 C  C   . THR C 1 137 ? 51.223 5.207   18.306  1.00 40.81 ? 537 THR C C   1 
ATOM   3217 O  O   . THR C 1 137 ? 50.564 5.831   17.477  1.00 44.77 ? 537 THR C O   1 
ATOM   3218 C  CB  . THR C 1 137 ? 49.259 5.515   19.906  1.00 39.17 ? 537 THR C CB  1 
ATOM   3219 O  OG1 . THR C 1 137 ? 49.587 6.848   20.337  1.00 36.72 ? 537 THR C OG1 1 
ATOM   3220 C  CG2 . THR C 1 137 ? 48.456 4.831   20.992  1.00 33.10 ? 537 THR C CG2 1 
ATOM   3221 N  N   . SER C 1 138 ? 52.524 4.949   18.153  1.00 45.33 ? 538 SER C N   1 
ATOM   3222 C  CA  . SER C 1 138 ? 53.286 5.419   16.983  1.00 48.75 ? 538 SER C CA  1 
ATOM   3223 C  C   . SER C 1 138 ? 53.223 4.607   15.682  1.00 50.16 ? 538 SER C C   1 
ATOM   3224 O  O   . SER C 1 138 ? 53.340 5.200   14.600  1.00 51.33 ? 538 SER C O   1 
ATOM   3225 C  CB  . SER C 1 138 ? 54.749 5.723   17.353  1.00 49.04 ? 538 SER C CB  1 
ATOM   3226 O  OG  . SER C 1 138 ? 54.908 7.080   17.746  1.00 54.06 ? 538 SER C OG  1 
ATOM   3227 N  N   . LYS C 1 139 ? 53.041 3.281   15.771  1.00 51.65 ? 539 LYS C N   1 
ATOM   3228 C  CA  . LYS C 1 139 ? 52.936 2.420   14.575  1.00 55.11 ? 539 LYS C CA  1 
ATOM   3229 C  C   . LYS C 1 139 ? 51.733 2.805   13.674  1.00 59.61 ? 539 LYS C C   1 
ATOM   3230 O  O   . LYS C 1 139 ? 51.488 2.196   12.619  1.00 60.30 ? 539 LYS C O   1 
ATOM   3231 C  CB  . LYS C 1 139 ? 52.869 0.935   14.965  1.00 56.23 ? 539 LYS C CB  1 
ATOM   3232 C  CG  . LYS C 1 139 ? 52.512 -0.004  13.798  1.00 58.85 ? 539 LYS C CG  1 
ATOM   3233 C  CD  . LYS C 1 139 ? 53.593 -1.053  13.536  1.00 64.07 ? 539 LYS C CD  1 
ATOM   3234 C  CE  . LYS C 1 139 ? 53.960 -1.131  12.049  1.00 64.13 ? 539 LYS C CE  1 
ATOM   3235 N  NZ  . LYS C 1 139 ? 55.438 -1.175  11.807  1.00 64.92 ? 539 LYS C NZ  1 
ATOM   3236 N  N   . TYR C 1 140 ? 51.003 3.834   14.111  1.00 61.82 ? 540 TYR C N   1 
ATOM   3237 C  CA  . TYR C 1 140 ? 49.805 4.441   13.686  1.00 61.21 ? 540 TYR C CA  1 
ATOM   3238 C  C   . TYR C 1 140 ? 49.448 5.935   13.745  1.00 63.05 ? 540 TYR C C   1 
ATOM   3239 O  O   . TYR C 1 140 ? 48.723 6.434   12.864  1.00 62.16 ? 540 TYR C O   1 
ATOM   3240 C  CB  . TYR C 1 140 ? 48.541 3.539   13.707  1.00 60.86 ? 540 TYR C CB  1 
ATOM   3241 C  CG  . TYR C 1 140 ? 48.128 2.861   15.026  1.00 57.18 ? 540 TYR C CG  1 
ATOM   3242 C  CD1 . TYR C 1 140 ? 48.087 3.565   16.244  1.00 54.87 ? 540 TYR C CD1 1 
ATOM   3243 C  CD2 . TYR C 1 140 ? 47.704 1.527   15.031  1.00 57.19 ? 540 TYR C CD2 1 
ATOM   3244 C  CE1 . TYR C 1 140 ? 47.630 2.956   17.429  1.00 51.26 ? 540 TYR C CE1 1 
ATOM   3245 C  CE2 . TYR C 1 140 ? 47.242 0.914   16.208  1.00 54.69 ? 540 TYR C CE2 1 
ATOM   3246 C  CZ  . TYR C 1 140 ? 47.210 1.633   17.396  1.00 53.15 ? 540 TYR C CZ  1 
ATOM   3247 O  OH  . TYR C 1 140 ? 46.746 1.008   18.531  1.00 52.99 ? 540 TYR C OH  1 
ATOM   3248 N  N   . ARG C 1 141 ? 49.912 6.615   14.798  1.00 66.85 ? 541 ARG C N   1 
ATOM   3249 C  CA  . ARG C 1 141 ? 49.800 8.075   14.955  1.00 70.53 ? 541 ARG C CA  1 
ATOM   3250 C  C   . ARG C 1 141 ? 50.721 8.491   16.108  1.00 71.70 ? 541 ARG C C   1 
ATOM   3251 O  O   . ARG C 1 141 ? 50.751 7.760   17.130  1.00 71.21 ? 541 ARG C O   1 
ATOM   3252 C  CB  . ARG C 1 141 ? 48.351 8.490   15.291  1.00 72.64 ? 541 ARG C CB  1 
ATOM   3253 C  CG  . ARG C 1 141 ? 48.086 10.003  15.384  1.00 69.67 ? 541 ARG C CG  1 
ATOM   3254 C  CD  . ARG C 1 141 ? 47.203 10.339  16.581  1.00 71.39 ? 541 ARG C CD  1 
ATOM   3255 N  NE  . ARG C 1 141 ? 45.884 10.829  16.173  1.00 70.24 ? 541 ARG C NE  1 
ATOM   3256 C  CZ  . ARG C 1 141 ? 45.426 10.807  14.920  1.00 71.85 ? 541 ARG C CZ  1 
ATOM   3257 N  NH1 . ARG C 1 141 ? 46.238 11.067  13.894  1.00 69.23 ? 541 ARG C NH1 1 
ATOM   3258 N  NH2 . ARG C 1 141 ? 44.144 10.537  14.692  1.00 69.74 ? 541 ARG C NH2 1 
ATOM   3259 O  OXT . ARG C 1 141 ? 51.392 9.541   15.975  1.00 75.23 ? 541 ARG C OXT 1 
ATOM   3260 N  N   . MET D 2 1   ? 20.727 9.317   37.674  1.00 64.73 ? 602 MET D N   1 
ATOM   3261 C  CA  . MET D 2 1   ? 21.505 8.148   37.178  1.00 63.80 ? 602 MET D CA  1 
ATOM   3262 C  C   . MET D 2 1   ? 22.039 7.458   38.431  1.00 61.73 ? 602 MET D C   1 
ATOM   3263 O  O   . MET D 2 1   ? 21.577 7.783   39.530  1.00 65.65 ? 602 MET D O   1 
ATOM   3264 C  CB  . MET D 2 1   ? 22.661 8.620   36.297  1.00 65.23 ? 602 MET D CB  1 
ATOM   3265 C  CG  . MET D 2 1   ? 23.084 7.609   35.244  1.00 65.50 ? 602 MET D CG  1 
ATOM   3266 S  SD  . MET D 2 1   ? 23.072 5.903   35.829  1.00 68.08 ? 602 MET D SD  1 
ATOM   3267 C  CE  . MET D 2 1   ? 21.803 5.201   34.724  1.00 61.92 ? 602 MET D CE  1 
ATOM   3268 N  N   . LEU D 2 2   ? 23.050 6.594   38.280  1.00 52.86 ? 603 LEU D N   1 
ATOM   3269 C  CA  . LEU D 2 2   ? 23.636 5.843   39.390  1.00 48.07 ? 603 LEU D CA  1 
ATOM   3270 C  C   . LEU D 2 2   ? 22.607 4.960   40.092  1.00 44.67 ? 603 LEU D C   1 
ATOM   3271 O  O   . LEU D 2 2   ? 21.404 5.214   40.040  1.00 45.65 ? 603 LEU D O   1 
ATOM   3272 C  CB  . LEU D 2 2   ? 24.262 6.782   40.439  1.00 45.48 ? 603 LEU D CB  1 
ATOM   3273 C  CG  . LEU D 2 2   ? 25.506 7.629   40.159  1.00 44.42 ? 603 LEU D CG  1 
ATOM   3274 C  CD1 . LEU D 2 2   ? 25.184 8.727   39.167  1.00 42.55 ? 603 LEU D CD1 1 
ATOM   3275 C  CD2 . LEU D 2 2   ? 25.982 8.244   41.462  1.00 42.32 ? 603 LEU D CD2 1 
ATOM   3276 N  N   . THR D 2 3   ? 23.081 3.894   40.715  1.00 42.18 ? 604 THR D N   1 
ATOM   3277 C  CA  . THR D 2 3   ? 22.191 3.031   41.456  1.00 43.28 ? 604 THR D CA  1 
ATOM   3278 C  C   . THR D 2 3   ? 21.944 3.783   42.767  1.00 42.99 ? 604 THR D C   1 
ATOM   3279 O  O   . THR D 2 3   ? 22.664 4.731   43.083  1.00 41.82 ? 604 THR D O   1 
ATOM   3280 C  CB  . THR D 2 3   ? 22.857 1.700   41.771  1.00 42.47 ? 604 THR D CB  1 
ATOM   3281 O  OG1 . THR D 2 3   ? 23.839 1.896   42.797  1.00 43.14 ? 604 THR D OG1 1 
ATOM   3282 C  CG2 . THR D 2 3   ? 23.526 1.141   40.522  1.00 43.19 ? 604 THR D CG2 1 
ATOM   3283 N  N   . ALA D 2 4   ? 20.969 3.346   43.556  1.00 42.64 ? 605 ALA D N   1 
ATOM   3284 C  CA  . ALA D 2 4   ? 20.689 4.020   44.816  1.00 42.09 ? 605 ALA D CA  1 
ATOM   3285 C  C   . ALA D 2 4   ? 21.848 3.904   45.812  1.00 38.65 ? 605 ALA D C   1 
ATOM   3286 O  O   . ALA D 2 4   ? 22.040 4.808   46.617  1.00 38.98 ? 605 ALA D O   1 
ATOM   3287 C  CB  . ALA D 2 4   ? 19.392 3.503   45.432  1.00 39.43 ? 605 ALA D CB  1 
ATOM   3288 N  N   . GLU D 2 5   ? 22.603 2.801   45.774  1.00 38.85 ? 606 GLU D N   1 
ATOM   3289 C  CA  . GLU D 2 5   ? 23.734 2.607   46.694  1.00 40.85 ? 606 GLU D CA  1 
ATOM   3290 C  C   . GLU D 2 5   ? 24.827 3.620   46.350  1.00 41.18 ? 606 GLU D C   1 
ATOM   3291 O  O   . GLU D 2 5   ? 25.412 4.250   47.241  1.00 43.48 ? 606 GLU D O   1 
ATOM   3292 C  CB  . GLU D 2 5   ? 24.252 1.140   46.659  1.00 44.11 ? 606 GLU D CB  1 
ATOM   3293 C  CG  . GLU D 2 5   ? 25.658 0.891   46.032  1.00 50.72 ? 606 GLU D CG  1 
ATOM   3294 C  CD  . GLU D 2 5   ? 25.756 -0.393  45.165  1.00 55.66 ? 606 GLU D CD  1 
ATOM   3295 O  OE1 . GLU D 2 5   ? 25.565 -0.322  43.917  1.00 52.72 ? 606 GLU D OE1 1 
ATOM   3296 O  OE2 . GLU D 2 5   ? 26.060 -1.469  45.729  1.00 59.47 ? 606 GLU D OE2 1 
ATOM   3297 N  N   . GLU D 2 6   ? 25.038 3.828   45.050  1.00 40.29 ? 607 GLU D N   1 
ATOM   3298 C  CA  . GLU D 2 6   ? 26.040 4.775   44.557  1.00 38.93 ? 607 GLU D CA  1 
ATOM   3299 C  C   . GLU D 2 6   ? 25.693 6.189   45.016  1.00 37.88 ? 607 GLU D C   1 
ATOM   3300 O  O   . GLU D 2 6   ? 26.509 6.854   45.651  1.00 35.80 ? 607 GLU D O   1 
ATOM   3301 C  CB  . GLU D 2 6   ? 26.137 4.718   43.017  1.00 37.75 ? 607 GLU D CB  1 
ATOM   3302 C  CG  . GLU D 2 6   ? 26.632 3.368   42.465  1.00 38.23 ? 607 GLU D CG  1 
ATOM   3303 C  CD  . GLU D 2 6   ? 26.764 3.332   40.940  1.00 42.34 ? 607 GLU D CD  1 
ATOM   3304 O  OE1 . GLU D 2 6   ? 27.734 2.719   40.446  1.00 48.57 ? 607 GLU D OE1 1 
ATOM   3305 O  OE2 . GLU D 2 6   ? 25.904 3.897   40.230  1.00 41.94 ? 607 GLU D OE2 1 
ATOM   3306 N  N   . LYS D 2 7   ? 24.459 6.603   44.726  1.00 38.84 ? 608 LYS D N   1 
ATOM   3307 C  CA  . LYS D 2 7   ? 23.907 7.917   45.078  1.00 36.62 ? 608 LYS D CA  1 
ATOM   3308 C  C   . LYS D 2 7   ? 24.097 8.270   46.558  1.00 36.41 ? 608 LYS D C   1 
ATOM   3309 O  O   . LYS D 2 7   ? 24.419 9.413   46.889  1.00 38.78 ? 608 LYS D O   1 
ATOM   3310 C  CB  . LYS D 2 7   ? 22.418 7.957   44.721  1.00 36.01 ? 608 LYS D CB  1 
ATOM   3311 C  CG  . LYS D 2 7   ? 21.895 9.335   44.410  1.00 39.74 ? 608 LYS D CG  1 
ATOM   3312 C  CD  . LYS D 2 7   ? 20.381 9.342   44.178  1.00 51.95 ? 608 LYS D CD  1 
ATOM   3313 C  CE  . LYS D 2 7   ? 19.946 8.525   42.945  1.00 55.57 ? 608 LYS D CE  1 
ATOM   3314 N  NZ  . LYS D 2 7   ? 18.483 8.702   42.601  1.00 52.64 ? 608 LYS D NZ  1 
ATOM   3315 N  N   . ALA D 2 8   ? 23.898 7.291   47.435  1.00 34.70 ? 609 ALA D N   1 
ATOM   3316 C  CA  . ALA D 2 8   ? 24.062 7.469   48.873  1.00 35.86 ? 609 ALA D CA  1 
ATOM   3317 C  C   . ALA D 2 8   ? 25.528 7.670   49.241  1.00 37.05 ? 609 ALA D C   1 
ATOM   3318 O  O   . ALA D 2 8   ? 25.842 8.516   50.079  1.00 38.50 ? 609 ALA D O   1 
ATOM   3319 C  CB  . ALA D 2 8   ? 23.500 6.256   49.629  1.00 37.88 ? 609 ALA D CB  1 
ATOM   3320 N  N   . ALA D 2 9   ? 26.420 6.896   48.619  1.00 39.47 ? 610 ALA D N   1 
ATOM   3321 C  CA  . ALA D 2 9   ? 27.861 6.992   48.888  1.00 38.99 ? 610 ALA D CA  1 
ATOM   3322 C  C   . ALA D 2 9   ? 28.405 8.348   48.450  1.00 37.09 ? 610 ALA D C   1 
ATOM   3323 O  O   . ALA D 2 9   ? 29.177 8.992   49.164  1.00 34.53 ? 610 ALA D O   1 
ATOM   3324 C  CB  . ALA D 2 9   ? 28.595 5.885   48.173  1.00 41.38 ? 610 ALA D CB  1 
ATOM   3325 N  N   . VAL D 2 10  ? 27.992 8.761   47.258  1.00 38.08 ? 611 VAL D N   1 
ATOM   3326 C  CA  . VAL D 2 10  ? 28.370 10.033  46.661  1.00 37.78 ? 611 VAL D CA  1 
ATOM   3327 C  C   . VAL D 2 10  ? 27.861 11.226  47.500  1.00 37.05 ? 611 VAL D C   1 
ATOM   3328 O  O   . VAL D 2 10  ? 28.609 12.169  47.804  1.00 34.85 ? 611 VAL D O   1 
ATOM   3329 C  CB  . VAL D 2 10  ? 27.829 10.096  45.188  1.00 37.25 ? 611 VAL D CB  1 
ATOM   3330 C  CG1 . VAL D 2 10  ? 27.725 11.514  44.694  1.00 37.15 ? 611 VAL D CG1 1 
ATOM   3331 C  CG2 . VAL D 2 10  ? 28.732 9.293   44.259  1.00 35.32 ? 611 VAL D CG2 1 
ATOM   3332 N  N   . THR D 2 11  ? 26.591 11.166  47.880  1.00 37.99 ? 612 THR D N   1 
ATOM   3333 C  CA  . THR D 2 11  ? 25.953 12.210  48.672  1.00 36.81 ? 612 THR D CA  1 
ATOM   3334 C  C   . THR D 2 11  ? 26.623 12.436  50.029  1.00 34.47 ? 612 THR D C   1 
ATOM   3335 O  O   . THR D 2 11  ? 26.908 13.574  50.398  1.00 36.89 ? 612 THR D O   1 
ATOM   3336 C  CB  . THR D 2 11  ? 24.443 11.893  48.833  1.00 35.58 ? 612 THR D CB  1 
ATOM   3337 O  OG1 . THR D 2 11  ? 23.779 12.178  47.598  1.00 39.42 ? 612 THR D OG1 1 
ATOM   3338 C  CG2 . THR D 2 11  ? 23.810 12.705  49.935  1.00 37.30 ? 612 THR D CG2 1 
ATOM   3339 N  N   . ALA D 2 12  ? 26.928 11.348  50.733  1.00 37.48 ? 613 ALA D N   1 
ATOM   3340 C  CA  . ALA D 2 12  ? 27.562 11.390  52.052  1.00 35.10 ? 613 ALA D CA  1 
ATOM   3341 C  C   . ALA D 2 12  ? 28.971 11.944  51.990  1.00 36.17 ? 613 ALA D C   1 
ATOM   3342 O  O   . ALA D 2 12  ? 29.385 12.698  52.870  1.00 39.11 ? 613 ALA D O   1 
ATOM   3343 C  CB  . ALA D 2 12  ? 27.576 10.006  52.662  1.00 35.73 ? 613 ALA D CB  1 
ATOM   3344 N  N   . PHE D 2 13  ? 29.713 11.554  50.957  1.00 35.54 ? 614 PHE D N   1 
ATOM   3345 C  CA  . PHE D 2 13  ? 31.074 12.029  50.773  1.00 32.05 ? 614 PHE D CA  1 
ATOM   3346 C  C   . PHE D 2 13  ? 31.079 13.539  50.555  1.00 31.87 ? 614 PHE D C   1 
ATOM   3347 O  O   . PHE D 2 13  ? 31.890 14.266  51.143  1.00 34.28 ? 614 PHE D O   1 
ATOM   3348 C  CB  . PHE D 2 13  ? 31.727 11.346  49.565  1.00 31.96 ? 614 PHE D CB  1 
ATOM   3349 C  CG  . PHE D 2 13  ? 33.146 11.800  49.297  1.00 33.65 ? 614 PHE D CG  1 
ATOM   3350 C  CD1 . PHE D 2 13  ? 34.186 11.413  50.140  1.00 34.45 ? 614 PHE D CD1 1 
ATOM   3351 C  CD2 . PHE D 2 13  ? 33.434 12.632  48.218  1.00 32.20 ? 614 PHE D CD2 1 
ATOM   3352 C  CE1 . PHE D 2 13  ? 35.491 11.852  49.907  1.00 36.33 ? 614 PHE D CE1 1 
ATOM   3353 C  CE2 . PHE D 2 13  ? 34.724 13.072  47.979  1.00 31.83 ? 614 PHE D CE2 1 
ATOM   3354 C  CZ  . PHE D 2 13  ? 35.755 12.683  48.824  1.00 35.10 ? 614 PHE D CZ  1 
ATOM   3355 N  N   . TRP D 2 14  ? 30.180 13.994  49.690  1.00 31.25 ? 615 TRP D N   1 
ATOM   3356 C  CA  . TRP D 2 14  ? 30.072 15.402  49.357  1.00 29.12 ? 615 TRP D CA  1 
ATOM   3357 C  C   . TRP D 2 14  ? 29.907 16.258  50.607  1.00 33.80 ? 615 TRP D C   1 
ATOM   3358 O  O   . TRP D 2 14  ? 30.322 17.412  50.642  1.00 33.62 ? 615 TRP D O   1 
ATOM   3359 C  CB  . TRP D 2 14  ? 28.910 15.619  48.385  1.00 32.59 ? 615 TRP D CB  1 
ATOM   3360 C  CG  . TRP D 2 14  ? 29.005 16.904  47.630  1.00 32.89 ? 615 TRP D CG  1 
ATOM   3361 C  CD1 . TRP D 2 14  ? 28.211 18.007  47.781  1.00 33.90 ? 615 TRP D CD1 1 
ATOM   3362 C  CD2 . TRP D 2 14  ? 29.997 17.251  46.655  1.00 34.92 ? 615 TRP D CD2 1 
ATOM   3363 N  NE1 . TRP D 2 14  ? 28.660 19.025  46.970  1.00 33.54 ? 615 TRP D NE1 1 
ATOM   3364 C  CE2 . TRP D 2 14  ? 29.754 18.588  46.268  1.00 32.91 ? 615 TRP D CE2 1 
ATOM   3365 C  CE3 . TRP D 2 14  ? 31.072 16.562  46.072  1.00 33.17 ? 615 TRP D CE3 1 
ATOM   3366 C  CZ2 . TRP D 2 14  ? 30.543 19.252  45.330  1.00 34.56 ? 615 TRP D CZ2 1 
ATOM   3367 C  CZ3 . TRP D 2 14  ? 31.856 17.221  45.136  1.00 34.28 ? 615 TRP D CZ3 1 
ATOM   3368 C  CH2 . TRP D 2 14  ? 31.585 18.556  44.774  1.00 32.74 ? 615 TRP D CH2 1 
ATOM   3369 N  N   . GLY D 2 15  ? 29.319 15.677  51.646  1.00 34.96 ? 616 GLY D N   1 
ATOM   3370 C  CA  . GLY D 2 15  ? 29.131 16.401  52.884  1.00 35.16 ? 616 GLY D CA  1 
ATOM   3371 C  C   . GLY D 2 15  ? 30.407 16.924  53.514  1.00 37.28 ? 616 GLY D C   1 
ATOM   3372 O  O   . GLY D 2 15  ? 30.367 17.904  54.245  1.00 40.99 ? 616 GLY D O   1 
ATOM   3373 N  N   . LYS D 2 16  ? 31.544 16.303  53.236  1.00 37.26 ? 617 LYS D N   1 
ATOM   3374 C  CA  . LYS D 2 16  ? 32.781 16.755  53.846  1.00 35.61 ? 617 LYS D CA  1 
ATOM   3375 C  C   . LYS D 2 16  ? 33.561 17.697  52.952  1.00 37.18 ? 617 LYS D C   1 
ATOM   3376 O  O   . LYS D 2 16  ? 34.589 18.241  53.365  1.00 42.26 ? 617 LYS D O   1 
ATOM   3377 C  CB  . LYS D 2 16  ? 33.670 15.571  54.153  1.00 37.89 ? 617 LYS D CB  1 
ATOM   3378 C  CG  . LYS D 2 16  ? 32.948 14.328  54.546  1.00 40.98 ? 617 LYS D CG  1 
ATOM   3379 C  CD  . LYS D 2 16  ? 33.962 13.262  54.824  1.00 39.83 ? 617 LYS D CD  1 
ATOM   3380 C  CE  . LYS D 2 16  ? 33.287 11.944  55.052  1.00 47.06 ? 617 LYS D CE  1 
ATOM   3381 N  NZ  . LYS D 2 16  ? 34.303 10.917  55.339  1.00 50.70 ? 617 LYS D NZ  1 
ATOM   3382 N  N   . VAL D 2 17  ? 33.076 17.909  51.738  1.00 36.64 ? 618 VAL D N   1 
ATOM   3383 C  CA  . VAL D 2 17  ? 33.784 18.749  50.781  1.00 38.90 ? 618 VAL D CA  1 
ATOM   3384 C  C   . VAL D 2 17  ? 33.710 20.265  50.946  1.00 38.89 ? 618 VAL D C   1 
ATOM   3385 O  O   . VAL D 2 17  ? 32.643 20.862  50.842  1.00 39.38 ? 618 VAL D O   1 
ATOM   3386 C  CB  . VAL D 2 17  ? 33.391 18.375  49.323  1.00 38.26 ? 618 VAL D CB  1 
ATOM   3387 C  CG1 . VAL D 2 17  ? 34.002 19.355  48.332  1.00 39.23 ? 618 VAL D CG1 1 
ATOM   3388 C  CG2 . VAL D 2 17  ? 33.852 16.965  49.006  1.00 34.93 ? 618 VAL D CG2 1 
ATOM   3389 N  N   . LYS D 2 18  ? 34.862 20.886  51.177  1.00 38.62 ? 619 LYS D N   1 
ATOM   3390 C  CA  . LYS D 2 18  ? 34.939 22.333  51.288  1.00 37.58 ? 619 LYS D CA  1 
ATOM   3391 C  C   . LYS D 2 18  ? 34.925 22.850  49.848  1.00 38.11 ? 619 LYS D C   1 
ATOM   3392 O  O   . LYS D 2 18  ? 35.971 23.006  49.222  1.00 37.85 ? 619 LYS D O   1 
ATOM   3393 C  CB  . LYS D 2 18  ? 36.237 22.746  51.973  1.00 40.99 ? 619 LYS D CB  1 
ATOM   3394 C  CG  . LYS D 2 18  ? 36.294 22.454  53.452  1.00 44.60 ? 619 LYS D CG  1 
ATOM   3395 C  CD  . LYS D 2 18  ? 35.285 23.317  54.182  1.00 56.36 ? 619 LYS D CD  1 
ATOM   3396 C  CE  . LYS D 2 18  ? 35.478 24.809  53.901  1.00 57.85 ? 619 LYS D CE  1 
ATOM   3397 N  NZ  . LYS D 2 18  ? 34.382 25.647  54.504  1.00 65.54 ? 619 LYS D NZ  1 
ATOM   3398 N  N   . VAL D 2 19  ? 33.735 23.096  49.319  1.00 39.73 ? 620 VAL D N   1 
ATOM   3399 C  CA  . VAL D 2 19  ? 33.586 23.562  47.947  1.00 39.57 ? 620 VAL D CA  1 
ATOM   3400 C  C   . VAL D 2 19  ? 34.245 24.905  47.640  1.00 39.13 ? 620 VAL D C   1 
ATOM   3401 O  O   . VAL D 2 19  ? 34.648 25.161  46.505  1.00 36.67 ? 620 VAL D O   1 
ATOM   3402 C  CB  . VAL D 2 19  ? 32.096 23.607  47.529  1.00 42.69 ? 620 VAL D CB  1 
ATOM   3403 C  CG1 . VAL D 2 19  ? 31.461 22.266  47.763  1.00 41.33 ? 620 VAL D CG1 1 
ATOM   3404 C  CG2 . VAL D 2 19  ? 31.344 24.696  48.289  1.00 45.53 ? 620 VAL D CG2 1 
ATOM   3405 N  N   . ASP D 2 20  ? 34.377 25.754  48.647  1.00 39.79 ? 621 ASP D N   1 
ATOM   3406 C  CA  . ASP D 2 20  ? 34.994 27.049  48.434  1.00 43.90 ? 621 ASP D CA  1 
ATOM   3407 C  C   . ASP D 2 20  ? 36.469 26.867  48.029  1.00 45.51 ? 621 ASP D C   1 
ATOM   3408 O  O   . ASP D 2 20  ? 36.955 27.537  47.106  1.00 48.40 ? 621 ASP D O   1 
ATOM   3409 C  CB  . ASP D 2 20  ? 34.869 27.909  49.696  1.00 49.68 ? 621 ASP D CB  1 
ATOM   3410 C  CG  . ASP D 2 20  ? 35.714 27.391  50.852  1.00 55.77 ? 621 ASP D CG  1 
ATOM   3411 O  OD1 . ASP D 2 20  ? 36.244 28.225  51.618  1.00 61.06 ? 621 ASP D OD1 1 
ATOM   3412 O  OD2 . ASP D 2 20  ? 35.855 26.157  50.994  1.00 56.63 ? 621 ASP D OD2 1 
ATOM   3413 N  N   . GLU D 2 21  ? 37.148 25.908  48.665  1.00 42.98 ? 622 GLU D N   1 
ATOM   3414 C  CA  . GLU D 2 21  ? 38.566 25.610  48.402  1.00 39.56 ? 622 GLU D CA  1 
ATOM   3415 C  C   . GLU D 2 21  ? 38.813 24.728  47.173  1.00 38.68 ? 622 GLU D C   1 
ATOM   3416 O  O   . GLU D 2 21  ? 39.584 25.076  46.269  1.00 36.41 ? 622 GLU D O   1 
ATOM   3417 C  CB  . GLU D 2 21  ? 39.171 24.927  49.620  1.00 41.97 ? 622 GLU D CB  1 
ATOM   3418 C  CG  . GLU D 2 21  ? 39.288 25.832  50.821  1.00 50.75 ? 622 GLU D CG  1 
ATOM   3419 C  CD  . GLU D 2 21  ? 39.451 25.064  52.108  1.00 55.71 ? 622 GLU D CD  1 
ATOM   3420 O  OE1 . GLU D 2 21  ? 40.357 24.190  52.175  1.00 52.77 ? 622 GLU D OE1 1 
ATOM   3421 O  OE2 . GLU D 2 21  ? 38.654 25.338  53.042  1.00 61.06 ? 622 GLU D OE2 1 
ATOM   3422 N  N   . VAL D 2 22  ? 38.193 23.554  47.187  1.00 36.86 ? 623 VAL D N   1 
ATOM   3423 C  CA  . VAL D 2 22  ? 38.293 22.599  46.101  1.00 32.93 ? 623 VAL D CA  1 
ATOM   3424 C  C   . VAL D 2 22  ? 37.977 23.257  44.751  1.00 32.10 ? 623 VAL D C   1 
ATOM   3425 O  O   . VAL D 2 22  ? 38.734 23.097  43.785  1.00 32.44 ? 623 VAL D O   1 
ATOM   3426 C  CB  . VAL D 2 22  ? 37.373 21.384  46.380  1.00 33.49 ? 623 VAL D CB  1 
ATOM   3427 C  CG1 . VAL D 2 22  ? 37.323 20.439  45.180  1.00 36.34 ? 623 VAL D CG1 1 
ATOM   3428 C  CG2 . VAL D 2 22  ? 37.885 20.643  47.578  1.00 24.65 ? 623 VAL D CG2 1 
ATOM   3429 N  N   . GLY D 2 23  ? 36.919 24.062  44.719  1.00 29.41 ? 624 GLY D N   1 
ATOM   3430 C  CA  . GLY D 2 23  ? 36.531 24.743  43.503  1.00 29.30 ? 624 GLY D CA  1 
ATOM   3431 C  C   . GLY D 2 23  ? 37.613 25.654  42.957  1.00 27.92 ? 624 GLY D C   1 
ATOM   3432 O  O   . GLY D 2 23  ? 37.878 25.673  41.748  1.00 27.42 ? 624 GLY D O   1 
ATOM   3433 N  N   . GLY D 2 24  ? 38.212 26.443  43.840  1.00 28.78 ? 625 GLY D N   1 
ATOM   3434 C  CA  . GLY D 2 24  ? 39.272 27.340  43.428  1.00 26.10 ? 625 GLY D CA  1 
ATOM   3435 C  C   . GLY D 2 24  ? 40.466 26.556  42.908  1.00 24.63 ? 625 GLY D C   1 
ATOM   3436 O  O   . GLY D 2 24  ? 41.071 26.926  41.891  1.00 25.51 ? 625 GLY D O   1 
ATOM   3437 N  N   . GLU D 2 25  ? 40.793 25.451  43.584  1.00 22.66 ? 626 GLU D N   1 
ATOM   3438 C  CA  . GLU D 2 25  ? 41.928 24.635  43.189  1.00 24.15 ? 626 GLU D CA  1 
ATOM   3439 C  C   . GLU D 2 25  ? 41.699 23.922  41.864  1.00 25.44 ? 626 GLU D C   1 
ATOM   3440 O  O   . GLU D 2 25  ? 42.627 23.778  41.071  1.00 28.73 ? 626 GLU D O   1 
ATOM   3441 C  CB  . GLU D 2 25  ? 42.237 23.602  44.255  1.00 22.14 ? 626 GLU D CB  1 
ATOM   3442 C  CG  . GLU D 2 25  ? 43.499 22.826  43.958  1.00 25.87 ? 626 GLU D CG  1 
ATOM   3443 C  CD  . GLU D 2 25  ? 43.762 21.696  44.934  1.00 27.10 ? 626 GLU D CD  1 
ATOM   3444 O  OE1 . GLU D 2 25  ? 44.551 20.798  44.582  1.00 30.76 ? 626 GLU D OE1 1 
ATOM   3445 O  OE2 . GLU D 2 25  ? 43.187 21.693  46.038  1.00 34.07 ? 626 GLU D OE2 1 
ATOM   3446 N  N   . ALA D 2 26  ? 40.465 23.495  41.621  1.00 26.48 ? 627 ALA D N   1 
ATOM   3447 C  CA  . ALA D 2 26  ? 40.101 22.806  40.392  1.00 26.62 ? 627 ALA D CA  1 
ATOM   3448 C  C   . ALA D 2 26  ? 40.234 23.710  39.168  1.00 24.85 ? 627 ALA D C   1 
ATOM   3449 O  O   . ALA D 2 26  ? 40.866 23.338  38.194  1.00 23.34 ? 627 ALA D O   1 
ATOM   3450 C  CB  . ALA D 2 26  ? 38.674 22.297  40.511  1.00 30.25 ? 627 ALA D CB  1 
ATOM   3451 N  N   . LEU D 2 27  ? 39.611 24.881  39.218  1.00 26.77 ? 628 LEU D N   1 
ATOM   3452 C  CA  . LEU D 2 27  ? 39.653 25.833  38.114  1.00 26.30 ? 628 LEU D CA  1 
ATOM   3453 C  C   . LEU D 2 27  ? 41.046 26.368  37.872  1.00 26.88 ? 628 LEU D C   1 
ATOM   3454 O  O   . LEU D 2 27  ? 41.446 26.584  36.729  1.00 27.41 ? 628 LEU D O   1 
ATOM   3455 C  CB  . LEU D 2 27  ? 38.687 26.988  38.334  1.00 30.17 ? 628 LEU D CB  1 
ATOM   3456 C  CG  . LEU D 2 27  ? 38.523 27.887  37.095  1.00 34.85 ? 628 LEU D CG  1 
ATOM   3457 C  CD1 . LEU D 2 27  ? 37.710 27.207  36.017  1.00 32.84 ? 628 LEU D CD1 1 
ATOM   3458 C  CD2 . LEU D 2 27  ? 37.857 29.176  37.491  1.00 41.18 ? 628 LEU D CD2 1 
ATOM   3459 N  N   . GLY D 2 28  ? 41.784 26.609  38.945  1.00 28.74 ? 629 GLY D N   1 
ATOM   3460 C  CA  . GLY D 2 28  ? 43.141 27.073  38.793  1.00 25.22 ? 629 GLY D CA  1 
ATOM   3461 C  C   . GLY D 2 28  ? 43.953 26.020  38.055  1.00 28.49 ? 629 GLY D C   1 
ATOM   3462 O  O   . GLY D 2 28  ? 44.622 26.321  37.065  1.00 29.94 ? 629 GLY D O   1 
ATOM   3463 N  N   . ARG D 2 29  ? 43.869 24.768  38.505  1.00 28.27 ? 630 ARG D N   1 
ATOM   3464 C  CA  . ARG D 2 29  ? 44.607 23.687  37.853  1.00 26.23 ? 630 ARG D CA  1 
ATOM   3465 C  C   . ARG D 2 29  ? 44.194 23.501  36.407  1.00 27.31 ? 630 ARG D C   1 
ATOM   3466 O  O   . ARG D 2 29  ? 45.029 23.176  35.560  1.00 30.23 ? 630 ARG D O   1 
ATOM   3467 C  CB  . ARG D 2 29  ? 44.465 22.368  38.598  1.00 23.14 ? 630 ARG D CB  1 
ATOM   3468 C  CG  . ARG D 2 29  ? 45.284 22.298  39.840  1.00 18.35 ? 630 ARG D CG  1 
ATOM   3469 C  CD  . ARG D 2 29  ? 45.120 20.978  40.528  1.00 24.41 ? 630 ARG D CD  1 
ATOM   3470 N  NE  . ARG D 2 29  ? 45.774 20.973  41.837  1.00 26.07 ? 630 ARG D NE  1 
ATOM   3471 C  CZ  . ARG D 2 29  ? 46.952 20.408  42.093  1.00 23.20 ? 630 ARG D CZ  1 
ATOM   3472 N  NH1 . ARG D 2 29  ? 47.627 19.804  41.123  1.00 22.71 ? 630 ARG D NH1 1 
ATOM   3473 N  NH2 . ARG D 2 29  ? 47.486 20.511  43.304  1.00 22.58 ? 630 ARG D NH2 1 
ATOM   3474 N  N   . LEU D 2 30  ? 42.913 23.676  36.110  1.00 27.76 ? 631 LEU D N   1 
ATOM   3475 C  CA  . LEU D 2 30  ? 42.462 23.531  34.737  1.00 29.09 ? 631 LEU D CA  1 
ATOM   3476 C  C   . LEU D 2 30  ? 43.193 24.547  33.871  1.00 29.41 ? 631 LEU D C   1 
ATOM   3477 O  O   . LEU D 2 30  ? 43.666 24.223  32.782  1.00 33.33 ? 631 LEU D O   1 
ATOM   3478 C  CB  . LEU D 2 30  ? 40.963 23.768  34.621  1.00 26.81 ? 631 LEU D CB  1 
ATOM   3479 C  CG  . LEU D 2 30  ? 40.490 23.687  33.176  1.00 28.27 ? 631 LEU D CG  1 
ATOM   3480 C  CD1 . LEU D 2 30  ? 40.352 22.225  32.790  1.00 20.81 ? 631 LEU D CD1 1 
ATOM   3481 C  CD2 . LEU D 2 30  ? 39.184 24.442  33.001  1.00 26.97 ? 631 LEU D CD2 1 
ATOM   3482 N  N   . LEU D 2 31  ? 43.327 25.761  34.400  1.00 28.70 ? 632 LEU D N   1 
ATOM   3483 C  CA  . LEU D 2 31  ? 43.988 26.865  33.707  1.00 26.46 ? 632 LEU D CA  1 
ATOM   3484 C  C   . LEU D 2 31  ? 45.517 26.715  33.597  1.00 24.26 ? 632 LEU D C   1 
ATOM   3485 O  O   . LEU D 2 31  ? 46.139 27.232  32.672  1.00 24.60 ? 632 LEU D O   1 
ATOM   3486 C  CB  . LEU D 2 31  ? 43.604 28.191  34.378  1.00 33.50 ? 632 LEU D CB  1 
ATOM   3487 C  CG  . LEU D 2 31  ? 42.326 29.004  34.051  1.00 31.28 ? 632 LEU D CG  1 
ATOM   3488 C  CD1 . LEU D 2 31  ? 41.139 28.132  33.710  1.00 39.74 ? 632 LEU D CD1 1 
ATOM   3489 C  CD2 . LEU D 2 31  ? 41.982 29.889  35.234  1.00 36.07 ? 632 LEU D CD2 1 
ATOM   3490 N  N   . VAL D 2 32  ? 46.123 26.005  34.538  1.00 24.99 ? 633 VAL D N   1 
ATOM   3491 C  CA  . VAL D 2 32  ? 47.566 25.787  34.512  1.00 25.12 ? 633 VAL D CA  1 
ATOM   3492 C  C   . VAL D 2 32  ? 47.923 24.615  33.604  1.00 26.51 ? 633 VAL D C   1 
ATOM   3493 O  O   . VAL D 2 32  ? 48.781 24.734  32.725  1.00 28.52 ? 633 VAL D O   1 
ATOM   3494 C  CB  . VAL D 2 32  ? 48.127 25.503  35.935  1.00 26.63 ? 633 VAL D CB  1 
ATOM   3495 C  CG1 . VAL D 2 32  ? 49.581 25.007  35.859  1.00 22.61 ? 633 VAL D CG1 1 
ATOM   3496 C  CG2 . VAL D 2 32  ? 48.057 26.773  36.788  1.00 20.23 ? 633 VAL D CG2 1 
ATOM   3497 N  N   . VAL D 2 33  ? 47.254 23.480  33.814  1.00 29.05 ? 634 VAL D N   1 
ATOM   3498 C  CA  . VAL D 2 33  ? 47.503 22.254  33.040  1.00 27.06 ? 634 VAL D CA  1 
ATOM   3499 C  C   . VAL D 2 33  ? 47.067 22.284  31.567  1.00 24.63 ? 634 VAL D C   1 
ATOM   3500 O  O   . VAL D 2 33  ? 47.757 21.736  30.711  1.00 30.57 ? 634 VAL D O   1 
ATOM   3501 C  CB  . VAL D 2 33  ? 46.892 21.022  33.759  1.00 25.99 ? 634 VAL D CB  1 
ATOM   3502 C  CG1 . VAL D 2 33  ? 47.337 19.738  33.079  1.00 25.93 ? 634 VAL D CG1 1 
ATOM   3503 C  CG2 . VAL D 2 33  ? 47.306 21.019  35.202  1.00 21.59 ? 634 VAL D CG2 1 
ATOM   3504 N  N   . TYR D 2 34  ? 45.937 22.922  31.285  1.00 22.58 ? 635 TYR D N   1 
ATOM   3505 C  CA  . TYR D 2 34  ? 45.395 23.025  29.927  1.00 25.75 ? 635 TYR D CA  1 
ATOM   3506 C  C   . TYR D 2 34  ? 45.279 24.507  29.587  1.00 25.86 ? 635 TYR D C   1 
ATOM   3507 O  O   . TYR D 2 34  ? 44.184 25.051  29.483  1.00 26.02 ? 635 TYR D O   1 
ATOM   3508 C  CB  . TYR D 2 34  ? 44.028 22.339  29.893  1.00 22.73 ? 635 TYR D CB  1 
ATOM   3509 C  CG  . TYR D 2 34  ? 44.077 20.910  30.383  1.00 24.88 ? 635 TYR D CG  1 
ATOM   3510 C  CD1 . TYR D 2 34  ? 44.707 19.922  29.634  1.00 25.56 ? 635 TYR D CD1 1 
ATOM   3511 C  CD2 . TYR D 2 34  ? 43.544 20.554  31.620  1.00 26.85 ? 635 TYR D CD2 1 
ATOM   3512 C  CE1 . TYR D 2 34  ? 44.810 18.622  30.104  1.00 29.03 ? 635 TYR D CE1 1 
ATOM   3513 C  CE2 . TYR D 2 34  ? 43.639 19.254  32.096  1.00 26.26 ? 635 TYR D CE2 1 
ATOM   3514 C  CZ  . TYR D 2 34  ? 44.274 18.299  31.331  1.00 28.27 ? 635 TYR D CZ  1 
ATOM   3515 O  OH  . TYR D 2 34  ? 44.377 17.011  31.780  1.00 32.85 ? 635 TYR D OH  1 
ATOM   3516 N  N   . PRO D 2 35  ? 46.415 25.144  29.288  1.00 31.34 ? 636 PRO D N   1 
ATOM   3517 C  CA  . PRO D 2 35  ? 46.588 26.559  28.950  1.00 31.75 ? 636 PRO D CA  1 
ATOM   3518 C  C   . PRO D 2 35  ? 45.593 27.277  28.039  1.00 32.10 ? 636 PRO D C   1 
ATOM   3519 O  O   . PRO D 2 35  ? 45.275 28.431  28.290  1.00 33.02 ? 636 PRO D O   1 
ATOM   3520 C  CB  . PRO D 2 35  ? 48.024 26.611  28.416  1.00 33.80 ? 636 PRO D CB  1 
ATOM   3521 C  CG  . PRO D 2 35  ? 48.700 25.554  29.219  1.00 31.15 ? 636 PRO D CG  1 
ATOM   3522 C  CD  . PRO D 2 35  ? 47.695 24.430  29.104  1.00 28.38 ? 636 PRO D CD  1 
ATOM   3523 N  N   . TRP D 2 36  ? 45.099 26.620  26.997  1.00 29.21 ? 637 TRP D N   1 
ATOM   3524 C  CA  . TRP D 2 36  ? 44.161 27.259  26.083  1.00 26.50 ? 637 TRP D CA  1 
ATOM   3525 C  C   . TRP D 2 36  ? 42.872 27.709  26.779  1.00 28.14 ? 637 TRP D C   1 
ATOM   3526 O  O   . TRP D 2 36  ? 42.192 28.634  26.318  1.00 31.57 ? 637 TRP D O   1 
ATOM   3527 C  CB  . TRP D 2 36  ? 43.837 26.331  24.902  1.00 25.64 ? 637 TRP D CB  1 
ATOM   3528 C  CG  . TRP D 2 36  ? 43.269 24.990  25.294  1.00 24.90 ? 637 TRP D CG  1 
ATOM   3529 C  CD1 . TRP D 2 36  ? 41.956 24.685  25.484  1.00 25.05 ? 637 TRP D CD1 1 
ATOM   3530 C  CD2 . TRP D 2 36  ? 44.005 23.788  25.586  1.00 27.46 ? 637 TRP D CD2 1 
ATOM   3531 N  NE1 . TRP D 2 36  ? 41.830 23.375  25.887  1.00 27.78 ? 637 TRP D NE1 1 
ATOM   3532 C  CE2 . TRP D 2 36  ? 43.070 22.801  25.957  1.00 25.32 ? 637 TRP D CE2 1 
ATOM   3533 C  CE3 . TRP D 2 36  ? 45.375 23.448  25.574  1.00 32.66 ? 637 TRP D CE3 1 
ATOM   3534 C  CZ2 . TRP D 2 36  ? 43.446 21.500  26.309  1.00 31.39 ? 637 TRP D CZ2 1 
ATOM   3535 C  CZ3 . TRP D 2 36  ? 45.752 22.145  25.928  1.00 29.53 ? 637 TRP D CZ3 1 
ATOM   3536 C  CH2 . TRP D 2 36  ? 44.790 21.190  26.291  1.00 29.88 ? 637 TRP D CH2 1 
ATOM   3537 N  N   . THR D 2 37  ? 42.561 27.090  27.909  1.00 30.07 ? 638 THR D N   1 
ATOM   3538 C  CA  . THR D 2 37  ? 41.354 27.430  28.633  1.00 27.71 ? 638 THR D CA  1 
ATOM   3539 C  C   . THR D 2 37  ? 41.367 28.849  29.158  1.00 26.78 ? 638 THR D C   1 
ATOM   3540 O  O   . THR D 2 37  ? 40.322 29.420  29.444  1.00 28.65 ? 638 THR D O   1 
ATOM   3541 C  CB  . THR D 2 37  ? 41.118 26.480  29.800  1.00 30.78 ? 638 THR D CB  1 
ATOM   3542 O  OG1 . THR D 2 37  ? 42.274 26.463  30.638  1.00 29.54 ? 638 THR D OG1 1 
ATOM   3543 C  CG2 . THR D 2 37  ? 40.812 25.066  29.292  1.00 27.49 ? 638 THR D CG2 1 
ATOM   3544 N  N   . GLN D 2 38  ? 42.556 29.414  29.302  1.00 28.57 ? 639 GLN D N   1 
ATOM   3545 C  CA  . GLN D 2 38  ? 42.696 30.776  29.779  1.00 27.35 ? 639 GLN D CA  1 
ATOM   3546 C  C   . GLN D 2 38  ? 42.121 31.767  28.794  1.00 27.02 ? 639 GLN D C   1 
ATOM   3547 O  O   . GLN D 2 38  ? 41.858 32.899  29.158  1.00 29.71 ? 639 GLN D O   1 
ATOM   3548 C  CB  . GLN D 2 38  ? 44.152 31.124  29.966  1.00 29.35 ? 639 GLN D CB  1 
ATOM   3549 C  CG  . GLN D 2 38  ? 44.884 30.220  30.891  1.00 30.47 ? 639 GLN D CG  1 
ATOM   3550 C  CD  . GLN D 2 38  ? 46.310 30.640  31.016  1.00 32.56 ? 639 GLN D CD  1 
ATOM   3551 O  OE1 . GLN D 2 38  ? 46.654 31.763  30.668  1.00 35.61 ? 639 GLN D OE1 1 
ATOM   3552 N  NE2 . GLN D 2 38  ? 47.159 29.747  31.509  1.00 32.08 ? 639 GLN D NE2 1 
ATOM   3553 N  N   . ARG D 2 39  ? 41.976 31.368  27.539  1.00 29.02 ? 640 ARG D N   1 
ATOM   3554 C  CA  . ARG D 2 39  ? 41.423 32.245  26.520  1.00 29.31 ? 640 ARG D CA  1 
ATOM   3555 C  C   . ARG D 2 39  ? 40.063 32.835  26.932  1.00 32.35 ? 640 ARG D C   1 
ATOM   3556 O  O   . ARG D 2 39  ? 39.736 33.994  26.619  1.00 31.71 ? 640 ARG D O   1 
ATOM   3557 C  CB  . ARG D 2 39  ? 41.289 31.476  25.211  1.00 32.30 ? 640 ARG D CB  1 
ATOM   3558 C  CG  . ARG D 2 39  ? 40.606 32.256  24.131  1.00 38.39 ? 640 ARG D CG  1 
ATOM   3559 C  CD  . ARG D 2 39  ? 40.445 31.463  22.864  1.00 38.71 ? 640 ARG D CD  1 
ATOM   3560 N  NE  . ARG D 2 39  ? 39.939 32.330  21.807  1.00 43.29 ? 640 ARG D NE  1 
ATOM   3561 C  CZ  . ARG D 2 39  ? 38.684 32.319  21.367  1.00 47.85 ? 640 ARG D CZ  1 
ATOM   3562 N  NH1 . ARG D 2 39  ? 37.794 31.472  21.883  1.00 49.09 ? 640 ARG D NH1 1 
ATOM   3563 N  NH2 . ARG D 2 39  ? 38.314 33.169  20.419  1.00 48.41 ? 640 ARG D NH2 1 
ATOM   3564 N  N   . PHE D 2 40  ? 39.297 32.041  27.667  1.00 33.45 ? 641 PHE D N   1 
ATOM   3565 C  CA  . PHE D 2 40  ? 37.973 32.416  28.127  1.00 33.60 ? 641 PHE D CA  1 
ATOM   3566 C  C   . PHE D 2 40  ? 37.974 33.267  29.390  1.00 34.92 ? 641 PHE D C   1 
ATOM   3567 O  O   . PHE D 2 40  ? 36.950 33.848  29.755  1.00 40.16 ? 641 PHE D O   1 
ATOM   3568 C  CB  . PHE D 2 40  ? 37.152 31.161  28.385  1.00 32.44 ? 641 PHE D CB  1 
ATOM   3569 C  CG  . PHE D 2 40  ? 37.045 30.259  27.207  1.00 35.98 ? 641 PHE D CG  1 
ATOM   3570 C  CD1 . PHE D 2 40  ? 37.986 29.256  26.998  1.00 37.46 ? 641 PHE D CD1 1 
ATOM   3571 C  CD2 . PHE D 2 40  ? 36.004 30.398  26.308  1.00 37.99 ? 641 PHE D CD2 1 
ATOM   3572 C  CE1 . PHE D 2 40  ? 37.887 28.399  25.908  1.00 38.54 ? 641 PHE D CE1 1 
ATOM   3573 C  CE2 . PHE D 2 40  ? 35.898 29.550  25.219  1.00 40.32 ? 641 PHE D CE2 1 
ATOM   3574 C  CZ  . PHE D 2 40  ? 36.843 28.548  25.017  1.00 40.92 ? 641 PHE D CZ  1 
ATOM   3575 N  N   . PHE D 2 41  ? 39.110 33.344  30.071  1.00 37.43 ? 642 PHE D N   1 
ATOM   3576 C  CA  . PHE D 2 41  ? 39.182 34.112  31.304  1.00 37.63 ? 642 PHE D CA  1 
ATOM   3577 C  C   . PHE D 2 41  ? 40.235 35.215  31.278  1.00 42.41 ? 642 PHE D C   1 
ATOM   3578 O  O   . PHE D 2 41  ? 40.789 35.550  32.323  1.00 48.00 ? 642 PHE D O   1 
ATOM   3579 C  CB  . PHE D 2 41  ? 39.481 33.173  32.478  1.00 37.62 ? 642 PHE D CB  1 
ATOM   3580 C  CG  . PHE D 2 41  ? 38.490 32.060  32.641  1.00 37.38 ? 642 PHE D CG  1 
ATOM   3581 C  CD1 . PHE D 2 41  ? 38.697 30.830  32.023  1.00 36.86 ? 642 PHE D CD1 1 
ATOM   3582 C  CD2 . PHE D 2 41  ? 37.355 32.232  33.428  1.00 35.58 ? 642 PHE D CD2 1 
ATOM   3583 C  CE1 . PHE D 2 41  ? 37.780 29.790  32.186  1.00 37.70 ? 642 PHE D CE1 1 
ATOM   3584 C  CE2 . PHE D 2 41  ? 36.433 31.194  33.594  1.00 36.49 ? 642 PHE D CE2 1 
ATOM   3585 C  CZ  . PHE D 2 41  ? 36.645 29.975  32.977  1.00 36.57 ? 642 PHE D CZ  1 
ATOM   3586 N  N   . GLU D 2 42  ? 40.536 35.785  30.114  1.00 44.89 ? 643 GLU D N   1 
ATOM   3587 C  CA  . GLU D 2 42  ? 41.549 36.844  30.068  1.00 51.07 ? 643 GLU D CA  1 
ATOM   3588 C  C   . GLU D 2 42  ? 41.177 38.016  30.975  1.00 52.12 ? 643 GLU D C   1 
ATOM   3589 O  O   . GLU D 2 42  ? 42.041 38.681  31.547  1.00 52.81 ? 643 GLU D O   1 
ATOM   3590 C  CB  . GLU D 2 42  ? 41.828 37.304  28.624  1.00 55.06 ? 643 GLU D CB  1 
ATOM   3591 C  CG  . GLU D 2 42  ? 40.608 37.444  27.707  1.00 62.51 ? 643 GLU D CG  1 
ATOM   3592 C  CD  . GLU D 2 42  ? 40.135 38.883  27.538  1.00 68.13 ? 643 GLU D CD  1 
ATOM   3593 O  OE1 . GLU D 2 42  ? 40.954 39.819  27.737  1.00 68.26 ? 643 GLU D OE1 1 
ATOM   3594 O  OE2 . GLU D 2 42  ? 38.940 39.074  27.192  1.00 71.40 ? 643 GLU D OE2 1 
ATOM   3595 N  N   . SER D 2 43  ? 39.875 38.176  31.181  1.00 51.55 ? 644 SER D N   1 
ATOM   3596 C  CA  . SER D 2 43  ? 39.305 39.229  32.012  1.00 50.12 ? 644 SER D CA  1 
ATOM   3597 C  C   . SER D 2 43  ? 39.665 39.126  33.496  1.00 49.83 ? 644 SER D C   1 
ATOM   3598 O  O   . SER D 2 43  ? 39.416 40.058  34.266  1.00 52.27 ? 644 SER D O   1 
ATOM   3599 C  CB  . SER D 2 43  ? 37.775 39.219  31.858  1.00 50.27 ? 644 SER D CB  1 
ATOM   3600 O  OG  . SER D 2 43  ? 37.319 37.968  31.356  1.00 55.26 ? 644 SER D OG  1 
ATOM   3601 N  N   . PHE D 2 44  ? 40.232 37.995  33.901  1.00 46.26 ? 645 PHE D N   1 
ATOM   3602 C  CA  . PHE D 2 44  ? 40.596 37.781  35.301  1.00 42.52 ? 645 PHE D CA  1 
ATOM   3603 C  C   . PHE D 2 44  ? 41.931 38.432  35.651  1.00 43.55 ? 645 PHE D C   1 
ATOM   3604 O  O   . PHE D 2 44  ? 42.399 38.339  36.791  1.00 40.50 ? 645 PHE D O   1 
ATOM   3605 C  CB  . PHE D 2 44  ? 40.593 36.280  35.626  1.00 41.31 ? 645 PHE D CB  1 
ATOM   3606 C  CG  . PHE D 2 44  ? 39.205 35.667  35.646  1.00 42.93 ? 645 PHE D CG  1 
ATOM   3607 C  CD1 . PHE D 2 44  ? 38.948 34.513  36.375  1.00 43.06 ? 645 PHE D CD1 1 
ATOM   3608 C  CD2 . PHE D 2 44  ? 38.142 36.271  34.966  1.00 44.96 ? 645 PHE D CD2 1 
ATOM   3609 C  CE1 . PHE D 2 44  ? 37.661 33.975  36.434  1.00 41.77 ? 645 PHE D CE1 1 
ATOM   3610 C  CE2 . PHE D 2 44  ? 36.853 35.742  35.018  1.00 42.26 ? 645 PHE D CE2 1 
ATOM   3611 C  CZ  . PHE D 2 44  ? 36.613 34.595  35.751  1.00 44.14 ? 645 PHE D CZ  1 
ATOM   3612 N  N   . GLY D 2 45  ? 42.508 39.127  34.672  1.00 42.11 ? 646 GLY D N   1 
ATOM   3613 C  CA  . GLY D 2 45  ? 43.776 39.797  34.863  1.00 43.28 ? 646 GLY D CA  1 
ATOM   3614 C  C   . GLY D 2 45  ? 45.010 38.953  34.563  1.00 45.52 ? 646 GLY D C   1 
ATOM   3615 O  O   . GLY D 2 45  ? 45.188 38.430  33.449  1.00 42.86 ? 646 GLY D O   1 
ATOM   3616 N  N   . ASP D 2 46  ? 45.842 38.787  35.589  1.00 44.93 ? 647 ASP D N   1 
ATOM   3617 C  CA  . ASP D 2 46  ? 47.094 38.058  35.477  1.00 42.92 ? 647 ASP D CA  1 
ATOM   3618 C  C   . ASP D 2 46  ? 47.026 36.565  35.751  1.00 44.66 ? 647 ASP D C   1 
ATOM   3619 O  O   . ASP D 2 46  ? 46.723 36.140  36.869  1.00 41.17 ? 647 ASP D O   1 
ATOM   3620 C  CB  . ASP D 2 46  ? 48.129 38.688  36.390  1.00 47.35 ? 647 ASP D CB  1 
ATOM   3621 C  CG  . ASP D 2 46  ? 49.528 38.245  36.058  1.00 52.52 ? 647 ASP D CG  1 
ATOM   3622 O  OD1 . ASP D 2 46  ? 49.895 38.323  34.859  1.00 52.59 ? 647 ASP D OD1 1 
ATOM   3623 O  OD2 . ASP D 2 46  ? 50.250 37.813  36.988  1.00 54.96 ? 647 ASP D OD2 1 
ATOM   3624 N  N   . LEU D 2 47  ? 47.400 35.789  34.730  1.00 46.18 ? 648 LEU D N   1 
ATOM   3625 C  CA  . LEU D 2 47  ? 47.399 34.329  34.777  1.00 44.44 ? 648 LEU D CA  1 
ATOM   3626 C  C   . LEU D 2 47  ? 48.709 33.780  34.235  1.00 43.09 ? 648 LEU D C   1 
ATOM   3627 O  O   . LEU D 2 47  ? 48.852 32.581  34.083  1.00 43.49 ? 648 LEU D O   1 
ATOM   3628 C  CB  . LEU D 2 47  ? 46.262 33.785  33.899  1.00 43.26 ? 648 LEU D CB  1 
ATOM   3629 C  CG  . LEU D 2 47  ? 44.842 34.338  34.092  1.00 43.37 ? 648 LEU D CG  1 
ATOM   3630 C  CD1 . LEU D 2 47  ? 44.001 34.098  32.847  1.00 41.66 ? 648 LEU D CD1 1 
ATOM   3631 C  CD2 . LEU D 2 47  ? 44.188 33.719  35.326  1.00 43.70 ? 648 LEU D CD2 1 
ATOM   3632 N  N   . SER D 2 48  ? 49.675 34.651  33.992  1.00 47.48 ? 649 SER D N   1 
ATOM   3633 C  CA  . SER D 2 48  ? 50.968 34.260  33.416  1.00 50.11 ? 649 SER D CA  1 
ATOM   3634 C  C   . SER D 2 48  ? 51.837 33.151  34.058  1.00 50.80 ? 649 SER D C   1 
ATOM   3635 O  O   . SER D 2 48  ? 52.691 32.571  33.380  1.00 52.40 ? 649 SER D O   1 
ATOM   3636 C  CB  . SER D 2 48  ? 51.811 35.511  33.167  1.00 51.83 ? 649 SER D CB  1 
ATOM   3637 O  OG  . SER D 2 48  ? 51.732 36.391  34.273  1.00 59.23 ? 649 SER D OG  1 
ATOM   3638 N  N   . THR D 2 49  ? 51.658 32.869  35.344  1.00 47.34 ? 650 THR D N   1 
ATOM   3639 C  CA  . THR D 2 49  ? 52.440 31.820  35.989  1.00 43.49 ? 650 THR D CA  1 
ATOM   3640 C  C   . THR D 2 49  ? 51.510 30.985  36.864  1.00 45.43 ? 650 THR D C   1 
ATOM   3641 O  O   . THR D 2 49  ? 50.442 31.451  37.268  1.00 46.41 ? 650 THR D O   1 
ATOM   3642 C  CB  . THR D 2 49  ? 53.569 32.400  36.860  1.00 44.27 ? 650 THR D CB  1 
ATOM   3643 O  OG1 . THR D 2 49  ? 53.003 33.215  37.892  1.00 46.25 ? 650 THR D OG1 1 
ATOM   3644 C  CG2 . THR D 2 49  ? 54.529 33.242  36.028  1.00 45.52 ? 650 THR D CG2 1 
ATOM   3645 N  N   . ALA D 2 50  ? 51.931 29.766  37.182  1.00 45.22 ? 651 ALA D N   1 
ATOM   3646 C  CA  . ALA D 2 50  ? 51.131 28.860  38.003  1.00 42.56 ? 651 ALA D CA  1 
ATOM   3647 C  C   . ALA D 2 50  ? 50.639 29.502  39.290  1.00 45.09 ? 651 ALA D C   1 
ATOM   3648 O  O   . ALA D 2 50  ? 49.508 29.290  39.702  1.00 47.62 ? 651 ALA D O   1 
ATOM   3649 C  CB  . ALA D 2 50  ? 51.928 27.621  38.331  1.00 40.56 ? 651 ALA D CB  1 
ATOM   3650 N  N   . ASP D 2 51  ? 51.490 30.301  39.920  1.00 48.48 ? 652 ASP D N   1 
ATOM   3651 C  CA  . ASP D 2 51  ? 51.128 30.944  41.177  1.00 46.91 ? 652 ASP D CA  1 
ATOM   3652 C  C   . ASP D 2 51  ? 50.226 32.145  40.995  1.00 41.58 ? 652 ASP D C   1 
ATOM   3653 O  O   . ASP D 2 51  ? 49.394 32.423  41.849  1.00 40.90 ? 652 ASP D O   1 
ATOM   3654 C  CB  . ASP D 2 51  ? 52.377 31.266  42.017  1.00 53.61 ? 652 ASP D CB  1 
ATOM   3655 C  CG  . ASP D 2 51  ? 52.890 30.043  42.796  1.00 60.17 ? 652 ASP D CG  1 
ATOM   3656 O  OD1 . ASP D 2 51  ? 53.972 29.495  42.454  1.00 63.06 ? 652 ASP D OD1 1 
ATOM   3657 O  OD2 . ASP D 2 51  ? 52.186 29.614  43.744  1.00 67.63 ? 652 ASP D OD2 1 
ATOM   3658 N  N   . ALA D 2 52  ? 50.366 32.849  39.881  1.00 41.58 ? 653 ALA D N   1 
ATOM   3659 C  CA  . ALA D 2 52  ? 49.498 33.993  39.620  1.00 44.92 ? 653 ALA D CA  1 
ATOM   3660 C  C   . ALA D 2 52  ? 48.075 33.470  39.420  1.00 45.72 ? 653 ALA D C   1 
ATOM   3661 O  O   . ALA D 2 52  ? 47.105 34.081  39.874  1.00 49.21 ? 653 ALA D O   1 
ATOM   3662 C  CB  . ALA D 2 52  ? 49.956 34.738  38.378  1.00 48.43 ? 653 ALA D CB  1 
ATOM   3663 N  N   . VAL D 2 53  ? 47.966 32.329  38.743  1.00 42.20 ? 654 VAL D N   1 
ATOM   3664 C  CA  . VAL D 2 53  ? 46.679 31.703  38.482  1.00 39.91 ? 654 VAL D CA  1 
ATOM   3665 C  C   . VAL D 2 53  ? 46.061 31.180  39.780  1.00 40.04 ? 654 VAL D C   1 
ATOM   3666 O  O   . VAL D 2 53  ? 44.940 31.533  40.120  1.00 40.49 ? 654 VAL D O   1 
ATOM   3667 C  CB  . VAL D 2 53  ? 46.811 30.533  37.482  1.00 35.21 ? 654 VAL D CB  1 
ATOM   3668 C  CG1 . VAL D 2 53  ? 45.464 29.860  37.276  1.00 31.02 ? 654 VAL D CG1 1 
ATOM   3669 C  CG2 . VAL D 2 53  ? 47.347 31.024  36.174  1.00 31.00 ? 654 VAL D CG2 1 
ATOM   3670 N  N   . MET D 2 54  ? 46.800 30.343  40.501  1.00 40.58 ? 655 MET D N   1 
ATOM   3671 C  CA  . MET D 2 54  ? 46.323 29.752  41.759  1.00 40.28 ? 655 MET D CA  1 
ATOM   3672 C  C   . MET D 2 54  ? 45.975 30.736  42.869  1.00 41.99 ? 655 MET D C   1 
ATOM   3673 O  O   . MET D 2 54  ? 45.141 30.436  43.729  1.00 42.44 ? 655 MET D O   1 
ATOM   3674 C  CB  . MET D 2 54  ? 47.342 28.736  42.294  1.00 42.71 ? 655 MET D CB  1 
ATOM   3675 C  CG  . MET D 2 54  ? 47.657 27.599  41.333  1.00 36.77 ? 655 MET D CG  1 
ATOM   3676 S  SD  . MET D 2 54  ? 46.179 26.702  40.862  1.00 33.90 ? 655 MET D SD  1 
ATOM   3677 C  CE  . MET D 2 54  ? 45.594 26.165  42.485  1.00 31.41 ? 655 MET D CE  1 
ATOM   3678 N  N   . ASN D 2 55  ? 46.622 31.897  42.863  1.00 43.63 ? 656 ASN D N   1 
ATOM   3679 C  CA  . ASN D 2 55  ? 46.377 32.908  43.886  1.00 43.75 ? 656 ASN D CA  1 
ATOM   3680 C  C   . ASN D 2 55  ? 45.525 34.069  43.403  1.00 43.10 ? 656 ASN D C   1 
ATOM   3681 O  O   . ASN D 2 55  ? 45.309 35.040  44.133  1.00 45.83 ? 656 ASN D O   1 
ATOM   3682 C  CB  . ASN D 2 55  ? 47.701 33.406  44.459  1.00 45.17 ? 656 ASN D CB  1 
ATOM   3683 C  CG  . ASN D 2 55  ? 48.451 32.317  45.194  1.00 47.76 ? 656 ASN D CG  1 
ATOM   3684 O  OD1 . ASN D 2 55  ? 48.093 31.942  46.315  1.00 51.11 ? 656 ASN D OD1 1 
ATOM   3685 N  ND2 . ASN D 2 55  ? 49.479 31.778  44.554  1.00 48.27 ? 656 ASN D ND2 1 
ATOM   3686 N  N   . ASN D 2 56  ? 45.037 33.953  42.172  1.00 41.09 ? 657 ASN D N   1 
ATOM   3687 C  CA  . ASN D 2 56  ? 44.177 34.956  41.553  1.00 40.26 ? 657 ASN D CA  1 
ATOM   3688 C  C   . ASN D 2 56  ? 42.782 34.949  42.208  1.00 38.83 ? 657 ASN D C   1 
ATOM   3689 O  O   . ASN D 2 56  ? 42.072 33.939  42.181  1.00 33.95 ? 657 ASN D O   1 
ATOM   3690 C  CB  . ASN D 2 56  ? 44.066 34.668  40.058  1.00 40.72 ? 657 ASN D CB  1 
ATOM   3691 C  CG  . ASN D 2 56  ? 43.210 35.675  39.334  1.00 42.09 ? 657 ASN D CG  1 
ATOM   3692 O  OD1 . ASN D 2 56  ? 41.997 35.751  39.553  1.00 48.50 ? 657 ASN D OD1 1 
ATOM   3693 N  ND2 . ASN D 2 56  ? 43.834 36.474  38.486  1.00 38.32 ? 657 ASN D ND2 1 
ATOM   3694 N  N   . PRO D 2 57  ? 42.368 36.089  42.788  1.00 41.68 ? 658 PRO D N   1 
ATOM   3695 C  CA  . PRO D 2 57  ? 41.076 36.257  43.465  1.00 41.40 ? 658 PRO D CA  1 
ATOM   3696 C  C   . PRO D 2 57  ? 39.812 35.877  42.684  1.00 39.68 ? 658 PRO D C   1 
ATOM   3697 O  O   . PRO D 2 57  ? 38.898 35.283  43.253  1.00 38.56 ? 658 PRO D O   1 
ATOM   3698 C  CB  . PRO D 2 57  ? 41.069 37.747  43.826  1.00 41.29 ? 658 PRO D CB  1 
ATOM   3699 C  CG  . PRO D 2 57  ? 42.519 38.063  43.985  1.00 41.25 ? 658 PRO D CG  1 
ATOM   3700 C  CD  . PRO D 2 57  ? 43.108 37.367  42.787  1.00 41.15 ? 658 PRO D CD  1 
ATOM   3701 N  N   . LYS D 2 58  ? 39.728 36.263  41.412  1.00 40.68 ? 659 LYS D N   1 
ATOM   3702 C  CA  . LYS D 2 58  ? 38.547 35.957  40.602  1.00 40.78 ? 659 LYS D CA  1 
ATOM   3703 C  C   . LYS D 2 58  ? 38.503 34.476  40.230  1.00 41.24 ? 659 LYS D C   1 
ATOM   3704 O  O   . LYS D 2 58  ? 37.427 33.904  40.025  1.00 39.74 ? 659 LYS D O   1 
ATOM   3705 C  CB  . LYS D 2 58  ? 38.497 36.836  39.346  1.00 44.81 ? 659 LYS D CB  1 
ATOM   3706 C  CG  . LYS D 2 58  ? 38.565 38.333  39.614  1.00 47.64 ? 659 LYS D CG  1 
ATOM   3707 C  CD  . LYS D 2 58  ? 38.064 39.161  38.419  1.00 54.95 ? 659 LYS D CD  1 
ATOM   3708 C  CE  . LYS D 2 58  ? 36.522 39.151  38.333  1.00 61.09 ? 659 LYS D CE  1 
ATOM   3709 N  NZ  . LYS D 2 58  ? 35.978 40.083  37.287  1.00 66.13 ? 659 LYS D NZ  1 
ATOM   3710 N  N   . VAL D 2 59  ? 39.677 33.862  40.119  1.00 40.29 ? 660 VAL D N   1 
ATOM   3711 C  CA  . VAL D 2 59  ? 39.761 32.438  39.823  1.00 39.34 ? 660 VAL D CA  1 
ATOM   3712 C  C   . VAL D 2 59  ? 39.143 31.632  40.984  1.00 39.69 ? 660 VAL D C   1 
ATOM   3713 O  O   . VAL D 2 59  ? 38.282 30.776  40.753  1.00 43.01 ? 660 VAL D O   1 
ATOM   3714 C  CB  . VAL D 2 59  ? 41.222 32.001  39.591  1.00 36.33 ? 660 VAL D CB  1 
ATOM   3715 C  CG1 . VAL D 2 59  ? 41.319 30.493  39.493  1.00 39.43 ? 660 VAL D CG1 1 
ATOM   3716 C  CG2 . VAL D 2 59  ? 41.753 32.629  38.323  1.00 32.94 ? 660 VAL D CG2 1 
ATOM   3717 N  N   . LYS D 2 60  ? 39.525 31.955  42.228  1.00 37.86 ? 661 LYS D N   1 
ATOM   3718 C  CA  . LYS D 2 60  ? 39.009 31.261  43.424  1.00 37.86 ? 661 LYS D CA  1 
ATOM   3719 C  C   . LYS D 2 60  ? 37.505 31.461  43.617  1.00 38.55 ? 661 LYS D C   1 
ATOM   3720 O  O   . LYS D 2 60  ? 36.816 30.597  44.162  1.00 40.26 ? 661 LYS D O   1 
ATOM   3721 C  CB  . LYS D 2 60  ? 39.721 31.742  44.697  1.00 37.68 ? 661 LYS D CB  1 
ATOM   3722 C  CG  . LYS D 2 60  ? 41.222 31.516  44.732  1.00 47.07 ? 661 LYS D CG  1 
ATOM   3723 C  CD  . LYS D 2 60  ? 41.792 31.736  46.143  1.00 47.53 ? 661 LYS D CD  1 
ATOM   3724 C  CE  . LYS D 2 60  ? 43.255 31.302  46.201  1.00 46.89 ? 661 LYS D CE  1 
ATOM   3725 N  NZ  . LYS D 2 60  ? 43.718 30.998  47.584  1.00 45.10 ? 661 LYS D NZ  1 
ATOM   3726 N  N   . ALA D 2 61  ? 37.027 32.628  43.189  1.00 40.56 ? 662 ALA D N   1 
ATOM   3727 C  CA  . ALA D 2 61  ? 35.632 33.028  43.295  1.00 39.38 ? 662 ALA D CA  1 
ATOM   3728 C  C   . ALA D 2 61  ? 34.773 32.356  42.245  1.00 38.60 ? 662 ALA D C   1 
ATOM   3729 O  O   . ALA D 2 61  ? 33.656 31.904  42.525  1.00 40.11 ? 662 ALA D O   1 
ATOM   3730 C  CB  . ALA D 2 61  ? 35.521 34.533  43.165  1.00 44.23 ? 662 ALA D CB  1 
ATOM   3731 N  N   . HIS D 2 62  ? 35.273 32.323  41.019  1.00 34.78 ? 663 HIS D N   1 
ATOM   3732 C  CA  . HIS D 2 62  ? 34.540 31.674  39.955  1.00 32.99 ? 663 HIS D CA  1 
ATOM   3733 C  C   . HIS D 2 62  ? 34.540 30.172  40.196  1.00 33.53 ? 663 HIS D C   1 
ATOM   3734 O  O   . HIS D 2 62  ? 33.572 29.493  39.859  1.00 34.83 ? 663 HIS D O   1 
ATOM   3735 C  CB  . HIS D 2 62  ? 35.149 31.973  38.599  1.00 35.70 ? 663 HIS D CB  1 
ATOM   3736 C  CG  . HIS D 2 62  ? 34.296 31.516  37.467  1.00 38.16 ? 663 HIS D CG  1 
ATOM   3737 N  ND1 . HIS D 2 62  ? 33.229 32.254  37.004  1.00 40.69 ? 663 HIS D ND1 1 
ATOM   3738 C  CD2 . HIS D 2 62  ? 34.302 30.371  36.747  1.00 34.79 ? 663 HIS D CD2 1 
ATOM   3739 C  CE1 . HIS D 2 62  ? 32.610 31.581  36.055  1.00 39.31 ? 663 HIS D CE1 1 
ATOM   3740 N  NE2 . HIS D 2 62  ? 33.242 30.435  35.881  1.00 36.44 ? 663 HIS D NE2 1 
ATOM   3741 N  N   . GLY D 2 63  ? 35.616 29.666  40.799  1.00 31.01 ? 664 GLY D N   1 
ATOM   3742 C  CA  . GLY D 2 63  ? 35.711 28.245  41.095  1.00 31.58 ? 664 GLY D CA  1 
ATOM   3743 C  C   . GLY D 2 63  ? 34.617 27.831  42.061  1.00 32.31 ? 664 GLY D C   1 
ATOM   3744 O  O   . GLY D 2 63  ? 33.936 26.817  41.866  1.00 32.16 ? 664 GLY D O   1 
ATOM   3745 N  N   . LYS D 2 64  ? 34.443 28.642  43.100  1.00 35.72 ? 665 LYS D N   1 
ATOM   3746 C  CA  . LYS D 2 64  ? 33.412 28.435  44.111  1.00 37.70 ? 665 LYS D CA  1 
ATOM   3747 C  C   . LYS D 2 64  ? 32.059 28.376  43.381  1.00 37.43 ? 665 LYS D C   1 
ATOM   3748 O  O   . LYS D 2 64  ? 31.213 27.537  43.685  1.00 37.84 ? 665 LYS D O   1 
ATOM   3749 C  CB  . LYS D 2 64  ? 33.447 29.624  45.090  1.00 42.64 ? 665 LYS D CB  1 
ATOM   3750 C  CG  . LYS D 2 64  ? 32.264 29.786  46.045  1.00 45.37 ? 665 LYS D CG  1 
ATOM   3751 C  CD  . LYS D 2 64  ? 32.288 28.758  47.170  1.00 55.36 ? 665 LYS D CD  1 
ATOM   3752 C  CE  . LYS D 2 64  ? 31.308 29.120  48.285  1.00 57.41 ? 665 LYS D CE  1 
ATOM   3753 N  NZ  . LYS D 2 64  ? 29.969 29.522  47.736  1.00 63.43 ? 665 LYS D NZ  1 
ATOM   3754 N  N   . LYS D 2 65  ? 31.880 29.258  42.399  1.00 37.07 ? 666 LYS D N   1 
ATOM   3755 C  CA  . LYS D 2 65  ? 30.650 29.327  41.621  1.00 35.31 ? 666 LYS D CA  1 
ATOM   3756 C  C   . LYS D 2 65  ? 30.421 28.057  40.810  1.00 34.92 ? 666 LYS D C   1 
ATOM   3757 O  O   . LYS D 2 65  ? 29.325 27.507  40.811  1.00 35.10 ? 666 LYS D O   1 
ATOM   3758 C  CB  . LYS D 2 65  ? 30.670 30.563  40.718  1.00 39.24 ? 666 LYS D CB  1 
ATOM   3759 C  CG  . LYS D 2 65  ? 29.654 31.633  41.081  1.00 45.27 ? 666 LYS D CG  1 
ATOM   3760 C  CD  . LYS D 2 65  ? 28.268 31.320  40.477  1.00 56.27 ? 666 LYS D CD  1 
ATOM   3761 C  CE  . LYS D 2 65  ? 27.501 30.186  41.195  1.00 60.31 ? 666 LYS D CE  1 
ATOM   3762 N  NZ  . LYS D 2 65  ? 26.313 29.664  40.434  1.00 56.64 ? 666 LYS D NZ  1 
ATOM   3763 N  N   . VAL D 2 66  ? 31.459 27.574  40.139  1.00 34.58 ? 667 VAL D N   1 
ATOM   3764 C  CA  . VAL D 2 66  ? 31.354 26.344  39.360  1.00 31.70 ? 667 VAL D CA  1 
ATOM   3765 C  C   . VAL D 2 66  ? 30.989 25.152  40.272  1.00 30.82 ? 667 VAL D C   1 
ATOM   3766 O  O   . VAL D 2 66  ? 30.126 24.331  39.939  1.00 32.57 ? 667 VAL D O   1 
ATOM   3767 C  CB  . VAL D 2 66  ? 32.681 26.049  38.633  1.00 30.20 ? 667 VAL D CB  1 
ATOM   3768 C  CG1 . VAL D 2 66  ? 32.555 24.816  37.756  1.00 33.35 ? 667 VAL D CG1 1 
ATOM   3769 C  CG2 . VAL D 2 66  ? 33.070 27.224  37.810  1.00 26.18 ? 667 VAL D CG2 1 
ATOM   3770 N  N   . LEU D 2 67  ? 31.613 25.081  41.439  1.00 32.19 ? 668 LEU D N   1 
ATOM   3771 C  CA  . LEU D 2 67  ? 31.344 23.990  42.372  1.00 37.85 ? 668 LEU D CA  1 
ATOM   3772 C  C   . LEU D 2 67  ? 29.914 24.023  42.929  1.00 39.02 ? 668 LEU D C   1 
ATOM   3773 O  O   . LEU D 2 67  ? 29.332 22.968  43.195  1.00 36.80 ? 668 LEU D O   1 
ATOM   3774 C  CB  . LEU D 2 67  ? 32.372 23.990  43.515  1.00 41.94 ? 668 LEU D CB  1 
ATOM   3775 C  CG  . LEU D 2 67  ? 33.525 22.969  43.500  1.00 43.25 ? 668 LEU D CG  1 
ATOM   3776 C  CD1 . LEU D 2 67  ? 33.175 21.727  44.308  1.00 44.08 ? 668 LEU D CD1 1 
ATOM   3777 C  CD2 . LEU D 2 67  ? 33.907 22.614  42.067  1.00 43.15 ? 668 LEU D CD2 1 
ATOM   3778 N  N   . ASP D 2 68  ? 29.357 25.220  43.131  1.00 41.25 ? 669 ASP D N   1 
ATOM   3779 C  CA  . ASP D 2 68  ? 27.978 25.350  43.628  1.00 42.01 ? 669 ASP D CA  1 
ATOM   3780 C  C   . ASP D 2 68  ? 26.987 24.736  42.617  1.00 42.79 ? 669 ASP D C   1 
ATOM   3781 O  O   . ASP D 2 68  ? 25.977 24.138  43.015  1.00 44.63 ? 669 ASP D O   1 
ATOM   3782 C  CB  . ASP D 2 68  ? 27.626 26.818  43.936  1.00 43.33 ? 669 ASP D CB  1 
ATOM   3783 C  CG  . ASP D 2 68  ? 28.258 27.331  45.249  1.00 44.88 ? 669 ASP D CG  1 
ATOM   3784 O  OD1 . ASP D 2 68  ? 28.574 28.546  45.323  1.00 42.58 ? 669 ASP D OD1 1 
ATOM   3785 O  OD2 . ASP D 2 68  ? 28.417 26.536  46.211  1.00 42.85 ? 669 ASP D OD2 1 
ATOM   3786 N  N   . SER D 2 69  ? 27.294 24.867  41.320  1.00 41.77 ? 670 SER D N   1 
ATOM   3787 C  CA  . SER D 2 69  ? 26.483 24.284  40.245  1.00 40.56 ? 670 SER D CA  1 
ATOM   3788 C  C   . SER D 2 69  ? 26.552 22.791  40.393  1.00 40.32 ? 670 SER D C   1 
ATOM   3789 O  O   . SER D 2 69  ? 25.619 22.075  40.054  1.00 46.84 ? 670 SER D O   1 
ATOM   3790 C  CB  . SER D 2 69  ? 27.049 24.614  38.870  1.00 41.29 ? 670 SER D CB  1 
ATOM   3791 O  OG  . SER D 2 69  ? 26.873 25.971  38.546  1.00 49.96 ? 670 SER D OG  1 
ATOM   3792 N  N   . PHE D 2 70  ? 27.708 22.316  40.825  1.00 40.34 ? 671 PHE D N   1 
ATOM   3793 C  CA  . PHE D 2 70  ? 27.906 20.900  41.016  1.00 41.02 ? 671 PHE D CA  1 
ATOM   3794 C  C   . PHE D 2 70  ? 27.075 20.395  42.169  1.00 42.02 ? 671 PHE D C   1 
ATOM   3795 O  O   . PHE D 2 70  ? 26.396 19.376  42.038  1.00 42.31 ? 671 PHE D O   1 
ATOM   3796 C  CB  . PHE D 2 70  ? 29.377 20.593  41.242  1.00 43.38 ? 671 PHE D CB  1 
ATOM   3797 C  CG  . PHE D 2 70  ? 30.035 19.980  40.061  1.00 42.58 ? 671 PHE D CG  1 
ATOM   3798 C  CD1 . PHE D 2 70  ? 30.644 20.780  39.093  1.00 48.42 ? 671 PHE D CD1 1 
ATOM   3799 C  CD2 . PHE D 2 70  ? 30.013 18.600  39.890  1.00 45.11 ? 671 PHE D CD2 1 
ATOM   3800 C  CE1 . PHE D 2 70  ? 31.227 20.210  37.959  1.00 49.55 ? 671 PHE D CE1 1 
ATOM   3801 C  CE2 . PHE D 2 70  ? 30.585 18.013  38.771  1.00 44.99 ? 671 PHE D CE2 1 
ATOM   3802 C  CZ  . PHE D 2 70  ? 31.196 18.820  37.796  1.00 50.42 ? 671 PHE D CZ  1 
ATOM   3803 N  N   . SER D 2 71  ? 27.141 21.093  43.302  1.00 43.95 ? 672 SER D N   1 
ATOM   3804 C  CA  . SER D 2 71  ? 26.363 20.720  44.473  1.00 41.36 ? 672 SER D CA  1 
ATOM   3805 C  C   . SER D 2 71  ? 24.901 20.706  44.076  1.00 42.46 ? 672 SER D C   1 
ATOM   3806 O  O   . SER D 2 71  ? 24.157 19.808  44.448  1.00 45.40 ? 672 SER D O   1 
ATOM   3807 C  CB  . SER D 2 71  ? 26.564 21.725  45.596  1.00 41.16 ? 672 SER D CB  1 
ATOM   3808 O  OG  . SER D 2 71  ? 27.898 21.729  46.027  1.00 41.57 ? 672 SER D OG  1 
ATOM   3809 N  N   . ASN D 2 72  ? 24.505 21.676  43.261  1.00 42.85 ? 673 ASN D N   1 
ATOM   3810 C  CA  . ASN D 2 72  ? 23.123 21.753  42.821  1.00 44.39 ? 673 ASN D CA  1 
ATOM   3811 C  C   . ASN D 2 72  ? 22.726 20.590  41.896  1.00 43.37 ? 673 ASN D C   1 
ATOM   3812 O  O   . ASN D 2 72  ? 21.590 20.119  41.947  1.00 46.45 ? 673 ASN D O   1 
ATOM   3813 C  CB  . ASN D 2 72  ? 22.830 23.113  42.172  1.00 45.25 ? 673 ASN D CB  1 
ATOM   3814 C  CG  . ASN D 2 72  ? 21.368 23.285  41.857  1.00 45.97 ? 673 ASN D CG  1 
ATOM   3815 O  OD1 . ASN D 2 72  ? 20.964 23.280  40.697  1.00 46.43 ? 673 ASN D OD1 1 
ATOM   3816 N  ND2 . ASN D 2 72  ? 20.550 23.383  42.899  1.00 52.87 ? 673 ASN D ND2 1 
ATOM   3817 N  N   . GLY D 2 73  ? 23.659 20.119  41.070  1.00 40.48 ? 674 GLY D N   1 
ATOM   3818 C  CA  . GLY D 2 73  ? 23.374 19.007  40.181  1.00 39.92 ? 674 GLY D CA  1 
ATOM   3819 C  C   . GLY D 2 73  ? 23.302 17.714  40.980  1.00 44.32 ? 674 GLY D C   1 
ATOM   3820 O  O   . GLY D 2 73  ? 22.636 16.758  40.568  1.00 42.09 ? 674 GLY D O   1 
ATOM   3821 N  N   . MET D 2 74  ? 23.987 17.706  42.130  1.00 47.66 ? 675 MET D N   1 
ATOM   3822 C  CA  . MET D 2 74  ? 24.039 16.574  43.072  1.00 48.52 ? 675 MET D CA  1 
ATOM   3823 C  C   . MET D 2 74  ? 22.693 16.360  43.792  1.00 46.96 ? 675 MET D C   1 
ATOM   3824 O  O   . MET D 2 74  ? 22.454 15.317  44.403  1.00 43.20 ? 675 MET D O   1 
ATOM   3825 C  CB  . MET D 2 74  ? 25.124 16.831  44.133  1.00 51.35 ? 675 MET D CB  1 
ATOM   3826 C  CG  . MET D 2 74  ? 26.568 16.869  43.618  1.00 52.95 ? 675 MET D CG  1 
ATOM   3827 S  SD  . MET D 2 74  ? 27.277 15.240  43.339  1.00 50.08 ? 675 MET D SD  1 
ATOM   3828 C  CE  . MET D 2 74  ? 27.854 14.845  44.958  1.00 48.17 ? 675 MET D CE  1 
ATOM   3829 N  N   . LYS D 2 75  ? 21.851 17.391  43.770  1.00 49.58 ? 676 LYS D N   1 
ATOM   3830 C  CA  . LYS D 2 75  ? 20.531 17.347  44.392  1.00 47.43 ? 676 LYS D CA  1 
ATOM   3831 C  C   . LYS D 2 75  ? 19.471 17.074  43.324  1.00 46.95 ? 676 LYS D C   1 
ATOM   3832 O  O   . LYS D 2 75  ? 18.279 17.008  43.623  1.00 47.74 ? 676 LYS D O   1 
ATOM   3833 C  CB  . LYS D 2 75  ? 20.224 18.682  45.076  1.00 48.68 ? 676 LYS D CB  1 
ATOM   3834 C  CG  . LYS D 2 75  ? 21.385 19.310  45.883  1.00 56.48 ? 676 LYS D CG  1 
ATOM   3835 C  CD  . LYS D 2 75  ? 21.729 18.538  47.175  1.00 62.47 ? 676 LYS D CD  1 
ATOM   3836 C  CE  . LYS D 2 75  ? 22.810 19.244  48.021  1.00 65.91 ? 676 LYS D CE  1 
ATOM   3837 N  NZ  . LYS D 2 75  ? 24.192 19.191  47.435  1.00 63.12 ? 676 LYS D NZ  1 
ATOM   3838 N  N   . HIS D 2 76  ? 19.906 16.978  42.069  1.00 46.30 ? 677 HIS D N   1 
ATOM   3839 C  CA  . HIS D 2 76  ? 19.020 16.715  40.944  1.00 47.31 ? 677 HIS D CA  1 
ATOM   3840 C  C   . HIS D 2 76  ? 19.666 15.673  40.064  1.00 46.75 ? 677 HIS D C   1 
ATOM   3841 O  O   . HIS D 2 76  ? 19.569 15.722  38.840  1.00 49.76 ? 677 HIS D O   1 
ATOM   3842 C  CB  . HIS D 2 76  ? 18.770 17.990  40.135  1.00 54.58 ? 677 HIS D CB  1 
ATOM   3843 C  CG  . HIS D 2 76  ? 18.032 19.050  40.893  1.00 58.61 ? 677 HIS D CG  1 
ATOM   3844 N  ND1 . HIS D 2 76  ? 18.541 20.317  41.088  1.00 59.96 ? 677 HIS D ND1 1 
ATOM   3845 C  CD2 . HIS D 2 76  ? 16.844 19.020  41.544  1.00 57.95 ? 677 HIS D CD2 1 
ATOM   3846 C  CE1 . HIS D 2 76  ? 17.705 21.019  41.830  1.00 61.28 ? 677 HIS D CE1 1 
ATOM   3847 N  NE2 . HIS D 2 76  ? 16.667 20.254  42.122  1.00 60.59 ? 677 HIS D NE2 1 
ATOM   3848 N  N   . LEU D 2 77  ? 20.290 14.699  40.711  1.00 47.13 ? 678 LEU D N   1 
ATOM   3849 C  CA  . LEU D 2 77  ? 20.973 13.614  40.027  1.00 47.76 ? 678 LEU D CA  1 
ATOM   3850 C  C   . LEU D 2 77  ? 20.135 12.778  39.087  1.00 46.81 ? 678 LEU D C   1 
ATOM   3851 O  O   . LEU D 2 77  ? 20.650 11.849  38.476  1.00 52.22 ? 678 LEU D O   1 
ATOM   3852 C  CB  . LEU D 2 77  ? 21.667 12.705  41.040  1.00 47.80 ? 678 LEU D CB  1 
ATOM   3853 C  CG  . LEU D 2 77  ? 22.949 13.333  41.598  1.00 51.04 ? 678 LEU D CG  1 
ATOM   3854 C  CD1 . LEU D 2 77  ? 23.653 12.393  42.577  1.00 50.30 ? 678 LEU D CD1 1 
ATOM   3855 C  CD2 . LEU D 2 77  ? 23.871 13.687  40.443  1.00 49.92 ? 678 LEU D CD2 1 
ATOM   3856 N  N   . ASP D 2 78  ? 18.849 13.075  38.973  1.00 48.39 ? 679 ASP D N   1 
ATOM   3857 C  CA  . ASP D 2 78  ? 17.980 12.308  38.083  1.00 52.04 ? 679 ASP D CA  1 
ATOM   3858 C  C   . ASP D 2 78  ? 17.526 13.168  36.921  1.00 47.85 ? 679 ASP D C   1 
ATOM   3859 O  O   . ASP D 2 78  ? 17.019 12.676  35.913  1.00 47.13 ? 679 ASP D O   1 
ATOM   3860 C  CB  . ASP D 2 78  ? 16.755 11.786  38.843  1.00 59.11 ? 679 ASP D CB  1 
ATOM   3861 C  CG  . ASP D 2 78  ? 17.112 10.759  39.915  1.00 67.03 ? 679 ASP D CG  1 
ATOM   3862 O  OD1 . ASP D 2 78  ? 16.208 10.396  40.697  1.00 67.58 ? 679 ASP D OD1 1 
ATOM   3863 O  OD2 . ASP D 2 78  ? 18.282 10.307  39.976  1.00 69.96 ? 679 ASP D OD2 1 
ATOM   3864 N  N   . ASP D 2 79  ? 17.739 14.463  37.069  1.00 48.99 ? 680 ASP D N   1 
ATOM   3865 C  CA  . ASP D 2 79  ? 17.347 15.417  36.057  1.00 53.27 ? 680 ASP D CA  1 
ATOM   3866 C  C   . ASP D 2 79  ? 18.543 16.329  35.823  1.00 52.28 ? 680 ASP D C   1 
ATOM   3867 O  O   . ASP D 2 79  ? 18.504 17.522  36.141  1.00 55.17 ? 680 ASP D O   1 
ATOM   3868 C  CB  . ASP D 2 79  ? 16.113 16.210  36.538  1.00 55.06 ? 680 ASP D CB  1 
ATOM   3869 C  CG  . ASP D 2 79  ? 15.730 17.361  35.597  1.00 60.91 ? 680 ASP D CG  1 
ATOM   3870 O  OD1 . ASP D 2 79  ? 15.353 18.449  36.110  1.00 63.47 ? 680 ASP D OD1 1 
ATOM   3871 O  OD2 . ASP D 2 79  ? 15.810 17.183  34.355  1.00 61.46 ? 680 ASP D OD2 1 
ATOM   3872 N  N   . LEU D 2 80  ? 19.628 15.761  35.308  1.00 48.92 ? 681 LEU D N   1 
ATOM   3873 C  CA  . LEU D 2 80  ? 20.803 16.575  35.031  1.00 44.90 ? 681 LEU D CA  1 
ATOM   3874 C  C   . LEU D 2 80  ? 20.629 17.378  33.733  1.00 43.16 ? 681 LEU D C   1 
ATOM   3875 O  O   . LEU D 2 80  ? 20.936 18.571  33.685  1.00 40.75 ? 681 LEU D O   1 
ATOM   3876 C  CB  . LEU D 2 80  ? 22.080 15.726  35.024  1.00 42.94 ? 681 LEU D CB  1 
ATOM   3877 C  CG  . LEU D 2 80  ? 22.561 15.357  36.433  1.00 45.51 ? 681 LEU D CG  1 
ATOM   3878 C  CD1 . LEU D 2 80  ? 23.915 14.657  36.365  1.00 40.46 ? 681 LEU D CD1 1 
ATOM   3879 C  CD2 . LEU D 2 80  ? 22.643 16.614  37.313  1.00 42.46 ? 681 LEU D CD2 1 
ATOM   3880 N  N   . LYS D 2 81  ? 20.026 16.759  32.725  1.00 44.13 ? 682 LYS D N   1 
ATOM   3881 C  CA  . LYS D 2 81  ? 19.808 17.422  31.440  1.00 48.45 ? 682 LYS D CA  1 
ATOM   3882 C  C   . LYS D 2 81  ? 18.898 18.645  31.579  1.00 49.35 ? 682 LYS D C   1 
ATOM   3883 O  O   . LYS D 2 81  ? 18.891 19.523  30.712  1.00 50.86 ? 682 LYS D O   1 
ATOM   3884 C  CB  . LYS D 2 81  ? 19.213 16.433  30.430  1.00 51.01 ? 682 LYS D CB  1 
ATOM   3885 C  CG  . LYS D 2 81  ? 20.026 15.124  30.245  1.00 52.01 ? 682 LYS D CG  1 
ATOM   3886 C  CD  . LYS D 2 81  ? 21.113 15.229  29.161  1.00 54.27 ? 682 LYS D CD  1 
ATOM   3887 C  CE  . LYS D 2 81  ? 21.929 13.924  29.016  1.00 59.42 ? 682 LYS D CE  1 
ATOM   3888 N  NZ  . LYS D 2 81  ? 22.937 13.665  30.118  1.00 58.28 ? 682 LYS D NZ  1 
ATOM   3889 N  N   . GLY D 2 82  ? 18.135 18.691  32.674  1.00 50.79 ? 683 GLY D N   1 
ATOM   3890 C  CA  . GLY D 2 82  ? 17.219 19.798  32.928  1.00 47.80 ? 683 GLY D CA  1 
ATOM   3891 C  C   . GLY D 2 82  ? 17.830 20.892  33.786  1.00 44.96 ? 683 GLY D C   1 
ATOM   3892 O  O   . GLY D 2 82  ? 17.710 22.082  33.483  1.00 46.91 ? 683 GLY D O   1 
ATOM   3893 N  N   . THR D 2 83  ? 18.507 20.492  34.851  1.00 40.69 ? 684 THR D N   1 
ATOM   3894 C  CA  . THR D 2 83  ? 19.152 21.444  35.742  1.00 43.80 ? 684 THR D CA  1 
ATOM   3895 C  C   . THR D 2 83  ? 20.179 22.356  35.029  1.00 42.42 ? 684 THR D C   1 
ATOM   3896 O  O   . THR D 2 83  ? 20.261 23.564  35.284  1.00 42.37 ? 684 THR D O   1 
ATOM   3897 C  CB  . THR D 2 83  ? 19.853 20.694  36.894  1.00 43.34 ? 684 THR D CB  1 
ATOM   3898 O  OG1 . THR D 2 83  ? 18.891 19.912  37.622  1.00 46.79 ? 684 THR D OG1 1 
ATOM   3899 C  CG2 . THR D 2 83  ? 20.531 21.681  37.837  1.00 49.82 ? 684 THR D CG2 1 
ATOM   3900 N  N   . PHE D 2 84  ? 20.932 21.776  34.103  1.00 42.85 ? 685 PHE D N   1 
ATOM   3901 C  CA  . PHE D 2 84  ? 21.968 22.518  33.395  1.00 41.97 ? 685 PHE D CA  1 
ATOM   3902 C  C   . PHE D 2 84  ? 21.584 23.027  32.004  1.00 41.09 ? 685 PHE D C   1 
ATOM   3903 O  O   . PHE D 2 84  ? 22.439 23.515  31.255  1.00 41.88 ? 685 PHE D O   1 
ATOM   3904 C  CB  . PHE D 2 84  ? 23.249 21.664  33.319  1.00 38.40 ? 685 PHE D CB  1 
ATOM   3905 C  CG  . PHE D 2 84  ? 23.924 21.440  34.658  1.00 33.90 ? 685 PHE D CG  1 
ATOM   3906 C  CD1 . PHE D 2 84  ? 23.747 20.242  35.352  1.00 34.46 ? 685 PHE D CD1 1 
ATOM   3907 C  CD2 . PHE D 2 84  ? 24.761 22.414  35.203  1.00 30.06 ? 685 PHE D CD2 1 
ATOM   3908 C  CE1 . PHE D 2 84  ? 24.393 20.019  36.564  1.00 34.49 ? 685 PHE D CE1 1 
ATOM   3909 C  CE2 . PHE D 2 84  ? 25.412 22.205  36.412  1.00 29.00 ? 685 PHE D CE2 1 
ATOM   3910 C  CZ  . PHE D 2 84  ? 25.234 21.007  37.097  1.00 31.49 ? 685 PHE D CZ  1 
ATOM   3911 N  N   . ALA D 2 85  ? 20.295 22.985  31.685  1.00 40.77 ? 686 ALA D N   1 
ATOM   3912 C  CA  . ALA D 2 85  ? 19.833 23.428  30.376  1.00 39.52 ? 686 ALA D CA  1 
ATOM   3913 C  C   . ALA D 2 85  ? 20.246 24.858  30.045  1.00 41.03 ? 686 ALA D C   1 
ATOM   3914 O  O   . ALA D 2 85  ? 20.771 25.112  28.954  1.00 41.92 ? 686 ALA D O   1 
ATOM   3915 C  CB  . ALA D 2 85  ? 18.319 23.272  30.261  1.00 41.60 ? 686 ALA D CB  1 
ATOM   3916 N  N   . ALA D 2 86  ? 20.050 25.771  31.000  1.00 38.65 ? 687 ALA D N   1 
ATOM   3917 C  CA  . ALA D 2 86  ? 20.378 27.191  30.812  1.00 38.66 ? 687 ALA D CA  1 
ATOM   3918 C  C   . ALA D 2 86  ? 21.878 27.391  30.736  1.00 38.77 ? 687 ALA D C   1 
ATOM   3919 O  O   . ALA D 2 86  ? 22.379 28.164  29.909  1.00 44.40 ? 687 ALA D O   1 
ATOM   3920 C  CB  . ALA D 2 86  ? 19.791 28.043  31.951  1.00 33.90 ? 687 ALA D CB  1 
ATOM   3921 N  N   . LEU D 2 87  ? 22.584 26.697  31.618  1.00 37.33 ? 688 LEU D N   1 
ATOM   3922 C  CA  . LEU D 2 87  ? 24.028 26.768  31.686  1.00 32.00 ? 688 LEU D CA  1 
ATOM   3923 C  C   . LEU D 2 87  ? 24.630 26.196  30.413  1.00 33.08 ? 688 LEU D C   1 
ATOM   3924 O  O   . LEU D 2 87  ? 25.675 26.647  29.959  1.00 34.17 ? 688 LEU D O   1 
ATOM   3925 C  CB  . LEU D 2 87  ? 24.505 25.993  32.900  1.00 35.05 ? 688 LEU D CB  1 
ATOM   3926 C  CG  . LEU D 2 87  ? 25.487 26.665  33.850  1.00 36.91 ? 688 LEU D CG  1 
ATOM   3927 C  CD1 . LEU D 2 87  ? 25.221 28.150  33.945  1.00 36.41 ? 688 LEU D CD1 1 
ATOM   3928 C  CD2 . LEU D 2 87  ? 25.386 25.983  35.210  1.00 37.49 ? 688 LEU D CD2 1 
ATOM   3929 N  N   . SER D 2 88  ? 23.945 25.233  29.815  1.00 31.18 ? 689 SER D N   1 
ATOM   3930 C  CA  . SER D 2 88  ? 24.415 24.623  28.586  1.00 34.10 ? 689 SER D CA  1 
ATOM   3931 C  C   . SER D 2 88  ? 24.371 25.608  27.429  1.00 39.58 ? 689 SER D C   1 
ATOM   3932 O  O   . SER D 2 88  ? 25.331 25.745  26.666  1.00 42.27 ? 689 SER D O   1 
ATOM   3933 C  CB  . SER D 2 88  ? 23.577 23.403  28.226  1.00 31.33 ? 689 SER D CB  1 
ATOM   3934 O  OG  . SER D 2 88  ? 23.966 22.919  26.956  1.00 30.49 ? 689 SER D OG  1 
ATOM   3935 N  N   . GLU D 2 89  ? 23.248 26.294  27.282  1.00 42.38 ? 690 GLU D N   1 
ATOM   3936 C  CA  . GLU D 2 89  ? 23.100 27.255  26.204  1.00 42.48 ? 690 GLU D CA  1 
ATOM   3937 C  C   . GLU D 2 89  ? 24.053 28.439  26.377  1.00 40.66 ? 690 GLU D C   1 
ATOM   3938 O  O   . GLU D 2 89  ? 24.563 29.000  25.403  1.00 40.37 ? 690 GLU D O   1 
ATOM   3939 C  CB  . GLU D 2 89  ? 21.659 27.722  26.147  1.00 48.04 ? 690 GLU D CB  1 
ATOM   3940 C  CG  . GLU D 2 89  ? 21.352 28.551  24.952  1.00 54.51 ? 690 GLU D CG  1 
ATOM   3941 C  CD  . GLU D 2 89  ? 20.442 29.678  25.310  1.00 59.33 ? 690 GLU D CD  1 
ATOM   3942 O  OE1 . GLU D 2 89  ? 20.929 30.838  25.330  1.00 63.22 ? 690 GLU D OE1 1 
ATOM   3943 O  OE2 . GLU D 2 89  ? 19.253 29.388  25.597  1.00 60.34 ? 690 GLU D OE2 1 
ATOM   3944 N  N   . LEU D 2 90  ? 24.294 28.821  27.622  1.00 36.22 ? 691 LEU D N   1 
ATOM   3945 C  CA  . LEU D 2 90  ? 25.212 29.916  27.889  1.00 35.90 ? 691 LEU D CA  1 
ATOM   3946 C  C   . LEU D 2 90  ? 26.598 29.540  27.360  1.00 35.82 ? 691 LEU D C   1 
ATOM   3947 O  O   . LEU D 2 90  ? 27.140 30.202  26.473  1.00 33.00 ? 691 LEU D O   1 
ATOM   3948 C  CB  . LEU D 2 90  ? 25.304 30.175  29.393  1.00 35.01 ? 691 LEU D CB  1 
ATOM   3949 C  CG  . LEU D 2 90  ? 26.315 31.245  29.810  1.00 36.78 ? 691 LEU D CG  1 
ATOM   3950 C  CD1 . LEU D 2 90  ? 25.765 32.600  29.404  1.00 35.96 ? 691 LEU D CD1 1 
ATOM   3951 C  CD2 . LEU D 2 90  ? 26.573 31.197  31.309  1.00 38.52 ? 691 LEU D CD2 1 
ATOM   3952 N  N   . HIS D 2 91  ? 27.144 28.444  27.884  1.00 37.79 ? 692 HIS D N   1 
ATOM   3953 C  CA  . HIS D 2 91  ? 28.475 27.972  27.510  1.00 35.71 ? 692 HIS D CA  1 
ATOM   3954 C  C   . HIS D 2 91  ? 28.617 27.660  26.036  1.00 37.49 ? 692 HIS D C   1 
ATOM   3955 O  O   . HIS D 2 91  ? 29.659 27.919  25.426  1.00 38.87 ? 692 HIS D O   1 
ATOM   3956 C  CB  . HIS D 2 91  ? 28.848 26.738  28.331  1.00 32.62 ? 692 HIS D CB  1 
ATOM   3957 C  CG  . HIS D 2 91  ? 29.170 27.037  29.766  1.00 33.39 ? 692 HIS D CG  1 
ATOM   3958 N  ND1 . HIS D 2 91  ? 28.226 27.160  30.763  1.00 30.55 ? 692 HIS D ND1 1 
ATOM   3959 C  CD2 . HIS D 2 91  ? 30.371 27.224  30.371  1.00 26.38 ? 692 HIS D CD2 1 
ATOM   3960 C  CE1 . HIS D 2 91  ? 28.861 27.404  31.907  1.00 29.30 ? 692 HIS D CE1 1 
ATOM   3961 N  NE2 . HIS D 2 91  ? 30.165 27.453  31.721  1.00 30.83 ? 692 HIS D NE2 1 
ATOM   3962 N  N   . CYS D 2 92  ? 27.553 27.124  25.460  1.00 39.37 ? 693 CYS D N   1 
ATOM   3963 C  CA  . CYS D 2 92  ? 27.565 26.755  24.068  1.00 39.98 ? 693 CYS D CA  1 
ATOM   3964 C  C   . CYS D 2 92  ? 27.291 27.925  23.134  1.00 39.62 ? 693 CYS D C   1 
ATOM   3965 O  O   . CYS D 2 92  ? 28.197 28.406  22.456  1.00 41.20 ? 693 CYS D O   1 
ATOM   3966 C  CB  . CYS D 2 92  ? 26.604 25.571  23.833  1.00 46.96 ? 693 CYS D CB  1 
ATOM   3967 S  SG  . CYS D 2 92  ? 27.097 23.954  24.712  1.00 57.31 ? 693 CYS D SG  1 
ATOM   3968 N  N   . ASP D 2 93  ? 26.086 28.474  23.183  1.00 45.56 ? 694 ASP D N   1 
ATOM   3969 C  CA  . ASP D 2 93  ? 25.722 29.561  22.284  1.00 45.63 ? 694 ASP D CA  1 
ATOM   3970 C  C   . ASP D 2 93  ? 26.285 30.946  22.566  1.00 46.21 ? 694 ASP D C   1 
ATOM   3971 O  O   . ASP D 2 93  ? 26.508 31.711  21.630  1.00 49.64 ? 694 ASP D O   1 
ATOM   3972 C  CB  . ASP D 2 93  ? 24.202 29.602  22.099  1.00 50.27 ? 694 ASP D CB  1 
ATOM   3973 C  CG  . ASP D 2 93  ? 23.615 28.221  21.724  1.00 57.81 ? 694 ASP D CG  1 
ATOM   3974 O  OD1 . ASP D 2 93  ? 22.664 27.776  22.400  1.00 58.86 ? 694 ASP D OD1 1 
ATOM   3975 O  OD2 . ASP D 2 93  ? 24.111 27.564  20.771  1.00 60.10 ? 694 ASP D OD2 1 
ATOM   3976 N  N   . LYS D 2 94  ? 26.562 31.280  23.821  1.00 47.59 ? 695 LYS D N   1 
ATOM   3977 C  CA  . LYS D 2 94  ? 27.104 32.620  24.108  1.00 49.06 ? 695 LYS D CA  1 
ATOM   3978 C  C   . LYS D 2 94  ? 28.615 32.665  24.420  1.00 46.16 ? 695 LYS D C   1 
ATOM   3979 O  O   . LYS D 2 94  ? 29.284 33.660  24.122  1.00 46.76 ? 695 LYS D O   1 
ATOM   3980 C  CB  . LYS D 2 94  ? 26.285 33.344  25.203  1.00 49.89 ? 695 LYS D CB  1 
ATOM   3981 C  CG  . LYS D 2 94  ? 24.794 33.543  24.867  1.00 48.89 ? 695 LYS D CG  1 
ATOM   3982 C  CD  . LYS D 2 94  ? 24.099 34.489  25.839  1.00 50.58 ? 695 LYS D CD  1 
ATOM   3983 C  CE  . LYS D 2 94  ? 22.576 34.255  25.894  1.00 52.52 ? 695 LYS D CE  1 
ATOM   3984 N  NZ  . LYS D 2 94  ? 22.162 33.197  26.891  1.00 51.11 ? 695 LYS D NZ  1 
ATOM   3985 N  N   . LEU D 2 95  ? 29.150 31.585  24.988  1.00 42.09 ? 696 LEU D N   1 
ATOM   3986 C  CA  . LEU D 2 95  ? 30.573 31.510  25.319  1.00 37.87 ? 696 LEU D CA  1 
ATOM   3987 C  C   . LEU D 2 95  ? 31.421 30.711  24.307  1.00 37.42 ? 696 LEU D C   1 
ATOM   3988 O  O   . LEU D 2 95  ? 32.621 30.966  24.159  1.00 37.51 ? 696 LEU D O   1 
ATOM   3989 C  CB  . LEU D 2 95  ? 30.759 30.941  26.721  1.00 38.77 ? 696 LEU D CB  1 
ATOM   3990 C  CG  . LEU D 2 95  ? 30.229 31.765  27.888  1.00 39.94 ? 696 LEU D CG  1 
ATOM   3991 C  CD1 . LEU D 2 95  ? 30.375 30.941  29.149  1.00 38.41 ? 696 LEU D CD1 1 
ATOM   3992 C  CD2 . LEU D 2 95  ? 30.966 33.103  28.010  1.00 34.88 ? 696 LEU D CD2 1 
ATOM   3993 N  N   . HIS D 2 96  ? 30.807 29.746  23.625  1.00 33.66 ? 697 HIS D N   1 
ATOM   3994 C  CA  . HIS D 2 96  ? 31.499 28.943  22.610  1.00 38.40 ? 697 HIS D CA  1 
ATOM   3995 C  C   . HIS D 2 96  ? 32.659 28.084  23.098  1.00 36.44 ? 697 HIS D C   1 
ATOM   3996 O  O   . HIS D 2 96  ? 33.733 28.061  22.493  1.00 35.02 ? 697 HIS D O   1 
ATOM   3997 C  CB  . HIS D 2 96  ? 31.952 29.841  21.456  1.00 44.61 ? 697 HIS D CB  1 
ATOM   3998 C  CG  . HIS D 2 96  ? 30.822 30.568  20.796  1.00 52.99 ? 697 HIS D CG  1 
ATOM   3999 N  ND1 . HIS D 2 96  ? 29.723 29.914  20.276  1.00 50.97 ? 697 HIS D ND1 1 
ATOM   4000 C  CD2 . HIS D 2 96  ? 30.590 31.892  20.622  1.00 53.21 ? 697 HIS D CD2 1 
ATOM   4001 C  CE1 . HIS D 2 96  ? 28.864 30.802  19.810  1.00 52.08 ? 697 HIS D CE1 1 
ATOM   4002 N  NE2 . HIS D 2 96  ? 29.366 32.009  20.009  1.00 57.12 ? 697 HIS D NE2 1 
ATOM   4003 N  N   . VAL D 2 97  ? 32.405 27.338  24.165  1.00 36.78 ? 698 VAL D N   1 
ATOM   4004 C  CA  . VAL D 2 97  ? 33.391 26.461  24.774  1.00 34.09 ? 698 VAL D CA  1 
ATOM   4005 C  C   . VAL D 2 97  ? 33.204 25.099  24.165  1.00 36.53 ? 698 VAL D C   1 
ATOM   4006 O  O   . VAL D 2 97  ? 32.086 24.590  24.138  1.00 40.32 ? 698 VAL D O   1 
ATOM   4007 C  CB  . VAL D 2 97  ? 33.118 26.270  26.275  1.00 34.58 ? 698 VAL D CB  1 
ATOM   4008 C  CG1 . VAL D 2 97  ? 34.220 25.448  26.889  1.00 32.26 ? 698 VAL D CG1 1 
ATOM   4009 C  CG2 . VAL D 2 97  ? 32.929 27.617  26.988  1.00 31.40 ? 698 VAL D CG2 1 
ATOM   4010 N  N   . ASP D 2 98  ? 34.277 24.494  23.677  1.00 37.61 ? 699 ASP D N   1 
ATOM   4011 C  CA  . ASP D 2 98  ? 34.161 23.152  23.116  1.00 38.79 ? 699 ASP D CA  1 
ATOM   4012 C  C   . ASP D 2 98  ? 33.841 22.175  24.267  1.00 37.32 ? 699 ASP D C   1 
ATOM   4013 O  O   . ASP D 2 98  ? 34.498 22.189  25.312  1.00 37.25 ? 699 ASP D O   1 
ATOM   4014 C  CB  . ASP D 2 98  ? 35.460 22.729  22.413  1.00 39.06 ? 699 ASP D CB  1 
ATOM   4015 C  CG  . ASP D 2 98  ? 35.291 21.454  21.589  1.00 43.85 ? 699 ASP D CG  1 
ATOM   4016 O  OD1 . ASP D 2 98  ? 34.979 21.575  20.385  1.00 46.08 ? 699 ASP D OD1 1 
ATOM   4017 O  OD2 . ASP D 2 98  ? 35.451 20.336  22.139  1.00 42.82 ? 699 ASP D OD2 1 
ATOM   4018 N  N   . PRO D 2 99  ? 32.825 21.315  24.083  1.00 35.49 ? 700 PRO D N   1 
ATOM   4019 C  CA  . PRO D 2 99  ? 32.378 20.314  25.062  1.00 31.01 ? 700 PRO D CA  1 
ATOM   4020 C  C   . PRO D 2 99  ? 33.484 19.435  25.639  1.00 33.62 ? 700 PRO D C   1 
ATOM   4021 O  O   . PRO D 2 99  ? 33.361 18.930  26.752  1.00 36.32 ? 700 PRO D O   1 
ATOM   4022 C  CB  . PRO D 2 99  ? 31.406 19.466  24.251  1.00 32.35 ? 700 PRO D CB  1 
ATOM   4023 C  CG  . PRO D 2 99  ? 30.825 20.428  23.312  1.00 28.40 ? 700 PRO D CG  1 
ATOM   4024 C  CD  . PRO D 2 99  ? 32.007 21.247  22.859  1.00 30.94 ? 700 PRO D CD  1 
ATOM   4025 N  N   . GLU D 2 100 ? 34.555 19.230  24.873  1.00 32.01 ? 701 GLU D N   1 
ATOM   4026 C  CA  . GLU D 2 100 ? 35.673 18.409  25.316  1.00 32.72 ? 701 GLU D CA  1 
ATOM   4027 C  C   . GLU D 2 100 ? 36.216 18.982  26.633  1.00 27.97 ? 701 GLU D C   1 
ATOM   4028 O  O   . GLU D 2 100 ? 36.600 18.243  27.536  1.00 24.54 ? 701 GLU D O   1 
ATOM   4029 C  CB  . GLU D 2 100 ? 36.748 18.386  24.209  1.00 34.90 ? 701 GLU D CB  1 
ATOM   4030 C  CG  . GLU D 2 100 ? 37.922 17.411  24.413  1.00 44.80 ? 701 GLU D CG  1 
ATOM   4031 C  CD  . GLU D 2 100 ? 37.506 15.935  24.506  1.00 52.02 ? 701 GLU D CD  1 
ATOM   4032 O  OE1 . GLU D 2 100 ? 36.667 15.486  23.684  1.00 54.65 ? 701 GLU D OE1 1 
ATOM   4033 O  OE2 . GLU D 2 100 ? 38.035 15.221  25.395  1.00 50.93 ? 701 GLU D OE2 1 
ATOM   4034 N  N   . ASN D 2 101 ? 36.135 20.299  26.779  1.00 25.70 ? 702 ASN D N   1 
ATOM   4035 C  CA  . ASN D 2 101 ? 36.638 20.969  27.964  1.00 23.95 ? 702 ASN D CA  1 
ATOM   4036 C  C   . ASN D 2 101 ? 35.844 20.694  29.206  1.00 26.43 ? 702 ASN D C   1 
ATOM   4037 O  O   . ASN D 2 101 ? 36.366 20.828  30.297  1.00 30.89 ? 702 ASN D O   1 
ATOM   4038 C  CB  . ASN D 2 101 ? 36.743 22.466  27.737  1.00 23.05 ? 702 ASN D CB  1 
ATOM   4039 C  CG  . ASN D 2 101 ? 37.681 22.808  26.611  1.00 27.28 ? 702 ASN D CG  1 
ATOM   4040 O  OD1 . ASN D 2 101 ? 37.274 23.351  25.594  1.00 37.17 ? 702 ASN D OD1 1 
ATOM   4041 N  ND2 . ASN D 2 101 ? 38.947 22.481  26.779  1.00 32.69 ? 702 ASN D ND2 1 
ATOM   4042 N  N   . PHE D 2 102 ? 34.569 20.349  29.050  1.00 29.91 ? 703 PHE D N   1 
ATOM   4043 C  CA  . PHE D 2 102 ? 33.720 20.022  30.196  1.00 26.58 ? 703 PHE D CA  1 
ATOM   4044 C  C   . PHE D 2 102 ? 34.274 18.740  30.835  1.00 21.02 ? 703 PHE D C   1 
ATOM   4045 O  O   . PHE D 2 102 ? 34.248 18.571  32.053  1.00 22.38 ? 703 PHE D O   1 
ATOM   4046 C  CB  . PHE D 2 102 ? 32.264 19.768  29.775  1.00 29.72 ? 703 PHE D CB  1 
ATOM   4047 C  CG  . PHE D 2 102 ? 31.591 20.935  29.087  1.00 36.39 ? 703 PHE D CG  1 
ATOM   4048 C  CD1 . PHE D 2 102 ? 31.905 22.253  29.416  1.00 39.64 ? 703 PHE D CD1 1 
ATOM   4049 C  CD2 . PHE D 2 102 ? 30.629 20.709  28.098  1.00 36.70 ? 703 PHE D CD2 1 
ATOM   4050 C  CE1 . PHE D 2 102 ? 31.279 23.326  28.773  1.00 38.66 ? 703 PHE D CE1 1 
ATOM   4051 C  CE2 . PHE D 2 102 ? 29.998 21.780  27.448  1.00 37.36 ? 703 PHE D CE2 1 
ATOM   4052 C  CZ  . PHE D 2 102 ? 30.327 23.090  27.790  1.00 39.56 ? 703 PHE D CZ  1 
ATOM   4053 N  N   . LYS D 2 103 ? 34.772 17.838  29.994  1.00 27.43 ? 704 LYS D N   1 
ATOM   4054 C  CA  . LYS D 2 103 ? 35.335 16.575  30.451  1.00 27.41 ? 704 LYS D CA  1 
ATOM   4055 C  C   . LYS D 2 103 ? 36.659 16.827  31.152  1.00 25.10 ? 704 LYS D C   1 
ATOM   4056 O  O   . LYS D 2 103 ? 36.964 16.181  32.159  1.00 28.23 ? 704 LYS D O   1 
ATOM   4057 C  CB  . LYS D 2 103 ? 35.518 15.627  29.272  1.00 28.85 ? 704 LYS D CB  1 
ATOM   4058 C  CG  . LYS D 2 103 ? 34.237 14.981  28.817  1.00 35.24 ? 704 LYS D CG  1 
ATOM   4059 C  CD  . LYS D 2 103 ? 34.313 14.570  27.347  1.00 44.20 ? 704 LYS D CD  1 
ATOM   4060 C  CE  . LYS D 2 103 ? 35.529 13.712  27.051  1.00 46.76 ? 704 LYS D CE  1 
ATOM   4061 N  NZ  . LYS D 2 103 ? 35.560 13.364  25.605  1.00 51.38 ? 704 LYS D NZ  1 
ATOM   4062 N  N   . LEU D 2 104 ? 37.458 17.738  30.603  1.00 24.93 ? 705 LEU D N   1 
ATOM   4063 C  CA  . LEU D 2 104 ? 38.735 18.077  31.217  1.00 27.02 ? 705 LEU D CA  1 
ATOM   4064 C  C   . LEU D 2 104 ? 38.541 18.686  32.611  1.00 25.60 ? 705 LEU D C   1 
ATOM   4065 O  O   . LEU D 2 104 ? 39.256 18.310  33.532  1.00 23.51 ? 705 LEU D O   1 
ATOM   4066 C  CB  . LEU D 2 104 ? 39.576 18.987  30.311  1.00 28.69 ? 705 LEU D CB  1 
ATOM   4067 C  CG  . LEU D 2 104 ? 40.076 18.474  28.954  1.00 28.16 ? 705 LEU D CG  1 
ATOM   4068 C  CD1 . LEU D 2 104 ? 40.774 19.587  28.220  1.00 22.02 ? 705 LEU D CD1 1 
ATOM   4069 C  CD2 . LEU D 2 104 ? 41.020 17.305  29.128  1.00 30.80 ? 705 LEU D CD2 1 
ATOM   4070 N  N   . LEU D 2 105 ? 37.612 19.634  32.780  1.00 23.46 ? 706 LEU D N   1 
ATOM   4071 C  CA  . LEU D 2 105 ? 37.366 20.217  34.112  1.00 24.91 ? 706 LEU D CA  1 
ATOM   4072 C  C   . LEU D 2 105 ? 36.872 19.118  35.054  1.00 24.56 ? 706 LEU D C   1 
ATOM   4073 O  O   . LEU D 2 105 ? 37.285 19.051  36.212  1.00 25.33 ? 706 LEU D O   1 
ATOM   4074 C  CB  . LEU D 2 105 ? 36.321 21.355  34.061  1.00 30.63 ? 706 LEU D CB  1 
ATOM   4075 C  CG  . LEU D 2 105 ? 36.447 22.615  34.964  1.00 30.39 ? 706 LEU D CG  1 
ATOM   4076 C  CD1 . LEU D 2 105 ? 35.124 23.331  35.028  1.00 26.69 ? 706 LEU D CD1 1 
ATOM   4077 C  CD2 . LEU D 2 105 ? 36.926 22.325  36.375  1.00 28.04 ? 706 LEU D CD2 1 
ATOM   4078 N  N   . GLY D 2 106 ? 35.959 18.284  34.561  1.00 26.37 ? 707 GLY D N   1 
ATOM   4079 C  CA  . GLY D 2 106 ? 35.434 17.182  35.341  1.00 22.02 ? 707 GLY D CA  1 
ATOM   4080 C  C   . GLY D 2 106 ? 36.562 16.322  35.874  1.00 25.22 ? 707 GLY D C   1 
ATOM   4081 O  O   . GLY D 2 106 ? 36.607 16.030  37.070  1.00 29.01 ? 707 GLY D O   1 
ATOM   4082 N  N   . ASN D 2 107 ? 37.513 15.958  35.023  1.00 24.82 ? 708 ASN D N   1 
ATOM   4083 C  CA  . ASN D 2 107 ? 38.619 15.118  35.471  1.00 24.73 ? 708 ASN D CA  1 
ATOM   4084 C  C   . ASN D 2 107 ? 39.568 15.795  36.447  1.00 19.98 ? 708 ASN D C   1 
ATOM   4085 O  O   . ASN D 2 107 ? 40.080 15.146  37.377  1.00 23.01 ? 708 ASN D O   1 
ATOM   4086 C  CB  . ASN D 2 107 ? 39.374 14.543  34.279  1.00 22.24 ? 708 ASN D CB  1 
ATOM   4087 C  CG  . ASN D 2 107 ? 38.586 13.462  33.572  1.00 24.09 ? 708 ASN D CG  1 
ATOM   4088 O  OD1 . ASN D 2 107 ? 37.635 12.895  34.125  1.00 29.68 ? 708 ASN D OD1 1 
ATOM   4089 N  ND2 . ASN D 2 107 ? 38.986 13.153  32.354  1.00 29.00 ? 708 ASN D ND2 1 
ATOM   4090 N  N   . VAL D 2 108 ? 39.770 17.101  36.272  1.00 26.21 ? 709 VAL D N   1 
ATOM   4091 C  CA  . VAL D 2 108 ? 40.634 17.884  37.161  1.00 23.98 ? 709 VAL D CA  1 
ATOM   4092 C  C   . VAL D 2 108 ? 40.011 17.903  38.575  1.00 25.42 ? 709 VAL D C   1 
ATOM   4093 O  O   . VAL D 2 108 ? 40.715 17.787  39.577  1.00 24.75 ? 709 VAL D O   1 
ATOM   4094 C  CB  . VAL D 2 108 ? 40.858 19.323  36.611  1.00 23.19 ? 709 VAL D CB  1 
ATOM   4095 C  CG1 . VAL D 2 108 ? 41.599 20.195  37.634  1.00 22.71 ? 709 VAL D CG1 1 
ATOM   4096 C  CG2 . VAL D 2 108 ? 41.653 19.254  35.323  1.00 23.06 ? 709 VAL D CG2 1 
ATOM   4097 N  N   . LEU D 2 109 ? 38.686 18.030  38.636  1.00 23.00 ? 710 LEU D N   1 
ATOM   4098 C  CA  . LEU D 2 109 ? 37.960 18.015  39.896  1.00 26.23 ? 710 LEU D CA  1 
ATOM   4099 C  C   . LEU D 2 109 ? 38.188 16.692  40.641  1.00 22.81 ? 710 LEU D C   1 
ATOM   4100 O  O   . LEU D 2 109 ? 38.372 16.680  41.865  1.00 23.58 ? 710 LEU D O   1 
ATOM   4101 C  CB  . LEU D 2 109 ? 36.468 18.202  39.627  1.00 24.00 ? 710 LEU D CB  1 
ATOM   4102 C  CG  . LEU D 2 109 ? 35.552 18.869  40.655  1.00 30.62 ? 710 LEU D CG  1 
ATOM   4103 C  CD1 . LEU D 2 109 ? 34.288 18.054  40.758  1.00 29.32 ? 710 LEU D CD1 1 
ATOM   4104 C  CD2 . LEU D 2 109 ? 36.197 19.010  42.012  1.00 26.37 ? 710 LEU D CD2 1 
ATOM   4105 N  N   . VAL D 2 110 ? 38.163 15.577  39.915  1.00 25.06 ? 711 VAL D N   1 
ATOM   4106 C  CA  . VAL D 2 110 ? 38.396 14.257  40.517  1.00 23.41 ? 711 VAL D CA  1 
ATOM   4107 C  C   . VAL D 2 110 ? 39.813 14.152  41.105  1.00 22.41 ? 711 VAL D C   1 
ATOM   4108 O  O   . VAL D 2 110 ? 39.993 13.610  42.188  1.00 28.32 ? 711 VAL D O   1 
ATOM   4109 C  CB  . VAL D 2 110 ? 38.139 13.099  39.514  1.00 25.84 ? 711 VAL D CB  1 
ATOM   4110 C  CG1 . VAL D 2 110 ? 38.643 11.791  40.064  1.00 20.61 ? 711 VAL D CG1 1 
ATOM   4111 C  CG2 . VAL D 2 110 ? 36.647 12.983  39.237  1.00 25.44 ? 711 VAL D CG2 1 
ATOM   4112 N  N   . VAL D 2 111 ? 40.803 14.674  40.393  1.00 25.58 ? 712 VAL D N   1 
ATOM   4113 C  CA  . VAL D 2 111 ? 42.193 14.692  40.849  1.00 21.90 ? 712 VAL D CA  1 
ATOM   4114 C  C   . VAL D 2 111 ? 42.298 15.587  42.110  1.00 21.98 ? 712 VAL D C   1 
ATOM   4115 O  O   . VAL D 2 111 ? 43.017 15.257  43.050  1.00 26.66 ? 712 VAL D O   1 
ATOM   4116 C  CB  . VAL D 2 111 ? 43.119 15.237  39.734  1.00 19.03 ? 712 VAL D CB  1 
ATOM   4117 C  CG1 . VAL D 2 111 ? 44.549 15.351  40.205  1.00 22.81 ? 712 VAL D CG1 1 
ATOM   4118 C  CG2 . VAL D 2 111 ? 43.058 14.340  38.517  1.00 24.50 ? 712 VAL D CG2 1 
ATOM   4119 N  N   . VAL D 2 112 ? 41.582 16.714  42.124  1.00 26.17 ? 713 VAL D N   1 
ATOM   4120 C  CA  . VAL D 2 112 ? 41.581 17.638  43.273  1.00 23.11 ? 713 VAL D CA  1 
ATOM   4121 C  C   . VAL D 2 112 ? 40.914 17.002  44.478  1.00 24.52 ? 713 VAL D C   1 
ATOM   4122 O  O   . VAL D 2 112 ? 41.386 17.143  45.607  1.00 25.43 ? 713 VAL D O   1 
ATOM   4123 C  CB  . VAL D 2 112 ? 40.924 18.977  42.933  1.00 19.37 ? 713 VAL D CB  1 
ATOM   4124 C  CG1 . VAL D 2 112 ? 40.750 19.821  44.169  1.00 19.39 ? 713 VAL D CG1 1 
ATOM   4125 C  CG2 . VAL D 2 112 ? 41.781 19.704  41.984  1.00 17.31 ? 713 VAL D CG2 1 
ATOM   4126 N  N   . LEU D 2 113 ? 39.820 16.300  44.238  1.00 24.73 ? 714 LEU D N   1 
ATOM   4127 C  CA  . LEU D 2 113 ? 39.147 15.603  45.315  1.00 25.67 ? 714 LEU D CA  1 
ATOM   4128 C  C   . LEU D 2 113 ? 40.098 14.534  45.858  1.00 26.06 ? 714 LEU D C   1 
ATOM   4129 O  O   . LEU D 2 113 ? 40.159 14.318  47.074  1.00 27.46 ? 714 LEU D O   1 
ATOM   4130 C  CB  . LEU D 2 113 ? 37.842 14.979  44.818  1.00 24.11 ? 714 LEU D CB  1 
ATOM   4131 C  CG  . LEU D 2 113 ? 36.744 16.034  44.658  1.00 29.68 ? 714 LEU D CG  1 
ATOM   4132 C  CD1 . LEU D 2 113 ? 35.502 15.407  44.061  1.00 28.25 ? 714 LEU D CD1 1 
ATOM   4133 C  CD2 . LEU D 2 113 ? 36.422 16.688  46.003  1.00 20.60 ? 714 LEU D CD2 1 
ATOM   4134 N  N   . ALA D 2 114 ? 40.832 13.870  44.968  1.00 26.64 ? 715 ALA D N   1 
ATOM   4135 C  CA  . ALA D 2 114 ? 41.789 12.845  45.370  1.00 22.85 ? 715 ALA D CA  1 
ATOM   4136 C  C   . ALA D 2 114 ? 42.957 13.405  46.200  1.00 25.08 ? 715 ALA D C   1 
ATOM   4137 O  O   . ALA D 2 114 ? 43.357 12.808  47.203  1.00 23.37 ? 715 ALA D O   1 
ATOM   4138 C  CB  . ALA D 2 114 ? 42.301 12.116  44.143  1.00 19.45 ? 715 ALA D CB  1 
ATOM   4139 N  N   . ARG D 2 115 ? 43.450 14.589  45.845  1.00 26.01 ? 716 ARG D N   1 
ATOM   4140 C  CA  . ARG D 2 115 ? 44.564 15.182  46.577  1.00 26.90 ? 716 ARG D CA  1 
ATOM   4141 C  C   . ARG D 2 115 ? 44.148 15.673  47.959  1.00 28.21 ? 716 ARG D C   1 
ATOM   4142 O  O   . ARG D 2 115 ? 44.933 15.634  48.898  1.00 30.40 ? 716 ARG D O   1 
ATOM   4143 C  CB  . ARG D 2 115 ? 45.180 16.331  45.788  1.00 28.55 ? 716 ARG D CB  1 
ATOM   4144 C  CG  . ARG D 2 115 ? 46.585 16.707  46.253  1.00 30.75 ? 716 ARG D CG  1 
ATOM   4145 C  CD  . ARG D 2 115 ? 47.071 18.006  45.614  1.00 30.25 ? 716 ARG D CD  1 
ATOM   4146 N  NE  . ARG D 2 115 ? 46.337 19.189  46.073  1.00 31.27 ? 716 ARG D NE  1 
ATOM   4147 C  CZ  . ARG D 2 115 ? 46.321 19.642  47.327  1.00 30.41 ? 716 ARG D CZ  1 
ATOM   4148 N  NH1 . ARG D 2 115 ? 47.009 19.025  48.289  1.00 31.39 ? 716 ARG D NH1 1 
ATOM   4149 N  NH2 . ARG D 2 115 ? 45.647 20.736  47.624  1.00 25.34 ? 716 ARG D NH2 1 
ATOM   4150 N  N   . ASN D 2 116 ? 42.895 16.105  48.082  1.00 31.55 ? 717 ASN D N   1 
ATOM   4151 C  CA  . ASN D 2 116 ? 42.347 16.598  49.354  1.00 33.13 ? 717 ASN D CA  1 
ATOM   4152 C  C   . ASN D 2 116 ? 41.788 15.531  50.313  1.00 32.24 ? 717 ASN D C   1 
ATOM   4153 O  O   . ASN D 2 116 ? 41.601 15.812  51.494  1.00 38.20 ? 717 ASN D O   1 
ATOM   4154 C  CB  . ASN D 2 116 ? 41.287 17.688  49.103  1.00 29.02 ? 717 ASN D CB  1 
ATOM   4155 C  CG  . ASN D 2 116 ? 41.902 19.008  48.606  1.00 34.65 ? 717 ASN D CG  1 
ATOM   4156 O  OD1 . ASN D 2 116 ? 42.250 19.884  49.407  1.00 32.21 ? 717 ASN D OD1 1 
ATOM   4157 N  ND2 . ASN D 2 116 ? 42.006 19.165  47.285  1.00 33.53 ? 717 ASN D ND2 1 
ATOM   4158 N  N   . PHE D 2 117 ? 41.528 14.316  49.834  1.00 30.74 ? 718 PHE D N   1 
ATOM   4159 C  CA  . PHE D 2 117 ? 40.989 13.273  50.707  1.00 29.49 ? 718 PHE D CA  1 
ATOM   4160 C  C   . PHE D 2 117 ? 41.869 12.032  50.825  1.00 29.66 ? 718 PHE D C   1 
ATOM   4161 O  O   . PHE D 2 117 ? 41.694 11.210  51.719  1.00 28.52 ? 718 PHE D O   1 
ATOM   4162 C  CB  . PHE D 2 117 ? 39.562 12.915  50.286  1.00 31.13 ? 718 PHE D CB  1 
ATOM   4163 C  CG  . PHE D 2 117 ? 38.577 14.002  50.572  1.00 35.07 ? 718 PHE D CG  1 
ATOM   4164 C  CD1 . PHE D 2 117 ? 38.312 14.990  49.627  1.00 35.48 ? 718 PHE D CD1 1 
ATOM   4165 C  CD2 . PHE D 2 117 ? 37.986 14.100  51.829  1.00 35.84 ? 718 PHE D CD2 1 
ATOM   4166 C  CE1 . PHE D 2 117 ? 37.481 16.062  49.933  1.00 35.75 ? 718 PHE D CE1 1 
ATOM   4167 C  CE2 . PHE D 2 117 ? 37.154 15.169  52.142  1.00 38.12 ? 718 PHE D CE2 1 
ATOM   4168 C  CZ  . PHE D 2 117 ? 36.902 16.154  51.192  1.00 36.22 ? 718 PHE D CZ  1 
ATOM   4169 N  N   . GLY D 2 118 ? 42.860 11.947  49.948  1.00 31.88 ? 719 GLY D N   1 
ATOM   4170 C  CA  . GLY D 2 118 ? 43.778 10.833  49.959  1.00 34.79 ? 719 GLY D CA  1 
ATOM   4171 C  C   . GLY D 2 118 ? 43.152 9.465   50.079  1.00 38.25 ? 719 GLY D C   1 
ATOM   4172 O  O   . GLY D 2 118 ? 42.400 9.032   49.211  1.00 43.76 ? 719 GLY D O   1 
ATOM   4173 N  N   . LYS D 2 119 ? 43.475 8.789   51.173  1.00 40.45 ? 720 LYS D N   1 
ATOM   4174 C  CA  . LYS D 2 119 ? 43.001 7.446   51.471  1.00 38.93 ? 720 LYS D CA  1 
ATOM   4175 C  C   . LYS D 2 119 ? 41.494 7.223   51.340  1.00 38.70 ? 720 LYS D C   1 
ATOM   4176 O  O   . LYS D 2 119 ? 41.048 6.172   50.865  1.00 41.65 ? 720 LYS D O   1 
ATOM   4177 C  CB  . LYS D 2 119 ? 43.481 7.068   52.880  1.00 44.32 ? 720 LYS D CB  1 
ATOM   4178 C  CG  . LYS D 2 119 ? 43.087 5.685   53.354  1.00 43.94 ? 720 LYS D CG  1 
ATOM   4179 C  CD  . LYS D 2 119 ? 43.431 4.613   52.327  1.00 54.58 ? 720 LYS D CD  1 
ATOM   4180 C  CE  . LYS D 2 119 ? 44.915 4.611   51.917  1.00 57.75 ? 720 LYS D CE  1 
ATOM   4181 N  NZ  . LYS D 2 119 ? 45.271 5.612   50.853  1.00 58.75 ? 720 LYS D NZ  1 
ATOM   4182 N  N   . GLU D 2 120 ? 40.712 8.193   51.784  1.00 33.91 ? 721 GLU D N   1 
ATOM   4183 C  CA  . GLU D 2 120 ? 39.268 8.065   51.705  1.00 33.10 ? 721 GLU D CA  1 
ATOM   4184 C  C   . GLU D 2 120 ? 38.758 8.044   50.266  1.00 31.73 ? 721 GLU D C   1 
ATOM   4185 O  O   . GLU D 2 120 ? 37.694 7.489   50.013  1.00 34.51 ? 721 GLU D O   1 
ATOM   4186 C  CB  . GLU D 2 120 ? 38.583 9.201   52.447  1.00 34.76 ? 721 GLU D CB  1 
ATOM   4187 C  CG  . GLU D 2 120 ? 39.034 9.390   53.858  1.00 42.17 ? 721 GLU D CG  1 
ATOM   4188 C  CD  . GLU D 2 120 ? 38.871 10.827  54.286  1.00 48.39 ? 721 GLU D CD  1 
ATOM   4189 O  OE1 . GLU D 2 120 ? 37.753 11.196  54.722  1.00 52.78 ? 721 GLU D OE1 1 
ATOM   4190 O  OE2 . GLU D 2 120 ? 39.852 11.601  54.139  1.00 49.22 ? 721 GLU D OE2 1 
ATOM   4191 N  N   . PHE D 2 121 ? 39.447 8.710   49.340  1.00 28.62 ? 722 PHE D N   1 
ATOM   4192 C  CA  . PHE D 2 121 ? 38.996 8.705   47.952  1.00 31.12 ? 722 PHE D CA  1 
ATOM   4193 C  C   . PHE D 2 121 ? 39.392 7.359   47.370  1.00 31.00 ? 722 PHE D C   1 
ATOM   4194 O  O   . PHE D 2 121 ? 40.423 7.217   46.707  1.00 34.26 ? 722 PHE D O   1 
ATOM   4195 C  CB  . PHE D 2 121 ? 39.590 9.863   47.137  1.00 29.11 ? 722 PHE D CB  1 
ATOM   4196 C  CG  . PHE D 2 121 ? 38.693 10.332  45.997  1.00 30.12 ? 722 PHE D CG  1 
ATOM   4197 C  CD1 . PHE D 2 121 ? 37.383 10.753  46.243  1.00 34.16 ? 722 PHE D CD1 1 
ATOM   4198 C  CD2 . PHE D 2 121 ? 39.155 10.358  44.684  1.00 28.32 ? 722 PHE D CD2 1 
ATOM   4199 C  CE1 . PHE D 2 121 ? 36.552 11.191  45.196  1.00 31.00 ? 722 PHE D CE1 1 
ATOM   4200 C  CE2 . PHE D 2 121 ? 38.331 10.797  43.632  1.00 30.51 ? 722 PHE D CE2 1 
ATOM   4201 C  CZ  . PHE D 2 121 ? 37.032 11.212  43.893  1.00 29.56 ? 722 PHE D CZ  1 
ATOM   4202 N  N   . THR D 2 122 ? 38.553 6.365   47.636  1.00 30.76 ? 723 THR D N   1 
ATOM   4203 C  CA  . THR D 2 122 ? 38.818 5.009   47.200  1.00 31.23 ? 723 THR D CA  1 
ATOM   4204 C  C   . THR D 2 122 ? 38.579 4.776   45.724  1.00 32.07 ? 723 THR D C   1 
ATOM   4205 O  O   . THR D 2 122 ? 38.001 5.624   45.036  1.00 34.27 ? 723 THR D O   1 
ATOM   4206 C  CB  . THR D 2 122 ? 37.988 4.003   48.003  1.00 29.84 ? 723 THR D CB  1 
ATOM   4207 O  OG1 . THR D 2 122 ? 36.604 4.162   47.686  1.00 31.59 ? 723 THR D OG1 1 
ATOM   4208 C  CG2 . THR D 2 122 ? 38.206 4.219   49.498  1.00 30.00 ? 723 THR D CG2 1 
ATOM   4209 N  N   . PRO D 2 123 ? 39.105 3.657   45.193  1.00 29.20 ? 724 PRO D N   1 
ATOM   4210 C  CA  . PRO D 2 123 ? 38.887 3.388   43.781  1.00 26.27 ? 724 PRO D CA  1 
ATOM   4211 C  C   . PRO D 2 123 ? 37.389 3.286   43.481  1.00 27.95 ? 724 PRO D C   1 
ATOM   4212 O  O   . PRO D 2 123 ? 36.941 3.773   42.442  1.00 28.77 ? 724 PRO D O   1 
ATOM   4213 C  CB  . PRO D 2 123 ? 39.612 2.066   43.592  1.00 28.17 ? 724 PRO D CB  1 
ATOM   4214 C  CG  . PRO D 2 123 ? 40.802 2.240   44.472  1.00 24.13 ? 724 PRO D CG  1 
ATOM   4215 C  CD  . PRO D 2 123 ? 40.156 2.776   45.729  1.00 24.03 ? 724 PRO D CD  1 
ATOM   4216 N  N   . VAL D 2 124 ? 36.599 2.726   44.402  1.00 30.09 ? 725 VAL D N   1 
ATOM   4217 C  CA  . VAL D 2 124 ? 35.161 2.591   44.149  1.00 31.55 ? 725 VAL D CA  1 
ATOM   4218 C  C   . VAL D 2 124 ? 34.425 3.912   44.276  1.00 30.26 ? 725 VAL D C   1 
ATOM   4219 O  O   . VAL D 2 124 ? 33.509 4.189   43.498  1.00 33.68 ? 725 VAL D O   1 
ATOM   4220 C  CB  . VAL D 2 124 ? 34.466 1.505   45.030  1.00 34.74 ? 725 VAL D CB  1 
ATOM   4221 C  CG1 . VAL D 2 124 ? 34.949 0.106   44.660  1.00 33.30 ? 725 VAL D CG1 1 
ATOM   4222 C  CG2 . VAL D 2 124 ? 34.697 1.784   46.478  1.00 39.46 ? 725 VAL D CG2 1 
ATOM   4223 N  N   . LEU D 2 125 ? 34.846 4.745   45.220  1.00 28.82 ? 726 LEU D N   1 
ATOM   4224 C  CA  . LEU D 2 125 ? 34.213 6.043   45.412  1.00 27.99 ? 726 LEU D CA  1 
ATOM   4225 C  C   . LEU D 2 125 ? 34.517 6.962   44.224  1.00 26.48 ? 726 LEU D C   1 
ATOM   4226 O  O   . LEU D 2 125 ? 33.705 7.803   43.838  1.00 29.26 ? 726 LEU D O   1 
ATOM   4227 C  CB  . LEU D 2 125 ? 34.700 6.670   46.718  1.00 26.72 ? 726 LEU D CB  1 
ATOM   4228 C  CG  . LEU D 2 125 ? 34.069 8.008   47.101  1.00 32.83 ? 726 LEU D CG  1 
ATOM   4229 C  CD1 . LEU D 2 125 ? 32.527 7.933   47.072  1.00 29.33 ? 726 LEU D CD1 1 
ATOM   4230 C  CD2 . LEU D 2 125 ? 34.578 8.389   48.479  1.00 27.72 ? 726 LEU D CD2 1 
ATOM   4231 N  N   . GLN D 2 126 ? 35.682 6.762   43.624  1.00 27.34 ? 727 GLN D N   1 
ATOM   4232 C  CA  . GLN D 2 126 ? 36.106 7.554   42.481  1.00 28.74 ? 727 GLN D CA  1 
ATOM   4233 C  C   . GLN D 2 126 ? 35.350 7.122   41.244  1.00 24.14 ? 727 GLN D C   1 
ATOM   4234 O  O   . GLN D 2 126 ? 35.112 7.924   40.344  1.00 25.33 ? 727 GLN D O   1 
ATOM   4235 C  CB  . GLN D 2 126 ? 37.622 7.412   42.244  1.00 29.86 ? 727 GLN D CB  1 
ATOM   4236 C  CG  . GLN D 2 126 ? 38.176 8.361   41.166  1.00 25.44 ? 727 GLN D CG  1 
ATOM   4237 C  CD  . GLN D 2 126 ? 39.163 7.693   40.252  1.00 21.39 ? 727 GLN D CD  1 
ATOM   4238 O  OE1 . GLN D 2 126 ? 39.922 6.824   40.666  1.00 26.50 ? 727 GLN D OE1 1 
ATOM   4239 N  NE2 . GLN D 2 126 ? 39.146 8.084   38.988  1.00 26.54 ? 727 GLN D NE2 1 
ATOM   4240 N  N   . ALA D 2 127 ? 35.034 5.834   41.173  1.00 26.51 ? 728 ALA D N   1 
ATOM   4241 C  CA  . ALA D 2 127 ? 34.296 5.300   40.039  1.00 27.71 ? 728 ALA D CA  1 
ATOM   4242 C  C   . ALA D 2 127 ? 32.939 5.984   40.049  1.00 28.19 ? 728 ALA D C   1 
ATOM   4243 O  O   . ALA D 2 127 ? 32.475 6.454   39.008  1.00 31.15 ? 728 ALA D O   1 
ATOM   4244 C  CB  . ALA D 2 127 ? 34.155 3.804   40.163  1.00 27.19 ? 728 ALA D CB  1 
ATOM   4245 N  N   . ASP D 2 128 ? 32.331 6.056   41.238  1.00 28.39 ? 729 ASP D N   1 
ATOM   4246 C  CA  . ASP D 2 128 ? 31.036 6.716   41.445  1.00 28.86 ? 729 ASP D CA  1 
ATOM   4247 C  C   . ASP D 2 128 ? 31.072 8.181   41.057  1.00 29.07 ? 729 ASP D C   1 
ATOM   4248 O  O   . ASP D 2 128 ? 30.163 8.672   40.409  1.00 35.11 ? 729 ASP D O   1 
ATOM   4249 C  CB  . ASP D 2 128 ? 30.574 6.590   42.904  1.00 32.42 ? 729 ASP D CB  1 
ATOM   4250 C  CG  . ASP D 2 128 ? 30.200 5.163   43.283  1.00 33.91 ? 729 ASP D CG  1 
ATOM   4251 O  OD1 . ASP D 2 128 ? 30.071 4.883   44.501  1.00 36.26 ? 729 ASP D OD1 1 
ATOM   4252 O  OD2 . ASP D 2 128 ? 30.038 4.329   42.364  1.00 34.73 ? 729 ASP D OD2 1 
ATOM   4253 N  N   . PHE D 2 129 ? 32.114 8.889   41.466  1.00 29.73 ? 730 PHE D N   1 
ATOM   4254 C  CA  . PHE D 2 129 ? 32.247 10.292  41.118  1.00 25.39 ? 730 PHE D CA  1 
ATOM   4255 C  C   . PHE D 2 129 ? 32.515 10.521  39.636  1.00 27.61 ? 730 PHE D C   1 
ATOM   4256 O  O   . PHE D 2 129 ? 32.142 11.565  39.104  1.00 27.76 ? 730 PHE D O   1 
ATOM   4257 C  CB  . PHE D 2 129 ? 33.315 10.972  41.961  1.00 31.89 ? 730 PHE D CB  1 
ATOM   4258 C  CG  . PHE D 2 129 ? 32.767 11.635  43.178  1.00 37.24 ? 730 PHE D CG  1 
ATOM   4259 C  CD1 . PHE D 2 129 ? 32.220 12.918  43.097  1.00 40.67 ? 730 PHE D CD1 1 
ATOM   4260 C  CD2 . PHE D 2 129 ? 32.740 10.959  44.400  1.00 40.55 ? 730 PHE D CD2 1 
ATOM   4261 C  CE1 . PHE D 2 129 ? 31.644 13.523  44.223  1.00 44.61 ? 730 PHE D CE1 1 
ATOM   4262 C  CE2 . PHE D 2 129 ? 32.172 11.539  45.534  1.00 38.86 ? 730 PHE D CE2 1 
ATOM   4263 C  CZ  . PHE D 2 129 ? 31.620 12.828  45.451  1.00 45.27 ? 730 PHE D CZ  1 
ATOM   4264 N  N   . GLN D 2 130 ? 33.181 9.573   38.971  1.00 28.89 ? 731 GLN D N   1 
ATOM   4265 C  CA  . GLN D 2 130 ? 33.445 9.681   37.534  1.00 24.68 ? 731 GLN D CA  1 
ATOM   4266 C  C   . GLN D 2 130 ? 32.113 9.652   36.779  1.00 27.46 ? 731 GLN D C   1 
ATOM   4267 O  O   . GLN D 2 130 ? 31.965 10.295  35.743  1.00 30.01 ? 731 GLN D O   1 
ATOM   4268 C  CB  . GLN D 2 130 ? 34.344 8.546   37.035  1.00 25.79 ? 731 GLN D CB  1 
ATOM   4269 C  CG  . GLN D 2 130 ? 35.807 8.609   37.486  1.00 28.74 ? 731 GLN D CG  1 
ATOM   4270 C  CD  . GLN D 2 130 ? 36.656 9.715   36.838  1.00 23.66 ? 731 GLN D CD  1 
ATOM   4271 O  OE1 . GLN D 2 130 ? 37.611 10.193  37.432  1.00 28.32 ? 731 GLN D OE1 1 
ATOM   4272 N  NE2 . GLN D 2 130 ? 36.345 10.075  35.611  1.00 26.52 ? 731 GLN D NE2 1 
ATOM   4273 N  N   . LYS D 2 131 ? 31.168 8.871   37.296  1.00 28.97 ? 732 LYS D N   1 
ATOM   4274 C  CA  . LYS D 2 131 ? 29.826 8.750   36.725  1.00 28.21 ? 732 LYS D CA  1 
ATOM   4275 C  C   . LYS D 2 131 ? 29.120 10.117  36.737  1.00 27.55 ? 732 LYS D C   1 
ATOM   4276 O  O   . LYS D 2 131 ? 28.543 10.538  35.733  1.00 31.28 ? 732 LYS D O   1 
ATOM   4277 C  CB  . LYS D 2 131 ? 29.017 7.735   37.539  1.00 27.00 ? 732 LYS D CB  1 
ATOM   4278 C  CG  . LYS D 2 131 ? 28.796 6.393   36.867  1.00 30.69 ? 732 LYS D CG  1 
ATOM   4279 C  CD  . LYS D 2 131 ? 28.632 5.287   37.890  1.00 36.52 ? 732 LYS D CD  1 
ATOM   4280 C  CE  . LYS D 2 131 ? 27.811 4.135   37.324  1.00 44.84 ? 732 LYS D CE  1 
ATOM   4281 N  NZ  . LYS D 2 131 ? 26.326 4.447   37.154  1.00 52.38 ? 732 LYS D NZ  1 
ATOM   4282 N  N   . VAL D 2 132 ? 29.156 10.790  37.888  1.00 29.84 ? 733 VAL D N   1 
ATOM   4283 C  CA  . VAL D 2 132 ? 28.549 12.113  38.078  1.00 29.69 ? 733 VAL D CA  1 
ATOM   4284 C  C   . VAL D 2 132 ? 29.183 13.149  37.156  1.00 29.02 ? 733 VAL D C   1 
ATOM   4285 O  O   . VAL D 2 132 ? 28.500 13.937  36.515  1.00 34.49 ? 733 VAL D O   1 
ATOM   4286 C  CB  . VAL D 2 132 ? 28.744 12.607  39.523  1.00 26.65 ? 733 VAL D CB  1 
ATOM   4287 C  CG1 . VAL D 2 132 ? 28.153 13.985  39.683  1.00 27.40 ? 733 VAL D CG1 1 
ATOM   4288 C  CG2 . VAL D 2 132 ? 28.115 11.638  40.509  1.00 27.81 ? 733 VAL D CG2 1 
ATOM   4289 N  N   . VAL D 2 133 ? 30.504 13.154  37.131  1.00 30.62 ? 734 VAL D N   1 
ATOM   4290 C  CA  . VAL D 2 133 ? 31.272 14.058  36.307  1.00 29.80 ? 734 VAL D CA  1 
ATOM   4291 C  C   . VAL D 2 133 ? 30.905 13.881  34.820  1.00 28.92 ? 734 VAL D C   1 
ATOM   4292 O  O   . VAL D 2 133 ? 30.723 14.869  34.104  1.00 28.18 ? 734 VAL D O   1 
ATOM   4293 C  CB  . VAL D 2 133 ? 32.771 13.813  36.585  1.00 33.22 ? 734 VAL D CB  1 
ATOM   4294 C  CG1 . VAL D 2 133 ? 33.626 14.076  35.357  1.00 40.56 ? 734 VAL D CG1 1 
ATOM   4295 C  CG2 . VAL D 2 133 ? 33.192 14.666  37.765  1.00 29.77 ? 734 VAL D CG2 1 
ATOM   4296 N  N   . ALA D 2 134 ? 30.767 12.630  34.375  1.00 28.27 ? 735 ALA D N   1 
ATOM   4297 C  CA  . ALA D 2 134 ? 30.394 12.337  33.001  1.00 28.73 ? 735 ALA D CA  1 
ATOM   4298 C  C   . ALA D 2 134 ? 28.988 12.860  32.749  1.00 28.65 ? 735 ALA D C   1 
ATOM   4299 O  O   . ALA D 2 134 ? 28.732 13.500  31.738  1.00 34.03 ? 735 ALA D O   1 
ATOM   4300 C  CB  . ALA D 2 134 ? 30.444 10.857  32.738  1.00 25.82 ? 735 ALA D CB  1 
ATOM   4301 N  N   . GLY D 2 135 ? 28.083 12.597  33.685  1.00 30.45 ? 736 GLY D N   1 
ATOM   4302 C  CA  . GLY D 2 135 ? 26.711 13.058  33.562  1.00 24.23 ? 736 GLY D CA  1 
ATOM   4303 C  C   . GLY D 2 135 ? 26.590 14.565  33.455  1.00 23.81 ? 736 GLY D C   1 
ATOM   4304 O  O   . GLY D 2 135 ? 25.859 15.073  32.620  1.00 25.60 ? 736 GLY D O   1 
ATOM   4305 N  N   . VAL D 2 136 ? 27.300 15.282  34.314  1.00 21.68 ? 737 VAL D N   1 
ATOM   4306 C  CA  . VAL D 2 136 ? 27.289 16.732  34.305  1.00 22.97 ? 737 VAL D CA  1 
ATOM   4307 C  C   . VAL D 2 136 ? 27.862 17.269  32.985  1.00 26.47 ? 737 VAL D C   1 
ATOM   4308 O  O   . VAL D 2 136 ? 27.317 18.208  32.409  1.00 29.91 ? 737 VAL D O   1 
ATOM   4309 C  CB  . VAL D 2 136 ? 28.106 17.274  35.459  1.00 21.34 ? 737 VAL D CB  1 
ATOM   4310 C  CG1 . VAL D 2 136 ? 28.338 18.771  35.298  1.00 24.03 ? 737 VAL D CG1 1 
ATOM   4311 C  CG2 . VAL D 2 136 ? 27.400 16.981  36.762  1.00 22.02 ? 737 VAL D CG2 1 
ATOM   4312 N  N   . ALA D 2 137 ? 28.972 16.700  32.522  1.00 27.41 ? 738 ALA D N   1 
ATOM   4313 C  CA  . ALA D 2 137 ? 29.580 17.130  31.259  1.00 30.28 ? 738 ALA D CA  1 
ATOM   4314 C  C   . ALA D 2 137 ? 28.618 16.952  30.079  1.00 31.46 ? 738 ALA D C   1 
ATOM   4315 O  O   . ALA D 2 137 ? 28.548 17.800  29.179  1.00 29.23 ? 738 ALA D O   1 
ATOM   4316 C  CB  . ALA D 2 137 ? 30.884 16.366  31.002  1.00 29.41 ? 738 ALA D CB  1 
ATOM   4317 N  N   . ASN D 2 138 ? 27.908 15.824  30.062  1.00 33.71 ? 739 ASN D N   1 
ATOM   4318 C  CA  . ASN D 2 138 ? 26.947 15.542  29.000  1.00 36.75 ? 739 ASN D CA  1 
ATOM   4319 C  C   . ASN D 2 138 ? 25.748 16.482  29.020  1.00 34.36 ? 739 ASN D C   1 
ATOM   4320 O  O   . ASN D 2 138 ? 25.208 16.820  27.963  1.00 33.26 ? 739 ASN D O   1 
ATOM   4321 C  CB  . ASN D 2 138 ? 26.465 14.094  29.063  1.00 42.17 ? 739 ASN D CB  1 
ATOM   4322 C  CG  . ASN D 2 138 ? 27.358 13.151  28.280  1.00 50.02 ? 739 ASN D CG  1 
ATOM   4323 O  OD1 . ASN D 2 138 ? 27.560 13.318  27.073  1.00 56.46 ? 739 ASN D OD1 1 
ATOM   4324 N  ND2 . ASN D 2 138 ? 27.899 12.150  28.960  1.00 52.02 ? 739 ASN D ND2 1 
ATOM   4325 N  N   . ALA D 2 139 ? 25.338 16.895  30.219  1.00 33.55 ? 740 ALA D N   1 
ATOM   4326 C  CA  . ALA D 2 139 ? 24.206 17.803  30.396  1.00 29.43 ? 740 ALA D CA  1 
ATOM   4327 C  C   . ALA D 2 139 ? 24.573 19.201  29.930  1.00 31.69 ? 740 ALA D C   1 
ATOM   4328 O  O   . ALA D 2 139 ? 23.746 19.916  29.376  1.00 36.57 ? 740 ALA D O   1 
ATOM   4329 C  CB  . ALA D 2 139 ? 23.777 17.830  31.837  1.00 28.65 ? 740 ALA D CB  1 
ATOM   4330 N  N   . LEU D 2 140 ? 25.815 19.595  30.177  1.00 30.54 ? 741 LEU D N   1 
ATOM   4331 C  CA  . LEU D 2 140 ? 26.307 20.899  29.765  1.00 31.59 ? 741 LEU D CA  1 
ATOM   4332 C  C   . LEU D 2 140 ? 26.508 20.978  28.255  1.00 34.84 ? 741 LEU D C   1 
ATOM   4333 O  O   . LEU D 2 140 ? 26.486 22.065  27.669  1.00 38.06 ? 741 LEU D O   1 
ATOM   4334 C  CB  . LEU D 2 140 ? 27.628 21.186  30.472  1.00 30.52 ? 741 LEU D CB  1 
ATOM   4335 C  CG  . LEU D 2 140 ? 27.789 22.419  31.363  1.00 32.10 ? 741 LEU D CG  1 
ATOM   4336 C  CD1 . LEU D 2 140 ? 26.463 22.997  31.827  1.00 31.93 ? 741 LEU D CD1 1 
ATOM   4337 C  CD2 . LEU D 2 140 ? 28.575 21.981  32.544  1.00 35.88 ? 741 LEU D CD2 1 
ATOM   4338 N  N   . ALA D 2 141 ? 26.676 19.821  27.624  1.00 38.16 ? 742 ALA D N   1 
ATOM   4339 C  CA  . ALA D 2 141 ? 26.930 19.745  26.188  1.00 40.67 ? 742 ALA D CA  1 
ATOM   4340 C  C   . ALA D 2 141 ? 25.747 19.498  25.251  1.00 43.40 ? 742 ALA D C   1 
ATOM   4341 O  O   . ALA D 2 141 ? 25.900 19.659  24.032  1.00 45.52 ? 742 ALA D O   1 
ATOM   4342 C  CB  . ALA D 2 141 ? 28.026 18.701  25.915  1.00 38.58 ? 742 ALA D CB  1 
ATOM   4343 N  N   . HIS D 2 142 ? 24.576 19.143  25.786  1.00 45.80 ? 743 HIS D N   1 
ATOM   4344 C  CA  . HIS D 2 142 ? 23.416 18.847  24.936  1.00 51.17 ? 743 HIS D CA  1 
ATOM   4345 C  C   . HIS D 2 142 ? 22.909 19.964  24.011  1.00 54.19 ? 743 HIS D C   1 
ATOM   4346 O  O   . HIS D 2 142 ? 22.047 19.701  23.179  1.00 54.07 ? 743 HIS D O   1 
ATOM   4347 C  CB  . HIS D 2 142 ? 22.248 18.270  25.750  1.00 57.83 ? 743 HIS D CB  1 
ATOM   4348 C  CG  . HIS D 2 142 ? 21.399 19.311  26.418  1.00 67.45 ? 743 HIS D CG  1 
ATOM   4349 N  ND1 . HIS D 2 142 ? 20.629 20.214  25.711  1.00 70.33 ? 743 HIS D ND1 1 
ATOM   4350 C  CD2 . HIS D 2 142 ? 21.227 19.617  27.727  1.00 69.02 ? 743 HIS D CD2 1 
ATOM   4351 C  CE1 . HIS D 2 142 ? 20.026 21.035  26.555  1.00 68.72 ? 743 HIS D CE1 1 
ATOM   4352 N  NE2 . HIS D 2 142 ? 20.371 20.693  27.784  1.00 71.35 ? 743 HIS D NE2 1 
ATOM   4353 N  N   . ARG D 2 143 ? 23.393 21.200  24.177  1.00 55.80 ? 744 ARG D N   1 
ATOM   4354 C  CA  . ARG D 2 143 ? 22.978 22.323  23.315  1.00 58.05 ? 744 ARG D CA  1 
ATOM   4355 C  C   . ARG D 2 143 ? 23.833 22.460  22.050  1.00 59.64 ? 744 ARG D C   1 
ATOM   4356 O  O   . ARG D 2 143 ? 23.756 23.467  21.325  1.00 58.69 ? 744 ARG D O   1 
ATOM   4357 C  CB  . ARG D 2 143 ? 22.981 23.650  24.081  1.00 60.90 ? 744 ARG D CB  1 
ATOM   4358 C  CG  . ARG D 2 143 ? 21.634 24.036  24.713  1.00 65.76 ? 744 ARG D CG  1 
ATOM   4359 C  CD  . ARG D 2 143 ? 20.510 24.210  23.677  1.00 68.04 ? 744 ARG D CD  1 
ATOM   4360 N  NE  . ARG D 2 143 ? 20.941 24.946  22.483  1.00 70.98 ? 744 ARG D NE  1 
ATOM   4361 C  CZ  . ARG D 2 143 ? 20.199 25.833  21.823  1.00 69.22 ? 744 ARG D CZ  1 
ATOM   4362 N  NH1 . ARG D 2 143 ? 18.962 26.127  22.231  1.00 67.14 ? 744 ARG D NH1 1 
ATOM   4363 N  NH2 . ARG D 2 143 ? 20.697 26.405  20.731  1.00 66.91 ? 744 ARG D NH2 1 
ATOM   4364 N  N   . TYR D 2 144 ? 24.713 21.487  21.845  1.00 60.97 ? 745 TYR D N   1 
ATOM   4365 C  CA  . TYR D 2 144 ? 25.566 21.454  20.664  1.00 63.93 ? 745 TYR D CA  1 
ATOM   4366 C  C   . TYR D 2 144 ? 24.936 20.556  19.582  1.00 66.62 ? 745 TYR D C   1 
ATOM   4367 O  O   . TYR D 2 144 ? 25.520 20.307  18.510  1.00 65.71 ? 745 TYR D O   1 
ATOM   4368 C  CB  . TYR D 2 144 ? 26.972 20.996  21.055  1.00 59.34 ? 745 TYR D CB  1 
ATOM   4369 C  CG  . TYR D 2 144 ? 27.852 22.161  21.425  1.00 56.79 ? 745 TYR D CG  1 
ATOM   4370 C  CD1 . TYR D 2 144 ? 28.229 23.096  20.455  1.00 59.64 ? 745 TYR D CD1 1 
ATOM   4371 C  CD2 . TYR D 2 144 ? 28.310 22.345  22.734  1.00 55.48 ? 745 TYR D CD2 1 
ATOM   4372 C  CE1 . TYR D 2 144 ? 29.044 24.194  20.773  1.00 60.45 ? 745 TYR D CE1 1 
ATOM   4373 C  CE2 . TYR D 2 144 ? 29.143 23.445  23.066  1.00 54.39 ? 745 TYR D CE2 1 
ATOM   4374 C  CZ  . TYR D 2 144 ? 29.498 24.359  22.074  1.00 56.77 ? 745 TYR D CZ  1 
ATOM   4375 O  OH  . TYR D 2 144 ? 30.311 25.431  22.358  1.00 59.04 ? 745 TYR D OH  1 
ATOM   4376 N  N   . HIS D 2 145 ? 23.734 20.078  19.900  1.00 67.65 ? 746 HIS D N   1 
ATOM   4377 C  CA  . HIS D 2 145 ? 22.928 19.224  19.035  1.00 71.34 ? 746 HIS D CA  1 
ATOM   4378 C  C   . HIS D 2 145 ? 21.504 19.166  19.624  1.00 71.97 ? 746 HIS D C   1 
ATOM   4379 O  O   . HIS D 2 145 ? 20.928 18.054  19.767  1.00 72.04 ? 746 HIS D O   1 
ATOM   4380 C  CB  . HIS D 2 145 ? 23.558 17.813  18.845  1.00 70.67 ? 746 HIS D CB  1 
ATOM   4381 C  CG  . HIS D 2 145 ? 24.137 17.204  20.094  1.00 70.69 ? 746 HIS D CG  1 
ATOM   4382 N  ND1 . HIS D 2 145 ? 23.370 16.927  21.211  1.00 70.18 ? 746 HIS D ND1 1 
ATOM   4383 C  CD2 . HIS D 2 145 ? 25.406 16.848  20.414  1.00 69.67 ? 746 HIS D CD2 1 
ATOM   4384 C  CE1 . HIS D 2 145 ? 24.141 16.424  22.159  1.00 68.02 ? 746 HIS D CE1 1 
ATOM   4385 N  NE2 . HIS D 2 145 ? 25.380 16.365  21.702  1.00 69.59 ? 746 HIS D NE2 1 
ATOM   4386 O  OXT . HIS D 2 145 ? 20.992 20.270  19.956  1.00 71.11 ? 746 HIS D OXT 1 
HETATM 4387 C  C   . CMO E 3 .   ? 45.160 29.528  10.616  1.00 27.27 ? 142 CMO A C   1 
HETATM 4388 O  O   . CMO E 3 .   ? 44.370 29.402  9.824   1.00 33.80 ? 142 CMO A O   1 
HETATM 4389 C  CHA . HEM F 4 .   ? 47.249 32.828  11.634  1.00 33.40 ? 143 HEM A CHA 1 
HETATM 4390 C  CHB . HEM F 4 .   ? 48.809 28.663  9.666   1.00 35.36 ? 143 HEM A CHB 1 
HETATM 4391 C  CHC . HEM F 4 .   ? 45.569 26.260  12.338  1.00 27.62 ? 143 HEM A CHC 1 
HETATM 4392 C  CHD . HEM F 4 .   ? 43.692 30.486  13.994  1.00 31.46 ? 143 HEM A CHD 1 
HETATM 4393 C  C1A . HEM F 4 .   ? 47.998 31.863  10.866  1.00 38.61 ? 143 HEM A C1A 1 
HETATM 4394 C  C2A . HEM F 4 .   ? 49.056 32.215  9.902   1.00 38.85 ? 143 HEM A C2A 1 
HETATM 4395 C  C3A . HEM F 4 .   ? 49.490 31.040  9.327   1.00 35.27 ? 143 HEM A C3A 1 
HETATM 4396 C  C4A . HEM F 4 .   ? 48.670 29.996  9.943   1.00 33.39 ? 143 HEM A C4A 1 
HETATM 4397 C  CMA . HEM F 4 .   ? 50.543 30.863  8.223   1.00 26.53 ? 143 HEM A CMA 1 
HETATM 4398 C  CAA . HEM F 4 .   ? 49.502 33.643  9.619   1.00 40.89 ? 143 HEM A CAA 1 
HETATM 4399 C  CBA . HEM F 4 .   ? 50.617 34.067  10.563  1.00 47.57 ? 143 HEM A CBA 1 
HETATM 4400 C  CGA . HEM F 4 .   ? 51.101 35.472  10.283  1.00 50.76 ? 143 HEM A CGA 1 
HETATM 4401 O  O1A . HEM F 4 .   ? 50.940 36.345  11.163  1.00 56.59 ? 143 HEM A O1A 1 
HETATM 4402 O  O2A . HEM F 4 .   ? 51.615 35.713  9.169   1.00 56.26 ? 143 HEM A O2A 1 
HETATM 4403 C  C1B . HEM F 4 .   ? 48.087 27.650  10.300  1.00 35.26 ? 143 HEM A C1B 1 
HETATM 4404 C  C2B . HEM F 4 .   ? 48.296 26.265  9.963   1.00 33.30 ? 143 HEM A C2B 1 
HETATM 4405 C  C3B . HEM F 4 .   ? 47.332 25.576  10.696  1.00 32.18 ? 143 HEM A C3B 1 
HETATM 4406 C  C4B . HEM F 4 .   ? 46.631 26.564  11.527  1.00 29.49 ? 143 HEM A C4B 1 
HETATM 4407 C  CMB . HEM F 4 .   ? 49.453 25.741  9.120   1.00 29.40 ? 143 HEM A CMB 1 
HETATM 4408 C  CAB . HEM F 4 .   ? 47.063 24.199  10.834  1.00 32.81 ? 143 HEM A CAB 1 
HETATM 4409 C  CBB . HEM F 4 .   ? 47.673 23.058  10.213  1.00 29.22 ? 143 HEM A CBB 1 
HETATM 4410 C  C1C . HEM F 4 .   ? 44.703 27.156  12.915  1.00 27.68 ? 143 HEM A C1C 1 
HETATM 4411 C  C2C . HEM F 4 .   ? 43.418 26.820  13.608  1.00 31.24 ? 143 HEM A C2C 1 
HETATM 4412 C  C3C . HEM F 4 .   ? 42.933 28.090  14.100  1.00 35.68 ? 143 HEM A C3C 1 
HETATM 4413 C  C4C . HEM F 4 .   ? 43.906 29.109  13.689  1.00 33.28 ? 143 HEM A C4C 1 
HETATM 4414 C  CMC . HEM F 4 .   ? 42.884 25.368  13.831  1.00 22.25 ? 143 HEM A CMC 1 
HETATM 4415 C  CAC . HEM F 4 .   ? 41.723 28.366  14.812  1.00 32.13 ? 143 HEM A CAC 1 
HETATM 4416 C  CBC . HEM F 4 .   ? 40.416 27.937  14.318  1.00 31.26 ? 143 HEM A CBC 1 
HETATM 4417 C  C1D . HEM F 4 .   ? 44.545 31.529  13.611  1.00 34.18 ? 143 HEM A C1D 1 
HETATM 4418 C  C2D . HEM F 4 .   ? 44.359 32.972  13.845  1.00 33.19 ? 143 HEM A C2D 1 
HETATM 4419 C  C3D . HEM F 4 .   ? 45.360 33.635  13.182  1.00 34.80 ? 143 HEM A C3D 1 
HETATM 4420 C  C4D . HEM F 4 .   ? 46.149 32.583  12.503  1.00 34.95 ? 143 HEM A C4D 1 
HETATM 4421 C  CMD . HEM F 4 .   ? 43.241 33.581  14.675  1.00 27.77 ? 143 HEM A CMD 1 
HETATM 4422 C  CAD . HEM F 4 .   ? 45.609 35.148  13.107  1.00 33.30 ? 143 HEM A CAD 1 
HETATM 4423 C  CBD . HEM F 4 .   ? 44.833 35.739  11.942  1.00 37.69 ? 143 HEM A CBD 1 
HETATM 4424 C  CGD . HEM F 4 .   ? 45.082 37.221  11.757  1.00 41.98 ? 143 HEM A CGD 1 
HETATM 4425 O  O1D . HEM F 4 .   ? 45.198 37.940  12.764  1.00 49.98 ? 143 HEM A O1D 1 
HETATM 4426 O  O2D . HEM F 4 .   ? 45.148 37.690  10.604  1.00 50.16 ? 143 HEM A O2D 1 
HETATM 4427 N  NA  . HEM F 4 .   ? 47.757 30.504  10.844  1.00 35.04 ? 143 HEM A NA  1 
HETATM 4428 N  NB  . HEM F 4 .   ? 47.070 27.851  11.267  1.00 34.59 ? 143 HEM A NB  1 
HETATM 4429 N  NC  . HEM F 4 .   ? 44.969 28.551  12.910  1.00 33.19 ? 143 HEM A NC  1 
HETATM 4430 N  ND  . HEM F 4 .   ? 45.645 31.333  12.749  1.00 34.99 ? 143 HEM A ND  1 
HETATM 4431 FE FE  . HEM F 4 .   ? 46.362 29.505  11.954  1.00 27.44 ? 143 HEM A FE  1 
HETATM 4432 C  C   . CMO G 3 .   ? 30.174 -0.906  11.383  1.00 33.02 ? 347 CMO B C   1 
HETATM 4433 O  O   . CMO G 3 .   ? 30.775 -0.765  10.449  1.00 38.24 ? 347 CMO B O   1 
HETATM 4434 C  CHA . HEM H 4 .   ? 28.052 -4.034  12.682  1.00 35.51 ? 348 HEM B CHA 1 
HETATM 4435 C  CHB . HEM H 4 .   ? 26.404 0.236   11.060  1.00 35.75 ? 348 HEM B CHB 1 
HETATM 4436 C  CHC . HEM H 4 .   ? 30.311 2.357   13.182  1.00 28.19 ? 348 HEM B CHC 1 
HETATM 4437 C  CHD . HEM H 4 .   ? 32.105 -1.933  14.371  1.00 34.02 ? 348 HEM B CHD 1 
HETATM 4438 C  C1A . HEM H 4 .   ? 27.193 -3.084  12.183  1.00 35.04 ? 348 HEM B C1A 1 
HETATM 4439 C  C2A . HEM H 4 .   ? 25.965 -3.333  11.409  1.00 39.84 ? 348 HEM B C2A 1 
HETATM 4440 C  C3A . HEM H 4 .   ? 25.550 -2.140  10.880  1.00 37.15 ? 348 HEM B C3A 1 
HETATM 4441 C  C4A . HEM H 4 .   ? 26.500 -1.144  11.339  1.00 37.95 ? 348 HEM B C4A 1 
HETATM 4442 C  CMA . HEM H 4 .   ? 24.373 -1.882  9.953   1.00 34.29 ? 348 HEM B CMA 1 
HETATM 4443 C  CAA . HEM H 4 .   ? 25.258 -4.667  11.157  1.00 45.40 ? 348 HEM B CAA 1 
HETATM 4444 C  CBA . HEM H 4 .   ? 24.444 -5.213  12.328  1.00 53.32 ? 348 HEM B CBA 1 
HETATM 4445 C  CGA . HEM H 4 .   ? 23.732 -6.512  11.989  1.00 56.84 ? 348 HEM B CGA 1 
HETATM 4446 O  O1A . HEM H 4 .   ? 24.024 -7.545  12.637  1.00 61.39 ? 348 HEM B O1A 1 
HETATM 4447 O  O2A . HEM H 4 .   ? 22.878 -6.489  11.075  1.00 61.34 ? 348 HEM B O2A 1 
HETATM 4448 C  C1B . HEM H 4 .   ? 27.298 1.165   11.596  1.00 33.80 ? 348 HEM B C1B 1 
HETATM 4449 C  C2B . HEM H 4 .   ? 27.058 2.570   11.506  1.00 31.91 ? 348 HEM B C2B 1 
HETATM 4450 C  C3B . HEM H 4 .   ? 28.160 3.177   12.042  1.00 34.47 ? 348 HEM B C3B 1 
HETATM 4451 C  C4B . HEM H 4 .   ? 29.064 2.117   12.552  1.00 34.29 ? 348 HEM B C4B 1 
HETATM 4452 C  CMB . HEM H 4 .   ? 25.787 3.255   10.935  1.00 36.94 ? 348 HEM B CMB 1 
HETATM 4453 C  CAB . HEM H 4 .   ? 28.433 4.549   11.873  1.00 36.27 ? 348 HEM B CAB 1 
HETATM 4454 C  CBB . HEM H 4 .   ? 28.735 5.539   12.903  1.00 36.01 ? 348 HEM B CBB 1 
HETATM 4455 C  C1C . HEM H 4 .   ? 31.207 1.419   13.637  1.00 28.04 ? 348 HEM B C1C 1 
HETATM 4456 C  C2C . HEM H 4 .   ? 32.536 1.630   14.178  1.00 30.32 ? 348 HEM B C2C 1 
HETATM 4457 C  C3C . HEM H 4 .   ? 33.049 0.421   14.491  1.00 31.95 ? 348 HEM B C3C 1 
HETATM 4458 C  C4C . HEM H 4 .   ? 32.040 -0.525  14.149  1.00 31.22 ? 348 HEM B C4C 1 
HETATM 4459 C  CMC . HEM H 4 .   ? 33.237 2.957   14.272  1.00 24.37 ? 348 HEM B CMC 1 
HETATM 4460 C  CAC . HEM H 4 .   ? 34.258 0.026   15.066  1.00 34.06 ? 348 HEM B CAC 1 
HETATM 4461 C  CBC . HEM H 4 .   ? 35.588 0.607   14.943  1.00 36.26 ? 348 HEM B CBC 1 
HETATM 4462 C  C1D . HEM H 4 .   ? 31.166 -2.897  13.974  1.00 32.08 ? 348 HEM B C1D 1 
HETATM 4463 C  C2D . HEM H 4 .   ? 31.377 -4.335  14.085  1.00 34.72 ? 348 HEM B C2D 1 
HETATM 4464 C  C3D . HEM H 4 .   ? 30.208 -4.855  13.588  1.00 37.60 ? 348 HEM B C3D 1 
HETATM 4465 C  C4D . HEM H 4 .   ? 29.333 -3.816  13.175  1.00 36.52 ? 348 HEM B C4D 1 
HETATM 4466 C  CMD . HEM H 4 .   ? 32.561 -5.151  14.687  1.00 26.74 ? 348 HEM B CMD 1 
HETATM 4467 C  CAD . HEM H 4 .   ? 29.853 -6.319  13.564  1.00 43.59 ? 348 HEM B CAD 1 
HETATM 4468 C  CBD . HEM H 4 .   ? 30.425 -6.983  12.336  1.00 49.12 ? 348 HEM B CBD 1 
HETATM 4469 C  CGD . HEM H 4 .   ? 30.278 -8.480  12.394  1.00 56.31 ? 348 HEM B CGD 1 
HETATM 4470 O  O1D . HEM H 4 .   ? 29.133 -8.957  12.242  1.00 58.86 ? 348 HEM B O1D 1 
HETATM 4471 O  O2D . HEM H 4 .   ? 31.302 -9.171  12.605  1.00 56.60 ? 348 HEM B O2D 1 
HETATM 4472 N  NA  . HEM H 4 .   ? 27.526 -1.758  12.133  1.00 38.28 ? 348 HEM B NA  1 
HETATM 4473 N  NB  . HEM H 4 .   ? 28.512 0.868   12.297  1.00 32.87 ? 348 HEM B NB  1 
HETATM 4474 N  NC  . HEM H 4 .   ? 30.931 0.099   13.603  1.00 34.86 ? 348 HEM B NC  1 
HETATM 4475 N  ND  . HEM H 4 .   ? 29.926 -2.586  13.372  1.00 34.02 ? 348 HEM B ND  1 
HETATM 4476 FE FE  . HEM H 4 .   ? 29.237 -0.870  12.923  1.00 34.14 ? 348 HEM B FE  1 
HETATM 4477 C  C   . CMO I 3 .   ? 49.197 -2.025  30.065  1.00 27.00 ? 542 CMO C C   1 
HETATM 4478 O  O   . CMO I 3 .   ? 48.744 -2.094  31.081  1.00 31.64 ? 542 CMO C O   1 
HETATM 4479 C  CHA . HEM J 4 .   ? 50.932 -4.971  28.153  1.00 36.52 ? 543 HEM C CHA 1 
HETATM 4480 C  CHB . HEM J 4 .   ? 52.922 -0.833  29.692  1.00 32.84 ? 543 HEM C CHB 1 
HETATM 4481 C  CHC . HEM J 4 .   ? 48.881 1.375   28.306  1.00 32.42 ? 543 HEM C CHC 1 
HETATM 4482 C  CHD . HEM J 4 .   ? 46.649 -2.831  27.358  1.00 31.57 ? 543 HEM C CHD 1 
HETATM 4483 C  C1A . HEM J 4 .   ? 51.826 -4.062  28.797  1.00 37.19 ? 543 HEM C C1A 1 
HETATM 4484 C  C2A . HEM J 4 .   ? 53.140 -4.364  29.420  1.00 37.43 ? 543 HEM C C2A 1 
HETATM 4485 C  C3A . HEM J 4 .   ? 53.683 -3.187  29.858  1.00 35.34 ? 543 HEM C C3A 1 
HETATM 4486 C  C4A . HEM J 4 .   ? 52.698 -2.189  29.523  1.00 30.10 ? 543 HEM C C4A 1 
HETATM 4487 C  CMA . HEM J 4 .   ? 55.020 -3.004  30.607  1.00 24.63 ? 543 HEM C CMA 1 
HETATM 4488 C  CAA . HEM J 4 .   ? 53.797 -5.747  29.525  1.00 37.52 ? 543 HEM C CAA 1 
HETATM 4489 C  CBA . HEM J 4 .   ? 54.602 -5.889  28.251  1.00 46.01 ? 543 HEM C CBA 1 
HETATM 4490 C  CGA . HEM J 4 .   ? 55.468 -7.127  28.222  1.00 51.26 ? 543 HEM C CGA 1 
HETATM 4491 O  O1A . HEM J 4 .   ? 56.398 -7.182  27.372  1.00 53.83 ? 543 HEM C O1A 1 
HETATM 4492 O  O2A . HEM J 4 .   ? 55.220 -8.039  29.043  1.00 49.66 ? 543 HEM C O2A 1 
HETATM 4493 C  C1B . HEM J 4 .   ? 52.027 0.163   29.419  1.00 30.37 ? 543 HEM C C1B 1 
HETATM 4494 C  C2B . HEM J 4 .   ? 52.193 1.545   29.665  1.00 34.86 ? 543 HEM C C2B 1 
HETATM 4495 C  C3B . HEM J 4 .   ? 51.043 2.183   29.283  1.00 31.77 ? 543 HEM C C3B 1 
HETATM 4496 C  C4B . HEM J 4 .   ? 50.181 1.161   28.785  1.00 30.79 ? 543 HEM C C4B 1 
HETATM 4497 C  CMB . HEM J 4 .   ? 53.438 2.143   30.275  1.00 35.44 ? 543 HEM C CMB 1 
HETATM 4498 C  CAB . HEM J 4 .   ? 50.795 3.525   29.192  1.00 27.14 ? 543 HEM C CAB 1 
HETATM 4499 C  CBB . HEM J 4 .   ? 50.842 4.439   30.237  1.00 29.75 ? 543 HEM C CBB 1 
HETATM 4500 C  C1C . HEM J 4 .   ? 47.869 0.449   27.943  1.00 32.19 ? 543 HEM C C1C 1 
HETATM 4501 C  C2C . HEM J 4 .   ? 46.502 0.781   27.622  1.00 32.16 ? 543 HEM C C2C 1 
HETATM 4502 C  C3C . HEM J 4 .   ? 45.842 -0.408  27.456  1.00 33.56 ? 543 HEM C C3C 1 
HETATM 4503 C  C4C . HEM J 4 .   ? 46.821 -1.470  27.616  1.00 32.54 ? 543 HEM C C4C 1 
HETATM 4504 C  CMC . HEM J 4 .   ? 45.931 2.183   27.621  1.00 26.88 ? 543 HEM C CMC 1 
HETATM 4505 C  CAC . HEM J 4 .   ? 44.498 -0.611  27.200  1.00 32.05 ? 543 HEM C CAC 1 
HETATM 4506 C  CBC . HEM J 4 .   ? 43.475 -0.600  28.190  1.00 24.95 ? 543 HEM C CBC 1 
HETATM 4507 C  C1D . HEM J 4 .   ? 47.630 -3.812  27.492  1.00 34.33 ? 543 HEM C C1D 1 
HETATM 4508 C  C2D . HEM J 4 .   ? 47.379 -5.220  27.293  1.00 34.78 ? 543 HEM C C2D 1 
HETATM 4509 C  C3D . HEM J 4 .   ? 48.607 -5.812  27.486  1.00 35.67 ? 543 HEM C C3D 1 
HETATM 4510 C  C4D . HEM J 4 .   ? 49.597 -4.788  27.782  1.00 34.09 ? 543 HEM C C4D 1 
HETATM 4511 C  CMD . HEM J 4 .   ? 46.054 -5.889  26.946  1.00 30.33 ? 543 HEM C CMD 1 
HETATM 4512 C  CAD . HEM J 4 .   ? 48.945 -7.296  27.424  1.00 38.40 ? 543 HEM C CAD 1 
HETATM 4513 C  CBD . HEM J 4 .   ? 48.598 -8.042  28.699  1.00 42.49 ? 543 HEM C CBD 1 
HETATM 4514 C  CGD . HEM J 4 .   ? 49.049 -9.485  28.662  1.00 47.74 ? 543 HEM C CGD 1 
HETATM 4515 O  O1D . HEM J 4 .   ? 49.973 -9.845  29.418  1.00 52.51 ? 543 HEM C O1D 1 
HETATM 4516 O  O2D . HEM J 4 .   ? 48.476 -10.268 27.883  1.00 54.09 ? 543 HEM C O2D 1 
HETATM 4517 N  NA  . HEM J 4 .   ? 51.552 -2.734  28.947  1.00 32.85 ? 543 HEM C NA  1 
HETATM 4518 N  NB  . HEM J 4 .   ? 50.770 -0.064  28.900  1.00 33.37 ? 543 HEM C NB  1 
HETATM 4519 N  NC  . HEM J 4 .   ? 48.041 -0.905  27.957  1.00 34.77 ? 543 HEM C NC  1 
HETATM 4520 N  ND  . HEM J 4 .   ? 48.987 -3.555  27.852  1.00 34.84 ? 543 HEM C ND  1 
HETATM 4521 FE FE  . HEM J 4 .   ? 49.877 -1.918  28.386  1.00 29.96 ? 543 HEM C FE  1 
HETATM 4522 C  C   . CMO K 3 .   ? 32.879 27.616  34.375  1.00 32.85 ? 747 CMO D C   1 
HETATM 4523 O  O   . CMO K 3 .   ? 33.808 27.715  34.975  1.00 40.61 ? 747 CMO D O   1 
HETATM 4524 C  CHA . HEM L 4 .   ? 30.461 30.731  33.768  1.00 36.17 ? 748 HEM D CHA 1 
HETATM 4525 C  CHB . HEM L 4 .   ? 29.475 26.238  35.441  1.00 36.96 ? 748 HEM D CHB 1 
HETATM 4526 C  CHC . HEM L 4 .   ? 32.777 24.353  32.531  1.00 25.95 ? 748 HEM D CHC 1 
HETATM 4527 C  CHD . HEM L 4 .   ? 33.962 28.812  31.035  1.00 36.33 ? 748 HEM D CHD 1 
HETATM 4528 C  C1A . HEM L 4 .   ? 29.921 29.649  34.495  1.00 34.11 ? 748 HEM D C1A 1 
HETATM 4529 C  C2A . HEM L 4 .   ? 28.860 29.789  35.482  1.00 36.91 ? 748 HEM D C2A 1 
HETATM 4530 C  C3A . HEM L 4 .   ? 28.597 28.581  35.960  1.00 37.16 ? 748 HEM D C3A 1 
HETATM 4531 C  C4A . HEM L 4 .   ? 29.488 27.629  35.248  1.00 37.26 ? 748 HEM D C4A 1 
HETATM 4532 C  CMA . HEM L 4 .   ? 27.500 28.331  36.979  1.00 31.21 ? 748 HEM D CMA 1 
HETATM 4533 C  CAA . HEM L 4 .   ? 28.079 31.013  35.855  1.00 42.38 ? 748 HEM D CAA 1 
HETATM 4534 C  CBA . HEM L 4 .   ? 28.691 31.585  37.110  1.00 47.55 ? 748 HEM D CBA 1 
HETATM 4535 C  CGA . HEM L 4 .   ? 28.050 32.896  37.503  1.00 51.85 ? 748 HEM D CGA 1 
HETATM 4536 O  O1A . HEM L 4 .   ? 28.808 33.861  37.697  1.00 55.05 ? 748 HEM D O1A 1 
HETATM 4537 O  O2A . HEM L 4 .   ? 26.798 32.971  37.589  1.00 54.78 ? 748 HEM D O2A 1 
HETATM 4538 C  C1B . HEM L 4 .   ? 30.310 25.331  34.859  1.00 33.00 ? 748 HEM D C1B 1 
HETATM 4539 C  C2B . HEM L 4 .   ? 30.311 23.919  35.158  1.00 34.72 ? 748 HEM D C2B 1 
HETATM 4540 C  C3B . HEM L 4 .   ? 31.263 23.359  34.375  1.00 30.19 ? 748 HEM D C3B 1 
HETATM 4541 C  C4B . HEM L 4 .   ? 31.800 24.452  33.538  1.00 29.72 ? 748 HEM D C4B 1 
HETATM 4542 C  CMB . HEM L 4 .   ? 29.403 23.135  36.113  1.00 30.23 ? 748 HEM D CMB 1 
HETATM 4543 C  CAB . HEM L 4 .   ? 31.704 22.031  34.566  1.00 30.64 ? 748 HEM D CAB 1 
HETATM 4544 C  CBB . HEM L 4 .   ? 32.029 21.030  33.558  1.00 27.81 ? 748 HEM D CBB 1 
HETATM 4545 C  C1C . HEM L 4 .   ? 33.403 25.396  31.863  1.00 24.62 ? 748 HEM D C1C 1 
HETATM 4546 C  C2C . HEM L 4 .   ? 34.534 25.269  31.042  1.00 26.64 ? 748 HEM D C2C 1 
HETATM 4547 C  C3C . HEM L 4 .   ? 34.834 26.506  30.564  1.00 26.78 ? 748 HEM D C3C 1 
HETATM 4548 C  C4C . HEM L 4 .   ? 33.931 27.404  31.186  1.00 29.08 ? 748 HEM D C4C 1 
HETATM 4549 C  CMC . HEM L 4 .   ? 35.323 23.987  30.832  1.00 21.86 ? 748 HEM D CMC 1 
HETATM 4550 C  CAC . HEM L 4 .   ? 35.731 26.839  29.558  1.00 21.96 ? 748 HEM D CAC 1 
HETATM 4551 C  CBC . HEM L 4 .   ? 37.171 26.974  29.673  1.00 22.76 ? 748 HEM D CBC 1 
HETATM 4552 C  C1D . HEM L 4 .   ? 33.131 29.776  31.636  1.00 35.01 ? 748 HEM D C1D 1 
HETATM 4553 C  C2D . HEM L 4 .   ? 33.077 31.197  31.360  1.00 34.93 ? 748 HEM D C2D 1 
HETATM 4554 C  C3D . HEM L 4 .   ? 32.078 31.709  32.094  1.00 38.05 ? 748 HEM D C3D 1 
HETATM 4555 C  C4D . HEM L 4 .   ? 31.516 30.643  32.852  1.00 36.95 ? 748 HEM D C4D 1 
HETATM 4556 C  CMD . HEM L 4 .   ? 34.026 32.045  30.544  1.00 33.15 ? 748 HEM D CMD 1 
HETATM 4557 C  CAD . HEM L 4 .   ? 31.633 33.134  32.211  1.00 45.80 ? 748 HEM D CAD 1 
HETATM 4558 C  CBD . HEM L 4 .   ? 32.478 33.838  33.267  1.00 55.42 ? 748 HEM D CBD 1 
HETATM 4559 C  CGD . HEM L 4 .   ? 31.826 35.109  33.798  1.00 60.54 ? 748 HEM D CGD 1 
HETATM 4560 O  O1D . HEM L 4 .   ? 30.586 35.263  33.648  1.00 62.41 ? 748 HEM D O1D 1 
HETATM 4561 O  O2D . HEM L 4 .   ? 32.559 35.948  34.373  1.00 61.73 ? 748 HEM D O2D 1 
HETATM 4562 N  NA  . HEM L 4 .   ? 30.316 28.310  34.355  1.00 36.54 ? 748 HEM D NA  1 
HETATM 4563 N  NB  . HEM L 4 .   ? 31.230 25.677  33.896  1.00 32.58 ? 748 HEM D NB  1 
HETATM 4564 N  NC  . HEM L 4 .   ? 33.055 26.733  31.975  1.00 29.03 ? 748 HEM D NC  1 
HETATM 4565 N  ND  . HEM L 4 .   ? 32.157 29.433  32.548  1.00 37.14 ? 748 HEM D ND  1 
HETATM 4566 FE FE  . HEM L 4 .   ? 31.662 27.545  33.127  1.00 30.63 ? 748 HEM D FE  1 
HETATM 4567 O  O   . HOH M 5 .   ? 48.870 4.662   -3.000  1.00 45.14 ? 804 HOH A O   1 
HETATM 4568 O  O   . HOH M 5 .   ? 45.011 17.212  13.689  1.00 37.93 ? 805 HOH A O   1 
HETATM 4569 O  O   . HOH M 5 .   ? 45.019 14.846  10.760  1.00 40.47 ? 810 HOH A O   1 
HETATM 4570 O  O   . HOH M 5 .   ? 39.164 25.698  -5.122  1.00 48.80 ? 811 HOH A O   1 
HETATM 4571 O  O   . HOH M 5 .   ? 54.632 15.081  -6.854  1.00 34.51 ? 812 HOH A O   1 
HETATM 4572 O  O   . HOH M 5 .   ? 61.125 5.395   7.988   1.00 40.72 ? 815 HOH A O   1 
HETATM 4573 O  O   . HOH M 5 .   ? 41.368 24.356  -9.702  1.00 51.53 ? 816 HOH A O   1 
HETATM 4574 O  O   . HOH M 5 .   ? 41.577 14.791  10.018  1.00 42.56 ? 817 HOH A O   1 
HETATM 4575 O  O   . HOH M 5 .   ? 40.064 10.829  7.434   1.00 29.04 ? 819 HOH A O   1 
HETATM 4576 O  O   . HOH M 5 .   ? 51.356 13.384  17.366  1.00 44.43 ? 823 HOH A O   1 
HETATM 4577 O  O   . HOH M 5 .   ? 42.300 6.778   -5.707  1.00 57.02 ? 824 HOH A O   1 
HETATM 4578 O  O   . HOH M 5 .   ? 48.752 36.908  8.869   1.00 51.57 ? 830 HOH A O   1 
HETATM 4579 O  O   . HOH M 5 .   ? 40.548 28.000  23.765  1.00 29.16 ? 832 HOH A O   1 
HETATM 4580 O  O   . HOH M 5 .   ? 39.113 13.537  8.330   1.00 40.09 ? 838 HOH A O   1 
HETATM 4581 O  O   . HOH M 5 .   ? 36.269 43.495  6.993   1.00 52.18 ? 839 HOH A O   1 
HETATM 4582 O  O   . HOH M 5 .   ? 58.139 3.705   5.871   1.00 49.46 ? 841 HOH A O   1 
HETATM 4583 O  O   . HOH M 5 .   ? 41.434 15.000  -10.943 1.00 36.12 ? 843 HOH A O   1 
HETATM 4584 O  O   . HOH M 5 .   ? 46.157 2.356   -1.028  1.00 44.77 ? 845 HOH A O   1 
HETATM 4585 O  O   . HOH M 5 .   ? 58.243 24.687  16.819  1.00 45.66 ? 848 HOH A O   1 
HETATM 4586 O  O   . HOH M 5 .   ? 51.411 34.059  1.360   1.00 52.32 ? 851 HOH A O   1 
HETATM 4587 O  O   . HOH M 5 .   ? 37.165 33.447  -0.333  1.00 28.78 ? 852 HOH A O   1 
HETATM 4588 O  O   . HOH M 5 .   ? 52.061 32.467  6.107   1.00 58.22 ? 854 HOH A O   1 
HETATM 4589 O  O   . HOH M 5 .   ? 40.145 20.741  24.352  1.00 31.51 ? 855 HOH A O   1 
HETATM 4590 O  O   . HOH M 5 .   ? 43.252 13.365  -9.601  1.00 44.69 ? 859 HOH A O   1 
HETATM 4591 O  O   . HOH M 5 .   ? 36.643 30.835  -0.207  1.00 60.58 ? 860 HOH A O   1 
HETATM 4592 O  O   . HOH M 5 .   ? 33.661 36.820  12.148  1.00 37.69 ? 863 HOH A O   1 
HETATM 4593 O  O   . HOH M 5 .   ? 63.480 22.822  8.968   1.00 57.03 ? 876 HOH A O   1 
HETATM 4594 O  O   . HOH M 5 .   ? 31.197 24.137  15.409  1.00 40.26 ? 883 HOH A O   1 
HETATM 4595 O  O   . HOH M 5 .   ? 34.501 32.703  3.130   1.00 44.10 ? 890 HOH A O   1 
HETATM 4596 O  O   . HOH M 5 .   ? 46.419 36.384  7.899   1.00 46.76 ? 891 HOH A O   1 
HETATM 4597 O  O   . HOH M 5 .   ? 31.362 31.246  7.106   1.00 54.89 ? 895 HOH A O   1 
HETATM 4598 O  O   . HOH M 5 .   ? 56.784 16.724  -6.344  1.00 57.92 ? 906 HOH A O   1 
HETATM 4599 O  O   . HOH M 5 .   ? 38.619 36.094  18.883  1.00 40.60 ? 908 HOH A O   1 
HETATM 4600 O  O   . HOH M 5 .   ? 52.500 22.828  -3.638  1.00 46.32 ? 912 HOH A O   1 
HETATM 4601 O  O   . HOH M 5 .   ? 35.203 24.485  18.561  1.00 56.37 ? 915 HOH A O   1 
HETATM 4602 O  O   . HOH M 5 .   ? 58.757 26.328  -2.313  1.00 60.33 ? 922 HOH A O   1 
HETATM 4603 O  O   . HOH M 5 .   ? 50.272 5.397   6.792   1.00 55.93 ? 923 HOH A O   1 
HETATM 4604 O  O   . HOH M 5 .   ? 48.069 29.782  -9.771  1.00 54.90 ? 924 HOH A O   1 
HETATM 4605 O  O   . HOH M 5 .   ? 43.789 37.818  5.493   1.00 54.34 ? 925 HOH A O   1 
HETATM 4606 O  O   . HOH M 5 .   ? 52.459 28.206  -1.410  1.00 53.70 ? 926 HOH A O   1 
HETATM 4607 O  O   . HOH M 5 .   ? 46.676 6.870   -8.272  1.00 54.35 ? 927 HOH A O   1 
HETATM 4608 O  O   . HOH M 5 .   ? 54.277 25.103  -2.976  1.00 51.10 ? 928 HOH A O   1 
HETATM 4609 O  O   . HOH M 5 .   ? 35.369 27.845  -2.779  1.00 55.36 ? 929 HOH A O   1 
HETATM 4610 O  O   . HOH N 5 .   ? 17.803 0.360   12.207  1.00 46.59 ? 808 HOH B O   1 
HETATM 4611 O  O   . HOH N 5 .   ? 20.335 -0.633  9.908   1.00 32.79 ? 822 HOH B O   1 
HETATM 4612 O  O   . HOH N 5 .   ? 34.963 20.991  6.953   1.00 39.21 ? 828 HOH B O   1 
HETATM 4613 O  O   . HOH N 5 .   ? 39.730 4.574   -3.338  1.00 38.46 ? 834 HOH B O   1 
HETATM 4614 O  O   . HOH N 5 .   ? 38.191 12.171  11.000  1.00 37.56 ? 840 HOH B O   1 
HETATM 4615 O  O   . HOH N 5 .   ? 37.129 1.346   21.430  1.00 45.89 ? 842 HOH B O   1 
HETATM 4616 O  O   . HOH N 5 .   ? 46.188 -2.586  7.514   1.00 43.97 ? 858 HOH B O   1 
HETATM 4617 O  O   . HOH N 5 .   ? 31.855 22.972  4.643   1.00 42.71 ? 862 HOH B O   1 
HETATM 4618 O  O   . HOH N 5 .   ? 35.505 -5.432  22.389  1.00 46.39 ? 864 HOH B O   1 
HETATM 4619 O  O   . HOH N 5 .   ? 21.103 12.406  17.075  1.00 41.35 ? 865 HOH B O   1 
HETATM 4620 O  O   . HOH N 5 .   ? 28.788 26.522  -1.306  1.00 36.51 ? 867 HOH B O   1 
HETATM 4621 O  O   . HOH N 5 .   ? 17.603 -1.400  0.905   1.00 51.93 ? 881 HOH B O   1 
HETATM 4622 O  O   . HOH N 5 .   ? 32.720 4.645   26.167  1.00 55.03 ? 884 HOH B O   1 
HETATM 4623 O  O   . HOH N 5 .   ? 29.635 -1.154  0.041   1.00 53.29 ? 886 HOH B O   1 
HETATM 4624 O  O   . HOH N 5 .   ? 36.177 10.271  -8.326  1.00 45.35 ? 888 HOH B O   1 
HETATM 4625 O  O   . HOH N 5 .   ? 35.637 -9.708  13.887  1.00 40.43 ? 896 HOH B O   1 
HETATM 4626 O  O   . HOH N 5 .   ? 24.084 10.485  23.243  1.00 45.07 ? 897 HOH B O   1 
HETATM 4627 O  O   . HOH N 5 .   ? 33.362 -0.634  -2.663  1.00 51.13 ? 901 HOH B O   1 
HETATM 4628 O  O   . HOH N 5 .   ? 27.960 22.193  -7.813  1.00 47.33 ? 902 HOH B O   1 
HETATM 4629 O  O   . HOH N 5 .   ? 18.058 26.107  5.854   1.00 54.62 ? 905 HOH B O   1 
HETATM 4630 O  O   . HOH N 5 .   ? 28.629 -8.096  8.230   1.00 47.81 ? 907 HOH B O   1 
HETATM 4631 O  O   . HOH N 5 .   ? 36.511 14.371  -7.829  1.00 48.54 ? 911 HOH B O   1 
HETATM 4632 O  O   . HOH N 5 .   ? 21.840 25.057  3.753   1.00 55.10 ? 914 HOH B O   1 
HETATM 4633 O  O   . HOH N 5 .   ? 23.597 1.942   -6.333  1.00 52.55 ? 921 HOH B O   1 
HETATM 4634 O  O   . HOH N 5 .   ? 21.797 -2.098  8.332   1.00 56.34 ? 930 HOH B O   1 
HETATM 4635 O  O   . HOH N 5 .   ? 43.012 -6.578  21.812  1.00 55.07 ? 933 HOH B O   1 
HETATM 4636 O  O   . HOH O 5 .   ? 38.002 1.024   23.942  1.00 39.61 ? 802 HOH C O   1 
HETATM 4637 O  O   . HOH O 5 .   ? 59.285 0.101   39.014  1.00 44.40 ? 807 HOH C O   1 
HETATM 4638 O  O   . HOH O 5 .   ? 47.403 9.092   18.600  1.00 53.87 ? 809 HOH C O   1 
HETATM 4639 O  O   . HOH O 5 .   ? 58.382 24.014  37.499  1.00 54.95 ? 813 HOH C O   1 
HETATM 4640 O  O   . HOH O 5 .   ? 38.231 4.088   40.113  1.00 23.53 ? 820 HOH C O   1 
HETATM 4641 O  O   . HOH O 5 .   ? 51.789 -4.537  41.975  1.00 45.46 ? 821 HOH C O   1 
HETATM 4642 O  O   . HOH O 5 .   ? 40.490 6.463   36.800  1.00 33.81 ? 825 HOH C O   1 
HETATM 4643 O  O   . HOH O 5 .   ? 41.004 -0.703  18.983  1.00 35.63 ? 826 HOH C O   1 
HETATM 4644 O  O   . HOH O 5 .   ? 39.673 6.594   19.139  1.00 37.31 ? 827 HOH C O   1 
HETATM 4645 O  O   . HOH O 5 .   ? 37.323 2.803   25.920  1.00 42.82 ? 831 HOH C O   1 
HETATM 4646 O  O   . HOH O 5 .   ? 49.980 20.849  46.514  1.00 46.41 ? 835 HOH C O   1 
HETATM 4647 O  O   . HOH O 5 .   ? 41.411 -8.190  24.001  1.00 52.02 ? 836 HOH C O   1 
HETATM 4648 O  O   . HOH O 5 .   ? 62.591 -0.650  34.776  1.00 38.71 ? 837 HOH C O   1 
HETATM 4649 O  O   . HOH O 5 .   ? 53.136 14.570  49.935  1.00 36.69 ? 847 HOH C O   1 
HETATM 4650 O  O   . HOH O 5 .   ? 48.232 13.136  30.580  1.00 39.94 ? 850 HOH C O   1 
HETATM 4651 O  O   . HOH O 5 .   ? 36.920 -8.837  30.635  1.00 41.53 ? 853 HOH C O   1 
HETATM 4652 O  O   . HOH O 5 .   ? 47.700 9.337   51.378  1.00 60.35 ? 856 HOH C O   1 
HETATM 4653 O  O   . HOH O 5 .   ? 51.172 23.903  31.036  1.00 41.97 ? 861 HOH C O   1 
HETATM 4654 O  O   . HOH O 5 .   ? 60.693 -1.323  25.092  1.00 45.31 ? 868 HOH C O   1 
HETATM 4655 O  O   . HOH O 5 .   ? 47.363 9.029   21.929  1.00 57.47 ? 869 HOH C O   1 
HETATM 4656 O  O   . HOH O 5 .   ? 66.250 10.034  35.429  1.00 49.01 ? 872 HOH C O   1 
HETATM 4657 O  O   . HOH O 5 .   ? 47.356 10.705  27.569  1.00 39.58 ? 873 HOH C O   1 
HETATM 4658 O  O   . HOH O 5 .   ? 37.288 -10.941 32.736  1.00 41.13 ? 874 HOH C O   1 
HETATM 4659 O  O   . HOH O 5 .   ? 52.726 25.337  41.206  1.00 43.04 ? 875 HOH C O   1 
HETATM 4660 O  O   . HOH O 5 .   ? 51.244 -8.997  32.048  1.00 50.33 ? 877 HOH C O   1 
HETATM 4661 O  O   . HOH O 5 .   ? 40.886 -10.652 44.832  1.00 42.67 ? 880 HOH C O   1 
HETATM 4662 O  O   . HOH O 5 .   ? 52.792 15.440  24.689  1.00 47.94 ? 882 HOH C O   1 
HETATM 4663 O  O   . HOH O 5 .   ? 54.308 25.627  43.917  1.00 50.96 ? 887 HOH C O   1 
HETATM 4664 O  O   . HOH O 5 .   ? 44.545 5.735   47.318  1.00 49.55 ? 892 HOH C O   1 
HETATM 4665 O  O   . HOH O 5 .   ? 56.657 0.204   13.482  1.00 46.57 ? 898 HOH C O   1 
HETATM 4666 O  O   . HOH O 5 .   ? 60.666 4.106   41.581  1.00 48.54 ? 903 HOH C O   1 
HETATM 4667 O  O   . HOH O 5 .   ? 62.171 11.463  23.003  1.00 49.17 ? 917 HOH C O   1 
HETATM 4668 O  O   . HOH O 5 .   ? 44.666 -6.408  13.870  1.00 44.38 ? 918 HOH C O   1 
HETATM 4669 O  O   . HOH O 5 .   ? 57.738 11.442  22.984  1.00 53.22 ? 920 HOH C O   1 
HETATM 4670 O  O   . HOH O 5 .   ? 54.770 22.335  32.786  1.00 55.61 ? 931 HOH C O   1 
HETATM 4671 O  O   . HOH O 5 .   ? 63.915 9.352   39.778  1.00 58.46 ? 932 HOH C O   1 
HETATM 4672 O  O   . HOH O 5 .   ? 50.677 -10.807 35.927  1.00 64.62 ? 934 HOH C O   1 
HETATM 4673 O  O   . HOH O 5 .   ? 43.965 11.810  30.286  1.00 55.63 ? 935 HOH C O   1 
HETATM 4674 O  O   . HOH P 5 .   ? 41.460 27.111  46.711  1.00 47.59 ? 801 HOH D O   1 
HETATM 4675 O  O   . HOH P 5 .   ? 43.389 14.060  34.369  1.00 27.77 ? 803 HOH D O   1 
HETATM 4676 O  O   . HOH P 5 .   ? 35.471 28.832  20.709  1.00 36.45 ? 806 HOH D O   1 
HETATM 4677 O  O   . HOH P 5 .   ? 20.182 6.600   47.674  1.00 43.64 ? 814 HOH D O   1 
HETATM 4678 O  O   . HOH P 5 .   ? 44.767 16.579  34.539  1.00 30.66 ? 818 HOH D O   1 
HETATM 4679 O  O   . HOH P 5 .   ? 34.233 10.383  33.866  1.00 35.81 ? 829 HOH D O   1 
HETATM 4680 O  O   . HOH P 5 .   ? 41.363 14.892  32.135  1.00 49.77 ? 833 HOH D O   1 
HETATM 4681 O  O   . HOH P 5 .   ? 18.619 32.437  25.121  1.00 41.31 ? 844 HOH D O   1 
HETATM 4682 O  O   . HOH P 5 .   ? 37.387 19.691  51.626  1.00 40.49 ? 846 HOH D O   1 
HETATM 4683 O  O   . HOH P 5 .   ? 38.390 8.034   56.249  1.00 45.48 ? 849 HOH D O   1 
HETATM 4684 O  O   . HOH P 5 .   ? 44.530 39.927  38.183  1.00 63.04 ? 857 HOH D O   1 
HETATM 4685 O  O   . HOH P 5 .   ? 45.067 12.959  32.574  1.00 37.91 ? 866 HOH D O   1 
HETATM 4686 O  O   . HOH P 5 .   ? 34.163 3.328   49.560  1.00 46.94 ? 870 HOH D O   1 
HETATM 4687 O  O   . HOH P 5 .   ? 25.181 15.928  25.228  1.00 60.39 ? 871 HOH D O   1 
HETATM 4688 O  O   . HOH P 5 .   ? 42.802 28.830  43.750  1.00 52.22 ? 878 HOH D O   1 
HETATM 4689 O  O   . HOH P 5 .   ? 32.237 5.264   36.291  1.00 49.02 ? 879 HOH D O   1 
HETATM 4690 O  O   . HOH P 5 .   ? 24.749 16.535  48.380  1.00 58.64 ? 885 HOH D O   1 
HETATM 4691 O  O   . HOH P 5 .   ? 32.889 24.676  51.966  1.00 50.43 ? 889 HOH D O   1 
HETATM 4692 O  O   . HOH P 5 .   ? 37.572 35.444  45.769  1.00 53.19 ? 893 HOH D O   1 
HETATM 4693 O  O   . HOH P 5 .   ? 41.702 22.274  48.585  1.00 43.19 ? 894 HOH D O   1 
HETATM 4694 O  O   . HOH P 5 .   ? 37.700 0.978   46.851  1.00 38.91 ? 899 HOH D O   1 
HETATM 4695 O  O   . HOH P 5 .   ? 21.114 26.120  34.211  1.00 53.82 ? 900 HOH D O   1 
HETATM 4696 O  O   . HOH P 5 .   ? 36.794 25.677  22.920  1.00 46.18 ? 904 HOH D O   1 
HETATM 4697 O  O   . HOH P 5 .   ? 41.887 4.047   49.070  1.00 37.78 ? 909 HOH D O   1 
HETATM 4698 O  O   . HOH P 5 .   ? 31.217 2.139   41.594  1.00 48.56 ? 910 HOH D O   1 
HETATM 4699 O  O   . HOH P 5 .   ? 35.012 17.643  21.558  1.00 53.07 ? 913 HOH D O   1 
HETATM 4700 O  O   . HOH P 5 .   ? 35.503 6.978   51.535  1.00 48.26 ? 916 HOH D O   1 
HETATM 4701 O  O   . HOH P 5 .   ? 37.811 36.072  25.121  1.00 52.56 ? 919 HOH D O   1 
HETATM 4702 O  O   . HOH P 5 .   ? 29.884 20.261  50.632  1.00 47.34 ? 936 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   1   VAL VAL A . n 
A 1 2   LEU 2   2   2   LEU LEU A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   ALA 4   4   4   ALA ALA A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   GLY 8   8   8   GLY GLY A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  TRP 14  14  14  TRP TRP A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  VAL 17  17  17  VAL VAL A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  HIS 20  20  20  HIS HIS A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  ALA 22  22  22  ALA ALA A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  GLU 30  30  30  GLU GLU A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  MET 32  32  32  MET MET A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  LYS 40  40  40  LYS LYS A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  TYR 42  42  42  TYR TYR A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  HIS 45  45  45  HIS HIS A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  SER 49  49  49  SER SER A . n 
A 1 50  HIS 50  50  50  HIS HIS A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  ALA 53  53  53  ALA ALA A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  HIS 58  58  58  HIS HIS A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  VAL 62  62  62  VAL VAL A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  THR 67  67  67  THR THR A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  HIS 72  72  72  HIS HIS A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  PRO 77  77  77  PRO PRO A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  HIS 87  87  87  HIS HIS A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  HIS 89  89  89  HIS HIS A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  PHE 98  98  98  PHE PHE A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 HIS 103 103 103 HIS HIS A . n 
A 1 104 SER 104 104 104 SER SER A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 THR 108 108 108 THR THR A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 HIS 112 112 112 HIS HIS A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
A 1 115 SER 115 115 115 SER SER A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 HIS 122 122 122 HIS HIS A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ASP 126 126 126 ASP ASP A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 PHE 128 128 128 PHE PHE A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 SER 133 133 133 SER SER A . n 
A 1 134 THR 134 134 134 THR THR A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 LYS 139 139 139 LYS LYS A . n 
A 1 140 TYR 140 140 140 TYR TYR A . n 
A 1 141 ARG 141 141 141 ARG ARG A . n 
B 2 1   MET 1   202 202 MET MET B . n 
B 2 2   LEU 2   203 203 LEU LEU B . n 
B 2 3   THR 3   204 204 THR THR B . n 
B 2 4   ALA 4   205 205 ALA ALA B . n 
B 2 5   GLU 5   206 206 GLU GLU B . n 
B 2 6   GLU 6   207 207 GLU GLU B . n 
B 2 7   LYS 7   208 208 LYS LYS B . n 
B 2 8   ALA 8   209 209 ALA ALA B . n 
B 2 9   ALA 9   210 210 ALA ALA B . n 
B 2 10  VAL 10  211 211 VAL VAL B . n 
B 2 11  THR 11  212 212 THR THR B . n 
B 2 12  ALA 12  213 213 ALA ALA B . n 
B 2 13  PHE 13  214 214 PHE PHE B . n 
B 2 14  TRP 14  215 215 TRP TRP B . n 
B 2 15  GLY 15  216 216 GLY GLY B . n 
B 2 16  LYS 16  217 217 LYS LYS B . n 
B 2 17  VAL 17  218 218 VAL VAL B . n 
B 2 18  LYS 18  219 219 LYS LYS B . n 
B 2 19  VAL 19  220 220 VAL VAL B . n 
B 2 20  ASP 20  221 221 ASP ASP B . n 
B 2 21  GLU 21  222 222 GLU GLU B . n 
B 2 22  VAL 22  223 223 VAL VAL B . n 
B 2 23  GLY 23  224 224 GLY GLY B . n 
B 2 24  GLY 24  225 225 GLY GLY B . n 
B 2 25  GLU 25  226 226 GLU GLU B . n 
B 2 26  ALA 26  227 227 ALA ALA B . n 
B 2 27  LEU 27  228 228 LEU LEU B . n 
B 2 28  GLY 28  229 229 GLY GLY B . n 
B 2 29  ARG 29  230 230 ARG ARG B . n 
B 2 30  LEU 30  231 231 LEU LEU B . n 
B 2 31  LEU 31  232 232 LEU LEU B . n 
B 2 32  VAL 32  233 233 VAL VAL B . n 
B 2 33  VAL 33  234 234 VAL VAL B . n 
B 2 34  TYR 34  235 235 TYR TYR B . n 
B 2 35  PRO 35  236 236 PRO PRO B . n 
B 2 36  TRP 36  237 237 TRP TRP B . n 
B 2 37  THR 37  238 238 THR THR B . n 
B 2 38  GLN 38  239 239 GLN GLN B . n 
B 2 39  ARG 39  240 240 ARG ARG B . n 
B 2 40  PHE 40  241 241 PHE PHE B . n 
B 2 41  PHE 41  242 242 PHE PHE B . n 
B 2 42  GLU 42  243 243 GLU GLU B . n 
B 2 43  SER 43  244 244 SER SER B . n 
B 2 44  PHE 44  245 245 PHE PHE B . n 
B 2 45  GLY 45  246 246 GLY GLY B . n 
B 2 46  ASP 46  247 247 ASP ASP B . n 
B 2 47  LEU 47  248 248 LEU LEU B . n 
B 2 48  SER 48  249 249 SER SER B . n 
B 2 49  THR 49  250 250 THR THR B . n 
B 2 50  ALA 50  251 251 ALA ALA B . n 
B 2 51  ASP 51  252 252 ASP ASP B . n 
B 2 52  ALA 52  253 253 ALA ALA B . n 
B 2 53  VAL 53  254 254 VAL VAL B . n 
B 2 54  MET 54  255 255 MET MET B . n 
B 2 55  ASN 55  256 256 ASN ASN B . n 
B 2 56  ASN 56  257 257 ASN ASN B . n 
B 2 57  PRO 57  258 258 PRO PRO B . n 
B 2 58  LYS 58  259 259 LYS LYS B . n 
B 2 59  VAL 59  260 260 VAL VAL B . n 
B 2 60  LYS 60  261 261 LYS LYS B . n 
B 2 61  ALA 61  262 262 ALA ALA B . n 
B 2 62  HIS 62  263 263 HIS HIS B . n 
B 2 63  GLY 63  264 264 GLY GLY B . n 
B 2 64  LYS 64  265 265 LYS LYS B . n 
B 2 65  LYS 65  266 266 LYS LYS B . n 
B 2 66  VAL 66  267 267 VAL VAL B . n 
B 2 67  LEU 67  268 268 LEU LEU B . n 
B 2 68  ASP 68  269 269 ASP ASP B . n 
B 2 69  SER 69  270 270 SER SER B . n 
B 2 70  PHE 70  271 271 PHE PHE B . n 
B 2 71  SER 71  272 272 SER SER B . n 
B 2 72  ASN 72  273 273 ASN ASN B . n 
B 2 73  GLY 73  274 274 GLY GLY B . n 
B 2 74  MET 74  275 275 MET MET B . n 
B 2 75  LYS 75  276 276 LYS LYS B . n 
B 2 76  HIS 76  277 277 HIS HIS B . n 
B 2 77  LEU 77  278 278 LEU LEU B . n 
B 2 78  ASP 78  279 279 ASP ASP B . n 
B 2 79  ASP 79  280 280 ASP ASP B . n 
B 2 80  LEU 80  281 281 LEU LEU B . n 
B 2 81  LYS 81  282 282 LYS LYS B . n 
B 2 82  GLY 82  283 283 GLY GLY B . n 
B 2 83  THR 83  284 284 THR THR B . n 
B 2 84  PHE 84  285 285 PHE PHE B . n 
B 2 85  ALA 85  286 286 ALA ALA B . n 
B 2 86  ALA 86  287 287 ALA ALA B . n 
B 2 87  LEU 87  288 288 LEU LEU B . n 
B 2 88  SER 88  289 289 SER SER B . n 
B 2 89  GLU 89  290 290 GLU GLU B . n 
B 2 90  LEU 90  291 291 LEU LEU B . n 
B 2 91  HIS 91  292 292 HIS HIS B . n 
B 2 92  CYS 92  293 293 CYS CYS B . n 
B 2 93  ASP 93  294 294 ASP ASP B . n 
B 2 94  LYS 94  295 295 LYS LYS B . n 
B 2 95  LEU 95  296 296 LEU LEU B . n 
B 2 96  HIS 96  297 297 HIS HIS B . n 
B 2 97  VAL 97  298 298 VAL VAL B . n 
B 2 98  ASP 98  299 299 ASP ASP B . n 
B 2 99  PRO 99  300 300 PRO PRO B . n 
B 2 100 GLU 100 301 301 GLU GLU B . n 
B 2 101 ASN 101 302 302 ASN ASN B . n 
B 2 102 PHE 102 303 303 PHE PHE B . n 
B 2 103 LYS 103 304 304 LYS LYS B . n 
B 2 104 LEU 104 305 305 LEU LEU B . n 
B 2 105 LEU 105 306 306 LEU LEU B . n 
B 2 106 GLY 106 307 307 GLY GLY B . n 
B 2 107 ASN 107 308 308 ASN ASN B . n 
B 2 108 VAL 108 309 309 VAL VAL B . n 
B 2 109 LEU 109 310 310 LEU LEU B . n 
B 2 110 VAL 110 311 311 VAL VAL B . n 
B 2 111 VAL 111 312 312 VAL VAL B . n 
B 2 112 VAL 112 313 313 VAL VAL B . n 
B 2 113 LEU 113 314 314 LEU LEU B . n 
B 2 114 ALA 114 315 315 ALA ALA B . n 
B 2 115 ARG 115 316 316 ARG ARG B . n 
B 2 116 ASN 116 317 317 ASN ASN B . n 
B 2 117 PHE 117 318 318 PHE PHE B . n 
B 2 118 GLY 118 319 319 GLY GLY B . n 
B 2 119 LYS 119 320 320 LYS LYS B . n 
B 2 120 GLU 120 321 321 GLU GLU B . n 
B 2 121 PHE 121 322 322 PHE PHE B . n 
B 2 122 THR 122 323 323 THR THR B . n 
B 2 123 PRO 123 324 324 PRO PRO B . n 
B 2 124 VAL 124 325 325 VAL VAL B . n 
B 2 125 LEU 125 326 326 LEU LEU B . n 
B 2 126 GLN 126 327 327 GLN GLN B . n 
B 2 127 ALA 127 328 328 ALA ALA B . n 
B 2 128 ASP 128 329 329 ASP ASP B . n 
B 2 129 PHE 129 330 330 PHE PHE B . n 
B 2 130 GLN 130 331 331 GLN GLN B . n 
B 2 131 LYS 131 332 332 LYS LYS B . n 
B 2 132 VAL 132 333 333 VAL VAL B . n 
B 2 133 VAL 133 334 334 VAL VAL B . n 
B 2 134 ALA 134 335 335 ALA ALA B . n 
B 2 135 GLY 135 336 336 GLY GLY B . n 
B 2 136 VAL 136 337 337 VAL VAL B . n 
B 2 137 ALA 137 338 338 ALA ALA B . n 
B 2 138 ASN 138 339 339 ASN ASN B . n 
B 2 139 ALA 139 340 340 ALA ALA B . n 
B 2 140 LEU 140 341 341 LEU LEU B . n 
B 2 141 ALA 141 342 342 ALA ALA B . n 
B 2 142 HIS 142 343 343 HIS HIS B . n 
B 2 143 ARG 143 344 344 ARG ARG B . n 
B 2 144 TYR 144 345 345 TYR TYR B . n 
B 2 145 HIS 145 346 346 HIS HIS B . n 
C 1 1   VAL 1   401 401 VAL VAL C . n 
C 1 2   LEU 2   402 402 LEU LEU C . n 
C 1 3   SER 3   403 403 SER SER C . n 
C 1 4   ALA 4   404 404 ALA ALA C . n 
C 1 5   ALA 5   405 405 ALA ALA C . n 
C 1 6   ASP 6   406 406 ASP ASP C . n 
C 1 7   LYS 7   407 407 LYS LYS C . n 
C 1 8   GLY 8   408 408 GLY GLY C . n 
C 1 9   ASN 9   409 409 ASN ASN C . n 
C 1 10  VAL 10  410 410 VAL VAL C . n 
C 1 11  LYS 11  411 411 LYS LYS C . n 
C 1 12  ALA 12  412 412 ALA ALA C . n 
C 1 13  ALA 13  413 413 ALA ALA C . n 
C 1 14  TRP 14  414 414 TRP TRP C . n 
C 1 15  GLY 15  415 415 GLY GLY C . n 
C 1 16  LYS 16  416 416 LYS LYS C . n 
C 1 17  VAL 17  417 417 VAL VAL C . n 
C 1 18  GLY 18  418 418 GLY GLY C . n 
C 1 19  GLY 19  419 419 GLY GLY C . n 
C 1 20  HIS 20  420 420 HIS HIS C . n 
C 1 21  ALA 21  421 421 ALA ALA C . n 
C 1 22  ALA 22  422 422 ALA ALA C . n 
C 1 23  GLU 23  423 423 GLU GLU C . n 
C 1 24  TYR 24  424 424 TYR TYR C . n 
C 1 25  GLY 25  425 425 GLY GLY C . n 
C 1 26  ALA 26  426 426 ALA ALA C . n 
C 1 27  GLU 27  427 427 GLU GLU C . n 
C 1 28  ALA 28  428 428 ALA ALA C . n 
C 1 29  LEU 29  429 429 LEU LEU C . n 
C 1 30  GLU 30  430 430 GLU GLU C . n 
C 1 31  ARG 31  431 431 ARG ARG C . n 
C 1 32  MET 32  432 432 MET MET C . n 
C 1 33  PHE 33  433 433 PHE PHE C . n 
C 1 34  LEU 34  434 434 LEU LEU C . n 
C 1 35  SER 35  435 435 SER SER C . n 
C 1 36  PHE 36  436 436 PHE PHE C . n 
C 1 37  PRO 37  437 437 PRO PRO C . n 
C 1 38  THR 38  438 438 THR THR C . n 
C 1 39  THR 39  439 439 THR THR C . n 
C 1 40  LYS 40  440 440 LYS LYS C . n 
C 1 41  THR 41  441 441 THR THR C . n 
C 1 42  TYR 42  442 442 TYR TYR C . n 
C 1 43  PHE 43  443 443 PHE PHE C . n 
C 1 44  PRO 44  444 444 PRO PRO C . n 
C 1 45  HIS 45  445 445 HIS HIS C . n 
C 1 46  PHE 46  446 446 PHE PHE C . n 
C 1 47  ASP 47  447 447 ASP ASP C . n 
C 1 48  LEU 48  448 448 LEU LEU C . n 
C 1 49  SER 49  449 449 SER SER C . n 
C 1 50  HIS 50  450 450 HIS HIS C . n 
C 1 51  GLY 51  451 451 GLY GLY C . n 
C 1 52  SER 52  452 452 SER SER C . n 
C 1 53  ALA 53  453 453 ALA ALA C . n 
C 1 54  GLN 54  454 454 GLN GLN C . n 
C 1 55  VAL 55  455 455 VAL VAL C . n 
C 1 56  LYS 56  456 456 LYS LYS C . n 
C 1 57  GLY 57  457 457 GLY GLY C . n 
C 1 58  HIS 58  458 458 HIS HIS C . n 
C 1 59  GLY 59  459 459 GLY GLY C . n 
C 1 60  ALA 60  460 460 ALA ALA C . n 
C 1 61  LYS 61  461 461 LYS LYS C . n 
C 1 62  VAL 62  462 462 VAL VAL C . n 
C 1 63  ALA 63  463 463 ALA ALA C . n 
C 1 64  ALA 64  464 464 ALA ALA C . n 
C 1 65  ALA 65  465 465 ALA ALA C . n 
C 1 66  LEU 66  466 466 LEU LEU C . n 
C 1 67  THR 67  467 467 THR THR C . n 
C 1 68  LYS 68  468 468 LYS LYS C . n 
C 1 69  ALA 69  469 469 ALA ALA C . n 
C 1 70  VAL 70  470 470 VAL VAL C . n 
C 1 71  GLU 71  471 471 GLU GLU C . n 
C 1 72  HIS 72  472 472 HIS HIS C . n 
C 1 73  LEU 73  473 473 LEU LEU C . n 
C 1 74  ASP 74  474 474 ASP ASP C . n 
C 1 75  ASP 75  475 475 ASP ASP C . n 
C 1 76  LEU 76  476 476 LEU LEU C . n 
C 1 77  PRO 77  477 477 PRO PRO C . n 
C 1 78  GLY 78  478 478 GLY GLY C . n 
C 1 79  ALA 79  479 479 ALA ALA C . n 
C 1 80  LEU 80  480 480 LEU LEU C . n 
C 1 81  SER 81  481 481 SER SER C . n 
C 1 82  GLU 82  482 482 GLU GLU C . n 
C 1 83  LEU 83  483 483 LEU LEU C . n 
C 1 84  SER 84  484 484 SER SER C . n 
C 1 85  ASP 85  485 485 ASP ASP C . n 
C 1 86  LEU 86  486 486 LEU LEU C . n 
C 1 87  HIS 87  487 487 HIS HIS C . n 
C 1 88  ALA 88  488 488 ALA ALA C . n 
C 1 89  HIS 89  489 489 HIS HIS C . n 
C 1 90  LYS 90  490 490 LYS LYS C . n 
C 1 91  LEU 91  491 491 LEU LEU C . n 
C 1 92  ARG 92  492 492 ARG ARG C . n 
C 1 93  VAL 93  493 493 VAL VAL C . n 
C 1 94  ASP 94  494 494 ASP ASP C . n 
C 1 95  PRO 95  495 495 PRO PRO C . n 
C 1 96  VAL 96  496 496 VAL VAL C . n 
C 1 97  ASN 97  497 497 ASN ASN C . n 
C 1 98  PHE 98  498 498 PHE PHE C . n 
C 1 99  LYS 99  499 499 LYS LYS C . n 
C 1 100 LEU 100 500 500 LEU LEU C . n 
C 1 101 LEU 101 501 501 LEU LEU C . n 
C 1 102 SER 102 502 502 SER SER C . n 
C 1 103 HIS 103 503 503 HIS HIS C . n 
C 1 104 SER 104 504 504 SER SER C . n 
C 1 105 LEU 105 505 505 LEU LEU C . n 
C 1 106 LEU 106 506 506 LEU LEU C . n 
C 1 107 VAL 107 507 507 VAL VAL C . n 
C 1 108 THR 108 508 508 THR THR C . n 
C 1 109 LEU 109 509 509 LEU LEU C . n 
C 1 110 ALA 110 510 510 ALA ALA C . n 
C 1 111 SER 111 511 511 SER SER C . n 
C 1 112 HIS 112 512 512 HIS HIS C . n 
C 1 113 LEU 113 513 513 LEU LEU C . n 
C 1 114 PRO 114 514 514 PRO PRO C . n 
C 1 115 SER 115 515 515 SER SER C . n 
C 1 116 ASP 116 516 516 ASP ASP C . n 
C 1 117 PHE 117 517 517 PHE PHE C . n 
C 1 118 THR 118 518 518 THR THR C . n 
C 1 119 PRO 119 519 519 PRO PRO C . n 
C 1 120 ALA 120 520 520 ALA ALA C . n 
C 1 121 VAL 121 521 521 VAL VAL C . n 
C 1 122 HIS 122 522 522 HIS HIS C . n 
C 1 123 ALA 123 523 523 ALA ALA C . n 
C 1 124 SER 124 524 524 SER SER C . n 
C 1 125 LEU 125 525 525 LEU LEU C . n 
C 1 126 ASP 126 526 526 ASP ASP C . n 
C 1 127 LYS 127 527 527 LYS LYS C . n 
C 1 128 PHE 128 528 528 PHE PHE C . n 
C 1 129 LEU 129 529 529 LEU LEU C . n 
C 1 130 ALA 130 530 530 ALA ALA C . n 
C 1 131 ASN 131 531 531 ASN ASN C . n 
C 1 132 VAL 132 532 532 VAL VAL C . n 
C 1 133 SER 133 533 533 SER SER C . n 
C 1 134 THR 134 534 534 THR THR C . n 
C 1 135 VAL 135 535 535 VAL VAL C . n 
C 1 136 LEU 136 536 536 LEU LEU C . n 
C 1 137 THR 137 537 537 THR THR C . n 
C 1 138 SER 138 538 538 SER SER C . n 
C 1 139 LYS 139 539 539 LYS LYS C . n 
C 1 140 TYR 140 540 540 TYR TYR C . n 
C 1 141 ARG 141 541 541 ARG ARG C . n 
D 2 1   MET 1   602 602 MET MET D . n 
D 2 2   LEU 2   603 603 LEU LEU D . n 
D 2 3   THR 3   604 604 THR THR D . n 
D 2 4   ALA 4   605 605 ALA ALA D . n 
D 2 5   GLU 5   606 606 GLU GLU D . n 
D 2 6   GLU 6   607 607 GLU GLU D . n 
D 2 7   LYS 7   608 608 LYS LYS D . n 
D 2 8   ALA 8   609 609 ALA ALA D . n 
D 2 9   ALA 9   610 610 ALA ALA D . n 
D 2 10  VAL 10  611 611 VAL VAL D . n 
D 2 11  THR 11  612 612 THR THR D . n 
D 2 12  ALA 12  613 613 ALA ALA D . n 
D 2 13  PHE 13  614 614 PHE PHE D . n 
D 2 14  TRP 14  615 615 TRP TRP D . n 
D 2 15  GLY 15  616 616 GLY GLY D . n 
D 2 16  LYS 16  617 617 LYS LYS D . n 
D 2 17  VAL 17  618 618 VAL VAL D . n 
D 2 18  LYS 18  619 619 LYS LYS D . n 
D 2 19  VAL 19  620 620 VAL VAL D . n 
D 2 20  ASP 20  621 621 ASP ASP D . n 
D 2 21  GLU 21  622 622 GLU GLU D . n 
D 2 22  VAL 22  623 623 VAL VAL D . n 
D 2 23  GLY 23  624 624 GLY GLY D . n 
D 2 24  GLY 24  625 625 GLY GLY D . n 
D 2 25  GLU 25  626 626 GLU GLU D . n 
D 2 26  ALA 26  627 627 ALA ALA D . n 
D 2 27  LEU 27  628 628 LEU LEU D . n 
D 2 28  GLY 28  629 629 GLY GLY D . n 
D 2 29  ARG 29  630 630 ARG ARG D . n 
D 2 30  LEU 30  631 631 LEU LEU D . n 
D 2 31  LEU 31  632 632 LEU LEU D . n 
D 2 32  VAL 32  633 633 VAL VAL D . n 
D 2 33  VAL 33  634 634 VAL VAL D . n 
D 2 34  TYR 34  635 635 TYR TYR D . n 
D 2 35  PRO 35  636 636 PRO PRO D . n 
D 2 36  TRP 36  637 637 TRP TRP D . n 
D 2 37  THR 37  638 638 THR THR D . n 
D 2 38  GLN 38  639 639 GLN GLN D . n 
D 2 39  ARG 39  640 640 ARG ARG D . n 
D 2 40  PHE 40  641 641 PHE PHE D . n 
D 2 41  PHE 41  642 642 PHE PHE D . n 
D 2 42  GLU 42  643 643 GLU GLU D . n 
D 2 43  SER 43  644 644 SER SER D . n 
D 2 44  PHE 44  645 645 PHE PHE D . n 
D 2 45  GLY 45  646 646 GLY GLY D . n 
D 2 46  ASP 46  647 647 ASP ASP D . n 
D 2 47  LEU 47  648 648 LEU LEU D . n 
D 2 48  SER 48  649 649 SER SER D . n 
D 2 49  THR 49  650 650 THR THR D . n 
D 2 50  ALA 50  651 651 ALA ALA D . n 
D 2 51  ASP 51  652 652 ASP ASP D . n 
D 2 52  ALA 52  653 653 ALA ALA D . n 
D 2 53  VAL 53  654 654 VAL VAL D . n 
D 2 54  MET 54  655 655 MET MET D . n 
D 2 55  ASN 55  656 656 ASN ASN D . n 
D 2 56  ASN 56  657 657 ASN ASN D . n 
D 2 57  PRO 57  658 658 PRO PRO D . n 
D 2 58  LYS 58  659 659 LYS LYS D . n 
D 2 59  VAL 59  660 660 VAL VAL D . n 
D 2 60  LYS 60  661 661 LYS LYS D . n 
D 2 61  ALA 61  662 662 ALA ALA D . n 
D 2 62  HIS 62  663 663 HIS HIS D . n 
D 2 63  GLY 63  664 664 GLY GLY D . n 
D 2 64  LYS 64  665 665 LYS LYS D . n 
D 2 65  LYS 65  666 666 LYS LYS D . n 
D 2 66  VAL 66  667 667 VAL VAL D . n 
D 2 67  LEU 67  668 668 LEU LEU D . n 
D 2 68  ASP 68  669 669 ASP ASP D . n 
D 2 69  SER 69  670 670 SER SER D . n 
D 2 70  PHE 70  671 671 PHE PHE D . n 
D 2 71  SER 71  672 672 SER SER D . n 
D 2 72  ASN 72  673 673 ASN ASN D . n 
D 2 73  GLY 73  674 674 GLY GLY D . n 
D 2 74  MET 74  675 675 MET MET D . n 
D 2 75  LYS 75  676 676 LYS LYS D . n 
D 2 76  HIS 76  677 677 HIS HIS D . n 
D 2 77  LEU 77  678 678 LEU LEU D . n 
D 2 78  ASP 78  679 679 ASP ASP D . n 
D 2 79  ASP 79  680 680 ASP ASP D . n 
D 2 80  LEU 80  681 681 LEU LEU D . n 
D 2 81  LYS 81  682 682 LYS LYS D . n 
D 2 82  GLY 82  683 683 GLY GLY D . n 
D 2 83  THR 83  684 684 THR THR D . n 
D 2 84  PHE 84  685 685 PHE PHE D . n 
D 2 85  ALA 85  686 686 ALA ALA D . n 
D 2 86  ALA 86  687 687 ALA ALA D . n 
D 2 87  LEU 87  688 688 LEU LEU D . n 
D 2 88  SER 88  689 689 SER SER D . n 
D 2 89  GLU 89  690 690 GLU GLU D . n 
D 2 90  LEU 90  691 691 LEU LEU D . n 
D 2 91  HIS 91  692 692 HIS HIS D . n 
D 2 92  CYS 92  693 693 CYS CYS D . n 
D 2 93  ASP 93  694 694 ASP ASP D . n 
D 2 94  LYS 94  695 695 LYS LYS D . n 
D 2 95  LEU 95  696 696 LEU LEU D . n 
D 2 96  HIS 96  697 697 HIS HIS D . n 
D 2 97  VAL 97  698 698 VAL VAL D . n 
D 2 98  ASP 98  699 699 ASP ASP D . n 
D 2 99  PRO 99  700 700 PRO PRO D . n 
D 2 100 GLU 100 701 701 GLU GLU D . n 
D 2 101 ASN 101 702 702 ASN ASN D . n 
D 2 102 PHE 102 703 703 PHE PHE D . n 
D 2 103 LYS 103 704 704 LYS LYS D . n 
D 2 104 LEU 104 705 705 LEU LEU D . n 
D 2 105 LEU 105 706 706 LEU LEU D . n 
D 2 106 GLY 106 707 707 GLY GLY D . n 
D 2 107 ASN 107 708 708 ASN ASN D . n 
D 2 108 VAL 108 709 709 VAL VAL D . n 
D 2 109 LEU 109 710 710 LEU LEU D . n 
D 2 110 VAL 110 711 711 VAL VAL D . n 
D 2 111 VAL 111 712 712 VAL VAL D . n 
D 2 112 VAL 112 713 713 VAL VAL D . n 
D 2 113 LEU 113 714 714 LEU LEU D . n 
D 2 114 ALA 114 715 715 ALA ALA D . n 
D 2 115 ARG 115 716 716 ARG ARG D . n 
D 2 116 ASN 116 717 717 ASN ASN D . n 
D 2 117 PHE 117 718 718 PHE PHE D . n 
D 2 118 GLY 118 719 719 GLY GLY D . n 
D 2 119 LYS 119 720 720 LYS LYS D . n 
D 2 120 GLU 120 721 721 GLU GLU D . n 
D 2 121 PHE 121 722 722 PHE PHE D . n 
D 2 122 THR 122 723 723 THR THR D . n 
D 2 123 PRO 123 724 724 PRO PRO D . n 
D 2 124 VAL 124 725 725 VAL VAL D . n 
D 2 125 LEU 125 726 726 LEU LEU D . n 
D 2 126 GLN 126 727 727 GLN GLN D . n 
D 2 127 ALA 127 728 728 ALA ALA D . n 
D 2 128 ASP 128 729 729 ASP ASP D . n 
D 2 129 PHE 129 730 730 PHE PHE D . n 
D 2 130 GLN 130 731 731 GLN GLN D . n 
D 2 131 LYS 131 732 732 LYS LYS D . n 
D 2 132 VAL 132 733 733 VAL VAL D . n 
D 2 133 VAL 133 734 734 VAL VAL D . n 
D 2 134 ALA 134 735 735 ALA ALA D . n 
D 2 135 GLY 135 736 736 GLY GLY D . n 
D 2 136 VAL 136 737 737 VAL VAL D . n 
D 2 137 ALA 137 738 738 ALA ALA D . n 
D 2 138 ASN 138 739 739 ASN ASN D . n 
D 2 139 ALA 139 740 740 ALA ALA D . n 
D 2 140 LEU 140 741 741 LEU LEU D . n 
D 2 141 ALA 141 742 742 ALA ALA D . n 
D 2 142 HIS 142 743 743 HIS HIS D . n 
D 2 143 ARG 143 744 744 ARG ARG D . n 
D 2 144 TYR 144 745 745 TYR TYR D . n 
D 2 145 HIS 145 746 746 HIS HIS D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 CMO 1  142 142 CMO CO  A . 
F 4 HEM 1  143 143 HEM HEM A . 
G 3 CMO 1  347 347 CMO CO  B . 
H 4 HEM 1  348 348 HEM HEM B . 
I 3 CMO 1  542 542 CMO CO  C . 
J 4 HEM 1  543 543 HEM HEM C . 
K 3 CMO 1  747 747 CMO CO  D . 
L 4 HEM 1  748 748 HEM HEM D . 
M 5 HOH 1  804 804 HOH H2O A . 
M 5 HOH 2  805 805 HOH H2O A . 
M 5 HOH 3  810 810 HOH H2O A . 
M 5 HOH 4  811 811 HOH H2O A . 
M 5 HOH 5  812 812 HOH H2O A . 
M 5 HOH 6  815 815 HOH H2O A . 
M 5 HOH 7  816 816 HOH H2O A . 
M 5 HOH 8  817 817 HOH H2O A . 
M 5 HOH 9  819 819 HOH H2O A . 
M 5 HOH 10 823 823 HOH H2O A . 
M 5 HOH 11 824 824 HOH H2O A . 
M 5 HOH 12 830 830 HOH H2O A . 
M 5 HOH 13 832 832 HOH H2O A . 
M 5 HOH 14 838 838 HOH H2O A . 
M 5 HOH 15 839 839 HOH H2O A . 
M 5 HOH 16 841 841 HOH H2O A . 
M 5 HOH 17 843 843 HOH H2O A . 
M 5 HOH 18 845 845 HOH H2O A . 
M 5 HOH 19 848 848 HOH H2O A . 
M 5 HOH 20 851 851 HOH H2O A . 
M 5 HOH 21 852 852 HOH H2O A . 
M 5 HOH 22 854 854 HOH H2O A . 
M 5 HOH 23 855 855 HOH H2O A . 
M 5 HOH 24 859 859 HOH H2O A . 
M 5 HOH 25 860 860 HOH H2O A . 
M 5 HOH 26 863 863 HOH H2O A . 
M 5 HOH 27 876 876 HOH H2O A . 
M 5 HOH 28 883 883 HOH H2O A . 
M 5 HOH 29 890 890 HOH H2O A . 
M 5 HOH 30 891 891 HOH H2O A . 
M 5 HOH 31 895 895 HOH H2O A . 
M 5 HOH 32 906 906 HOH H2O A . 
M 5 HOH 33 908 908 HOH H2O A . 
M 5 HOH 34 912 912 HOH H2O A . 
M 5 HOH 35 915 915 HOH H2O A . 
M 5 HOH 36 922 922 HOH H2O A . 
M 5 HOH 37 923 923 HOH H2O A . 
M 5 HOH 38 924 924 HOH H2O A . 
M 5 HOH 39 925 925 HOH H2O A . 
M 5 HOH 40 926 926 HOH H2O A . 
M 5 HOH 41 927 927 HOH H2O A . 
M 5 HOH 42 928 928 HOH H2O A . 
M 5 HOH 43 929 929 HOH H2O A . 
N 5 HOH 1  808 808 HOH H2O B . 
N 5 HOH 2  822 822 HOH H2O B . 
N 5 HOH 3  828 828 HOH H2O B . 
N 5 HOH 4  834 834 HOH H2O B . 
N 5 HOH 5  840 840 HOH H2O B . 
N 5 HOH 6  842 842 HOH H2O B . 
N 5 HOH 7  858 858 HOH H2O B . 
N 5 HOH 8  862 862 HOH H2O B . 
N 5 HOH 9  864 864 HOH H2O B . 
N 5 HOH 10 865 865 HOH H2O B . 
N 5 HOH 11 867 867 HOH H2O B . 
N 5 HOH 12 881 881 HOH H2O B . 
N 5 HOH 13 884 884 HOH H2O B . 
N 5 HOH 14 886 886 HOH H2O B . 
N 5 HOH 15 888 888 HOH H2O B . 
N 5 HOH 16 896 896 HOH H2O B . 
N 5 HOH 17 897 897 HOH H2O B . 
N 5 HOH 18 901 901 HOH H2O B . 
N 5 HOH 19 902 902 HOH H2O B . 
N 5 HOH 20 905 905 HOH H2O B . 
N 5 HOH 21 907 907 HOH H2O B . 
N 5 HOH 22 911 911 HOH H2O B . 
N 5 HOH 23 914 914 HOH H2O B . 
N 5 HOH 24 921 921 HOH H2O B . 
N 5 HOH 25 930 930 HOH H2O B . 
N 5 HOH 26 933 933 HOH H2O B . 
O 5 HOH 1  802 802 HOH H2O C . 
O 5 HOH 2  807 807 HOH H2O C . 
O 5 HOH 3  809 809 HOH H2O C . 
O 5 HOH 4  813 813 HOH H2O C . 
O 5 HOH 5  820 820 HOH H2O C . 
O 5 HOH 6  821 821 HOH H2O C . 
O 5 HOH 7  825 825 HOH H2O C . 
O 5 HOH 8  826 826 HOH H2O C . 
O 5 HOH 9  827 827 HOH H2O C . 
O 5 HOH 10 831 831 HOH H2O C . 
O 5 HOH 11 835 835 HOH H2O C . 
O 5 HOH 12 836 836 HOH H2O C . 
O 5 HOH 13 837 837 HOH H2O C . 
O 5 HOH 14 847 847 HOH H2O C . 
O 5 HOH 15 850 850 HOH H2O C . 
O 5 HOH 16 853 853 HOH H2O C . 
O 5 HOH 17 856 856 HOH H2O C . 
O 5 HOH 18 861 861 HOH H2O C . 
O 5 HOH 19 868 868 HOH H2O C . 
O 5 HOH 20 869 869 HOH H2O C . 
O 5 HOH 21 872 872 HOH H2O C . 
O 5 HOH 22 873 873 HOH H2O C . 
O 5 HOH 23 874 874 HOH H2O C . 
O 5 HOH 24 875 875 HOH H2O C . 
O 5 HOH 25 877 877 HOH H2O C . 
O 5 HOH 26 880 880 HOH H2O C . 
O 5 HOH 27 882 882 HOH H2O C . 
O 5 HOH 28 887 887 HOH H2O C . 
O 5 HOH 29 892 892 HOH H2O C . 
O 5 HOH 30 898 898 HOH H2O C . 
O 5 HOH 31 903 903 HOH H2O C . 
O 5 HOH 32 917 917 HOH H2O C . 
O 5 HOH 33 918 918 HOH H2O C . 
O 5 HOH 34 920 920 HOH H2O C . 
O 5 HOH 35 931 931 HOH H2O C . 
O 5 HOH 36 932 932 HOH H2O C . 
O 5 HOH 37 934 934 HOH H2O C . 
O 5 HOH 38 935 935 HOH H2O C . 
P 5 HOH 1  801 801 HOH H2O D . 
P 5 HOH 2  803 803 HOH H2O D . 
P 5 HOH 3  806 806 HOH H2O D . 
P 5 HOH 4  814 814 HOH H2O D . 
P 5 HOH 5  818 818 HOH H2O D . 
P 5 HOH 6  829 829 HOH H2O D . 
P 5 HOH 7  833 833 HOH H2O D . 
P 5 HOH 8  844 844 HOH H2O D . 
P 5 HOH 9  846 846 HOH H2O D . 
P 5 HOH 10 849 849 HOH H2O D . 
P 5 HOH 11 857 857 HOH H2O D . 
P 5 HOH 12 866 866 HOH H2O D . 
P 5 HOH 13 870 870 HOH H2O D . 
P 5 HOH 14 871 871 HOH H2O D . 
P 5 HOH 15 878 878 HOH H2O D . 
P 5 HOH 16 879 879 HOH H2O D . 
P 5 HOH 17 885 885 HOH H2O D . 
P 5 HOH 18 889 889 HOH H2O D . 
P 5 HOH 19 893 893 HOH H2O D . 
P 5 HOH 20 894 894 HOH H2O D . 
P 5 HOH 21 899 899 HOH H2O D . 
P 5 HOH 22 900 900 HOH H2O D . 
P 5 HOH 23 904 904 HOH H2O D . 
P 5 HOH 24 909 909 HOH H2O D . 
P 5 HOH 25 910 910 HOH H2O D . 
P 5 HOH 26 913 913 HOH H2O D . 
P 5 HOH 27 916 916 HOH H2O D . 
P 5 HOH 28 919 919 HOH H2O D . 
P 5 HOH 29 936 936 HOH H2O D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 11780 ? 
1 MORE         -113  ? 
1 'SSA (A^2)'  23290 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 87 ? A HIS 87  ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 NA  ? F HEM .  ? A HEM 143 ? 1_555 91.3  ? 
2  NE2 ? A HIS 87 ? A HIS 87  ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 NB  ? F HEM .  ? A HEM 143 ? 1_555 89.5  ? 
3  NA  ? F HEM .  ? A HEM 143 ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 NB  ? F HEM .  ? A HEM 143 ? 1_555 88.6  ? 
4  NE2 ? A HIS 87 ? A HIS 87  ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 NC  ? F HEM .  ? A HEM 143 ? 1_555 92.2  ? 
5  NA  ? F HEM .  ? A HEM 143 ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 NC  ? F HEM .  ? A HEM 143 ? 1_555 176.5 ? 
6  NB  ? F HEM .  ? A HEM 143 ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 NC  ? F HEM .  ? A HEM 143 ? 1_555 91.0  ? 
7  NE2 ? A HIS 87 ? A HIS 87  ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 ND  ? F HEM .  ? A HEM 143 ? 1_555 88.7  ? 
8  NA  ? F HEM .  ? A HEM 143 ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 ND  ? F HEM .  ? A HEM 143 ? 1_555 90.7  ? 
9  NB  ? F HEM .  ? A HEM 143 ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 ND  ? F HEM .  ? A HEM 143 ? 1_555 178.0 ? 
10 NC  ? F HEM .  ? A HEM 143 ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 ND  ? F HEM .  ? A HEM 143 ? 1_555 89.8  ? 
11 NE2 ? A HIS 87 ? A HIS 87  ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 C   ? E CMO .  ? A CMO 142 ? 1_555 175.9 ? 
12 NA  ? F HEM .  ? A HEM 143 ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 C   ? E CMO .  ? A CMO 142 ? 1_555 92.6  ? 
13 NB  ? F HEM .  ? A HEM 143 ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 C   ? E CMO .  ? A CMO 142 ? 1_555 89.5  ? 
14 NC  ? F HEM .  ? A HEM 143 ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 C   ? E CMO .  ? A CMO 142 ? 1_555 83.9  ? 
15 ND  ? F HEM .  ? A HEM 143 ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 C   ? E CMO .  ? A CMO 142 ? 1_555 92.4  ? 
16 NE2 ? A HIS 87 ? A HIS 87  ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 O   ? E CMO .  ? A CMO 142 ? 1_555 173.1 ? 
17 NA  ? F HEM .  ? A HEM 143 ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 O   ? E CMO .  ? A CMO 142 ? 1_555 95.0  ? 
18 NB  ? F HEM .  ? A HEM 143 ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 O   ? E CMO .  ? A CMO 142 ? 1_555 87.7  ? 
19 NC  ? F HEM .  ? A HEM 143 ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 O   ? E CMO .  ? A CMO 142 ? 1_555 81.5  ? 
20 ND  ? F HEM .  ? A HEM 143 ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 O   ? E CMO .  ? A CMO 142 ? 1_555 94.2  ? 
21 C   ? E CMO .  ? A CMO 142 ? 1_555 FE ? F HEM . ? A HEM 143 ? 1_555 O   ? E CMO .  ? A CMO 142 ? 1_555 3.0   ? 
22 C   ? G CMO .  ? B CMO 347 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 NA  ? H HEM .  ? B HEM 348 ? 1_555 95.4  ? 
23 C   ? G CMO .  ? B CMO 347 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 NB  ? H HEM .  ? B HEM 348 ? 1_555 86.4  ? 
24 NA  ? H HEM .  ? B HEM 348 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 NB  ? H HEM .  ? B HEM 348 ? 1_555 87.3  ? 
25 C   ? G CMO .  ? B CMO 347 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 NC  ? H HEM .  ? B HEM 348 ? 1_555 82.2  ? 
26 NA  ? H HEM .  ? B HEM 348 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 NC  ? H HEM .  ? B HEM 348 ? 1_555 176.2 ? 
27 NB  ? H HEM .  ? B HEM 348 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 NC  ? H HEM .  ? B HEM 348 ? 1_555 89.6  ? 
28 C   ? G CMO .  ? B CMO 347 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 ND  ? H HEM .  ? B HEM 348 ? 1_555 89.7  ? 
29 NA  ? H HEM .  ? B HEM 348 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 ND  ? H HEM .  ? B HEM 348 ? 1_555 90.1  ? 
30 NB  ? H HEM .  ? B HEM 348 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 ND  ? H HEM .  ? B HEM 348 ? 1_555 175.2 ? 
31 NC  ? H HEM .  ? B HEM 348 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 ND  ? H HEM .  ? B HEM 348 ? 1_555 92.8  ? 
32 C   ? G CMO .  ? B CMO 347 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 NE2 ? B HIS 91 ? B HIS 292 ? 1_555 173.6 ? 
33 NA  ? H HEM .  ? B HEM 348 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 NE2 ? B HIS 91 ? B HIS 292 ? 1_555 89.8  ? 
34 NB  ? H HEM .  ? B HEM 348 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 NE2 ? B HIS 91 ? B HIS 292 ? 1_555 90.0  ? 
35 NC  ? H HEM .  ? B HEM 348 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 NE2 ? B HIS 91 ? B HIS 292 ? 1_555 92.4  ? 
36 ND  ? H HEM .  ? B HEM 348 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 NE2 ? B HIS 91 ? B HIS 292 ? 1_555 94.1  ? 
37 C   ? G CMO .  ? B CMO 347 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 O   ? G CMO .  ? B CMO 347 ? 1_555 3.3   ? 
38 NA  ? H HEM .  ? B HEM 348 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 O   ? G CMO .  ? B CMO 347 ? 1_555 97.3  ? 
39 NB  ? H HEM .  ? B HEM 348 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 O   ? G CMO .  ? B CMO 347 ? 1_555 83.9  ? 
40 NC  ? H HEM .  ? B HEM 348 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 O   ? G CMO .  ? B CMO 347 ? 1_555 80.2  ? 
41 ND  ? H HEM .  ? B HEM 348 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 O   ? G CMO .  ? B CMO 347 ? 1_555 92.4  ? 
42 NE2 ? B HIS 91 ? B HIS 292 ? 1_555 FE ? H HEM . ? B HEM 348 ? 1_555 O   ? G CMO .  ? B CMO 347 ? 1_555 170.4 ? 
43 C   ? I CMO .  ? C CMO 542 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 NA  ? J HEM .  ? C HEM 543 ? 1_555 91.8  ? 
44 C   ? I CMO .  ? C CMO 542 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 NB  ? J HEM .  ? C HEM 543 ? 1_555 89.1  ? 
45 NA  ? J HEM .  ? C HEM 543 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 NB  ? J HEM .  ? C HEM 543 ? 1_555 86.2  ? 
46 C   ? I CMO .  ? C CMO 542 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 NC  ? J HEM .  ? C HEM 543 ? 1_555 83.8  ? 
47 NA  ? J HEM .  ? C HEM 543 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 NC  ? J HEM .  ? C HEM 543 ? 1_555 174.1 ? 
48 NB  ? J HEM .  ? C HEM 543 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 NC  ? J HEM .  ? C HEM 543 ? 1_555 89.8  ? 
49 C   ? I CMO .  ? C CMO 542 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 ND  ? J HEM .  ? C HEM 543 ? 1_555 91.9  ? 
50 NA  ? J HEM .  ? C HEM 543 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 ND  ? J HEM .  ? C HEM 543 ? 1_555 96.9  ? 
51 NB  ? J HEM .  ? C HEM 543 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 ND  ? J HEM .  ? C HEM 543 ? 1_555 176.6 ? 
52 NC  ? J HEM .  ? C HEM 543 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 ND  ? J HEM .  ? C HEM 543 ? 1_555 87.2  ? 
53 C   ? I CMO .  ? C CMO 542 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 NE2 ? C HIS 87 ? C HIS 487 ? 1_555 176.4 ? 
54 NA  ? J HEM .  ? C HEM 543 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 NE2 ? C HIS 87 ? C HIS 487 ? 1_555 88.2  ? 
55 NB  ? J HEM .  ? C HEM 543 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 NE2 ? C HIS 87 ? C HIS 487 ? 1_555 87.2  ? 
56 NC  ? J HEM .  ? C HEM 543 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 NE2 ? C HIS 87 ? C HIS 487 ? 1_555 96.0  ? 
57 ND  ? J HEM .  ? C HEM 543 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 NE2 ? C HIS 87 ? C HIS 487 ? 1_555 91.7  ? 
58 C   ? I CMO .  ? C CMO 542 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 O   ? I CMO .  ? C CMO 542 ? 1_555 0.8   ? 
59 NA  ? J HEM .  ? C HEM 543 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 O   ? I CMO .  ? C CMO 542 ? 1_555 92.4  ? 
60 NB  ? J HEM .  ? C HEM 543 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 O   ? I CMO .  ? C CMO 542 ? 1_555 89.6  ? 
61 NC  ? J HEM .  ? C HEM 543 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 O   ? I CMO .  ? C CMO 542 ? 1_555 83.2  ? 
62 ND  ? J HEM .  ? C HEM 543 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 O   ? I CMO .  ? C CMO 542 ? 1_555 91.4  ? 
63 NE2 ? C HIS 87 ? C HIS 487 ? 1_555 FE ? J HEM . ? C HEM 543 ? 1_555 O   ? I CMO .  ? C CMO 542 ? 1_555 176.7 ? 
64 C   ? K CMO .  ? D CMO 747 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 NA  ? L HEM .  ? D HEM 748 ? 1_555 90.9  ? 
65 C   ? K CMO .  ? D CMO 747 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 NB  ? L HEM .  ? D HEM 748 ? 1_555 85.2  ? 
66 NA  ? L HEM .  ? D HEM 748 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 NB  ? L HEM .  ? D HEM 748 ? 1_555 88.6  ? 
67 C   ? K CMO .  ? D CMO 747 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 NC  ? L HEM .  ? D HEM 748 ? 1_555 86.7  ? 
68 NA  ? L HEM .  ? D HEM 748 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 NC  ? L HEM .  ? D HEM 748 ? 1_555 177.1 ? 
69 NB  ? L HEM .  ? D HEM 748 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 NC  ? L HEM .  ? D HEM 748 ? 1_555 89.6  ? 
70 C   ? K CMO .  ? D CMO 747 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 ND  ? L HEM .  ? D HEM 748 ? 1_555 89.8  ? 
71 NA  ? L HEM .  ? D HEM 748 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 ND  ? L HEM .  ? D HEM 748 ? 1_555 89.0  ? 
72 NB  ? L HEM .  ? D HEM 748 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 ND  ? L HEM .  ? D HEM 748 ? 1_555 174.4 ? 
73 NC  ? L HEM .  ? D HEM 748 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 ND  ? L HEM .  ? D HEM 748 ? 1_555 92.5  ? 
74 C   ? K CMO .  ? D CMO 747 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 O   ? K CMO .  ? D CMO 747 ? 1_555 5.1   ? 
75 NA  ? L HEM .  ? D HEM 748 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 O   ? K CMO .  ? D CMO 747 ? 1_555 95.0  ? 
76 NB  ? L HEM .  ? D HEM 748 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 O   ? K CMO .  ? D CMO 747 ? 1_555 88.3  ? 
77 NC  ? L HEM .  ? D HEM 748 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 O   ? K CMO .  ? D CMO 747 ? 1_555 82.6  ? 
78 ND  ? L HEM .  ? D HEM 748 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 O   ? K CMO .  ? D CMO 747 ? 1_555 86.9  ? 
79 C   ? K CMO .  ? D CMO 747 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 NE2 ? D HIS 91 ? D HIS 692 ? 1_555 177.5 ? 
80 NA  ? L HEM .  ? D HEM 748 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 NE2 ? D HIS 91 ? D HIS 692 ? 1_555 86.9  ? 
81 NB  ? L HEM .  ? D HEM 748 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 NE2 ? D HIS 91 ? D HIS 692 ? 1_555 93.5  ? 
82 NC  ? L HEM .  ? D HEM 748 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 NE2 ? D HIS 91 ? D HIS 692 ? 1_555 95.5  ? 
83 ND  ? L HEM .  ? D HEM 748 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 NE2 ? D HIS 91 ? D HIS 692 ? 1_555 91.4  ? 
84 O   ? K CMO .  ? D CMO 747 ? 1_555 FE ? L HEM . ? D HEM 748 ? 1_555 NE2 ? D HIS 91 ? D HIS 692 ? 1_555 177.4 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-06-06 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE    phasing        .           ? 1 
X-PLOR   refinement     3.843       ? 2 
CCP4     'data scaling' '(AGROVATA' ? 3 
ROTAVATA 'data scaling' .           ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   C 
_pdbx_validate_close_contact.auth_comp_id_1   THR 
_pdbx_validate_close_contact.auth_seq_id_1    537 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   C 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    541 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.97 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             N 
_pdbx_validate_rmsd_angle.auth_asym_id_1             C 
_pdbx_validate_rmsd_angle.auth_comp_id_1             TYR 
_pdbx_validate_rmsd_angle.auth_seq_id_1              540 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_2             C 
_pdbx_validate_rmsd_angle.auth_comp_id_2             TYR 
_pdbx_validate_rmsd_angle.auth_seq_id_2              540 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             C 
_pdbx_validate_rmsd_angle.auth_asym_id_3             C 
_pdbx_validate_rmsd_angle.auth_comp_id_3             TYR 
_pdbx_validate_rmsd_angle.auth_seq_id_3              540 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                127.21 
_pdbx_validate_rmsd_angle.angle_target_value         111.00 
_pdbx_validate_rmsd_angle.angle_deviation            16.21 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.70 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU B 278 ? ? -54.32  0.77   
2 1 ASP B 279 ? ? -107.90 -63.96 
3 1 ASP C 475 ? ? -161.25 66.53  
4 1 LYS C 539 ? ? -60.87  0.23   
5 1 TYR C 540 ? ? -144.88 -35.32 
6 1 LEU D 603 ? ? 59.46   154.26 
7 1 LEU D 678 ? ? -58.06  -1.16  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    C 
_pdbx_validate_planes.auth_seq_id     541 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.177 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'CARBON MONOXIDE'                 CMO 
4 'PROTOPORPHYRIN IX CONTAINING FE' HEM 
5 water                             HOH 
#