data_1FTA
# 
_entry.id   1FTA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1FTA         
WWPDB D_1000173412 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1FTA 
_pdbx_database_status.recvd_initial_deposition_date   1993-09-27 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Y.'      1 
'Liang, J.-Y.'   2 
'Huang, S.'      3 
'Lipscomb, W.N.' 4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'The allosteric site of human liver fructose-1,6-bisphosphatase. Analysis of six AMP site mutants based on the crystal structure.' 
J.Biol.Chem.           269 27732 27738 1994 JBCHA3 US 0021-9258 0071 ? 7961695 ? 
1       'Isolation of a Human Liver Fructose-1, 6-Bisphosphatase Cdna and Expression of the Protein in Escherichia Coli' 
J.Biol.Chem.           268 9466  ?     1993 JBCHA3 US 0021-9258 0071 ? ?       ? 
2       'Crystal Structure of Fructose-1,6-Bisphosphatase Complexed with Fructose 6-Phosphate, AMP, and Magnesium' 
Proc.Natl.Acad.Sci.USA 87  5243  ?     1990 PNASA6 US 0027-8424 0040 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gidh-Jain, M.'          1  
primary 'Zhang, Y.'              2  
primary 'van Poelje, P.D.'       3  
primary 'Liang, J.Y.'            4  
primary 'Huang, S.'              5  
primary 'Kim, J.'                6  
primary 'Elliott, J.T.'          7  
primary 'Erion, M.D.'            8  
primary 'Pilkis, S.J.'           9  
primary 'Raafat el-Maghrabi, M.' 10 
1       'El-Maghrabi, M.R.'      11 
1       'Gidh-Jain, M.'          12 
1       'Austin, L.R.'           13 
1       'Pilkis, S.J.'           14 
2       'Ke, H.'                 15 
2       'Zhang, Y.'              16 
2       'Lipscomb, W.N.'         17 
# 
_cell.entry_id           1FTA 
_cell.length_a           68.600 
_cell.length_b           84.800 
_cell.length_c           281.100 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1FTA 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man FRUCTOSE-1,6-BISPHOSPHATASE 36741.309 4   3.1.3.11 ? ? ? 
2 non-polymer syn 'ADENOSINE MONOPHOSPHATE'   347.221   4   ?        ? ? ? 
3 water       nat water                       18.015    347 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'D-FRUCTOSE-1,6-BISPHOSPHATE, 1-PHOSPHOHYDROLASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ADQAPFDTDVVTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDL
VMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLV
AAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEAYAKDFDPAVTEYIQRKKFPPDNSAPY
GARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPIILGS
PDDVLEFLKVYEKHSAQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ADQAPFDTDVVTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDL
VMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLV
AAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEAYAKDFDPAVTEYIQRKKFPPDNSAPY
GARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPIILGS
PDDVLEFLKVYEKHSAQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ASP n 
1 3   GLN n 
1 4   ALA n 
1 5   PRO n 
1 6   PHE n 
1 7   ASP n 
1 8   THR n 
1 9   ASP n 
1 10  VAL n 
1 11  VAL n 
1 12  THR n 
1 13  LEU n 
1 14  THR n 
1 15  ARG n 
1 16  PHE n 
1 17  VAL n 
1 18  MET n 
1 19  GLU n 
1 20  GLU n 
1 21  GLY n 
1 22  ARG n 
1 23  LYS n 
1 24  ALA n 
1 25  ARG n 
1 26  GLY n 
1 27  THR n 
1 28  GLY n 
1 29  GLU n 
1 30  LEU n 
1 31  THR n 
1 32  GLN n 
1 33  LEU n 
1 34  LEU n 
1 35  ASN n 
1 36  SER n 
1 37  LEU n 
1 38  CYS n 
1 39  THR n 
1 40  ALA n 
1 41  VAL n 
1 42  LYS n 
1 43  ALA n 
1 44  ILE n 
1 45  SER n 
1 46  SER n 
1 47  ALA n 
1 48  VAL n 
1 49  ARG n 
1 50  LYS n 
1 51  ALA n 
1 52  GLY n 
1 53  ILE n 
1 54  ALA n 
1 55  HIS n 
1 56  LEU n 
1 57  TYR n 
1 58  GLY n 
1 59  ILE n 
1 60  ALA n 
1 61  GLY n 
1 62  SER n 
1 63  THR n 
1 64  ASN n 
1 65  VAL n 
1 66  THR n 
1 67  GLY n 
1 68  ASP n 
1 69  GLN n 
1 70  VAL n 
1 71  LYS n 
1 72  LYS n 
1 73  LEU n 
1 74  ASP n 
1 75  VAL n 
1 76  LEU n 
1 77  SER n 
1 78  ASN n 
1 79  ASP n 
1 80  LEU n 
1 81  VAL n 
1 82  MET n 
1 83  ASN n 
1 84  MET n 
1 85  LEU n 
1 86  LYS n 
1 87  SER n 
1 88  SER n 
1 89  PHE n 
1 90  ALA n 
1 91  THR n 
1 92  CYS n 
1 93  VAL n 
1 94  LEU n 
1 95  VAL n 
1 96  SER n 
1 97  GLU n 
1 98  GLU n 
1 99  ASP n 
1 100 LYS n 
1 101 HIS n 
1 102 ALA n 
1 103 ILE n 
1 104 ILE n 
1 105 VAL n 
1 106 GLU n 
1 107 PRO n 
1 108 GLU n 
1 109 LYS n 
1 110 ARG n 
1 111 GLY n 
1 112 LYS n 
1 113 TYR n 
1 114 VAL n 
1 115 VAL n 
1 116 CYS n 
1 117 PHE n 
1 118 ASP n 
1 119 PRO n 
1 120 LEU n 
1 121 ASP n 
1 122 GLY n 
1 123 SER n 
1 124 SER n 
1 125 ASN n 
1 126 ILE n 
1 127 ASP n 
1 128 CYS n 
1 129 LEU n 
1 130 VAL n 
1 131 SER n 
1 132 VAL n 
1 133 GLY n 
1 134 THR n 
1 135 ILE n 
1 136 PHE n 
1 137 GLY n 
1 138 ILE n 
1 139 TYR n 
1 140 ARG n 
1 141 LYS n 
1 142 LYS n 
1 143 SER n 
1 144 THR n 
1 145 ASP n 
1 146 GLU n 
1 147 PRO n 
1 148 SER n 
1 149 GLU n 
1 150 LYS n 
1 151 ASP n 
1 152 ALA n 
1 153 LEU n 
1 154 GLN n 
1 155 PRO n 
1 156 GLY n 
1 157 ARG n 
1 158 ASN n 
1 159 LEU n 
1 160 VAL n 
1 161 ALA n 
1 162 ALA n 
1 163 GLY n 
1 164 TYR n 
1 165 ALA n 
1 166 LEU n 
1 167 TYR n 
1 168 GLY n 
1 169 SER n 
1 170 ALA n 
1 171 THR n 
1 172 MET n 
1 173 LEU n 
1 174 VAL n 
1 175 LEU n 
1 176 ALA n 
1 177 MET n 
1 178 ASP n 
1 179 CYS n 
1 180 GLY n 
1 181 VAL n 
1 182 ASN n 
1 183 CYS n 
1 184 PHE n 
1 185 MET n 
1 186 LEU n 
1 187 ASP n 
1 188 PRO n 
1 189 ALA n 
1 190 ILE n 
1 191 GLY n 
1 192 GLU n 
1 193 PHE n 
1 194 ILE n 
1 195 LEU n 
1 196 VAL n 
1 197 ASP n 
1 198 LYS n 
1 199 ASP n 
1 200 VAL n 
1 201 LYS n 
1 202 ILE n 
1 203 LYS n 
1 204 LYS n 
1 205 LYS n 
1 206 GLY n 
1 207 LYS n 
1 208 ILE n 
1 209 TYR n 
1 210 SER n 
1 211 LEU n 
1 212 ASN n 
1 213 GLU n 
1 214 ALA n 
1 215 TYR n 
1 216 ALA n 
1 217 LYS n 
1 218 ASP n 
1 219 PHE n 
1 220 ASP n 
1 221 PRO n 
1 222 ALA n 
1 223 VAL n 
1 224 THR n 
1 225 GLU n 
1 226 TYR n 
1 227 ILE n 
1 228 GLN n 
1 229 ARG n 
1 230 LYS n 
1 231 LYS n 
1 232 PHE n 
1 233 PRO n 
1 234 PRO n 
1 235 ASP n 
1 236 ASN n 
1 237 SER n 
1 238 ALA n 
1 239 PRO n 
1 240 TYR n 
1 241 GLY n 
1 242 ALA n 
1 243 ARG n 
1 244 TYR n 
1 245 VAL n 
1 246 GLY n 
1 247 SER n 
1 248 MET n 
1 249 VAL n 
1 250 ALA n 
1 251 ASP n 
1 252 VAL n 
1 253 HIS n 
1 254 ARG n 
1 255 THR n 
1 256 LEU n 
1 257 VAL n 
1 258 TYR n 
1 259 GLY n 
1 260 GLY n 
1 261 ILE n 
1 262 PHE n 
1 263 LEU n 
1 264 TYR n 
1 265 PRO n 
1 266 ALA n 
1 267 ASN n 
1 268 LYS n 
1 269 LYS n 
1 270 SER n 
1 271 PRO n 
1 272 ASN n 
1 273 GLY n 
1 274 LYS n 
1 275 LEU n 
1 276 ARG n 
1 277 LEU n 
1 278 LEU n 
1 279 TYR n 
1 280 GLU n 
1 281 CYS n 
1 282 ASN n 
1 283 PRO n 
1 284 MET n 
1 285 ALA n 
1 286 TYR n 
1 287 VAL n 
1 288 MET n 
1 289 GLU n 
1 290 LYS n 
1 291 ALA n 
1 292 GLY n 
1 293 GLY n 
1 294 MET n 
1 295 ALA n 
1 296 THR n 
1 297 THR n 
1 298 GLY n 
1 299 LYS n 
1 300 GLU n 
1 301 ALA n 
1 302 VAL n 
1 303 LEU n 
1 304 ASP n 
1 305 VAL n 
1 306 ILE n 
1 307 PRO n 
1 308 THR n 
1 309 ASP n 
1 310 ILE n 
1 311 HIS n 
1 312 GLN n 
1 313 ARG n 
1 314 ALA n 
1 315 PRO n 
1 316 ILE n 
1 317 ILE n 
1 318 LEU n 
1 319 GLY n 
1 320 SER n 
1 321 PRO n 
1 322 ASP n 
1 323 ASP n 
1 324 VAL n 
1 325 LEU n 
1 326 GLU n 
1 327 PHE n 
1 328 LEU n 
1 329 LYS n 
1 330 VAL n 
1 331 TYR n 
1 332 GLU n 
1 333 LYS n 
1 334 HIS n 
1 335 SER n 
1 336 ALA n 
1 337 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 CDNA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                LIVER 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    F16P_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P09467 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;ADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDL
VMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLV
AAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPY
GARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGS
PDDVLEFLKVYEKHSAQ
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1FTA A 1 ? 337 ? P09467 1 ? 337 ? 1 337 
2 1 1FTA B 1 ? 337 ? P09467 1 ? 337 ? 1 337 
3 1 1FTA C 1 ? 337 ? P09467 1 ? 337 ? 1 337 
4 1 1FTA D 1 ? 337 ? P09467 1 ? 337 ? 1 337 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1FTA VAL A 11  ? UNP P09467 ASN 11  CONFLICT 11  1  
1 1FTA ALA A 214 ? UNP P09467 GLY 214 CONFLICT 214 2  
1 1FTA ILE A 316 ? UNP P09467 VAL 316 CONFLICT 316 3  
2 1FTA VAL B 11  ? UNP P09467 ASN 11  CONFLICT 11  4  
2 1FTA ALA B 214 ? UNP P09467 GLY 214 CONFLICT 214 5  
2 1FTA ILE B 316 ? UNP P09467 VAL 316 CONFLICT 316 6  
3 1FTA VAL C 11  ? UNP P09467 ASN 11  CONFLICT 11  7  
3 1FTA ALA C 214 ? UNP P09467 GLY 214 CONFLICT 214 8  
3 1FTA ILE C 316 ? UNP P09467 VAL 316 CONFLICT 316 9  
4 1FTA VAL D 11  ? UNP P09467 ASN 11  CONFLICT 11  10 
4 1FTA ALA D 214 ? UNP P09467 GLY 214 CONFLICT 214 11 
4 1FTA ILE D 316 ? UNP P09467 VAL 316 CONFLICT 316 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                   ? 'C3 H7 N O2'      89.093  
AMP non-polymer         . 'ADENOSINE MONOPHOSPHATE' ? 'C10 H14 N5 O7 P' 347.221 
ARG 'L-peptide linking' y ARGININE                  ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                  ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                   ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                 ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                     ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                   ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                    ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE             ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                   ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                    ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                 ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                  ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                    ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1FTA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.78 
_exptl_crystal.density_percent_sol   55.76 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1FTA 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            2.3 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2000000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2000000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9729 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         92 
_refine_hist.number_atoms_solvent             347 
_refine_hist.number_atoms_total               10168 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        . 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             2.57  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.028595  -0.008787 -0.999552 -0.031196 -0.999482 0.007894  -0.999104 0.030956  -0.028855 52.78335  63.21147 53.92884 
2 given ? -0.866745 -0.482217 0.127354  -0.479541 0.735552  -0.478544 0.137087  -0.475847 -0.868779 49.21598  33.97237 74.42398 
3 given ? -0.186676 0.531751  0.826071  0.504397  -0.669688 0.545069  0.843051  0.518419  -0.143199 -18.85766 23.89915 5.41434  
# 
_struct.entry_id                  1FTA 
_struct.title                     
;FRUCTOSE-1,6-BISPHOSPHATASE(D-FRUCTOSE-1,6-BISPHOSPHATE, 1-PHOSPHOHYDROLASE) (E.C.3.1.3.11) COMPLEXED WITH THE ALLOSTERIC INHIBITOR AMP
;
_struct.pdbx_descriptor           'FRUCTOSE-1,6-BISPHOSPHATASE, ADENOSINE MONOPHOSPHATE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1FTA 
_struct_keywords.pdbx_keywords   'HYDROLASE (PHOSPHORIC MONOESTER)' 
_struct_keywords.text            'HYDROLASE (PHOSPHORIC MONOESTER)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;MTRIX
 THE TRANSFORMATIONS PRESENTED ON MTRIX RECORDS BELOW
 DESCRIBE NON-CRYSTALLOGRAPHIC RELATIONSHIPS AMONG THE
 VARIOUS DOMAINS IN THIS ENTRY.  APPLYING THE APPROPRIATE
 MTRIX TRANSFORMATION TO THE RESIDUES LISTED FIRST WILL
 YIELD APPROXIMATE COORDINATES FOR THE RESIDUES LISTED
 SECOND.

           APPLIED TO           TRANSFORMED TO
 MTRIX      RESIDUES               RESIDUES         RMSD
   M1   B    9  ..  B  335     A    9  ..  A  335   0.920
   M2   C    9  ..  C  335     A    9  ..  A  335   0.444
   M3   D    9  ..  D  335     A    9  ..  A  335   1.678
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  H1A THR A 12  ? ALA A 24  ? THR A 12  ALA A 24  1 ? 13 
HELX_P HELX_P2  H2A GLY A 28  ? LYS A 50  ? GLY A 28  LYS A 50  1 ? 23 
HELX_P HELX_P3  H3A LYS A 72  ? SER A 88  ? LYS A 72  SER A 88  1 ? 17 
HELX_P HELX_P4  H4A SER A 123 ? ASP A 127 ? SER A 123 ASP A 127 1 ? 5  
HELX_P HELX_P5  H5A GLU A 149 ? LEU A 153 ? GLU A 149 LEU A 153 1 ? 5  
HELX_P HELX_P6  H6A PRO A 221 ? PHE A 232 ? PRO A 221 PHE A 232 1 ? 12 
HELX_P HELX_P7  H7A SER A 247 ? TYR A 258 ? SER A 247 TYR A 258 1 ? 12 
HELX_P HELX_P8  H8A ARG A 276 ? ALA A 291 ? ARG A 276 ALA A 291 1 ? 16 
HELX_P HELX_P9  H9A SER A 320 ? LYS A 333 ? SER A 320 LYS A 333 1 ? 14 
HELX_P HELX_P10 H1B THR B 12  ? ALA B 24  ? THR B 12  ALA B 24  1 ? 13 
HELX_P HELX_P11 H2B GLY B 28  ? LYS B 50  ? GLY B 28  LYS B 50  1 ? 23 
HELX_P HELX_P12 H3B LYS B 72  ? SER B 88  ? LYS B 72  SER B 88  1 ? 17 
HELX_P HELX_P13 H4B SER B 123 ? ASP B 127 ? SER B 123 ASP B 127 1 ? 5  
HELX_P HELX_P14 H5B GLU B 149 ? LEU B 153 ? GLU B 149 LEU B 153 1 ? 5  
HELX_P HELX_P15 H6B PRO B 221 ? PHE B 232 ? PRO B 221 PHE B 232 1 ? 12 
HELX_P HELX_P16 H7B SER B 247 ? TYR B 258 ? SER B 247 TYR B 258 1 ? 12 
HELX_P HELX_P17 H8B ARG B 276 ? ALA B 291 ? ARG B 276 ALA B 291 1 ? 16 
HELX_P HELX_P18 H9B SER B 320 ? LYS B 333 ? SER B 320 LYS B 333 1 ? 14 
HELX_P HELX_P19 H1C THR C 12  ? ALA C 24  ? THR C 12  ALA C 24  1 ? 13 
HELX_P HELX_P20 H2C GLY C 28  ? LYS C 50  ? GLY C 28  LYS C 50  1 ? 23 
HELX_P HELX_P21 H3C LYS C 72  ? SER C 88  ? LYS C 72  SER C 88  1 ? 17 
HELX_P HELX_P22 H4C SER C 123 ? ASP C 127 ? SER C 123 ASP C 127 1 ? 5  
HELX_P HELX_P23 H5C GLU C 149 ? LEU C 153 ? GLU C 149 LEU C 153 1 ? 5  
HELX_P HELX_P24 H6C PRO C 221 ? PHE C 232 ? PRO C 221 PHE C 232 1 ? 12 
HELX_P HELX_P25 H7C SER C 247 ? TYR C 258 ? SER C 247 TYR C 258 1 ? 12 
HELX_P HELX_P26 H8C ARG C 276 ? ALA C 291 ? ARG C 276 ALA C 291 1 ? 16 
HELX_P HELX_P27 H9C SER C 320 ? LYS C 333 ? SER C 320 LYS C 333 1 ? 14 
HELX_P HELX_P28 H1D THR D 12  ? ALA D 24  ? THR D 12  ALA D 24  1 ? 13 
HELX_P HELX_P29 H2D GLY D 28  ? LYS D 50  ? GLY D 28  LYS D 50  1 ? 23 
HELX_P HELX_P30 H3D LYS D 72  ? SER D 88  ? LYS D 72  SER D 88  1 ? 17 
HELX_P HELX_P31 H4D SER D 123 ? ASP D 127 ? SER D 123 ASP D 127 1 ? 5  
HELX_P HELX_P32 H5D GLU D 149 ? LEU D 153 ? GLU D 149 LEU D 153 1 ? 5  
HELX_P HELX_P33 H6D PRO D 221 ? PHE D 232 ? PRO D 221 PHE D 232 1 ? 12 
HELX_P HELX_P34 H7D SER D 247 ? TYR D 258 ? SER D 247 TYR D 258 1 ? 12 
HELX_P HELX_P35 H8D ARG D 276 ? ALA D 291 ? ARG D 276 ALA D 291 1 ? 16 
HELX_P HELX_P36 H9D SER D 320 ? LYS D 333 ? SER D 320 LYS D 333 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
S1A ? 8 ? 
S2A ? 5 ? 
S1B ? 8 ? 
S2B ? 5 ? 
S1C ? 8 ? 
S2C ? 5 ? 
S1D ? 8 ? 
S2D ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1A 1 2 ? anti-parallel 
S1A 2 3 ? anti-parallel 
S1A 3 4 ? anti-parallel 
S1A 4 5 ? anti-parallel 
S1A 5 6 ? anti-parallel 
S1A 6 7 ? anti-parallel 
S1A 7 8 ? anti-parallel 
S2A 1 2 ? anti-parallel 
S2A 2 3 ? anti-parallel 
S2A 3 4 ? anti-parallel 
S2A 4 5 ? anti-parallel 
S1B 1 2 ? anti-parallel 
S1B 2 3 ? anti-parallel 
S1B 3 4 ? anti-parallel 
S1B 4 5 ? anti-parallel 
S1B 5 6 ? anti-parallel 
S1B 6 7 ? anti-parallel 
S1B 7 8 ? anti-parallel 
S2B 1 2 ? anti-parallel 
S2B 2 3 ? anti-parallel 
S2B 3 4 ? anti-parallel 
S2B 4 5 ? anti-parallel 
S1C 1 2 ? anti-parallel 
S1C 2 3 ? anti-parallel 
S1C 3 4 ? anti-parallel 
S1C 4 5 ? anti-parallel 
S1C 5 6 ? anti-parallel 
S1C 6 7 ? anti-parallel 
S1C 7 8 ? anti-parallel 
S2C 1 2 ? anti-parallel 
S2C 2 3 ? anti-parallel 
S2C 3 4 ? anti-parallel 
S2C 4 5 ? anti-parallel 
S1D 1 2 ? anti-parallel 
S1D 2 3 ? anti-parallel 
S1D 3 4 ? anti-parallel 
S1D 4 5 ? anti-parallel 
S1D 5 6 ? anti-parallel 
S1D 6 7 ? anti-parallel 
S1D 7 8 ? anti-parallel 
S2D 1 2 ? anti-parallel 
S2D 2 3 ? anti-parallel 
S2D 3 4 ? anti-parallel 
S2D 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1A 1 ILE A 103 ? GLU A 106 ? ILE A 103 GLU A 106 
S1A 2 CYS A 92  ? VAL A 95  ? CYS A 92  VAL A 95  
S1A 3 TYR A 113 ? ASP A 118 ? TYR A 113 ASP A 118 
S1A 4 VAL A 132 ? TYR A 139 ? VAL A 132 TYR A 139 
S1A 5 VAL A 160 ? TYR A 167 ? VAL A 160 TYR A 167 
S1A 6 THR A 171 ? ALA A 176 ? THR A 171 ALA A 176 
S1A 7 VAL A 181 ? ASP A 187 ? VAL A 181 ASP A 187 
S1A 8 GLU A 192 ? ASP A 199 ? GLU A 192 ASP A 199 
S2A 1 TYR A 240 ? ARG A 243 ? TYR A 240 ARG A 243 
S2A 2 ILE A 208 ? SER A 210 ? ILE A 208 SER A 210 
S2A 3 GLY A 260 ? TYR A 264 ? GLY A 260 TYR A 264 
S2A 4 ILE A 316 ? GLY A 319 ? ILE A 316 GLY A 319 
S2A 5 MET A 294 ? THR A 296 ? MET A 294 THR A 296 
S1B 1 ILE B 103 ? GLU B 106 ? ILE B 103 GLU B 106 
S1B 2 CYS B 92  ? VAL B 95  ? CYS B 92  VAL B 95  
S1B 3 TYR B 113 ? ASP B 118 ? TYR B 113 ASP B 118 
S1B 4 VAL B 132 ? TYR B 139 ? VAL B 132 TYR B 139 
S1B 5 VAL B 160 ? TYR B 167 ? VAL B 160 TYR B 167 
S1B 6 THR B 171 ? ALA B 176 ? THR B 171 ALA B 176 
S1B 7 VAL B 181 ? ASP B 187 ? VAL B 181 ASP B 187 
S1B 8 GLU B 192 ? ASP B 199 ? GLU B 192 ASP B 199 
S2B 1 TYR B 240 ? ARG B 243 ? TYR B 240 ARG B 243 
S2B 2 ILE B 208 ? SER B 210 ? ILE B 208 SER B 210 
S2B 3 GLY B 260 ? TYR B 264 ? GLY B 260 TYR B 264 
S2B 4 ILE B 316 ? GLY B 319 ? ILE B 316 GLY B 319 
S2B 5 MET B 294 ? THR B 296 ? MET B 294 THR B 296 
S1C 1 ILE C 103 ? GLU C 106 ? ILE C 103 GLU C 106 
S1C 2 CYS C 92  ? VAL C 95  ? CYS C 92  VAL C 95  
S1C 3 TYR C 113 ? ASP C 118 ? TYR C 113 ASP C 118 
S1C 4 VAL C 132 ? TYR C 139 ? VAL C 132 TYR C 139 
S1C 5 VAL C 160 ? TYR C 167 ? VAL C 160 TYR C 167 
S1C 6 THR C 171 ? ALA C 176 ? THR C 171 ALA C 176 
S1C 7 VAL C 181 ? ASP C 187 ? VAL C 181 ASP C 187 
S1C 8 GLU C 192 ? ASP C 199 ? GLU C 192 ASP C 199 
S2C 1 TYR C 240 ? ARG C 243 ? TYR C 240 ARG C 243 
S2C 2 ILE C 208 ? SER C 210 ? ILE C 208 SER C 210 
S2C 3 GLY C 260 ? TYR C 264 ? GLY C 260 TYR C 264 
S2C 4 ILE C 316 ? GLY C 319 ? ILE C 316 GLY C 319 
S2C 5 MET C 294 ? THR C 296 ? MET C 294 THR C 296 
S1D 1 ILE D 103 ? GLU D 106 ? ILE D 103 GLU D 106 
S1D 2 CYS D 92  ? VAL D 95  ? CYS D 92  VAL D 95  
S1D 3 TYR D 113 ? ASP D 118 ? TYR D 113 ASP D 118 
S1D 4 VAL D 132 ? TYR D 139 ? VAL D 132 TYR D 139 
S1D 5 VAL D 160 ? TYR D 167 ? VAL D 160 TYR D 167 
S1D 6 THR D 171 ? ALA D 176 ? THR D 171 ALA D 176 
S1D 7 VAL D 181 ? ASP D 187 ? VAL D 181 ASP D 187 
S1D 8 GLU D 192 ? ASP D 199 ? GLU D 192 ASP D 199 
S2D 1 TYR D 240 ? ARG D 243 ? TYR D 240 ARG D 243 
S2D 2 ILE D 208 ? SER D 210 ? ILE D 208 SER D 210 
S2D 3 GLY D 260 ? TYR D 264 ? GLY D 260 TYR D 264 
S2D 4 ILE D 316 ? GLY D 319 ? ILE D 316 GLY D 319 
S2D 5 MET D 294 ? THR D 296 ? MET D 294 THR D 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
E1  Author   ? ? ? ? 14 'ALLOSTERIC SITE OF CHAIN A'         
E2  Author   ? ? ? ? 14 'ALLOSTERIC SITE OF CHAIN A'         
E3  Author   ? ? ? ? 14 'ALLOSTERIC SITE OF CHAIN A'         
E4  Author   ? ? ? ? 14 'ALLOSTERIC SITE OF CHAIN A'         
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE AMP A 338' 
AC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE AMP B 338' 
AC3 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE AMP C 338' 
AC4 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE AMP D 338' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   E1  14 GLU A 20  ? GLU A 20  . ? 1_555 ? 
2   E1  14 GLY A 21  ? GLY A 21  . ? 1_555 ? 
3   E1  14 ALA A 24  ? ALA A 24  . ? 1_555 ? 
4   E1  14 GLY A 26  ? GLY A 26  . ? 1_555 ? 
5   E1  14 THR A 27  ? THR A 27  . ? 1_555 ? 
6   E1  14 GLY A 28  ? GLY A 28  . ? 1_555 ? 
7   E1  14 GLU A 29  ? GLU A 29  . ? 1_555 ? 
8   E1  14 LEU A 30  ? LEU A 30  . ? 1_555 ? 
9   E1  14 THR A 31  ? THR A 31  . ? 1_555 ? 
10  E1  14 LYS A 112 ? LYS A 112 . ? 1_555 ? 
11  E1  14 TYR A 113 ? TYR A 113 . ? 1_555 ? 
12  E1  14 ARG A 140 ? ARG A 140 . ? 1_555 ? 
13  E1  14 VAL A 160 ? VAL A 160 . ? 1_555 ? 
14  E1  14 MET A 177 ? MET A 177 . ? 1_555 ? 
15  E2  14 GLU B 20  ? GLU B 20  . ? 1_555 ? 
16  E2  14 GLY B 21  ? GLY B 21  . ? 1_555 ? 
17  E2  14 ALA B 24  ? ALA B 24  . ? 1_555 ? 
18  E2  14 GLY B 26  ? GLY B 26  . ? 1_555 ? 
19  E2  14 THR B 27  ? THR B 27  . ? 1_555 ? 
20  E2  14 GLY B 28  ? GLY B 28  . ? 1_555 ? 
21  E2  14 GLU B 29  ? GLU B 29  . ? 1_555 ? 
22  E2  14 LEU B 30  ? LEU B 30  . ? 1_555 ? 
23  E2  14 THR B 31  ? THR B 31  . ? 1_555 ? 
24  E2  14 LYS B 112 ? LYS B 112 . ? 1_555 ? 
25  E2  14 TYR B 113 ? TYR B 113 . ? 1_555 ? 
26  E2  14 ARG B 140 ? ARG B 140 . ? 1_555 ? 
27  E2  14 VAL B 160 ? VAL B 160 . ? 1_555 ? 
28  E2  14 MET B 177 ? MET B 177 . ? 1_555 ? 
29  E3  14 GLU C 20  ? GLU C 20  . ? 1_555 ? 
30  E3  14 GLY C 21  ? GLY C 21  . ? 1_555 ? 
31  E3  14 ALA C 24  ? ALA C 24  . ? 1_555 ? 
32  E3  14 GLY C 26  ? GLY C 26  . ? 1_555 ? 
33  E3  14 THR C 27  ? THR C 27  . ? 1_555 ? 
34  E3  14 GLY C 28  ? GLY C 28  . ? 1_555 ? 
35  E3  14 GLU C 29  ? GLU C 29  . ? 1_555 ? 
36  E3  14 LEU C 30  ? LEU C 30  . ? 1_555 ? 
37  E3  14 THR C 31  ? THR C 31  . ? 1_555 ? 
38  E3  14 LYS C 112 ? LYS C 112 . ? 1_555 ? 
39  E3  14 TYR C 113 ? TYR C 113 . ? 1_555 ? 
40  E3  14 ARG C 140 ? ARG C 140 . ? 1_555 ? 
41  E3  14 VAL C 160 ? VAL C 160 . ? 1_555 ? 
42  E3  14 MET C 177 ? MET C 177 . ? 1_555 ? 
43  E4  14 GLU D 20  ? GLU D 20  . ? 1_555 ? 
44  E4  14 GLY D 21  ? GLY D 21  . ? 1_555 ? 
45  E4  14 ALA D 24  ? ALA D 24  . ? 1_555 ? 
46  E4  14 GLY D 26  ? GLY D 26  . ? 1_555 ? 
47  E4  14 THR D 27  ? THR D 27  . ? 1_555 ? 
48  E4  14 GLY D 28  ? GLY D 28  . ? 1_555 ? 
49  E4  14 GLU D 29  ? GLU D 29  . ? 1_555 ? 
50  E4  14 LEU D 30  ? LEU D 30  . ? 1_555 ? 
51  E4  14 THR D 31  ? THR D 31  . ? 1_555 ? 
52  E4  14 LYS D 112 ? LYS D 112 . ? 1_555 ? 
53  E4  14 TYR D 113 ? TYR D 113 . ? 1_555 ? 
54  E4  14 ARG D 140 ? ARG D 140 . ? 1_555 ? 
55  E4  14 VAL D 160 ? VAL D 160 . ? 1_555 ? 
56  E4  14 MET D 177 ? MET D 177 . ? 1_555 ? 
57  AC1 14 VAL A 17  ? VAL A 17  . ? 1_555 ? 
58  AC1 14 GLU A 20  ? GLU A 20  . ? 1_555 ? 
59  AC1 14 GLY A 21  ? GLY A 21  . ? 1_555 ? 
60  AC1 14 ALA A 24  ? ALA A 24  . ? 1_555 ? 
61  AC1 14 GLY A 26  ? GLY A 26  . ? 1_555 ? 
62  AC1 14 THR A 27  ? THR A 27  . ? 1_555 ? 
63  AC1 14 GLY A 28  ? GLY A 28  . ? 1_555 ? 
64  AC1 14 GLU A 29  ? GLU A 29  . ? 1_555 ? 
65  AC1 14 LEU A 30  ? LEU A 30  . ? 1_555 ? 
66  AC1 14 THR A 31  ? THR A 31  . ? 1_555 ? 
67  AC1 14 LYS A 112 ? LYS A 112 . ? 1_555 ? 
68  AC1 14 TYR A 113 ? TYR A 113 . ? 1_555 ? 
69  AC1 14 VAL A 160 ? VAL A 160 . ? 1_555 ? 
70  AC1 14 HOH I .   ? HOH A 409 . ? 1_555 ? 
71  AC2 16 VAL B 17  ? VAL B 17  . ? 1_555 ? 
72  AC2 16 GLU B 20  ? GLU B 20  . ? 1_555 ? 
73  AC2 16 GLY B 21  ? GLY B 21  . ? 1_555 ? 
74  AC2 16 GLY B 26  ? GLY B 26  . ? 1_555 ? 
75  AC2 16 THR B 27  ? THR B 27  . ? 1_555 ? 
76  AC2 16 GLY B 28  ? GLY B 28  . ? 1_555 ? 
77  AC2 16 GLU B 29  ? GLU B 29  . ? 1_555 ? 
78  AC2 16 LEU B 30  ? LEU B 30  . ? 1_555 ? 
79  AC2 16 THR B 31  ? THR B 31  . ? 1_555 ? 
80  AC2 16 LYS B 112 ? LYS B 112 . ? 1_555 ? 
81  AC2 16 TYR B 113 ? TYR B 113 . ? 1_555 ? 
82  AC2 16 ARG B 140 ? ARG B 140 . ? 1_555 ? 
83  AC2 16 VAL B 160 ? VAL B 160 . ? 1_555 ? 
84  AC2 16 MET B 177 ? MET B 177 . ? 1_555 ? 
85  AC2 16 HOH J .   ? HOH B 415 . ? 1_555 ? 
86  AC2 16 HOH J .   ? HOH B 416 . ? 1_555 ? 
87  AC3 16 VAL C 17  ? VAL C 17  . ? 1_555 ? 
88  AC3 16 GLU C 20  ? GLU C 20  . ? 1_555 ? 
89  AC3 16 GLY C 21  ? GLY C 21  . ? 1_555 ? 
90  AC3 16 ALA C 24  ? ALA C 24  . ? 1_555 ? 
91  AC3 16 GLY C 26  ? GLY C 26  . ? 1_555 ? 
92  AC3 16 THR C 27  ? THR C 27  . ? 1_555 ? 
93  AC3 16 GLY C 28  ? GLY C 28  . ? 1_555 ? 
94  AC3 16 GLU C 29  ? GLU C 29  . ? 1_555 ? 
95  AC3 16 LEU C 30  ? LEU C 30  . ? 1_555 ? 
96  AC3 16 THR C 31  ? THR C 31  . ? 1_555 ? 
97  AC3 16 LYS C 112 ? LYS C 112 . ? 1_555 ? 
98  AC3 16 TYR C 113 ? TYR C 113 . ? 1_555 ? 
99  AC3 16 ARG C 140 ? ARG C 140 . ? 1_555 ? 
100 AC3 16 VAL C 160 ? VAL C 160 . ? 1_555 ? 
101 AC3 16 MET C 177 ? MET C 177 . ? 1_555 ? 
102 AC3 16 HOH K .   ? HOH C 395 . ? 1_555 ? 
103 AC4 16 VAL D 17  ? VAL D 17  . ? 1_555 ? 
104 AC4 16 GLU D 20  ? GLU D 20  . ? 1_555 ? 
105 AC4 16 GLY D 21  ? GLY D 21  . ? 1_555 ? 
106 AC4 16 GLY D 26  ? GLY D 26  . ? 1_555 ? 
107 AC4 16 THR D 27  ? THR D 27  . ? 1_555 ? 
108 AC4 16 GLY D 28  ? GLY D 28  . ? 1_555 ? 
109 AC4 16 GLU D 29  ? GLU D 29  . ? 1_555 ? 
110 AC4 16 LEU D 30  ? LEU D 30  . ? 1_555 ? 
111 AC4 16 THR D 31  ? THR D 31  . ? 1_555 ? 
112 AC4 16 LYS D 112 ? LYS D 112 . ? 1_555 ? 
113 AC4 16 TYR D 113 ? TYR D 113 . ? 1_555 ? 
114 AC4 16 ARG D 140 ? ARG D 140 . ? 1_555 ? 
115 AC4 16 MET D 177 ? MET D 177 . ? 1_555 ? 
116 AC4 16 HOH L .   ? HOH D 449 . ? 1_555 ? 
117 AC4 16 HOH L .   ? HOH D 458 . ? 1_555 ? 
118 AC4 16 HOH L .   ? HOH D 461 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1FTA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1FTA 
_atom_sites.fract_transf_matrix[1][1]   0.014577 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011792 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003557 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . ASP A 1 9   ? 30.209  54.382  37.733  1.00 51.91  ? 9   ASP A N     1 
ATOM   2     C CA    . ASP A 1 9   ? 28.846  53.984  37.996  1.00 52.69  ? 9   ASP A CA    1 
ATOM   3     C C     . ASP A 1 9   ? 28.655  52.970  36.886  1.00 49.82  ? 9   ASP A C     1 
ATOM   4     O O     . ASP A 1 9   ? 29.141  53.253  35.781  1.00 50.24  ? 9   ASP A O     1 
ATOM   5     C CB    . ASP A 1 9   ? 27.871  55.166  37.822  1.00 56.83  ? 9   ASP A CB    1 
ATOM   6     C CG    . ASP A 1 9   ? 27.854  56.223  38.938  1.00 58.16  ? 9   ASP A CG    1 
ATOM   7     O OD1   . ASP A 1 9   ? 27.845  55.854  40.117  1.00 55.79  ? 9   ASP A OD1   1 
ATOM   8     O OD2   . ASP A 1 9   ? 27.822  57.419  38.623  1.00 56.61  ? 9   ASP A OD2   1 
ATOM   9     N N     . VAL A 1 10  ? 28.092  51.796  37.170  1.00 44.36  ? 10  VAL A N     1 
ATOM   10    C CA    . VAL A 1 10  ? 27.831  50.795  36.146  1.00 35.91  ? 10  VAL A CA    1 
ATOM   11    C C     . VAL A 1 10  ? 26.875  51.454  35.154  1.00 32.56  ? 10  VAL A C     1 
ATOM   12    O O     . VAL A 1 10  ? 26.126  52.357  35.554  1.00 28.37  ? 10  VAL A O     1 
ATOM   13    C CB    . VAL A 1 10  ? 27.208  49.510  36.825  1.00 32.80  ? 10  VAL A CB    1 
ATOM   14    C CG1   . VAL A 1 10  ? 25.894  49.818  37.528  1.00 35.61  ? 10  VAL A CG1   1 
ATOM   15    C CG2   . VAL A 1 10  ? 26.963  48.454  35.770  1.00 28.32  ? 10  VAL A CG2   1 
ATOM   16    H H     . VAL A 1 10  ? 27.766  51.625  38.079  1.00 0.00   ? 10  VAL A H     1 
ATOM   17    N N     . VAL A 1 11  ? 26.946  51.172  33.858  1.00 29.37  ? 11  VAL A N     1 
ATOM   18    C CA    . VAL A 1 11  ? 25.895  51.667  32.989  1.00 26.90  ? 11  VAL A CA    1 
ATOM   19    C C     . VAL A 1 11  ? 25.582  50.462  32.141  1.00 22.59  ? 11  VAL A C     1 
ATOM   20    O O     . VAL A 1 11  ? 26.446  49.642  31.819  1.00 21.02  ? 11  VAL A O     1 
ATOM   21    C CB    . VAL A 1 11  ? 26.287  52.834  32.036  1.00 28.30  ? 11  VAL A CB    1 
ATOM   22    C CG1   . VAL A 1 11  ? 25.016  53.672  31.843  1.00 22.91  ? 11  VAL A CG1   1 
ATOM   23    C CG2   . VAL A 1 11  ? 27.398  53.728  32.574  1.00 34.28  ? 11  VAL A CG2   1 
ATOM   24    H H     . VAL A 1 11  ? 27.674  50.603  33.508  1.00 0.00   ? 11  VAL A H     1 
ATOM   25    N N     . THR A 1 12  ? 24.299  50.316  31.878  1.00 21.80  ? 12  THR A N     1 
ATOM   26    C CA    . THR A 1 12  ? 23.783  49.242  31.059  1.00 20.03  ? 12  THR A CA    1 
ATOM   27    C C     . THR A 1 12  ? 23.614  49.772  29.633  1.00 17.20  ? 12  THR A C     1 
ATOM   28    O O     . THR A 1 12  ? 23.626  51.005  29.442  1.00 15.44  ? 12  THR A O     1 
ATOM   29    C CB    . THR A 1 12  ? 22.454  48.784  31.731  1.00 19.83  ? 12  THR A CB    1 
ATOM   30    O OG1   . THR A 1 12  ? 21.587  49.892  31.987  1.00 14.54  ? 12  THR A OG1   1 
ATOM   31    C CG2   . THR A 1 12  ? 22.775  48.126  33.063  1.00 20.10  ? 12  THR A CG2   1 
ATOM   32    H H     . THR A 1 12  ? 23.664  50.991  32.189  1.00 0.00   ? 12  THR A H     1 
ATOM   33    H HG1   . THR A 1 12  ? 20.928  49.569  32.625  1.00 0.00   ? 12  THR A HG1   1 
ATOM   34    N N     . LEU A 1 13  ? 23.445  48.934  28.606  1.00 12.19  ? 13  LEU A N     1 
ATOM   35    C CA    . LEU A 1 13  ? 23.223  49.434  27.250  1.00 12.77  ? 13  LEU A CA    1 
ATOM   36    C C     . LEU A 1 13  ? 21.975  50.302  27.209  1.00 14.18  ? 13  LEU A C     1 
ATOM   37    O O     . LEU A 1 13  ? 21.967  51.378  26.608  1.00 15.08  ? 13  LEU A O     1 
ATOM   38    C CB    . LEU A 1 13  ? 23.051  48.286  26.260  1.00 4.77   ? 13  LEU A CB    1 
ATOM   39    C CG    . LEU A 1 13  ? 22.687  48.617  24.821  1.00 3.44   ? 13  LEU A CG    1 
ATOM   40    C CD1   . LEU A 1 13  ? 23.719  49.485  24.184  1.00 5.42   ? 13  LEU A CD1   1 
ATOM   41    C CD2   . LEU A 1 13  ? 22.614  47.336  24.029  1.00 8.31   ? 13  LEU A CD2   1 
ATOM   42    H H     . LEU A 1 13  ? 23.530  47.971  28.766  1.00 0.00   ? 13  LEU A H     1 
ATOM   43    N N     . THR A 1 14  ? 20.931  49.866  27.917  1.00 17.16  ? 14  THR A N     1 
ATOM   44    C CA    . THR A 1 14  ? 19.669  50.577  27.961  1.00 14.57  ? 14  THR A CA    1 
ATOM   45    C C     . THR A 1 14  ? 19.757  51.946  28.609  1.00 15.95  ? 14  THR A C     1 
ATOM   46    O O     . THR A 1 14  ? 19.115  52.876  28.121  1.00 21.53  ? 14  THR A O     1 
ATOM   47    C CB    . THR A 1 14  ? 18.648  49.700  28.687  1.00 15.59  ? 14  THR A CB    1 
ATOM   48    O OG1   . THR A 1 14  ? 18.779  48.355  28.192  1.00 12.31  ? 14  THR A OG1   1 
ATOM   49    C CG2   . THR A 1 14  ? 17.228  50.195  28.450  1.00 10.96  ? 14  THR A CG2   1 
ATOM   50    H H     . THR A 1 14  ? 20.981  48.991  28.357  1.00 0.00   ? 14  THR A H     1 
ATOM   51    H HG1   . THR A 1 14  ? 18.602  48.402  27.231  1.00 0.00   ? 14  THR A HG1   1 
ATOM   52    N N     . ARG A 1 15  ? 20.547  52.148  29.663  1.00 16.84  ? 15  ARG A N     1 
ATOM   53    C CA    . ARG A 1 15  ? 20.622  53.468  30.266  1.00 19.49  ? 15  ARG A CA    1 
ATOM   54    C C     . ARG A 1 15  ? 21.518  54.383  29.411  1.00 21.60  ? 15  ARG A C     1 
ATOM   55    O O     . ARG A 1 15  ? 21.265  55.582  29.243  1.00 24.43  ? 15  ARG A O     1 
ATOM   56    C CB    . ARG A 1 15  ? 21.136  53.268  31.686  1.00 20.15  ? 15  ARG A CB    1 
ATOM   57    C CG    . ARG A 1 15  ? 20.696  54.391  32.598  1.00 23.83  ? 15  ARG A CG    1 
ATOM   58    C CD    . ARG A 1 15  ? 20.581  53.888  34.020  1.00 23.07  ? 15  ARG A CD    1 
ATOM   59    N NE    . ARG A 1 15  ? 21.889  53.582  34.570  1.00 23.87  ? 15  ARG A NE    1 
ATOM   60    C CZ    . ARG A 1 15  ? 22.079  53.459  35.888  1.00 24.09  ? 15  ARG A CZ    1 
ATOM   61    N NH1   . ARG A 1 15  ? 21.092  53.637  36.773  1.00 19.59  ? 15  ARG A NH1   1 
ATOM   62    N NH2   . ARG A 1 15  ? 23.299  53.166  36.332  1.00 20.34  ? 15  ARG A NH2   1 
ATOM   63    H H     . ARG A 1 15  ? 21.104  51.422  30.015  1.00 0.00   ? 15  ARG A H     1 
ATOM   64    H HE    . ARG A 1 15  ? 22.652  53.461  33.967  1.00 0.00   ? 15  ARG A HE    1 
ATOM   65    H HH11  . ARG A 1 15  ? 20.175  53.881  36.465  1.00 0.00   ? 15  ARG A HH11  1 
ATOM   66    H HH12  . ARG A 1 15  ? 21.276  53.536  37.751  1.00 0.00   ? 15  ARG A HH12  1 
ATOM   67    H HH21  . ARG A 1 15  ? 24.049  53.042  35.684  1.00 0.00   ? 15  ARG A HH21  1 
ATOM   68    H HH22  . ARG A 1 15  ? 23.455  53.050  37.312  1.00 0.00   ? 15  ARG A HH22  1 
ATOM   69    N N     . PHE A 1 16  ? 22.532  53.807  28.765  1.00 18.98  ? 16  PHE A N     1 
ATOM   70    C CA    . PHE A 1 16  ? 23.388  54.532  27.857  1.00 16.68  ? 16  PHE A CA    1 
ATOM   71    C C     . PHE A 1 16  ? 22.596  55.056  26.668  1.00 14.16  ? 16  PHE A C     1 
ATOM   72    O O     . PHE A 1 16  ? 22.560  56.264  26.442  1.00 12.67  ? 16  PHE A O     1 
ATOM   73    C CB    . PHE A 1 16  ? 24.505  53.575  27.426  1.00 20.91  ? 16  PHE A CB    1 
ATOM   74    C CG    . PHE A 1 16  ? 25.452  54.072  26.348  1.00 21.44  ? 16  PHE A CG    1 
ATOM   75    C CD1   . PHE A 1 16  ? 26.501  54.908  26.685  1.00 24.39  ? 16  PHE A CD1   1 
ATOM   76    C CD2   . PHE A 1 16  ? 25.219  53.718  25.028  1.00 26.42  ? 16  PHE A CD2   1 
ATOM   77    C CE1   . PHE A 1 16  ? 27.286  55.427  25.678  1.00 26.81  ? 16  PHE A CE1   1 
ATOM   78    C CE2   . PHE A 1 16  ? 26.004  54.242  24.028  1.00 29.77  ? 16  PHE A CE2   1 
ATOM   79    C CZ    . PHE A 1 16  ? 27.031  55.103  24.357  1.00 30.94  ? 16  PHE A CZ    1 
ATOM   80    H H     . PHE A 1 16  ? 22.710  52.853  28.904  1.00 0.00   ? 16  PHE A H     1 
ATOM   81    N N     . VAL A 1 17  ? 21.946  54.196  25.889  1.00 14.27  ? 17  VAL A N     1 
ATOM   82    C CA    . VAL A 1 17  ? 21.191  54.623  24.709  1.00 15.88  ? 17  VAL A CA    1 
ATOM   83    C C     . VAL A 1 17  ? 20.116  55.666  25.007  1.00 16.70  ? 17  VAL A C     1 
ATOM   84    O O     . VAL A 1 17  ? 20.010  56.682  24.309  1.00 15.39  ? 17  VAL A O     1 
ATOM   85    C CB    . VAL A 1 17  ? 20.616  53.342  24.065  1.00 14.98  ? 17  VAL A CB    1 
ATOM   86    C CG1   . VAL A 1 17  ? 19.580  53.603  22.993  1.00 18.75  ? 17  VAL A CG1   1 
ATOM   87    C CG2   . VAL A 1 17  ? 21.775  52.657  23.368  1.00 9.90   ? 17  VAL A CG2   1 
ATOM   88    H H     . VAL A 1 17  ? 22.001  53.242  26.107  1.00 0.00   ? 17  VAL A H     1 
ATOM   89    N N     . MET A 1 18  ? 19.378  55.460  26.101  1.00 19.79  ? 18  MET A N     1 
ATOM   90    C CA    . MET A 1 18  ? 18.321  56.372  26.544  1.00 19.46  ? 18  MET A CA    1 
ATOM   91    C C     . MET A 1 18  ? 18.926  57.722  26.839  1.00 19.03  ? 18  MET A C     1 
ATOM   92    O O     . MET A 1 18  ? 18.439  58.708  26.290  1.00 20.88  ? 18  MET A O     1 
ATOM   93    C CB    . MET A 1 18  ? 17.628  55.831  27.810  1.00 15.77  ? 18  MET A CB    1 
ATOM   94    C CG    . MET A 1 18  ? 16.519  56.637  28.463  1.00 9.13   ? 18  MET A CG    1 
ATOM   95    S SD    . MET A 1 18  ? 15.107  57.128  27.443  1.00 20.04  ? 18  MET A SD    1 
ATOM   96    C CE    . MET A 1 18  ? 14.927  58.730  28.144  1.00 4.30   ? 18  MET A CE    1 
ATOM   97    H H     . MET A 1 18  ? 19.542  54.654  26.632  1.00 0.00   ? 18  MET A H     1 
ATOM   98    N N     . GLU A 1 19  ? 19.992  57.802  27.631  1.00 20.43  ? 19  GLU A N     1 
ATOM   99    C CA    . GLU A 1 19  ? 20.585  59.085  27.944  1.00 22.53  ? 19  GLU A CA    1 
ATOM   100   C C     . GLU A 1 19  ? 21.105  59.743  26.670  1.00 24.60  ? 19  GLU A C     1 
ATOM   101   O O     . GLU A 1 19  ? 20.859  60.929  26.425  1.00 24.57  ? 19  GLU A O     1 
ATOM   102   C CB    . GLU A 1 19  ? 21.701  58.869  28.951  1.00 23.02  ? 19  GLU A CB    1 
ATOM   103   C CG    . GLU A 1 19  ? 22.280  60.135  29.580  1.00 33.39  ? 19  GLU A CG    1 
ATOM   104   C CD    . GLU A 1 19  ? 21.326  60.952  30.446  1.00 39.29  ? 19  GLU A CD    1 
ATOM   105   O OE1   . GLU A 1 19  ? 21.175  60.636  31.628  1.00 46.05  ? 19  GLU A OE1   1 
ATOM   106   O OE2   . GLU A 1 19  ? 20.755  61.925  29.949  1.00 42.44  ? 19  GLU A OE2   1 
ATOM   107   H H     . GLU A 1 19  ? 20.375  56.993  28.039  1.00 0.00   ? 19  GLU A H     1 
ATOM   108   N N     . GLU A 1 20  ? 21.753  58.997  25.782  1.00 26.28  ? 20  GLU A N     1 
ATOM   109   C CA    . GLU A 1 20  ? 22.291  59.550  24.545  1.00 25.38  ? 20  GLU A CA    1 
ATOM   110   C C     . GLU A 1 20  ? 21.181  60.119  23.671  1.00 25.17  ? 20  GLU A C     1 
ATOM   111   O O     . GLU A 1 20  ? 21.337  61.133  22.984  1.00 25.59  ? 20  GLU A O     1 
ATOM   112   C CB    . GLU A 1 20  ? 23.043  58.446  23.817  1.00 29.49  ? 20  GLU A CB    1 
ATOM   113   C CG    . GLU A 1 20  ? 24.382  58.853  23.202  1.00 28.61  ? 20  GLU A CG    1 
ATOM   114   C CD    . GLU A 1 20  ? 25.309  59.540  24.183  1.00 28.07  ? 20  GLU A CD    1 
ATOM   115   O OE1   . GLU A 1 20  ? 25.769  58.916  25.141  1.00 29.35  ? 20  GLU A OE1   1 
ATOM   116   O OE2   . GLU A 1 20  ? 25.552  60.727  23.982  1.00 32.25  ? 20  GLU A OE2   1 
ATOM   117   H H     . GLU A 1 20  ? 21.873  58.043  25.974  1.00 0.00   ? 20  GLU A H     1 
ATOM   118   N N     . GLY A 1 21  ? 20.014  59.499  23.747  1.00 22.44  ? 21  GLY A N     1 
ATOM   119   C CA    . GLY A 1 21  ? 18.849  59.975  23.046  1.00 23.04  ? 21  GLY A CA    1 
ATOM   120   C C     . GLY A 1 21  ? 18.384  61.287  23.625  1.00 22.12  ? 21  GLY A C     1 
ATOM   121   O O     . GLY A 1 21  ? 18.003  62.171  22.862  1.00 23.37  ? 21  GLY A O     1 
ATOM   122   H H     . GLY A 1 21  ? 19.938  58.673  24.272  1.00 0.00   ? 21  GLY A H     1 
ATOM   123   N N     . ARG A 1 22  ? 18.421  61.438  24.951  1.00 23.82  ? 22  ARG A N     1 
ATOM   124   C CA    . ARG A 1 22  ? 18.003  62.660  25.627  1.00 26.22  ? 22  ARG A CA    1 
ATOM   125   C C     . ARG A 1 22  ? 18.891  63.818  25.213  1.00 31.31  ? 22  ARG A C     1 
ATOM   126   O O     . ARG A 1 22  ? 18.395  64.892  24.874  1.00 32.36  ? 22  ARG A O     1 
ATOM   127   C CB    . ARG A 1 22  ? 18.098  62.527  27.135  1.00 24.16  ? 22  ARG A CB    1 
ATOM   128   C CG    . ARG A 1 22  ? 16.987  61.730  27.778  1.00 25.41  ? 22  ARG A CG    1 
ATOM   129   C CD    . ARG A 1 22  ? 17.258  61.520  29.271  1.00 25.67  ? 22  ARG A CD    1 
ATOM   130   N NE    . ARG A 1 22  ? 17.000  62.688  30.102  1.00 29.13  ? 22  ARG A NE    1 
ATOM   131   C CZ    . ARG A 1 22  ? 17.308  62.709  31.413  1.00 36.05  ? 22  ARG A CZ    1 
ATOM   132   N NH1   . ARG A 1 22  ? 17.915  61.684  32.039  1.00 39.71  ? 22  ARG A NH1   1 
ATOM   133   N NH2   . ARG A 1 22  ? 17.011  63.801  32.121  1.00 35.31  ? 22  ARG A NH2   1 
ATOM   134   H H     . ARG A 1 22  ? 18.723  60.673  25.489  1.00 0.00   ? 22  ARG A H     1 
ATOM   135   H HE    . ARG A 1 22  ? 16.586  63.479  29.700  1.00 0.00   ? 22  ARG A HE    1 
ATOM   136   H HH11  . ARG A 1 22  ? 18.162  60.857  31.534  1.00 0.00   ? 22  ARG A HH11  1 
ATOM   137   H HH12  . ARG A 1 22  ? 18.125  61.753  33.014  1.00 0.00   ? 22  ARG A HH12  1 
ATOM   138   H HH21  . ARG A 1 22  ? 16.572  64.580  31.674  1.00 0.00   ? 22  ARG A HH21  1 
ATOM   139   H HH22  . ARG A 1 22  ? 17.234  63.845  33.094  1.00 0.00   ? 22  ARG A HH22  1 
ATOM   140   N N     . LYS A 1 23  ? 20.209  63.593  25.215  1.00 36.42  ? 23  LYS A N     1 
ATOM   141   C CA    . LYS A 1 23  ? 21.166  64.587  24.763  1.00 37.61  ? 23  LYS A CA    1 
ATOM   142   C C     . LYS A 1 23  ? 20.860  64.940  23.314  1.00 39.49  ? 23  LYS A C     1 
ATOM   143   O O     . LYS A 1 23  ? 20.854  66.113  22.935  1.00 40.41  ? 23  LYS A O     1 
ATOM   144   C CB    . LYS A 1 23  ? 22.603  64.071  24.813  1.00 38.55  ? 23  LYS A CB    1 
ATOM   145   C CG    . LYS A 1 23  ? 23.325  63.880  26.152  1.00 42.80  ? 23  LYS A CG    1 
ATOM   146   C CD    . LYS A 1 23  ? 24.819  63.720  25.790  1.00 46.82  ? 23  LYS A CD    1 
ATOM   147   C CE    . LYS A 1 23  ? 25.825  63.571  26.938  1.00 47.95  ? 23  LYS A CE    1 
ATOM   148   N NZ    . LYS A 1 23  ? 25.953  62.205  27.410  1.00 48.71  ? 23  LYS A NZ    1 
ATOM   149   H H     . LYS A 1 23  ? 20.532  62.723  25.535  1.00 0.00   ? 23  LYS A H     1 
ATOM   150   H HZ1   . LYS A 1 23  ? 25.025  61.870  27.740  1.00 0.00   ? 23  LYS A HZ1   1 
ATOM   151   H HZ2   . LYS A 1 23  ? 26.283  61.597  26.633  1.00 0.00   ? 23  LYS A HZ2   1 
ATOM   152   H HZ3   . LYS A 1 23  ? 26.636  62.171  28.194  1.00 0.00   ? 23  LYS A HZ3   1 
ATOM   153   N N     . ALA A 1 24  ? 20.573  63.912  22.505  1.00 40.76  ? 24  ALA A N     1 
ATOM   154   C CA    . ALA A 1 24  ? 20.259  64.094  21.096  1.00 42.82  ? 24  ALA A CA    1 
ATOM   155   C C     . ALA A 1 24  ? 18.910  64.735  20.802  1.00 44.98  ? 24  ALA A C     1 
ATOM   156   O O     . ALA A 1 24  ? 18.638  65.103  19.656  1.00 47.67  ? 24  ALA A O     1 
ATOM   157   C CB    . ALA A 1 24  ? 20.293  62.755  20.378  1.00 41.10  ? 24  ALA A CB    1 
ATOM   158   H H     . ALA A 1 24  ? 20.618  63.001  22.860  1.00 0.00   ? 24  ALA A H     1 
ATOM   159   N N     . ARG A 1 25  ? 18.058  64.864  21.826  1.00 45.16  ? 25  ARG A N     1 
ATOM   160   C CA    . ARG A 1 25  ? 16.722  65.436  21.724  1.00 46.50  ? 25  ARG A CA    1 
ATOM   161   C C     . ARG A 1 25  ? 15.879  64.793  20.625  1.00 43.38  ? 25  ARG A C     1 
ATOM   162   O O     . ARG A 1 25  ? 15.149  65.438  19.865  1.00 44.74  ? 25  ARG A O     1 
ATOM   163   C CB    . ARG A 1 25  ? 16.842  66.950  21.504  1.00 52.15  ? 25  ARG A CB    1 
ATOM   164   C CG    . ARG A 1 25  ? 17.367  67.711  22.712  1.00 62.54  ? 25  ARG A CG    1 
ATOM   165   C CD    . ARG A 1 25  ? 17.617  69.126  22.236  1.00 74.62  ? 25  ARG A CD    1 
ATOM   166   N NE    . ARG A 1 25  ? 17.809  70.075  23.322  1.00 83.87  ? 25  ARG A NE    1 
ATOM   167   C CZ    . ARG A 1 25  ? 17.749  71.402  23.113  1.00 88.85  ? 25  ARG A CZ    1 
ATOM   168   N NH1   . ARG A 1 25  ? 17.525  71.931  21.900  1.00 91.82  ? 25  ARG A NH1   1 
ATOM   169   N NH2   . ARG A 1 25  ? 17.911  72.232  24.143  1.00 92.05  ? 25  ARG A NH2   1 
ATOM   170   H H     . ARG A 1 25  ? 18.351  64.557  22.706  1.00 0.00   ? 25  ARG A H     1 
ATOM   171   H HE    . ARG A 1 25  ? 17.953  69.742  24.231  1.00 0.00   ? 25  ARG A HE    1 
ATOM   172   H HH11  . ARG A 1 25  ? 17.398  71.341  21.103  1.00 0.00   ? 25  ARG A HH11  1 
ATOM   173   H HH12  . ARG A 1 25  ? 17.484  72.923  21.792  1.00 0.00   ? 25  ARG A HH12  1 
ATOM   174   H HH21  . ARG A 1 25  ? 18.044  71.868  25.064  1.00 0.00   ? 25  ARG A HH21  1 
ATOM   175   H HH22  . ARG A 1 25  ? 17.845  73.219  24.001  1.00 0.00   ? 25  ARG A HH22  1 
ATOM   176   N N     . GLY A 1 26  ? 15.988  63.470  20.579  1.00 39.58  ? 26  GLY A N     1 
ATOM   177   C CA    . GLY A 1 26  ? 15.250  62.680  19.621  1.00 36.29  ? 26  GLY A CA    1 
ATOM   178   C C     . GLY A 1 26  ? 13.911  62.329  20.227  1.00 35.60  ? 26  GLY A C     1 
ATOM   179   O O     . GLY A 1 26  ? 13.783  62.290  21.458  1.00 37.81  ? 26  GLY A O     1 
ATOM   180   H H     . GLY A 1 26  ? 16.539  63.015  21.247  1.00 0.00   ? 26  GLY A H     1 
ATOM   181   N N     . THR A 1 27  ? 12.921  62.067  19.385  1.00 31.86  ? 27  THR A N     1 
ATOM   182   C CA    . THR A 1 27  ? 11.575  61.726  19.795  1.00 32.30  ? 27  THR A CA    1 
ATOM   183   C C     . THR A 1 27  ? 11.538  60.431  20.591  1.00 32.28  ? 27  THR A C     1 
ATOM   184   O O     . THR A 1 27  ? 10.663  60.199  21.433  1.00 34.25  ? 27  THR A O     1 
ATOM   185   C CB    . THR A 1 27  ? 10.657  61.579  18.557  1.00 32.48  ? 27  THR A CB    1 
ATOM   186   O OG1   . THR A 1 27  ? 11.173  60.556  17.718  1.00 35.26  ? 27  THR A OG1   1 
ATOM   187   C CG2   . THR A 1 27  ? 10.550  62.881  17.796  1.00 29.95  ? 27  THR A CG2   1 
ATOM   188   H H     . THR A 1 27  ? 13.141  62.009  18.429  1.00 0.00   ? 27  THR A H     1 
ATOM   189   H HG1   . THR A 1 27  ? 12.052  60.763  17.324  1.00 0.00   ? 27  THR A HG1   1 
ATOM   190   N N     . GLY A 1 28  ? 12.497  59.573  20.257  1.00 31.36  ? 28  GLY A N     1 
ATOM   191   C CA    . GLY A 1 28  ? 12.648  58.298  20.900  1.00 24.86  ? 28  GLY A CA    1 
ATOM   192   C C     . GLY A 1 28  ? 12.407  57.158  19.931  1.00 18.82  ? 28  GLY A C     1 
ATOM   193   O O     . GLY A 1 28  ? 12.300  56.005  20.359  1.00 13.77  ? 28  GLY A O     1 
ATOM   194   H H     . GLY A 1 28  ? 13.069  59.765  19.467  1.00 0.00   ? 28  GLY A H     1 
ATOM   195   N N     . GLU A 1 29  ? 12.409  57.419  18.629  1.00 18.17  ? 29  GLU A N     1 
ATOM   196   C CA    . GLU A 1 29  ? 12.107  56.391  17.657  1.00 16.13  ? 29  GLU A CA    1 
ATOM   197   C C     . GLU A 1 29  ? 13.350  55.538  17.520  1.00 15.90  ? 29  GLU A C     1 
ATOM   198   O O     . GLU A 1 29  ? 13.244  54.311  17.628  1.00 18.23  ? 29  GLU A O     1 
ATOM   199   C CB    . GLU A 1 29  ? 11.788  57.006  16.340  1.00 16.38  ? 29  GLU A CB    1 
ATOM   200   C CG    . GLU A 1 29  ? 10.427  56.589  15.871  1.00 24.79  ? 29  GLU A CG    1 
ATOM   201   C CD    . GLU A 1 29  ? 10.337  56.648  14.359  1.00 29.77  ? 29  GLU A CD    1 
ATOM   202   O OE1   . GLU A 1 29  ? 11.201  56.080  13.695  1.00 31.52  ? 29  GLU A OE1   1 
ATOM   203   O OE2   . GLU A 1 29  ? 9.401   57.253  13.840  1.00 37.68  ? 29  GLU A OE2   1 
ATOM   204   H H     . GLU A 1 29  ? 12.772  58.279  18.293  1.00 0.00   ? 29  GLU A H     1 
ATOM   205   N N     . LEU A 1 30  ? 14.544  56.134  17.386  1.00 6.76   ? 30  LEU A N     1 
ATOM   206   C CA    . LEU A 1 30  ? 15.745  55.347  17.239  1.00 6.70   ? 30  LEU A CA    1 
ATOM   207   C C     . LEU A 1 30  ? 15.998  54.599  18.536  1.00 11.31  ? 30  LEU A C     1 
ATOM   208   O O     . LEU A 1 30  ? 16.302  53.404  18.491  1.00 13.02  ? 30  LEU A O     1 
ATOM   209   C CB    . LEU A 1 30  ? 16.950  56.218  16.924  1.00 4.55   ? 30  LEU A CB    1 
ATOM   210   C CG    . LEU A 1 30  ? 18.289  55.495  16.755  1.00 5.53   ? 30  LEU A CG    1 
ATOM   211   C CD1   . LEU A 1 30  ? 18.289  54.596  15.539  1.00 2.00   ? 30  LEU A CD1   1 
ATOM   212   C CD2   . LEU A 1 30  ? 19.366  56.530  16.579  1.00 6.25   ? 30  LEU A CD2   1 
ATOM   213   H H     . LEU A 1 30  ? 14.573  57.129  17.328  1.00 0.00   ? 30  LEU A H     1 
ATOM   214   N N     . THR A 1 31  ? 15.842  55.238  19.700  1.00 10.18  ? 31  THR A N     1 
ATOM   215   C CA    . THR A 1 31  ? 16.002  54.541  20.979  1.00 9.59   ? 31  THR A CA    1 
ATOM   216   C C     . THR A 1 31  ? 15.132  53.280  21.089  1.00 11.53  ? 31  THR A C     1 
ATOM   217   O O     . THR A 1 31  ? 15.595  52.233  21.564  1.00 3.47   ? 31  THR A O     1 
ATOM   218   C CB    . THR A 1 31  ? 15.669  55.507  22.128  1.00 6.44   ? 31  THR A CB    1 
ATOM   219   O OG1   . THR A 1 31  ? 16.598  56.571  22.008  1.00 13.51  ? 31  THR A OG1   1 
ATOM   220   C CG2   . THR A 1 31  ? 15.816  54.904  23.515  1.00 7.06   ? 31  THR A CG2   1 
ATOM   221   H H     . THR A 1 31  ? 15.597  56.183  19.669  1.00 0.00   ? 31  THR A H     1 
ATOM   222   H HG1   . THR A 1 31  ? 16.427  57.143  21.258  1.00 0.00   ? 31  THR A HG1   1 
ATOM   223   N N     . GLN A 1 32  ? 13.881  53.339  20.592  1.00 14.72  ? 32  GLN A N     1 
ATOM   224   C CA    . GLN A 1 32  ? 13.027  52.166  20.616  1.00 18.87  ? 32  GLN A CA    1 
ATOM   225   C C     . GLN A 1 32  ? 13.626  51.108  19.706  1.00 19.61  ? 32  GLN A C     1 
ATOM   226   O O     . GLN A 1 32  ? 13.935  50.026  20.198  1.00 23.21  ? 32  GLN A O     1 
ATOM   227   C CB    . GLN A 1 32  ? 11.607  52.517  20.171  1.00 19.93  ? 32  GLN A CB    1 
ATOM   228   C CG    . GLN A 1 32  ? 10.756  53.117  21.289  1.00 23.63  ? 32  GLN A CG    1 
ATOM   229   C CD    . GLN A 1 32  ? 10.497  52.171  22.455  1.00 27.52  ? 32  GLN A CD    1 
ATOM   230   O OE1   . GLN A 1 32  ? 9.362   51.791  22.704  1.00 25.82  ? 32  GLN A OE1   1 
ATOM   231   N NE2   . GLN A 1 32  ? 11.465  51.753  23.270  1.00 27.44  ? 32  GLN A NE2   1 
ATOM   232   H H     . GLN A 1 32  ? 13.536  54.170  20.194  1.00 0.00   ? 32  GLN A H     1 
ATOM   233   H HE21  . GLN A 1 32  ? 11.185  51.154  23.987  1.00 0.00   ? 32  GLN A HE21  1 
ATOM   234   H HE22  . GLN A 1 32  ? 12.391  52.048  23.147  1.00 0.00   ? 32  GLN A HE22  1 
ATOM   235   N N     . LEU A 1 33  ? 13.899  51.416  18.442  1.00 18.73  ? 33  LEU A N     1 
ATOM   236   C CA    . LEU A 1 33  ? 14.581  50.530  17.503  1.00 17.14  ? 33  LEU A CA    1 
ATOM   237   C C     . LEU A 1 33  ? 15.774  49.800  18.112  1.00 15.83  ? 33  LEU A C     1 
ATOM   238   O O     . LEU A 1 33  ? 15.911  48.577  18.012  1.00 14.44  ? 33  LEU A O     1 
ATOM   239   C CB    . LEU A 1 33  ? 14.981  51.422  16.365  1.00 19.11  ? 33  LEU A CB    1 
ATOM   240   C CG    . LEU A 1 33  ? 15.797  50.960  15.216  1.00 18.18  ? 33  LEU A CG    1 
ATOM   241   C CD1   . LEU A 1 33  ? 15.129  49.853  14.444  1.00 17.90  ? 33  LEU A CD1   1 
ATOM   242   C CD2   . LEU A 1 33  ? 15.934  52.137  14.307  1.00 12.48  ? 33  LEU A CD2   1 
ATOM   243   H H     . LEU A 1 33  ? 13.614  52.299  18.120  1.00 0.00   ? 33  LEU A H     1 
ATOM   244   N N     . LEU A 1 34  ? 16.601  50.568  18.825  1.00 13.04  ? 34  LEU A N     1 
ATOM   245   C CA    . LEU A 1 34  ? 17.751  50.035  19.526  1.00 15.05  ? 34  LEU A CA    1 
ATOM   246   C C     . LEU A 1 34  ? 17.408  49.217  20.768  1.00 16.04  ? 34  LEU A C     1 
ATOM   247   O O     . LEU A 1 34  ? 18.098  48.232  21.049  1.00 14.62  ? 34  LEU A O     1 
ATOM   248   C CB    . LEU A 1 34  ? 18.692  51.187  19.913  1.00 14.66  ? 34  LEU A CB    1 
ATOM   249   C CG    . LEU A 1 34  ? 19.445  51.851  18.752  1.00 15.61  ? 34  LEU A CG    1 
ATOM   250   C CD1   . LEU A 1 34  ? 20.341  52.922  19.313  1.00 15.62  ? 34  LEU A CD1   1 
ATOM   251   C CD2   . LEU A 1 34  ? 20.273  50.822  17.970  1.00 8.99   ? 34  LEU A CD2   1 
ATOM   252   H H     . LEU A 1 34  ? 16.415  51.527  18.877  1.00 0.00   ? 34  LEU A H     1 
ATOM   253   N N     . ASN A 1 35  ? 16.350  49.542  21.531  1.00 17.24  ? 35  ASN A N     1 
ATOM   254   C CA    . ASN A 1 35  ? 15.975  48.792  22.718  1.00 14.55  ? 35  ASN A CA    1 
ATOM   255   C C     . ASN A 1 35  ? 15.330  47.504  22.238  1.00 16.29  ? 35  ASN A C     1 
ATOM   256   O O     . ASN A 1 35  ? 15.379  46.481  22.933  1.00 19.14  ? 35  ASN A O     1 
ATOM   257   C CB    . ASN A 1 35  ? 14.967  49.535  23.611  1.00 17.56  ? 35  ASN A CB    1 
ATOM   258   C CG    . ASN A 1 35  ? 15.438  50.770  24.398  1.00 26.55  ? 35  ASN A CG    1 
ATOM   259   O OD1   . ASN A 1 35  ? 14.712  51.772  24.509  1.00 27.06  ? 35  ASN A OD1   1 
ATOM   260   N ND2   . ASN A 1 35  ? 16.607  50.839  25.025  1.00 33.69  ? 35  ASN A ND2   1 
ATOM   261   H H     . ASN A 1 35  ? 15.797  50.300  21.242  1.00 0.00   ? 35  ASN A H     1 
ATOM   262   H HD21  . ASN A 1 35  ? 16.770  51.640  25.565  1.00 0.00   ? 35  ASN A HD21  1 
ATOM   263   H HD22  . ASN A 1 35  ? 17.243  50.099  24.964  1.00 0.00   ? 35  ASN A HD22  1 
ATOM   264   N N     . SER A 1 36  ? 14.756  47.505  21.033  1.00 17.74  ? 36  SER A N     1 
ATOM   265   C CA    . SER A 1 36  ? 14.186  46.333  20.402  1.00 17.41  ? 36  SER A CA    1 
ATOM   266   C C     . SER A 1 36  ? 15.306  45.429  19.936  1.00 18.32  ? 36  SER A C     1 
ATOM   267   O O     . SER A 1 36  ? 15.342  44.244  20.278  1.00 23.67  ? 36  SER A O     1 
ATOM   268   C CB    . SER A 1 36  ? 13.354  46.739  19.219  1.00 15.12  ? 36  SER A CB    1 
ATOM   269   O OG    . SER A 1 36  ? 12.330  47.638  19.618  1.00 20.28  ? 36  SER A OG    1 
ATOM   270   H H     . SER A 1 36  ? 14.651  48.347  20.550  1.00 0.00   ? 36  SER A H     1 
ATOM   271   H HG    . SER A 1 36  ? 11.489  47.202  19.438  1.00 0.00   ? 36  SER A HG    1 
ATOM   272   N N     . LEU A 1 37  ? 16.266  45.947  19.184  1.00 17.44  ? 37  LEU A N     1 
ATOM   273   C CA    . LEU A 1 37  ? 17.388  45.152  18.734  1.00 14.30  ? 37  LEU A CA    1 
ATOM   274   C C     . LEU A 1 37  ? 18.161  44.550  19.910  1.00 13.66  ? 37  LEU A C     1 
ATOM   275   O O     . LEU A 1 37  ? 18.542  43.383  19.871  1.00 13.19  ? 37  LEU A O     1 
ATOM   276   C CB    . LEU A 1 37  ? 18.200  46.078  17.901  1.00 11.09  ? 37  LEU A CB    1 
ATOM   277   C CG    . LEU A 1 37  ? 19.399  45.595  17.185  1.00 8.78   ? 37  LEU A CG    1 
ATOM   278   C CD1   . LEU A 1 37  ? 19.095  44.416  16.276  1.00 8.61   ? 37  LEU A CD1   1 
ATOM   279   C CD2   . LEU A 1 37  ? 19.889  46.780  16.396  1.00 11.97  ? 37  LEU A CD2   1 
ATOM   280   H H     . LEU A 1 37  ? 16.197  46.885  18.905  1.00 0.00   ? 37  LEU A H     1 
ATOM   281   N N     . CYS A 1 38  ? 18.368  45.278  21.004  1.00 15.09  ? 38  CYS A N     1 
ATOM   282   C CA    . CYS A 1 38  ? 18.986  44.701  22.185  1.00 15.29  ? 38  CYS A CA    1 
ATOM   283   C C     . CYS A 1 38  ? 18.176  43.498  22.700  1.00 13.76  ? 38  CYS A C     1 
ATOM   284   O O     . CYS A 1 38  ? 18.802  42.501  23.069  1.00 13.26  ? 38  CYS A O     1 
ATOM   285   C CB    . CYS A 1 38  ? 19.124  45.844  23.211  1.00 16.61  ? 38  CYS A CB    1 
ATOM   286   S SG    . CYS A 1 38  ? 19.274  45.444  24.983  1.00 28.07  ? 38  CYS A SG    1 
ATOM   287   H H     . CYS A 1 38  ? 18.147  46.233  20.985  1.00 0.00   ? 38  CYS A H     1 
ATOM   288   N N     . THR A 1 39  ? 16.828  43.450  22.761  1.00 16.10  ? 39  THR A N     1 
ATOM   289   C CA    . THR A 1 39  ? 16.118  42.219  23.162  1.00 14.20  ? 39  THR A CA    1 
ATOM   290   C C     . THR A 1 39  ? 16.293  41.079  22.134  1.00 12.97  ? 39  THR A C     1 
ATOM   291   O O     . THR A 1 39  ? 16.556  39.922  22.495  1.00 18.04  ? 39  THR A O     1 
ATOM   292   C CB    . THR A 1 39  ? 14.608  42.507  23.343  1.00 14.91  ? 39  THR A CB    1 
ATOM   293   O OG1   . THR A 1 39  ? 14.437  43.526  24.321  1.00 13.31  ? 39  THR A OG1   1 
ATOM   294   C CG2   . THR A 1 39  ? 13.875  41.264  23.793  1.00 16.78  ? 39  THR A CG2   1 
ATOM   295   H H     . THR A 1 39  ? 16.292  44.243  22.549  1.00 0.00   ? 39  THR A H     1 
ATOM   296   H HG1   . THR A 1 39  ? 14.861  43.216  25.128  1.00 0.00   ? 39  THR A HG1   1 
ATOM   297   N N     . ALA A 1 40  ? 16.209  41.371  20.833  1.00 10.18  ? 40  ALA A N     1 
ATOM   298   C CA    . ALA A 1 40  ? 16.390  40.384  19.780  1.00 7.13   ? 40  ALA A CA    1 
ATOM   299   C C     . ALA A 1 40  ? 17.733  39.691  19.925  1.00 6.16   ? 40  ALA A C     1 
ATOM   300   O O     . ALA A 1 40  ? 17.849  38.475  19.831  1.00 13.05  ? 40  ALA A O     1 
ATOM   301   C CB    . ALA A 1 40  ? 16.327  41.073  18.422  1.00 2.00   ? 40  ALA A CB    1 
ATOM   302   H H     . ALA A 1 40  ? 16.043  42.303  20.573  1.00 0.00   ? 40  ALA A H     1 
ATOM   303   N N     . VAL A 1 41  ? 18.752  40.440  20.278  1.00 4.73   ? 41  VAL A N     1 
ATOM   304   C CA    . VAL A 1 41  ? 20.087  39.917  20.457  1.00 5.72   ? 41  VAL A CA    1 
ATOM   305   C C     . VAL A 1 41  ? 20.151  39.047  21.700  1.00 8.74   ? 41  VAL A C     1 
ATOM   306   O O     . VAL A 1 41  ? 20.783  37.993  21.629  1.00 12.09  ? 41  VAL A O     1 
ATOM   307   C CB    . VAL A 1 41  ? 21.080  41.102  20.550  1.00 7.07   ? 41  VAL A CB    1 
ATOM   308   C CG1   . VAL A 1 41  ? 22.455  40.642  21.037  1.00 4.34   ? 41  VAL A CG1   1 
ATOM   309   C CG2   . VAL A 1 41  ? 21.197  41.731  19.162  1.00 4.22   ? 41  VAL A CG2   1 
ATOM   310   H H     . VAL A 1 41  ? 18.608  41.401  20.402  1.00 0.00   ? 41  VAL A H     1 
ATOM   311   N N     . LYS A 1 42  ? 19.546  39.362  22.853  1.00 6.14   ? 42  LYS A N     1 
ATOM   312   C CA    . LYS A 1 42  ? 19.617  38.444  23.989  1.00 2.00   ? 42  LYS A CA    1 
ATOM   313   C C     . LYS A 1 42  ? 18.947  37.103  23.693  1.00 6.48   ? 42  LYS A C     1 
ATOM   314   O O     . LYS A 1 42  ? 19.372  36.018  24.111  1.00 8.82   ? 42  LYS A O     1 
ATOM   315   C CB    . LYS A 1 42  ? 18.958  39.070  25.169  1.00 2.89   ? 42  LYS A CB    1 
ATOM   316   C CG    . LYS A 1 42  ? 19.719  40.324  25.503  1.00 4.30   ? 42  LYS A CG    1 
ATOM   317   C CD    . LYS A 1 42  ? 19.204  40.975  26.762  1.00 5.98   ? 42  LYS A CD    1 
ATOM   318   C CE    . LYS A 1 42  ? 17.816  41.549  26.636  1.00 6.32   ? 42  LYS A CE    1 
ATOM   319   N NZ    . LYS A 1 42  ? 17.383  42.105  27.920  1.00 7.81   ? 42  LYS A NZ    1 
ATOM   320   H H     . LYS A 1 42  ? 19.063  40.215  22.924  1.00 0.00   ? 42  LYS A H     1 
ATOM   321   H HZ1   . LYS A 1 42  ? 18.053  42.842  28.221  1.00 0.00   ? 42  LYS A HZ1   1 
ATOM   322   H HZ2   . LYS A 1 42  ? 16.436  42.519  27.819  1.00 0.00   ? 42  LYS A HZ2   1 
ATOM   323   H HZ3   . LYS A 1 42  ? 17.355  41.349  28.633  1.00 0.00   ? 42  LYS A HZ3   1 
ATOM   324   N N     . ALA A 1 43  ? 17.899  37.149  22.883  1.00 10.56  ? 43  ALA A N     1 
ATOM   325   C CA    . ALA A 1 43  ? 17.137  35.972  22.558  1.00 6.36   ? 43  ALA A CA    1 
ATOM   326   C C     . ALA A 1 43  ? 17.954  35.148  21.611  1.00 8.48   ? 43  ALA A C     1 
ATOM   327   O O     . ALA A 1 43  ? 18.010  33.922  21.767  1.00 14.23  ? 43  ALA A O     1 
ATOM   328   C CB    . ALA A 1 43  ? 15.838  36.367  21.897  1.00 10.05  ? 43  ALA A CB    1 
ATOM   329   H H     . ALA A 1 43  ? 17.613  38.021  22.530  1.00 0.00   ? 43  ALA A H     1 
ATOM   330   N N     . ILE A 1 44  ? 18.633  35.773  20.649  1.00 9.44   ? 44  ILE A N     1 
ATOM   331   C CA    . ILE A 1 44  ? 19.492  35.005  19.766  1.00 8.05   ? 44  ILE A CA    1 
ATOM   332   C C     . ILE A 1 44  ? 20.645  34.417  20.566  1.00 9.03   ? 44  ILE A C     1 
ATOM   333   O O     . ILE A 1 44  ? 20.953  33.229  20.384  1.00 11.60  ? 44  ILE A O     1 
ATOM   334   C CB    . ILE A 1 44  ? 20.062  35.854  18.627  1.00 5.55   ? 44  ILE A CB    1 
ATOM   335   C CG1   . ILE A 1 44  ? 18.932  36.412  17.771  1.00 5.95   ? 44  ILE A CG1   1 
ATOM   336   C CG2   . ILE A 1 44  ? 20.926  34.969  17.731  1.00 5.78   ? 44  ILE A CG2   1 
ATOM   337   C CD1   . ILE A 1 44  ? 19.397  37.518  16.805  1.00 4.90   ? 44  ILE A CD1   1 
ATOM   338   H H     . ILE A 1 44  ? 18.528  36.741  20.519  1.00 0.00   ? 44  ILE A H     1 
ATOM   339   N N     . SER A 1 45  ? 21.236  35.155  21.496  1.00 5.80   ? 45  SER A N     1 
ATOM   340   C CA    . SER A 1 45  ? 22.305  34.603  22.295  1.00 7.51   ? 45  SER A CA    1 
ATOM   341   C C     . SER A 1 45  ? 21.852  33.351  23.013  1.00 8.85   ? 45  SER A C     1 
ATOM   342   O O     . SER A 1 45  ? 22.484  32.297  22.895  1.00 16.58  ? 45  SER A O     1 
ATOM   343   C CB    . SER A 1 45  ? 22.755  35.608  23.307  1.00 4.79   ? 45  SER A CB    1 
ATOM   344   O OG    . SER A 1 45  ? 24.140  35.396  23.555  1.00 11.74  ? 45  SER A OG    1 
ATOM   345   H H     . SER A 1 45  ? 21.003  36.102  21.591  1.00 0.00   ? 45  SER A H     1 
ATOM   346   H HG    . SER A 1 45  ? 24.429  35.940  24.297  1.00 0.00   ? 45  SER A HG    1 
ATOM   347   N N     . SER A 1 46  ? 20.685  33.421  23.641  1.00 9.40   ? 46  SER A N     1 
ATOM   348   C CA    . SER A 1 46  ? 20.108  32.323  24.390  1.00 7.88   ? 46  SER A CA    1 
ATOM   349   C C     . SER A 1 46  ? 19.950  31.080  23.540  1.00 8.36   ? 46  SER A C     1 
ATOM   350   O O     . SER A 1 46  ? 20.213  29.965  23.989  1.00 12.09  ? 46  SER A O     1 
ATOM   351   C CB    . SER A 1 46  ? 18.771  32.804  24.920  1.00 12.57  ? 46  SER A CB    1 
ATOM   352   O OG    . SER A 1 46  ? 17.851  31.841  25.423  1.00 11.59  ? 46  SER A OG    1 
ATOM   353   H H     . SER A 1 46  ? 20.184  34.264  23.615  1.00 0.00   ? 46  SER A H     1 
ATOM   354   H HG    . SER A 1 46  ? 18.280  31.332  26.134  1.00 0.00   ? 46  SER A HG    1 
ATOM   355   N N     . ALA A 1 47  ? 19.577  31.255  22.281  1.00 7.68   ? 47  ALA A N     1 
ATOM   356   C CA    . ALA A 1 47  ? 19.345  30.121  21.426  1.00 6.25   ? 47  ALA A CA    1 
ATOM   357   C C     . ALA A 1 47  ? 20.676  29.556  20.964  1.00 7.05   ? 47  ALA A C     1 
ATOM   358   O O     . ALA A 1 47  ? 20.863  28.331  20.973  1.00 9.26   ? 47  ALA A O     1 
ATOM   359   C CB    . ALA A 1 47  ? 18.501  30.555  20.227  1.00 2.00   ? 47  ALA A CB    1 
ATOM   360   H H     . ALA A 1 47  ? 19.488  32.164  21.921  1.00 0.00   ? 47  ALA A H     1 
ATOM   361   N N     . VAL A 1 48  ? 21.642  30.411  20.621  1.00 9.12   ? 48  VAL A N     1 
ATOM   362   C CA    . VAL A 1 48  ? 22.956  29.980  20.142  1.00 4.39   ? 48  VAL A CA    1 
ATOM   363   C C     . VAL A 1 48  ? 23.666  29.107  21.165  1.00 2.90   ? 48  VAL A C     1 
ATOM   364   O O     . VAL A 1 48  ? 24.307  28.114  20.820  1.00 2.00   ? 48  VAL A O     1 
ATOM   365   C CB    . VAL A 1 48  ? 23.749  31.258  19.787  1.00 5.20   ? 48  VAL A CB    1 
ATOM   366   C CG1   . VAL A 1 48  ? 25.227  30.968  19.555  1.00 9.35   ? 48  VAL A CG1   1 
ATOM   367   C CG2   . VAL A 1 48  ? 23.171  31.837  18.486  1.00 6.93   ? 48  VAL A CG2   1 
ATOM   368   H H     . VAL A 1 48  ? 21.479  31.374  20.722  1.00 0.00   ? 48  VAL A H     1 
ATOM   369   N N     . ARG A 1 49  ? 23.476  29.460  22.432  1.00 2.93   ? 49  ARG A N     1 
ATOM   370   C CA    . ARG A 1 49  ? 23.999  28.717  23.560  1.00 2.74   ? 49  ARG A CA    1 
ATOM   371   C C     . ARG A 1 49  ? 23.266  27.411  23.865  1.00 9.81   ? 49  ARG A C     1 
ATOM   372   O O     . ARG A 1 49  ? 23.597  26.691  24.826  1.00 10.95  ? 49  ARG A O     1 
ATOM   373   C CB    . ARG A 1 49  ? 23.941  29.598  24.764  1.00 2.00   ? 49  ARG A CB    1 
ATOM   374   C CG    . ARG A 1 49  ? 25.198  30.392  25.035  1.00 2.00   ? 49  ARG A CG    1 
ATOM   375   C CD    . ARG A 1 49  ? 25.512  31.327  23.918  1.00 8.40   ? 49  ARG A CD    1 
ATOM   376   N NE    . ARG A 1 49  ? 26.341  32.415  24.400  1.00 12.55  ? 49  ARG A NE    1 
ATOM   377   C CZ    . ARG A 1 49  ? 27.629  32.500  24.122  1.00 2.63   ? 49  ARG A CZ    1 
ATOM   378   N NH1   . ARG A 1 49  ? 28.249  31.556  23.414  1.00 4.76   ? 49  ARG A NH1   1 
ATOM   379   N NH2   . ARG A 1 49  ? 28.284  33.553  24.590  1.00 8.15   ? 49  ARG A NH2   1 
ATOM   380   H H     . ARG A 1 49  ? 23.032  30.319  22.602  1.00 0.00   ? 49  ARG A H     1 
ATOM   381   H HE    . ARG A 1 49  ? 25.931  33.111  24.956  1.00 0.00   ? 49  ARG A HE    1 
ATOM   382   H HH11  . ARG A 1 49  ? 27.742  30.759  23.095  1.00 0.00   ? 49  ARG A HH11  1 
ATOM   383   H HH12  . ARG A 1 49  ? 29.225  31.634  23.216  1.00 0.00   ? 49  ARG A HH12  1 
ATOM   384   H HH21  . ARG A 1 49  ? 27.802  34.245  25.128  1.00 0.00   ? 49  ARG A HH21  1 
ATOM   385   H HH22  . ARG A 1 49  ? 29.261  33.656  24.402  1.00 0.00   ? 49  ARG A HH22  1 
ATOM   386   N N     . LYS A 1 50  ? 22.226  27.142  23.054  1.00 8.83   ? 50  LYS A N     1 
ATOM   387   C CA    . LYS A 1 50  ? 21.400  25.951  23.069  1.00 9.90   ? 50  LYS A CA    1 
ATOM   388   C C     . LYS A 1 50  ? 20.583  25.767  24.350  1.00 8.03   ? 50  LYS A C     1 
ATOM   389   O O     . LYS A 1 50  ? 20.250  24.664  24.798  1.00 6.47   ? 50  LYS A O     1 
ATOM   390   C CB    . LYS A 1 50  ? 22.316  24.717  22.781  1.00 10.31  ? 50  LYS A CB    1 
ATOM   391   C CG    . LYS A 1 50  ? 23.048  24.701  21.424  1.00 13.19  ? 50  LYS A CG    1 
ATOM   392   C CD    . LYS A 1 50  ? 22.014  24.551  20.320  1.00 20.54  ? 50  LYS A CD    1 
ATOM   393   C CE    . LYS A 1 50  ? 22.522  24.852  18.916  1.00 18.76  ? 50  LYS A CE    1 
ATOM   394   N NZ    . LYS A 1 50  ? 23.344  23.787  18.394  1.00 34.26  ? 50  LYS A NZ    1 
ATOM   395   H H     . LYS A 1 50  ? 22.015  27.810  22.381  1.00 0.00   ? 50  LYS A H     1 
ATOM   396   H HZ1   . LYS A 1 50  ? 24.169  23.648  19.013  1.00 0.00   ? 50  LYS A HZ1   1 
ATOM   397   H HZ2   . LYS A 1 50  ? 22.788  22.908  18.354  1.00 0.00   ? 50  LYS A HZ2   1 
ATOM   398   H HZ3   . LYS A 1 50  ? 23.667  24.036  17.437  1.00 0.00   ? 50  LYS A HZ3   1 
ATOM   399   N N     . ALA A 1 51  ? 20.156  26.868  24.961  1.00 10.58  ? 51  ALA A N     1 
ATOM   400   C CA    . ALA A 1 51  ? 19.292  26.778  26.124  1.00 13.82  ? 51  ALA A CA    1 
ATOM   401   C C     . ALA A 1 51  ? 17.985  26.158  25.635  1.00 15.46  ? 51  ALA A C     1 
ATOM   402   O O     . ALA A 1 51  ? 17.265  26.695  24.795  1.00 21.25  ? 51  ALA A O     1 
ATOM   403   C CB    . ALA A 1 51  ? 18.987  28.146  26.692  1.00 13.86  ? 51  ALA A CB    1 
ATOM   404   H H     . ALA A 1 51  ? 20.325  27.751  24.565  1.00 0.00   ? 51  ALA A H     1 
ATOM   405   N N     . GLY A 1 52  ? 17.768  24.918  26.018  1.00 12.76  ? 52  GLY A N     1 
ATOM   406   C CA    . GLY A 1 52  ? 16.531  24.265  25.665  1.00 16.14  ? 52  GLY A CA    1 
ATOM   407   C C     . GLY A 1 52  ? 16.716  22.969  24.888  1.00 18.54  ? 52  GLY A C     1 
ATOM   408   O O     . GLY A 1 52  ? 15.724  22.234  24.785  1.00 15.32  ? 52  GLY A O     1 
ATOM   409   H H     . GLY A 1 52  ? 18.537  24.406  26.326  1.00 0.00   ? 52  GLY A H     1 
ATOM   410   N N     . ILE A 1 53  ? 17.944  22.603  24.418  1.00 19.05  ? 53  ILE A N     1 
ATOM   411   C CA    . ILE A 1 53  ? 18.066  21.404  23.589  1.00 18.68  ? 53  ILE A CA    1 
ATOM   412   C C     . ILE A 1 53  ? 17.694  20.100  24.237  1.00 15.77  ? 53  ILE A C     1 
ATOM   413   O O     . ILE A 1 53  ? 17.393  19.142  23.526  1.00 18.03  ? 53  ILE A O     1 
ATOM   414   C CB    . ILE A 1 53  ? 19.482  21.151  22.967  1.00 22.38  ? 53  ILE A CB    1 
ATOM   415   C CG1   . ILE A 1 53  ? 20.628  21.530  23.849  1.00 20.57  ? 53  ILE A CG1   1 
ATOM   416   C CG2   . ILE A 1 53  ? 19.463  21.862  21.641  1.00 26.50  ? 53  ILE A CG2   1 
ATOM   417   C CD1   . ILE A 1 53  ? 21.052  20.375  24.761  1.00 26.30  ? 53  ILE A CD1   1 
ATOM   418   H H     . ILE A 1 53  ? 18.719  23.196  24.538  1.00 0.00   ? 53  ILE A H     1 
ATOM   419   N N     . ALA A 1 54  ? 17.636  20.031  25.562  1.00 13.00  ? 54  ALA A N     1 
ATOM   420   C CA    . ALA A 1 54  ? 17.177  18.830  26.246  1.00 13.50  ? 54  ALA A CA    1 
ATOM   421   C C     . ALA A 1 54  ? 15.782  18.492  25.758  1.00 15.43  ? 54  ALA A C     1 
ATOM   422   O O     . ALA A 1 54  ? 15.412  17.325  25.598  1.00 19.48  ? 54  ALA A O     1 
ATOM   423   C CB    . ALA A 1 54  ? 17.108  19.060  27.731  1.00 12.45  ? 54  ALA A CB    1 
ATOM   424   H H     . ALA A 1 54  ? 17.951  20.788  26.082  1.00 0.00   ? 54  ALA A H     1 
ATOM   425   N N     . HIS A 1 55  ? 14.971  19.506  25.465  1.00 14.96  ? 55  HIS A N     1 
ATOM   426   C CA    . HIS A 1 55  ? 13.645  19.242  24.947  1.00 16.07  ? 55  HIS A CA    1 
ATOM   427   C C     . HIS A 1 55  ? 13.673  18.674  23.542  1.00 16.17  ? 55  HIS A C     1 
ATOM   428   O O     . HIS A 1 55  ? 12.810  17.850  23.226  1.00 17.44  ? 55  HIS A O     1 
ATOM   429   C CB    . HIS A 1 55  ? 12.810  20.523  24.991  1.00 14.61  ? 55  HIS A CB    1 
ATOM   430   C CG    . HIS A 1 55  ? 12.252  20.726  26.397  1.00 17.97  ? 55  HIS A CG    1 
ATOM   431   N ND1   . HIS A 1 55  ? 11.297  19.962  26.931  1.00 22.35  ? 55  HIS A ND1   1 
ATOM   432   C CD2   . HIS A 1 55  ? 12.687  21.592  27.365  1.00 20.97  ? 55  HIS A CD2   1 
ATOM   433   C CE1   . HIS A 1 55  ? 11.158  20.308  28.191  1.00 20.45  ? 55  HIS A CE1   1 
ATOM   434   N NE2   . HIS A 1 55  ? 11.999  21.280  28.440  1.00 23.01  ? 55  HIS A NE2   1 
ATOM   435   H H     . HIS A 1 55  ? 15.302  20.426  25.550  1.00 0.00   ? 55  HIS A H     1 
ATOM   436   H HD1   . HIS A 1 55  ? 10.714  19.341  26.445  1.00 0.00   ? 55  HIS A HD1   1 
ATOM   437   H HE2   . HIS A 1 55  ? 12.136  21.689  29.336  1.00 0.00   ? 55  HIS A HE2   1 
ATOM   438   N N     . LEU A 1 56  ? 14.671  19.015  22.721  1.00 16.47  ? 56  LEU A N     1 
ATOM   439   C CA    . LEU A 1 56  ? 14.787  18.474  21.366  1.00 14.85  ? 56  LEU A CA    1 
ATOM   440   C C     . LEU A 1 56  ? 15.230  17.025  21.364  1.00 13.64  ? 56  LEU A C     1 
ATOM   441   O O     . LEU A 1 56  ? 15.088  16.317  20.369  1.00 13.69  ? 56  LEU A O     1 
ATOM   442   C CB    . LEU A 1 56  ? 15.822  19.149  20.528  1.00 15.21  ? 56  LEU A CB    1 
ATOM   443   C CG    . LEU A 1 56  ? 15.516  20.230  19.579  1.00 17.64  ? 56  LEU A CG    1 
ATOM   444   C CD1   . LEU A 1 56  ? 15.250  21.559  20.281  1.00 22.23  ? 56  LEU A CD1   1 
ATOM   445   C CD2   . LEU A 1 56  ? 16.734  20.319  18.679  1.00 20.45  ? 56  LEU A CD2   1 
ATOM   446   H H     . LEU A 1 56  ? 15.397  19.577  23.055  1.00 0.00   ? 56  LEU A H     1 
ATOM   447   N N     . TYR A 1 57  ? 15.856  16.582  22.445  1.00 12.81  ? 57  TYR A N     1 
ATOM   448   C CA    . TYR A 1 57  ? 16.342  15.227  22.492  1.00 15.80  ? 57  TYR A CA    1 
ATOM   449   C C     . TYR A 1 57  ? 15.480  14.357  23.380  1.00 16.82  ? 57  TYR A C     1 
ATOM   450   O O     . TYR A 1 57  ? 15.887  13.313  23.890  1.00 24.30  ? 57  TYR A O     1 
ATOM   451   C CB    . TYR A 1 57  ? 17.802  15.249  22.954  1.00 10.15  ? 57  TYR A CB    1 
ATOM   452   C CG    . TYR A 1 57  ? 18.735  15.784  21.872  1.00 12.15  ? 57  TYR A CG    1 
ATOM   453   C CD1   . TYR A 1 57  ? 18.768  17.134  21.575  1.00 13.36  ? 57  TYR A CD1   1 
ATOM   454   C CD2   . TYR A 1 57  ? 19.516  14.908  21.140  1.00 7.44   ? 57  TYR A CD2   1 
ATOM   455   C CE1   . TYR A 1 57  ? 19.523  17.607  20.525  1.00 14.25  ? 57  TYR A CE1   1 
ATOM   456   C CE2   . TYR A 1 57  ? 20.277  15.380  20.086  1.00 8.78   ? 57  TYR A CE2   1 
ATOM   457   C CZ    . TYR A 1 57  ? 20.271  16.720  19.779  1.00 13.96  ? 57  TYR A CZ    1 
ATOM   458   O OH    . TYR A 1 57  ? 21.014  17.176  18.702  1.00 16.40  ? 57  TYR A OH    1 
ATOM   459   H H     . TYR A 1 57  ? 16.027  17.179  23.203  1.00 0.00   ? 57  TYR A H     1 
ATOM   460   H HH    . TYR A 1 57  ? 21.145  18.133  18.813  1.00 0.00   ? 57  TYR A HH    1 
ATOM   461   N N     . GLY A 1 58  ? 14.237  14.791  23.525  1.00 20.36  ? 58  GLY A N     1 
ATOM   462   C CA    . GLY A 1 58  ? 13.194  14.038  24.195  1.00 18.82  ? 58  GLY A CA    1 
ATOM   463   C C     . GLY A 1 58  ? 13.274  13.967  25.700  1.00 16.91  ? 58  GLY A C     1 
ATOM   464   O O     . GLY A 1 58  ? 12.933  12.929  26.267  1.00 22.72  ? 58  GLY A O     1 
ATOM   465   H H     . GLY A 1 58  ? 13.980  15.644  23.124  1.00 0.00   ? 58  GLY A H     1 
ATOM   466   N N     . ILE A 1 59  ? 13.717  15.019  26.395  1.00 18.31  ? 59  ILE A N     1 
ATOM   467   C CA    . ILE A 1 59  ? 13.722  14.962  27.852  1.00 18.53  ? 59  ILE A CA    1 
ATOM   468   C C     . ILE A 1 59  ? 12.299  14.837  28.361  1.00 22.23  ? 59  ILE A C     1 
ATOM   469   O O     . ILE A 1 59  ? 12.039  14.171  29.353  1.00 23.92  ? 59  ILE A O     1 
ATOM   470   C CB    . ILE A 1 59  ? 14.391  16.222  28.459  1.00 16.62  ? 59  ILE A CB    1 
ATOM   471   C CG1   . ILE A 1 59  ? 14.496  16.001  29.957  1.00 15.90  ? 59  ILE A CG1   1 
ATOM   472   C CG2   . ILE A 1 59  ? 13.620  17.494  28.151  1.00 12.49  ? 59  ILE A CG2   1 
ATOM   473   C CD1   . ILE A 1 59  ? 14.889  17.256  30.741  1.00 17.12  ? 59  ILE A CD1   1 
ATOM   474   H H     . ILE A 1 59  ? 14.150  15.760  25.922  1.00 0.00   ? 59  ILE A H     1 
ATOM   475   N N     . ALA A 1 60  ? 11.358  15.436  27.632  1.00 28.64  ? 60  ALA A N     1 
ATOM   476   C CA    . ALA A 1 60  ? 9.971   15.448  28.049  1.00 32.40  ? 60  ALA A CA    1 
ATOM   477   C C     . ALA A 1 60  ? 9.180   14.308  27.422  1.00 38.19  ? 60  ALA A C     1 
ATOM   478   O O     . ALA A 1 60  ? 7.974   14.197  27.666  1.00 37.61  ? 60  ALA A O     1 
ATOM   479   C CB    . ALA A 1 60  ? 9.353   16.778  27.651  1.00 27.98  ? 60  ALA A CB    1 
ATOM   480   H H     . ALA A 1 60  ? 11.564  15.701  26.716  1.00 0.00   ? 60  ALA A H     1 
ATOM   481   N N     . GLY A 1 61  ? 9.882   13.437  26.693  1.00 42.36  ? 61  GLY A N     1 
ATOM   482   C CA    . GLY A 1 61  ? 9.286   12.371  25.913  1.00 46.62  ? 61  GLY A CA    1 
ATOM   483   C C     . GLY A 1 61  ? 9.319   12.753  24.436  1.00 50.31  ? 61  GLY A C     1 
ATOM   484   O O     . GLY A 1 61  ? 9.677   13.892  24.124  1.00 53.22  ? 61  GLY A O     1 
ATOM   485   H H     . GLY A 1 61  ? 10.845  13.525  26.587  1.00 0.00   ? 61  GLY A H     1 
ATOM   486   N N     . VAL A 1 70  ? 14.461  22.236  16.044  1.00 50.54  ? 70  VAL A N     1 
ATOM   487   C CA    . VAL A 1 70  ? 13.246  23.032  16.018  1.00 47.30  ? 70  VAL A CA    1 
ATOM   488   C C     . VAL A 1 70  ? 13.540  23.837  14.745  1.00 45.24  ? 70  VAL A C     1 
ATOM   489   O O     . VAL A 1 70  ? 14.069  23.188  13.832  1.00 44.60  ? 70  VAL A O     1 
ATOM   490   C CB    . VAL A 1 70  ? 13.190  23.800  17.421  1.00 47.34  ? 70  VAL A CB    1 
ATOM   491   C CG1   . VAL A 1 70  ? 14.445  24.628  17.694  1.00 49.29  ? 70  VAL A CG1   1 
ATOM   492   C CG2   . VAL A 1 70  ? 11.958  24.697  17.442  1.00 46.56  ? 70  VAL A CG2   1 
ATOM   493   N N     . LYS A 1 71  ? 13.277  25.132  14.547  1.00 40.30  ? 71  LYS A N     1 
ATOM   494   C CA    . LYS A 1 71  ? 13.738  25.810  13.350  1.00 35.01  ? 71  LYS A CA    1 
ATOM   495   C C     . LYS A 1 71  ? 15.254  25.826  13.351  1.00 32.84  ? 71  LYS A C     1 
ATOM   496   O O     . LYS A 1 71  ? 15.889  25.732  14.408  1.00 36.75  ? 71  LYS A O     1 
ATOM   497   C CB    . LYS A 1 71  ? 13.245  27.238  13.310  1.00 31.44  ? 71  LYS A CB    1 
ATOM   498   C CG    . LYS A 1 71  ? 11.832  27.293  12.810  1.00 31.16  ? 71  LYS A CG    1 
ATOM   499   C CD    . LYS A 1 71  ? 11.425  28.744  12.616  1.00 37.08  ? 71  LYS A CD    1 
ATOM   500   C CE    . LYS A 1 71  ? 10.040  28.787  11.981  1.00 42.49  ? 71  LYS A CE    1 
ATOM   501   N NZ    . LYS A 1 71  ? 9.600   30.153  11.788  1.00 42.62  ? 71  LYS A NZ    1 
ATOM   502   H H     . LYS A 1 71  ? 12.803  25.655  15.214  1.00 0.00   ? 71  LYS A H     1 
ATOM   503   H HZ1   . LYS A 1 71  ? 10.273  30.656  11.175  1.00 0.00   ? 71  LYS A HZ1   1 
ATOM   504   H HZ2   . LYS A 1 71  ? 8.658   30.158  11.347  1.00 0.00   ? 71  LYS A HZ2   1 
ATOM   505   H HZ3   . LYS A 1 71  ? 9.552   30.635  12.708  1.00 0.00   ? 71  LYS A HZ3   1 
ATOM   506   N N     . LYS A 1 72  ? 15.849  25.834  12.173  1.00 29.07  ? 72  LYS A N     1 
ATOM   507   C CA    . LYS A 1 72  ? 17.284  25.990  12.071  1.00 26.85  ? 72  LYS A CA    1 
ATOM   508   C C     . LYS A 1 72  ? 17.623  27.375  12.644  1.00 22.08  ? 72  LYS A C     1 
ATOM   509   O O     . LYS A 1 72  ? 16.915  28.359  12.391  1.00 16.97  ? 72  LYS A O     1 
ATOM   510   C CB    . LYS A 1 72  ? 17.651  25.862  10.601  1.00 34.28  ? 72  LYS A CB    1 
ATOM   511   C CG    . LYS A 1 72  ? 19.043  25.310  10.260  1.00 39.33  ? 72  LYS A CG    1 
ATOM   512   C CD    . LYS A 1 72  ? 19.151  23.777  10.232  1.00 42.29  ? 72  LYS A CD    1 
ATOM   513   C CE    . LYS A 1 72  ? 19.219  23.080  11.589  1.00 44.26  ? 72  LYS A CE    1 
ATOM   514   N NZ    . LYS A 1 72  ? 19.196  21.641  11.410  1.00 42.52  ? 72  LYS A NZ    1 
ATOM   515   H H     . LYS A 1 72  ? 15.289  25.710  11.377  1.00 0.00   ? 72  LYS A H     1 
ATOM   516   H HZ1   . LYS A 1 72  ? 18.317  21.371  10.923  1.00 0.00   ? 72  LYS A HZ1   1 
ATOM   517   H HZ2   . LYS A 1 72  ? 20.012  21.349  10.836  1.00 0.00   ? 72  LYS A HZ2   1 
ATOM   518   H HZ3   . LYS A 1 72  ? 19.236  21.172  12.337  1.00 0.00   ? 72  LYS A HZ3   1 
ATOM   519   N N     . LEU A 1 73  ? 18.722  27.509  13.387  1.00 23.18  ? 73  LEU A N     1 
ATOM   520   C CA    . LEU A 1 73  ? 19.051  28.736  14.095  1.00 19.00  ? 73  LEU A CA    1 
ATOM   521   C C     . LEU A 1 73  ? 19.018  30.008  13.289  1.00 19.85  ? 73  LEU A C     1 
ATOM   522   O O     . LEU A 1 73  ? 18.364  30.970  13.697  1.00 22.33  ? 73  LEU A O     1 
ATOM   523   C CB    . LEU A 1 73  ? 20.408  28.596  14.731  1.00 19.25  ? 73  LEU A CB    1 
ATOM   524   C CG    . LEU A 1 73  ? 20.425  28.677  16.245  1.00 20.88  ? 73  LEU A CG    1 
ATOM   525   C CD1   . LEU A 1 73  ? 19.449  27.661  16.792  1.00 27.27  ? 73  LEU A CD1   1 
ATOM   526   C CD2   . LEU A 1 73  ? 21.811  28.368  16.787  1.00 21.84  ? 73  LEU A CD2   1 
ATOM   527   H H     . LEU A 1 73  ? 19.308  26.725  13.503  1.00 0.00   ? 73  LEU A H     1 
ATOM   528   N N     . ASP A 1 74  ? 19.598  30.009  12.096  1.00 16.74  ? 74  ASP A N     1 
ATOM   529   C CA    . ASP A 1 74  ? 19.538  31.181  11.251  1.00 16.13  ? 74  ASP A CA    1 
ATOM   530   C C     . ASP A 1 74  ? 18.107  31.573  10.833  1.00 16.20  ? 74  ASP A C     1 
ATOM   531   O O     . ASP A 1 74  ? 17.860  32.739  10.526  1.00 16.63  ? 74  ASP A O     1 
ATOM   532   C CB    . ASP A 1 74  ? 20.450  30.908  10.050  1.00 19.27  ? 74  ASP A CB    1 
ATOM   533   C CG    . ASP A 1 74  ? 20.084  29.733  9.146   1.00 25.47  ? 74  ASP A CG    1 
ATOM   534   O OD1   . ASP A 1 74  ? 19.702  28.677  9.644   1.00 31.40  ? 74  ASP A OD1   1 
ATOM   535   O OD2   . ASP A 1 74  ? 20.189  29.879  7.930   1.00 27.43  ? 74  ASP A OD2   1 
ATOM   536   H H     . ASP A 1 74  ? 20.093  29.212  11.820  1.00 0.00   ? 74  ASP A H     1 
ATOM   537   N N     . VAL A 1 75  ? 17.116  30.677  10.838  1.00 16.49  ? 75  VAL A N     1 
ATOM   538   C CA    . VAL A 1 75  ? 15.734  31.012  10.474  1.00 13.89  ? 75  VAL A CA    1 
ATOM   539   C C     . VAL A 1 75  ? 15.116  31.712  11.683  1.00 13.43  ? 75  VAL A C     1 
ATOM   540   O O     . VAL A 1 75  ? 14.495  32.770  11.560  1.00 14.20  ? 75  VAL A O     1 
ATOM   541   C CB    . VAL A 1 75  ? 14.950  29.715  10.125  1.00 13.67  ? 75  VAL A CB    1 
ATOM   542   C CG1   . VAL A 1 75  ? 13.504  30.011  9.781   1.00 8.82   ? 75  VAL A CG1   1 
ATOM   543   C CG2   . VAL A 1 75  ? 15.569  29.076  8.903   1.00 12.43  ? 75  VAL A CG2   1 
ATOM   544   H H     . VAL A 1 75  ? 17.319  29.771  11.137  1.00 0.00   ? 75  VAL A H     1 
ATOM   545   N N     . LEU A 1 76  ? 15.383  31.145  12.863  1.00 13.29  ? 76  LEU A N     1 
ATOM   546   C CA    . LEU A 1 76  ? 14.926  31.668  14.129  1.00 10.56  ? 76  LEU A CA    1 
ATOM   547   C C     . LEU A 1 76  ? 15.494  33.060  14.409  1.00 12.35  ? 76  LEU A C     1 
ATOM   548   O O     . LEU A 1 76  ? 14.740  33.958  14.790  1.00 16.20  ? 76  LEU A O     1 
ATOM   549   C CB    . LEU A 1 76  ? 15.336  30.701  15.245  1.00 8.12   ? 76  LEU A CB    1 
ATOM   550   C CG    . LEU A 1 76  ? 14.914  31.098  16.657  1.00 5.14   ? 76  LEU A CG    1 
ATOM   551   C CD1   . LEU A 1 76  ? 13.408  31.156  16.668  1.00 11.16  ? 76  LEU A CD1   1 
ATOM   552   C CD2   . LEU A 1 76  ? 15.367  30.102  17.705  1.00 2.00   ? 76  LEU A CD2   1 
ATOM   553   H H     . LEU A 1 76  ? 15.966  30.355  12.874  1.00 0.00   ? 76  LEU A H     1 
ATOM   554   N N     . SER A 1 77  ? 16.796  33.311  14.269  1.00 13.22  ? 77  SER A N     1 
ATOM   555   C CA    . SER A 1 77  ? 17.391  34.628  14.480  1.00 10.85  ? 77  SER A CA    1 
ATOM   556   C C     . SER A 1 77  ? 16.840  35.668  13.527  1.00 11.07  ? 77  SER A C     1 
ATOM   557   O O     . SER A 1 77  ? 16.574  36.792  13.949  1.00 14.51  ? 77  SER A O     1 
ATOM   558   C CB    . SER A 1 77  ? 18.867  34.554  14.282  1.00 7.72   ? 77  SER A CB    1 
ATOM   559   O OG    . SER A 1 77  ? 19.381  33.429  14.977  1.00 14.09  ? 77  SER A OG    1 
ATOM   560   H H     . SER A 1 77  ? 17.410  32.575  14.062  1.00 0.00   ? 77  SER A H     1 
ATOM   561   H HG    . SER A 1 77  ? 19.346  33.588  15.924  1.00 0.00   ? 77  SER A HG    1 
ATOM   562   N N     . ASN A 1 78  ? 16.630  35.321  12.255  1.00 12.75  ? 78  ASN A N     1 
ATOM   563   C CA    . ASN A 1 78  ? 16.006  36.218  11.298  1.00 12.63  ? 78  ASN A CA    1 
ATOM   564   C C     . ASN A 1 78  ? 14.600  36.549  11.765  1.00 10.62  ? 78  ASN A C     1 
ATOM   565   O O     . ASN A 1 78  ? 14.189  37.700  11.708  1.00 10.16  ? 78  ASN A O     1 
ATOM   566   C CB    . ASN A 1 78  ? 15.901  35.580  9.934   1.00 15.42  ? 78  ASN A CB    1 
ATOM   567   C CG    . ASN A 1 78  ? 15.266  36.509  8.915   1.00 15.36  ? 78  ASN A CG    1 
ATOM   568   O OD1   . ASN A 1 78  ? 15.807  37.547  8.569   1.00 18.66  ? 78  ASN A OD1   1 
ATOM   569   N ND2   . ASN A 1 78  ? 14.110  36.181  8.373   1.00 18.38  ? 78  ASN A ND2   1 
ATOM   570   H H     . ASN A 1 78  ? 16.885  34.420  11.951  1.00 0.00   ? 78  ASN A H     1 
ATOM   571   H HD21  . ASN A 1 78  ? 13.671  36.805  7.762   1.00 0.00   ? 78  ASN A HD21  1 
ATOM   572   H HD22  . ASN A 1 78  ? 13.722  35.317  8.639   1.00 0.00   ? 78  ASN A HD22  1 
ATOM   573   N N     . ASP A 1 79  ? 13.846  35.580  12.276  1.00 9.15   ? 79  ASP A N     1 
ATOM   574   C CA    . ASP A 1 79  ? 12.507  35.866  12.767  1.00 10.36  ? 79  ASP A CA    1 
ATOM   575   C C     . ASP A 1 79  ? 12.524  36.726  14.015  1.00 10.13  ? 79  ASP A C     1 
ATOM   576   O O     . ASP A 1 79  ? 11.801  37.714  14.030  1.00 13.17  ? 79  ASP A O     1 
ATOM   577   C CB    . ASP A 1 79  ? 11.737  34.594  13.100  1.00 14.67  ? 79  ASP A CB    1 
ATOM   578   C CG    . ASP A 1 79  ? 11.385  33.649  11.953  1.00 12.82  ? 79  ASP A CG    1 
ATOM   579   O OD1   . ASP A 1 79  ? 11.343  34.045  10.782  1.00 18.65  ? 79  ASP A OD1   1 
ATOM   580   O OD2   . ASP A 1 79  ? 11.143  32.489  12.265  1.00 10.59  ? 79  ASP A OD2   1 
ATOM   581   H H     . ASP A 1 79  ? 14.188  34.663  12.305  1.00 0.00   ? 79  ASP A H     1 
ATOM   582   N N     . LEU A 1 80  ? 13.321  36.441  15.042  1.00 8.12   ? 80  LEU A N     1 
ATOM   583   C CA    . LEU A 1 80  ? 13.406  37.273  16.237  1.00 8.87   ? 80  LEU A CA    1 
ATOM   584   C C     . LEU A 1 80  ? 13.820  38.703  15.920  1.00 9.73   ? 80  LEU A C     1 
ATOM   585   O O     . LEU A 1 80  ? 13.208  39.634  16.452  1.00 15.55  ? 80  LEU A O     1 
ATOM   586   C CB    . LEU A 1 80  ? 14.423  36.725  17.214  1.00 4.03   ? 80  LEU A CB    1 
ATOM   587   C CG    . LEU A 1 80  ? 14.143  35.418  17.916  1.00 4.98   ? 80  LEU A CG    1 
ATOM   588   C CD1   . LEU A 1 80  ? 15.423  34.723  18.320  1.00 2.12   ? 80  LEU A CD1   1 
ATOM   589   C CD2   . LEU A 1 80  ? 13.323  35.725  19.150  1.00 5.94   ? 80  LEU A CD2   1 
ATOM   590   H H     . LEU A 1 80  ? 13.841  35.619  14.999  1.00 0.00   ? 80  LEU A H     1 
ATOM   591   N N     . VAL A 1 81  ? 14.787  38.923  15.031  1.00 9.84   ? 81  VAL A N     1 
ATOM   592   C CA    . VAL A 1 81  ? 15.248  40.272  14.729  1.00 13.21  ? 81  VAL A CA    1 
ATOM   593   C C     . VAL A 1 81  ? 14.154  40.965  13.950  1.00 10.90  ? 81  VAL A C     1 
ATOM   594   O O     . VAL A 1 81  ? 13.714  42.054  14.323  1.00 16.57  ? 81  VAL A O     1 
ATOM   595   C CB    . VAL A 1 81  ? 16.577  40.333  13.884  1.00 11.25  ? 81  VAL A CB    1 
ATOM   596   C CG1   . VAL A 1 81  ? 17.024  41.785  13.718  1.00 4.93   ? 81  VAL A CG1   1 
ATOM   597   C CG2   . VAL A 1 81  ? 17.722  39.663  14.595  1.00 5.36   ? 81  VAL A CG2   1 
ATOM   598   H H     . VAL A 1 81  ? 15.233  38.156  14.592  1.00 0.00   ? 81  VAL A H     1 
ATOM   599   N N     . MET A 1 82  ? 13.652  40.329  12.904  1.00 9.20   ? 82  MET A N     1 
ATOM   600   C CA    . MET A 1 82  ? 12.630  40.976  12.112  1.00 11.32  ? 82  MET A CA    1 
ATOM   601   C C     . MET A 1 82  ? 11.348  41.233  12.894  1.00 12.13  ? 82  MET A C     1 
ATOM   602   O O     . MET A 1 82  ? 10.790  42.334  12.807  1.00 15.89  ? 82  MET A O     1 
ATOM   603   C CB    . MET A 1 82  ? 12.387  40.110  10.923  1.00 13.49  ? 82  MET A CB    1 
ATOM   604   C CG    . MET A 1 82  ? 11.948  41.083  9.874   1.00 21.05  ? 82  MET A CG    1 
ATOM   605   S SD    . MET A 1 82  ? 12.523  40.465  8.293   1.00 28.35  ? 82  MET A SD    1 
ATOM   606   C CE    . MET A 1 82  ? 13.702  41.704  7.873   1.00 26.24  ? 82  MET A CE    1 
ATOM   607   H H     . MET A 1 82  ? 13.947  39.424  12.662  1.00 0.00   ? 82  MET A H     1 
ATOM   608   N N     . ASN A 1 83  ? 10.895  40.332  13.752  1.00 13.83  ? 83  ASN A N     1 
ATOM   609   C CA    . ASN A 1 83  ? 9.686   40.553  14.521  1.00 18.49  ? 83  ASN A CA    1 
ATOM   610   C C     . ASN A 1 83  ? 9.846   41.691  15.515  1.00 17.37  ? 83  ASN A C     1 
ATOM   611   O O     . ASN A 1 83  ? 8.948   42.521  15.631  1.00 20.01  ? 83  ASN A O     1 
ATOM   612   C CB    . ASN A 1 83  ? 9.238   39.345  15.363  1.00 19.60  ? 83  ASN A CB    1 
ATOM   613   C CG    . ASN A 1 83  ? 7.839   39.642  15.898  1.00 27.18  ? 83  ASN A CG    1 
ATOM   614   O OD1   . ASN A 1 83  ? 7.607   40.004  17.055  1.00 30.55  ? 83  ASN A OD1   1 
ATOM   615   N ND2   . ASN A 1 83  ? 6.855   39.547  15.017  1.00 30.85  ? 83  ASN A ND2   1 
ATOM   616   H H     . ASN A 1 83  ? 11.424  39.521  13.886  1.00 0.00   ? 83  ASN A H     1 
ATOM   617   H HD21  . ASN A 1 83  ? 5.963   39.858  15.288  1.00 0.00   ? 83  ASN A HD21  1 
ATOM   618   H HD22  . ASN A 1 83  ? 7.056   39.196  14.126  1.00 0.00   ? 83  ASN A HD22  1 
ATOM   619   N N     . MET A 1 84  ? 10.985  41.811  16.178  1.00 19.96  ? 84  MET A N     1 
ATOM   620   C CA    . MET A 1 84  ? 11.214  42.871  17.139  1.00 19.36  ? 84  MET A CA    1 
ATOM   621   C C     . MET A 1 84  ? 11.394  44.218  16.469  1.00 16.99  ? 84  MET A C     1 
ATOM   622   O O     . MET A 1 84  ? 11.066  45.271  17.019  1.00 16.50  ? 84  MET A O     1 
ATOM   623   C CB    . MET A 1 84  ? 12.452  42.560  17.958  1.00 15.80  ? 84  MET A CB    1 
ATOM   624   C CG    . MET A 1 84  ? 12.286  41.395  18.915  1.00 20.42  ? 84  MET A CG    1 
ATOM   625   S SD    . MET A 1 84  ? 10.890  41.578  20.052  1.00 25.46  ? 84  MET A SD    1 
ATOM   626   C CE    . MET A 1 84  ? 11.570  42.779  21.156  1.00 22.44  ? 84  MET A CE    1 
ATOM   627   H H     . MET A 1 84  ? 11.689  41.133  16.049  1.00 0.00   ? 84  MET A H     1 
ATOM   628   N N     . LEU A 1 85  ? 11.947  44.217  15.264  1.00 18.34  ? 85  LEU A N     1 
ATOM   629   C CA    . LEU A 1 85  ? 12.134  45.459  14.553  1.00 17.96  ? 85  LEU A CA    1 
ATOM   630   C C     . LEU A 1 85  ? 10.815  45.931  14.027  1.00 13.47  ? 85  LEU A C     1 
ATOM   631   O O     . LEU A 1 85  ? 10.560  47.119  14.124  1.00 12.93  ? 85  LEU A O     1 
ATOM   632   C CB    . LEU A 1 85  ? 13.133  45.305  13.398  1.00 16.88  ? 85  LEU A CB    1 
ATOM   633   C CG    . LEU A 1 85  ? 14.583  45.176  13.825  1.00 18.42  ? 85  LEU A CG    1 
ATOM   634   C CD1   . LEU A 1 85  ? 15.447  45.207  12.595  1.00 20.79  ? 85  LEU A CD1   1 
ATOM   635   C CD2   . LEU A 1 85  ? 14.996  46.322  14.730  1.00 15.07  ? 85  LEU A CD2   1 
ATOM   636   H H     . LEU A 1 85  ? 12.267  43.373  14.881  1.00 0.00   ? 85  LEU A H     1 
ATOM   637   N N     . LYS A 1 86  ? 9.926   45.071  13.526  1.00 18.97  ? 86  LYS A N     1 
ATOM   638   C CA    . LYS A 1 86  ? 8.613   45.505  13.080  1.00 16.44  ? 86  LYS A CA    1 
ATOM   639   C C     . LYS A 1 86  ? 7.850   46.024  14.278  1.00 18.80  ? 86  LYS A C     1 
ATOM   640   O O     . LYS A 1 86  ? 7.352   47.149  14.227  1.00 21.18  ? 86  LYS A O     1 
ATOM   641   C CB    . LYS A 1 86  ? 7.828   44.362  12.494  1.00 18.05  ? 86  LYS A CB    1 
ATOM   642   C CG    . LYS A 1 86  ? 8.253   43.964  11.118  1.00 17.58  ? 86  LYS A CG    1 
ATOM   643   C CD    . LYS A 1 86  ? 7.407   42.762  10.815  1.00 26.93  ? 86  LYS A CD    1 
ATOM   644   C CE    . LYS A 1 86  ? 7.209   42.707  9.310   1.00 34.29  ? 86  LYS A CE    1 
ATOM   645   N NZ    . LYS A 1 86  ? 6.199   41.716  8.981   1.00 36.23  ? 86  LYS A NZ    1 
ATOM   646   H H     . LYS A 1 86  ? 10.181  44.128  13.444  1.00 0.00   ? 86  LYS A H     1 
ATOM   647   H HZ1   . LYS A 1 86  ? 5.302   41.967  9.442   1.00 0.00   ? 86  LYS A HZ1   1 
ATOM   648   H HZ2   . LYS A 1 86  ? 6.066   41.690  7.950   1.00 0.00   ? 86  LYS A HZ2   1 
ATOM   649   H HZ3   . LYS A 1 86  ? 6.511   40.782  9.315   1.00 0.00   ? 86  LYS A HZ3   1 
ATOM   650   N N     . SER A 1 87  ? 7.797   45.303  15.409  1.00 19.32  ? 87  SER A N     1 
ATOM   651   C CA    . SER A 1 87  ? 7.033   45.793  16.543  1.00 21.92  ? 87  SER A CA    1 
ATOM   652   C C     . SER A 1 87  ? 7.587   47.061  17.196  1.00 21.07  ? 87  SER A C     1 
ATOM   653   O O     . SER A 1 87  ? 6.931   47.611  18.075  1.00 25.88  ? 87  SER A O     1 
ATOM   654   C CB    . SER A 1 87  ? 6.921   44.664  17.544  1.00 20.23  ? 87  SER A CB    1 
ATOM   655   O OG    . SER A 1 87  ? 8.153   43.991  17.714  1.00 31.85  ? 87  SER A OG    1 
ATOM   656   H H     . SER A 1 87  ? 8.316   44.476  15.534  1.00 0.00   ? 87  SER A H     1 
ATOM   657   H HG    . SER A 1 87  ? 8.011   43.036  17.622  1.00 0.00   ? 87  SER A HG    1 
ATOM   658   N N     . SER A 1 88  ? 8.735   47.618  16.793  1.00 20.77  ? 88  SER A N     1 
ATOM   659   C CA    . SER A 1 88  ? 9.248   48.844  17.391  1.00 16.73  ? 88  SER A CA    1 
ATOM   660   C C     . SER A 1 88  ? 8.562   50.115  16.926  1.00 17.94  ? 88  SER A C     1 
ATOM   661   O O     . SER A 1 88  ? 8.734   51.169  17.539  1.00 16.31  ? 88  SER A O     1 
ATOM   662   C CB    . SER A 1 88  ? 10.726  49.023  17.086  1.00 21.34  ? 88  SER A CB    1 
ATOM   663   O OG    . SER A 1 88  ? 10.969  49.243  15.695  1.00 16.99  ? 88  SER A OG    1 
ATOM   664   H H     . SER A 1 88  ? 9.257   47.180  16.093  1.00 0.00   ? 88  SER A H     1 
ATOM   665   H HG    . SER A 1 88  ? 10.926  48.384  15.281  1.00 0.00   ? 88  SER A HG    1 
ATOM   666   N N     . PHE A 1 89  ? 7.855   50.054  15.785  1.00 20.32  ? 89  PHE A N     1 
ATOM   667   C CA    . PHE A 1 89  ? 7.227   51.203  15.153  1.00 23.49  ? 89  PHE A CA    1 
ATOM   668   C C     . PHE A 1 89  ? 8.259   52.273  14.789  1.00 27.71  ? 89  PHE A C     1 
ATOM   669   O O     . PHE A 1 89  ? 7.976   53.473  14.691  1.00 34.24  ? 89  PHE A O     1 
ATOM   670   C CB    . PHE A 1 89  ? 6.154   51.825  16.069  1.00 26.73  ? 89  PHE A CB    1 
ATOM   671   C CG    . PHE A 1 89  ? 4.947   50.935  16.349  1.00 30.45  ? 89  PHE A CG    1 
ATOM   672   C CD1   . PHE A 1 89  ? 4.964   50.033  17.402  1.00 35.43  ? 89  PHE A CD1   1 
ATOM   673   C CD2   . PHE A 1 89  ? 3.804   51.058  15.582  1.00 32.97  ? 89  PHE A CD2   1 
ATOM   674   C CE1   . PHE A 1 89  ? 3.842   49.278  17.693  1.00 35.43  ? 89  PHE A CE1   1 
ATOM   675   C CE2   . PHE A 1 89  ? 2.683   50.308  15.886  1.00 32.69  ? 89  PHE A CE2   1 
ATOM   676   C CZ    . PHE A 1 89  ? 2.696   49.423  16.942  1.00 34.30  ? 89  PHE A CZ    1 
ATOM   677   H H     . PHE A 1 89  ? 7.748   49.184  15.342  1.00 0.00   ? 89  PHE A H     1 
ATOM   678   N N     . ALA A 1 90  ? 9.501   51.852  14.567  1.00 25.91  ? 90  ALA A N     1 
ATOM   679   C CA    . ALA A 1 90  ? 10.547  52.764  14.186  1.00 22.57  ? 90  ALA A CA    1 
ATOM   680   C C     . ALA A 1 90  ? 11.120  52.484  12.807  1.00 21.35  ? 90  ALA A C     1 
ATOM   681   O O     . ALA A 1 90  ? 11.892  53.307  12.301  1.00 21.12  ? 90  ALA A O     1 
ATOM   682   C CB    . ALA A 1 90  ? 11.667  52.697  15.194  1.00 23.60  ? 90  ALA A CB    1 
ATOM   683   H H     . ALA A 1 90  ? 9.722   50.910  14.715  1.00 0.00   ? 90  ALA A H     1 
ATOM   684   N N     . THR A 1 91  ? 10.726  51.400  12.139  1.00 19.37  ? 91  THR A N     1 
ATOM   685   C CA    . THR A 1 91  ? 11.269  51.020  10.851  1.00 16.53  ? 91  THR A CA    1 
ATOM   686   C C     . THR A 1 91  ? 10.287  51.163  9.712   1.00 16.40  ? 91  THR A C     1 
ATOM   687   O O     . THR A 1 91  ? 9.089   51.270  9.950   1.00 19.36  ? 91  THR A O     1 
ATOM   688   C CB    . THR A 1 91  ? 11.712  49.594  10.902  1.00 14.97  ? 91  THR A CB    1 
ATOM   689   O OG1   . THR A 1 91  ? 10.649  48.896  11.542  1.00 18.43  ? 91  THR A OG1   1 
ATOM   690   C CG2   . THR A 1 91  ? 13.042  49.428  11.581  1.00 15.19  ? 91  THR A CG2   1 
ATOM   691   H H     . THR A 1 91  ? 9.979   50.848  12.452  1.00 0.00   ? 91  THR A H     1 
ATOM   692   H HG1   . THR A 1 91  ? 10.941  48.470  12.356  1.00 0.00   ? 91  THR A HG1   1 
ATOM   693   N N     . CYS A 1 92  ? 10.774  51.241  8.481   1.00 15.54  ? 92  CYS A N     1 
ATOM   694   C CA    . CYS A 1 92  ? 9.922   51.246  7.316   1.00 17.18  ? 92  CYS A CA    1 
ATOM   695   C C     . CYS A 1 92  ? 10.499  50.273  6.305   1.00 16.62  ? 92  CYS A C     1 
ATOM   696   O O     . CYS A 1 92  ? 9.760   49.569  5.613   1.00 17.16  ? 92  CYS A O     1 
ATOM   697   C CB    . CYS A 1 92  ? 9.828   52.651  6.718   1.00 14.27  ? 92  CYS A CB    1 
ATOM   698   S SG    . CYS A 1 92  ? 11.399  53.400  6.231   1.00 20.34  ? 92  CYS A SG    1 
ATOM   699   H H     . CYS A 1 92  ? 11.739  51.366  8.377   1.00 0.00   ? 92  CYS A H     1 
ATOM   700   N N     . VAL A 1 93  ? 11.809  50.156  6.180   1.00 19.50  ? 93  VAL A N     1 
ATOM   701   C CA    . VAL A 1 93  ? 12.366  49.184  5.262   1.00 19.87  ? 93  VAL A CA    1 
ATOM   702   C C     . VAL A 1 93  ? 13.332  48.416  6.146   1.00 19.59  ? 93  VAL A C     1 
ATOM   703   O O     . VAL A 1 93  ? 14.015  49.020  6.993   1.00 18.92  ? 93  VAL A O     1 
ATOM   704   C CB    . VAL A 1 93  ? 13.118  49.882  4.087   1.00 23.06  ? 93  VAL A CB    1 
ATOM   705   C CG1   . VAL A 1 93  ? 13.485  48.832  3.057   1.00 21.68  ? 93  VAL A CG1   1 
ATOM   706   C CG2   . VAL A 1 93  ? 12.253  50.919  3.379   1.00 21.65  ? 93  VAL A CG2   1 
ATOM   707   H H     . VAL A 1 93  ? 12.422  50.650  6.762   1.00 0.00   ? 93  VAL A H     1 
ATOM   708   N N     . LEU A 1 94  ? 13.352  47.090  5.994   1.00 22.86  ? 94  LEU A N     1 
ATOM   709   C CA    . LEU A 1 94  ? 14.262  46.179  6.686   1.00 22.52  ? 94  LEU A CA    1 
ATOM   710   C C     . LEU A 1 94  ? 14.926  45.348  5.586   1.00 23.88  ? 94  LEU A C     1 
ATOM   711   O O     . LEU A 1 94  ? 14.196  44.950  4.667   1.00 21.96  ? 94  LEU A O     1 
ATOM   712   C CB    . LEU A 1 94  ? 13.515  45.202  7.574   1.00 22.90  ? 94  LEU A CB    1 
ATOM   713   C CG    . LEU A 1 94  ? 12.518  45.692  8.581   1.00 18.67  ? 94  LEU A CG    1 
ATOM   714   C CD1   . LEU A 1 94  ? 11.669  44.543  9.050   1.00 21.77  ? 94  LEU A CD1   1 
ATOM   715   C CD2   . LEU A 1 94  ? 13.246  46.338  9.721   1.00 18.52  ? 94  LEU A CD2   1 
ATOM   716   H H     . LEU A 1 94  ? 12.727  46.691  5.347   1.00 0.00   ? 94  LEU A H     1 
ATOM   717   N N     . VAL A 1 95  ? 16.237  45.039  5.605   1.00 21.77  ? 95  VAL A N     1 
ATOM   718   C CA    . VAL A 1 95  ? 16.890  44.196  4.608   1.00 18.77  ? 95  VAL A CA    1 
ATOM   719   C C     . VAL A 1 95  ? 17.637  43.156  5.435   1.00 22.76  ? 95  VAL A C     1 
ATOM   720   O O     . VAL A 1 95  ? 18.396  43.474  6.368   1.00 19.51  ? 95  VAL A O     1 
ATOM   721   C CB    . VAL A 1 95  ? 17.915  44.974  3.752   1.00 19.24  ? 95  VAL A CB    1 
ATOM   722   C CG1   . VAL A 1 95  ? 18.615  44.042  2.769   1.00 15.73  ? 95  VAL A CG1   1 
ATOM   723   C CG2   . VAL A 1 95  ? 17.205  46.054  2.966   1.00 20.92  ? 95  VAL A CG2   1 
ATOM   724   H H     . VAL A 1 95  ? 16.789  45.325  6.364   1.00 0.00   ? 95  VAL A H     1 
ATOM   725   N N     . SER A 1 96  ? 17.416  41.896  5.091   1.00 21.24  ? 96  SER A N     1 
ATOM   726   C CA    . SER A 1 96  ? 18.026  40.803  5.792   1.00 19.02  ? 96  SER A CA    1 
ATOM   727   C C     . SER A 1 96  ? 18.748  39.996  4.769   1.00 23.83  ? 96  SER A C     1 
ATOM   728   O O     . SER A 1 96  ? 18.385  39.934  3.590   1.00 26.63  ? 96  SER A O     1 
ATOM   729   C CB    . SER A 1 96  ? 17.009  39.902  6.438   1.00 20.84  ? 96  SER A CB    1 
ATOM   730   O OG    . SER A 1 96  ? 17.618  38.730  6.964   1.00 12.36  ? 96  SER A OG    1 
ATOM   731   H H     . SER A 1 96  ? 16.895  41.707  4.284   1.00 0.00   ? 96  SER A H     1 
ATOM   732   H HG    . SER A 1 96  ? 17.112  38.523  7.767   1.00 0.00   ? 96  SER A HG    1 
ATOM   733   N N     . GLU A 1 97  ? 19.752  39.330  5.313   1.00 26.31  ? 97  GLU A N     1 
ATOM   734   C CA    . GLU A 1 97  ? 20.556  38.403  4.568   1.00 30.75  ? 97  GLU A CA    1 
ATOM   735   C C     . GLU A 1 97  ? 19.653  37.259  4.108   1.00 34.77  ? 97  GLU A C     1 
ATOM   736   O O     . GLU A 1 97  ? 19.776  36.799  2.973   1.00 37.22  ? 97  GLU A O     1 
ATOM   737   C CB    . GLU A 1 97  ? 21.668  37.940  5.497   1.00 31.79  ? 97  GLU A CB    1 
ATOM   738   C CG    . GLU A 1 97  ? 22.830  37.137  4.904   1.00 43.56  ? 97  GLU A CG    1 
ATOM   739   C CD    . GLU A 1 97  ? 22.643  35.630  4.680   1.00 49.78  ? 97  GLU A CD    1 
ATOM   740   O OE1   . GLU A 1 97  ? 21.956  34.971  5.467   1.00 51.64  ? 97  GLU A OE1   1 
ATOM   741   O OE2   . GLU A 1 97  ? 23.213  35.109  3.716   1.00 50.74  ? 97  GLU A OE2   1 
ATOM   742   H H     . GLU A 1 97  ? 19.941  39.500  6.260   1.00 0.00   ? 97  GLU A H     1 
ATOM   743   N N     . GLU A 1 98  ? 18.678  36.826  4.921   1.00 36.13  ? 98  GLU A N     1 
ATOM   744   C CA    . GLU A 1 98  ? 17.836  35.681  4.575   1.00 37.07  ? 98  GLU A CA    1 
ATOM   745   C C     . GLU A 1 98  ? 16.769  35.944  3.526   1.00 36.37  ? 98  GLU A C     1 
ATOM   746   O O     . GLU A 1 98  ? 16.171  35.009  2.997   1.00 37.20  ? 98  GLU A O     1 
ATOM   747   C CB    . GLU A 1 98  ? 17.099  35.138  5.797   1.00 35.88  ? 98  GLU A CB    1 
ATOM   748   C CG    . GLU A 1 98  ? 17.961  34.747  6.994   1.00 41.47  ? 98  GLU A CG    1 
ATOM   749   C CD    . GLU A 1 98  ? 18.874  33.532  6.867   1.00 41.99  ? 98  GLU A CD    1 
ATOM   750   O OE1   . GLU A 1 98  ? 18.565  32.594  6.124   1.00 37.85  ? 98  GLU A OE1   1 
ATOM   751   O OE2   . GLU A 1 98  ? 19.906  33.537  7.542   1.00 46.04  ? 98  GLU A OE2   1 
ATOM   752   H H     . GLU A 1 98  ? 18.494  37.323  5.749   1.00 0.00   ? 98  GLU A H     1 
ATOM   753   N N     . ASP A 1 99  ? 16.488  37.201  3.204   1.00 40.10  ? 99  ASP A N     1 
ATOM   754   C CA    . ASP A 1 99  ? 15.358  37.530  2.357   1.00 41.93  ? 99  ASP A CA    1 
ATOM   755   C C     . ASP A 1 99  ? 15.811  38.149  1.061   1.00 41.83  ? 99  ASP A C     1 
ATOM   756   O O     . ASP A 1 99  ? 16.539  39.147  1.063   1.00 40.62  ? 99  ASP A O     1 
ATOM   757   C CB    . ASP A 1 99  ? 14.434  38.519  3.057   1.00 47.33  ? 99  ASP A CB    1 
ATOM   758   C CG    . ASP A 1 99  ? 13.658  37.992  4.258   1.00 52.01  ? 99  ASP A CG    1 
ATOM   759   O OD1   . ASP A 1 99  ? 14.219  37.901  5.353   1.00 54.37  ? 99  ASP A OD1   1 
ATOM   760   O OD2   . ASP A 1 99  ? 12.474  37.698  4.095   1.00 56.82  ? 99  ASP A OD2   1 
ATOM   761   H H     . ASP A 1 99  ? 17.124  37.908  3.440   1.00 0.00   ? 99  ASP A H     1 
ATOM   762   N N     . LYS A 1 100 ? 15.355  37.590  -0.059  1.00 41.85  ? 100 LYS A N     1 
ATOM   763   C CA    . LYS A 1 100 ? 15.703  38.121  -1.365  1.00 40.65  ? 100 LYS A CA    1 
ATOM   764   C C     . LYS A 1 100 ? 15.155  39.530  -1.630  1.00 39.91  ? 100 LYS A C     1 
ATOM   765   O O     . LYS A 1 100 ? 15.630  40.252  -2.507  1.00 42.09  ? 100 LYS A O     1 
ATOM   766   C CB    . LYS A 1 100 ? 15.203  37.139  -2.408  1.00 41.28  ? 100 LYS A CB    1 
ATOM   767   C CG    . LYS A 1 100 ? 15.667  37.483  -3.815  1.00 47.76  ? 100 LYS A CG    1 
ATOM   768   C CD    . LYS A 1 100 ? 17.144  37.214  -4.061  1.00 53.59  ? 100 LYS A CD    1 
ATOM   769   C CE    . LYS A 1 100 ? 17.477  37.657  -5.484  1.00 57.14  ? 100 LYS A CE    1 
ATOM   770   N NZ    . LYS A 1 100 ? 18.817  37.251  -5.876  1.00 60.95  ? 100 LYS A NZ    1 
ATOM   771   H H     . LYS A 1 100 ? 14.856  36.752  0.015   1.00 0.00   ? 100 LYS A H     1 
ATOM   772   H HZ1   . LYS A 1 100 ? 19.510  37.667  -5.221  1.00 0.00   ? 100 LYS A HZ1   1 
ATOM   773   H HZ2   . LYS A 1 100 ? 18.889  36.214  -5.855  1.00 0.00   ? 100 LYS A HZ2   1 
ATOM   774   H HZ3   . LYS A 1 100 ? 19.005  37.594  -6.840  1.00 0.00   ? 100 LYS A HZ3   1 
ATOM   775   N N     . HIS A 1 101 ? 14.147  40.014  -0.912  1.00 40.28  ? 101 HIS A N     1 
ATOM   776   C CA    . HIS A 1 101 ? 13.585  41.330  -1.173  1.00 36.16  ? 101 HIS A CA    1 
ATOM   777   C C     . HIS A 1 101 ? 13.592  42.121  0.109   1.00 32.80  ? 101 HIS A C     1 
ATOM   778   O O     . HIS A 1 101 ? 13.625  41.534  1.191   1.00 32.43  ? 101 HIS A O     1 
ATOM   779   C CB    . HIS A 1 101 ? 12.148  41.241  -1.653  1.00 39.15  ? 101 HIS A CB    1 
ATOM   780   C CG    . HIS A 1 101 ? 11.949  40.579  -3.011  1.00 43.54  ? 101 HIS A CG    1 
ATOM   781   N ND1   . HIS A 1 101 ? 12.568  40.972  -4.122  1.00 44.54  ? 101 HIS A ND1   1 
ATOM   782   C CD2   . HIS A 1 101 ? 11.090  39.546  -3.309  1.00 44.62  ? 101 HIS A CD2   1 
ATOM   783   C CE1   . HIS A 1 101 ? 12.094  40.227  -5.096  1.00 46.15  ? 101 HIS A CE1   1 
ATOM   784   N NE2   . HIS A 1 101 ? 11.217  39.380  -4.599  1.00 46.79  ? 101 HIS A NE2   1 
ATOM   785   H H     . HIS A 1 101 ? 13.866  39.565  -0.088  1.00 0.00   ? 101 HIS A H     1 
ATOM   786   H HD1   . HIS A 1 101 ? 13.382  41.521  -4.185  1.00 0.00   ? 101 HIS A HD1   1 
ATOM   787   H HE2   . HIS A 1 101 ? 10.736  38.700  -5.124  1.00 0.00   ? 101 HIS A HE2   1 
ATOM   788   N N     . ALA A 1 102 ? 13.607  43.440  -0.008  1.00 30.77  ? 102 ALA A N     1 
ATOM   789   C CA    . ALA A 1 102 ? 13.543  44.292  1.167   1.00 29.21  ? 102 ALA A CA    1 
ATOM   790   C C     . ALA A 1 102 ? 12.112  44.211  1.671   1.00 27.68  ? 102 ALA A C     1 
ATOM   791   O O     . ALA A 1 102 ? 11.205  44.152  0.834   1.00 31.25  ? 102 ALA A O     1 
ATOM   792   C CB    . ALA A 1 102 ? 13.863  45.740  0.799   1.00 22.71  ? 102 ALA A CB    1 
ATOM   793   H H     . ALA A 1 102 ? 13.626  43.860  -0.885  1.00 0.00   ? 102 ALA A H     1 
ATOM   794   N N     . ILE A 1 103 ? 11.900  44.160  2.985   1.00 25.07  ? 103 ILE A N     1 
ATOM   795   C CA    . ILE A 1 103 ? 10.584  44.088  3.588   1.00 20.55  ? 103 ILE A CA    1 
ATOM   796   C C     . ILE A 1 103 ? 10.155  45.518  3.842   1.00 24.05  ? 103 ILE A C     1 
ATOM   797   O O     . ILE A 1 103 ? 10.925  46.284  4.418   1.00 29.11  ? 103 ILE A O     1 
ATOM   798   C CB    . ILE A 1 103 ? 10.659  43.274  4.910   1.00 18.82  ? 103 ILE A CB    1 
ATOM   799   C CG1   . ILE A 1 103 ? 10.680  41.779  4.594   1.00 17.94  ? 103 ILE A CG1   1 
ATOM   800   C CG2   . ILE A 1 103 ? 9.461   43.543  5.805   1.00 20.46  ? 103 ILE A CG2   1 
ATOM   801   C CD1   . ILE A 1 103 ? 12.072  41.215  4.270   1.00 26.42  ? 103 ILE A CD1   1 
ATOM   802   H H     . ILE A 1 103 ? 12.678  44.243  3.577   1.00 0.00   ? 103 ILE A H     1 
ATOM   803   N N     . ILE A 1 104 ? 8.959   45.904  3.404   1.00 26.40  ? 104 ILE A N     1 
ATOM   804   C CA    . ILE A 1 104 ? 8.424   47.233  3.641   1.00 27.70  ? 104 ILE A CA    1 
ATOM   805   C C     . ILE A 1 104 ? 7.448   46.983  4.772   1.00 30.73  ? 104 ILE A C     1 
ATOM   806   O O     . ILE A 1 104 ? 6.591   46.104  4.634   1.00 30.97  ? 104 ILE A O     1 
ATOM   807   C CB    . ILE A 1 104 ? 7.678   47.769  2.421   1.00 25.20  ? 104 ILE A CB    1 
ATOM   808   C CG1   . ILE A 1 104 ? 8.543   47.696  1.171   1.00 29.69  ? 104 ILE A CG1   1 
ATOM   809   C CG2   . ILE A 1 104 ? 7.279   49.213  2.705   1.00 31.74  ? 104 ILE A CG2   1 
ATOM   810   C CD1   . ILE A 1 104 ? 9.926   48.372  1.295   1.00 31.94  ? 104 ILE A CD1   1 
ATOM   811   H H     . ILE A 1 104 ? 8.363   45.248  2.992   1.00 0.00   ? 104 ILE A H     1 
ATOM   812   N N     . VAL A 1 105 ? 7.598   47.662  5.915   1.00 33.10  ? 105 VAL A N     1 
ATOM   813   C CA    . VAL A 1 105 ? 6.742   47.434  7.078   1.00 33.48  ? 105 VAL A CA    1 
ATOM   814   C C     . VAL A 1 105 ? 5.348   47.991  6.776   1.00 35.47  ? 105 VAL A C     1 
ATOM   815   O O     . VAL A 1 105 ? 5.176   48.961  6.027   1.00 35.63  ? 105 VAL A O     1 
ATOM   816   C CB    . VAL A 1 105 ? 7.369   48.121  8.329   1.00 30.13  ? 105 VAL A CB    1 
ATOM   817   C CG1   . VAL A 1 105 ? 6.542   47.865  9.570   1.00 29.88  ? 105 VAL A CG1   1 
ATOM   818   C CG2   . VAL A 1 105 ? 8.744   47.541  8.591   1.00 33.21  ? 105 VAL A CG2   1 
ATOM   819   H H     . VAL A 1 105 ? 8.246   48.395  5.926   1.00 0.00   ? 105 VAL A H     1 
ATOM   820   N N     . GLU A 1 106 ? 4.328   47.360  7.353   1.00 37.20  ? 106 GLU A N     1 
ATOM   821   C CA    . GLU A 1 106 ? 2.947   47.765  7.138   1.00 40.19  ? 106 GLU A CA    1 
ATOM   822   C C     . GLU A 1 106 ? 2.752   49.116  7.814   1.00 42.69  ? 106 GLU A C     1 
ATOM   823   O O     . GLU A 1 106 ? 3.226   49.286  8.945   1.00 42.55  ? 106 GLU A O     1 
ATOM   824   C CB    . GLU A 1 106 ? 1.944   46.785  7.758   1.00 43.16  ? 106 GLU A CB    1 
ATOM   825   C CG    . GLU A 1 106 ? 2.351   45.344  8.072   1.00 48.34  ? 106 GLU A CG    1 
ATOM   826   C CD    . GLU A 1 106 ? 3.183   45.215  9.343   1.00 53.80  ? 106 GLU A CD    1 
ATOM   827   O OE1   . GLU A 1 106 ? 2.750   45.726  10.374  1.00 55.49  ? 106 GLU A OE1   1 
ATOM   828   O OE2   . GLU A 1 106 ? 4.261   44.615  9.296   1.00 52.55  ? 106 GLU A OE2   1 
ATOM   829   H H     . GLU A 1 106 ? 4.552   46.638  7.965   1.00 0.00   ? 106 GLU A H     1 
ATOM   830   N N     . PRO A 1 107 ? 2.026   50.077  7.225   1.00 46.44  ? 107 PRO A N     1 
ATOM   831   C CA    . PRO A 1 107 ? 1.953   51.481  7.651   1.00 46.72  ? 107 PRO A CA    1 
ATOM   832   C C     . PRO A 1 107 ? 1.720   51.714  9.130   1.00 47.01  ? 107 PRO A C     1 
ATOM   833   O O     . PRO A 1 107 ? 2.254   52.642  9.731   1.00 47.62  ? 107 PRO A O     1 
ATOM   834   C CB    . PRO A 1 107 ? 0.843   52.086  6.825   1.00 48.77  ? 107 PRO A CB    1 
ATOM   835   C CG    . PRO A 1 107 ? 0.835   51.231  5.581   1.00 50.04  ? 107 PRO A CG    1 
ATOM   836   C CD    . PRO A 1 107 ? 1.093   49.833  6.126   1.00 48.24  ? 107 PRO A CD    1 
ATOM   837   N N     . GLU A 1 108 ? 0.919   50.817  9.704   1.00 48.70  ? 108 GLU A N     1 
ATOM   838   C CA    . GLU A 1 108 ? 0.542   50.847  11.107  1.00 49.56  ? 108 GLU A CA    1 
ATOM   839   C C     . GLU A 1 108 ? 1.754   50.853  12.026  1.00 47.64  ? 108 GLU A C     1 
ATOM   840   O O     . GLU A 1 108 ? 1.782   51.543  13.047  1.00 45.47  ? 108 GLU A O     1 
ATOM   841   C CB    . GLU A 1 108 ? -0.313  49.631  11.451  1.00 54.05  ? 108 GLU A CB    1 
ATOM   842   C CG    . GLU A 1 108 ? -1.594  49.415  10.641  1.00 61.70  ? 108 GLU A CG    1 
ATOM   843   C CD    . GLU A 1 108 ? -1.445  48.607  9.353   1.00 66.57  ? 108 GLU A CD    1 
ATOM   844   O OE1   . GLU A 1 108 ? -1.028  47.445  9.408   1.00 67.99  ? 108 GLU A OE1   1 
ATOM   845   O OE2   . GLU A 1 108 ? -1.769  49.144  8.295   1.00 69.93  ? 108 GLU A OE2   1 
ATOM   846   H H     . GLU A 1 108 ? 0.595   50.087  9.143   1.00 0.00   ? 108 GLU A H     1 
ATOM   847   N N     . LYS A 1 109 ? 2.763   50.086  11.615  1.00 45.13  ? 109 LYS A N     1 
ATOM   848   C CA    . LYS A 1 109 ? 3.983   49.930  12.369  1.00 41.73  ? 109 LYS A CA    1 
ATOM   849   C C     . LYS A 1 109 ? 5.148   50.678  11.743  1.00 39.37  ? 109 LYS A C     1 
ATOM   850   O O     . LYS A 1 109 ? 6.308   50.348  12.009  1.00 37.85  ? 109 LYS A O     1 
ATOM   851   C CB    . LYS A 1 109 ? 4.306   48.445  12.476  1.00 42.81  ? 109 LYS A CB    1 
ATOM   852   C CG    . LYS A 1 109 ? 3.310   47.615  13.258  1.00 43.69  ? 109 LYS A CG    1 
ATOM   853   C CD    . LYS A 1 109 ? 3.852   46.198  13.344  1.00 49.06  ? 109 LYS A CD    1 
ATOM   854   C CE    . LYS A 1 109 ? 2.843   45.248  13.963  1.00 51.94  ? 109 LYS A CE    1 
ATOM   855   N NZ    . LYS A 1 109 ? 1.634   45.176  13.165  1.00 56.55  ? 109 LYS A NZ    1 
ATOM   856   H H     . LYS A 1 109 ? 2.722   49.651  10.743  1.00 0.00   ? 109 LYS A H     1 
ATOM   857   H HZ1   . LYS A 1 109 ? 1.874   44.855  12.205  1.00 0.00   ? 109 LYS A HZ1   1 
ATOM   858   H HZ2   . LYS A 1 109 ? 0.972   44.504  13.602  1.00 0.00   ? 109 LYS A HZ2   1 
ATOM   859   H HZ3   . LYS A 1 109 ? 1.192   46.116  13.115  1.00 0.00   ? 109 LYS A HZ3   1 
ATOM   860   N N     . ARG A 1 110 ? 4.876   51.698  10.927  1.00 36.69  ? 110 ARG A N     1 
ATOM   861   C CA    . ARG A 1 110 ? 5.968   52.411  10.298  1.00 36.37  ? 110 ARG A CA    1 
ATOM   862   C C     . ARG A 1 110 ? 6.563   53.534  11.121  1.00 35.98  ? 110 ARG A C     1 
ATOM   863   O O     . ARG A 1 110 ? 5.903   54.241  11.889  1.00 38.09  ? 110 ARG A O     1 
ATOM   864   C CB    . ARG A 1 110 ? 5.573   53.036  8.978   1.00 37.37  ? 110 ARG A CB    1 
ATOM   865   C CG    . ARG A 1 110 ? 5.594   52.049  7.842   1.00 38.39  ? 110 ARG A CG    1 
ATOM   866   C CD    . ARG A 1 110 ? 5.443   52.800  6.528   1.00 38.39  ? 110 ARG A CD    1 
ATOM   867   N NE    . ARG A 1 110 ? 5.182   51.804  5.509   1.00 37.88  ? 110 ARG A NE    1 
ATOM   868   C CZ    . ARG A 1 110 ? 4.364   52.022  4.483   1.00 36.68  ? 110 ARG A CZ    1 
ATOM   869   N NH1   . ARG A 1 110 ? 3.823   53.224  4.255   1.00 34.32  ? 110 ARG A NH1   1 
ATOM   870   N NH2   . ARG A 1 110 ? 4.121   51.009  3.649   1.00 35.87  ? 110 ARG A NH2   1 
ATOM   871   H H     . ARG A 1 110 ? 3.970   52.057  10.844  1.00 0.00   ? 110 ARG A H     1 
ATOM   872   H HE    . ARG A 1 110 ? 5.642   50.943  5.567   1.00 0.00   ? 110 ARG A HE    1 
ATOM   873   H HH11  . ARG A 1 110 ? 4.031   53.997  4.853   1.00 0.00   ? 110 ARG A HH11  1 
ATOM   874   H HH12  . ARG A 1 110 ? 3.218   53.353  3.469   1.00 0.00   ? 110 ARG A HH12  1 
ATOM   875   H HH21  . ARG A 1 110 ? 4.549   50.120  3.811   1.00 0.00   ? 110 ARG A HH21  1 
ATOM   876   H HH22  . ARG A 1 110 ? 3.509   51.139  2.869   1.00 0.00   ? 110 ARG A HH22  1 
ATOM   877   N N     . GLY A 1 111 ? 7.851   53.676  10.863  1.00 33.04  ? 111 GLY A N     1 
ATOM   878   C CA    . GLY A 1 111 ? 8.691   54.709  11.421  1.00 29.28  ? 111 GLY A CA    1 
ATOM   879   C C     . GLY A 1 111 ? 9.668   55.117  10.322  1.00 26.68  ? 111 GLY A C     1 
ATOM   880   O O     . GLY A 1 111 ? 9.565   54.639  9.178   1.00 25.12  ? 111 GLY A O     1 
ATOM   881   H H     . GLY A 1 111 ? 8.264   53.051  10.229  1.00 0.00   ? 111 GLY A H     1 
ATOM   882   N N     . LYS A 1 112 ? 10.681  55.923  10.653  1.00 21.80  ? 112 LYS A N     1 
ATOM   883   C CA    . LYS A 1 112 ? 11.540  56.461  9.618   1.00 20.49  ? 112 LYS A CA    1 
ATOM   884   C C     . LYS A 1 112 ? 12.852  55.733  9.315   1.00 18.86  ? 112 LYS A C     1 
ATOM   885   O O     . LYS A 1 112 ? 13.585  56.123  8.403   1.00 14.24  ? 112 LYS A O     1 
ATOM   886   C CB    . LYS A 1 112 ? 11.795  57.929  9.980   1.00 23.14  ? 112 LYS A CB    1 
ATOM   887   C CG    . LYS A 1 112 ? 12.888  58.235  11.005  1.00 26.24  ? 112 LYS A CG    1 
ATOM   888   C CD    . LYS A 1 112 ? 13.136  59.729  11.181  1.00 17.65  ? 112 LYS A CD    1 
ATOM   889   C CE    . LYS A 1 112 ? 12.221  60.358  12.222  1.00 20.39  ? 112 LYS A CE    1 
ATOM   890   N NZ    . LYS A 1 112 ? 12.654  59.980  13.544  1.00 17.74  ? 112 LYS A NZ    1 
ATOM   891   H H     . LYS A 1 112 ? 10.865  56.104  11.594  1.00 0.00   ? 112 LYS A H     1 
ATOM   892   H HZ1   . LYS A 1 112 ? 13.660  60.222  13.654  1.00 0.00   ? 112 LYS A HZ1   1 
ATOM   893   H HZ2   . LYS A 1 112 ? 12.097  60.490  14.261  1.00 0.00   ? 112 LYS A HZ2   1 
ATOM   894   H HZ3   . LYS A 1 112 ? 12.534  58.954  13.674  1.00 0.00   ? 112 LYS A HZ3   1 
ATOM   895   N N     . TYR A 1 113 ? 13.183  54.653  10.018  1.00 18.86  ? 113 TYR A N     1 
ATOM   896   C CA    . TYR A 1 113 ? 14.473  54.014  9.858   1.00 15.27  ? 113 TYR A CA    1 
ATOM   897   C C     . TYR A 1 113 ? 14.488  52.753  8.998   1.00 16.16  ? 113 TYR A C     1 
ATOM   898   O O     . TYR A 1 113 ? 13.524  51.982  8.953   1.00 11.02  ? 113 TYR A O     1 
ATOM   899   C CB    . TYR A 1 113 ? 15.009  53.712  11.247  1.00 16.96  ? 113 TYR A CB    1 
ATOM   900   C CG    . TYR A 1 113 ? 15.377  54.954  12.045  1.00 18.88  ? 113 TYR A CG    1 
ATOM   901   C CD1   . TYR A 1 113 ? 16.585  55.576  11.828  1.00 15.73  ? 113 TYR A CD1   1 
ATOM   902   C CD2   . TYR A 1 113 ? 14.495  55.479  12.971  1.00 22.59  ? 113 TYR A CD2   1 
ATOM   903   C CE1   . TYR A 1 113 ? 16.905  56.738  12.500  1.00 17.44  ? 113 TYR A CE1   1 
ATOM   904   C CE2   . TYR A 1 113 ? 14.806  56.647  13.643  1.00 21.34  ? 113 TYR A CE2   1 
ATOM   905   C CZ    . TYR A 1 113 ? 16.003  57.279  13.386  1.00 22.23  ? 113 TYR A CZ    1 
ATOM   906   O OH    . TYR A 1 113 ? 16.312  58.478  13.994  1.00 24.71  ? 113 TYR A OH    1 
ATOM   907   H H     . TYR A 1 113 ? 12.524  54.228  10.607  1.00 0.00   ? 113 TYR A H     1 
ATOM   908   H HH    . TYR A 1 113 ? 15.532  58.805  14.503  1.00 0.00   ? 113 TYR A HH    1 
ATOM   909   N N     . VAL A 1 114 ? 15.622  52.541  8.326   1.00 16.85  ? 114 VAL A N     1 
ATOM   910   C CA    . VAL A 1 114 ? 15.892  51.433  7.424   1.00 17.81  ? 114 VAL A CA    1 
ATOM   911   C C     . VAL A 1 114 ? 16.938  50.560  8.105   1.00 18.62  ? 114 VAL A C     1 
ATOM   912   O O     . VAL A 1 114 ? 17.975  51.100  8.504   1.00 20.07  ? 114 VAL A O     1 
ATOM   913   C CB    . VAL A 1 114 ? 16.462  51.941  6.090   1.00 14.59  ? 114 VAL A CB    1 
ATOM   914   C CG1   . VAL A 1 114 ? 16.706  50.749  5.171   1.00 19.25  ? 114 VAL A CG1   1 
ATOM   915   C CG2   . VAL A 1 114 ? 15.505  52.910  5.439   1.00 13.63  ? 114 VAL A CG2   1 
ATOM   916   H H     . VAL A 1 114 ? 16.367  53.147  8.504   1.00 0.00   ? 114 VAL A H     1 
ATOM   917   N N     . VAL A 1 115 ? 16.750  49.251  8.257   1.00 15.48  ? 115 VAL A N     1 
ATOM   918   C CA    . VAL A 1 115 ? 17.734  48.459  8.968   1.00 15.15  ? 115 VAL A CA    1 
ATOM   919   C C     . VAL A 1 115 ? 18.300  47.309  8.147   1.00 10.22  ? 115 VAL A C     1 
ATOM   920   O O     . VAL A 1 115 ? 17.608  46.378  7.764   1.00 11.87  ? 115 VAL A O     1 
ATOM   921   C CB    . VAL A 1 115 ? 17.120  47.903  10.277  1.00 15.63  ? 115 VAL A CB    1 
ATOM   922   C CG1   . VAL A 1 115 ? 18.227  47.185  11.052  1.00 16.34  ? 115 VAL A CG1   1 
ATOM   923   C CG2   . VAL A 1 115 ? 16.568  49.007  11.156  1.00 10.54  ? 115 VAL A CG2   1 
ATOM   924   H H     . VAL A 1 115 ? 15.953  48.824  7.877   1.00 0.00   ? 115 VAL A H     1 
ATOM   925   N N     . CYS A 1 116 ? 19.578  47.336  7.869   1.00 13.49  ? 116 CYS A N     1 
ATOM   926   C CA    . CYS A 1 116 ? 20.223  46.289  7.109   1.00 13.66  ? 116 CYS A CA    1 
ATOM   927   C C     . CYS A 1 116 ? 20.905  45.411  8.113   1.00 8.43   ? 116 CYS A C     1 
ATOM   928   O O     . CYS A 1 116 ? 21.643  45.946  8.939   1.00 8.46   ? 116 CYS A O     1 
ATOM   929   C CB    . CYS A 1 116 ? 21.216  46.909  6.187   1.00 15.95  ? 116 CYS A CB    1 
ATOM   930   S SG    . CYS A 1 116 ? 20.324  47.980  5.049   1.00 24.95  ? 116 CYS A SG    1 
ATOM   931   H H     . CYS A 1 116 ? 20.130  48.058  8.231   1.00 0.00   ? 116 CYS A H     1 
ATOM   932   N N     . PHE A 1 117 ? 20.690  44.100  8.097   1.00 11.42  ? 117 PHE A N     1 
ATOM   933   C CA    . PHE A 1 117 ? 21.277  43.249  9.113   1.00 11.14  ? 117 PHE A CA    1 
ATOM   934   C C     . PHE A 1 117 ? 21.573  41.842  8.651   1.00 9.23   ? 117 PHE A C     1 
ATOM   935   O O     . PHE A 1 117 ? 20.946  41.296  7.734   1.00 5.83   ? 117 PHE A O     1 
ATOM   936   C CB    . PHE A 1 117 ? 20.336  43.185  10.354  1.00 17.08  ? 117 PHE A CB    1 
ATOM   937   C CG    . PHE A 1 117 ? 18.911  42.675  10.157  1.00 8.47   ? 117 PHE A CG    1 
ATOM   938   C CD1   . PHE A 1 117 ? 17.937  43.514  9.663   1.00 11.09  ? 117 PHE A CD1   1 
ATOM   939   C CD2   . PHE A 1 117 ? 18.598  41.371  10.491  1.00 9.91   ? 117 PHE A CD2   1 
ATOM   940   C CE1   . PHE A 1 117 ? 16.652  43.041  9.511   1.00 13.45  ? 117 PHE A CE1   1 
ATOM   941   C CE2   . PHE A 1 117 ? 17.308  40.901  10.341  1.00 11.89  ? 117 PHE A CE2   1 
ATOM   942   C CZ    . PHE A 1 117 ? 16.340  41.738  9.856   1.00 9.90   ? 117 PHE A CZ    1 
ATOM   943   H H     . PHE A 1 117 ? 20.094  43.687  7.433   1.00 0.00   ? 117 PHE A H     1 
ATOM   944   N N     . ASP A 1 118 ? 22.561  41.248  9.291   1.00 8.64   ? 118 ASP A N     1 
ATOM   945   C CA    . ASP A 1 118 ? 22.885  39.866  9.018   1.00 15.46  ? 118 ASP A CA    1 
ATOM   946   C C     . ASP A 1 118 ? 22.578  39.194  10.342  1.00 13.81  ? 118 ASP A C     1 
ATOM   947   O O     . ASP A 1 118 ? 23.281  39.415  11.332  1.00 18.83  ? 118 ASP A O     1 
ATOM   948   C CB    . ASP A 1 118 ? 24.375  39.699  8.645   1.00 8.89   ? 118 ASP A CB    1 
ATOM   949   C CG    . ASP A 1 118 ? 24.803  38.305  8.218   1.00 11.95  ? 118 ASP A CG    1 
ATOM   950   O OD1   . ASP A 1 118 ? 24.011  37.361  8.221   1.00 12.14  ? 118 ASP A OD1   1 
ATOM   951   O OD2   . ASP A 1 118 ? 25.973  38.150  7.881   1.00 21.20  ? 118 ASP A OD2   1 
ATOM   952   H H     . ASP A 1 118 ? 23.046  41.736  9.986   1.00 0.00   ? 118 ASP A H     1 
ATOM   953   N N     . PRO A 1 119 ? 21.510  38.423  10.441  1.00 15.12  ? 119 PRO A N     1 
ATOM   954   C CA    . PRO A 1 119 ? 21.074  37.841  11.694  1.00 16.61  ? 119 PRO A CA    1 
ATOM   955   C C     . PRO A 1 119 ? 22.020  36.831  12.308  1.00 16.75  ? 119 PRO A C     1 
ATOM   956   O O     . PRO A 1 119 ? 22.206  36.894  13.519  1.00 16.26  ? 119 PRO A O     1 
ATOM   957   C CB    . PRO A 1 119 ? 19.744  37.248  11.391  1.00 16.03  ? 119 PRO A CB    1 
ATOM   958   C CG    . PRO A 1 119 ? 19.800  36.969  9.907   1.00 20.64  ? 119 PRO A CG    1 
ATOM   959   C CD    . PRO A 1 119 ? 20.554  38.175  9.374   1.00 16.48  ? 119 PRO A CD    1 
ATOM   960   N N     . LEU A 1 120 ? 22.616  35.892  11.585  1.00 15.75  ? 120 LEU A N     1 
ATOM   961   C CA    . LEU A 1 120 ? 23.510  34.937  12.211  1.00 15.54  ? 120 LEU A CA    1 
ATOM   962   C C     . LEU A 1 120 ? 24.622  34.669  11.239  1.00 18.98  ? 120 LEU A C     1 
ATOM   963   O O     . LEU A 1 120 ? 24.647  33.716  10.445  1.00 18.59  ? 120 LEU A O     1 
ATOM   964   C CB    . LEU A 1 120 ? 22.831  33.616  12.514  1.00 7.85   ? 120 LEU A CB    1 
ATOM   965   C CG    . LEU A 1 120 ? 23.442  32.958  13.709  1.00 7.52   ? 120 LEU A CG    1 
ATOM   966   C CD1   . LEU A 1 120 ? 23.314  33.887  14.912  1.00 2.86   ? 120 LEU A CD1   1 
ATOM   967   C CD2   . LEU A 1 120 ? 22.705  31.672  14.007  1.00 4.27   ? 120 LEU A CD2   1 
ATOM   968   H H     . LEU A 1 120 ? 22.462  35.827  10.616  1.00 0.00   ? 120 LEU A H     1 
ATOM   969   N N     . ASP A 1 121 ? 25.534  35.614  11.305  1.00 22.32  ? 121 ASP A N     1 
ATOM   970   C CA    . ASP A 1 121 ? 26.716  35.562  10.486  1.00 25.36  ? 121 ASP A CA    1 
ATOM   971   C C     . ASP A 1 121 ? 27.606  34.377  10.848  1.00 24.92  ? 121 ASP A C     1 
ATOM   972   O O     . ASP A 1 121 ? 27.855  34.086  12.019  1.00 24.13  ? 121 ASP A O     1 
ATOM   973   C CB    . ASP A 1 121 ? 27.456  36.863  10.662  1.00 29.40  ? 121 ASP A CB    1 
ATOM   974   C CG    . ASP A 1 121 ? 28.693  36.898  9.802   1.00 31.15  ? 121 ASP A CG    1 
ATOM   975   O OD1   . ASP A 1 121 ? 28.558  36.948  8.576   1.00 32.35  ? 121 ASP A OD1   1 
ATOM   976   O OD2   . ASP A 1 121 ? 29.774  36.838  10.387  1.00 31.67  ? 121 ASP A OD2   1 
ATOM   977   H H     . ASP A 1 121 ? 25.391  36.357  11.921  1.00 0.00   ? 121 ASP A H     1 
ATOM   978   N N     . GLY A 1 122 ? 28.072  33.695  9.809   1.00 25.54  ? 122 GLY A N     1 
ATOM   979   C CA    . GLY A 1 122 ? 28.933  32.543  9.947   1.00 26.78  ? 122 GLY A CA    1 
ATOM   980   C C     . GLY A 1 122 ? 28.163  31.328  10.430  1.00 33.68  ? 122 GLY A C     1 
ATOM   981   O O     . GLY A 1 122 ? 28.770  30.357  10.876  1.00 30.27  ? 122 GLY A O     1 
ATOM   982   H H     . GLY A 1 122 ? 27.724  33.922  8.924   1.00 0.00   ? 122 GLY A H     1 
ATOM   983   N N     . SER A 1 123 ? 26.832  31.314  10.248  1.00 41.46  ? 123 SER A N     1 
ATOM   984   C CA    . SER A 1 123 ? 25.951  30.266  10.749  1.00 46.51  ? 123 SER A CA    1 
ATOM   985   C C     . SER A 1 123 ? 26.355  28.864  10.327  1.00 50.15  ? 123 SER A C     1 
ATOM   986   O O     . SER A 1 123 ? 26.143  27.871  11.037  1.00 51.43  ? 123 SER A O     1 
ATOM   987   C CB    . SER A 1 123 ? 24.549  30.567  10.262  1.00 46.57  ? 123 SER A CB    1 
ATOM   988   O OG    . SER A 1 123 ? 24.543  30.713  8.842   1.00 53.40  ? 123 SER A OG    1 
ATOM   989   H H     . SER A 1 123 ? 26.419  32.025  9.706   1.00 0.00   ? 123 SER A H     1 
ATOM   990   H HG    . SER A 1 123 ? 23.699  31.116  8.637   1.00 0.00   ? 123 SER A HG    1 
ATOM   991   N N     . SER A 1 124 ? 26.997  28.825  9.158   1.00 53.78  ? 124 SER A N     1 
ATOM   992   C CA    . SER A 1 124 ? 27.592  27.630  8.573   1.00 57.89  ? 124 SER A CA    1 
ATOM   993   C C     . SER A 1 124 ? 28.487  26.877  9.577   1.00 59.32  ? 124 SER A C     1 
ATOM   994   O O     . SER A 1 124 ? 28.437  25.654  9.763   1.00 56.96  ? 124 SER A O     1 
ATOM   995   C CB    . SER A 1 124 ? 28.368  28.111  7.321   1.00 59.50  ? 124 SER A CB    1 
ATOM   996   O OG    . SER A 1 124 ? 28.795  29.489  7.324   1.00 56.58  ? 124 SER A OG    1 
ATOM   997   H H     . SER A 1 124 ? 27.075  29.668  8.664   1.00 0.00   ? 124 SER A H     1 
ATOM   998   H HG    . SER A 1 124 ? 29.438  29.602  6.607   1.00 0.00   ? 124 SER A HG    1 
ATOM   999   N N     . ASN A 1 125 ? 29.250  27.690  10.299  1.00 60.84  ? 125 ASN A N     1 
ATOM   1000  C CA    . ASN A 1 125 ? 30.195  27.261  11.314  1.00 61.70  ? 125 ASN A CA    1 
ATOM   1001  C C     . ASN A 1 125 ? 29.558  26.834  12.646  1.00 60.98  ? 125 ASN A C     1 
ATOM   1002  O O     . ASN A 1 125 ? 30.276  26.287  13.496  1.00 61.78  ? 125 ASN A O     1 
ATOM   1003  C CB    . ASN A 1 125 ? 31.218  28.396  11.555  1.00 62.17  ? 125 ASN A CB    1 
ATOM   1004  C CG    . ASN A 1 125 ? 32.381  28.561  10.563  1.00 63.28  ? 125 ASN A CG    1 
ATOM   1005  O OD1   . ASN A 1 125 ? 33.130  27.632  10.252  1.00 64.42  ? 125 ASN A OD1   1 
ATOM   1006  N ND2   . ASN A 1 125 ? 32.618  29.750  10.022  1.00 61.58  ? 125 ASN A ND2   1 
ATOM   1007  H H     . ASN A 1 125 ? 29.144  28.655  10.149  1.00 0.00   ? 125 ASN A H     1 
ATOM   1008  H HD21  . ASN A 1 125 ? 33.349  29.832  9.375   1.00 0.00   ? 125 ASN A HD21  1 
ATOM   1009  H HD22  . ASN A 1 125 ? 32.052  30.502  10.290  1.00 0.00   ? 125 ASN A HD22  1 
ATOM   1010  N N     . ILE A 1 126 ? 28.243  26.992  12.897  1.00 58.73  ? 126 ILE A N     1 
ATOM   1011  C CA    . ILE A 1 126 ? 27.601  26.598  14.159  1.00 56.63  ? 126 ILE A CA    1 
ATOM   1012  C C     . ILE A 1 126 ? 27.793  25.127  14.483  1.00 57.59  ? 126 ILE A C     1 
ATOM   1013  O O     . ILE A 1 126 ? 28.009  24.775  15.643  1.00 58.37  ? 126 ILE A O     1 
ATOM   1014  C CB    . ILE A 1 126 ? 26.090  26.897  14.109  1.00 54.07  ? 126 ILE A CB    1 
ATOM   1015  C CG1   . ILE A 1 126 ? 25.951  28.371  14.288  1.00 54.34  ? 126 ILE A CG1   1 
ATOM   1016  C CG2   . ILE A 1 126 ? 25.276  26.212  15.211  1.00 53.14  ? 126 ILE A CG2   1 
ATOM   1017  C CD1   . ILE A 1 126 ? 24.552  28.751  13.818  1.00 57.38  ? 126 ILE A CD1   1 
ATOM   1018  H H     . ILE A 1 126 ? 27.683  27.385  12.195  1.00 0.00   ? 126 ILE A H     1 
ATOM   1019  N N     . ASP A 1 127 ? 27.739  24.233  13.492  1.00 57.26  ? 127 ASP A N     1 
ATOM   1020  C CA    . ASP A 1 127 ? 27.927  22.803  13.743  1.00 56.19  ? 127 ASP A CA    1 
ATOM   1021  C C     . ASP A 1 127 ? 29.294  22.507  14.365  1.00 53.72  ? 127 ASP A C     1 
ATOM   1022  O O     . ASP A 1 127 ? 29.449  21.631  15.223  1.00 53.04  ? 127 ASP A O     1 
ATOM   1023  C CB    . ASP A 1 127 ? 27.775  22.020  12.431  1.00 60.09  ? 127 ASP A CB    1 
ATOM   1024  C CG    . ASP A 1 127 ? 26.368  22.084  11.830  1.00 63.88  ? 127 ASP A CG    1 
ATOM   1025  O OD1   . ASP A 1 127 ? 25.397  21.793  12.533  1.00 64.36  ? 127 ASP A OD1   1 
ATOM   1026  O OD2   . ASP A 1 127 ? 26.244  22.426  10.651  1.00 66.68  ? 127 ASP A OD2   1 
ATOM   1027  H H     . ASP A 1 127 ? 27.575  24.551  12.579  1.00 0.00   ? 127 ASP A H     1 
ATOM   1028  N N     . CYS A 1 128 ? 30.265  23.335  13.978  1.00 48.09  ? 128 CYS A N     1 
ATOM   1029  C CA    . CYS A 1 128 ? 31.623  23.251  14.468  1.00 43.11  ? 128 CYS A CA    1 
ATOM   1030  C C     . CYS A 1 128 ? 31.823  24.109  15.747  1.00 41.22  ? 128 CYS A C     1 
ATOM   1031  O O     . CYS A 1 128 ? 32.938  24.234  16.258  1.00 42.18  ? 128 CYS A O     1 
ATOM   1032  C CB    . CYS A 1 128 ? 32.499  23.665  13.252  1.00 43.39  ? 128 CYS A CB    1 
ATOM   1033  S SG    . CYS A 1 128 ? 32.280  22.648  11.743  1.00 42.43  ? 128 CYS A SG    1 
ATOM   1034  H H     . CYS A 1 128 ? 30.065  24.044  13.336  1.00 0.00   ? 128 CYS A H     1 
ATOM   1035  N N     . LEU A 1 129 ? 30.732  24.632  16.350  1.00 35.52  ? 129 LEU A N     1 
ATOM   1036  C CA    . LEU A 1 129 ? 30.654  25.498  17.536  1.00 28.19  ? 129 LEU A CA    1 
ATOM   1037  C C     . LEU A 1 129 ? 31.551  26.715  17.511  1.00 24.33  ? 129 LEU A C     1 
ATOM   1038  O O     . LEU A 1 129 ? 32.131  27.202  18.494  1.00 26.10  ? 129 LEU A O     1 
ATOM   1039  C CB    . LEU A 1 129 ? 30.965  24.746  18.825  1.00 27.78  ? 129 LEU A CB    1 
ATOM   1040  C CG    . LEU A 1 129 ? 30.232  23.481  19.261  1.00 28.11  ? 129 LEU A CG    1 
ATOM   1041  C CD1   . LEU A 1 129 ? 30.632  23.212  20.696  1.00 25.53  ? 129 LEU A CD1   1 
ATOM   1042  C CD2   . LEU A 1 129 ? 28.726  23.628  19.198  1.00 30.70  ? 129 LEU A CD2   1 
ATOM   1043  H H     . LEU A 1 129 ? 29.867  24.387  15.973  1.00 0.00   ? 129 LEU A H     1 
ATOM   1044  N N     . VAL A 1 130 ? 31.531  27.297  16.338  1.00 20.88  ? 130 VAL A N     1 
ATOM   1045  C CA    . VAL A 1 130 ? 32.344  28.452  16.078  1.00 25.86  ? 130 VAL A CA    1 
ATOM   1046  C C     . VAL A 1 130 ? 31.541  29.701  16.427  1.00 24.34  ? 130 VAL A C     1 
ATOM   1047  O O     . VAL A 1 130 ? 30.309  29.679  16.395  1.00 27.97  ? 130 VAL A O     1 
ATOM   1048  C CB    . VAL A 1 130 ? 32.751  28.377  14.586  1.00 27.80  ? 130 VAL A CB    1 
ATOM   1049  C CG1   . VAL A 1 130 ? 33.496  29.631  14.159  1.00 30.34  ? 130 VAL A CG1   1 
ATOM   1050  C CG2   . VAL A 1 130 ? 33.662  27.167  14.366  1.00 29.82  ? 130 VAL A CG2   1 
ATOM   1051  H H     . VAL A 1 130 ? 30.894  26.996  15.658  1.00 0.00   ? 130 VAL A H     1 
ATOM   1052  N N     . SER A 1 131 ? 32.242  30.761  16.825  1.00 23.16  ? 131 SER A N     1 
ATOM   1053  C CA    . SER A 1 131 ? 31.688  32.075  17.082  1.00 22.53  ? 131 SER A CA    1 
ATOM   1054  C C     . SER A 1 131 ? 30.893  32.503  15.861  1.00 21.20  ? 131 SER A C     1 
ATOM   1055  O O     . SER A 1 131 ? 31.237  32.208  14.708  1.00 19.84  ? 131 SER A O     1 
ATOM   1056  C CB    . SER A 1 131 ? 32.817  33.049  17.334  1.00 21.69  ? 131 SER A CB    1 
ATOM   1057  O OG    . SER A 1 131 ? 33.839  32.434  18.126  1.00 39.01  ? 131 SER A OG    1 
ATOM   1058  H H     . SER A 1 131 ? 33.193  30.664  17.031  1.00 0.00   ? 131 SER A H     1 
ATOM   1059  H HG    . SER A 1 131 ? 34.690  32.628  17.724  1.00 0.00   ? 131 SER A HG    1 
ATOM   1060  N N     . VAL A 1 132 ? 29.829  33.225  16.170  1.00 20.34  ? 132 VAL A N     1 
ATOM   1061  C CA    . VAL A 1 132 ? 28.783  33.575  15.229  1.00 14.92  ? 132 VAL A CA    1 
ATOM   1062  C C     . VAL A 1 132 ? 28.305  34.932  15.732  1.00 10.27  ? 132 VAL A C     1 
ATOM   1063  O O     . VAL A 1 132 ? 28.509  35.264  16.907  1.00 8.48   ? 132 VAL A O     1 
ATOM   1064  C CB    . VAL A 1 132 ? 27.856  32.340  15.384  1.00 16.30  ? 132 VAL A CB    1 
ATOM   1065  C CG1   . VAL A 1 132 ? 26.437  32.719  15.690  1.00 22.50  ? 132 VAL A CG1   1 
ATOM   1066  C CG2   . VAL A 1 132 ? 27.940  31.522  14.110  1.00 16.16  ? 132 VAL A CG2   1 
ATOM   1067  H H     . VAL A 1 132 ? 29.719  33.548  17.091  1.00 0.00   ? 132 VAL A H     1 
ATOM   1068  N N     . GLY A 1 133 ? 27.682  35.774  14.938  1.00 5.66   ? 133 GLY A N     1 
ATOM   1069  C CA    . GLY A 1 133 ? 27.264  37.059  15.434  1.00 6.96   ? 133 GLY A CA    1 
ATOM   1070  C C     . GLY A 1 133 ? 26.154  37.626  14.582  1.00 12.45  ? 133 GLY A C     1 
ATOM   1071  O O     . GLY A 1 133 ? 25.688  36.967  13.643  1.00 15.02  ? 133 GLY A O     1 
ATOM   1072  H H     . GLY A 1 133 ? 27.468  35.527  14.010  1.00 0.00   ? 133 GLY A H     1 
ATOM   1073  N N     . THR A 1 134 ? 25.755  38.851  14.877  1.00 14.93  ? 134 THR A N     1 
ATOM   1074  C CA    . THR A 1 134 ? 24.656  39.548  14.214  1.00 12.62  ? 134 THR A CA    1 
ATOM   1075  C C     . THR A 1 134 ? 25.250  40.898  13.865  1.00 14.71  ? 134 THR A C     1 
ATOM   1076  O O     . THR A 1 134 ? 25.897  41.539  14.699  1.00 16.82  ? 134 THR A O     1 
ATOM   1077  C CB    . THR A 1 134 ? 23.488  39.768  15.162  1.00 12.03  ? 134 THR A CB    1 
ATOM   1078  O OG1   . THR A 1 134 ? 23.097  38.485  15.668  1.00 7.16   ? 134 THR A OG1   1 
ATOM   1079  C CG2   . THR A 1 134 ? 22.368  40.524  14.479  1.00 8.13   ? 134 THR A CG2   1 
ATOM   1080  H H     . THR A 1 134 ? 26.232  39.339  15.582  1.00 0.00   ? 134 THR A H     1 
ATOM   1081  H HG1   . THR A 1 134 ? 22.875  37.947  14.891  1.00 0.00   ? 134 THR A HG1   1 
ATOM   1082  N N     . ILE A 1 135 ? 25.035  41.341  12.645  1.00 11.34  ? 135 ILE A N     1 
ATOM   1083  C CA    . ILE A 1 135 ? 25.555  42.597  12.171  1.00 6.40   ? 135 ILE A CA    1 
ATOM   1084  C C     . ILE A 1 135 ? 24.314  43.438  11.863  1.00 3.51   ? 135 ILE A C     1 
ATOM   1085  O O     . ILE A 1 135 ? 23.278  42.892  11.471  1.00 5.46   ? 135 ILE A O     1 
ATOM   1086  C CB    . ILE A 1 135 ? 26.428  42.248  10.935  1.00 6.96   ? 135 ILE A CB    1 
ATOM   1087  C CG1   . ILE A 1 135 ? 27.487  41.229  11.306  1.00 2.00   ? 135 ILE A CG1   1 
ATOM   1088  C CG2   . ILE A 1 135 ? 27.187  43.473  10.447  1.00 10.90  ? 135 ILE A CG2   1 
ATOM   1089  C CD1   . ILE A 1 135 ? 28.136  40.556  10.083  1.00 3.23   ? 135 ILE A CD1   1 
ATOM   1090  H H     . ILE A 1 135 ? 24.421  40.849  12.059  1.00 0.00   ? 135 ILE A H     1 
ATOM   1091  N N     . PHE A 1 136 ? 24.302  44.740  12.041  1.00 3.89   ? 136 PHE A N     1 
ATOM   1092  C CA    . PHE A 1 136 ? 23.149  45.546  11.702  1.00 5.40   ? 136 PHE A CA    1 
ATOM   1093  C C     . PHE A 1 136 ? 23.671  46.906  11.335  1.00 6.06   ? 136 PHE A C     1 
ATOM   1094  O O     . PHE A 1 136 ? 24.780  47.250  11.756  1.00 5.25   ? 136 PHE A O     1 
ATOM   1095  C CB    . PHE A 1 136 ? 22.188  45.665  12.889  1.00 7.30   ? 136 PHE A CB    1 
ATOM   1096  C CG    . PHE A 1 136 ? 22.807  46.168  14.191  1.00 8.79   ? 136 PHE A CG    1 
ATOM   1097  C CD1   . PHE A 1 136 ? 22.944  47.527  14.433  1.00 4.61   ? 136 PHE A CD1   1 
ATOM   1098  C CD2   . PHE A 1 136 ? 23.236  45.239  15.130  1.00 10.66  ? 136 PHE A CD2   1 
ATOM   1099  C CE1   . PHE A 1 136 ? 23.533  47.951  15.613  1.00 6.93   ? 136 PHE A CE1   1 
ATOM   1100  C CE2   . PHE A 1 136 ? 23.819  45.674  16.301  1.00 8.89   ? 136 PHE A CE2   1 
ATOM   1101  C CZ    . PHE A 1 136 ? 23.977  47.027  16.536  1.00 7.20   ? 136 PHE A CZ    1 
ATOM   1102  H H     . PHE A 1 136 ? 25.110  45.193  12.373  1.00 0.00   ? 136 PHE A H     1 
ATOM   1103  N N     . GLY A 1 137 ? 22.897  47.694  10.592  1.00 11.65  ? 137 GLY A N     1 
ATOM   1104  C CA    . GLY A 1 137 ? 23.266  49.044  10.173  1.00 10.10  ? 137 GLY A CA    1 
ATOM   1105  C C     . GLY A 1 137 ? 21.959  49.788  10.002  1.00 12.84  ? 137 GLY A C     1 
ATOM   1106  O O     . GLY A 1 137 ? 20.991  49.218  9.488   1.00 13.81  ? 137 GLY A O     1 
ATOM   1107  H H     . GLY A 1 137 ? 22.039  47.347  10.265  1.00 0.00   ? 137 GLY A H     1 
ATOM   1108  N N     . ILE A 1 138 ? 21.885  51.044  10.428  1.00 13.78  ? 138 ILE A N     1 
ATOM   1109  C CA    . ILE A 1 138 ? 20.627  51.785  10.458  1.00 15.35  ? 138 ILE A CA    1 
ATOM   1110  C C     . ILE A 1 138 ? 20.749  53.048  9.610   1.00 18.54  ? 138 ILE A C     1 
ATOM   1111  O O     . ILE A 1 138 ? 21.647  53.850  9.869   1.00 19.78  ? 138 ILE A O     1 
ATOM   1112  C CB    . ILE A 1 138 ? 20.317  52.115  11.947  1.00 9.07   ? 138 ILE A CB    1 
ATOM   1113  C CG1   . ILE A 1 138 ? 20.189  50.834  12.757  1.00 4.49   ? 138 ILE A CG1   1 
ATOM   1114  C CG2   . ILE A 1 138 ? 19.030  52.877  12.065  1.00 4.10   ? 138 ILE A CG2   1 
ATOM   1115  C CD1   . ILE A 1 138 ? 20.476  51.063  14.250  1.00 7.40   ? 138 ILE A CD1   1 
ATOM   1116  H H     . ILE A 1 138 ? 22.698  51.495  10.734  1.00 0.00   ? 138 ILE A H     1 
ATOM   1117  N N     . TYR A 1 139 ? 19.913  53.240  8.591   1.00 21.27  ? 139 TYR A N     1 
ATOM   1118  C CA    . TYR A 1 139 ? 19.910  54.425  7.751   1.00 23.07  ? 139 TYR A CA    1 
ATOM   1119  C C     . TYR A 1 139 ? 18.625  55.179  8.032   1.00 25.25  ? 139 TYR A C     1 
ATOM   1120  O O     . TYR A 1 139 ? 17.616  54.538  8.352   1.00 21.81  ? 139 TYR A O     1 
ATOM   1121  C CB    . TYR A 1 139 ? 19.885  54.106  6.273   1.00 23.43  ? 139 TYR A CB    1 
ATOM   1122  C CG    . TYR A 1 139 ? 21.110  53.386  5.792   1.00 23.51  ? 139 TYR A CG    1 
ATOM   1123  C CD1   . TYR A 1 139 ? 22.227  54.115  5.464   1.00 25.77  ? 139 TYR A CD1   1 
ATOM   1124  C CD2   . TYR A 1 139 ? 21.092  52.015  5.700   1.00 24.50  ? 139 TYR A CD2   1 
ATOM   1125  C CE1   . TYR A 1 139 ? 23.360  53.453  5.050   1.00 31.05  ? 139 TYR A CE1   1 
ATOM   1126  C CE2   . TYR A 1 139 ? 22.223  51.352  5.286   1.00 29.97  ? 139 TYR A CE2   1 
ATOM   1127  C CZ    . TYR A 1 139 ? 23.354  52.077  4.979   1.00 30.53  ? 139 TYR A CZ    1 
ATOM   1128  O OH    . TYR A 1 139 ? 24.514  51.417  4.636   1.00 34.26  ? 139 TYR A OH    1 
ATOM   1129  H H     . TYR A 1 139 ? 19.207  52.575  8.447   1.00 0.00   ? 139 TYR A H     1 
ATOM   1130  H HH    . TYR A 1 139 ? 24.595  51.446  3.673   1.00 0.00   ? 139 TYR A HH    1 
ATOM   1131  N N     . ARG A 1 140 ? 18.598  56.512  7.976   1.00 25.14  ? 140 ARG A N     1 
ATOM   1132  C CA    . ARG A 1 140 ? 17.322  57.185  8.095   1.00 30.31  ? 140 ARG A CA    1 
ATOM   1133  C C     . ARG A 1 140 ? 16.842  57.185  6.648   1.00 34.98  ? 140 ARG A C     1 
ATOM   1134  O O     . ARG A 1 140 ? 17.656  57.348  5.730   1.00 36.18  ? 140 ARG A O     1 
ATOM   1135  C CB    . ARG A 1 140 ? 17.476  58.617  8.589   1.00 34.31  ? 140 ARG A CB    1 
ATOM   1136  C CG    . ARG A 1 140 ? 16.136  59.340  8.524   1.00 39.86  ? 140 ARG A CG    1 
ATOM   1137  C CD    . ARG A 1 140 ? 16.214  60.835  8.740   1.00 48.88  ? 140 ARG A CD    1 
ATOM   1138  N NE    . ARG A 1 140 ? 16.103  61.179  10.147  1.00 58.32  ? 140 ARG A NE    1 
ATOM   1139  C CZ    . ARG A 1 140 ? 16.414  62.396  10.606  1.00 62.71  ? 140 ARG A CZ    1 
ATOM   1140  N NH1   . ARG A 1 140 ? 16.895  63.348  9.803   1.00 66.41  ? 140 ARG A NH1   1 
ATOM   1141  N NH2   . ARG A 1 140 ? 16.259  62.668  11.903  1.00 64.65  ? 140 ARG A NH2   1 
ATOM   1142  H H     . ARG A 1 140 ? 19.388  57.012  7.691   1.00 0.00   ? 140 ARG A H     1 
ATOM   1143  H HE    . ARG A 1 140 ? 15.791  60.501  10.782  1.00 0.00   ? 140 ARG A HE    1 
ATOM   1144  H HH11  . ARG A 1 140 ? 17.043  63.163  8.833   1.00 0.00   ? 140 ARG A HH11  1 
ATOM   1145  H HH12  . ARG A 1 140 ? 17.128  64.243  10.182  1.00 0.00   ? 140 ARG A HH12  1 
ATOM   1146  H HH21  . ARG A 1 140 ? 15.911  61.967  12.525  1.00 0.00   ? 140 ARG A HH21  1 
ATOM   1147  H HH22  . ARG A 1 140 ? 16.494  63.574  12.256  1.00 0.00   ? 140 ARG A HH22  1 
ATOM   1148  N N     . LYS A 1 141 ? 15.548  56.942  6.453   1.00 39.09  ? 141 LYS A N     1 
ATOM   1149  C CA    . LYS A 1 141 ? 14.891  57.022  5.166   1.00 44.23  ? 141 LYS A CA    1 
ATOM   1150  C C     . LYS A 1 141 ? 15.018  58.463  4.711   1.00 50.71  ? 141 LYS A C     1 
ATOM   1151  O O     . LYS A 1 141 ? 14.483  59.368  5.358   1.00 50.86  ? 141 LYS A O     1 
ATOM   1152  C CB    . LYS A 1 141 ? 13.439  56.654  5.337   1.00 41.62  ? 141 LYS A CB    1 
ATOM   1153  C CG    . LYS A 1 141 ? 12.600  56.911  4.120   1.00 41.99  ? 141 LYS A CG    1 
ATOM   1154  C CD    . LYS A 1 141 ? 11.154  56.644  4.443   1.00 42.56  ? 141 LYS A CD    1 
ATOM   1155  C CE    . LYS A 1 141 ? 10.297  57.018  3.247   1.00 44.75  ? 141 LYS A CE    1 
ATOM   1156  N NZ    . LYS A 1 141 ? 10.714  56.301  2.054   1.00 47.12  ? 141 LYS A NZ    1 
ATOM   1157  H H     . LYS A 1 141 ? 14.996  56.709  7.228   1.00 0.00   ? 141 LYS A H     1 
ATOM   1158  H HZ1   . LYS A 1 141 ? 10.692  55.278  2.243   1.00 0.00   ? 141 LYS A HZ1   1 
ATOM   1159  H HZ2   . LYS A 1 141 ? 10.074  56.524  1.266   1.00 0.00   ? 141 LYS A HZ2   1 
ATOM   1160  H HZ3   . LYS A 1 141 ? 11.683  56.580  1.800   1.00 0.00   ? 141 LYS A HZ3   1 
ATOM   1161  N N     . LYS A 1 142 ? 15.794  58.695  3.656   1.00 59.63  ? 142 LYS A N     1 
ATOM   1162  C CA    . LYS A 1 142 ? 15.944  60.046  3.140   1.00 66.35  ? 142 LYS A CA    1 
ATOM   1163  C C     . LYS A 1 142 ? 14.829  60.480  2.206   1.00 69.17  ? 142 LYS A C     1 
ATOM   1164  O O     . LYS A 1 142 ? 14.576  61.678  2.049   1.00 71.24  ? 142 LYS A O     1 
ATOM   1165  C CB    . LYS A 1 142 ? 17.276  60.195  2.414   1.00 67.72  ? 142 LYS A CB    1 
ATOM   1166  C CG    . LYS A 1 142 ? 18.348  60.606  3.408   1.00 75.19  ? 142 LYS A CG    1 
ATOM   1167  C CD    . LYS A 1 142 ? 19.631  61.043  2.718   1.00 80.18  ? 142 LYS A CD    1 
ATOM   1168  C CE    . LYS A 1 142 ? 20.623  61.486  3.788   1.00 81.35  ? 142 LYS A CE    1 
ATOM   1169  N NZ    . LYS A 1 142 ? 21.870  61.919  3.190   1.00 85.71  ? 142 LYS A NZ    1 
ATOM   1170  H H     . LYS A 1 142 ? 16.342  57.960  3.306   1.00 0.00   ? 142 LYS A H     1 
ATOM   1171  H HZ1   . LYS A 1 142 ? 22.278  61.135  2.640   1.00 0.00   ? 142 LYS A HZ1   1 
ATOM   1172  H HZ2   . LYS A 1 142 ? 21.692  62.726  2.559   1.00 0.00   ? 142 LYS A HZ2   1 
ATOM   1173  H HZ3   . LYS A 1 142 ? 22.537  62.197  3.937   1.00 0.00   ? 142 LYS A HZ3   1 
ATOM   1174  N N     . SER A 1 143 ? 14.158  59.534  1.554   1.00 71.14  ? 143 SER A N     1 
ATOM   1175  C CA    . SER A 1 143 ? 13.082  59.858  0.644   1.00 71.84  ? 143 SER A CA    1 
ATOM   1176  C C     . SER A 1 143 ? 11.816  60.279  1.378   1.00 72.12  ? 143 SER A C     1 
ATOM   1177  O O     . SER A 1 143 ? 11.582  59.934  2.533   1.00 70.61  ? 143 SER A O     1 
ATOM   1178  C CB    . SER A 1 143 ? 12.810  58.646  -0.212  1.00 71.94  ? 143 SER A CB    1 
ATOM   1179  O OG    . SER A 1 143 ? 12.070  58.985  -1.363  1.00 75.44  ? 143 SER A OG    1 
ATOM   1180  H H     . SER A 1 143 ? 14.383  58.596  1.710   1.00 0.00   ? 143 SER A H     1 
ATOM   1181  H HG    . SER A 1 143 ? 12.169  58.203  -1.938  1.00 0.00   ? 143 SER A HG    1 
ATOM   1182  N N     . THR A 1 144 ? 10.996  61.095  0.732   1.00 75.70  ? 144 THR A N     1 
ATOM   1183  C CA    . THR A 1 144 ? 9.682   61.431  1.271   1.00 80.03  ? 144 THR A CA    1 
ATOM   1184  C C     . THR A 1 144 ? 8.686   60.510  0.558   1.00 79.39  ? 144 THR A C     1 
ATOM   1185  O O     . THR A 1 144 ? 7.491   60.480  0.866   1.00 80.47  ? 144 THR A O     1 
ATOM   1186  C CB    . THR A 1 144 ? 9.331   62.925  0.986   1.00 83.46  ? 144 THR A CB    1 
ATOM   1187  O OG1   . THR A 1 144 ? 10.499  63.702  1.268   1.00 87.13  ? 144 THR A OG1   1 
ATOM   1188  C CG2   . THR A 1 144 ? 8.164   63.427  1.839   1.00 83.69  ? 144 THR A CG2   1 
ATOM   1189  H H     . THR A 1 144 ? 11.280  61.484  -0.120  1.00 0.00   ? 144 THR A H     1 
ATOM   1190  H HG1   . THR A 1 144 ? 11.122  63.177  1.788   1.00 0.00   ? 144 THR A HG1   1 
ATOM   1191  N N     . ASP A 1 145 ? 9.183   59.726  -0.406  1.00 78.86  ? 145 ASP A N     1 
ATOM   1192  C CA    . ASP A 1 145 ? 8.359   58.870  -1.231  1.00 78.59  ? 145 ASP A CA    1 
ATOM   1193  C C     . ASP A 1 145 ? 7.906   57.658  -0.418  1.00 76.75  ? 145 ASP A C     1 
ATOM   1194  O O     . ASP A 1 145 ? 8.357   57.435  0.711   1.00 78.37  ? 145 ASP A O     1 
ATOM   1195  C CB    . ASP A 1 145 ? 9.181   58.447  -2.473  1.00 81.41  ? 145 ASP A CB    1 
ATOM   1196  C CG    . ASP A 1 145 ? 9.821   59.563  -3.322  1.00 86.03  ? 145 ASP A CG    1 
ATOM   1197  O OD1   . ASP A 1 145 ? 9.724   60.750  -2.996  1.00 87.08  ? 145 ASP A OD1   1 
ATOM   1198  O OD2   . ASP A 1 145 ? 10.458  59.232  -4.324  1.00 87.57  ? 145 ASP A OD2   1 
ATOM   1199  H H     . ASP A 1 145 ? 10.149  59.598  -0.490  1.00 0.00   ? 145 ASP A H     1 
ATOM   1200  N N     . GLU A 1 146 ? 6.982   56.855  -0.945  1.00 72.64  ? 146 GLU A N     1 
ATOM   1201  C CA    . GLU A 1 146 ? 6.509   55.671  -0.241  1.00 66.08  ? 146 GLU A CA    1 
ATOM   1202  C C     . GLU A 1 146 ? 7.693   54.702  -0.186  1.00 60.40  ? 146 GLU A C     1 
ATOM   1203  O O     . GLU A 1 146 ? 8.371   54.511  -1.205  1.00 59.67  ? 146 GLU A O     1 
ATOM   1204  C CB    . GLU A 1 146 ? 5.320   55.054  -1.003  1.00 67.39  ? 146 GLU A CB    1 
ATOM   1205  C CG    . GLU A 1 146 ? 4.601   53.855  -0.360  1.00 71.00  ? 146 GLU A CG    1 
ATOM   1206  C CD    . GLU A 1 146 ? 3.717   54.084  0.875   1.00 74.82  ? 146 GLU A CD    1 
ATOM   1207  O OE1   . GLU A 1 146 ? 3.866   55.082  1.588   1.00 74.73  ? 146 GLU A OE1   1 
ATOM   1208  O OE2   . GLU A 1 146 ? 2.866   53.232  1.133   1.00 76.44  ? 146 GLU A OE2   1 
ATOM   1209  H H     . GLU A 1 146 ? 6.713   57.015  -1.872  1.00 0.00   ? 146 GLU A H     1 
ATOM   1210  N N     . PRO A 1 147 ? 8.032   54.152  0.981   1.00 54.68  ? 147 PRO A N     1 
ATOM   1211  C CA    . PRO A 1 147 ? 9.132   53.220  1.145   1.00 52.03  ? 147 PRO A CA    1 
ATOM   1212  C C     . PRO A 1 147 ? 9.217   52.038  0.183   1.00 49.43  ? 147 PRO A C     1 
ATOM   1213  O O     . PRO A 1 147 ? 8.278   51.252  0.041   1.00 47.76  ? 147 PRO A O     1 
ATOM   1214  C CB    . PRO A 1 147 ? 9.012   52.823  2.606   1.00 53.43  ? 147 PRO A CB    1 
ATOM   1215  C CG    . PRO A 1 147 ? 7.633   53.258  3.031   1.00 54.23  ? 147 PRO A CG    1 
ATOM   1216  C CD    . PRO A 1 147 ? 7.510   54.555  2.275   1.00 53.53  ? 147 PRO A CD    1 
ATOM   1217  N N     . SER A 1 148 ? 10.367  51.969  -0.496  1.00 48.03  ? 148 SER A N     1 
ATOM   1218  C CA    . SER A 1 148 ? 10.725  50.890  -1.407  1.00 44.61  ? 148 SER A CA    1 
ATOM   1219  C C     . SER A 1 148 ? 12.151  50.480  -1.035  1.00 43.20  ? 148 SER A C     1 
ATOM   1220  O O     . SER A 1 148 ? 12.801  51.149  -0.215  1.00 39.36  ? 148 SER A O     1 
ATOM   1221  C CB    . SER A 1 148 ? 10.684  51.369  -2.875  1.00 44.20  ? 148 SER A CB    1 
ATOM   1222  O OG    . SER A 1 148 ? 11.724  52.258  -3.294  1.00 41.11  ? 148 SER A OG    1 
ATOM   1223  H H     . SER A 1 148 ? 11.030  52.676  -0.361  1.00 0.00   ? 148 SER A H     1 
ATOM   1224  H HG    . SER A 1 148 ? 11.397  52.801  -4.020  1.00 0.00   ? 148 SER A HG    1 
ATOM   1225  N N     . GLU A 1 149 ? 12.705  49.397  -1.599  1.00 44.15  ? 149 GLU A N     1 
ATOM   1226  C CA    . GLU A 1 149 ? 14.092  49.032  -1.324  1.00 44.62  ? 149 GLU A CA    1 
ATOM   1227  C C     . GLU A 1 149 ? 15.080  50.082  -1.769  1.00 41.86  ? 149 GLU A C     1 
ATOM   1228  O O     . GLU A 1 149 ? 16.208  50.092  -1.284  1.00 42.50  ? 149 GLU A O     1 
ATOM   1229  C CB    . GLU A 1 149 ? 14.524  47.726  -1.975  1.00 45.30  ? 149 GLU A CB    1 
ATOM   1230  C CG    . GLU A 1 149 ? 13.822  47.248  -3.208  1.00 53.37  ? 149 GLU A CG    1 
ATOM   1231  C CD    . GLU A 1 149 ? 13.834  45.728  -3.263  1.00 56.18  ? 149 GLU A CD    1 
ATOM   1232  O OE1   . GLU A 1 149 ? 13.029  45.091  -2.572  1.00 53.89  ? 149 GLU A OE1   1 
ATOM   1233  O OE2   . GLU A 1 149 ? 14.661  45.189  -3.999  1.00 58.55  ? 149 GLU A OE2   1 
ATOM   1234  H H     . GLU A 1 149 ? 12.145  48.824  -2.165  1.00 0.00   ? 149 GLU A H     1 
ATOM   1235  N N     . LYS A 1 150 ? 14.668  51.037  -2.603  1.00 40.37  ? 150 LYS A N     1 
ATOM   1236  C CA    . LYS A 1 150 ? 15.497  52.176  -2.959  1.00 37.44  ? 150 LYS A CA    1 
ATOM   1237  C C     . LYS A 1 150 ? 15.853  53.030  -1.746  1.00 34.65  ? 150 LYS A C     1 
ATOM   1238  O O     . LYS A 1 150 ? 16.589  53.998  -1.901  1.00 38.64  ? 150 LYS A O     1 
ATOM   1239  C CB    . LYS A 1 150 ? 14.792  53.088  -3.951  1.00 42.04  ? 150 LYS A CB    1 
ATOM   1240  C CG    . LYS A 1 150 ? 14.640  52.532  -5.344  1.00 51.68  ? 150 LYS A CG    1 
ATOM   1241  C CD    . LYS A 1 150 ? 14.109  53.654  -6.219  1.00 59.37  ? 150 LYS A CD    1 
ATOM   1242  C CE    . LYS A 1 150 ? 14.152  53.233  -7.686  1.00 65.06  ? 150 LYS A CE    1 
ATOM   1243  N NZ    . LYS A 1 150 ? 13.785  54.335  -8.558  1.00 67.00  ? 150 LYS A NZ    1 
ATOM   1244  H H     . LYS A 1 150 ? 13.759  50.989  -2.961  1.00 0.00   ? 150 LYS A H     1 
ATOM   1245  H HZ1   . LYS A 1 150 ? 14.434  55.133  -8.403  1.00 0.00   ? 150 LYS A HZ1   1 
ATOM   1246  H HZ2   . LYS A 1 150 ? 13.846  54.029  -9.550  1.00 0.00   ? 150 LYS A HZ2   1 
ATOM   1247  H HZ3   . LYS A 1 150 ? 12.811  54.635  -8.347  1.00 0.00   ? 150 LYS A HZ3   1 
ATOM   1248  N N     . ASP A 1 151 ? 15.342  52.812  -0.528  1.00 32.44  ? 151 ASP A N     1 
ATOM   1249  C CA    . ASP A 1 151 ? 15.776  53.581  0.634   1.00 27.61  ? 151 ASP A CA    1 
ATOM   1250  C C     . ASP A 1 151 ? 16.934  52.879  1.342   1.00 26.78  ? 151 ASP A C     1 
ATOM   1251  O O     . ASP A 1 151 ? 17.688  53.497  2.086   1.00 20.47  ? 151 ASP A O     1 
ATOM   1252  C CB    . ASP A 1 151 ? 14.620  53.761  1.598   1.00 26.86  ? 151 ASP A CB    1 
ATOM   1253  C CG    . ASP A 1 151 ? 13.463  54.588  1.038   1.00 32.58  ? 151 ASP A CG    1 
ATOM   1254  O OD1   . ASP A 1 151 ? 13.567  55.811  0.998   1.00 32.38  ? 151 ASP A OD1   1 
ATOM   1255  O OD2   . ASP A 1 151 ? 12.446  54.014  0.654   1.00 34.18  ? 151 ASP A OD2   1 
ATOM   1256  H H     . ASP A 1 151 ? 14.601  52.183  -0.426  1.00 0.00   ? 151 ASP A H     1 
ATOM   1257  N N     . ALA A 1 152 ? 17.125  51.575  1.114   1.00 26.09  ? 152 ALA A N     1 
ATOM   1258  C CA    . ALA A 1 152 ? 18.225  50.841  1.723   1.00 25.33  ? 152 ALA A CA    1 
ATOM   1259  C C     . ALA A 1 152 ? 19.544  51.103  1.019   1.00 27.45  ? 152 ALA A C     1 
ATOM   1260  O O     . ALA A 1 152 ? 20.626  50.983  1.600   1.00 31.00  ? 152 ALA A O     1 
ATOM   1261  C CB    . ALA A 1 152 ? 17.949  49.363  1.661   1.00 20.79  ? 152 ALA A CB    1 
ATOM   1262  H H     . ALA A 1 152 ? 16.534  51.104  0.492   1.00 0.00   ? 152 ALA A H     1 
ATOM   1263  N N     . LEU A 1 153 ? 19.476  51.475  -0.259  1.00 28.22  ? 153 LEU A N     1 
ATOM   1264  C CA    . LEU A 1 153 ? 20.658  51.701  -1.071  1.00 25.99  ? 153 LEU A CA    1 
ATOM   1265  C C     . LEU A 1 153 ? 21.282  53.047  -0.796  1.00 25.54  ? 153 LEU A C     1 
ATOM   1266  O O     . LEU A 1 153 ? 21.329  53.928  -1.652  1.00 29.29  ? 153 LEU A O     1 
ATOM   1267  C CB    . LEU A 1 153 ? 20.297  51.604  -2.546  1.00 23.95  ? 153 LEU A CB    1 
ATOM   1268  C CG    . LEU A 1 153 ? 19.715  50.290  -2.996  1.00 24.84  ? 153 LEU A CG    1 
ATOM   1269  C CD1   . LEU A 1 153 ? 19.253  50.424  -4.426  1.00 23.95  ? 153 LEU A CD1   1 
ATOM   1270  C CD2   . LEU A 1 153 ? 20.743  49.197  -2.841  1.00 21.42  ? 153 LEU A CD2   1 
ATOM   1271  H H     . LEU A 1 153 ? 18.599  51.623  -0.661  1.00 0.00   ? 153 LEU A H     1 
ATOM   1272  N N     . GLN A 1 154 ? 21.737  53.258  0.429   1.00 25.79  ? 154 GLN A N     1 
ATOM   1273  C CA    . GLN A 1 154 ? 22.410  54.491  0.775   1.00 23.79  ? 154 GLN A CA    1 
ATOM   1274  C C     . GLN A 1 154 ? 23.867  54.110  0.973   1.00 25.32  ? 154 GLN A C     1 
ATOM   1275  O O     . GLN A 1 154 ? 24.104  52.978  1.409   1.00 29.35  ? 154 GLN A O     1 
ATOM   1276  C CB    . GLN A 1 154 ? 21.821  55.063  2.056   1.00 24.67  ? 154 GLN A CB    1 
ATOM   1277  C CG    . GLN A 1 154 ? 20.422  55.595  1.834   1.00 24.87  ? 154 GLN A CG    1 
ATOM   1278  C CD    . GLN A 1 154 ? 19.766  56.190  3.058   1.00 26.83  ? 154 GLN A CD    1 
ATOM   1279  O OE1   . GLN A 1 154 ? 18.549  56.190  3.173   1.00 35.09  ? 154 GLN A OE1   1 
ATOM   1280  N NE2   . GLN A 1 154 ? 20.452  56.764  4.028   1.00 26.61  ? 154 GLN A NE2   1 
ATOM   1281  H H     . GLN A 1 154 ? 21.726  52.530  1.088   1.00 0.00   ? 154 GLN A H     1 
ATOM   1282  H HE21  . GLN A 1 154 ? 19.870  57.088  4.754   1.00 0.00   ? 154 GLN A HE21  1 
ATOM   1283  H HE22  . GLN A 1 154 ? 21.420  56.832  4.013   1.00 0.00   ? 154 GLN A HE22  1 
ATOM   1284  N N     . PRO A 1 155 ? 24.886  54.942  0.680   1.00 25.14  ? 155 PRO A N     1 
ATOM   1285  C CA    . PRO A 1 155 ? 26.289  54.676  1.015   1.00 24.29  ? 155 PRO A CA    1 
ATOM   1286  C C     . PRO A 1 155 ? 26.509  54.572  2.518   1.00 23.04  ? 155 PRO A C     1 
ATOM   1287  O O     . PRO A 1 155 ? 25.812  55.227  3.304   1.00 21.51  ? 155 PRO A O     1 
ATOM   1288  C CB    . PRO A 1 155 ? 27.042  55.828  0.387   1.00 26.10  ? 155 PRO A CB    1 
ATOM   1289  C CG    . PRO A 1 155 ? 26.037  56.964  0.461   1.00 26.44  ? 155 PRO A CG    1 
ATOM   1290  C CD    . PRO A 1 155 ? 24.755  56.253  0.047   1.00 22.79  ? 155 PRO A CD    1 
ATOM   1291  N N     . GLY A 1 156 ? 27.537  53.840  2.931   1.00 23.52  ? 156 GLY A N     1 
ATOM   1292  C CA    . GLY A 1 156 ? 27.805  53.614  4.342   1.00 24.03  ? 156 GLY A CA    1 
ATOM   1293  C C     . GLY A 1 156 ? 28.003  54.887  5.141   1.00 26.67  ? 156 GLY A C     1 
ATOM   1294  O O     . GLY A 1 156 ? 27.669  54.942  6.322   1.00 27.70  ? 156 GLY A O     1 
ATOM   1295  H H     . GLY A 1 156 ? 28.130  53.459  2.251   1.00 0.00   ? 156 GLY A H     1 
ATOM   1296  N N     . ARG A 1 157 ? 28.520  55.934  4.496   1.00 29.19  ? 157 ARG A N     1 
ATOM   1297  C CA    . ARG A 1 157 ? 28.729  57.228  5.129   1.00 30.60  ? 157 ARG A CA    1 
ATOM   1298  C C     . ARG A 1 157 ? 27.461  57.788  5.773   1.00 26.48  ? 157 ARG A C     1 
ATOM   1299  O O     . ARG A 1 157 ? 27.542  58.464  6.799   1.00 26.20  ? 157 ARG A O     1 
ATOM   1300  C CB    . ARG A 1 157 ? 29.267  58.226  4.091   1.00 36.59  ? 157 ARG A CB    1 
ATOM   1301  C CG    . ARG A 1 157 ? 30.706  58.707  4.334   1.00 49.63  ? 157 ARG A CG    1 
ATOM   1302  C CD    . ARG A 1 157 ? 31.036  59.738  3.234   1.00 62.29  ? 157 ARG A CD    1 
ATOM   1303  N NE    . ARG A 1 157 ? 32.089  60.731  3.557   1.00 70.66  ? 157 ARG A NE    1 
ATOM   1304  C CZ    . ARG A 1 157 ? 32.435  61.768  2.736   1.00 68.82  ? 157 ARG A CZ    1 
ATOM   1305  N NH1   . ARG A 1 157 ? 31.892  61.898  1.489   1.00 68.09  ? 157 ARG A NH1   1 
ATOM   1306  N NH2   . ARG A 1 157 ? 33.373  62.659  3.160   1.00 66.81  ? 157 ARG A NH2   1 
ATOM   1307  H H     . ARG A 1 157 ? 28.797  55.818  3.564   1.00 0.00   ? 157 ARG A H     1 
ATOM   1308  H HE    . ARG A 1 157 ? 32.562  60.645  4.408   1.00 0.00   ? 157 ARG A HE    1 
ATOM   1309  H HH11  . ARG A 1 157 ? 31.221  61.239  1.164   1.00 0.00   ? 157 ARG A HH11  1 
ATOM   1310  H HH12  . ARG A 1 157 ? 32.171  62.655  0.903   1.00 0.00   ? 157 ARG A HH12  1 
ATOM   1311  H HH21  . ARG A 1 157 ? 33.786  62.561  4.068   1.00 0.00   ? 157 ARG A HH21  1 
ATOM   1312  H HH22  . ARG A 1 157 ? 33.643  63.416  2.562   1.00 0.00   ? 157 ARG A HH22  1 
ATOM   1313  N N     . ASN A 1 158 ? 26.279  57.448  5.268   1.00 25.38  ? 158 ASN A N     1 
ATOM   1314  C CA    . ASN A 1 158 ? 25.022  57.971  5.791   1.00 24.60  ? 158 ASN A CA    1 
ATOM   1315  C C     . ASN A 1 158 ? 24.456  57.136  6.940   1.00 22.23  ? 158 ASN A C     1 
ATOM   1316  O O     . ASN A 1 158 ? 23.264  57.231  7.240   1.00 21.55  ? 158 ASN A O     1 
ATOM   1317  C CB    . ASN A 1 158 ? 23.982  58.029  4.671   1.00 28.52  ? 158 ASN A CB    1 
ATOM   1318  C CG    . ASN A 1 158 ? 24.326  58.891  3.465   1.00 32.75  ? 158 ASN A CG    1 
ATOM   1319  O OD1   . ASN A 1 158 ? 25.354  59.558  3.382   1.00 37.17  ? 158 ASN A OD1   1 
ATOM   1320  N ND2   . ASN A 1 158 ? 23.495  58.905  2.430   1.00 37.21  ? 158 ASN A ND2   1 
ATOM   1321  H H     . ASN A 1 158 ? 26.253  56.783  4.549   1.00 0.00   ? 158 ASN A H     1 
ATOM   1322  H HD21  . ASN A 1 158 ? 23.780  59.479  1.686   1.00 0.00   ? 158 ASN A HD21  1 
ATOM   1323  H HD22  . ASN A 1 158 ? 22.668  58.390  2.443   1.00 0.00   ? 158 ASN A HD22  1 
ATOM   1324  N N     . LEU A 1 159 ? 25.229  56.262  7.588   1.00 23.94  ? 159 LEU A N     1 
ATOM   1325  C CA    . LEU A 1 159 ? 24.725  55.431  8.666   1.00 24.93  ? 159 LEU A CA    1 
ATOM   1326  C C     . LEU A 1 159 ? 24.588  56.210  9.962   1.00 26.96  ? 159 LEU A C     1 
ATOM   1327  O O     . LEU A 1 159 ? 25.501  56.930  10.374  1.00 29.54  ? 159 LEU A O     1 
ATOM   1328  C CB    . LEU A 1 159 ? 25.655  54.250  8.909   1.00 19.21  ? 159 LEU A CB    1 
ATOM   1329  C CG    . LEU A 1 159 ? 25.619  53.082  7.961   1.00 18.56  ? 159 LEU A CG    1 
ATOM   1330  C CD1   . LEU A 1 159 ? 26.936  52.338  8.014   1.00 15.55  ? 159 LEU A CD1   1 
ATOM   1331  C CD2   . LEU A 1 159 ? 24.478  52.168  8.337   1.00 18.97  ? 159 LEU A CD2   1 
ATOM   1332  H H     . LEU A 1 159 ? 26.183  56.215  7.370   1.00 0.00   ? 159 LEU A H     1 
ATOM   1333  N N     . VAL A 1 160 ? 23.426  56.056  10.599  1.00 26.93  ? 160 VAL A N     1 
ATOM   1334  C CA    . VAL A 1 160 ? 23.126  56.653  11.891  1.00 25.72  ? 160 VAL A CA    1 
ATOM   1335  C C     . VAL A 1 160 ? 23.855  55.866  12.983  1.00 23.63  ? 160 VAL A C     1 
ATOM   1336  O O     . VAL A 1 160 ? 24.457  56.427  13.897  1.00 27.99  ? 160 VAL A O     1 
ATOM   1337  C CB    . VAL A 1 160 ? 21.594  56.607  12.128  1.00 28.90  ? 160 VAL A CB    1 
ATOM   1338  C CG1   . VAL A 1 160 ? 21.260  57.232  13.468  1.00 31.50  ? 160 VAL A CG1   1 
ATOM   1339  C CG2   . VAL A 1 160 ? 20.853  57.396  11.054  1.00 31.41  ? 160 VAL A CG2   1 
ATOM   1340  H H     . VAL A 1 160 ? 22.748  55.500  10.162  1.00 0.00   ? 160 VAL A H     1 
ATOM   1341  N N     . ALA A 1 161 ? 23.756  54.545  12.913  1.00 18.30  ? 161 ALA A N     1 
ATOM   1342  C CA    . ALA A 1 161 ? 24.327  53.647  13.891  1.00 13.50  ? 161 ALA A CA    1 
ATOM   1343  C C     . ALA A 1 161 ? 24.603  52.341  13.177  1.00 13.83  ? 161 ALA A C     1 
ATOM   1344  O O     . ALA A 1 161 ? 23.909  52.000  12.206  1.00 11.83  ? 161 ALA A O     1 
ATOM   1345  C CB    . ALA A 1 161 ? 23.345  53.348  15.010  1.00 14.81  ? 161 ALA A CB    1 
ATOM   1346  H H     . ALA A 1 161 ? 23.320  54.133  12.138  1.00 0.00   ? 161 ALA A H     1 
ATOM   1347  N N     . ALA A 1 162 ? 25.610  51.602  13.604  1.00 13.53  ? 162 ALA A N     1 
ATOM   1348  C CA    . ALA A 1 162 ? 25.863  50.273  13.072  1.00 12.00  ? 162 ALA A CA    1 
ATOM   1349  C C     . ALA A 1 162 ? 26.581  49.478  14.150  1.00 9.50   ? 162 ALA A C     1 
ATOM   1350  O O     . ALA A 1 162 ? 27.083  50.050  15.128  1.00 12.74  ? 162 ALA A O     1 
ATOM   1351  C CB    . ALA A 1 162 ? 26.752  50.337  11.851  1.00 17.80  ? 162 ALA A CB    1 
ATOM   1352  H H     . ALA A 1 162 ? 26.189  51.923  14.329  1.00 0.00   ? 162 ALA A H     1 
ATOM   1353  N N     . GLY A 1 163 ? 26.645  48.169  14.070  1.00 2.98   ? 163 GLY A N     1 
ATOM   1354  C CA    . GLY A 1 163 ? 27.336  47.465  15.114  1.00 4.37   ? 163 GLY A CA    1 
ATOM   1355  C C     . GLY A 1 163 ? 27.149  46.004  14.879  1.00 5.26   ? 163 GLY A C     1 
ATOM   1356  O O     . GLY A 1 163 ? 26.659  45.597  13.813  1.00 7.79   ? 163 GLY A O     1 
ATOM   1357  H H     . GLY A 1 163 ? 26.241  47.656  13.333  1.00 0.00   ? 163 GLY A H     1 
ATOM   1358  N N     . TYR A 1 164 ? 27.518  45.229  15.879  1.00 5.10   ? 164 TYR A N     1 
ATOM   1359  C CA    . TYR A 1 164 ? 27.418  43.799  15.822  1.00 5.92   ? 164 TYR A CA    1 
ATOM   1360  C C     . TYR A 1 164 ? 27.350  43.267  17.236  1.00 6.78   ? 164 TYR A C     1 
ATOM   1361  O O     . TYR A 1 164 ? 27.678  43.976  18.191  1.00 9.09   ? 164 TYR A O     1 
ATOM   1362  C CB    . TYR A 1 164 ? 28.630  43.202  15.081  1.00 5.90   ? 164 TYR A CB    1 
ATOM   1363  C CG    . TYR A 1 164 ? 30.043  43.450  15.628  1.00 12.56  ? 164 TYR A CG    1 
ATOM   1364  C CD1   . TYR A 1 164 ? 30.506  42.683  16.678  1.00 15.63  ? 164 TYR A CD1   1 
ATOM   1365  C CD2   . TYR A 1 164 ? 30.885  44.405  15.072  1.00 15.02  ? 164 TYR A CD2   1 
ATOM   1366  C CE1   . TYR A 1 164 ? 31.775  42.863  17.174  1.00 9.30   ? 164 TYR A CE1   1 
ATOM   1367  C CE2   . TYR A 1 164 ? 32.154  44.605  15.579  1.00 11.00  ? 164 TYR A CE2   1 
ATOM   1368  C CZ    . TYR A 1 164 ? 32.581  43.837  16.632  1.00 14.73  ? 164 TYR A CZ    1 
ATOM   1369  O OH    . TYR A 1 164 ? 33.830  44.012  17.199  1.00 12.30  ? 164 TYR A OH    1 
ATOM   1370  H H     . TYR A 1 164 ? 27.797  45.632  16.730  1.00 0.00   ? 164 TYR A H     1 
ATOM   1371  H HH    . TYR A 1 164 ? 34.193  43.135  17.054  1.00 0.00   ? 164 TYR A HH    1 
ATOM   1372  N N     . ALA A 1 165 ? 26.895  42.031  17.358  1.00 8.47   ? 165 ALA A N     1 
ATOM   1373  C CA    . ALA A 1 165 ? 26.864  41.284  18.594  1.00 8.98   ? 165 ALA A CA    1 
ATOM   1374  C C     . ALA A 1 165 ? 27.704  40.070  18.246  1.00 8.48   ? 165 ALA A C     1 
ATOM   1375  O O     . ALA A 1 165 ? 27.618  39.577  17.114  1.00 12.94  ? 165 ALA A O     1 
ATOM   1376  C CB    . ALA A 1 165 ? 25.506  40.784  18.921  1.00 4.92   ? 165 ALA A CB    1 
ATOM   1377  H H     . ALA A 1 165 ? 26.643  41.559  16.537  1.00 0.00   ? 165 ALA A H     1 
ATOM   1378  N N     . LEU A 1 166 ? 28.539  39.561  19.130  1.00 5.35   ? 166 LEU A N     1 
ATOM   1379  C CA    . LEU A 1 166 ? 29.388  38.436  18.829  1.00 4.21   ? 166 LEU A CA    1 
ATOM   1380  C C     . LEU A 1 166 ? 29.102  37.457  19.956  1.00 10.04  ? 166 LEU A C     1 
ATOM   1381  O O     . LEU A 1 166 ? 29.104  37.823  21.154  1.00 8.06   ? 166 LEU A O     1 
ATOM   1382  C CB    . LEU A 1 166 ? 30.861  38.878  18.835  1.00 4.91   ? 166 LEU A CB    1 
ATOM   1383  C CG    . LEU A 1 166 ? 31.948  37.795  18.769  1.00 7.90   ? 166 LEU A CG    1 
ATOM   1384  C CD1   . LEU A 1 166 ? 31.794  36.966  17.508  1.00 2.00   ? 166 LEU A CD1   1 
ATOM   1385  C CD2   . LEU A 1 166 ? 33.301  38.450  18.847  1.00 6.71   ? 166 LEU A CD2   1 
ATOM   1386  H H     . LEU A 1 166 ? 28.543  39.897  20.044  1.00 0.00   ? 166 LEU A H     1 
ATOM   1387  N N     . TYR A 1 167 ? 28.819  36.220  19.539  1.00 8.17   ? 167 TYR A N     1 
ATOM   1388  C CA    . TYR A 1 167 ? 28.498  35.134  20.451  1.00 11.27  ? 167 TYR A CA    1 
ATOM   1389  C C     . TYR A 1 167 ? 29.739  34.270  20.527  1.00 8.02   ? 167 TYR A C     1 
ATOM   1390  O O     . TYR A 1 167 ? 29.888  33.305  19.782  1.00 9.99   ? 167 TYR A O     1 
ATOM   1391  C CB    . TYR A 1 167 ? 27.305  34.307  19.919  1.00 11.32  ? 167 TYR A CB    1 
ATOM   1392  C CG    . TYR A 1 167 ? 26.067  35.130  19.566  1.00 8.59   ? 167 TYR A CG    1 
ATOM   1393  C CD1   . TYR A 1 167 ? 25.451  35.917  20.514  1.00 6.97   ? 167 TYR A CD1   1 
ATOM   1394  C CD2   . TYR A 1 167 ? 25.658  35.205  18.251  1.00 9.51   ? 167 TYR A CD2   1 
ATOM   1395  C CE1   . TYR A 1 167 ? 24.518  36.853  20.123  1.00 2.72   ? 167 TYR A CE1   1 
ATOM   1396  C CE2   . TYR A 1 167 ? 24.738  36.145  17.855  1.00 8.37   ? 167 TYR A CE2   1 
ATOM   1397  C CZ    . TYR A 1 167 ? 24.207  36.982  18.792  1.00 4.69   ? 167 TYR A CZ    1 
ATOM   1398  O OH    . TYR A 1 167 ? 23.371  38.003  18.381  1.00 13.38  ? 167 TYR A OH    1 
ATOM   1399  H H     . TYR A 1 167 ? 28.863  36.024  18.583  1.00 0.00   ? 167 TYR A H     1 
ATOM   1400  H HH    . TYR A 1 167 ? 23.308  38.026  17.416  1.00 0.00   ? 167 TYR A HH    1 
ATOM   1401  N N     . GLY A 1 168 ? 30.664  34.674  21.388  1.00 9.45   ? 168 GLY A N     1 
ATOM   1402  C CA    . GLY A 1 168 ? 31.926  33.987  21.507  1.00 6.50   ? 168 GLY A CA    1 
ATOM   1403  C C     . GLY A 1 168 ? 31.981  33.288  22.841  1.00 10.11  ? 168 GLY A C     1 
ATOM   1404  O O     . GLY A 1 168 ? 30.986  32.710  23.269  1.00 13.02  ? 168 GLY A O     1 
ATOM   1405  H H     . GLY A 1 168 ? 30.469  35.398  22.020  1.00 0.00   ? 168 GLY A H     1 
ATOM   1406  N N     . SER A 1 169 ? 33.102  33.421  23.549  1.00 5.52   ? 169 SER A N     1 
ATOM   1407  C CA    . SER A 1 169 ? 33.217  32.810  24.841  1.00 7.54   ? 169 SER A CA    1 
ATOM   1408  C C     . SER A 1 169 ? 32.216  33.441  25.781  1.00 6.88   ? 169 SER A C     1 
ATOM   1409  O O     . SER A 1 169 ? 31.765  32.819  26.739  1.00 16.01  ? 169 SER A O     1 
ATOM   1410  C CB    . SER A 1 169 ? 34.673  32.957  25.357  1.00 7.21   ? 169 SER A CB    1 
ATOM   1411  O OG    . SER A 1 169 ? 35.216  34.281  25.350  1.00 16.52  ? 169 SER A OG    1 
ATOM   1412  H H     . SER A 1 169 ? 33.860  33.922  23.177  1.00 0.00   ? 169 SER A H     1 
ATOM   1413  H HG    . SER A 1 169 ? 35.510  34.490  26.245  1.00 0.00   ? 169 SER A HG    1 
ATOM   1414  N N     . ALA A 1 170 ? 31.893  34.692  25.480  1.00 7.48   ? 170 ALA A N     1 
ATOM   1415  C CA    . ALA A 1 170 ? 30.914  35.526  26.142  1.00 2.51   ? 170 ALA A CA    1 
ATOM   1416  C C     . ALA A 1 170 ? 30.214  36.275  25.012  1.00 7.19   ? 170 ALA A C     1 
ATOM   1417  O O     . ALA A 1 170 ? 30.680  36.208  23.861  1.00 8.63   ? 170 ALA A O     1 
ATOM   1418  C CB    . ALA A 1 170 ? 31.635  36.489  27.008  1.00 2.00   ? 170 ALA A CB    1 
ATOM   1419  H H     . ALA A 1 170 ? 32.322  35.091  24.697  1.00 0.00   ? 170 ALA A H     1 
ATOM   1420  N N     . THR A 1 171 ? 29.106  36.977  25.260  1.00 7.46   ? 171 THR A N     1 
ATOM   1421  C CA    . THR A 1 171 ? 28.436  37.774  24.251  1.00 6.85   ? 171 THR A CA    1 
ATOM   1422  C C     . THR A 1 171 ? 28.720  39.250  24.463  1.00 8.54   ? 171 THR A C     1 
ATOM   1423  O O     . THR A 1 171 ? 28.573  39.815  25.554  1.00 7.10   ? 171 THR A O     1 
ATOM   1424  C CB    . THR A 1 171 ? 26.937  37.511  24.311  1.00 2.00   ? 171 THR A CB    1 
ATOM   1425  O OG1   . THR A 1 171 ? 26.848  36.105  24.060  1.00 3.15   ? 171 THR A OG1   1 
ATOM   1426  C CG2   . THR A 1 171 ? 26.088  38.317  23.320  1.00 2.00   ? 171 THR A CG2   1 
ATOM   1427  H H     . THR A 1 171 ? 28.731  36.987  26.163  1.00 0.00   ? 171 THR A H     1 
ATOM   1428  H HG1   . THR A 1 171 ? 27.155  35.918  23.166  1.00 0.00   ? 171 THR A HG1   1 
ATOM   1429  N N     . MET A 1 172 ? 29.083  39.876  23.362  1.00 10.31  ? 172 MET A N     1 
ATOM   1430  C CA    . MET A 1 172 ? 29.431  41.262  23.369  1.00 8.29   ? 172 MET A CA    1 
ATOM   1431  C C     . MET A 1 172 ? 28.711  41.931  22.242  1.00 9.65   ? 172 MET A C     1 
ATOM   1432  O O     . MET A 1 172 ? 28.598  41.349  21.162  1.00 5.67   ? 172 MET A O     1 
ATOM   1433  C CB    . MET A 1 172 ? 30.923  41.428  23.174  1.00 15.73  ? 172 MET A CB    1 
ATOM   1434  C CG    . MET A 1 172 ? 31.402  42.875  23.040  1.00 18.66  ? 172 MET A CG    1 
ATOM   1435  S SD    . MET A 1 172 ? 33.002  43.195  23.817  1.00 30.62  ? 172 MET A SD    1 
ATOM   1436  C CE    . MET A 1 172 ? 32.493  43.642  25.441  1.00 19.92  ? 172 MET A CE    1 
ATOM   1437  H H     . MET A 1 172 ? 29.117  39.396  22.506  1.00 0.00   ? 172 MET A H     1 
ATOM   1438  N N     . LEU A 1 173 ? 28.254  43.146  22.523  1.00 8.55   ? 173 LEU A N     1 
ATOM   1439  C CA    . LEU A 1 173 ? 27.613  43.991  21.548  1.00 8.62   ? 173 LEU A CA    1 
ATOM   1440  C C     . LEU A 1 173 ? 28.587  45.158  21.412  1.00 9.14   ? 173 LEU A C     1 
ATOM   1441  O O     . LEU A 1 173 ? 29.086  45.653  22.427  1.00 7.15   ? 173 LEU A O     1 
ATOM   1442  C CB    . LEU A 1 173 ? 26.253  44.486  22.072  1.00 5.81   ? 173 LEU A CB    1 
ATOM   1443  C CG    . LEU A 1 173 ? 25.379  45.340  21.146  1.00 6.01   ? 173 LEU A CG    1 
ATOM   1444  C CD1   . LEU A 1 173 ? 24.006  44.725  21.012  1.00 4.19   ? 173 LEU A CD1   1 
ATOM   1445  C CD2   . LEU A 1 173 ? 25.219  46.727  21.715  1.00 4.36   ? 173 LEU A CD2   1 
ATOM   1446  H H     . LEU A 1 173 ? 28.424  43.532  23.402  1.00 0.00   ? 173 LEU A H     1 
ATOM   1447  N N     . VAL A 1 174 ? 28.901  45.584  20.187  1.00 10.01  ? 174 VAL A N     1 
ATOM   1448  C CA    . VAL A 1 174 ? 29.767  46.720  19.890  1.00 5.33   ? 174 VAL A CA    1 
ATOM   1449  C C     . VAL A 1 174 ? 28.798  47.633  19.171  1.00 5.60   ? 174 VAL A C     1 
ATOM   1450  O O     . VAL A 1 174 ? 28.145  47.205  18.206  1.00 6.05   ? 174 VAL A O     1 
ATOM   1451  C CB    . VAL A 1 174 ? 30.921  46.300  18.951  1.00 5.34   ? 174 VAL A CB    1 
ATOM   1452  C CG1   . VAL A 1 174 ? 31.776  47.469  18.513  1.00 2.59   ? 174 VAL A CG1   1 
ATOM   1453  C CG2   . VAL A 1 174 ? 31.830  45.383  19.710  1.00 2.00   ? 174 VAL A CG2   1 
ATOM   1454  H H     . VAL A 1 174 ? 28.444  45.167  19.431  1.00 0.00   ? 174 VAL A H     1 
ATOM   1455  N N     . LEU A 1 175 ? 28.652  48.863  19.646  1.00 5.29   ? 175 LEU A N     1 
ATOM   1456  C CA    . LEU A 1 175 ? 27.702  49.794  19.059  1.00 9.05   ? 175 LEU A CA    1 
ATOM   1457  C C     . LEU A 1 175 ? 28.478  51.002  18.589  1.00 10.92  ? 175 LEU A C     1 
ATOM   1458  O O     . LEU A 1 175 ? 29.256  51.574  19.369  1.00 17.48  ? 175 LEU A O     1 
ATOM   1459  C CB    . LEU A 1 175 ? 26.643  50.230  20.110  1.00 11.27  ? 175 LEU A CB    1 
ATOM   1460  C CG    . LEU A 1 175 ? 25.565  51.232  19.697  1.00 11.27  ? 175 LEU A CG    1 
ATOM   1461  C CD1   . LEU A 1 175 ? 24.938  50.789  18.383  1.00 8.72   ? 175 LEU A CD1   1 
ATOM   1462  C CD2   . LEU A 1 175 ? 24.501  51.330  20.790  1.00 16.96  ? 175 LEU A CD2   1 
ATOM   1463  H H     . LEU A 1 175 ? 29.196  49.166  20.407  1.00 0.00   ? 175 LEU A H     1 
ATOM   1464  N N     . ALA A 1 176 ? 28.308  51.365  17.324  1.00 9.82   ? 176 ALA A N     1 
ATOM   1465  C CA    . ALA A 1 176 ? 29.025  52.479  16.749  1.00 13.36  ? 176 ALA A CA    1 
ATOM   1466  C C     . ALA A 1 176 ? 28.031  53.475  16.229  1.00 17.93  ? 176 ALA A C     1 
ATOM   1467  O O     . ALA A 1 176 ? 27.047  53.112  15.574  1.00 19.89  ? 176 ALA A O     1 
ATOM   1468  C CB    . ALA A 1 176 ? 29.868  52.052  15.581  1.00 13.50  ? 176 ALA A CB    1 
ATOM   1469  H H     . ALA A 1 176 ? 27.650  50.909  16.759  1.00 0.00   ? 176 ALA A H     1 
ATOM   1470  N N     . MET A 1 177 ? 28.251  54.724  16.590  1.00 21.99  ? 177 MET A N     1 
ATOM   1471  C CA    . MET A 1 177 ? 27.435  55.840  16.147  1.00 26.13  ? 177 MET A CA    1 
ATOM   1472  C C     . MET A 1 177 ? 28.397  56.993  16.017  1.00 27.34  ? 177 MET A C     1 
ATOM   1473  O O     . MET A 1 177 ? 29.555  56.862  16.409  1.00 28.53  ? 177 MET A O     1 
ATOM   1474  C CB    . MET A 1 177 ? 26.389  56.247  17.166  1.00 24.07  ? 177 MET A CB    1 
ATOM   1475  C CG    . MET A 1 177 ? 25.339  55.194  17.398  1.00 26.90  ? 177 MET A CG    1 
ATOM   1476  S SD    . MET A 1 177 ? 24.277  55.529  18.812  1.00 28.52  ? 177 MET A SD    1 
ATOM   1477  C CE    . MET A 1 177 ? 25.532  55.511  20.067  1.00 28.77  ? 177 MET A CE    1 
ATOM   1478  H H     . MET A 1 177 ? 29.045  54.927  17.138  1.00 0.00   ? 177 MET A H     1 
ATOM   1479  N N     . ASP A 1 178 ? 27.923  58.145  15.551  1.00 32.04  ? 178 ASP A N     1 
ATOM   1480  C CA    . ASP A 1 178 ? 28.728  59.353  15.415  1.00 35.93  ? 178 ASP A CA    1 
ATOM   1481  C C     . ASP A 1 178 ? 29.687  59.693  16.564  1.00 35.53  ? 178 ASP A C     1 
ATOM   1482  O O     . ASP A 1 178 ? 30.788  60.183  16.324  1.00 32.37  ? 178 ASP A O     1 
ATOM   1483  C CB    . ASP A 1 178 ? 27.757  60.507  15.167  1.00 43.83  ? 178 ASP A CB    1 
ATOM   1484  C CG    . ASP A 1 178 ? 28.364  61.902  14.989  1.00 51.11  ? 178 ASP A CG    1 
ATOM   1485  O OD1   . ASP A 1 178 ? 29.388  62.053  14.316  1.00 59.74  ? 178 ASP A OD1   1 
ATOM   1486  O OD2   . ASP A 1 178 ? 27.797  62.852  15.526  1.00 55.27  ? 178 ASP A OD2   1 
ATOM   1487  H H     . ASP A 1 178 ? 27.023  58.125  15.161  1.00 0.00   ? 178 ASP A H     1 
ATOM   1488  N N     . CYS A 1 179 ? 29.321  59.461  17.827  1.00 34.48  ? 179 CYS A N     1 
ATOM   1489  C CA    . CYS A 1 179 ? 30.241  59.745  18.912  1.00 33.73  ? 179 CYS A CA    1 
ATOM   1490  C C     . CYS A 1 179 ? 31.424  58.765  18.979  1.00 30.77  ? 179 CYS A C     1 
ATOM   1491  O O     . CYS A 1 179 ? 32.477  59.100  19.530  1.00 33.09  ? 179 CYS A O     1 
ATOM   1492  C CB    . CYS A 1 179 ? 29.455  59.764  20.261  1.00 38.35  ? 179 CYS A CB    1 
ATOM   1493  S SG    . CYS A 1 179 ? 28.416  58.399  20.893  1.00 41.90  ? 179 CYS A SG    1 
ATOM   1494  H H     . CYS A 1 179 ? 28.465  59.038  18.013  1.00 0.00   ? 179 CYS A H     1 
ATOM   1495  N N     . GLY A 1 180 ? 31.328  57.556  18.431  1.00 25.89  ? 180 GLY A N     1 
ATOM   1496  C CA    . GLY A 1 180 ? 32.409  56.597  18.518  1.00 21.98  ? 180 GLY A CA    1 
ATOM   1497  C C     . GLY A 1 180 ? 31.861  55.204  18.758  1.00 17.71  ? 180 GLY A C     1 
ATOM   1498  O O     . GLY A 1 180 ? 30.664  54.932  18.589  1.00 19.13  ? 180 GLY A O     1 
ATOM   1499  H H     . GLY A 1 180 ? 30.514  57.265  17.978  1.00 0.00   ? 180 GLY A H     1 
ATOM   1500  N N     . VAL A 1 181 ? 32.764  54.312  19.121  1.00 10.51  ? 181 VAL A N     1 
ATOM   1501  C CA    . VAL A 1 181 ? 32.491  52.909  19.326  1.00 8.54   ? 181 VAL A CA    1 
ATOM   1502  C C     . VAL A 1 181 ? 32.439  52.600  20.817  1.00 13.79  ? 181 VAL A C     1 
ATOM   1503  O O     . VAL A 1 181 ? 33.361  53.016  21.552  1.00 19.05  ? 181 VAL A O     1 
ATOM   1504  C CB    . VAL A 1 181 ? 33.615  52.128  18.651  1.00 3.89   ? 181 VAL A CB    1 
ATOM   1505  C CG1   . VAL A 1 181 ? 33.471  50.635  18.859  1.00 2.12   ? 181 VAL A CG1   1 
ATOM   1506  C CG2   . VAL A 1 181 ? 33.571  52.422  17.186  1.00 7.78   ? 181 VAL A CG2   1 
ATOM   1507  H H     . VAL A 1 181 ? 33.675  54.625  19.300  1.00 0.00   ? 181 VAL A H     1 
ATOM   1508  N N     . ASN A 1 182 ? 31.458  51.849  21.325  1.00 10.47  ? 182 ASN A N     1 
ATOM   1509  C CA    . ASN A 1 182 ? 31.448  51.494  22.734  1.00 11.13  ? 182 ASN A CA    1 
ATOM   1510  C C     . ASN A 1 182 ? 31.190  50.011  22.821  1.00 12.83  ? 182 ASN A C     1 
ATOM   1511  O O     . ASN A 1 182 ? 30.269  49.524  22.161  1.00 18.17  ? 182 ASN A O     1 
ATOM   1512  C CB    . ASN A 1 182 ? 30.349  52.221  23.473  1.00 12.67  ? 182 ASN A CB    1 
ATOM   1513  C CG    . ASN A 1 182 ? 30.606  53.701  23.668  1.00 16.69  ? 182 ASN A CG    1 
ATOM   1514  O OD1   . ASN A 1 182 ? 30.173  54.583  22.930  1.00 15.32  ? 182 ASN A OD1   1 
ATOM   1515  N ND2   . ASN A 1 182 ? 31.312  54.055  24.721  1.00 20.69  ? 182 ASN A ND2   1 
ATOM   1516  H H     . ASN A 1 182 ? 30.711  51.555  20.757  1.00 0.00   ? 182 ASN A H     1 
ATOM   1517  H HD21  . ASN A 1 182 ? 31.478  55.015  24.842  1.00 0.00   ? 182 ASN A HD21  1 
ATOM   1518  H HD22  . ASN A 1 182 ? 31.575  53.336  25.328  1.00 0.00   ? 182 ASN A HD22  1 
ATOM   1519  N N     . CYS A 1 183 ? 31.990  49.243  23.553  1.00 11.62  ? 183 CYS A N     1 
ATOM   1520  C CA    . CYS A 1 183 ? 31.758  47.822  23.668  1.00 9.77   ? 183 CYS A CA    1 
ATOM   1521  C C     . CYS A 1 183 ? 30.902  47.555  24.901  1.00 10.50  ? 183 CYS A C     1 
ATOM   1522  O O     . CYS A 1 183 ? 31.030  48.252  25.918  1.00 13.38  ? 183 CYS A O     1 
ATOM   1523  C CB    . CYS A 1 183 ? 33.107  47.133  23.748  1.00 10.66  ? 183 CYS A CB    1 
ATOM   1524  S SG    . CYS A 1 183 ? 34.228  47.468  22.339  1.00 16.97  ? 183 CYS A SG    1 
ATOM   1525  H H     . CYS A 1 183 ? 32.712  49.648  24.067  1.00 0.00   ? 183 CYS A H     1 
ATOM   1526  N N     . PHE A 1 184 ? 30.026  46.551  24.851  1.00 9.35   ? 184 PHE A N     1 
ATOM   1527  C CA    . PHE A 1 184 ? 29.088  46.209  25.897  1.00 2.92   ? 184 PHE A CA    1 
ATOM   1528  C C     . PHE A 1 184 ? 29.112  44.696  26.059  1.00 9.08   ? 184 PHE A C     1 
ATOM   1529  O O     . PHE A 1 184 ? 29.091  43.966  25.062  1.00 12.00  ? 184 PHE A O     1 
ATOM   1530  C CB    . PHE A 1 184 ? 27.698  46.589  25.512  1.00 2.00   ? 184 PHE A CB    1 
ATOM   1531  C CG    . PHE A 1 184 ? 27.394  48.065  25.481  1.00 7.14   ? 184 PHE A CG    1 
ATOM   1532  C CD1   . PHE A 1 184 ? 27.037  48.700  26.649  1.00 7.33   ? 184 PHE A CD1   1 
ATOM   1533  C CD2   . PHE A 1 184 ? 27.506  48.768  24.296  1.00 4.02   ? 184 PHE A CD2   1 
ATOM   1534  C CE1   . PHE A 1 184 ? 26.862  50.062  26.643  1.00 3.22   ? 184 PHE A CE1   1 
ATOM   1535  C CE2   . PHE A 1 184 ? 27.335  50.127  24.308  1.00 2.00   ? 184 PHE A CE2   1 
ATOM   1536  C CZ    . PHE A 1 184 ? 27.037  50.769  25.483  1.00 5.49   ? 184 PHE A CZ    1 
ATOM   1537  H H     . PHE A 1 184 ? 30.005  45.982  24.053  1.00 0.00   ? 184 PHE A H     1 
ATOM   1538  N N     . MET A 1 185 ? 29.093  44.172  27.273  1.00 6.66   ? 185 MET A N     1 
ATOM   1539  C CA    . MET A 1 185 ? 29.177  42.744  27.537  1.00 11.01  ? 185 MET A CA    1 
ATOM   1540  C C     . MET A 1 185 ? 27.863  42.200  28.101  1.00 10.59  ? 185 MET A C     1 
ATOM   1541  O O     . MET A 1 185 ? 27.291  42.847  28.977  1.00 13.50  ? 185 MET A O     1 
ATOM   1542  C CB    . MET A 1 185 ? 30.313  42.518  28.536  1.00 8.44   ? 185 MET A CB    1 
ATOM   1543  C CG    . MET A 1 185 ? 30.620  41.076  28.866  1.00 12.58  ? 185 MET A CG    1 
ATOM   1544  S SD    . MET A 1 185 ? 31.815  40.366  27.717  1.00 22.28  ? 185 MET A SD    1 
ATOM   1545  C CE    . MET A 1 185 ? 33.270  40.700  28.669  1.00 16.96  ? 185 MET A CE    1 
ATOM   1546  H H     . MET A 1 185 ? 28.949  44.761  28.035  1.00 0.00   ? 185 MET A H     1 
ATOM   1547  N N     . LEU A 1 186 ? 27.350  41.026  27.721  1.00 11.27  ? 186 LEU A N     1 
ATOM   1548  C CA    . LEU A 1 186 ? 26.096  40.538  28.258  1.00 7.59   ? 186 LEU A CA    1 
ATOM   1549  C C     . LEU A 1 186 ? 26.279  39.793  29.545  1.00 5.22   ? 186 LEU A C     1 
ATOM   1550  O O     . LEU A 1 186 ? 27.036  38.830  29.568  1.00 3.36   ? 186 LEU A O     1 
ATOM   1551  C CB    . LEU A 1 186 ? 25.414  39.602  27.290  1.00 7.33   ? 186 LEU A CB    1 
ATOM   1552  C CG    . LEU A 1 186 ? 24.072  38.990  27.669  1.00 6.64   ? 186 LEU A CG    1 
ATOM   1553  C CD1   . LEU A 1 186 ? 23.004  40.032  27.973  1.00 6.27   ? 186 LEU A CD1   1 
ATOM   1554  C CD2   . LEU A 1 186 ? 23.630  38.170  26.484  1.00 7.26   ? 186 LEU A CD2   1 
ATOM   1555  H H     . LEU A 1 186 ? 27.877  40.439  27.147  1.00 0.00   ? 186 LEU A H     1 
ATOM   1556  N N     . ASP A 1 187 ? 25.616  40.181  30.615  1.00 3.88   ? 187 ASP A N     1 
ATOM   1557  C CA    . ASP A 1 187 ? 25.634  39.357  31.795  1.00 4.01   ? 187 ASP A CA    1 
ATOM   1558  C C     . ASP A 1 187 ? 24.441  38.391  31.719  1.00 6.29   ? 187 ASP A C     1 
ATOM   1559  O O     . ASP A 1 187 ? 23.321  38.794  32.061  1.00 9.83   ? 187 ASP A O     1 
ATOM   1560  C CB    . ASP A 1 187 ? 25.503  40.202  33.024  1.00 2.00   ? 187 ASP A CB    1 
ATOM   1561  C CG    . ASP A 1 187 ? 25.696  39.451  34.324  1.00 2.00   ? 187 ASP A CG    1 
ATOM   1562  O OD1   . ASP A 1 187 ? 25.372  38.268  34.431  1.00 3.50   ? 187 ASP A OD1   1 
ATOM   1563  O OD2   . ASP A 1 187 ? 26.183  40.055  35.263  1.00 2.00   ? 187 ASP A OD2   1 
ATOM   1564  H H     . ASP A 1 187 ? 25.166  41.046  30.614  1.00 0.00   ? 187 ASP A H     1 
ATOM   1565  N N     . PRO A 1 188 ? 24.592  37.096  31.427  1.00 5.29   ? 188 PRO A N     1 
ATOM   1566  C CA    . PRO A 1 188 ? 23.499  36.146  31.262  1.00 7.77   ? 188 PRO A CA    1 
ATOM   1567  C C     . PRO A 1 188 ? 22.626  35.919  32.494  1.00 9.13   ? 188 PRO A C     1 
ATOM   1568  O O     . PRO A 1 188 ? 21.440  35.595  32.424  1.00 10.63  ? 188 PRO A O     1 
ATOM   1569  C CB    . PRO A 1 188 ? 24.203  34.897  30.774  1.00 5.43   ? 188 PRO A CB    1 
ATOM   1570  C CG    . PRO A 1 188 ? 25.535  34.986  31.446  1.00 6.66   ? 188 PRO A CG    1 
ATOM   1571  C CD    . PRO A 1 188 ? 25.862  36.435  31.236  1.00 2.00   ? 188 PRO A CD    1 
ATOM   1572  N N     . ALA A 1 189 ? 23.222  36.095  33.667  1.00 8.27   ? 189 ALA A N     1 
ATOM   1573  C CA    . ALA A 1 189 ? 22.470  35.978  34.896  1.00 3.96   ? 189 ALA A CA    1 
ATOM   1574  C C     . ALA A 1 189 ? 21.408  37.060  35.047  1.00 8.76   ? 189 ALA A C     1 
ATOM   1575  O O     . ALA A 1 189 ? 20.466  36.834  35.800  1.00 11.60  ? 189 ALA A O     1 
ATOM   1576  C CB    . ALA A 1 189 ? 23.421  36.074  36.050  1.00 4.72   ? 189 ALA A CB    1 
ATOM   1577  H H     . ALA A 1 189 ? 24.180  36.277  33.688  1.00 0.00   ? 189 ALA A H     1 
ATOM   1578  N N     . ILE A 1 190 ? 21.541  38.265  34.453  1.00 9.49   ? 190 ILE A N     1 
ATOM   1579  C CA    . ILE A 1 190 ? 20.519  39.298  34.576  1.00 3.83   ? 190 ILE A CA    1 
ATOM   1580  C C     . ILE A 1 190 ? 20.070  39.834  33.231  1.00 7.68   ? 190 ILE A C     1 
ATOM   1581  O O     . ILE A 1 190 ? 19.203  40.691  33.218  1.00 11.08  ? 190 ILE A O     1 
ATOM   1582  C CB    . ILE A 1 190 ? 20.950  40.550  35.434  1.00 3.00   ? 190 ILE A CB    1 
ATOM   1583  C CG1   . ILE A 1 190 ? 22.196  41.251  34.952  1.00 5.17   ? 190 ILE A CG1   1 
ATOM   1584  C CG2   . ILE A 1 190 ? 21.173  40.060  36.847  1.00 2.00   ? 190 ILE A CG2   1 
ATOM   1585  C CD1   . ILE A 1 190 ? 22.369  42.619  35.623  1.00 2.00   ? 190 ILE A CD1   1 
ATOM   1586  H H     . ILE A 1 190 ? 22.289  38.426  33.843  1.00 0.00   ? 190 ILE A H     1 
ATOM   1587  N N     . GLY A 1 191 ? 20.575  39.399  32.074  1.00 12.76  ? 191 GLY A N     1 
ATOM   1588  C CA    . GLY A 1 191 ? 20.103  39.894  30.779  1.00 8.13   ? 191 GLY A CA    1 
ATOM   1589  C C     . GLY A 1 191 ? 20.323  41.376  30.578  1.00 8.92   ? 191 GLY A C     1 
ATOM   1590  O O     . GLY A 1 191 ? 19.485  42.112  30.073  1.00 11.30  ? 191 GLY A O     1 
ATOM   1591  H H     . GLY A 1 191 ? 21.251  38.696  32.069  1.00 0.00   ? 191 GLY A H     1 
ATOM   1592  N N     . GLU A 1 192 ? 21.483  41.861  30.964  1.00 8.55   ? 192 GLU A N     1 
ATOM   1593  C CA    . GLU A 1 192 ? 21.801  43.256  30.804  1.00 7.95   ? 192 GLU A CA    1 
ATOM   1594  C C     . GLU A 1 192 ? 23.137  43.296  30.113  1.00 7.45   ? 192 GLU A C     1 
ATOM   1595  O O     . GLU A 1 192 ? 23.998  42.455  30.358  1.00 12.21  ? 192 GLU A O     1 
ATOM   1596  C CB    . GLU A 1 192 ? 21.991  43.992  32.112  1.00 7.85   ? 192 GLU A CB    1 
ATOM   1597  C CG    . GLU A 1 192 ? 20.793  44.361  32.900  1.00 7.99   ? 192 GLU A CG    1 
ATOM   1598  C CD    . GLU A 1 192 ? 19.871  45.395  32.302  1.00 17.08  ? 192 GLU A CD    1 
ATOM   1599  O OE1   . GLU A 1 192 ? 20.210  46.071  31.346  1.00 22.18  ? 192 GLU A OE1   1 
ATOM   1600  O OE2   . GLU A 1 192 ? 18.773  45.533  32.817  1.00 17.89  ? 192 GLU A OE2   1 
ATOM   1601  H H     . GLU A 1 192 ? 22.184  41.250  31.259  1.00 0.00   ? 192 GLU A H     1 
ATOM   1602  N N     . PHE A 1 193 ? 23.327  44.288  29.275  1.00 10.15  ? 193 PHE A N     1 
ATOM   1603  C CA    . PHE A 1 193 ? 24.588  44.518  28.607  1.00 7.07   ? 193 PHE A CA    1 
ATOM   1604  C C     . PHE A 1 193 ? 25.269  45.597  29.425  1.00 9.04   ? 193 PHE A C     1 
ATOM   1605  O O     . PHE A 1 193 ? 24.692  46.670  29.593  1.00 11.70  ? 193 PHE A O     1 
ATOM   1606  C CB    . PHE A 1 193 ? 24.307  45.013  27.233  1.00 7.13   ? 193 PHE A CB    1 
ATOM   1607  C CG    . PHE A 1 193 ? 24.087  43.908  26.249  1.00 6.72   ? 193 PHE A CG    1 
ATOM   1608  C CD1   . PHE A 1 193 ? 25.171  43.170  25.799  1.00 9.25   ? 193 PHE A CD1   1 
ATOM   1609  C CD2   . PHE A 1 193 ? 22.830  43.688  25.759  1.00 5.41   ? 193 PHE A CD2   1 
ATOM   1610  C CE1   . PHE A 1 193 ? 25.012  42.201  24.828  1.00 5.10   ? 193 PHE A CE1   1 
ATOM   1611  C CE2   . PHE A 1 193 ? 22.684  42.732  24.776  1.00 9.09   ? 193 PHE A CE2   1 
ATOM   1612  C CZ    . PHE A 1 193 ? 23.758  41.997  24.315  1.00 10.17  ? 193 PHE A CZ    1 
ATOM   1613  H H     . PHE A 1 193 ? 22.626  44.965  29.173  1.00 0.00   ? 193 PHE A H     1 
ATOM   1614  N N     . ILE A 1 194 ? 26.464  45.407  29.945  1.00 11.05  ? 194 ILE A N     1 
ATOM   1615  C CA    . ILE A 1 194 ? 27.144  46.382  30.767  1.00 7.32   ? 194 ILE A CA    1 
ATOM   1616  C C     . ILE A 1 194 ? 28.196  47.002  29.870  1.00 10.44  ? 194 ILE A C     1 
ATOM   1617  O O     . ILE A 1 194 ? 28.803  46.307  29.048  1.00 10.77  ? 194 ILE A O     1 
ATOM   1618  C CB    . ILE A 1 194 ? 27.724  45.605  31.969  1.00 6.58   ? 194 ILE A CB    1 
ATOM   1619  C CG1   . ILE A 1 194 ? 26.629  45.432  32.955  1.00 3.62   ? 194 ILE A CG1   1 
ATOM   1620  C CG2   . ILE A 1 194 ? 28.843  46.310  32.680  1.00 8.48   ? 194 ILE A CG2   1 
ATOM   1621  C CD1   . ILE A 1 194 ? 26.281  43.950  32.971  1.00 16.16  ? 194 ILE A CD1   1 
ATOM   1622  H H     . ILE A 1 194 ? 26.927  44.568  29.749  1.00 0.00   ? 194 ILE A H     1 
ATOM   1623  N N     . LEU A 1 195 ? 28.393  48.313  30.005  1.00 14.25  ? 195 LEU A N     1 
ATOM   1624  C CA    . LEU A 1 195 ? 29.412  49.072  29.288  1.00 13.44  ? 195 LEU A CA    1 
ATOM   1625  C C     . LEU A 1 195 ? 30.730  48.653  29.885  1.00 15.35  ? 195 LEU A C     1 
ATOM   1626  O O     . LEU A 1 195 ? 30.964  48.846  31.088  1.00 19.20  ? 195 LEU A O     1 
ATOM   1627  C CB    . LEU A 1 195 ? 29.213  50.585  29.491  1.00 9.44   ? 195 LEU A CB    1 
ATOM   1628  C CG    . LEU A 1 195 ? 30.116  51.635  28.831  1.00 6.17   ? 195 LEU A CG    1 
ATOM   1629  C CD1   . LEU A 1 195 ? 30.299  51.342  27.366  1.00 2.00   ? 195 LEU A CD1   1 
ATOM   1630  C CD2   . LEU A 1 195 ? 29.456  53.012  28.948  1.00 4.83   ? 195 LEU A CD2   1 
ATOM   1631  H H     . LEU A 1 195 ? 27.856  48.786  30.675  1.00 0.00   ? 195 LEU A H     1 
ATOM   1632  N N     . VAL A 1 196 ? 31.596  48.040  29.090  1.00 14.02  ? 196 VAL A N     1 
ATOM   1633  C CA    . VAL A 1 196 ? 32.864  47.633  29.648  1.00 14.61  ? 196 VAL A CA    1 
ATOM   1634  C C     . VAL A 1 196 ? 34.036  48.328  28.958  1.00 20.07  ? 196 VAL A C     1 
ATOM   1635  O O     . VAL A 1 196 ? 35.156  48.311  29.475  1.00 19.10  ? 196 VAL A O     1 
ATOM   1636  C CB    . VAL A 1 196 ? 33.030  46.084  29.556  1.00 15.80  ? 196 VAL A CB    1 
ATOM   1637  C CG1   . VAL A 1 196 ? 32.031  45.393  30.445  1.00 7.35   ? 196 VAL A CG1   1 
ATOM   1638  C CG2   . VAL A 1 196 ? 32.798  45.606  28.163  1.00 17.37  ? 196 VAL A CG2   1 
ATOM   1639  H H     . VAL A 1 196 ? 31.366  47.896  28.144  1.00 0.00   ? 196 VAL A H     1 
ATOM   1640  N N     . ASP A 1 197 ? 33.850  49.008  27.824  1.00 22.10  ? 197 ASP A N     1 
ATOM   1641  C CA    . ASP A 1 197 ? 34.970  49.621  27.121  1.00 24.98  ? 197 ASP A CA    1 
ATOM   1642  C C     . ASP A 1 197 ? 34.358  50.791  26.392  1.00 23.05  ? 197 ASP A C     1 
ATOM   1643  O O     . ASP A 1 197 ? 33.569  50.598  25.470  1.00 24.36  ? 197 ASP A O     1 
ATOM   1644  C CB    . ASP A 1 197 ? 35.530  48.572  26.169  1.00 29.37  ? 197 ASP A CB    1 
ATOM   1645  C CG    . ASP A 1 197 ? 36.968  48.688  25.708  1.00 32.86  ? 197 ASP A CG    1 
ATOM   1646  O OD1   . ASP A 1 197 ? 37.540  49.778  25.763  1.00 32.73  ? 197 ASP A OD1   1 
ATOM   1647  O OD2   . ASP A 1 197 ? 37.501  47.657  25.281  1.00 36.27  ? 197 ASP A OD2   1 
ATOM   1648  H H     . ASP A 1 197 ? 32.950  49.125  27.451  1.00 0.00   ? 197 ASP A H     1 
ATOM   1649  N N     . LYS A 1 198 ? 34.607  52.017  26.798  1.00 27.68  ? 198 LYS A N     1 
ATOM   1650  C CA    . LYS A 1 198 ? 33.988  53.117  26.108  1.00 28.72  ? 198 LYS A CA    1 
ATOM   1651  C C     . LYS A 1 198 ? 34.986  53.887  25.281  1.00 28.13  ? 198 LYS A C     1 
ATOM   1652  O O     . LYS A 1 198 ? 36.133  54.012  25.677  1.00 24.67  ? 198 LYS A O     1 
ATOM   1653  C CB    . LYS A 1 198 ? 33.303  54.034  27.112  1.00 32.43  ? 198 LYS A CB    1 
ATOM   1654  C CG    . LYS A 1 198 ? 34.017  54.493  28.360  1.00 43.21  ? 198 LYS A CG    1 
ATOM   1655  C CD    . LYS A 1 198 ? 33.147  55.619  28.925  1.00 51.94  ? 198 LYS A CD    1 
ATOM   1656  C CE    . LYS A 1 198 ? 33.714  56.183  30.226  1.00 57.99  ? 198 LYS A CE    1 
ATOM   1657  N NZ    . LYS A 1 198 ? 32.864  57.237  30.753  1.00 58.30  ? 198 LYS A NZ    1 
ATOM   1658  H H     . LYS A 1 198 ? 35.320  52.199  27.444  1.00 0.00   ? 198 LYS A H     1 
ATOM   1659  H HZ1   . LYS A 1 198 ? 31.913  56.858  30.937  1.00 0.00   ? 198 LYS A HZ1   1 
ATOM   1660  H HZ2   . LYS A 1 198 ? 33.270  57.592  31.642  1.00 0.00   ? 198 LYS A HZ2   1 
ATOM   1661  H HZ3   . LYS A 1 198 ? 32.803  58.016  30.067  1.00 0.00   ? 198 LYS A HZ3   1 
ATOM   1662  N N     . ASP A 1 199 ? 34.531  54.299  24.097  1.00 31.54  ? 199 ASP A N     1 
ATOM   1663  C CA    . ASP A 1 199 ? 35.266  55.123  23.146  1.00 33.31  ? 199 ASP A CA    1 
ATOM   1664  C C     . ASP A 1 199 ? 36.503  54.386  22.616  1.00 34.44  ? 199 ASP A C     1 
ATOM   1665  O O     . ASP A 1 199 ? 37.617  54.902  22.526  1.00 36.57  ? 199 ASP A O     1 
ATOM   1666  C CB    . ASP A 1 199 ? 35.611  56.439  23.864  1.00 37.16  ? 199 ASP A CB    1 
ATOM   1667  C CG    . ASP A 1 199 ? 35.545  57.734  23.066  1.00 43.72  ? 199 ASP A CG    1 
ATOM   1668  O OD1   . ASP A 1 199 ? 35.620  57.732  21.831  1.00 48.98  ? 199 ASP A OD1   1 
ATOM   1669  O OD2   . ASP A 1 199 ? 35.425  58.771  23.721  1.00 51.37  ? 199 ASP A OD2   1 
ATOM   1670  H H     . ASP A 1 199 ? 33.666  53.964  23.785  1.00 0.00   ? 199 ASP A H     1 
ATOM   1671  N N     . VAL A 1 200 ? 36.245  53.160  22.161  1.00 32.14  ? 200 VAL A N     1 
ATOM   1672  C CA    . VAL A 1 200 ? 37.270  52.224  21.717  1.00 24.27  ? 200 VAL A CA    1 
ATOM   1673  C C     . VAL A 1 200 ? 37.956  52.749  20.462  1.00 24.49  ? 200 VAL A C     1 
ATOM   1674  O O     . VAL A 1 200 ? 37.282  53.178  19.527  1.00 26.23  ? 200 VAL A O     1 
ATOM   1675  C CB    . VAL A 1 200 ? 36.616  50.849  21.431  1.00 25.92  ? 200 VAL A CB    1 
ATOM   1676  C CG1   . VAL A 1 200 ? 37.681  49.781  21.410  1.00 22.44  ? 200 VAL A CG1   1 
ATOM   1677  C CG2   . VAL A 1 200 ? 35.615  50.476  22.510  1.00 26.06  ? 200 VAL A CG2   1 
ATOM   1678  H H     . VAL A 1 200 ? 35.305  52.938  22.012  1.00 0.00   ? 200 VAL A H     1 
ATOM   1679  N N     . LYS A 1 201 ? 39.289  52.738  20.423  1.00 23.96  ? 201 LYS A N     1 
ATOM   1680  C CA    . LYS A 1 201 ? 40.045  53.197  19.268  1.00 22.33  ? 201 LYS A CA    1 
ATOM   1681  C C     . LYS A 1 201 ? 40.974  52.056  18.877  1.00 22.86  ? 201 LYS A C     1 
ATOM   1682  O O     . LYS A 1 201 ? 41.406  51.324  19.777  1.00 25.33  ? 201 LYS A O     1 
ATOM   1683  C CB    . LYS A 1 201 ? 40.858  54.434  19.630  1.00 23.08  ? 201 LYS A CB    1 
ATOM   1684  C CG    . LYS A 1 201 ? 40.051  55.718  19.790  1.00 27.77  ? 201 LYS A CG    1 
ATOM   1685  C CD    . LYS A 1 201 ? 39.510  56.173  18.436  1.00 32.11  ? 201 LYS A CD    1 
ATOM   1686  C CE    . LYS A 1 201 ? 38.548  57.355  18.536  1.00 39.97  ? 201 LYS A CE    1 
ATOM   1687  N NZ    . LYS A 1 201 ? 38.074  57.761  17.217  1.00 40.88  ? 201 LYS A NZ    1 
ATOM   1688  H H     . LYS A 1 201 ? 39.798  52.345  21.161  1.00 0.00   ? 201 LYS A H     1 
ATOM   1689  H HZ1   . LYS A 1 201 ? 37.582  56.963  16.765  1.00 0.00   ? 201 LYS A HZ1   1 
ATOM   1690  H HZ2   . LYS A 1 201 ? 37.416  58.561  17.314  1.00 0.00   ? 201 LYS A HZ2   1 
ATOM   1691  H HZ3   . LYS A 1 201 ? 38.883  58.045  16.628  1.00 0.00   ? 201 LYS A HZ3   1 
ATOM   1692  N N     . ILE A 1 202 ? 41.347  51.841  17.617  1.00 18.57  ? 202 ILE A N     1 
ATOM   1693  C CA    . ILE A 1 202 ? 42.159  50.686  17.277  1.00 21.75  ? 202 ILE A CA    1 
ATOM   1694  C C     . ILE A 1 202 ? 43.658  50.990  17.266  1.00 26.95  ? 202 ILE A C     1 
ATOM   1695  O O     . ILE A 1 202 ? 44.102  52.130  17.084  1.00 24.23  ? 202 ILE A O     1 
ATOM   1696  C CB    . ILE A 1 202 ? 41.694  50.137  15.903  1.00 17.84  ? 202 ILE A CB    1 
ATOM   1697  C CG1   . ILE A 1 202 ? 42.357  48.791  15.639  1.00 16.77  ? 202 ILE A CG1   1 
ATOM   1698  C CG2   . ILE A 1 202 ? 41.985  51.161  14.817  1.00 16.37  ? 202 ILE A CG2   1 
ATOM   1699  C CD1   . ILE A 1 202 ? 41.906  48.073  14.365  1.00 19.42  ? 202 ILE A CD1   1 
ATOM   1700  H H     . ILE A 1 202 ? 41.185  52.526  16.941  1.00 0.00   ? 202 ILE A H     1 
ATOM   1701  N N     . LYS A 1 203 ? 44.455  49.941  17.510  1.00 32.33  ? 203 LYS A N     1 
ATOM   1702  C CA    . LYS A 1 203 ? 45.906  49.997  17.388  1.00 37.58  ? 203 LYS A CA    1 
ATOM   1703  C C     . LYS A 1 203 ? 46.295  50.537  16.016  1.00 38.87  ? 203 LYS A C     1 
ATOM   1704  O O     . LYS A 1 203 ? 45.696  50.184  14.988  1.00 35.27  ? 203 LYS A O     1 
ATOM   1705  C CB    . LYS A 1 203 ? 46.522  48.618  17.547  1.00 37.77  ? 203 LYS A CB    1 
ATOM   1706  C CG    . LYS A 1 203 ? 46.977  48.282  18.955  1.00 39.87  ? 203 LYS A CG    1 
ATOM   1707  C CD    . LYS A 1 203 ? 48.032  47.196  18.751  1.00 47.57  ? 203 LYS A CD    1 
ATOM   1708  C CE    . LYS A 1 203 ? 48.740  46.702  20.011  1.00 47.09  ? 203 LYS A CE    1 
ATOM   1709  N NZ    . LYS A 1 203 ? 49.502  45.497  19.707  1.00 50.97  ? 203 LYS A NZ    1 
ATOM   1710  H H     . LYS A 1 203 ? 44.025  49.103  17.780  1.00 0.00   ? 203 LYS A H     1 
ATOM   1711  H HZ1   . LYS A 1 203 ? 48.854  44.763  19.353  1.00 0.00   ? 203 LYS A HZ1   1 
ATOM   1712  H HZ2   . LYS A 1 203 ? 50.216  45.709  18.981  1.00 0.00   ? 203 LYS A HZ2   1 
ATOM   1713  H HZ3   . LYS A 1 203 ? 49.973  45.158  20.569  1.00 0.00   ? 203 LYS A HZ3   1 
ATOM   1714  N N     . LYS A 1 204 ? 47.308  51.405  16.031  1.00 41.47  ? 204 LYS A N     1 
ATOM   1715  C CA    . LYS A 1 204 ? 47.744  52.079  14.822  1.00 42.95  ? 204 LYS A CA    1 
ATOM   1716  C C     . LYS A 1 204 ? 48.370  51.094  13.851  1.00 41.21  ? 204 LYS A C     1 
ATOM   1717  O O     . LYS A 1 204 ? 48.197  51.192  12.630  1.00 42.12  ? 204 LYS A O     1 
ATOM   1718  C CB    . LYS A 1 204 ? 48.735  53.167  15.186  1.00 46.36  ? 204 LYS A CB    1 
ATOM   1719  C CG    . LYS A 1 204 ? 48.691  54.234  14.109  1.00 54.56  ? 204 LYS A CG    1 
ATOM   1720  C CD    . LYS A 1 204 ? 49.656  55.379  14.364  1.00 60.08  ? 204 LYS A CD    1 
ATOM   1721  C CE    . LYS A 1 204 ? 49.485  56.410  13.256  1.00 63.38  ? 204 LYS A CE    1 
ATOM   1722  N NZ    . LYS A 1 204 ? 50.440  57.490  13.399  1.00 67.67  ? 204 LYS A NZ    1 
ATOM   1723  H H     . LYS A 1 204 ? 47.743  51.601  16.883  1.00 0.00   ? 204 LYS A H     1 
ATOM   1724  H HZ1   . LYS A 1 204 ? 51.402  57.095  13.396  1.00 0.00   ? 204 LYS A HZ1   1 
ATOM   1725  H HZ2   . LYS A 1 204 ? 50.335  58.148  12.599  1.00 0.00   ? 204 LYS A HZ2   1 
ATOM   1726  H HZ3   . LYS A 1 204 ? 50.275  57.996  14.292  1.00 0.00   ? 204 LYS A HZ3   1 
ATOM   1727  N N     . LYS A 1 205 ? 49.080  50.126  14.411  1.00 37.57  ? 205 LYS A N     1 
ATOM   1728  C CA    . LYS A 1 205 ? 49.695  49.056  13.663  1.00 39.56  ? 205 LYS A CA    1 
ATOM   1729  C C     . LYS A 1 205 ? 49.552  47.891  14.619  1.00 38.27  ? 205 LYS A C     1 
ATOM   1730  O O     . LYS A 1 205 ? 49.680  48.084  15.831  1.00 39.93  ? 205 LYS A O     1 
ATOM   1731  C CB    . LYS A 1 205 ? 51.175  49.303  13.410  1.00 43.85  ? 205 LYS A CB    1 
ATOM   1732  C CG    . LYS A 1 205 ? 51.768  48.309  12.408  1.00 48.09  ? 205 LYS A CG    1 
ATOM   1733  C CD    . LYS A 1 205 ? 53.281  48.402  12.335  1.00 53.99  ? 205 LYS A CD    1 
ATOM   1734  C CE    . LYS A 1 205 ? 53.742  48.196  10.894  1.00 59.94  ? 205 LYS A CE    1 
ATOM   1735  N NZ    . LYS A 1 205 ? 55.190  48.171  10.779  1.00 63.52  ? 205 LYS A NZ    1 
ATOM   1736  H H     . LYS A 1 205 ? 49.168  50.075  15.387  1.00 0.00   ? 205 LYS A H     1 
ATOM   1737  H HZ1   . LYS A 1 205 ? 55.584  49.042  11.188  1.00 0.00   ? 205 LYS A HZ1   1 
ATOM   1738  H HZ2   . LYS A 1 205 ? 55.566  47.349  11.294  1.00 0.00   ? 205 LYS A HZ2   1 
ATOM   1739  H HZ3   . LYS A 1 205 ? 55.455  48.108  9.774   1.00 0.00   ? 205 LYS A HZ3   1 
ATOM   1740  N N     . GLY A 1 206 ? 49.254  46.703  14.126  1.00 37.50  ? 206 GLY A N     1 
ATOM   1741  C CA    . GLY A 1 206 ? 49.079  45.552  14.987  1.00 35.67  ? 206 GLY A CA    1 
ATOM   1742  C C     . GLY A 1 206 ? 50.003  44.470  14.489  1.00 35.00  ? 206 GLY A C     1 
ATOM   1743  O O     . GLY A 1 206 ? 50.769  44.690  13.558  1.00 34.31  ? 206 GLY A O     1 
ATOM   1744  H H     . GLY A 1 206 ? 49.307  46.548  13.161  1.00 0.00   ? 206 GLY A H     1 
ATOM   1745  N N     . LYS A 1 207 ? 49.920  43.268  15.037  1.00 35.82  ? 207 LYS A N     1 
ATOM   1746  C CA    . LYS A 1 207 ? 50.829  42.214  14.629  1.00 33.43  ? 207 LYS A CA    1 
ATOM   1747  C C     . LYS A 1 207 ? 50.192  41.016  13.946  1.00 29.76  ? 207 LYS A C     1 
ATOM   1748  O O     . LYS A 1 207 ? 50.890  40.020  13.767  1.00 24.93  ? 207 LYS A O     1 
ATOM   1749  C CB    . LYS A 1 207 ? 51.610  41.734  15.856  1.00 38.30  ? 207 LYS A CB    1 
ATOM   1750  C CG    . LYS A 1 207 ? 52.535  42.801  16.425  1.00 50.34  ? 207 LYS A CG    1 
ATOM   1751  C CD    . LYS A 1 207 ? 53.413  42.226  17.525  1.00 57.40  ? 207 LYS A CD    1 
ATOM   1752  C CE    . LYS A 1 207 ? 54.275  43.338  18.096  1.00 59.61  ? 207 LYS A CE    1 
ATOM   1753  N NZ    . LYS A 1 207 ? 55.153  42.806  19.121  1.00 64.60  ? 207 LYS A NZ    1 
ATOM   1754  H H     . LYS A 1 207 ? 49.250  43.089  15.730  1.00 0.00   ? 207 LYS A H     1 
ATOM   1755  H HZ1   . LYS A 1 207 ? 55.755  42.064  18.711  1.00 0.00   ? 207 LYS A HZ1   1 
ATOM   1756  H HZ2   . LYS A 1 207 ? 55.752  43.568  19.496  1.00 0.00   ? 207 LYS A HZ2   1 
ATOM   1757  H HZ3   . LYS A 1 207 ? 54.585  42.401  19.893  1.00 0.00   ? 207 LYS A HZ3   1 
ATOM   1758  N N     . ILE A 1 208 ? 48.928  41.017  13.510  1.00 27.78  ? 208 ILE A N     1 
ATOM   1759  C CA    . ILE A 1 208 ? 48.288  39.803  13.013  1.00 22.94  ? 208 ILE A CA    1 
ATOM   1760  C C     . ILE A 1 208 ? 47.677  40.041  11.648  1.00 19.85  ? 208 ILE A C     1 
ATOM   1761  O O     . ILE A 1 208 ? 47.280  41.184  11.400  1.00 17.32  ? 208 ILE A O     1 
ATOM   1762  C CB    . ILE A 1 208 ? 47.236  39.368  14.097  1.00 26.53  ? 208 ILE A CB    1 
ATOM   1763  C CG1   . ILE A 1 208 ? 48.022  38.589  15.139  1.00 27.74  ? 208 ILE A CG1   1 
ATOM   1764  C CG2   . ILE A 1 208 ? 46.099  38.488  13.581  1.00 26.21  ? 208 ILE A CG2   1 
ATOM   1765  C CD1   . ILE A 1 208 ? 47.233  38.152  16.373  1.00 28.66  ? 208 ILE A CD1   1 
ATOM   1766  H H     . ILE A 1 208 ? 48.439  41.856  13.389  1.00 0.00   ? 208 ILE A H     1 
ATOM   1767  N N     . TYR A 1 209 ? 47.631  39.055  10.733  1.00 17.20  ? 209 TYR A N     1 
ATOM   1768  C CA    . TYR A 1 209 ? 46.899  39.231  9.483   1.00 17.39  ? 209 TYR A CA    1 
ATOM   1769  C C     . TYR A 1 209 ? 45.852  38.119  9.332   1.00 16.78  ? 209 TYR A C     1 
ATOM   1770  O O     . TYR A 1 209 ? 46.115  36.972  9.734   1.00 16.79  ? 209 TYR A O     1 
ATOM   1771  C CB    . TYR A 1 209 ? 47.893  39.254  8.274   1.00 17.61  ? 209 TYR A CB    1 
ATOM   1772  C CG    . TYR A 1 209 ? 48.721  38.021  7.911   1.00 13.98  ? 209 TYR A CG    1 
ATOM   1773  C CD1   . TYR A 1 209 ? 49.821  37.654  8.656   1.00 14.11  ? 209 TYR A CD1   1 
ATOM   1774  C CD2   . TYR A 1 209 ? 48.328  37.235  6.845   1.00 10.85  ? 209 TYR A CD2   1 
ATOM   1775  C CE1   . TYR A 1 209 ? 50.446  36.448  8.401   1.00 12.03  ? 209 TYR A CE1   1 
ATOM   1776  C CE2   . TYR A 1 209 ? 48.933  36.021  6.612   1.00 7.08   ? 209 TYR A CE2   1 
ATOM   1777  C CZ    . TYR A 1 209 ? 49.942  35.609  7.433   1.00 6.19   ? 209 TYR A CZ    1 
ATOM   1778  O OH    . TYR A 1 209 ? 50.397  34.312  7.347   1.00 11.66  ? 209 TYR A OH    1 
ATOM   1779  H H     . TYR A 1 209 ? 48.004  38.175  10.943  1.00 0.00   ? 209 TYR A H     1 
ATOM   1780  H HH    . TYR A 1 209 ? 51.307  34.282  7.672   1.00 0.00   ? 209 TYR A HH    1 
ATOM   1781  N N     . SER A 1 210 ? 44.640  38.418  8.826   1.00 14.26  ? 210 SER A N     1 
ATOM   1782  C CA    . SER A 1 210 ? 43.600  37.419  8.606   1.00 14.94  ? 210 SER A CA    1 
ATOM   1783  C C     . SER A 1 210 ? 43.132  37.392  7.166   1.00 13.92  ? 210 SER A C     1 
ATOM   1784  O O     . SER A 1 210 ? 42.674  38.418  6.655   1.00 11.87  ? 210 SER A O     1 
ATOM   1785  C CB    . SER A 1 210 ? 42.283  37.646  9.354   1.00 16.52  ? 210 SER A CB    1 
ATOM   1786  O OG    . SER A 1 210 ? 42.355  37.768  10.750  1.00 25.04  ? 210 SER A OG    1 
ATOM   1787  H H     . SER A 1 210 ? 44.404  39.359  8.672   1.00 0.00   ? 210 SER A H     1 
ATOM   1788  H HG    . SER A 1 210 ? 42.875  37.028  11.081  1.00 0.00   ? 210 SER A HG    1 
ATOM   1789  N N     . LEU A 1 211 ? 43.242  36.247  6.504   1.00 15.56  ? 211 LEU A N     1 
ATOM   1790  C CA    . LEU A 1 211 ? 42.595  36.031  5.229   1.00 21.45  ? 211 LEU A CA    1 
ATOM   1791  C C     . LEU A 1 211 ? 42.620  34.533  4.996   1.00 24.34  ? 211 LEU A C     1 
ATOM   1792  O O     . LEU A 1 211 ? 43.369  33.801  5.652   1.00 28.79  ? 211 LEU A O     1 
ATOM   1793  C CB    . LEU A 1 211 ? 43.305  36.750  4.080   1.00 20.61  ? 211 LEU A CB    1 
ATOM   1794  C CG    . LEU A 1 211 ? 44.518  36.281  3.342   1.00 19.05  ? 211 LEU A CG    1 
ATOM   1795  C CD1   . LEU A 1 211 ? 44.660  37.223  2.169   1.00 17.73  ? 211 LEU A CD1   1 
ATOM   1796  C CD2   . LEU A 1 211 ? 45.750  36.245  4.222   1.00 12.80  ? 211 LEU A CD2   1 
ATOM   1797  H H     . LEU A 1 211 ? 43.728  35.491  6.891   1.00 0.00   ? 211 LEU A H     1 
ATOM   1798  N N     . ASN A 1 212 ? 41.777  34.027  4.119   1.00 29.73  ? 212 ASN A N     1 
ATOM   1799  C CA    . ASN A 1 212 ? 41.745  32.604  3.858   1.00 29.43  ? 212 ASN A CA    1 
ATOM   1800  C C     . ASN A 1 212 ? 42.826  32.322  2.836   1.00 31.03  ? 212 ASN A C     1 
ATOM   1801  O O     . ASN A 1 212 ? 42.639  32.560  1.636   1.00 28.24  ? 212 ASN A O     1 
ATOM   1802  C CB    . ASN A 1 212 ? 40.373  32.239  3.325   1.00 30.41  ? 212 ASN A CB    1 
ATOM   1803  C CG    . ASN A 1 212 ? 40.160  30.747  3.177   1.00 30.84  ? 212 ASN A CG    1 
ATOM   1804  O OD1   . ASN A 1 212 ? 41.021  29.914  3.455   1.00 33.08  ? 212 ASN A OD1   1 
ATOM   1805  N ND2   . ASN A 1 212 ? 39.003  30.326  2.713   1.00 34.91  ? 212 ASN A ND2   1 
ATOM   1806  H H     . ASN A 1 212 ? 41.182  34.628  3.617   1.00 0.00   ? 212 ASN A H     1 
ATOM   1807  H HD21  . ASN A 1 212 ? 38.853  29.364  2.634   1.00 0.00   ? 212 ASN A HD21  1 
ATOM   1808  H HD22  . ASN A 1 212 ? 38.326  31.004  2.504   1.00 0.00   ? 212 ASN A HD22  1 
ATOM   1809  N N     . GLU A 1 213 ? 43.980  31.820  3.295   1.00 33.67  ? 213 GLU A N     1 
ATOM   1810  C CA    . GLU A 1 213 ? 45.103  31.514  2.401   1.00 33.03  ? 213 GLU A CA    1 
ATOM   1811  C C     . GLU A 1 213 ? 44.963  30.297  1.501   1.00 32.21  ? 213 GLU A C     1 
ATOM   1812  O O     . GLU A 1 213 ? 45.775  29.976  0.634   1.00 30.94  ? 213 GLU A O     1 
ATOM   1813  C CB    . GLU A 1 213 ? 46.357  31.356  3.206   1.00 37.29  ? 213 GLU A CB    1 
ATOM   1814  C CG    . GLU A 1 213 ? 46.943  32.718  3.524   1.00 38.04  ? 213 GLU A CG    1 
ATOM   1815  C CD    . GLU A 1 213 ? 48.337  32.615  4.113   1.00 38.74  ? 213 GLU A CD    1 
ATOM   1816  O OE1   . GLU A 1 213 ? 49.258  32.390  3.334   1.00 39.94  ? 213 GLU A OE1   1 
ATOM   1817  O OE2   . GLU A 1 213 ? 48.498  32.753  5.330   1.00 40.96  ? 213 GLU A OE2   1 
ATOM   1818  H H     . GLU A 1 213 ? 44.076  31.703  4.262   1.00 0.00   ? 213 GLU A H     1 
ATOM   1819  N N     . ALA A 1 214 ? 43.860  29.613  1.703   1.00 32.07  ? 214 ALA A N     1 
ATOM   1820  C CA    . ALA A 1 214 ? 43.447  28.532  0.855   1.00 32.95  ? 214 ALA A CA    1 
ATOM   1821  C C     . ALA A 1 214 ? 43.270  28.988  -0.572  1.00 33.94  ? 214 ALA A C     1 
ATOM   1822  O O     . ALA A 1 214 ? 43.469  28.212  -1.500  1.00 37.62  ? 214 ALA A O     1 
ATOM   1823  C CB    . ALA A 1 214 ? 42.140  28.049  1.293   1.00 40.82  ? 214 ALA A CB    1 
ATOM   1824  H H     . ALA A 1 214 ? 43.307  29.816  2.485   1.00 0.00   ? 214 ALA A H     1 
ATOM   1825  N N     . TYR A 1 215 ? 42.879  30.246  -0.770  1.00 31.86  ? 215 TYR A N     1 
ATOM   1826  C CA    . TYR A 1 215 ? 42.656  30.771  -2.105  1.00 34.46  ? 215 TYR A CA    1 
ATOM   1827  C C     . TYR A 1 215 ? 43.955  31.268  -2.715  1.00 32.42  ? 215 TYR A C     1 
ATOM   1828  O O     . TYR A 1 215 ? 43.907  32.052  -3.668  1.00 28.64  ? 215 TYR A O     1 
ATOM   1829  C CB    . TYR A 1 215 ? 41.706  31.970  -2.117  1.00 43.26  ? 215 TYR A CB    1 
ATOM   1830  C CG    . TYR A 1 215 ? 40.384  31.909  -1.375  1.00 51.46  ? 215 TYR A CG    1 
ATOM   1831  C CD1   . TYR A 1 215 ? 39.595  30.770  -1.353  1.00 53.90  ? 215 TYR A CD1   1 
ATOM   1832  C CD2   . TYR A 1 215 ? 39.962  33.075  -0.761  1.00 56.67  ? 215 TYR A CD2   1 
ATOM   1833  C CE1   . TYR A 1 215 ? 38.358  30.817  -0.740  1.00 58.01  ? 215 TYR A CE1   1 
ATOM   1834  C CE2   . TYR A 1 215 ? 38.727  33.129  -0.154  1.00 60.39  ? 215 TYR A CE2   1 
ATOM   1835  C CZ    . TYR A 1 215 ? 37.927  32.007  -0.174  1.00 60.64  ? 215 TYR A CZ    1 
ATOM   1836  O OH    . TYR A 1 215 ? 36.650  32.106  0.347   1.00 64.35  ? 215 TYR A OH    1 
ATOM   1837  H H     . TYR A 1 215 ? 42.749  30.834  0.002   1.00 0.00   ? 215 TYR A H     1 
ATOM   1838  H HH    . TYR A 1 215 ? 36.184  31.269  0.179   1.00 0.00   ? 215 TYR A HH    1 
ATOM   1839  N N     . ALA A 1 216 ? 45.122  30.860  -2.206  1.00 31.43  ? 216 ALA A N     1 
ATOM   1840  C CA    . ALA A 1 216 ? 46.408  31.335  -2.677  1.00 32.31  ? 216 ALA A CA    1 
ATOM   1841  C C     . ALA A 1 216 ? 46.547  31.369  -4.187  1.00 33.38  ? 216 ALA A C     1 
ATOM   1842  O O     . ALA A 1 216 ? 46.958  32.397  -4.726  1.00 29.20  ? 216 ALA A O     1 
ATOM   1843  C CB    . ALA A 1 216 ? 47.521  30.466  -2.124  1.00 35.10  ? 216 ALA A CB    1 
ATOM   1844  H H     . ALA A 1 216 ? 45.131  30.195  -1.490  1.00 0.00   ? 216 ALA A H     1 
ATOM   1845  N N     . LYS A 1 217 ? 46.106  30.322  -4.888  1.00 37.04  ? 217 LYS A N     1 
ATOM   1846  C CA    . LYS A 1 217 ? 46.234  30.271  -6.334  1.00 43.57  ? 217 LYS A CA    1 
ATOM   1847  C C     . LYS A 1 217 ? 45.347  31.247  -7.099  1.00 43.61  ? 217 LYS A C     1 
ATOM   1848  O O     . LYS A 1 217 ? 45.599  31.519  -8.275  1.00 46.51  ? 217 LYS A O     1 
ATOM   1849  C CB    . LYS A 1 217 ? 45.957  28.846  -6.851  1.00 45.73  ? 217 LYS A CB    1 
ATOM   1850  C CG    . LYS A 1 217 ? 44.533  28.347  -6.978  1.00 56.91  ? 217 LYS A CG    1 
ATOM   1851  C CD    . LYS A 1 217 ? 44.535  27.025  -7.746  1.00 63.56  ? 217 LYS A CD    1 
ATOM   1852  C CE    . LYS A 1 217 ? 43.105  26.555  -8.024  1.00 68.99  ? 217 LYS A CE    1 
ATOM   1853  N NZ    . LYS A 1 217 ? 43.077  25.206  -8.577  1.00 74.29  ? 217 LYS A NZ    1 
ATOM   1854  H H     . LYS A 1 217 ? 45.685  29.582  -4.412  1.00 0.00   ? 217 LYS A H     1 
ATOM   1855  H HZ1   . LYS A 1 217 ? 43.612  25.186  -9.469  1.00 0.00   ? 217 LYS A HZ1   1 
ATOM   1856  H HZ2   . LYS A 1 217 ? 43.504  24.540  -7.902  1.00 0.00   ? 217 LYS A HZ2   1 
ATOM   1857  H HZ3   . LYS A 1 217 ? 42.092  24.927  -8.761  1.00 0.00   ? 217 LYS A HZ3   1 
ATOM   1858  N N     . ASP A 1 218 ? 44.301  31.768  -6.462  1.00 40.70  ? 218 ASP A N     1 
ATOM   1859  C CA    . ASP A 1 218 ? 43.408  32.690  -7.117  1.00 38.60  ? 218 ASP A CA    1 
ATOM   1860  C C     . ASP A 1 218 ? 43.612  34.102  -6.591  1.00 40.76  ? 218 ASP A C     1 
ATOM   1861  O O     . ASP A 1 218 ? 42.829  35.011  -6.911  1.00 42.37  ? 218 ASP A O     1 
ATOM   1862  C CB    . ASP A 1 218 ? 41.968  32.257  -6.885  1.00 39.48  ? 218 ASP A CB    1 
ATOM   1863  C CG    . ASP A 1 218 ? 41.577  30.865  -7.378  1.00 43.77  ? 218 ASP A CG    1 
ATOM   1864  O OD1   . ASP A 1 218 ? 42.029  30.433  -8.442  1.00 39.82  ? 218 ASP A OD1   1 
ATOM   1865  O OD2   . ASP A 1 218 ? 40.797  30.211  -6.680  1.00 48.28  ? 218 ASP A OD2   1 
ATOM   1866  H H     . ASP A 1 218 ? 44.170  31.579  -5.512  1.00 0.00   ? 218 ASP A H     1 
ATOM   1867  N N     . PHE A 1 219 ? 44.636  34.335  -5.768  1.00 40.30  ? 219 PHE A N     1 
ATOM   1868  C CA    . PHE A 1 219 ? 44.872  35.665  -5.231  1.00 41.44  ? 219 PHE A CA    1 
ATOM   1869  C C     . PHE A 1 219 ? 45.354  36.656  -6.252  1.00 43.16  ? 219 PHE A C     1 
ATOM   1870  O O     . PHE A 1 219 ? 46.008  36.313  -7.233  1.00 45.53  ? 219 PHE A O     1 
ATOM   1871  C CB    . PHE A 1 219 ? 45.911  35.664  -4.131  1.00 37.14  ? 219 PHE A CB    1 
ATOM   1872  C CG    . PHE A 1 219 ? 45.363  35.302  -2.768  1.00 37.52  ? 219 PHE A CG    1 
ATOM   1873  C CD1   . PHE A 1 219 ? 44.003  35.377  -2.504  1.00 35.41  ? 219 PHE A CD1   1 
ATOM   1874  C CD2   . PHE A 1 219 ? 46.245  34.870  -1.799  1.00 35.28  ? 219 PHE A CD2   1 
ATOM   1875  C CE1   . PHE A 1 219 ? 43.526  34.981  -1.273  1.00 37.19  ? 219 PHE A CE1   1 
ATOM   1876  C CE2   . PHE A 1 219 ? 45.753  34.471  -0.572  1.00 37.16  ? 219 PHE A CE2   1 
ATOM   1877  C CZ    . PHE A 1 219 ? 44.401  34.519  -0.311  1.00 35.52  ? 219 PHE A CZ    1 
ATOM   1878  H H     . PHE A 1 219 ? 45.300  33.633  -5.605  1.00 0.00   ? 219 PHE A H     1 
ATOM   1879  N N     . ASP A 1 220 ? 45.018  37.914  -6.019  1.00 47.89  ? 220 ASP A N     1 
ATOM   1880  C CA    . ASP A 1 220 ? 45.505  38.990  -6.857  1.00 52.37  ? 220 ASP A CA    1 
ATOM   1881  C C     . ASP A 1 220 ? 46.979  39.193  -6.506  1.00 50.90  ? 220 ASP A C     1 
ATOM   1882  O O     . ASP A 1 220 ? 47.279  39.292  -5.310  1.00 51.76  ? 220 ASP A O     1 
ATOM   1883  C CB    . ASP A 1 220 ? 44.657  40.252  -6.570  1.00 62.62  ? 220 ASP A CB    1 
ATOM   1884  C CG    . ASP A 1 220 ? 45.372  41.610  -6.565  1.00 70.71  ? 220 ASP A CG    1 
ATOM   1885  O OD1   . ASP A 1 220 ? 45.794  42.096  -7.621  1.00 75.72  ? 220 ASP A OD1   1 
ATOM   1886  O OD2   . ASP A 1 220 ? 45.509  42.179  -5.480  1.00 76.01  ? 220 ASP A OD2   1 
ATOM   1887  H H     . ASP A 1 220 ? 44.434  38.118  -5.261  1.00 0.00   ? 220 ASP A H     1 
ATOM   1888  N N     . PRO A 1 221 ? 47.903  39.373  -7.467  1.00 48.08  ? 221 PRO A N     1 
ATOM   1889  C CA    . PRO A 1 221 ? 49.322  39.634  -7.238  1.00 43.99  ? 221 PRO A CA    1 
ATOM   1890  C C     . PRO A 1 221 ? 49.688  40.618  -6.127  1.00 40.83  ? 221 PRO A C     1 
ATOM   1891  O O     . PRO A 1 221 ? 50.702  40.440  -5.442  1.00 39.79  ? 221 PRO A O     1 
ATOM   1892  C CB    . PRO A 1 221 ? 49.815  40.071  -8.599  1.00 45.16  ? 221 PRO A CB    1 
ATOM   1893  C CG    . PRO A 1 221 ? 48.577  40.557  -9.304  1.00 45.19  ? 221 PRO A CG    1 
ATOM   1894  C CD    . PRO A 1 221 ? 47.621  39.458  -8.894  1.00 46.52  ? 221 PRO A CD    1 
ATOM   1895  N N     . ALA A 1 222 ? 48.885  41.673  -5.935  1.00 34.85  ? 222 ALA A N     1 
ATOM   1896  C CA    . ALA A 1 222 ? 49.139  42.650  -4.890  1.00 30.71  ? 222 ALA A CA    1 
ATOM   1897  C C     . ALA A 1 222 ? 48.883  42.034  -3.526  1.00 30.95  ? 222 ALA A C     1 
ATOM   1898  O O     . ALA A 1 222 ? 49.648  42.286  -2.599  1.00 32.98  ? 222 ALA A O     1 
ATOM   1899  C CB    . ALA A 1 222 ? 48.237  43.849  -5.068  1.00 30.92  ? 222 ALA A CB    1 
ATOM   1900  H H     . ALA A 1 222 ? 48.079  41.749  -6.480  1.00 0.00   ? 222 ALA A H     1 
ATOM   1901  N N     . VAL A 1 223 ? 47.856  41.184  -3.403  1.00 29.32  ? 223 VAL A N     1 
ATOM   1902  C CA    . VAL A 1 223 ? 47.545  40.487  -2.163  1.00 28.86  ? 223 VAL A CA    1 
ATOM   1903  C C     . VAL A 1 223 ? 48.675  39.501  -1.925  1.00 29.71  ? 223 VAL A C     1 
ATOM   1904  O O     . VAL A 1 223 ? 49.221  39.451  -0.816  1.00 33.74  ? 223 VAL A O     1 
ATOM   1905  C CB    . VAL A 1 223 ? 46.185  39.737  -2.285  1.00 29.20  ? 223 VAL A CB    1 
ATOM   1906  C CG1   . VAL A 1 223 ? 45.930  38.753  -1.161  1.00 22.87  ? 223 VAL A CG1   1 
ATOM   1907  C CG2   . VAL A 1 223 ? 45.096  40.800  -2.251  1.00 26.07  ? 223 VAL A CG2   1 
ATOM   1908  H H     . VAL A 1 223 ? 47.342  40.962  -4.200  1.00 0.00   ? 223 VAL A H     1 
ATOM   1909  N N     . THR A 1 224 ? 49.050  38.753  -2.966  1.00 29.59  ? 224 THR A N     1 
ATOM   1910  C CA    . THR A 1 224 ? 50.153  37.801  -2.931  1.00 29.29  ? 224 THR A CA    1 
ATOM   1911  C C     . THR A 1 224 ? 51.424  38.415  -2.365  1.00 29.49  ? 224 THR A C     1 
ATOM   1912  O O     . THR A 1 224 ? 52.042  37.837  -1.467  1.00 31.25  ? 224 THR A O     1 
ATOM   1913  C CB    . THR A 1 224 ? 50.405  37.308  -4.349  1.00 27.66  ? 224 THR A CB    1 
ATOM   1914  O OG1   . THR A 1 224 ? 49.138  36.971  -4.904  1.00 32.82  ? 224 THR A OG1   1 
ATOM   1915  C CG2   . THR A 1 224 ? 51.305  36.090  -4.387  1.00 26.49  ? 224 THR A CG2   1 
ATOM   1916  H H     . THR A 1 224 ? 48.538  38.781  -3.803  1.00 0.00   ? 224 THR A H     1 
ATOM   1917  H HG1   . THR A 1 224 ? 48.957  36.031  -4.760  1.00 0.00   ? 224 THR A HG1   1 
ATOM   1918  N N     . GLU A 1 225 ? 51.786  39.614  -2.836  1.00 32.78  ? 225 GLU A N     1 
ATOM   1919  C CA    . GLU A 1 225 ? 52.944  40.340  -2.343  1.00 33.92  ? 225 GLU A CA    1 
ATOM   1920  C C     . GLU A 1 225 ? 52.767  40.773  -0.888  1.00 35.82  ? 225 GLU A C     1 
ATOM   1921  O O     . GLU A 1 225 ? 53.652  40.512  -0.061  1.00 37.90  ? 225 GLU A O     1 
ATOM   1922  C CB    . GLU A 1 225 ? 53.181  41.563  -3.217  1.00 34.07  ? 225 GLU A CB    1 
ATOM   1923  C CG    . GLU A 1 225 ? 54.581  42.176  -3.076  1.00 39.83  ? 225 GLU A CG    1 
ATOM   1924  C CD    . GLU A 1 225 ? 54.756  43.482  -3.851  1.00 44.71  ? 225 GLU A CD    1 
ATOM   1925  O OE1   . GLU A 1 225 ? 54.600  43.475  -5.078  1.00 47.15  ? 225 GLU A OE1   1 
ATOM   1926  O OE2   . GLU A 1 225 ? 55.049  44.509  -3.230  1.00 42.45  ? 225 GLU A OE2   1 
ATOM   1927  H H     . GLU A 1 225 ? 51.236  40.022  -3.537  1.00 0.00   ? 225 GLU A H     1 
ATOM   1928  N N     . TYR A 1 226 ? 51.634  41.381  -0.514  1.00 34.61  ? 226 TYR A N     1 
ATOM   1929  C CA    . TYR A 1 226 ? 51.438  41.835  0.854   1.00 37.12  ? 226 TYR A CA    1 
ATOM   1930  C C     . TYR A 1 226 ? 51.591  40.729  1.897   1.00 37.21  ? 226 TYR A C     1 
ATOM   1931  O O     . TYR A 1 226 ? 52.169  41.005  2.954   1.00 36.08  ? 226 TYR A O     1 
ATOM   1932  C CB    . TYR A 1 226 ? 50.046  42.479  1.018   1.00 38.27  ? 226 TYR A CB    1 
ATOM   1933  C CG    . TYR A 1 226 ? 49.832  43.032  2.425   1.00 38.32  ? 226 TYR A CG    1 
ATOM   1934  C CD1   . TYR A 1 226 ? 50.520  44.151  2.841   1.00 37.37  ? 226 TYR A CD1   1 
ATOM   1935  C CD2   . TYR A 1 226 ? 49.012  42.364  3.316   1.00 41.09  ? 226 TYR A CD2   1 
ATOM   1936  C CE1   . TYR A 1 226 ? 50.410  44.590  4.144   1.00 38.09  ? 226 TYR A CE1   1 
ATOM   1937  C CE2   . TYR A 1 226 ? 48.916  42.787  4.630   1.00 39.07  ? 226 TYR A CE2   1 
ATOM   1938  C CZ    . TYR A 1 226 ? 49.621  43.896  5.035   1.00 38.85  ? 226 TYR A CZ    1 
ATOM   1939  O OH    . TYR A 1 226 ? 49.550  44.312  6.350   1.00 40.75  ? 226 TYR A OH    1 
ATOM   1940  H H     . TYR A 1 226 ? 50.918  41.508  -1.171  1.00 0.00   ? 226 TYR A H     1 
ATOM   1941  H HH    . TYR A 1 226 ? 49.076  43.664  6.873   1.00 0.00   ? 226 TYR A HH    1 
ATOM   1942  N N     . ILE A 1 227 ? 51.114  39.496  1.647   1.00 36.21  ? 227 ILE A N     1 
ATOM   1943  C CA    . ILE A 1 227 ? 51.205  38.415  2.634   1.00 32.53  ? 227 ILE A CA    1 
ATOM   1944  C C     . ILE A 1 227 ? 52.665  38.034  2.846   1.00 34.60  ? 227 ILE A C     1 
ATOM   1945  O O     . ILE A 1 227 ? 53.135  37.829  3.971   1.00 30.93  ? 227 ILE A O     1 
ATOM   1946  C CB    . ILE A 1 227 ? 50.477  37.138  2.192   1.00 26.93  ? 227 ILE A CB    1 
ATOM   1947  C CG1   . ILE A 1 227 ? 49.057  37.381  1.763   1.00 27.31  ? 227 ILE A CG1   1 
ATOM   1948  C CG2   . ILE A 1 227 ? 50.492  36.204  3.379   1.00 19.05  ? 227 ILE A CG2   1 
ATOM   1949  C CD1   . ILE A 1 227 ? 48.512  36.134  1.059   1.00 31.19  ? 227 ILE A CD1   1 
ATOM   1950  H H     . ILE A 1 227 ? 50.678  39.337  0.782   1.00 0.00   ? 227 ILE A H     1 
ATOM   1951  N N     . GLN A 1 228 ? 53.391  37.982  1.721   1.00 38.09  ? 228 GLN A N     1 
ATOM   1952  C CA    . GLN A 1 228 ? 54.788  37.602  1.719   1.00 39.13  ? 228 GLN A CA    1 
ATOM   1953  C C     . GLN A 1 228 ? 55.570  38.614  2.526   1.00 36.21  ? 228 GLN A C     1 
ATOM   1954  O O     . GLN A 1 228 ? 56.362  38.187  3.359   1.00 35.69  ? 228 GLN A O     1 
ATOM   1955  C CB    . GLN A 1 228 ? 55.311  37.556  0.313   1.00 47.07  ? 228 GLN A CB    1 
ATOM   1956  C CG    . GLN A 1 228 ? 56.581  36.738  0.292   1.00 59.30  ? 228 GLN A CG    1 
ATOM   1957  C CD    . GLN A 1 228 ? 57.164  36.696  -1.103  1.00 68.65  ? 228 GLN A CD    1 
ATOM   1958  O OE1   . GLN A 1 228 ? 58.079  37.444  -1.443  1.00 74.53  ? 228 GLN A OE1   1 
ATOM   1959  N NE2   . GLN A 1 228 ? 56.633  35.851  -1.978  1.00 74.35  ? 228 GLN A NE2   1 
ATOM   1960  H H     . GLN A 1 228 ? 52.972  38.274  0.882   1.00 0.00   ? 228 GLN A H     1 
ATOM   1961  H HE21  . GLN A 1 228 ? 57.038  35.844  -2.869  1.00 0.00   ? 228 GLN A HE21  1 
ATOM   1962  H HE22  . GLN A 1 228 ? 55.870  35.302  -1.712  1.00 0.00   ? 228 GLN A HE22  1 
ATOM   1963  N N     . ARG A 1 229 ? 55.291  39.919  2.364   1.00 33.97  ? 229 ARG A N     1 
ATOM   1964  C CA    . ARG A 1 229 ? 55.894  40.936  3.207   1.00 32.79  ? 229 ARG A CA    1 
ATOM   1965  C C     . ARG A 1 229 ? 55.620  40.679  4.682   1.00 32.68  ? 229 ARG A C     1 
ATOM   1966  O O     . ARG A 1 229 ? 56.414  41.074  5.543   1.00 37.83  ? 229 ARG A O     1 
ATOM   1967  C CB    . ARG A 1 229 ? 55.356  42.310  2.903   1.00 33.73  ? 229 ARG A CB    1 
ATOM   1968  C CG    . ARG A 1 229 ? 56.077  42.974  1.766   1.00 37.90  ? 229 ARG A CG    1 
ATOM   1969  C CD    . ARG A 1 229 ? 55.516  44.384  1.575   1.00 42.68  ? 229 ARG A CD    1 
ATOM   1970  N NE    . ARG A 1 229 ? 55.912  45.347  2.601   1.00 44.34  ? 229 ARG A NE    1 
ATOM   1971  C CZ    . ARG A 1 229 ? 56.142  46.629  2.292   1.00 47.17  ? 229 ARG A CZ    1 
ATOM   1972  N NH1   . ARG A 1 229 ? 56.022  47.076  1.039   1.00 50.10  ? 229 ARG A NH1   1 
ATOM   1973  N NH2   . ARG A 1 229 ? 56.510  47.488  3.244   1.00 47.56  ? 229 ARG A NH2   1 
ATOM   1974  H H     . ARG A 1 229 ? 54.693  40.190  1.637   1.00 0.00   ? 229 ARG A H     1 
ATOM   1975  H HE    . ARG A 1 229 ? 56.009  45.046  3.530   1.00 0.00   ? 229 ARG A HE    1 
ATOM   1976  H HH11  . ARG A 1 229 ? 55.754  46.454  0.305   1.00 0.00   ? 229 ARG A HH11  1 
ATOM   1977  H HH12  . ARG A 1 229 ? 56.197  48.039  0.840   1.00 0.00   ? 229 ARG A HH12  1 
ATOM   1978  H HH21  . ARG A 1 229 ? 56.614  47.177  4.190   1.00 0.00   ? 229 ARG A HH21  1 
ATOM   1979  H HH22  . ARG A 1 229 ? 56.678  48.445  3.010   1.00 0.00   ? 229 ARG A HH22  1 
ATOM   1980  N N     . LYS A 1 230 ? 54.523  40.011  5.033   1.00 27.78  ? 230 LYS A N     1 
ATOM   1981  C CA    . LYS A 1 230 ? 54.252  39.722  6.420   1.00 21.71  ? 230 LYS A CA    1 
ATOM   1982  C C     . LYS A 1 230 ? 54.904  38.439  6.861   1.00 21.00  ? 230 LYS A C     1 
ATOM   1983  O O     . LYS A 1 230 ? 55.190  38.280  8.043   1.00 21.58  ? 230 LYS A O     1 
ATOM   1984  C CB    . LYS A 1 230 ? 52.742  39.681  6.602   1.00 24.63  ? 230 LYS A CB    1 
ATOM   1985  C CG    . LYS A 1 230 ? 52.046  41.026  6.774   1.00 15.33  ? 230 LYS A CG    1 
ATOM   1986  C CD    . LYS A 1 230 ? 52.569  42.161  5.927   1.00 23.50  ? 230 LYS A CD    1 
ATOM   1987  C CE    . LYS A 1 230 ? 53.544  43.044  6.700   1.00 24.31  ? 230 LYS A CE    1 
ATOM   1988  N NZ    . LYS A 1 230 ? 52.784  43.888  7.592   1.00 32.90  ? 230 LYS A NZ    1 
ATOM   1989  H H     . LYS A 1 230 ? 53.868  39.751  4.353   1.00 0.00   ? 230 LYS A H     1 
ATOM   1990  H HZ1   . LYS A 1 230 ? 52.134  44.476  7.032   1.00 0.00   ? 230 LYS A HZ1   1 
ATOM   1991  H HZ2   . LYS A 1 230 ? 52.242  43.294  8.253   1.00 0.00   ? 230 LYS A HZ2   1 
ATOM   1992  H HZ3   . LYS A 1 230 ? 53.434  44.501  8.125   1.00 0.00   ? 230 LYS A HZ3   1 
ATOM   1993  N N     . LYS A 1 231 ? 55.166  37.518  5.954   1.00 20.87  ? 231 LYS A N     1 
ATOM   1994  C CA    . LYS A 1 231 ? 55.810  36.262  6.298   1.00 26.49  ? 231 LYS A CA    1 
ATOM   1995  C C     . LYS A 1 231 ? 57.339  36.288  6.304   1.00 31.49  ? 231 LYS A C     1 
ATOM   1996  O O     . LYS A 1 231 ? 58.004  35.540  7.036   1.00 30.29  ? 231 LYS A O     1 
ATOM   1997  C CB    . LYS A 1 231 ? 55.380  35.193  5.332   1.00 22.33  ? 231 LYS A CB    1 
ATOM   1998  C CG    . LYS A 1 231 ? 53.974  34.730  5.570   1.00 23.79  ? 231 LYS A CG    1 
ATOM   1999  C CD    . LYS A 1 231 ? 53.757  33.580  4.621   1.00 25.36  ? 231 LYS A CD    1 
ATOM   2000  C CE    . LYS A 1 231 ? 52.324  33.148  4.668   1.00 23.33  ? 231 LYS A CE    1 
ATOM   2001  N NZ    . LYS A 1 231 ? 52.128  32.125  3.664   1.00 28.07  ? 231 LYS A NZ    1 
ATOM   2002  H H     . LYS A 1 231 ? 54.932  37.706  5.024   1.00 0.00   ? 231 LYS A H     1 
ATOM   2003  H HZ1   . LYS A 1 231 ? 52.788  31.340  3.836   1.00 0.00   ? 231 LYS A HZ1   1 
ATOM   2004  H HZ2   . LYS A 1 231 ? 51.153  31.771  3.720   1.00 0.00   ? 231 LYS A HZ2   1 
ATOM   2005  H HZ3   . LYS A 1 231 ? 52.302  32.526  2.721   1.00 0.00   ? 231 LYS A HZ3   1 
ATOM   2006  N N     . PHE A 1 232 ? 57.907  37.124  5.434   1.00 34.33  ? 232 PHE A N     1 
ATOM   2007  C CA    . PHE A 1 232 ? 59.344  37.257  5.261   1.00 39.07  ? 232 PHE A CA    1 
ATOM   2008  C C     . PHE A 1 232 ? 59.570  38.755  5.176   1.00 42.15  ? 232 PHE A C     1 
ATOM   2009  O O     . PHE A 1 232 ? 59.610  39.310  4.071   1.00 41.77  ? 232 PHE A O     1 
ATOM   2010  C CB    . PHE A 1 232 ? 59.837  36.618  3.949   1.00 38.42  ? 232 PHE A CB    1 
ATOM   2011  C CG    . PHE A 1 232 ? 59.437  35.169  3.725   1.00 36.62  ? 232 PHE A CG    1 
ATOM   2012  C CD1   . PHE A 1 232 ? 60.090  34.159  4.401   1.00 35.65  ? 232 PHE A CD1   1 
ATOM   2013  C CD2   . PHE A 1 232 ? 58.402  34.886  2.862   1.00 34.17  ? 232 PHE A CD2   1 
ATOM   2014  C CE1   . PHE A 1 232 ? 59.682  32.858  4.221   1.00 32.98  ? 232 PHE A CE1   1 
ATOM   2015  C CE2   . PHE A 1 232 ? 57.999  33.585  2.699   1.00 32.94  ? 232 PHE A CE2   1 
ATOM   2016  C CZ    . PHE A 1 232 ? 58.636  32.574  3.379   1.00 31.78  ? 232 PHE A CZ    1 
ATOM   2017  H H     . PHE A 1 232 ? 57.335  37.720  4.909   1.00 0.00   ? 232 PHE A H     1 
ATOM   2018  N N     . PRO A 1 233 ? 59.663  39.481  6.294   1.00 44.86  ? 233 PRO A N     1 
ATOM   2019  C CA    . PRO A 1 233 ? 59.684  40.932  6.288   1.00 48.26  ? 233 PRO A CA    1 
ATOM   2020  C C     . PRO A 1 233 ? 60.953  41.439  5.605   1.00 52.34  ? 233 PRO A C     1 
ATOM   2021  O O     . PRO A 1 233 ? 62.041  40.983  5.965   1.00 53.46  ? 233 PRO A O     1 
ATOM   2022  C CB    . PRO A 1 233 ? 59.575  41.297  7.749   1.00 45.30  ? 233 PRO A CB    1 
ATOM   2023  C CG    . PRO A 1 233 ? 58.955  40.075  8.370   1.00 43.45  ? 233 PRO A CG    1 
ATOM   2024  C CD    . PRO A 1 233 ? 59.698  38.970  7.657   1.00 44.16  ? 233 PRO A CD    1 
ATOM   2025  N N     . PRO A 1 234 ? 60.901  42.387  4.654   1.00 56.35  ? 234 PRO A N     1 
ATOM   2026  C CA    . PRO A 1 234 ? 62.062  42.921  3.944   1.00 59.25  ? 234 PRO A CA    1 
ATOM   2027  C C     . PRO A 1 234 ? 63.105  43.505  4.892   1.00 60.51  ? 234 PRO A C     1 
ATOM   2028  O O     . PRO A 1 234 ? 64.291  43.170  4.882   1.00 60.09  ? 234 PRO A O     1 
ATOM   2029  C CB    . PRO A 1 234 ? 61.458  43.938  2.988   1.00 59.43  ? 234 PRO A CB    1 
ATOM   2030  C CG    . PRO A 1 234 ? 60.173  44.360  3.660   1.00 59.22  ? 234 PRO A CG    1 
ATOM   2031  C CD    . PRO A 1 234 ? 59.674  43.022  4.182   1.00 57.88  ? 234 PRO A CD    1 
ATOM   2032  N N     . ASP A 1 235 ? 62.611  44.310  5.828   1.00 62.19  ? 235 ASP A N     1 
ATOM   2033  C CA    . ASP A 1 235 ? 63.430  44.969  6.832   1.00 64.61  ? 235 ASP A CA    1 
ATOM   2034  C C     . ASP A 1 235 ? 63.751  44.067  8.023   1.00 63.65  ? 235 ASP A C     1 
ATOM   2035  O O     . ASP A 1 235 ? 64.092  44.540  9.104   1.00 61.50  ? 235 ASP A O     1 
ATOM   2036  C CB    . ASP A 1 235 ? 62.688  46.221  7.286   1.00 66.95  ? 235 ASP A CB    1 
ATOM   2037  C CG    . ASP A 1 235 ? 61.393  45.933  8.029   1.00 70.88  ? 235 ASP A CG    1 
ATOM   2038  O OD1   . ASP A 1 235 ? 60.536  45.207  7.520   1.00 75.19  ? 235 ASP A OD1   1 
ATOM   2039  O OD2   . ASP A 1 235 ? 61.253  46.438  9.136   1.00 74.95  ? 235 ASP A OD2   1 
ATOM   2040  H H     . ASP A 1 235 ? 61.645  44.446  5.851   1.00 0.00   ? 235 ASP A H     1 
ATOM   2041  N N     . ASN A 1 236 ? 63.598  42.760  7.805   1.00 63.95  ? 236 ASN A N     1 
ATOM   2042  C CA    . ASN A 1 236 ? 63.817  41.691  8.761   1.00 65.80  ? 236 ASN A CA    1 
ATOM   2043  C C     . ASN A 1 236 ? 63.371  41.929  10.198  1.00 67.32  ? 236 ASN A C     1 
ATOM   2044  O O     . ASN A 1 236 ? 64.052  41.723  11.206  1.00 69.27  ? 236 ASN A O     1 
ATOM   2045  C CB    . ASN A 1 236 ? 65.295  41.314  8.679   1.00 65.44  ? 236 ASN A CB    1 
ATOM   2046  C CG    . ASN A 1 236 ? 65.539  40.439  7.460   1.00 64.63  ? 236 ASN A CG    1 
ATOM   2047  O OD1   . ASN A 1 236 ? 65.559  39.213  7.533   1.00 64.02  ? 236 ASN A OD1   1 
ATOM   2048  N ND2   . ASN A 1 236 ? 65.717  41.015  6.280   1.00 64.04  ? 236 ASN A ND2   1 
ATOM   2049  H H     . ASN A 1 236 ? 63.354  42.447  6.914   1.00 0.00   ? 236 ASN A H     1 
ATOM   2050  H HD21  . ASN A 1 236 ? 65.861  40.413  5.524   1.00 0.00   ? 236 ASN A HD21  1 
ATOM   2051  H HD22  . ASN A 1 236 ? 65.677  41.990  6.190   1.00 0.00   ? 236 ASN A HD22  1 
ATOM   2052  N N     . SER A 1 237 ? 62.139  42.421  10.246  1.00 65.98  ? 237 SER A N     1 
ATOM   2053  C CA    . SER A 1 237 ? 61.437  42.602  11.492  1.00 64.26  ? 237 SER A CA    1 
ATOM   2054  C C     . SER A 1 237 ? 60.768  41.267  11.853  1.00 62.69  ? 237 SER A C     1 
ATOM   2055  O O     . SER A 1 237 ? 60.947  40.246  11.174  1.00 63.72  ? 237 SER A O     1 
ATOM   2056  C CB    . SER A 1 237 ? 60.438  43.746  11.266  1.00 63.91  ? 237 SER A CB    1 
ATOM   2057  O OG    . SER A 1 237 ? 59.866  43.760  9.956   1.00 62.51  ? 237 SER A OG    1 
ATOM   2058  H H     . SER A 1 237 ? 61.671  42.675  9.430   1.00 0.00   ? 237 SER A H     1 
ATOM   2059  H HG    . SER A 1 237 ? 59.029  43.276  9.971   1.00 0.00   ? 237 SER A HG    1 
ATOM   2060  N N     . ALA A 1 238 ? 59.975  41.221  12.923  1.00 59.31  ? 238 ALA A N     1 
ATOM   2061  C CA    . ALA A 1 238 ? 59.243  40.017  13.272  1.00 55.32  ? 238 ALA A CA    1 
ATOM   2062  C C     . ALA A 1 238 ? 58.152  39.789  12.218  1.00 53.06  ? 238 ALA A C     1 
ATOM   2063  O O     . ALA A 1 238 ? 57.538  40.778  11.779  1.00 51.08  ? 238 ALA A O     1 
ATOM   2064  C CB    . ALA A 1 238 ? 58.600  40.190  14.631  1.00 56.57  ? 238 ALA A CB    1 
ATOM   2065  H H     . ALA A 1 238 ? 59.817  42.032  13.439  1.00 0.00   ? 238 ALA A H     1 
ATOM   2066  N N     . PRO A 1 239 ? 57.945  38.543  11.740  1.00 51.04  ? 239 PRO A N     1 
ATOM   2067  C CA    . PRO A 1 239 ? 56.846  38.151  10.856  1.00 47.78  ? 239 PRO A CA    1 
ATOM   2068  C C     . PRO A 1 239 ? 55.511  38.304  11.577  1.00 47.62  ? 239 PRO A C     1 
ATOM   2069  O O     . PRO A 1 239 ? 55.405  38.043  12.788  1.00 47.50  ? 239 PRO A O     1 
ATOM   2070  C CB    . PRO A 1 239 ? 57.122  36.715  10.484  1.00 48.14  ? 239 PRO A CB    1 
ATOM   2071  C CG    . PRO A 1 239 ? 58.566  36.511  10.850  1.00 47.94  ? 239 PRO A CG    1 
ATOM   2072  C CD    . PRO A 1 239 ? 58.721  37.359  12.095  1.00 46.50  ? 239 PRO A CD    1 
ATOM   2073  N N     . TYR A 1 240 ? 54.485  38.708  10.829  1.00 45.44  ? 240 TYR A N     1 
ATOM   2074  C CA    . TYR A 1 240 ? 53.164  38.937  11.390  1.00 40.39  ? 240 TYR A CA    1 
ATOM   2075  C C     . TYR A 1 240 ? 52.492  37.615  11.712  1.00 38.36  ? 240 TYR A C     1 
ATOM   2076  O O     . TYR A 1 240 ? 52.635  36.686  10.921  1.00 39.02  ? 240 TYR A O     1 
ATOM   2077  C CB    . TYR A 1 240 ? 52.323  39.699  10.395  1.00 37.39  ? 240 TYR A CB    1 
ATOM   2078  C CG    . TYR A 1 240 ? 52.394  41.209  10.531  1.00 38.90  ? 240 TYR A CG    1 
ATOM   2079  C CD1   . TYR A 1 240 ? 53.593  41.880  10.704  1.00 38.85  ? 240 TYR A CD1   1 
ATOM   2080  C CD2   . TYR A 1 240 ? 51.212  41.912  10.467  1.00 39.37  ? 240 TYR A CD2   1 
ATOM   2081  C CE1   . TYR A 1 240 ? 53.607  43.256  10.816  1.00 37.70  ? 240 TYR A CE1   1 
ATOM   2082  C CE2   . TYR A 1 240 ? 51.222  43.282  10.569  1.00 40.63  ? 240 TYR A CE2   1 
ATOM   2083  C CZ    . TYR A 1 240 ? 52.417  43.943  10.736  1.00 38.82  ? 240 TYR A CZ    1 
ATOM   2084  O OH    . TYR A 1 240 ? 52.407  45.317  10.809  1.00 39.93  ? 240 TYR A OH    1 
ATOM   2085  H H     . TYR A 1 240 ? 54.605  38.720  9.859   1.00 0.00   ? 240 TYR A H     1 
ATOM   2086  H HH    . TYR A 1 240 ? 53.264  45.619  11.115  1.00 0.00   ? 240 TYR A HH    1 
ATOM   2087  N N     . GLY A 1 241 ? 51.755  37.499  12.816  1.00 34.63  ? 241 GLY A N     1 
ATOM   2088  C CA    . GLY A 1 241 ? 51.052  36.279  13.179  1.00 33.46  ? 241 GLY A CA    1 
ATOM   2089  C C     . GLY A 1 241 ? 49.801  36.071  12.331  1.00 30.55  ? 241 GLY A C     1 
ATOM   2090  O O     . GLY A 1 241 ? 49.087  37.028  12.012  1.00 31.06  ? 241 GLY A O     1 
ATOM   2091  H H     . GLY A 1 241 ? 51.643  38.298  13.370  1.00 0.00   ? 241 GLY A H     1 
ATOM   2092  N N     . ALA A 1 242 ? 49.512  34.830  11.955  1.00 29.15  ? 242 ALA A N     1 
ATOM   2093  C CA    . ALA A 1 242 ? 48.329  34.505  11.166  1.00 28.58  ? 242 ALA A CA    1 
ATOM   2094  C C     . ALA A 1 242 ? 47.192  34.017  12.055  1.00 24.74  ? 242 ALA A C     1 
ATOM   2095  O O     . ALA A 1 242 ? 47.434  33.316  13.039  1.00 24.78  ? 242 ALA A O     1 
ATOM   2096  C CB    . ALA A 1 242 ? 48.657  33.402  10.177  1.00 30.66  ? 242 ALA A CB    1 
ATOM   2097  H H     . ALA A 1 242 ? 50.036  34.076  12.291  1.00 0.00   ? 242 ALA A H     1 
ATOM   2098  N N     . ARG A 1 243 ? 45.951  34.379  11.726  1.00 26.79  ? 243 ARG A N     1 
ATOM   2099  C CA    . ARG A 1 243 ? 44.728  33.996  12.436  1.00 20.06  ? 243 ARG A CA    1 
ATOM   2100  C C     . ARG A 1 243 ? 43.549  34.072  11.482  1.00 16.78  ? 243 ARG A C     1 
ATOM   2101  O O     . ARG A 1 243 ? 43.397  35.133  10.857  1.00 17.68  ? 243 ARG A O     1 
ATOM   2102  C CB    . ARG A 1 243 ? 44.364  34.940  13.554  1.00 15.80  ? 243 ARG A CB    1 
ATOM   2103  C CG    . ARG A 1 243 ? 45.253  34.950  14.732  1.00 13.14  ? 243 ARG A CG    1 
ATOM   2104  C CD    . ARG A 1 243 ? 45.000  33.648  15.400  1.00 11.86  ? 243 ARG A CD    1 
ATOM   2105  N NE    . ARG A 1 243 ? 45.730  33.645  16.646  1.00 23.73  ? 243 ARG A NE    1 
ATOM   2106  C CZ    . ARG A 1 243 ? 46.989  33.208  16.746  1.00 18.98  ? 243 ARG A CZ    1 
ATOM   2107  N NH1   . ARG A 1 243 ? 47.652  32.732  15.695  1.00 24.67  ? 243 ARG A NH1   1 
ATOM   2108  N NH2   . ARG A 1 243 ? 47.571  33.224  17.941  1.00 18.86  ? 243 ARG A NH2   1 
ATOM   2109  H H     . ARG A 1 243 ? 45.832  34.927  10.923  1.00 0.00   ? 243 ARG A H     1 
ATOM   2110  H HE    . ARG A 1 243 ? 45.282  33.974  17.454  1.00 0.00   ? 243 ARG A HE    1 
ATOM   2111  H HH11  . ARG A 1 243 ? 47.197  32.670  14.809  1.00 0.00   ? 243 ARG A HH11  1 
ATOM   2112  H HH12  . ARG A 1 243 ? 48.590  32.404  15.803  1.00 0.00   ? 243 ARG A HH12  1 
ATOM   2113  H HH21  . ARG A 1 243 ? 47.068  33.549  18.742  1.00 0.00   ? 243 ARG A HH21  1 
ATOM   2114  H HH22  . ARG A 1 243 ? 48.509  32.891  18.041  1.00 0.00   ? 243 ARG A HH22  1 
ATOM   2115  N N     . TYR A 1 244 ? 42.681  33.058  11.349  1.00 11.12  ? 244 TYR A N     1 
ATOM   2116  C CA    . TYR A 1 244 ? 41.502  33.170  10.497  1.00 8.57   ? 244 TYR A CA    1 
ATOM   2117  C C     . TYR A 1 244 ? 40.414  32.222  10.973  1.00 8.95   ? 244 TYR A C     1 
ATOM   2118  O O     . TYR A 1 244 ? 40.384  31.049  10.601  1.00 8.02   ? 244 TYR A O     1 
ATOM   2119  C CB    . TYR A 1 244 ? 41.868  32.846  9.058   1.00 9.44   ? 244 TYR A CB    1 
ATOM   2120  C CG    . TYR A 1 244 ? 40.710  33.015  8.104   1.00 4.40   ? 244 TYR A CG    1 
ATOM   2121  C CD1   . TYR A 1 244 ? 40.252  34.278  7.813   1.00 6.03   ? 244 TYR A CD1   1 
ATOM   2122  C CD2   . TYR A 1 244 ? 40.158  31.899  7.524   1.00 7.71   ? 244 TYR A CD2   1 
ATOM   2123  C CE1   . TYR A 1 244 ? 39.222  34.425  6.928   1.00 4.50   ? 244 TYR A CE1   1 
ATOM   2124  C CE2   . TYR A 1 244 ? 39.121  32.044  6.635   1.00 6.73   ? 244 TYR A CE2   1 
ATOM   2125  C CZ    . TYR A 1 244 ? 38.658  33.304  6.359   1.00 7.13   ? 244 TYR A CZ    1 
ATOM   2126  O OH    . TYR A 1 244 ? 37.582  33.463  5.498   1.00 10.62  ? 244 TYR A OH    1 
ATOM   2127  H H     . TYR A 1 244 ? 42.851  32.225  11.836  1.00 0.00   ? 244 TYR A H     1 
ATOM   2128  H HH    . TYR A 1 244 ? 37.280  32.588  5.203   1.00 0.00   ? 244 TYR A HH    1 
ATOM   2129  N N     . VAL A 1 245 ? 39.510  32.716  11.821  1.00 9.91   ? 245 VAL A N     1 
ATOM   2130  C CA    . VAL A 1 245 ? 38.426  31.909  12.378  1.00 8.47   ? 245 VAL A CA    1 
ATOM   2131  C C     . VAL A 1 245 ? 37.434  31.524  11.279  1.00 9.88   ? 245 VAL A C     1 
ATOM   2132  O O     . VAL A 1 245 ? 36.874  30.431  11.280  1.00 11.35  ? 245 VAL A O     1 
ATOM   2133  C CB    . VAL A 1 245 ? 37.754  32.731  13.491  1.00 5.61   ? 245 VAL A CB    1 
ATOM   2134  C CG1   . VAL A 1 245 ? 36.737  31.888  14.184  1.00 5.40   ? 245 VAL A CG1   1 
ATOM   2135  C CG2   . VAL A 1 245 ? 38.765  33.155  14.544  1.00 6.78   ? 245 VAL A CG2   1 
ATOM   2136  H H     . VAL A 1 245 ? 39.623  33.643  12.110  1.00 0.00   ? 245 VAL A H     1 
ATOM   2137  N N     . GLY A 1 246 ? 37.200  32.411  10.317  1.00 9.40   ? 246 GLY A N     1 
ATOM   2138  C CA    . GLY A 1 246 ? 36.302  32.134  9.213   1.00 12.02  ? 246 GLY A CA    1 
ATOM   2139  C C     . GLY A 1 246 ? 34.865  32.577  9.479   1.00 14.64  ? 246 GLY A C     1 
ATOM   2140  O O     . GLY A 1 246 ? 33.941  32.102  8.812   1.00 16.01  ? 246 GLY A O     1 
ATOM   2141  H H     . GLY A 1 246 ? 37.643  33.280  10.351  1.00 0.00   ? 246 GLY A H     1 
ATOM   2142  N N     . SER A 1 247 ? 34.653  33.463  10.453  1.00 12.14  ? 247 SER A N     1 
ATOM   2143  C CA    . SER A 1 247 ? 33.357  33.996  10.822  1.00 7.81   ? 247 SER A CA    1 
ATOM   2144  C C     . SER A 1 247 ? 33.712  35.464  10.914  1.00 8.23   ? 247 SER A C     1 
ATOM   2145  O O     . SER A 1 247 ? 34.522  35.848  11.761  1.00 9.74   ? 247 SER A O     1 
ATOM   2146  C CB    . SER A 1 247 ? 32.957  33.422  12.168  1.00 10.09  ? 247 SER A CB    1 
ATOM   2147  O OG    . SER A 1 247 ? 32.040  34.181  12.949  1.00 10.11  ? 247 SER A OG    1 
ATOM   2148  H H     . SER A 1 247 ? 35.418  33.879  10.898  1.00 0.00   ? 247 SER A H     1 
ATOM   2149  H HG    . SER A 1 247 ? 31.457  33.522  13.362  1.00 0.00   ? 247 SER A HG    1 
ATOM   2150  N N     . MET A 1 248 ? 33.151  36.300  10.050  1.00 10.11  ? 248 MET A N     1 
ATOM   2151  C CA    . MET A 1 248 ? 33.488  37.715  9.956   1.00 12.94  ? 248 MET A CA    1 
ATOM   2152  C C     . MET A 1 248 ? 33.522  38.425  11.287  1.00 13.65  ? 248 MET A C     1 
ATOM   2153  O O     . MET A 1 248 ? 34.504  39.086  11.583  1.00 18.17  ? 248 MET A O     1 
ATOM   2154  C CB    . MET A 1 248 ? 32.501  38.494  9.106   1.00 3.80   ? 248 MET A CB    1 
ATOM   2155  C CG    . MET A 1 248 ? 33.208  39.753  8.688   1.00 11.13  ? 248 MET A CG    1 
ATOM   2156  S SD    . MET A 1 248 ? 32.065  40.941  7.986   1.00 16.88  ? 248 MET A SD    1 
ATOM   2157  C CE    . MET A 1 248 ? 33.255  42.218  7.735   1.00 14.77  ? 248 MET A CE    1 
ATOM   2158  H H     . MET A 1 248 ? 32.467  35.936  9.450   1.00 0.00   ? 248 MET A H     1 
ATOM   2159  N N     . VAL A 1 249 ? 32.510  38.264  12.130  1.00 16.49  ? 249 VAL A N     1 
ATOM   2160  C CA    . VAL A 1 249 ? 32.453  38.993  13.383  1.00 19.79  ? 249 VAL A CA    1 
ATOM   2161  C C     . VAL A 1 249 ? 33.567  38.620  14.346  1.00 16.00  ? 249 VAL A C     1 
ATOM   2162  O O     . VAL A 1 249 ? 34.086  39.494  15.038  1.00 21.72  ? 249 VAL A O     1 
ATOM   2163  C CB    . VAL A 1 249 ? 31.077  38.764  14.040  1.00 21.15  ? 249 VAL A CB    1 
ATOM   2164  C CG1   . VAL A 1 249 ? 30.965  39.531  15.334  1.00 24.26  ? 249 VAL A CG1   1 
ATOM   2165  C CG2   . VAL A 1 249 ? 30.005  39.387  13.196  1.00 20.00  ? 249 VAL A CG2   1 
ATOM   2166  H H     . VAL A 1 249 ? 31.822  37.603  11.915  1.00 0.00   ? 249 VAL A H     1 
ATOM   2167  N N     . ALA A 1 250 ? 33.978  37.366  14.411  1.00 17.67  ? 250 ALA A N     1 
ATOM   2168  C CA    . ALA A 1 250 ? 35.033  36.964  15.324  1.00 17.08  ? 250 ALA A CA    1 
ATOM   2169  C C     . ALA A 1 250 ? 36.326  37.631  14.870  1.00 16.29  ? 250 ALA A C     1 
ATOM   2170  O O     . ALA A 1 250 ? 37.051  38.247  15.660  1.00 17.98  ? 250 ALA A O     1 
ATOM   2171  C CB    . ALA A 1 250 ? 35.170  35.450  15.286  1.00 8.27   ? 250 ALA A CB    1 
ATOM   2172  H H     . ALA A 1 250 ? 33.597  36.705  13.799  1.00 0.00   ? 250 ALA A H     1 
ATOM   2173  N N     . ASP A 1 251 ? 36.493  37.649  13.544  1.00 14.35  ? 251 ASP A N     1 
ATOM   2174  C CA    . ASP A 1 251 ? 37.658  38.210  12.911  1.00 15.30  ? 251 ASP A CA    1 
ATOM   2175  C C     . ASP A 1 251 ? 37.741  39.735  12.949  1.00 16.18  ? 251 ASP A C     1 
ATOM   2176  O O     . ASP A 1 251 ? 38.805  40.284  13.271  1.00 21.32  ? 251 ASP A O     1 
ATOM   2177  C CB    . ASP A 1 251 ? 37.689  37.651  11.491  1.00 11.36  ? 251 ASP A CB    1 
ATOM   2178  C CG    . ASP A 1 251 ? 38.078  36.177  11.446  1.00 8.66   ? 251 ASP A CG    1 
ATOM   2179  O OD1   . ASP A 1 251 ? 38.793  35.702  12.325  1.00 16.72  ? 251 ASP A OD1   1 
ATOM   2180  O OD2   . ASP A 1 251 ? 37.691  35.486  10.516  1.00 9.43   ? 251 ASP A OD2   1 
ATOM   2181  H H     . ASP A 1 251 ? 35.785  37.270  12.979  1.00 0.00   ? 251 ASP A H     1 
ATOM   2182  N N     . VAL A 1 252 ? 36.698  40.511  12.690  1.00 14.99  ? 252 VAL A N     1 
ATOM   2183  C CA    . VAL A 1 252 ? 36.776  41.955  12.875  1.00 15.17  ? 252 VAL A CA    1 
ATOM   2184  C C     . VAL A 1 252 ? 36.896  42.245  14.367  1.00 14.86  ? 252 VAL A C     1 
ATOM   2185  O O     . VAL A 1 252 ? 37.630  43.159  14.750  1.00 18.77  ? 252 VAL A O     1 
ATOM   2186  C CB    . VAL A 1 252 ? 35.524  42.649  12.309  1.00 17.29  ? 252 VAL A CB    1 
ATOM   2187  C CG1   . VAL A 1 252 ? 35.485  44.135  12.634  1.00 18.66  ? 252 VAL A CG1   1 
ATOM   2188  C CG2   . VAL A 1 252 ? 35.571  42.510  10.796  1.00 20.93  ? 252 VAL A CG2   1 
ATOM   2189  H H     . VAL A 1 252 ? 35.873  40.101  12.365  1.00 0.00   ? 252 VAL A H     1 
ATOM   2190  N N     . HIS A 1 253 ? 36.305  41.475  15.279  1.00 12.18  ? 253 HIS A N     1 
ATOM   2191  C CA    . HIS A 1 253 ? 36.400  41.833  16.680  1.00 13.59  ? 253 HIS A CA    1 
ATOM   2192  C C     . HIS A 1 253 ? 37.832  41.704  17.175  1.00 16.55  ? 253 HIS A C     1 
ATOM   2193  O O     . HIS A 1 253 ? 38.362  42.648  17.774  1.00 19.71  ? 253 HIS A O     1 
ATOM   2194  C CB    . HIS A 1 253 ? 35.495  40.957  17.518  1.00 11.18  ? 253 HIS A CB    1 
ATOM   2195  C CG    . HIS A 1 253 ? 35.350  41.501  18.919  1.00 11.00  ? 253 HIS A CG    1 
ATOM   2196  N ND1   . HIS A 1 253 ? 34.995  42.748  19.187  1.00 14.87  ? 253 HIS A ND1   1 
ATOM   2197  C CD2   . HIS A 1 253 ? 35.577  40.831  20.087  1.00 14.52  ? 253 HIS A CD2   1 
ATOM   2198  C CE1   . HIS A 1 253 ? 34.970  42.857  20.489  1.00 15.01  ? 253 HIS A CE1   1 
ATOM   2199  N NE2   . HIS A 1 253 ? 35.322  41.713  21.006  1.00 13.66  ? 253 HIS A NE2   1 
ATOM   2200  H H     . HIS A 1 253 ? 35.782  40.682  15.001  1.00 0.00   ? 253 HIS A H     1 
ATOM   2201  H HD1   . HIS A 1 253 ? 34.978  43.543  18.621  1.00 0.00   ? 253 HIS A HD1   1 
ATOM   2202  H HE2   . HIS A 1 253 ? 35.441  41.597  21.973  1.00 0.00   ? 253 HIS A HE2   1 
ATOM   2203  N N     . ARG A 1 254 ? 38.492  40.590  16.913  1.00 12.73  ? 254 ARG A N     1 
ATOM   2204  C CA    . ARG A 1 254 ? 39.864  40.436  17.320  1.00 12.72  ? 254 ARG A CA    1 
ATOM   2205  C C     . ARG A 1 254 ? 40.702  41.529  16.680  1.00 17.92  ? 254 ARG A C     1 
ATOM   2206  O O     . ARG A 1 254 ? 41.602  42.054  17.335  1.00 17.05  ? 254 ARG A O     1 
ATOM   2207  C CB    . ARG A 1 254 ? 40.351  39.114  16.877  1.00 13.81  ? 254 ARG A CB    1 
ATOM   2208  C CG    . ARG A 1 254 ? 41.689  38.770  17.487  1.00 15.35  ? 254 ARG A CG    1 
ATOM   2209  C CD    . ARG A 1 254 ? 42.637  38.221  16.443  1.00 18.14  ? 254 ARG A CD    1 
ATOM   2210  N NE    . ARG A 1 254 ? 41.982  37.229  15.617  1.00 18.85  ? 254 ARG A NE    1 
ATOM   2211  C CZ    . ARG A 1 254 ? 41.827  37.430  14.306  1.00 15.51  ? 254 ARG A CZ    1 
ATOM   2212  N NH1   . ARG A 1 254 ? 42.330  38.498  13.687  1.00 16.03  ? 254 ARG A NH1   1 
ATOM   2213  N NH2   . ARG A 1 254 ? 41.164  36.516  13.616  1.00 16.87  ? 254 ARG A NH2   1 
ATOM   2214  H H     . ARG A 1 254 ? 38.051  39.847  16.441  1.00 0.00   ? 254 ARG A H     1 
ATOM   2215  H HE    . ARG A 1 254 ? 41.634  36.410  16.028  1.00 0.00   ? 254 ARG A HE    1 
ATOM   2216  H HH11  . ARG A 1 254 ? 42.842  39.190  14.197  1.00 0.00   ? 254 ARG A HH11  1 
ATOM   2217  H HH12  . ARG A 1 254 ? 42.190  38.609  12.702  1.00 0.00   ? 254 ARG A HH12  1 
ATOM   2218  H HH21  . ARG A 1 254 ? 40.797  35.709  14.081  1.00 0.00   ? 254 ARG A HH21  1 
ATOM   2219  H HH22  . ARG A 1 254 ? 41.028  36.630  12.632  1.00 0.00   ? 254 ARG A HH22  1 
ATOM   2220  N N     . THR A 1 255 ? 40.396  41.946  15.448  1.00 16.39  ? 255 THR A N     1 
ATOM   2221  C CA    . THR A 1 255 ? 41.114  43.040  14.821  1.00 17.17  ? 255 THR A CA    1 
ATOM   2222  C C     . THR A 1 255 ? 40.882  44.379  15.517  1.00 19.90  ? 255 THR A C     1 
ATOM   2223  O O     . THR A 1 255 ? 41.775  45.232  15.567  1.00 22.54  ? 255 THR A O     1 
ATOM   2224  C CB    . THR A 1 255 ? 40.684  43.100  13.352  1.00 16.64  ? 255 THR A CB    1 
ATOM   2225  O OG1   . THR A 1 255 ? 41.148  41.849  12.833  1.00 28.44  ? 255 THR A OG1   1 
ATOM   2226  C CG2   . THR A 1 255 ? 41.239  44.270  12.537  1.00 13.92  ? 255 THR A CG2   1 
ATOM   2227  H H     . THR A 1 255 ? 39.734  41.461  14.913  1.00 0.00   ? 255 THR A H     1 
ATOM   2228  H HG1   . THR A 1 255 ? 40.482  41.154  12.909  1.00 0.00   ? 255 THR A HG1   1 
ATOM   2229  N N     . LEU A 1 256 ? 39.716  44.595  16.099  1.00 16.80  ? 256 LEU A N     1 
ATOM   2230  C CA    . LEU A 1 256 ? 39.442  45.847  16.762  1.00 17.17  ? 256 LEU A CA    1 
ATOM   2231  C C     . LEU A 1 256 ? 40.196  45.919  18.084  1.00 18.10  ? 256 LEU A C     1 
ATOM   2232  O O     . LEU A 1 256 ? 40.831  46.920  18.424  1.00 12.98  ? 256 LEU A O     1 
ATOM   2233  C CB    . LEU A 1 256 ? 37.936  45.936  16.973  1.00 19.26  ? 256 LEU A CB    1 
ATOM   2234  C CG    . LEU A 1 256 ? 37.356  47.138  17.680  1.00 18.96  ? 256 LEU A CG    1 
ATOM   2235  C CD1   . LEU A 1 256 ? 37.530  48.402  16.859  1.00 16.62  ? 256 LEU A CD1   1 
ATOM   2236  C CD2   . LEU A 1 256 ? 35.882  46.867  17.895  1.00 23.42  ? 256 LEU A CD2   1 
ATOM   2237  H H     . LEU A 1 256 ? 39.015  43.913  16.034  1.00 0.00   ? 256 LEU A H     1 
ATOM   2238  N N     . VAL A 1 257 ? 40.126  44.784  18.780  1.00 18.11  ? 257 VAL A N     1 
ATOM   2239  C CA    . VAL A 1 257 ? 40.641  44.661  20.132  1.00 23.40  ? 257 VAL A CA    1 
ATOM   2240  C C     . VAL A 1 257 ? 42.167  44.619  20.144  1.00 27.69  ? 257 VAL A C     1 
ATOM   2241  O O     . VAL A 1 257 ? 42.830  45.328  20.905  1.00 30.34  ? 257 VAL A O     1 
ATOM   2242  C CB    . VAL A 1 257 ? 40.024  43.369  20.781  1.00 23.44  ? 257 VAL A CB    1 
ATOM   2243  C CG1   . VAL A 1 257 ? 40.398  43.283  22.241  1.00 22.22  ? 257 VAL A CG1   1 
ATOM   2244  C CG2   . VAL A 1 257 ? 38.509  43.416  20.779  1.00 21.73  ? 257 VAL A CG2   1 
ATOM   2245  H H     . VAL A 1 257 ? 39.728  44.003  18.346  1.00 0.00   ? 257 VAL A H     1 
ATOM   2246  N N     . TYR A 1 258 ? 42.728  43.790  19.270  1.00 31.91  ? 258 TYR A N     1 
ATOM   2247  C CA    . TYR A 1 258 ? 44.157  43.570  19.200  1.00 34.80  ? 258 TYR A CA    1 
ATOM   2248  C C     . TYR A 1 258 ? 44.822  44.344  18.052  1.00 31.40  ? 258 TYR A C     1 
ATOM   2249  O O     . TYR A 1 258 ? 46.020  44.642  18.129  1.00 32.76  ? 258 TYR A O     1 
ATOM   2250  C CB    . TYR A 1 258 ? 44.354  42.023  19.095  1.00 40.56  ? 258 TYR A CB    1 
ATOM   2251  C CG    . TYR A 1 258 ? 45.778  41.501  19.296  1.00 50.78  ? 258 TYR A CG    1 
ATOM   2252  C CD1   . TYR A 1 258 ? 46.668  41.524  18.230  1.00 56.62  ? 258 TYR A CD1   1 
ATOM   2253  C CD2   . TYR A 1 258 ? 46.208  41.060  20.537  1.00 51.91  ? 258 TYR A CD2   1 
ATOM   2254  C CE1   . TYR A 1 258 ? 47.986  41.151  18.394  1.00 57.87  ? 258 TYR A CE1   1 
ATOM   2255  C CE2   . TYR A 1 258 ? 47.529  40.669  20.704  1.00 55.42  ? 258 TYR A CE2   1 
ATOM   2256  C CZ    . TYR A 1 258 ? 48.408  40.711  19.628  1.00 57.60  ? 258 TYR A CZ    1 
ATOM   2257  O OH    . TYR A 1 258 ? 49.722  40.286  19.756  1.00 55.42  ? 258 TYR A OH    1 
ATOM   2258  H H     . TYR A 1 258 ? 42.159  43.323  18.630  1.00 0.00   ? 258 TYR A H     1 
ATOM   2259  H HH    . TYR A 1 258 ? 49.877  40.000  20.660  1.00 0.00   ? 258 TYR A HH    1 
ATOM   2260  N N     . GLY A 1 259 ? 44.129  44.723  16.988  1.00 25.23  ? 259 GLY A N     1 
ATOM   2261  C CA    . GLY A 1 259 ? 44.790  45.398  15.895  1.00 23.58  ? 259 GLY A CA    1 
ATOM   2262  C C     . GLY A 1 259 ? 45.350  44.408  14.887  1.00 22.41  ? 259 GLY A C     1 
ATOM   2263  O O     . GLY A 1 259 ? 45.639  43.237  15.177  1.00 22.56  ? 259 GLY A O     1 
ATOM   2264  H H     . GLY A 1 259 ? 43.180  44.511  16.903  1.00 0.00   ? 259 GLY A H     1 
ATOM   2265  N N     . GLY A 1 260 ? 45.543  44.872  13.662  1.00 21.85  ? 260 GLY A N     1 
ATOM   2266  C CA    . GLY A 1 260 ? 46.091  44.043  12.608  1.00 19.49  ? 260 GLY A CA    1 
ATOM   2267  C C     . GLY A 1 260 ? 45.280  44.321  11.360  1.00 17.57  ? 260 GLY A C     1 
ATOM   2268  O O     . GLY A 1 260 ? 44.686  45.400  11.203  1.00 8.25   ? 260 GLY A O     1 
ATOM   2269  H H     . GLY A 1 260 ? 45.229  45.773  13.429  1.00 0.00   ? 260 GLY A H     1 
ATOM   2270  N N     . ILE A 1 261 ? 45.259  43.377  10.443  1.00 14.64  ? 261 ILE A N     1 
ATOM   2271  C CA    . ILE A 1 261 ? 44.494  43.605  9.256   1.00 17.04  ? 261 ILE A CA    1 
ATOM   2272  C C     . ILE A 1 261 ? 43.719  42.332  9.001   1.00 14.14  ? 261 ILE A C     1 
ATOM   2273  O O     . ILE A 1 261 ? 44.126  41.222  9.352   1.00 15.35  ? 261 ILE A O     1 
ATOM   2274  C CB    . ILE A 1 261 ? 45.504  44.019  8.140   1.00 17.15  ? 261 ILE A CB    1 
ATOM   2275  C CG1   . ILE A 1 261 ? 44.687  44.539  6.971   1.00 20.87  ? 261 ILE A CG1   1 
ATOM   2276  C CG2   . ILE A 1 261 ? 46.422  42.884  7.719   1.00 19.09  ? 261 ILE A CG2   1 
ATOM   2277  C CD1   . ILE A 1 261 ? 45.446  45.474  6.023   1.00 9.38   ? 261 ILE A CD1   1 
ATOM   2278  H H     . ILE A 1 261 ? 45.642  42.486  10.609  1.00 0.00   ? 261 ILE A H     1 
ATOM   2279  N N     . PHE A 1 262 ? 42.536  42.545  8.471   1.00 14.20  ? 262 PHE A N     1 
ATOM   2280  C CA    . PHE A 1 262 ? 41.640  41.492  8.082   1.00 13.33  ? 262 PHE A CA    1 
ATOM   2281  C C     . PHE A 1 262 ? 41.436  41.818  6.630   1.00 14.93  ? 262 PHE A C     1 
ATOM   2282  O O     . PHE A 1 262 ? 41.150  42.972  6.263   1.00 16.12  ? 262 PHE A O     1 
ATOM   2283  C CB    . PHE A 1 262 ? 40.304  41.597  8.825   1.00 12.61  ? 262 PHE A CB    1 
ATOM   2284  C CG    . PHE A 1 262 ? 39.228  40.693  8.251   1.00 11.11  ? 262 PHE A CG    1 
ATOM   2285  C CD1   . PHE A 1 262 ? 39.289  39.320  8.451   1.00 8.14   ? 262 PHE A CD1   1 
ATOM   2286  C CD2   . PHE A 1 262 ? 38.234  41.255  7.467   1.00 11.55  ? 262 PHE A CD2   1 
ATOM   2287  C CE1   . PHE A 1 262 ? 38.373  38.513  7.814   1.00 12.41  ? 262 PHE A CE1   1 
ATOM   2288  C CE2   . PHE A 1 262 ? 37.309  40.439  6.852   1.00 6.44   ? 262 PHE A CE2   1 
ATOM   2289  C CZ    . PHE A 1 262 ? 37.385  39.069  7.018   1.00 13.63  ? 262 PHE A CZ    1 
ATOM   2290  H H     . PHE A 1 262 ? 42.250  43.465  8.279   1.00 0.00   ? 262 PHE A H     1 
ATOM   2291  N N     . LEU A 1 263 ? 41.536  40.780  5.827   1.00 19.16  ? 263 LEU A N     1 
ATOM   2292  C CA    . LEU A 1 263 ? 41.322  40.913  4.404   1.00 25.48  ? 263 LEU A CA    1 
ATOM   2293  C C     . LEU A 1 263 ? 40.387  39.826  3.925   1.00 25.52  ? 263 LEU A C     1 
ATOM   2294  O O     . LEU A 1 263 ? 40.546  38.652  4.274   1.00 21.19  ? 263 LEU A O     1 
ATOM   2295  C CB    . LEU A 1 263 ? 42.573  40.733  3.559   1.00 25.23  ? 263 LEU A CB    1 
ATOM   2296  C CG    . LEU A 1 263 ? 43.867  41.474  3.772   1.00 25.97  ? 263 LEU A CG    1 
ATOM   2297  C CD1   . LEU A 1 263 ? 44.696  40.793  4.855   1.00 26.06  ? 263 LEU A CD1   1 
ATOM   2298  C CD2   . LEU A 1 263 ? 44.654  41.446  2.474   1.00 25.86  ? 263 LEU A CD2   1 
ATOM   2299  H H     . LEU A 1 263 ? 41.666  39.883  6.187   1.00 0.00   ? 263 LEU A H     1 
ATOM   2300  N N     . TYR A 1 264 ? 39.390  40.197  3.128   1.00 29.14  ? 264 TYR A N     1 
ATOM   2301  C CA    . TYR A 1 264 ? 38.571  39.235  2.406   1.00 32.02  ? 264 TYR A CA    1 
ATOM   2302  C C     . TYR A 1 264 ? 38.547  39.907  1.041   1.00 35.77  ? 264 TYR A C     1 
ATOM   2303  O O     . TYR A 1 264 ? 37.571  40.570  0.641   1.00 34.87  ? 264 TYR A O     1 
ATOM   2304  C CB    . TYR A 1 264 ? 37.124  39.103  2.928   1.00 32.65  ? 264 TYR A CB    1 
ATOM   2305  C CG    . TYR A 1 264 ? 36.547  37.699  2.699   1.00 30.74  ? 264 TYR A CG    1 
ATOM   2306  C CD1   . TYR A 1 264 ? 36.507  37.130  1.432   1.00 27.88  ? 264 TYR A CD1   1 
ATOM   2307  C CD2   . TYR A 1 264 ? 36.147  36.948  3.791   1.00 28.30  ? 264 TYR A CD2   1 
ATOM   2308  C CE1   . TYR A 1 264 ? 36.146  35.810  1.260   1.00 21.11  ? 264 TYR A CE1   1 
ATOM   2309  C CE2   . TYR A 1 264 ? 35.786  35.622  3.624   1.00 25.42  ? 264 TYR A CE2   1 
ATOM   2310  C CZ    . TYR A 1 264 ? 35.819  35.063  2.365   1.00 21.72  ? 264 TYR A CZ    1 
ATOM   2311  O OH    . TYR A 1 264 ? 35.561  33.723  2.218   1.00 22.73  ? 264 TYR A OH    1 
ATOM   2312  H H     . TYR A 1 264 ? 39.215  41.154  3.012   1.00 0.00   ? 264 TYR A H     1 
ATOM   2313  H HH    . TYR A 1 264 ? 35.805  33.464  1.315   1.00 0.00   ? 264 TYR A HH    1 
ATOM   2314  N N     . PRO A 1 265 ? 39.682  39.803  0.329   1.00 37.67  ? 265 PRO A N     1 
ATOM   2315  C CA    . PRO A 1 265 ? 39.937  40.554  -0.884  1.00 37.68  ? 265 PRO A CA    1 
ATOM   2316  C C     . PRO A 1 265 ? 39.244  39.915  -2.088  1.00 40.66  ? 265 PRO A C     1 
ATOM   2317  O O     . PRO A 1 265 ? 38.801  38.751  -2.063  1.00 36.68  ? 265 PRO A O     1 
ATOM   2318  C CB    . PRO A 1 265 ? 41.438  40.550  -0.929  1.00 36.92  ? 265 PRO A CB    1 
ATOM   2319  C CG    . PRO A 1 265 ? 41.776  39.122  -0.533  1.00 37.89  ? 265 PRO A CG    1 
ATOM   2320  C CD    . PRO A 1 265 ? 40.728  38.788  0.522   1.00 37.46  ? 265 PRO A CD    1 
ATOM   2321  N N     . ALA A 1 266 ? 39.153  40.697  -3.161  1.00 43.67  ? 266 ALA A N     1 
ATOM   2322  C CA    . ALA A 1 266 ? 38.620  40.160  -4.393  1.00 48.71  ? 266 ALA A CA    1 
ATOM   2323  C C     . ALA A 1 266 ? 39.672  39.156  -4.869  1.00 53.05  ? 266 ALA A C     1 
ATOM   2324  O O     . ALA A 1 266 ? 40.882  39.420  -4.837  1.00 54.60  ? 266 ALA A O     1 
ATOM   2325  C CB    . ALA A 1 266 ? 38.458  41.272  -5.412  1.00 49.04  ? 266 ALA A CB    1 
ATOM   2326  H H     . ALA A 1 266 ? 39.585  41.574  -3.175  1.00 0.00   ? 266 ALA A H     1 
ATOM   2327  N N     . ASN A 1 267 ? 39.224  37.955  -5.194  1.00 57.85  ? 267 ASN A N     1 
ATOM   2328  C CA    . ASN A 1 267 ? 40.092  36.892  -5.675  1.00 63.38  ? 267 ASN A CA    1 
ATOM   2329  C C     . ASN A 1 267 ? 39.437  36.472  -6.980  1.00 66.30  ? 267 ASN A C     1 
ATOM   2330  O O     . ASN A 1 267 ? 38.225  36.664  -7.121  1.00 69.27  ? 267 ASN A O     1 
ATOM   2331  C CB    . ASN A 1 267 ? 40.141  35.710  -4.674  1.00 64.68  ? 267 ASN A CB    1 
ATOM   2332  C CG    . ASN A 1 267 ? 38.967  34.729  -4.656  1.00 66.54  ? 267 ASN A CG    1 
ATOM   2333  O OD1   . ASN A 1 267 ? 38.834  33.885  -5.540  1.00 64.99  ? 267 ASN A OD1   1 
ATOM   2334  N ND2   . ASN A 1 267 ? 38.074  34.776  -3.681  1.00 67.06  ? 267 ASN A ND2   1 
ATOM   2335  H H     . ASN A 1 267 ? 38.257  37.799  -5.233  1.00 0.00   ? 267 ASN A H     1 
ATOM   2336  H HD21  . ASN A 1 267 ? 37.344  34.113  -3.656  1.00 0.00   ? 267 ASN A HD21  1 
ATOM   2337  H HD22  . ASN A 1 267 ? 38.180  35.469  -3.001  1.00 0.00   ? 267 ASN A HD22  1 
ATOM   2338  N N     . LYS A 1 268 ? 40.150  35.883  -7.937  1.00 70.35  ? 268 LYS A N     1 
ATOM   2339  C CA    . LYS A 1 268 ? 39.577  35.543  -9.238  1.00 75.38  ? 268 LYS A CA    1 
ATOM   2340  C C     . LYS A 1 268 ? 38.231  34.842  -9.279  1.00 76.19  ? 268 LYS A C     1 
ATOM   2341  O O     . LYS A 1 268 ? 37.479  35.063  -10.225 1.00 77.01  ? 268 LYS A O     1 
ATOM   2342  C CB    . LYS A 1 268 ? 40.512  34.659  -10.059 1.00 81.01  ? 268 LYS A CB    1 
ATOM   2343  C CG    . LYS A 1 268 ? 41.110  35.396  -11.262 1.00 87.74  ? 268 LYS A CG    1 
ATOM   2344  C CD    . LYS A 1 268 ? 41.377  34.490  -12.478 1.00 89.71  ? 268 LYS A CD    1 
ATOM   2345  C CE    . LYS A 1 268 ? 40.090  34.117  -13.223 1.00 88.94  ? 268 LYS A CE    1 
ATOM   2346  N NZ    . LYS A 1 268 ? 40.388  33.449  -14.476 1.00 87.46  ? 268 LYS A NZ    1 
ATOM   2347  H H     . LYS A 1 268 ? 41.090  35.661  -7.753  1.00 0.00   ? 268 LYS A H     1 
ATOM   2348  H HZ1   . LYS A 1 268 ? 40.936  32.586  -14.288 1.00 0.00   ? 268 LYS A HZ1   1 
ATOM   2349  H HZ2   . LYS A 1 268 ? 39.499  33.197  -14.953 1.00 0.00   ? 268 LYS A HZ2   1 
ATOM   2350  H HZ3   . LYS A 1 268 ? 40.940  34.087  -15.084 1.00 0.00   ? 268 LYS A HZ3   1 
ATOM   2351  N N     . LYS A 1 269 ? 37.904  34.010  -8.291  1.00 77.10  ? 269 LYS A N     1 
ATOM   2352  C CA    . LYS A 1 269 ? 36.643  33.291  -8.279  1.00 77.44  ? 269 LYS A CA    1 
ATOM   2353  C C     . LYS A 1 269 ? 35.495  34.279  -8.156  1.00 75.94  ? 269 LYS A C     1 
ATOM   2354  O O     . LYS A 1 269 ? 34.500  34.195  -8.882  1.00 76.86  ? 269 LYS A O     1 
ATOM   2355  C CB    . LYS A 1 269 ? 36.624  32.324  -7.102  1.00 79.94  ? 269 LYS A CB    1 
ATOM   2356  C CG    . LYS A 1 269 ? 35.390  31.442  -6.979  1.00 83.88  ? 269 LYS A CG    1 
ATOM   2357  C CD    . LYS A 1 269 ? 35.443  30.696  -5.649  1.00 86.28  ? 269 LYS A CD    1 
ATOM   2358  C CE    . LYS A 1 269 ? 34.266  29.738  -5.483  1.00 87.32  ? 269 LYS A CE    1 
ATOM   2359  N NZ    . LYS A 1 269 ? 34.305  29.114  -4.174  1.00 86.24  ? 269 LYS A NZ    1 
ATOM   2360  H H     . LYS A 1 269 ? 38.486  33.941  -7.507  1.00 0.00   ? 269 LYS A H     1 
ATOM   2361  H HZ1   . LYS A 1 269 ? 35.200  28.595  -4.066  1.00 0.00   ? 269 LYS A HZ1   1 
ATOM   2362  H HZ2   . LYS A 1 269 ? 34.241  29.848  -3.440  1.00 0.00   ? 269 LYS A HZ2   1 
ATOM   2363  H HZ3   . LYS A 1 269 ? 33.508  28.455  -4.072  1.00 0.00   ? 269 LYS A HZ3   1 
ATOM   2364  N N     . SER A 1 270 ? 35.632  35.257  -7.267  1.00 72.39  ? 270 SER A N     1 
ATOM   2365  C CA    . SER A 1 270 ? 34.549  36.182  -7.031  1.00 67.98  ? 270 SER A CA    1 
ATOM   2366  C C     . SER A 1 270 ? 35.094  37.600  -7.196  1.00 64.12  ? 270 SER A C     1 
ATOM   2367  O O     . SER A 1 270 ? 35.604  38.188  -6.237  1.00 63.54  ? 270 SER A O     1 
ATOM   2368  C CB    . SER A 1 270 ? 34.024  35.892  -5.624  1.00 68.79  ? 270 SER A CB    1 
ATOM   2369  O OG    . SER A 1 270 ? 33.979  34.493  -5.335  1.00 68.61  ? 270 SER A OG    1 
ATOM   2370  H H     . SER A 1 270 ? 36.481  35.380  -6.796  1.00 0.00   ? 270 SER A H     1 
ATOM   2371  H HG    . SER A 1 270 ? 33.219  34.058  -5.770  1.00 0.00   ? 270 SER A HG    1 
ATOM   2372  N N     . PRO A 1 271 ? 35.025  38.218  -8.386  1.00 61.61  ? 271 PRO A N     1 
ATOM   2373  C CA    . PRO A 1 271 ? 35.625  39.529  -8.699  1.00 59.62  ? 271 PRO A CA    1 
ATOM   2374  C C     . PRO A 1 271 ? 35.239  40.760  -7.872  1.00 58.15  ? 271 PRO A C     1 
ATOM   2375  O O     . PRO A 1 271 ? 35.878  41.814  -7.928  1.00 56.07  ? 271 PRO A O     1 
ATOM   2376  C CB    . PRO A 1 271 ? 35.320  39.716  -10.175 1.00 58.51  ? 271 PRO A CB    1 
ATOM   2377  C CG    . PRO A 1 271 ? 34.096  38.867  -10.394 1.00 59.82  ? 271 PRO A CG    1 
ATOM   2378  C CD    . PRO A 1 271 ? 34.412  37.636  -9.573  1.00 59.24  ? 271 PRO A CD    1 
ATOM   2379  N N     . ASN A 1 272 ? 34.169  40.635  -7.085  1.00 57.21  ? 272 ASN A N     1 
ATOM   2380  C CA    . ASN A 1 272 ? 33.654  41.714  -6.250  1.00 51.93  ? 272 ASN A CA    1 
ATOM   2381  C C     . ASN A 1 272 ? 33.784  41.300  -4.803  1.00 48.21  ? 272 ASN A C     1 
ATOM   2382  O O     . ASN A 1 272 ? 33.191  41.903  -3.915  1.00 48.80  ? 272 ASN A O     1 
ATOM   2383  C CB    . ASN A 1 272 ? 32.187  41.974  -6.510  1.00 51.18  ? 272 ASN A CB    1 
ATOM   2384  C CG    . ASN A 1 272 ? 31.895  41.977  -7.985  1.00 53.90  ? 272 ASN A CG    1 
ATOM   2385  O OD1   . ASN A 1 272 ? 31.891  40.926  -8.627  1.00 56.70  ? 272 ASN A OD1   1 
ATOM   2386  N ND2   . ASN A 1 272 ? 31.695  43.125  -8.602  1.00 58.39  ? 272 ASN A ND2   1 
ATOM   2387  H H     . ASN A 1 272 ? 33.682  39.787  -7.084  1.00 0.00   ? 272 ASN A H     1 
ATOM   2388  H HD21  . ASN A 1 272 ? 31.524  43.076  -9.565  1.00 0.00   ? 272 ASN A HD21  1 
ATOM   2389  H HD22  . ASN A 1 272 ? 31.735  43.951  -8.081  1.00 0.00   ? 272 ASN A HD22  1 
ATOM   2390  N N     . GLY A 1 273 ? 34.593  40.293  -4.512  1.00 45.87  ? 273 GLY A N     1 
ATOM   2391  C CA    . GLY A 1 273 ? 34.714  39.783  -3.164  1.00 41.61  ? 273 GLY A CA    1 
ATOM   2392  C C     . GLY A 1 273 ? 33.586  38.802  -2.971  1.00 37.70  ? 273 GLY A C     1 
ATOM   2393  O O     . GLY A 1 273 ? 32.957  38.353  -3.944  1.00 39.42  ? 273 GLY A O     1 
ATOM   2394  H H     . GLY A 1 273 ? 35.036  39.802  -5.231  1.00 0.00   ? 273 GLY A H     1 
ATOM   2395  N N     . LYS A 1 274 ? 33.333  38.450  -1.733  1.00 34.08  ? 274 LYS A N     1 
ATOM   2396  C CA    . LYS A 1 274 ? 32.274  37.523  -1.430  1.00 31.58  ? 274 LYS A CA    1 
ATOM   2397  C C     . LYS A 1 274 ? 31.349  38.159  -0.405  1.00 26.35  ? 274 LYS A C     1 
ATOM   2398  O O     . LYS A 1 274 ? 30.145  37.929  -0.393  1.00 25.44  ? 274 LYS A O     1 
ATOM   2399  C CB    . LYS A 1 274 ? 32.919  36.247  -0.910  1.00 37.00  ? 274 LYS A CB    1 
ATOM   2400  C CG    . LYS A 1 274 ? 31.972  35.083  -0.698  1.00 43.92  ? 274 LYS A CG    1 
ATOM   2401  C CD    . LYS A 1 274 ? 32.694  34.126  0.224   1.00 51.69  ? 274 LYS A CD    1 
ATOM   2402  C CE    . LYS A 1 274 ? 31.740  33.061  0.729   1.00 56.25  ? 274 LYS A CE    1 
ATOM   2403  N NZ    . LYS A 1 274 ? 32.135  32.650  2.065   1.00 58.44  ? 274 LYS A NZ    1 
ATOM   2404  H H     . LYS A 1 274 ? 33.854  38.868  -1.016  1.00 0.00   ? 274 LYS A H     1 
ATOM   2405  H HZ1   . LYS A 1 274 ? 33.120  32.314  2.050   1.00 0.00   ? 274 LYS A HZ1   1 
ATOM   2406  H HZ2   . LYS A 1 274 ? 32.053  33.463  2.709   1.00 0.00   ? 274 LYS A HZ2   1 
ATOM   2407  H HZ3   . LYS A 1 274 ? 31.509  31.886  2.389   1.00 0.00   ? 274 LYS A HZ3   1 
ATOM   2408  N N     . LEU A 1 275 ? 31.899  39.004  0.453   1.00 23.97  ? 275 LEU A N     1 
ATOM   2409  C CA    . LEU A 1 275 ? 31.180  39.593  1.554   1.00 22.29  ? 275 LEU A CA    1 
ATOM   2410  C C     . LEU A 1 275 ? 30.204  40.645  1.071   1.00 22.34  ? 275 LEU A C     1 
ATOM   2411  O O     . LEU A 1 275 ? 30.552  41.511  0.276   1.00 24.48  ? 275 LEU A O     1 
ATOM   2412  C CB    . LEU A 1 275 ? 32.159  40.230  2.536   1.00 17.80  ? 275 LEU A CB    1 
ATOM   2413  C CG    . LEU A 1 275 ? 33.148  39.368  3.310   1.00 17.20  ? 275 LEU A CG    1 
ATOM   2414  C CD1   . LEU A 1 275 ? 33.792  40.243  4.364   1.00 19.55  ? 275 LEU A CD1   1 
ATOM   2415  C CD2   . LEU A 1 275 ? 32.472  38.223  4.033   1.00 2.00   ? 275 LEU A CD2   1 
ATOM   2416  H H     . LEU A 1 275 ? 32.807  39.315  0.280   1.00 0.00   ? 275 LEU A H     1 
ATOM   2417  N N     . ARG A 1 276 ? 28.960  40.568  1.522   1.00 21.77  ? 276 ARG A N     1 
ATOM   2418  C CA    . ARG A 1 276 ? 27.950  41.534  1.172   1.00 20.84  ? 276 ARG A CA    1 
ATOM   2419  C C     . ARG A 1 276 ? 28.160  42.867  1.835   1.00 19.74  ? 276 ARG A C     1 
ATOM   2420  O O     . ARG A 1 276 ? 28.385  43.018  3.042   1.00 18.80  ? 276 ARG A O     1 
ATOM   2421  C CB    . ARG A 1 276 ? 26.598  41.058  1.566   1.00 27.70  ? 276 ARG A CB    1 
ATOM   2422  C CG    . ARG A 1 276 ? 25.955  40.289  0.452   1.00 38.73  ? 276 ARG A CG    1 
ATOM   2423  C CD    . ARG A 1 276 ? 26.303  38.911  -0.052  1.00 46.87  ? 276 ARG A CD    1 
ATOM   2424  N NE    . ARG A 1 276 ? 27.142  38.086  0.810   1.00 58.79  ? 276 ARG A NE    1 
ATOM   2425  C CZ    . ARG A 1 276 ? 26.718  37.445  1.905   1.00 63.65  ? 276 ARG A CZ    1 
ATOM   2426  N NH1   . ARG A 1 276 ? 25.773  37.974  2.666   1.00 65.33  ? 276 ARG A NH1   1 
ATOM   2427  N NH2   . ARG A 1 276 ? 27.480  36.516  2.476   1.00 68.97  ? 276 ARG A NH2   1 
ATOM   2428  H H     . ARG A 1 276 ? 28.726  39.787  2.052   1.00 0.00   ? 276 ARG A H     1 
ATOM   2429  H HE    . ARG A 1 276 ? 28.091  38.068  0.564   1.00 0.00   ? 276 ARG A HE    1 
ATOM   2430  H HH11  . ARG A 1 276 ? 25.646  38.959  2.571   1.00 0.00   ? 276 ARG A HH11  1 
ATOM   2431  H HH12  . ARG A 1 276 ? 25.436  37.509  3.493   1.00 0.00   ? 276 ARG A HH12  1 
ATOM   2432  H HH21  . ARG A 1 276 ? 28.275  36.212  1.978   1.00 0.00   ? 276 ARG A HH21  1 
ATOM   2433  H HH22  . ARG A 1 276 ? 27.062  35.914  3.141   1.00 0.00   ? 276 ARG A HH22  1 
ATOM   2434  N N     . LEU A 1 277 ? 27.937  43.829  0.973   1.00 13.93  ? 277 LEU A N     1 
ATOM   2435  C CA    . LEU A 1 277 ? 28.095  45.229  1.283   1.00 16.88  ? 277 LEU A CA    1 
ATOM   2436  C C     . LEU A 1 277 ? 27.211  45.800  2.373   1.00 19.65  ? 277 LEU A C     1 
ATOM   2437  O O     . LEU A 1 277 ? 27.732  46.080  3.448   1.00 23.02  ? 277 LEU A O     1 
ATOM   2438  C CB    . LEU A 1 277 ? 27.876  46.061  0.033   1.00 9.14   ? 277 LEU A CB    1 
ATOM   2439  C CG    . LEU A 1 277 ? 28.211  47.522  0.161   1.00 13.27  ? 277 LEU A CG    1 
ATOM   2440  C CD1   . LEU A 1 277 ? 29.733  47.693  0.360   1.00 12.69  ? 277 LEU A CD1   1 
ATOM   2441  C CD2   . LEU A 1 277 ? 27.743  48.239  -1.079  1.00 10.92  ? 277 LEU A CD2   1 
ATOM   2442  H H     . LEU A 1 277 ? 27.777  43.543  0.059   1.00 0.00   ? 277 LEU A H     1 
ATOM   2443  N N     . LEU A 1 278 ? 25.904  45.938  2.159   1.00 20.84  ? 278 LEU A N     1 
ATOM   2444  C CA    . LEU A 1 278 ? 25.028  46.624  3.080   1.00 18.66  ? 278 LEU A CA    1 
ATOM   2445  C C     . LEU A 1 278 ? 24.998  46.032  4.471   1.00 16.21  ? 278 LEU A C     1 
ATOM   2446  O O     . LEU A 1 278 ? 25.041  46.799  5.429   1.00 17.70  ? 278 LEU A O     1 
ATOM   2447  C CB    . LEU A 1 278 ? 23.599  46.644  2.544   1.00 22.76  ? 278 LEU A CB    1 
ATOM   2448  C CG    . LEU A 1 278 ? 23.192  47.454  1.327   1.00 24.69  ? 278 LEU A CG    1 
ATOM   2449  C CD1   . LEU A 1 278 ? 21.687  47.419  1.211   1.00 20.52  ? 278 LEU A CD1   1 
ATOM   2450  C CD2   . LEU A 1 278 ? 23.598  48.915  1.482   1.00 30.41  ? 278 LEU A CD2   1 
ATOM   2451  H H     . LEU A 1 278 ? 25.525  45.540  1.349   1.00 0.00   ? 278 LEU A H     1 
ATOM   2452  N N     . TYR A 1 279 ? 24.943  44.700  4.634   1.00 13.31  ? 279 TYR A N     1 
ATOM   2453  C CA    . TYR A 1 279 ? 24.889  44.104  5.978   1.00 9.98   ? 279 TYR A CA    1 
ATOM   2454  C C     . TYR A 1 279 ? 26.112  43.401  6.550   1.00 9.57   ? 279 TYR A C     1 
ATOM   2455  O O     . TYR A 1 279 ? 26.041  42.796  7.630   1.00 8.25   ? 279 TYR A O     1 
ATOM   2456  C CB    . TYR A 1 279 ? 23.726  43.120  6.089   1.00 6.36   ? 279 TYR A CB    1 
ATOM   2457  C CG    . TYR A 1 279 ? 23.365  42.343  4.846   1.00 9.87   ? 279 TYR A CG    1 
ATOM   2458  C CD1   . TYR A 1 279 ? 22.482  42.920  3.963   1.00 12.99  ? 279 TYR A CD1   1 
ATOM   2459  C CD2   . TYR A 1 279 ? 23.894  41.087  4.632   1.00 12.79  ? 279 TYR A CD2   1 
ATOM   2460  C CE1   . TYR A 1 279 ? 22.140  42.243  2.823   1.00 17.69  ? 279 TYR A CE1   1 
ATOM   2461  C CE2   . TYR A 1 279 ? 23.558  40.407  3.496   1.00 13.27  ? 279 TYR A CE2   1 
ATOM   2462  C CZ    . TYR A 1 279 ? 22.710  41.003  2.594   1.00 19.26  ? 279 TYR A CZ    1 
ATOM   2463  O OH    . TYR A 1 279 ? 22.463  40.364  1.393   1.00 18.22  ? 279 TYR A OH    1 
ATOM   2464  H H     . TYR A 1 279 ? 24.979  44.128  3.844   1.00 0.00   ? 279 TYR A H     1 
ATOM   2465  H HH    . TYR A 1 279 ? 23.244  40.539  0.847   1.00 0.00   ? 279 TYR A HH    1 
ATOM   2466  N N     . GLU A 1 280 ? 27.239  43.405  5.836   1.00 7.02   ? 280 GLU A N     1 
ATOM   2467  C CA    . GLU A 1 280 ? 28.444  42.873  6.413   1.00 11.64  ? 280 GLU A CA    1 
ATOM   2468  C C     . GLU A 1 280 ? 29.489  43.963  6.258   1.00 14.77  ? 280 GLU A C     1 
ATOM   2469  O O     . GLU A 1 280 ? 29.948  44.531  7.252   1.00 15.84  ? 280 GLU A O     1 
ATOM   2470  C CB    . GLU A 1 280 ? 28.842  41.595  5.690   1.00 12.63  ? 280 GLU A CB    1 
ATOM   2471  C CG    . GLU A 1 280 ? 27.760  40.538  5.841   1.00 12.70  ? 280 GLU A CG    1 
ATOM   2472  C CD    . GLU A 1 280 ? 28.122  39.226  5.197   1.00 15.21  ? 280 GLU A CD    1 
ATOM   2473  O OE1   . GLU A 1 280 ? 28.485  39.219  4.030   1.00 22.26  ? 280 GLU A OE1   1 
ATOM   2474  O OE2   . GLU A 1 280 ? 28.052  38.203  5.866   1.00 20.48  ? 280 GLU A OE2   1 
ATOM   2475  H H     . GLU A 1 280 ? 27.276  43.825  4.955   1.00 0.00   ? 280 GLU A H     1 
ATOM   2476  N N     . CYS A 1 281 ? 29.808  44.404  5.044   1.00 17.23  ? 281 CYS A N     1 
ATOM   2477  C CA    . CYS A 1 281 ? 30.846  45.398  4.855   1.00 18.39  ? 281 CYS A CA    1 
ATOM   2478  C C     . CYS A 1 281 ? 30.558  46.762  5.451   1.00 21.03  ? 281 CYS A C     1 
ATOM   2479  O O     . CYS A 1 281 ? 31.307  47.181  6.338   1.00 25.09  ? 281 CYS A O     1 
ATOM   2480  C CB    . CYS A 1 281 ? 31.126  45.553  3.376   1.00 21.05  ? 281 CYS A CB    1 
ATOM   2481  S SG    . CYS A 1 281 ? 31.697  44.008  2.616   1.00 27.55  ? 281 CYS A SG    1 
ATOM   2482  H H     . CYS A 1 281 ? 29.365  44.032  4.257   1.00 0.00   ? 281 CYS A H     1 
ATOM   2483  N N     . ASN A 1 282 ? 29.505  47.497  5.094   1.00 21.08  ? 282 ASN A N     1 
ATOM   2484  C CA    . ASN A 1 282 ? 29.311  48.828  5.629   1.00 21.45  ? 282 ASN A CA    1 
ATOM   2485  C C     . ASN A 1 282 ? 29.224  48.885  7.142   1.00 21.11  ? 282 ASN A C     1 
ATOM   2486  O O     . ASN A 1 282 ? 29.958  49.713  7.698   1.00 19.17  ? 282 ASN A O     1 
ATOM   2487  C CB    . ASN A 1 282 ? 28.066  49.475  5.024   1.00 24.02  ? 282 ASN A CB    1 
ATOM   2488  C CG    . ASN A 1 282 ? 28.346  49.963  3.613   1.00 28.45  ? 282 ASN A CG    1 
ATOM   2489  O OD1   . ASN A 1 282 ? 27.687  49.579  2.656   1.00 36.78  ? 282 ASN A OD1   1 
ATOM   2490  N ND2   . ASN A 1 282 ? 29.338  50.795  3.354   1.00 28.13  ? 282 ASN A ND2   1 
ATOM   2491  H H     . ASN A 1 282 ? 28.834  47.126  4.491   1.00 0.00   ? 282 ASN A H     1 
ATOM   2492  H HD21  . ASN A 1 282 ? 29.472  51.003  2.404   1.00 0.00   ? 282 ASN A HD21  1 
ATOM   2493  H HD22  . ASN A 1 282 ? 29.890  51.131  4.085   1.00 0.00   ? 282 ASN A HD22  1 
ATOM   2494  N N     . PRO A 1 283 ? 28.482  48.043  7.889   1.00 20.74  ? 283 PRO A N     1 
ATOM   2495  C CA    . PRO A 1 283 ? 28.500  48.036  9.346   1.00 17.20  ? 283 PRO A CA    1 
ATOM   2496  C C     . PRO A 1 283 ? 29.900  47.876  9.910   1.00 15.52  ? 283 PRO A C     1 
ATOM   2497  O O     . PRO A 1 283 ? 30.316  48.658  10.770  1.00 17.56  ? 283 PRO A O     1 
ATOM   2498  C CB    . PRO A 1 283 ? 27.582  46.922  9.689   1.00 10.62  ? 283 PRO A CB    1 
ATOM   2499  C CG    . PRO A 1 283 ? 26.565  47.012  8.591   1.00 10.51  ? 283 PRO A CG    1 
ATOM   2500  C CD    . PRO A 1 283 ? 27.479  47.097  7.415   1.00 14.18  ? 283 PRO A CD    1 
ATOM   2501  N N     . MET A 1 284 ? 30.692  46.946  9.380   1.00 16.65  ? 284 MET A N     1 
ATOM   2502  C CA    . MET A 1 284 ? 32.022  46.727  9.923   1.00 14.68  ? 284 MET A CA    1 
ATOM   2503  C C     . MET A 1 284 ? 32.942  47.870  9.572   1.00 16.43  ? 284 MET A C     1 
ATOM   2504  O O     . MET A 1 284 ? 33.689  48.328  10.430  1.00 19.40  ? 284 MET A O     1 
ATOM   2505  C CB    . MET A 1 284 ? 32.549  45.430  9.393   1.00 14.50  ? 284 MET A CB    1 
ATOM   2506  C CG    . MET A 1 284 ? 31.592  44.359  9.896   1.00 9.07   ? 284 MET A CG    1 
ATOM   2507  S SD    . MET A 1 284 ? 31.584  44.273  11.698  1.00 16.34  ? 284 MET A SD    1 
ATOM   2508  C CE    . MET A 1 284 ? 31.409  42.524  11.848  1.00 7.68   ? 284 MET A CE    1 
ATOM   2509  H H     . MET A 1 284 ? 30.389  46.415  8.612   1.00 0.00   ? 284 MET A H     1 
ATOM   2510  N N     . ALA A 1 285 ? 32.845  48.412  8.362   1.00 16.50  ? 285 ALA A N     1 
ATOM   2511  C CA    . ALA A 1 285 ? 33.620  49.560  7.922   1.00 16.83  ? 285 ALA A CA    1 
ATOM   2512  C C     . ALA A 1 285 ? 33.345  50.797  8.779   1.00 16.64  ? 285 ALA A C     1 
ATOM   2513  O O     . ALA A 1 285 ? 34.252  51.570  9.103   1.00 16.47  ? 285 ALA A O     1 
ATOM   2514  C CB    . ALA A 1 285 ? 33.271  49.879  6.480   1.00 13.00  ? 285 ALA A CB    1 
ATOM   2515  H H     . ALA A 1 285 ? 32.197  48.018  7.749   1.00 0.00   ? 285 ALA A H     1 
ATOM   2516  N N     . TYR A 1 286 ? 32.097  50.995  9.189   1.00 16.52  ? 286 TYR A N     1 
ATOM   2517  C CA    . TYR A 1 286 ? 31.687  52.101  10.042  1.00 14.78  ? 286 TYR A CA    1 
ATOM   2518  C C     . TYR A 1 286 ? 32.223  51.910  11.465  1.00 14.51  ? 286 TYR A C     1 
ATOM   2519  O O     . TYR A 1 286 ? 32.603  52.887  12.114  1.00 17.72  ? 286 TYR A O     1 
ATOM   2520  C CB    . TYR A 1 286 ? 30.163  52.142  10.008  1.00 15.06  ? 286 TYR A CB    1 
ATOM   2521  C CG    . TYR A 1 286 ? 29.533  53.343  10.678  1.00 13.41  ? 286 TYR A CG    1 
ATOM   2522  C CD1   . TYR A 1 286 ? 29.373  54.502  9.964   1.00 7.77   ? 286 TYR A CD1   1 
ATOM   2523  C CD2   . TYR A 1 286 ? 29.157  53.272  12.002  1.00 13.69  ? 286 TYR A CD2   1 
ATOM   2524  C CE1   . TYR A 1 286 ? 28.867  55.615  10.590  1.00 10.86  ? 286 TYR A CE1   1 
ATOM   2525  C CE2   . TYR A 1 286 ? 28.639  54.385  12.629  1.00 15.12  ? 286 TYR A CE2   1 
ATOM   2526  C CZ    . TYR A 1 286 ? 28.506  55.555  11.919  1.00 10.34  ? 286 TYR A CZ    1 
ATOM   2527  O OH    . TYR A 1 286 ? 27.996  56.683  12.548  1.00 15.08  ? 286 TYR A OH    1 
ATOM   2528  H H     . TYR A 1 286 ? 31.411  50.360  8.894   1.00 0.00   ? 286 TYR A H     1 
ATOM   2529  H HH    . TYR A 1 286 ? 27.468  57.168  11.892  1.00 0.00   ? 286 TYR A HH    1 
ATOM   2530  N N     . VAL A 1 287 ? 32.235  50.687  12.008  1.00 11.88  ? 287 VAL A N     1 
ATOM   2531  C CA    . VAL A 1 287 ? 32.815  50.425  13.319  1.00 13.54  ? 287 VAL A CA    1 
ATOM   2532  C C     . VAL A 1 287 ? 34.294  50.826  13.312  1.00 17.46  ? 287 VAL A C     1 
ATOM   2533  O O     . VAL A 1 287 ? 34.749  51.640  14.123  1.00 16.64  ? 287 VAL A O     1 
ATOM   2534  C CB    . VAL A 1 287 ? 32.616  48.913  13.626  1.00 11.31  ? 287 VAL A CB    1 
ATOM   2535  C CG1   . VAL A 1 287 ? 33.536  48.382  14.708  1.00 8.00   ? 287 VAL A CG1   1 
ATOM   2536  C CG2   . VAL A 1 287 ? 31.214  48.742  14.172  1.00 8.77   ? 287 VAL A CG2   1 
ATOM   2537  H H     . VAL A 1 287 ? 31.802  49.954  11.517  1.00 0.00   ? 287 VAL A H     1 
ATOM   2538  N N     . MET A 1 288 ? 35.022  50.247  12.342  1.00 21.40  ? 288 MET A N     1 
ATOM   2539  C CA    . MET A 1 288 ? 36.439  50.455  12.108  1.00 22.11  ? 288 MET A CA    1 
ATOM   2540  C C     . MET A 1 288 ? 36.743  51.914  11.954  1.00 24.04  ? 288 MET A C     1 
ATOM   2541  O O     . MET A 1 288 ? 37.612  52.376  12.680  1.00 27.17  ? 288 MET A O     1 
ATOM   2542  C CB    . MET A 1 288 ? 36.893  49.767  10.856  1.00 18.63  ? 288 MET A CB    1 
ATOM   2543  C CG    . MET A 1 288 ? 37.107  48.304  11.053  1.00 17.13  ? 288 MET A CG    1 
ATOM   2544  S SD    . MET A 1 288 ? 38.637  48.094  11.978  1.00 19.86  ? 288 MET A SD    1 
ATOM   2545  C CE    . MET A 1 288 ? 38.218  46.659  12.916  1.00 17.16  ? 288 MET A CE    1 
ATOM   2546  H H     . MET A 1 288 ? 34.546  49.641  11.734  1.00 0.00   ? 288 MET A H     1 
ATOM   2547  N N     . GLU A 1 289 ? 36.049  52.676  11.104  1.00 24.34  ? 289 GLU A N     1 
ATOM   2548  C CA    . GLU A 1 289 ? 36.323  54.094  10.989  1.00 25.31  ? 289 GLU A CA    1 
ATOM   2549  C C     . GLU A 1 289 ? 36.075  54.834  12.283  1.00 27.12  ? 289 GLU A C     1 
ATOM   2550  O O     . GLU A 1 289 ? 36.982  55.547  12.716  1.00 30.12  ? 289 GLU A O     1 
ATOM   2551  C CB    . GLU A 1 289 ? 35.479  54.731  9.918   1.00 27.96  ? 289 GLU A CB    1 
ATOM   2552  C CG    . GLU A 1 289 ? 35.993  54.257  8.561   1.00 36.44  ? 289 GLU A CG    1 
ATOM   2553  C CD    . GLU A 1 289 ? 36.098  55.292  7.442   1.00 39.22  ? 289 GLU A CD    1 
ATOM   2554  O OE1   . GLU A 1 289 ? 35.744  56.457  7.662   1.00 46.46  ? 289 GLU A OE1   1 
ATOM   2555  O OE2   . GLU A 1 289 ? 36.548  54.920  6.350   1.00 34.57  ? 289 GLU A OE2   1 
ATOM   2556  H H     . GLU A 1 289 ? 35.335  52.275  10.565  1.00 0.00   ? 289 GLU A H     1 
ATOM   2557  N N     . LYS A 1 290 ? 34.948  54.661  12.986  1.00 24.79  ? 290 LYS A N     1 
ATOM   2558  C CA    . LYS A 1 290 ? 34.732  55.392  14.233  1.00 22.80  ? 290 LYS A CA    1 
ATOM   2559  C C     . LYS A 1 290 ? 35.709  55.005  15.333  1.00 19.83  ? 290 LYS A C     1 
ATOM   2560  O O     . LYS A 1 290 ? 35.887  55.756  16.281  1.00 22.59  ? 290 LYS A O     1 
ATOM   2561  C CB    . LYS A 1 290 ? 33.314  55.170  14.739  1.00 24.28  ? 290 LYS A CB    1 
ATOM   2562  C CG    . LYS A 1 290 ? 32.231  55.789  13.876  1.00 25.52  ? 290 LYS A CG    1 
ATOM   2563  C CD    . LYS A 1 290 ? 32.306  57.302  13.928  1.00 30.72  ? 290 LYS A CD    1 
ATOM   2564  C CE    . LYS A 1 290 ? 31.274  57.915  12.994  1.00 33.51  ? 290 LYS A CE    1 
ATOM   2565  N NZ    . LYS A 1 290 ? 31.343  59.363  13.057  1.00 41.67  ? 290 LYS A NZ    1 
ATOM   2566  H H     . LYS A 1 290 ? 34.276  54.008  12.691  1.00 0.00   ? 290 LYS A H     1 
ATOM   2567  H HZ1   . LYS A 1 290 ? 32.299  59.672  12.786  1.00 0.00   ? 290 LYS A HZ1   1 
ATOM   2568  H HZ2   . LYS A 1 290 ? 30.647  59.771  12.401  1.00 0.00   ? 290 LYS A HZ2   1 
ATOM   2569  H HZ3   . LYS A 1 290 ? 31.137  59.681  14.026  1.00 0.00   ? 290 LYS A HZ3   1 
ATOM   2570  N N     . ALA A 1 291 ? 36.334  53.837  15.276  1.00 18.73  ? 291 ALA A N     1 
ATOM   2571  C CA    . ALA A 1 291 ? 37.365  53.493  16.229  1.00 17.54  ? 291 ALA A CA    1 
ATOM   2572  C C     . ALA A 1 291 ? 38.757  53.972  15.772  1.00 19.00  ? 291 ALA A C     1 
ATOM   2573  O O     . ALA A 1 291 ? 39.772  53.567  16.341  1.00 19.05  ? 291 ALA A O     1 
ATOM   2574  C CB    . ALA A 1 291 ? 37.369  51.990  16.398  1.00 5.92   ? 291 ALA A CB    1 
ATOM   2575  H H     . ALA A 1 291 ? 36.051  53.165  14.621  1.00 0.00   ? 291 ALA A H     1 
ATOM   2576  N N     . GLY A 1 292 ? 38.919  54.825  14.755  1.00 21.20  ? 292 GLY A N     1 
ATOM   2577  C CA    . GLY A 1 292 ? 40.237  55.247  14.253  1.00 20.58  ? 292 GLY A CA    1 
ATOM   2578  C C     . GLY A 1 292 ? 40.851  54.328  13.175  1.00 20.23  ? 292 GLY A C     1 
ATOM   2579  O O     . GLY A 1 292 ? 42.018  54.459  12.805  1.00 25.01  ? 292 GLY A O     1 
ATOM   2580  H H     . GLY A 1 292 ? 38.122  55.175  14.308  1.00 0.00   ? 292 GLY A H     1 
ATOM   2581  N N     . GLY A 1 293 ? 40.112  53.376  12.631  1.00 17.47  ? 293 GLY A N     1 
ATOM   2582  C CA    . GLY A 1 293 ? 40.656  52.458  11.645  1.00 16.57  ? 293 GLY A CA    1 
ATOM   2583  C C     . GLY A 1 293 ? 40.391  52.890  10.215  1.00 18.23  ? 293 GLY A C     1 
ATOM   2584  O O     . GLY A 1 293 ? 40.138  54.048  9.900   1.00 13.06  ? 293 GLY A O     1 
ATOM   2585  H H     . GLY A 1 293 ? 39.162  53.370  12.838  1.00 0.00   ? 293 GLY A H     1 
ATOM   2586  N N     . MET A 1 294 ? 40.431  51.937  9.302   1.00 23.49  ? 294 MET A N     1 
ATOM   2587  C CA    . MET A 1 294 ? 40.146  52.179  7.901   1.00 27.58  ? 294 MET A CA    1 
ATOM   2588  C C     . MET A 1 294 ? 39.547  50.894  7.377   1.00 27.95  ? 294 MET A C     1 
ATOM   2589  O O     . MET A 1 294 ? 39.769  49.800  7.906   1.00 29.95  ? 294 MET A O     1 
ATOM   2590  C CB    . MET A 1 294 ? 41.395  52.439  7.060   1.00 28.66  ? 294 MET A CB    1 
ATOM   2591  C CG    . MET A 1 294 ? 42.136  53.718  7.345   1.00 32.19  ? 294 MET A CG    1 
ATOM   2592  S SD    . MET A 1 294 ? 43.738  53.731  6.509   1.00 35.51  ? 294 MET A SD    1 
ATOM   2593  C CE    . MET A 1 294 ? 43.178  54.587  5.069   1.00 28.75  ? 294 MET A CE    1 
ATOM   2594  H H     . MET A 1 294 ? 40.679  51.022  9.568   1.00 0.00   ? 294 MET A H     1 
ATOM   2595  N N     . ALA A 1 295 ? 38.795  51.044  6.306   1.00 29.74  ? 295 ALA A N     1 
ATOM   2596  C CA    . ALA A 1 295 ? 38.234  49.919  5.595   1.00 30.83  ? 295 ALA A CA    1 
ATOM   2597  C C     . ALA A 1 295 ? 38.253  50.388  4.153   1.00 30.94  ? 295 ALA A C     1 
ATOM   2598  O O     . ALA A 1 295 ? 37.752  51.489  3.847   1.00 29.39  ? 295 ALA A O     1 
ATOM   2599  C CB    . ALA A 1 295 ? 36.809  49.672  6.012   1.00 30.65  ? 295 ALA A CB    1 
ATOM   2600  H H     . ALA A 1 295 ? 38.633  51.938  5.940   1.00 0.00   ? 295 ALA A H     1 
ATOM   2601  N N     . THR A 1 296 ? 38.869  49.577  3.304   1.00 27.94  ? 296 THR A N     1 
ATOM   2602  C CA    . THR A 1 296 ? 39.023  49.879  1.907   1.00 27.85  ? 296 THR A CA    1 
ATOM   2603  C C     . THR A 1 296 ? 38.712  48.625  1.097   1.00 27.62  ? 296 THR A C     1 
ATOM   2604  O O     . THR A 1 296 ? 38.836  47.480  1.550   1.00 26.96  ? 296 THR A O     1 
ATOM   2605  C CB    . THR A 1 296 ? 40.479  50.389  1.653   1.00 26.22  ? 296 THR A CB    1 
ATOM   2606  O OG1   . THR A 1 296 ? 40.502  50.846  0.308   1.00 31.76  ? 296 THR A OG1   1 
ATOM   2607  C CG2   . THR A 1 296 ? 41.565  49.340  1.796   1.00 26.76  ? 296 THR A CG2   1 
ATOM   2608  H H     . THR A 1 296 ? 39.167  48.693  3.589   1.00 0.00   ? 296 THR A H     1 
ATOM   2609  H HG1   . THR A 1 296 ? 39.983  51.656  0.226   1.00 0.00   ? 296 THR A HG1   1 
ATOM   2610  N N     . THR A 1 297 ? 38.217  48.905  -0.100  1.00 26.67  ? 297 THR A N     1 
ATOM   2611  C CA    . THR A 1 297 ? 37.988  47.891  -1.101  1.00 28.47  ? 297 THR A CA    1 
ATOM   2612  C C     . THR A 1 297 ? 39.320  47.597  -1.790  1.00 28.69  ? 297 THR A C     1 
ATOM   2613  O O     . THR A 1 297 ? 39.590  46.520  -2.319  1.00 34.86  ? 297 THR A O     1 
ATOM   2614  C CB    . THR A 1 297 ? 36.924  48.420  -2.120  1.00 27.68  ? 297 THR A CB    1 
ATOM   2615  O OG1   . THR A 1 297 ? 37.298  49.737  -2.532  1.00 27.84  ? 297 THR A OG1   1 
ATOM   2616  C CG2   . THR A 1 297 ? 35.525  48.488  -1.512  1.00 26.74  ? 297 THR A CG2   1 
ATOM   2617  H H     . THR A 1 297 ? 38.023  49.832  -0.347  1.00 0.00   ? 297 THR A H     1 
ATOM   2618  H HG1   . THR A 1 297 ? 36.463  50.179  -2.740  1.00 0.00   ? 297 THR A HG1   1 
ATOM   2619  N N     . GLY A 1 298 ? 40.187  48.592  -1.774  1.00 30.78  ? 298 GLY A N     1 
ATOM   2620  C CA    . GLY A 1 298 ? 41.415  48.589  -2.519  1.00 32.51  ? 298 GLY A CA    1 
ATOM   2621  C C     . GLY A 1 298 ? 41.403  49.931  -3.213  1.00 34.94  ? 298 GLY A C     1 
ATOM   2622  O O     . GLY A 1 298 ? 42.309  50.730  -3.051  1.00 38.57  ? 298 GLY A O     1 
ATOM   2623  H H     . GLY A 1 298 ? 40.027  49.366  -1.192  1.00 0.00   ? 298 GLY A H     1 
ATOM   2624  N N     . LYS A 1 299 ? 40.334  50.221  -3.950  1.00 40.62  ? 299 LYS A N     1 
ATOM   2625  C CA    . LYS A 1 299 ? 40.171  51.486  -4.668  1.00 45.02  ? 299 LYS A CA    1 
ATOM   2626  C C     . LYS A 1 299 ? 39.674  52.628  -3.794  1.00 43.71  ? 299 LYS A C     1 
ATOM   2627  O O     . LYS A 1 299 ? 40.257  53.709  -3.740  1.00 44.97  ? 299 LYS A O     1 
ATOM   2628  C CB    . LYS A 1 299 ? 39.157  51.396  -5.804  1.00 49.89  ? 299 LYS A CB    1 
ATOM   2629  C CG    . LYS A 1 299 ? 39.295  50.280  -6.814  1.00 59.49  ? 299 LYS A CG    1 
ATOM   2630  C CD    . LYS A 1 299 ? 38.129  50.483  -7.768  1.00 70.67  ? 299 LYS A CD    1 
ATOM   2631  C CE    . LYS A 1 299 ? 38.107  49.419  -8.863  1.00 77.81  ? 299 LYS A CE    1 
ATOM   2632  N NZ    . LYS A 1 299 ? 37.160  49.768  -9.918  1.00 82.00  ? 299 LYS A NZ    1 
ATOM   2633  H H     . LYS A 1 299 ? 39.609  49.566  -3.956  1.00 0.00   ? 299 LYS A H     1 
ATOM   2634  H HZ1   . LYS A 1 299 ? 37.342  50.743  -10.227 1.00 0.00   ? 299 LYS A HZ1   1 
ATOM   2635  H HZ2   . LYS A 1 299 ? 37.294  49.125  -10.725 1.00 0.00   ? 299 LYS A HZ2   1 
ATOM   2636  H HZ3   . LYS A 1 299 ? 36.186  49.689  -9.566  1.00 0.00   ? 299 LYS A HZ3   1 
ATOM   2637  N N     . GLU A 1 300 ? 38.532  52.387  -3.143  1.00 42.44  ? 300 GLU A N     1 
ATOM   2638  C CA    . GLU A 1 300 ? 37.848  53.409  -2.372  1.00 39.92  ? 300 GLU A CA    1 
ATOM   2639  C C     . GLU A 1 300 ? 37.656  52.922  -0.948  1.00 38.20  ? 300 GLU A C     1 
ATOM   2640  O O     . GLU A 1 300 ? 37.919  51.758  -0.603  1.00 36.11  ? 300 GLU A O     1 
ATOM   2641  C CB    . GLU A 1 300 ? 36.448  53.709  -2.885  1.00 40.53  ? 300 GLU A CB    1 
ATOM   2642  C CG    . GLU A 1 300 ? 36.183  53.559  -4.357  1.00 44.23  ? 300 GLU A CG    1 
ATOM   2643  C CD    . GLU A 1 300 ? 34.974  52.676  -4.618  1.00 48.24  ? 300 GLU A CD    1 
ATOM   2644  O OE1   . GLU A 1 300 ? 34.837  51.618  -3.990  1.00 52.17  ? 300 GLU A OE1   1 
ATOM   2645  O OE2   . GLU A 1 300 ? 34.169  53.052  -5.470  1.00 52.88  ? 300 GLU A OE2   1 
ATOM   2646  H H     . GLU A 1 300 ? 38.228  51.463  -3.048  1.00 0.00   ? 300 GLU A H     1 
ATOM   2647  N N     . ALA A 1 301 ? 37.170  53.839  -0.112  1.00 34.19  ? 301 ALA A N     1 
ATOM   2648  C CA    . ALA A 1 301 ? 36.767  53.502  1.232   1.00 30.46  ? 301 ALA A CA    1 
ATOM   2649  C C     . ALA A 1 301 ? 35.458  52.753  1.042   1.00 31.41  ? 301 ALA A C     1 
ATOM   2650  O O     . ALA A 1 301 ? 34.650  53.125  0.172   1.00 32.16  ? 301 ALA A O     1 
ATOM   2651  C CB    . ALA A 1 301 ? 36.487  54.735  2.045   1.00 28.51  ? 301 ALA A CB    1 
ATOM   2652  H H     . ALA A 1 301 ? 36.999  54.744  -0.435  1.00 0.00   ? 301 ALA A H     1 
ATOM   2653  N N     . VAL A 1 302 ? 35.251  51.704  1.852   1.00 29.01  ? 302 VAL A N     1 
ATOM   2654  C CA    . VAL A 1 302 ? 34.055  50.882  1.772   1.00 23.94  ? 302 VAL A CA    1 
ATOM   2655  C C     . VAL A 1 302 ? 32.839  51.789  1.946   1.00 24.50  ? 302 VAL A C     1 
ATOM   2656  O O     . VAL A 1 302 ? 31.900  51.738  1.150   1.00 18.41  ? 302 VAL A O     1 
ATOM   2657  C CB    . VAL A 1 302 ? 34.054  49.801  2.878   1.00 20.83  ? 302 VAL A CB    1 
ATOM   2658  C CG1   . VAL A 1 302 ? 32.734  49.042  2.855   1.00 15.19  ? 302 VAL A CG1   1 
ATOM   2659  C CG2   . VAL A 1 302 ? 35.146  48.787  2.638   1.00 19.57  ? 302 VAL A CG2   1 
ATOM   2660  H H     . VAL A 1 302 ? 35.920  51.530  2.549   1.00 0.00   ? 302 VAL A H     1 
ATOM   2661  N N     . LEU A 1 303 ? 32.877  52.709  2.917   1.00 22.65  ? 303 LEU A N     1 
ATOM   2662  C CA    . LEU A 1 303 ? 31.722  53.546  3.206   1.00 23.96  ? 303 LEU A CA    1 
ATOM   2663  C C     . LEU A 1 303 ? 31.255  54.489  2.109   1.00 24.46  ? 303 LEU A C     1 
ATOM   2664  O O     . LEU A 1 303 ? 30.177  55.080  2.231   1.00 26.68  ? 303 LEU A O     1 
ATOM   2665  C CB    . LEU A 1 303 ? 31.997  54.350  4.487   1.00 24.34  ? 303 LEU A CB    1 
ATOM   2666  C CG    . LEU A 1 303 ? 32.145  53.571  5.810   1.00 24.79  ? 303 LEU A CG    1 
ATOM   2667  C CD1   . LEU A 1 303 ? 32.381  54.552  6.937   1.00 24.51  ? 303 LEU A CD1   1 
ATOM   2668  C CD2   . LEU A 1 303 ? 30.877  52.796  6.140   1.00 20.00  ? 303 LEU A CD2   1 
ATOM   2669  H H     . LEU A 1 303 ? 33.713  52.831  3.421   1.00 0.00   ? 303 LEU A H     1 
ATOM   2670  N N     . ASP A 1 304 ? 31.995  54.585  1.016   1.00 26.41  ? 304 ASP A N     1 
ATOM   2671  C CA    . ASP A 1 304 ? 31.662  55.485  -0.063  1.00 26.71  ? 304 ASP A CA    1 
ATOM   2672  C C     . ASP A 1 304 ? 31.149  54.776  -1.295  1.00 28.52  ? 304 ASP A C     1 
ATOM   2673  O O     . ASP A 1 304 ? 30.694  55.442  -2.235  1.00 30.27  ? 304 ASP A O     1 
ATOM   2674  C CB    . ASP A 1 304 ? 32.881  56.299  -0.439  1.00 27.82  ? 304 ASP A CB    1 
ATOM   2675  C CG    . ASP A 1 304 ? 33.169  57.374  0.586   1.00 28.10  ? 304 ASP A CG    1 
ATOM   2676  O OD1   . ASP A 1 304 ? 32.341  58.272  0.697   1.00 33.71  ? 304 ASP A OD1   1 
ATOM   2677  O OD2   . ASP A 1 304 ? 34.199  57.321  1.257   1.00 27.22  ? 304 ASP A OD2   1 
ATOM   2678  H H     . ASP A 1 304 ? 32.754  53.981  0.881   1.00 0.00   ? 304 ASP A H     1 
ATOM   2679  N N     . VAL A 1 305 ? 31.233  53.441  -1.347  1.00 25.68  ? 305 VAL A N     1 
ATOM   2680  C CA    . VAL A 1 305 ? 30.680  52.760  -2.493  1.00 26.82  ? 305 VAL A CA    1 
ATOM   2681  C C     . VAL A 1 305 ? 29.167  53.003  -2.455  1.00 30.47  ? 305 VAL A C     1 
ATOM   2682  O O     . VAL A 1 305 ? 28.529  52.998  -1.396  1.00 35.06  ? 305 VAL A O     1 
ATOM   2683  C CB    . VAL A 1 305 ? 31.052  51.252  -2.434  1.00 20.81  ? 305 VAL A CB    1 
ATOM   2684  C CG1   . VAL A 1 305 ? 30.608  50.620  -1.170  1.00 26.59  ? 305 VAL A CG1   1 
ATOM   2685  C CG2   . VAL A 1 305 ? 30.338  50.505  -3.538  1.00 20.04  ? 305 VAL A CG2   1 
ATOM   2686  H H     . VAL A 1 305 ? 31.546  52.934  -0.571  1.00 0.00   ? 305 VAL A H     1 
ATOM   2687  N N     . ILE A 1 306 ? 28.607  53.355  -3.608  1.00 32.16  ? 306 ILE A N     1 
ATOM   2688  C CA    . ILE A 1 306 ? 27.188  53.596  -3.709  1.00 32.81  ? 306 ILE A CA    1 
ATOM   2689  C C     . ILE A 1 306 ? 26.561  52.296  -4.216  1.00 31.41  ? 306 ILE A C     1 
ATOM   2690  O O     . ILE A 1 306 ? 27.003  51.712  -5.218  1.00 32.13  ? 306 ILE A O     1 
ATOM   2691  C CB    . ILE A 1 306 ? 26.977  54.855  -4.630  1.00 31.78  ? 306 ILE A CB    1 
ATOM   2692  C CG1   . ILE A 1 306 ? 25.487  55.026  -4.812  1.00 34.64  ? 306 ILE A CG1   1 
ATOM   2693  C CG2   . ILE A 1 306 ? 27.690  54.754  -5.965  1.00 33.12  ? 306 ILE A CG2   1 
ATOM   2694  C CD1   . ILE A 1 306 ? 25.123  56.375  -5.456  1.00 42.62  ? 306 ILE A CD1   1 
ATOM   2695  H H     . ILE A 1 306 ? 29.164  53.406  -4.408  1.00 0.00   ? 306 ILE A H     1 
ATOM   2696  N N     . PRO A 1 307 ? 25.617  51.734  -3.445  1.00 32.01  ? 307 PRO A N     1 
ATOM   2697  C CA    . PRO A 1 307 ? 25.032  50.435  -3.701  1.00 32.89  ? 307 PRO A CA    1 
ATOM   2698  C C     . PRO A 1 307 ? 24.002  50.491  -4.815  1.00 35.80  ? 307 PRO A C     1 
ATOM   2699  O O     . PRO A 1 307 ? 23.236  51.448  -4.925  1.00 34.88  ? 307 PRO A O     1 
ATOM   2700  C CB    . PRO A 1 307 ? 24.445  50.017  -2.367  1.00 30.96  ? 307 PRO A CB    1 
ATOM   2701  C CG    . PRO A 1 307 ? 24.952  51.011  -1.352  1.00 28.97  ? 307 PRO A CG    1 
ATOM   2702  C CD    . PRO A 1 307 ? 25.083  52.259  -2.193  1.00 28.64  ? 307 PRO A CD    1 
ATOM   2703  N N     . THR A 1 308 ? 23.973  49.487  -5.677  1.00 41.49  ? 308 THR A N     1 
ATOM   2704  C CA    . THR A 1 308 ? 22.960  49.379  -6.710  1.00 43.82  ? 308 THR A CA    1 
ATOM   2705  C C     . THR A 1 308 ? 22.074  48.135  -6.526  1.00 44.79  ? 308 THR A C     1 
ATOM   2706  O O     . THR A 1 308 ? 21.022  47.994  -7.161  1.00 47.36  ? 308 THR A O     1 
ATOM   2707  C CB    . THR A 1 308 ? 23.672  49.380  -8.095  1.00 45.11  ? 308 THR A CB    1 
ATOM   2708  O OG1   . THR A 1 308 ? 25.042  48.994  -7.935  1.00 46.89  ? 308 THR A OG1   1 
ATOM   2709  C CG2   . THR A 1 308 ? 23.563  50.760  -8.739  1.00 46.59  ? 308 THR A CG2   1 
ATOM   2710  H H     . THR A 1 308 ? 24.679  48.810  -5.673  1.00 0.00   ? 308 THR A H     1 
ATOM   2711  H HG1   . THR A 1 308 ? 25.523  49.740  -7.558  1.00 0.00   ? 308 THR A HG1   1 
ATOM   2712  N N     . ASP A 1 309 ? 22.429  47.220  -5.622  1.00 40.78  ? 309 ASP A N     1 
ATOM   2713  C CA    . ASP A 1 309 ? 21.666  46.007  -5.381  1.00 39.18  ? 309 ASP A CA    1 
ATOM   2714  C C     . ASP A 1 309 ? 21.729  45.872  -3.867  1.00 37.44  ? 309 ASP A C     1 
ATOM   2715  O O     . ASP A 1 309 ? 22.829  45.920  -3.309  1.00 38.04  ? 309 ASP A O     1 
ATOM   2716  C CB    . ASP A 1 309 ? 22.377  44.839  -6.098  1.00 42.34  ? 309 ASP A CB    1 
ATOM   2717  C CG    . ASP A 1 309 ? 21.759  43.437  -6.117  1.00 44.85  ? 309 ASP A CG    1 
ATOM   2718  O OD1   . ASP A 1 309 ? 21.355  42.908  -5.081  1.00 45.27  ? 309 ASP A OD1   1 
ATOM   2719  O OD2   . ASP A 1 309 ? 21.715  42.848  -7.195  1.00 47.90  ? 309 ASP A OD2   1 
ATOM   2720  H H     . ASP A 1 309 ? 23.236  47.375  -5.083  1.00 0.00   ? 309 ASP A H     1 
ATOM   2721  N N     . ILE A 1 310 ? 20.633  45.672  -3.124  1.00 33.81  ? 310 ILE A N     1 
ATOM   2722  C CA    . ILE A 1 310 ? 20.728  45.489  -1.669  1.00 28.45  ? 310 ILE A CA    1 
ATOM   2723  C C     . ILE A 1 310 ? 21.566  44.284  -1.257  1.00 27.50  ? 310 ILE A C     1 
ATOM   2724  O O     . ILE A 1 310 ? 21.890  44.117  -0.089  1.00 28.04  ? 310 ILE A O     1 
ATOM   2725  C CB    . ILE A 1 310 ? 19.343  45.310  -0.970  1.00 22.04  ? 310 ILE A CB    1 
ATOM   2726  C CG1   . ILE A 1 310 ? 18.575  44.155  -1.550  1.00 14.72  ? 310 ILE A CG1   1 
ATOM   2727  C CG2   . ILE A 1 310 ? 18.548  46.595  -1.109  1.00 22.62  ? 310 ILE A CG2   1 
ATOM   2728  C CD1   . ILE A 1 310 ? 17.403  43.758  -0.642  1.00 23.63  ? 310 ILE A CD1   1 
ATOM   2729  H H     . ILE A 1 310 ? 19.754  45.744  -3.554  1.00 0.00   ? 310 ILE A H     1 
ATOM   2730  N N     . HIS A 1 311 ? 21.940  43.376  -2.153  1.00 29.71  ? 311 HIS A N     1 
ATOM   2731  C CA    . HIS A 1 311 ? 22.724  42.193  -1.795  1.00 32.55  ? 311 HIS A CA    1 
ATOM   2732  C C     . HIS A 1 311 ? 24.097  42.114  -2.487  1.00 31.92  ? 311 HIS A C     1 
ATOM   2733  O O     . HIS A 1 311 ? 24.743  41.069  -2.603  1.00 33.65  ? 311 HIS A O     1 
ATOM   2734  C CB    . HIS A 1 311 ? 21.862  40.974  -2.109  1.00 28.54  ? 311 HIS A CB    1 
ATOM   2735  C CG    . HIS A 1 311 ? 20.647  40.796  -1.196  1.00 29.23  ? 311 HIS A CG    1 
ATOM   2736  N ND1   . HIS A 1 311 ? 20.481  41.422  -0.032  1.00 30.92  ? 311 HIS A ND1   1 
ATOM   2737  C CD2   . HIS A 1 311 ? 19.632  39.899  -1.343  1.00 26.92  ? 311 HIS A CD2   1 
ATOM   2738  C CE1   . HIS A 1 311 ? 19.424  40.913  0.548   1.00 27.07  ? 311 HIS A CE1   1 
ATOM   2739  N NE2   . HIS A 1 311 ? 18.944  40.000  -0.242  1.00 24.88  ? 311 HIS A NE2   1 
ATOM   2740  H H     . HIS A 1 311 ? 21.799  43.564  -3.099  1.00 0.00   ? 311 HIS A H     1 
ATOM   2741  H HD1   . HIS A 1 311 ? 21.084  42.052  0.417   1.00 0.00   ? 311 HIS A HD1   1 
ATOM   2742  H HE2   . HIS A 1 311 ? 18.221  39.390  0.034   1.00 0.00   ? 311 HIS A HE2   1 
ATOM   2743  N N     . GLN A 1 312 ? 24.546  43.291  -2.925  1.00 30.48  ? 312 GLN A N     1 
ATOM   2744  C CA    . GLN A 1 312 ? 25.808  43.505  -3.609  1.00 27.00  ? 312 GLN A CA    1 
ATOM   2745  C C     . GLN A 1 312 ? 26.967  43.155  -2.689  1.00 29.01  ? 312 GLN A C     1 
ATOM   2746  O O     . GLN A 1 312 ? 26.906  43.491  -1.504  1.00 26.41  ? 312 GLN A O     1 
ATOM   2747  C CB    . GLN A 1 312 ? 25.844  44.970  -4.011  1.00 25.79  ? 312 GLN A CB    1 
ATOM   2748  C CG    . GLN A 1 312 ? 27.088  45.573  -4.645  1.00 28.03  ? 312 GLN A CG    1 
ATOM   2749  C CD    . GLN A 1 312 ? 26.944  47.073  -4.779  1.00 31.00  ? 312 GLN A CD    1 
ATOM   2750  O OE1   . GLN A 1 312 ? 25.837  47.610  -4.832  1.00 35.41  ? 312 GLN A OE1   1 
ATOM   2751  N NE2   . GLN A 1 312 ? 28.016  47.834  -4.796  1.00 30.77  ? 312 GLN A NE2   1 
ATOM   2752  H H     . GLN A 1 312 ? 24.007  44.093  -2.754  1.00 0.00   ? 312 GLN A H     1 
ATOM   2753  H HE21  . GLN A 1 312 ? 27.887  48.793  -4.934  1.00 0.00   ? 312 GLN A HE21  1 
ATOM   2754  H HE22  . GLN A 1 312 ? 28.889  47.402  -4.684  1.00 0.00   ? 312 GLN A HE22  1 
ATOM   2755  N N     . ARG A 1 313 ? 28.014  42.524  -3.216  1.00 27.99  ? 313 ARG A N     1 
ATOM   2756  C CA    . ARG A 1 313 ? 29.177  42.139  -2.439  1.00 26.81  ? 313 ARG A CA    1 
ATOM   2757  C C     . ARG A 1 313 ? 30.267  43.184  -2.663  1.00 25.65  ? 313 ARG A C     1 
ATOM   2758  O O     . ARG A 1 313 ? 30.175  43.969  -3.612  1.00 24.52  ? 313 ARG A O     1 
ATOM   2759  C CB    . ARG A 1 313 ? 29.674  40.775  -2.886  1.00 26.79  ? 313 ARG A CB    1 
ATOM   2760  C CG    . ARG A 1 313 ? 28.589  39.726  -2.915  1.00 29.69  ? 313 ARG A CG    1 
ATOM   2761  C CD    . ARG A 1 313 ? 29.109  38.377  -3.337  1.00 28.91  ? 313 ARG A CD    1 
ATOM   2762  N NE    . ARG A 1 313 ? 27.992  37.547  -3.748  1.00 40.01  ? 313 ARG A NE    1 
ATOM   2763  C CZ    . ARG A 1 313 ? 27.869  36.252  -3.435  1.00 41.45  ? 313 ARG A CZ    1 
ATOM   2764  N NH1   . ARG A 1 313 ? 28.727  35.613  -2.644  1.00 44.80  ? 313 ARG A NH1   1 
ATOM   2765  N NH2   . ARG A 1 313 ? 26.829  35.581  -3.915  1.00 43.86  ? 313 ARG A NH2   1 
ATOM   2766  H H     . ARG A 1 313 ? 28.065  42.406  -4.184  1.00 0.00   ? 313 ARG A H     1 
ATOM   2767  H HE    . ARG A 1 313 ? 27.282  37.958  -4.285  1.00 0.00   ? 313 ARG A HE    1 
ATOM   2768  H HH11  . ARG A 1 313 ? 29.508  36.095  -2.249  1.00 0.00   ? 313 ARG A HH11  1 
ATOM   2769  H HH12  . ARG A 1 313 ? 28.586  34.644  -2.443  1.00 0.00   ? 313 ARG A HH12  1 
ATOM   2770  H HH21  . ARG A 1 313 ? 26.160  36.045  -4.495  1.00 0.00   ? 313 ARG A HH21  1 
ATOM   2771  H HH22  . ARG A 1 313 ? 26.716  34.612  -3.696  1.00 0.00   ? 313 ARG A HH22  1 
ATOM   2772  N N     . ALA A 1 314 ? 31.283  43.241  -1.815  1.00 22.43  ? 314 ALA A N     1 
ATOM   2773  C CA    . ALA A 1 314 ? 32.358  44.196  -1.942  1.00 23.60  ? 314 ALA A CA    1 
ATOM   2774  C C     . ALA A 1 314 ? 33.616  43.471  -1.513  1.00 22.06  ? 314 ALA A C     1 
ATOM   2775  O O     . ALA A 1 314 ? 33.541  42.513  -0.732  1.00 21.17  ? 314 ALA A O     1 
ATOM   2776  C CB    . ALA A 1 314 ? 32.150  45.396  -1.022  1.00 21.02  ? 314 ALA A CB    1 
ATOM   2777  H H     . ALA A 1 314 ? 31.377  42.559  -1.117  1.00 0.00   ? 314 ALA A H     1 
ATOM   2778  N N     . PRO A 1 315 ? 34.793  43.831  -2.032  1.00 23.02  ? 315 PRO A N     1 
ATOM   2779  C CA    . PRO A 1 315 ? 36.079  43.522  -1.427  1.00 23.01  ? 315 PRO A CA    1 
ATOM   2780  C C     . PRO A 1 315 ? 36.190  44.325  -0.153  1.00 24.13  ? 315 PRO A C     1 
ATOM   2781  O O     . PRO A 1 315 ? 35.669  45.451  -0.055  1.00 22.30  ? 315 PRO A O     1 
ATOM   2782  C CB    . PRO A 1 315 ? 37.130  43.934  -2.439  1.00 22.52  ? 315 PRO A CB    1 
ATOM   2783  C CG    . PRO A 1 315 ? 36.353  43.940  -3.730  1.00 23.16  ? 315 PRO A CG    1 
ATOM   2784  C CD    . PRO A 1 315 ? 35.000  44.505  -3.302  1.00 24.80  ? 315 PRO A CD    1 
ATOM   2785  N N     . ILE A 1 316 ? 36.880  43.749  0.817   1.00 23.04  ? 316 ILE A N     1 
ATOM   2786  C CA    . ILE A 1 316 ? 37.123  44.515  2.010   1.00 26.01  ? 316 ILE A CA    1 
ATOM   2787  C C     . ILE A 1 316 ? 38.488  44.133  2.559   1.00 25.75  ? 316 ILE A C     1 
ATOM   2788  O O     . ILE A 1 316 ? 38.893  42.967  2.578   1.00 28.98  ? 316 ILE A O     1 
ATOM   2789  C CB    . ILE A 1 316 ? 35.950  44.244  3.003   1.00 26.69  ? 316 ILE A CB    1 
ATOM   2790  C CG1   . ILE A 1 316 ? 36.038  45.299  4.076   1.00 28.20  ? 316 ILE A CG1   1 
ATOM   2791  C CG2   . ILE A 1 316 ? 35.977  42.832  3.590   1.00 28.88  ? 316 ILE A CG2   1 
ATOM   2792  C CD1   . ILE A 1 316 ? 34.830  45.285  5.006   1.00 34.42  ? 316 ILE A CD1   1 
ATOM   2793  H H     . ILE A 1 316 ? 37.250  42.843  0.742   1.00 0.00   ? 316 ILE A H     1 
ATOM   2794  N N     . ILE A 1 317 ? 39.251  45.148  2.892   1.00 23.56  ? 317 ILE A N     1 
ATOM   2795  C CA    . ILE A 1 317 ? 40.537  45.019  3.545   1.00 20.89  ? 317 ILE A CA    1 
ATOM   2796  C C     . ILE A 1 317 ? 40.278  46.046  4.620   1.00 17.18  ? 317 ILE A C     1 
ATOM   2797  O O     . ILE A 1 317 ? 39.914  47.178  4.275   1.00 18.17  ? 317 ILE A O     1 
ATOM   2798  C CB    . ILE A 1 317 ? 41.721  45.503  2.678   1.00 22.22  ? 317 ILE A CB    1 
ATOM   2799  C CG1   . ILE A 1 317 ? 41.885  44.642  1.434   1.00 24.54  ? 317 ILE A CG1   1 
ATOM   2800  C CG2   . ILE A 1 317 ? 42.977  45.476  3.522   1.00 16.39  ? 317 ILE A CG2   1 
ATOM   2801  C CD1   . ILE A 1 317 ? 41.031  45.090  0.224   1.00 27.69  ? 317 ILE A CD1   1 
ATOM   2802  H H     . ILE A 1 317 ? 38.929  46.058  2.737   1.00 0.00   ? 317 ILE A H     1 
ATOM   2803  N N     . LEU A 1 318 ? 40.359  45.703  5.890   1.00 14.84  ? 318 LEU A N     1 
ATOM   2804  C CA    . LEU A 1 318 ? 40.122  46.673  6.945   1.00 12.70  ? 318 LEU A CA    1 
ATOM   2805  C C     . LEU A 1 318 ? 41.070  46.387  8.080   1.00 12.72  ? 318 LEU A C     1 
ATOM   2806  O O     . LEU A 1 318 ? 41.604  45.272  8.182   1.00 15.28  ? 318 LEU A O     1 
ATOM   2807  C CB    . LEU A 1 318 ? 38.686  46.584  7.458   1.00 8.83   ? 318 LEU A CB    1 
ATOM   2808  C CG    . LEU A 1 318 ? 37.977  45.285  7.872   1.00 7.71   ? 318 LEU A CG    1 
ATOM   2809  C CD1   . LEU A 1 318 ? 38.425  44.724  9.220   1.00 5.40   ? 318 LEU A CD1   1 
ATOM   2810  C CD2   . LEU A 1 318 ? 36.521  45.640  8.075   1.00 5.25   ? 318 LEU A CD2   1 
ATOM   2811  H H     . LEU A 1 318 ? 40.637  44.801  6.147   1.00 0.00   ? 318 LEU A H     1 
ATOM   2812  N N     . GLY A 1 319 ? 41.296  47.364  8.934   1.00 12.76  ? 319 GLY A N     1 
ATOM   2813  C CA    . GLY A 1 319 ? 42.108  47.113  10.096  1.00 17.02  ? 319 GLY A CA    1 
ATOM   2814  C C     . GLY A 1 319 ? 42.846  48.337  10.551  1.00 19.87  ? 319 GLY A C     1 
ATOM   2815  O O     . GLY A 1 319 ? 42.414  49.466  10.272  1.00 24.52  ? 319 GLY A O     1 
ATOM   2816  H H     . GLY A 1 319 ? 40.962  48.273  8.766   1.00 0.00   ? 319 GLY A H     1 
ATOM   2817  N N     . SER A 1 320 ? 43.942  48.102  11.261  1.00 21.95  ? 320 SER A N     1 
ATOM   2818  C CA    . SER A 1 320 ? 44.801  49.129  11.797  1.00 25.03  ? 320 SER A CA    1 
ATOM   2819  C C     . SER A 1 320 ? 45.309  50.009  10.678  1.00 27.50  ? 320 SER A C     1 
ATOM   2820  O O     . SER A 1 320 ? 45.764  49.481  9.649   1.00 30.24  ? 320 SER A O     1 
ATOM   2821  C CB    . SER A 1 320 ? 45.943  48.453  12.510  1.00 21.25  ? 320 SER A CB    1 
ATOM   2822  O OG    . SER A 1 320 ? 45.467  47.705  13.618  1.00 24.02  ? 320 SER A OG    1 
ATOM   2823  H H     . SER A 1 320 ? 44.209  47.178  11.418  1.00 0.00   ? 320 SER A H     1 
ATOM   2824  H HG    . SER A 1 320 ? 45.140  48.379  14.239  1.00 0.00   ? 320 SER A HG    1 
ATOM   2825  N N     . PRO A 1 321 ? 45.253  51.337  10.841  1.00 29.70  ? 321 PRO A N     1 
ATOM   2826  C CA    . PRO A 1 321 ? 45.544  52.297  9.784   1.00 32.09  ? 321 PRO A CA    1 
ATOM   2827  C C     . PRO A 1 321 ? 46.863  52.053  9.053   1.00 35.45  ? 321 PRO A C     1 
ATOM   2828  O O     . PRO A 1 321 ? 46.849  51.886  7.829   1.00 39.54  ? 321 PRO A O     1 
ATOM   2829  C CB    . PRO A 1 321 ? 45.462  53.641  10.491  1.00 29.19  ? 321 PRO A CB    1 
ATOM   2830  C CG    . PRO A 1 321 ? 45.627  53.308  11.953  1.00 30.12  ? 321 PRO A CG    1 
ATOM   2831  C CD    . PRO A 1 321 ? 44.864  52.011  12.077  1.00 28.55  ? 321 PRO A CD    1 
ATOM   2832  N N     . ASP A 1 322 ? 47.993  51.914  9.759   1.00 34.92  ? 322 ASP A N     1 
ATOM   2833  C CA    . ASP A 1 322 ? 49.290  51.712  9.126   1.00 34.64  ? 322 ASP A CA    1 
ATOM   2834  C C     . ASP A 1 322 ? 49.326  50.474  8.264   1.00 33.94  ? 322 ASP A C     1 
ATOM   2835  O O     . ASP A 1 322 ? 49.854  50.479  7.145   1.00 38.92  ? 322 ASP A O     1 
ATOM   2836  C CB    . ASP A 1 322 ? 50.412  51.569  10.154  1.00 38.03  ? 322 ASP A CB    1 
ATOM   2837  C CG    . ASP A 1 322 ? 50.841  52.822  10.912  1.00 40.94  ? 322 ASP A CG    1 
ATOM   2838  O OD1   . ASP A 1 322 ? 50.289  53.903  10.691  1.00 44.06  ? 322 ASP A OD1   1 
ATOM   2839  O OD2   . ASP A 1 322 ? 51.749  52.705  11.738  1.00 44.42  ? 322 ASP A OD2   1 
ATOM   2840  H H     . ASP A 1 322 ? 47.945  51.935  10.739  1.00 0.00   ? 322 ASP A H     1 
ATOM   2841  N N     . ASP A 1 323 ? 48.700  49.419  8.762   1.00 29.29  ? 323 ASP A N     1 
ATOM   2842  C CA    . ASP A 1 323 ? 48.678  48.193  8.013   1.00 26.29  ? 323 ASP A CA    1 
ATOM   2843  C C     . ASP A 1 323 ? 47.848  48.315  6.762   1.00 25.37  ? 323 ASP A C     1 
ATOM   2844  O O     . ASP A 1 323 ? 48.252  47.797  5.719   1.00 28.27  ? 323 ASP A O     1 
ATOM   2845  C CB    . ASP A 1 323 ? 48.134  47.099  8.867   1.00 29.39  ? 323 ASP A CB    1 
ATOM   2846  C CG    . ASP A 1 323 ? 49.248  46.500  9.692   1.00 30.03  ? 323 ASP A CG    1 
ATOM   2847  O OD1   . ASP A 1 323 ? 50.164  45.924  9.090   1.00 37.65  ? 323 ASP A OD1   1 
ATOM   2848  O OD2   . ASP A 1 323 ? 49.190  46.620  10.916  1.00 29.05  ? 323 ASP A OD2   1 
ATOM   2849  H H     . ASP A 1 323 ? 48.171  49.502  9.579   1.00 0.00   ? 323 ASP A H     1 
ATOM   2850  N N     . VAL A 1 324 ? 46.733  49.040  6.809   1.00 21.09  ? 324 VAL A N     1 
ATOM   2851  C CA    . VAL A 1 324 ? 45.921  49.191  5.613   1.00 21.56  ? 324 VAL A CA    1 
ATOM   2852  C C     . VAL A 1 324 ? 46.697  50.060  4.649   1.00 23.72  ? 324 VAL A C     1 
ATOM   2853  O O     . VAL A 1 324 ? 46.698  49.738  3.462   1.00 23.87  ? 324 VAL A O     1 
ATOM   2854  C CB    . VAL A 1 324 ? 44.551  49.843  5.906   1.00 21.77  ? 324 VAL A CB    1 
ATOM   2855  C CG1   . VAL A 1 324 ? 43.716  49.919  4.644   1.00 19.87  ? 324 VAL A CG1   1 
ATOM   2856  C CG2   . VAL A 1 324 ? 43.767  48.984  6.882   1.00 18.91  ? 324 VAL A CG2   1 
ATOM   2857  H H     . VAL A 1 324 ? 46.465  49.475  7.647   1.00 0.00   ? 324 VAL A H     1 
ATOM   2858  N N     . LEU A 1 325 ? 47.400  51.112  5.094   1.00 27.11  ? 325 LEU A N     1 
ATOM   2859  C CA    . LEU A 1 325 ? 48.221  51.920  4.199   1.00 26.41  ? 325 LEU A CA    1 
ATOM   2860  C C     . LEU A 1 325 ? 49.281  51.091  3.497   1.00 28.24  ? 325 LEU A C     1 
ATOM   2861  O O     . LEU A 1 325 ? 49.392  51.165  2.270   1.00 29.80  ? 325 LEU A O     1 
ATOM   2862  C CB    . LEU A 1 325 ? 48.934  53.045  4.934   1.00 24.08  ? 325 LEU A CB    1 
ATOM   2863  C CG    . LEU A 1 325 ? 48.286  54.431  5.043   1.00 21.63  ? 325 LEU A CG    1 
ATOM   2864  C CD1   . LEU A 1 325 ? 47.106  54.555  4.105   1.00 20.75  ? 325 LEU A CD1   1 
ATOM   2865  C CD2   . LEU A 1 325 ? 47.840  54.656  6.465   1.00 20.25  ? 325 LEU A CD2   1 
ATOM   2866  H H     . LEU A 1 325 ? 47.336  51.354  6.040   1.00 0.00   ? 325 LEU A H     1 
ATOM   2867  N N     . GLU A 1 326 ? 50.015  50.259  4.237   1.00 25.45  ? 326 GLU A N     1 
ATOM   2868  C CA    . GLU A 1 326 ? 51.020  49.371  3.675   1.00 25.17  ? 326 GLU A CA    1 
ATOM   2869  C C     . GLU A 1 326 ? 50.402  48.480  2.603   1.00 26.72  ? 326 GLU A C     1 
ATOM   2870  O O     . GLU A 1 326 ? 50.952  48.365  1.511   1.00 28.55  ? 326 GLU A O     1 
ATOM   2871  C CB    . GLU A 1 326 ? 51.576  48.552  4.796   1.00 25.12  ? 326 GLU A CB    1 
ATOM   2872  C CG    . GLU A 1 326 ? 52.727  47.650  4.430   1.00 31.57  ? 326 GLU A CG    1 
ATOM   2873  C CD    . GLU A 1 326 ? 53.223  46.734  5.549   1.00 38.72  ? 326 GLU A CD    1 
ATOM   2874  O OE1   . GLU A 1 326 ? 52.750  46.791  6.692   1.00 45.06  ? 326 GLU A OE1   1 
ATOM   2875  O OE2   . GLU A 1 326 ? 54.109  45.935  5.254   1.00 44.80  ? 326 GLU A OE2   1 
ATOM   2876  H H     . GLU A 1 326 ? 49.862  50.244  5.205   1.00 0.00   ? 326 GLU A H     1 
ATOM   2877  N N     . PHE A 1 327 ? 49.250  47.856  2.847   1.00 27.71  ? 327 PHE A N     1 
ATOM   2878  C CA    . PHE A 1 327 ? 48.581  47.070  1.830   1.00 29.29  ? 327 PHE A CA    1 
ATOM   2879  C C     . PHE A 1 327 ? 48.279  47.968  0.638   1.00 33.21  ? 327 PHE A C     1 
ATOM   2880  O O     . PHE A 1 327 ? 48.569  47.617  -0.507  1.00 34.84  ? 327 PHE A O     1 
ATOM   2881  C CB    . PHE A 1 327 ? 47.265  46.486  2.380   1.00 24.80  ? 327 PHE A CB    1 
ATOM   2882  C CG    . PHE A 1 327 ? 46.457  45.764  1.310   1.00 20.83  ? 327 PHE A CG    1 
ATOM   2883  C CD1   . PHE A 1 327 ? 46.764  44.452  0.997   1.00 23.48  ? 327 PHE A CD1   1 
ATOM   2884  C CD2   . PHE A 1 327 ? 45.529  46.456  0.560   1.00 14.40  ? 327 PHE A CD2   1 
ATOM   2885  C CE1   . PHE A 1 327 ? 46.191  43.855  -0.107  1.00 22.58  ? 327 PHE A CE1   1 
ATOM   2886  C CE2   . PHE A 1 327 ? 44.987  45.858  -0.550  1.00 19.54  ? 327 PHE A CE2   1 
ATOM   2887  C CZ    . PHE A 1 327 ? 45.317  44.561  -0.894  1.00 20.27  ? 327 PHE A CZ    1 
ATOM   2888  H H     . PHE A 1 327 ? 48.864  47.901  3.751   1.00 0.00   ? 327 PHE A H     1 
ATOM   2889  N N     . LEU A 1 328 ? 47.700  49.137  0.901   1.00 35.32  ? 328 LEU A N     1 
ATOM   2890  C CA    . LEU A 1 328 ? 47.312  50.063  -0.136  1.00 38.81  ? 328 LEU A CA    1 
ATOM   2891  C C     . LEU A 1 328 ? 48.463  50.512  -0.995  1.00 42.57  ? 328 LEU A C     1 
ATOM   2892  O O     . LEU A 1 328 ? 48.276  50.770  -2.185  1.00 45.78  ? 328 LEU A O     1 
ATOM   2893  C CB    . LEU A 1 328 ? 46.660  51.289  0.458   1.00 39.71  ? 328 LEU A CB    1 
ATOM   2894  C CG    . LEU A 1 328 ? 45.167  51.216  0.731   1.00 39.23  ? 328 LEU A CG    1 
ATOM   2895  C CD1   . LEU A 1 328 ? 44.668  52.563  1.246   1.00 35.89  ? 328 LEU A CD1   1 
ATOM   2896  C CD2   . LEU A 1 328 ? 44.441  50.843  -0.553  1.00 37.90  ? 328 LEU A CD2   1 
ATOM   2897  H H     . LEU A 1 328 ? 47.565  49.392  1.833   1.00 0.00   ? 328 LEU A H     1 
ATOM   2898  N N     . LYS A 1 329 ? 49.663  50.564  -0.430  1.00 44.95  ? 329 LYS A N     1 
ATOM   2899  C CA    . LYS A 1 329 ? 50.846  50.901  -1.189  1.00 46.19  ? 329 LYS A CA    1 
ATOM   2900  C C     . LYS A 1 329 ? 51.144  49.758  -2.135  1.00 44.00  ? 329 LYS A C     1 
ATOM   2901  O O     . LYS A 1 329 ? 51.241  50.033  -3.333  1.00 45.37  ? 329 LYS A O     1 
ATOM   2902  C CB    . LYS A 1 329 ? 52.018  51.139  -0.250  1.00 52.27  ? 329 LYS A CB    1 
ATOM   2903  C CG    . LYS A 1 329 ? 51.784  52.416  0.555   1.00 62.45  ? 329 LYS A CG    1 
ATOM   2904  C CD    . LYS A 1 329 ? 52.836  52.653  1.636   1.00 67.89  ? 329 LYS A CD    1 
ATOM   2905  C CE    . LYS A 1 329 ? 52.455  53.877  2.472   1.00 70.62  ? 329 LYS A CE    1 
ATOM   2906  N NZ    . LYS A 1 329 ? 53.472  54.162  3.470   1.00 73.56  ? 329 LYS A NZ    1 
ATOM   2907  H H     . LYS A 1 329 ? 49.742  50.378  0.529   1.00 0.00   ? 329 LYS A H     1 
ATOM   2908  H HZ1   . LYS A 1 329 ? 53.574  53.340  4.098   1.00 0.00   ? 329 LYS A HZ1   1 
ATOM   2909  H HZ2   . LYS A 1 329 ? 54.375  54.360  2.996   1.00 0.00   ? 329 LYS A HZ2   1 
ATOM   2910  H HZ3   . LYS A 1 329 ? 53.181  54.992  4.026   1.00 0.00   ? 329 LYS A HZ3   1 
ATOM   2911  N N     . VAL A 1 330 ? 51.192  48.483  -1.704  1.00 41.12  ? 330 VAL A N     1 
ATOM   2912  C CA    . VAL A 1 330 ? 51.484  47.400  -2.636  1.00 39.91  ? 330 VAL A CA    1 
ATOM   2913  C C     . VAL A 1 330 ? 50.355  47.314  -3.647  1.00 42.81  ? 330 VAL A C     1 
ATOM   2914  O O     . VAL A 1 330 ? 50.571  46.897  -4.786  1.00 43.99  ? 330 VAL A O     1 
ATOM   2915  C CB    . VAL A 1 330 ? 51.646  45.971  -1.970  1.00 40.11  ? 330 VAL A CB    1 
ATOM   2916  C CG1   . VAL A 1 330 ? 52.582  46.122  -0.795  1.00 37.64  ? 330 VAL A CG1   1 
ATOM   2917  C CG2   . VAL A 1 330 ? 50.344  45.347  -1.508  1.00 42.72  ? 330 VAL A CG2   1 
ATOM   2918  H H     . VAL A 1 330 ? 50.989  48.289  -0.762  1.00 0.00   ? 330 VAL A H     1 
ATOM   2919  N N     . TYR A 1 331 ? 49.154  47.747  -3.278  1.00 46.29  ? 331 TYR A N     1 
ATOM   2920  C CA    . TYR A 1 331 ? 48.029  47.740  -4.182  1.00 50.63  ? 331 TYR A CA    1 
ATOM   2921  C C     . TYR A 1 331 ? 48.217  48.767  -5.285  1.00 55.48  ? 331 TYR A C     1 
ATOM   2922  O O     . TYR A 1 331 ? 48.126  48.443  -6.471  1.00 58.22  ? 331 TYR A O     1 
ATOM   2923  C CB    . TYR A 1 331 ? 46.761  48.048  -3.424  1.00 48.60  ? 331 TYR A CB    1 
ATOM   2924  C CG    . TYR A 1 331 ? 45.572  47.492  -4.177  1.00 50.53  ? 331 TYR A CG    1 
ATOM   2925  C CD1   . TYR A 1 331 ? 45.456  46.122  -4.294  1.00 50.72  ? 331 TYR A CD1   1 
ATOM   2926  C CD2   . TYR A 1 331 ? 44.650  48.333  -4.760  1.00 48.03  ? 331 TYR A CD2   1 
ATOM   2927  C CE1   . TYR A 1 331 ? 44.420  45.573  -5.002  1.00 49.42  ? 331 TYR A CE1   1 
ATOM   2928  C CE2   . TYR A 1 331 ? 43.608  47.783  -5.470  1.00 50.97  ? 331 TYR A CE2   1 
ATOM   2929  C CZ    . TYR A 1 331 ? 43.505  46.412  -5.577  1.00 51.32  ? 331 TYR A CZ    1 
ATOM   2930  O OH    . TYR A 1 331 ? 42.456  45.843  -6.266  1.00 57.76  ? 331 TYR A OH    1 
ATOM   2931  H H     . TYR A 1 331 ? 49.023  48.029  -2.350  1.00 0.00   ? 331 TYR A H     1 
ATOM   2932  H HH    . TYR A 1 331 ? 41.855  46.528  -6.567  1.00 0.00   ? 331 TYR A HH    1 
ATOM   2933  N N     . GLU A 1 332 ? 48.552  49.995  -4.901  1.00 59.79  ? 332 GLU A N     1 
ATOM   2934  C CA    . GLU A 1 332 ? 48.770  51.095  -5.823  1.00 65.02  ? 332 GLU A CA    1 
ATOM   2935  C C     . GLU A 1 332 ? 49.907  50.722  -6.774  1.00 65.45  ? 332 GLU A C     1 
ATOM   2936  O O     . GLU A 1 332 ? 49.856  50.989  -7.976  1.00 64.94  ? 332 GLU A O     1 
ATOM   2937  C CB    . GLU A 1 332 ? 49.101  52.341  -4.999  1.00 70.88  ? 332 GLU A CB    1 
ATOM   2938  C CG    . GLU A 1 332 ? 49.016  53.689  -5.716  1.00 77.89  ? 332 GLU A CG    1 
ATOM   2939  C CD    . GLU A 1 332 ? 47.614  54.122  -6.147  1.00 81.79  ? 332 GLU A CD    1 
ATOM   2940  O OE1   . GLU A 1 332 ? 46.783  54.411  -5.282  1.00 83.42  ? 332 GLU A OE1   1 
ATOM   2941  O OE2   . GLU A 1 332 ? 47.365  54.188  -7.354  1.00 84.65  ? 332 GLU A OE2   1 
ATOM   2942  H H     . GLU A 1 332 ? 48.674  50.164  -3.945  1.00 0.00   ? 332 GLU A H     1 
ATOM   2943  N N     . LYS A 1 333 ? 50.907  49.993  -6.277  1.00 66.15  ? 333 LYS A N     1 
ATOM   2944  C CA    . LYS A 1 333 ? 52.016  49.485  -7.073  1.00 66.80  ? 333 LYS A CA    1 
ATOM   2945  C C     . LYS A 1 333 ? 51.550  48.466  -8.130  1.00 66.79  ? 333 LYS A C     1 
ATOM   2946  O O     . LYS A 1 333 ? 52.376  47.793  -8.745  1.00 64.03  ? 333 LYS A O     1 
ATOM   2947  C CB    . LYS A 1 333 ? 53.025  48.860  -6.097  1.00 68.41  ? 333 LYS A CB    1 
ATOM   2948  C CG    . LYS A 1 333 ? 54.363  48.377  -6.636  1.00 70.27  ? 333 LYS A CG    1 
ATOM   2949  C CD    . LYS A 1 333 ? 54.910  47.265  -5.756  1.00 75.07  ? 333 LYS A CD    1 
ATOM   2950  C CE    . LYS A 1 333 ? 56.125  46.659  -6.449  1.00 79.75  ? 333 LYS A CE    1 
ATOM   2951  N NZ    . LYS A 1 333 ? 56.735  45.612  -5.652  1.00 81.49  ? 333 LYS A NZ    1 
ATOM   2952  H H     . LYS A 1 333 ? 50.912  49.839  -5.308  1.00 0.00   ? 333 LYS A H     1 
ATOM   2953  H HZ1   . LYS A 1 333 ? 56.991  45.992  -4.718  1.00 0.00   ? 333 LYS A HZ1   1 
ATOM   2954  H HZ2   . LYS A 1 333 ? 56.059  44.832  -5.528  1.00 0.00   ? 333 LYS A HZ2   1 
ATOM   2955  H HZ3   . LYS A 1 333 ? 57.588  45.257  -6.129  1.00 0.00   ? 333 LYS A HZ3   1 
ATOM   2956  N N     . HIS A 1 334 ? 50.266  48.206  -8.388  1.00 68.78  ? 334 HIS A N     1 
ATOM   2957  C CA    . HIS A 1 334 ? 49.860  47.247  -9.406  1.00 72.55  ? 334 HIS A CA    1 
ATOM   2958  C C     . HIS A 1 334 ? 48.678  47.767  -10.205 1.00 77.35  ? 334 HIS A C     1 
ATOM   2959  O O     . HIS A 1 334 ? 47.851  46.956  -10.645 1.00 78.82  ? 334 HIS A O     1 
ATOM   2960  C CB    . HIS A 1 334 ? 49.478  45.908  -8.760  1.00 70.00  ? 334 HIS A CB    1 
ATOM   2961  C CG    . HIS A 1 334 ? 50.654  45.138  -8.186  1.00 68.50  ? 334 HIS A CG    1 
ATOM   2962  N ND1   . HIS A 1 334 ? 51.240  45.465  -7.046  1.00 69.73  ? 334 HIS A ND1   1 
ATOM   2963  C CD2   . HIS A 1 334 ? 51.316  44.067  -8.722  1.00 68.79  ? 334 HIS A CD2   1 
ATOM   2964  C CE1   . HIS A 1 334 ? 52.242  44.648  -6.861  1.00 67.28  ? 334 HIS A CE1   1 
ATOM   2965  N NE2   . HIS A 1 334 ? 52.280  43.813  -7.870  1.00 67.83  ? 334 HIS A NE2   1 
ATOM   2966  H H     . HIS A 1 334 ? 49.548  48.690  -7.926  1.00 0.00   ? 334 HIS A H     1 
ATOM   2967  H HD1   . HIS A 1 334 ? 50.988  46.199  -6.443  1.00 0.00   ? 334 HIS A HD1   1 
ATOM   2968  H HE2   . HIS A 1 334 ? 52.979  43.139  -7.996  1.00 0.00   ? 334 HIS A HE2   1 
ATOM   2969  N N     . SER A 1 335 ? 48.636  49.099  -10.367 1.00 82.20  ? 335 SER A N     1 
ATOM   2970  C CA    . SER A 1 335 ? 47.576  49.778  -11.101 1.00 87.30  ? 335 SER A CA    1 
ATOM   2971  C C     . SER A 1 335 ? 47.940  49.871  -12.584 1.00 90.09  ? 335 SER A C     1 
ATOM   2972  O O     . SER A 1 335 ? 49.131  50.028  -12.893 1.00 92.33  ? 335 SER A O     1 
ATOM   2973  C CB    . SER A 1 335 ? 47.368  51.195  -10.564 1.00 87.39  ? 335 SER A CB    1 
ATOM   2974  O OG    . SER A 1 335 ? 47.358  51.241  -9.141  1.00 92.15  ? 335 SER A OG    1 
ATOM   2975  H H     . SER A 1 335 ? 49.414  49.645  -10.151 1.00 0.00   ? 335 SER A H     1 
ATOM   2976  H HG    . SER A 1 335 ? 48.242  50.955  -8.912  1.00 0.00   ? 335 SER A HG    1 
ATOM   2977  N N     . ASP B 1 9   ? 15.803  8.316   23.401  1.00 48.08  ? 9   ASP B N     1 
ATOM   2978  C CA    . ASP B 1 9   ? 15.258  8.960   24.572  1.00 47.09  ? 9   ASP B CA    1 
ATOM   2979  C C     . ASP B 1 9   ? 16.511  9.491   25.248  1.00 43.56  ? 9   ASP B C     1 
ATOM   2980  O O     . ASP B 1 9   ? 17.577  8.907   25.016  1.00 41.40  ? 9   ASP B O     1 
ATOM   2981  C CB    . ASP B 1 9   ? 14.504  7.932   25.460  1.00 53.96  ? 9   ASP B CB    1 
ATOM   2982  C CG    . ASP B 1 9   ? 15.166  6.623   25.926  1.00 59.51  ? 9   ASP B CG    1 
ATOM   2983  O OD1   . ASP B 1 9   ? 16.310  6.310   25.568  1.00 61.64  ? 9   ASP B OD1   1 
ATOM   2984  O OD2   . ASP B 1 9   ? 14.492  5.899   26.667  1.00 60.31  ? 9   ASP B OD2   1 
ATOM   2985  N N     . VAL B 1 10  ? 16.390  10.594  25.965  1.00 36.98  ? 10  VAL B N     1 
ATOM   2986  C CA    . VAL B 1 10  ? 17.504  11.207  26.660  1.00 35.63  ? 10  VAL B CA    1 
ATOM   2987  C C     . VAL B 1 10  ? 18.523  10.341  27.392  1.00 34.12  ? 10  VAL B C     1 
ATOM   2988  O O     . VAL B 1 10  ? 18.176  9.329   28.021  1.00 32.48  ? 10  VAL B O     1 
ATOM   2989  C CB    . VAL B 1 10  ? 17.028  12.228  27.727  1.00 38.05  ? 10  VAL B CB    1 
ATOM   2990  C CG1   . VAL B 1 10  ? 16.960  13.575  27.042  1.00 38.75  ? 10  VAL B CG1   1 
ATOM   2991  C CG2   . VAL B 1 10  ? 15.708  11.798  28.399  1.00 37.74  ? 10  VAL B CG2   1 
ATOM   2992  H H     . VAL B 1 10  ? 15.523  11.042  26.025  1.00 0.00   ? 10  VAL B H     1 
ATOM   2993  N N     . VAL B 1 11  ? 19.797  10.725  27.230  1.00 27.74  ? 11  VAL B N     1 
ATOM   2994  C CA    . VAL B 1 11  ? 20.803  10.274  28.165  1.00 18.65  ? 11  VAL B CA    1 
ATOM   2995  C C     . VAL B 1 11  ? 21.548  11.549  28.484  1.00 17.42  ? 11  VAL B C     1 
ATOM   2996  O O     . VAL B 1 11  ? 21.726  12.461  27.664  1.00 9.53   ? 11  VAL B O     1 
ATOM   2997  C CB    . VAL B 1 11  ? 21.884  9.294   27.674  1.00 19.33  ? 11  VAL B CB    1 
ATOM   2998  C CG1   . VAL B 1 11  ? 21.962  8.244   28.800  1.00 6.25   ? 11  VAL B CG1   1 
ATOM   2999  C CG2   . VAL B 1 11  ? 21.613  8.666   26.304  1.00 25.69  ? 11  VAL B CG2   1 
ATOM   3000  H H     . VAL B 1 11  ? 20.048  11.307  26.472  1.00 0.00   ? 11  VAL B H     1 
ATOM   3001  N N     . THR B 1 12  ? 21.897  11.622  29.756  1.00 14.48  ? 12  THR B N     1 
ATOM   3002  C CA    . THR B 1 12  ? 22.681  12.714  30.263  1.00 13.92  ? 12  THR B CA    1 
ATOM   3003  C C     . THR B 1 12  ? 24.099  12.190  30.440  1.00 11.99  ? 12  THR B C     1 
ATOM   3004  O O     . THR B 1 12  ? 24.307  10.968  30.437  1.00 18.46  ? 12  THR B O     1 
ATOM   3005  C CB    . THR B 1 12  ? 22.012  13.147  31.572  1.00 10.63  ? 12  THR B CB    1 
ATOM   3006  O OG1   . THR B 1 12  ? 21.786  11.987  32.342  1.00 9.47   ? 12  THR B OG1   1 
ATOM   3007  C CG2   . THR B 1 12  ? 20.667  13.765  31.347  1.00 11.43  ? 12  THR B CG2   1 
ATOM   3008  H H     . THR B 1 12  ? 21.635  10.938  30.404  1.00 0.00   ? 12  THR B H     1 
ATOM   3009  H HG1   . THR B 1 12  ? 21.365  12.271  33.165  1.00 0.00   ? 12  THR B HG1   1 
ATOM   3010  N N     . LEU B 1 13  ? 25.123  13.024  30.571  1.00 7.60   ? 13  LEU B N     1 
ATOM   3011  C CA    . LEU B 1 13  ? 26.465  12.528  30.846  1.00 9.33   ? 13  LEU B CA    1 
ATOM   3012  C C     . LEU B 1 13  ? 26.454  11.690  32.114  1.00 4.40   ? 13  LEU B C     1 
ATOM   3013  O O     . LEU B 1 13  ? 27.012  10.605  32.137  1.00 8.67   ? 13  LEU B O     1 
ATOM   3014  C CB    . LEU B 1 13  ? 27.460  13.673  31.047  1.00 17.22  ? 13  LEU B CB    1 
ATOM   3015  C CG    . LEU B 1 13  ? 28.905  13.347  31.438  1.00 20.77  ? 13  LEU B CG    1 
ATOM   3016  C CD1   . LEU B 1 13  ? 29.646  12.869  30.215  1.00 26.32  ? 13  LEU B CD1   1 
ATOM   3017  C CD2   . LEU B 1 13  ? 29.614  14.586  31.978  1.00 26.08  ? 13  LEU B CD2   1 
ATOM   3018  H H     . LEU B 1 13  ? 24.980  13.970  30.357  1.00 0.00   ? 13  LEU B H     1 
ATOM   3019  N N     . THR B 1 14  ? 25.769  12.123  33.160  1.00 2.00   ? 14  THR B N     1 
ATOM   3020  C CA    . THR B 1 14  ? 25.741  11.432  34.436  1.00 3.79   ? 14  THR B CA    1 
ATOM   3021  C C     . THR B 1 14  ? 25.175  10.029  34.368  1.00 7.01   ? 14  THR B C     1 
ATOM   3022  O O     . THR B 1 14  ? 25.718  9.120   35.002  1.00 7.61   ? 14  THR B O     1 
ATOM   3023  C CB    . THR B 1 14  ? 24.917  12.310  35.375  1.00 4.07   ? 14  THR B CB    1 
ATOM   3024  O OG1   . THR B 1 14  ? 25.472  13.620  35.190  1.00 6.25   ? 14  THR B OG1   1 
ATOM   3025  C CG2   . THR B 1 14  ? 24.943  11.867  36.826  1.00 2.00   ? 14  THR B CG2   1 
ATOM   3026  H H     . THR B 1 14  ? 25.324  12.984  33.097  1.00 0.00   ? 14  THR B H     1 
ATOM   3027  H HG1   . THR B 1 14  ? 24.741  14.254  35.123  1.00 0.00   ? 14  THR B HG1   1 
ATOM   3028  N N     . ARG B 1 15  ? 24.094  9.826   33.624  1.00 8.29   ? 15  ARG B N     1 
ATOM   3029  C CA    . ARG B 1 15  ? 23.552  8.503   33.484  1.00 9.75   ? 15  ARG B CA    1 
ATOM   3030  C C     . ARG B 1 15  ? 24.525  7.704   32.625  1.00 15.86  ? 15  ARG B C     1 
ATOM   3031  O O     . ARG B 1 15  ? 24.862  6.591   33.014  1.00 19.50  ? 15  ARG B O     1 
ATOM   3032  C CB    . ARG B 1 15  ? 22.210  8.612   32.843  1.00 14.18  ? 15  ARG B CB    1 
ATOM   3033  C CG    . ARG B 1 15  ? 21.469  7.303   32.795  1.00 20.12  ? 15  ARG B CG    1 
ATOM   3034  C CD    . ARG B 1 15  ? 20.235  7.463   31.929  1.00 17.25  ? 15  ARG B CD    1 
ATOM   3035  N NE    . ARG B 1 15  ? 19.118  7.987   32.689  1.00 17.14  ? 15  ARG B NE    1 
ATOM   3036  C CZ    . ARG B 1 15  ? 18.030  8.446   32.078  1.00 11.78  ? 15  ARG B CZ    1 
ATOM   3037  N NH1   . ARG B 1 15  ? 17.950  8.568   30.752  1.00 12.77  ? 15  ARG B NH1   1 
ATOM   3038  N NH2   . ARG B 1 15  ? 17.014  8.828   32.827  1.00 14.54  ? 15  ARG B NH2   1 
ATOM   3039  H H     . ARG B 1 15  ? 23.660  10.564  33.147  1.00 0.00   ? 15  ARG B H     1 
ATOM   3040  H HE    . ARG B 1 15  ? 19.167  8.013   33.668  1.00 0.00   ? 15  ARG B HE    1 
ATOM   3041  H HH11  . ARG B 1 15  ? 18.723  8.316   30.169  1.00 0.00   ? 15  ARG B HH11  1 
ATOM   3042  H HH12  . ARG B 1 15  ? 17.108  8.914   30.339  1.00 0.00   ? 15  ARG B HH12  1 
ATOM   3043  H HH21  . ARG B 1 15  ? 17.075  8.767   33.822  1.00 0.00   ? 15  ARG B HH21  1 
ATOM   3044  H HH22  . ARG B 1 15  ? 16.179  9.172   32.399  1.00 0.00   ? 15  ARG B HH22  1 
ATOM   3045  N N     . PHE B 1 16  ? 25.070  8.216   31.515  1.00 14.47  ? 16  PHE B N     1 
ATOM   3046  C CA    . PHE B 1 16  ? 26.050  7.473   30.713  1.00 14.50  ? 16  PHE B CA    1 
ATOM   3047  C C     . PHE B 1 16  ? 27.271  6.990   31.520  1.00 12.22  ? 16  PHE B C     1 
ATOM   3048  O O     . PHE B 1 16  ? 27.575  5.798   31.611  1.00 12.85  ? 16  PHE B O     1 
ATOM   3049  C CB    . PHE B 1 16  ? 26.482  8.392   29.553  1.00 16.29  ? 16  PHE B CB    1 
ATOM   3050  C CG    . PHE B 1 16  ? 27.352  7.756   28.478  1.00 17.13  ? 16  PHE B CG    1 
ATOM   3051  C CD1   . PHE B 1 16  ? 26.751  7.157   27.383  1.00 16.71  ? 16  PHE B CD1   1 
ATOM   3052  C CD2   . PHE B 1 16  ? 28.730  7.773   28.596  1.00 13.43  ? 16  PHE B CD2   1 
ATOM   3053  C CE1   . PHE B 1 16  ? 27.532  6.555   26.421  1.00 14.50  ? 16  PHE B CE1   1 
ATOM   3054  C CE2   . PHE B 1 16  ? 29.496  7.158   27.638  1.00 12.48  ? 16  PHE B CE2   1 
ATOM   3055  C CZ    . PHE B 1 16  ? 28.901  6.545   26.561  1.00 15.24  ? 16  PHE B CZ    1 
ATOM   3056  H H     . PHE B 1 16  ? 24.802  9.112   31.219  1.00 0.00   ? 16  PHE B H     1 
ATOM   3057  N N     . VAL B 1 17  ? 27.981  7.898   32.168  1.00 14.59  ? 17  VAL B N     1 
ATOM   3058  C CA    . VAL B 1 17  ? 29.171  7.612   32.969  1.00 12.07  ? 17  VAL B CA    1 
ATOM   3059  C C     . VAL B 1 17  ? 28.865  6.641   34.092  1.00 13.96  ? 17  VAL B C     1 
ATOM   3060  O O     . VAL B 1 17  ? 29.697  5.778   34.401  1.00 16.94  ? 17  VAL B O     1 
ATOM   3061  C CB    . VAL B 1 17  ? 29.696  8.955   33.496  1.00 9.07   ? 17  VAL B CB    1 
ATOM   3062  C CG1   . VAL B 1 17  ? 30.757  8.747   34.556  1.00 7.37   ? 17  VAL B CG1   1 
ATOM   3063  C CG2   . VAL B 1 17  ? 30.268  9.758   32.317  1.00 6.04   ? 17  VAL B CG2   1 
ATOM   3064  H H     . VAL B 1 17  ? 27.684  8.828   32.099  1.00 0.00   ? 17  VAL B H     1 
ATOM   3065  N N     . MET B 1 18  ? 27.690  6.733   34.712  1.00 11.71  ? 18  MET B N     1 
ATOM   3066  C CA    . MET B 1 18  ? 27.347  5.797   35.770  1.00 12.50  ? 18  MET B CA    1 
ATOM   3067  C C     . MET B 1 18  ? 27.102  4.405   35.195  1.00 16.78  ? 18  MET B C     1 
ATOM   3068  O O     . MET B 1 18  ? 27.599  3.420   35.740  1.00 20.96  ? 18  MET B O     1 
ATOM   3069  C CB    . MET B 1 18  ? 26.121  6.293   36.473  1.00 11.34  ? 18  MET B CB    1 
ATOM   3070  C CG    . MET B 1 18  ? 25.588  5.341   37.522  1.00 13.05  ? 18  MET B CG    1 
ATOM   3071  S SD    . MET B 1 18  ? 26.765  5.064   38.854  1.00 19.61  ? 18  MET B SD    1 
ATOM   3072  C CE    . MET B 1 18  ? 26.109  3.505   39.356  1.00 15.54  ? 18  MET B CE    1 
ATOM   3073  H H     . MET B 1 18  ? 27.036  7.408   34.429  1.00 0.00   ? 18  MET B H     1 
ATOM   3074  N N     . GLU B 1 19  ? 26.392  4.308   34.073  1.00 18.44  ? 19  GLU B N     1 
ATOM   3075  C CA    . GLU B 1 19  ? 26.083  3.059   33.414  1.00 21.99  ? 19  GLU B CA    1 
ATOM   3076  C C     . GLU B 1 19  ? 27.316  2.346   32.882  1.00 22.17  ? 19  GLU B C     1 
ATOM   3077  O O     . GLU B 1 19  ? 27.444  1.125   33.013  1.00 20.14  ? 19  GLU B O     1 
ATOM   3078  C CB    . GLU B 1 19  ? 25.095  3.338   32.272  1.00 25.18  ? 19  GLU B CB    1 
ATOM   3079  C CG    . GLU B 1 19  ? 24.375  2.097   31.758  1.00 29.63  ? 19  GLU B CG    1 
ATOM   3080  C CD    . GLU B 1 19  ? 23.616  1.333   32.848  1.00 35.86  ? 19  GLU B CD    1 
ATOM   3081  O OE1   . GLU B 1 19  ? 23.038  1.966   33.738  1.00 38.96  ? 19  GLU B OE1   1 
ATOM   3082  O OE2   . GLU B 1 19  ? 23.611  0.100   32.809  1.00 35.92  ? 19  GLU B OE2   1 
ATOM   3083  H H     . GLU B 1 19  ? 26.000  5.123   33.688  1.00 0.00   ? 19  GLU B H     1 
ATOM   3084  N N     . GLU B 1 20  ? 28.262  3.067   32.282  1.00 22.73  ? 20  GLU B N     1 
ATOM   3085  C CA    . GLU B 1 20  ? 29.497  2.468   31.792  1.00 20.19  ? 20  GLU B CA    1 
ATOM   3086  C C     . GLU B 1 20  ? 30.319  1.941   32.955  1.00 19.99  ? 20  GLU B C     1 
ATOM   3087  O O     . GLU B 1 20  ? 30.881  0.845   32.884  1.00 12.48  ? 20  GLU B O     1 
ATOM   3088  C CB    . GLU B 1 20  ? 30.328  3.484   31.028  1.00 20.12  ? 20  GLU B CB    1 
ATOM   3089  C CG    . GLU B 1 20  ? 29.755  3.861   29.681  1.00 19.64  ? 20  GLU B CG    1 
ATOM   3090  C CD    . GLU B 1 20  ? 29.677  2.762   28.629  1.00 21.30  ? 20  GLU B CD    1 
ATOM   3091  O OE1   . GLU B 1 20  ? 30.383  1.754   28.706  1.00 23.62  ? 20  GLU B OE1   1 
ATOM   3092  O OE2   . GLU B 1 20  ? 28.904  2.938   27.696  1.00 26.72  ? 20  GLU B OE2   1 
ATOM   3093  H H     . GLU B 1 20  ? 28.084  4.021   32.135  1.00 0.00   ? 20  GLU B H     1 
ATOM   3094  N N     . GLY B 1 21  ? 30.330  2.710   34.052  1.00 19.09  ? 21  GLY B N     1 
ATOM   3095  C CA    . GLY B 1 21  ? 30.981  2.321   35.285  1.00 12.09  ? 21  GLY B CA    1 
ATOM   3096  C C     . GLY B 1 21  ? 30.412  0.999   35.743  1.00 11.95  ? 21  GLY B C     1 
ATOM   3097  O O     . GLY B 1 21  ? 31.157  0.120   36.166  1.00 14.58  ? 21  GLY B O     1 
ATOM   3098  H H     . GLY B 1 21  ? 29.883  3.582   34.024  1.00 0.00   ? 21  GLY B H     1 
ATOM   3099  N N     . ARG B 1 22  ? 29.102  0.804   35.602  1.00 12.89  ? 22  ARG B N     1 
ATOM   3100  C CA    . ARG B 1 22  ? 28.467  -0.449  36.000  1.00 15.59  ? 22  ARG B CA    1 
ATOM   3101  C C     . ARG B 1 22  ? 28.862  -1.613  35.101  1.00 18.33  ? 22  ARG B C     1 
ATOM   3102  O O     . ARG B 1 22  ? 29.221  -2.677  35.600  1.00 16.71  ? 22  ARG B O     1 
ATOM   3103  C CB    . ARG B 1 22  ? 26.934  -0.317  35.983  1.00 14.45  ? 22  ARG B CB    1 
ATOM   3104  C CG    . ARG B 1 22  ? 26.415  0.742   36.936  1.00 13.96  ? 22  ARG B CG    1 
ATOM   3105  C CD    . ARG B 1 22  ? 25.051  0.442   37.531  1.00 22.14  ? 22  ARG B CD    1 
ATOM   3106  N NE    . ARG B 1 22  ? 23.954  0.574   36.595  1.00 26.37  ? 22  ARG B NE    1 
ATOM   3107  C CZ    . ARG B 1 22  ? 22.856  -0.174  36.670  1.00 23.34  ? 22  ARG B CZ    1 
ATOM   3108  N NH1   . ARG B 1 22  ? 22.695  -1.149  37.567  1.00 22.31  ? 22  ARG B NH1   1 
ATOM   3109  N NH2   . ARG B 1 22  ? 21.899  0.068   35.789  1.00 29.40  ? 22  ARG B NH2   1 
ATOM   3110  H H     . ARG B 1 22  ? 28.546  1.554   35.298  1.00 0.00   ? 22  ARG B H     1 
ATOM   3111  H HE    . ARG B 1 22  ? 24.025  1.233   35.874  1.00 0.00   ? 22  ARG B HE    1 
ATOM   3112  H HH11  . ARG B 1 22  ? 23.417  -1.355  38.227  1.00 0.00   ? 22  ARG B HH11  1 
ATOM   3113  H HH12  . ARG B 1 22  ? 21.844  -1.675  37.575  1.00 0.00   ? 22  ARG B HH12  1 
ATOM   3114  H HH21  . ARG B 1 22  ? 22.021  0.793   35.111  1.00 0.00   ? 22  ARG B HH21  1 
ATOM   3115  H HH22  . ARG B 1 22  ? 21.056  -0.466  35.799  1.00 0.00   ? 22  ARG B HH22  1 
ATOM   3116  N N     . LYS B 1 23  ? 28.849  -1.429  33.775  1.00 23.85  ? 23  LYS B N     1 
ATOM   3117  C CA    . LYS B 1 23  ? 29.221  -2.466  32.814  1.00 25.08  ? 23  LYS B CA    1 
ATOM   3118  C C     . LYS B 1 23  ? 30.643  -2.949  33.024  1.00 26.76  ? 23  LYS B C     1 
ATOM   3119  O O     . LYS B 1 23  ? 30.950  -4.131  32.926  1.00 29.65  ? 23  LYS B O     1 
ATOM   3120  C CB    . LYS B 1 23  ? 29.133  -1.957  31.381  1.00 26.18  ? 23  LYS B CB    1 
ATOM   3121  C CG    . LYS B 1 23  ? 27.761  -1.596  30.848  1.00 28.11  ? 23  LYS B CG    1 
ATOM   3122  C CD    . LYS B 1 23  ? 28.001  -1.111  29.432  1.00 32.85  ? 23  LYS B CD    1 
ATOM   3123  C CE    . LYS B 1 23  ? 26.796  -0.359  28.883  1.00 37.67  ? 23  LYS B CE    1 
ATOM   3124  N NZ    . LYS B 1 23  ? 27.108  0.260   27.603  1.00 39.41  ? 23  LYS B NZ    1 
ATOM   3125  H H     . LYS B 1 23  ? 28.540  -0.560  33.439  1.00 0.00   ? 23  LYS B H     1 
ATOM   3126  H HZ1   . LYS B 1 23  ? 27.909  0.913   27.724  1.00 0.00   ? 23  LYS B HZ1   1 
ATOM   3127  H HZ2   . LYS B 1 23  ? 27.361  -0.471  26.909  1.00 0.00   ? 23  LYS B HZ2   1 
ATOM   3128  H HZ3   . LYS B 1 23  ? 26.281  0.790   27.263  1.00 0.00   ? 23  LYS B HZ3   1 
ATOM   3129  N N     . ALA B 1 24  ? 31.523  -1.999  33.304  1.00 28.65  ? 24  ALA B N     1 
ATOM   3130  C CA    . ALA B 1 24  ? 32.922  -2.267  33.571  1.00 27.90  ? 24  ALA B CA    1 
ATOM   3131  C C     . ALA B 1 24  ? 33.174  -2.826  34.971  1.00 26.82  ? 24  ALA B C     1 
ATOM   3132  O O     . ALA B 1 24  ? 34.292  -3.233  35.261  1.00 25.85  ? 24  ALA B O     1 
ATOM   3133  C CB    . ALA B 1 24  ? 33.708  -0.972  33.396  1.00 25.64  ? 24  ALA B CB    1 
ATOM   3134  H H     . ALA B 1 24  ? 31.210  -1.073  33.359  1.00 0.00   ? 24  ALA B H     1 
ATOM   3135  N N     . ARG B 1 25  ? 32.169  -2.881  35.854  1.00 29.10  ? 25  ARG B N     1 
ATOM   3136  C CA    . ARG B 1 25  ? 32.276  -3.353  37.235  1.00 30.79  ? 25  ARG B CA    1 
ATOM   3137  C C     . ARG B 1 25  ? 33.342  -2.637  38.058  1.00 29.76  ? 25  ARG B C     1 
ATOM   3138  O O     . ARG B 1 25  ? 34.093  -3.221  38.854  1.00 30.70  ? 25  ARG B O     1 
ATOM   3139  C CB    . ARG B 1 25  ? 32.540  -4.853  37.236  1.00 33.86  ? 25  ARG B CB    1 
ATOM   3140  C CG    . ARG B 1 25  ? 31.358  -5.573  36.677  1.00 47.77  ? 25  ARG B CG    1 
ATOM   3141  C CD    . ARG B 1 25  ? 31.725  -7.018  36.634  1.00 61.00  ? 25  ARG B CD    1 
ATOM   3142  N NE    . ARG B 1 25  ? 30.555  -7.802  36.281  1.00 78.63  ? 25  ARG B NE    1 
ATOM   3143  C CZ    . ARG B 1 25  ? 30.354  -9.031  36.778  1.00 86.95  ? 25  ARG B CZ    1 
ATOM   3144  N NH1   . ARG B 1 25  ? 31.215  -9.593  37.640  1.00 91.95  ? 25  ARG B NH1   1 
ATOM   3145  N NH2   . ARG B 1 25  ? 29.264  -9.715  36.417  1.00 90.25  ? 25  ARG B NH2   1 
ATOM   3146  H H     . ARG B 1 25  ? 31.282  -2.617  35.542  1.00 0.00   ? 25  ARG B H     1 
ATOM   3147  H HE    . ARG B 1 25  ? 29.886  -7.423  35.675  1.00 0.00   ? 25  ARG B HE    1 
ATOM   3148  H HH11  . ARG B 1 25  ? 32.036  -9.100  37.929  1.00 0.00   ? 25  ARG B HH11  1 
ATOM   3149  H HH12  . ARG B 1 25  ? 31.040  -10.510 37.999  1.00 0.00   ? 25  ARG B HH12  1 
ATOM   3150  H HH21  . ARG B 1 25  ? 28.594  -9.306  35.800  1.00 0.00   ? 25  ARG B HH21  1 
ATOM   3151  H HH22  . ARG B 1 25  ? 29.103  -10.625 36.800  1.00 0.00   ? 25  ARG B HH22  1 
ATOM   3152  N N     . GLY B 1 26  ? 33.355  -1.315  37.891  1.00 24.92  ? 26  GLY B N     1 
ATOM   3153  C CA    . GLY B 1 26  ? 34.326  -0.488  38.580  1.00 27.45  ? 26  GLY B CA    1 
ATOM   3154  C C     . GLY B 1 26  ? 33.923  -0.251  40.021  1.00 28.31  ? 26  GLY B C     1 
ATOM   3155  O O     . GLY B 1 26  ? 32.742  -0.396  40.351  1.00 33.17  ? 26  GLY B O     1 
ATOM   3156  H H     . GLY B 1 26  ? 32.623  -0.882  37.398  1.00 0.00   ? 26  GLY B H     1 
ATOM   3157  N N     . THR B 1 27  ? 34.845  0.162   40.889  1.00 26.02  ? 27  THR B N     1 
ATOM   3158  C CA    . THR B 1 27  ? 34.538  0.405   42.285  1.00 22.78  ? 27  THR B CA    1 
ATOM   3159  C C     . THR B 1 27  ? 33.650  1.651   42.389  1.00 23.61  ? 27  THR B C     1 
ATOM   3160  O O     . THR B 1 27  ? 32.915  1.824   43.361  1.00 22.36  ? 27  THR B O     1 
ATOM   3161  C CB    . THR B 1 27  ? 35.859  0.586   43.128  1.00 22.40  ? 27  THR B CB    1 
ATOM   3162  O OG1   . THR B 1 27  ? 36.674  1.647   42.651  1.00 19.68  ? 27  THR B OG1   1 
ATOM   3163  C CG2   . THR B 1 27  ? 36.628  -0.722  43.092  1.00 23.49  ? 27  THR B CG2   1 
ATOM   3164  H H     . THR B 1 27  ? 35.716  0.473   40.548  1.00 0.00   ? 27  THR B H     1 
ATOM   3165  H HG1   . THR B 1 27  ? 37.105  1.379   41.819  1.00 0.00   ? 27  THR B HG1   1 
ATOM   3166  N N     . GLY B 1 28  ? 33.657  2.527   41.389  1.00 22.10  ? 28  GLY B N     1 
ATOM   3167  C CA    . GLY B 1 28  ? 32.907  3.767   41.392  1.00 15.36  ? 28  GLY B CA    1 
ATOM   3168  C C     . GLY B 1 28  ? 33.876  4.939   41.472  1.00 14.05  ? 28  GLY B C     1 
ATOM   3169  O O     . GLY B 1 28  ? 33.464  6.110   41.535  1.00 10.34  ? 28  GLY B O     1 
ATOM   3170  H H     . GLY B 1 28  ? 34.294  2.356   40.653  1.00 0.00   ? 28  GLY B H     1 
ATOM   3171  N N     . GLU B 1 29  ? 35.183  4.677   41.446  1.00 15.29  ? 29  GLU B N     1 
ATOM   3172  C CA    . GLU B 1 29  ? 36.163  5.736   41.652  1.00 11.71  ? 29  GLU B CA    1 
ATOM   3173  C C     . GLU B 1 29  ? 36.297  6.557   40.390  1.00 7.97   ? 29  GLU B C     1 
ATOM   3174  O O     . GLU B 1 29  ? 36.179  7.787   40.456  1.00 7.80   ? 29  GLU B O     1 
ATOM   3175  C CB    . GLU B 1 29  ? 37.493  5.132   42.013  1.00 7.55   ? 29  GLU B CB    1 
ATOM   3176  C CG    . GLU B 1 29  ? 38.233  5.991   42.979  1.00 17.79  ? 29  GLU B CG    1 
ATOM   3177  C CD    . GLU B 1 29  ? 39.663  5.549   43.175  1.00 20.60  ? 29  GLU B CD    1 
ATOM   3178  O OE1   . GLU B 1 29  ? 39.908  4.622   43.940  1.00 29.68  ? 29  GLU B OE1   1 
ATOM   3179  O OE2   . GLU B 1 29  ? 40.535  6.147   42.558  1.00 23.81  ? 29  GLU B OE2   1 
ATOM   3180  H H     . GLU B 1 29  ? 35.539  3.785   41.197  1.00 0.00   ? 29  GLU B H     1 
ATOM   3181  N N     . LEU B 1 30  ? 36.490  5.947   39.221  1.00 8.12   ? 30  LEU B N     1 
ATOM   3182  C CA    . LEU B 1 30  ? 36.610  6.747   38.024  1.00 6.56   ? 30  LEU B CA    1 
ATOM   3183  C C     . LEU B 1 30  ? 35.295  7.461   37.799  1.00 6.77   ? 30  LEU B C     1 
ATOM   3184  O O     . LEU B 1 30  ? 35.372  8.651   37.517  1.00 6.22   ? 30  LEU B O     1 
ATOM   3185  C CB    . LEU B 1 30  ? 36.966  5.898   36.810  1.00 2.00   ? 30  LEU B CB    1 
ATOM   3186  C CG    . LEU B 1 30  ? 37.156  6.655   35.498  1.00 2.00   ? 30  LEU B CG    1 
ATOM   3187  C CD1   . LEU B 1 30  ? 38.175  7.757   35.594  1.00 3.76   ? 30  LEU B CD1   1 
ATOM   3188  C CD2   . LEU B 1 30  ? 37.658  5.678   34.479  1.00 4.71   ? 30  LEU B CD2   1 
ATOM   3189  H H     . LEU B 1 30  ? 36.684  4.971   39.217  1.00 0.00   ? 30  LEU B H     1 
ATOM   3190  N N     . THR B 1 31  ? 34.105  6.852   37.952  1.00 13.44  ? 31  THR B N     1 
ATOM   3191  C CA    . THR B 1 31  ? 32.804  7.542   37.872  1.00 11.79  ? 31  THR B CA    1 
ATOM   3192  C C     . THR B 1 31  ? 32.784  8.808   38.762  1.00 8.35   ? 31  THR B C     1 
ATOM   3193  O O     . THR B 1 31  ? 32.497  9.898   38.255  1.00 5.46   ? 31  THR B O     1 
ATOM   3194  C CB    . THR B 1 31  ? 31.704  6.543   38.298  1.00 12.94  ? 31  THR B CB    1 
ATOM   3195  O OG1   . THR B 1 31  ? 31.724  5.417   37.402  1.00 20.88  ? 31  THR B OG1   1 
ATOM   3196  C CG2   . THR B 1 31  ? 30.336  7.203   38.284  1.00 16.41  ? 31  THR B CG2   1 
ATOM   3197  H H     . THR B 1 31  ? 34.094  5.878   38.119  1.00 0.00   ? 31  THR B H     1 
ATOM   3198  H HG1   . THR B 1 31  ? 31.389  5.715   36.546  1.00 0.00   ? 31  THR B HG1   1 
ATOM   3199  N N     . GLN B 1 32  ? 33.137  8.740   40.067  1.00 7.03   ? 32  GLN B N     1 
ATOM   3200  C CA    . GLN B 1 32  ? 33.242  9.933   40.916  1.00 8.24   ? 32  GLN B CA    1 
ATOM   3201  C C     . GLN B 1 32  ? 34.203  10.997  40.443  1.00 11.07  ? 32  GLN B C     1 
ATOM   3202  O O     . GLN B 1 32  ? 34.000  12.204  40.674  1.00 11.22  ? 32  GLN B O     1 
ATOM   3203  C CB    . GLN B 1 32  ? 33.674  9.606   42.322  1.00 5.89   ? 32  GLN B CB    1 
ATOM   3204  C CG    . GLN B 1 32  ? 32.511  9.022   43.061  1.00 9.36   ? 32  GLN B CG    1 
ATOM   3205  C CD    . GLN B 1 32  ? 31.412  10.029  43.330  1.00 12.65  ? 32  GLN B CD    1 
ATOM   3206  O OE1   . GLN B 1 32  ? 31.109  10.260  44.490  1.00 18.82  ? 32  GLN B OE1   1 
ATOM   3207  N NE2   . GLN B 1 32  ? 30.694  10.647  42.398  1.00 12.14  ? 32  GLN B NE2   1 
ATOM   3208  H H     . GLN B 1 32  ? 33.379  7.869   40.457  1.00 0.00   ? 32  GLN B H     1 
ATOM   3209  H HE21  . GLN B 1 32  ? 30.057  11.314  42.721  1.00 0.00   ? 32  GLN B HE21  1 
ATOM   3210  H HE22  . GLN B 1 32  ? 30.817  10.441  41.449  1.00 0.00   ? 32  GLN B HE22  1 
ATOM   3211  N N     . LEU B 1 33  ? 35.247  10.525  39.766  1.00 11.29  ? 33  LEU B N     1 
ATOM   3212  C CA    . LEU B 1 33  ? 36.204  11.433  39.175  1.00 12.04  ? 33  LEU B CA    1 
ATOM   3213  C C     . LEU B 1 33  ? 35.582  12.134  37.968  1.00 12.09  ? 33  LEU B C     1 
ATOM   3214  O O     . LEU B 1 33  ? 35.619  13.373  37.907  1.00 14.90  ? 33  LEU B O     1 
ATOM   3215  C CB    . LEU B 1 33  ? 37.444  10.673  38.742  1.00 12.07  ? 33  LEU B CB    1 
ATOM   3216  C CG    . LEU B 1 33  ? 38.555  11.494  38.091  1.00 14.35  ? 33  LEU B CG    1 
ATOM   3217  C CD1   . LEU B 1 33  ? 39.035  12.519  39.078  1.00 20.31  ? 33  LEU B CD1   1 
ATOM   3218  C CD2   . LEU B 1 33  ? 39.725  10.628  37.746  1.00 15.41  ? 33  LEU B CD2   1 
ATOM   3219  H H     . LEU B 1 33  ? 35.385  9.556   39.683  1.00 0.00   ? 33  LEU B H     1 
ATOM   3220  N N     . LEU B 1 34  ? 34.997  11.417  36.998  1.00 10.78  ? 34  LEU B N     1 
ATOM   3221  C CA    . LEU B 1 34  ? 34.386  12.090  35.867  1.00 11.93  ? 34  LEU B CA    1 
ATOM   3222  C C     . LEU B 1 34  ? 33.268  13.019  36.291  1.00 10.46  ? 34  LEU B C     1 
ATOM   3223  O O     . LEU B 1 34  ? 33.164  14.095  35.689  1.00 7.11   ? 34  LEU B O     1 
ATOM   3224  C CB    . LEU B 1 34  ? 33.760  11.165  34.866  1.00 7.80   ? 34  LEU B CB    1 
ATOM   3225  C CG    . LEU B 1 34  ? 34.571  10.414  33.866  1.00 6.12   ? 34  LEU B CG    1 
ATOM   3226  C CD1   . LEU B 1 34  ? 35.846  11.159  33.563  1.00 6.65   ? 34  LEU B CD1   1 
ATOM   3227  C CD2   . LEU B 1 34  ? 34.828  9.040   34.411  1.00 14.01  ? 34  LEU B CD2   1 
ATOM   3228  H H     . LEU B 1 34  ? 34.988  10.442  37.058  1.00 0.00   ? 34  LEU B H     1 
ATOM   3229  N N     . ASN B 1 35  ? 32.486  12.684  37.338  1.00 6.84   ? 35  ASN B N     1 
ATOM   3230  C CA    . ASN B 1 35  ? 31.415  13.583  37.755  1.00 11.29  ? 35  ASN B CA    1 
ATOM   3231  C C     . ASN B 1 35  ? 31.999  14.886  38.260  1.00 13.62  ? 35  ASN B C     1 
ATOM   3232  O O     . ASN B 1 35  ? 31.593  15.954  37.803  1.00 18.09  ? 35  ASN B O     1 
ATOM   3233  C CB    . ASN B 1 35  ? 30.538  12.966  38.857  1.00 16.95  ? 35  ASN B CB    1 
ATOM   3234  C CG    . ASN B 1 35  ? 29.582  11.840  38.422  1.00 19.52  ? 35  ASN B CG    1 
ATOM   3235  O OD1   . ASN B 1 35  ? 29.136  11.052  39.274  1.00 16.18  ? 35  ASN B OD1   1 
ATOM   3236  N ND2   . ASN B 1 35  ? 29.193  11.688  37.152  1.00 15.11  ? 35  ASN B ND2   1 
ATOM   3237  H H     . ASN B 1 35  ? 32.630  11.824  37.786  1.00 0.00   ? 35  ASN B H     1 
ATOM   3238  H HD21  . ASN B 1 35  ? 28.778  10.840  36.894  1.00 0.00   ? 35  ASN B HD21  1 
ATOM   3239  H HD22  . ASN B 1 35  ? 29.375  12.412  36.510  1.00 0.00   ? 35  ASN B HD22  1 
ATOM   3240  N N     . SER B 1 36  ? 33.044  14.861  39.089  1.00 18.48  ? 36  SER B N     1 
ATOM   3241  C CA    . SER B 1 36  ? 33.685  16.065  39.611  1.00 19.01  ? 36  SER B CA    1 
ATOM   3242  C C     . SER B 1 36  ? 34.202  16.954  38.491  1.00 20.54  ? 36  SER B C     1 
ATOM   3243  O O     . SER B 1 36  ? 34.029  18.178  38.490  1.00 23.12  ? 36  SER B O     1 
ATOM   3244  C CB    . SER B 1 36  ? 34.804  15.610  40.546  1.00 13.74  ? 36  SER B CB    1 
ATOM   3245  O OG    . SER B 1 36  ? 34.210  14.782  41.564  1.00 14.02  ? 36  SER B OG    1 
ATOM   3246  H H     . SER B 1 36  ? 33.401  14.000  39.409  1.00 0.00   ? 36  SER B H     1 
ATOM   3247  H HG    . SER B 1 36  ? 33.487  15.269  41.966  1.00 0.00   ? 36  SER B HG    1 
ATOM   3248  N N     . LEU B 1 37  ? 34.759  16.310  37.480  1.00 22.38  ? 37  LEU B N     1 
ATOM   3249  C CA    . LEU B 1 37  ? 35.244  16.992  36.304  1.00 22.54  ? 37  LEU B CA    1 
ATOM   3250  C C     . LEU B 1 37  ? 34.063  17.671  35.592  1.00 19.73  ? 37  LEU B C     1 
ATOM   3251  O O     . LEU B 1 37  ? 34.165  18.835  35.213  1.00 23.66  ? 37  LEU B O     1 
ATOM   3252  C CB    . LEU B 1 37  ? 35.930  15.905  35.500  1.00 26.33  ? 37  LEU B CB    1 
ATOM   3253  C CG    . LEU B 1 37  ? 37.148  16.139  34.633  1.00 26.56  ? 37  LEU B CG    1 
ATOM   3254  C CD1   . LEU B 1 37  ? 36.783  17.070  33.503  1.00 26.22  ? 37  LEU B CD1   1 
ATOM   3255  C CD2   . LEU B 1 37  ? 38.264  16.699  35.472  1.00 26.07  ? 37  LEU B CD2   1 
ATOM   3256  H H     . LEU B 1 37  ? 34.862  15.334  37.542  1.00 0.00   ? 37  LEU B H     1 
ATOM   3257  N N     . CYS B 1 38  ? 32.907  17.019  35.457  1.00 19.24  ? 38  CYS B N     1 
ATOM   3258  C CA    . CYS B 1 38  ? 31.700  17.581  34.836  1.00 16.81  ? 38  CYS B CA    1 
ATOM   3259  C C     . CYS B 1 38  ? 31.223  18.837  35.557  1.00 11.40  ? 38  CYS B C     1 
ATOM   3260  O O     . CYS B 1 38  ? 30.994  19.865  34.910  1.00 15.61  ? 38  CYS B O     1 
ATOM   3261  C CB    . CYS B 1 38  ? 30.606  16.480  34.824  1.00 22.92  ? 38  CYS B CB    1 
ATOM   3262  S SG    . CYS B 1 38  ? 28.838  16.920  34.647  1.00 29.81  ? 38  CYS B SG    1 
ATOM   3263  H H     . CYS B 1 38  ? 32.868  16.099  35.799  1.00 0.00   ? 38  CYS B H     1 
ATOM   3264  N N     . THR B 1 39  ? 31.116  18.822  36.891  1.00 7.02   ? 39  THR B N     1 
ATOM   3265  C CA    . THR B 1 39  ? 30.718  19.988  37.665  1.00 3.66   ? 39  THR B CA    1 
ATOM   3266  C C     . THR B 1 39  ? 31.701  21.128  37.410  1.00 8.14   ? 39  THR B C     1 
ATOM   3267  O O     . THR B 1 39  ? 31.299  22.265  37.113  1.00 8.32   ? 39  THR B O     1 
ATOM   3268  C CB    . THR B 1 39  ? 30.688  19.602  39.162  1.00 2.21   ? 39  THR B CB    1 
ATOM   3269  O OG1   . THR B 1 39  ? 29.828  18.473  39.260  1.00 9.55   ? 39  THR B OG1   1 
ATOM   3270  C CG2   . THR B 1 39  ? 30.179  20.701  40.080  1.00 2.00   ? 39  THR B CG2   1 
ATOM   3271  H H     . THR B 1 39  ? 31.323  17.990  37.373  1.00 0.00   ? 39  THR B H     1 
ATOM   3272  H HG1   . THR B 1 39  ? 29.153  18.481  38.567  1.00 0.00   ? 39  THR B HG1   1 
ATOM   3273  N N     . ALA B 1 40  ? 32.999  20.823  37.443  1.00 3.62   ? 40  ALA B N     1 
ATOM   3274  C CA    . ALA B 1 40  ? 34.000  21.837  37.190  1.00 6.73   ? 40  ALA B CA    1 
ATOM   3275  C C     . ALA B 1 40  ? 33.806  22.494  35.836  1.00 7.42   ? 40  ALA B C     1 
ATOM   3276  O O     . ALA B 1 40  ? 33.743  23.723  35.773  1.00 12.39  ? 40  ALA B O     1 
ATOM   3277  C CB    . ALA B 1 40  ? 35.388  21.230  37.220  1.00 8.78   ? 40  ALA B CB    1 
ATOM   3278  H H     . ALA B 1 40  ? 33.292  19.907  37.638  1.00 0.00   ? 40  ALA B H     1 
ATOM   3279  N N     . VAL B 1 41  ? 33.598  21.715  34.777  1.00 5.48   ? 41  VAL B N     1 
ATOM   3280  C CA    . VAL B 1 41  ? 33.414  22.275  33.453  1.00 8.31   ? 41  VAL B CA    1 
ATOM   3281  C C     . VAL B 1 41  ? 32.196  23.184  33.410  1.00 12.30  ? 41  VAL B C     1 
ATOM   3282  O O     . VAL B 1 41  ? 32.269  24.241  32.789  1.00 16.36  ? 41  VAL B O     1 
ATOM   3283  C CB    . VAL B 1 41  ? 33.303  21.106  32.472  1.00 10.68  ? 41  VAL B CB    1 
ATOM   3284  C CG1   . VAL B 1 41  ? 32.885  21.541  31.082  1.00 2.82   ? 41  VAL B CG1   1 
ATOM   3285  C CG2   . VAL B 1 41  ? 34.693  20.484  32.378  1.00 9.54   ? 41  VAL B CG2   1 
ATOM   3286  H H     . VAL B 1 41  ? 33.579  20.740  34.899  1.00 0.00   ? 41  VAL B H     1 
ATOM   3287  N N     . LYS B 1 42  ? 31.076  22.879  34.078  1.00 11.05  ? 42  LYS B N     1 
ATOM   3288  C CA    . LYS B 1 42  ? 29.932  23.781  34.115  1.00 4.49   ? 42  LYS B CA    1 
ATOM   3289  C C     . LYS B 1 42  ? 30.235  25.084  34.839  1.00 4.49   ? 42  LYS B C     1 
ATOM   3290  O O     . LYS B 1 42  ? 29.904  26.185  34.403  1.00 9.24   ? 42  LYS B O     1 
ATOM   3291  C CB    . LYS B 1 42  ? 28.762  23.110  34.808  1.00 9.45   ? 42  LYS B CB    1 
ATOM   3292  C CG    . LYS B 1 42  ? 28.193  21.964  34.011  1.00 4.98   ? 42  LYS B CG    1 
ATOM   3293  C CD    . LYS B 1 42  ? 26.834  21.501  34.512  1.00 8.32   ? 42  LYS B CD    1 
ATOM   3294  C CE    . LYS B 1 42  ? 26.913  20.787  35.831  1.00 2.00   ? 42  LYS B CE    1 
ATOM   3295  N NZ    . LYS B 1 42  ? 25.633  20.214  36.132  1.00 2.00   ? 42  LYS B NZ    1 
ATOM   3296  H H     . LYS B 1 42  ? 31.038  22.013  34.540  1.00 0.00   ? 42  LYS B H     1 
ATOM   3297  H HZ1   . LYS B 1 42  ? 25.346  19.591  35.350  1.00 0.00   ? 42  LYS B HZ1   1 
ATOM   3298  H HZ2   . LYS B 1 42  ? 25.678  19.663  37.009  1.00 0.00   ? 42  LYS B HZ2   1 
ATOM   3299  H HZ3   . LYS B 1 42  ? 24.936  20.979  36.235  1.00 0.00   ? 42  LYS B HZ3   1 
ATOM   3300  N N     . ALA B 1 43  ? 30.935  25.007  35.952  1.00 6.57   ? 43  ALA B N     1 
ATOM   3301  C CA    . ALA B 1 43  ? 31.309  26.177  36.716  1.00 4.32   ? 43  ALA B CA    1 
ATOM   3302  C C     . ALA B 1 43  ? 32.245  27.053  35.911  1.00 8.56   ? 43  ALA B C     1 
ATOM   3303  O O     . ALA B 1 43  ? 32.119  28.288  35.973  1.00 8.49   ? 43  ALA B O     1 
ATOM   3304  C CB    . ALA B 1 43  ? 31.994  25.734  37.991  1.00 2.00   ? 43  ALA B CB    1 
ATOM   3305  H H     . ALA B 1 43  ? 31.228  24.120  36.258  1.00 0.00   ? 43  ALA B H     1 
ATOM   3306  N N     . ILE B 1 44  ? 33.148  26.437  35.120  1.00 7.63   ? 44  ILE B N     1 
ATOM   3307  C CA    . ILE B 1 44  ? 34.035  27.201  34.254  1.00 3.40   ? 44  ILE B CA    1 
ATOM   3308  C C     . ILE B 1 44  ? 33.190  27.777  33.144  1.00 6.21   ? 44  ILE B C     1 
ATOM   3309  O O     . ILE B 1 44  ? 33.324  28.976  32.897  1.00 15.76  ? 44  ILE B O     1 
ATOM   3310  C CB    . ILE B 1 44  ? 35.161  26.315  33.676  1.00 5.72   ? 44  ILE B CB    1 
ATOM   3311  C CG1   . ILE B 1 44  ? 36.089  25.889  34.805  1.00 2.00   ? 44  ILE B CG1   1 
ATOM   3312  C CG2   . ILE B 1 44  ? 36.060  27.092  32.701  1.00 2.38   ? 44  ILE B CG2   1 
ATOM   3313  C CD1   . ILE B 1 44  ? 36.973  24.675  34.430  1.00 3.49   ? 44  ILE B CD1   1 
ATOM   3314  H H     . ILE B 1 44  ? 33.217  25.460  35.142  1.00 0.00   ? 44  ILE B H     1 
ATOM   3315  N N     . SER B 1 45  ? 32.247  27.063  32.520  1.00 12.65  ? 45  SER B N     1 
ATOM   3316  C CA    . SER B 1 45  ? 31.415  27.605  31.445  1.00 13.33  ? 45  SER B CA    1 
ATOM   3317  C C     . SER B 1 45  ? 30.653  28.851  31.883  1.00 16.84  ? 45  SER B C     1 
ATOM   3318  O O     . SER B 1 45  ? 30.680  29.879  31.194  1.00 21.71  ? 45  SER B O     1 
ATOM   3319  C CB    . SER B 1 45  ? 30.419  26.559  30.972  1.00 12.06  ? 45  SER B CB    1 
ATOM   3320  O OG    . SER B 1 45  ? 29.756  27.051  29.806  1.00 9.81   ? 45  SER B OG    1 
ATOM   3321  H H     . SER B 1 45  ? 32.118  26.131  32.790  1.00 0.00   ? 45  SER B H     1 
ATOM   3322  H HG    . SER B 1 45  ? 30.419  27.371  29.180  1.00 0.00   ? 45  SER B HG    1 
ATOM   3323  N N     . SER B 1 46  ? 30.038  28.820  33.061  1.00 15.30  ? 46  SER B N     1 
ATOM   3324  C CA    . SER B 1 46  ? 29.325  29.967  33.595  1.00 13.43  ? 46  SER B CA    1 
ATOM   3325  C C     . SER B 1 46  ? 30.285  31.155  33.758  1.00 11.51  ? 46  SER B C     1 
ATOM   3326  O O     . SER B 1 46  ? 29.950  32.281  33.377  1.00 12.84  ? 46  SER B O     1 
ATOM   3327  C CB    . SER B 1 46  ? 28.677  29.509  34.932  1.00 8.30   ? 46  SER B CB    1 
ATOM   3328  O OG    . SER B 1 46  ? 27.965  30.541  35.612  1.00 14.27  ? 46  SER B OG    1 
ATOM   3329  H H     . SER B 1 46  ? 29.987  27.975  33.557  1.00 0.00   ? 46  SER B H     1 
ATOM   3330  H HG    . SER B 1 46  ? 28.457  31.363  35.588  1.00 0.00   ? 46  SER B HG    1 
ATOM   3331  N N     . ALA B 1 47  ? 31.504  30.957  34.263  1.00 10.08  ? 47  ALA B N     1 
ATOM   3332  C CA    . ALA B 1 47  ? 32.443  32.035  34.439  1.00 8.56   ? 47  ALA B CA    1 
ATOM   3333  C C     . ALA B 1 47  ? 33.008  32.539  33.105  1.00 11.57  ? 47  ALA B C     1 
ATOM   3334  O O     . ALA B 1 47  ? 33.270  33.743  32.948  1.00 8.47   ? 47  ALA B O     1 
ATOM   3335  C CB    . ALA B 1 47  ? 33.569  31.551  35.327  1.00 9.85   ? 47  ALA B CB    1 
ATOM   3336  H H     . ALA B 1 47  ? 31.787  30.042  34.484  1.00 0.00   ? 47  ALA B H     1 
ATOM   3337  N N     . VAL B 1 48  ? 33.154  31.672  32.093  1.00 6.38   ? 48  VAL B N     1 
ATOM   3338  C CA    . VAL B 1 48  ? 33.655  32.115  30.789  1.00 6.29   ? 48  VAL B CA    1 
ATOM   3339  C C     . VAL B 1 48  ? 32.629  33.028  30.138  1.00 6.83   ? 48  VAL B C     1 
ATOM   3340  O O     . VAL B 1 48  ? 32.998  34.050  29.583  1.00 6.98   ? 48  VAL B O     1 
ATOM   3341  C CB    . VAL B 1 48  ? 33.957  30.864  29.919  1.00 9.07   ? 48  VAL B CB    1 
ATOM   3342  C CG1   . VAL B 1 48  ? 34.310  31.195  28.481  1.00 7.72   ? 48  VAL B CG1   1 
ATOM   3343  C CG2   . VAL B 1 48  ? 35.191  30.190  30.524  1.00 6.55   ? 48  VAL B CG2   1 
ATOM   3344  H H     . VAL B 1 48  ? 32.915  30.733  32.224  1.00 0.00   ? 48  VAL B H     1 
ATOM   3345  N N     . ARG B 1 49  ? 31.342  32.711  30.265  1.00 8.27   ? 49  ARG B N     1 
ATOM   3346  C CA    . ARG B 1 49  ? 30.231  33.519  29.773  1.00 8.20   ? 49  ARG B CA    1 
ATOM   3347  C C     . ARG B 1 49  ? 29.949  34.827  30.474  1.00 7.49   ? 49  ARG B C     1 
ATOM   3348  O O     . ARG B 1 49  ? 28.990  35.529  30.144  1.00 9.54   ? 49  ARG B O     1 
ATOM   3349  C CB    . ARG B 1 49  ? 28.933  32.742  29.809  1.00 7.70   ? 49  ARG B CB    1 
ATOM   3350  C CG    . ARG B 1 49  ? 28.691  32.106  28.481  1.00 4.51   ? 49  ARG B CG    1 
ATOM   3351  C CD    . ARG B 1 49  ? 29.505  30.869  28.317  1.00 2.00   ? 49  ARG B CD    1 
ATOM   3352  N NE    . ARG B 1 49  ? 29.469  30.670  26.895  1.00 12.15  ? 49  ARG B NE    1 
ATOM   3353  C CZ    . ARG B 1 49  ? 29.871  29.552  26.340  1.00 9.30   ? 49  ARG B CZ    1 
ATOM   3354  N NH1   . ARG B 1 49  ? 30.267  28.537  27.078  1.00 15.10  ? 49  ARG B NH1   1 
ATOM   3355  N NH2   . ARG B 1 49  ? 29.832  29.447  25.028  1.00 12.60  ? 49  ARG B NH2   1 
ATOM   3356  H H     . ARG B 1 49  ? 31.130  31.846  30.675  1.00 0.00   ? 49  ARG B H     1 
ATOM   3357  H HE    . ARG B 1 49  ? 29.145  31.391  26.315  1.00 0.00   ? 49  ARG B HE    1 
ATOM   3358  H HH11  . ARG B 1 49  ? 30.265  28.601  28.076  1.00 0.00   ? 49  ARG B HH11  1 
ATOM   3359  H HH12  . ARG B 1 49  ? 30.578  27.696  26.636  1.00 0.00   ? 49  ARG B HH12  1 
ATOM   3360  H HH21  . ARG B 1 49  ? 29.510  30.216  24.476  1.00 0.00   ? 49  ARG B HH21  1 
ATOM   3361  H HH22  . ARG B 1 49  ? 30.137  28.605  24.582  1.00 0.00   ? 49  ARG B HH22  1 
ATOM   3362  N N     . LYS B 1 50  ? 30.772  35.135  31.466  1.00 10.62  ? 50  LYS B N     1 
ATOM   3363  C CA    . LYS B 1 50  ? 30.719  36.375  32.217  1.00 13.18  ? 50  LYS B CA    1 
ATOM   3364  C C     . LYS B 1 50  ? 29.459  36.612  33.028  1.00 11.43  ? 50  LYS B C     1 
ATOM   3365  O O     . LYS B 1 50  ? 28.996  37.745  33.266  1.00 11.00  ? 50  LYS B O     1 
ATOM   3366  C CB    . LYS B 1 50  ? 30.989  37.557  31.238  1.00 9.35   ? 50  LYS B CB    1 
ATOM   3367  C CG    . LYS B 1 50  ? 32.439  37.610  30.750  1.00 10.15  ? 50  LYS B CG    1 
ATOM   3368  C CD    . LYS B 1 50  ? 33.371  37.517  31.966  1.00 15.93  ? 50  LYS B CD    1 
ATOM   3369  C CE    . LYS B 1 50  ? 34.818  37.991  31.797  1.00 15.97  ? 50  LYS B CE    1 
ATOM   3370  N NZ    . LYS B 1 50  ? 35.589  37.091  30.972  1.00 21.57  ? 50  LYS B NZ    1 
ATOM   3371  H H     . LYS B 1 50  ? 31.505  34.521  31.683  1.00 0.00   ? 50  LYS B H     1 
ATOM   3372  H HZ1   . LYS B 1 50  ? 35.602  36.147  31.409  1.00 0.00   ? 50  LYS B HZ1   1 
ATOM   3373  H HZ2   . LYS B 1 50  ? 35.154  37.027  30.029  1.00 0.00   ? 50  LYS B HZ2   1 
ATOM   3374  H HZ3   . LYS B 1 50  ? 36.563  37.447  30.878  1.00 0.00   ? 50  LYS B HZ3   1 
ATOM   3375  N N     . ALA B 1 51  ? 28.960  35.501  33.576  1.00 9.07   ? 51  ALA B N     1 
ATOM   3376  C CA    . ALA B 1 51  ? 27.772  35.526  34.409  1.00 11.16  ? 51  ALA B CA    1 
ATOM   3377  C C     . ALA B 1 51  ? 28.131  36.217  35.694  1.00 10.64  ? 51  ALA B C     1 
ATOM   3378  O O     . ALA B 1 51  ? 28.868  35.698  36.513  1.00 15.55  ? 51  ALA B O     1 
ATOM   3379  C CB    . ALA B 1 51  ? 27.306  34.130  34.742  1.00 10.84  ? 51  ALA B CB    1 
ATOM   3380  H H     . ALA B 1 51  ? 29.441  34.653  33.470  1.00 0.00   ? 51  ALA B H     1 
ATOM   3381  N N     . GLY B 1 52  ? 27.751  37.465  35.799  1.00 15.35  ? 52  GLY B N     1 
ATOM   3382  C CA    . GLY B 1 52  ? 27.982  38.206  37.024  1.00 18.25  ? 52  GLY B CA    1 
ATOM   3383  C C     . GLY B 1 52  ? 28.949  39.370  36.858  1.00 19.14  ? 52  GLY B C     1 
ATOM   3384  O O     . GLY B 1 52  ? 29.225  40.045  37.858  1.00 18.35  ? 52  GLY B O     1 
ATOM   3385  H H     . GLY B 1 52  ? 27.503  37.920  34.972  1.00 0.00   ? 52  GLY B H     1 
ATOM   3386  N N     . ILE B 1 53  ? 29.433  39.706  35.641  1.00 19.27  ? 53  ILE B N     1 
ATOM   3387  C CA    . ILE B 1 53  ? 30.365  40.835  35.556  1.00 24.54  ? 53  ILE B CA    1 
ATOM   3388  C C     . ILE B 1 53  ? 29.754  42.155  35.970  1.00 22.22  ? 53  ILE B C     1 
ATOM   3389  O O     . ILE B 1 53  ? 30.497  43.099  36.215  1.00 25.33  ? 53  ILE B O     1 
ATOM   3390  C CB    . ILE B 1 53  ? 30.997  41.149  34.152  1.00 27.36  ? 53  ILE B CB    1 
ATOM   3391  C CG1   . ILE B 1 53  ? 30.160  40.676  32.990  1.00 24.98  ? 53  ILE B CG1   1 
ATOM   3392  C CG2   . ILE B 1 53  ? 32.400  40.581  34.183  1.00 29.91  ? 53  ILE B CG2   1 
ATOM   3393  C CD1   . ILE B 1 53  ? 28.976  41.588  32.687  1.00 23.23  ? 53  ILE B CD1   1 
ATOM   3394  H H     . ILE B 1 53  ? 29.246  39.150  34.854  1.00 0.00   ? 53  ILE B H     1 
ATOM   3395  N N     . ALA B 1 54  ? 28.431  42.268  36.103  1.00 20.61  ? 54  ALA B N     1 
ATOM   3396  C CA    . ALA B 1 54  ? 27.792  43.488  36.569  1.00 17.57  ? 54  ALA B CA    1 
ATOM   3397  C C     . ALA B 1 54  ? 28.207  43.782  37.990  1.00 16.98  ? 54  ALA B C     1 
ATOM   3398  O O     . ALA B 1 54  ? 28.304  44.932  38.415  1.00 15.37  ? 54  ALA B O     1 
ATOM   3399  C CB    . ALA B 1 54  ? 26.312  43.330  36.552  1.00 16.78  ? 54  ALA B CB    1 
ATOM   3400  H H     . ALA B 1 54  ? 27.876  41.511  35.841  1.00 0.00   ? 54  ALA B H     1 
ATOM   3401  N N     . HIS B 1 55  ? 28.459  42.721  38.751  1.00 16.53  ? 55  HIS B N     1 
ATOM   3402  C CA    . HIS B 1 55  ? 28.926  42.881  40.098  1.00 19.72  ? 55  HIS B CA    1 
ATOM   3403  C C     . HIS B 1 55  ? 30.371  43.320  40.146  1.00 20.83  ? 55  HIS B C     1 
ATOM   3404  O O     . HIS B 1 55  ? 30.790  43.890  41.155  1.00 23.62  ? 55  HIS B O     1 
ATOM   3405  C CB    . HIS B 1 55  ? 28.747  41.590  40.823  1.00 25.69  ? 55  HIS B CB    1 
ATOM   3406  C CG    . HIS B 1 55  ? 27.391  41.588  41.501  1.00 33.36  ? 55  HIS B CG    1 
ATOM   3407  N ND1   . HIS B 1 55  ? 26.319  41.010  40.975  1.00 37.25  ? 55  HIS B ND1   1 
ATOM   3408  C CD2   . HIS B 1 55  ? 27.064  42.108  42.730  1.00 33.70  ? 55  HIS B CD2   1 
ATOM   3409  C CE1   . HIS B 1 55  ? 25.351  41.145  41.850  1.00 36.23  ? 55  HIS B CE1   1 
ATOM   3410  N NE2   . HIS B 1 55  ? 25.806  41.800  42.897  1.00 34.24  ? 55  HIS B NE2   1 
ATOM   3411  H H     . HIS B 1 55  ? 28.402  41.821  38.367  1.00 0.00   ? 55  HIS B H     1 
ATOM   3412  H HD1   . HIS B 1 55  ? 26.252  40.532  40.112  1.00 0.00   ? 55  HIS B HD1   1 
ATOM   3413  H HE2   . HIS B 1 55  ? 25.264  42.011  43.688  1.00 0.00   ? 55  HIS B HE2   1 
ATOM   3414  N N     . LEU B 1 56  ? 31.147  43.081  39.086  1.00 24.38  ? 56  LEU B N     1 
ATOM   3415  C CA    . LEU B 1 56  ? 32.501  43.616  39.008  1.00 26.84  ? 56  LEU B CA    1 
ATOM   3416  C C     . LEU B 1 56  ? 32.385  45.090  38.701  1.00 24.86  ? 56  LEU B C     1 
ATOM   3417  O O     . LEU B 1 56  ? 32.860  45.929  39.449  1.00 31.69  ? 56  LEU B O     1 
ATOM   3418  C CB    . LEU B 1 56  ? 33.341  43.020  37.897  1.00 28.12  ? 56  LEU B CB    1 
ATOM   3419  C CG    . LEU B 1 56  ? 33.865  41.621  38.068  1.00 34.01  ? 56  LEU B CG    1 
ATOM   3420  C CD1   . LEU B 1 56  ? 34.884  41.380  36.967  1.00 36.58  ? 56  LEU B CD1   1 
ATOM   3421  C CD2   . LEU B 1 56  ? 34.536  41.444  39.424  1.00 33.89  ? 56  LEU B CD2   1 
ATOM   3422  H H     . LEU B 1 56  ? 30.798  42.566  38.334  1.00 0.00   ? 56  LEU B H     1 
ATOM   3423  N N     . TYR B 1 57  ? 31.673  45.457  37.656  1.00 23.81  ? 57  TYR B N     1 
ATOM   3424  C CA    . TYR B 1 57  ? 31.473  46.842  37.282  1.00 25.63  ? 57  TYR B CA    1 
ATOM   3425  C C     . TYR B 1 57  ? 30.624  47.718  38.229  1.00 28.56  ? 57  TYR B C     1 
ATOM   3426  O O     . TYR B 1 57  ? 30.138  48.785  37.829  1.00 28.75  ? 57  TYR B O     1 
ATOM   3427  C CB    . TYR B 1 57  ? 30.901  46.806  35.858  1.00 25.24  ? 57  TYR B CB    1 
ATOM   3428  C CG    . TYR B 1 57  ? 31.972  46.384  34.852  1.00 28.13  ? 57  TYR B CG    1 
ATOM   3429  C CD1   . TYR B 1 57  ? 32.236  45.045  34.632  1.00 22.30  ? 57  TYR B CD1   1 
ATOM   3430  C CD2   . TYR B 1 57  ? 32.742  47.362  34.233  1.00 27.78  ? 57  TYR B CD2   1 
ATOM   3431  C CE1   . TYR B 1 57  ? 33.313  44.683  33.869  1.00 21.09  ? 57  TYR B CE1   1 
ATOM   3432  C CE2   . TYR B 1 57  ? 33.822  47.002  33.458  1.00 21.59  ? 57  TYR B CE2   1 
ATOM   3433  C CZ    . TYR B 1 57  ? 34.101  45.665  33.321  1.00 20.65  ? 57  TYR B CZ    1 
ATOM   3434  O OH    . TYR B 1 57  ? 35.228  45.299  32.640  1.00 20.23  ? 57  TYR B OH    1 
ATOM   3435  H H     . TYR B 1 57  ? 31.233  44.761  37.124  1.00 0.00   ? 57  TYR B H     1 
ATOM   3436  H HH    . TYR B 1 57  ? 35.250  44.329  32.561  1.00 0.00   ? 57  TYR B HH    1 
ATOM   3437  N N     . GLY B 1 58  ? 30.440  47.305  39.497  1.00 29.29  ? 58  GLY B N     1 
ATOM   3438  C CA    . GLY B 1 58  ? 29.774  48.082  40.537  1.00 28.72  ? 58  GLY B CA    1 
ATOM   3439  C C     . GLY B 1 58  ? 28.257  48.239  40.514  1.00 26.70  ? 58  GLY B C     1 
ATOM   3440  O O     . GLY B 1 58  ? 27.742  49.293  40.920  1.00 26.65  ? 58  GLY B O     1 
ATOM   3441  H H     . GLY B 1 58  ? 30.863  46.476  39.786  1.00 0.00   ? 58  GLY B H     1 
ATOM   3442  N N     . ILE B 1 59  ? 27.512  47.208  40.086  1.00 25.34  ? 59  ILE B N     1 
ATOM   3443  C CA    . ILE B 1 59  ? 26.056  47.288  40.085  1.00 20.51  ? 59  ILE B CA    1 
ATOM   3444  C C     . ILE B 1 59  ? 25.511  47.410  41.505  1.00 22.56  ? 59  ILE B C     1 
ATOM   3445  O O     . ILE B 1 59  ? 24.470  48.019  41.713  1.00 22.51  ? 59  ILE B O     1 
ATOM   3446  C CB    . ILE B 1 59  ? 25.489  46.038  39.359  1.00 16.05  ? 59  ILE B CB    1 
ATOM   3447  C CG1   . ILE B 1 59  ? 24.053  46.312  39.012  1.00 9.60   ? 59  ILE B CG1   1 
ATOM   3448  C CG2   . ILE B 1 59  ? 25.608  44.779  40.212  1.00 12.18  ? 59  ILE B CG2   1 
ATOM   3449  C CD1   . ILE B 1 59  ? 23.489  45.298  38.024  1.00 13.58  ? 59  ILE B CD1   1 
ATOM   3450  H H     . ILE B 1 59  ? 27.964  46.446  39.669  1.00 0.00   ? 59  ILE B H     1 
ATOM   3451  N N     . ALA B 1 60  ? 26.212  46.896  42.516  1.00 22.82  ? 60  ALA B N     1 
ATOM   3452  C CA    . ALA B 1 60  ? 25.707  46.945  43.871  1.00 22.40  ? 60  ALA B CA    1 
ATOM   3453  C C     . ALA B 1 60  ? 26.656  47.711  44.774  1.00 27.52  ? 60  ALA B C     1 
ATOM   3454  O O     . ALA B 1 60  ? 26.794  47.425  45.974  1.00 24.67  ? 60  ALA B O     1 
ATOM   3455  C CB    . ALA B 1 60  ? 25.550  45.543  44.391  1.00 19.52  ? 60  ALA B CB    1 
ATOM   3456  H H     . ALA B 1 60  ? 27.135  46.609  42.371  1.00 0.00   ? 60  ALA B H     1 
ATOM   3457  N N     . GLY B 1 61  ? 27.292  48.712  44.165  1.00 32.78  ? 61  GLY B N     1 
ATOM   3458  C CA    . GLY B 1 61  ? 28.252  49.535  44.878  1.00 42.33  ? 61  GLY B CA    1 
ATOM   3459  C C     . GLY B 1 61  ? 29.685  49.160  44.524  1.00 48.95  ? 61  GLY B C     1 
ATOM   3460  O O     . GLY B 1 61  ? 29.902  48.113  43.900  1.00 52.57  ? 61  GLY B O     1 
ATOM   3461  H H     . GLY B 1 61  ? 27.223  48.845  43.199  1.00 0.00   ? 61  GLY B H     1 
ATOM   3462  N N     . LYS B 1 72  ? 42.616  36.583  36.080  1.00 40.64  ? 72  LYS B N     1 
ATOM   3463  C CA    . LYS B 1 72  ? 41.911  35.766  37.048  1.00 40.90  ? 72  LYS B CA    1 
ATOM   3464  C C     . LYS B 1 72  ? 41.080  34.629  36.468  1.00 36.96  ? 72  LYS B C     1 
ATOM   3465  O O     . LYS B 1 72  ? 41.149  33.574  37.072  1.00 34.04  ? 72  LYS B O     1 
ATOM   3466  C CB    . LYS B 1 72  ? 40.988  36.626  37.927  1.00 43.86  ? 72  LYS B CB    1 
ATOM   3467  C CG    . LYS B 1 72  ? 40.699  35.904  39.245  1.00 50.24  ? 72  LYS B CG    1 
ATOM   3468  C CD    . LYS B 1 72  ? 40.064  36.758  40.327  1.00 55.49  ? 72  LYS B CD    1 
ATOM   3469  C CE    . LYS B 1 72  ? 38.625  37.099  39.986  1.00 60.49  ? 72  LYS B CE    1 
ATOM   3470  N NZ    . LYS B 1 72  ? 37.999  37.812  41.085  1.00 63.78  ? 72  LYS B NZ    1 
ATOM   3471  H HZ1   . LYS B 1 72  ? 38.527  38.687  41.277  1.00 0.00   ? 72  LYS B HZ1   1 
ATOM   3472  H HZ2   . LYS B 1 72  ? 37.019  38.045  40.827  1.00 0.00   ? 72  LYS B HZ2   1 
ATOM   3473  H HZ3   . LYS B 1 72  ? 38.000  37.211  41.934  1.00 0.00   ? 72  LYS B HZ3   1 
ATOM   3474  N N     . LEU B 1 73  ? 40.353  34.695  35.344  1.00 34.68  ? 73  LEU B N     1 
ATOM   3475  C CA    . LEU B 1 73  ? 39.555  33.564  34.872  1.00 30.62  ? 73  LEU B CA    1 
ATOM   3476  C C     . LEU B 1 73  ? 40.320  32.255  34.721  1.00 28.04  ? 73  LEU B C     1 
ATOM   3477  O O     . LEU B 1 73  ? 39.866  31.225  35.196  1.00 25.89  ? 73  LEU B O     1 
ATOM   3478  C CB    . LEU B 1 73  ? 38.907  33.965  33.553  1.00 31.31  ? 73  LEU B CB    1 
ATOM   3479  C CG    . LEU B 1 73  ? 37.824  33.113  32.887  1.00 31.28  ? 73  LEU B CG    1 
ATOM   3480  C CD1   . LEU B 1 73  ? 36.824  32.583  33.902  1.00 33.17  ? 73  LEU B CD1   1 
ATOM   3481  C CD2   . LEU B 1 73  ? 37.113  33.984  31.862  1.00 31.65  ? 73  LEU B CD2   1 
ATOM   3482  H H     . LEU B 1 73  ? 40.215  35.537  34.869  1.00 0.00   ? 73  LEU B H     1 
ATOM   3483  N N     . ASP B 1 74  ? 41.520  32.253  34.155  1.00 27.90  ? 74  ASP B N     1 
ATOM   3484  C CA    . ASP B 1 74  ? 42.330  31.042  34.081  1.00 25.64  ? 74  ASP B CA    1 
ATOM   3485  C C     . ASP B 1 74  ? 42.820  30.556  35.435  1.00 16.19  ? 74  ASP B C     1 
ATOM   3486  O O     . ASP B 1 74  ? 43.019  29.360  35.635  1.00 15.39  ? 74  ASP B O     1 
ATOM   3487  C CB    . ASP B 1 74  ? 43.523  31.281  33.146  1.00 37.14  ? 74  ASP B CB    1 
ATOM   3488  C CG    . ASP B 1 74  ? 44.423  32.442  33.533  1.00 46.50  ? 74  ASP B CG    1 
ATOM   3489  O OD1   . ASP B 1 74  ? 43.968  33.589  33.477  1.00 53.51  ? 74  ASP B OD1   1 
ATOM   3490  O OD2   . ASP B 1 74  ? 45.582  32.192  33.879  1.00 52.95  ? 74  ASP B OD2   1 
ATOM   3491  H H     . ASP B 1 74  ? 41.799  33.036  33.647  1.00 0.00   ? 74  ASP B H     1 
ATOM   3492  N N     . VAL B 1 75  ? 42.953  31.453  36.399  1.00 13.17  ? 75  VAL B N     1 
ATOM   3493  C CA    . VAL B 1 75  ? 43.338  31.092  37.765  1.00 16.75  ? 75  VAL B CA    1 
ATOM   3494  C C     . VAL B 1 75  ? 42.118  30.435  38.411  1.00 16.87  ? 75  VAL B C     1 
ATOM   3495  O O     . VAL B 1 75  ? 42.210  29.378  39.039  1.00 17.61  ? 75  VAL B O     1 
ATOM   3496  C CB    . VAL B 1 75  ? 43.734  32.357  38.588  1.00 19.00  ? 75  VAL B CB    1 
ATOM   3497  C CG1   . VAL B 1 75  ? 44.048  32.000  40.037  1.00 15.03  ? 75  VAL B CG1   1 
ATOM   3498  C CG2   . VAL B 1 75  ? 44.951  32.992  37.943  1.00 20.33  ? 75  VAL B CG2   1 
ATOM   3499  H H     . VAL B 1 75  ? 42.703  32.372  36.217  1.00 0.00   ? 75  VAL B H     1 
ATOM   3500  N N     . LEU B 1 76  ? 40.950  31.035  38.184  1.00 13.15  ? 76  LEU B N     1 
ATOM   3501  C CA    . LEU B 1 76  ? 39.707  30.586  38.732  1.00 10.98  ? 76  LEU B CA    1 
ATOM   3502  C C     . LEU B 1 76  ? 39.468  29.207  38.181  1.00 12.55  ? 76  LEU B C     1 
ATOM   3503  O O     . LEU B 1 76  ? 39.270  28.278  38.964  1.00 18.47  ? 76  LEU B O     1 
ATOM   3504  C CB    . LEU B 1 76  ? 38.610  31.552  38.319  1.00 14.74  ? 76  LEU B CB    1 
ATOM   3505  C CG    . LEU B 1 76  ? 37.191  31.227  38.786  1.00 19.63  ? 76  LEU B CG    1 
ATOM   3506  C CD1   . LEU B 1 76  ? 37.149  31.093  40.305  1.00 16.36  ? 76  LEU B CD1   1 
ATOM   3507  C CD2   . LEU B 1 76  ? 36.257  32.311  38.295  1.00 14.34  ? 76  LEU B CD2   1 
ATOM   3508  H H     . LEU B 1 76  ? 40.933  31.811  37.603  1.00 0.00   ? 76  LEU B H     1 
ATOM   3509  N N     . SER B 1 77  ? 39.608  29.026  36.873  1.00 8.58   ? 77  SER B N     1 
ATOM   3510  C CA    . SER B 1 77  ? 39.430  27.730  36.250  1.00 9.21   ? 77  SER B CA    1 
ATOM   3511  C C     . SER B 1 77  ? 40.370  26.707  36.857  1.00 11.06  ? 77  SER B C     1 
ATOM   3512  O O     . SER B 1 77  ? 39.955  25.599  37.182  1.00 13.49  ? 77  SER B O     1 
ATOM   3513  C CB    . SER B 1 77  ? 39.702  27.849  34.786  1.00 8.37   ? 77  SER B CB    1 
ATOM   3514  O OG    . SER B 1 77  ? 38.832  28.825  34.249  1.00 16.55  ? 77  SER B OG    1 
ATOM   3515  H H     . SER B 1 77  ? 39.887  29.776  36.325  1.00 0.00   ? 77  SER B H     1 
ATOM   3516  H HG    . SER B 1 77  ? 38.937  29.681  34.671  1.00 0.00   ? 77  SER B HG    1 
ATOM   3517  N N     . ASN B 1 78  ? 41.637  27.060  37.084  1.00 12.68  ? 78  ASN B N     1 
ATOM   3518  C CA    . ASN B 1 78  ? 42.568  26.117  37.672  1.00 8.57   ? 78  ASN B CA    1 
ATOM   3519  C C     . ASN B 1 78  ? 42.060  25.768  39.052  1.00 9.50   ? 78  ASN B C     1 
ATOM   3520  O O     . ASN B 1 78  ? 41.925  24.590  39.383  1.00 13.00  ? 78  ASN B O     1 
ATOM   3521  C CB    . ASN B 1 78  ? 43.958  26.735  37.759  1.00 8.43   ? 78  ASN B CB    1 
ATOM   3522  C CG    . ASN B 1 78  ? 45.069  25.755  38.123  1.00 13.66  ? 78  ASN B CG    1 
ATOM   3523  O OD1   . ASN B 1 78  ? 45.328  24.745  37.465  1.00 8.26   ? 78  ASN B OD1   1 
ATOM   3524  N ND2   . ASN B 1 78  ? 45.837  26.023  39.164  1.00 17.11  ? 78  ASN B ND2   1 
ATOM   3525  H H     . ASN B 1 78  ? 41.944  27.965  36.857  1.00 0.00   ? 78  ASN B H     1 
ATOM   3526  H HD21  . ASN B 1 78  ? 46.529  25.374  39.398  1.00 0.00   ? 78  ASN B HD21  1 
ATOM   3527  H HD22  . ASN B 1 78  ? 45.700  26.863  39.648  1.00 0.00   ? 78  ASN B HD22  1 
ATOM   3528  N N     . ASP B 1 79  ? 41.617  26.752  39.832  1.00 14.36  ? 79  ASP B N     1 
ATOM   3529  C CA    . ASP B 1 79  ? 41.162  26.467  41.179  1.00 17.11  ? 79  ASP B CA    1 
ATOM   3530  C C     . ASP B 1 79  ? 39.937  25.575  41.212  1.00 13.71  ? 79  ASP B C     1 
ATOM   3531  O O     . ASP B 1 79  ? 39.915  24.623  41.995  1.00 13.94  ? 79  ASP B O     1 
ATOM   3532  C CB    . ASP B 1 79  ? 40.866  27.764  41.912  1.00 20.30  ? 79  ASP B CB    1 
ATOM   3533  C CG    . ASP B 1 79  ? 42.121  28.589  42.178  1.00 29.36  ? 79  ASP B CG    1 
ATOM   3534  O OD1   . ASP B 1 79  ? 43.142  28.031  42.603  1.00 30.15  ? 79  ASP B OD1   1 
ATOM   3535  O OD2   . ASP B 1 79  ? 42.064  29.803  41.956  1.00 37.09  ? 79  ASP B OD2   1 
ATOM   3536  H H     . ASP B 1 79  ? 41.548  27.665  39.488  1.00 0.00   ? 79  ASP B H     1 
ATOM   3537  N N     . LEU B 1 80  ? 38.976  25.810  40.322  1.00 13.71  ? 80  LEU B N     1 
ATOM   3538  C CA    . LEU B 1 80  ? 37.751  25.024  40.216  1.00 10.04  ? 80  LEU B CA    1 
ATOM   3539  C C     . LEU B 1 80  ? 38.084  23.591  39.905  1.00 9.68   ? 80  LEU B C     1 
ATOM   3540  O O     . LEU B 1 80  ? 37.574  22.712  40.589  1.00 9.39   ? 80  LEU B O     1 
ATOM   3541  C CB    . LEU B 1 80  ? 36.853  25.582  39.108  1.00 14.27  ? 80  LEU B CB    1 
ATOM   3542  C CG    . LEU B 1 80  ? 36.116  26.899  39.361  1.00 16.34  ? 80  LEU B CG    1 
ATOM   3543  C CD1   . LEU B 1 80  ? 35.684  27.561  38.070  1.00 10.26  ? 80  LEU B CD1   1 
ATOM   3544  C CD2   . LEU B 1 80  ? 34.919  26.589  40.232  1.00 20.63  ? 80  LEU B CD2   1 
ATOM   3545  H H     . LEU B 1 80  ? 39.127  26.527  39.678  1.00 0.00   ? 80  LEU B H     1 
ATOM   3546  N N     . VAL B 1 81  ? 39.007  23.321  38.971  1.00 11.42  ? 81  VAL B N     1 
ATOM   3547  C CA    . VAL B 1 81  ? 39.333  21.950  38.620  1.00 10.52  ? 81  VAL B CA    1 
ATOM   3548  C C     . VAL B 1 81  ? 40.072  21.295  39.768  1.00 11.54  ? 81  VAL B C     1 
ATOM   3549  O O     . VAL B 1 81  ? 39.680  20.225  40.208  1.00 10.24  ? 81  VAL B O     1 
ATOM   3550  C CB    . VAL B 1 81  ? 40.212  21.873  37.371  1.00 5.28   ? 81  VAL B CB    1 
ATOM   3551  C CG1   . VAL B 1 81  ? 40.319  20.416  36.992  1.00 6.16   ? 81  VAL B CG1   1 
ATOM   3552  C CG2   . VAL B 1 81  ? 39.608  22.598  36.183  1.00 6.67   ? 81  VAL B CG2   1 
ATOM   3553  H H     . VAL B 1 81  ? 39.475  24.062  38.533  1.00 0.00   ? 81  VAL B H     1 
ATOM   3554  N N     . MET B 1 82  ? 41.115  21.934  40.297  1.00 15.63  ? 82  MET B N     1 
ATOM   3555  C CA    . MET B 1 82  ? 41.912  21.420  41.405  1.00 18.86  ? 82  MET B CA    1 
ATOM   3556  C C     . MET B 1 82  ? 41.065  21.019  42.580  1.00 18.83  ? 82  MET B C     1 
ATOM   3557  O O     . MET B 1 82  ? 41.119  19.895  43.064  1.00 19.91  ? 82  MET B O     1 
ATOM   3558  C CB    . MET B 1 82  ? 42.906  22.453  41.923  1.00 22.69  ? 82  MET B CB    1 
ATOM   3559  C CG    . MET B 1 82  ? 44.096  22.766  41.057  1.00 31.94  ? 82  MET B CG    1 
ATOM   3560  S SD    . MET B 1 82  ? 45.190  21.353  40.830  1.00 34.17  ? 82  MET B SD    1 
ATOM   3561  C CE    . MET B 1 82  ? 45.883  21.514  42.449  1.00 39.87  ? 82  MET B CE    1 
ATOM   3562  H H     . MET B 1 82  ? 41.343  22.798  39.902  1.00 0.00   ? 82  MET B H     1 
ATOM   3563  N N     . ASN B 1 83  ? 40.228  21.943  43.014  1.00 19.79  ? 83  ASN B N     1 
ATOM   3564  C CA    . ASN B 1 83  ? 39.416  21.671  44.159  1.00 23.78  ? 83  ASN B CA    1 
ATOM   3565  C C     . ASN B 1 83  ? 38.408  20.628  43.889  1.00 21.29  ? 83  ASN B C     1 
ATOM   3566  O O     . ASN B 1 83  ? 38.212  19.766  44.727  1.00 21.65  ? 83  ASN B O     1 
ATOM   3567  C CB    . ASN B 1 83  ? 38.732  22.907  44.624  1.00 30.67  ? 83  ASN B CB    1 
ATOM   3568  C CG    . ASN B 1 83  ? 39.826  23.721  45.261  1.00 40.91  ? 83  ASN B CG    1 
ATOM   3569  O OD1   . ASN B 1 83  ? 40.438  23.271  46.238  1.00 46.59  ? 83  ASN B OD1   1 
ATOM   3570  N ND2   . ASN B 1 83  ? 40.188  24.904  44.771  1.00 45.49  ? 83  ASN B ND2   1 
ATOM   3571  H H     . ASN B 1 83  ? 40.156  22.773  42.517  1.00 0.00   ? 83  ASN B H     1 
ATOM   3572  H HD21  . ASN B 1 83  ? 40.756  25.457  45.324  1.00 0.00   ? 83  ASN B HD21  1 
ATOM   3573  H HD22  . ASN B 1 83  ? 39.781  25.198  43.915  1.00 0.00   ? 83  ASN B HD22  1 
ATOM   3574  N N     . MET B 1 84  ? 37.810  20.568  42.713  1.00 18.69  ? 84  MET B N     1 
ATOM   3575  C CA    . MET B 1 84  ? 36.833  19.529  42.468  1.00 17.27  ? 84  MET B CA    1 
ATOM   3576  C C     . MET B 1 84  ? 37.452  18.153  42.429  1.00 20.26  ? 84  MET B C     1 
ATOM   3577  O O     . MET B 1 84  ? 36.931  17.242  43.085  1.00 20.53  ? 84  MET B O     1 
ATOM   3578  C CB    . MET B 1 84  ? 36.106  19.879  41.177  1.00 18.02  ? 84  MET B CB    1 
ATOM   3579  C CG    . MET B 1 84  ? 35.091  20.996  41.485  1.00 18.05  ? 84  MET B CG    1 
ATOM   3580  S SD    . MET B 1 84  ? 33.534  20.387  42.176  1.00 23.71  ? 84  MET B SD    1 
ATOM   3581  C CE    . MET B 1 84  ? 33.831  19.771  43.809  1.00 15.92  ? 84  MET B CE    1 
ATOM   3582  H H     . MET B 1 84  ? 37.988  21.254  42.013  1.00 0.00   ? 84  MET B H     1 
ATOM   3583  N N     . LEU B 1 85  ? 38.615  18.040  41.794  1.00 19.03  ? 85  LEU B N     1 
ATOM   3584  C CA    . LEU B 1 85  ? 39.318  16.782  41.687  1.00 17.50  ? 85  LEU B CA    1 
ATOM   3585  C C     . LEU B 1 85  ? 39.809  16.302  43.021  1.00 17.63  ? 85  LEU B C     1 
ATOM   3586  O O     . LEU B 1 85  ? 39.688  15.121  43.327  1.00 20.77  ? 85  LEU B O     1 
ATOM   3587  C CB    . LEU B 1 85  ? 40.508  16.901  40.780  1.00 15.58  ? 85  LEU B CB    1 
ATOM   3588  C CG    . LEU B 1 85  ? 40.136  17.148  39.366  1.00 18.28  ? 85  LEU B CG    1 
ATOM   3589  C CD1   . LEU B 1 85  ? 41.396  17.384  38.593  1.00 19.27  ? 85  LEU B CD1   1 
ATOM   3590  C CD2   . LEU B 1 85  ? 39.350  15.979  38.821  1.00 14.15  ? 85  LEU B CD2   1 
ATOM   3591  H H     . LEU B 1 85  ? 39.014  18.838  41.388  1.00 0.00   ? 85  LEU B H     1 
ATOM   3592  N N     . LYS B 1 86  ? 40.367  17.181  43.849  1.00 21.27  ? 86  LYS B N     1 
ATOM   3593  C CA    . LYS B 1 86  ? 40.808  16.767  45.164  1.00 22.45  ? 86  LYS B CA    1 
ATOM   3594  C C     . LYS B 1 86  ? 39.621  16.179  45.902  1.00 23.00  ? 86  LYS B C     1 
ATOM   3595  O O     . LYS B 1 86  ? 39.657  15.012  46.304  1.00 25.06  ? 86  LYS B O     1 
ATOM   3596  C CB    . LYS B 1 86  ? 41.369  17.960  45.895  1.00 26.95  ? 86  LYS B CB    1 
ATOM   3597  C CG    . LYS B 1 86  ? 42.768  18.231  45.384  1.00 35.04  ? 86  LYS B CG    1 
ATOM   3598  C CD    . LYS B 1 86  ? 43.480  19.194  46.312  1.00 41.66  ? 86  LYS B CD    1 
ATOM   3599  C CE    . LYS B 1 86  ? 44.908  19.420  45.838  1.00 42.59  ? 86  LYS B CE    1 
ATOM   3600  N NZ    . LYS B 1 86  ? 45.613  20.258  46.788  1.00 47.61  ? 86  LYS B NZ    1 
ATOM   3601  H H     . LYS B 1 86  ? 40.525  18.099  43.538  1.00 0.00   ? 86  LYS B H     1 
ATOM   3602  H HZ1   . LYS B 1 86  ? 45.120  21.169  46.877  1.00 0.00   ? 86  LYS B HZ1   1 
ATOM   3603  H HZ2   . LYS B 1 86  ? 45.632  19.782  47.713  1.00 0.00   ? 86  LYS B HZ2   1 
ATOM   3604  H HZ3   . LYS B 1 86  ? 46.587  20.413  46.456  1.00 0.00   ? 86  LYS B HZ3   1 
ATOM   3605  N N     . SER B 1 87  ? 38.513  16.924  45.901  1.00 22.35  ? 87  SER B N     1 
ATOM   3606  C CA    . SER B 1 87  ? 37.263  16.524  46.514  1.00 20.45  ? 87  SER B CA    1 
ATOM   3607  C C     . SER B 1 87  ? 36.695  15.206  46.025  1.00 19.79  ? 87  SER B C     1 
ATOM   3608  O O     . SER B 1 87  ? 35.927  14.578  46.753  1.00 17.29  ? 87  SER B O     1 
ATOM   3609  C CB    . SER B 1 87  ? 36.236  17.577  46.262  1.00 22.96  ? 87  SER B CB    1 
ATOM   3610  O OG    . SER B 1 87  ? 36.647  18.839  46.770  1.00 36.53  ? 87  SER B OG    1 
ATOM   3611  H H     . SER B 1 87  ? 38.525  17.788  45.434  1.00 0.00   ? 87  SER B H     1 
ATOM   3612  H HG    . SER B 1 87  ? 37.061  19.330  46.057  1.00 0.00   ? 87  SER B HG    1 
ATOM   3613  N N     . SER B 1 88  ? 37.052  14.740  44.828  1.00 18.86  ? 88  SER B N     1 
ATOM   3614  C CA    . SER B 1 88  ? 36.505  13.519  44.294  1.00 15.74  ? 88  SER B CA    1 
ATOM   3615  C C     . SER B 1 88  ? 36.978  12.281  45.034  1.00 13.90  ? 88  SER B C     1 
ATOM   3616  O O     . SER B 1 88  ? 36.423  11.191  44.857  1.00 16.85  ? 88  SER B O     1 
ATOM   3617  C CB    . SER B 1 88  ? 36.902  13.417  42.827  1.00 17.05  ? 88  SER B CB    1 
ATOM   3618  O OG    . SER B 1 88  ? 38.256  12.988  42.656  1.00 17.16  ? 88  SER B OG    1 
ATOM   3619  H H     . SER B 1 88  ? 37.709  15.216  44.275  1.00 0.00   ? 88  SER B H     1 
ATOM   3620  H HG    . SER B 1 88  ? 38.162  12.176  42.162  1.00 0.00   ? 88  SER B HG    1 
ATOM   3621  N N     . PHE B 1 89  ? 38.083  12.413  45.779  1.00 17.71  ? 89  PHE B N     1 
ATOM   3622  C CA    . PHE B 1 89  ? 38.765  11.316  46.465  1.00 16.44  ? 89  PHE B CA    1 
ATOM   3623  C C     . PHE B 1 89  ? 39.222  10.282  45.432  1.00 18.06  ? 89  PHE B C     1 
ATOM   3624  O O     . PHE B 1 89  ? 39.343  9.079   45.711  1.00 19.69  ? 89  PHE B O     1 
ATOM   3625  C CB    . PHE B 1 89  ? 37.835  10.643  47.502  1.00 9.80   ? 89  PHE B CB    1 
ATOM   3626  C CG    . PHE B 1 89  ? 37.647  11.416  48.786  1.00 10.21  ? 89  PHE B CG    1 
ATOM   3627  C CD1   . PHE B 1 89  ? 36.997  12.621  48.801  1.00 17.75  ? 89  PHE B CD1   1 
ATOM   3628  C CD2   . PHE B 1 89  ? 38.140  10.906  49.964  1.00 19.95  ? 89  PHE B CD2   1 
ATOM   3629  C CE1   . PHE B 1 89  ? 36.822  13.317  49.983  1.00 24.35  ? 89  PHE B CE1   1 
ATOM   3630  C CE2   . PHE B 1 89  ? 37.973  11.606  51.145  1.00 21.75  ? 89  PHE B CE2   1 
ATOM   3631  C CZ    . PHE B 1 89  ? 37.309  12.812  51.161  1.00 21.32  ? 89  PHE B CZ    1 
ATOM   3632  H H     . PHE B 1 89  ? 38.490  13.304  45.840  1.00 0.00   ? 89  PHE B H     1 
ATOM   3633  N N     . ALA B 1 90  ? 39.469  10.721  44.194  1.00 15.52  ? 90  ALA B N     1 
ATOM   3634  C CA    . ALA B 1 90  ? 39.859  9.776   43.169  1.00 14.84  ? 90  ALA B CA    1 
ATOM   3635  C C     . ALA B 1 90  ? 41.268  10.034  42.685  1.00 17.15  ? 90  ALA B C     1 
ATOM   3636  O O     . ALA B 1 90  ? 41.758  9.204   41.917  1.00 15.83  ? 90  ALA B O     1 
ATOM   3637  C CB    . ALA B 1 90  ? 38.928  9.854   41.967  1.00 10.73  ? 90  ALA B CB    1 
ATOM   3638  H H     . ALA B 1 90  ? 39.443  11.688  44.017  1.00 0.00   ? 90  ALA B H     1 
ATOM   3639  N N     . THR B 1 91  ? 41.964  11.095  43.125  1.00 15.62  ? 91  THR B N     1 
ATOM   3640  C CA    . THR B 1 91  ? 43.287  11.417  42.614  1.00 17.70  ? 91  THR B CA    1 
ATOM   3641  C C     . THR B 1 91  ? 44.476  11.314  43.580  1.00 19.73  ? 91  THR B C     1 
ATOM   3642  O O     . THR B 1 91  ? 44.371  11.357  44.819  1.00 15.43  ? 91  THR B O     1 
ATOM   3643  C CB    . THR B 1 91  ? 43.247  12.840  41.997  1.00 15.05  ? 91  THR B CB    1 
ATOM   3644  O OG1   . THR B 1 91  ? 42.859  13.752  42.999  1.00 14.43  ? 91  THR B OG1   1 
ATOM   3645  C CG2   . THR B 1 91  ? 42.260  12.948  40.859  1.00 14.32  ? 91  THR B CG2   1 
ATOM   3646  H H     . THR B 1 91  ? 41.627  11.644  43.864  1.00 0.00   ? 91  THR B H     1 
ATOM   3647  H HG1   . THR B 1 91  ? 42.035  13.504  43.446  1.00 0.00   ? 91  THR B HG1   1 
ATOM   3648  N N     . CYS B 1 92  ? 45.630  11.047  42.980  1.00 20.07  ? 92  CYS B N     1 
ATOM   3649  C CA    . CYS B 1 92  ? 46.854  11.017  43.723  1.00 21.18  ? 92  CYS B CA    1 
ATOM   3650  C C     . CYS B 1 92  ? 47.829  12.038  43.165  1.00 21.90  ? 92  CYS B C     1 
ATOM   3651  O O     . CYS B 1 92  ? 48.586  12.610  43.960  1.00 21.22  ? 92  CYS B O     1 
ATOM   3652  C CB    . CYS B 1 92  ? 47.485  9.628   43.674  1.00 23.59  ? 92  CYS B CB    1 
ATOM   3653  S SG    . CYS B 1 92  ? 47.844  9.033   42.010  1.00 31.86  ? 92  CYS B SG    1 
ATOM   3654  H H     . CYS B 1 92  ? 45.649  10.836  42.025  1.00 0.00   ? 92  CYS B H     1 
ATOM   3655  N N     . VAL B 1 93  ? 47.870  12.319  41.854  1.00 19.50  ? 93  VAL B N     1 
ATOM   3656  C CA    . VAL B 1 93  ? 48.812  13.296  41.310  1.00 20.15  ? 93  VAL B CA    1 
ATOM   3657  C C     . VAL B 1 93  ? 48.035  14.142  40.308  1.00 19.32  ? 93  VAL B C     1 
ATOM   3658  O O     . VAL B 1 93  ? 47.273  13.581  39.513  1.00 15.67  ? 93  VAL B O     1 
ATOM   3659  C CB    . VAL B 1 93  ? 50.019  12.617  40.571  1.00 23.06  ? 93  VAL B CB    1 
ATOM   3660  C CG1   . VAL B 1 93  ? 50.993  13.704  40.099  1.00 26.20  ? 93  VAL B CG1   1 
ATOM   3661  C CG2   . VAL B 1 93  ? 50.788  11.671  41.489  1.00 24.07  ? 93  VAL B CG2   1 
ATOM   3662  H H     . VAL B 1 93  ? 47.228  11.916  41.233  1.00 0.00   ? 93  VAL B H     1 
ATOM   3663  N N     . LEU B 1 94  ? 48.225  15.465  40.335  1.00 17.09  ? 94  LEU B N     1 
ATOM   3664  C CA    . LEU B 1 94  ? 47.512  16.394  39.487  1.00 16.31  ? 94  LEU B CA    1 
ATOM   3665  C C     . LEU B 1 94  ? 48.513  17.289  38.793  1.00 18.15  ? 94  LEU B C     1 
ATOM   3666  O O     . LEU B 1 94  ? 49.279  18.004  39.457  1.00 20.88  ? 94  LEU B O     1 
ATOM   3667  C CB    . LEU B 1 94  ? 46.580  17.260  40.318  1.00 18.08  ? 94  LEU B CB    1 
ATOM   3668  C CG    . LEU B 1 94  ? 45.445  16.628  41.105  1.00 18.79  ? 94  LEU B CG    1 
ATOM   3669  C CD1   . LEU B 1 94  ? 44.895  17.612  42.113  1.00 15.44  ? 94  LEU B CD1   1 
ATOM   3670  C CD2   . LEU B 1 94  ? 44.382  16.180  40.146  1.00 18.54  ? 94  LEU B CD2   1 
ATOM   3671  H H     . LEU B 1 94  ? 48.865  15.838  40.980  1.00 0.00   ? 94  LEU B H     1 
ATOM   3672  N N     . VAL B 1 95  ? 48.574  17.274  37.467  1.00 18.12  ? 95  VAL B N     1 
ATOM   3673  C CA    . VAL B 1 95  ? 49.522  18.115  36.758  1.00 17.85  ? 95  VAL B CA    1 
ATOM   3674  C C     . VAL B 1 95  ? 48.742  19.123  35.942  1.00 17.21  ? 95  VAL B C     1 
ATOM   3675  O O     . VAL B 1 95  ? 47.905  18.818  35.090  1.00 17.79  ? 95  VAL B O     1 
ATOM   3676  C CB    . VAL B 1 95  ? 50.422  17.256  35.858  1.00 17.20  ? 95  VAL B CB    1 
ATOM   3677  C CG1   . VAL B 1 95  ? 51.315  18.158  35.018  1.00 15.27  ? 95  VAL B CG1   1 
ATOM   3678  C CG2   . VAL B 1 95  ? 51.283  16.335  36.715  1.00 12.06  ? 95  VAL B CG2   1 
ATOM   3679  H H     . VAL B 1 95  ? 47.937  16.730  36.954  1.00 0.00   ? 95  VAL B H     1 
ATOM   3680  N N     . SER B 1 96  ? 49.074  20.358  36.229  1.00 20.28  ? 96  SER B N     1 
ATOM   3681  C CA    . SER B 1 96  ? 48.416  21.479  35.645  1.00 16.05  ? 96  SER B CA    1 
ATOM   3682  C C     . SER B 1 96  ? 49.399  22.361  34.917  1.00 20.69  ? 96  SER B C     1 
ATOM   3683  O O     . SER B 1 96  ? 50.565  22.565  35.278  1.00 15.38  ? 96  SER B O     1 
ATOM   3684  C CB    . SER B 1 96  ? 47.755  22.200  36.760  1.00 16.58  ? 96  SER B CB    1 
ATOM   3685  O OG    . SER B 1 96  ? 47.572  23.573  36.459  1.00 19.48  ? 96  SER B OG    1 
ATOM   3686  H H     . SER B 1 96  ? 49.850  20.529  36.812  1.00 0.00   ? 96  SER B H     1 
ATOM   3687  H HG    . SER B 1 96  ? 46.816  23.857  36.992  1.00 0.00   ? 96  SER B HG    1 
ATOM   3688  N N     . GLU B 1 97  ? 48.832  22.980  33.904  1.00 24.06  ? 97  GLU B N     1 
ATOM   3689  C CA    . GLU B 1 97  ? 49.561  23.938  33.124  1.00 28.75  ? 97  GLU B CA    1 
ATOM   3690  C C     . GLU B 1 97  ? 49.973  25.118  34.001  1.00 33.41  ? 97  GLU B C     1 
ATOM   3691  O O     . GLU B 1 97  ? 51.065  25.667  33.827  1.00 37.00  ? 97  GLU B O     1 
ATOM   3692  C CB    . GLU B 1 97  ? 48.654  24.360  31.991  1.00 31.75  ? 97  GLU B CB    1 
ATOM   3693  C CG    . GLU B 1 97  ? 49.213  25.318  30.940  1.00 34.37  ? 97  GLU B CG    1 
ATOM   3694  C CD    . GLU B 1 97  ? 49.398  26.770  31.371  1.00 35.14  ? 97  GLU B CD    1 
ATOM   3695  O OE1   . GLU B 1 97  ? 48.407  27.441  31.661  1.00 36.03  ? 97  GLU B OE1   1 
ATOM   3696  O OE2   . GLU B 1 97  ? 50.545  27.209  31.439  1.00 35.51  ? 97  GLU B OE2   1 
ATOM   3697  H H     . GLU B 1 97  ? 47.892  22.775  33.710  1.00 0.00   ? 97  GLU B H     1 
ATOM   3698  N N     . GLU B 1 98  ? 49.142  25.551  34.947  1.00 36.01  ? 98  GLU B N     1 
ATOM   3699  C CA    . GLU B 1 98  ? 49.494  26.685  35.792  1.00 38.52  ? 98  GLU B CA    1 
ATOM   3700  C C     . GLU B 1 98  ? 50.516  26.357  36.862  1.00 38.36  ? 98  GLU B C     1 
ATOM   3701  O O     . GLU B 1 98  ? 51.083  27.272  37.462  1.00 37.28  ? 98  GLU B O     1 
ATOM   3702  C CB    . GLU B 1 98  ? 48.295  27.232  36.531  1.00 41.52  ? 98  GLU B CB    1 
ATOM   3703  C CG    . GLU B 1 98  ? 47.259  27.947  35.688  1.00 49.76  ? 98  GLU B CG    1 
ATOM   3704  C CD    . GLU B 1 98  ? 47.706  29.268  35.083  1.00 51.77  ? 98  GLU B CD    1 
ATOM   3705  O OE1   . GLU B 1 98  ? 48.205  30.143  35.805  1.00 50.81  ? 98  GLU B OE1   1 
ATOM   3706  O OE2   . GLU B 1 98  ? 47.529  29.408  33.873  1.00 54.19  ? 98  GLU B OE2   1 
ATOM   3707  H H     . GLU B 1 98  ? 48.336  25.031  35.152  1.00 0.00   ? 98  GLU B H     1 
ATOM   3708  N N     . ASP B 1 99  ? 50.755  25.084  37.173  1.00 40.75  ? 99  ASP B N     1 
ATOM   3709  C CA    . ASP B 1 99  ? 51.610  24.744  38.295  1.00 44.22  ? 99  ASP B CA    1 
ATOM   3710  C C     . ASP B 1 99  ? 52.945  24.155  37.859  1.00 41.17  ? 99  ASP B C     1 
ATOM   3711  O O     . ASP B 1 99  ? 52.987  23.155  37.143  1.00 39.77  ? 99  ASP B O     1 
ATOM   3712  C CB    . ASP B 1 99  ? 50.849  23.765  39.206  1.00 49.54  ? 99  ASP B CB    1 
ATOM   3713  C CG    . ASP B 1 99  ? 49.551  24.319  39.806  1.00 54.20  ? 99  ASP B CG    1 
ATOM   3714  O OD1   . ASP B 1 99  ? 49.602  25.192  40.671  1.00 56.23  ? 99  ASP B OD1   1 
ATOM   3715  O OD2   . ASP B 1 99  ? 48.475  23.870  39.418  1.00 59.26  ? 99  ASP B OD2   1 
ATOM   3716  H H     . ASP B 1 99  ? 50.444  24.367  36.582  1.00 0.00   ? 99  ASP B H     1 
ATOM   3717  N N     . LYS B 1 100 ? 54.073  24.742  38.274  1.00 38.10  ? 100 LYS B N     1 
ATOM   3718  C CA    . LYS B 1 100 ? 55.396  24.270  37.888  1.00 37.08  ? 100 LYS B CA    1 
ATOM   3719  C C     . LYS B 1 100 ? 55.667  22.852  38.364  1.00 33.87  ? 100 LYS B C     1 
ATOM   3720  O O     . LYS B 1 100 ? 56.418  22.128  37.712  1.00 29.65  ? 100 LYS B O     1 
ATOM   3721  C CB    . LYS B 1 100 ? 56.495  25.179  38.449  1.00 42.80  ? 100 LYS B CB    1 
ATOM   3722  C CG    . LYS B 1 100 ? 57.897  24.856  37.882  1.00 52.60  ? 100 LYS B CG    1 
ATOM   3723  C CD    . LYS B 1 100 ? 59.029  25.646  38.549  1.00 59.81  ? 100 LYS B CD    1 
ATOM   3724  C CE    . LYS B 1 100 ? 60.425  25.208  38.062  1.00 64.77  ? 100 LYS B CE    1 
ATOM   3725  N NZ    . LYS B 1 100 ? 61.460  26.100  38.576  1.00 64.87  ? 100 LYS B NZ    1 
ATOM   3726  H H     . LYS B 1 100 ? 53.985  25.558  38.807  1.00 0.00   ? 100 LYS B H     1 
ATOM   3727  H HZ1   . LYS B 1 100 ? 61.266  27.069  38.252  1.00 0.00   ? 100 LYS B HZ1   1 
ATOM   3728  H HZ2   . LYS B 1 100 ? 61.456  26.080  39.615  1.00 0.00   ? 100 LYS B HZ2   1 
ATOM   3729  H HZ3   . LYS B 1 100 ? 62.393  25.802  38.226  1.00 0.00   ? 100 LYS B HZ3   1 
ATOM   3730  N N     . HIS B 1 101 ? 55.082  22.390  39.465  1.00 34.05  ? 101 HIS B N     1 
ATOM   3731  C CA    . HIS B 1 101 ? 55.341  21.039  39.939  1.00 34.05  ? 101 HIS B CA    1 
ATOM   3732  C C     . HIS B 1 101 ? 54.018  20.345  40.087  1.00 31.98  ? 101 HIS B C     1 
ATOM   3733  O O     . HIS B 1 101 ? 53.002  21.026  40.267  1.00 33.29  ? 101 HIS B O     1 
ATOM   3734  C CB    . HIS B 1 101 ? 56.005  21.015  41.297  1.00 40.58  ? 101 HIS B CB    1 
ATOM   3735  C CG    . HIS B 1 101 ? 57.356  21.703  41.325  1.00 47.67  ? 101 HIS B CG    1 
ATOM   3736  N ND1   . HIS B 1 101 ? 58.311  21.485  40.424  1.00 52.13  ? 101 HIS B ND1   1 
ATOM   3737  C CD2   . HIS B 1 101 ? 57.771  22.665  42.207  1.00 48.58  ? 101 HIS B CD2   1 
ATOM   3738  C CE1   . HIS B 1 101 ? 59.294  22.294  40.729  1.00 51.47  ? 101 HIS B CE1   1 
ATOM   3739  N NE2   . HIS B 1 101 ? 58.959  22.997  41.787  1.00 48.48  ? 101 HIS B NE2   1 
ATOM   3740  H H     . HIS B 1 101 ? 54.326  22.867  39.867  1.00 0.00   ? 101 HIS B H     1 
ATOM   3741  H HD1   . HIS B 1 101 ? 58.283  20.930  39.598  1.00 0.00   ? 101 HIS B HD1   1 
ATOM   3742  H HE2   . HIS B 1 101 ? 59.513  23.704  42.182  1.00 0.00   ? 101 HIS B HE2   1 
ATOM   3743  N N     . ALA B 1 102 ? 54.068  19.021  39.974  1.00 27.51  ? 102 ALA B N     1 
ATOM   3744  C CA    . ALA B 1 102 ? 52.907  18.183  40.163  1.00 24.37  ? 102 ALA B CA    1 
ATOM   3745  C C     . ALA B 1 102 ? 52.431  18.345  41.598  1.00 26.82  ? 102 ALA B C     1 
ATOM   3746  O O     . ALA B 1 102 ? 53.257  18.414  42.518  1.00 28.78  ? 102 ALA B O     1 
ATOM   3747  C CB    . ALA B 1 102 ? 53.273  16.747  39.942  1.00 19.33  ? 102 ALA B CB    1 
ATOM   3748  H H     . ALA B 1 102 ? 54.919  18.585  39.784  1.00 0.00   ? 102 ALA B H     1 
ATOM   3749  N N     . ILE B 1 103 ? 51.115  18.468  41.778  1.00 27.16  ? 103 ILE B N     1 
ATOM   3750  C CA    . ILE B 1 103 ? 50.494  18.640  43.085  1.00 25.42  ? 103 ILE B CA    1 
ATOM   3751  C C     . ILE B 1 103 ? 50.189  17.238  43.551  1.00 27.03  ? 103 ILE B C     1 
ATOM   3752  O O     . ILE B 1 103 ? 49.558  16.478  42.799  1.00 30.60  ? 103 ILE B O     1 
ATOM   3753  C CB    . ILE B 1 103 ? 49.174  19.451  42.983  1.00 23.80  ? 103 ILE B CB    1 
ATOM   3754  C CG1   . ILE B 1 103 ? 49.424  20.840  42.430  1.00 22.17  ? 103 ILE B CG1   1 
ATOM   3755  C CG2   . ILE B 1 103 ? 48.552  19.576  44.356  1.00 24.05  ? 103 ILE B CG2   1 
ATOM   3756  C CD1   . ILE B 1 103 ? 49.381  20.895  40.898  1.00 25.83  ? 103 ILE B CD1   1 
ATOM   3757  H H     . ILE B 1 103 ? 50.531  18.409  40.992  1.00 0.00   ? 103 ILE B H     1 
ATOM   3758  N N     . ILE B 1 104 ? 50.632  16.851  44.751  1.00 26.20  ? 104 ILE B N     1 
ATOM   3759  C CA    . ILE B 1 104 ? 50.357  15.496  45.216  1.00 24.89  ? 104 ILE B CA    1 
ATOM   3760  C C     . ILE B 1 104 ? 49.245  15.622  46.257  1.00 28.27  ? 104 ILE B C     1 
ATOM   3761  O O     . ILE B 1 104 ? 49.256  16.537  47.101  1.00 28.29  ? 104 ILE B O     1 
ATOM   3762  C CB    . ILE B 1 104 ? 51.634  14.869  45.817  1.00 23.21  ? 104 ILE B CB    1 
ATOM   3763  C CG1   . ILE B 1 104 ? 52.846  15.025  44.890  1.00 23.13  ? 104 ILE B CG1   1 
ATOM   3764  C CG2   . ILE B 1 104 ? 51.365  13.381  46.036  1.00 23.75  ? 104 ILE B CG2   1 
ATOM   3765  C CD1   . ILE B 1 104 ? 52.725  14.444  43.460  1.00 22.93  ? 104 ILE B CD1   1 
ATOM   3766  H H     . ILE B 1 104 ? 51.094  17.475  45.346  1.00 0.00   ? 104 ILE B H     1 
ATOM   3767  N N     . VAL B 1 105 ? 48.229  14.759  46.173  1.00 27.83  ? 105 VAL B N     1 
ATOM   3768  C CA    . VAL B 1 105 ? 47.069  14.913  47.027  1.00 23.22  ? 105 VAL B CA    1 
ATOM   3769  C C     . VAL B 1 105 ? 47.444  14.410  48.397  1.00 25.58  ? 105 VAL B C     1 
ATOM   3770  O O     . VAL B 1 105 ? 48.282  13.530  48.576  1.00 23.94  ? 105 VAL B O     1 
ATOM   3771  C CB    . VAL B 1 105 ? 45.873  14.129  46.431  1.00 19.53  ? 105 VAL B CB    1 
ATOM   3772  C CG1   . VAL B 1 105 ? 44.650  14.225  47.299  1.00 16.49  ? 105 VAL B CG1   1 
ATOM   3773  C CG2   . VAL B 1 105 ? 45.452  14.780  45.127  1.00 16.71  ? 105 VAL B CG2   1 
ATOM   3774  H H     . VAL B 1 105 ? 48.323  13.961  45.610  1.00 0.00   ? 105 VAL B H     1 
ATOM   3775  N N     . GLU B 1 106 ? 46.833  15.087  49.355  1.00 26.71  ? 106 GLU B N     1 
ATOM   3776  C CA    . GLU B 1 106 ? 46.961  14.791  50.767  1.00 29.96  ? 106 GLU B CA    1 
ATOM   3777  C C     . GLU B 1 106 ? 46.569  13.332  50.949  1.00 31.24  ? 106 GLU B C     1 
ATOM   3778  O O     . GLU B 1 106 ? 45.632  12.883  50.277  1.00 33.68  ? 106 GLU B O     1 
ATOM   3779  C CB    . GLU B 1 106 ? 46.009  15.652  51.597  1.00 33.23  ? 106 GLU B CB    1 
ATOM   3780  C CG    . GLU B 1 106 ? 46.103  17.161  51.422  1.00 41.69  ? 106 GLU B CG    1 
ATOM   3781  C CD    . GLU B 1 106 ? 45.426  17.695  50.165  1.00 50.44  ? 106 GLU B CD    1 
ATOM   3782  O OE1   . GLU B 1 106 ? 44.216  17.914  50.208  1.00 58.01  ? 106 GLU B OE1   1 
ATOM   3783  O OE2   . GLU B 1 106 ? 46.096  17.886  49.146  1.00 53.58  ? 106 GLU B OE2   1 
ATOM   3784  H H     . GLU B 1 106 ? 46.219  15.780  49.062  1.00 0.00   ? 106 GLU B H     1 
ATOM   3785  N N     . PRO B 1 107 ? 47.159  12.552  51.854  1.00 33.20  ? 107 PRO B N     1 
ATOM   3786  C CA    . PRO B 1 107 ? 46.930  11.117  51.940  1.00 33.70  ? 107 PRO B CA    1 
ATOM   3787  C C     . PRO B 1 107 ? 45.452  10.762  52.101  1.00 33.89  ? 107 PRO B C     1 
ATOM   3788  O O     . PRO B 1 107 ? 44.950  9.879   51.417  1.00 38.53  ? 107 PRO B O     1 
ATOM   3789  C CB    . PRO B 1 107 ? 47.797  10.686  53.116  1.00 33.34  ? 107 PRO B CB    1 
ATOM   3790  C CG    . PRO B 1 107 ? 48.835  11.768  53.265  1.00 31.86  ? 107 PRO B CG    1 
ATOM   3791  C CD    . PRO B 1 107 ? 48.023  13.012  52.943  1.00 33.10  ? 107 PRO B CD    1 
ATOM   3792  N N     . GLU B 1 108 ? 44.718  11.506  52.932  1.00 33.92  ? 108 GLU B N     1 
ATOM   3793  C CA    . GLU B 1 108 ? 43.314  11.228  53.222  1.00 38.07  ? 108 GLU B CA    1 
ATOM   3794  C C     . GLU B 1 108 ? 42.420  11.308  52.006  1.00 35.85  ? 108 GLU B C     1 
ATOM   3795  O O     . GLU B 1 108 ? 41.421  10.601  51.904  1.00 38.54  ? 108 GLU B O     1 
ATOM   3796  C CB    . GLU B 1 108 ? 42.657  12.200  54.194  1.00 41.52  ? 108 GLU B CB    1 
ATOM   3797  C CG    . GLU B 1 108 ? 43.425  12.745  55.380  1.00 54.20  ? 108 GLU B CG    1 
ATOM   3798  C CD    . GLU B 1 108 ? 44.394  13.871  55.026  1.00 62.89  ? 108 GLU B CD    1 
ATOM   3799  O OE1   . GLU B 1 108 ? 43.979  14.868  54.419  1.00 66.57  ? 108 GLU B OE1   1 
ATOM   3800  O OE2   . GLU B 1 108 ? 45.571  13.740  55.367  1.00 66.62  ? 108 GLU B OE2   1 
ATOM   3801  H H     . GLU B 1 108 ? 45.149  12.274  53.345  1.00 0.00   ? 108 GLU B H     1 
ATOM   3802  N N     . LYS B 1 109 ? 42.780  12.219  51.113  1.00 31.36  ? 109 LYS B N     1 
ATOM   3803  C CA    . LYS B 1 109 ? 41.966  12.484  49.956  1.00 28.59  ? 109 LYS B CA    1 
ATOM   3804  C C     . LYS B 1 109 ? 42.443  11.744  48.720  1.00 27.66  ? 109 LYS B C     1 
ATOM   3805  O O     . LYS B 1 109 ? 41.951  11.984  47.617  1.00 27.54  ? 109 LYS B O     1 
ATOM   3806  C CB    . LYS B 1 109 ? 41.965  13.981  49.720  1.00 31.98  ? 109 LYS B CB    1 
ATOM   3807  C CG    . LYS B 1 109 ? 41.109  14.768  50.695  1.00 34.28  ? 109 LYS B CG    1 
ATOM   3808  C CD    . LYS B 1 109 ? 41.069  16.212  50.218  1.00 39.37  ? 109 LYS B CD    1 
ATOM   3809  C CE    . LYS B 1 109 ? 39.923  17.012  50.828  1.00 42.67  ? 109 LYS B CE    1 
ATOM   3810  N NZ    . LYS B 1 109 ? 40.049  17.105  52.268  1.00 49.53  ? 109 LYS B NZ    1 
ATOM   3811  H H     . LYS B 1 109 ? 43.674  12.612  51.154  1.00 0.00   ? 109 LYS B H     1 
ATOM   3812  H HZ1   . LYS B 1 109 ? 40.952  17.559  52.510  1.00 0.00   ? 109 LYS B HZ1   1 
ATOM   3813  H HZ2   . LYS B 1 109 ? 39.262  17.668  52.648  1.00 0.00   ? 109 LYS B HZ2   1 
ATOM   3814  H HZ3   . LYS B 1 109 ? 40.018  16.151  52.681  1.00 0.00   ? 109 LYS B HZ3   1 
ATOM   3815  N N     . ARG B 1 110 ? 43.413  10.855  48.869  1.00 27.46  ? 110 ARG B N     1 
ATOM   3816  C CA    . ARG B 1 110 ? 43.960  10.128  47.747  1.00 24.37  ? 110 ARG B CA    1 
ATOM   3817  C C     . ARG B 1 110 ? 43.115  9.017   47.176  1.00 22.73  ? 110 ARG B C     1 
ATOM   3818  O O     . ARG B 1 110 ? 42.389  8.319   47.893  1.00 22.90  ? 110 ARG B O     1 
ATOM   3819  C CB    . ARG B 1 110 ? 45.271  9.525   48.129  1.00 24.36  ? 110 ARG B CB    1 
ATOM   3820  C CG    . ARG B 1 110 ? 46.373  10.396  47.633  1.00 26.39  ? 110 ARG B CG    1 
ATOM   3821  C CD    . ARG B 1 110 ? 47.646  9.694   47.960  1.00 23.03  ? 110 ARG B CD    1 
ATOM   3822  N NE    . ARG B 1 110 ? 48.462  10.662  48.651  1.00 27.03  ? 110 ARG B NE    1 
ATOM   3823  C CZ    . ARG B 1 110 ? 49.628  10.355  49.198  1.00 24.58  ? 110 ARG B CZ    1 
ATOM   3824  N NH1   . ARG B 1 110 ? 50.116  9.107   49.158  1.00 30.30  ? 110 ARG B NH1   1 
ATOM   3825  N NH2   . ARG B 1 110 ? 50.294  11.331  49.806  1.00 20.70  ? 110 ARG B NH2   1 
ATOM   3826  H H     . ARG B 1 110 ? 43.692  10.574  49.764  1.00 0.00   ? 110 ARG B H     1 
ATOM   3827  H HE    . ARG B 1 110 ? 48.128  11.575  48.744  1.00 0.00   ? 110 ARG B HE    1 
ATOM   3828  H HH11  . ARG B 1 110 ? 49.598  8.377   48.711  1.00 0.00   ? 110 ARG B HH11  1 
ATOM   3829  H HH12  . ARG B 1 110 ? 50.999  8.902   49.580  1.00 0.00   ? 110 ARG B HH12  1 
ATOM   3830  H HH21  . ARG B 1 110 ? 49.906  12.252  49.836  1.00 0.00   ? 110 ARG B HH21  1 
ATOM   3831  H HH22  . ARG B 1 110 ? 51.178  11.143  50.233  1.00 0.00   ? 110 ARG B HH22  1 
ATOM   3832  N N     . GLY B 1 111 ? 43.306  8.860   45.866  1.00 21.33  ? 111 GLY B N     1 
ATOM   3833  C CA    . GLY B 1 111 ? 42.729  7.778   45.064  1.00 20.27  ? 111 GLY B CA    1 
ATOM   3834  C C     . GLY B 1 111 ? 43.776  7.300   44.037  1.00 19.25  ? 111 GLY B C     1 
ATOM   3835  O O     . GLY B 1 111 ? 44.872  7.855   43.980  1.00 20.16  ? 111 GLY B O     1 
ATOM   3836  H H     . GLY B 1 111 ? 43.916  9.489   45.423  1.00 0.00   ? 111 GLY B H     1 
ATOM   3837  N N     . LYS B 1 112 ? 43.483  6.319   43.166  1.00 14.74  ? 112 LYS B N     1 
ATOM   3838  C CA    . LYS B 1 112 ? 44.470  5.814   42.219  1.00 11.67  ? 112 LYS B CA    1 
ATOM   3839  C C     . LYS B 1 112 ? 44.675  6.551   40.903  1.00 11.40  ? 112 LYS B C     1 
ATOM   3840  O O     . LYS B 1 112 ? 45.350  6.001   40.035  1.00 15.15  ? 112 LYS B O     1 
ATOM   3841  C CB    . LYS B 1 112 ? 44.156  4.328   41.915  1.00 7.04   ? 112 LYS B CB    1 
ATOM   3842  C CG    . LYS B 1 112 ? 42.757  3.936   41.471  1.00 21.98  ? 112 LYS B CG    1 
ATOM   3843  C CD    . LYS B 1 112 ? 42.515  2.427   41.348  1.00 22.93  ? 112 LYS B CD    1 
ATOM   3844  C CE    . LYS B 1 112 ? 41.023  2.073   41.152  1.00 25.88  ? 112 LYS B CE    1 
ATOM   3845  N NZ    . LYS B 1 112 ? 40.279  2.117   42.401  1.00 28.77  ? 112 LYS B NZ    1 
ATOM   3846  H H     . LYS B 1 112 ? 42.581  5.951   43.171  1.00 0.00   ? 112 LYS B H     1 
ATOM   3847  H HZ1   . LYS B 1 112 ? 40.381  3.061   42.821  1.00 0.00   ? 112 LYS B HZ1   1 
ATOM   3848  H HZ2   . LYS B 1 112 ? 39.274  1.921   42.216  1.00 0.00   ? 112 LYS B HZ2   1 
ATOM   3849  H HZ3   . LYS B 1 112 ? 40.659  1.403   43.055  1.00 0.00   ? 112 LYS B HZ3   1 
ATOM   3850  N N     . TYR B 1 113 ? 44.196  7.770   40.649  1.00 9.15   ? 113 TYR B N     1 
ATOM   3851  C CA    . TYR B 1 113 ? 44.318  8.351   39.317  1.00 8.03   ? 113 TYR B CA    1 
ATOM   3852  C C     . TYR B 1 113 ? 45.160  9.599   39.242  1.00 6.40   ? 113 TYR B C     1 
ATOM   3853  O O     . TYR B 1 113 ? 45.270  10.373  40.195  1.00 5.97   ? 113 TYR B O     1 
ATOM   3854  C CB    . TYR B 1 113 ? 42.917  8.666   38.760  1.00 9.88   ? 113 TYR B CB    1 
ATOM   3855  C CG    . TYR B 1 113 ? 42.093  7.424   38.423  1.00 7.82   ? 113 TYR B CG    1 
ATOM   3856  C CD1   . TYR B 1 113 ? 42.362  6.733   37.253  1.00 9.22   ? 113 TYR B CD1   1 
ATOM   3857  C CD2   . TYR B 1 113 ? 41.132  6.952   39.301  1.00 4.92   ? 113 TYR B CD2   1 
ATOM   3858  C CE1   . TYR B 1 113 ? 41.707  5.544   36.984  1.00 10.46  ? 113 TYR B CE1   1 
ATOM   3859  C CE2   . TYR B 1 113 ? 40.494  5.749   39.045  1.00 5.65   ? 113 TYR B CE2   1 
ATOM   3860  C CZ    . TYR B 1 113 ? 40.815  5.041   37.899  1.00 6.74   ? 113 TYR B CZ    1 
ATOM   3861  O OH    . TYR B 1 113 ? 40.268  3.798   37.677  1.00 12.38  ? 113 TYR B OH    1 
ATOM   3862  H H     . TYR B 1 113 ? 43.779  8.299   41.358  1.00 0.00   ? 113 TYR B H     1 
ATOM   3863  H HH    . TYR B 1 113 ? 40.720  3.337   36.976  1.00 0.00   ? 113 TYR B HH    1 
ATOM   3864  N N     . VAL B 1 114 ? 45.748  9.791   38.073  1.00 7.99   ? 114 VAL B N     1 
ATOM   3865  C CA    . VAL B 1 114 ? 46.631  10.913  37.779  1.00 7.92   ? 114 VAL B CA    1 
ATOM   3866  C C     . VAL B 1 114 ? 45.914  11.711  36.687  1.00 8.94   ? 114 VAL B C     1 
ATOM   3867  O O     . VAL B 1 114 ? 45.595  11.149  35.628  1.00 12.92  ? 114 VAL B O     1 
ATOM   3868  C CB    . VAL B 1 114 ? 47.992  10.329  37.290  1.00 6.78   ? 114 VAL B CB    1 
ATOM   3869  C CG1   . VAL B 1 114 ? 48.927  11.464  36.956  1.00 13.63  ? 114 VAL B CG1   1 
ATOM   3870  C CG2   . VAL B 1 114 ? 48.621  9.441   38.361  1.00 2.00   ? 114 VAL B CG2   1 
ATOM   3871  H H     . VAL B 1 114 ? 45.565  9.169   37.338  1.00 0.00   ? 114 VAL B H     1 
ATOM   3872  N N     . VAL B 1 115 ? 45.620  12.992  36.900  1.00 11.59  ? 115 VAL B N     1 
ATOM   3873  C CA    . VAL B 1 115 ? 44.873  13.815  35.954  1.00 12.47  ? 115 VAL B CA    1 
ATOM   3874  C C     . VAL B 1 115 ? 45.817  14.893  35.501  1.00 13.17  ? 115 VAL B C     1 
ATOM   3875  O O     . VAL B 1 115 ? 46.447  15.514  36.368  1.00 16.07  ? 115 VAL B O     1 
ATOM   3876  C CB    . VAL B 1 115 ? 43.617  14.493  36.614  1.00 11.54  ? 115 VAL B CB    1 
ATOM   3877  C CG1   . VAL B 1 115 ? 42.824  15.346  35.628  1.00 8.39   ? 115 VAL B CG1   1 
ATOM   3878  C CG2   . VAL B 1 115 ? 42.647  13.420  37.041  1.00 6.52   ? 115 VAL B CG2   1 
ATOM   3879  H H     . VAL B 1 115 ? 45.998  13.429  37.694  1.00 0.00   ? 115 VAL B H     1 
ATOM   3880  N N     . CYS B 1 116 ? 45.931  15.115  34.193  1.00 8.02   ? 116 CYS B N     1 
ATOM   3881  C CA    . CYS B 1 116 ? 46.766  16.177  33.661  1.00 9.20   ? 116 CYS B CA    1 
ATOM   3882  C C     . CYS B 1 116 ? 45.789  17.037  32.888  1.00 7.44   ? 116 CYS B C     1 
ATOM   3883  O O     . CYS B 1 116 ? 45.034  16.507  32.073  1.00 9.93   ? 116 CYS B O     1 
ATOM   3884  C CB    . CYS B 1 116 ? 47.853  15.631  32.714  1.00 7.94   ? 116 CYS B CB    1 
ATOM   3885  S SG    . CYS B 1 116 ? 49.035  14.502  33.501  1.00 17.91  ? 116 CYS B SG    1 
ATOM   3886  H H     . CYS B 1 116 ? 45.411  14.577  33.564  1.00 0.00   ? 116 CYS B H     1 
ATOM   3887  N N     . PHE B 1 117 ? 45.751  18.336  33.090  1.00 7.36   ? 117 PHE B N     1 
ATOM   3888  C CA    . PHE B 1 117 ? 44.726  19.149  32.488  1.00 11.70  ? 117 PHE B CA    1 
ATOM   3889  C C     . PHE B 1 117 ? 45.215  20.547  32.265  1.00 15.15  ? 117 PHE B C     1 
ATOM   3890  O O     . PHE B 1 117 ? 46.041  21.050  33.030  1.00 20.09  ? 117 PHE B O     1 
ATOM   3891  C CB    . PHE B 1 117 ? 43.508  19.227  33.377  1.00 7.78   ? 117 PHE B CB    1 
ATOM   3892  C CG    . PHE B 1 117 ? 43.771  19.708  34.790  1.00 2.69   ? 117 PHE B CG    1 
ATOM   3893  C CD1   . PHE B 1 117 ? 44.183  18.802  35.741  1.00 3.30   ? 117 PHE B CD1   1 
ATOM   3894  C CD2   . PHE B 1 117 ? 43.625  21.044  35.100  1.00 2.00   ? 117 PHE B CD2   1 
ATOM   3895  C CE1   . PHE B 1 117 ? 44.510  19.236  37.007  1.00 4.17   ? 117 PHE B CE1   1 
ATOM   3896  C CE2   . PHE B 1 117 ? 43.936  21.476  36.373  1.00 5.84   ? 117 PHE B CE2   1 
ATOM   3897  C CZ    . PHE B 1 117 ? 44.384  20.577  37.323  1.00 5.57   ? 117 PHE B CZ    1 
ATOM   3898  H H     . PHE B 1 117 ? 46.431  18.783  33.642  1.00 0.00   ? 117 PHE B H     1 
ATOM   3899  N N     . ASP B 1 118 ? 44.697  21.188  31.236  1.00 19.21  ? 118 ASP B N     1 
ATOM   3900  C CA    . ASP B 1 118 ? 45.025  22.561  30.952  1.00 20.78  ? 118 ASP B CA    1 
ATOM   3901  C C     . ASP B 1 118 ? 43.677  23.214  31.224  1.00 20.01  ? 118 ASP B C     1 
ATOM   3902  O O     . ASP B 1 118 ? 42.762  23.051  30.415  1.00 21.55  ? 118 ASP B O     1 
ATOM   3903  C CB    . ASP B 1 118 ? 45.465  22.664  29.488  1.00 23.43  ? 118 ASP B CB    1 
ATOM   3904  C CG    . ASP B 1 118 ? 45.915  24.029  28.981  1.00 26.43  ? 118 ASP B CG    1 
ATOM   3905  O OD1   . ASP B 1 118 ? 45.723  25.060  29.634  1.00 34.85  ? 118 ASP B OD1   1 
ATOM   3906  O OD2   . ASP B 1 118 ? 46.460  24.058  27.885  1.00 29.64  ? 118 ASP B OD2   1 
ATOM   3907  H H     . ASP B 1 118 ? 44.036  20.723  30.677  1.00 0.00   ? 118 ASP B H     1 
ATOM   3908  N N     . PRO B 1 119 ? 43.490  23.935  32.342  1.00 20.84  ? 119 PRO B N     1 
ATOM   3909  C CA    . PRO B 1 119 ? 42.205  24.449  32.819  1.00 18.89  ? 119 PRO B CA    1 
ATOM   3910  C C     . PRO B 1 119 ? 41.485  25.307  31.796  1.00 18.36  ? 119 PRO B C     1 
ATOM   3911  O O     . PRO B 1 119 ? 40.282  25.159  31.577  1.00 23.84  ? 119 PRO B O     1 
ATOM   3912  C CB    . PRO B 1 119 ? 42.528  25.239  34.058  1.00 16.63  ? 119 PRO B CB    1 
ATOM   3913  C CG    . PRO B 1 119 ? 43.867  24.716  34.481  1.00 19.25  ? 119 PRO B CG    1 
ATOM   3914  C CD    . PRO B 1 119 ? 44.562  24.491  33.158  1.00 22.70  ? 119 PRO B CD    1 
ATOM   3915  N N     . LEU B 1 120 ? 42.212  26.178  31.121  1.00 12.05  ? 120 LEU B N     1 
ATOM   3916  C CA    . LEU B 1 120 ? 41.572  27.081  30.207  1.00 13.75  ? 120 LEU B CA    1 
ATOM   3917  C C     . LEU B 1 120 ? 42.539  27.332  29.074  1.00 16.14  ? 120 LEU B C     1 
ATOM   3918  O O     . LEU B 1 120 ? 43.334  28.281  29.071  1.00 17.84  ? 120 LEU B O     1 
ATOM   3919  C CB    . LEU B 1 120 ? 41.270  28.348  30.935  1.00 15.65  ? 120 LEU B CB    1 
ATOM   3920  C CG    . LEU B 1 120 ? 40.177  29.169  30.344  1.00 13.91  ? 120 LEU B CG    1 
ATOM   3921  C CD1   . LEU B 1 120 ? 38.865  28.550  30.742  1.00 15.87  ? 120 LEU B CD1   1 
ATOM   3922  C CD2   . LEU B 1 120 ? 40.231  30.584  30.862  1.00 14.53  ? 120 LEU B CD2   1 
ATOM   3923  H H     . LEU B 1 120 ? 43.184  26.196  31.217  1.00 0.00   ? 120 LEU B H     1 
ATOM   3924  N N     . ASP B 1 121 ? 42.559  26.403  28.142  1.00 16.11  ? 121 ASP B N     1 
ATOM   3925  C CA    . ASP B 1 121 ? 43.405  26.528  26.982  1.00 19.48  ? 121 ASP B CA    1 
ATOM   3926  C C     . ASP B 1 121 ? 42.984  27.744  26.196  1.00 18.86  ? 121 ASP B C     1 
ATOM   3927  O O     . ASP B 1 121 ? 41.803  28.049  26.051  1.00 19.82  ? 121 ASP B O     1 
ATOM   3928  C CB    . ASP B 1 121 ? 43.291  25.291  26.092  1.00 23.90  ? 121 ASP B CB    1 
ATOM   3929  C CG    . ASP B 1 121 ? 44.345  25.240  24.995  1.00 29.44  ? 121 ASP B CG    1 
ATOM   3930  O OD1   . ASP B 1 121 ? 45.505  25.559  25.263  1.00 33.29  ? 121 ASP B OD1   1 
ATOM   3931  O OD2   . ASP B 1 121 ? 43.997  24.895  23.870  1.00 31.59  ? 121 ASP B OD2   1 
ATOM   3932  H H     . ASP B 1 121 ? 41.965  25.633  28.236  1.00 0.00   ? 121 ASP B H     1 
ATOM   3933  N N     . GLY B 1 122 ? 43.995  28.440  25.719  1.00 20.04  ? 122 GLY B N     1 
ATOM   3934  C CA    . GLY B 1 122 ? 43.799  29.640  24.941  1.00 20.75  ? 122 GLY B CA    1 
ATOM   3935  C C     . GLY B 1 122 ? 43.412  30.840  25.784  1.00 23.15  ? 122 GLY B C     1 
ATOM   3936  O O     . GLY B 1 122 ? 42.883  31.798  25.228  1.00 24.94  ? 122 GLY B O     1 
ATOM   3937  H H     . GLY B 1 122 ? 44.902  28.132  25.911  1.00 0.00   ? 122 GLY B H     1 
ATOM   3938  N N     . SER B 1 123 ? 43.749  30.890  27.077  1.00 25.90  ? 123 SER B N     1 
ATOM   3939  C CA    . SER B 1 123 ? 43.341  31.993  27.945  1.00 34.58  ? 123 SER B CA    1 
ATOM   3940  C C     . SER B 1 123 ? 43.641  33.388  27.402  1.00 39.81  ? 123 SER B C     1 
ATOM   3941  O O     . SER B 1 123 ? 42.917  34.332  27.704  1.00 40.44  ? 123 SER B O     1 
ATOM   3942  C CB    . SER B 1 123 ? 44.009  31.864  29.310  1.00 36.75  ? 123 SER B CB    1 
ATOM   3943  O OG    . SER B 1 123 ? 44.786  30.675  29.441  1.00 47.05  ? 123 SER B OG    1 
ATOM   3944  H H     . SER B 1 123 ? 44.286  30.178  27.480  1.00 0.00   ? 123 SER B H     1 
ATOM   3945  H HG    . SER B 1 123 ? 44.173  29.925  29.491  1.00 0.00   ? 123 SER B HG    1 
ATOM   3946  N N     . SER B 1 124 ? 44.664  33.545  26.556  1.00 45.11  ? 124 SER B N     1 
ATOM   3947  C CA    . SER B 1 124 ? 45.024  34.814  25.922  1.00 50.05  ? 124 SER B CA    1 
ATOM   3948  C C     . SER B 1 124 ? 43.854  35.490  25.196  1.00 51.53  ? 124 SER B C     1 
ATOM   3949  O O     . SER B 1 124 ? 43.480  36.649  25.412  1.00 49.56  ? 124 SER B O     1 
ATOM   3950  C CB    . SER B 1 124 ? 46.179  34.579  24.897  1.00 54.42  ? 124 SER B CB    1 
ATOM   3951  O OG    . SER B 1 124 ? 46.680  33.238  24.731  1.00 55.35  ? 124 SER B OG    1 
ATOM   3952  H H     . SER B 1 124 ? 45.215  32.769  26.315  1.00 0.00   ? 124 SER B H     1 
ATOM   3953  H HG    . SER B 1 124 ? 47.062  33.192  23.841  1.00 0.00   ? 124 SER B HG    1 
ATOM   3954  N N     . ASN B 1 125 ? 43.209  34.588  24.456  1.00 54.32  ? 125 ASN B N     1 
ATOM   3955  C CA    . ASN B 1 125 ? 42.132  34.856  23.510  1.00 56.71  ? 125 ASN B CA    1 
ATOM   3956  C C     . ASN B 1 125 ? 40.792  35.249  24.106  1.00 54.30  ? 125 ASN B C     1 
ATOM   3957  O O     . ASN B 1 125 ? 39.888  35.701  23.385  1.00 53.14  ? 125 ASN B O     1 
ATOM   3958  C CB    . ASN B 1 125 ? 41.885  33.633  22.634  1.00 60.75  ? 125 ASN B CB    1 
ATOM   3959  C CG    . ASN B 1 125 ? 43.106  32.894  22.095  1.00 64.47  ? 125 ASN B CG    1 
ATOM   3960  O OD1   . ASN B 1 125 ? 44.269  33.317  22.120  1.00 65.36  ? 125 ASN B OD1   1 
ATOM   3961  N ND2   . ASN B 1 125 ? 42.837  31.692  21.637  1.00 67.72  ? 125 ASN B ND2   1 
ATOM   3962  H H     . ASN B 1 125 ? 43.478  33.649  24.556  1.00 0.00   ? 125 ASN B H     1 
ATOM   3963  H HD21  . ASN B 1 125 ? 43.582  31.181  21.256  1.00 0.00   ? 125 ASN B HD21  1 
ATOM   3964  H HD22  . ASN B 1 125 ? 41.916  31.370  21.701  1.00 0.00   ? 125 ASN B HD22  1 
ATOM   3965  N N     . ILE B 1 126 ? 40.653  35.112  25.428  1.00 51.63  ? 126 ILE B N     1 
ATOM   3966  C CA    . ILE B 1 126 ? 39.439  35.453  26.135  1.00 48.54  ? 126 ILE B CA    1 
ATOM   3967  C C     . ILE B 1 126 ? 39.154  36.949  25.957  1.00 48.44  ? 126 ILE B C     1 
ATOM   3968  O O     . ILE B 1 126 ? 37.993  37.324  25.876  1.00 49.51  ? 126 ILE B O     1 
ATOM   3969  C CB    . ILE B 1 126 ? 39.638  35.015  27.626  1.00 47.02  ? 126 ILE B CB    1 
ATOM   3970  C CG1   . ILE B 1 126 ? 38.283  34.868  28.292  1.00 45.66  ? 126 ILE B CG1   1 
ATOM   3971  C CG2   . ILE B 1 126 ? 40.459  36.027  28.408  1.00 47.21  ? 126 ILE B CG2   1 
ATOM   3972  C CD1   . ILE B 1 126 ? 37.477  33.660  27.807  1.00 42.86  ? 126 ILE B CD1   1 
ATOM   3973  H H     . ILE B 1 126 ? 41.424  34.787  25.942  1.00 0.00   ? 126 ILE B H     1 
ATOM   3974  N N     . ASP B 1 127 ? 40.141  37.844  25.802  1.00 47.63  ? 127 ASP B N     1 
ATOM   3975  C CA    . ASP B 1 127 ? 39.906  39.276  25.563  1.00 46.06  ? 127 ASP B CA    1 
ATOM   3976  C C     . ASP B 1 127 ? 39.245  39.556  24.206  1.00 42.98  ? 127 ASP B C     1 
ATOM   3977  O O     . ASP B 1 127 ? 38.504  40.523  24.019  1.00 38.93  ? 127 ASP B O     1 
ATOM   3978  C CB    . ASP B 1 127 ? 41.222  40.063  25.597  1.00 49.32  ? 127 ASP B CB    1 
ATOM   3979  C CG    . ASP B 1 127 ? 41.986  40.159  26.915  1.00 51.62  ? 127 ASP B CG    1 
ATOM   3980  O OD1   . ASP B 1 127 ? 41.789  39.341  27.815  1.00 56.37  ? 127 ASP B OD1   1 
ATOM   3981  O OD2   . ASP B 1 127 ? 42.804  41.070  27.029  1.00 55.21  ? 127 ASP B OD2   1 
ATOM   3982  H H     . ASP B 1 127 ? 41.069  37.525  25.866  1.00 0.00   ? 127 ASP B H     1 
ATOM   3983  N N     . CYS B 1 128 ? 39.534  38.703  23.226  1.00 40.28  ? 128 CYS B N     1 
ATOM   3984  C CA    . CYS B 1 128 ? 38.965  38.797  21.893  1.00 36.77  ? 128 CYS B CA    1 
ATOM   3985  C C     . CYS B 1 128 ? 37.714  37.952  21.760  1.00 32.64  ? 128 CYS B C     1 
ATOM   3986  O O     . CYS B 1 128 ? 37.118  37.850  20.682  1.00 32.62  ? 128 CYS B O     1 
ATOM   3987  C CB    . CYS B 1 128 ? 40.013  38.344  20.915  1.00 38.90  ? 128 CYS B CB    1 
ATOM   3988  S SG    . CYS B 1 128 ? 41.467  39.398  21.090  1.00 42.51  ? 128 CYS B SG    1 
ATOM   3989  H H     . CYS B 1 128 ? 40.174  37.983  23.398  1.00 0.00   ? 128 CYS B H     1 
ATOM   3990  N N     . LEU B 1 129 ? 37.350  37.344  22.898  1.00 31.17  ? 129 LEU B N     1 
ATOM   3991  C CA    . LEU B 1 129 ? 36.200  36.480  23.113  1.00 27.37  ? 129 LEU B CA    1 
ATOM   3992  C C     . LEU B 1 129 ? 36.237  35.294  22.170  1.00 26.68  ? 129 LEU B C     1 
ATOM   3993  O O     . LEU B 1 129 ? 35.220  34.852  21.621  1.00 30.18  ? 129 LEU B O     1 
ATOM   3994  C CB    . LEU B 1 129 ? 34.879  37.269  22.923  1.00 24.95  ? 129 LEU B CB    1 
ATOM   3995  C CG    . LEU B 1 129 ? 34.589  38.640  23.566  1.00 24.86  ? 129 LEU B CG    1 
ATOM   3996  C CD1   . LEU B 1 129 ? 33.077  38.777  23.642  1.00 22.54  ? 129 LEU B CD1   1 
ATOM   3997  C CD2   . LEU B 1 129 ? 35.137  38.776  24.986  1.00 18.97  ? 129 LEU B CD2   1 
ATOM   3998  H H     . LEU B 1 129 ? 37.904  37.474  23.693  1.00 0.00   ? 129 LEU B H     1 
ATOM   3999  N N     . VAL B 1 130 ? 37.444  34.784  21.966  1.00 19.01  ? 130 VAL B N     1 
ATOM   4000  C CA    . VAL B 1 130 ? 37.642  33.683  21.049  1.00 18.58  ? 130 VAL B CA    1 
ATOM   4001  C C     . VAL B 1 130 ? 37.488  32.420  21.893  1.00 18.75  ? 130 VAL B C     1 
ATOM   4002  O O     . VAL B 1 130 ? 37.779  32.447  23.101  1.00 18.39  ? 130 VAL B O     1 
ATOM   4003  C CB    . VAL B 1 130 ? 39.058  33.917  20.408  1.00 20.49  ? 130 VAL B CB    1 
ATOM   4004  C CG1   . VAL B 1 130 ? 39.793  32.675  19.927  1.00 12.19  ? 130 VAL B CG1   1 
ATOM   4005  C CG2   . VAL B 1 130 ? 38.789  34.761  19.164  1.00 22.05  ? 130 VAL B CG2   1 
ATOM   4006  H H     . VAL B 1 130 ? 38.179  35.050  22.555  1.00 0.00   ? 130 VAL B H     1 
ATOM   4007  N N     . SER B 1 131 ? 37.026  31.340  21.251  1.00 14.70  ? 131 SER B N     1 
ATOM   4008  C CA    . SER B 1 131 ? 36.789  30.062  21.901  1.00 16.48  ? 131 SER B CA    1 
ATOM   4009  C C     . SER B 1 131 ? 37.920  29.650  22.830  1.00 17.91  ? 131 SER B C     1 
ATOM   4010  O O     . SER B 1 131 ? 39.108  29.885  22.565  1.00 24.56  ? 131 SER B O     1 
ATOM   4011  C CB    . SER B 1 131 ? 36.563  28.992  20.829  1.00 19.05  ? 131 SER B CB    1 
ATOM   4012  O OG    . SER B 1 131 ? 35.567  29.311  19.848  1.00 23.30  ? 131 SER B OG    1 
ATOM   4013  H H     . SER B 1 131 ? 36.767  31.411  20.312  1.00 0.00   ? 131 SER B H     1 
ATOM   4014  H HG    . SER B 1 131 ? 35.045  28.522  19.655  1.00 0.00   ? 131 SER B HG    1 
ATOM   4015  N N     . VAL B 1 132 ? 37.525  29.090  23.960  1.00 15.27  ? 132 VAL B N     1 
ATOM   4016  C CA    . VAL B 1 132 ? 38.442  28.703  25.012  1.00 13.77  ? 132 VAL B CA    1 
ATOM   4017  C C     . VAL B 1 132 ? 38.144  27.235  25.380  1.00 12.22  ? 132 VAL B C     1 
ATOM   4018  O O     . VAL B 1 132 ? 37.168  26.710  24.836  1.00 11.32  ? 132 VAL B O     1 
ATOM   4019  C CB    . VAL B 1 132 ? 38.141  29.825  26.026  1.00 13.42  ? 132 VAL B CB    1 
ATOM   4020  C CG1   . VAL B 1 132 ? 38.490  29.477  27.425  1.00 17.72  ? 132 VAL B CG1   1 
ATOM   4021  C CG2   . VAL B 1 132 ? 39.040  30.992  25.681  1.00 9.67   ? 132 VAL B CG2   1 
ATOM   4022  H H     . VAL B 1 132 ? 36.573  28.913  24.098  1.00 0.00   ? 132 VAL B H     1 
ATOM   4023  N N     . GLY B 1 133 ? 38.854  26.453  26.211  1.00 9.04   ? 133 GLY B N     1 
ATOM   4024  C CA    . GLY B 1 133 ? 38.472  25.072  26.453  1.00 2.00   ? 133 GLY B CA    1 
ATOM   4025  C C     . GLY B 1 133 ? 39.230  24.448  27.597  1.00 4.98   ? 133 GLY B C     1 
ATOM   4026  O O     . GLY B 1 133 ? 40.232  24.989  28.068  1.00 10.48  ? 133 GLY B O     1 
ATOM   4027  H H     . GLY B 1 133 ? 39.681  26.790  26.620  1.00 0.00   ? 133 GLY B H     1 
ATOM   4028  N N     . THR B 1 134 ? 38.811  23.301  28.092  1.00 5.14   ? 134 THR B N     1 
ATOM   4029  C CA    . THR B 1 134 ? 39.509  22.658  29.193  1.00 6.12   ? 134 THR B CA    1 
ATOM   4030  C C     . THR B 1 134 ? 39.883  21.311  28.659  1.00 7.09   ? 134 THR B C     1 
ATOM   4031  O O     . THR B 1 134 ? 38.966  20.592  28.254  1.00 10.85  ? 134 THR B O     1 
ATOM   4032  C CB    . THR B 1 134 ? 38.568  22.540  30.390  1.00 4.58   ? 134 THR B CB    1 
ATOM   4033  O OG1   . THR B 1 134 ? 38.130  23.887  30.637  1.00 4.74   ? 134 THR B OG1   1 
ATOM   4034  C CG2   . THR B 1 134 ? 39.207  21.880  31.604  1.00 3.11   ? 134 THR B CG2   1 
ATOM   4035  H H     . THR B 1 134 ? 37.987  22.893  27.755  1.00 0.00   ? 134 THR B H     1 
ATOM   4036  H HG1   . THR B 1 134 ? 38.906  24.462  30.549  1.00 0.00   ? 134 THR B HG1   1 
ATOM   4037  N N     . ILE B 1 135 ? 41.191  20.999  28.613  1.00 7.95   ? 135 ILE B N     1 
ATOM   4038  C CA    . ILE B 1 135 ? 41.699  19.742  28.065  1.00 7.44   ? 135 ILE B CA    1 
ATOM   4039  C C     . ILE B 1 135 ? 42.056  18.849  29.235  1.00 7.86   ? 135 ILE B C     1 
ATOM   4040  O O     . ILE B 1 135 ? 42.574  19.385  30.222  1.00 12.29  ? 135 ILE B O     1 
ATOM   4041  C CB    . ILE B 1 135 ? 42.974  19.967  27.203  1.00 8.05   ? 135 ILE B CB    1 
ATOM   4042  C CG1   . ILE B 1 135 ? 42.821  21.092  26.191  1.00 2.44   ? 135 ILE B CG1   1 
ATOM   4043  C CG2   . ILE B 1 135 ? 43.257  18.665  26.479  1.00 9.23   ? 135 ILE B CG2   1 
ATOM   4044  C CD1   . ILE B 1 135 ? 43.983  21.353  25.219  1.00 2.00   ? 135 ILE B CD1   1 
ATOM   4045  H H     . ILE B 1 135 ? 41.835  21.594  29.058  1.00 0.00   ? 135 ILE B H     1 
ATOM   4046  N N     . PHE B 1 136 ? 41.834  17.537  29.214  1.00 9.55   ? 136 PHE B N     1 
ATOM   4047  C CA    . PHE B 1 136 ? 42.214  16.704  30.353  1.00 12.03  ? 136 PHE B CA    1 
ATOM   4048  C C     . PHE B 1 136 ? 42.514  15.257  29.965  1.00 10.80  ? 136 PHE B C     1 
ATOM   4049  O O     . PHE B 1 136 ? 41.935  14.714  29.007  1.00 11.35  ? 136 PHE B O     1 
ATOM   4050  C CB    . PHE B 1 136 ? 41.095  16.733  31.434  1.00 12.56  ? 136 PHE B CB    1 
ATOM   4051  C CG    . PHE B 1 136 ? 39.698  16.347  30.948  1.00 9.85   ? 136 PHE B CG    1 
ATOM   4052  C CD1   . PHE B 1 136 ? 39.311  15.017  30.925  1.00 9.91   ? 136 PHE B CD1   1 
ATOM   4053  C CD2   . PHE B 1 136 ? 38.850  17.317  30.443  1.00 4.89   ? 136 PHE B CD2   1 
ATOM   4054  C CE1   . PHE B 1 136 ? 38.117  14.661  30.331  1.00 7.26   ? 136 PHE B CE1   1 
ATOM   4055  C CE2   . PHE B 1 136 ? 37.667  16.948  29.846  1.00 3.94   ? 136 PHE B CE2   1 
ATOM   4056  C CZ    . PHE B 1 136 ? 37.306  15.618  29.780  1.00 4.33   ? 136 PHE B CZ    1 
ATOM   4057  H H     . PHE B 1 136 ? 41.422  17.106  28.437  1.00 0.00   ? 136 PHE B H     1 
ATOM   4058  N N     . GLY B 1 137 ? 43.415  14.638  30.720  1.00 4.30   ? 137 GLY B N     1 
ATOM   4059  C CA    . GLY B 1 137 ? 43.826  13.263  30.500  1.00 6.59   ? 137 GLY B CA    1 
ATOM   4060  C C     . GLY B 1 137 ? 43.940  12.574  31.845  1.00 8.43   ? 137 GLY B C     1 
ATOM   4061  O O     . GLY B 1 137 ? 44.305  13.206  32.841  1.00 12.23  ? 137 GLY B O     1 
ATOM   4062  H H     . GLY B 1 137 ? 43.820  15.113  31.475  1.00 0.00   ? 137 GLY B H     1 
ATOM   4063  N N     . ILE B 1 138 ? 43.592  11.295  31.917  1.00 15.41  ? 138 ILE B N     1 
ATOM   4064  C CA    . ILE B 1 138 ? 43.554  10.547  33.173  1.00 17.02  ? 138 ILE B CA    1 
ATOM   4065  C C     . ILE B 1 138 ? 44.383  9.282   33.004  1.00 15.51  ? 138 ILE B C     1 
ATOM   4066  O O     . ILE B 1 138 ? 44.076  8.475   32.121  1.00 14.50  ? 138 ILE B O     1 
ATOM   4067  C CB    . ILE B 1 138 ? 42.042  10.242  33.497  1.00 17.64  ? 138 ILE B CB    1 
ATOM   4068  C CG1   . ILE B 1 138 ? 41.301  11.559  33.760  1.00 18.66  ? 138 ILE B CG1   1 
ATOM   4069  C CG2   . ILE B 1 138 ? 41.916  9.370   34.737  1.00 14.75  ? 138 ILE B CG2   1 
ATOM   4070  C CD1   . ILE B 1 138 ? 39.778  11.522  33.599  1.00 19.08  ? 138 ILE B CD1   1 
ATOM   4071  H H     . ILE B 1 138 ? 43.315  10.827  31.099  1.00 0.00   ? 138 ILE B H     1 
ATOM   4072  N N     . TYR B 1 139 ? 45.470  9.084   33.744  1.00 16.96  ? 139 TYR B N     1 
ATOM   4073  C CA    . TYR B 1 139 ? 46.274  7.883   33.621  1.00 14.94  ? 139 TYR B CA    1 
ATOM   4074  C C     . TYR B 1 139 ? 46.072  7.198   34.952  1.00 18.65  ? 139 TYR B C     1 
ATOM   4075  O O     . TYR B 1 139 ? 45.840  7.856   35.973  1.00 23.11  ? 139 TYR B O     1 
ATOM   4076  C CB    . TYR B 1 139 ? 47.775  8.144   33.481  1.00 12.55  ? 139 TYR B CB    1 
ATOM   4077  C CG    . TYR B 1 139 ? 48.285  9.054   32.371  1.00 16.58  ? 139 TYR B CG    1 
ATOM   4078  C CD1   . TYR B 1 139 ? 48.281  10.419  32.567  1.00 23.01  ? 139 TYR B CD1   1 
ATOM   4079  C CD2   . TYR B 1 139 ? 48.793  8.528   31.196  1.00 16.94  ? 139 TYR B CD2   1 
ATOM   4080  C CE1   . TYR B 1 139 ? 48.759  11.263  31.581  1.00 31.95  ? 139 TYR B CE1   1 
ATOM   4081  C CE2   . TYR B 1 139 ? 49.276  9.369   30.206  1.00 23.52  ? 139 TYR B CE2   1 
ATOM   4082  C CZ    . TYR B 1 139 ? 49.229  10.740  30.390  1.00 30.98  ? 139 TYR B CZ    1 
ATOM   4083  O OH    . TYR B 1 139 ? 49.596  11.606  29.368  1.00 32.97  ? 139 TYR B OH    1 
ATOM   4084  H H     . TYR B 1 139 ? 45.696  9.719   34.450  1.00 0.00   ? 139 TYR B H     1 
ATOM   4085  H HH    . TYR B 1 139 ? 49.743  12.491  29.711  1.00 0.00   ? 139 TYR B HH    1 
ATOM   4086  N N     . ARG B 1 140 ? 46.138  5.880   35.001  1.00 23.49  ? 140 ARG B N     1 
ATOM   4087  C CA    . ARG B 1 140 ? 45.995  5.214   36.271  1.00 29.46  ? 140 ARG B CA    1 
ATOM   4088  C C     . ARG B 1 140 ? 47.403  5.145   36.831  1.00 35.48  ? 140 ARG B C     1 
ATOM   4089  O O     . ARG B 1 140 ? 48.349  4.857   36.076  1.00 34.76  ? 140 ARG B O     1 
ATOM   4090  C CB    . ARG B 1 140 ? 45.456  3.836   36.053  1.00 32.81  ? 140 ARG B CB    1 
ATOM   4091  C CG    . ARG B 1 140 ? 44.973  3.180   37.344  1.00 41.26  ? 140 ARG B CG    1 
ATOM   4092  C CD    . ARG B 1 140 ? 44.644  1.697   37.143  1.00 45.93  ? 140 ARG B CD    1 
ATOM   4093  N NE    . ARG B 1 140 ? 43.777  1.484   35.988  1.00 51.62  ? 140 ARG B NE    1 
ATOM   4094  C CZ    . ARG B 1 140 ? 42.777  0.600   35.990  1.00 52.79  ? 140 ARG B CZ    1 
ATOM   4095  N NH1   . ARG B 1 140 ? 42.478  -0.139  37.065  1.00 55.45  ? 140 ARG B NH1   1 
ATOM   4096  N NH2   . ARG B 1 140 ? 42.058  0.471   34.877  1.00 53.65  ? 140 ARG B NH2   1 
ATOM   4097  H H     . ARG B 1 140 ? 46.389  5.372   34.203  1.00 0.00   ? 140 ARG B H     1 
ATOM   4098  H HE    . ARG B 1 140 ? 43.929  1.997   35.168  1.00 0.00   ? 140 ARG B HE    1 
ATOM   4099  H HH11  . ARG B 1 140 ? 43.012  -0.046  37.905  1.00 0.00   ? 140 ARG B HH11  1 
ATOM   4100  H HH12  . ARG B 1 140 ? 41.719  -0.789  37.028  1.00 0.00   ? 140 ARG B HH12  1 
ATOM   4101  H HH21  . ARG B 1 140 ? 42.270  1.036   34.079  1.00 0.00   ? 140 ARG B HH21  1 
ATOM   4102  H HH22  . ARG B 1 140 ? 41.292  -0.171  34.845  1.00 0.00   ? 140 ARG B HH22  1 
ATOM   4103  N N     . LYS B 1 141 ? 47.568  5.409   38.126  1.00 39.52  ? 141 LYS B N     1 
ATOM   4104  C CA    . LYS B 1 141 ? 48.877  5.327   38.745  1.00 46.89  ? 141 LYS B CA    1 
ATOM   4105  C C     . LYS B 1 141 ? 49.138  3.833   38.898  1.00 52.79  ? 141 LYS B C     1 
ATOM   4106  O O     . LYS B 1 141 ? 48.442  3.128   39.629  1.00 54.68  ? 141 LYS B O     1 
ATOM   4107  C CB    . LYS B 1 141 ? 48.871  6.024   40.111  1.00 43.71  ? 141 LYS B CB    1 
ATOM   4108  C CG    . LYS B 1 141 ? 50.163  5.822   40.893  1.00 44.57  ? 141 LYS B CG    1 
ATOM   4109  C CD    . LYS B 1 141 ? 50.080  6.391   42.304  1.00 45.79  ? 141 LYS B CD    1 
ATOM   4110  C CE    . LYS B 1 141 ? 50.981  5.634   43.285  1.00 42.50  ? 141 LYS B CE    1 
ATOM   4111  N NZ    . LYS B 1 141 ? 52.385  5.682   42.931  1.00 39.18  ? 141 LYS B NZ    1 
ATOM   4112  H H     . LYS B 1 141 ? 46.787  5.596   38.693  1.00 0.00   ? 141 LYS B H     1 
ATOM   4113  H HZ1   . LYS B 1 141 ? 52.513  5.349   41.955  1.00 0.00   ? 141 LYS B HZ1   1 
ATOM   4114  H HZ2   . LYS B 1 141 ? 52.732  6.658   43.021  1.00 0.00   ? 141 LYS B HZ2   1 
ATOM   4115  H HZ3   . LYS B 1 141 ? 52.919  5.066   43.577  1.00 0.00   ? 141 LYS B HZ3   1 
ATOM   4116  N N     . LYS B 1 142 ? 50.101  3.329   38.136  1.00 58.79  ? 142 LYS B N     1 
ATOM   4117  C CA    . LYS B 1 142 ? 50.455  1.912   38.175  1.00 64.78  ? 142 LYS B CA    1 
ATOM   4118  C C     . LYS B 1 142 ? 51.538  1.568   39.196  1.00 64.61  ? 142 LYS B C     1 
ATOM   4119  O O     . LYS B 1 142 ? 51.816  0.415   39.529  1.00 64.80  ? 142 LYS B O     1 
ATOM   4120  C CB    . LYS B 1 142 ? 50.893  1.479   36.759  1.00 70.35  ? 142 LYS B CB    1 
ATOM   4121  C CG    . LYS B 1 142 ? 51.978  2.334   36.082  1.00 79.02  ? 142 LYS B CG    1 
ATOM   4122  C CD    . LYS B 1 142 ? 52.144  1.967   34.601  1.00 84.65  ? 142 LYS B CD    1 
ATOM   4123  C CE    . LYS B 1 142 ? 53.070  2.931   33.835  1.00 87.34  ? 142 LYS B CE    1 
ATOM   4124  N NZ    . LYS B 1 142 ? 54.476  2.777   34.167  1.00 89.96  ? 142 LYS B NZ    1 
ATOM   4125  H H     . LYS B 1 142 ? 50.523  3.937   37.492  1.00 0.00   ? 142 LYS B H     1 
ATOM   4126  H HZ1   . LYS B 1 142 ? 54.613  2.936   35.185  1.00 0.00   ? 142 LYS B HZ1   1 
ATOM   4127  H HZ2   . LYS B 1 142 ? 54.779  1.812   33.923  1.00 0.00   ? 142 LYS B HZ2   1 
ATOM   4128  H HZ3   . LYS B 1 142 ? 55.038  3.463   33.624  1.00 0.00   ? 142 LYS B HZ3   1 
ATOM   4129  N N     . SER B 1 143 ? 52.171  2.587   39.737  1.00 65.80  ? 143 SER B N     1 
ATOM   4130  C CA    . SER B 1 143 ? 53.295  2.408   40.617  1.00 66.57  ? 143 SER B CA    1 
ATOM   4131  C C     . SER B 1 143 ? 52.863  2.040   42.017  1.00 66.09  ? 143 SER B C     1 
ATOM   4132  O O     . SER B 1 143 ? 51.908  2.563   42.576  1.00 63.93  ? 143 SER B O     1 
ATOM   4133  C CB    . SER B 1 143 ? 54.066  3.700   40.578  1.00 70.23  ? 143 SER B CB    1 
ATOM   4134  O OG    . SER B 1 143 ? 54.157  4.123   39.213  1.00 78.28  ? 143 SER B OG    1 
ATOM   4135  H H     . SER B 1 143 ? 51.861  3.494   39.565  1.00 0.00   ? 143 SER B H     1 
ATOM   4136  H HG    . SER B 1 143 ? 54.381  5.059   39.148  1.00 0.00   ? 143 SER B HG    1 
ATOM   4137  N N     . THR B 1 144 ? 53.636  1.130   42.578  1.00 67.23  ? 144 THR B N     1 
ATOM   4138  C CA    . THR B 1 144 ? 53.388  0.628   43.914  1.00 69.73  ? 144 THR B CA    1 
ATOM   4139  C C     . THR B 1 144 ? 53.790  1.632   45.004  1.00 69.69  ? 144 THR B C     1 
ATOM   4140  O O     . THR B 1 144 ? 53.374  1.540   46.157  1.00 71.46  ? 144 THR B O     1 
ATOM   4141  C CB    . THR B 1 144 ? 54.179  -0.697  44.019  1.00 71.62  ? 144 THR B CB    1 
ATOM   4142  O OG1   . THR B 1 144 ? 53.901  -1.457  42.833  1.00 71.12  ? 144 THR B OG1   1 
ATOM   4143  C CG2   . THR B 1 144 ? 53.823  -1.483  45.275  1.00 73.53  ? 144 THR B CG2   1 
ATOM   4144  H H     . THR B 1 144 ? 54.380  0.744   42.072  1.00 0.00   ? 144 THR B H     1 
ATOM   4145  H HG1   . THR B 1 144 ? 53.367  -0.986  42.180  1.00 0.00   ? 144 THR B HG1   1 
ATOM   4146  N N     . ASP B 1 145 ? 54.620  2.607   44.644  1.00 68.82  ? 145 ASP B N     1 
ATOM   4147  C CA    . ASP B 1 145 ? 55.205  3.536   45.600  1.00 67.52  ? 145 ASP B CA    1 
ATOM   4148  C C     . ASP B 1 145 ? 54.352  4.711   46.056  1.00 62.87  ? 145 ASP B C     1 
ATOM   4149  O O     . ASP B 1 145 ? 53.234  4.916   45.590  1.00 66.03  ? 145 ASP B O     1 
ATOM   4150  C CB    . ASP B 1 145 ? 56.524  4.072   45.006  1.00 75.01  ? 145 ASP B CB    1 
ATOM   4151  C CG    . ASP B 1 145 ? 56.493  4.631   43.577  1.00 80.28  ? 145 ASP B CG    1 
ATOM   4152  O OD1   . ASP B 1 145 ? 56.085  5.781   43.368  1.00 83.55  ? 145 ASP B OD1   1 
ATOM   4153  O OD2   . ASP B 1 145 ? 56.906  3.903   42.672  1.00 82.25  ? 145 ASP B OD2   1 
ATOM   4154  H H     . ASP B 1 145 ? 54.705  2.811   43.699  1.00 0.00   ? 145 ASP B H     1 
ATOM   4155  N N     . GLU B 1 146 ? 54.908  5.510   46.971  1.00 55.55  ? 146 GLU B N     1 
ATOM   4156  C CA    . GLU B 1 146 ? 54.305  6.764   47.391  1.00 48.62  ? 146 GLU B CA    1 
ATOM   4157  C C     . GLU B 1 146 ? 54.259  7.668   46.150  1.00 42.56  ? 146 GLU B C     1 
ATOM   4158  O O     . GLU B 1 146 ? 55.223  7.658   45.380  1.00 41.20  ? 146 GLU B O     1 
ATOM   4159  C CB    . GLU B 1 146 ? 55.173  7.372   48.503  1.00 51.33  ? 146 GLU B CB    1 
ATOM   4160  C CG    . GLU B 1 146 ? 54.800  8.804   48.918  1.00 56.09  ? 146 GLU B CG    1 
ATOM   4161  C CD    . GLU B 1 146 ? 55.487  9.334   50.169  1.00 56.33  ? 146 GLU B CD    1 
ATOM   4162  O OE1   . GLU B 1 146 ? 56.714  9.419   50.203  1.00 55.11  ? 146 GLU B OE1   1 
ATOM   4163  O OE2   . GLU B 1 146 ? 54.778  9.670   51.116  1.00 59.55  ? 146 GLU B OE2   1 
ATOM   4164  H H     . GLU B 1 146 ? 55.772  5.261   47.346  1.00 0.00   ? 146 GLU B H     1 
ATOM   4165  N N     . PRO B 1 147 ? 53.191  8.411   45.850  1.00 37.90  ? 147 PRO B N     1 
ATOM   4166  C CA    . PRO B 1 147 ? 53.091  9.233   44.654  1.00 36.09  ? 147 PRO B CA    1 
ATOM   4167  C C     . PRO B 1 147 ? 54.090  10.370  44.542  1.00 34.82  ? 147 PRO B C     1 
ATOM   4168  O O     . PRO B 1 147 ? 54.486  10.993  45.530  1.00 33.52  ? 147 PRO B O     1 
ATOM   4169  C CB    . PRO B 1 147 ? 51.665  9.707   44.657  1.00 33.11  ? 147 PRO B CB    1 
ATOM   4170  C CG    . PRO B 1 147 ? 51.326  9.696   46.112  1.00 33.71  ? 147 PRO B CG    1 
ATOM   4171  C CD    . PRO B 1 147 ? 51.926  8.390   46.561  1.00 34.39  ? 147 PRO B CD    1 
ATOM   4172  N N     . SER B 1 148 ? 54.468  10.655  43.307  1.00 31.96  ? 148 SER B N     1 
ATOM   4173  C CA    . SER B 1 148 ? 55.447  11.682  43.013  1.00 33.65  ? 148 SER B CA    1 
ATOM   4174  C C     . SER B 1 148 ? 55.231  12.173  41.596  1.00 33.52  ? 148 SER B C     1 
ATOM   4175  O O     . SER B 1 148 ? 54.476  11.555  40.834  1.00 34.84  ? 148 SER B O     1 
ATOM   4176  C CB    . SER B 1 148 ? 56.822  11.088  43.142  1.00 35.35  ? 148 SER B CB    1 
ATOM   4177  O OG    . SER B 1 148 ? 56.827  9.783   42.554  1.00 41.87  ? 148 SER B OG    1 
ATOM   4178  H H     . SER B 1 148 ? 54.098  10.161  42.547  1.00 0.00   ? 148 SER B H     1 
ATOM   4179  H HG    . SER B 1 148 ? 56.598  9.157   43.264  1.00 0.00   ? 148 SER B HG    1 
ATOM   4180  N N     . GLU B 1 149 ? 55.929  13.245  41.212  1.00 31.52  ? 149 GLU B N     1 
ATOM   4181  C CA    . GLU B 1 149 ? 55.847  13.805  39.870  1.00 29.36  ? 149 GLU B CA    1 
ATOM   4182  C C     . GLU B 1 149 ? 56.141  12.742  38.819  1.00 27.67  ? 149 GLU B C     1 
ATOM   4183  O O     . GLU B 1 149 ? 55.472  12.729  37.795  1.00 28.04  ? 149 GLU B O     1 
ATOM   4184  C CB    . GLU B 1 149 ? 56.844  14.969  39.741  1.00 30.59  ? 149 GLU B CB    1 
ATOM   4185  C CG    . GLU B 1 149 ? 56.659  15.860  38.504  1.00 35.75  ? 149 GLU B CG    1 
ATOM   4186  C CD    . GLU B 1 149 ? 57.473  17.162  38.450  1.00 38.45  ? 149 GLU B CD    1 
ATOM   4187  O OE1   . GLU B 1 149 ? 57.272  18.040  39.291  1.00 38.30  ? 149 GLU B OE1   1 
ATOM   4188  O OE2   . GLU B 1 149 ? 58.291  17.317  37.539  1.00 38.45  ? 149 GLU B OE2   1 
ATOM   4189  H H     . GLU B 1 149 ? 56.472  13.710  41.880  1.00 0.00   ? 149 GLU B H     1 
ATOM   4190  N N     . LYS B 1 150 ? 57.051  11.784  39.058  1.00 27.40  ? 150 LYS B N     1 
ATOM   4191  C CA    . LYS B 1 150 ? 57.384  10.755  38.077  1.00 25.74  ? 150 LYS B CA    1 
ATOM   4192  C C     . LYS B 1 150 ? 56.144  9.955   37.695  1.00 28.18  ? 150 LYS B C     1 
ATOM   4193  O O     . LYS B 1 150 ? 56.070  9.488   36.560  1.00 29.30  ? 150 LYS B O     1 
ATOM   4194  C CB    . LYS B 1 150 ? 58.415  9.741   38.591  1.00 23.25  ? 150 LYS B CB    1 
ATOM   4195  C CG    . LYS B 1 150 ? 59.808  10.186  39.040  1.00 24.34  ? 150 LYS B CG    1 
ATOM   4196  C CD    . LYS B 1 150 ? 60.563  10.885  37.910  1.00 31.44  ? 150 LYS B CD    1 
ATOM   4197  C CE    . LYS B 1 150 ? 62.011  11.248  38.254  1.00 32.46  ? 150 LYS B CE    1 
ATOM   4198  N NZ    . LYS B 1 150 ? 62.128  11.977  39.503  1.00 30.73  ? 150 LYS B NZ    1 
ATOM   4199  H H     . LYS B 1 150 ? 57.491  11.756  39.928  1.00 0.00   ? 150 LYS B H     1 
ATOM   4200  H HZ1   . LYS B 1 150 ? 61.584  12.862  39.446  1.00 0.00   ? 150 LYS B HZ1   1 
ATOM   4201  H HZ2   . LYS B 1 150 ? 61.757  11.396  40.282  1.00 0.00   ? 150 LYS B HZ2   1 
ATOM   4202  H HZ3   . LYS B 1 150 ? 63.127  12.197  39.686  1.00 0.00   ? 150 LYS B HZ3   1 
ATOM   4203  N N     . ASP B 1 151 ? 55.122  9.838   38.566  1.00 25.33  ? 151 ASP B N     1 
ATOM   4204  C CA    . ASP B 1 151 ? 53.920  9.093   38.238  1.00 22.41  ? 151 ASP B CA    1 
ATOM   4205  C C     . ASP B 1 151 ? 53.143  9.736   37.106  1.00 21.44  ? 151 ASP B C     1 
ATOM   4206  O O     . ASP B 1 151 ? 52.241  9.115   36.574  1.00 19.17  ? 151 ASP B O     1 
ATOM   4207  C CB    . ASP B 1 151 ? 52.994  8.973   39.449  1.00 22.49  ? 151 ASP B CB    1 
ATOM   4208  C CG    . ASP B 1 151 ? 53.424  7.922   40.475  1.00 24.93  ? 151 ASP B CG    1 
ATOM   4209  O OD1   . ASP B 1 151 ? 54.043  6.921   40.105  1.00 22.13  ? 151 ASP B OD1   1 
ATOM   4210  O OD2   . ASP B 1 151 ? 53.129  8.095   41.657  1.00 18.20  ? 151 ASP B OD2   1 
ATOM   4211  H H     . ASP B 1 151 ? 55.150  10.336  39.407  1.00 0.00   ? 151 ASP B H     1 
ATOM   4212  N N     . ALA B 1 152 ? 53.456  10.968  36.706  1.00 20.31  ? 152 ALA B N     1 
ATOM   4213  C CA    . ALA B 1 152 ? 52.804  11.610  35.588  1.00 17.67  ? 152 ALA B CA    1 
ATOM   4214  C C     . ALA B 1 152 ? 53.519  11.328  34.283  1.00 15.45  ? 152 ALA B C     1 
ATOM   4215  O O     . ALA B 1 152 ? 53.029  11.649  33.197  1.00 22.31  ? 152 ALA B O     1 
ATOM   4216  C CB    . ALA B 1 152 ? 52.772  13.108  35.809  1.00 20.46  ? 152 ALA B CB    1 
ATOM   4217  H H     . ALA B 1 152 ? 54.144  11.468  37.185  1.00 0.00   ? 152 ALA B H     1 
ATOM   4218  N N     . LEU B 1 153 ? 54.688  10.710  34.347  1.00 17.35  ? 153 LEU B N     1 
ATOM   4219  C CA    . LEU B 1 153 ? 55.464  10.408  33.165  1.00 15.09  ? 153 LEU B CA    1 
ATOM   4220  C C     . LEU B 1 153 ? 55.084  9.029   32.662  1.00 16.29  ? 153 LEU B C     1 
ATOM   4221  O O     . LEU B 1 153 ? 55.815  8.048   32.833  1.00 18.02  ? 153 LEU B O     1 
ATOM   4222  C CB    . LEU B 1 153 ? 56.939  10.457  33.513  1.00 13.68  ? 153 LEU B CB    1 
ATOM   4223  C CG    . LEU B 1 153 ? 57.500  11.684  34.217  1.00 9.69   ? 153 LEU B CG    1 
ATOM   4224  C CD1   . LEU B 1 153 ? 59.005  11.509  34.375  1.00 11.07  ? 153 LEU B CD1   1 
ATOM   4225  C CD2   . LEU B 1 153 ? 57.231  12.928  33.413  1.00 7.47   ? 153 LEU B CD2   1 
ATOM   4226  H H     . LEU B 1 153 ? 55.006  10.362  35.203  1.00 0.00   ? 153 LEU B H     1 
ATOM   4227  N N     . GLN B 1 154 ? 53.885  8.889   32.087  1.00 18.27  ? 154 GLN B N     1 
ATOM   4228  C CA    . GLN B 1 154 ? 53.474  7.610   31.502  1.00 18.98  ? 154 GLN B CA    1 
ATOM   4229  C C     . GLN B 1 154 ? 53.143  7.991   30.068  1.00 19.27  ? 154 GLN B C     1 
ATOM   4230  O O     . GLN B 1 154 ? 52.714  9.131   29.870  1.00 20.91  ? 154 GLN B O     1 
ATOM   4231  C CB    . GLN B 1 154 ? 52.235  7.052   32.196  1.00 16.40  ? 154 GLN B CB    1 
ATOM   4232  C CG    . GLN B 1 154 ? 52.345  7.118   33.704  1.00 14.42  ? 154 GLN B CG    1 
ATOM   4233  C CD    . GLN B 1 154 ? 51.224  6.460   34.473  1.00 25.56  ? 154 GLN B CD    1 
ATOM   4234  O OE1   . GLN B 1 154 ? 50.903  6.851   35.590  1.00 26.12  ? 154 GLN B OE1   1 
ATOM   4235  N NE2   . GLN B 1 154 ? 50.570  5.410   33.984  1.00 26.93  ? 154 GLN B NE2   1 
ATOM   4236  H H     . GLN B 1 154 ? 53.310  9.676   31.957  1.00 0.00   ? 154 GLN B H     1 
ATOM   4237  H HE21  . GLN B 1 154 ? 49.831  5.100   34.564  1.00 0.00   ? 154 GLN B HE21  1 
ATOM   4238  H HE22  . GLN B 1 154 ? 50.822  5.038   33.125  1.00 0.00   ? 154 GLN B HE22  1 
ATOM   4239  N N     . PRO B 1 155 ? 53.336  7.179   29.023  1.00 20.34  ? 155 PRO B N     1 
ATOM   4240  C CA    . PRO B 1 155 ? 53.043  7.590   27.652  1.00 22.22  ? 155 PRO B CA    1 
ATOM   4241  C C     . PRO B 1 155 ? 51.537  7.678   27.480  1.00 23.71  ? 155 PRO B C     1 
ATOM   4242  O O     . PRO B 1 155 ? 50.821  6.936   28.167  1.00 24.27  ? 155 PRO B O     1 
ATOM   4243  C CB    . PRO B 1 155 ? 53.725  6.526   26.823  1.00 18.06  ? 155 PRO B CB    1 
ATOM   4244  C CG    . PRO B 1 155 ? 53.617  5.294   27.674  1.00 15.53  ? 155 PRO B CG    1 
ATOM   4245  C CD    . PRO B 1 155 ? 53.916  5.842   29.065  1.00 19.00  ? 155 PRO B CD    1 
ATOM   4246  N N     . GLY B 1 156 ? 51.011  8.515   26.583  1.00 27.62  ? 156 GLY B N     1 
ATOM   4247  C CA    . GLY B 1 156 ? 49.569  8.667   26.356  1.00 25.34  ? 156 GLY B CA    1 
ATOM   4248  C C     . GLY B 1 156 ? 48.849  7.376   26.056  1.00 26.26  ? 156 GLY B C     1 
ATOM   4249  O O     . GLY B 1 156 ? 47.638  7.248   26.186  1.00 30.86  ? 156 GLY B O     1 
ATOM   4250  H H     . GLY B 1 156 ? 51.617  9.133   26.122  1.00 0.00   ? 156 GLY B H     1 
ATOM   4251  N N     . ARG B 1 157 ? 49.582  6.365   25.641  1.00 27.71  ? 157 ARG B N     1 
ATOM   4252  C CA    . ARG B 1 157 ? 49.058  5.034   25.408  1.00 27.87  ? 157 ARG B CA    1 
ATOM   4253  C C     . ARG B 1 157 ? 48.492  4.436   26.691  1.00 27.71  ? 157 ARG B C     1 
ATOM   4254  O O     . ARG B 1 157 ? 47.638  3.548   26.657  1.00 29.09  ? 157 ARG B O     1 
ATOM   4255  C CB    . ARG B 1 157 ? 50.199  4.180   24.853  1.00 26.62  ? 157 ARG B CB    1 
ATOM   4256  C CG    . ARG B 1 157 ? 49.799  2.849   24.246  1.00 25.80  ? 157 ARG B CG    1 
ATOM   4257  C CD    . ARG B 1 157 ? 49.045  3.105   22.958  1.00 24.99  ? 157 ARG B CD    1 
ATOM   4258  N NE    . ARG B 1 157 ? 49.891  3.603   21.881  1.00 19.12  ? 157 ARG B NE    1 
ATOM   4259  C CZ    . ARG B 1 157 ? 49.346  3.931   20.706  1.00 22.91  ? 157 ARG B CZ    1 
ATOM   4260  N NH1   . ARG B 1 157 ? 48.024  3.843   20.505  1.00 18.85  ? 157 ARG B NH1   1 
ATOM   4261  N NH2   . ARG B 1 157 ? 50.124  4.379   19.722  1.00 22.22  ? 157 ARG B NH2   1 
ATOM   4262  H H     . ARG B 1 157 ? 50.526  6.544   25.445  1.00 0.00   ? 157 ARG B H     1 
ATOM   4263  H HE    . ARG B 1 157 ? 50.854  3.708   22.022  1.00 0.00   ? 157 ARG B HE    1 
ATOM   4264  H HH11  . ARG B 1 157 ? 47.414  3.536   21.235  1.00 0.00   ? 157 ARG B HH11  1 
ATOM   4265  H HH12  . ARG B 1 157 ? 47.643  4.102   19.617  1.00 0.00   ? 157 ARG B HH12  1 
ATOM   4266  H HH21  . ARG B 1 157 ? 51.107  4.475   19.871  1.00 0.00   ? 157 ARG B HH21  1 
ATOM   4267  H HH22  . ARG B 1 157 ? 49.722  4.635   18.843  1.00 0.00   ? 157 ARG B HH22  1 
ATOM   4268  N N     . ASN B 1 158 ? 48.927  4.916   27.846  1.00 27.13  ? 158 ASN B N     1 
ATOM   4269  C CA    . ASN B 1 158 ? 48.421  4.424   29.117  1.00 30.19  ? 158 ASN B CA    1 
ATOM   4270  C C     . ASN B 1 158 ? 47.206  5.214   29.632  1.00 29.51  ? 158 ASN B C     1 
ATOM   4271  O O     . ASN B 1 158 ? 46.851  5.120   30.822  1.00 30.22  ? 158 ASN B O     1 
ATOM   4272  C CB    . ASN B 1 158 ? 49.561  4.460   30.160  1.00 33.05  ? 158 ASN B CB    1 
ATOM   4273  C CG    . ASN B 1 158 ? 50.684  3.433   29.976  1.00 35.88  ? 158 ASN B CG    1 
ATOM   4274  O OD1   . ASN B 1 158 ? 51.001  2.984   28.868  1.00 37.31  ? 158 ASN B OD1   1 
ATOM   4275  N ND2   . ASN B 1 158 ? 51.348  3.023   31.052  1.00 31.82  ? 158 ASN B ND2   1 
ATOM   4276  H H     . ASN B 1 158 ? 49.607  5.610   27.840  1.00 0.00   ? 158 ASN B H     1 
ATOM   4277  H HD21  . ASN B 1 158 ? 52.111  2.409   30.912  1.00 0.00   ? 158 ASN B HD21  1 
ATOM   4278  H HD22  . ASN B 1 158 ? 51.064  3.321   31.932  1.00 0.00   ? 158 ASN B HD22  1 
ATOM   4279  N N     . LEU B 1 159 ? 46.570  6.032   28.771  1.00 22.34  ? 159 LEU B N     1 
ATOM   4280  C CA    . LEU B 1 159 ? 45.408  6.825   29.135  1.00 18.63  ? 159 LEU B CA    1 
ATOM   4281  C C     . LEU B 1 159 ? 44.156  5.994   29.310  1.00 20.80  ? 159 LEU B C     1 
ATOM   4282  O O     . LEU B 1 159 ? 43.796  5.189   28.450  1.00 23.95  ? 159 LEU B O     1 
ATOM   4283  C CB    . LEU B 1 159 ? 45.072  7.886   28.087  1.00 10.36  ? 159 LEU B CB    1 
ATOM   4284  C CG    . LEU B 1 159 ? 45.854  9.169   28.130  1.00 5.95   ? 159 LEU B CG    1 
ATOM   4285  C CD1   . LEU B 1 159 ? 45.459  10.063  26.980  1.00 5.98   ? 159 LEU B CD1   1 
ATOM   4286  C CD2   . LEU B 1 159 ? 45.586  9.860   29.450  1.00 7.24   ? 159 LEU B CD2   1 
ATOM   4287  H H     . LEU B 1 159 ? 46.867  6.067   27.838  1.00 0.00   ? 159 LEU B H     1 
ATOM   4288  N N     . VAL B 1 160 ? 43.468  6.227   30.428  1.00 21.66  ? 160 VAL B N     1 
ATOM   4289  C CA    . VAL B 1 160 ? 42.230  5.539   30.738  1.00 17.24  ? 160 VAL B CA    1 
ATOM   4290  C C     . VAL B 1 160 ? 41.092  6.314   30.067  1.00 15.64  ? 160 VAL B C     1 
ATOM   4291  O O     . VAL B 1 160 ? 40.123  5.734   29.576  1.00 16.27  ? 160 VAL B O     1 
ATOM   4292  C CB    . VAL B 1 160 ? 41.977  5.487   32.283  1.00 17.44  ? 160 VAL B CB    1 
ATOM   4293  C CG1   . VAL B 1 160 ? 40.897  4.443   32.477  1.00 22.31  ? 160 VAL B CG1   1 
ATOM   4294  C CG2   . VAL B 1 160 ? 43.180  5.078   33.130  1.00 14.91  ? 160 VAL B CG2   1 
ATOM   4295  H H     . VAL B 1 160 ? 43.824  6.889   31.055  1.00 0.00   ? 160 VAL B H     1 
ATOM   4296  N N     . ALA B 1 161 ? 41.158  7.637   30.077  1.00 13.68  ? 161 ALA B N     1 
ATOM   4297  C CA    . ALA B 1 161 ? 40.108  8.478   29.528  1.00 14.49  ? 161 ALA B CA    1 
ATOM   4298  C C     . ALA B 1 161 ? 40.720  9.836   29.249  1.00 14.65  ? 161 ALA B C     1 
ATOM   4299  O O     . ALA B 1 161 ? 41.744  10.213  29.842  1.00 22.59  ? 161 ALA B O     1 
ATOM   4300  C CB    . ALA B 1 161 ? 38.992  8.676   30.527  1.00 13.37  ? 161 ALA B CB    1 
ATOM   4301  H H     . ALA B 1 161 ? 41.961  8.093   30.410  1.00 0.00   ? 161 ALA B H     1 
ATOM   4302  N N     . ALA B 1 162 ? 40.126  10.593  28.356  1.00 12.47  ? 162 ALA B N     1 
ATOM   4303  C CA    . ALA B 1 162 ? 40.640  11.894  28.012  1.00 7.35   ? 162 ALA B CA    1 
ATOM   4304  C C     . ALA B 1 162 ? 39.492  12.610  27.359  1.00 8.78   ? 162 ALA B C     1 
ATOM   4305  O O     . ALA B 1 162 ? 38.484  11.990  27.013  1.00 8.17   ? 162 ALA B O     1 
ATOM   4306  C CB    . ALA B 1 162 ? 41.750  11.789  26.996  1.00 6.20   ? 162 ALA B CB    1 
ATOM   4307  H H     . ALA B 1 162 ? 39.316  10.281  27.892  1.00 0.00   ? 162 ALA B H     1 
ATOM   4308  N N     . GLY B 1 163 ? 39.646  13.902  27.174  1.00 7.35   ? 163 GLY B N     1 
ATOM   4309  C CA    . GLY B 1 163 ? 38.652  14.675  26.498  1.00 9.49   ? 163 GLY B CA    1 
ATOM   4310  C C     . GLY B 1 163 ? 38.928  16.143  26.727  1.00 9.37   ? 163 GLY B C     1 
ATOM   4311  O O     . GLY B 1 163 ? 39.990  16.532  27.237  1.00 14.46  ? 163 GLY B O     1 
ATOM   4312  H H     . GLY B 1 163 ? 40.424  14.371  27.549  1.00 0.00   ? 163 GLY B H     1 
ATOM   4313  N N     . TYR B 1 164 ? 37.968  16.960  26.361  1.00 8.97   ? 164 TYR B N     1 
ATOM   4314  C CA    . TYR B 1 164 ? 38.051  18.396  26.514  1.00 8.49   ? 164 TYR B CA    1 
ATOM   4315  C C     . TYR B 1 164 ? 36.615  18.880  26.625  1.00 7.81   ? 164 TYR B C     1 
ATOM   4316  O O     . TYR B 1 164 ? 35.666  18.132  26.384  1.00 5.73   ? 164 TYR B O     1 
ATOM   4317  C CB    . TYR B 1 164 ? 38.681  19.097  25.306  1.00 7.77   ? 164 TYR B CB    1 
ATOM   4318  C CG    . TYR B 1 164 ? 38.055  18.778  23.943  1.00 10.89  ? 164 TYR B CG    1 
ATOM   4319  C CD1   . TYR B 1 164 ? 38.421  17.606  23.301  1.00 11.21  ? 164 TYR B CD1   1 
ATOM   4320  C CD2   . TYR B 1 164 ? 37.213  19.671  23.300  1.00 7.30   ? 164 TYR B CD2   1 
ATOM   4321  C CE1   . TYR B 1 164 ? 37.988  17.344  22.012  1.00 13.22  ? 164 TYR B CE1   1 
ATOM   4322  C CE2   . TYR B 1 164 ? 36.766  19.410  22.011  1.00 11.34  ? 164 TYR B CE2   1 
ATOM   4323  C CZ    . TYR B 1 164 ? 37.165  18.253  21.377  1.00 14.44  ? 164 TYR B CZ    1 
ATOM   4324  O OH    . TYR B 1 164 ? 36.732  18.006  20.092  1.00 9.48   ? 164 TYR B OH    1 
ATOM   4325  H H     . TYR B 1 164 ? 37.107  16.582  26.073  1.00 0.00   ? 164 TYR B H     1 
ATOM   4326  H HH    . TYR B 1 164 ? 37.235  17.236  19.790  1.00 0.00   ? 164 TYR B HH    1 
ATOM   4327  N N     . ALA B 1 165 ? 36.502  20.168  26.875  1.00 8.10   ? 165 ALA B N     1 
ATOM   4328  C CA    . ALA B 1 165 ? 35.259  20.902  26.966  1.00 8.84   ? 165 ALA B CA    1 
ATOM   4329  C C     . ALA B 1 165 ? 35.557  22.143  26.149  1.00 9.16   ? 165 ALA B C     1 
ATOM   4330  O O     . ALA B 1 165 ? 36.561  22.804  26.435  1.00 11.57  ? 165 ALA B O     1 
ATOM   4331  C CB    . ALA B 1 165 ? 34.994  21.330  28.392  1.00 2.95   ? 165 ALA B CB    1 
ATOM   4332  H H     . ALA B 1 165 ? 37.326  20.674  27.029  1.00 0.00   ? 165 ALA B H     1 
ATOM   4333  N N     . LEU B 1 166 ? 34.807  22.484  25.117  1.00 8.75   ? 166 LEU B N     1 
ATOM   4334  C CA    . LEU B 1 166 ? 35.065  23.696  24.351  1.00 8.09   ? 166 LEU B CA    1 
ATOM   4335  C C     . LEU B 1 166 ? 34.039  24.754  24.778  1.00 8.76   ? 166 LEU B C     1 
ATOM   4336  O O     . LEU B 1 166 ? 32.849  24.430  24.860  1.00 11.41  ? 166 LEU B O     1 
ATOM   4337  C CB    . LEU B 1 166 ? 34.938  23.344  22.840  1.00 8.59   ? 166 LEU B CB    1 
ATOM   4338  C CG    . LEU B 1 166 ? 34.761  24.445  21.776  1.00 8.47   ? 166 LEU B CG    1 
ATOM   4339  C CD1   . LEU B 1 166 ? 35.961  25.370  21.771  1.00 5.26   ? 166 LEU B CD1   1 
ATOM   4340  C CD2   . LEU B 1 166 ? 34.568  23.817  20.413  1.00 6.35   ? 166 LEU B CD2   1 
ATOM   4341  H H     . LEU B 1 166 ? 34.012  21.956  24.908  1.00 0.00   ? 166 LEU B H     1 
ATOM   4342  N N     . TYR B 1 167 ? 34.388  26.007  25.063  1.00 6.37   ? 167 TYR B N     1 
ATOM   4343  C CA    . TYR B 1 167 ? 33.386  27.025  25.352  1.00 7.38   ? 167 TYR B CA    1 
ATOM   4344  C C     . TYR B 1 167 ? 33.361  27.919  24.115  1.00 8.08   ? 167 TYR B C     1 
ATOM   4345  O O     . TYR B 1 167 ? 33.959  29.003  24.032  1.00 6.01   ? 167 TYR B O     1 
ATOM   4346  C CB    . TYR B 1 167 ? 33.778  27.821  26.606  1.00 2.00   ? 167 TYR B CB    1 
ATOM   4347  C CG    . TYR B 1 167 ? 34.105  26.899  27.768  1.00 5.98   ? 167 TYR B CG    1 
ATOM   4348  C CD1   . TYR B 1 167 ? 33.178  26.055  28.329  1.00 11.30  ? 167 TYR B CD1   1 
ATOM   4349  C CD2   . TYR B 1 167 ? 35.399  26.820  28.199  1.00 3.81   ? 167 TYR B CD2   1 
ATOM   4350  C CE1   . TYR B 1 167 ? 33.567  25.105  29.271  1.00 7.25   ? 167 TYR B CE1   1 
ATOM   4351  C CE2   . TYR B 1 167 ? 35.785  25.895  29.135  1.00 2.71   ? 167 TYR B CE2   1 
ATOM   4352  C CZ    . TYR B 1 167 ? 34.879  25.037  29.660  1.00 2.00   ? 167 TYR B CZ    1 
ATOM   4353  O OH    . TYR B 1 167 ? 35.295  24.128  30.601  1.00 5.80   ? 167 TYR B OH    1 
ATOM   4354  H H     . TYR B 1 167 ? 35.331  26.259  25.025  1.00 0.00   ? 167 TYR B H     1 
ATOM   4355  H HH    . TYR B 1 167 ? 36.256  24.183  30.724  1.00 0.00   ? 167 TYR B HH    1 
ATOM   4356  N N     . GLY B 1 168 ? 32.764  27.371  23.078  1.00 7.69   ? 168 GLY B N     1 
ATOM   4357  C CA    . GLY B 1 168 ? 32.707  28.061  21.791  1.00 11.95  ? 168 GLY B CA    1 
ATOM   4358  C C     . GLY B 1 168 ? 31.400  28.810  21.738  1.00 10.82  ? 168 GLY B C     1 
ATOM   4359  O O     . GLY B 1 168 ? 31.071  29.458  22.716  1.00 13.80  ? 168 GLY B O     1 
ATOM   4360  H H     . GLY B 1 168 ? 32.246  26.549  23.225  1.00 0.00   ? 168 GLY B H     1 
ATOM   4361  N N     . SER B 1 169 ? 30.595  28.708  20.676  1.00 13.52  ? 169 SER B N     1 
ATOM   4362  C CA    . SER B 1 169 ? 29.299  29.381  20.706  1.00 15.13  ? 169 SER B CA    1 
ATOM   4363  C C     . SER B 1 169 ? 28.331  28.673  21.637  1.00 14.32  ? 169 SER B C     1 
ATOM   4364  O O     . SER B 1 169 ? 27.331  29.250  22.050  1.00 18.62  ? 169 SER B O     1 
ATOM   4365  C CB    . SER B 1 169 ? 28.720  29.452  19.307  1.00 12.28  ? 169 SER B CB    1 
ATOM   4366  O OG    . SER B 1 169 ? 29.074  28.326  18.523  1.00 23.13  ? 169 SER B OG    1 
ATOM   4367  H H     . SER B 1 169 ? 30.870  28.225  19.867  1.00 0.00   ? 169 SER B H     1 
ATOM   4368  H HG    . SER B 1 169 ? 29.165  28.676  17.619  1.00 0.00   ? 169 SER B HG    1 
ATOM   4369  N N     . ALA B 1 170 ? 28.608  27.405  21.966  1.00 16.90  ? 170 ALA B N     1 
ATOM   4370  C CA    . ALA B 1 170 ? 27.869  26.600  22.934  1.00 12.66  ? 170 ALA B CA    1 
ATOM   4371  C C     . ALA B 1 170 ? 28.914  25.798  23.715  1.00 10.85  ? 170 ALA B C     1 
ATOM   4372  O O     . ALA B 1 170 ? 30.005  25.602  23.173  1.00 13.05  ? 170 ALA B O     1 
ATOM   4373  C CB    . ALA B 1 170 ? 26.963  25.607  22.241  1.00 7.89   ? 170 ALA B CB    1 
ATOM   4374  H H     . ALA B 1 170 ? 29.424  26.996  21.616  1.00 0.00   ? 170 ALA B H     1 
ATOM   4375  N N     . THR B 1 171 ? 28.682  25.315  24.946  1.00 8.78   ? 171 THR B N     1 
ATOM   4376  C CA    . THR B 1 171 ? 29.632  24.446  25.639  1.00 3.28   ? 171 THR B CA    1 
ATOM   4377  C C     . THR B 1 171 ? 29.409  22.976  25.284  1.00 6.83   ? 171 THR B C     1 
ATOM   4378  O O     . THR B 1 171 ? 28.342  22.414  25.568  1.00 6.28   ? 171 THR B O     1 
ATOM   4379  C CB    . THR B 1 171 ? 29.406  24.620  27.146  1.00 2.89   ? 171 THR B CB    1 
ATOM   4380  O OG1   . THR B 1 171 ? 29.680  26.001  27.349  1.00 2.45   ? 171 THR B OG1   1 
ATOM   4381  C CG2   . THR B 1 171 ? 30.263  23.734  28.019  1.00 2.00   ? 171 THR B CG2   1 
ATOM   4382  H H     . THR B 1 171 ? 27.848  25.545  25.397  1.00 0.00   ? 171 THR B H     1 
ATOM   4383  H HG1   . THR B 1 171 ? 29.197  26.236  28.160  1.00 0.00   ? 171 THR B HG1   1 
ATOM   4384  N N     . MET B 1 172 ? 30.404  22.338  24.628  1.00 9.59   ? 172 MET B N     1 
ATOM   4385  C CA    . MET B 1 172 ? 30.365  20.924  24.315  1.00 2.00   ? 172 MET B CA    1 
ATOM   4386  C C     . MET B 1 172 ? 31.504  20.203  25.003  1.00 2.00   ? 172 MET B C     1 
ATOM   4387  O O     . MET B 1 172 ? 32.643  20.664  24.949  1.00 2.00   ? 172 MET B O     1 
ATOM   4388  C CB    . MET B 1 172 ? 30.528  20.635  22.836  1.00 3.26   ? 172 MET B CB    1 
ATOM   4389  C CG    . MET B 1 172 ? 30.374  19.119  22.540  1.00 7.27   ? 172 MET B CG    1 
ATOM   4390  S SD    . MET B 1 172 ? 30.023  18.603  20.835  1.00 25.22  ? 172 MET B SD    1 
ATOM   4391  C CE    . MET B 1 172 ? 28.299  18.980  20.788  1.00 15.28  ? 172 MET B CE    1 
ATOM   4392  H H     . MET B 1 172 ? 31.204  22.856  24.403  1.00 0.00   ? 172 MET B H     1 
ATOM   4393  N N     . LEU B 1 173 ? 31.210  19.070  25.637  1.00 3.72   ? 173 LEU B N     1 
ATOM   4394  C CA    . LEU B 1 173 ? 32.217  18.210  26.220  1.00 6.77   ? 173 LEU B CA    1 
ATOM   4395  C C     . LEU B 1 173 ? 32.410  17.000  25.304  1.00 8.00   ? 173 LEU B C     1 
ATOM   4396  O O     . LEU B 1 173 ? 31.440  16.352  24.918  1.00 12.42  ? 173 LEU B O     1 
ATOM   4397  C CB    . LEU B 1 173 ? 31.790  17.699  27.575  1.00 2.00   ? 173 LEU B CB    1 
ATOM   4398  C CG    . LEU B 1 173 ? 32.824  16.870  28.296  1.00 4.41   ? 173 LEU B CG    1 
ATOM   4399  C CD1   . LEU B 1 173 ? 33.510  17.713  29.348  1.00 4.11   ? 173 LEU B CD1   1 
ATOM   4400  C CD2   . LEU B 1 173 ? 32.142  15.665  28.923  1.00 2.00   ? 173 LEU B CD2   1 
ATOM   4401  H H     . LEU B 1 173 ? 30.274  18.774  25.648  1.00 0.00   ? 173 LEU B H     1 
ATOM   4402  N N     . VAL B 1 174 ? 33.639  16.676  24.934  1.00 11.34  ? 174 VAL B N     1 
ATOM   4403  C CA    . VAL B 1 174 ? 33.955  15.504  24.161  1.00 9.26   ? 174 VAL B CA    1 
ATOM   4404  C C     . VAL B 1 174 ? 34.759  14.643  25.120  1.00 10.07  ? 174 VAL B C     1 
ATOM   4405  O O     . VAL B 1 174 ? 35.782  15.085  25.660  1.00 10.79  ? 174 VAL B O     1 
ATOM   4406  C CB    . VAL B 1 174 ? 34.771  15.899  22.953  1.00 4.61   ? 174 VAL B CB    1 
ATOM   4407  C CG1   . VAL B 1 174 ? 35.165  14.655  22.216  1.00 2.67   ? 174 VAL B CG1   1 
ATOM   4408  C CG2   . VAL B 1 174 ? 33.949  16.748  22.012  1.00 7.68   ? 174 VAL B CG2   1 
ATOM   4409  H H     . VAL B 1 174 ? 34.385  17.198  25.293  1.00 0.00   ? 174 VAL B H     1 
ATOM   4410  N N     . LEU B 1 175 ? 34.240  13.441  25.347  1.00 11.57  ? 175 LEU B N     1 
ATOM   4411  C CA    . LEU B 1 175 ? 34.807  12.457  26.245  1.00 9.98   ? 175 LEU B CA    1 
ATOM   4412  C C     . LEU B 1 175 ? 35.115  11.226  25.433  1.00 10.77  ? 175 LEU B C     1 
ATOM   4413  O O     . LEU B 1 175 ? 34.260  10.715  24.707  1.00 11.24  ? 175 LEU B O     1 
ATOM   4414  C CB    . LEU B 1 175 ? 33.815  12.104  27.339  1.00 4.53   ? 175 LEU B CB    1 
ATOM   4415  C CG    . LEU B 1 175 ? 34.092  10.952  28.281  1.00 10.68  ? 175 LEU B CG    1 
ATOM   4416  C CD1   . LEU B 1 175 ? 35.431  11.118  28.979  1.00 6.25   ? 175 LEU B CD1   1 
ATOM   4417  C CD2   . LEU B 1 175 ? 32.995  10.924  29.329  1.00 9.28   ? 175 LEU B CD2   1 
ATOM   4418  H H     . LEU B 1 175 ? 33.413  13.188  24.879  1.00 0.00   ? 175 LEU B H     1 
ATOM   4419  N N     . ALA B 1 176 ? 36.350  10.762  25.558  1.00 13.73  ? 176 ALA B N     1 
ATOM   4420  C CA    . ALA B 1 176 ? 36.838  9.612   24.831  1.00 12.47  ? 176 ALA B CA    1 
ATOM   4421  C C     . ALA B 1 176 ? 37.372  8.696   25.884  1.00 12.60  ? 176 ALA B C     1 
ATOM   4422  O O     . ALA B 1 176 ? 38.080  9.121   26.799  1.00 16.34  ? 176 ALA B O     1 
ATOM   4423  C CB    . ALA B 1 176 ? 37.990  9.957   23.911  1.00 12.53  ? 176 ALA B CB    1 
ATOM   4424  H H     . ALA B 1 176 ? 36.953  11.149  26.226  1.00 0.00   ? 176 ALA B H     1 
ATOM   4425  N N     . MET B 1 177 ? 36.956  7.455   25.779  1.00 16.92  ? 177 MET B N     1 
ATOM   4426  C CA    . MET B 1 177 ? 37.386  6.395   26.665  1.00 22.85  ? 177 MET B CA    1 
ATOM   4427  C C     . MET B 1 177 ? 37.605  5.188   25.786  1.00 25.88  ? 177 MET B C     1 
ATOM   4428  O O     . MET B 1 177 ? 37.505  5.308   24.562  1.00 29.48  ? 177 MET B O     1 
ATOM   4429  C CB    . MET B 1 177 ? 36.330  6.045   27.643  1.00 25.03  ? 177 MET B CB    1 
ATOM   4430  C CG    . MET B 1 177 ? 36.107  7.129   28.622  1.00 31.70  ? 177 MET B CG    1 
ATOM   4431  S SD    . MET B 1 177 ? 35.036  6.424   29.864  1.00 35.37  ? 177 MET B SD    1 
ATOM   4432  C CE    . MET B 1 177 ? 33.484  6.843   29.125  1.00 35.82  ? 177 MET B CE    1 
ATOM   4433  H H     . MET B 1 177 ? 36.388  7.197   25.018  1.00 0.00   ? 177 MET B H     1 
ATOM   4434  N N     . ASP B 1 178 ? 37.800  4.004   26.364  1.00 28.93  ? 178 ASP B N     1 
ATOM   4435  C CA    . ASP B 1 178 ? 38.062  2.834   25.566  1.00 31.01  ? 178 ASP B CA    1 
ATOM   4436  C C     . ASP B 1 178 ? 36.996  2.527   24.544  1.00 32.50  ? 178 ASP B C     1 
ATOM   4437  O O     . ASP B 1 178 ? 37.383  2.300   23.402  1.00 35.64  ? 178 ASP B O     1 
ATOM   4438  C CB    . ASP B 1 178 ? 38.242  1.624   26.449  1.00 38.50  ? 178 ASP B CB    1 
ATOM   4439  C CG    . ASP B 1 178 ? 39.263  0.668   25.847  1.00 49.05  ? 178 ASP B CG    1 
ATOM   4440  O OD1   . ASP B 1 178 ? 40.366  1.118   25.518  1.00 54.03  ? 178 ASP B OD1   1 
ATOM   4441  O OD2   . ASP B 1 178 ? 38.962  -0.521  25.708  1.00 55.83  ? 178 ASP B OD2   1 
ATOM   4442  H H     . ASP B 1 178 ? 37.843  3.927   27.341  1.00 0.00   ? 178 ASP B H     1 
ATOM   4443  N N     . CYS B 1 179 ? 35.689  2.524   24.856  1.00 29.68  ? 179 CYS B N     1 
ATOM   4444  C CA    . CYS B 1 179 ? 34.692  2.250   23.827  1.00 29.71  ? 179 CYS B CA    1 
ATOM   4445  C C     . CYS B 1 179 ? 34.667  3.184   22.609  1.00 25.63  ? 179 CYS B C     1 
ATOM   4446  O O     . CYS B 1 179 ? 34.294  2.735   21.518  1.00 27.86  ? 179 CYS B O     1 
ATOM   4447  C CB    . CYS B 1 179 ? 33.292  2.227   24.462  1.00 35.11  ? 179 CYS B CB    1 
ATOM   4448  S SG    . CYS B 1 179 ? 32.832  3.644   25.492  1.00 43.79  ? 179 CYS B SG    1 
ATOM   4449  H H     . CYS B 1 179 ? 35.405  2.682   25.784  1.00 0.00   ? 179 CYS B H     1 
ATOM   4450  N N     . GLY B 1 180 ? 35.037  4.463   22.723  1.00 18.67  ? 180 GLY B N     1 
ATOM   4451  C CA    . GLY B 1 180 ? 35.036  5.379   21.594  1.00 11.76  ? 180 GLY B CA    1 
ATOM   4452  C C     . GLY B 1 180 ? 34.799  6.793   22.073  1.00 8.26   ? 180 GLY B C     1 
ATOM   4453  O O     . GLY B 1 180 ? 34.934  7.065   23.274  1.00 4.38   ? 180 GLY B O     1 
ATOM   4454  H H     . GLY B 1 180 ? 35.342  4.827   23.582  1.00 0.00   ? 180 GLY B H     1 
ATOM   4455  N N     . VAL B 1 181 ? 34.474  7.708   21.155  1.00 8.52   ? 181 VAL B N     1 
ATOM   4456  C CA    . VAL B 1 181 ? 34.257  9.114   21.483  1.00 6.89   ? 181 VAL B CA    1 
ATOM   4457  C C     . VAL B 1 181 ? 32.767  9.405   21.613  1.00 9.02   ? 181 VAL B C     1 
ATOM   4458  O O     . VAL B 1 181 ? 31.985  8.821   20.853  1.00 14.76  ? 181 VAL B O     1 
ATOM   4459  C CB    . VAL B 1 181 ? 34.896  9.971   20.365  1.00 5.77   ? 181 VAL B CB    1 
ATOM   4460  C CG1   . VAL B 1 181 ? 34.783  11.449  20.622  1.00 2.00   ? 181 VAL B CG1   1 
ATOM   4461  C CG2   . VAL B 1 181 ? 36.383  9.677   20.324  1.00 9.16   ? 181 VAL B CG2   1 
ATOM   4462  H H     . VAL B 1 181 ? 34.366  7.427   20.223  1.00 0.00   ? 181 VAL B H     1 
ATOM   4463  N N     . ASN B 1 182 ? 32.314  10.284  22.516  1.00 10.32  ? 182 ASN B N     1 
ATOM   4464  C CA    . ASN B 1 182 ? 30.919  10.682  22.639  1.00 6.74   ? 182 ASN B CA    1 
ATOM   4465  C C     . ASN B 1 182 ? 30.807  12.181  22.908  1.00 8.68   ? 182 ASN B C     1 
ATOM   4466  O O     . ASN B 1 182 ? 31.410  12.639  23.883  1.00 10.01  ? 182 ASN B O     1 
ATOM   4467  C CB    . ASN B 1 182 ? 30.277  9.940   23.775  1.00 10.50  ? 182 ASN B CB    1 
ATOM   4468  C CG    . ASN B 1 182 ? 30.095  8.469   23.490  1.00 6.31   ? 182 ASN B CG    1 
ATOM   4469  O OD1   . ASN B 1 182 ? 30.835  7.602   23.946  1.00 15.46  ? 182 ASN B OD1   1 
ATOM   4470  N ND2   . ASN B 1 182 ? 29.087  8.099   22.730  1.00 12.05  ? 182 ASN B ND2   1 
ATOM   4471  H H     . ASN B 1 182 ? 32.946  10.677  23.159  1.00 0.00   ? 182 ASN B H     1 
ATOM   4472  H HD21  . ASN B 1 182 ? 28.899  7.135   22.651  1.00 0.00   ? 182 ASN B HD21  1 
ATOM   4473  H HD22  . ASN B 1 182 ? 28.531  8.820   22.372  1.00 0.00   ? 182 ASN B HD22  1 
ATOM   4474  N N     . CYS B 1 183 ? 30.134  13.004  22.085  1.00 9.69   ? 183 CYS B N     1 
ATOM   4475  C CA    . CYS B 1 183 ? 30.037  14.447  22.311  1.00 10.82  ? 183 CYS B CA    1 
ATOM   4476  C C     . CYS B 1 183 ? 28.769  14.767  23.124  1.00 14.53  ? 183 CYS B C     1 
ATOM   4477  O O     . CYS B 1 183 ? 27.698  14.197  22.868  1.00 14.36  ? 183 CYS B O     1 
ATOM   4478  C CB    . CYS B 1 183 ? 29.983  15.212  20.979  1.00 9.30   ? 183 CYS B CB    1 
ATOM   4479  S SG    . CYS B 1 183 ? 31.344  15.064  19.770  1.00 13.03  ? 183 CYS B SG    1 
ATOM   4480  H H     . CYS B 1 183 ? 29.606  12.607  21.363  1.00 0.00   ? 183 CYS B H     1 
ATOM   4481  N N     . PHE B 1 184 ? 28.818  15.662  24.125  1.00 15.91  ? 184 PHE B N     1 
ATOM   4482  C CA    . PHE B 1 184 ? 27.698  16.017  25.000  1.00 9.34   ? 184 PHE B CA    1 
ATOM   4483  C C     . PHE B 1 184 ? 27.444  17.525  24.929  1.00 7.87   ? 184 PHE B C     1 
ATOM   4484  O O     . PHE B 1 184 ? 28.377  18.327  24.994  1.00 11.92  ? 184 PHE B O     1 
ATOM   4485  C CB    . PHE B 1 184 ? 28.028  15.631  26.433  1.00 3.30   ? 184 PHE B CB    1 
ATOM   4486  C CG    . PHE B 1 184 ? 28.252  14.141  26.611  1.00 7.56   ? 184 PHE B CG    1 
ATOM   4487  C CD1   . PHE B 1 184 ? 29.451  13.554  26.272  1.00 13.80  ? 184 PHE B CD1   1 
ATOM   4488  C CD2   . PHE B 1 184 ? 27.247  13.340  27.116  1.00 17.21  ? 184 PHE B CD2   1 
ATOM   4489  C CE1   . PHE B 1 184 ? 29.630  12.184  26.401  1.00 12.96  ? 184 PHE B CE1   1 
ATOM   4490  C CE2   . PHE B 1 184 ? 27.429  11.969  27.224  1.00 18.68  ? 184 PHE B CE2   1 
ATOM   4491  C CZ    . PHE B 1 184 ? 28.621  11.385  26.855  1.00 15.39  ? 184 PHE B CZ    1 
ATOM   4492  H H     . PHE B 1 184 ? 29.668  16.119  24.291  1.00 0.00   ? 184 PHE B H     1 
ATOM   4493  N N     . MET B 1 185 ? 26.216  17.988  24.788  1.00 8.70   ? 185 MET B N     1 
ATOM   4494  C CA    . MET B 1 185 ? 25.913  19.406  24.672  1.00 6.99   ? 185 MET B CA    1 
ATOM   4495  C C     . MET B 1 185 ? 25.415  19.918  26.015  1.00 8.16   ? 185 MET B C     1 
ATOM   4496  O O     . MET B 1 185 ? 24.544  19.283  26.625  1.00 4.06   ? 185 MET B O     1 
ATOM   4497  C CB    . MET B 1 185 ? 24.855  19.574  23.625  1.00 4.22   ? 185 MET B CB    1 
ATOM   4498  C CG    . MET B 1 185 ? 24.612  21.004  23.260  1.00 10.05  ? 185 MET B CG    1 
ATOM   4499  S SD    . MET B 1 185 ? 26.126  21.678  22.553  1.00 16.10  ? 185 MET B SD    1 
ATOM   4500  C CE    . MET B 1 185 ? 25.591  21.528  20.866  1.00 7.82   ? 185 MET B CE    1 
ATOM   4501  H H     . MET B 1 185 ? 25.465  17.366  24.870  1.00 0.00   ? 185 MET B H     1 
ATOM   4502  N N     . LEU B 1 186 ? 25.956  21.013  26.543  1.00 11.59  ? 186 LEU B N     1 
ATOM   4503  C CA    . LEU B 1 186 ? 25.441  21.555  27.790  1.00 11.79  ? 186 LEU B CA    1 
ATOM   4504  C C     . LEU B 1 186 ? 24.230  22.395  27.485  1.00 14.62  ? 186 LEU B C     1 
ATOM   4505  O O     . LEU B 1 186 ? 24.317  23.347  26.705  1.00 15.21  ? 186 LEU B O     1 
ATOM   4506  C CB    . LEU B 1 186 ? 26.381  22.501  28.510  1.00 5.36   ? 186 LEU B CB    1 
ATOM   4507  C CG    . LEU B 1 186 ? 25.893  23.189  29.789  1.00 5.96   ? 186 LEU B CG    1 
ATOM   4508  C CD1   . LEU B 1 186 ? 25.871  22.203  30.936  1.00 2.00   ? 186 LEU B CD1   1 
ATOM   4509  C CD2   . LEU B 1 186 ? 26.826  24.314  30.158  1.00 3.21   ? 186 LEU B CD2   1 
ATOM   4510  H H     . LEU B 1 186 ? 26.660  21.497  26.061  1.00 0.00   ? 186 LEU B H     1 
ATOM   4511  N N     . ASP B 1 187 ? 23.117  22.054  28.124  1.00 15.58  ? 187 ASP B N     1 
ATOM   4512  C CA    . ASP B 1 187 ? 21.932  22.884  28.099  1.00 13.67  ? 187 ASP B CA    1 
ATOM   4513  C C     . ASP B 1 187 ? 22.092  23.792  29.318  1.00 12.34  ? 187 ASP B C     1 
ATOM   4514  O O     . ASP B 1 187 ? 21.846  23.322  30.450  1.00 11.44  ? 187 ASP B O     1 
ATOM   4515  C CB    . ASP B 1 187 ? 20.650  22.034  28.260  1.00 17.40  ? 187 ASP B CB    1 
ATOM   4516  C CG    . ASP B 1 187 ? 19.327  22.769  28.073  1.00 19.74  ? 187 ASP B CG    1 
ATOM   4517  O OD1   . ASP B 1 187 ? 19.236  23.963  28.359  1.00 22.56  ? 187 ASP B OD1   1 
ATOM   4518  O OD2   . ASP B 1 187 ? 18.372  22.142  27.623  1.00 19.28  ? 187 ASP B OD2   1 
ATOM   4519  H H     . ASP B 1 187 ? 23.098  21.195  28.598  1.00 0.00   ? 187 ASP B H     1 
ATOM   4520  N N     . PRO B 1 188 ? 22.400  25.087  29.176  1.00 6.60   ? 188 PRO B N     1 
ATOM   4521  C CA    . PRO B 1 188 ? 22.565  26.002  30.291  1.00 7.84   ? 188 PRO B CA    1 
ATOM   4522  C C     . PRO B 1 188 ? 21.324  26.224  31.150  1.00 14.05  ? 188 PRO B C     1 
ATOM   4523  O O     . PRO B 1 188 ? 21.432  26.568  32.327  1.00 18.25  ? 188 PRO B O     1 
ATOM   4524  C CB    . PRO B 1 188 ? 23.092  27.269  29.637  1.00 7.98   ? 188 PRO B CB    1 
ATOM   4525  C CG    . PRO B 1 188 ? 22.612  27.221  28.216  1.00 2.59   ? 188 PRO B CG    1 
ATOM   4526  C CD    . PRO B 1 188 ? 22.725  25.742  27.910  1.00 5.51   ? 188 PRO B CD    1 
ATOM   4527  N N     . ALA B 1 189 ? 20.142  25.984  30.572  1.00 11.07  ? 189 ALA B N     1 
ATOM   4528  C CA    . ALA B 1 189 ? 18.880  26.186  31.258  1.00 11.60  ? 189 ALA B CA    1 
ATOM   4529  C C     . ALA B 1 189 ? 18.640  25.255  32.431  1.00 12.74  ? 189 ALA B C     1 
ATOM   4530  O O     . ALA B 1 189 ? 18.040  25.628  33.451  1.00 17.63  ? 189 ALA B O     1 
ATOM   4531  C CB    . ALA B 1 189 ? 17.688  25.994  30.320  1.00 7.88   ? 189 ALA B CB    1 
ATOM   4532  H H     . ALA B 1 189 ? 20.147  25.732  29.631  1.00 0.00   ? 189 ALA B H     1 
ATOM   4533  N N     . ILE B 1 190 ? 19.003  23.990  32.234  1.00 8.61   ? 190 ILE B N     1 
ATOM   4534  C CA    . ILE B 1 190 ? 18.853  23.040  33.303  1.00 2.37   ? 190 ILE B CA    1 
ATOM   4535  C C     . ILE B 1 190 ? 20.239  22.605  33.755  1.00 7.00   ? 190 ILE B C     1 
ATOM   4536  O O     . ILE B 1 190 ? 20.314  21.845  34.710  1.00 10.72  ? 190 ILE B O     1 
ATOM   4537  C CB    . ILE B 1 190 ? 17.991  21.826  32.824  1.00 3.50   ? 190 ILE B CB    1 
ATOM   4538  C CG1   . ILE B 1 190 ? 18.637  20.967  31.765  1.00 2.00   ? 190 ILE B CG1   1 
ATOM   4539  C CG2   . ILE B 1 190 ? 16.711  22.397  32.194  1.00 3.90   ? 190 ILE B CG2   1 
ATOM   4540  C CD1   . ILE B 1 190 ? 17.934  19.592  31.738  1.00 2.00   ? 190 ILE B CD1   1 
ATOM   4541  H H     . ILE B 1 190 ? 19.438  23.716  31.403  1.00 0.00   ? 190 ILE B H     1 
ATOM   4542  N N     . GLY B 1 191 ? 21.342  23.017  33.096  1.00 6.65   ? 191 GLY B N     1 
ATOM   4543  C CA    . GLY B 1 191 ? 22.692  22.653  33.487  1.00 2.00   ? 191 GLY B CA    1 
ATOM   4544  C C     . GLY B 1 191 ? 22.914  21.159  33.423  1.00 6.18   ? 191 GLY B C     1 
ATOM   4545  O O     . GLY B 1 191 ? 23.243  20.500  34.410  1.00 3.42   ? 191 GLY B O     1 
ATOM   4546  H H     . GLY B 1 191 ? 21.244  23.615  32.336  1.00 0.00   ? 191 GLY B H     1 
ATOM   4547  N N     . GLU B 1 192 ? 22.788  20.603  32.227  1.00 4.60   ? 192 GLU B N     1 
ATOM   4548  C CA    . GLU B 1 192 ? 22.857  19.183  32.067  1.00 4.42   ? 192 GLU B CA    1 
ATOM   4549  C C     . GLU B 1 192 ? 23.545  18.936  30.750  1.00 6.24   ? 192 GLU B C     1 
ATOM   4550  O O     . GLU B 1 192 ? 23.341  19.704  29.804  1.00 7.99   ? 192 GLU B O     1 
ATOM   4551  C CB    . GLU B 1 192 ? 21.434  18.675  32.087  1.00 3.50   ? 192 GLU B CB    1 
ATOM   4552  C CG    . GLU B 1 192 ? 21.242  17.195  32.284  1.00 2.88   ? 192 GLU B CG    1 
ATOM   4553  C CD    . GLU B 1 192 ? 21.666  16.761  33.667  1.00 8.62   ? 192 GLU B CD    1 
ATOM   4554  O OE1   . GLU B 1 192 ? 20.970  17.069  34.622  1.00 10.44  ? 192 GLU B OE1   1 
ATOM   4555  O OE2   . GLU B 1 192 ? 22.699  16.112  33.802  1.00 20.78  ? 192 GLU B OE2   1 
ATOM   4556  H H     . GLU B 1 192 ? 22.674  21.162  31.428  1.00 0.00   ? 192 GLU B H     1 
ATOM   4557  N N     . PHE B 1 193 ? 24.412  17.932  30.678  1.00 3.43   ? 193 PHE B N     1 
ATOM   4558  C CA    . PHE B 1 193 ? 25.099  17.639  29.439  1.00 3.86   ? 193 PHE B CA    1 
ATOM   4559  C C     . PHE B 1 193 ? 24.255  16.532  28.847  1.00 4.66   ? 193 PHE B C     1 
ATOM   4560  O O     . PHE B 1 193 ? 24.104  15.477  29.459  1.00 3.79   ? 193 PHE B O     1 
ATOM   4561  C CB    . PHE B 1 193 ? 26.535  17.165  29.721  1.00 4.55   ? 193 PHE B CB    1 
ATOM   4562  C CG    . PHE B 1 193 ? 27.589  18.279  29.839  1.00 7.27   ? 193 PHE B CG    1 
ATOM   4563  C CD1   . PHE B 1 193 ? 28.027  18.944  28.706  1.00 7.27   ? 193 PHE B CD1   1 
ATOM   4564  C CD2   . PHE B 1 193 ? 28.115  18.624  31.072  1.00 2.96   ? 193 PHE B CD2   1 
ATOM   4565  C CE1   . PHE B 1 193 ? 28.938  19.981  28.810  1.00 9.40   ? 193 PHE B CE1   1 
ATOM   4566  C CE2   . PHE B 1 193 ? 29.017  19.654  31.165  1.00 2.00   ? 193 PHE B CE2   1 
ATOM   4567  C CZ    . PHE B 1 193 ? 29.412  20.357  30.042  1.00 4.01   ? 193 PHE B CZ    1 
ATOM   4568  H H     . PHE B 1 193 ? 24.568  17.368  31.459  1.00 0.00   ? 193 PHE B H     1 
ATOM   4569  N N     . ILE B 1 194 ? 23.614  16.802  27.726  1.00 7.81   ? 194 ILE B N     1 
ATOM   4570  C CA    . ILE B 1 194 ? 22.762  15.860  27.039  1.00 10.08  ? 194 ILE B CA    1 
ATOM   4571  C C     . ILE B 1 194 ? 23.647  15.180  25.996  1.00 12.36  ? 194 ILE B C     1 
ATOM   4572  O O     . ILE B 1 194 ? 24.456  15.835  25.328  1.00 11.87  ? 194 ILE B O     1 
ATOM   4573  C CB    . ILE B 1 194 ? 21.547  16.696  26.446  1.00 14.38  ? 194 ILE B CB    1 
ATOM   4574  C CG1   . ILE B 1 194 ? 20.428  16.725  27.482  1.00 15.29  ? 194 ILE B CG1   1 
ATOM   4575  C CG2   . ILE B 1 194 ? 20.941  16.088  25.189  1.00 12.98  ? 194 ILE B CG2   1 
ATOM   4576  C CD1   . ILE B 1 194 ? 20.643  17.702  28.630  1.00 16.12  ? 194 ILE B CD1   1 
ATOM   4577  H H     . ILE B 1 194 ? 23.745  17.685  27.324  1.00 0.00   ? 194 ILE B H     1 
ATOM   4578  N N     . LEU B 1 195 ? 23.562  13.862  25.818  1.00 11.57  ? 195 LEU B N     1 
ATOM   4579  C CA    . LEU B 1 195 ? 24.383  13.185  24.838  1.00 6.38   ? 195 LEU B CA    1 
ATOM   4580  C C     . LEU B 1 195 ? 23.849  13.514  23.473  1.00 7.72   ? 195 LEU B C     1 
ATOM   4581  O O     . LEU B 1 195 ? 22.725  13.130  23.134  1.00 12.30  ? 195 LEU B O     1 
ATOM   4582  C CB    . LEU B 1 195 ? 24.345  11.662  25.027  1.00 3.78   ? 195 LEU B CB    1 
ATOM   4583  C CG    . LEU B 1 195 ? 25.063  10.790  23.995  1.00 5.12   ? 195 LEU B CG    1 
ATOM   4584  C CD1   . LEU B 1 195 ? 26.465  11.321  23.710  1.00 6.39   ? 195 LEU B CD1   1 
ATOM   4585  C CD2   . LEU B 1 195 ? 25.198  9.394   24.537  1.00 6.83   ? 195 LEU B CD2   1 
ATOM   4586  H H     . LEU B 1 195 ? 22.900  13.352  26.332  1.00 0.00   ? 195 LEU B H     1 
ATOM   4587  N N     . VAL B 1 196 ? 24.613  14.211  22.664  1.00 6.45   ? 196 VAL B N     1 
ATOM   4588  C CA    . VAL B 1 196 ? 24.113  14.481  21.330  1.00 7.51   ? 196 VAL B CA    1 
ATOM   4589  C C     . VAL B 1 196 ? 24.760  13.615  20.274  1.00 7.58   ? 196 VAL B C     1 
ATOM   4590  O O     . VAL B 1 196 ? 24.156  13.474  19.226  1.00 10.25  ? 196 VAL B O     1 
ATOM   4591  C CB    . VAL B 1 196 ? 24.294  15.996  20.928  1.00 10.35  ? 196 VAL B CB    1 
ATOM   4592  C CG1   . VAL B 1 196 ? 23.447  16.852  21.850  1.00 2.00   ? 196 VAL B CG1   1 
ATOM   4593  C CG2   . VAL B 1 196 ? 25.757  16.424  20.993  1.00 5.12   ? 196 VAL B CG2   1 
ATOM   4594  H H     . VAL B 1 196 ? 25.509  14.499  22.945  1.00 0.00   ? 196 VAL B H     1 
ATOM   4595  N N     . ASP B 1 197 ? 25.936  12.990  20.420  1.00 14.47  ? 197 ASP B N     1 
ATOM   4596  C CA    . ASP B 1 197 ? 26.510  12.214  19.331  1.00 11.61  ? 197 ASP B CA    1 
ATOM   4597  C C     . ASP B 1 197 ? 27.218  11.038  19.948  1.00 12.66  ? 197 ASP B C     1 
ATOM   4598  O O     . ASP B 1 197 ? 28.060  11.211  20.840  1.00 11.06  ? 197 ASP B O     1 
ATOM   4599  C CB    . ASP B 1 197 ? 27.484  13.082  18.571  1.00 20.89  ? 197 ASP B CB    1 
ATOM   4600  C CG    . ASP B 1 197 ? 27.646  12.831  17.077  1.00 27.26  ? 197 ASP B CG    1 
ATOM   4601  O OD1   . ASP B 1 197 ? 27.279  11.760  16.592  1.00 36.65  ? 197 ASP B OD1   1 
ATOM   4602  O OD2   . ASP B 1 197 ? 28.163  13.722  16.395  1.00 27.17  ? 197 ASP B OD2   1 
ATOM   4603  H H     . ASP B 1 197 ? 26.424  13.033  21.271  1.00 0.00   ? 197 ASP B H     1 
ATOM   4604  N N     . LYS B 1 198 ? 26.872  9.827   19.537  1.00 12.98  ? 198 LYS B N     1 
ATOM   4605  C CA    . LYS B 1 198 ? 27.477  8.649   20.129  1.00 16.49  ? 198 LYS B CA    1 
ATOM   4606  C C     . LYS B 1 198 ? 28.436  8.030   19.147  1.00 17.36  ? 198 LYS B C     1 
ATOM   4607  O O     . LYS B 1 198 ? 28.232  8.179   17.943  1.00 16.26  ? 198 LYS B O     1 
ATOM   4608  C CB    . LYS B 1 198 ? 26.468  7.593   20.458  1.00 24.50  ? 198 LYS B CB    1 
ATOM   4609  C CG    . LYS B 1 198 ? 25.231  8.149   21.100  1.00 38.40  ? 198 LYS B CG    1 
ATOM   4610  C CD    . LYS B 1 198 ? 24.310  6.976   21.243  1.00 50.48  ? 198 LYS B CD    1 
ATOM   4611  C CE    . LYS B 1 198 ? 22.902  7.447   21.558  1.00 56.97  ? 198 LYS B CE    1 
ATOM   4612  N NZ    . LYS B 1 198 ? 22.075  6.269   21.720  1.00 64.67  ? 198 LYS B NZ    1 
ATOM   4613  H H     . LYS B 1 198 ? 26.285  9.724   18.750  1.00 0.00   ? 198 LYS B H     1 
ATOM   4614  H HZ1   . LYS B 1 198 ? 22.489  5.684   22.476  1.00 0.00   ? 198 LYS B HZ1   1 
ATOM   4615  H HZ2   . LYS B 1 198 ? 21.105  6.540   21.976  1.00 0.00   ? 198 LYS B HZ2   1 
ATOM   4616  H HZ3   . LYS B 1 198 ? 22.072  5.720   20.836  1.00 0.00   ? 198 LYS B HZ3   1 
ATOM   4617  N N     . ASP B 1 199 ? 29.437  7.322   19.678  1.00 21.58  ? 199 ASP B N     1 
ATOM   4618  C CA    . ASP B 1 199 ? 30.491  6.638   18.919  1.00 28.00  ? 199 ASP B CA    1 
ATOM   4619  C C     . ASP B 1 199 ? 30.910  7.405   17.663  1.00 24.98  ? 199 ASP B C     1 
ATOM   4620  O O     . ASP B 1 199 ? 30.700  7.009   16.517  1.00 26.14  ? 199 ASP B O     1 
ATOM   4621  C CB    . ASP B 1 199 ? 30.016  5.208   18.543  1.00 34.61  ? 199 ASP B CB    1 
ATOM   4622  C CG    . ASP B 1 199 ? 29.545  4.376   19.744  1.00 43.94  ? 199 ASP B CG    1 
ATOM   4623  O OD1   . ASP B 1 199 ? 30.363  3.783   20.455  1.00 45.87  ? 199 ASP B OD1   1 
ATOM   4624  O OD2   . ASP B 1 199 ? 28.334  4.323   19.968  1.00 48.84  ? 199 ASP B OD2   1 
ATOM   4625  H H     . ASP B 1 199 ? 29.485  7.256   20.649  1.00 0.00   ? 199 ASP B H     1 
ATOM   4626  N N     . VAL B 1 200 ? 31.480  8.577   17.922  1.00 23.11  ? 200 VAL B N     1 
ATOM   4627  C CA    . VAL B 1 200 ? 31.872  9.489   16.853  1.00 23.18  ? 200 VAL B CA    1 
ATOM   4628  C C     . VAL B 1 200 ? 33.097  8.926   16.123  1.00 23.70  ? 200 VAL B C     1 
ATOM   4629  O O     . VAL B 1 200 ? 34.012  8.402   16.772  1.00 22.52  ? 200 VAL B O     1 
ATOM   4630  C CB    . VAL B 1 200 ? 32.204  10.885  17.461  1.00 22.51  ? 200 VAL B CB    1 
ATOM   4631  C CG1   . VAL B 1 200 ? 32.510  11.864  16.351  1.00 25.66  ? 200 VAL B CG1   1 
ATOM   4632  C CG2   . VAL B 1 200 ? 31.025  11.416  18.261  1.00 22.78  ? 200 VAL B CG2   1 
ATOM   4633  H H     . VAL B 1 200 ? 31.727  8.773   18.843  1.00 0.00   ? 200 VAL B H     1 
ATOM   4634  N N     . LYS B 1 201 ? 33.093  9.056   14.792  1.00 18.72  ? 201 LYS B N     1 
ATOM   4635  C CA    . LYS B 1 201 ? 34.186  8.648   13.938  1.00 17.82  ? 201 LYS B CA    1 
ATOM   4636  C C     . LYS B 1 201 ? 34.466  9.843   13.063  1.00 20.35  ? 201 LYS B C     1 
ATOM   4637  O O     . LYS B 1 201 ? 33.511  10.479  12.594  1.00 25.83  ? 201 LYS B O     1 
ATOM   4638  C CB    . LYS B 1 201 ? 33.813  7.485   13.036  1.00 18.35  ? 201 LYS B CB    1 
ATOM   4639  C CG    . LYS B 1 201 ? 33.590  6.164   13.770  1.00 24.45  ? 201 LYS B CG    1 
ATOM   4640  C CD    . LYS B 1 201 ? 34.796  5.897   14.655  1.00 28.45  ? 201 LYS B CD    1 
ATOM   4641  C CE    . LYS B 1 201 ? 34.541  4.826   15.693  1.00 35.31  ? 201 LYS B CE    1 
ATOM   4642  N NZ    . LYS B 1 201 ? 35.457  4.995   16.810  1.00 38.28  ? 201 LYS B NZ    1 
ATOM   4643  H H     . LYS B 1 201 ? 32.330  9.483   14.358  1.00 0.00   ? 201 LYS B H     1 
ATOM   4644  H HZ1   . LYS B 1 201 ? 36.428  5.115   16.459  1.00 0.00   ? 201 LYS B HZ1   1 
ATOM   4645  H HZ2   . LYS B 1 201 ? 35.178  5.846   17.341  1.00 0.00   ? 201 LYS B HZ2   1 
ATOM   4646  H HZ3   . LYS B 1 201 ? 35.396  4.171   17.440  1.00 0.00   ? 201 LYS B HZ3   1 
ATOM   4647  N N     . ILE B 1 202 ? 35.733  10.189  12.862  1.00 16.56  ? 202 ILE B N     1 
ATOM   4648  C CA    . ILE B 1 202 ? 36.112  11.366  12.080  1.00 18.45  ? 202 ILE B CA    1 
ATOM   4649  C C     . ILE B 1 202 ? 36.062  11.065  10.584  1.00 19.03  ? 202 ILE B C     1 
ATOM   4650  O O     . ILE B 1 202 ? 36.172  9.891   10.209  1.00 17.59  ? 202 ILE B O     1 
ATOM   4651  C CB    . ILE B 1 202 ? 37.539  11.806  12.526  1.00 18.34  ? 202 ILE B CB    1 
ATOM   4652  C CG1   . ILE B 1 202 ? 37.910  13.135  11.872  1.00 16.61  ? 202 ILE B CG1   1 
ATOM   4653  C CG2   . ILE B 1 202 ? 38.538  10.700  12.204  1.00 11.57  ? 202 ILE B CG2   1 
ATOM   4654  C CD1   . ILE B 1 202 ? 39.273  13.671  12.339  1.00 10.20  ? 202 ILE B CD1   1 
ATOM   4655  H H     . ILE B 1 202 ? 36.421  9.578   13.189  1.00 0.00   ? 202 ILE B H     1 
ATOM   4656  N N     . LYS B 1 203 ? 35.886  12.050  9.688   1.00 18.55  ? 203 LYS B N     1 
ATOM   4657  C CA    . LYS B 1 203 ? 35.904  11.770  8.253   1.00 21.18  ? 203 LYS B CA    1 
ATOM   4658  C C     . LYS B 1 203 ? 37.289  11.274  7.837   1.00 24.78  ? 203 LYS B C     1 
ATOM   4659  O O     . LYS B 1 203 ? 38.299  11.785  8.337   1.00 22.66  ? 203 LYS B O     1 
ATOM   4660  C CB    . LYS B 1 203 ? 35.643  12.997  7.391   1.00 24.96  ? 203 LYS B CB    1 
ATOM   4661  C CG    . LYS B 1 203 ? 34.288  13.653  7.327   1.00 27.36  ? 203 LYS B CG    1 
ATOM   4662  C CD    . LYS B 1 203 ? 34.407  14.614  6.156   1.00 36.79  ? 203 LYS B CD    1 
ATOM   4663  C CE    . LYS B 1 203 ? 33.265  15.623  6.055   1.00 42.18  ? 203 LYS B CE    1 
ATOM   4664  N NZ    . LYS B 1 203 ? 33.596  16.653  5.084   1.00 45.93  ? 203 LYS B NZ    1 
ATOM   4665  H H     . LYS B 1 203 ? 35.753  12.962  10.015  1.00 0.00   ? 203 LYS B H     1 
ATOM   4666  H HZ1   . LYS B 1 203 ? 33.799  16.199  4.170   1.00 0.00   ? 203 LYS B HZ1   1 
ATOM   4667  H HZ2   . LYS B 1 203 ? 32.795  17.307  4.978   1.00 0.00   ? 203 LYS B HZ2   1 
ATOM   4668  H HZ3   . LYS B 1 203 ? 34.436  17.181  5.402   1.00 0.00   ? 203 LYS B HZ3   1 
ATOM   4669  N N     . LYS B 1 204 ? 37.357  10.329  6.893   1.00 27.30  ? 204 LYS B N     1 
ATOM   4670  C CA    . LYS B 1 204 ? 38.604  9.738   6.406   1.00 24.74  ? 204 LYS B CA    1 
ATOM   4671  C C     . LYS B 1 204 ? 39.537  10.764  5.783   1.00 20.92  ? 204 LYS B C     1 
ATOM   4672  O O     . LYS B 1 204 ? 40.754  10.704  5.986   1.00 22.64  ? 204 LYS B O     1 
ATOM   4673  C CB    . LYS B 1 204 ? 38.247  8.665   5.393   1.00 30.39  ? 204 LYS B CB    1 
ATOM   4674  C CG    . LYS B 1 204 ? 39.309  7.653   5.021   1.00 31.48  ? 204 LYS B CG    1 
ATOM   4675  C CD    . LYS B 1 204 ? 38.703  6.761   3.953   1.00 41.09  ? 204 LYS B CD    1 
ATOM   4676  C CE    . LYS B 1 204 ? 39.609  5.608   3.502   1.00 47.11  ? 204 LYS B CE    1 
ATOM   4677  N NZ    . LYS B 1 204 ? 40.704  6.072   2.680   1.00 48.21  ? 204 LYS B NZ    1 
ATOM   4678  H H     . LYS B 1 204 ? 36.513  10.012  6.515   1.00 0.00   ? 204 LYS B H     1 
ATOM   4679  H HZ1   . LYS B 1 204 ? 40.323  6.562   1.844   1.00 0.00   ? 204 LYS B HZ1   1 
ATOM   4680  H HZ2   . LYS B 1 204 ? 41.291  6.731   3.229   1.00 0.00   ? 204 LYS B HZ2   1 
ATOM   4681  H HZ3   . LYS B 1 204 ? 41.280  5.264   2.373   1.00 0.00   ? 204 LYS B HZ3   1 
ATOM   4682  N N     . LYS B 1 205 ? 39.009  11.724  5.041   1.00 19.34  ? 205 LYS B N     1 
ATOM   4683  C CA    . LYS B 1 205 ? 39.797  12.772  4.423   1.00 17.28  ? 205 LYS B CA    1 
ATOM   4684  C C     . LYS B 1 205 ? 39.006  14.025  4.717   1.00 19.05  ? 205 LYS B C     1 
ATOM   4685  O O     . LYS B 1 205 ? 37.780  13.930  4.819   1.00 26.06  ? 205 LYS B O     1 
ATOM   4686  C CB    . LYS B 1 205 ? 39.884  12.554  2.938   1.00 17.80  ? 205 LYS B CB    1 
ATOM   4687  C CG    . LYS B 1 205 ? 41.019  13.340  2.343   1.00 30.34  ? 205 LYS B CG    1 
ATOM   4688  C CD    . LYS B 1 205 ? 41.205  12.932  0.907   1.00 33.29  ? 205 LYS B CD    1 
ATOM   4689  C CE    . LYS B 1 205 ? 41.978  14.050  0.254   1.00 37.67  ? 205 LYS B CE    1 
ATOM   4690  N NZ    . LYS B 1 205 ? 41.788  14.011  -1.180  1.00 41.86  ? 205 LYS B NZ    1 
ATOM   4691  H H     . LYS B 1 205 ? 38.037  11.791  4.941   1.00 0.00   ? 205 LYS B H     1 
ATOM   4692  H HZ1   . LYS B 1 205 ? 40.771  14.062  -1.388  1.00 0.00   ? 205 LYS B HZ1   1 
ATOM   4693  H HZ2   . LYS B 1 205 ? 42.282  14.810  -1.627  1.00 0.00   ? 205 LYS B HZ2   1 
ATOM   4694  H HZ3   . LYS B 1 205 ? 42.162  13.110  -1.545  1.00 0.00   ? 205 LYS B HZ3   1 
ATOM   4695  N N     . GLY B 1 206 ? 39.641  15.182  4.860   1.00 15.36  ? 206 GLY B N     1 
ATOM   4696  C CA    . GLY B 1 206 ? 38.952  16.407  5.192   1.00 8.52   ? 206 GLY B CA    1 
ATOM   4697  C C     . GLY B 1 206 ? 39.158  17.356  4.035   1.00 11.60  ? 206 GLY B C     1 
ATOM   4698  O O     . GLY B 1 206 ? 39.590  16.961  2.954   1.00 8.88   ? 206 GLY B O     1 
ATOM   4699  H H     . GLY B 1 206 ? 40.566  15.257  4.556   1.00 0.00   ? 206 GLY B H     1 
ATOM   4700  N N     . LYS B 1 207 ? 38.958  18.637  4.261   1.00 16.57  ? 207 LYS B N     1 
ATOM   4701  C CA    . LYS B 1 207 ? 39.032  19.645  3.231   1.00 17.44  ? 207 LYS B CA    1 
ATOM   4702  C C     . LYS B 1 207 ? 39.619  20.910  3.831   1.00 15.37  ? 207 LYS B C     1 
ATOM   4703  O O     . LYS B 1 207 ? 39.685  21.933  3.152   1.00 13.73  ? 207 LYS B O     1 
ATOM   4704  C CB    . LYS B 1 207 ? 37.614  19.855  2.710   1.00 29.63  ? 207 LYS B CB    1 
ATOM   4705  C CG    . LYS B 1 207 ? 37.462  20.786  1.507   1.00 47.44  ? 207 LYS B CG    1 
ATOM   4706  C CD    . LYS B 1 207 ? 36.038  20.854  0.946   1.00 56.32  ? 207 LYS B CD    1 
ATOM   4707  C CE    . LYS B 1 207 ? 36.100  21.591  -0.396  1.00 59.42  ? 207 LYS B CE    1 
ATOM   4708  N NZ    . LYS B 1 207 ? 34.939  21.314  -1.225  1.00 62.50  ? 207 LYS B NZ    1 
ATOM   4709  H H     . LYS B 1 207 ? 38.665  18.900  5.156   1.00 0.00   ? 207 LYS B H     1 
ATOM   4710  H HZ1   . LYS B 1 207 ? 34.844  20.285  -1.353  1.00 0.00   ? 207 LYS B HZ1   1 
ATOM   4711  H HZ2   . LYS B 1 207 ? 34.082  21.689  -0.770  1.00 0.00   ? 207 LYS B HZ2   1 
ATOM   4712  H HZ3   . LYS B 1 207 ? 35.063  21.764  -2.155  1.00 0.00   ? 207 LYS B HZ3   1 
ATOM   4713  N N     . ILE B 1 208 ? 40.089  20.941  5.078   1.00 16.32  ? 208 ILE B N     1 
ATOM   4714  C CA    . ILE B 1 208 ? 40.661  22.151  5.673   1.00 14.50  ? 208 ILE B CA    1 
ATOM   4715  C C     . ILE B 1 208 ? 41.988  21.774  6.302   1.00 12.96  ? 208 ILE B C     1 
ATOM   4716  O O     . ILE B 1 208 ? 42.110  20.638  6.800   1.00 12.31  ? 208 ILE B O     1 
ATOM   4717  C CB    . ILE B 1 208 ? 39.686  22.719  6.708   1.00 15.87  ? 208 ILE B CB    1 
ATOM   4718  C CG1   . ILE B 1 208 ? 38.633  23.480  5.940   1.00 19.00  ? 208 ILE B CG1   1 
ATOM   4719  C CG2   . ILE B 1 208 ? 40.355  23.653  7.725   1.00 17.66  ? 208 ILE B CG2   1 
ATOM   4720  C CD1   . ILE B 1 208 ? 37.355  23.745  6.730   1.00 19.67  ? 208 ILE B CD1   1 
ATOM   4721  H H     . ILE B 1 208 ? 40.161  20.124  5.608   1.00 0.00   ? 208 ILE B H     1 
ATOM   4722  N N     . TYR B 1 209 ? 42.993  22.643  6.206   1.00 11.45  ? 209 TYR B N     1 
ATOM   4723  C CA    . TYR B 1 209 ? 44.251  22.390  6.892   1.00 14.96  ? 209 TYR B CA    1 
ATOM   4724  C C     . TYR B 1 209 ? 44.409  23.522  7.919   1.00 16.97  ? 209 TYR B C     1 
ATOM   4725  O O     . TYR B 1 209 ? 44.115  24.676  7.571   1.00 16.71  ? 209 TYR B O     1 
ATOM   4726  C CB    . TYR B 1 209 ? 45.418  22.349  5.861   1.00 15.00  ? 209 TYR B CB    1 
ATOM   4727  C CG    . TYR B 1 209 ? 45.773  23.634  5.119   1.00 13.36  ? 209 TYR B CG    1 
ATOM   4728  C CD1   . TYR B 1 209 ? 46.664  24.529  5.673   1.00 9.30   ? 209 TYR B CD1   1 
ATOM   4729  C CD2   . TYR B 1 209 ? 45.149  23.940  3.932   1.00 13.47  ? 209 TYR B CD2   1 
ATOM   4730  C CE1   . TYR B 1 209 ? 46.883  25.760  5.089   1.00 7.50   ? 209 TYR B CE1   1 
ATOM   4731  C CE2   . TYR B 1 209 ? 45.365  25.170  3.332   1.00 17.21  ? 209 TYR B CE2   1 
ATOM   4732  C CZ    . TYR B 1 209 ? 46.224  26.077  3.925   1.00 13.59  ? 209 TYR B CZ    1 
ATOM   4733  O OH    . TYR B 1 209 ? 46.440  27.315  3.343   1.00 21.56  ? 209 TYR B OH    1 
ATOM   4734  H H     . TYR B 1 209 ? 42.857  23.511  5.760   1.00 0.00   ? 209 TYR B H     1 
ATOM   4735  H HH    . TYR B 1 209 ? 46.289  27.244  2.392   1.00 0.00   ? 209 TYR B HH    1 
ATOM   4736  N N     . SER B 1 210 ? 44.835  23.283  9.163   1.00 14.88  ? 210 SER B N     1 
ATOM   4737  C CA    . SER B 1 210 ? 44.933  24.337  10.168  1.00 16.14  ? 210 SER B CA    1 
ATOM   4738  C C     . SER B 1 210 ? 46.347  24.404  10.744  1.00 17.97  ? 210 SER B C     1 
ATOM   4739  O O     . SER B 1 210 ? 46.891  23.384  11.195  1.00 17.40  ? 210 SER B O     1 
ATOM   4740  C CB    . SER B 1 210 ? 43.913  24.036  11.273  1.00 14.81  ? 210 SER B CB    1 
ATOM   4741  O OG    . SER B 1 210 ? 43.816  25.005  12.312  1.00 14.56  ? 210 SER B OG    1 
ATOM   4742  H H     . SER B 1 210 ? 45.134  22.390  9.418   1.00 0.00   ? 210 SER B H     1 
ATOM   4743  H HG    . SER B 1 210 ? 43.476  25.767  11.819  1.00 0.00   ? 210 SER B HG    1 
ATOM   4744  N N     . LEU B 1 211 ? 46.983  25.578  10.691  1.00 20.54  ? 211 LEU B N     1 
ATOM   4745  C CA    . LEU B 1 211 ? 48.285  25.844  11.307  1.00 21.47  ? 211 LEU B CA    1 
ATOM   4746  C C     . LEU B 1 211 ? 48.569  27.344  11.167  1.00 24.27  ? 211 LEU B C     1 
ATOM   4747  O O     . LEU B 1 211 ? 47.973  28.041  10.340  1.00 25.39  ? 211 LEU B O     1 
ATOM   4748  C CB    . LEU B 1 211 ? 49.461  25.091  10.641  1.00 18.30  ? 211 LEU B CB    1 
ATOM   4749  C CG    . LEU B 1 211 ? 50.179  25.577  9.386   1.00 9.71   ? 211 LEU B CG    1 
ATOM   4750  C CD1   . LEU B 1 211 ? 51.482  24.843  9.321   1.00 13.24  ? 211 LEU B CD1   1 
ATOM   4751  C CD2   . LEU B 1 211 ? 49.358  25.353  8.140   1.00 15.16  ? 211 LEU B CD2   1 
ATOM   4752  H H     . LEU B 1 211 ? 46.536  26.322  10.222  1.00 0.00   ? 211 LEU B H     1 
ATOM   4753  N N     . ASN B 1 212 ? 49.492  27.895  11.949  1.00 26.21  ? 212 ASN B N     1 
ATOM   4754  C CA    . ASN B 1 212 ? 49.805  29.318  11.892  1.00 24.52  ? 212 ASN B CA    1 
ATOM   4755  C C     . ASN B 1 212 ? 50.849  29.559  10.814  1.00 26.96  ? 212 ASN B C     1 
ATOM   4756  O O     . ASN B 1 212 ? 52.050  29.326  11.049  1.00 29.72  ? 212 ASN B O     1 
ATOM   4757  C CB    . ASN B 1 212 ? 50.352  29.787  13.250  1.00 22.89  ? 212 ASN B CB    1 
ATOM   4758  C CG    . ASN B 1 212 ? 50.574  31.287  13.363  1.00 23.93  ? 212 ASN B CG    1 
ATOM   4759  O OD1   . ASN B 1 212 ? 50.748  32.021  12.390  1.00 24.58  ? 212 ASN B OD1   1 
ATOM   4760  N ND2   . ASN B 1 212 ? 50.585  31.816  14.569  1.00 21.86  ? 212 ASN B ND2   1 
ATOM   4761  H H     . ASN B 1 212 ? 50.040  27.305  12.508  1.00 0.00   ? 212 ASN B H     1 
ATOM   4762  H HD21  . ASN B 1 212 ? 50.661  32.785  14.640  1.00 0.00   ? 212 ASN B HD21  1 
ATOM   4763  H HD22  . ASN B 1 212 ? 50.475  31.224  15.345  1.00 0.00   ? 212 ASN B HD22  1 
ATOM   4764  N N     . GLU B 1 213 ? 50.438  30.044  9.643   1.00 24.99  ? 213 GLU B N     1 
ATOM   4765  C CA    . GLU B 1 213 ? 51.392  30.271  8.572   1.00 22.73  ? 213 GLU B CA    1 
ATOM   4766  C C     . GLU B 1 213 ? 52.342  31.442  8.776   1.00 24.66  ? 213 GLU B C     1 
ATOM   4767  O O     . GLU B 1 213 ? 53.217  31.650  7.937   1.00 26.49  ? 213 GLU B O     1 
ATOM   4768  C CB    . GLU B 1 213 ? 50.651  30.449  7.258   1.00 21.31  ? 213 GLU B CB    1 
ATOM   4769  C CG    . GLU B 1 213 ? 50.252  29.080  6.736   1.00 22.85  ? 213 GLU B CG    1 
ATOM   4770  C CD    . GLU B 1 213 ? 49.864  29.026  5.264   1.00 24.94  ? 213 GLU B CD    1 
ATOM   4771  O OE1   . GLU B 1 213 ? 50.735  29.185  4.409   1.00 24.07  ? 213 GLU B OE1   1 
ATOM   4772  O OE2   . GLU B 1 213 ? 48.693  28.794  4.969   1.00 23.41  ? 213 GLU B OE2   1 
ATOM   4773  H H     . GLU B 1 213 ? 49.485  30.247  9.508   1.00 0.00   ? 213 GLU B H     1 
ATOM   4774  N N     . ALA B 1 214 ? 52.264  32.219  9.863   1.00 25.87  ? 214 ALA B N     1 
ATOM   4775  C CA    . ALA B 1 214 ? 53.217  33.296  10.165  1.00 27.56  ? 214 ALA B CA    1 
ATOM   4776  C C     . ALA B 1 214 ? 54.663  32.829  10.244  1.00 30.93  ? 214 ALA B C     1 
ATOM   4777  O O     . ALA B 1 214 ? 55.640  33.461  9.822   1.00 29.69  ? 214 ALA B O     1 
ATOM   4778  C CB    . ALA B 1 214 ? 52.973  33.898  11.505  1.00 33.56  ? 214 ALA B CB    1 
ATOM   4779  H H     . ALA B 1 214 ? 51.530  32.064  10.493  1.00 0.00   ? 214 ALA B H     1 
ATOM   4780  N N     . TYR B 1 215 ? 54.762  31.626  10.800  1.00 30.51  ? 215 TYR B N     1 
ATOM   4781  C CA    . TYR B 1 215 ? 56.036  31.007  11.010  1.00 33.77  ? 215 TYR B CA    1 
ATOM   4782  C C     . TYR B 1 215 ? 56.496  30.300  9.761   1.00 31.75  ? 215 TYR B C     1 
ATOM   4783  O O     . TYR B 1 215 ? 57.297  29.376  9.876   1.00 33.65  ? 215 TYR B O     1 
ATOM   4784  C CB    . TYR B 1 215 ? 55.943  30.010  12.153  1.00 40.23  ? 215 TYR B CB    1 
ATOM   4785  C CG    . TYR B 1 215 ? 55.407  30.515  13.490  1.00 50.22  ? 215 TYR B CG    1 
ATOM   4786  C CD1   . TYR B 1 215 ? 55.415  31.855  13.860  1.00 55.32  ? 215 TYR B CD1   1 
ATOM   4787  C CD2   . TYR B 1 215 ? 54.915  29.562  14.362  1.00 55.91  ? 215 TYR B CD2   1 
ATOM   4788  C CE1   . TYR B 1 215 ? 54.936  32.228  15.105  1.00 60.64  ? 215 TYR B CE1   1 
ATOM   4789  C CE2   . TYR B 1 215 ? 54.451  29.923  15.608  1.00 59.39  ? 215 TYR B CE2   1 
ATOM   4790  C CZ    . TYR B 1 215 ? 54.465  31.251  15.970  1.00 62.19  ? 215 TYR B CZ    1 
ATOM   4791  O OH    . TYR B 1 215 ? 53.970  31.587  17.219  1.00 68.86  ? 215 TYR B OH    1 
ATOM   4792  H H     . TYR B 1 215 ? 53.944  31.138  11.035  1.00 0.00   ? 215 TYR B H     1 
ATOM   4793  H HH    . TYR B 1 215 ? 54.209  30.878  17.831  1.00 0.00   ? 215 TYR B HH    1 
ATOM   4794  N N     . ALA B 1 216 ? 56.069  30.694  8.561   1.00 34.99  ? 216 ALA B N     1 
ATOM   4795  C CA    . ALA B 1 216 ? 56.490  30.044  7.324   1.00 40.22  ? 216 ALA B CA    1 
ATOM   4796  C C     . ALA B 1 216 ? 58.006  30.066  7.176   1.00 42.70  ? 216 ALA B C     1 
ATOM   4797  O O     . ALA B 1 216 ? 58.640  29.057  6.883   1.00 41.36  ? 216 ALA B O     1 
ATOM   4798  C CB    . ALA B 1 216 ? 55.875  30.743  6.127   1.00 38.42  ? 216 ALA B CB    1 
ATOM   4799  H H     . ALA B 1 216 ? 55.421  31.426  8.490   1.00 0.00   ? 216 ALA B H     1 
ATOM   4800  N N     . LYS B 1 217 ? 58.602  31.205  7.529   1.00 48.13  ? 217 LYS B N     1 
ATOM   4801  C CA    . LYS B 1 217 ? 60.045  31.419  7.537   1.00 49.22  ? 217 LYS B CA    1 
ATOM   4802  C C     . LYS B 1 217 ? 60.835  30.344  8.295   1.00 47.62  ? 217 LYS B C     1 
ATOM   4803  O O     . LYS B 1 217 ? 62.025  30.152  8.040   1.00 52.66  ? 217 LYS B O     1 
ATOM   4804  C CB    . LYS B 1 217 ? 60.308  32.793  8.161   1.00 54.55  ? 217 LYS B CB    1 
ATOM   4805  C CG    . LYS B 1 217 ? 61.742  33.322  8.090   1.00 63.94  ? 217 LYS B CG    1 
ATOM   4806  C CD    . LYS B 1 217 ? 61.966  34.490  9.056   1.00 69.60  ? 217 LYS B CD    1 
ATOM   4807  C CE    . LYS B 1 217 ? 63.382  35.053  8.921   1.00 72.37  ? 217 LYS B CE    1 
ATOM   4808  N NZ    . LYS B 1 217 ? 63.620  36.130  9.869   1.00 74.06  ? 217 LYS B NZ    1 
ATOM   4809  H H     . LYS B 1 217 ? 58.027  31.956  7.783   1.00 0.00   ? 217 LYS B H     1 
ATOM   4810  H HZ1   . LYS B 1 217 ? 62.900  36.869  9.748   1.00 0.00   ? 217 LYS B HZ1   1 
ATOM   4811  H HZ2   . LYS B 1 217 ? 63.577  35.756  10.839  1.00 0.00   ? 217 LYS B HZ2   1 
ATOM   4812  H HZ3   . LYS B 1 217 ? 64.561  36.536  9.699   1.00 0.00   ? 217 LYS B HZ3   1 
ATOM   4813  N N     . ASP B 1 218 ? 60.227  29.632  9.244   1.00 42.72  ? 218 ASP B N     1 
ATOM   4814  C CA    . ASP B 1 218 ? 60.943  28.678  10.059  1.00 37.79  ? 218 ASP B CA    1 
ATOM   4815  C C     . ASP B 1 218 ? 60.459  27.250  9.906   1.00 36.33  ? 218 ASP B C     1 
ATOM   4816  O O     . ASP B 1 218 ? 60.804  26.381  10.713  1.00 36.59  ? 218 ASP B O     1 
ATOM   4817  C CB    . ASP B 1 218 ? 60.825  29.102  11.508  1.00 37.80  ? 218 ASP B CB    1 
ATOM   4818  C CG    . ASP B 1 218 ? 61.515  30.411  11.852  1.00 37.93  ? 218 ASP B CG    1 
ATOM   4819  O OD1   . ASP B 1 218 ? 62.458  30.818  11.175  1.00 41.84  ? 218 ASP B OD1   1 
ATOM   4820  O OD2   . ASP B 1 218 ? 61.100  31.028  12.825  1.00 43.55  ? 218 ASP B OD2   1 
ATOM   4821  H H     . ASP B 1 218 ? 59.251  29.658  9.326   1.00 0.00   ? 218 ASP B H     1 
ATOM   4822  N N     . PHE B 1 219 ? 59.658  26.973  8.893   1.00 34.20  ? 219 PHE B N     1 
ATOM   4823  C CA    . PHE B 1 219 ? 59.123  25.651  8.723   1.00 33.82  ? 219 PHE B CA    1 
ATOM   4824  C C     . PHE B 1 219 ? 60.135  24.761  8.034   1.00 35.16  ? 219 PHE B C     1 
ATOM   4825  O O     . PHE B 1 219 ? 60.753  25.114  7.024   1.00 33.59  ? 219 PHE B O     1 
ATOM   4826  C CB    . PHE B 1 219 ? 57.837  25.711  7.896   1.00 33.15  ? 219 PHE B CB    1 
ATOM   4827  C CG    . PHE B 1 219 ? 56.585  26.181  8.632   1.00 32.94  ? 219 PHE B CG    1 
ATOM   4828  C CD1   . PHE B 1 219 ? 56.510  26.164  10.014  1.00 32.28  ? 219 PHE B CD1   1 
ATOM   4829  C CD2   . PHE B 1 219 ? 55.524  26.661  7.891   1.00 32.55  ? 219 PHE B CD2   1 
ATOM   4830  C CE1   . PHE B 1 219 ? 55.392  26.662  10.648  1.00 34.73  ? 219 PHE B CE1   1 
ATOM   4831  C CE2   . PHE B 1 219 ? 54.408  27.161  8.532   1.00 32.22  ? 219 PHE B CE2   1 
ATOM   4832  C CZ    . PHE B 1 219 ? 54.344  27.168  9.909   1.00 36.01  ? 219 PHE B CZ    1 
ATOM   4833  H H     . PHE B 1 219 ? 59.532  27.621  8.167   1.00 0.00   ? 219 PHE B H     1 
ATOM   4834  N N     . ASP B 1 220 ? 60.326  23.566  8.587   1.00 38.10  ? 220 ASP B N     1 
ATOM   4835  C CA    . ASP B 1 220 ? 61.201  22.596  7.951   1.00 41.83  ? 220 ASP B CA    1 
ATOM   4836  C C     . ASP B 1 220 ? 60.637  22.248  6.566   1.00 40.58  ? 220 ASP B C     1 
ATOM   4837  O O     . ASP B 1 220 ? 59.409  22.210  6.415   1.00 39.91  ? 220 ASP B O     1 
ATOM   4838  C CB    . ASP B 1 220 ? 61.308  21.336  8.837   1.00 46.75  ? 220 ASP B CB    1 
ATOM   4839  C CG    . ASP B 1 220 ? 60.022  20.551  9.040   1.00 54.24  ? 220 ASP B CG    1 
ATOM   4840  O OD1   . ASP B 1 220 ? 59.739  19.677  8.219   1.00 56.85  ? 220 ASP B OD1   1 
ATOM   4841  O OD2   . ASP B 1 220 ? 59.312  20.816  10.016  1.00 62.15  ? 220 ASP B OD2   1 
ATOM   4842  H H     . ASP B 1 220 ? 59.873  23.348  9.427   1.00 0.00   ? 220 ASP B H     1 
ATOM   4843  N N     . PRO B 1 221 ? 61.413  21.966  5.517   1.00 37.66  ? 221 PRO B N     1 
ATOM   4844  C CA    . PRO B 1 221 ? 60.919  21.725  4.167   1.00 36.12  ? 221 PRO B CA    1 
ATOM   4845  C C     . PRO B 1 221 ? 59.706  20.814  3.970   1.00 33.24  ? 221 PRO B C     1 
ATOM   4846  O O     . PRO B 1 221 ? 58.921  21.083  3.062   1.00 30.87  ? 221 PRO B O     1 
ATOM   4847  C CB    . PRO B 1 221 ? 62.146  21.232  3.435   1.00 38.31  ? 221 PRO B CB    1 
ATOM   4848  C CG    . PRO B 1 221 ? 63.045  20.722  4.526   1.00 39.56  ? 221 PRO B CG    1 
ATOM   4849  C CD    . PRO B 1 221 ? 62.855  21.816  5.559   1.00 37.84  ? 221 PRO B CD    1 
ATOM   4850  N N     . ALA B 1 222 ? 59.513  19.745  4.765   1.00 30.52  ? 222 ALA B N     1 
ATOM   4851  C CA    . ALA B 1 222 ? 58.368  18.845  4.630   1.00 29.06  ? 222 ALA B CA    1 
ATOM   4852  C C     . ALA B 1 222 ? 57.030  19.534  4.937   1.00 29.10  ? 222 ALA B C     1 
ATOM   4853  O O     . ALA B 1 222 ? 56.117  19.462  4.102   1.00 29.27  ? 222 ALA B O     1 
ATOM   4854  C CB    . ALA B 1 222 ? 58.542  17.650  5.564   1.00 24.46  ? 222 ALA B CB    1 
ATOM   4855  H H     . ALA B 1 222 ? 60.147  19.592  5.492   1.00 0.00   ? 222 ALA B H     1 
ATOM   4856  N N     . VAL B 1 223 ? 56.866  20.264  6.057   1.00 28.31  ? 223 VAL B N     1 
ATOM   4857  C CA    . VAL B 1 223 ? 55.619  20.994  6.292   1.00 28.60  ? 223 VAL B CA    1 
ATOM   4858  C C     . VAL B 1 223 ? 55.478  22.082  5.223   1.00 25.79  ? 223 VAL B C     1 
ATOM   4859  O O     . VAL B 1 223 ? 54.361  22.268  4.745   1.00 29.09  ? 223 VAL B O     1 
ATOM   4860  C CB    . VAL B 1 223 ? 55.594  21.554  7.775   1.00 25.21  ? 223 VAL B CB    1 
ATOM   4861  C CG1   . VAL B 1 223 ? 56.806  22.320  8.166   1.00 23.12  ? 223 VAL B CG1   1 
ATOM   4862  C CG2   . VAL B 1 223 ? 54.471  22.547  7.897   1.00 27.35  ? 223 VAL B CG2   1 
ATOM   4863  H H     . VAL B 1 223 ? 57.604  20.326  6.693   1.00 0.00   ? 223 VAL B H     1 
ATOM   4864  N N     . THR B 1 224 ? 56.525  22.752  4.738   1.00 25.68  ? 224 THR B N     1 
ATOM   4865  C CA    . THR B 1 224 ? 56.417  23.697  3.612   1.00 28.27  ? 224 THR B CA    1 
ATOM   4866  C C     . THR B 1 224 ? 55.842  23.020  2.352   1.00 28.74  ? 224 THR B C     1 
ATOM   4867  O O     . THR B 1 224 ? 54.881  23.507  1.746   1.00 29.28  ? 224 THR B O     1 
ATOM   4868  C CB    . THR B 1 224 ? 57.828  24.309  3.286   1.00 31.05  ? 224 THR B CB    1 
ATOM   4869  O OG1   . THR B 1 224 ? 58.390  24.766  4.523   1.00 33.16  ? 224 THR B OG1   1 
ATOM   4870  C CG2   . THR B 1 224 ? 57.758  25.481  2.294   1.00 23.17  ? 224 THR B CG2   1 
ATOM   4871  H H     . THR B 1 224 ? 57.396  22.676  5.180   1.00 0.00   ? 224 THR B H     1 
ATOM   4872  H HG1   . THR B 1 224 ? 59.156  24.268  4.820   1.00 0.00   ? 224 THR B HG1   1 
ATOM   4873  N N     . GLU B 1 225 ? 56.360  21.856  1.962   1.00 30.22  ? 225 GLU B N     1 
ATOM   4874  C CA    . GLU B 1 225 ? 55.866  21.131  0.805   1.00 31.11  ? 225 GLU B CA    1 
ATOM   4875  C C     . GLU B 1 225 ? 54.439  20.643  1.022   1.00 30.85  ? 225 GLU B C     1 
ATOM   4876  O O     . GLU B 1 225 ? 53.606  20.651  0.104   1.00 31.27  ? 225 GLU B O     1 
ATOM   4877  C CB    . GLU B 1 225 ? 56.768  19.941  0.520   1.00 33.59  ? 225 GLU B CB    1 
ATOM   4878  C CG    . GLU B 1 225 ? 56.388  19.231  -0.780  1.00 37.01  ? 225 GLU B CG    1 
ATOM   4879  C CD    . GLU B 1 225 ? 57.253  18.036  -1.135  1.00 40.82  ? 225 GLU B CD    1 
ATOM   4880  O OE1   . GLU B 1 225 ? 57.525  17.197  -0.272  1.00 45.07  ? 225 GLU B OE1   1 
ATOM   4881  O OE2   . GLU B 1 225 ? 57.649  17.947  -2.295  1.00 43.73  ? 225 GLU B OE2   1 
ATOM   4882  H H     . GLU B 1 225 ? 57.084  21.460  2.490   1.00 0.00   ? 225 GLU B H     1 
ATOM   4883  N N     . TYR B 1 226 ? 54.126  20.239  2.249   1.00 29.16  ? 226 TYR B N     1 
ATOM   4884  C CA    . TYR B 1 226 ? 52.786  19.809  2.581   1.00 23.54  ? 226 TYR B CA    1 
ATOM   4885  C C     . TYR B 1 226 ? 51.797  20.940  2.328   1.00 21.07  ? 226 TYR B C     1 
ATOM   4886  O O     . TYR B 1 226 ? 50.847  20.749  1.575   1.00 21.80  ? 226 TYR B O     1 
ATOM   4887  C CB    . TYR B 1 226 ? 52.740  19.392  4.038   1.00 24.10  ? 226 TYR B CB    1 
ATOM   4888  C CG    . TYR B 1 226 ? 51.379  18.827  4.380   1.00 26.34  ? 226 TYR B CG    1 
ATOM   4889  C CD1   . TYR B 1 226 ? 50.980  17.655  3.772   1.00 21.62  ? 226 TYR B CD1   1 
ATOM   4890  C CD2   . TYR B 1 226 ? 50.514  19.560  5.183   1.00 27.08  ? 226 TYR B CD2   1 
ATOM   4891  C CE1   . TYR B 1 226 ? 49.677  17.240  3.909   1.00 23.63  ? 226 TYR B CE1   1 
ATOM   4892  C CE2   . TYR B 1 226 ? 49.203  19.154  5.309   1.00 26.48  ? 226 TYR B CE2   1 
ATOM   4893  C CZ    . TYR B 1 226 ? 48.797  18.001  4.656   1.00 25.02  ? 226 TYR B CZ    1 
ATOM   4894  O OH    . TYR B 1 226 ? 47.479  17.589  4.745   1.00 25.52  ? 226 TYR B OH    1 
ATOM   4895  H H     . TYR B 1 226 ? 54.820  20.232  2.936   1.00 0.00   ? 226 TYR B H     1 
ATOM   4896  H HH    . TYR B 1 226 ? 47.410  16.708  4.371   1.00 0.00   ? 226 TYR B HH    1 
ATOM   4897  N N     . ILE B 1 227 ? 52.003  22.128  2.895   1.00 20.96  ? 227 ILE B N     1 
ATOM   4898  C CA    . ILE B 1 227 ? 51.115  23.269  2.726   1.00 23.87  ? 227 ILE B CA    1 
ATOM   4899  C C     . ILE B 1 227 ? 50.942  23.671  1.267   1.00 27.59  ? 227 ILE B C     1 
ATOM   4900  O O     . ILE B 1 227 ? 49.840  24.030  0.841   1.00 26.65  ? 227 ILE B O     1 
ATOM   4901  C CB    . ILE B 1 227 ? 51.670  24.442  3.556   1.00 19.72  ? 227 ILE B CB    1 
ATOM   4902  C CG1   . ILE B 1 227 ? 51.503  24.113  5.006   1.00 23.37  ? 227 ILE B CG1   1 
ATOM   4903  C CG2   . ILE B 1 227 ? 50.901  25.725  3.340   1.00 22.06  ? 227 ILE B CG2   1 
ATOM   4904  C CD1   . ILE B 1 227 ? 52.285  25.126  5.846   1.00 27.09  ? 227 ILE B CD1   1 
ATOM   4905  H H     . ILE B 1 227 ? 52.808  22.232  3.448   1.00 0.00   ? 227 ILE B H     1 
ATOM   4906  N N     . GLN B 1 228 ? 52.003  23.597  0.467   1.00 32.16  ? 228 GLN B N     1 
ATOM   4907  C CA    . GLN B 1 228 ? 51.916  23.950  -0.936  1.00 35.25  ? 228 GLN B CA    1 
ATOM   4908  C C     . GLN B 1 228 ? 50.989  23.009  -1.688  1.00 33.73  ? 228 GLN B C     1 
ATOM   4909  O O     . GLN B 1 228 ? 50.135  23.461  -2.444  1.00 37.88  ? 228 GLN B O     1 
ATOM   4910  C CB    . GLN B 1 228 ? 53.288  23.898  -1.530  1.00 45.74  ? 228 GLN B CB    1 
ATOM   4911  C CG    . GLN B 1 228 ? 53.369  24.410  -2.964  1.00 61.37  ? 228 GLN B CG    1 
ATOM   4912  C CD    . GLN B 1 228 ? 54.777  24.279  -3.522  1.00 68.42  ? 228 GLN B CD    1 
ATOM   4913  O OE1   . GLN B 1 228 ? 55.027  23.584  -4.507  1.00 72.17  ? 228 GLN B OE1   1 
ATOM   4914  N NE2   . GLN B 1 228 ? 55.730  24.949  -2.883  1.00 73.73  ? 228 GLN B NE2   1 
ATOM   4915  H H     . GLN B 1 228 ? 52.861  23.305  0.847   1.00 0.00   ? 228 GLN B H     1 
ATOM   4916  H HE21  . GLN B 1 228 ? 56.670  24.765  -3.092  1.00 0.00   ? 228 GLN B HE21  1 
ATOM   4917  H HE22  . GLN B 1 228 ? 55.471  25.541  -2.151  1.00 0.00   ? 228 GLN B HE22  1 
ATOM   4918  N N     . ARG B 1 229 ? 51.089  21.713  -1.422  1.00 30.45  ? 229 ARG B N     1 
ATOM   4919  C CA    . ARG B 1 229 ? 50.261  20.671  -2.018  1.00 27.40  ? 229 ARG B CA    1 
ATOM   4920  C C     . ARG B 1 229 ? 48.764  20.826  -1.678  1.00 28.30  ? 229 ARG B C     1 
ATOM   4921  O O     . ARG B 1 229 ? 47.870  20.308  -2.357  1.00 22.30  ? 229 ARG B O     1 
ATOM   4922  C CB    . ARG B 1 229 ? 50.862  19.409  -1.493  1.00 21.94  ? 229 ARG B CB    1 
ATOM   4923  C CG    . ARG B 1 229 ? 50.637  18.130  -2.210  1.00 27.06  ? 229 ARG B CG    1 
ATOM   4924  C CD    . ARG B 1 229 ? 51.209  17.099  -1.247  1.00 29.71  ? 229 ARG B CD    1 
ATOM   4925  N NE    . ARG B 1 229 ? 50.948  15.733  -1.668  1.00 30.93  ? 229 ARG B NE    1 
ATOM   4926  C CZ    . ARG B 1 229 ? 51.838  15.025  -2.363  1.00 30.90  ? 229 ARG B CZ    1 
ATOM   4927  N NH1   . ARG B 1 229 ? 52.996  15.560  -2.757  1.00 39.61  ? 229 ARG B NH1   1 
ATOM   4928  N NH2   . ARG B 1 229 ? 51.564  13.763  -2.676  1.00 29.65  ? 229 ARG B NH2   1 
ATOM   4929  H H     . ARG B 1 229 ? 51.778  21.429  -0.781  1.00 0.00   ? 229 ARG B H     1 
ATOM   4930  H HE    . ARG B 1 229 ? 50.087  15.323  -1.443  1.00 0.00   ? 229 ARG B HE    1 
ATOM   4931  H HH11  . ARG B 1 229 ? 53.219  16.508  -2.531  1.00 0.00   ? 229 ARG B HH11  1 
ATOM   4932  H HH12  . ARG B 1 229 ? 53.651  15.002  -3.265  1.00 0.00   ? 229 ARG B HH12  1 
ATOM   4933  H HH21  . ARG B 1 229 ? 50.693  13.360  -2.396  1.00 0.00   ? 229 ARG B HH21  1 
ATOM   4934  H HH22  . ARG B 1 229 ? 52.224  13.221  -3.195  1.00 0.00   ? 229 ARG B HH22  1 
ATOM   4935  N N     . LYS B 1 230 ? 48.486  21.527  -0.568  1.00 29.63  ? 230 LYS B N     1 
ATOM   4936  C CA    . LYS B 1 230 ? 47.145  21.872  -0.136  1.00 27.07  ? 230 LYS B CA    1 
ATOM   4937  C C     . LYS B 1 230 ? 46.599  23.098  -0.827  1.00 26.27  ? 230 LYS B C     1 
ATOM   4938  O O     . LYS B 1 230 ? 45.383  23.249  -0.878  1.00 27.66  ? 230 LYS B O     1 
ATOM   4939  C CB    . LYS B 1 230 ? 47.081  22.151  1.359   1.00 26.22  ? 230 LYS B CB    1 
ATOM   4940  C CG    . LYS B 1 230 ? 47.385  20.990  2.291   1.00 29.17  ? 230 LYS B CG    1 
ATOM   4941  C CD    . LYS B 1 230 ? 46.508  19.745  2.140   1.00 29.75  ? 230 LYS B CD    1 
ATOM   4942  C CE    . LYS B 1 230 ? 46.958  18.751  1.059   1.00 35.51  ? 230 LYS B CE    1 
ATOM   4943  N NZ    . LYS B 1 230 ? 46.025  17.643  0.905   1.00 37.93  ? 230 LYS B NZ    1 
ATOM   4944  H H     . LYS B 1 230 ? 49.236  21.774  0.012   1.00 0.00   ? 230 LYS B H     1 
ATOM   4945  H HZ1   . LYS B 1 230 ? 45.088  18.011  0.645   1.00 0.00   ? 230 LYS B HZ1   1 
ATOM   4946  H HZ2   . LYS B 1 230 ? 46.369  17.008  0.157   1.00 0.00   ? 230 LYS B HZ2   1 
ATOM   4947  H HZ3   . LYS B 1 230 ? 45.959  17.119  1.801   1.00 0.00   ? 230 LYS B HZ3   1 
ATOM   4948  N N     . LYS B 1 231 ? 47.403  24.024  -1.333  1.00 24.58  ? 231 LYS B N     1 
ATOM   4949  C CA    . LYS B 1 231 ? 46.865  25.192  -2.028  1.00 20.25  ? 231 LYS B CA    1 
ATOM   4950  C C     . LYS B 1 231 ? 46.920  24.934  -3.533  1.00 22.49  ? 231 LYS B C     1 
ATOM   4951  O O     . LYS B 1 231 ? 46.099  25.446  -4.293  1.00 18.25  ? 231 LYS B O     1 
ATOM   4952  C CB    . LYS B 1 231 ? 47.685  26.433  -1.715  1.00 13.94  ? 231 LYS B CB    1 
ATOM   4953  C CG    . LYS B 1 231 ? 47.998  26.580  -0.238  1.00 10.64  ? 231 LYS B CG    1 
ATOM   4954  C CD    . LYS B 1 231 ? 48.982  27.694  -0.067  1.00 9.92   ? 231 LYS B CD    1 
ATOM   4955  C CE    . LYS B 1 231 ? 49.077  28.040  1.394   1.00 13.27  ? 231 LYS B CE    1 
ATOM   4956  N NZ    . LYS B 1 231 ? 49.848  29.260  1.556   1.00 9.64   ? 231 LYS B NZ    1 
ATOM   4957  H H     . LYS B 1 231 ? 48.375  23.902  -1.254  1.00 0.00   ? 231 LYS B H     1 
ATOM   4958  H HZ1   . LYS B 1 231 ? 49.410  30.019  0.997   1.00 0.00   ? 231 LYS B HZ1   1 
ATOM   4959  H HZ2   . LYS B 1 231 ? 49.863  29.534  2.559   1.00 0.00   ? 231 LYS B HZ2   1 
ATOM   4960  H HZ3   . LYS B 1 231 ? 50.820  29.099  1.223   1.00 0.00   ? 231 LYS B HZ3   1 
ATOM   4961  N N     . PHE B 1 232 ? 47.895  24.152  -4.006  1.00 24.57  ? 232 PHE B N     1 
ATOM   4962  C CA    . PHE B 1 232 ? 48.089  23.827  -5.422  1.00 29.03  ? 232 PHE B CA    1 
ATOM   4963  C C     . PHE B 1 232 ? 48.146  22.298  -5.520  1.00 29.74  ? 232 PHE B C     1 
ATOM   4964  O O     . PHE B 1 232 ? 49.240  21.725  -5.450  1.00 29.72  ? 232 PHE B O     1 
ATOM   4965  C CB    . PHE B 1 232 ? 49.424  24.405  -5.971  1.00 23.26  ? 232 PHE B CB    1 
ATOM   4966  C CG    . PHE B 1 232 ? 49.624  25.894  -5.716  1.00 19.84  ? 232 PHE B CG    1 
ATOM   4967  C CD1   . PHE B 1 232 ? 50.173  26.326  -4.523  1.00 18.30  ? 232 PHE B CD1   1 
ATOM   4968  C CD2   . PHE B 1 232 ? 49.181  26.817  -6.632  1.00 17.64  ? 232 PHE B CD2   1 
ATOM   4969  C CE1   . PHE B 1 232 ? 50.201  27.674  -4.213  1.00 17.97  ? 232 PHE B CE1   1 
ATOM   4970  C CE2   . PHE B 1 232 ? 49.228  28.163  -6.313  1.00 19.08  ? 232 PHE B CE2   1 
ATOM   4971  C CZ    . PHE B 1 232 ? 49.706  28.596  -5.099  1.00 14.58  ? 232 PHE B CZ    1 
ATOM   4972  H H     . PHE B 1 232 ? 48.521  23.742  -3.378  1.00 0.00   ? 232 PHE B H     1 
ATOM   4973  N N     . PRO B 1 233 ? 47.017  21.579  -5.613  1.00 29.98  ? 233 PRO B N     1 
ATOM   4974  C CA    . PRO B 1 233 ? 46.981  20.120  -5.578  1.00 32.22  ? 233 PRO B CA    1 
ATOM   4975  C C     . PRO B 1 233 ? 47.561  19.533  -6.860  1.00 34.39  ? 233 PRO B C     1 
ATOM   4976  O O     . PRO B 1 233 ? 47.271  20.059  -7.944  1.00 37.09  ? 233 PRO B O     1 
ATOM   4977  C CB    . PRO B 1 233 ? 45.524  19.780  -5.370  1.00 27.80  ? 233 PRO B CB    1 
ATOM   4978  C CG    . PRO B 1 233 ? 44.891  21.093  -4.971  1.00 25.21  ? 233 PRO B CG    1 
ATOM   4979  C CD    . PRO B 1 233 ? 45.670  22.109  -5.786  1.00 28.71  ? 233 PRO B CD    1 
ATOM   4980  N N     . PRO B 1 234 ? 48.404  18.484  -6.780  1.00 36.96  ? 234 PRO B N     1 
ATOM   4981  C CA    . PRO B 1 234 ? 49.012  17.785  -7.914  1.00 36.88  ? 234 PRO B CA    1 
ATOM   4982  C C     . PRO B 1 234 ? 47.980  17.160  -8.835  1.00 38.62  ? 234 PRO B C     1 
ATOM   4983  O O     . PRO B 1 234 ? 48.016  17.343  -10.056 1.00 38.12  ? 234 PRO B O     1 
ATOM   4984  C CB    . PRO B 1 234 ? 49.924  16.754  -7.286  1.00 38.83  ? 234 PRO B CB    1 
ATOM   4985  C CG    . PRO B 1 234 ? 50.292  17.351  -5.954  1.00 40.36  ? 234 PRO B CG    1 
ATOM   4986  C CD    . PRO B 1 234 ? 48.949  17.957  -5.532  1.00 38.92  ? 234 PRO B CD    1 
ATOM   4987  N N     . ASP B 1 235 ? 47.116  16.306  -8.269  1.00 40.06  ? 235 ASP B N     1 
ATOM   4988  C CA    . ASP B 1 235 ? 45.967  15.782  -8.998  1.00 42.57  ? 235 ASP B CA    1 
ATOM   4989  C C     . ASP B 1 235 ? 45.122  17.033  -9.068  1.00 43.16  ? 235 ASP B C     1 
ATOM   4990  O O     . ASP B 1 235 ? 45.082  17.708  -8.029  1.00 46.20  ? 235 ASP B O     1 
ATOM   4991  C CB    . ASP B 1 235 ? 45.272  14.669  -8.194  1.00 41.04  ? 235 ASP B CB    1 
ATOM   4992  C CG    . ASP B 1 235 ? 44.689  14.928  -6.803  1.00 38.89  ? 235 ASP B CG    1 
ATOM   4993  O OD1   . ASP B 1 235 ? 44.998  15.908  -6.126  1.00 38.69  ? 235 ASP B OD1   1 
ATOM   4994  O OD2   . ASP B 1 235 ? 43.904  14.085  -6.381  1.00 40.57  ? 235 ASP B OD2   1 
ATOM   4995  H H     . ASP B 1 235 ? 47.149  16.164  -7.304  1.00 0.00   ? 235 ASP B H     1 
ATOM   4996  N N     . ASN B 1 236 ? 44.456  17.464  -10.120 1.00 45.55  ? 236 ASN B N     1 
ATOM   4997  C CA    . ASN B 1 236 ? 43.896  18.806  -10.014 1.00 51.65  ? 236 ASN B CA    1 
ATOM   4998  C C     . ASN B 1 236 ? 42.545  18.967  -9.354  1.00 50.22  ? 236 ASN B C     1 
ATOM   4999  O O     . ASN B 1 236 ? 41.521  19.252  -9.991  1.00 54.84  ? 236 ASN B O     1 
ATOM   5000  C CB    . ASN B 1 236 ? 43.888  19.489  -11.377 1.00 58.21  ? 236 ASN B CB    1 
ATOM   5001  C CG    . ASN B 1 236 ? 45.142  20.347  -11.487 1.00 66.30  ? 236 ASN B CG    1 
ATOM   5002  O OD1   . ASN B 1 236 ? 45.946  20.202  -12.415 1.00 71.77  ? 236 ASN B OD1   1 
ATOM   5003  N ND2   . ASN B 1 236 ? 45.370  21.283  -10.574 1.00 66.83  ? 236 ASN B ND2   1 
ATOM   5004  H H     . ASN B 1 236 ? 44.360  16.926  -10.932 1.00 0.00   ? 236 ASN B H     1 
ATOM   5005  H HD21  . ASN B 1 236 ? 46.215  21.760  -10.638 1.00 0.00   ? 236 ASN B HD21  1 
ATOM   5006  H HD22  . ASN B 1 236 ? 44.707  21.427  -9.871  1.00 0.00   ? 236 ASN B HD22  1 
ATOM   5007  N N     . SER B 1 237 ? 42.574  18.739  -8.046  1.00 45.17  ? 237 SER B N     1 
ATOM   5008  C CA    . SER B 1 237 ? 41.433  18.911  -7.180  1.00 39.33  ? 237 SER B CA    1 
ATOM   5009  C C     . SER B 1 237 ? 41.431  20.366  -6.731  1.00 34.87  ? 237 SER B C     1 
ATOM   5010  O O     . SER B 1 237 ? 42.258  21.180  -7.155  1.00 33.92  ? 237 SER B O     1 
ATOM   5011  C CB    . SER B 1 237 ? 41.561  17.941  -6.003  1.00 39.63  ? 237 SER B CB    1 
ATOM   5012  O OG    . SER B 1 237 ? 42.844  17.865  -5.388  1.00 37.98  ? 237 SER B OG    1 
ATOM   5013  H H     . SER B 1 237 ? 43.423  18.515  -7.607  1.00 0.00   ? 237 SER B H     1 
ATOM   5014  H HG    . SER B 1 237 ? 43.048  18.708  -4.970  1.00 0.00   ? 237 SER B HG    1 
ATOM   5015  N N     . ALA B 1 238 ? 40.478  20.712  -5.867  1.00 34.30  ? 238 ALA B N     1 
ATOM   5016  C CA    . ALA B 1 238 ? 40.353  22.073  -5.362  1.00 28.42  ? 238 ALA B CA    1 
ATOM   5017  C C     . ALA B 1 238 ? 41.240  22.187  -4.126  1.00 23.11  ? 238 ALA B C     1 
ATOM   5018  O O     . ALA B 1 238 ? 41.459  21.155  -3.482  1.00 21.29  ? 238 ALA B O     1 
ATOM   5019  C CB    . ALA B 1 238 ? 38.913  22.339  -4.974  1.00 27.05  ? 238 ALA B CB    1 
ATOM   5020  H H     . ALA B 1 238 ? 39.921  20.027  -5.453  1.00 0.00   ? 238 ALA B H     1 
ATOM   5021  N N     . PRO B 1 239 ? 41.800  23.353  -3.780  1.00 18.79  ? 239 PRO B N     1 
ATOM   5022  C CA    . PRO B 1 239 ? 42.675  23.535  -2.633  1.00 19.15  ? 239 PRO B CA    1 
ATOM   5023  C C     . PRO B 1 239 ? 41.905  23.318  -1.338  1.00 21.26  ? 239 PRO B C     1 
ATOM   5024  O O     . PRO B 1 239 ? 40.680  23.455  -1.324  1.00 26.28  ? 239 PRO B O     1 
ATOM   5025  C CB    . PRO B 1 239 ? 43.175  24.938  -2.769  1.00 17.57  ? 239 PRO B CB    1 
ATOM   5026  C CG    . PRO B 1 239 ? 42.899  25.293  -4.209  1.00 14.44  ? 239 PRO B CG    1 
ATOM   5027  C CD    . PRO B 1 239 ? 41.572  24.633  -4.426  1.00 13.36  ? 239 PRO B CD    1 
ATOM   5028  N N     . TYR B 1 240 ? 42.564  22.993  -0.236  1.00 17.43  ? 240 TYR B N     1 
ATOM   5029  C CA    . TYR B 1 240 ? 41.865  22.883  1.025   1.00 14.53  ? 240 TYR B CA    1 
ATOM   5030  C C     . TYR B 1 240 ? 41.524  24.284  1.473   1.00 16.64  ? 240 TYR B C     1 
ATOM   5031  O O     . TYR B 1 240 ? 42.148  25.241  1.027   1.00 11.80  ? 240 TYR B O     1 
ATOM   5032  C CB    . TYR B 1 240 ? 42.734  22.257  2.103   1.00 12.68  ? 240 TYR B CB    1 
ATOM   5033  C CG    . TYR B 1 240 ? 42.783  20.733  2.093   1.00 11.83  ? 240 TYR B CG    1 
ATOM   5034  C CD1   . TYR B 1 240 ? 42.517  20.035  0.932   1.00 4.26   ? 240 TYR B CD1   1 
ATOM   5035  C CD2   . TYR B 1 240 ? 43.089  20.061  3.268   1.00 11.54  ? 240 TYR B CD2   1 
ATOM   5036  C CE1   . TYR B 1 240 ? 42.560  18.670  0.940   1.00 9.91   ? 240 TYR B CE1   1 
ATOM   5037  C CE2   . TYR B 1 240 ? 43.135  18.682  3.280   1.00 9.83   ? 240 TYR B CE2   1 
ATOM   5038  C CZ    . TYR B 1 240 ? 42.873  18.015  2.104   1.00 8.86   ? 240 TYR B CZ    1 
ATOM   5039  O OH    . TYR B 1 240 ? 42.909  16.647  2.055   1.00 16.66  ? 240 TYR B OH    1 
ATOM   5040  H H     . TYR B 1 240 ? 43.540  22.951  -0.263  1.00 0.00   ? 240 TYR B H     1 
ATOM   5041  H HH    . TYR B 1 240 ? 43.786  16.362  2.330   1.00 0.00   ? 240 TYR B HH    1 
ATOM   5042  N N     . GLY B 1 241 ? 40.517  24.435  2.315   1.00 18.55  ? 241 GLY B N     1 
ATOM   5043  C CA    . GLY B 1 241 ? 40.238  25.713  2.933   1.00 15.32  ? 241 GLY B CA    1 
ATOM   5044  C C     . GLY B 1 241 ? 41.216  25.890  4.086   1.00 12.12  ? 241 GLY B C     1 
ATOM   5045  O O     . GLY B 1 241 ? 41.756  24.905  4.615   1.00 9.52   ? 241 GLY B O     1 
ATOM   5046  H H     . GLY B 1 241 ? 39.979  23.653  2.533   1.00 0.00   ? 241 GLY B H     1 
ATOM   5047  N N     . ALA B 1 242 ? 41.450  27.132  4.482   1.00 10.85  ? 242 ALA B N     1 
ATOM   5048  C CA    . ALA B 1 242 ? 42.317  27.411  5.606   1.00 14.50  ? 242 ALA B CA    1 
ATOM   5049  C C     . ALA B 1 242 ? 41.473  27.964  6.743   1.00 14.02  ? 242 ALA B C     1 
ATOM   5050  O O     . ALA B 1 242 ? 40.565  28.757  6.500   1.00 14.35  ? 242 ALA B O     1 
ATOM   5051  C CB    . ALA B 1 242 ? 43.347  28.455  5.246   1.00 16.03  ? 242 ALA B CB    1 
ATOM   5052  H H     . ALA B 1 242 ? 40.976  27.892  4.086   1.00 0.00   ? 242 ALA B H     1 
ATOM   5053  N N     . ARG B 1 243 ? 41.733  27.542  7.978   1.00 15.21  ? 243 ARG B N     1 
ATOM   5054  C CA    . ARG B 1 243 ? 41.032  28.007  9.158   1.00 15.04  ? 243 ARG B CA    1 
ATOM   5055  C C     . ARG B 1 243 ? 42.030  27.831  10.287  1.00 16.58  ? 243 ARG B C     1 
ATOM   5056  O O     . ARG B 1 243 ? 42.709  26.798  10.375  1.00 14.62  ? 243 ARG B O     1 
ATOM   5057  C CB    . ARG B 1 243 ? 39.811  27.166  9.529   1.00 17.80  ? 243 ARG B CB    1 
ATOM   5058  C CG    . ARG B 1 243 ? 38.597  27.233  8.635   1.00 10.59  ? 243 ARG B CG    1 
ATOM   5059  C CD    . ARG B 1 243 ? 38.095  28.652  8.473   1.00 16.60  ? 243 ARG B CD    1 
ATOM   5060  N NE    . ARG B 1 243 ? 36.855  28.624  7.717   1.00 23.40  ? 243 ARG B NE    1 
ATOM   5061  C CZ    . ARG B 1 243 ? 36.807  28.373  6.397   1.00 24.39  ? 243 ARG B CZ    1 
ATOM   5062  N NH1   . ARG B 1 243 ? 37.894  28.196  5.653   1.00 25.50  ? 243 ARG B NH1   1 
ATOM   5063  N NH2   . ARG B 1 243 ? 35.634  28.320  5.774   1.00 27.08  ? 243 ARG B NH2   1 
ATOM   5064  H H     . ARG B 1 243 ? 42.476  26.912  8.124   1.00 0.00   ? 243 ARG B H     1 
ATOM   5065  H HE    . ARG B 1 243 ? 36.012  28.792  8.190   1.00 0.00   ? 243 ARG B HE    1 
ATOM   5066  H HH11  . ARG B 1 243 ? 38.800  28.234  6.068   1.00 0.00   ? 243 ARG B HH11  1 
ATOM   5067  H HH12  . ARG B 1 243 ? 37.803  28.016  4.674   1.00 0.00   ? 243 ARG B HH12  1 
ATOM   5068  H HH21  . ARG B 1 243 ? 34.787  28.467  6.284   1.00 0.00   ? 243 ARG B HH21  1 
ATOM   5069  H HH22  . ARG B 1 243 ? 35.603  28.138  4.791   1.00 0.00   ? 243 ARG B HH22  1 
ATOM   5070  N N     . TYR B 1 244 ? 42.151  28.816  11.172  1.00 15.33  ? 244 TYR B N     1 
ATOM   5071  C CA    . TYR B 1 244 ? 43.078  28.731  12.283  1.00 14.53  ? 244 TYR B CA    1 
ATOM   5072  C C     . TYR B 1 244 ? 42.584  29.718  13.339  1.00 15.38  ? 244 TYR B C     1 
ATOM   5073  O O     . TYR B 1 244 ? 42.770  30.940  13.221  1.00 11.97  ? 244 TYR B O     1 
ATOM   5074  C CB    . TYR B 1 244 ? 44.518  29.089  11.810  1.00 11.53  ? 244 TYR B CB    1 
ATOM   5075  C CG    . TYR B 1 244 ? 45.545  28.883  12.904  1.00 2.00   ? 244 TYR B CG    1 
ATOM   5076  C CD1   . TYR B 1 244 ? 45.826  27.596  13.295  1.00 5.66   ? 244 TYR B CD1   1 
ATOM   5077  C CD2   . TYR B 1 244 ? 46.111  29.963  13.551  1.00 7.56   ? 244 TYR B CD2   1 
ATOM   5078  C CE1   . TYR B 1 244 ? 46.654  27.386  14.364  1.00 5.74   ? 244 TYR B CE1   1 
ATOM   5079  C CE2   . TYR B 1 244 ? 46.935  29.761  14.633  1.00 5.38   ? 244 TYR B CE2   1 
ATOM   5080  C CZ    . TYR B 1 244 ? 47.186  28.466  15.030  1.00 8.38   ? 244 TYR B CZ    1 
ATOM   5081  O OH    . TYR B 1 244 ? 47.970  28.211  16.137  1.00 13.02  ? 244 TYR B OH    1 
ATOM   5082  H H     . TYR B 1 244 ? 41.587  29.612  11.061  1.00 0.00   ? 244 TYR B H     1 
ATOM   5083  H HH    . TYR B 1 244 ? 48.315  29.036  16.509  1.00 0.00   ? 244 TYR B HH    1 
ATOM   5084  N N     . VAL B 1 245 ? 41.900  29.172  14.359  1.00 13.53  ? 245 VAL B N     1 
ATOM   5085  C CA    . VAL B 1 245 ? 41.380  29.965  15.468  1.00 11.63  ? 245 VAL B CA    1 
ATOM   5086  C C     . VAL B 1 245 ? 42.549  30.457  16.312  1.00 14.56  ? 245 VAL B C     1 
ATOM   5087  O O     . VAL B 1 245 ? 42.607  31.611  16.734  1.00 18.31  ? 245 VAL B O     1 
ATOM   5088  C CB    . VAL B 1 245 ? 40.459  29.141  16.401  1.00 12.66  ? 245 VAL B CB    1 
ATOM   5089  C CG1   . VAL B 1 245 ? 39.830  30.100  17.404  1.00 9.01   ? 245 VAL B CG1   1 
ATOM   5090  C CG2   . VAL B 1 245 ? 39.361  28.423  15.635  1.00 5.42   ? 245 VAL B CG2   1 
ATOM   5091  H H     . VAL B 1 245 ? 41.674  28.229  14.288  1.00 0.00   ? 245 VAL B H     1 
ATOM   5092  N N     . GLY B 1 246 ? 43.520  29.578  16.518  1.00 13.61  ? 246 GLY B N     1 
ATOM   5093  C CA    . GLY B 1 246 ? 44.609  29.891  17.407  1.00 15.55  ? 246 GLY B CA    1 
ATOM   5094  C C     . GLY B 1 246 ? 44.142  29.529  18.805  1.00 16.98  ? 246 GLY B C     1 
ATOM   5095  O O     . GLY B 1 246 ? 44.333  30.251  19.774  1.00 18.42  ? 246 GLY B O     1 
ATOM   5096  H H     . GLY B 1 246 ? 43.513  28.711  16.071  1.00 0.00   ? 246 GLY B H     1 
ATOM   5097  N N     . SER B 1 247 ? 43.468  28.403  18.932  1.00 17.58  ? 247 SER B N     1 
ATOM   5098  C CA    . SER B 1 247 ? 42.992  27.927  20.203  1.00 13.71  ? 247 SER B CA    1 
ATOM   5099  C C     . SER B 1 247 ? 42.892  26.476  19.832  1.00 14.08  ? 247 SER B C     1 
ATOM   5100  O O     . SER B 1 247 ? 42.100  26.068  18.975  1.00 19.66  ? 247 SER B O     1 
ATOM   5101  C CB    . SER B 1 247 ? 41.647  28.529  20.526  1.00 13.07  ? 247 SER B CB    1 
ATOM   5102  O OG    . SER B 1 247 ? 41.153  27.929  21.711  1.00 21.76  ? 247 SER B OG    1 
ATOM   5103  H H     . SER B 1 247 ? 43.375  27.811  18.158  1.00 0.00   ? 247 SER B H     1 
ATOM   5104  H HG    . SER B 1 247 ? 40.461  28.530  22.051  1.00 0.00   ? 247 SER B HG    1 
ATOM   5105  N N     . MET B 1 248 ? 43.792  25.713  20.419  1.00 15.06  ? 248 MET B N     1 
ATOM   5106  C CA    . MET B 1 248 ? 43.910  24.301  20.111  1.00 20.03  ? 248 MET B CA    1 
ATOM   5107  C C     . MET B 1 248 ? 42.569  23.590  20.229  1.00 20.23  ? 248 MET B C     1 
ATOM   5108  O O     . MET B 1 248 ? 42.123  23.028  19.239  1.00 26.28  ? 248 MET B O     1 
ATOM   5109  C CB    . MET B 1 248 ? 44.921  23.666  21.050  1.00 15.50  ? 248 MET B CB    1 
ATOM   5110  C CG    . MET B 1 248 ? 45.156  22.238  20.704  1.00 20.09  ? 248 MET B CG    1 
ATOM   5111  S SD    . MET B 1 248 ? 45.796  21.443  22.178  1.00 28.26  ? 248 MET B SD    1 
ATOM   5112  C CE    . MET B 1 248 ? 46.562  20.082  21.348  1.00 26.53  ? 248 MET B CE    1 
ATOM   5113  H H     . MET B 1 248 ? 44.413  26.130  21.049  1.00 0.00   ? 248 MET B H     1 
ATOM   5114  N N     . VAL B 1 249 ? 41.854  23.679  21.351  1.00 17.53  ? 249 VAL B N     1 
ATOM   5115  C CA    . VAL B 1 249 ? 40.565  23.027  21.534  1.00 13.19  ? 249 VAL B CA    1 
ATOM   5116  C C     . VAL B 1 249 ? 39.574  23.363  20.446  1.00 13.21  ? 249 VAL B C     1 
ATOM   5117  O O     . VAL B 1 249 ? 38.820  22.505  19.991  1.00 16.47  ? 249 VAL B O     1 
ATOM   5118  C CB    . VAL B 1 249 ? 40.010  23.434  22.884  1.00 12.76  ? 249 VAL B CB    1 
ATOM   5119  C CG1   . VAL B 1 249 ? 38.652  22.856  23.164  1.00 13.44  ? 249 VAL B CG1   1 
ATOM   5120  C CG2   . VAL B 1 249 ? 40.865  22.805  23.932  1.00 12.08  ? 249 VAL B CG2   1 
ATOM   5121  H H     . VAL B 1 249 ? 42.220  24.219  22.078  1.00 0.00   ? 249 VAL B H     1 
ATOM   5122  N N     . ALA B 1 250 ? 39.600  24.602  19.992  1.00 15.26  ? 250 ALA B N     1 
ATOM   5123  C CA    . ALA B 1 250 ? 38.679  25.040  18.965  1.00 17.42  ? 250 ALA B CA    1 
ATOM   5124  C C     . ALA B 1 250 ? 39.002  24.397  17.636  1.00 16.41  ? 250 ALA B C     1 
ATOM   5125  O O     . ALA B 1 250 ? 38.126  23.841  16.961  1.00 22.43  ? 250 ALA B O     1 
ATOM   5126  C CB    . ALA B 1 250 ? 38.760  26.547  18.814  1.00 17.27  ? 250 ALA B CB    1 
ATOM   5127  H H     . ALA B 1 250 ? 40.280  25.224  20.321  1.00 0.00   ? 250 ALA B H     1 
ATOM   5128  N N     . ASP B 1 251 ? 40.291  24.385  17.324  1.00 15.05  ? 251 ASP B N     1 
ATOM   5129  C CA    . ASP B 1 251 ? 40.776  23.867  16.059  1.00 16.58  ? 251 ASP B CA    1 
ATOM   5130  C C     . ASP B 1 251 ? 40.712  22.349  15.990  1.00 13.06  ? 251 ASP B C     1 
ATOM   5131  O O     . ASP B 1 251 ? 40.359  21.789  14.955  1.00 15.91  ? 251 ASP B O     1 
ATOM   5132  C CB    . ASP B 1 251 ? 42.207  24.400  15.856  1.00 13.89  ? 251 ASP B CB    1 
ATOM   5133  C CG    . ASP B 1 251 ? 42.184  25.881  15.526  1.00 12.86  ? 251 ASP B CG    1 
ATOM   5134  O OD1   . ASP B 1 251 ? 41.470  26.243  14.602  1.00 14.48  ? 251 ASP B OD1   1 
ATOM   5135  O OD2   . ASP B 1 251 ? 42.858  26.676  16.172  1.00 15.26  ? 251 ASP B OD2   1 
ATOM   5136  H H     . ASP B 1 251 ? 40.946  24.703  17.983  1.00 0.00   ? 251 ASP B H     1 
ATOM   5137  N N     . VAL B 1 252 ? 40.956  21.641  17.086  1.00 11.01  ? 252 VAL B N     1 
ATOM   5138  C CA    . VAL B 1 252 ? 40.832  20.206  17.131  1.00 10.59  ? 252 VAL B CA    1 
ATOM   5139  C C     . VAL B 1 252 ? 39.346  19.853  17.103  1.00 13.01  ? 252 VAL B C     1 
ATOM   5140  O O     . VAL B 1 252 ? 38.978  18.923  16.381  1.00 15.11  ? 252 VAL B O     1 
ATOM   5141  C CB    . VAL B 1 252 ? 41.520  19.689  18.406  1.00 13.02  ? 252 VAL B CB    1 
ATOM   5142  C CG1   . VAL B 1 252 ? 41.316  18.181  18.606  1.00 4.78   ? 252 VAL B CG1   1 
ATOM   5143  C CG2   . VAL B 1 252 ? 43.017  19.950  18.255  1.00 10.75  ? 252 VAL B CG2   1 
ATOM   5144  H H     . VAL B 1 252 ? 41.215  22.120  17.895  1.00 0.00   ? 252 VAL B H     1 
ATOM   5145  N N     . HIS B 1 253 ? 38.416  20.529  17.786  1.00 11.61  ? 253 HIS B N     1 
ATOM   5146  C CA    . HIS B 1 253 ? 37.010  20.144  17.689  1.00 10.45  ? 253 HIS B CA    1 
ATOM   5147  C C     . HIS B 1 253 ? 36.531  20.332  16.255  1.00 7.71   ? 253 HIS B C     1 
ATOM   5148  O O     . HIS B 1 253 ? 35.888  19.419  15.739  1.00 10.38  ? 253 HIS B O     1 
ATOM   5149  C CB    . HIS B 1 253 ? 36.140  20.979  18.614  1.00 13.25  ? 253 HIS B CB    1 
ATOM   5150  C CG    . HIS B 1 253 ? 34.727  20.420  18.765  1.00 12.19  ? 253 HIS B CG    1 
ATOM   5151  N ND1   . HIS B 1 253 ? 34.468  19.244  19.319  1.00 13.08  ? 253 HIS B ND1   1 
ATOM   5152  C CD2   . HIS B 1 253 ? 33.554  20.961  18.326  1.00 10.86  ? 253 HIS B CD2   1 
ATOM   5153  C CE1   . HIS B 1 253 ? 33.186  19.029  19.214  1.00 11.35  ? 253 HIS B CE1   1 
ATOM   5154  N NE2   . HIS B 1 253 ? 32.649  20.056  18.605  1.00 11.58  ? 253 HIS B NE2   1 
ATOM   5155  H H     . HIS B 1 253 ? 38.682  21.287  18.353  1.00 0.00   ? 253 HIS B H     1 
ATOM   5156  H HD1   . HIS B 1 253 ? 35.116  18.640  19.727  1.00 0.00   ? 253 HIS B HD1   1 
ATOM   5157  H HE2   . HIS B 1 253 ? 31.710  20.101  18.328  1.00 0.00   ? 253 HIS B HE2   1 
ATOM   5158  N N     . ARG B 1 254 ? 36.806  21.436  15.561  1.00 5.78   ? 254 ARG B N     1 
ATOM   5159  C CA    . ARG B 1 254 ? 36.459  21.531  14.150  1.00 5.29   ? 254 ARG B CA    1 
ATOM   5160  C C     . ARG B 1 254 ? 37.123  20.408  13.365  1.00 9.37   ? 254 ARG B C     1 
ATOM   5161  O O     . ARG B 1 254 ? 36.513  19.917  12.421  1.00 14.60  ? 254 ARG B O     1 
ATOM   5162  C CB    . ARG B 1 254 ? 36.912  22.839  13.568  1.00 2.00   ? 254 ARG B CB    1 
ATOM   5163  C CG    . ARG B 1 254 ? 36.493  22.940  12.094  1.00 7.16   ? 254 ARG B CG    1 
ATOM   5164  C CD    . ARG B 1 254 ? 37.108  24.130  11.376  1.00 11.70  ? 254 ARG B CD    1 
ATOM   5165  N NE    . ARG B 1 254 ? 38.556  24.032  11.452  1.00 15.02  ? 254 ARG B NE    1 
ATOM   5166  C CZ    . ARG B 1 254 ? 39.269  24.788  12.293  1.00 13.98  ? 254 ARG B CZ    1 
ATOM   5167  N NH1   . ARG B 1 254 ? 38.713  25.756  13.006  1.00 14.23  ? 254 ARG B NH1   1 
ATOM   5168  N NH2   . ARG B 1 254 ? 40.570  24.590  12.402  1.00 18.03  ? 254 ARG B NH2   1 
ATOM   5169  H H     . ARG B 1 254 ? 37.235  22.204  16.004  1.00 0.00   ? 254 ARG B H     1 
ATOM   5170  H HE    . ARG B 1 254 ? 39.023  23.397  10.870  1.00 0.00   ? 254 ARG B HE    1 
ATOM   5171  H HH11  . ARG B 1 254 ? 37.733  25.938  12.931  1.00 0.00   ? 254 ARG B HH11  1 
ATOM   5172  H HH12  . ARG B 1 254 ? 39.275  26.294  13.635  1.00 0.00   ? 254 ARG B HH12  1 
ATOM   5173  H HH21  . ARG B 1 254 ? 41.012  23.880  11.853  1.00 0.00   ? 254 ARG B HH21  1 
ATOM   5174  H HH22  . ARG B 1 254 ? 41.114  25.149  13.021  1.00 0.00   ? 254 ARG B HH22  1 
ATOM   5175  N N     . THR B 1 255 ? 38.317  19.916  13.700  1.00 12.94  ? 255 THR B N     1 
ATOM   5176  C CA    . THR B 1 255 ? 38.866  18.810  12.940  1.00 18.16  ? 255 THR B CA    1 
ATOM   5177  C C     . THR B 1 255 ? 38.077  17.551  13.267  1.00 16.97  ? 255 THR B C     1 
ATOM   5178  O O     . THR B 1 255 ? 37.784  16.777  12.354  1.00 18.25  ? 255 THR B O     1 
ATOM   5179  C CB    . THR B 1 255 ? 40.349  18.577  13.268  1.00 21.81  ? 255 THR B CB    1 
ATOM   5180  O OG1   . THR B 1 255 ? 41.067  19.801  13.120  1.00 26.74  ? 255 THR B OG1   1 
ATOM   5181  C CG2   . THR B 1 255 ? 40.955  17.569  12.297  1.00 19.16  ? 255 THR B CG2   1 
ATOM   5182  H H     . THR B 1 255 ? 38.852  20.330  14.408  1.00 0.00   ? 255 THR B H     1 
ATOM   5183  H HG1   . THR B 1 255 ? 40.561  20.580  13.391  1.00 0.00   ? 255 THR B HG1   1 
ATOM   5184  N N     . LEU B 1 256 ? 37.645  17.365  14.519  1.00 12.44  ? 256 LEU B N     1 
ATOM   5185  C CA    . LEU B 1 256 ? 36.945  16.159  14.898  1.00 12.13  ? 256 LEU B CA    1 
ATOM   5186  C C     . LEU B 1 256 ? 35.618  16.029  14.181  1.00 15.22  ? 256 LEU B C     1 
ATOM   5187  O O     . LEU B 1 256 ? 35.263  14.922  13.778  1.00 16.96  ? 256 LEU B O     1 
ATOM   5188  C CB    . LEU B 1 256 ? 36.698  16.143  16.392  1.00 5.20   ? 256 LEU B CB    1 
ATOM   5189  C CG    . LEU B 1 256 ? 35.882  14.980  16.932  1.00 2.00   ? 256 LEU B CG    1 
ATOM   5190  C CD1   . LEU B 1 256 ? 36.510  13.643  16.630  1.00 2.00   ? 256 LEU B CD1   1 
ATOM   5191  C CD2   . LEU B 1 256 ? 35.756  15.198  18.408  1.00 4.09   ? 256 LEU B CD2   1 
ATOM   5192  H H     . LEU B 1 256 ? 37.790  18.066  15.183  1.00 0.00   ? 256 LEU B H     1 
ATOM   5193  N N     . VAL B 1 257 ? 34.945  17.184  14.068  1.00 15.58  ? 257 VAL B N     1 
ATOM   5194  C CA    . VAL B 1 257 ? 33.616  17.330  13.489  1.00 18.40  ? 257 VAL B CA    1 
ATOM   5195  C C     . VAL B 1 257 ? 33.642  17.449  11.974  1.00 17.23  ? 257 VAL B C     1 
ATOM   5196  O O     . VAL B 1 257 ? 33.016  16.646  11.300  1.00 16.97  ? 257 VAL B O     1 
ATOM   5197  C CB    . VAL B 1 257 ? 32.926  18.581  14.184  1.00 20.10  ? 257 VAL B CB    1 
ATOM   5198  C CG1   . VAL B 1 257 ? 31.726  19.121  13.440  1.00 20.44  ? 257 VAL B CG1   1 
ATOM   5199  C CG2   . VAL B 1 257 ? 32.362  18.117  15.527  1.00 18.98  ? 257 VAL B CG2   1 
ATOM   5200  H H     . VAL B 1 257 ? 35.396  17.986  14.396  1.00 0.00   ? 257 VAL B H     1 
ATOM   5201  N N     . TYR B 1 258 ? 34.351  18.415  11.407  1.00 21.05  ? 258 TYR B N     1 
ATOM   5202  C CA    . TYR B 1 258 ? 34.395  18.622  9.974   1.00 24.76  ? 258 TYR B CA    1 
ATOM   5203  C C     . TYR B 1 258 ? 35.507  17.802  9.293   1.00 23.35  ? 258 TYR B C     1 
ATOM   5204  O O     . TYR B 1 258 ? 35.523  17.670  8.062   1.00 23.37  ? 258 TYR B O     1 
ATOM   5205  C CB    . TYR B 1 258 ? 34.563  20.138  9.758   1.00 30.61  ? 258 TYR B CB    1 
ATOM   5206  C CG    . TYR B 1 258 ? 34.132  20.639  8.388   1.00 41.07  ? 258 TYR B CG    1 
ATOM   5207  C CD1   . TYR B 1 258 ? 34.970  20.525  7.293   1.00 45.39  ? 258 TYR B CD1   1 
ATOM   5208  C CD2   . TYR B 1 258 ? 32.887  21.208  8.229   1.00 45.04  ? 258 TYR B CD2   1 
ATOM   5209  C CE1   . TYR B 1 258 ? 34.576  20.956  6.039   1.00 50.69  ? 258 TYR B CE1   1 
ATOM   5210  C CE2   . TYR B 1 258 ? 32.488  21.650  6.974   1.00 51.46  ? 258 TYR B CE2   1 
ATOM   5211  C CZ    . TYR B 1 258 ? 33.333  21.527  5.883   1.00 51.14  ? 258 TYR B CZ    1 
ATOM   5212  O OH    . TYR B 1 258 ? 32.939  21.978  4.630   1.00 51.72  ? 258 TYR B OH    1 
ATOM   5213  H H     . TYR B 1 258 ? 34.893  18.997  11.975  1.00 0.00   ? 258 TYR B H     1 
ATOM   5214  H HH    . TYR B 1 258 ? 33.586  21.692  3.975   1.00 0.00   ? 258 TYR B HH    1 
ATOM   5215  N N     . GLY B 1 259 ? 36.460  17.208  10.001  1.00 19.84  ? 259 GLY B N     1 
ATOM   5216  C CA    . GLY B 1 259 ? 37.549  16.471  9.363   1.00 19.28  ? 259 GLY B CA    1 
ATOM   5217  C C     . GLY B 1 259 ? 38.657  17.437  8.940   1.00 18.06  ? 259 GLY B C     1 
ATOM   5218  O O     . GLY B 1 259 ? 38.445  18.661  8.962   1.00 22.97  ? 259 GLY B O     1 
ATOM   5219  H H     . GLY B 1 259 ? 36.467  17.315  10.974  1.00 0.00   ? 259 GLY B H     1 
ATOM   5220  N N     . GLY B 1 260 ? 39.853  16.965  8.571   1.00 13.45  ? 260 GLY B N     1 
ATOM   5221  C CA    . GLY B 1 260 ? 40.914  17.867  8.128   1.00 11.65  ? 260 GLY B CA    1 
ATOM   5222  C C     . GLY B 1 260 ? 42.222  17.515  8.799   1.00 9.92   ? 260 GLY B C     1 
ATOM   5223  O O     . GLY B 1 260 ? 42.443  16.357  9.158   1.00 8.56   ? 260 GLY B O     1 
ATOM   5224  H H     . GLY B 1 260 ? 40.097  16.032  8.760   1.00 0.00   ? 260 GLY B H     1 
ATOM   5225  N N     . ILE B 1 261 ? 43.105  18.480  8.982   1.00 13.86  ? 261 ILE B N     1 
ATOM   5226  C CA    . ILE B 1 261 ? 44.394  18.219  9.589   1.00 12.62  ? 261 ILE B CA    1 
ATOM   5227  C C     . ILE B 1 261 ? 44.789  19.527  10.267  1.00 13.44  ? 261 ILE B C     1 
ATOM   5228  O O     . ILE B 1 261 ? 44.578  20.648  9.785   1.00 15.18  ? 261 ILE B O     1 
ATOM   5229  C CB    . ILE B 1 261 ? 45.422  17.772  8.475   1.00 15.95  ? 261 ILE B CB    1 
ATOM   5230  C CG1   . ILE B 1 261 ? 46.640  17.192  9.165   1.00 16.54  ? 261 ILE B CG1   1 
ATOM   5231  C CG2   . ILE B 1 261 ? 45.824  18.941  7.544   1.00 13.99  ? 261 ILE B CG2   1 
ATOM   5232  C CD1   . ILE B 1 261 ? 47.784  16.863  8.192   1.00 10.89  ? 261 ILE B CD1   1 
ATOM   5233  H H     . ILE B 1 261 ? 42.895  19.406  8.724   1.00 0.00   ? 261 ILE B H     1 
ATOM   5234  N N     . PHE B 1 262 ? 45.379  19.346  11.425  1.00 18.11  ? 262 PHE B N     1 
ATOM   5235  C CA    . PHE B 1 262 ? 45.814  20.401  12.301  1.00 15.54  ? 262 PHE B CA    1 
ATOM   5236  C C     . PHE B 1 262 ? 47.279  20.113  12.525  1.00 13.07  ? 262 PHE B C     1 
ATOM   5237  O O     . PHE B 1 262 ? 47.630  18.966  12.805  1.00 14.08  ? 262 PHE B O     1 
ATOM   5238  C CB    . PHE B 1 262 ? 45.041  20.293  13.590  1.00 16.68  ? 262 PHE B CB    1 
ATOM   5239  C CG    . PHE B 1 262 ? 45.555  21.216  14.663  1.00 10.88  ? 262 PHE B CG    1 
ATOM   5240  C CD1   . PHE B 1 262 ? 45.375  22.576  14.529  1.00 6.70   ? 262 PHE B CD1   1 
ATOM   5241  C CD2   . PHE B 1 262 ? 46.230  20.669  15.727  1.00 10.51  ? 262 PHE B CD2   1 
ATOM   5242  C CE1   . PHE B 1 262 ? 45.895  23.405  15.492  1.00 13.93  ? 262 PHE B CE1   1 
ATOM   5243  C CE2   . PHE B 1 262 ? 46.747  21.508  16.683  1.00 10.55  ? 262 PHE B CE2   1 
ATOM   5244  C CZ    . PHE B 1 262 ? 46.578  22.875  16.566  1.00 14.10  ? 262 PHE B CZ    1 
ATOM   5245  H H     . PHE B 1 262 ? 45.597  18.435  11.710  1.00 0.00   ? 262 PHE B H     1 
ATOM   5246  N N     . LEU B 1 263 ? 48.122  21.125  12.436  1.00 10.65  ? 263 LEU B N     1 
ATOM   5247  C CA    . LEU B 1 263 ? 49.538  20.945  12.581  1.00 10.12  ? 263 LEU B CA    1 
ATOM   5248  C C     . LEU B 1 263 ? 50.126  21.981  13.528  1.00 13.67  ? 263 LEU B C     1 
ATOM   5249  O O     . LEU B 1 263 ? 49.953  23.175  13.272  1.00 10.21  ? 263 LEU B O     1 
ATOM   5250  C CB    . LEU B 1 263 ? 50.253  21.125  11.266  1.00 8.35   ? 263 LEU B CB    1 
ATOM   5251  C CG    . LEU B 1 263 ? 49.979  20.440  9.943   1.00 4.21   ? 263 LEU B CG    1 
ATOM   5252  C CD1   . LEU B 1 263 ? 48.959  21.189  9.135   1.00 2.97   ? 263 LEU B CD1   1 
ATOM   5253  C CD2   . LEU B 1 263 ? 51.272  20.488  9.114   1.00 10.69  ? 263 LEU B CD2   1 
ATOM   5254  H H     . LEU B 1 263 ? 47.789  22.038  12.286  1.00 0.00   ? 263 LEU B H     1 
ATOM   5255  N N     . TYR B 1 264 ? 50.750  21.652  14.663  1.00 18.58  ? 264 TYR B N     1 
ATOM   5256  C CA    . TYR B 1 264 ? 51.574  22.644  15.332  1.00 22.35  ? 264 TYR B CA    1 
ATOM   5257  C C     . TYR B 1 264 ? 52.926  21.956  15.291  1.00 25.29  ? 264 TYR B C     1 
ATOM   5258  O O     . TYR B 1 264 ? 53.293  21.200  16.203  1.00 24.97  ? 264 TYR B O     1 
ATOM   5259  C CB    . TYR B 1 264 ? 51.256  22.911  16.788  1.00 20.98  ? 264 TYR B CB    1 
ATOM   5260  C CG    . TYR B 1 264 ? 51.709  24.325  17.178  1.00 23.12  ? 264 TYR B CG    1 
ATOM   5261  C CD1   . TYR B 1 264 ? 53.041  24.713  17.151  1.00 26.54  ? 264 TYR B CD1   1 
ATOM   5262  C CD2   . TYR B 1 264 ? 50.747  25.267  17.478  1.00 27.00  ? 264 TYR B CD2   1 
ATOM   5263  C CE1   . TYR B 1 264 ? 53.404  26.028  17.349  1.00 25.58  ? 264 TYR B CE1   1 
ATOM   5264  C CE2   . TYR B 1 264 ? 51.097  26.583  17.703  1.00 29.43  ? 264 TYR B CE2   1 
ATOM   5265  C CZ    . TYR B 1 264 ? 52.424  26.964  17.620  1.00 33.20  ? 264 TYR B CZ    1 
ATOM   5266  O OH    . TYR B 1 264 ? 52.753  28.299  17.838  1.00 32.40  ? 264 TYR B OH    1 
ATOM   5267  H H     . TYR B 1 264 ? 50.675  20.750  15.030  1.00 0.00   ? 264 TYR B H     1 
ATOM   5268  H HH    . TYR B 1 264 ? 51.965  28.710  18.222  1.00 0.00   ? 264 TYR B HH    1 
ATOM   5269  N N     . PRO B 1 265 ? 53.656  22.147  14.185  1.00 31.11  ? 265 PRO B N     1 
ATOM   5270  C CA    . PRO B 1 265 ? 54.912  21.481  13.914  1.00 37.80  ? 265 PRO B CA    1 
ATOM   5271  C C     . PRO B 1 265 ? 56.038  22.154  14.694  1.00 44.03  ? 265 PRO B C     1 
ATOM   5272  O O     . PRO B 1 265 ? 55.849  23.154  15.392  1.00 45.76  ? 265 PRO B O     1 
ATOM   5273  C CB    . PRO B 1 265 ? 55.025  21.589  12.411  1.00 32.84  ? 265 PRO B CB    1 
ATOM   5274  C CG    . PRO B 1 265 ? 54.587  23.013  12.190  1.00 35.26  ? 265 PRO B CG    1 
ATOM   5275  C CD    . PRO B 1 265 ? 53.409  23.149  13.145  1.00 32.72  ? 265 PRO B CD    1 
ATOM   5276  N N     . ALA B 1 266 ? 57.232  21.591  14.598  1.00 53.73  ? 266 ALA B N     1 
ATOM   5277  C CA    . ALA B 1 266 ? 58.380  22.227  15.205  1.00 59.96  ? 266 ALA B CA    1 
ATOM   5278  C C     . ALA B 1 266 ? 58.914  23.137  14.112  1.00 64.42  ? 266 ALA B C     1 
ATOM   5279  O O     . ALA B 1 266 ? 59.322  22.713  13.023  1.00 65.90  ? 266 ALA B O     1 
ATOM   5280  C CB    . ALA B 1 266 ? 59.443  21.208  15.567  1.00 58.62  ? 266 ALA B CB    1 
ATOM   5281  H H     . ALA B 1 266 ? 57.373  20.813  14.023  1.00 0.00   ? 266 ALA B H     1 
ATOM   5282  N N     . ASN B 1 267 ? 58.689  24.409  14.341  1.00 69.89  ? 267 ASN B N     1 
ATOM   5283  C CA    . ASN B 1 267 ? 59.273  25.424  13.501  1.00 75.97  ? 267 ASN B CA    1 
ATOM   5284  C C     . ASN B 1 267 ? 60.479  25.848  14.320  1.00 79.68  ? 267 ASN B C     1 
ATOM   5285  O O     . ASN B 1 267 ? 60.430  25.846  15.554  1.00 80.29  ? 267 ASN B O     1 
ATOM   5286  C CB    . ASN B 1 267 ? 58.310  26.591  13.298  1.00 76.87  ? 267 ASN B CB    1 
ATOM   5287  C CG    . ASN B 1 267 ? 57.783  27.166  14.594  1.00 79.18  ? 267 ASN B CG    1 
ATOM   5288  O OD1   . ASN B 1 267 ? 56.924  26.581  15.248  1.00 79.52  ? 267 ASN B OD1   1 
ATOM   5289  N ND2   . ASN B 1 267 ? 58.247  28.338  14.986  1.00 80.37  ? 267 ASN B ND2   1 
ATOM   5290  H H     . ASN B 1 267 ? 58.124  24.683  15.101  1.00 0.00   ? 267 ASN B H     1 
ATOM   5291  H HD21  . ASN B 1 267 ? 58.018  28.556  15.919  1.00 0.00   ? 267 ASN B HD21  1 
ATOM   5292  H HD22  . ASN B 1 267 ? 58.815  28.874  14.407  1.00 0.00   ? 267 ASN B HD22  1 
ATOM   5293  N N     . LYS B 1 268 ? 61.586  26.191  13.652  1.00 83.84  ? 268 LYS B N     1 
ATOM   5294  C CA    . LYS B 1 268 ? 62.859  26.554  14.283  1.00 86.61  ? 268 LYS B CA    1 
ATOM   5295  C C     . LYS B 1 268 ? 62.725  27.414  15.550  1.00 86.83  ? 268 LYS B C     1 
ATOM   5296  O O     . LYS B 1 268 ? 63.421  27.216  16.546  1.00 86.62  ? 268 LYS B O     1 
ATOM   5297  C CB    . LYS B 1 268 ? 63.694  27.255  13.213  1.00 89.21  ? 268 LYS B CB    1 
ATOM   5298  C CG    . LYS B 1 268 ? 65.175  27.441  13.502  1.00 93.30  ? 268 LYS B CG    1 
ATOM   5299  C CD    . LYS B 1 268 ? 65.708  28.431  12.472  1.00 96.00  ? 268 LYS B CD    1 
ATOM   5300  C CE    . LYS B 1 268 ? 67.118  28.869  12.839  1.00 98.45  ? 268 LYS B CE    1 
ATOM   5301  N NZ    . LYS B 1 268 ? 67.467  30.093  12.139  1.00 96.43  ? 268 LYS B NZ    1 
ATOM   5302  H H     . LYS B 1 268 ? 61.543  26.142  12.670  1.00 0.00   ? 268 LYS B H     1 
ATOM   5303  H HZ1   . LYS B 1 268 ? 67.418  29.932  11.115  1.00 0.00   ? 268 LYS B HZ1   1 
ATOM   5304  H HZ2   . LYS B 1 268 ? 66.798  30.842  12.407  1.00 0.00   ? 268 LYS B HZ2   1 
ATOM   5305  H HZ3   . LYS B 1 268 ? 68.431  30.380  12.405  1.00 0.00   ? 268 LYS B HZ3   1 
ATOM   5306  N N     . LYS B 1 269 ? 61.792  28.363  15.560  1.00 87.38  ? 269 LYS B N     1 
ATOM   5307  C CA    . LYS B 1 269 ? 61.497  29.121  16.759  1.00 87.11  ? 269 LYS B CA    1 
ATOM   5308  C C     . LYS B 1 269 ? 60.602  28.189  17.582  1.00 84.80  ? 269 LYS B C     1 
ATOM   5309  O O     . LYS B 1 269 ? 59.406  28.046  17.318  1.00 84.78  ? 269 LYS B O     1 
ATOM   5310  C CB    . LYS B 1 269 ? 60.779  30.410  16.359  1.00 90.08  ? 269 LYS B CB    1 
ATOM   5311  C CG    . LYS B 1 269 ? 60.236  31.264  17.504  1.00 94.71  ? 269 LYS B CG    1 
ATOM   5312  C CD    . LYS B 1 269 ? 61.310  31.865  18.402  1.00 99.29  ? 269 LYS B CD    1 
ATOM   5313  C CE    . LYS B 1 269 ? 62.090  32.964  17.686  1.00 102.21 ? 269 LYS B CE    1 
ATOM   5314  N NZ    . LYS B 1 269 ? 62.953  33.652  18.626  1.00 105.57 ? 269 LYS B NZ    1 
ATOM   5315  H H     . LYS B 1 269 ? 61.239  28.483  14.769  1.00 0.00   ? 269 LYS B H     1 
ATOM   5316  H HZ1   . LYS B 1 269 ? 63.609  32.971  19.059  1.00 0.00   ? 269 LYS B HZ1   1 
ATOM   5317  H HZ2   . LYS B 1 269 ? 63.492  34.393  18.135  1.00 0.00   ? 269 LYS B HZ2   1 
ATOM   5318  H HZ3   . LYS B 1 269 ? 62.371  34.086  19.371  1.00 0.00   ? 269 LYS B HZ3   1 
ATOM   5319  N N     . SER B 1 270 ? 61.239  27.603  18.592  1.00 80.06  ? 270 SER B N     1 
ATOM   5320  C CA    . SER B 1 270 ? 60.709  26.598  19.510  1.00 76.06  ? 270 SER B CA    1 
ATOM   5321  C C     . SER B 1 270 ? 60.694  25.228  18.817  1.00 73.31  ? 270 SER B C     1 
ATOM   5322  O O     . SER B 1 270 ? 59.681  24.528  18.742  1.00 74.95  ? 270 SER B O     1 
ATOM   5323  C CB    . SER B 1 270 ? 59.278  26.947  20.009  1.00 74.12  ? 270 SER B CB    1 
ATOM   5324  O OG    . SER B 1 270 ? 59.189  28.279  20.499  1.00 71.68  ? 270 SER B OG    1 
ATOM   5325  H H     . SER B 1 270 ? 62.187  27.830  18.676  1.00 0.00   ? 270 SER B H     1 
ATOM   5326  H HG    . SER B 1 270 ? 58.877  28.768  19.731  1.00 0.00   ? 270 SER B HG    1 
ATOM   5327  N N     . PRO B 1 271 ? 61.855  24.695  18.404  1.00 71.26  ? 271 PRO B N     1 
ATOM   5328  C CA    . PRO B 1 271 ? 61.991  23.478  17.599  1.00 69.02  ? 271 PRO B CA    1 
ATOM   5329  C C     . PRO B 1 271 ? 61.724  22.151  18.322  1.00 66.51  ? 271 PRO B C     1 
ATOM   5330  O O     . PRO B 1 271 ? 62.297  21.101  18.018  1.00 65.74  ? 271 PRO B O     1 
ATOM   5331  C CB    . PRO B 1 271 ? 63.390  23.589  17.062  1.00 70.21  ? 271 PRO B CB    1 
ATOM   5332  C CG    . PRO B 1 271 ? 64.123  24.078  18.289  1.00 73.13  ? 271 PRO B CG    1 
ATOM   5333  C CD    . PRO B 1 271 ? 63.175  25.131  18.853  1.00 71.81  ? 271 PRO B CD    1 
ATOM   5334  N N     . ASN B 1 272 ? 60.902  22.187  19.362  1.00 63.46  ? 272 ASN B N     1 
ATOM   5335  C CA    . ASN B 1 272 ? 60.479  21.013  20.093  1.00 58.96  ? 272 ASN B CA    1 
ATOM   5336  C C     . ASN B 1 272 ? 58.970  20.959  20.014  1.00 54.87  ? 272 ASN B C     1 
ATOM   5337  O O     . ASN B 1 272 ? 58.339  20.030  20.516  1.00 54.16  ? 272 ASN B O     1 
ATOM   5338  C CB    . ASN B 1 272 ? 60.901  21.115  21.548  1.00 63.64  ? 272 ASN B CB    1 
ATOM   5339  C CG    . ASN B 1 272 ? 62.091  20.233  21.909  1.00 69.93  ? 272 ASN B CG    1 
ATOM   5340  O OD1   . ASN B 1 272 ? 62.233  19.806  23.060  1.00 74.32  ? 272 ASN B OD1   1 
ATOM   5341  N ND2   . ASN B 1 272 ? 63.025  19.916  21.014  1.00 71.82  ? 272 ASN B ND2   1 
ATOM   5342  H H     . ASN B 1 272 ? 60.502  23.033  19.644  1.00 0.00   ? 272 ASN B H     1 
ATOM   5343  H HD21  . ASN B 1 272 ? 63.781  19.389  21.340  1.00 0.00   ? 272 ASN B HD21  1 
ATOM   5344  H HD22  . ASN B 1 272 ? 62.937  20.216  20.081  1.00 0.00   ? 272 ASN B HD22  1 
ATOM   5345  N N     . GLY B 1 273 ? 58.375  21.920  19.316  1.00 47.87  ? 273 GLY B N     1 
ATOM   5346  C CA    . GLY B 1 273 ? 56.951  22.046  19.310  1.00 43.36  ? 273 GLY B CA    1 
ATOM   5347  C C     . GLY B 1 273 ? 56.653  23.042  20.408  1.00 40.35  ? 273 GLY B C     1 
ATOM   5348  O O     . GLY B 1 273 ? 57.549  23.425  21.166  1.00 38.17  ? 273 GLY B O     1 
ATOM   5349  H H     . GLY B 1 273 ? 58.882  22.647  18.902  1.00 0.00   ? 273 GLY B H     1 
ATOM   5350  N N     . LYS B 1 274 ? 55.422  23.532  20.436  1.00 39.14  ? 274 LYS B N     1 
ATOM   5351  C CA    . LYS B 1 274 ? 54.982  24.472  21.444  1.00 36.01  ? 274 LYS B CA    1 
ATOM   5352  C C     . LYS B 1 274 ? 54.062  23.780  22.436  1.00 29.42  ? 274 LYS B C     1 
ATOM   5353  O O     . LYS B 1 274 ? 54.186  23.909  23.652  1.00 29.72  ? 274 LYS B O     1 
ATOM   5354  C CB    . LYS B 1 274 ? 54.257  25.635  20.751  1.00 39.77  ? 274 LYS B CB    1 
ATOM   5355  C CG    . LYS B 1 274 ? 53.583  26.648  21.685  1.00 48.79  ? 274 LYS B CG    1 
ATOM   5356  C CD    . LYS B 1 274 ? 53.023  27.850  20.939  1.00 51.21  ? 274 LYS B CD    1 
ATOM   5357  C CE    . LYS B 1 274 ? 52.355  28.873  21.859  1.00 57.79  ? 274 LYS B CE    1 
ATOM   5358  N NZ    . LYS B 1 274 ? 52.091  30.109  21.131  1.00 60.53  ? 274 LYS B NZ    1 
ATOM   5359  H H     . LYS B 1 274 ? 54.812  23.244  19.730  1.00 0.00   ? 274 LYS B H     1 
ATOM   5360  H HZ1   . LYS B 1 274 ? 51.477  29.893  20.319  1.00 0.00   ? 274 LYS B HZ1   1 
ATOM   5361  H HZ2   . LYS B 1 274 ? 51.620  30.795  21.755  1.00 0.00   ? 274 LYS B HZ2   1 
ATOM   5362  H HZ3   . LYS B 1 274 ? 52.990  30.503  20.787  1.00 0.00   ? 274 LYS B HZ3   1 
ATOM   5363  N N     . LEU B 1 275 ? 53.149  22.997  21.880  1.00 21.17  ? 275 LEU B N     1 
ATOM   5364  C CA    . LEU B 1 275 ? 52.111  22.398  22.668  1.00 17.02  ? 275 LEU B CA    1 
ATOM   5365  C C     . LEU B 1 275 ? 52.668  21.356  23.613  1.00 14.14  ? 275 LEU B C     1 
ATOM   5366  O O     . LEU B 1 275 ? 53.648  20.691  23.293  1.00 21.13  ? 275 LEU B O     1 
ATOM   5367  C CB    . LEU B 1 275 ? 51.100  21.843  21.683  1.00 15.50  ? 275 LEU B CB    1 
ATOM   5368  C CG    . LEU B 1 275 ? 50.506  22.896  20.747  1.00 7.66   ? 275 LEU B CG    1 
ATOM   5369  C CD1   . LEU B 1 275 ? 49.592  22.204  19.785  1.00 10.04  ? 275 LEU B CD1   1 
ATOM   5370  C CD2   . LEU B 1 275 ? 49.729  23.959  21.527  1.00 3.23   ? 275 LEU B CD2   1 
ATOM   5371  H H     . LEU B 1 275 ? 53.285  22.676  20.971  1.00 0.00   ? 275 LEU B H     1 
ATOM   5372  N N     . ARG B 1 276 ? 52.096  21.219  24.799  1.00 11.25  ? 276 ARG B N     1 
ATOM   5373  C CA    . ARG B 1 276 ? 52.646  20.325  25.783  1.00 11.59  ? 276 ARG B CA    1 
ATOM   5374  C C     . ARG B 1 276 ? 52.130  18.928  25.604  1.00 15.28  ? 276 ARG B C     1 
ATOM   5375  O O     . ARG B 1 276 ? 50.954  18.692  25.320  1.00 23.79  ? 276 ARG B O     1 
ATOM   5376  C CB    . ARG B 1 276 ? 52.316  20.773  27.181  1.00 9.39   ? 276 ARG B CB    1 
ATOM   5377  C CG    . ARG B 1 276 ? 53.108  21.994  27.648  1.00 17.83  ? 276 ARG B CG    1 
ATOM   5378  C CD    . ARG B 1 276 ? 52.549  23.266  27.055  1.00 21.69  ? 276 ARG B CD    1 
ATOM   5379  N NE    . ARG B 1 276 ? 52.512  24.330  28.036  1.00 34.00  ? 276 ARG B NE    1 
ATOM   5380  C CZ    . ARG B 1 276 ? 51.457  25.144  28.173  1.00 34.52  ? 276 ARG B CZ    1 
ATOM   5381  N NH1   . ARG B 1 276 ? 50.329  24.990  27.479  1.00 40.13  ? 276 ARG B NH1   1 
ATOM   5382  N NH2   . ARG B 1 276 ? 51.522  26.133  29.054  1.00 36.06  ? 276 ARG B NH2   1 
ATOM   5383  H H     . ARG B 1 276 ? 51.265  21.674  24.984  1.00 0.00   ? 276 ARG B H     1 
ATOM   5384  H HE    . ARG B 1 276 ? 53.281  24.453  28.631  1.00 0.00   ? 276 ARG B HE    1 
ATOM   5385  H HH11  . ARG B 1 276 ? 50.237  24.237  26.829  1.00 0.00   ? 276 ARG B HH11  1 
ATOM   5386  H HH12  . ARG B 1 276 ? 49.565  25.619  27.623  1.00 0.00   ? 276 ARG B HH12  1 
ATOM   5387  H HH21  . ARG B 1 276 ? 52.346  26.253  29.607  1.00 0.00   ? 276 ARG B HH21  1 
ATOM   5388  H HH22  . ARG B 1 276 ? 50.745  26.751  29.172  1.00 0.00   ? 276 ARG B HH22  1 
ATOM   5389  N N     . LEU B 1 277 ? 52.980  17.969  25.863  1.00 16.32  ? 277 LEU B N     1 
ATOM   5390  C CA    . LEU B 1 277 ? 52.655  16.576  25.689  1.00 15.46  ? 277 LEU B CA    1 
ATOM   5391  C C     . LEU B 1 277 ? 51.640  16.056  26.698  1.00 17.06  ? 277 LEU B C     1 
ATOM   5392  O O     . LEU B 1 277 ? 50.612  15.488  26.289  1.00 19.16  ? 277 LEU B O     1 
ATOM   5393  C CB    . LEU B 1 277 ? 53.946  15.802  25.789  1.00 17.13  ? 277 LEU B CB    1 
ATOM   5394  C CG    . LEU B 1 277 ? 54.004  14.335  25.508  1.00 16.37  ? 277 LEU B CG    1 
ATOM   5395  C CD1   . LEU B 1 277 ? 53.815  14.040  24.038  1.00 12.31  ? 277 LEU B CD1   1 
ATOM   5396  C CD2   . LEU B 1 277 ? 55.360  13.868  25.966  1.00 22.47  ? 277 LEU B CD2   1 
ATOM   5397  H H     . LEU B 1 277 ? 53.883  18.229  26.152  1.00 0.00   ? 277 LEU B H     1 
ATOM   5398  N N     . LEU B 1 278 ? 51.843  16.286  27.999  1.00 13.12  ? 278 LEU B N     1 
ATOM   5399  C CA    . LEU B 1 278 ? 50.968  15.606  28.936  1.00 13.95  ? 278 LEU B CA    1 
ATOM   5400  C C     . LEU B 1 278 ? 49.537  16.107  28.983  1.00 13.43  ? 278 LEU B C     1 
ATOM   5401  O O     . LEU B 1 278 ? 48.618  15.309  29.129  1.00 12.68  ? 278 LEU B O     1 
ATOM   5402  C CB    . LEU B 1 278 ? 51.526  15.672  30.352  1.00 11.77  ? 278 LEU B CB    1 
ATOM   5403  C CG    . LEU B 1 278 ? 52.712  14.830  30.766  1.00 12.12  ? 278 LEU B CG    1 
ATOM   5404  C CD1   . LEU B 1 278 ? 52.789  15.004  32.267  1.00 13.01  ? 278 LEU B CD1   1 
ATOM   5405  C CD2   . LEU B 1 278 ? 52.568  13.344  30.466  1.00 7.16   ? 278 LEU B CD2   1 
ATOM   5406  H H     . LEU B 1 278 ? 52.596  16.829  28.309  1.00 0.00   ? 278 LEU B H     1 
ATOM   5407  N N     . TYR B 1 279 ? 49.329  17.418  28.862  1.00 9.59   ? 279 TYR B N     1 
ATOM   5408  C CA    . TYR B 1 279 ? 48.002  17.975  28.994  1.00 8.63   ? 279 TYR B CA    1 
ATOM   5409  C C     . TYR B 1 279 ? 47.451  18.700  27.787  1.00 8.77   ? 279 TYR B C     1 
ATOM   5410  O O     . TYR B 1 279 ? 46.439  19.375  27.922  1.00 5.38   ? 279 TYR B O     1 
ATOM   5411  C CB    . TYR B 1 279 ? 47.977  18.908  30.219  1.00 3.66   ? 279 TYR B CB    1 
ATOM   5412  C CG    . TYR B 1 279 ? 49.168  19.829  30.390  1.00 8.20   ? 279 TYR B CG    1 
ATOM   5413  C CD1   . TYR B 1 279 ? 49.279  20.985  29.639  1.00 11.67  ? 279 TYR B CD1   1 
ATOM   5414  C CD2   . TYR B 1 279 ? 50.129  19.510  31.327  1.00 15.87  ? 279 TYR B CD2   1 
ATOM   5415  C CE1   . TYR B 1 279 ? 50.351  21.837  29.839  1.00 14.86  ? 279 TYR B CE1   1 
ATOM   5416  C CE2   . TYR B 1 279 ? 51.217  20.351  31.519  1.00 18.49  ? 279 TYR B CE2   1 
ATOM   5417  C CZ    . TYR B 1 279 ? 51.313  21.511  30.778  1.00 13.75  ? 279 TYR B CZ    1 
ATOM   5418  O OH    . TYR B 1 279 ? 52.398  22.337  30.977  1.00 9.27   ? 279 TYR B OH    1 
ATOM   5419  H H     . TYR B 1 279 ? 50.086  18.012  28.692  1.00 0.00   ? 279 TYR B H     1 
ATOM   5420  H HH    . TYR B 1 279 ? 52.197  23.248  30.698  1.00 0.00   ? 279 TYR B HH    1 
ATOM   5421  N N     . GLU B 1 280 ? 48.102  18.657  26.624  1.00 9.85   ? 280 GLU B N     1 
ATOM   5422  C CA    . GLU B 1 280 ? 47.543  19.288  25.447  1.00 11.35  ? 280 GLU B CA    1 
ATOM   5423  C C     . GLU B 1 280 ? 47.529  18.278  24.324  1.00 11.19  ? 280 GLU B C     1 
ATOM   5424  O O     . GLU B 1 280 ? 46.482  17.869  23.841  1.00 12.58  ? 280 GLU B O     1 
ATOM   5425  C CB    . GLU B 1 280 ? 48.360  20.497  25.029  1.00 5.98   ? 280 GLU B CB    1 
ATOM   5426  C CG    . GLU B 1 280 ? 47.758  21.768  25.577  1.00 11.76  ? 280 GLU B CG    1 
ATOM   5427  C CD    . GLU B 1 280 ? 48.580  23.039  25.353  1.00 17.34  ? 280 GLU B CD    1 
ATOM   5428  O OE1   . GLU B 1 280 ? 49.796  22.966  25.214  1.00 13.14  ? 280 GLU B OE1   1 
ATOM   5429  O OE2   . GLU B 1 280 ? 48.011  24.134  25.328  1.00 16.36  ? 280 GLU B OE2   1 
ATOM   5430  H H     . GLU B 1 280 ? 48.933  18.150  26.544  1.00 0.00   ? 280 GLU B H     1 
ATOM   5431  N N     . CYS B 1 281 ? 48.697  17.805  23.924  1.00 16.64  ? 281 CYS B N     1 
ATOM   5432  C CA    . CYS B 1 281 ? 48.854  16.862  22.834  1.00 17.28  ? 281 CYS B CA    1 
ATOM   5433  C C     . CYS B 1 281 ? 48.278  15.490  23.114  1.00 15.25  ? 281 CYS B C     1 
ATOM   5434  O O     . CYS B 1 281 ? 47.506  14.959  22.307  1.00 14.72  ? 281 CYS B O     1 
ATOM   5435  C CB    . CYS B 1 281 ? 50.349  16.727  22.500  1.00 19.71  ? 281 CYS B CB    1 
ATOM   5436  S SG    . CYS B 1 281 ? 51.152  18.271  21.992  1.00 21.47  ? 281 CYS B SG    1 
ATOM   5437  H H     . CYS B 1 281 ? 49.504  18.174  24.321  1.00 0.00   ? 281 CYS B H     1 
ATOM   5438  N N     . ASN B 1 282 ? 48.590  14.854  24.244  1.00 14.92  ? 282 ASN B N     1 
ATOM   5439  C CA    . ASN B 1 282 ? 48.066  13.513  24.432  1.00 14.56  ? 282 ASN B CA    1 
ATOM   5440  C C     . ASN B 1 282 ? 46.569  13.400  24.553  1.00 16.75  ? 282 ASN B C     1 
ATOM   5441  O O     . ASN B 1 282 ? 46.086  12.461  23.920  1.00 18.39  ? 282 ASN B O     1 
ATOM   5442  C CB    . ASN B 1 282 ? 48.684  12.824  25.646  1.00 16.04  ? 282 ASN B CB    1 
ATOM   5443  C CG    . ASN B 1 282 ? 49.952  12.060  25.313  1.00 18.21  ? 282 ASN B CG    1 
ATOM   5444  O OD1   . ASN B 1 282 ? 50.670  11.651  26.216  1.00 24.70  ? 282 ASN B OD1   1 
ATOM   5445  N ND2   . ASN B 1 282 ? 50.345  11.788  24.069  1.00 17.45  ? 282 ASN B ND2   1 
ATOM   5446  H H     . ASN B 1 282 ? 49.162  15.256  24.933  1.00 0.00   ? 282 ASN B H     1 
ATOM   5447  H HD21  . ASN B 1 282 ? 51.234  11.374  23.974  1.00 0.00   ? 282 ASN B HD21  1 
ATOM   5448  H HD22  . ASN B 1 282 ? 49.781  12.029  23.314  1.00 0.00   ? 282 ASN B HD22  1 
ATOM   5449  N N     . PRO B 1 283 ? 45.767  14.248  25.232  1.00 14.54  ? 283 PRO B N     1 
ATOM   5450  C CA    . PRO B 1 283 ? 44.307  14.205  25.194  1.00 12.95  ? 283 PRO B CA    1 
ATOM   5451  C C     . PRO B 1 283 ? 43.763  14.290  23.784  1.00 12.13  ? 283 PRO B C     1 
ATOM   5452  O O     . PRO B 1 283 ? 43.040  13.392  23.343  1.00 16.18  ? 283 PRO B O     1 
ATOM   5453  C CB    . PRO B 1 283 ? 43.882  15.352  26.065  1.00 9.25   ? 283 PRO B CB    1 
ATOM   5454  C CG    . PRO B 1 283 ? 44.912  15.258  27.138  1.00 14.06  ? 283 PRO B CG    1 
ATOM   5455  C CD    . PRO B 1 283 ? 46.184  15.120  26.320  1.00 11.95  ? 283 PRO B CD    1 
ATOM   5456  N N     . MET B 1 284 ? 44.135  15.319  23.035  1.00 10.94  ? 284 MET B N     1 
ATOM   5457  C CA    . MET B 1 284 ? 43.685  15.444  21.660  1.00 10.84  ? 284 MET B CA    1 
ATOM   5458  C C     . MET B 1 284 ? 44.170  14.270  20.831  1.00 12.82  ? 284 MET B C     1 
ATOM   5459  O O     . MET B 1 284 ? 43.498  13.881  19.881  1.00 17.78  ? 284 MET B O     1 
ATOM   5460  C CB    . MET B 1 284 ? 44.211  16.727  21.052  1.00 9.28   ? 284 MET B CB    1 
ATOM   5461  C CG    . MET B 1 284 ? 43.762  17.909  21.881  1.00 11.94  ? 284 MET B CG    1 
ATOM   5462  S SD    . MET B 1 284 ? 41.955  17.933  22.073  1.00 15.26  ? 284 MET B SD    1 
ATOM   5463  C CE    . MET B 1 284 ? 41.767  19.687  22.149  1.00 2.00   ? 284 MET B CE    1 
ATOM   5464  H H     . MET B 1 284 ? 44.739  15.998  23.405  1.00 0.00   ? 284 MET B H     1 
ATOM   5465  N N     . ALA B 1 285 ? 45.292  13.636  21.158  1.00 9.94   ? 285 ALA B N     1 
ATOM   5466  C CA    . ALA B 1 285 ? 45.754  12.503  20.382  1.00 10.69  ? 285 ALA B CA    1 
ATOM   5467  C C     . ALA B 1 285 ? 44.901  11.282  20.679  1.00 9.60   ? 285 ALA B C     1 
ATOM   5468  O O     . ALA B 1 285 ? 44.382  10.612  19.775  1.00 12.01  ? 285 ALA B O     1 
ATOM   5469  C CB    . ALA B 1 285 ? 47.224  12.196  20.716  1.00 3.98   ? 285 ALA B CB    1 
ATOM   5470  H H     . ALA B 1 285 ? 45.840  13.975  21.892  1.00 0.00   ? 285 ALA B H     1 
ATOM   5471  N N     . TYR B 1 286 ? 44.676  11.000  21.951  1.00 8.49   ? 286 TYR B N     1 
ATOM   5472  C CA    . TYR B 1 286 ? 43.842  9.881   22.363  1.00 10.42  ? 286 TYR B CA    1 
ATOM   5473  C C     . TYR B 1 286 ? 42.460  9.982   21.730  1.00 11.84  ? 286 TYR B C     1 
ATOM   5474  O O     . TYR B 1 286 ? 41.954  8.979   21.233  1.00 20.33  ? 286 TYR B O     1 
ATOM   5475  C CB    . TYR B 1 286 ? 43.701  9.898   23.850  1.00 3.11   ? 286 TYR B CB    1 
ATOM   5476  C CG    . TYR B 1 286 ? 43.076  8.648   24.413  1.00 5.78   ? 286 TYR B CG    1 
ATOM   5477  C CD1   . TYR B 1 286 ? 43.805  7.480   24.480  1.00 2.00   ? 286 TYR B CD1   1 
ATOM   5478  C CD2   . TYR B 1 286 ? 41.796  8.719   24.923  1.00 7.36   ? 286 TYR B CD2   1 
ATOM   5479  C CE1   . TYR B 1 286 ? 43.248  6.377   25.073  1.00 7.37   ? 286 TYR B CE1   1 
ATOM   5480  C CE2   . TYR B 1 286 ? 41.230  7.605   25.513  1.00 11.31  ? 286 TYR B CE2   1 
ATOM   5481  C CZ    . TYR B 1 286 ? 41.952  6.440   25.560  1.00 6.34   ? 286 TYR B CZ    1 
ATOM   5482  O OH    . TYR B 1 286 ? 41.359  5.311   26.081  1.00 10.62  ? 286 TYR B OH    1 
ATOM   5483  H H     . TYR B 1 286 ? 45.043  11.596  22.630  1.00 0.00   ? 286 TYR B H     1 
ATOM   5484  H HH    . TYR B 1 286 ? 42.065  4.705   26.343  1.00 0.00   ? 286 TYR B HH    1 
ATOM   5485  N N     . VAL B 1 287 ? 41.846  11.172  21.748  1.00 13.65  ? 287 VAL B N     1 
ATOM   5486  C CA    . VAL B 1 287 ? 40.534  11.458  21.152  1.00 9.81   ? 287 VAL B CA    1 
ATOM   5487  C C     . VAL B 1 287 ? 40.596  11.102  19.687  1.00 11.15  ? 287 VAL B C     1 
ATOM   5488  O O     . VAL B 1 287 ? 39.768  10.334  19.193  1.00 10.94  ? 287 VAL B O     1 
ATOM   5489  C CB    . VAL B 1 287 ? 40.181  12.960  21.293  1.00 6.58   ? 287 VAL B CB    1 
ATOM   5490  C CG1   . VAL B 1 287 ? 39.011  13.342  20.426  1.00 11.10  ? 287 VAL B CG1   1 
ATOM   5491  C CG2   . VAL B 1 287 ? 39.763  13.242  22.717  1.00 4.94   ? 287 VAL B CG2   1 
ATOM   5492  H H     . VAL B 1 287 ? 42.314  11.902  22.207  1.00 0.00   ? 287 VAL B H     1 
ATOM   5493  N N     . MET B 1 288 ? 41.606  11.616  18.984  1.00 11.66  ? 288 MET B N     1 
ATOM   5494  C CA    . MET B 1 288 ? 41.726  11.345  17.566  1.00 12.78  ? 288 MET B CA    1 
ATOM   5495  C C     . MET B 1 288 ? 41.878  9.858   17.327  1.00 14.20  ? 288 MET B C     1 
ATOM   5496  O O     . MET B 1 288 ? 41.155  9.342   16.485  1.00 18.62  ? 288 MET B O     1 
ATOM   5497  C CB    . MET B 1 288 ? 42.917  12.092  16.983  1.00 10.13  ? 288 MET B CB    1 
ATOM   5498  C CG    . MET B 1 288 ? 42.617  13.563  16.860  1.00 3.06   ? 288 MET B CG    1 
ATOM   5499  S SD    . MET B 1 288 ? 41.328  13.778  15.639  1.00 11.51  ? 288 MET B SD    1 
ATOM   5500  C CE    . MET B 1 288 ? 40.993  15.482  15.966  1.00 12.92  ? 288 MET B CE    1 
ATOM   5501  H H     . MET B 1 288 ? 42.282  12.172  19.427  1.00 0.00   ? 288 MET B H     1 
ATOM   5502  N N     . GLU B 1 289 ? 42.657  9.097   18.079  1.00 15.09  ? 289 GLU B N     1 
ATOM   5503  C CA    . GLU B 1 289 ? 42.822  7.682   17.800  1.00 17.32  ? 289 GLU B CA    1 
ATOM   5504  C C     . GLU B 1 289 ? 41.535  6.914   18.044  1.00 18.78  ? 289 GLU B C     1 
ATOM   5505  O O     . GLU B 1 289 ? 41.145  6.066   17.232  1.00 24.34  ? 289 GLU B O     1 
ATOM   5506  C CB    . GLU B 1 289 ? 43.933  7.090   18.659  1.00 15.54  ? 289 GLU B CB    1 
ATOM   5507  C CG    . GLU B 1 289 ? 45.299  7.701   18.280  1.00 27.60  ? 289 GLU B CG    1 
ATOM   5508  C CD    . GLU B 1 289 ? 46.423  6.714   17.942  1.00 30.49  ? 289 GLU B CD    1 
ATOM   5509  O OE1   . GLU B 1 289 ? 46.655  5.799   18.732  1.00 31.76  ? 289 GLU B OE1   1 
ATOM   5510  O OE2   . GLU B 1 289 ? 47.067  6.861   16.893  1.00 32.79  ? 289 GLU B OE2   1 
ATOM   5511  H H     . GLU B 1 289 ? 43.118  9.498   18.845  1.00 0.00   ? 289 GLU B H     1 
ATOM   5512  N N     . LYS B 1 290 ? 40.804  7.233   19.110  1.00 17.12  ? 290 LYS B N     1 
ATOM   5513  C CA    . LYS B 1 290 ? 39.523  6.584   19.362  1.00 10.81  ? 290 LYS B CA    1 
ATOM   5514  C C     . LYS B 1 290 ? 38.458  7.056   18.392  1.00 7.63   ? 290 LYS B C     1 
ATOM   5515  O O     . LYS B 1 290 ? 37.403  6.443   18.327  1.00 12.00  ? 290 LYS B O     1 
ATOM   5516  C CB    . LYS B 1 290 ? 39.097  6.871   20.777  1.00 5.83   ? 290 LYS B CB    1 
ATOM   5517  C CG    . LYS B 1 290 ? 40.108  6.279   21.737  1.00 8.99   ? 290 LYS B CG    1 
ATOM   5518  C CD    . LYS B 1 290 ? 40.007  4.766   21.683  1.00 13.94  ? 290 LYS B CD    1 
ATOM   5519  C CE    . LYS B 1 290 ? 41.019  4.070   22.564  1.00 19.02  ? 290 LYS B CE    1 
ATOM   5520  N NZ    . LYS B 1 290 ? 40.873  2.625   22.428  1.00 15.51  ? 290 LYS B NZ    1 
ATOM   5521  H H     . LYS B 1 290 ? 41.124  7.926   19.728  1.00 0.00   ? 290 LYS B H     1 
ATOM   5522  H HZ1   . LYS B 1 290 ? 41.002  2.355   21.432  1.00 0.00   ? 290 LYS B HZ1   1 
ATOM   5523  H HZ2   . LYS B 1 290 ? 41.590  2.153   23.016  1.00 0.00   ? 290 LYS B HZ2   1 
ATOM   5524  H HZ3   . LYS B 1 290 ? 39.923  2.343   22.745  1.00 0.00   ? 290 LYS B HZ3   1 
ATOM   5525  N N     . ALA B 1 291 ? 38.673  8.130   17.627  1.00 11.09  ? 291 ALA B N     1 
ATOM   5526  C CA    . ALA B 1 291 ? 37.697  8.582   16.650  1.00 14.80  ? 291 ALA B CA    1 
ATOM   5527  C C     . ALA B 1 291 ? 38.047  8.041   15.290  1.00 19.37  ? 291 ALA B C     1 
ATOM   5528  O O     . ALA B 1 291 ? 37.387  8.381   14.312  1.00 21.78  ? 291 ALA B O     1 
ATOM   5529  C CB    . ALA B 1 291 ? 37.684  10.090  16.509  1.00 13.53  ? 291 ALA B CB    1 
ATOM   5530  H H     . ALA B 1 291 ? 39.463  8.688   17.782  1.00 0.00   ? 291 ALA B H     1 
ATOM   5531  N N     . GLY B 1 292 ? 39.106  7.242   15.179  1.00 22.79  ? 292 GLY B N     1 
ATOM   5532  C CA    . GLY B 1 292 ? 39.545  6.731   13.895  1.00 22.56  ? 292 GLY B CA    1 
ATOM   5533  C C     . GLY B 1 292 ? 40.565  7.635   13.216  1.00 22.50  ? 292 GLY B C     1 
ATOM   5534  O O     . GLY B 1 292 ? 40.824  7.518   12.014  1.00 28.52  ? 292 GLY B O     1 
ATOM   5535  H H     . GLY B 1 292 ? 39.593  6.963   15.983  1.00 0.00   ? 292 GLY B H     1 
ATOM   5536  N N     . GLY B 1 293 ? 41.178  8.543   13.959  1.00 21.85  ? 293 GLY B N     1 
ATOM   5537  C CA    . GLY B 1 293 ? 42.184  9.458   13.428  1.00 17.69  ? 293 GLY B CA    1 
ATOM   5538  C C     . GLY B 1 293 ? 43.625  9.079   13.754  1.00 16.51  ? 293 GLY B C     1 
ATOM   5539  O O     . GLY B 1 293 ? 43.951  7.996   14.277  1.00 10.47  ? 293 GLY B O     1 
ATOM   5540  H H     . GLY B 1 293 ? 40.937  8.558   14.894  1.00 0.00   ? 293 GLY B H     1 
ATOM   5541  N N     . MET B 1 294 ? 44.529  10.004  13.446  1.00 18.00  ? 294 MET B N     1 
ATOM   5542  C CA    . MET B 1 294 ? 45.941  9.821   13.671  1.00 20.35  ? 294 MET B CA    1 
ATOM   5543  C C     . MET B 1 294 ? 46.547  11.083  14.246  1.00 22.12  ? 294 MET B C     1 
ATOM   5544  O O     . MET B 1 294 ? 46.051  12.193  13.994  1.00 27.19  ? 294 MET B O     1 
ATOM   5545  C CB    . MET B 1 294 ? 46.619  9.503   12.376  1.00 21.09  ? 294 MET B CB    1 
ATOM   5546  C CG    . MET B 1 294 ? 46.349  8.111   11.861  1.00 20.44  ? 294 MET B CG    1 
ATOM   5547  S SD    . MET B 1 294 ? 47.161  7.898   10.265  1.00 24.72  ? 294 MET B SD    1 
ATOM   5548  C CE    . MET B 1 294 ? 48.832  8.072   10.829  1.00 22.78  ? 294 MET B CE    1 
ATOM   5549  H H     . MET B 1 294 ? 44.228  10.864  13.071  1.00 0.00   ? 294 MET B H     1 
ATOM   5550  N N     . ALA B 1 295 ? 47.611  10.892  15.034  1.00 22.17  ? 295 ALA B N     1 
ATOM   5551  C CA    . ALA B 1 295 ? 48.348  11.977  15.670  1.00 20.42  ? 295 ALA B CA    1 
ATOM   5552  C C     . ALA B 1 295 ? 49.811  11.572  15.734  1.00 21.11  ? 295 ALA B C     1 
ATOM   5553  O O     . ALA B 1 295 ? 50.223  10.582  16.358  1.00 20.76  ? 295 ALA B O     1 
ATOM   5554  C CB    . ALA B 1 295 ? 47.869  12.217  17.088  1.00 20.28  ? 295 ALA B CB    1 
ATOM   5555  H H     . ALA B 1 295 ? 47.940  9.982   15.193  1.00 0.00   ? 295 ALA B H     1 
ATOM   5556  N N     . THR B 1 296 ? 50.608  12.378  15.072  1.00 23.35  ? 296 THR B N     1 
ATOM   5557  C CA    . THR B 1 296 ? 51.998  12.074  14.907  1.00 26.85  ? 296 THR B CA    1 
ATOM   5558  C C     . THR B 1 296 ? 52.795  13.321  15.275  1.00 29.35  ? 296 THR B C     1 
ATOM   5559  O O     . THR B 1 296 ? 52.253  14.428  15.379  1.00 32.40  ? 296 THR B O     1 
ATOM   5560  C CB    . THR B 1 296 ? 52.149  11.599  13.416  1.00 24.63  ? 296 THR B CB    1 
ATOM   5561  O OG1   . THR B 1 296 ? 53.454  11.059  13.274  1.00 26.07  ? 296 THR B OG1   1 
ATOM   5562  C CG2   . THR B 1 296 ? 51.976  12.713  12.398  1.00 22.65  ? 296 THR B CG2   1 
ATOM   5563  H H     . THR B 1 296 ? 50.291  13.252  14.758  1.00 0.00   ? 296 THR B H     1 
ATOM   5564  H HG1   . THR B 1 296 ? 53.489  10.521  12.474  1.00 0.00   ? 296 THR B HG1   1 
ATOM   5565  N N     . THR B 1 297 ? 54.056  13.054  15.585  1.00 25.93  ? 297 THR B N     1 
ATOM   5566  C CA    . THR B 1 297 ? 55.078  14.065  15.765  1.00 27.38  ? 297 THR B CA    1 
ATOM   5567  C C     . THR B 1 297 ? 55.788  14.178  14.421  1.00 27.58  ? 297 THR B C     1 
ATOM   5568  O O     . THR B 1 297 ? 56.667  15.002  14.204  1.00 30.82  ? 297 THR B O     1 
ATOM   5569  C CB    . THR B 1 297 ? 56.094  13.636  16.828  1.00 29.71  ? 297 THR B CB    1 
ATOM   5570  O OG1   . THR B 1 297 ? 56.623  12.383  16.375  1.00 33.88  ? 297 THR B OG1   1 
ATOM   5571  C CG2   . THR B 1 297 ? 55.497  13.446  18.216  1.00 27.28  ? 297 THR B CG2   1 
ATOM   5572  H H     . THR B 1 297 ? 54.292  12.118  15.717  1.00 0.00   ? 297 THR B H     1 
ATOM   5573  H HG1   . THR B 1 297 ? 55.965  11.717  16.602  1.00 0.00   ? 297 THR B HG1   1 
ATOM   5574  N N     . GLY B 1 298 ? 55.448  13.293  13.488  1.00 31.72  ? 298 GLY B N     1 
ATOM   5575  C CA    . GLY B 1 298 ? 56.075  13.212  12.192  1.00 32.95  ? 298 GLY B CA    1 
ATOM   5576  C C     . GLY B 1 298 ? 56.948  11.991  12.321  1.00 33.23  ? 298 GLY B C     1 
ATOM   5577  O O     . GLY B 1 298 ? 56.834  11.018  11.586  1.00 33.24  ? 298 GLY B O     1 
ATOM   5578  H H     . GLY B 1 298 ? 54.775  12.611  13.690  1.00 0.00   ? 298 GLY B H     1 
ATOM   5579  N N     . LYS B 1 299 ? 57.788  12.026  13.326  1.00 35.85  ? 299 LYS B N     1 
ATOM   5580  C CA    . LYS B 1 299 ? 58.730  10.976  13.584  1.00 41.82  ? 299 LYS B CA    1 
ATOM   5581  C C     . LYS B 1 299 ? 58.087  9.736   14.187  1.00 40.86  ? 299 LYS B C     1 
ATOM   5582  O O     . LYS B 1 299 ? 58.446  8.619   13.824  1.00 42.67  ? 299 LYS B O     1 
ATOM   5583  C CB    . LYS B 1 299 ? 59.776  11.594  14.490  1.00 52.16  ? 299 LYS B CB    1 
ATOM   5584  C CG    . LYS B 1 299 ? 61.117  10.918  14.374  1.00 64.40  ? 299 LYS B CG    1 
ATOM   5585  C CD    . LYS B 1 299 ? 62.205  11.721  15.065  1.00 73.74  ? 299 LYS B CD    1 
ATOM   5586  C CE    . LYS B 1 299 ? 63.508  10.982  14.760  1.00 82.06  ? 299 LYS B CE    1 
ATOM   5587  N NZ    . LYS B 1 299 ? 64.690  11.589  15.354  1.00 87.91  ? 299 LYS B NZ    1 
ATOM   5588  H H     . LYS B 1 299 ? 57.805  12.835  13.880  1.00 0.00   ? 299 LYS B H     1 
ATOM   5589  H HZ1   . LYS B 1 299 ? 64.768  12.582  15.053  1.00 0.00   ? 299 LYS B HZ1   1 
ATOM   5590  H HZ2   . LYS B 1 299 ? 64.621  11.543  16.391  1.00 0.00   ? 299 LYS B HZ2   1 
ATOM   5591  H HZ3   . LYS B 1 299 ? 65.529  11.059  15.041  1.00 0.00   ? 299 LYS B HZ3   1 
ATOM   5592  N N     . GLU B 1 300 ? 57.140  9.904   15.115  1.00 40.19  ? 300 GLU B N     1 
ATOM   5593  C CA    . GLU B 1 300 ? 56.471  8.794   15.797  1.00 34.82  ? 300 GLU B CA    1 
ATOM   5594  C C     . GLU B 1 300 ? 55.073  9.166   16.260  1.00 28.49  ? 300 GLU B C     1 
ATOM   5595  O O     . GLU B 1 300 ? 54.728  10.346  16.228  1.00 29.63  ? 300 GLU B O     1 
ATOM   5596  C CB    . GLU B 1 300 ? 57.279  8.360   17.008  1.00 38.54  ? 300 GLU B CB    1 
ATOM   5597  C CG    . GLU B 1 300 ? 57.470  9.422   18.084  1.00 44.56  ? 300 GLU B CG    1 
ATOM   5598  C CD    . GLU B 1 300 ? 58.442  9.035   19.192  1.00 48.86  ? 300 GLU B CD    1 
ATOM   5599  O OE1   . GLU B 1 300 ? 58.417  7.885   19.649  1.00 51.44  ? 300 GLU B OE1   1 
ATOM   5600  O OE2   . GLU B 1 300 ? 59.218  9.902   19.606  1.00 48.25  ? 300 GLU B OE2   1 
ATOM   5601  H H     . GLU B 1 300 ? 56.871  10.819  15.319  1.00 0.00   ? 300 GLU B H     1 
ATOM   5602  N N     . ALA B 1 301 ? 54.260  8.224   16.721  1.00 23.95  ? 301 ALA B N     1 
ATOM   5603  C CA    . ALA B 1 301 ? 52.914  8.503   17.186  1.00 18.14  ? 301 ALA B CA    1 
ATOM   5604  C C     . ALA B 1 301 ? 52.948  9.113   18.563  1.00 15.87  ? 301 ALA B C     1 
ATOM   5605  O O     . ALA B 1 301 ? 53.524  8.529   19.490  1.00 12.48  ? 301 ALA B O     1 
ATOM   5606  C CB    . ALA B 1 301 ? 52.091  7.242   17.301  1.00 21.85  ? 301 ALA B CB    1 
ATOM   5607  H H     . ALA B 1 301 ? 54.592  7.308   16.788  1.00 0.00   ? 301 ALA B H     1 
ATOM   5608  N N     . VAL B 1 302 ? 52.219  10.224  18.707  1.00 16.17  ? 302 VAL B N     1 
ATOM   5609  C CA    . VAL B 1 302 ? 52.152  11.032  19.929  1.00 10.10  ? 302 VAL B CA    1 
ATOM   5610  C C     . VAL B 1 302 ? 51.801  10.209  21.157  1.00 13.10  ? 302 VAL B C     1 
ATOM   5611  O O     . VAL B 1 302 ? 52.364  10.477  22.212  1.00 11.43  ? 302 VAL B O     1 
ATOM   5612  C CB    . VAL B 1 302 ? 51.103  12.176  19.785  1.00 8.86   ? 302 VAL B CB    1 
ATOM   5613  C CG1   . VAL B 1 302 ? 51.134  13.085  21.017  1.00 5.30   ? 302 VAL B CG1   1 
ATOM   5614  C CG2   . VAL B 1 302 ? 51.443  13.066  18.590  1.00 3.95   ? 302 VAL B CG2   1 
ATOM   5615  H H     . VAL B 1 302 ? 51.673  10.489  17.934  1.00 0.00   ? 302 VAL B H     1 
ATOM   5616  N N     . LEU B 1 303 ? 50.958  9.170   21.133  1.00 15.32  ? 303 LEU B N     1 
ATOM   5617  C CA    . LEU B 1 303 ? 50.666  8.479   22.383  1.00 17.44  ? 303 LEU B CA    1 
ATOM   5618  C C     . LEU B 1 303 ? 51.798  7.614   22.921  1.00 20.83  ? 303 LEU B C     1 
ATOM   5619  O O     . LEU B 1 303 ? 51.782  7.200   24.083  1.00 22.89  ? 303 LEU B O     1 
ATOM   5620  C CB    . LEU B 1 303 ? 49.400  7.628   22.214  1.00 17.89  ? 303 LEU B CB    1 
ATOM   5621  C CG    . LEU B 1 303 ? 48.064  8.366   22.022  1.00 17.37  ? 303 LEU B CG    1 
ATOM   5622  C CD1   . LEU B 1 303 ? 46.953  7.353   21.971  1.00 13.12  ? 303 LEU B CD1   1 
ATOM   5623  C CD2   . LEU B 1 303 ? 47.798  9.324   23.175  1.00 16.58  ? 303 LEU B CD2   1 
ATOM   5624  H H     . LEU B 1 303 ? 50.590  8.859   20.283  1.00 0.00   ? 303 LEU B H     1 
ATOM   5625  N N     . ASP B 1 304 ? 52.798  7.347   22.092  1.00 22.54  ? 304 ASP B N     1 
ATOM   5626  C CA    . ASP B 1 304 ? 53.928  6.519   22.466  1.00 22.43  ? 304 ASP B CA    1 
ATOM   5627  C C     . ASP B 1 304 ? 55.142  7.276   22.971  1.00 21.41  ? 304 ASP B C     1 
ATOM   5628  O O     . ASP B 1 304 ? 56.002  6.652   23.584  1.00 23.48  ? 304 ASP B O     1 
ATOM   5629  C CB    . ASP B 1 304 ? 54.375  5.685   21.280  1.00 27.73  ? 304 ASP B CB    1 
ATOM   5630  C CG    . ASP B 1 304 ? 53.460  4.529   20.902  1.00 28.24  ? 304 ASP B CG    1 
ATOM   5631  O OD1   . ASP B 1 304 ? 53.045  3.797   21.807  1.00 32.31  ? 304 ASP B OD1   1 
ATOM   5632  O OD2   . ASP B 1 304 ? 53.201  4.357   19.703  1.00 26.08  ? 304 ASP B OD2   1 
ATOM   5633  H H     . ASP B 1 304 ? 52.817  7.762   21.207  1.00 0.00   ? 304 ASP B H     1 
ATOM   5634  N N     . VAL B 1 305 ? 55.288  8.583   22.751  1.00 18.88  ? 305 VAL B N     1 
ATOM   5635  C CA    . VAL B 1 305 ? 56.472  9.276   23.224  1.00 21.35  ? 305 VAL B CA    1 
ATOM   5636  C C     . VAL B 1 305 ? 56.388  9.451   24.740  1.00 22.64  ? 305 VAL B C     1 
ATOM   5637  O O     . VAL B 1 305 ? 55.528  10.135  25.295  1.00 26.47  ? 305 VAL B O     1 
ATOM   5638  C CB    . VAL B 1 305 ? 56.659  10.664  22.447  1.00 12.27  ? 305 VAL B CB    1 
ATOM   5639  C CG1   . VAL B 1 305 ? 55.389  11.380  22.289  1.00 17.33  ? 305 VAL B CG1   1 
ATOM   5640  C CG2   . VAL B 1 305 ? 57.523  11.636  23.229  1.00 14.12  ? 305 VAL B CG2   1 
ATOM   5641  H H     . VAL B 1 305 ? 54.525  9.082   22.395  1.00 0.00   ? 305 VAL B H     1 
ATOM   5642  N N     . ILE B 1 306 ? 57.269  8.682   25.380  1.00 20.33  ? 306 ILE B N     1 
ATOM   5643  C CA    . ILE B 1 306 ? 57.462  8.685   26.824  1.00 21.07  ? 306 ILE B CA    1 
ATOM   5644  C C     . ILE B 1 306 ? 58.153  9.980   27.271  1.00 20.21  ? 306 ILE B C     1 
ATOM   5645  O O     . ILE B 1 306 ? 59.184  10.388  26.722  1.00 23.71  ? 306 ILE B O     1 
ATOM   5646  C CB    . ILE B 1 306 ? 58.258  7.356   27.274  1.00 22.52  ? 306 ILE B CB    1 
ATOM   5647  C CG1   . ILE B 1 306 ? 59.105  7.606   28.527  1.00 26.48  ? 306 ILE B CG1   1 
ATOM   5648  C CG2   . ILE B 1 306 ? 59.153  6.839   26.170  1.00 20.65  ? 306 ILE B CG2   1 
ATOM   5649  C CD1   . ILE B 1 306 ? 58.394  7.530   29.898  1.00 28.24  ? 306 ILE B CD1   1 
ATOM   5650  H H     . ILE B 1 306 ? 57.778  8.087   24.799  1.00 0.00   ? 306 ILE B H     1 
ATOM   5651  N N     . PRO B 1 307 ? 57.538  10.686  28.231  1.00 18.81  ? 307 PRO B N     1 
ATOM   5652  C CA    . PRO B 1 307 ? 57.999  11.948  28.777  1.00 20.21  ? 307 PRO B CA    1 
ATOM   5653  C C     . PRO B 1 307 ? 59.156  11.794  29.749  1.00 21.60  ? 307 PRO B C     1 
ATOM   5654  O O     . PRO B 1 307 ? 59.364  10.770  30.404  1.00 16.61  ? 307 PRO B O     1 
ATOM   5655  C CB    . PRO B 1 307 ? 56.809  12.579  29.469  1.00 17.18  ? 307 PRO B CB    1 
ATOM   5656  C CG    . PRO B 1 307 ? 55.656  11.689  29.116  1.00 20.50  ? 307 PRO B CG    1 
ATOM   5657  C CD    . PRO B 1 307 ? 56.285  10.331  28.888  1.00 17.45  ? 307 PRO B CD    1 
ATOM   5658  N N     . THR B 1 308 ? 59.853  12.915  29.833  1.00 23.95  ? 308 THR B N     1 
ATOM   5659  C CA    . THR B 1 308 ? 61.007  13.151  30.683  1.00 27.16  ? 308 THR B CA    1 
ATOM   5660  C C     . THR B 1 308 ? 60.662  14.315  31.616  1.00 26.07  ? 308 THR B C     1 
ATOM   5661  O O     . THR B 1 308 ? 61.247  14.489  32.691  1.00 27.52  ? 308 THR B O     1 
ATOM   5662  C CB    . THR B 1 308 ? 62.209  13.452  29.725  1.00 25.05  ? 308 THR B CB    1 
ATOM   5663  O OG1   . THR B 1 308 ? 62.594  12.167  29.254  1.00 27.43  ? 308 THR B OG1   1 
ATOM   5664  C CG2   . THR B 1 308 ? 63.399  14.183  30.329  1.00 25.25  ? 308 THR B CG2   1 
ATOM   5665  H H     . THR B 1 308 ? 59.590  13.638  29.235  1.00 0.00   ? 308 THR B H     1 
ATOM   5666  H HG1   . THR B 1 308 ? 61.850  11.704  28.856  1.00 0.00   ? 308 THR B HG1   1 
ATOM   5667  N N     . ASP B 1 309 ? 59.655  15.105  31.258  1.00 27.21  ? 309 ASP B N     1 
ATOM   5668  C CA    . ASP B 1 309 ? 59.350  16.303  32.007  1.00 27.35  ? 309 ASP B CA    1 
ATOM   5669  C C     . ASP B 1 309 ? 57.869  16.560  31.876  1.00 26.08  ? 309 ASP B C     1 
ATOM   5670  O O     . ASP B 1 309 ? 57.411  16.680  30.744  1.00 27.10  ? 309 ASP B O     1 
ATOM   5671  C CB    . ASP B 1 309 ? 60.148  17.457  31.411  1.00 25.20  ? 309 ASP B CB    1 
ATOM   5672  C CG    . ASP B 1 309 ? 59.989  18.787  32.122  1.00 26.16  ? 309 ASP B CG    1 
ATOM   5673  O OD1   . ASP B 1 309 ? 60.052  18.819  33.353  1.00 31.65  ? 309 ASP B OD1   1 
ATOM   5674  O OD2   . ASP B 1 309 ? 59.819  19.791  31.437  1.00 21.52  ? 309 ASP B OD2   1 
ATOM   5675  H H     . ASP B 1 309 ? 59.108  14.910  30.469  1.00 0.00   ? 309 ASP B H     1 
ATOM   5676  N N     . ILE B 1 310 ? 57.108  16.704  32.972  1.00 26.45  ? 310 ILE B N     1 
ATOM   5677  C CA    . ILE B 1 310 ? 55.673  16.995  32.900  1.00 21.11  ? 310 ILE B CA    1 
ATOM   5678  C C     . ILE B 1 310 ? 55.295  18.197  32.018  1.00 22.14  ? 310 ILE B C     1 
ATOM   5679  O O     . ILE B 1 310 ? 54.141  18.347  31.617  1.00 27.22  ? 310 ILE B O     1 
ATOM   5680  C CB    . ILE B 1 310 ? 55.057  17.218  34.342  1.00 17.72  ? 310 ILE B CB    1 
ATOM   5681  C CG1   . ILE B 1 310 ? 55.712  18.315  35.119  1.00 10.47  ? 310 ILE B CG1   1 
ATOM   5682  C CG2   . ILE B 1 310 ? 55.199  15.925  35.122  1.00 11.33  ? 310 ILE B CG2   1 
ATOM   5683  C CD1   . ILE B 1 310 ? 54.877  18.670  36.358  1.00 10.94  ? 310 ILE B CD1   1 
ATOM   5684  H H     . ILE B 1 310 ? 57.517  16.550  33.849  1.00 0.00   ? 310 ILE B H     1 
ATOM   5685  N N     . HIS B 1 311 ? 56.242  19.062  31.640  1.00 19.43  ? 311 HIS B N     1 
ATOM   5686  C CA    . HIS B 1 311 ? 55.961  20.212  30.798  1.00 18.24  ? 311 HIS B CA    1 
ATOM   5687  C C     . HIS B 1 311 ? 56.747  20.080  29.493  1.00 16.53  ? 311 HIS B C     1 
ATOM   5688  O O     . HIS B 1 311 ? 57.147  21.076  28.865  1.00 14.81  ? 311 HIS B O     1 
ATOM   5689  C CB    . HIS B 1 311 ? 56.362  21.519  31.515  1.00 21.89  ? 311 HIS B CB    1 
ATOM   5690  C CG    . HIS B 1 311 ? 55.562  21.810  32.780  1.00 26.09  ? 311 HIS B CG    1 
ATOM   5691  N ND1   . HIS B 1 311 ? 54.324  22.284  32.767  1.00 28.83  ? 311 HIS B ND1   1 
ATOM   5692  C CD2   . HIS B 1 311 ? 55.935  21.598  34.078  1.00 23.37  ? 311 HIS B CD2   1 
ATOM   5693  C CE1   . HIS B 1 311 ? 53.914  22.343  34.001  1.00 29.57  ? 311 HIS B CE1   1 
ATOM   5694  N NE2   . HIS B 1 311 ? 54.887  21.928  34.776  1.00 25.32  ? 311 HIS B NE2   1 
ATOM   5695  H H     . HIS B 1 311 ? 57.181  18.847  31.798  1.00 0.00   ? 311 HIS B H     1 
ATOM   5696  H HD1   . HIS B 1 311 ? 53.847  22.713  32.020  1.00 0.00   ? 311 HIS B HD1   1 
ATOM   5697  H HE2   . HIS B 1 311 ? 54.804  21.882  35.754  1.00 0.00   ? 311 HIS B HE2   1 
ATOM   5698  N N     . GLN B 1 312 ? 56.988  18.840  29.072  1.00 9.56   ? 312 GLN B N     1 
ATOM   5699  C CA    . GLN B 1 312 ? 57.735  18.592  27.864  1.00 11.77  ? 312 GLN B CA    1 
ATOM   5700  C C     . GLN B 1 312 ? 56.885  19.031  26.699  1.00 15.48  ? 312 GLN B C     1 
ATOM   5701  O O     . GLN B 1 312 ? 55.690  18.732  26.673  1.00 19.69  ? 312 GLN B O     1 
ATOM   5702  C CB    . GLN B 1 312 ? 58.013  17.128  27.760  1.00 10.12  ? 312 GLN B CB    1 
ATOM   5703  C CG    . GLN B 1 312 ? 58.939  16.717  26.647  1.00 15.40  ? 312 GLN B CG    1 
ATOM   5704  C CD    . GLN B 1 312 ? 59.127  15.215  26.678  1.00 17.12  ? 312 GLN B CD    1 
ATOM   5705  O OE1   . GLN B 1 312 ? 59.158  14.622  27.756  1.00 15.37  ? 312 GLN B OE1   1 
ATOM   5706  N NE2   . GLN B 1 312 ? 59.243  14.513  25.565  1.00 15.21  ? 312 GLN B NE2   1 
ATOM   5707  H H     . GLN B 1 312 ? 56.604  18.077  29.542  1.00 0.00   ? 312 GLN B H     1 
ATOM   5708  H HE21  . GLN B 1 312 ? 59.369  13.547  25.641  1.00 0.00   ? 312 GLN B HE21  1 
ATOM   5709  H HE22  . GLN B 1 312 ? 59.176  14.971  24.696  1.00 0.00   ? 312 GLN B HE22  1 
ATOM   5710  N N     . ARG B 1 313 ? 57.434  19.749  25.736  1.00 19.00  ? 313 ARG B N     1 
ATOM   5711  C CA    . ARG B 1 313 ? 56.673  20.123  24.550  1.00 20.75  ? 313 ARG B CA    1 
ATOM   5712  C C     . ARG B 1 313 ? 56.801  19.056  23.477  1.00 18.28  ? 313 ARG B C     1 
ATOM   5713  O O     . ARG B 1 313 ? 57.731  18.242  23.565  1.00 21.20  ? 313 ARG B O     1 
ATOM   5714  C CB    . ARG B 1 313 ? 57.186  21.439  24.043  1.00 20.89  ? 313 ARG B CB    1 
ATOM   5715  C CG    . ARG B 1 313 ? 56.787  22.424  25.109  1.00 28.23  ? 313 ARG B CG    1 
ATOM   5716  C CD    . ARG B 1 313 ? 57.377  23.786  24.904  1.00 37.34  ? 313 ARG B CD    1 
ATOM   5717  N NE    . ARG B 1 313 ? 56.853  24.660  25.938  1.00 45.11  ? 313 ARG B NE    1 
ATOM   5718  C CZ    . ARG B 1 313 ? 56.920  25.981  25.837  1.00 46.20  ? 313 ARG B CZ    1 
ATOM   5719  N NH1   . ARG B 1 313 ? 57.435  26.585  24.760  1.00 52.80  ? 313 ARG B NH1   1 
ATOM   5720  N NH2   . ARG B 1 313 ? 56.435  26.715  26.826  1.00 48.78  ? 313 ARG B NH2   1 
ATOM   5721  H H     . ARG B 1 313 ? 58.375  19.994  25.793  1.00 0.00   ? 313 ARG B H     1 
ATOM   5722  H HE    . ARG B 1 313 ? 56.417  24.268  26.723  1.00 0.00   ? 313 ARG B HE    1 
ATOM   5723  H HH11  . ARG B 1 313 ? 57.768  26.039  23.992  1.00 0.00   ? 313 ARG B HH11  1 
ATOM   5724  H HH12  . ARG B 1 313 ? 57.475  27.583  24.720  1.00 0.00   ? 313 ARG B HH12  1 
ATOM   5725  H HH21  . ARG B 1 313 ? 56.023  26.267  27.613  1.00 0.00   ? 313 ARG B HH21  1 
ATOM   5726  H HH22  . ARG B 1 313 ? 56.477  27.713  26.777  1.00 0.00   ? 313 ARG B HH22  1 
ATOM   5727  N N     . ALA B 1 314 ? 55.895  18.950  22.511  1.00 12.86  ? 314 ALA B N     1 
ATOM   5728  C CA    . ALA B 1 314 ? 56.050  17.974  21.442  1.00 12.42  ? 314 ALA B CA    1 
ATOM   5729  C C     . ALA B 1 314 ? 55.584  18.651  20.178  1.00 14.18  ? 314 ALA B C     1 
ATOM   5730  O O     . ALA B 1 314 ? 54.856  19.649  20.240  1.00 19.22  ? 314 ALA B O     1 
ATOM   5731  C CB    . ALA B 1 314 ? 55.185  16.727  21.620  1.00 10.21  ? 314 ALA B CB    1 
ATOM   5732  H H     . ALA B 1 314 ? 55.140  19.578  22.479  1.00 0.00   ? 314 ALA B H     1 
ATOM   5733  N N     . PRO B 1 315 ? 56.011  18.221  19.001  1.00 14.36  ? 315 PRO B N     1 
ATOM   5734  C CA    . PRO B 1 315 ? 55.370  18.579  17.737  1.00 17.49  ? 315 PRO B CA    1 
ATOM   5735  C C     . PRO B 1 315 ? 54.157  17.697  17.518  1.00 14.68  ? 315 PRO B C     1 
ATOM   5736  O O     . PRO B 1 315 ? 54.232  16.504  17.835  1.00 15.61  ? 315 PRO B O     1 
ATOM   5737  C CB    . PRO B 1 315 ? 56.450  18.376  16.690  1.00 19.52  ? 315 PRO B CB    1 
ATOM   5738  C CG    . PRO B 1 315 ? 57.739  18.316  17.510  1.00 16.38  ? 315 PRO B CG    1 
ATOM   5739  C CD    . PRO B 1 315 ? 57.293  17.585  18.759  1.00 16.25  ? 315 PRO B CD    1 
ATOM   5740  N N     . ILE B 1 316 ? 53.058  18.224  16.978  1.00 15.48  ? 316 ILE B N     1 
ATOM   5741  C CA    . ILE B 1 316 ? 51.887  17.387  16.712  1.00 15.73  ? 316 ILE B CA    1 
ATOM   5742  C C     . ILE B 1 316 ? 51.194  17.750  15.407  1.00 10.70  ? 316 ILE B C     1 
ATOM   5743  O O     . ILE B 1 316 ? 51.049  18.931  15.076  1.00 8.17   ? 316 ILE B O     1 
ATOM   5744  C CB    . ILE B 1 316 ? 50.868  17.484  17.882  1.00 17.25  ? 316 ILE B CB    1 
ATOM   5745  C CG1   . ILE B 1 316 ? 49.811  16.427  17.624  1.00 21.23  ? 316 ILE B CG1   1 
ATOM   5746  C CG2   . ILE B 1 316 ? 50.225  18.854  18.004  1.00 12.52  ? 316 ILE B CG2   1 
ATOM   5747  C CD1   . ILE B 1 316 ? 48.867  16.195  18.799  1.00 30.33  ? 316 ILE B CD1   1 
ATOM   5748  H H     . ILE B 1 316 ? 53.032  19.171  16.715  1.00 0.00   ? 316 ILE B H     1 
ATOM   5749  N N     . ILE B 1 317 ? 50.856  16.718  14.646  1.00 10.68  ? 317 ILE B N     1 
ATOM   5750  C CA    . ILE B 1 317 ? 50.119  16.815  13.396  1.00 17.24  ? 317 ILE B CA    1 
ATOM   5751  C C     . ILE B 1 317 ? 48.995  15.812  13.598  1.00 14.71  ? 317 ILE B C     1 
ATOM   5752  O O     . ILE B 1 317 ? 49.302  14.641  13.842  1.00 16.88  ? 317 ILE B O     1 
ATOM   5753  C CB    . ILE B 1 317 ? 50.951  16.369  12.152  1.00 21.51  ? 317 ILE B CB    1 
ATOM   5754  C CG1   . ILE B 1 317 ? 52.105  17.320  11.844  1.00 23.34  ? 317 ILE B CG1   1 
ATOM   5755  C CG2   . ILE B 1 317 ? 50.023  16.339  10.944  1.00 18.76  ? 317 ILE B CG2   1 
ATOM   5756  C CD1   . ILE B 1 317 ? 53.432  17.000  12.539  1.00 20.79  ? 317 ILE B CD1   1 
ATOM   5757  H H     . ILE B 1 317 ? 51.065  15.817  14.958  1.00 0.00   ? 317 ILE B H     1 
ATOM   5758  N N     . LEU B 1 318 ? 47.722  16.188  13.535  1.00 17.40  ? 318 LEU B N     1 
ATOM   5759  C CA    . LEU B 1 318 ? 46.615  15.264  13.778  1.00 15.20  ? 318 LEU B CA    1 
ATOM   5760  C C     . LEU B 1 318 ? 45.455  15.560  12.850  1.00 14.14  ? 318 LEU B C     1 
ATOM   5761  O O     . LEU B 1 318 ? 45.356  16.665  12.292  1.00 17.02  ? 318 LEU B O     1 
ATOM   5762  C CB    . LEU B 1 318 ? 46.153  15.348  15.249  1.00 6.24   ? 318 LEU B CB    1 
ATOM   5763  C CG    . LEU B 1 318 ? 45.927  16.662  15.967  1.00 2.00   ? 318 LEU B CG    1 
ATOM   5764  C CD1   . LEU B 1 318 ? 44.686  17.361  15.453  1.00 7.49   ? 318 LEU B CD1   1 
ATOM   5765  C CD2   . LEU B 1 318 ? 45.678  16.390  17.431  1.00 2.00   ? 318 LEU B CD2   1 
ATOM   5766  H H     . LEU B 1 318 ? 47.497  17.096  13.253  1.00 0.00   ? 318 LEU B H     1 
ATOM   5767  N N     . GLY B 1 319 ? 44.609  14.568  12.631  1.00 11.44  ? 319 GLY B N     1 
ATOM   5768  C CA    . GLY B 1 319 ? 43.458  14.774  11.786  1.00 13.87  ? 319 GLY B CA    1 
ATOM   5769  C C     . GLY B 1 319 ? 42.982  13.483  11.138  1.00 17.58  ? 319 GLY B C     1 
ATOM   5770  O O     . GLY B 1 319 ? 43.235  12.364  11.622  1.00 13.57  ? 319 GLY B O     1 
ATOM   5771  H H     . GLY B 1 319 ? 44.798  13.666  12.975  1.00 0.00   ? 319 GLY B H     1 
ATOM   5772  N N     . SER B 1 320 ? 42.292  13.655  10.017  1.00 16.89  ? 320 SER B N     1 
ATOM   5773  C CA    . SER B 1 320 ? 41.742  12.572  9.243   1.00 19.34  ? 320 SER B CA    1 
ATOM   5774  C C     . SER B 1 320 ? 42.874  11.661  8.797   1.00 19.09  ? 320 SER B C     1 
ATOM   5775  O O     . SER B 1 320 ? 43.940  12.180  8.426   1.00 18.31  ? 320 SER B O     1 
ATOM   5776  C CB    . SER B 1 320 ? 41.051  13.177  8.061   1.00 21.54  ? 320 SER B CB    1 
ATOM   5777  O OG    . SER B 1 320 ? 40.090  14.170  8.405   1.00 25.64  ? 320 SER B OG    1 
ATOM   5778  H H     . SER B 1 320 ? 42.160  14.560  9.677   1.00 0.00   ? 320 SER B H     1 
ATOM   5779  H HG    . SER B 1 320 ? 39.227  13.734  8.296   1.00 0.00   ? 320 SER B HG    1 
ATOM   5780  N N     . PRO B 1 321 ? 42.700  10.334  8.788   1.00 19.75  ? 321 PRO B N     1 
ATOM   5781  C CA    . PRO B 1 321 ? 43.749  9.376   8.502   1.00 21.05  ? 321 PRO B CA    1 
ATOM   5782  C C     . PRO B 1 321 ? 44.426  9.622   7.171   1.00 22.58  ? 321 PRO B C     1 
ATOM   5783  O O     . PRO B 1 321 ? 45.651  9.583   7.090   1.00 27.56  ? 321 PRO B O     1 
ATOM   5784  C CB    . PRO B 1 321 ? 43.061  8.031   8.592   1.00 20.54  ? 321 PRO B CB    1 
ATOM   5785  C CG    . PRO B 1 321 ? 41.625  8.350   8.338   1.00 14.89  ? 321 PRO B CG    1 
ATOM   5786  C CD    . PRO B 1 321 ? 41.454  9.643   9.103   1.00 18.33  ? 321 PRO B CD    1 
ATOM   5787  N N     . ASP B 1 322 ? 43.690  9.973   6.124   1.00 24.32  ? 322 ASP B N     1 
ATOM   5788  C CA    . ASP B 1 322 ? 44.313  10.192  4.834   1.00 23.88  ? 322 ASP B CA    1 
ATOM   5789  C C     . ASP B 1 322 ? 45.042  11.518  4.741   1.00 22.77  ? 322 ASP B C     1 
ATOM   5790  O O     . ASP B 1 322 ? 45.992  11.654  3.970   1.00 26.58  ? 322 ASP B O     1 
ATOM   5791  C CB    . ASP B 1 322 ? 43.261  10.105  3.738   1.00 27.55  ? 322 ASP B CB    1 
ATOM   5792  C CG    . ASP B 1 322 ? 42.537  8.768   3.578   1.00 27.34  ? 322 ASP B CG    1 
ATOM   5793  O OD1   . ASP B 1 322 ? 42.859  7.773   4.251   1.00 26.77  ? 322 ASP B OD1   1 
ATOM   5794  O OD2   . ASP B 1 322 ? 41.612  8.749   2.762   1.00 28.48  ? 322 ASP B OD2   1 
ATOM   5795  H H     . ASP B 1 322 ? 42.716  10.066  6.213   1.00 0.00   ? 322 ASP B H     1 
ATOM   5796  N N     . ASP B 1 323 ? 44.667  12.524  5.527   1.00 22.62  ? 323 ASP B N     1 
ATOM   5797  C CA    . ASP B 1 323 ? 45.408  13.777  5.544   1.00 19.62  ? 323 ASP B CA    1 
ATOM   5798  C C     . ASP B 1 323 ? 46.722  13.586  6.304   1.00 20.91  ? 323 ASP B C     1 
ATOM   5799  O O     . ASP B 1 323 ? 47.793  13.908  5.773   1.00 24.86  ? 323 ASP B O     1 
ATOM   5800  C CB    . ASP B 1 323 ? 44.616  14.858  6.228   1.00 22.56  ? 323 ASP B CB    1 
ATOM   5801  C CG    . ASP B 1 323 ? 43.338  15.264  5.512   1.00 20.16  ? 323 ASP B CG    1 
ATOM   5802  O OD1   . ASP B 1 323 ? 43.349  15.470  4.304   1.00 7.71   ? 323 ASP B OD1   1 
ATOM   5803  O OD2   . ASP B 1 323 ? 42.327  15.389  6.184   1.00 26.52  ? 323 ASP B OD2   1 
ATOM   5804  H H     . ASP B 1 323 ? 43.957  12.375  6.181   1.00 0.00   ? 323 ASP B H     1 
ATOM   5805  N N     . VAL B 1 324 ? 46.703  13.022  7.521   1.00 17.17  ? 324 VAL B N     1 
ATOM   5806  C CA    . VAL B 1 324 ? 47.925  12.770  8.276   1.00 16.11  ? 324 VAL B CA    1 
ATOM   5807  C C     . VAL B 1 324 ? 48.826  11.785  7.527   1.00 18.50  ? 324 VAL B C     1 
ATOM   5808  O O     . VAL B 1 324 ? 50.051  11.953  7.539   1.00 21.88  ? 324 VAL B O     1 
ATOM   5809  C CB    . VAL B 1 324 ? 47.585  12.228  9.671   1.00 10.83  ? 324 VAL B CB    1 
ATOM   5810  C CG1   . VAL B 1 324 ? 48.831  11.944  10.490  1.00 8.84   ? 324 VAL B CG1   1 
ATOM   5811  C CG2   . VAL B 1 324 ? 46.886  13.325  10.441  1.00 10.28  ? 324 VAL B CG2   1 
ATOM   5812  H H     . VAL B 1 324 ? 45.837  12.773  7.914   1.00 0.00   ? 324 VAL B H     1 
ATOM   5813  N N     . LEU B 1 325 ? 48.281  10.786  6.840   1.00 16.20  ? 325 LEU B N     1 
ATOM   5814  C CA    . LEU B 1 325 ? 49.060  9.913   5.966   1.00 19.18  ? 325 LEU B CA    1 
ATOM   5815  C C     . LEU B 1 325 ? 49.778  10.651  4.832   1.00 23.26  ? 325 LEU B C     1 
ATOM   5816  O O     . LEU B 1 325 ? 50.924  10.333  4.455   1.00 19.61  ? 325 LEU B O     1 
ATOM   5817  C CB    . LEU B 1 325 ? 48.130  8.878   5.388   1.00 16.63  ? 325 LEU B CB    1 
ATOM   5818  C CG    . LEU B 1 325 ? 48.323  7.417   5.748   1.00 18.84  ? 325 LEU B CG    1 
ATOM   5819  C CD1   . LEU B 1 325 ? 48.950  7.269   7.126   1.00 16.62  ? 325 LEU B CD1   1 
ATOM   5820  C CD2   . LEU B 1 325 ? 46.964  6.726   5.656   1.00 13.79  ? 325 LEU B CD2   1 
ATOM   5821  H H     . LEU B 1 325 ? 47.332  10.587  6.973   1.00 0.00   ? 325 LEU B H     1 
ATOM   5822  N N     . GLU B 1 326 ? 49.098  11.686  4.308   1.00 24.09  ? 326 GLU B N     1 
ATOM   5823  C CA    . GLU B 1 326 ? 49.659  12.517  3.258   1.00 23.80  ? 326 GLU B CA    1 
ATOM   5824  C C     . GLU B 1 326 ? 50.825  13.275  3.850   1.00 23.05  ? 326 GLU B C     1 
ATOM   5825  O O     . GLU B 1 326 ? 51.899  13.246  3.259   1.00 24.51  ? 326 GLU B O     1 
ATOM   5826  C CB    . GLU B 1 326 ? 48.615  13.491  2.741   1.00 27.12  ? 326 GLU B CB    1 
ATOM   5827  C CG    . GLU B 1 326 ? 48.821  13.784  1.265   1.00 28.68  ? 326 GLU B CG    1 
ATOM   5828  C CD    . GLU B 1 326 ? 47.701  14.588  0.633   1.00 29.30  ? 326 GLU B CD    1 
ATOM   5829  O OE1   . GLU B 1 326 ? 46.554  14.136  0.620   1.00 33.83  ? 326 GLU B OE1   1 
ATOM   5830  O OE2   . GLU B 1 326 ? 47.983  15.667  0.128   1.00 31.76  ? 326 GLU B OE2   1 
ATOM   5831  H H     . GLU B 1 326 ? 48.184  11.861  4.613   1.00 0.00   ? 326 GLU B H     1 
ATOM   5832  N N     . PHE B 1 327 ? 50.688  13.907  5.020   1.00 23.01  ? 327 PHE B N     1 
ATOM   5833  C CA    . PHE B 1 327 ? 51.811  14.608  5.642   1.00 21.96  ? 327 PHE B CA    1 
ATOM   5834  C C     . PHE B 1 327 ? 53.000  13.672  5.845   1.00 22.11  ? 327 PHE B C     1 
ATOM   5835  O O     . PHE B 1 327 ? 54.127  13.987  5.447   1.00 21.92  ? 327 PHE B O     1 
ATOM   5836  C CB    . PHE B 1 327 ? 51.392  15.188  6.994   1.00 19.80  ? 327 PHE B CB    1 
ATOM   5837  C CG    . PHE B 1 327 ? 52.513  15.925  7.705   1.00 18.60  ? 327 PHE B CG    1 
ATOM   5838  C CD1   . PHE B 1 327 ? 52.827  17.211  7.327   1.00 17.28  ? 327 PHE B CD1   1 
ATOM   5839  C CD2   . PHE B 1 327 ? 53.292  15.257  8.630   1.00 19.74  ? 327 PHE B CD2   1 
ATOM   5840  C CE1   . PHE B 1 327 ? 53.974  17.799  7.814   1.00 22.33  ? 327 PHE B CE1   1 
ATOM   5841  C CE2   . PHE B 1 327 ? 54.441  15.854  9.106   1.00 23.00  ? 327 PHE B CE2   1 
ATOM   5842  C CZ    . PHE B 1 327 ? 54.791  17.117  8.691   1.00 21.32  ? 327 PHE B CZ    1 
ATOM   5843  H H     . PHE B 1 327 ? 49.815  13.882  5.468   1.00 0.00   ? 327 PHE B H     1 
ATOM   5844  N N     . LEU B 1 328 ? 52.787  12.501  6.436   1.00 22.80  ? 328 LEU B N     1 
ATOM   5845  C CA    . LEU B 1 328 ? 53.852  11.539  6.638   1.00 19.73  ? 328 LEU B CA    1 
ATOM   5846  C C     . LEU B 1 328 ? 54.617  11.201  5.364   1.00 23.26  ? 328 LEU B C     1 
ATOM   5847  O O     . LEU B 1 328 ? 55.857  11.134  5.382   1.00 25.47  ? 328 LEU B O     1 
ATOM   5848  C CB    . LEU B 1 328 ? 53.262  10.284  7.246   1.00 19.71  ? 328 LEU B CB    1 
ATOM   5849  C CG    . LEU B 1 328 ? 52.765  10.398  8.679   1.00 14.84  ? 328 LEU B CG    1 
ATOM   5850  C CD1   . LEU B 1 328 ? 52.368  9.030   9.185   1.00 13.36  ? 328 LEU B CD1   1 
ATOM   5851  C CD2   . LEU B 1 328 ? 53.873  10.894  9.584   1.00 13.24  ? 328 LEU B CD2   1 
ATOM   5852  H H     . LEU B 1 328 ? 51.875  12.284  6.729   1.00 0.00   ? 328 LEU B H     1 
ATOM   5853  N N     . LYS B 1 329 ? 53.930  11.072  4.234   1.00 26.00  ? 329 LYS B N     1 
ATOM   5854  C CA    . LYS B 1 329 ? 54.584  10.839  2.956   1.00 29.56  ? 329 LYS B CA    1 
ATOM   5855  C C     . LYS B 1 329 ? 55.478  12.022  2.563   1.00 29.30  ? 329 LYS B C     1 
ATOM   5856  O O     . LYS B 1 329 ? 56.577  11.759  2.083   1.00 31.41  ? 329 LYS B O     1 
ATOM   5857  C CB    . LYS B 1 329 ? 53.505  10.598  1.908   1.00 36.65  ? 329 LYS B CB    1 
ATOM   5858  C CG    . LYS B 1 329 ? 53.823  9.767   0.662   1.00 39.96  ? 329 LYS B CG    1 
ATOM   5859  C CD    . LYS B 1 329 ? 52.508  9.422   -0.056  1.00 49.20  ? 329 LYS B CD    1 
ATOM   5860  C CE    . LYS B 1 329 ? 51.583  8.564   0.848   1.00 57.52  ? 329 LYS B CE    1 
ATOM   5861  N NZ    . LYS B 1 329 ? 50.233  8.391   0.321   1.00 57.84  ? 329 LYS B NZ    1 
ATOM   5862  H H     . LYS B 1 329 ? 52.949  11.122  4.263   1.00 0.00   ? 329 LYS B H     1 
ATOM   5863  H HZ1   . LYS B 1 329 ? 49.793  9.325   0.192   1.00 0.00   ? 329 LYS B HZ1   1 
ATOM   5864  H HZ2   . LYS B 1 329 ? 50.277  7.899   -0.594  1.00 0.00   ? 329 LYS B HZ2   1 
ATOM   5865  H HZ3   . LYS B 1 329 ? 49.669  7.830   0.991   1.00 0.00   ? 329 LYS B HZ3   1 
ATOM   5866  N N     . VAL B 1 330 ? 55.172  13.317  2.723   1.00 28.47  ? 330 VAL B N     1 
ATOM   5867  C CA    . VAL B 1 330 ? 56.152  14.327  2.338   1.00 29.88  ? 330 VAL B CA    1 
ATOM   5868  C C     . VAL B 1 330 ? 57.241  14.407  3.407   1.00 32.31  ? 330 VAL B C     1 
ATOM   5869  O O     . VAL B 1 330 ? 58.351  14.874  3.134   1.00 34.63  ? 330 VAL B O     1 
ATOM   5870  C CB    . VAL B 1 330 ? 55.558  15.776  2.148   1.00 27.79  ? 330 VAL B CB    1 
ATOM   5871  C CG1   . VAL B 1 330 ? 54.529  15.741  1.047   1.00 19.14  ? 330 VAL B CG1   1 
ATOM   5872  C CG2   . VAL B 1 330 ? 54.912  16.304  3.408   1.00 36.44  ? 330 VAL B CG2   1 
ATOM   5873  H H     . VAL B 1 330 ? 54.307  13.566  3.122   1.00 0.00   ? 330 VAL B H     1 
ATOM   5874  N N     . TYR B 1 331 ? 56.968  13.965  4.638   1.00 35.45  ? 331 TYR B N     1 
ATOM   5875  C CA    . TYR B 1 331 ? 57.942  13.994  5.709   1.00 38.60  ? 331 TYR B CA    1 
ATOM   5876  C C     . TYR B 1 331 ? 59.032  13.001  5.353   1.00 44.24  ? 331 TYR B C     1 
ATOM   5877  O O     . TYR B 1 331 ? 60.203  13.369  5.210   1.00 46.92  ? 331 TYR B O     1 
ATOM   5878  C CB    . TYR B 1 331 ? 57.232  13.624  7.009   1.00 34.75  ? 331 TYR B CB    1 
ATOM   5879  C CG    . TYR B 1 331 ? 58.060  13.806  8.273   1.00 40.11  ? 331 TYR B CG    1 
ATOM   5880  C CD1   . TYR B 1 331 ? 58.270  15.059  8.831   1.00 40.71  ? 331 TYR B CD1   1 
ATOM   5881  C CD2   . TYR B 1 331 ? 58.586  12.685  8.881   1.00 45.28  ? 331 TYR B CD2   1 
ATOM   5882  C CE1   . TYR B 1 331 ? 58.989  15.189  10.007  1.00 43.32  ? 331 TYR B CE1   1 
ATOM   5883  C CE2   . TYR B 1 331 ? 59.320  12.806  10.044  1.00 46.88  ? 331 TYR B CE2   1 
ATOM   5884  C CZ    . TYR B 1 331 ? 59.504  14.051  10.606  1.00 47.25  ? 331 TYR B CZ    1 
ATOM   5885  O OH    . TYR B 1 331 ? 60.202  14.124  11.795  1.00 50.58  ? 331 TYR B OH    1 
ATOM   5886  H H     . TYR B 1 331 ? 56.060  13.645  4.826   1.00 0.00   ? 331 TYR B H     1 
ATOM   5887  H HH    . TYR B 1 331 ? 60.713  13.319  11.913  1.00 0.00   ? 331 TYR B HH    1 
ATOM   5888  N N     . GLU B 1 332 ? 58.650  11.752  5.091   1.00 51.36  ? 332 GLU B N     1 
ATOM   5889  C CA    . GLU B 1 332 ? 59.571  10.684  4.727   1.00 57.11  ? 332 GLU B CA    1 
ATOM   5890  C C     . GLU B 1 332 ? 60.274  10.922  3.397   1.00 57.89  ? 332 GLU B C     1 
ATOM   5891  O O     . GLU B 1 332 ? 61.289  10.315  3.075   1.00 59.85  ? 332 GLU B O     1 
ATOM   5892  C CB    . GLU B 1 332 ? 58.838  9.348   4.637   1.00 62.94  ? 332 GLU B CB    1 
ATOM   5893  C CG    . GLU B 1 332 ? 58.369  8.782   5.978   1.00 70.13  ? 332 GLU B CG    1 
ATOM   5894  C CD    . GLU B 1 332 ? 57.721  7.401   5.854   1.00 74.68  ? 332 GLU B CD    1 
ATOM   5895  O OE1   . GLU B 1 332 ? 58.435  6.414   5.645   1.00 77.63  ? 332 GLU B OE1   1 
ATOM   5896  O OE2   . GLU B 1 332 ? 56.496  7.310   5.978   1.00 76.97  ? 332 GLU B OE2   1 
ATOM   5897  H H     . GLU B 1 332 ? 57.700  11.536  5.136   1.00 0.00   ? 332 GLU B H     1 
ATOM   5898  N N     . LYS B 1 333 ? 59.771  11.853  2.603   1.00 58.97  ? 333 LYS B N     1 
ATOM   5899  C CA    . LYS B 1 333 ? 60.398  12.213  1.346   1.00 58.54  ? 333 LYS B CA    1 
ATOM   5900  C C     . LYS B 1 333 ? 61.380  13.354  1.651   1.00 58.95  ? 333 LYS B C     1 
ATOM   5901  O O     . LYS B 1 333 ? 61.689  14.192  0.803   1.00 58.35  ? 333 LYS B O     1 
ATOM   5902  C CB    . LYS B 1 333 ? 59.253  12.616  0.431   1.00 56.59  ? 333 LYS B CB    1 
ATOM   5903  C CG    . LYS B 1 333 ? 59.583  12.775  -1.023  1.00 57.93  ? 333 LYS B CG    1 
ATOM   5904  C CD    . LYS B 1 333 ? 59.134  14.155  -1.472  1.00 62.05  ? 333 LYS B CD    1 
ATOM   5905  C CE    . LYS B 1 333 ? 59.507  14.359  -2.937  1.00 65.42  ? 333 LYS B CE    1 
ATOM   5906  N NZ    . LYS B 1 333 ? 59.151  15.688  -3.391  1.00 66.15  ? 333 LYS B NZ    1 
ATOM   5907  H H     . LYS B 1 333 ? 58.932  12.295  2.857   1.00 0.00   ? 333 LYS B H     1 
ATOM   5908  H HZ1   . LYS B 1 333 ? 59.647  16.398  -2.815  1.00 0.00   ? 333 LYS B HZ1   1 
ATOM   5909  H HZ2   . LYS B 1 333 ? 59.423  15.800  -4.386  1.00 0.00   ? 333 LYS B HZ2   1 
ATOM   5910  H HZ3   . LYS B 1 333 ? 58.125  15.826  -3.287  1.00 0.00   ? 333 LYS B HZ3   1 
ATOM   5911  N N     . HIS B 1 334 ? 61.795  13.555  2.895   1.00 62.43  ? 334 HIS B N     1 
ATOM   5912  C CA    . HIS B 1 334 ? 62.740  14.596  3.303   1.00 68.33  ? 334 HIS B CA    1 
ATOM   5913  C C     . HIS B 1 334 ? 63.603  14.113  4.457   1.00 74.14  ? 334 HIS B C     1 
ATOM   5914  O O     . HIS B 1 334 ? 64.205  14.899  5.190   1.00 74.51  ? 334 HIS B O     1 
ATOM   5915  C CB    . HIS B 1 334 ? 61.991  15.878  3.746   1.00 64.18  ? 334 HIS B CB    1 
ATOM   5916  C CG    . HIS B 1 334 ? 61.612  16.743  2.561   1.00 59.35  ? 334 HIS B CG    1 
ATOM   5917  N ND1   . HIS B 1 334 ? 60.452  16.617  1.943   1.00 58.42  ? 334 HIS B ND1   1 
ATOM   5918  C CD2   . HIS B 1 334 ? 62.414  17.598  1.863   1.00 57.56  ? 334 HIS B CD2   1 
ATOM   5919  C CE1   . HIS B 1 334 ? 60.532  17.359  0.869   1.00 57.47  ? 334 HIS B CE1   1 
ATOM   5920  N NE2   . HIS B 1 334 ? 61.695  17.940  0.827   1.00 55.97  ? 334 HIS B NE2   1 
ATOM   5921  H H     . HIS B 1 334 ? 61.441  12.993  3.604   1.00 0.00   ? 334 HIS B H     1 
ATOM   5922  H HD1   . HIS B 1 334 ? 59.721  16.002  2.181   1.00 0.00   ? 334 HIS B HD1   1 
ATOM   5923  H HE2   . HIS B 1 334 ? 62.016  18.517  0.110   1.00 0.00   ? 334 HIS B HE2   1 
ATOM   5924  N N     . SER B 1 335 ? 63.673  12.794  4.556   1.00 81.39  ? 335 SER B N     1 
ATOM   5925  C CA    . SER B 1 335 ? 64.468  12.146  5.569   1.00 88.65  ? 335 SER B CA    1 
ATOM   5926  C C     . SER B 1 335 ? 65.228  11.006  4.838   1.00 92.23  ? 335 SER B C     1 
ATOM   5927  O O     . SER B 1 335 ? 65.703  10.090  5.518   1.00 95.60  ? 335 SER B O     1 
ATOM   5928  C CB    . SER B 1 335 ? 63.469  11.662  6.643   1.00 89.81  ? 335 SER B CB    1 
ATOM   5929  O OG    . SER B 1 335 ? 64.089  11.196  7.834   1.00 93.85  ? 335 SER B OG    1 
ATOM   5930  H H     . SER B 1 335 ? 63.344  12.187  3.870   1.00 0.00   ? 335 SER B H     1 
ATOM   5931  H HG    . SER B 1 335 ? 64.749  10.604  7.430   1.00 0.00   ? 335 SER B HG    1 
ATOM   5932  N N     . ASP C 1 9   ? 1.879   41.750  19.528  1.00 57.00  ? 9   ASP C N     1 
ATOM   5933  C CA    . ASP C 1 9   ? 3.321   41.859  19.437  1.00 57.06  ? 9   ASP C CA    1 
ATOM   5934  C C     . ASP C 1 9   ? 3.748   41.654  20.884  1.00 52.17  ? 9   ASP C C     1 
ATOM   5935  O O     . ASP C 1 9   ? 2.947   42.039  21.745  1.00 52.30  ? 9   ASP C O     1 
ATOM   5936  C CB    . ASP C 1 9   ? 3.791   43.261  18.997  1.00 61.39  ? 9   ASP C CB    1 
ATOM   5937  C CG    . ASP C 1 9   ? 3.324   43.770  17.635  1.00 64.50  ? 9   ASP C CG    1 
ATOM   5938  O OD1   . ASP C 1 9   ? 3.779   43.255  16.609  1.00 65.20  ? 9   ASP C OD1   1 
ATOM   5939  O OD2   . ASP C 1 9   ? 2.519   44.706  17.608  1.00 67.23  ? 9   ASP C OD2   1 
ATOM   5940  N N     . VAL C 1 10  ? 4.880   41.012  21.185  1.00 44.06  ? 10  VAL C N     1 
ATOM   5941  C CA    . VAL C 1 10  ? 5.435   40.991  22.544  1.00 35.48  ? 10  VAL C CA    1 
ATOM   5942  C C     . VAL C 1 10  ? 5.568   42.431  23.017  1.00 30.71  ? 10  VAL C C     1 
ATOM   5943  O O     . VAL C 1 10  ? 5.784   43.318  22.181  1.00 30.79  ? 10  VAL C O     1 
ATOM   5944  C CB    . VAL C 1 10  ? 6.881   40.447  22.669  1.00 33.19  ? 10  VAL C CB    1 
ATOM   5945  C CG1   . VAL C 1 10  ? 6.844   39.011  23.092  1.00 34.28  ? 10  VAL C CG1   1 
ATOM   5946  C CG2   . VAL C 1 10  ? 7.635   40.651  21.353  1.00 35.86  ? 10  VAL C CG2   1 
ATOM   5947  H H     . VAL C 1 10  ? 5.350   40.549  20.458  1.00 0.00   ? 10  VAL C H     1 
ATOM   5948  N N     . VAL C 1 11  ? 5.393   42.764  24.280  1.00 23.03  ? 11  VAL C N     1 
ATOM   5949  C CA    . VAL C 1 11  ? 5.802   44.101  24.684  1.00 23.86  ? 11  VAL C CA    1 
ATOM   5950  C C     . VAL C 1 11  ? 6.576   43.745  25.932  1.00 16.45  ? 11  VAL C C     1 
ATOM   5951  O O     . VAL C 1 11  ? 6.237   42.815  26.669  1.00 11.41  ? 11  VAL C O     1 
ATOM   5952  C CB    . VAL C 1 11  ? 4.642   45.100  25.060  1.00 25.39  ? 11  VAL C CB    1 
ATOM   5953  C CG1   . VAL C 1 11  ? 5.142   46.530  24.835  1.00 17.85  ? 11  VAL C CG1   1 
ATOM   5954  C CG2   . VAL C 1 11  ? 3.419   44.942  24.178  1.00 34.68  ? 11  VAL C CG2   1 
ATOM   5955  H H     . VAL C 1 11  ? 5.063   42.125  24.947  1.00 0.00   ? 11  VAL C H     1 
ATOM   5956  N N     . THR C 1 12  ? 7.683   44.428  26.109  1.00 13.35  ? 12  THR C N     1 
ATOM   5957  C CA    . THR C 1 12  ? 8.571   44.171  27.218  1.00 11.56  ? 12  THR C CA    1 
ATOM   5958  C C     . THR C 1 12  ? 8.414   45.344  28.175  1.00 9.82   ? 12  THR C C     1 
ATOM   5959  O O     . THR C 1 12  ? 7.904   46.391  27.758  1.00 13.88  ? 12  THR C O     1 
ATOM   5960  C CB    . THR C 1 12  ? 9.994   44.056  26.628  1.00 13.44  ? 12  THR C CB    1 
ATOM   5961  O OG1   . THR C 1 12  ? 10.263  45.270  25.934  1.00 9.69   ? 12  THR C OG1   1 
ATOM   5962  C CG2   . THR C 1 12  ? 10.137  42.938  25.599  1.00 12.80  ? 12  THR C CG2   1 
ATOM   5963  H H     . THR C 1 12  ? 7.903   45.179  25.520  1.00 0.00   ? 12  THR C H     1 
ATOM   5964  H HG1   . THR C 1 12  ? 11.223  45.303  25.798  1.00 0.00   ? 12  THR C HG1   1 
ATOM   5965  N N     . LEU C 1 13  ? 8.840   45.272  29.430  1.00 7.09   ? 13  LEU C N     1 
ATOM   5966  C CA    . LEU C 1 13  ? 8.744   46.400  30.333  1.00 8.52   ? 13  LEU C CA    1 
ATOM   5967  C C     . LEU C 1 13  ? 9.538   47.585  29.795  1.00 13.33  ? 13  LEU C C     1 
ATOM   5968  O O     . LEU C 1 13  ? 9.096   48.712  29.964  1.00 14.48  ? 13  LEU C O     1 
ATOM   5969  C CB    . LEU C 1 13  ? 9.236   45.925  31.700  1.00 5.35   ? 13  LEU C CB    1 
ATOM   5970  C CG    . LEU C 1 13  ? 9.168   46.767  32.957  1.00 2.00   ? 13  LEU C CG    1 
ATOM   5971  C CD1   . LEU C 1 13  ? 10.419  47.543  33.089  1.00 9.52   ? 13  LEU C CD1   1 
ATOM   5972  C CD2   . LEU C 1 13  ? 8.027   47.733  32.908  1.00 4.96   ? 13  LEU C CD2   1 
ATOM   5973  H H     . LEU C 1 13  ? 9.164   44.407  29.759  1.00 0.00   ? 13  LEU C H     1 
ATOM   5974  N N     . THR C 1 14  ? 10.702  47.403  29.153  1.00 18.56  ? 14  THR C N     1 
ATOM   5975  C CA    . THR C 1 14  ? 11.430  48.494  28.523  1.00 16.48  ? 14  THR C CA    1 
ATOM   5976  C C     . THR C 1 14  ? 10.661  49.187  27.389  1.00 18.18  ? 14  THR C C     1 
ATOM   5977  O O     . THR C 1 14  ? 10.504  50.411  27.428  1.00 16.50  ? 14  THR C O     1 
ATOM   5978  C CB    . THR C 1 14  ? 12.747  47.959  27.971  1.00 17.16  ? 14  THR C CB    1 
ATOM   5979  O OG1   . THR C 1 14  ? 13.360  47.139  28.969  1.00 25.10  ? 14  THR C OG1   1 
ATOM   5980  C CG2   . THR C 1 14  ? 13.685  49.104  27.622  1.00 12.38  ? 14  THR C CG2   1 
ATOM   5981  H H     . THR C 1 14  ? 11.146  46.529  29.196  1.00 0.00   ? 14  THR C H     1 
ATOM   5982  H HG1   . THR C 1 14  ? 14.191  46.831  28.566  1.00 0.00   ? 14  THR C HG1   1 
ATOM   5983  N N     . ARG C 1 15  ? 10.163  48.456  26.382  1.00 17.93  ? 15  ARG C N     1 
ATOM   5984  C CA    . ARG C 1 15  ? 9.414   49.054  25.291  1.00 17.12  ? 15  ARG C CA    1 
ATOM   5985  C C     . ARG C 1 15  ? 8.147   49.749  25.799  1.00 18.80  ? 15  ARG C C     1 
ATOM   5986  O O     . ARG C 1 15  ? 7.886   50.902  25.415  1.00 15.40  ? 15  ARG C O     1 
ATOM   5987  C CB    . ARG C 1 15  ? 9.098   47.945  24.286  1.00 19.49  ? 15  ARG C CB    1 
ATOM   5988  C CG    . ARG C 1 15  ? 8.244   48.372  23.092  1.00 24.38  ? 15  ARG C CG    1 
ATOM   5989  C CD    . ARG C 1 15  ? 8.648   47.655  21.815  1.00 27.56  ? 15  ARG C CD    1 
ATOM   5990  N NE    . ARG C 1 15  ? 8.211   46.274  21.723  1.00 27.73  ? 15  ARG C NE    1 
ATOM   5991  C CZ    . ARG C 1 15  ? 8.613   45.495  20.708  1.00 30.76  ? 15  ARG C CZ    1 
ATOM   5992  N NH1   . ARG C 1 15  ? 9.505   45.908  19.802  1.00 32.10  ? 15  ARG C NH1   1 
ATOM   5993  N NH2   . ARG C 1 15  ? 8.151   44.254  20.604  1.00 29.88  ? 15  ARG C NH2   1 
ATOM   5994  H H     . ARG C 1 15  ? 10.357  47.495  26.334  1.00 0.00   ? 15  ARG C H     1 
ATOM   5995  H HE    . ARG C 1 15  ? 7.619   45.905  22.411  1.00 0.00   ? 15  ARG C HE    1 
ATOM   5996  H HH11  . ARG C 1 15  ? 9.904   46.823  19.861  1.00 0.00   ? 15  ARG C HH11  1 
ATOM   5997  H HH12  . ARG C 1 15  ? 9.777   45.296  19.059  1.00 0.00   ? 15  ARG C HH12  1 
ATOM   5998  H HH21  . ARG C 1 15  ? 7.509   43.901  21.283  1.00 0.00   ? 15  ARG C HH21  1 
ATOM   5999  H HH22  . ARG C 1 15  ? 8.454   43.673  19.849  1.00 0.00   ? 15  ARG C HH22  1 
ATOM   6000  N N     . PHE C 1 16  ? 7.404   49.114  26.732  1.00 16.89  ? 16  PHE C N     1 
ATOM   6001  C CA    . PHE C 1 16  ? 6.185   49.709  27.293  1.00 16.51  ? 16  PHE C CA    1 
ATOM   6002  C C     . PHE C 1 16  ? 6.442   51.037  28.023  1.00 14.89  ? 16  PHE C C     1 
ATOM   6003  O O     . PHE C 1 16  ? 5.715   52.009  27.798  1.00 15.12  ? 16  PHE C O     1 
ATOM   6004  C CB    . PHE C 1 16  ? 5.506   48.689  28.254  1.00 16.19  ? 16  PHE C CB    1 
ATOM   6005  C CG    . PHE C 1 16  ? 4.315   49.189  29.092  1.00 15.69  ? 16  PHE C CG    1 
ATOM   6006  C CD1   . PHE C 1 16  ? 3.048   49.204  28.557  1.00 16.29  ? 16  PHE C CD1   1 
ATOM   6007  C CD2   . PHE C 1 16  ? 4.510   49.651  30.392  1.00 18.23  ? 16  PHE C CD2   1 
ATOM   6008  C CE1   . PHE C 1 16  ? 1.992   49.678  29.315  1.00 18.99  ? 16  PHE C CE1   1 
ATOM   6009  C CE2   . PHE C 1 16  ? 3.458   50.142  31.141  1.00 18.06  ? 16  PHE C CE2   1 
ATOM   6010  C CZ    . PHE C 1 16  ? 2.192   50.148  30.598  1.00 16.82  ? 16  PHE C CZ    1 
ATOM   6011  H H     . PHE C 1 16  ? 7.702   48.237  27.050  1.00 0.00   ? 16  PHE C H     1 
ATOM   6012  N N     . VAL C 1 17  ? 7.448   51.126  28.902  1.00 14.94  ? 17  VAL C N     1 
ATOM   6013  C CA    . VAL C 1 17  ? 7.741   52.346  29.637  1.00 13.55  ? 17  VAL C CA    1 
ATOM   6014  C C     . VAL C 1 17  ? 8.168   53.453  28.693  1.00 14.82  ? 17  VAL C C     1 
ATOM   6015  O O     . VAL C 1 17  ? 7.755   54.588  28.925  1.00 16.74  ? 17  VAL C O     1 
ATOM   6016  C CB    . VAL C 1 17  ? 8.842   52.062  30.686  1.00 10.47  ? 17  VAL C CB    1 
ATOM   6017  C CG1   . VAL C 1 17  ? 9.365   53.333  31.334  1.00 17.10  ? 17  VAL C CG1   1 
ATOM   6018  C CG2   . VAL C 1 17  ? 8.234   51.263  31.809  1.00 8.30   ? 17  VAL C CG2   1 
ATOM   6019  H H     . VAL C 1 17  ? 7.994   50.326  29.072  1.00 0.00   ? 17  VAL C H     1 
ATOM   6020  N N     . MET C 1 18  ? 8.950   53.164  27.639  1.00 17.17  ? 18  MET C N     1 
ATOM   6021  C CA    . MET C 1 18  ? 9.373   54.169  26.672  1.00 18.63  ? 18  MET C CA    1 
ATOM   6022  C C     . MET C 1 18  ? 8.156   54.766  26.024  1.00 20.62  ? 18  MET C C     1 
ATOM   6023  O O     . MET C 1 18  ? 8.003   55.988  25.984  1.00 23.32  ? 18  MET C O     1 
ATOM   6024  C CB    . MET C 1 18  ? 10.195  53.627  25.524  1.00 17.77  ? 18  MET C CB    1 
ATOM   6025  C CG    . MET C 1 18  ? 11.563  54.275  25.349  1.00 24.28  ? 18  MET C CG    1 
ATOM   6026  S SD    . MET C 1 18  ? 11.678  56.064  25.646  1.00 29.67  ? 18  MET C SD    1 
ATOM   6027  C CE    . MET C 1 18  ? 12.121  56.735  24.076  1.00 21.03  ? 18  MET C CE    1 
ATOM   6028  H H     . MET C 1 18  ? 9.258   52.240  27.520  1.00 0.00   ? 18  MET C H     1 
ATOM   6029  N N     . GLU C 1 19  ? 7.250   53.918  25.543  1.00 20.69  ? 19  GLU C N     1 
ATOM   6030  C CA    . GLU C 1 19  ? 6.071   54.421  24.884  1.00 21.92  ? 19  GLU C CA    1 
ATOM   6031  C C     . GLU C 1 19  ? 5.241   55.293  25.808  1.00 23.41  ? 19  GLU C C     1 
ATOM   6032  O O     . GLU C 1 19  ? 4.909   56.424  25.438  1.00 24.11  ? 19  GLU C O     1 
ATOM   6033  C CB    . GLU C 1 19  ? 5.294   53.232  24.362  1.00 22.38  ? 19  GLU C CB    1 
ATOM   6034  C CG    . GLU C 1 19  ? 4.893   53.473  22.903  1.00 31.27  ? 19  GLU C CG    1 
ATOM   6035  C CD    . GLU C 1 19  ? 5.995   53.845  21.895  1.00 35.82  ? 19  GLU C CD    1 
ATOM   6036  O OE1   . GLU C 1 19  ? 7.124   53.353  21.995  1.00 40.88  ? 19  GLU C OE1   1 
ATOM   6037  O OE2   . GLU C 1 19  ? 5.709   54.628  20.983  1.00 34.52  ? 19  GLU C OE2   1 
ATOM   6038  H H     . GLU C 1 19  ? 7.421   52.950  25.577  1.00 0.00   ? 19  GLU C H     1 
ATOM   6039  N N     . GLU C 1 20  ? 4.966   54.862  27.042  1.00 24.81  ? 20  GLU C N     1 
ATOM   6040  C CA    . GLU C 1 20  ? 4.268   55.702  28.014  1.00 22.21  ? 20  GLU C CA    1 
ATOM   6041  C C     . GLU C 1 20  ? 4.964   57.039  28.212  1.00 21.89  ? 20  GLU C C     1 
ATOM   6042  O O     . GLU C 1 20  ? 4.327   58.095  28.251  1.00 15.15  ? 20  GLU C O     1 
ATOM   6043  C CB    . GLU C 1 20  ? 4.170   54.982  29.354  1.00 24.19  ? 20  GLU C CB    1 
ATOM   6044  C CG    . GLU C 1 20  ? 3.283   53.745  29.265  1.00 23.89  ? 20  GLU C CG    1 
ATOM   6045  C CD    . GLU C 1 20  ? 1.917   54.005  28.628  1.00 29.28  ? 20  GLU C CD    1 
ATOM   6046  O OE1   . GLU C 1 20  ? 1.138   54.777  29.183  1.00 28.35  ? 20  GLU C OE1   1 
ATOM   6047  O OE2   . GLU C 1 20  ? 1.642   53.440  27.567  1.00 30.57  ? 20  GLU C OE2   1 
ATOM   6048  H H     . GLU C 1 20  ? 5.245   53.953  27.292  1.00 0.00   ? 20  GLU C H     1 
ATOM   6049  N N     . GLY C 1 21  ? 6.293   56.970  28.231  1.00 21.10  ? 21  GLY C N     1 
ATOM   6050  C CA    . GLY C 1 21  ? 7.158   58.125  28.335  1.00 19.66  ? 21  GLY C CA    1 
ATOM   6051  C C     . GLY C 1 21  ? 6.930   59.091  27.204  1.00 19.46  ? 21  GLY C C     1 
ATOM   6052  O O     . GLY C 1 21  ? 6.747   60.280  27.454  1.00 24.55  ? 21  GLY C O     1 
ATOM   6053  H H     . GLY C 1 21  ? 6.728   56.093  28.160  1.00 0.00   ? 21  GLY C H     1 
ATOM   6054  N N     . ARG C 1 22  ? 6.861   58.617  25.967  1.00 20.88  ? 22  ARG C N     1 
ATOM   6055  C CA    . ARG C 1 22  ? 6.698   59.508  24.825  1.00 19.98  ? 22  ARG C CA    1 
ATOM   6056  C C     . ARG C 1 22  ? 5.283   60.055  24.780  1.00 23.09  ? 22  ARG C C     1 
ATOM   6057  O O     . ARG C 1 22  ? 5.070   61.217  24.427  1.00 23.22  ? 22  ARG C O     1 
ATOM   6058  C CB    . ARG C 1 22  ? 7.008   58.756  23.542  1.00 20.00  ? 22  ARG C CB    1 
ATOM   6059  C CG    . ARG C 1 22  ? 8.438   58.252  23.473  1.00 14.02  ? 22  ARG C CG    1 
ATOM   6060  C CD    . ARG C 1 22  ? 8.597   57.170  22.414  1.00 22.66  ? 22  ARG C CD    1 
ATOM   6061  N NE    . ARG C 1 22  ? 8.425   57.676  21.058  1.00 30.89  ? 22  ARG C NE    1 
ATOM   6062  C CZ    . ARG C 1 22  ? 8.363   56.870  19.990  1.00 35.07  ? 22  ARG C CZ    1 
ATOM   6063  N NH1   . ARG C 1 22  ? 8.393   55.540  20.094  1.00 40.75  ? 22  ARG C NH1   1 
ATOM   6064  N NH2   . ARG C 1 22  ? 8.254   57.402  18.775  1.00 36.30  ? 22  ARG C NH2   1 
ATOM   6065  H H     . ARG C 1 22  ? 6.927   57.648  25.831  1.00 0.00   ? 22  ARG C H     1 
ATOM   6066  H HE    . ARG C 1 22  ? 8.359   58.645  20.918  1.00 0.00   ? 22  ARG C HE    1 
ATOM   6067  H HH11  . ARG C 1 22  ? 8.455   55.103  20.991  1.00 0.00   ? 22  ARG C HH11  1 
ATOM   6068  H HH12  . ARG C 1 22  ? 8.350   54.978  19.268  1.00 0.00   ? 22  ARG C HH12  1 
ATOM   6069  H HH21  . ARG C 1 22  ? 8.226   58.395  18.661  1.00 0.00   ? 22  ARG C HH21  1 
ATOM   6070  H HH22  . ARG C 1 22  ? 8.221   56.806  17.972  1.00 0.00   ? 22  ARG C HH22  1 
ATOM   6071  N N     . LYS C 1 23  ? 4.294   59.271  25.186  1.00 22.87  ? 23  LYS C N     1 
ATOM   6072  C CA    . LYS C 1 23  ? 2.948   59.796  25.230  1.00 27.12  ? 23  LYS C CA    1 
ATOM   6073  C C     . LYS C 1 23  ? 2.876   60.891  26.260  1.00 30.14  ? 23  LYS C C     1 
ATOM   6074  O O     . LYS C 1 23  ? 2.257   61.920  26.020  1.00 36.40  ? 23  LYS C O     1 
ATOM   6075  C CB    . LYS C 1 23  ? 1.938   58.767  25.626  1.00 25.29  ? 23  LYS C CB    1 
ATOM   6076  C CG    . LYS C 1 23  ? 1.686   57.759  24.544  1.00 31.90  ? 23  LYS C CG    1 
ATOM   6077  C CD    . LYS C 1 23  ? 0.835   56.709  25.209  1.00 41.79  ? 23  LYS C CD    1 
ATOM   6078  C CE    . LYS C 1 23  ? 0.639   55.518  24.304  1.00 47.65  ? 23  LYS C CE    1 
ATOM   6079  N NZ    . LYS C 1 23  ? 0.079   54.431  25.083  1.00 54.82  ? 23  LYS C NZ    1 
ATOM   6080  H H     . LYS C 1 23  ? 4.479   58.342  25.435  1.00 0.00   ? 23  LYS C H     1 
ATOM   6081  H HZ1   . LYS C 1 23  ? -0.819  54.734  25.511  1.00 0.00   ? 23  LYS C HZ1   1 
ATOM   6082  H HZ2   . LYS C 1 23  ? -0.091  53.614  24.462  1.00 0.00   ? 23  LYS C HZ2   1 
ATOM   6083  H HZ3   . LYS C 1 23  ? 0.747   54.162  25.832  1.00 0.00   ? 23  LYS C HZ3   1 
ATOM   6084  N N     . ALA C 1 24  ? 3.525   60.719  27.404  1.00 32.10  ? 24  ALA C N     1 
ATOM   6085  C CA    . ALA C 1 24  ? 3.449   61.711  28.456  1.00 32.50  ? 24  ALA C CA    1 
ATOM   6086  C C     . ALA C 1 24  ? 4.293   62.956  28.232  1.00 36.11  ? 24  ALA C C     1 
ATOM   6087  O O     . ALA C 1 24  ? 4.238   63.892  29.026  1.00 37.77  ? 24  ALA C O     1 
ATOM   6088  C CB    . ALA C 1 24  ? 3.867   61.071  29.744  1.00 31.39  ? 24  ALA C CB    1 
ATOM   6089  H H     . ALA C 1 24  ? 4.067   59.913  27.535  1.00 0.00   ? 24  ALA C H     1 
ATOM   6090  N N     . ARG C 1 25  ? 5.084   62.974  27.158  1.00 38.67  ? 25  ARG C N     1 
ATOM   6091  C CA    . ARG C 1 25  ? 5.987   64.060  26.822  1.00 43.58  ? 25  ARG C CA    1 
ATOM   6092  C C     . ARG C 1 25  ? 6.930   64.460  27.958  1.00 42.67  ? 25  ARG C C     1 
ATOM   6093  O O     . ARG C 1 25  ? 7.285   65.630  28.148  1.00 46.16  ? 25  ARG C O     1 
ATOM   6094  C CB    . ARG C 1 25  ? 5.137   65.246  26.340  1.00 48.66  ? 25  ARG C CB    1 
ATOM   6095  C CG    . ARG C 1 25  ? 4.528   64.931  24.979  1.00 62.35  ? 25  ARG C CG    1 
ATOM   6096  C CD    . ARG C 1 25  ? 3.613   66.051  24.506  1.00 73.54  ? 25  ARG C CD    1 
ATOM   6097  N NE    . ARG C 1 25  ? 3.162   65.828  23.134  1.00 84.23  ? 25  ARG C NE    1 
ATOM   6098  C CZ    . ARG C 1 25  ? 2.282   66.634  22.507  1.00 86.71  ? 25  ARG C CZ    1 
ATOM   6099  N NH1   . ARG C 1 25  ? 1.735   67.694  23.111  1.00 87.48  ? 25  ARG C NH1   1 
ATOM   6100  N NH2   . ARG C 1 25  ? 1.932   66.369  21.243  1.00 86.60  ? 25  ARG C NH2   1 
ATOM   6101  H H     . ARG C 1 25  ? 5.031   62.224  26.532  1.00 0.00   ? 25  ARG C H     1 
ATOM   6102  H HE    . ARG C 1 25  ? 3.515   65.056  22.644  1.00 0.00   ? 25  ARG C HE    1 
ATOM   6103  H HH11  . ARG C 1 25  ? 1.975   67.916  24.056  1.00 0.00   ? 25  ARG C HH11  1 
ATOM   6104  H HH12  . ARG C 1 25  ? 1.090   68.270  22.612  1.00 0.00   ? 25  ARG C HH12  1 
ATOM   6105  H HH21  . ARG C 1 25  ? 2.327   65.580  20.773  1.00 0.00   ? 25  ARG C HH21  1 
ATOM   6106  H HH22  . ARG C 1 25  ? 1.284   66.962  20.768  1.00 0.00   ? 25  ARG C HH22  1 
ATOM   6107  N N     . GLY C 1 26  ? 7.372   63.438  28.690  1.00 38.79  ? 26  GLY C N     1 
ATOM   6108  C CA    . GLY C 1 26  ? 8.285   63.617  29.808  1.00 37.49  ? 26  GLY C CA    1 
ATOM   6109  C C     . GLY C 1 26  ? 9.704   63.898  29.314  1.00 35.26  ? 26  GLY C C     1 
ATOM   6110  O O     . GLY C 1 26  ? 10.008  63.730  28.123  1.00 33.37  ? 26  GLY C O     1 
ATOM   6111  H H     . GLY C 1 26  ? 7.123   62.531  28.427  1.00 0.00   ? 26  GLY C H     1 
ATOM   6112  N N     . THR C 1 27  ? 10.613  64.307  30.194  1.00 30.70  ? 27  THR C N     1 
ATOM   6113  C CA    . THR C 1 27  ? 11.957  64.600  29.753  1.00 27.02  ? 27  THR C CA    1 
ATOM   6114  C C     . THR C 1 27  ? 12.812  63.349  29.715  1.00 27.00  ? 27  THR C C     1 
ATOM   6115  O O     . THR C 1 27  ? 13.925  63.329  29.175  1.00 30.13  ? 27  THR C O     1 
ATOM   6116  C CB    . THR C 1 27  ? 12.600  65.655  30.671  1.00 24.80  ? 27  THR C CB    1 
ATOM   6117  O OG1   . THR C 1 27  ? 12.544  65.242  32.025  1.00 21.16  ? 27  THR C OG1   1 
ATOM   6118  C CG2   . THR C 1 27  ? 11.915  66.987  30.445  1.00 22.51  ? 27  THR C CG2   1 
ATOM   6119  H H     . THR C 1 27  ? 10.407  64.258  31.159  1.00 0.00   ? 27  THR C H     1 
ATOM   6120  H HG1   . THR C 1 27  ? 11.658  64.914  32.316  1.00 0.00   ? 27  THR C HG1   1 
ATOM   6121  N N     . GLY C 1 28  ? 12.295  62.280  30.303  1.00 27.19  ? 28  GLY C N     1 
ATOM   6122  C CA    . GLY C 1 28  ? 12.998  61.021  30.342  1.00 24.23  ? 28  GLY C CA    1 
ATOM   6123  C C     . GLY C 1 28  ? 13.551  60.732  31.730  1.00 21.69  ? 28  GLY C C     1 
ATOM   6124  O O     . GLY C 1 28  ? 14.199  59.692  31.895  1.00 23.18  ? 28  GLY C O     1 
ATOM   6125  H H     . GLY C 1 28  ? 11.488  62.407  30.864  1.00 0.00   ? 28  GLY C H     1 
ATOM   6126  N N     . GLU C 1 29  ? 13.226  61.532  32.751  1.00 19.72  ? 29  GLU C N     1 
ATOM   6127  C CA    . GLU C 1 29  ? 13.762  61.335  34.081  1.00 15.89  ? 29  GLU C CA    1 
ATOM   6128  C C     . GLU C 1 29  ? 13.120  60.109  34.675  1.00 16.00  ? 29  GLU C C     1 
ATOM   6129  O O     . GLU C 1 29  ? 13.791  59.161  35.101  1.00 12.40  ? 29  GLU C O     1 
ATOM   6130  C CB    . GLU C 1 29  ? 13.442  62.482  34.973  1.00 15.56  ? 29  GLU C CB    1 
ATOM   6131  C CG    . GLU C 1 29  ? 14.575  63.455  34.992  1.00 18.84  ? 29  GLU C CG    1 
ATOM   6132  C CD    . GLU C 1 29  ? 14.730  64.174  36.321  1.00 22.31  ? 29  GLU C CD    1 
ATOM   6133  O OE1   . GLU C 1 29  ? 14.471  63.583  37.368  1.00 24.70  ? 29  GLU C OE1   1 
ATOM   6134  O OE2   . GLU C 1 29  ? 15.152  65.328  36.305  1.00 28.90  ? 29  GLU C OE2   1 
ATOM   6135  H H     . GLU C 1 29  ? 12.492  62.197  32.658  1.00 0.00   ? 29  GLU C H     1 
ATOM   6136  N N     . LEU C 1 30  ? 11.795  60.089  34.641  1.00 13.74  ? 30  LEU C N     1 
ATOM   6137  C CA    . LEU C 1 30  ? 11.087  58.944  35.159  1.00 14.03  ? 30  LEU C CA    1 
ATOM   6138  C C     . LEU C 1 30  ? 11.424  57.720  34.317  1.00 15.74  ? 30  LEU C C     1 
ATOM   6139  O O     . LEU C 1 30  ? 11.754  56.688  34.914  1.00 15.17  ? 30  LEU C O     1 
ATOM   6140  C CB    . LEU C 1 30  ? 9.561   59.198  35.162  1.00 12.44  ? 30  LEU C CB    1 
ATOM   6141  C CG    . LEU C 1 30  ? 8.651   58.202  35.907  1.00 9.19   ? 30  LEU C CG    1 
ATOM   6142  C CD1   . LEU C 1 30  ? 9.006   58.133  37.377  1.00 6.43   ? 30  LEU C CD1   1 
ATOM   6143  C CD2   . LEU C 1 30  ? 7.216   58.655  35.792  1.00 2.82   ? 30  LEU C CD2   1 
ATOM   6144  H H     . LEU C 1 30  ? 11.305  60.918  34.380  1.00 0.00   ? 30  LEU C H     1 
ATOM   6145  N N     . THR C 1 31  ? 11.470  57.782  32.980  1.00 13.26  ? 31  THR C N     1 
ATOM   6146  C CA    . THR C 1 31  ? 11.791  56.586  32.209  1.00 15.03  ? 31  THR C CA    1 
ATOM   6147  C C     . THR C 1 31  ? 13.141  56.021  32.630  1.00 17.30  ? 31  THR C C     1 
ATOM   6148  O O     . THR C 1 31  ? 13.258  54.802  32.798  1.00 18.14  ? 31  THR C O     1 
ATOM   6149  C CB    . THR C 1 31  ? 11.780  56.928  30.719  1.00 14.97  ? 31  THR C CB    1 
ATOM   6150  O OG1   . THR C 1 31  ? 10.408  57.096  30.380  1.00 14.37  ? 31  THR C OG1   1 
ATOM   6151  C CG2   . THR C 1 31  ? 12.361  55.870  29.831  1.00 7.64   ? 31  THR C CG2   1 
ATOM   6152  H H     . THR C 1 31  ? 11.317  58.645  32.547  1.00 0.00   ? 31  THR C H     1 
ATOM   6153  H HG1   . THR C 1 31  ? 10.010  57.840  30.835  1.00 0.00   ? 31  THR C HG1   1 
ATOM   6154  N N     . GLN C 1 32  ? 14.138  56.888  32.893  1.00 17.55  ? 32  GLN C N     1 
ATOM   6155  C CA    . GLN C 1 32  ? 15.439  56.422  33.355  1.00 14.77  ? 32  GLN C CA    1 
ATOM   6156  C C     . GLN C 1 32  ? 15.313  55.814  34.728  1.00 11.66  ? 32  GLN C C     1 
ATOM   6157  O O     . GLN C 1 32  ? 15.897  54.760  34.947  1.00 17.40  ? 32  GLN C O     1 
ATOM   6158  C CB    . GLN C 1 32  ? 16.458  57.546  33.435  1.00 15.31  ? 32  GLN C CB    1 
ATOM   6159  C CG    . GLN C 1 32  ? 17.001  57.946  32.086  1.00 17.59  ? 32  GLN C CG    1 
ATOM   6160  C CD    . GLN C 1 32  ? 18.024  56.966  31.546  1.00 20.53  ? 32  GLN C CD    1 
ATOM   6161  O OE1   . GLN C 1 32  ? 19.170  57.343  31.316  1.00 28.73  ? 32  GLN C OE1   1 
ATOM   6162  N NE2   . GLN C 1 32  ? 17.718  55.706  31.268  1.00 19.50  ? 32  GLN C NE2   1 
ATOM   6163  H H     . GLN C 1 32  ? 13.996  57.855  32.805  1.00 0.00   ? 32  GLN C H     1 
ATOM   6164  H HE21  . GLN C 1 32  ? 18.446  55.167  30.908  1.00 0.00   ? 32  GLN C HE21  1 
ATOM   6165  H HE22  . GLN C 1 32  ? 16.811  55.361  31.400  1.00 0.00   ? 32  GLN C HE22  1 
ATOM   6166  N N     . LEU C 1 33  ? 14.509  56.373  35.627  1.00 9.96   ? 33  LEU C N     1 
ATOM   6167  C CA    . LEU C 1 33  ? 14.323  55.790  36.944  1.00 10.65  ? 33  LEU C CA    1 
ATOM   6168  C C     . LEU C 1 33  ? 13.649  54.421  36.859  1.00 10.51  ? 33  LEU C C     1 
ATOM   6169  O O     . LEU C 1 33  ? 14.034  53.488  37.567  1.00 10.25  ? 33  LEU C O     1 
ATOM   6170  C CB    . LEU C 1 33  ? 13.525  56.801  37.750  1.00 4.78   ? 33  LEU C CB    1 
ATOM   6171  C CG    . LEU C 1 33  ? 12.712  56.462  38.977  1.00 10.69  ? 33  LEU C CG    1 
ATOM   6172  C CD1   . LEU C 1 33  ? 13.482  55.688  39.993  1.00 11.64  ? 33  LEU C CD1   1 
ATOM   6173  C CD2   . LEU C 1 33  ? 12.297  57.761  39.594  1.00 6.71   ? 33  LEU C CD2   1 
ATOM   6174  H H     . LEU C 1 33  ? 14.054  57.210  35.405  1.00 0.00   ? 33  LEU C H     1 
ATOM   6175  N N     . LEU C 1 34  ? 12.680  54.219  35.971  1.00 11.58  ? 34  LEU C N     1 
ATOM   6176  C CA    . LEU C 1 34  ? 12.012  52.942  35.859  1.00 10.06  ? 34  LEU C CA    1 
ATOM   6177  C C     . LEU C 1 34  ? 12.898  51.899  35.186  1.00 10.74  ? 34  LEU C C     1 
ATOM   6178  O O     . LEU C 1 34  ? 12.866  50.706  35.529  1.00 14.46  ? 34  LEU C O     1 
ATOM   6179  C CB    . LEU C 1 34  ? 10.704  53.152  35.101  1.00 5.44   ? 34  LEU C CB    1 
ATOM   6180  C CG    . LEU C 1 34  ? 9.604   53.941  35.811  1.00 6.30   ? 34  LEU C CG    1 
ATOM   6181  C CD1   . LEU C 1 34  ? 8.359   53.986  34.918  1.00 5.81   ? 34  LEU C CD1   1 
ATOM   6182  C CD2   . LEU C 1 34  ? 9.260   53.287  37.144  1.00 2.00   ? 34  LEU C CD2   1 
ATOM   6183  H H     . LEU C 1 34  ? 12.425  54.958  35.383  1.00 0.00   ? 34  LEU C H     1 
ATOM   6184  N N     . ASN C 1 35  ? 13.761  52.340  34.275  1.00 10.48  ? 35  ASN C N     1 
ATOM   6185  C CA    . ASN C 1 35  ? 14.730  51.448  33.652  1.00 10.57  ? 35  ASN C CA    1 
ATOM   6186  C C     . ASN C 1 35  ? 15.694  50.984  34.735  1.00 9.25   ? 35  ASN C C     1 
ATOM   6187  O O     . ASN C 1 35  ? 15.978  49.789  34.841  1.00 9.94   ? 35  ASN C O     1 
ATOM   6188  C CB    . ASN C 1 35  ? 15.534  52.152  32.566  1.00 6.59   ? 35  ASN C CB    1 
ATOM   6189  C CG    . ASN C 1 35  ? 14.856  52.360  31.210  1.00 8.01   ? 35  ASN C CG    1 
ATOM   6190  O OD1   . ASN C 1 35  ? 15.262  53.261  30.461  1.00 9.03   ? 35  ASN C OD1   1 
ATOM   6191  N ND2   . ASN C 1 35  ? 13.868  51.583  30.776  1.00 4.17   ? 35  ASN C ND2   1 
ATOM   6192  H H     . ASN C 1 35  ? 13.745  53.289  34.021  1.00 0.00   ? 35  ASN C H     1 
ATOM   6193  H HD21  . ASN C 1 35  ? 13.492  51.819  29.902  1.00 0.00   ? 35  ASN C HD21  1 
ATOM   6194  H HD22  . ASN C 1 35  ? 13.568  50.818  31.318  1.00 0.00   ? 35  ASN C HD22  1 
ATOM   6195  N N     . SER C 1 36  ? 16.168  51.881  35.602  1.00 8.78   ? 36  SER C N     1 
ATOM   6196  C CA    . SER C 1 36  ? 17.056  51.533  36.710  1.00 11.62  ? 36  SER C CA    1 
ATOM   6197  C C     . SER C 1 36  ? 16.473  50.523  37.681  1.00 9.61   ? 36  SER C C     1 
ATOM   6198  O O     . SER C 1 36  ? 17.119  49.568  38.130  1.00 11.57  ? 36  SER C O     1 
ATOM   6199  C CB    . SER C 1 36  ? 17.420  52.790  37.481  1.00 9.20   ? 36  SER C CB    1 
ATOM   6200  O OG    . SER C 1 36  ? 18.133  53.695  36.652  1.00 16.57  ? 36  SER C OG    1 
ATOM   6201  H H     . SER C 1 36  ? 15.978  52.836  35.471  1.00 0.00   ? 36  SER C H     1 
ATOM   6202  H HG    . SER C 1 36  ? 18.996  53.313  36.486  1.00 0.00   ? 36  SER C HG    1 
ATOM   6203  N N     . LEU C 1 37  ? 15.211  50.728  37.998  1.00 11.81  ? 37  LEU C N     1 
ATOM   6204  C CA    . LEU C 1 37  ? 14.505  49.858  38.904  1.00 11.79  ? 37  LEU C CA    1 
ATOM   6205  C C     . LEU C 1 37  ? 14.353  48.483  38.295  1.00 12.85  ? 37  LEU C C     1 
ATOM   6206  O O     . LEU C 1 37  ? 14.543  47.478  38.983  1.00 13.99  ? 37  LEU C O     1 
ATOM   6207  C CB    . LEU C 1 37  ? 13.203  50.505  39.159  1.00 10.46  ? 37  LEU C CB    1 
ATOM   6208  C CG    . LEU C 1 37  ? 12.576  50.275  40.489  1.00 12.58  ? 37  LEU C CG    1 
ATOM   6209  C CD1   . LEU C 1 37  ? 13.507  50.480  41.672  1.00 9.46   ? 37  LEU C CD1   1 
ATOM   6210  C CD2   . LEU C 1 37  ? 11.459  51.275  40.522  1.00 10.27  ? 37  LEU C CD2   1 
ATOM   6211  H H     . LEU C 1 37  ? 14.754  51.520  37.634  1.00 0.00   ? 37  LEU C H     1 
ATOM   6212  N N     . CYS C 1 38  ? 14.085  48.427  36.991  1.00 12.12  ? 38  CYS C N     1 
ATOM   6213  C CA    . CYS C 1 38  ? 13.980  47.161  36.285  1.00 16.56  ? 38  CYS C CA    1 
ATOM   6214  C C     . CYS C 1 38  ? 15.269  46.365  36.474  1.00 16.26  ? 38  CYS C C     1 
ATOM   6215  O O     . CYS C 1 38  ? 15.222  45.216  36.930  1.00 19.25  ? 38  CYS C O     1 
ATOM   6216  C CB    . CYS C 1 38  ? 13.701  47.453  34.790  1.00 21.54  ? 38  CYS C CB    1 
ATOM   6217  S SG    . CYS C 1 38  ? 13.716  46.115  33.546  1.00 23.38  ? 38  CYS C SG    1 
ATOM   6218  H H     . CYS C 1 38  ? 13.925  49.260  36.499  1.00 0.00   ? 38  CYS C H     1 
ATOM   6219  N N     . THR C 1 39  ? 16.447  46.953  36.227  1.00 14.01  ? 39  THR C N     1 
ATOM   6220  C CA    . THR C 1 39  ? 17.702  46.222  36.366  1.00 12.54  ? 39  THR C CA    1 
ATOM   6221  C C     . THR C 1 39  ? 17.891  45.739  37.810  1.00 11.84  ? 39  THR C C     1 
ATOM   6222  O O     . THR C 1 39  ? 18.136  44.540  38.026  1.00 14.23  ? 39  THR C O     1 
ATOM   6223  C CB    . THR C 1 39  ? 18.873  47.159  35.916  1.00 14.51  ? 39  THR C CB    1 
ATOM   6224  O OG1   . THR C 1 39  ? 18.578  47.592  34.590  1.00 10.56  ? 39  THR C OG1   1 
ATOM   6225  C CG2   . THR C 1 39  ? 20.233  46.484  35.956  1.00 13.09  ? 39  THR C CG2   1 
ATOM   6226  H H     . THR C 1 39  ? 16.467  47.888  35.927  1.00 0.00   ? 39  THR C H     1 
ATOM   6227  H HG1   . THR C 1 39  ? 17.921  47.011  34.202  1.00 0.00   ? 39  THR C HG1   1 
ATOM   6228  N N     . ALA C 1 40  ? 17.701  46.635  38.791  1.00 6.30   ? 40  ALA C N     1 
ATOM   6229  C CA    . ALA C 1 40  ? 17.872  46.312  40.195  1.00 6.31   ? 40  ALA C CA    1 
ATOM   6230  C C     . ALA C 1 40  ? 17.094  45.063  40.536  1.00 4.63   ? 40  ALA C C     1 
ATOM   6231  O O     . ALA C 1 40  ? 17.681  44.107  41.062  1.00 3.22   ? 40  ALA C O     1 
ATOM   6232  C CB    . ALA C 1 40  ? 17.362  47.411  41.125  1.00 2.00   ? 40  ALA C CB    1 
ATOM   6233  H H     . ALA C 1 40  ? 17.419  47.546  38.555  1.00 0.00   ? 40  ALA C H     1 
ATOM   6234  N N     . VAL C 1 41  ? 15.830  45.050  40.088  1.00 5.72   ? 41  VAL C N     1 
ATOM   6235  C CA    . VAL C 1 41  ? 14.916  43.948  40.348  1.00 2.26   ? 41  VAL C CA    1 
ATOM   6236  C C     . VAL C 1 41  ? 15.417  42.670  39.700  1.00 4.62   ? 41  VAL C C     1 
ATOM   6237  O O     . VAL C 1 41  ? 15.505  41.646  40.385  1.00 6.51   ? 41  VAL C O     1 
ATOM   6238  C CB    . VAL C 1 41  ? 13.549  44.393  39.840  1.00 2.00   ? 41  VAL C CB    1 
ATOM   6239  C CG1   . VAL C 1 41  ? 12.615  43.234  39.650  1.00 2.15   ? 41  VAL C CG1   1 
ATOM   6240  C CG2   . VAL C 1 41  ? 12.970  45.339  40.878  1.00 2.00   ? 41  VAL C CG2   1 
ATOM   6241  H H     . VAL C 1 41  ? 15.501  45.814  39.568  1.00 0.00   ? 41  VAL C H     1 
ATOM   6242  N N     . LYS C 1 42  ? 15.838  42.625  38.435  1.00 7.23   ? 42  LYS C N     1 
ATOM   6243  C CA    . LYS C 1 42  ? 16.374  41.371  37.904  1.00 5.16   ? 42  LYS C CA    1 
ATOM   6244  C C     . LYS C 1 42  ? 17.638  40.964  38.661  1.00 6.47   ? 42  LYS C C     1 
ATOM   6245  O O     . LYS C 1 42  ? 17.899  39.773  38.837  1.00 12.14  ? 42  LYS C O     1 
ATOM   6246  C CB    . LYS C 1 42  ? 16.701  41.514  36.444  1.00 4.23   ? 42  LYS C CB    1 
ATOM   6247  C CG    . LYS C 1 42  ? 15.527  42.025  35.650  1.00 2.00   ? 42  LYS C CG    1 
ATOM   6248  C CD    . LYS C 1 42  ? 15.778  42.072  34.147  1.00 6.92   ? 42  LYS C CD    1 
ATOM   6249  C CE    . LYS C 1 42  ? 16.924  42.998  33.764  1.00 7.66   ? 42  LYS C CE    1 
ATOM   6250  N NZ    . LYS C 1 42  ? 17.035  43.121  32.322  1.00 5.89   ? 42  LYS C NZ    1 
ATOM   6251  H H     . LYS C 1 42  ? 15.807  43.441  37.887  1.00 0.00   ? 42  LYS C H     1 
ATOM   6252  H HZ1   . LYS C 1 42  ? 17.194  42.179  31.910  1.00 0.00   ? 42  LYS C HZ1   1 
ATOM   6253  H HZ2   . LYS C 1 42  ? 16.161  43.527  31.933  1.00 0.00   ? 42  LYS C HZ2   1 
ATOM   6254  H HZ3   . LYS C 1 42  ? 17.840  43.736  32.088  1.00 0.00   ? 42  LYS C HZ3   1 
ATOM   6255  N N     . ALA C 1 43  ? 18.422  41.894  39.212  1.00 8.34   ? 43  ALA C N     1 
ATOM   6256  C CA    . ALA C 1 43  ? 19.592  41.524  40.003  1.00 6.10   ? 43  ALA C CA    1 
ATOM   6257  C C     . ALA C 1 43  ? 19.181  40.933  41.342  1.00 8.85   ? 43  ALA C C     1 
ATOM   6258  O O     . ALA C 1 43  ? 19.730  39.900  41.751  1.00 12.51  ? 43  ALA C O     1 
ATOM   6259  C CB    . ALA C 1 43  ? 20.464  42.720  40.297  1.00 2.00   ? 43  ALA C CB    1 
ATOM   6260  H H     . ALA C 1 43  ? 18.208  42.842  39.083  1.00 0.00   ? 43  ALA C H     1 
ATOM   6261  N N     . ILE C 1 44  ? 18.216  41.526  42.047  1.00 5.12   ? 44  ILE C N     1 
ATOM   6262  C CA    . ILE C 1 44  ? 17.742  40.943  43.292  1.00 5.90   ? 44  ILE C CA    1 
ATOM   6263  C C     . ILE C 1 44  ? 17.129  39.576  43.010  1.00 5.37   ? 44  ILE C C     1 
ATOM   6264  O O     . ILE C 1 44  ? 17.414  38.626  43.736  1.00 7.71   ? 44  ILE C O     1 
ATOM   6265  C CB    . ILE C 1 44  ? 16.707  41.853  43.962  1.00 2.00   ? 44  ILE C CB    1 
ATOM   6266  C CG1   . ILE C 1 44  ? 17.297  43.197  44.213  1.00 2.00   ? 44  ILE C CG1   1 
ATOM   6267  C CG2   . ILE C 1 44  ? 16.361  41.312  45.330  1.00 2.00   ? 44  ILE C CG2   1 
ATOM   6268  C CD1   . ILE C 1 44  ? 16.306  44.261  44.627  1.00 2.00   ? 44  ILE C CD1   1 
ATOM   6269  H H     . ILE C 1 44  ? 17.811  42.345  41.700  1.00 0.00   ? 44  ILE C H     1 
ATOM   6270  N N     . SER C 1 45  ? 16.359  39.389  41.948  1.00 6.62   ? 45  SER C N     1 
ATOM   6271  C CA    . SER C 1 45  ? 15.775  38.095  41.594  1.00 6.92   ? 45  SER C CA    1 
ATOM   6272  C C     . SER C 1 45  ? 16.861  37.022  41.533  1.00 10.05  ? 45  SER C C     1 
ATOM   6273  O O     . SER C 1 45  ? 16.803  36.034  42.262  1.00 12.46  ? 45  SER C O     1 
ATOM   6274  C CB    . SER C 1 45  ? 15.071  38.269  40.247  1.00 6.63   ? 45  SER C CB    1 
ATOM   6275  O OG    . SER C 1 45  ? 14.437  37.097  39.763  1.00 7.49   ? 45  SER C OG    1 
ATOM   6276  H H     . SER C 1 45  ? 16.149  40.167  41.393  1.00 0.00   ? 45  SER C H     1 
ATOM   6277  H HG    . SER C 1 45  ? 14.408  37.129  38.799  1.00 0.00   ? 45  SER C HG    1 
ATOM   6278  N N     . SER C 1 46  ? 17.936  37.235  40.773  1.00 13.92  ? 46  SER C N     1 
ATOM   6279  C CA    . SER C 1 46  ? 19.045  36.296  40.671  1.00 9.72   ? 46  SER C CA    1 
ATOM   6280  C C     . SER C 1 46  ? 19.636  35.971  42.033  1.00 8.60   ? 46  SER C C     1 
ATOM   6281  O O     . SER C 1 46  ? 19.789  34.801  42.384  1.00 11.91  ? 46  SER C O     1 
ATOM   6282  C CB    . SER C 1 46  ? 20.105  36.898  39.797  1.00 6.91   ? 46  SER C CB    1 
ATOM   6283  O OG    . SER C 1 46  ? 20.505  35.970  38.802  1.00 14.12  ? 46  SER C OG    1 
ATOM   6284  H H     . SER C 1 46  ? 17.997  38.064  40.250  1.00 0.00   ? 46  SER C H     1 
ATOM   6285  H HG    . SER C 1 46  ? 20.270  36.307  37.922  1.00 0.00   ? 46  SER C HG    1 
ATOM   6286  N N     . ALA C 1 47  ? 19.892  36.977  42.863  1.00 7.78   ? 47  ALA C N     1 
ATOM   6287  C CA    . ALA C 1 47  ? 20.444  36.757  44.188  1.00 6.62   ? 47  ALA C CA    1 
ATOM   6288  C C     . ALA C 1 47  ? 19.502  35.914  45.019  1.00 6.73   ? 47  ALA C C     1 
ATOM   6289  O O     . ALA C 1 47  ? 19.948  35.011  45.724  1.00 6.03   ? 47  ALA C O     1 
ATOM   6290  C CB    . ALA C 1 47  ? 20.650  38.073  44.894  1.00 4.62   ? 47  ALA C CB    1 
ATOM   6291  H H     . ALA C 1 47  ? 19.668  37.892  42.586  1.00 0.00   ? 47  ALA C H     1 
ATOM   6292  N N     . VAL C 1 48  ? 18.194  36.142  44.874  1.00 8.52   ? 48  VAL C N     1 
ATOM   6293  C CA    . VAL C 1 48  ? 17.178  35.403  45.624  1.00 6.27   ? 48  VAL C CA    1 
ATOM   6294  C C     . VAL C 1 48  ? 17.171  33.956  45.135  1.00 10.98  ? 48  VAL C C     1 
ATOM   6295  O O     . VAL C 1 48  ? 17.171  33.022  45.948  1.00 15.47  ? 48  VAL C O     1 
ATOM   6296  C CB    . VAL C 1 48  ? 15.796  36.077  45.412  1.00 7.61   ? 48  VAL C CB    1 
ATOM   6297  C CG1   . VAL C 1 48  ? 14.661  35.299  46.060  1.00 9.98   ? 48  VAL C CG1   1 
ATOM   6298  C CG2   . VAL C 1 48  ? 15.812  37.429  46.081  1.00 3.35   ? 48  VAL C CG2   1 
ATOM   6299  H H     . VAL C 1 48  ? 17.895  36.802  44.214  1.00 0.00   ? 48  VAL C H     1 
ATOM   6300  N N     . ARG C 1 49  ? 17.282  33.690  43.828  1.00 6.91   ? 49  ARG C N     1 
ATOM   6301  C CA    . ARG C 1 49  ? 17.253  32.316  43.337  1.00 6.31   ? 49  ARG C CA    1 
ATOM   6302  C C     . ARG C 1 49  ? 18.536  31.562  43.591  1.00 7.21   ? 49  ARG C C     1 
ATOM   6303  O O     . ARG C 1 49  ? 18.771  30.500  43.020  1.00 9.34   ? 49  ARG C O     1 
ATOM   6304  C CB    . ARG C 1 49  ? 16.954  32.259  41.827  1.00 2.75   ? 49  ARG C CB    1 
ATOM   6305  C CG    . ARG C 1 49  ? 15.463  32.132  41.538  1.00 2.00   ? 49  ARG C CG    1 
ATOM   6306  C CD    . ARG C 1 49  ? 14.753  33.463  41.795  1.00 5.58   ? 49  ARG C CD    1 
ATOM   6307  N NE    . ARG C 1 49  ? 13.330  33.307  42.057  1.00 11.76  ? 49  ARG C NE    1 
ATOM   6308  C CZ    . ARG C 1 49  ? 12.453  33.227  41.063  1.00 12.64  ? 49  ARG C CZ    1 
ATOM   6309  N NH1   . ARG C 1 49  ? 12.792  33.287  39.762  1.00 19.99  ? 49  ARG C NH1   1 
ATOM   6310  N NH2   . ARG C 1 49  ? 11.197  33.084  41.390  1.00 4.30   ? 49  ARG C NH2   1 
ATOM   6311  H H     . ARG C 1 49  ? 17.352  34.433  43.192  1.00 0.00   ? 49  ARG C H     1 
ATOM   6312  H HE    . ARG C 1 49  ? 13.015  33.254  42.984  1.00 0.00   ? 49  ARG C HE    1 
ATOM   6313  H HH11  . ARG C 1 49  ? 13.748  33.397  39.490  1.00 0.00   ? 49  ARG C HH11  1 
ATOM   6314  H HH12  . ARG C 1 49  ? 12.082  33.225  39.059  1.00 0.00   ? 49  ARG C HH12  1 
ATOM   6315  H HH21  . ARG C 1 49  ? 10.937  33.038  42.355  1.00 0.00   ? 49  ARG C HH21  1 
ATOM   6316  H HH22  . ARG C 1 49  ? 10.497  33.021  40.679  1.00 0.00   ? 49  ARG C HH22  1 
ATOM   6317  N N     . LYS C 1 50  ? 19.389  32.165  44.419  1.00 12.39  ? 50  LYS C N     1 
ATOM   6318  C CA    . LYS C 1 50  ? 20.630  31.631  44.902  1.00 9.15   ? 50  LYS C CA    1 
ATOM   6319  C C     . LYS C 1 50  ? 21.695  31.334  43.851  1.00 9.40   ? 50  LYS C C     1 
ATOM   6320  O O     . LYS C 1 50  ? 22.621  30.524  44.016  1.00 9.35   ? 50  LYS C O     1 
ATOM   6321  C CB    . LYS C 1 50  ? 20.234  30.413  45.737  1.00 13.22  ? 50  LYS C CB    1 
ATOM   6322  C CG    . LYS C 1 50  ? 20.419  30.717  47.214  1.00 16.76  ? 50  LYS C CG    1 
ATOM   6323  C CD    . LYS C 1 50  ? 19.539  31.805  47.743  1.00 18.07  ? 50  LYS C CD    1 
ATOM   6324  C CE    . LYS C 1 50  ? 19.880  32.116  49.189  1.00 25.47  ? 50  LYS C CE    1 
ATOM   6325  N NZ    . LYS C 1 50  ? 21.001  33.035  49.266  1.00 27.49  ? 50  LYS C NZ    1 
ATOM   6326  H H     . LYS C 1 50  ? 19.192  33.066  44.736  1.00 0.00   ? 50  LYS C H     1 
ATOM   6327  H HZ1   . LYS C 1 50  ? 21.829  32.610  48.803  1.00 0.00   ? 50  LYS C HZ1   1 
ATOM   6328  H HZ2   . LYS C 1 50  ? 20.755  33.924  48.785  1.00 0.00   ? 50  LYS C HZ2   1 
ATOM   6329  H HZ3   . LYS C 1 50  ? 21.222  33.227  50.265  1.00 0.00   ? 50  LYS C HZ3   1 
ATOM   6330  N N     . ALA C 1 51  ? 21.654  32.061  42.740  1.00 11.70  ? 51  ALA C N     1 
ATOM   6331  C CA    . ALA C 1 51  ? 22.630  31.883  41.690  1.00 7.43   ? 51  ALA C CA    1 
ATOM   6332  C C     . ALA C 1 51  ? 24.018  32.178  42.247  1.00 14.61  ? 51  ALA C C     1 
ATOM   6333  O O     . ALA C 1 51  ? 24.242  33.092  43.042  1.00 16.70  ? 51  ALA C O     1 
ATOM   6334  C CB    . ALA C 1 51  ? 22.335  32.832  40.568  1.00 9.70   ? 51  ALA C CB    1 
ATOM   6335  H H     . ALA C 1 51  ? 21.008  32.798  42.679  1.00 0.00   ? 51  ALA C H     1 
ATOM   6336  N N     . GLY C 1 52  ? 24.958  31.320  41.903  1.00 10.84  ? 52  GLY C N     1 
ATOM   6337  C CA    . GLY C 1 52  ? 26.306  31.472  42.378  1.00 11.73  ? 52  GLY C CA    1 
ATOM   6338  C C     . GLY C 1 52  ? 26.610  30.887  43.749  1.00 11.90  ? 52  GLY C C     1 
ATOM   6339  O O     . GLY C 1 52  ? 27.803  30.720  44.033  1.00 18.90  ? 52  GLY C O     1 
ATOM   6340  H H     . GLY C 1 52  ? 24.731  30.600  41.299  1.00 0.00   ? 52  GLY C H     1 
ATOM   6341  N N     . ILE C 1 53  ? 25.653  30.444  44.573  1.00 12.49  ? 53  ILE C N     1 
ATOM   6342  C CA    . ILE C 1 53  ? 26.023  30.036  45.930  1.00 16.10  ? 53  ILE C CA    1 
ATOM   6343  C C     . ILE C 1 53  ? 26.970  28.884  46.067  1.00 14.44  ? 53  ILE C C     1 
ATOM   6344  O O     . ILE C 1 53  ? 27.544  28.709  47.140  1.00 18.39  ? 53  ILE C O     1 
ATOM   6345  C CB    . ILE C 1 53  ? 24.819  29.674  46.847  1.00 14.41  ? 53  ILE C CB    1 
ATOM   6346  C CG1   . ILE C 1 53  ? 23.834  28.681  46.258  1.00 16.04  ? 53  ILE C CG1   1 
ATOM   6347  C CG2   . ILE C 1 53  ? 24.227  31.025  47.207  1.00 20.76  ? 53  ILE C CG2   1 
ATOM   6348  C CD1   . ILE C 1 53  ? 24.158  27.192  46.425  1.00 18.20  ? 53  ILE C CD1   1 
ATOM   6349  H H     . ILE C 1 53  ? 24.703  30.490  44.317  1.00 0.00   ? 53  ILE C H     1 
ATOM   6350  N N     . ALA C 1 54  ? 27.163  28.110  44.989  1.00 18.69  ? 54  ALA C N     1 
ATOM   6351  C CA    . ALA C 1 54  ? 28.100  26.985  44.967  1.00 17.84  ? 54  ALA C CA    1 
ATOM   6352  C C     . ALA C 1 54  ? 29.484  27.453  45.350  1.00 18.16  ? 54  ALA C C     1 
ATOM   6353  O O     . ALA C 1 54  ? 30.278  26.768  45.991  1.00 17.66  ? 54  ALA C O     1 
ATOM   6354  C CB    . ALA C 1 54  ? 28.222  26.378  43.590  1.00 12.03  ? 54  ALA C CB    1 
ATOM   6355  H H     . ALA C 1 54  ? 26.615  28.292  44.205  1.00 0.00   ? 54  ALA C H     1 
ATOM   6356  N N     . HIS C 1 55  ? 29.724  28.696  44.953  1.00 20.78  ? 55  HIS C N     1 
ATOM   6357  C CA    . HIS C 1 55  ? 30.965  29.354  45.224  1.00 27.11  ? 55  HIS C CA    1 
ATOM   6358  C C     . HIS C 1 55  ? 31.166  29.550  46.723  1.00 31.31  ? 55  HIS C C     1 
ATOM   6359  O O     . HIS C 1 55  ? 32.277  29.292  47.213  1.00 31.19  ? 55  HIS C O     1 
ATOM   6360  C CB    . HIS C 1 55  ? 30.953  30.664  44.436  1.00 29.19  ? 55  HIS C CB    1 
ATOM   6361  C CG    . HIS C 1 55  ? 31.290  30.473  42.949  1.00 32.18  ? 55  HIS C CG    1 
ATOM   6362  N ND1   . HIS C 1 55  ? 30.379  30.459  41.967  1.00 32.74  ? 55  HIS C ND1   1 
ATOM   6363  C CD2   . HIS C 1 55  ? 32.534  30.271  42.390  1.00 29.78  ? 55  HIS C CD2   1 
ATOM   6364  C CE1   . HIS C 1 55  ? 31.034  30.244  40.841  1.00 35.76  ? 55  HIS C CE1   1 
ATOM   6365  N NE2   . HIS C 1 55  ? 32.316  30.126  41.104  1.00 31.93  ? 55  HIS C NE2   1 
ATOM   6366  H H     . HIS C 1 55  ? 29.010  29.190  44.501  1.00 0.00   ? 55  HIS C H     1 
ATOM   6367  H HD1   . HIS C 1 55  ? 29.401  30.551  42.030  1.00 0.00   ? 55  HIS C HD1   1 
ATOM   6368  H HE2   . HIS C 1 55  ? 33.006  29.959  40.429  1.00 0.00   ? 55  HIS C HE2   1 
ATOM   6369  N N     . LEU C 1 56  ? 30.101  29.884  47.468  1.00 33.68  ? 56  LEU C N     1 
ATOM   6370  C CA    . LEU C 1 56  ? 30.193  30.065  48.919  1.00 34.97  ? 56  LEU C CA    1 
ATOM   6371  C C     . LEU C 1 56  ? 30.426  28.750  49.604  1.00 35.58  ? 56  LEU C C     1 
ATOM   6372  O O     . LEU C 1 56  ? 31.156  28.696  50.586  1.00 37.40  ? 56  LEU C O     1 
ATOM   6373  C CB    . LEU C 1 56  ? 28.947  30.585  49.595  1.00 37.47  ? 56  LEU C CB    1 
ATOM   6374  C CG    . LEU C 1 56  ? 28.602  32.047  49.579  1.00 42.08  ? 56  LEU C CG    1 
ATOM   6375  C CD1   . LEU C 1 56  ? 27.920  32.485  48.286  1.00 42.76  ? 56  LEU C CD1   1 
ATOM   6376  C CD2   . LEU C 1 56  ? 27.692  32.267  50.774  1.00 44.07  ? 56  LEU C CD2   1 
ATOM   6377  H H     . LEU C 1 56  ? 29.214  29.936  47.069  1.00 0.00   ? 56  LEU C H     1 
ATOM   6378  N N     . TYR C 1 57  ? 29.835  27.663  49.109  1.00 35.50  ? 57  TYR C N     1 
ATOM   6379  C CA    . TYR C 1 57  ? 30.075  26.364  49.716  1.00 33.88  ? 57  TYR C CA    1 
ATOM   6380  C C     . TYR C 1 57  ? 31.387  25.727  49.249  1.00 31.89  ? 57  TYR C C     1 
ATOM   6381  O O     . TYR C 1 57  ? 31.670  24.540  49.442  1.00 31.40  ? 57  TYR C O     1 
ATOM   6382  C CB    . TYR C 1 57  ? 28.844  25.513  49.429  1.00 33.25  ? 57  TYR C CB    1 
ATOM   6383  C CG    . TYR C 1 57  ? 27.688  25.976  50.311  1.00 35.01  ? 57  TYR C CG    1 
ATOM   6384  C CD1   . TYR C 1 57  ? 26.872  27.021  49.905  1.00 36.24  ? 57  TYR C CD1   1 
ATOM   6385  C CD2   . TYR C 1 57  ? 27.495  25.391  51.554  1.00 35.21  ? 57  TYR C CD2   1 
ATOM   6386  C CE1   . TYR C 1 57  ? 25.890  27.498  50.750  1.00 34.25  ? 57  TYR C CE1   1 
ATOM   6387  C CE2   . TYR C 1 57  ? 26.499  25.853  52.395  1.00 31.10  ? 57  TYR C CE2   1 
ATOM   6388  C CZ    . TYR C 1 57  ? 25.707  26.907  51.988  1.00 34.36  ? 57  TYR C CZ    1 
ATOM   6389  O OH    . TYR C 1 57  ? 24.701  27.358  52.824  1.00 36.85  ? 57  TYR C OH    1 
ATOM   6390  H H     . TYR C 1 57  ? 29.252  27.741  48.332  1.00 0.00   ? 57  TYR C H     1 
ATOM   6391  H HH    . TYR C 1 57  ? 24.592  26.735  53.557  1.00 0.00   ? 57  TYR C HH    1 
ATOM   6392  N N     . GLY C 1 58  ? 32.257  26.552  48.661  1.00 32.12  ? 58  GLY C N     1 
ATOM   6393  C CA    . GLY C 1 58  ? 33.586  26.182  48.256  1.00 30.67  ? 58  GLY C CA    1 
ATOM   6394  C C     . GLY C 1 58  ? 33.573  25.259  47.069  1.00 29.49  ? 58  GLY C C     1 
ATOM   6395  O O     . GLY C 1 58  ? 33.882  24.070  47.201  1.00 32.19  ? 58  GLY C O     1 
ATOM   6396  H H     . GLY C 1 58  ? 32.005  27.481  48.507  1.00 0.00   ? 58  GLY C H     1 
ATOM   6397  N N     . ILE C 1 59  ? 33.103  25.720  45.928  1.00 28.30  ? 59  ILE C N     1 
ATOM   6398  C CA    . ILE C 1 59  ? 33.274  24.879  44.767  1.00 30.03  ? 59  ILE C CA    1 
ATOM   6399  C C     . ILE C 1 59  ? 34.695  25.088  44.260  1.00 34.53  ? 59  ILE C C     1 
ATOM   6400  O O     . ILE C 1 59  ? 35.280  24.183  43.686  1.00 35.62  ? 59  ILE C O     1 
ATOM   6401  C CB    . ILE C 1 59  ? 32.179  25.215  43.714  1.00 28.46  ? 59  ILE C CB    1 
ATOM   6402  C CG1   . ILE C 1 59  ? 32.212  24.128  42.656  1.00 27.50  ? 59  ILE C CG1   1 
ATOM   6403  C CG2   . ILE C 1 59  ? 32.337  26.588  43.146  1.00 27.24  ? 59  ILE C CG2   1 
ATOM   6404  C CD1   . ILE C 1 59  ? 31.017  24.131  41.696  1.00 26.91  ? 59  ILE C CD1   1 
ATOM   6405  H H     . ILE C 1 59  ? 32.496  26.487  45.939  1.00 0.00   ? 59  ILE C H     1 
ATOM   6406  N N     . ALA C 1 60  ? 35.319  26.216  44.546  1.00 38.86  ? 60  ALA C N     1 
ATOM   6407  C CA    . ALA C 1 60  ? 36.673  26.510  44.100  1.00 43.81  ? 60  ALA C CA    1 
ATOM   6408  C C     . ALA C 1 60  ? 37.589  26.687  45.297  1.00 49.21  ? 60  ALA C C     1 
ATOM   6409  O O     . ALA C 1 60  ? 38.614  27.355  45.179  1.00 53.31  ? 60  ALA C O     1 
ATOM   6410  C CB    . ALA C 1 60  ? 36.720  27.803  43.326  1.00 38.47  ? 60  ALA C CB    1 
ATOM   6411  H H     . ALA C 1 60  ? 34.867  26.864  45.114  1.00 0.00   ? 60  ALA C H     1 
ATOM   6412  N N     . GLY C 1 61  ? 37.321  26.081  46.457  1.00 55.20  ? 61  GLY C N     1 
ATOM   6413  C CA    . GLY C 1 61  ? 38.102  26.285  47.669  1.00 58.89  ? 61  GLY C CA    1 
ATOM   6414  C C     . GLY C 1 61  ? 37.250  25.826  48.834  1.00 61.71  ? 61  GLY C C     1 
ATOM   6415  O O     . GLY C 1 61  ? 36.672  24.738  48.746  1.00 64.65  ? 61  GLY C O     1 
ATOM   6416  H H     . GLY C 1 61  ? 36.649  25.382  46.534  1.00 0.00   ? 61  GLY C H     1 
ATOM   6417  N N     . LYS C 1 72  ? 24.026  39.141  53.480  1.00 36.18  ? 72  LYS C N     1 
ATOM   6418  C CA    . LYS C 1 72  ? 22.696  38.932  54.035  1.00 35.50  ? 72  LYS C CA    1 
ATOM   6419  C C     . LYS C 1 72  ? 21.942  39.465  52.839  1.00 33.87  ? 72  LYS C C     1 
ATOM   6420  O O     . LYS C 1 72  ? 22.273  40.569  52.385  1.00 35.79  ? 72  LYS C O     1 
ATOM   6421  C CB    . LYS C 1 72  ? 22.409  39.815  55.220  1.00 38.69  ? 72  LYS C CB    1 
ATOM   6422  C CG    . LYS C 1 72  ? 21.348  39.203  56.135  1.00 48.80  ? 72  LYS C CG    1 
ATOM   6423  C CD    . LYS C 1 72  ? 20.676  40.154  57.139  1.00 56.48  ? 72  LYS C CD    1 
ATOM   6424  C CE    . LYS C 1 72  ? 21.429  41.412  57.592  1.00 62.03  ? 72  LYS C CE    1 
ATOM   6425  N NZ    . LYS C 1 72  ? 22.716  41.138  58.218  1.00 68.60  ? 72  LYS C NZ    1 
ATOM   6426  H HZ1   . LYS C 1 72  ? 23.322  40.630  57.543  1.00 0.00   ? 72  LYS C HZ1   1 
ATOM   6427  H HZ2   . LYS C 1 72  ? 23.165  42.044  58.474  1.00 0.00   ? 72  LYS C HZ2   1 
ATOM   6428  H HZ3   . LYS C 1 72  ? 22.578  40.558  59.071  1.00 0.00   ? 72  LYS C HZ3   1 
ATOM   6429  N N     . LEU C 1 73  ? 20.958  38.735  52.336  1.00 29.79  ? 73  LEU C N     1 
ATOM   6430  C CA    . LEU C 1 73  ? 20.391  39.066  51.054  1.00 22.73  ? 73  LEU C CA    1 
ATOM   6431  C C     . LEU C 1 73  ? 19.749  40.437  50.987  1.00 22.22  ? 73  LEU C C     1 
ATOM   6432  O O     . LEU C 1 73  ? 19.966  41.166  50.031  1.00 21.80  ? 73  LEU C O     1 
ATOM   6433  C CB    . LEU C 1 73  ? 19.445  37.942  50.729  1.00 24.32  ? 73  LEU C CB    1 
ATOM   6434  C CG    . LEU C 1 73  ? 19.178  37.634  49.264  1.00 25.38  ? 73  LEU C CG    1 
ATOM   6435  C CD1   . LEU C 1 73  ? 20.463  37.366  48.537  1.00 27.51  ? 73  LEU C CD1   1 
ATOM   6436  C CD2   . LEU C 1 73  ? 18.323  36.390  49.165  1.00 25.20  ? 73  LEU C CD2   1 
ATOM   6437  H H     . LEU C 1 73  ? 20.610  37.954  52.832  1.00 0.00   ? 73  LEU C H     1 
ATOM   6438  N N     . ASP C 1 74  ? 19.095  40.906  52.034  1.00 22.74  ? 74  ASP C N     1 
ATOM   6439  C CA    . ASP C 1 74  ? 18.485  42.229  51.989  1.00 23.21  ? 74  ASP C CA    1 
ATOM   6440  C C     . ASP C 1 74  ? 19.464  43.386  51.900  1.00 21.48  ? 74  ASP C C     1 
ATOM   6441  O O     . ASP C 1 74  ? 19.130  44.415  51.318  1.00 25.79  ? 74  ASP C O     1 
ATOM   6442  C CB    . ASP C 1 74  ? 17.575  42.422  53.207  1.00 26.42  ? 74  ASP C CB    1 
ATOM   6443  C CG    . ASP C 1 74  ? 18.030  41.824  54.528  1.00 28.22  ? 74  ASP C CG    1 
ATOM   6444  O OD1   . ASP C 1 74  ? 19.233  41.757  54.776  1.00 26.82  ? 74  ASP C OD1   1 
ATOM   6445  O OD2   . ASP C 1 74  ? 17.163  41.422  55.302  1.00 30.86  ? 74  ASP C OD2   1 
ATOM   6446  H H     . ASP C 1 74  ? 18.987  40.334  52.815  1.00 0.00   ? 74  ASP C H     1 
ATOM   6447  N N     . VAL C 1 75  ? 20.695  43.268  52.383  1.00 18.90  ? 75  VAL C N     1 
ATOM   6448  C CA    . VAL C 1 75  ? 21.669  44.357  52.289  1.00 15.25  ? 75  VAL C CA    1 
ATOM   6449  C C     . VAL C 1 75  ? 22.113  44.499  50.848  1.00 15.64  ? 75  VAL C C     1 
ATOM   6450  O O     . VAL C 1 75  ? 22.132  45.600  50.319  1.00 17.97  ? 75  VAL C O     1 
ATOM   6451  C CB    . VAL C 1 75  ? 22.860  44.060  53.156  1.00 12.77  ? 75  VAL C CB    1 
ATOM   6452  C CG1   . VAL C 1 75  ? 23.920  45.138  53.028  1.00 12.81  ? 75  VAL C CG1   1 
ATOM   6453  C CG2   . VAL C 1 75  ? 22.360  43.942  54.584  1.00 17.65  ? 75  VAL C CG2   1 
ATOM   6454  H H     . VAL C 1 75  ? 20.964  42.410  52.760  1.00 0.00   ? 75  VAL C H     1 
ATOM   6455  N N     . LEU C 1 76  ? 22.444  43.388  50.193  1.00 16.36  ? 76  LEU C N     1 
ATOM   6456  C CA    . LEU C 1 76  ? 22.764  43.361  48.779  1.00 11.09  ? 76  LEU C CA    1 
ATOM   6457  C C     . LEU C 1 76  ? 21.579  43.938  48.024  1.00 8.11   ? 76  LEU C C     1 
ATOM   6458  O O     . LEU C 1 76  ? 21.789  44.724  47.109  1.00 12.83  ? 76  LEU C O     1 
ATOM   6459  C CB    . LEU C 1 76  ? 23.012  41.922  48.335  1.00 10.95  ? 76  LEU C CB    1 
ATOM   6460  C CG    . LEU C 1 76  ? 23.195  41.652  46.846  1.00 14.89  ? 76  LEU C CG    1 
ATOM   6461  C CD1   . LEU C 1 76  ? 24.451  42.304  46.341  1.00 12.00  ? 76  LEU C CD1   1 
ATOM   6462  C CD2   . LEU C 1 76  ? 23.317  40.170  46.603  1.00 18.63  ? 76  LEU C CD2   1 
ATOM   6463  H H     . LEU C 1 76  ? 22.421  42.539  50.671  1.00 0.00   ? 76  LEU C H     1 
ATOM   6464  N N     . SER C 1 77  ? 20.338  43.616  48.389  1.00 9.69   ? 77  SER C N     1 
ATOM   6465  C CA    . SER C 1 77  ? 19.165  44.146  47.711  1.00 8.82   ? 77  SER C CA    1 
ATOM   6466  C C     . SER C 1 77  ? 18.983  45.618  47.943  1.00 6.23   ? 77  SER C C     1 
ATOM   6467  O O     . SER C 1 77  ? 18.580  46.365  47.056  1.00 10.75  ? 77  SER C O     1 
ATOM   6468  C CB    . SER C 1 77  ? 17.946  43.413  48.191  1.00 9.51   ? 77  SER C CB    1 
ATOM   6469  O OG    . SER C 1 77  ? 18.174  42.042  47.868  1.00 12.25  ? 77  SER C OG    1 
ATOM   6470  H H     . SER C 1 77  ? 20.188  42.895  49.038  1.00 0.00   ? 77  SER C H     1 
ATOM   6471  H HG    . SER C 1 77  ? 17.398  41.518  48.079  1.00 0.00   ? 77  SER C HG    1 
ATOM   6472  N N     . ASN C 1 78  ? 19.330  46.077  49.132  1.00 5.27   ? 78  ASN C N     1 
ATOM   6473  C CA    . ASN C 1 78  ? 19.220  47.478  49.435  1.00 5.34   ? 78  ASN C CA    1 
ATOM   6474  C C     . ASN C 1 78  ? 20.254  48.215  48.612  1.00 7.92   ? 78  ASN C C     1 
ATOM   6475  O O     . ASN C 1 78  ? 19.951  49.248  48.033  1.00 11.16  ? 78  ASN C O     1 
ATOM   6476  C CB    . ASN C 1 78  ? 19.468  47.706  50.906  1.00 4.96   ? 78  ASN C CB    1 
ATOM   6477  C CG    . ASN C 1 78  ? 19.313  49.158  51.288  1.00 4.91   ? 78  ASN C CG    1 
ATOM   6478  O OD1   . ASN C 1 78  ? 18.262  49.752  51.068  1.00 7.55   ? 78  ASN C OD1   1 
ATOM   6479  N ND2   . ASN C 1 78  ? 20.299  49.778  51.929  1.00 9.73   ? 78  ASN C ND2   1 
ATOM   6480  H H     . ASN C 1 78  ? 19.681  45.457  49.805  1.00 0.00   ? 78  ASN C H     1 
ATOM   6481  H HD21  . ASN C 1 78  ? 20.171  50.728  52.077  1.00 0.00   ? 78  ASN C HD21  1 
ATOM   6482  H HD22  . ASN C 1 78  ? 21.116  49.307  52.199  1.00 0.00   ? 78  ASN C HD22  1 
ATOM   6483  N N     . ASP C 1 79  ? 21.463  47.655  48.502  1.00 9.41   ? 79  ASP C N     1 
ATOM   6484  C CA    . ASP C 1 79  ? 22.567  48.238  47.778  1.00 8.67   ? 79  ASP C CA    1 
ATOM   6485  C C     . ASP C 1 79  ? 22.236  48.236  46.301  1.00 6.54   ? 79  ASP C C     1 
ATOM   6486  O O     . ASP C 1 79  ? 22.389  49.266  45.673  1.00 14.86  ? 79  ASP C O     1 
ATOM   6487  C CB    . ASP C 1 79  ? 23.843  47.429  48.073  1.00 8.37   ? 79  ASP C CB    1 
ATOM   6488  C CG    . ASP C 1 79  ? 24.453  47.569  49.483  1.00 11.10  ? 79  ASP C CG    1 
ATOM   6489  O OD1   . ASP C 1 79  ? 23.911  48.247  50.372  1.00 12.61  ? 79  ASP C OD1   1 
ATOM   6490  O OD2   . ASP C 1 79  ? 25.508  46.982  49.692  1.00 8.05   ? 79  ASP C OD2   1 
ATOM   6491  H H     . ASP C 1 79  ? 21.597  46.776  48.908  1.00 0.00   ? 79  ASP C H     1 
ATOM   6492  N N     . LEU C 1 80  ? 21.734  47.187  45.678  1.00 6.51   ? 80  LEU C N     1 
ATOM   6493  C CA    . LEU C 1 80  ? 21.333  47.211  44.280  1.00 4.82   ? 80  LEU C CA    1 
ATOM   6494  C C     . LEU C 1 80  ? 20.248  48.253  43.997  1.00 8.39   ? 80  LEU C C     1 
ATOM   6495  O O     . LEU C 1 80  ? 20.351  48.974  43.000  1.00 11.22  ? 80  LEU C O     1 
ATOM   6496  C CB    . LEU C 1 80  ? 20.839  45.816  43.905  1.00 6.31   ? 80  LEU C CB    1 
ATOM   6497  C CG    . LEU C 1 80  ? 21.850  44.688  43.800  1.00 7.40   ? 80  LEU C CG    1 
ATOM   6498  C CD1   . LEU C 1 80  ? 21.234  43.307  43.896  1.00 8.09   ? 80  LEU C CD1   1 
ATOM   6499  C CD2   . LEU C 1 80  ? 22.502  44.843  42.453  1.00 17.27  ? 80  LEU C CD2   1 
ATOM   6500  H H     . LEU C 1 80  ? 21.648  46.355  46.180  1.00 0.00   ? 80  LEU C H     1 
ATOM   6501  N N     . VAL C 1 81  ? 19.186  48.411  44.804  1.00 7.78   ? 81  VAL C N     1 
ATOM   6502  C CA    . VAL C 1 81  ? 18.197  49.434  44.512  1.00 5.06   ? 81  VAL C CA    1 
ATOM   6503  C C     . VAL C 1 81  ? 18.815  50.795  44.806  1.00 7.87   ? 81  VAL C C     1 
ATOM   6504  O O     . VAL C 1 81  ? 18.686  51.697  43.976  1.00 11.45  ? 81  VAL C O     1 
ATOM   6505  C CB    . VAL C 1 81  ? 16.934  49.237  45.350  1.00 5.88   ? 81  VAL C CB    1 
ATOM   6506  C CG1   . VAL C 1 81  ? 15.848  50.128  44.795  1.00 5.57   ? 81  VAL C CG1   1 
ATOM   6507  C CG2   . VAL C 1 81  ? 16.358  47.856  45.203  1.00 5.83   ? 81  VAL C CG2   1 
ATOM   6508  H H     . VAL C 1 81  ? 19.077  47.833  45.590  1.00 0.00   ? 81  VAL C H     1 
ATOM   6509  N N     . MET C 1 82  ? 19.564  50.993  45.901  1.00 7.50   ? 82  MET C N     1 
ATOM   6510  C CA    . MET C 1 82  ? 20.212  52.265  46.208  1.00 4.18   ? 82  MET C CA    1 
ATOM   6511  C C     . MET C 1 82  ? 21.132  52.715  45.091  1.00 10.07  ? 82  MET C C     1 
ATOM   6512  O O     . MET C 1 82  ? 20.992  53.833  44.573  1.00 15.20  ? 82  MET C O     1 
ATOM   6513  C CB    . MET C 1 82  ? 21.058  52.176  47.457  1.00 6.94   ? 82  MET C CB    1 
ATOM   6514  C CG    . MET C 1 82  ? 20.265  52.190  48.736  1.00 13.33  ? 82  MET C CG    1 
ATOM   6515  S SD    . MET C 1 82  ? 19.503  53.809  48.922  1.00 18.16  ? 82  MET C SD    1 
ATOM   6516  C CE    . MET C 1 82  ? 18.664  53.623  50.468  1.00 14.45  ? 82  MET C CE    1 
ATOM   6517  H H     . MET C 1 82  ? 19.679  50.239  46.506  1.00 0.00   ? 82  MET C H     1 
ATOM   6518  N N     . ASN C 1 83  ? 22.062  51.863  44.645  1.00 6.36   ? 83  ASN C N     1 
ATOM   6519  C CA    . ASN C 1 83  ? 22.997  52.265  43.619  1.00 10.50  ? 83  ASN C CA    1 
ATOM   6520  C C     . ASN C 1 83  ? 22.338  52.518  42.279  1.00 10.64  ? 83  ASN C C     1 
ATOM   6521  O O     . ASN C 1 83  ? 22.580  53.558  41.674  1.00 17.73  ? 83  ASN C O     1 
ATOM   6522  C CB    . ASN C 1 83  ? 24.068  51.226  43.414  1.00 17.96  ? 83  ASN C CB    1 
ATOM   6523  C CG    . ASN C 1 83  ? 25.334  51.853  42.847  1.00 22.63  ? 83  ASN C CG    1 
ATOM   6524  O OD1   . ASN C 1 83  ? 25.435  52.365  41.737  1.00 26.70  ? 83  ASN C OD1   1 
ATOM   6525  N ND2   . ASN C 1 83  ? 26.404  51.847  43.618  1.00 29.98  ? 83  ASN C ND2   1 
ATOM   6526  H H     . ASN C 1 83  ? 22.062  50.946  44.979  1.00 0.00   ? 83  ASN C H     1 
ATOM   6527  H HD21  . ASN C 1 83  ? 27.225  52.241  43.256  1.00 0.00   ? 83  ASN C HD21  1 
ATOM   6528  H HD22  . ASN C 1 83  ? 26.357  51.424  44.499  1.00 0.00   ? 83  ASN C HD22  1 
ATOM   6529  N N     . MET C 1 84  ? 21.407  51.694  41.818  1.00 14.39  ? 84  MET C N     1 
ATOM   6530  C CA    . MET C 1 84  ? 20.809  51.917  40.514  1.00 12.00  ? 84  MET C CA    1 
ATOM   6531  C C     . MET C 1 84  ? 19.976  53.161  40.496  1.00 13.44  ? 84  MET C C     1 
ATOM   6532  O O     . MET C 1 84  ? 19.837  53.793  39.445  1.00 9.30   ? 84  MET C O     1 
ATOM   6533  C CB    . MET C 1 84  ? 19.947  50.751  40.106  1.00 12.53  ? 84  MET C CB    1 
ATOM   6534  C CG    . MET C 1 84  ? 20.753  49.514  39.807  1.00 6.28   ? 84  MET C CG    1 
ATOM   6535  S SD    . MET C 1 84  ? 22.014  49.782  38.537  1.00 21.69  ? 84  MET C SD    1 
ATOM   6536  C CE    . MET C 1 84  ? 21.088  50.094  37.056  1.00 4.87   ? 84  MET C CE    1 
ATOM   6537  H H     . MET C 1 84  ? 21.148  50.901  42.334  1.00 0.00   ? 84  MET C H     1 
ATOM   6538  N N     . LEU C 1 85  ? 19.479  53.535  41.681  1.00 16.93  ? 85  LEU C N     1 
ATOM   6539  C CA    . LEU C 1 85  ? 18.707  54.749  41.798  1.00 18.04  ? 85  LEU C CA    1 
ATOM   6540  C C     . LEU C 1 85  ? 19.582  55.992  41.856  1.00 17.24  ? 85  LEU C C     1 
ATOM   6541  O O     . LEU C 1 85  ? 19.318  56.911  41.074  1.00 14.75  ? 85  LEU C O     1 
ATOM   6542  C CB    . LEU C 1 85  ? 17.783  54.652  43.027  1.00 18.11  ? 85  LEU C CB    1 
ATOM   6543  C CG    . LEU C 1 85  ? 16.643  53.614  42.902  1.00 20.25  ? 85  LEU C CG    1 
ATOM   6544  C CD1   . LEU C 1 85  ? 15.705  53.771  44.066  1.00 22.02  ? 85  LEU C CD1   1 
ATOM   6545  C CD2   . LEU C 1 85  ? 15.854  53.797  41.627  1.00 15.13  ? 85  LEU C CD2   1 
ATOM   6546  H H     . LEU C 1 85  ? 19.619  52.969  42.472  1.00 0.00   ? 85  LEU C H     1 
ATOM   6547  N N     . LYS C 1 86  ? 20.635  56.119  42.671  1.00 18.86  ? 86  LYS C N     1 
ATOM   6548  C CA    . LYS C 1 86  ? 21.515  57.299  42.609  1.00 17.85  ? 86  LYS C CA    1 
ATOM   6549  C C     . LYS C 1 86  ? 22.058  57.495  41.191  1.00 18.30  ? 86  LYS C C     1 
ATOM   6550  O O     . LYS C 1 86  ? 21.973  58.600  40.639  1.00 22.50  ? 86  LYS C O     1 
ATOM   6551  C CB    . LYS C 1 86  ? 22.709  57.168  43.532  1.00 13.37  ? 86  LYS C CB    1 
ATOM   6552  C CG    . LYS C 1 86  ? 22.249  57.028  44.957  1.00 17.02  ? 86  LYS C CG    1 
ATOM   6553  C CD    . LYS C 1 86  ? 23.391  56.626  45.855  1.00 18.09  ? 86  LYS C CD    1 
ATOM   6554  C CE    . LYS C 1 86  ? 22.795  56.441  47.250  1.00 25.79  ? 86  LYS C CE    1 
ATOM   6555  N NZ    . LYS C 1 86  ? 23.839  56.171  48.229  1.00 33.01  ? 86  LYS C NZ    1 
ATOM   6556  H H     . LYS C 1 86  ? 20.818  55.399  43.315  1.00 0.00   ? 86  LYS C H     1 
ATOM   6557  H HZ1   . LYS C 1 86  ? 24.359  55.317  47.942  1.00 0.00   ? 86  LYS C HZ1   1 
ATOM   6558  H HZ2   . LYS C 1 86  ? 24.490  56.981  48.265  1.00 0.00   ? 86  LYS C HZ2   1 
ATOM   6559  H HZ3   . LYS C 1 86  ? 23.411  56.023  49.166  1.00 0.00   ? 86  LYS C HZ3   1 
ATOM   6560  N N     . SER C 1 87  ? 22.503  56.405  40.554  1.00 15.62  ? 87  SER C N     1 
ATOM   6561  C CA    . SER C 1 87  ? 23.024  56.413  39.194  1.00 14.38  ? 87  SER C CA    1 
ATOM   6562  C C     . SER C 1 87  ? 22.007  56.783  38.127  1.00 14.10  ? 87  SER C C     1 
ATOM   6563  O O     . SER C 1 87  ? 22.442  56.977  36.987  1.00 15.05  ? 87  SER C O     1 
ATOM   6564  C CB    . SER C 1 87  ? 23.555  55.049  38.780  1.00 16.13  ? 87  SER C CB    1 
ATOM   6565  O OG    . SER C 1 87  ? 24.281  54.356  39.773  1.00 24.79  ? 87  SER C OG    1 
ATOM   6566  H H     . SER C 1 87  ? 22.483  55.525  41.002  1.00 0.00   ? 87  SER C H     1 
ATOM   6567  H HG    . SER C 1 87  ? 24.946  54.890  40.206  1.00 0.00   ? 87  SER C HG    1 
ATOM   6568  N N     . SER C 1 88  ? 20.695  56.873  38.385  1.00 13.86  ? 88  SER C N     1 
ATOM   6569  C CA    . SER C 1 88  ? 19.757  57.189  37.318  1.00 14.11  ? 88  SER C CA    1 
ATOM   6570  C C     . SER C 1 88  ? 19.721  58.674  37.000  1.00 16.49  ? 88  SER C C     1 
ATOM   6571  O O     . SER C 1 88  ? 19.310  59.093  35.916  1.00 17.37  ? 88  SER C O     1 
ATOM   6572  C CB    . SER C 1 88  ? 18.366  56.732  37.706  1.00 17.68  ? 88  SER C CB    1 
ATOM   6573  O OG    . SER C 1 88  ? 17.951  57.304  38.938  1.00 18.96  ? 88  SER C OG    1 
ATOM   6574  H H     . SER C 1 88  ? 20.336  56.745  39.288  1.00 0.00   ? 88  SER C H     1 
ATOM   6575  H HG    . SER C 1 88  ? 18.074  56.629  39.613  1.00 0.00   ? 88  SER C HG    1 
ATOM   6576  N N     . PHE C 1 89  ? 20.201  59.459  37.978  1.00 19.40  ? 89  PHE C N     1 
ATOM   6577  C CA    . PHE C 1 89  ? 20.263  60.906  37.980  1.00 20.28  ? 89  PHE C CA    1 
ATOM   6578  C C     . PHE C 1 89  ? 18.841  61.408  38.045  1.00 19.18  ? 89  PHE C C     1 
ATOM   6579  O O     . PHE C 1 89  ? 18.531  62.508  37.590  1.00 20.79  ? 89  PHE C O     1 
ATOM   6580  C CB    . PHE C 1 89  ? 20.974  61.454  36.708  1.00 31.23  ? 89  PHE C CB    1 
ATOM   6581  C CG    . PHE C 1 89  ? 22.481  61.161  36.669  1.00 40.41  ? 89  PHE C CG    1 
ATOM   6582  C CD1   . PHE C 1 89  ? 23.332  61.740  37.599  1.00 42.84  ? 89  PHE C CD1   1 
ATOM   6583  C CD2   . PHE C 1 89  ? 22.992  60.270  35.742  1.00 42.57  ? 89  PHE C CD2   1 
ATOM   6584  C CE1   . PHE C 1 89  ? 24.668  61.400  37.637  1.00 44.04  ? 89  PHE C CE1   1 
ATOM   6585  C CE2   . PHE C 1 89  ? 24.329  59.931  35.790  1.00 46.07  ? 89  PHE C CE2   1 
ATOM   6586  C CZ    . PHE C 1 89  ? 25.163  60.483  36.741  1.00 46.65  ? 89  PHE C CZ    1 
ATOM   6587  H H     . PHE C 1 89  ? 20.478  59.015  38.807  1.00 0.00   ? 89  PHE C H     1 
ATOM   6588  N N     . ALA C 1 90  ? 17.935  60.629  38.639  1.00 14.69  ? 90  ALA C N     1 
ATOM   6589  C CA    . ALA C 1 90  ? 16.547  61.024  38.646  1.00 8.91   ? 90  ALA C CA    1 
ATOM   6590  C C     . ALA C 1 90  ? 15.992  61.033  40.051  1.00 7.32   ? 90  ALA C C     1 
ATOM   6591  O O     . ALA C 1 90  ? 14.853  61.456  40.242  1.00 10.64  ? 90  ALA C O     1 
ATOM   6592  C CB    . ALA C 1 90  ? 15.731  60.068  37.798  1.00 6.31   ? 90  ALA C CB    1 
ATOM   6593  H H     . ALA C 1 90  ? 18.222  59.822  39.121  1.00 0.00   ? 90  ALA C H     1 
ATOM   6594  N N     . THR C 1 91  ? 16.751  60.668  41.077  1.00 7.05   ? 91  THR C N     1 
ATOM   6595  C CA    . THR C 1 91  ? 16.197  60.672  42.410  1.00 6.59   ? 91  THR C CA    1 
ATOM   6596  C C     . THR C 1 91  ? 16.802  61.811  43.198  1.00 8.90   ? 91  THR C C     1 
ATOM   6597  O O     . THR C 1 91  ? 17.808  62.364  42.752  1.00 13.27  ? 91  THR C O     1 
ATOM   6598  C CB    . THR C 1 91  ? 16.475  59.311  43.062  1.00 5.99   ? 91  THR C CB    1 
ATOM   6599  O OG1   . THR C 1 91  ? 17.876  59.160  43.214  1.00 7.04   ? 91  THR C OG1   1 
ATOM   6600  C CG2   . THR C 1 91  ? 15.859  58.172  42.227  1.00 3.46   ? 91  THR C CG2   1 
ATOM   6601  H H     . THR C 1 91  ? 17.703  60.491  40.963  1.00 0.00   ? 91  THR C H     1 
ATOM   6602  H HG1   . THR C 1 91  ? 18.327  59.219  42.354  1.00 0.00   ? 91  THR C HG1   1 
ATOM   6603  N N     . CYS C 1 92  ? 16.171  62.277  44.276  1.00 9.34   ? 92  CYS C N     1 
ATOM   6604  C CA    . CYS C 1 92  ? 16.786  63.247  45.143  1.00 6.64   ? 92  CYS C CA    1 
ATOM   6605  C C     . CYS C 1 92  ? 16.617  62.859  46.601  1.00 7.88   ? 92  CYS C C     1 
ATOM   6606  O O     . CYS C 1 92  ? 17.402  63.320  47.439  1.00 13.44  ? 92  CYS C O     1 
ATOM   6607  C CB    . CYS C 1 92  ? 16.202  64.641  44.903  1.00 9.31   ? 92  CYS C CB    1 
ATOM   6608  S SG    . CYS C 1 92  ? 14.438  64.929  45.207  1.00 15.37  ? 92  CYS C SG    1 
ATOM   6609  H H     . CYS C 1 92  ? 15.233  62.029  44.416  1.00 0.00   ? 92  CYS C H     1 
ATOM   6610  N N     . VAL C 1 93  ? 15.647  62.033  47.002  1.00 6.38   ? 93  VAL C N     1 
ATOM   6611  C CA    . VAL C 1 93  ? 15.510  61.564  48.391  1.00 7.14   ? 93  VAL C CA    1 
ATOM   6612  C C     . VAL C 1 93  ? 15.095  60.105  48.252  1.00 3.93   ? 93  VAL C C     1 
ATOM   6613  O O     . VAL C 1 93  ? 14.211  59.832  47.438  1.00 5.35   ? 93  VAL C O     1 
ATOM   6614  C CB    . VAL C 1 93  ? 14.432  62.372  49.154  1.00 3.33   ? 93  VAL C CB    1 
ATOM   6615  C CG1   . VAL C 1 93  ? 14.067  61.778  50.498  1.00 6.09   ? 93  VAL C CG1   1 
ATOM   6616  C CG2   . VAL C 1 93  ? 15.040  63.680  49.529  1.00 7.10   ? 93  VAL C CG2   1 
ATOM   6617  H H     . VAL C 1 93  ? 15.017  61.660  46.351  1.00 0.00   ? 93  VAL C H     1 
ATOM   6618  N N     . LEU C 1 94  ? 15.748  59.156  48.922  1.00 4.28   ? 94  LEU C N     1 
ATOM   6619  C CA    . LEU C 1 94  ? 15.437  57.727  48.822  1.00 3.51   ? 94  LEU C CA    1 
ATOM   6620  C C     . LEU C 1 94  ? 15.119  57.234  50.210  1.00 6.56   ? 94  LEU C C     1 
ATOM   6621  O O     . LEU C 1 94  ? 15.926  57.495  51.120  1.00 8.28   ? 94  LEU C O     1 
ATOM   6622  C CB    . LEU C 1 94  ? 16.618  56.943  48.334  1.00 2.00   ? 94  LEU C CB    1 
ATOM   6623  C CG    . LEU C 1 94  ? 17.094  57.243  46.939  1.00 2.03   ? 94  LEU C CG    1 
ATOM   6624  C CD1   . LEU C 1 94  ? 18.337  56.468  46.686  1.00 9.23   ? 94  LEU C CD1   1 
ATOM   6625  C CD2   . LEU C 1 94  ? 16.059  56.838  45.920  1.00 7.42   ? 94  LEU C CD2   1 
ATOM   6626  H H     . LEU C 1 94  ? 16.445  59.428  49.560  1.00 0.00   ? 94  LEU C H     1 
ATOM   6627  N N     . VAL C 1 95  ? 14.006  56.546  50.458  1.00 2.01   ? 95  VAL C N     1 
ATOM   6628  C CA    . VAL C 1 95  ? 13.714  56.065  51.797  1.00 3.54   ? 95  VAL C CA    1 
ATOM   6629  C C     . VAL C 1 95  ? 13.556  54.574  51.661  1.00 8.12   ? 95  VAL C C     1 
ATOM   6630  O O     . VAL C 1 95  ? 12.686  54.049  50.950  1.00 2.95   ? 95  VAL C O     1 
ATOM   6631  C CB    . VAL C 1 95  ? 12.426  56.728  52.333  1.00 7.84   ? 95  VAL C CB    1 
ATOM   6632  C CG1   . VAL C 1 95  ? 11.902  56.111  53.618  1.00 10.42  ? 95  VAL C CG1   1 
ATOM   6633  C CG2   . VAL C 1 95  ? 12.787  58.153  52.671  1.00 10.44  ? 95  VAL C CG2   1 
ATOM   6634  H H     . VAL C 1 95  ? 13.396  56.309  49.731  1.00 0.00   ? 95  VAL C H     1 
ATOM   6635  N N     . SER C 1 96  ? 14.445  53.888  52.357  1.00 9.65   ? 96  SER C N     1 
ATOM   6636  C CA    . SER C 1 96  ? 14.408  52.468  52.316  1.00 10.59  ? 96  SER C CA    1 
ATOM   6637  C C     . SER C 1 96  ? 14.022  51.970  53.679  1.00 12.82  ? 96  SER C C     1 
ATOM   6638  O O     . SER C 1 96  ? 14.285  52.577  54.727  1.00 10.95  ? 96  SER C O     1 
ATOM   6639  C CB    . SER C 1 96  ? 15.745  51.919  51.969  1.00 10.16  ? 96  SER C CB    1 
ATOM   6640  O OG    . SER C 1 96  ? 15.754  50.490  51.985  1.00 18.44  ? 96  SER C OG    1 
ATOM   6641  H H     . SER C 1 96  ? 14.994  54.335  53.037  1.00 0.00   ? 96  SER C H     1 
ATOM   6642  H HG    . SER C 1 96  ? 16.549  50.243  51.490  1.00 0.00   ? 96  SER C HG    1 
ATOM   6643  N N     . GLU C 1 97  ? 13.426  50.790  53.600  1.00 11.10  ? 97  GLU C N     1 
ATOM   6644  C CA    . GLU C 1 97  ? 13.137  50.006  54.781  1.00 17.12  ? 97  GLU C CA    1 
ATOM   6645  C C     . GLU C 1 97  ? 14.423  49.742  55.557  1.00 17.90  ? 97  GLU C C     1 
ATOM   6646  O O     . GLU C 1 97  ? 14.397  49.732  56.784  1.00 19.26  ? 97  GLU C O     1 
ATOM   6647  C CB    . GLU C 1 97  ? 12.522  48.684  54.375  1.00 16.28  ? 97  GLU C CB    1 
ATOM   6648  C CG    . GLU C 1 97  ? 11.776  47.920  55.462  1.00 24.14  ? 97  GLU C CG    1 
ATOM   6649  C CD    . GLU C 1 97  ? 12.494  46.897  56.335  1.00 29.11  ? 97  GLU C CD    1 
ATOM   6650  O OE1   . GLU C 1 97  ? 13.658  46.546  56.089  1.00 31.87  ? 97  GLU C OE1   1 
ATOM   6651  O OE2   . GLU C 1 97  ? 11.850  46.439  57.279  1.00 29.78  ? 97  GLU C OE2   1 
ATOM   6652  H H     . GLU C 1 97  ? 13.204  50.455  52.701  1.00 0.00   ? 97  GLU C H     1 
ATOM   6653  N N     . GLU C 1 98  ? 15.546  49.540  54.868  1.00 16.67  ? 98  GLU C N     1 
ATOM   6654  C CA    . GLU C 1 98  ? 16.803  49.207  55.530  1.00 19.87  ? 98  GLU C CA    1 
ATOM   6655  C C     . GLU C 1 98  ? 17.531  50.264  56.335  1.00 21.22  ? 98  GLU C C     1 
ATOM   6656  O O     . GLU C 1 98  ? 18.284  49.978  57.271  1.00 19.09  ? 98  GLU C O     1 
ATOM   6657  C CB    . GLU C 1 98  ? 17.784  48.699  54.512  1.00 21.47  ? 98  GLU C CB    1 
ATOM   6658  C CG    . GLU C 1 98  ? 17.487  47.294  54.016  1.00 30.66  ? 98  GLU C CG    1 
ATOM   6659  C CD    . GLU C 1 98  ? 17.583  46.217  55.084  1.00 33.89  ? 98  GLU C CD    1 
ATOM   6660  O OE1   . GLU C 1 98  ? 18.554  46.222  55.848  1.00 34.90  ? 98  GLU C OE1   1 
ATOM   6661  O OE2   . GLU C 1 98  ? 16.679  45.378  55.139  1.00 38.75  ? 98  GLU C OE2   1 
ATOM   6662  H H     . GLU C 1 98  ? 15.527  49.628  53.891  1.00 0.00   ? 98  GLU C H     1 
ATOM   6663  N N     . ASP C 1 99  ? 17.352  51.508  55.917  1.00 24.44  ? 99  ASP C N     1 
ATOM   6664  C CA    . ASP C 1 99  ? 18.098  52.607  56.479  1.00 23.77  ? 99  ASP C CA    1 
ATOM   6665  C C     . ASP C 1 99  ? 17.206  53.406  57.392  1.00 22.17  ? 99  ASP C C     1 
ATOM   6666  O O     . ASP C 1 99  ? 16.070  53.732  57.026  1.00 21.47  ? 99  ASP C O     1 
ATOM   6667  C CB    . ASP C 1 99  ? 18.618  53.475  55.344  1.00 29.19  ? 99  ASP C CB    1 
ATOM   6668  C CG    . ASP C 1 99  ? 19.520  52.736  54.348  1.00 34.06  ? 99  ASP C CG    1 
ATOM   6669  O OD1   . ASP C 1 99  ? 20.736  52.696  54.537  1.00 32.87  ? 99  ASP C OD1   1 
ATOM   6670  O OD2   . ASP C 1 99  ? 19.004  52.200  53.368  1.00 38.65  ? 99  ASP C OD2   1 
ATOM   6671  H H     . ASP C 1 99  ? 16.593  51.708  55.334  1.00 0.00   ? 99  ASP C H     1 
ATOM   6672  N N     . LYS C 1 100 ? 17.695  53.757  58.580  1.00 23.67  ? 100 LYS C N     1 
ATOM   6673  C CA    . LYS C 1 100 ? 16.896  54.550  59.504  1.00 27.03  ? 100 LYS C CA    1 
ATOM   6674  C C     . LYS C 1 100 ? 16.626  55.987  59.069  1.00 25.03  ? 100 LYS C C     1 
ATOM   6675  O O     . LYS C 1 100 ? 15.691  56.615  59.568  1.00 25.67  ? 100 LYS C O     1 
ATOM   6676  C CB    . LYS C 1 100 ? 17.553  54.588  60.876  1.00 35.17  ? 100 LYS C CB    1 
ATOM   6677  C CG    . LYS C 1 100 ? 16.563  55.015  61.986  1.00 49.75  ? 100 LYS C CG    1 
ATOM   6678  C CD    . LYS C 1 100 ? 17.204  55.058  63.373  1.00 60.55  ? 100 LYS C CD    1 
ATOM   6679  C CE    . LYS C 1 100 ? 16.196  55.299  64.512  1.00 63.77  ? 100 LYS C CE    1 
ATOM   6680  N NZ    . LYS C 1 100 ? 16.754  54.775  65.763  1.00 69.37  ? 100 LYS C NZ    1 
ATOM   6681  H H     . LYS C 1 100 ? 18.550  53.378  58.866  1.00 0.00   ? 100 LYS C H     1 
ATOM   6682  H HZ1   . LYS C 1 100 ? 17.657  55.243  65.984  1.00 0.00   ? 100 LYS C HZ1   1 
ATOM   6683  H HZ2   . LYS C 1 100 ? 16.084  54.916  66.545  1.00 0.00   ? 100 LYS C HZ2   1 
ATOM   6684  H HZ3   . LYS C 1 100 ? 16.932  53.755  65.650  1.00 0.00   ? 100 LYS C HZ3   1 
ATOM   6685  N N     . HIS C 1 101 ? 17.364  56.576  58.142  1.00 23.55  ? 101 HIS C N     1 
ATOM   6686  C CA    . HIS C 1 101 ? 17.143  57.971  57.781  1.00 23.27  ? 101 HIS C CA    1 
ATOM   6687  C C     . HIS C 1 101 ? 16.934  58.066  56.295  1.00 22.67  ? 101 HIS C C     1 
ATOM   6688  O O     . HIS C 1 101 ? 17.368  57.158  55.582  1.00 18.89  ? 101 HIS C O     1 
ATOM   6689  C CB    . HIS C 1 101 ? 18.340  58.822  58.152  1.00 28.77  ? 101 HIS C CB    1 
ATOM   6690  C CG    . HIS C 1 101 ? 18.415  59.123  59.636  1.00 34.00  ? 101 HIS C CG    1 
ATOM   6691  N ND1   . HIS C 1 101 ? 17.803  60.166  60.196  1.00 37.84  ? 101 HIS C ND1   1 
ATOM   6692  C CD2   . HIS C 1 101 ? 19.097  58.427  60.595  1.00 35.82  ? 101 HIS C CD2   1 
ATOM   6693  C CE1   . HIS C 1 101 ? 18.102  60.134  61.474  1.00 39.92  ? 101 HIS C CE1   1 
ATOM   6694  N NE2   . HIS C 1 101 ? 18.873  59.094  61.701  1.00 39.06  ? 101 HIS C NE2   1 
ATOM   6695  H H     . HIS C 1 101 ? 17.957  56.049  57.570  1.00 0.00   ? 101 HIS C H     1 
ATOM   6696  H HD1   . HIS C 1 101 ? 17.207  60.816  59.765  1.00 0.00   ? 101 HIS C HD1   1 
ATOM   6697  H HE2   . HIS C 1 101 ? 19.243  58.852  62.579  1.00 0.00   ? 101 HIS C HE2   1 
ATOM   6698  N N     . ALA C 1 102 ? 16.259  59.118  55.827  1.00 19.46  ? 102 ALA C N     1 
ATOM   6699  C CA    . ALA C 1 102 ? 16.073  59.276  54.393  1.00 19.11  ? 102 ALA C CA    1 
ATOM   6700  C C     . ALA C 1 102 ? 17.459  59.578  53.834  1.00 17.00  ? 102 ALA C C     1 
ATOM   6701  O O     . ALA C 1 102 ? 18.152  60.401  54.442  1.00 14.95  ? 102 ALA C O     1 
ATOM   6702  C CB    . ALA C 1 102 ? 15.173  60.459  54.078  1.00 12.02  ? 102 ALA C CB    1 
ATOM   6703  H H     . ALA C 1 102 ? 15.931  59.821  56.416  1.00 0.00   ? 102 ALA C H     1 
ATOM   6704  N N     . ILE C 1 103 ? 17.897  58.899  52.769  1.00 15.91  ? 103 ILE C N     1 
ATOM   6705  C CA    . ILE C 1 103 ? 19.173  59.164  52.089  1.00 14.93  ? 103 ILE C CA    1 
ATOM   6706  C C     . ILE C 1 103 ? 18.954  60.363  51.184  1.00 12.19  ? 103 ILE C C     1 
ATOM   6707  O O     . ILE C 1 103 ? 17.931  60.401  50.503  1.00 17.17  ? 103 ILE C O     1 
ATOM   6708  C CB    . ILE C 1 103 ? 19.612  57.926  51.228  1.00 14.71  ? 103 ILE C CB    1 
ATOM   6709  C CG1   . ILE C 1 103 ? 20.345  56.951  52.112  1.00 10.45  ? 103 ILE C CG1   1 
ATOM   6710  C CG2   . ILE C 1 103 ? 20.554  58.312  50.079  1.00 12.69  ? 103 ILE C CG2   1 
ATOM   6711  C CD1   . ILE C 1 103 ? 19.436  56.271  53.135  1.00 15.44  ? 103 ILE C CD1   1 
ATOM   6712  H H     . ILE C 1 103 ? 17.299  58.230  52.373  1.00 0.00   ? 103 ILE C H     1 
ATOM   6713  N N     . ILE C 1 104 ? 19.850  61.335  51.083  1.00 14.31  ? 104 ILE C N     1 
ATOM   6714  C CA    . ILE C 1 104 ? 19.631  62.474  50.208  1.00 13.26  ? 104 ILE C CA    1 
ATOM   6715  C C     . ILE C 1 104 ? 20.617  62.231  49.087  1.00 16.66  ? 104 ILE C C     1 
ATOM   6716  O O     . ILE C 1 104 ? 21.764  61.857  49.344  1.00 14.18  ? 104 ILE C O     1 
ATOM   6717  C CB    . ILE C 1 104 ? 19.958  63.795  50.916  1.00 13.26  ? 104 ILE C CB    1 
ATOM   6718  C CG1   . ILE C 1 104 ? 19.219  63.931  52.246  1.00 6.67   ? 104 ILE C CG1   1 
ATOM   6719  C CG2   . ILE C 1 104 ? 19.637  64.915  49.950  1.00 8.16   ? 104 ILE C CG2   1 
ATOM   6720  C CD1   . ILE C 1 104 ? 17.730  63.700  52.229  1.00 9.67   ? 104 ILE C CD1   1 
ATOM   6721  H H     . ILE C 1 104 ? 20.725  61.253  51.510  1.00 0.00   ? 104 ILE C H     1 
ATOM   6722  N N     . VAL C 1 105 ? 20.228  62.385  47.831  1.00 19.58  ? 105 VAL C N     1 
ATOM   6723  C CA    . VAL C 1 105 ? 21.178  62.097  46.778  1.00 22.48  ? 105 VAL C CA    1 
ATOM   6724  C C     . VAL C 1 105 ? 22.158  63.268  46.695  1.00 29.91  ? 105 VAL C C     1 
ATOM   6725  O O     . VAL C 1 105 ? 21.856  64.411  47.052  1.00 32.35  ? 105 VAL C O     1 
ATOM   6726  C CB    . VAL C 1 105 ? 20.400  61.859  45.458  1.00 19.50  ? 105 VAL C CB    1 
ATOM   6727  C CG1   . VAL C 1 105 ? 21.287  61.541  44.263  1.00 11.21  ? 105 VAL C CG1   1 
ATOM   6728  C CG2   . VAL C 1 105 ? 19.565  60.614  45.672  1.00 15.62  ? 105 VAL C CG2   1 
ATOM   6729  H H     . VAL C 1 105 ? 19.363  62.805  47.635  1.00 0.00   ? 105 VAL C H     1 
ATOM   6730  N N     . GLU C 1 106 ? 23.377  62.936  46.261  1.00 33.27  ? 106 GLU C N     1 
ATOM   6731  C CA    . GLU C 1 106 ? 24.468  63.882  46.079  1.00 34.07  ? 106 GLU C CA    1 
ATOM   6732  C C     . GLU C 1 106 ? 24.104  64.854  44.967  1.00 34.01  ? 106 GLU C C     1 
ATOM   6733  O O     . GLU C 1 106 ? 23.649  64.413  43.902  1.00 33.80  ? 106 GLU C O     1 
ATOM   6734  C CB    . GLU C 1 106 ? 25.762  63.187  45.669  1.00 36.50  ? 106 GLU C CB    1 
ATOM   6735  C CG    . GLU C 1 106 ? 26.219  62.041  46.560  1.00 43.92  ? 106 GLU C CG    1 
ATOM   6736  C CD    . GLU C 1 106 ? 25.596  60.697  46.199  1.00 46.07  ? 106 GLU C CD    1 
ATOM   6737  O OE1   . GLU C 1 106 ? 26.097  60.067  45.270  1.00 49.45  ? 106 GLU C OE1   1 
ATOM   6738  O OE2   . GLU C 1 106 ? 24.629  60.280  46.844  1.00 48.97  ? 106 GLU C OE2   1 
ATOM   6739  H H     . GLU C 1 106 ? 23.511  62.004  46.013  1.00 0.00   ? 106 GLU C H     1 
ATOM   6740  N N     . PRO C 1 107 ? 24.367  66.153  45.110  1.00 32.65  ? 107 PRO C N     1 
ATOM   6741  C CA    . PRO C 1 107 ? 23.931  67.197  44.195  1.00 31.56  ? 107 PRO C CA    1 
ATOM   6742  C C     . PRO C 1 107 ? 24.189  66.999  42.714  1.00 34.05  ? 107 PRO C C     1 
ATOM   6743  O O     . PRO C 1 107 ? 23.412  67.466  41.881  1.00 34.39  ? 107 PRO C O     1 
ATOM   6744  C CB    . PRO C 1 107 ? 24.586  68.437  44.733  1.00 29.39  ? 107 PRO C CB    1 
ATOM   6745  C CG    . PRO C 1 107 ? 25.700  67.943  45.617  1.00 30.88  ? 107 PRO C CG    1 
ATOM   6746  C CD    . PRO C 1 107 ? 25.053  66.737  46.257  1.00 32.03  ? 107 PRO C CD    1 
ATOM   6747  N N     . GLU C 1 108 ? 25.261  66.278  42.354  1.00 36.55  ? 108 GLU C N     1 
ATOM   6748  C CA    . GLU C 1 108 ? 25.569  66.027  40.950  1.00 38.83  ? 108 GLU C CA    1 
ATOM   6749  C C     . GLU C 1 108 ? 24.611  65.023  40.335  1.00 33.88  ? 108 GLU C C     1 
ATOM   6750  O O     . GLU C 1 108 ? 24.293  65.046  39.149  1.00 30.87  ? 108 GLU C O     1 
ATOM   6751  C CB    . GLU C 1 108 ? 27.003  65.493  40.789  1.00 50.14  ? 108 GLU C CB    1 
ATOM   6752  C CG    . GLU C 1 108 ? 27.347  65.186  39.307  1.00 65.88  ? 108 GLU C CG    1 
ATOM   6753  C CD    . GLU C 1 108 ? 28.841  65.162  38.989  1.00 75.27  ? 108 GLU C CD    1 
ATOM   6754  O OE1   . GLU C 1 108 ? 29.450  66.242  38.976  1.00 78.44  ? 108 GLU C OE1   1 
ATOM   6755  O OE2   . GLU C 1 108 ? 29.383  64.076  38.732  1.00 80.87  ? 108 GLU C OE2   1 
ATOM   6756  H H     . GLU C 1 108 ? 25.835  65.897  43.045  1.00 0.00   ? 108 GLU C H     1 
ATOM   6757  N N     . LYS C 1 109 ? 24.181  64.119  41.200  1.00 30.26  ? 109 LYS C N     1 
ATOM   6758  C CA    . LYS C 1 109 ? 23.333  63.026  40.807  1.00 27.74  ? 109 LYS C CA    1 
ATOM   6759  C C     . LYS C 1 109 ? 21.858  63.270  41.058  1.00 23.62  ? 109 LYS C C     1 
ATOM   6760  O O     . LYS C 1 109 ? 21.088  62.318  40.951  1.00 23.51  ? 109 LYS C O     1 
ATOM   6761  C CB    . LYS C 1 109 ? 23.820  61.799  41.542  1.00 28.86  ? 109 LYS C CB    1 
ATOM   6762  C CG    . LYS C 1 109 ? 25.237  61.511  41.110  1.00 31.70  ? 109 LYS C CG    1 
ATOM   6763  C CD    . LYS C 1 109 ? 25.677  60.241  41.758  1.00 33.93  ? 109 LYS C CD    1 
ATOM   6764  C CE    . LYS C 1 109 ? 26.993  59.870  41.145  1.00 35.44  ? 109 LYS C CE    1 
ATOM   6765  N NZ    . LYS C 1 109 ? 27.463  58.663  41.791  1.00 40.86  ? 109 LYS C NZ    1 
ATOM   6766  H H     . LYS C 1 109 ? 24.375  64.232  42.148  1.00 0.00   ? 109 LYS C H     1 
ATOM   6767  H HZ1   . LYS C 1 109 ? 27.581  58.837  42.811  1.00 0.00   ? 109 LYS C HZ1   1 
ATOM   6768  H HZ2   . LYS C 1 109 ? 26.770  57.901  41.640  1.00 0.00   ? 109 LYS C HZ2   1 
ATOM   6769  H HZ3   . LYS C 1 109 ? 28.375  58.375  41.382  1.00 0.00   ? 109 LYS C HZ3   1 
ATOM   6770  N N     . ARG C 1 110 ? 21.423  64.493  41.408  1.00 21.46  ? 110 ARG C N     1 
ATOM   6771  C CA    . ARG C 1 110 ? 20.021  64.757  41.708  1.00 13.88  ? 110 ARG C CA    1 
ATOM   6772  C C     . ARG C 1 110 ? 19.121  64.916  40.516  1.00 12.67  ? 110 ARG C C     1 
ATOM   6773  O O     . ARG C 1 110 ? 19.475  65.423  39.455  1.00 16.53  ? 110 ARG C O     1 
ATOM   6774  C CB    . ARG C 1 110 ? 19.847  65.998  42.534  1.00 10.26  ? 110 ARG C CB    1 
ATOM   6775  C CG    . ARG C 1 110 ? 20.161  65.719  43.973  1.00 8.30   ? 110 ARG C CG    1 
ATOM   6776  C CD    . ARG C 1 110 ? 19.911  66.980  44.767  1.00 10.75  ? 110 ARG C CD    1 
ATOM   6777  N NE    . ARG C 1 110 ? 20.644  66.842  46.007  1.00 13.10  ? 110 ARG C NE    1 
ATOM   6778  C CZ    . ARG C 1 110 ? 21.015  67.883  46.730  1.00 17.48  ? 110 ARG C CZ    1 
ATOM   6779  N NH1   . ARG C 1 110 ? 20.564  69.103  46.442  1.00 23.58  ? 110 ARG C NH1   1 
ATOM   6780  N NH2   . ARG C 1 110 ? 21.793  67.666  47.792  1.00 17.03  ? 110 ARG C NH2   1 
ATOM   6781  H H     . ARG C 1 110 ? 22.039  65.247  41.382  1.00 0.00   ? 110 ARG C H     1 
ATOM   6782  H HE    . ARG C 1 110 ? 20.843  65.945  46.337  1.00 0.00   ? 110 ARG C HE    1 
ATOM   6783  H HH11  . ARG C 1 110 ? 19.945  69.245  45.671  1.00 0.00   ? 110 ARG C HH11  1 
ATOM   6784  H HH12  . ARG C 1 110 ? 20.854  69.875  47.004  1.00 0.00   ? 110 ARG C HH12  1 
ATOM   6785  H HH21  . ARG C 1 110 ? 22.074  66.732  48.016  1.00 0.00   ? 110 ARG C HH21  1 
ATOM   6786  H HH22  . ARG C 1 110 ? 22.083  68.434  48.364  1.00 0.00   ? 110 ARG C HH22  1 
ATOM   6787  N N     . GLY C 1 111 ? 17.930  64.434  40.792  1.00 13.13  ? 111 GLY C N     1 
ATOM   6788  C CA    . GLY C 1 111 ? 16.819  64.498  39.862  1.00 15.98  ? 111 GLY C CA    1 
ATOM   6789  C C     . GLY C 1 111 ? 15.611  64.854  40.702  1.00 15.92  ? 111 GLY C C     1 
ATOM   6790  O O     . GLY C 1 111 ? 15.753  65.099  41.908  1.00 20.46  ? 111 GLY C O     1 
ATOM   6791  H H     . GLY C 1 111 ? 17.746  64.075  41.688  1.00 0.00   ? 111 GLY C H     1 
ATOM   6792  N N     . LYS C 1 112 ? 14.407  64.810  40.132  1.00 13.09  ? 112 LYS C N     1 
ATOM   6793  C CA    . LYS C 1 112 ? 13.228  65.287  40.852  1.00 11.60  ? 112 LYS C CA    1 
ATOM   6794  C C     . LYS C 1 112 ? 12.357  64.297  41.602  1.00 13.54  ? 112 LYS C C     1 
ATOM   6795  O O     . LYS C 1 112 ? 11.390  64.695  42.263  1.00 12.76  ? 112 LYS C O     1 
ATOM   6796  C CB    . LYS C 1 112 ? 12.344  66.048  39.883  1.00 14.67  ? 112 LYS C CB    1 
ATOM   6797  C CG    . LYS C 1 112 ? 11.873  65.372  38.608  1.00 18.32  ? 112 LYS C CG    1 
ATOM   6798  C CD    . LYS C 1 112 ? 11.041  66.397  37.831  1.00 24.89  ? 112 LYS C CD    1 
ATOM   6799  C CE    . LYS C 1 112 ? 10.331  65.855  36.597  1.00 22.97  ? 112 LYS C CE    1 
ATOM   6800  N NZ    . LYS C 1 112 ? 11.318  65.491  35.604  1.00 31.51  ? 112 LYS C NZ    1 
ATOM   6801  H H     . LYS C 1 112 ? 14.299  64.370  39.271  1.00 0.00   ? 112 LYS C H     1 
ATOM   6802  H HZ1   . LYS C 1 112 ? 11.923  66.307  35.385  1.00 0.00   ? 112 LYS C HZ1   1 
ATOM   6803  H HZ2   . LYS C 1 112 ? 11.899  64.709  35.969  1.00 0.00   ? 112 LYS C HZ2   1 
ATOM   6804  H HZ3   . LYS C 1 112 ? 10.835  65.183  34.736  1.00 0.00   ? 112 LYS C HZ3   1 
ATOM   6805  N N     . TYR C 1 113 ? 12.657  63.009  41.541  1.00 10.78  ? 113 TYR C N     1 
ATOM   6806  C CA    . TYR C 1 113 ? 11.780  62.024  42.115  1.00 6.68   ? 113 TYR C CA    1 
ATOM   6807  C C     . TYR C 1 113 ? 12.228  61.589  43.506  1.00 2.14   ? 113 TYR C C     1 
ATOM   6808  O O     . TYR C 1 113 ? 13.412  61.632  43.833  1.00 2.00   ? 113 TYR C O     1 
ATOM   6809  C CB    . TYR C 1 113 ? 11.735  60.916  41.057  1.00 9.03   ? 113 TYR C CB    1 
ATOM   6810  C CG    . TYR C 1 113 ? 10.905  61.312  39.834  1.00 2.50   ? 113 TYR C CG    1 
ATOM   6811  C CD1   . TYR C 1 113 ? 9.537   61.393  39.980  1.00 5.74   ? 113 TYR C CD1   1 
ATOM   6812  C CD2   . TYR C 1 113 ? 11.477  61.653  38.629  1.00 2.00   ? 113 TYR C CD2   1 
ATOM   6813  C CE1   . TYR C 1 113 ? 8.752   61.858  38.950  1.00 6.19   ? 113 TYR C CE1   1 
ATOM   6814  C CE2   . TYR C 1 113 ? 10.687  62.128  37.589  1.00 2.00   ? 113 TYR C CE2   1 
ATOM   6815  C CZ    . TYR C 1 113 ? 9.328   62.218  37.756  1.00 6.21   ? 113 TYR C CZ    1 
ATOM   6816  O OH    . TYR C 1 113 ? 8.479   62.589  36.742  1.00 4.37   ? 113 TYR C OH    1 
ATOM   6817  H H     . TYR C 1 113 ? 13.521  62.710  41.186  1.00 0.00   ? 113 TYR C H     1 
ATOM   6818  H HH    . TYR C 1 113 ? 7.753   63.104  37.080  1.00 0.00   ? 113 TYR C HH    1 
ATOM   6819  N N     . VAL C 1 114 ? 11.289  61.224  44.362  1.00 2.00   ? 114 VAL C N     1 
ATOM   6820  C CA    . VAL C 1 114 ? 11.540  60.844  45.747  1.00 6.04   ? 114 VAL C CA    1 
ATOM   6821  C C     . VAL C 1 114 ? 11.026  59.407  45.772  1.00 11.05  ? 114 VAL C C     1 
ATOM   6822  O O     . VAL C 1 114 ? 9.858   59.238  45.405  1.00 12.04  ? 114 VAL C O     1 
ATOM   6823  C CB    . VAL C 1 114 ? 10.713  61.738  46.708  1.00 8.04   ? 114 VAL C CB    1 
ATOM   6824  C CG1   . VAL C 1 114 ? 10.907  61.240  48.133  1.00 9.75   ? 114 VAL C CG1   1 
ATOM   6825  C CG2   . VAL C 1 114 ? 11.147  63.179  46.644  1.00 2.00   ? 114 VAL C CG2   1 
ATOM   6826  H H     . VAL C 1 114 ? 10.370  61.133  44.027  1.00 0.00   ? 114 VAL C H     1 
ATOM   6827  N N     . VAL C 1 115 ? 11.787  58.376  46.174  1.00 5.91   ? 115 VAL C N     1 
ATOM   6828  C CA    . VAL C 1 115 ? 11.371  57.001  46.027  1.00 3.10   ? 115 VAL C CA    1 
ATOM   6829  C C     . VAL C 1 115 ? 11.386  56.364  47.404  1.00 5.16   ? 115 VAL C C     1 
ATOM   6830  O O     . VAL C 1 115 ? 12.375  56.471  48.131  1.00 5.49   ? 115 VAL C O     1 
ATOM   6831  C CB    . VAL C 1 115 ? 12.344  56.194  45.096  1.00 4.39   ? 115 VAL C CB    1 
ATOM   6832  C CG1   . VAL C 1 115 ? 11.864  54.754  44.941  1.00 2.12   ? 115 VAL C CG1   1 
ATOM   6833  C CG2   . VAL C 1 115 ? 12.348  56.743  43.695  1.00 4.12   ? 115 VAL C CG2   1 
ATOM   6834  H H     . VAL C 1 115 ? 12.624  58.560  46.654  1.00 0.00   ? 115 VAL C H     1 
ATOM   6835  N N     . CYS C 1 116 ? 10.328  55.666  47.776  1.00 5.95   ? 116 CYS C N     1 
ATOM   6836  C CA    . CYS C 1 116 ? 10.264  54.982  49.053  1.00 6.38   ? 116 CYS C CA    1 
ATOM   6837  C C     . CYS C 1 116 ? 10.225  53.508  48.686  1.00 5.20   ? 116 CYS C C     1 
ATOM   6838  O O     . CYS C 1 116 ? 9.449   53.165  47.790  1.00 9.51   ? 116 CYS C O     1 
ATOM   6839  C CB    . CYS C 1 116 ? 9.007   55.428  49.767  1.00 2.53   ? 116 CYS C CB    1 
ATOM   6840  S SG    . CYS C 1 116 ? 8.962   57.218  50.049  1.00 3.81   ? 116 CYS C SG    1 
ATOM   6841  H H     . CYS C 1 116 ? 9.598   55.531  47.135  1.00 0.00   ? 116 CYS C H     1 
ATOM   6842  N N     . PHE C 1 117 ? 11.010  52.602  49.272  1.00 4.68   ? 117 PHE C N     1 
ATOM   6843  C CA    . PHE C 1 117 ? 10.999  51.217  48.845  1.00 7.44   ? 117 PHE C CA    1 
ATOM   6844  C C     . PHE C 1 117 ? 11.354  50.249  49.959  1.00 8.21   ? 117 PHE C C     1 
ATOM   6845  O O     . PHE C 1 117 ? 12.021  50.589  50.946  1.00 11.77  ? 117 PHE C O     1 
ATOM   6846  C CB    . PHE C 1 117 ? 11.983  51.015  47.671  1.00 4.74   ? 117 PHE C CB    1 
ATOM   6847  C CG    . PHE C 1 117 ? 13.452  51.376  47.937  1.00 4.23   ? 117 PHE C CG    1 
ATOM   6848  C CD1   . PHE C 1 117 ? 13.889  52.674  47.818  1.00 2.00   ? 117 PHE C CD1   1 
ATOM   6849  C CD2   . PHE C 1 117 ? 14.370  50.396  48.250  1.00 9.33   ? 117 PHE C CD2   1 
ATOM   6850  C CE1   . PHE C 1 117 ? 15.215  52.976  47.987  1.00 6.34   ? 117 PHE C CE1   1 
ATOM   6851  C CE2   . PHE C 1 117 ? 15.706  50.705  48.422  1.00 6.46   ? 117 PHE C CE2   1 
ATOM   6852  C CZ    . PHE C 1 117 ? 16.133  51.997  48.286  1.00 5.83   ? 117 PHE C CZ    1 
ATOM   6853  H H     . PHE C 1 117 ? 11.584  52.831  50.030  1.00 0.00   ? 117 PHE C H     1 
ATOM   6854  N N     . ASP C 1 118 ? 10.867  49.024  49.843  1.00 7.66   ? 118 ASP C N     1 
ATOM   6855  C CA    . ASP C 1 118 ? 11.235  47.982  50.773  1.00 9.74   ? 118 ASP C CA    1 
ATOM   6856  C C     . ASP C 1 118 ? 12.002  47.038  49.843  1.00 8.92   ? 118 ASP C C     1 
ATOM   6857  O O     . ASP C 1 118 ? 11.406  46.464  48.921  1.00 9.01   ? 118 ASP C O     1 
ATOM   6858  C CB    . ASP C 1 118 ? 10.005  47.274  51.364  1.00 9.88   ? 118 ASP C CB    1 
ATOM   6859  C CG    . ASP C 1 118 ? 10.287  46.207  52.420  1.00 13.14  ? 118 ASP C CG    1 
ATOM   6860  O OD1   . ASP C 1 118 ? 11.421  45.755  52.585  1.00 21.64  ? 118 ASP C OD1   1 
ATOM   6861  O OD2   . ASP C 1 118 ? 9.348   45.801  53.095  1.00 11.89  ? 118 ASP C OD2   1 
ATOM   6862  H H     . ASP C 1 118 ? 10.298  48.813  49.071  1.00 0.00   ? 118 ASP C H     1 
ATOM   6863  N N     . PRO C 1 119 ? 13.324  46.889  50.010  1.00 5.02   ? 119 PRO C N     1 
ATOM   6864  C CA    . PRO C 1 119 ? 14.146  46.184  49.063  1.00 2.00   ? 119 PRO C CA    1 
ATOM   6865  C C     . PRO C 1 119 ? 13.839  44.717  49.045  1.00 3.49   ? 119 PRO C C     1 
ATOM   6866  O O     . PRO C 1 119 ? 13.697  44.198  47.943  1.00 6.44   ? 119 PRO C O     1 
ATOM   6867  C CB    . PRO C 1 119 ? 15.561  46.522  49.470  1.00 3.95   ? 119 PRO C CB    1 
ATOM   6868  C CG    . PRO C 1 119 ? 15.449  46.865  50.934  1.00 5.85   ? 119 PRO C CG    1 
ATOM   6869  C CD    . PRO C 1 119 ? 14.151  47.634  50.957  1.00 4.90   ? 119 PRO C CD    1 
ATOM   6870  N N     . LEU C 1 120 ? 13.677  43.979  50.146  1.00 5.35   ? 120 LEU C N     1 
ATOM   6871  C CA    . LEU C 1 120 ? 13.373  42.573  49.993  1.00 5.92   ? 120 LEU C CA    1 
ATOM   6872  C C     . LEU C 1 120 ? 12.383  42.295  51.081  1.00 10.21  ? 120 LEU C C     1 
ATOM   6873  O O     . LEU C 1 120 ? 12.726  41.874  52.188  1.00 11.66  ? 120 LEU C O     1 
ATOM   6874  C CB    . LEU C 1 120 ? 14.600  41.699  50.204  1.00 6.34   ? 120 LEU C CB    1 
ATOM   6875  C CG    . LEU C 1 120 ? 14.386  40.297  49.767  1.00 3.60   ? 120 LEU C CG    1 
ATOM   6876  C CD1   . LEU C 1 120 ? 14.471  40.255  48.265  1.00 6.63   ? 120 LEU C CD1   1 
ATOM   6877  C CD2   . LEU C 1 120 ? 15.409  39.390  50.382  1.00 5.06   ? 120 LEU C CD2   1 
ATOM   6878  H H     . LEU C 1 120 ? 13.752  44.338  51.061  1.00 0.00   ? 120 LEU C H     1 
ATOM   6879  N N     . ASP C 1 121 ? 11.136  42.644  50.791  1.00 17.78  ? 121 ASP C N     1 
ATOM   6880  C CA    . ASP C 1 121 ? 10.052  42.453  51.722  1.00 15.42  ? 121 ASP C CA    1 
ATOM   6881  C C     . ASP C 1 121 ? 9.807   40.984  51.946  1.00 16.74  ? 121 ASP C C     1 
ATOM   6882  O O     . ASP C 1 121 ? 9.731   40.188  51.007  1.00 14.01  ? 121 ASP C O     1 
ATOM   6883  C CB    . ASP C 1 121 ? 8.782   43.092  51.198  1.00 22.32  ? 121 ASP C CB    1 
ATOM   6884  C CG    . ASP C 1 121 ? 7.653   42.968  52.220  1.00 25.52  ? 121 ASP C CG    1 
ATOM   6885  O OD1   . ASP C 1 121 ? 7.737   43.584  53.289  1.00 25.02  ? 121 ASP C OD1   1 
ATOM   6886  O OD2   . ASP C 1 121 ? 6.718   42.212  51.949  1.00 22.43  ? 121 ASP C OD2   1 
ATOM   6887  H H     . ASP C 1 121 ? 10.949  43.020  49.909  1.00 0.00   ? 121 ASP C H     1 
ATOM   6888  N N     . GLY C 1 122 ? 9.649   40.671  53.223  1.00 19.10  ? 122 GLY C N     1 
ATOM   6889  C CA    . GLY C 1 122 ? 9.407   39.299  53.611  1.00 28.11  ? 122 GLY C CA    1 
ATOM   6890  C C     . GLY C 1 122 ? 10.692  38.520  53.811  1.00 33.34  ? 122 GLY C C     1 
ATOM   6891  O O     . GLY C 1 122 ? 10.634  37.296  54.004  1.00 30.80  ? 122 GLY C O     1 
ATOM   6892  H H     . GLY C 1 122 ? 9.707   41.368  53.913  1.00 0.00   ? 122 GLY C H     1 
ATOM   6893  N N     . SER C 1 123 ? 11.821  39.236  53.849  1.00 38.44  ? 123 SER C N     1 
ATOM   6894  C CA    . SER C 1 123 ? 13.158  38.682  53.999  1.00 43.85  ? 123 SER C CA    1 
ATOM   6895  C C     . SER C 1 123 ? 13.281  37.684  55.134  1.00 47.69  ? 123 SER C C     1 
ATOM   6896  O O     . SER C 1 123 ? 13.935  36.650  54.989  1.00 50.59  ? 123 SER C O     1 
ATOM   6897  C CB    . SER C 1 123 ? 14.139  39.850  54.191  1.00 40.71  ? 123 SER C CB    1 
ATOM   6898  O OG    . SER C 1 123 ? 13.554  40.928  54.926  1.00 43.49  ? 123 SER C OG    1 
ATOM   6899  H H     . SER C 1 123 ? 11.788  40.210  53.765  1.00 0.00   ? 123 SER C H     1 
ATOM   6900  H HG    . SER C 1 123 ? 14.152  41.677  54.885  1.00 0.00   ? 123 SER C HG    1 
ATOM   6901  N N     . SER C 1 124 ? 12.588  37.925  56.244  1.00 52.84  ? 124 SER C N     1 
ATOM   6902  C CA    . SER C 1 124 ? 12.590  37.051  57.417  1.00 56.53  ? 124 SER C CA    1 
ATOM   6903  C C     . SER C 1 124 ? 12.180  35.593  57.144  1.00 57.84  ? 124 SER C C     1 
ATOM   6904  O O     . SER C 1 124 ? 12.571  34.663  57.859  1.00 58.01  ? 124 SER C O     1 
ATOM   6905  C CB    . SER C 1 124 ? 11.658  37.681  58.454  1.00 56.38  ? 124 SER C CB    1 
ATOM   6906  O OG    . SER C 1 124 ? 11.731  39.106  58.412  1.00 58.11  ? 124 SER C OG    1 
ATOM   6907  H H     . SER C 1 124 ? 12.107  38.775  56.313  1.00 0.00   ? 124 SER C H     1 
ATOM   6908  H HG    . SER C 1 124 ? 11.422  39.457  59.251  1.00 0.00   ? 124 SER C HG    1 
ATOM   6909  N N     . ASN C 1 125 ? 11.416  35.347  56.078  1.00 58.38  ? 125 ASN C N     1 
ATOM   6910  C CA    . ASN C 1 125 ? 10.941  34.014  55.755  1.00 58.15  ? 125 ASN C CA    1 
ATOM   6911  C C     . ASN C 1 125 ? 11.701  33.390  54.601  1.00 52.88  ? 125 ASN C C     1 
ATOM   6912  O O     . ASN C 1 125 ? 11.382  32.278  54.177  1.00 51.98  ? 125 ASN C O     1 
ATOM   6913  C CB    . ASN C 1 125 ? 9.443   34.078  55.440  1.00 63.87  ? 125 ASN C CB    1 
ATOM   6914  C CG    . ASN C 1 125 ? 8.530   33.900  56.657  1.00 68.49  ? 125 ASN C CG    1 
ATOM   6915  O OD1   . ASN C 1 125 ? 8.824   33.125  57.571  1.00 70.12  ? 125 ASN C OD1   1 
ATOM   6916  N ND2   . ASN C 1 125 ? 7.419   34.613  56.764  1.00 66.09  ? 125 ASN C ND2   1 
ATOM   6917  H H     . ASN C 1 125 ? 11.212  36.076  55.454  1.00 0.00   ? 125 ASN C H     1 
ATOM   6918  H HD21  . ASN C 1 125 ? 6.749   34.242  57.381  1.00 0.00   ? 125 ASN C HD21  1 
ATOM   6919  H HD22  . ASN C 1 125 ? 7.214   35.341  56.149  1.00 0.00   ? 125 ASN C HD22  1 
ATOM   6920  N N     . ILE C 1 126 ? 12.765  34.034  54.122  1.00 50.38  ? 126 ILE C N     1 
ATOM   6921  C CA    . ILE C 1 126 ? 13.574  33.530  53.030  1.00 49.17  ? 126 ILE C CA    1 
ATOM   6922  C C     . ILE C 1 126 ? 14.175  32.215  53.483  1.00 46.59  ? 126 ILE C C     1 
ATOM   6923  O O     . ILE C 1 126 ? 14.306  31.325  52.661  1.00 47.62  ? 126 ILE C O     1 
ATOM   6924  C CB    . ILE C 1 126 ? 14.695  34.574  52.630  1.00 52.61  ? 126 ILE C CB    1 
ATOM   6925  C CG1   . ILE C 1 126 ? 15.310  34.203  51.287  1.00 53.14  ? 126 ILE C CG1   1 
ATOM   6926  C CG2   . ILE C 1 126 ? 15.820  34.614  53.660  1.00 55.14  ? 126 ILE C CG2   1 
ATOM   6927  C CD1   . ILE C 1 126 ? 14.421  34.549  50.081  1.00 55.80  ? 126 ILE C CD1   1 
ATOM   6928  H H     . ILE C 1 126 ? 13.007  34.901  54.517  1.00 0.00   ? 126 ILE C H     1 
ATOM   6929  N N     . ASP C 1 127 ? 14.466  32.003  54.774  1.00 47.14  ? 127 ASP C N     1 
ATOM   6930  C CA    . ASP C 1 127 ? 15.027  30.728  55.263  1.00 48.25  ? 127 ASP C CA    1 
ATOM   6931  C C     . ASP C 1 127 ? 14.122  29.512  55.018  1.00 45.61  ? 127 ASP C C     1 
ATOM   6932  O O     . ASP C 1 127 ? 14.556  28.371  54.810  1.00 44.95  ? 127 ASP C O     1 
ATOM   6933  C CB    . ASP C 1 127 ? 15.289  30.756  56.781  1.00 49.96  ? 127 ASP C CB    1 
ATOM   6934  C CG    . ASP C 1 127 ? 16.052  31.954  57.323  1.00 54.77  ? 127 ASP C CG    1 
ATOM   6935  O OD1   . ASP C 1 127 ? 17.036  32.371  56.711  1.00 56.57  ? 127 ASP C OD1   1 
ATOM   6936  O OD2   . ASP C 1 127 ? 15.656  32.468  58.374  1.00 60.03  ? 127 ASP C OD2   1 
ATOM   6937  H H     . ASP C 1 127 ? 14.326  32.736  55.407  1.00 0.00   ? 127 ASP C H     1 
ATOM   6938  N N     . CYS C 1 128 ? 12.820  29.824  55.056  1.00 43.50  ? 128 CYS C N     1 
ATOM   6939  C CA    . CYS C 1 128 ? 11.732  28.883  54.884  1.00 37.85  ? 128 CYS C CA    1 
ATOM   6940  C C     . CYS C 1 128 ? 11.300  28.859  53.405  1.00 33.54  ? 128 CYS C C     1 
ATOM   6941  O O     . CYS C 1 128 ? 10.289  28.245  53.045  1.00 34.47  ? 128 CYS C O     1 
ATOM   6942  C CB    . CYS C 1 128 ? 10.600  29.333  55.841  1.00 43.11  ? 128 CYS C CB    1 
ATOM   6943  S SG    . CYS C 1 128 ? 11.097  29.851  57.527  1.00 51.35  ? 128 CYS C SG    1 
ATOM   6944  H H     . CYS C 1 128 ? 12.576  30.761  55.210  1.00 0.00   ? 128 CYS C H     1 
ATOM   6945  N N     . LEU C 1 129 ? 12.074  29.512  52.525  1.00 27.04  ? 129 LEU C N     1 
ATOM   6946  C CA    . LEU C 1 129 ? 11.901  29.615  51.075  1.00 23.76  ? 129 LEU C CA    1 
ATOM   6947  C C     . LEU C 1 129 ? 10.616  30.186  50.510  1.00 20.94  ? 129 LEU C C     1 
ATOM   6948  O O     . LEU C 1 129 ? 10.186  30.012  49.358  1.00 18.61  ? 129 LEU C O     1 
ATOM   6949  C CB    . LEU C 1 129 ? 12.151  28.240  50.475  1.00 24.35  ? 129 LEU C CB    1 
ATOM   6950  C CG    . LEU C 1 129 ? 13.589  27.743  50.533  1.00 23.51  ? 129 LEU C CG    1 
ATOM   6951  C CD1   . LEU C 1 129 ? 13.725  26.541  49.621  1.00 24.79  ? 129 LEU C CD1   1 
ATOM   6952  C CD2   . LEU C 1 129 ? 14.572  28.801  50.047  1.00 23.89  ? 129 LEU C CD2   1 
ATOM   6953  H H     . LEU C 1 129 ? 12.878  29.956  52.864  1.00 0.00   ? 129 LEU C H     1 
ATOM   6954  N N     . VAL C 1 130 ? 10.078  30.980  51.410  1.00 22.57  ? 130 VAL C N     1 
ATOM   6955  C CA    . VAL C 1 130 ? 8.835   31.668  51.174  1.00 27.19  ? 130 VAL C CA    1 
ATOM   6956  C C     . VAL C 1 130 ? 9.172   32.795  50.230  1.00 29.41  ? 130 VAL C C     1 
ATOM   6957  O O     . VAL C 1 130 ? 10.290  33.330  50.236  1.00 36.01  ? 130 VAL C O     1 
ATOM   6958  C CB    . VAL C 1 130 ? 8.298   32.159  52.532  1.00 25.53  ? 130 VAL C CB    1 
ATOM   6959  C CG1   . VAL C 1 130 ? 7.304   33.287  52.420  1.00 27.07  ? 130 VAL C CG1   1 
ATOM   6960  C CG2   . VAL C 1 130 ? 7.564   30.979  53.167  1.00 27.75  ? 130 VAL C CG2   1 
ATOM   6961  H H     . VAL C 1 130 ? 10.588  31.196  52.214  1.00 0.00   ? 130 VAL C H     1 
ATOM   6962  N N     . SER C 1 131 ? 8.171   33.052  49.396  1.00 27.44  ? 131 SER C N     1 
ATOM   6963  C CA    . SER C 1 131 ? 8.170   34.107  48.412  1.00 22.27  ? 131 SER C CA    1 
ATOM   6964  C C     . SER C 1 131 ? 8.591   35.418  49.054  1.00 20.60  ? 131 SER C C     1 
ATOM   6965  O O     . SER C 1 131 ? 8.288   35.705  50.218  1.00 23.91  ? 131 SER C O     1 
ATOM   6966  C CB    . SER C 1 131 ? 6.774   34.174  47.846  1.00 23.68  ? 131 SER C CB    1 
ATOM   6967  O OG    . SER C 1 131 ? 6.289   32.857  47.540  1.00 36.82  ? 131 SER C OG    1 
ATOM   6968  H H     . SER C 1 131 ? 7.374   32.485  49.402  1.00 0.00   ? 131 SER C H     1 
ATOM   6969  H HG    . SER C 1 131 ? 5.561   32.950  46.916  1.00 0.00   ? 131 SER C HG    1 
ATOM   6970  N N     . VAL C 1 132 ? 9.296   36.225  48.292  1.00 14.10  ? 132 VAL C N     1 
ATOM   6971  C CA    . VAL C 1 132 ? 9.814   37.442  48.836  1.00 7.56   ? 132 VAL C CA    1 
ATOM   6972  C C     . VAL C 1 132 ? 9.611   38.437  47.711  1.00 5.39   ? 132 VAL C C     1 
ATOM   6973  O O     . VAL C 1 132 ? 9.240   38.022  46.611  1.00 2.00   ? 132 VAL C O     1 
ATOM   6974  C CB    . VAL C 1 132 ? 11.241  36.969  49.237  1.00 12.02  ? 132 VAL C CB    1 
ATOM   6975  C CG1   . VAL C 1 132 ? 12.192  37.063  48.085  1.00 13.69  ? 132 VAL C CG1   1 
ATOM   6976  C CG2   . VAL C 1 132 ? 11.678  37.726  50.442  1.00 7.88   ? 132 VAL C CG2   1 
ATOM   6977  H H     . VAL C 1 132 ? 9.415   36.037  47.336  1.00 0.00   ? 132 VAL C H     1 
ATOM   6978  N N     . GLY C 1 133 ? 9.775   39.734  47.902  1.00 4.42   ? 133 GLY C N     1 
ATOM   6979  C CA    . GLY C 1 133 ? 9.588   40.656  46.811  1.00 6.07   ? 133 GLY C CA    1 
ATOM   6980  C C     . GLY C 1 133 ? 10.106  42.052  47.120  1.00 8.08   ? 133 GLY C C     1 
ATOM   6981  O O     . GLY C 1 133 ? 10.589  42.299  48.230  1.00 9.80   ? 133 GLY C O     1 
ATOM   6982  H H     . GLY C 1 133 ? 10.000  40.082  48.794  1.00 0.00   ? 133 GLY C H     1 
ATOM   6983  N N     . THR C 1 134 ? 10.001  42.979  46.178  1.00 2.33   ? 134 THR C N     1 
ATOM   6984  C CA    . THR C 1 134 ? 10.453  44.336  46.385  1.00 5.41   ? 134 THR C CA    1 
ATOM   6985  C C     . THR C 1 134 ? 9.255   45.249  46.228  1.00 9.01   ? 134 THR C C     1 
ATOM   6986  O O     . THR C 1 134 ? 8.407   44.975  45.373  1.00 12.77  ? 134 THR C O     1 
ATOM   6987  C CB    . THR C 1 134 ? 11.499  44.654  45.354  1.00 11.52  ? 134 THR C CB    1 
ATOM   6988  O OG1   . THR C 1 134 ? 12.545  43.672  45.495  1.00 14.69  ? 134 THR C OG1   1 
ATOM   6989  C CG2   . THR C 1 134 ? 11.999  46.070  45.501  1.00 7.54   ? 134 THR C CG2   1 
ATOM   6990  H H     . THR C 1 134 ? 9.562   42.759  45.335  1.00 0.00   ? 134 THR C H     1 
ATOM   6991  H HG1   . THR C 1 134 ? 12.848  43.751  46.404  1.00 0.00   ? 134 THR C HG1   1 
ATOM   6992  N N     . ILE C 1 135 ? 9.087   46.319  47.002  1.00 7.18   ? 135 ILE C N     1 
ATOM   6993  C CA    . ILE C 1 135 ? 7.926   47.187  46.858  1.00 4.21   ? 135 ILE C CA    1 
ATOM   6994  C C     . ILE C 1 135 ? 8.462   48.608  46.659  1.00 6.00   ? 135 ILE C C     1 
ATOM   6995  O O     . ILE C 1 135 ? 9.487   48.963  47.261  1.00 7.56   ? 135 ILE C O     1 
ATOM   6996  C CB    . ILE C 1 135 ? 7.072   47.038  48.141  1.00 6.57   ? 135 ILE C CB    1 
ATOM   6997  C CG1   . ILE C 1 135 ? 6.720   45.593  48.471  1.00 4.08   ? 135 ILE C CG1   1 
ATOM   6998  C CG2   . ILE C 1 135 ? 5.777   47.760  47.895  1.00 8.13   ? 135 ILE C CG2   1 
ATOM   6999  C CD1   . ILE C 1 135 ? 5.954   45.402  49.777  1.00 2.00   ? 135 ILE C CD1   1 
ATOM   7000  H H     . ILE C 1 135 ? 9.784   46.574  47.644  1.00 0.00   ? 135 ILE C H     1 
ATOM   7001  N N     . PHE C 1 136 ? 7.898   49.431  45.780  1.00 4.83   ? 136 PHE C N     1 
ATOM   7002  C CA    . PHE C 1 136 ? 8.385   50.791  45.615  1.00 10.01  ? 136 PHE C CA    1 
ATOM   7003  C C     . PHE C 1 136 ? 7.260   51.786  45.348  1.00 9.65   ? 136 PHE C C     1 
ATOM   7004  O O     . PHE C 1 136 ? 6.197   51.403  44.836  1.00 9.01   ? 136 PHE C O     1 
ATOM   7005  C CB    . PHE C 1 136 ? 9.371   50.867  44.463  1.00 11.92  ? 136 PHE C CB    1 
ATOM   7006  C CG    . PHE C 1 136 ? 8.807   50.343  43.149  1.00 12.45  ? 136 PHE C CG    1 
ATOM   7007  C CD1   . PHE C 1 136 ? 8.913   48.994  42.861  1.00 8.00   ? 136 PHE C CD1   1 
ATOM   7008  C CD2   . PHE C 1 136 ? 8.190   51.214  42.258  1.00 9.77   ? 136 PHE C CD2   1 
ATOM   7009  C CE1   . PHE C 1 136 ? 8.375   48.516  41.681  1.00 11.75  ? 136 PHE C CE1   1 
ATOM   7010  C CE2   . PHE C 1 136 ? 7.655   50.723  41.086  1.00 5.11   ? 136 PHE C CE2   1 
ATOM   7011  C CZ    . PHE C 1 136 ? 7.744   49.376  40.805  1.00 9.58   ? 136 PHE C CZ    1 
ATOM   7012  H H     . PHE C 1 136 ? 7.102   49.153  45.278  1.00 0.00   ? 136 PHE C H     1 
ATOM   7013  N N     . GLY C 1 137 ? 7.492   53.053  45.669  1.00 3.74   ? 137 GLY C N     1 
ATOM   7014  C CA    . GLY C 1 137 ? 6.558   54.116  45.384  1.00 2.00   ? 137 GLY C CA    1 
ATOM   7015  C C     . GLY C 1 137 ? 7.385   55.262  44.876  1.00 3.68   ? 137 GLY C C     1 
ATOM   7016  O O     . GLY C 1 137 ? 8.551   55.354  45.243  1.00 7.84   ? 137 GLY C O     1 
ATOM   7017  H H     . GLY C 1 137 ? 8.337   53.292  46.110  1.00 0.00   ? 137 GLY C H     1 
ATOM   7018  N N     . ILE C 1 138 ? 6.854   56.147  44.048  1.00 2.17   ? 138 ILE C N     1 
ATOM   7019  C CA    . ILE C 1 138 ? 7.634   57.214  43.487  1.00 2.00   ? 138 ILE C CA    1 
ATOM   7020  C C     . ILE C 1 138 ? 6.821   58.467  43.598  1.00 5.96   ? 138 ILE C C     1 
ATOM   7021  O O     . ILE C 1 138 ? 5.731   58.546  43.027  1.00 8.53   ? 138 ILE C O     1 
ATOM   7022  C CB    . ILE C 1 138 ? 7.927   56.913  42.017  1.00 4.48   ? 138 ILE C CB    1 
ATOM   7023  C CG1   . ILE C 1 138 ? 8.808   55.688  41.860  1.00 6.28   ? 138 ILE C CG1   1 
ATOM   7024  C CG2   . ILE C 1 138 ? 8.556   58.152  41.413  1.00 2.92   ? 138 ILE C CG2   1 
ATOM   7025  C CD1   . ILE C 1 138 ? 8.640   54.943  40.517  1.00 8.07   ? 138 ILE C CD1   1 
ATOM   7026  H H     . ILE C 1 138 ? 5.918   56.058  43.770  1.00 0.00   ? 138 ILE C H     1 
ATOM   7027  N N     . TYR C 1 139 ? 7.317   59.428  44.348  1.00 10.09  ? 139 TYR C N     1 
ATOM   7028  C CA    . TYR C 1 139 ? 6.704   60.730  44.464  1.00 10.87  ? 139 TYR C CA    1 
ATOM   7029  C C     . TYR C 1 139 ? 7.497   61.687  43.594  1.00 12.58  ? 139 TYR C C     1 
ATOM   7030  O O     . TYR C 1 139 ? 8.527   61.353  43.004  1.00 18.79  ? 139 TYR C O     1 
ATOM   7031  C CB    . TYR C 1 139 ? 6.753   61.221  45.895  1.00 10.12  ? 139 TYR C CB    1 
ATOM   7032  C CG    . TYR C 1 139 ? 5.977   60.361  46.875  1.00 14.69  ? 139 TYR C CG    1 
ATOM   7033  C CD1   . TYR C 1 139 ? 4.588   60.347  46.861  1.00 13.61  ? 139 TYR C CD1   1 
ATOM   7034  C CD2   . TYR C 1 139 ? 6.673   59.620  47.799  1.00 16.22  ? 139 TYR C CD2   1 
ATOM   7035  C CE1   . TYR C 1 139 ? 3.894   59.594  47.782  1.00 13.31  ? 139 TYR C CE1   1 
ATOM   7036  C CE2   . TYR C 1 139 ? 5.979   58.865  48.722  1.00 21.30  ? 139 TYR C CE2   1 
ATOM   7037  C CZ    . TYR C 1 139 ? 4.599   58.851  48.701  1.00 17.10  ? 139 TYR C CZ    1 
ATOM   7038  O OH    . TYR C 1 139 ? 3.927   58.047  49.597  1.00 21.78  ? 139 TYR C OH    1 
ATOM   7039  H H     . TYR C 1 139 ? 8.172   59.273  44.778  1.00 0.00   ? 139 TYR C H     1 
ATOM   7040  H HH    . TYR C 1 139 ? 3.380   58.605  50.162  1.00 0.00   ? 139 TYR C HH    1 
ATOM   7041  N N     . ARG C 1 140 ? 7.076   62.933  43.562  1.00 18.44  ? 140 ARG C N     1 
ATOM   7042  C CA    . ARG C 1 140 ? 7.732   63.994  42.815  1.00 16.53  ? 140 ARG C CA    1 
ATOM   7043  C C     . ARG C 1 140 ? 7.953   65.011  43.912  1.00 12.92  ? 140 ARG C C     1 
ATOM   7044  O O     . ARG C 1 140 ? 7.031   65.269  44.683  1.00 16.40  ? 140 ARG C O     1 
ATOM   7045  C CB    . ARG C 1 140 ? 6.770   64.496  41.764  1.00 18.41  ? 140 ARG C CB    1 
ATOM   7046  C CG    . ARG C 1 140 ? 7.230   65.443  40.664  1.00 27.69  ? 140 ARG C CG    1 
ATOM   7047  C CD    . ARG C 1 140 ? 5.973   65.618  39.781  1.00 37.49  ? 140 ARG C CD    1 
ATOM   7048  N NE    . ARG C 1 140 ? 6.163   66.400  38.558  1.00 44.22  ? 140 ARG C NE    1 
ATOM   7049  C CZ    . ARG C 1 140 ? 5.457   66.163  37.431  1.00 46.29  ? 140 ARG C CZ    1 
ATOM   7050  N NH1   . ARG C 1 140 ? 4.540   65.186  37.340  1.00 45.71  ? 140 ARG C NH1   1 
ATOM   7051  N NH2   . ARG C 1 140 ? 5.685   66.911  36.350  1.00 44.16  ? 140 ARG C NH2   1 
ATOM   7052  H H     . ARG C 1 140 ? 6.352   63.215  44.160  1.00 0.00   ? 140 ARG C H     1 
ATOM   7053  H HE    . ARG C 1 140 ? 6.833   67.114  38.555  1.00 0.00   ? 140 ARG C HE    1 
ATOM   7054  H HH11  . ARG C 1 140 ? 4.366   64.581  38.117  1.00 0.00   ? 140 ARG C HH11  1 
ATOM   7055  H HH12  . ARG C 1 140 ? 4.052   65.044  36.480  1.00 0.00   ? 140 ARG C HH12  1 
ATOM   7056  H HH21  . ARG C 1 140 ? 6.373   67.636  36.382  1.00 0.00   ? 140 ARG C HH21  1 
ATOM   7057  H HH22  . ARG C 1 140 ? 5.169   66.745  35.510  1.00 0.00   ? 140 ARG C HH22  1 
ATOM   7058  N N     . LYS C 1 141 ? 9.158   65.536  44.060  1.00 15.83  ? 141 LYS C N     1 
ATOM   7059  C CA    . LYS C 1 141 ? 9.461   66.550  45.053  1.00 17.08  ? 141 LYS C CA    1 
ATOM   7060  C C     . LYS C 1 141 ? 8.569   67.765  44.836  1.00 15.70  ? 141 LYS C C     1 
ATOM   7061  O O     . LYS C 1 141 ? 8.472   68.268  43.718  1.00 15.26  ? 141 LYS C O     1 
ATOM   7062  C CB    . LYS C 1 141 ? 10.934  66.920  44.921  1.00 16.12  ? 141 LYS C CB    1 
ATOM   7063  C CG    . LYS C 1 141 ? 11.400  68.042  45.818  1.00 10.47  ? 141 LYS C CG    1 
ATOM   7064  C CD    . LYS C 1 141 ? 12.920  67.984  45.977  1.00 15.34  ? 141 LYS C CD    1 
ATOM   7065  C CE    . LYS C 1 141 ? 13.454  69.298  46.501  1.00 15.77  ? 141 LYS C CE    1 
ATOM   7066  N NZ    . LYS C 1 141 ? 12.752  69.678  47.710  1.00 16.36  ? 141 LYS C NZ    1 
ATOM   7067  H H     . LYS C 1 141 ? 9.866   65.260  43.439  1.00 0.00   ? 141 LYS C H     1 
ATOM   7068  H HZ1   . LYS C 1 141 ? 12.869  68.925  48.420  1.00 0.00   ? 141 LYS C HZ1   1 
ATOM   7069  H HZ2   . LYS C 1 141 ? 13.140  70.569  48.079  1.00 0.00   ? 141 LYS C HZ2   1 
ATOM   7070  H HZ3   . LYS C 1 141 ? 11.740  69.804  47.504  1.00 0.00   ? 141 LYS C HZ3   1 
ATOM   7071  N N     . LYS C 1 142 ? 7.882   68.196  45.891  1.00 15.78  ? 142 LYS C N     1 
ATOM   7072  C CA    . LYS C 1 142 ? 6.971   69.314  45.800  1.00 21.37  ? 142 LYS C CA    1 
ATOM   7073  C C     . LYS C 1 142 ? 7.473   70.714  46.147  1.00 21.90  ? 142 LYS C C     1 
ATOM   7074  O O     . LYS C 1 142 ? 6.960   71.726  45.655  1.00 22.89  ? 142 LYS C O     1 
ATOM   7075  C CB    . LYS C 1 142 ? 5.753   68.976  46.656  1.00 25.80  ? 142 LYS C CB    1 
ATOM   7076  C CG    . LYS C 1 142 ? 4.916   67.831  46.066  1.00 31.00  ? 142 LYS C CG    1 
ATOM   7077  C CD    . LYS C 1 142 ? 4.326   68.188  44.701  1.00 35.95  ? 142 LYS C CD    1 
ATOM   7078  C CE    . LYS C 1 142 ? 3.619   66.975  44.119  1.00 41.27  ? 142 LYS C CE    1 
ATOM   7079  N NZ    . LYS C 1 142 ? 2.285   67.334  43.680  1.00 47.82  ? 142 LYS C NZ    1 
ATOM   7080  H H     . LYS C 1 142 ? 7.938   67.687  46.726  1.00 0.00   ? 142 LYS C H     1 
ATOM   7081  H HZ1   . LYS C 1 142 ? 2.343   68.077  42.955  1.00 0.00   ? 142 LYS C HZ1   1 
ATOM   7082  H HZ2   . LYS C 1 142 ? 1.813   66.495  43.287  1.00 0.00   ? 142 LYS C HZ2   1 
ATOM   7083  H HZ3   . LYS C 1 142 ? 1.744   67.684  44.496  1.00 0.00   ? 142 LYS C HZ3   1 
ATOM   7084  N N     . SER C 1 143 ? 8.454   70.804  47.020  1.00 19.42  ? 143 SER C N     1 
ATOM   7085  C CA    . SER C 1 143 ? 8.965   72.069  47.470  1.00 23.03  ? 143 SER C CA    1 
ATOM   7086  C C     . SER C 1 143 ? 10.227  72.445  46.711  1.00 22.34  ? 143 SER C C     1 
ATOM   7087  O O     . SER C 1 143 ? 10.928  71.578  46.166  1.00 22.24  ? 143 SER C O     1 
ATOM   7088  C CB    . SER C 1 143 ? 9.237   71.943  48.956  1.00 22.62  ? 143 SER C CB    1 
ATOM   7089  O OG    . SER C 1 143 ? 9.912   70.713  49.235  1.00 30.26  ? 143 SER C OG    1 
ATOM   7090  H H     . SER C 1 143 ? 8.965   70.011  47.280  1.00 0.00   ? 143 SER C H     1 
ATOM   7091  H HG    . SER C 1 143 ? 10.134  70.658  50.172  1.00 0.00   ? 143 SER C HG    1 
ATOM   7092  N N     . THR C 1 144 ? 10.560  73.727  46.680  1.00 18.16  ? 144 THR C N     1 
ATOM   7093  C CA    . THR C 1 144 ? 11.825  74.114  46.091  1.00 19.45  ? 144 THR C CA    1 
ATOM   7094  C C     . THR C 1 144 ? 12.925  74.177  47.150  1.00 18.25  ? 144 THR C C     1 
ATOM   7095  O O     . THR C 1 144 ? 14.014  74.669  46.902  1.00 23.01  ? 144 THR C O     1 
ATOM   7096  C CB    . THR C 1 144 ? 11.583  75.439  45.411  1.00 17.65  ? 144 THR C CB    1 
ATOM   7097  O OG1   . THR C 1 144 ? 10.944  76.269  46.388  1.00 23.09  ? 144 THR C OG1   1 
ATOM   7098  C CG2   . THR C 1 144 ? 10.761  75.278  44.136  1.00 15.62  ? 144 THR C CG2   1 
ATOM   7099  H H     . THR C 1 144 ? 9.951   74.433  46.987  1.00 0.00   ? 144 THR C H     1 
ATOM   7100  H HG1   . THR C 1 144 ? 11.217  77.192  46.218  1.00 0.00   ? 144 THR C HG1   1 
ATOM   7101  N N     . ASP C 1 145 ? 12.714  73.677  48.364  1.00 22.39  ? 145 ASP C N     1 
ATOM   7102  C CA    . ASP C 1 145 ? 13.719  73.704  49.411  1.00 27.72  ? 145 ASP C CA    1 
ATOM   7103  C C     . ASP C 1 145 ? 14.814  72.671  49.137  1.00 32.11  ? 145 ASP C C     1 
ATOM   7104  O O     . ASP C 1 145 ? 14.711  71.849  48.224  1.00 33.20  ? 145 ASP C O     1 
ATOM   7105  C CB    . ASP C 1 145 ? 13.074  73.394  50.751  1.00 34.88  ? 145 ASP C CB    1 
ATOM   7106  C CG    . ASP C 1 145 ? 12.094  74.444  51.275  1.00 43.89  ? 145 ASP C CG    1 
ATOM   7107  O OD1   . ASP C 1 145 ? 11.148  74.807  50.573  1.00 50.41  ? 145 ASP C OD1   1 
ATOM   7108  O OD2   . ASP C 1 145 ? 12.283  74.896  52.408  1.00 51.39  ? 145 ASP C OD2   1 
ATOM   7109  H H     . ASP C 1 145 ? 11.929  73.121  48.492  1.00 0.00   ? 145 ASP C H     1 
ATOM   7110  N N     . GLU C 1 146 ? 15.873  72.654  49.956  1.00 35.10  ? 146 GLU C N     1 
ATOM   7111  C CA    . GLU C 1 146 ? 16.958  71.678  49.858  1.00 32.46  ? 146 GLU C CA    1 
ATOM   7112  C C     . GLU C 1 146 ? 16.345  70.298  50.177  1.00 27.81  ? 146 GLU C C     1 
ATOM   7113  O O     . GLU C 1 146 ? 15.496  70.232  51.084  1.00 25.86  ? 146 GLU C O     1 
ATOM   7114  C CB    . GLU C 1 146 ? 18.020  72.136  50.871  1.00 42.11  ? 146 GLU C CB    1 
ATOM   7115  C CG    . GLU C 1 146 ? 19.448  71.582  50.736  1.00 57.96  ? 146 GLU C CG    1 
ATOM   7116  C CD    . GLU C 1 146 ? 20.219  71.955  49.463  1.00 64.49  ? 146 GLU C CD    1 
ATOM   7117  O OE1   . GLU C 1 146 ? 20.007  73.042  48.909  1.00 67.85  ? 146 GLU C OE1   1 
ATOM   7118  O OE2   . GLU C 1 146 ? 21.045  71.143  49.026  1.00 67.70  ? 146 GLU C OE2   1 
ATOM   7119  H H     . GLU C 1 146 ? 15.885  73.277  50.704  1.00 0.00   ? 146 GLU C H     1 
ATOM   7120  N N     . PRO C 1 147 ? 16.634  69.196  49.441  1.00 21.91  ? 147 PRO C N     1 
ATOM   7121  C CA    . PRO C 1 147 ? 15.994  67.894  49.634  1.00 19.72  ? 147 PRO C CA    1 
ATOM   7122  C C     . PRO C 1 147 ? 16.195  67.405  51.046  1.00 16.38  ? 147 PRO C C     1 
ATOM   7123  O O     . PRO C 1 147 ? 17.277  67.568  51.613  1.00 16.04  ? 147 PRO C O     1 
ATOM   7124  C CB    . PRO C 1 147 ? 16.613  66.994  48.577  1.00 14.88  ? 147 PRO C CB    1 
ATOM   7125  C CG    . PRO C 1 147 ? 17.877  67.683  48.196  1.00 15.65  ? 147 PRO C CG    1 
ATOM   7126  C CD    . PRO C 1 147 ? 17.490  69.153  48.271  1.00 20.14  ? 147 PRO C CD    1 
ATOM   7127  N N     . SER C 1 148 ? 15.148  66.839  51.627  1.00 15.12  ? 148 SER C N     1 
ATOM   7128  C CA    . SER C 1 148 ? 15.207  66.425  53.017  1.00 20.17  ? 148 SER C CA    1 
ATOM   7129  C C     . SER C 1 148 ? 14.177  65.327  53.248  1.00 21.32  ? 148 SER C C     1 
ATOM   7130  O O     . SER C 1 148 ? 13.356  65.047  52.372  1.00 24.46  ? 148 SER C O     1 
ATOM   7131  C CB    . SER C 1 148 ? 14.915  67.629  53.889  1.00 20.33  ? 148 SER C CB    1 
ATOM   7132  O OG    . SER C 1 148 ? 13.587  68.075  53.653  1.00 28.70  ? 148 SER C OG    1 
ATOM   7133  H H     . SER C 1 148 ? 14.352  66.619  51.108  1.00 0.00   ? 148 SER C H     1 
ATOM   7134  H HG    . SER C 1 148 ? 13.545  68.269  52.703  1.00 0.00   ? 148 SER C HG    1 
ATOM   7135  N N     . GLU C 1 149 ? 14.184  64.710  54.425  1.00 22.94  ? 149 GLU C N     1 
ATOM   7136  C CA    . GLU C 1 149 ? 13.186  63.740  54.859  1.00 22.17  ? 149 GLU C CA    1 
ATOM   7137  C C     . GLU C 1 149 ? 11.739  64.196  54.595  1.00 21.54  ? 149 GLU C C     1 
ATOM   7138  O O     . GLU C 1 149 ? 10.847  63.398  54.274  1.00 23.36  ? 149 GLU C O     1 
ATOM   7139  C CB    . GLU C 1 149 ? 13.445  63.507  56.338  1.00 24.61  ? 149 GLU C CB    1 
ATOM   7140  C CG    . GLU C 1 149 ? 12.586  62.401  56.888  1.00 37.79  ? 149 GLU C CG    1 
ATOM   7141  C CD    . GLU C 1 149 ? 12.720  62.186  58.382  1.00 44.42  ? 149 GLU C CD    1 
ATOM   7142  O OE1   . GLU C 1 149 ? 13.637  61.466  58.777  1.00 50.94  ? 149 GLU C OE1   1 
ATOM   7143  O OE2   . GLU C 1 149 ? 11.901  62.713  59.139  1.00 47.41  ? 149 GLU C OE2   1 
ATOM   7144  H H     . GLU C 1 149 ? 14.957  64.868  55.003  1.00 0.00   ? 149 GLU C H     1 
ATOM   7145  N N     . LYS C 1 150 ? 11.489  65.501  54.673  1.00 18.37  ? 150 LYS C N     1 
ATOM   7146  C CA    . LYS C 1 150 ? 10.193  66.087  54.373  1.00 22.20  ? 150 LYS C CA    1 
ATOM   7147  C C     . LYS C 1 150 ? 9.657   65.964  52.963  1.00 20.80  ? 150 LYS C C     1 
ATOM   7148  O O     . LYS C 1 150 ? 8.458   66.165  52.772  1.00 19.25  ? 150 LYS C O     1 
ATOM   7149  C CB    . LYS C 1 150 ? 10.190  67.555  54.712  1.00 29.68  ? 150 LYS C CB    1 
ATOM   7150  C CG    . LYS C 1 150 ? 9.862   67.715  56.170  1.00 43.40  ? 150 LYS C CG    1 
ATOM   7151  C CD    . LYS C 1 150 ? 9.796   69.179  56.526  1.00 53.15  ? 150 LYS C CD    1 
ATOM   7152  C CE    . LYS C 1 150 ? 9.458   69.265  58.006  1.00 60.94  ? 150 LYS C CE    1 
ATOM   7153  N NZ    . LYS C 1 150 ? 9.423   70.656  58.418  1.00 66.74  ? 150 LYS C NZ    1 
ATOM   7154  H H     . LYS C 1 150 ? 12.184  66.093  55.016  1.00 0.00   ? 150 LYS C H     1 
ATOM   7155  H HZ1   . LYS C 1 150 ? 10.348  71.098  58.239  1.00 0.00   ? 150 LYS C HZ1   1 
ATOM   7156  H HZ2   . LYS C 1 150 ? 8.687   71.156  57.877  1.00 0.00   ? 150 LYS C HZ2   1 
ATOM   7157  H HZ3   . LYS C 1 150 ? 9.198   70.709  59.431  1.00 0.00   ? 150 LYS C HZ3   1 
ATOM   7158  N N     . ASP C 1 151 ? 10.452  65.660  51.937  1.00 20.26  ? 151 ASP C N     1 
ATOM   7159  C CA    . ASP C 1 151 ? 9.869   65.459  50.611  1.00 19.48  ? 151 ASP C CA    1 
ATOM   7160  C C     . ASP C 1 151 ? 9.225   64.090  50.500  1.00 20.03  ? 151 ASP C C     1 
ATOM   7161  O O     . ASP C 1 151 ? 8.312   63.874  49.703  1.00 13.40  ? 151 ASP C O     1 
ATOM   7162  C CB    . ASP C 1 151 ? 10.929  65.578  49.560  1.00 21.08  ? 151 ASP C CB    1 
ATOM   7163  C CG    . ASP C 1 151 ? 11.427  66.999  49.486  1.00 18.14  ? 151 ASP C CG    1 
ATOM   7164  O OD1   . ASP C 1 151 ? 10.692  67.818  48.949  1.00 16.94  ? 151 ASP C OD1   1 
ATOM   7165  O OD2   . ASP C 1 151 ? 12.524  67.267  49.971  1.00 12.23  ? 151 ASP C OD2   1 
ATOM   7166  H H     . ASP C 1 151 ? 11.406  65.510  52.086  1.00 0.00   ? 151 ASP C H     1 
ATOM   7167  N N     . ALA C 1 152 ? 9.767   63.159  51.316  1.00 18.39  ? 152 ALA C N     1 
ATOM   7168  C CA    . ALA C 1 152 ? 9.266   61.797  51.403  1.00 17.61  ? 152 ALA C CA    1 
ATOM   7169  C C     . ALA C 1 152 ? 7.905   61.770  52.092  1.00 18.54  ? 152 ALA C C     1 
ATOM   7170  O O     . ALA C 1 152 ? 7.041   60.966  51.754  1.00 16.75  ? 152 ALA C O     1 
ATOM   7171  C CB    . ALA C 1 152 ? 10.236  60.946  52.206  1.00 12.66  ? 152 ALA C CB    1 
ATOM   7172  H H     . ALA C 1 152 ? 10.514  63.415  51.891  1.00 0.00   ? 152 ALA C H     1 
ATOM   7173  N N     . LEU C 1 153 ? 7.643   62.653  53.061  1.00 19.68  ? 153 LEU C N     1 
ATOM   7174  C CA    . LEU C 1 153 ? 6.358   62.657  53.760  1.00 17.56  ? 153 LEU C CA    1 
ATOM   7175  C C     . LEU C 1 153 ? 5.121   63.139  52.984  1.00 15.10  ? 153 LEU C C     1 
ATOM   7176  O O     . LEU C 1 153 ? 4.346   63.941  53.501  1.00 14.96  ? 153 LEU C O     1 
ATOM   7177  C CB    . LEU C 1 153 ? 6.529   63.486  55.026  1.00 14.12  ? 153 LEU C CB    1 
ATOM   7178  C CG    . LEU C 1 153 ? 7.589   63.033  55.991  1.00 14.26  ? 153 LEU C CG    1 
ATOM   7179  C CD1   . LEU C 1 153 ? 7.676   64.043  57.106  1.00 12.72  ? 153 LEU C CD1   1 
ATOM   7180  C CD2   . LEU C 1 153 ? 7.266   61.651  56.507  1.00 3.76   ? 153 LEU C CD2   1 
ATOM   7181  H H     . LEU C 1 153 ? 8.315   63.332  53.275  1.00 0.00   ? 153 LEU C H     1 
ATOM   7182  N N     . GLN C 1 154 ? 4.841   62.697  51.752  1.00 15.79  ? 154 GLN C N     1 
ATOM   7183  C CA    . GLN C 1 154 ? 3.641   63.118  51.021  1.00 14.07  ? 154 GLN C CA    1 
ATOM   7184  C C     . GLN C 1 154 ? 2.625   62.012  51.194  1.00 14.33  ? 154 GLN C C     1 
ATOM   7185  O O     . GLN C 1 154 ? 3.026   60.848  51.205  1.00 18.12  ? 154 GLN C O     1 
ATOM   7186  C CB    . GLN C 1 154 ? 3.889   63.290  49.514  1.00 9.74   ? 154 GLN C CB    1 
ATOM   7187  C CG    . GLN C 1 154 ? 4.825   64.470  49.233  1.00 8.54   ? 154 GLN C CG    1 
ATOM   7188  C CD    . GLN C 1 154 ? 5.412   64.500  47.828  1.00 11.49  ? 154 GLN C CD    1 
ATOM   7189  O OE1   . GLN C 1 154 ? 6.619   64.595  47.626  1.00 11.56  ? 154 GLN C OE1   1 
ATOM   7190  N NE2   . GLN C 1 154 ? 4.630   64.426  46.762  1.00 9.17   ? 154 GLN C NE2   1 
ATOM   7191  H H     . GLN C 1 154 ? 5.397   61.982  51.375  1.00 0.00   ? 154 GLN C H     1 
ATOM   7192  H HE21  . GLN C 1 154 ? 5.128   64.566  45.924  1.00 0.00   ? 154 GLN C HE21  1 
ATOM   7193  H HE22  . GLN C 1 154 ? 3.670   64.295  46.828  1.00 0.00   ? 154 GLN C HE22  1 
ATOM   7194  N N     . PRO C 1 155 ? 1.319   62.263  51.324  1.00 15.85  ? 155 PRO C N     1 
ATOM   7195  C CA    . PRO C 1 155 ? 0.286   61.236  51.373  1.00 13.37  ? 155 PRO C CA    1 
ATOM   7196  C C     . PRO C 1 155 ? 0.276   60.408  50.102  1.00 12.34  ? 155 PRO C C     1 
ATOM   7197  O O     . PRO C 1 155 ? 0.520   60.960  49.020  1.00 14.82  ? 155 PRO C O     1 
ATOM   7198  C CB    . PRO C 1 155 ? -0.973  62.016  51.581  1.00 13.17  ? 155 PRO C CB    1 
ATOM   7199  C CG    . PRO C 1 155 ? -0.676  63.298  50.863  1.00 14.68  ? 155 PRO C CG    1 
ATOM   7200  C CD    . PRO C 1 155 ? 0.717   63.581  51.376  1.00 12.73  ? 155 PRO C CD    1 
ATOM   7201  N N     . GLY C 1 156 ? -0.126  59.147  50.190  1.00 12.85  ? 156 GLY C N     1 
ATOM   7202  C CA    . GLY C 1 156 ? -0.111  58.222  49.083  1.00 12.29  ? 156 GLY C CA    1 
ATOM   7203  C C     . GLY C 1 156 ? -0.816  58.715  47.835  1.00 11.65  ? 156 GLY C C     1 
ATOM   7204  O O     . GLY C 1 156 ? -0.434  58.375  46.720  1.00 15.89  ? 156 GLY C O     1 
ATOM   7205  H H     . GLY C 1 156 ? -0.496  58.844  51.040  1.00 0.00   ? 156 GLY C H     1 
ATOM   7206  N N     . ARG C 1 157 ? -1.840  59.539  47.974  1.00 13.03  ? 157 ARG C N     1 
ATOM   7207  C CA    . ARG C 1 157 ? -2.611  60.039  46.850  1.00 11.76  ? 157 ARG C CA    1 
ATOM   7208  C C     . ARG C 1 157 ? -1.756  60.719  45.774  1.00 11.47  ? 157 ARG C C     1 
ATOM   7209  O O     . ARG C 1 157 ? -2.033  60.643  44.576  1.00 11.81  ? 157 ARG C O     1 
ATOM   7210  C CB    . ARG C 1 157 ? -3.644  60.984  47.437  1.00 18.38  ? 157 ARG C CB    1 
ATOM   7211  C CG    . ARG C 1 157 ? -4.729  61.447  46.469  1.00 19.32  ? 157 ARG C CG    1 
ATOM   7212  C CD    . ARG C 1 157 ? -5.639  60.314  46.015  1.00 20.31  ? 157 ARG C CD    1 
ATOM   7213  N NE    . ARG C 1 157 ? -6.509  59.836  47.082  1.00 13.69  ? 157 ARG C NE    1 
ATOM   7214  C CZ    . ARG C 1 157 ? -7.218  58.700  46.969  1.00 16.83  ? 157 ARG C CZ    1 
ATOM   7215  N NH1   . ARG C 1 157 ? -7.174  57.966  45.861  1.00 16.95  ? 157 ARG C NH1   1 
ATOM   7216  N NH2   . ARG C 1 157 ? -7.987  58.283  47.973  1.00 13.83  ? 157 ARG C NH2   1 
ATOM   7217  H H     . ARG C 1 157 ? -2.110  59.785  48.885  1.00 0.00   ? 157 ARG C H     1 
ATOM   7218  H HE    . ARG C 1 157 ? -6.606  60.383  47.883  1.00 0.00   ? 157 ARG C HE    1 
ATOM   7219  H HH11  . ARG C 1 157 ? -6.605  58.247  45.089  1.00 0.00   ? 157 ARG C HH11  1 
ATOM   7220  H HH12  . ARG C 1 157 ? -7.711  57.126  45.801  1.00 0.00   ? 157 ARG C HH12  1 
ATOM   7221  H HH21  . ARG C 1 157 ? -8.044  58.817  48.817  1.00 0.00   ? 157 ARG C HH21  1 
ATOM   7222  H HH22  . ARG C 1 157 ? -8.506  57.433  47.881  1.00 0.00   ? 157 ARG C HH22  1 
ATOM   7223  N N     . ASN C 1 158 ? -0.675  61.344  46.224  1.00 7.99   ? 158 ASN C N     1 
ATOM   7224  C CA    . ASN C 1 158 ? 0.275   62.040  45.371  1.00 10.61  ? 158 ASN C CA    1 
ATOM   7225  C C     . ASN C 1 158 ? 1.280   61.165  44.614  1.00 10.40  ? 158 ASN C C     1 
ATOM   7226  O O     . ASN C 1 158 ? 2.237   61.716  44.065  1.00 10.68  ? 158 ASN C O     1 
ATOM   7227  C CB    . ASN C 1 158 ? 1.078   63.027  46.201  1.00 13.02  ? 158 ASN C CB    1 
ATOM   7228  C CG    . ASN C 1 158 ? 0.318   64.232  46.698  1.00 17.30  ? 158 ASN C CG    1 
ATOM   7229  O OD1   . ASN C 1 158 ? -0.743  64.611  46.209  1.00 17.56  ? 158 ASN C OD1   1 
ATOM   7230  N ND2   . ASN C 1 158 ? 0.854   64.896  47.716  1.00 17.31  ? 158 ASN C ND2   1 
ATOM   7231  H H     . ASN C 1 158 ? -0.476  61.275  47.181  1.00 0.00   ? 158 ASN C H     1 
ATOM   7232  H HD21  . ASN C 1 158 ? 0.361   65.700  47.989  1.00 0.00   ? 158 ASN C HD21  1 
ATOM   7233  H HD22  . ASN C 1 158 ? 1.674   64.571  48.127  1.00 0.00   ? 158 ASN C HD22  1 
ATOM   7234  N N     . LEU C 1 159 ? 1.176   59.825  44.601  1.00 10.30  ? 159 LEU C N     1 
ATOM   7235  C CA    . LEU C 1 159 ? 2.112   58.948  43.894  1.00 12.31  ? 159 LEU C CA    1 
ATOM   7236  C C     . LEU C 1 159 ? 2.040   59.058  42.381  1.00 12.51  ? 159 LEU C C     1 
ATOM   7237  O O     . LEU C 1 159 ? 0.961   59.048  41.792  1.00 19.45  ? 159 LEU C O     1 
ATOM   7238  C CB    . LEU C 1 159 ? 1.869   57.484  44.232  1.00 6.11   ? 159 LEU C CB    1 
ATOM   7239  C CG    . LEU C 1 159 ? 2.223   57.006  45.628  1.00 7.53   ? 159 LEU C CG    1 
ATOM   7240  C CD1   . LEU C 1 159 ? 1.473   55.741  45.935  1.00 12.06  ? 159 LEU C CD1   1 
ATOM   7241  C CD2   . LEU C 1 159 ? 3.697   56.759  45.722  1.00 12.92  ? 159 LEU C CD2   1 
ATOM   7242  H H     . LEU C 1 159 ? 0.390   59.418  45.020  1.00 0.00   ? 159 LEU C H     1 
ATOM   7243  N N     . VAL C 1 160 ? 3.193   59.072  41.735  1.00 9.12   ? 160 VAL C N     1 
ATOM   7244  C CA    . VAL C 1 160 ? 3.263   59.147  40.291  1.00 7.06   ? 160 VAL C CA    1 
ATOM   7245  C C     . VAL C 1 160 ? 3.175   57.718  39.776  1.00 7.32   ? 160 VAL C C     1 
ATOM   7246  O O     . VAL C 1 160 ? 2.507   57.431  38.776  1.00 7.34   ? 160 VAL C O     1 
ATOM   7247  C CB    . VAL C 1 160 ? 4.606   59.836  39.891  1.00 6.52   ? 160 VAL C CB    1 
ATOM   7248  C CG1   . VAL C 1 160 ? 4.700   59.973  38.390  1.00 7.86   ? 160 VAL C CG1   1 
ATOM   7249  C CG2   . VAL C 1 160 ? 4.669   61.246  40.435  1.00 2.00   ? 160 VAL C CG2   1 
ATOM   7250  H H     . VAL C 1 160 ? 4.020   59.063  42.258  1.00 0.00   ? 160 VAL C H     1 
ATOM   7251  N N     . ALA C 1 161 ? 3.847   56.793  40.456  1.00 7.49   ? 161 ALA C N     1 
ATOM   7252  C CA    . ALA C 1 161 ? 3.840   55.401  40.063  1.00 8.11   ? 161 ALA C CA    1 
ATOM   7253  C C     . ALA C 1 161 ? 4.087   54.559  41.308  1.00 10.92  ? 161 ALA C C     1 
ATOM   7254  O O     . ALA C 1 161 ? 4.621   55.085  42.294  1.00 8.21   ? 161 ALA C O     1 
ATOM   7255  C CB    . ALA C 1 161 ? 4.955   55.137  39.073  1.00 6.57   ? 161 ALA C CB    1 
ATOM   7256  H H     . ALA C 1 161 ? 4.327   57.029  41.277  1.00 0.00   ? 161 ALA C H     1 
ATOM   7257  N N     . ALA C 1 162 ? 3.702   53.292  41.337  1.00 5.81   ? 162 ALA C N     1 
ATOM   7258  C CA    . ALA C 1 162 ? 4.007   52.429  42.463  1.00 7.16   ? 162 ALA C CA    1 
ATOM   7259  C C     . ALA C 1 162 ? 3.893   50.989  41.992  1.00 4.60   ? 162 ALA C C     1 
ATOM   7260  O O     . ALA C 1 162 ? 3.387   50.739  40.896  1.00 5.79   ? 162 ALA C O     1 
ATOM   7261  C CB    . ALA C 1 162 ? 3.024   52.629  43.591  1.00 4.46   ? 162 ALA C CB    1 
ATOM   7262  H H     . ALA C 1 162 ? 3.258   52.883  40.567  1.00 0.00   ? 162 ALA C H     1 
ATOM   7263  N N     . GLY C 1 163 ? 4.354   49.992  42.726  1.00 5.64   ? 163 GLY C N     1 
ATOM   7264  C CA    . GLY C 1 163 ? 4.252   48.621  42.257  1.00 3.22   ? 163 GLY C CA    1 
ATOM   7265  C C     . GLY C 1 163 ? 5.136   47.732  43.099  1.00 6.75   ? 163 GLY C C     1 
ATOM   7266  O O     . GLY C 1 163 ? 5.705   48.148  44.112  1.00 8.10   ? 163 GLY C O     1 
ATOM   7267  H H     . GLY C 1 163 ? 4.814   50.166  43.577  1.00 0.00   ? 163 GLY C H     1 
ATOM   7268  N N     . TYR C 1 164 ? 5.314   46.502  42.684  1.00 7.25   ? 164 TYR C N     1 
ATOM   7269  C CA    . TYR C 1 164 ? 6.083   45.546  43.447  1.00 6.61   ? 164 TYR C CA    1 
ATOM   7270  C C     . TYR C 1 164 ? 6.625   44.523  42.502  1.00 3.90   ? 164 TYR C C     1 
ATOM   7271  O O     . TYR C 1 164 ? 6.121   44.370  41.387  1.00 3.94   ? 164 TYR C O     1 
ATOM   7272  C CB    . TYR C 1 164 ? 5.247   44.779  44.488  1.00 8.77   ? 164 TYR C CB    1 
ATOM   7273  C CG    . TYR C 1 164 ? 4.022   44.035  43.959  1.00 4.60   ? 164 TYR C CG    1 
ATOM   7274  C CD1   . TYR C 1 164 ? 2.833   44.726  43.911  1.00 8.00   ? 164 TYR C CD1   1 
ATOM   7275  C CD2   . TYR C 1 164 ? 4.019   42.688  43.627  1.00 11.45  ? 164 TYR C CD2   1 
ATOM   7276  C CE1   . TYR C 1 164 ? 1.656   44.107  43.584  1.00 2.00   ? 164 TYR C CE1   1 
ATOM   7277  C CE2   . TYR C 1 164 ? 2.823   42.048  43.287  1.00 8.30   ? 164 TYR C CE2   1 
ATOM   7278  C CZ    . TYR C 1 164 ? 1.652   42.779  43.287  1.00 3.69   ? 164 TYR C CZ    1 
ATOM   7279  O OH    . TYR C 1 164 ? 0.449   42.179  42.978  1.00 4.34   ? 164 TYR C OH    1 
ATOM   7280  H H     . TYR C 1 164 ? 5.007   46.238  41.789  1.00 0.00   ? 164 TYR C H     1 
ATOM   7281  H HH    . TYR C 1 164 ? -0.219  42.760  43.368  1.00 0.00   ? 164 TYR C HH    1 
ATOM   7282  N N     . ALA C 1 165 ? 7.585   43.767  42.966  1.00 2.00   ? 165 ALA C N     1 
ATOM   7283  C CA    . ALA C 1 165 ? 8.056   42.666  42.166  1.00 6.00   ? 165 ALA C CA    1 
ATOM   7284  C C     . ALA C 1 165 ? 7.984   41.489  43.109  1.00 6.51   ? 165 ALA C C     1 
ATOM   7285  O O     . ALA C 1 165 ? 8.408   41.623  44.263  1.00 4.62   ? 165 ALA C O     1 
ATOM   7286  C CB    . ALA C 1 165 ? 9.485   42.887  41.732  1.00 5.41   ? 165 ALA C CB    1 
ATOM   7287  H H     . ALA C 1 165 ? 7.912   43.872  43.883  1.00 0.00   ? 165 ALA C H     1 
ATOM   7288  N N     . LEU C 1 166 ? 7.357   40.399  42.682  1.00 4.79   ? 166 LEU C N     1 
ATOM   7289  C CA    . LEU C 1 166 ? 7.252   39.183  43.473  1.00 7.54   ? 166 LEU C CA    1 
ATOM   7290  C C     . LEU C 1 166 ? 8.202   38.118  42.965  1.00 4.70   ? 166 LEU C C     1 
ATOM   7291  O O     . LEU C 1 166 ? 8.218   37.775  41.785  1.00 9.74   ? 166 LEU C O     1 
ATOM   7292  C CB    . LEU C 1 166 ? 5.808   38.643  43.419  1.00 7.32   ? 166 LEU C CB    1 
ATOM   7293  C CG    . LEU C 1 166 ? 5.503   37.227  43.897  1.00 2.67   ? 166 LEU C CG    1 
ATOM   7294  C CD1   . LEU C 1 166 ? 5.784   37.058  45.378  1.00 7.55   ? 166 LEU C CD1   1 
ATOM   7295  C CD2   . LEU C 1 166 ? 4.045   36.954  43.664  1.00 8.68   ? 166 LEU C CD2   1 
ATOM   7296  H H     . LEU C 1 166 ? 6.978   40.398  41.783  1.00 0.00   ? 166 LEU C H     1 
ATOM   7297  N N     . TYR C 1 167 ? 9.000   37.592  43.860  1.00 5.82   ? 167 TYR C N     1 
ATOM   7298  C CA    . TYR C 1 167 ? 9.910   36.528  43.545  1.00 5.32   ? 167 TYR C CA    1 
ATOM   7299  C C     . TYR C 1 167 ? 9.203   35.289  44.089  1.00 5.84   ? 167 TYR C C     1 
ATOM   7300  O O     . TYR C 1 167 ? 9.344   34.961  45.274  1.00 3.14   ? 167 TYR C O     1 
ATOM   7301  C CB    . TYR C 1 167 ? 11.239  36.738  44.263  1.00 6.52   ? 167 TYR C CB    1 
ATOM   7302  C CG    . TYR C 1 167 ? 11.914  38.067  43.987  1.00 5.78   ? 167 TYR C CG    1 
ATOM   7303  C CD1   . TYR C 1 167 ? 12.253  38.460  42.718  1.00 2.00   ? 167 TYR C CD1   1 
ATOM   7304  C CD2   . TYR C 1 167 ? 12.077  38.935  45.033  1.00 4.20   ? 167 TYR C CD2   1 
ATOM   7305  C CE1   . TYR C 1 167 ? 12.620  39.774  42.505  1.00 2.50   ? 167 TYR C CE1   1 
ATOM   7306  C CE2   . TYR C 1 167 ? 12.463  40.230  44.820  1.00 2.56   ? 167 TYR C CE2   1 
ATOM   7307  C CZ    . TYR C 1 167 ? 12.684  40.662  43.553  1.00 2.17   ? 167 TYR C CZ    1 
ATOM   7308  O OH    . TYR C 1 167 ? 12.920  42.009  43.334  1.00 4.48   ? 167 TYR C OH    1 
ATOM   7309  H H     . TYR C 1 167 ? 8.935   37.893  44.784  1.00 0.00   ? 167 TYR C H     1 
ATOM   7310  H HH    . TYR C 1 167 ? 12.797  42.497  44.158  1.00 0.00   ? 167 TYR C HH    1 
ATOM   7311  N N     . GLY C 1 168 ? 8.360   34.652  43.283  1.00 7.25   ? 168 GLY C N     1 
ATOM   7312  C CA    . GLY C 1 168 ? 7.603   33.475  43.726  1.00 12.67  ? 168 GLY C CA    1 
ATOM   7313  C C     . GLY C 1 168 ? 7.941   32.233  42.898  1.00 9.02   ? 168 GLY C C     1 
ATOM   7314  O O     . GLY C 1 168 ? 9.114   31.943  42.724  1.00 9.62   ? 168 GLY C O     1 
ATOM   7315  H H     . GLY C 1 168 ? 8.320   34.904  42.334  1.00 0.00   ? 168 GLY C H     1 
ATOM   7316  N N     . SER C 1 169 ? 6.979   31.495  42.341  1.00 3.51   ? 169 SER C N     1 
ATOM   7317  C CA    . SER C 1 169 ? 7.357   30.379  41.507  1.00 4.72   ? 169 SER C CA    1 
ATOM   7318  C C     . SER C 1 169 ? 7.966   30.861  40.194  1.00 3.90   ? 169 SER C C     1 
ATOM   7319  O O     . SER C 1 169 ? 8.578   30.098  39.447  1.00 8.19   ? 169 SER C O     1 
ATOM   7320  C CB    . SER C 1 169 ? 6.125   29.519  41.277  1.00 2.00   ? 169 SER C CB    1 
ATOM   7321  O OG    . SER C 1 169 ? 5.013   30.256  40.809  1.00 13.86  ? 169 SER C OG    1 
ATOM   7322  H H     . SER C 1 169 ? 6.025   31.671  42.495  1.00 0.00   ? 169 SER C H     1 
ATOM   7323  H HG    . SER C 1 169 ? 4.880   29.978  39.882  1.00 0.00   ? 169 SER C HG    1 
ATOM   7324  N N     . ALA C 1 170 ? 7.773   32.137  39.876  1.00 5.29   ? 170 ALA C N     1 
ATOM   7325  C CA    . ALA C 1 170 ? 8.342   32.851  38.734  1.00 2.77   ? 170 ALA C CA    1 
ATOM   7326  C C     . ALA C 1 170 ? 8.453   34.296  39.215  1.00 2.66   ? 170 ALA C C     1 
ATOM   7327  O O     . ALA C 1 170 ? 7.945   34.602  40.300  1.00 2.36   ? 170 ALA C O     1 
ATOM   7328  C CB    . ALA C 1 170 ? 7.426   32.825  37.531  1.00 2.00   ? 170 ALA C CB    1 
ATOM   7329  H H     . ALA C 1 170 ? 7.243   32.686  40.489  1.00 0.00   ? 170 ALA C H     1 
ATOM   7330  N N     . THR C 1 171 ? 9.114   35.217  38.535  1.00 4.72   ? 171 THR C N     1 
ATOM   7331  C CA    . THR C 1 171 ? 9.252   36.554  39.066  1.00 2.77   ? 171 THR C CA    1 
ATOM   7332  C C     . THR C 1 171 ? 8.360   37.420  38.249  1.00 7.33   ? 171 THR C C     1 
ATOM   7333  O O     . THR C 1 171 ? 8.424   37.380  37.012  1.00 6.73   ? 171 THR C O     1 
ATOM   7334  C CB    . THR C 1 171 ? 10.715  36.990  38.961  1.00 7.39   ? 171 THR C CB    1 
ATOM   7335  O OG1   . THR C 1 171 ? 11.420  36.087  39.820  1.00 8.68   ? 171 THR C OG1   1 
ATOM   7336  C CG2   . THR C 1 171 ? 10.964  38.459  39.331  1.00 4.83   ? 171 THR C CG2   1 
ATOM   7337  H H     . THR C 1 171 ? 9.607   34.983  37.719  1.00 0.00   ? 171 THR C H     1 
ATOM   7338  H HG1   . THR C 1 171 ? 12.364  36.291  39.830  1.00 0.00   ? 171 THR C HG1   1 
ATOM   7339  N N     . MET C 1 172 ? 7.568   38.219  38.965  1.00 11.65  ? 172 MET C N     1 
ATOM   7340  C CA    . MET C 1 172 ? 6.555   39.077  38.372  1.00 9.41   ? 172 MET C CA    1 
ATOM   7341  C C     . MET C 1 172 ? 6.711   40.518  38.803  1.00 13.53  ? 172 MET C C     1 
ATOM   7342  O O     . MET C 1 172 ? 7.044   40.739  39.973  1.00 19.60  ? 172 MET C O     1 
ATOM   7343  C CB    . MET C 1 172 ? 5.177   38.606  38.799  1.00 18.17  ? 172 MET C CB    1 
ATOM   7344  C CG    . MET C 1 172 ? 3.984   39.393  38.257  1.00 20.31  ? 172 MET C CG    1 
ATOM   7345  S SD    . MET C 1 172 ? 2.782   38.232  37.581  1.00 27.20  ? 172 MET C SD    1 
ATOM   7346  C CE    . MET C 1 172 ? 3.206   38.446  35.886  1.00 25.54  ? 172 MET C CE    1 
ATOM   7347  H H     . MET C 1 172 ? 7.685   38.246  39.940  1.00 0.00   ? 172 MET C H     1 
ATOM   7348  N N     . LEU C 1 173 ? 6.465   41.523  37.964  1.00 9.91   ? 173 LEU C N     1 
ATOM   7349  C CA    . LEU C 1 173 ? 6.535   42.903  38.423  1.00 7.01   ? 173 LEU C CA    1 
ATOM   7350  C C     . LEU C 1 173 ? 5.151   43.426  38.117  1.00 6.08   ? 173 LEU C C     1 
ATOM   7351  O O     . LEU C 1 173 ? 4.623   43.165  37.034  1.00 9.34   ? 173 LEU C O     1 
ATOM   7352  C CB    . LEU C 1 173 ? 7.567   43.717  37.648  1.00 3.50   ? 173 LEU C CB    1 
ATOM   7353  C CG    . LEU C 1 173 ? 7.772   45.191  38.043  1.00 10.62  ? 173 LEU C CG    1 
ATOM   7354  C CD1   . LEU C 1 173 ? 9.132   45.391  38.673  1.00 12.51  ? 173 LEU C CD1   1 
ATOM   7355  C CD2   . LEU C 1 173 ? 7.708   46.061  36.811  1.00 8.33   ? 173 LEU C CD2   1 
ATOM   7356  H H     . LEU C 1 173 ? 6.188   41.337  37.041  1.00 0.00   ? 173 LEU C H     1 
ATOM   7357  N N     . VAL C 1 174 ? 4.529   44.082  39.061  1.00 2.00   ? 174 VAL C N     1 
ATOM   7358  C CA    . VAL C 1 174 ? 3.231   44.663  38.860  1.00 8.44   ? 174 VAL C CA    1 
ATOM   7359  C C     . VAL C 1 174 ? 3.531   46.148  38.987  1.00 9.55   ? 174 VAL C C     1 
ATOM   7360  O O     . VAL C 1 174 ? 4.157   46.575  39.969  1.00 8.53   ? 174 VAL C O     1 
ATOM   7361  C CB    . VAL C 1 174 ? 2.263   44.165  39.952  1.00 5.31   ? 174 VAL C CB    1 
ATOM   7362  C CG1   . VAL C 1 174 ? 0.928   44.818  39.759  1.00 11.93  ? 174 VAL C CG1   1 
ATOM   7363  C CG2   . VAL C 1 174 ? 2.009   42.700  39.834  1.00 2.00   ? 174 VAL C CG2   1 
ATOM   7364  H H     . VAL C 1 174 ? 5.001   44.276  39.894  1.00 0.00   ? 174 VAL C H     1 
ATOM   7365  N N     . LEU C 1 175 ? 3.105   46.955  38.019  1.00 11.14  ? 175 LEU C N     1 
ATOM   7366  C CA    . LEU C 1 175 ? 3.455   48.356  37.998  1.00 9.74   ? 175 LEU C CA    1 
ATOM   7367  C C     . LEU C 1 175 ? 2.213   49.194  37.856  1.00 11.02  ? 175 LEU C C     1 
ATOM   7368  O O     . LEU C 1 175 ? 1.532   49.098  36.833  1.00 17.59  ? 175 LEU C O     1 
ATOM   7369  C CB    . LEU C 1 175 ? 4.412   48.578  36.828  1.00 9.48   ? 175 LEU C CB    1 
ATOM   7370  C CG    . LEU C 1 175 ? 4.664   49.969  36.231  1.00 13.56  ? 175 LEU C CG    1 
ATOM   7371  C CD1   . LEU C 1 175 ? 5.291   50.916  37.242  1.00 4.63   ? 175 LEU C CD1   1 
ATOM   7372  C CD2   . LEU C 1 175 ? 5.547   49.780  35.006  1.00 5.67   ? 175 LEU C CD2   1 
ATOM   7373  H H     . LEU C 1 175 ? 2.536   46.606  37.298  1.00 0.00   ? 175 LEU C H     1 
ATOM   7374  N N     . ALA C 1 176 ? 1.847   49.962  38.868  1.00 8.88   ? 176 ALA C N     1 
ATOM   7375  C CA    . ALA C 1 176 ? 0.724   50.843  38.732  1.00 5.28   ? 176 ALA C CA    1 
ATOM   7376  C C     . ALA C 1 176 ? 1.146   52.290  38.558  1.00 10.55  ? 176 ALA C C     1 
ATOM   7377  O O     . ALA C 1 176 ? 1.967   52.924  39.239  1.00 11.32  ? 176 ALA C O     1 
ATOM   7378  C CB    . ALA C 1 176 ? -0.163  50.757  39.941  1.00 6.71   ? 176 ALA C CB    1 
ATOM   7379  H H     . ALA C 1 176 ? 2.330   49.912  39.706  1.00 0.00   ? 176 ALA C H     1 
ATOM   7380  N N     . MET C 1 177 ? 0.576   52.804  37.509  1.00 13.42  ? 177 MET C N     1 
ATOM   7381  C CA    . MET C 1 177 ? 0.680   54.202  37.208  1.00 17.33  ? 177 MET C CA    1 
ATOM   7382  C C     . MET C 1 177 ? -0.781  54.619  37.054  1.00 22.45  ? 177 MET C C     1 
ATOM   7383  O O     . MET C 1 177 ? -1.721  53.806  37.055  1.00 19.35  ? 177 MET C O     1 
ATOM   7384  C CB    . MET C 1 177 ? 1.442   54.418  35.912  1.00 16.08  ? 177 MET C CB    1 
ATOM   7385  C CG    . MET C 1 177 ? 2.909   54.087  36.034  1.00 16.51  ? 177 MET C CG    1 
ATOM   7386  S SD    . MET C 1 177 ? 3.900   54.685  34.648  1.00 21.92  ? 177 MET C SD    1 
ATOM   7387  C CE    . MET C 1 177 ? 3.198   53.653  33.385  1.00 18.90  ? 177 MET C CE    1 
ATOM   7388  H H     . MET C 1 177 ? -0.019  52.239  36.960  1.00 0.00   ? 177 MET C H     1 
ATOM   7389  N N     . ASP C 1 178 ? -0.991  55.917  36.921  1.00 26.13  ? 178 ASP C N     1 
ATOM   7390  C CA    . ASP C 1 178 ? -2.309  56.490  36.743  1.00 30.39  ? 178 ASP C CA    1 
ATOM   7391  C C     . ASP C 1 178 ? -3.123  55.846  35.621  1.00 30.13  ? 178 ASP C C     1 
ATOM   7392  O O     . ASP C 1 178 ? -4.337  55.676  35.748  1.00 28.70  ? 178 ASP C O     1 
ATOM   7393  C CB    . ASP C 1 178 ? -2.117  57.965  36.489  1.00 35.64  ? 178 ASP C CB    1 
ATOM   7394  C CG    . ASP C 1 178 ? -3.361  58.777  36.767  1.00 43.38  ? 178 ASP C CG    1 
ATOM   7395  O OD1   . ASP C 1 178 ? -3.580  59.121  37.930  1.00 48.23  ? 178 ASP C OD1   1 
ATOM   7396  O OD2   . ASP C 1 178 ? -4.101  59.057  35.821  1.00 49.56  ? 178 ASP C OD2   1 
ATOM   7397  H H     . ASP C 1 178 ? -0.226  56.515  37.052  1.00 0.00   ? 178 ASP C H     1 
ATOM   7398  N N     . CYS C 1 179 ? -2.478  55.475  34.505  1.00 31.70  ? 179 CYS C N     1 
ATOM   7399  C CA    . CYS C 1 179 ? -3.191  54.838  33.410  1.00 31.11  ? 179 CYS C CA    1 
ATOM   7400  C C     . CYS C 1 179 ? -3.743  53.474  33.831  1.00 30.89  ? 179 CYS C C     1 
ATOM   7401  O O     . CYS C 1 179 ? -4.716  53.049  33.206  1.00 34.53  ? 179 CYS C O     1 
ATOM   7402  C CB    . CYS C 1 179 ? -2.269  54.670  32.168  1.00 30.02  ? 179 CYS C CB    1 
ATOM   7403  S SG    . CYS C 1 179 ? -1.168  53.219  32.019  1.00 38.74  ? 179 CYS C SG    1 
ATOM   7404  H H     . CYS C 1 179 ? -1.525  55.669  34.393  1.00 0.00   ? 179 CYS C H     1 
ATOM   7405  N N     . GLY C 1 180 ? -3.228  52.768  34.857  1.00 26.25  ? 180 GLY C N     1 
ATOM   7406  C CA    . GLY C 1 180 ? -3.767  51.478  35.256  1.00 21.13  ? 180 GLY C CA    1 
ATOM   7407  C C     . GLY C 1 180 ? -2.691  50.566  35.796  1.00 16.71  ? 180 GLY C C     1 
ATOM   7408  O O     . GLY C 1 180 ? -1.532  50.957  35.942  1.00 19.47  ? 180 GLY C O     1 
ATOM   7409  H H     . GLY C 1 180 ? -2.455  53.088  35.367  1.00 0.00   ? 180 GLY C H     1 
ATOM   7410  N N     . VAL C 1 181 ? -3.068  49.344  36.121  1.00 16.32  ? 181 VAL C N     1 
ATOM   7411  C CA    . VAL C 1 181 ? -2.157  48.335  36.639  1.00 13.19  ? 181 VAL C CA    1 
ATOM   7412  C C     . VAL C 1 181 ? -1.793  47.426  35.495  1.00 16.73  ? 181 VAL C C     1 
ATOM   7413  O O     . VAL C 1 181 ? -2.697  46.999  34.763  1.00 24.38  ? 181 VAL C O     1 
ATOM   7414  C CB    . VAL C 1 181 ? -2.838  47.485  37.727  1.00 11.79  ? 181 VAL C CB    1 
ATOM   7415  C CG1   . VAL C 1 181 ? -1.941  46.363  38.183  1.00 6.95   ? 181 VAL C CG1   1 
ATOM   7416  C CG2   . VAL C 1 181 ? -3.120  48.353  38.929  1.00 9.17   ? 181 VAL C CG2   1 
ATOM   7417  H H     . VAL C 1 181 ? -3.992  49.078  35.947  1.00 0.00   ? 181 VAL C H     1 
ATOM   7418  N N     . ASN C 1 182 ? -0.529  47.065  35.294  1.00 19.93  ? 182 ASN C N     1 
ATOM   7419  C CA    . ASN C 1 182 ? -0.149  46.102  34.267  1.00 14.11  ? 182 ASN C CA    1 
ATOM   7420  C C     . ASN C 1 182 ? 0.809   45.144  34.950  1.00 11.64  ? 182 ASN C C     1 
ATOM   7421  O O     . ASN C 1 182 ? 1.582   45.567  35.808  1.00 9.42   ? 182 ASN C O     1 
ATOM   7422  C CB    . ASN C 1 182 ? 0.548   46.799  33.115  1.00 19.89  ? 182 ASN C CB    1 
ATOM   7423  C CG    . ASN C 1 182 ? -0.289  47.900  32.469  1.00 24.25  ? 182 ASN C CG    1 
ATOM   7424  O OD1   . ASN C 1 182 ? -0.477  48.968  33.043  1.00 33.81  ? 182 ASN C OD1   1 
ATOM   7425  N ND2   . ASN C 1 182 ? -0.845  47.779  31.275  1.00 24.49  ? 182 ASN C ND2   1 
ATOM   7426  H H     . ASN C 1 182 ? 0.191   47.507  35.799  1.00 0.00   ? 182 ASN C H     1 
ATOM   7427  H HD21  . ASN C 1 182 ? -1.336  48.568  30.955  1.00 0.00   ? 182 ASN C HD21  1 
ATOM   7428  H HD22  . ASN C 1 182 ? -0.701  46.956  30.767  1.00 0.00   ? 182 ASN C HD22  1 
ATOM   7429  N N     . CYS C 1 183 ? 0.741   43.852  34.651  1.00 12.83  ? 183 CYS C N     1 
ATOM   7430  C CA    . CYS C 1 183 ? 1.576   42.814  35.240  1.00 12.59  ? 183 CYS C CA    1 
ATOM   7431  C C     . CYS C 1 183 ? 2.586   42.277  34.203  1.00 13.57  ? 183 CYS C C     1 
ATOM   7432  O O     . CYS C 1 183 ? 2.171   41.955  33.078  1.00 13.57  ? 183 CYS C O     1 
ATOM   7433  C CB    . CYS C 1 183 ? 0.689   41.659  35.734  1.00 11.23  ? 183 CYS C CB    1 
ATOM   7434  S SG    . CYS C 1 183 ? -0.534  41.962  37.038  1.00 16.80  ? 183 CYS C SG    1 
ATOM   7435  H H     . CYS C 1 183 ? 0.136   43.574  33.933  1.00 0.00   ? 183 CYS C H     1 
ATOM   7436  N N     . PHE C 1 184 ? 3.898   42.119  34.498  1.00 11.22  ? 184 PHE C N     1 
ATOM   7437  C CA    . PHE C 1 184 ? 4.943   41.653  33.575  1.00 6.82   ? 184 PHE C CA    1 
ATOM   7438  C C     . PHE C 1 184 ? 5.653   40.413  34.120  1.00 6.20   ? 184 PHE C C     1 
ATOM   7439  O O     . PHE C 1 184 ? 5.961   40.388  35.309  1.00 11.36  ? 184 PHE C O     1 
ATOM   7440  C CB    . PHE C 1 184 ? 6.011   42.710  33.383  1.00 10.91  ? 184 PHE C CB    1 
ATOM   7441  C CG    . PHE C 1 184 ? 5.544   44.048  32.813  1.00 7.37   ? 184 PHE C CG    1 
ATOM   7442  C CD1   . PHE C 1 184 ? 4.878   44.940  33.617  1.00 2.37   ? 184 PHE C CD1   1 
ATOM   7443  C CD2   . PHE C 1 184 ? 5.732   44.306  31.473  1.00 6.24   ? 184 PHE C CD2   1 
ATOM   7444  C CE1   . PHE C 1 184 ? 4.311   46.053  33.051  1.00 3.76   ? 184 PHE C CE1   1 
ATOM   7445  C CE2   . PHE C 1 184 ? 5.185   45.425  30.914  1.00 3.44   ? 184 PHE C CE2   1 
ATOM   7446  C CZ    . PHE C 1 184 ? 4.457   46.284  31.703  1.00 9.56   ? 184 PHE C CZ    1 
ATOM   7447  H H     . PHE C 1 184 ? 4.184   42.319  35.411  1.00 0.00   ? 184 PHE C H     1 
ATOM   7448  N N     . MET C 1 185 ? 5.977   39.393  33.346  1.00 3.07   ? 185 MET C N     1 
ATOM   7449  C CA    . MET C 1 185 ? 6.600   38.163  33.816  1.00 7.72   ? 185 MET C CA    1 
ATOM   7450  C C     . MET C 1 185 ? 8.054   38.172  33.387  1.00 7.85   ? 185 MET C C     1 
ATOM   7451  O O     . MET C 1 185 ? 8.361   38.533  32.249  1.00 13.06  ? 185 MET C O     1 
ATOM   7452  C CB    . MET C 1 185 ? 5.920   36.962  33.192  1.00 9.11   ? 185 MET C CB    1 
ATOM   7453  C CG    . MET C 1 185 ? 6.302   35.579  33.710  1.00 10.03  ? 185 MET C CG    1 
ATOM   7454  S SD    . MET C 1 185 ? 5.576   35.170  35.310  1.00 20.98  ? 185 MET C SD    1 
ATOM   7455  C CE    . MET C 1 185 ? 3.977   34.643  34.766  1.00 12.92  ? 185 MET C CE    1 
ATOM   7456  H H     . MET C 1 185 ? 5.872   39.490  32.382  1.00 0.00   ? 185 MET C H     1 
ATOM   7457  N N     . LEU C 1 186 ? 8.993   37.766  34.216  1.00 7.47   ? 186 LEU C N     1 
ATOM   7458  C CA    . LEU C 1 186 ? 10.367  37.754  33.800  1.00 4.68   ? 186 LEU C CA    1 
ATOM   7459  C C     . LEU C 1 186 ? 10.646  36.459  33.097  1.00 8.00   ? 186 LEU C C     1 
ATOM   7460  O O     . LEU C 1 186 ? 10.369  35.392  33.658  1.00 10.28  ? 186 LEU C O     1 
ATOM   7461  C CB    . LEU C 1 186 ? 11.258  37.851  34.985  1.00 6.86   ? 186 LEU C CB    1 
ATOM   7462  C CG    . LEU C 1 186 ? 12.737  37.767  34.776  1.00 4.48   ? 186 LEU C CG    1 
ATOM   7463  C CD1   . LEU C 1 186 ? 13.223  39.023  34.092  1.00 5.74   ? 186 LEU C CD1   1 
ATOM   7464  C CD2   . LEU C 1 186 ? 13.399  37.548  36.115  1.00 7.93   ? 186 LEU C CD2   1 
ATOM   7465  H H     . LEU C 1 186 ? 8.748   37.388  35.087  1.00 0.00   ? 186 LEU C H     1 
ATOM   7466  N N     . ASP C 1 187 ? 11.200  36.548  31.889  1.00 7.55   ? 187 ASP C N     1 
ATOM   7467  C CA    . ASP C 1 187 ? 11.640  35.360  31.194  1.00 8.30   ? 187 ASP C CA    1 
ATOM   7468  C C     . ASP C 1 187 ? 13.110  35.319  31.558  1.00 10.03  ? 187 ASP C C     1 
ATOM   7469  O O     . ASP C 1 187 ? 13.932  36.048  30.981  1.00 13.17  ? 187 ASP C O     1 
ATOM   7470  C CB    . ASP C 1 187 ? 11.498  35.478  29.666  1.00 7.20   ? 187 ASP C CB    1 
ATOM   7471  C CG    . ASP C 1 187 ? 12.021  34.307  28.826  1.00 11.28  ? 187 ASP C CG    1 
ATOM   7472  O OD1   . ASP C 1 187 ? 12.771  33.449  29.287  1.00 8.91   ? 187 ASP C OD1   1 
ATOM   7473  O OD2   . ASP C 1 187 ? 11.682  34.251  27.652  1.00 20.69  ? 187 ASP C OD2   1 
ATOM   7474  H H     . ASP C 1 187 ? 11.265  37.424  31.465  1.00 0.00   ? 187 ASP C H     1 
ATOM   7475  N N     . PRO C 1 188 ? 13.549  34.450  32.458  1.00 9.31   ? 188 PRO C N     1 
ATOM   7476  C CA    . PRO C 1 188 ? 14.930  34.395  32.842  1.00 4.69   ? 188 PRO C CA    1 
ATOM   7477  C C     . PRO C 1 188 ? 15.798  33.889  31.705  1.00 6.41   ? 188 PRO C C     1 
ATOM   7478  O O     . PRO C 1 188 ? 16.999  34.077  31.787  1.00 9.01   ? 188 PRO C O     1 
ATOM   7479  C CB    . PRO C 1 188 ? 14.912  33.529  34.060  1.00 2.52   ? 188 PRO C CB    1 
ATOM   7480  C CG    . PRO C 1 188 ? 13.786  32.583  33.759  1.00 8.34   ? 188 PRO C CG    1 
ATOM   7481  C CD    . PRO C 1 188 ? 12.737  33.489  33.178  1.00 4.58   ? 188 PRO C CD    1 
ATOM   7482  N N     . ALA C 1 189 ? 15.343  33.266  30.617  1.00 5.76   ? 189 ALA C N     1 
ATOM   7483  C CA    . ALA C 1 189 ? 16.301  32.909  29.580  1.00 4.26   ? 189 ALA C CA    1 
ATOM   7484  C C     . ALA C 1 189 ? 16.822  34.152  28.876  1.00 6.61   ? 189 ALA C C     1 
ATOM   7485  O O     . ALA C 1 189 ? 17.935  34.122  28.352  1.00 9.10   ? 189 ALA C O     1 
ATOM   7486  C CB    . ALA C 1 189 ? 15.701  32.008  28.502  1.00 2.00   ? 189 ALA C CB    1 
ATOM   7487  H H     . ALA C 1 189 ? 14.412  32.991  30.562  1.00 0.00   ? 189 ALA C H     1 
ATOM   7488  N N     . ILE C 1 190 ? 16.099  35.269  28.810  1.00 5.00   ? 190 ILE C N     1 
ATOM   7489  C CA    . ILE C 1 190 ? 16.616  36.431  28.098  1.00 3.95   ? 190 ILE C CA    1 
ATOM   7490  C C     . ILE C 1 190 ? 16.696  37.711  28.920  1.00 6.31   ? 190 ILE C C     1 
ATOM   7491  O O     . ILE C 1 190 ? 17.093  38.739  28.374  1.00 9.57   ? 190 ILE C O     1 
ATOM   7492  C CB    . ILE C 1 190 ? 15.768  36.698  26.819  1.00 6.27   ? 190 ILE C CB    1 
ATOM   7493  C CG1   . ILE C 1 190 ? 14.317  36.994  27.154  1.00 4.24   ? 190 ILE C CG1   1 
ATOM   7494  C CG2   . ILE C 1 190 ? 15.852  35.473  25.908  1.00 2.28   ? 190 ILE C CG2   1 
ATOM   7495  C CD1   . ILE C 1 190 ? 13.524  37.460  25.912  1.00 9.45   ? 190 ILE C CD1   1 
ATOM   7496  H H     . ILE C 1 190 ? 15.254  35.338  29.296  1.00 0.00   ? 190 ILE C H     1 
ATOM   7497  N N     . GLY C 1 191 ? 16.292  37.724  30.196  1.00 7.03   ? 191 GLY C N     1 
ATOM   7498  C CA    . GLY C 1 191 ? 16.439  38.902  31.041  1.00 3.59   ? 191 GLY C CA    1 
ATOM   7499  C C     . GLY C 1 191 ? 15.455  39.974  30.627  1.00 13.64  ? 191 GLY C C     1 
ATOM   7500  O O     . GLY C 1 191 ? 15.791  41.160  30.564  1.00 19.57  ? 191 GLY C O     1 
ATOM   7501  H H     . GLY C 1 191 ? 15.903  36.919  30.586  1.00 0.00   ? 191 GLY C H     1 
ATOM   7502  N N     . GLU C 1 192 ? 14.198  39.591  30.400  1.00 8.61   ? 192 GLU C N     1 
ATOM   7503  C CA    . GLU C 1 192 ? 13.219  40.517  29.890  1.00 8.94   ? 192 GLU C CA    1 
ATOM   7504  C C     . GLU C 1 192 ? 11.909  40.336  30.643  1.00 4.58   ? 192 GLU C C     1 
ATOM   7505  O O     . GLU C 1 192 ? 11.572  39.213  31.004  1.00 6.11   ? 192 GLU C O     1 
ATOM   7506  C CB    . GLU C 1 192 ? 13.097  40.208  28.406  1.00 10.31  ? 192 GLU C CB    1 
ATOM   7507  C CG    . GLU C 1 192 ? 12.568  41.317  27.535  1.00 13.46  ? 192 GLU C CG    1 
ATOM   7508  C CD    . GLU C 1 192 ? 13.398  42.588  27.503  1.00 13.85  ? 192 GLU C CD    1 
ATOM   7509  O OE1   . GLU C 1 192 ? 14.542  42.550  27.087  1.00 20.09  ? 192 GLU C OE1   1 
ATOM   7510  O OE2   . GLU C 1 192 ? 12.901  43.648  27.859  1.00 23.97  ? 192 GLU C OE2   1 
ATOM   7511  H H     . GLU C 1 192 ? 13.899  38.695  30.656  1.00 0.00   ? 192 GLU C H     1 
ATOM   7512  N N     . PHE C 1 193 ? 11.203  41.408  30.971  1.00 6.65   ? 193 PHE C N     1 
ATOM   7513  C CA    . PHE C 1 193 ? 9.904   41.321  31.615  1.00 4.85   ? 193 PHE C CA    1 
ATOM   7514  C C     . PHE C 1 193 ? 8.920   41.427  30.474  1.00 3.95   ? 193 PHE C C     1 
ATOM   7515  O O     . PHE C 1 193 ? 8.832   42.495  29.877  1.00 3.23   ? 193 PHE C O     1 
ATOM   7516  C CB    . PHE C 1 193 ? 9.674   42.476  32.552  1.00 2.00   ? 193 PHE C CB    1 
ATOM   7517  C CG    . PHE C 1 193 ? 10.357  42.349  33.895  1.00 2.00   ? 193 PHE C CG    1 
ATOM   7518  C CD1   . PHE C 1 193 ? 9.844   41.495  34.848  1.00 3.22   ? 193 PHE C CD1   1 
ATOM   7519  C CD2   . PHE C 1 193 ? 11.448  43.134  34.173  1.00 2.00   ? 193 PHE C CD2   1 
ATOM   7520  C CE1   . PHE C 1 193 ? 10.437  41.423  36.084  1.00 2.46   ? 193 PHE C CE1   1 
ATOM   7521  C CE2   . PHE C 1 193 ? 12.026  43.074  35.417  1.00 2.74   ? 193 PHE C CE2   1 
ATOM   7522  C CZ    . PHE C 1 193 ? 11.536  42.208  36.363  1.00 2.35   ? 193 PHE C CZ    1 
ATOM   7523  H H     . PHE C 1 193 ? 11.543  42.296  30.721  1.00 0.00   ? 193 PHE C H     1 
ATOM   7524  N N     . ILE C 1 194 ? 8.221   40.365  30.109  1.00 7.56   ? 194 ILE C N     1 
ATOM   7525  C CA    . ILE C 1 194 ? 7.258   40.324  29.010  1.00 8.70   ? 194 ILE C CA    1 
ATOM   7526  C C     . ILE C 1 194 ? 5.950   40.769  29.638  1.00 8.67   ? 194 ILE C C     1 
ATOM   7527  O O     . ILE C 1 194 ? 5.709   40.426  30.798  1.00 10.49  ? 194 ILE C O     1 
ATOM   7528  C CB    . ILE C 1 194 ? 7.127   38.862  28.457  1.00 10.73  ? 194 ILE C CB    1 
ATOM   7529  C CG1   . ILE C 1 194 ? 8.500   38.270  28.098  1.00 5.07   ? 194 ILE C CG1   1 
ATOM   7530  C CG2   . ILE C 1 194 ? 6.250   38.869  27.217  1.00 7.93   ? 194 ILE C CG2   1 
ATOM   7531  C CD1   . ILE C 1 194 ? 9.304   39.003  26.987  1.00 6.69   ? 194 ILE C CD1   1 
ATOM   7532  H H     . ILE C 1 194 ? 8.329   39.558  30.650  1.00 0.00   ? 194 ILE C H     1 
ATOM   7533  N N     . LEU C 1 195 ? 5.091   41.523  28.952  1.00 9.08   ? 195 LEU C N     1 
ATOM   7534  C CA    . LEU C 1 195 ? 3.820   41.980  29.488  1.00 4.36   ? 195 LEU C CA    1 
ATOM   7535  C C     . LEU C 1 195 ? 2.799   40.873  29.333  1.00 8.52   ? 195 LEU C C     1 
ATOM   7536  O O     . LEU C 1 195 ? 2.501   40.455  28.209  1.00 14.27  ? 195 LEU C O     1 
ATOM   7537  C CB    . LEU C 1 195 ? 3.404   43.233  28.735  1.00 2.57   ? 195 LEU C CB    1 
ATOM   7538  C CG    . LEU C 1 195 ? 1.959   43.718  28.828  1.00 3.00   ? 195 LEU C CG    1 
ATOM   7539  C CD1   . LEU C 1 195 ? 1.561   44.048  30.246  1.00 6.19   ? 195 LEU C CD1   1 
ATOM   7540  C CD2   . LEU C 1 195 ? 1.842   44.950  28.014  1.00 7.03   ? 195 LEU C CD2   1 
ATOM   7541  H H     . LEU C 1 195 ? 5.316   41.751  28.028  1.00 0.00   ? 195 LEU C H     1 
ATOM   7542  N N     . VAL C 1 196 ? 2.238   40.353  30.432  1.00 13.46  ? 196 VAL C N     1 
ATOM   7543  C CA    . VAL C 1 196 ? 1.268   39.263  30.321  1.00 13.06  ? 196 VAL C CA    1 
ATOM   7544  C C     . VAL C 1 196 ? -0.169  39.606  30.694  1.00 17.40  ? 196 VAL C C     1 
ATOM   7545  O O     . VAL C 1 196 ? -1.084  38.789  30.493  1.00 15.44  ? 196 VAL C O     1 
ATOM   7546  C CB    . VAL C 1 196 ? 1.730   38.043  31.170  1.00 9.66   ? 196 VAL C CB    1 
ATOM   7547  C CG1   . VAL C 1 196 ? 3.094   37.614  30.696  1.00 3.85   ? 196 VAL C CG1   1 
ATOM   7548  C CG2   . VAL C 1 196 ? 1.776   38.375  32.633  1.00 6.62   ? 196 VAL C CG2   1 
ATOM   7549  H H     . VAL C 1 196 ? 2.471   40.728  31.310  1.00 0.00   ? 196 VAL C H     1 
ATOM   7550  N N     . ASP C 1 197 ? -0.407  40.787  31.273  1.00 19.79  ? 197 ASP C N     1 
ATOM   7551  C CA    . ASP C 1 197 ? -1.740  41.215  31.640  1.00 20.34  ? 197 ASP C CA    1 
ATOM   7552  C C     . ASP C 1 197 ? -1.696  42.725  31.671  1.00 21.23  ? 197 ASP C C     1 
ATOM   7553  O O     . ASP C 1 197 ? -0.790  43.355  32.221  1.00 19.71  ? 197 ASP C O     1 
ATOM   7554  C CB    . ASP C 1 197 ? -2.122  40.674  33.006  1.00 28.11  ? 197 ASP C CB    1 
ATOM   7555  C CG    . ASP C 1 197 ? -3.507  40.024  33.096  1.00 30.06  ? 197 ASP C CG    1 
ATOM   7556  O OD1   . ASP C 1 197 ? -4.456  40.468  32.443  1.00 27.33  ? 197 ASP C OD1   1 
ATOM   7557  O OD2   . ASP C 1 197 ? -3.630  39.056  33.849  1.00 37.59  ? 197 ASP C OD2   1 
ATOM   7558  H H     . ASP C 1 197 ? 0.341   41.397  31.455  1.00 0.00   ? 197 ASP C H     1 
ATOM   7559  N N     . LYS C 1 198 ? -2.713  43.310  31.078  1.00 22.42  ? 198 LYS C N     1 
ATOM   7560  C CA    . LYS C 1 198 ? -2.742  44.724  30.796  1.00 26.73  ? 198 LYS C CA    1 
ATOM   7561  C C     . LYS C 1 198 ? -4.067  45.229  31.317  1.00 25.90  ? 198 LYS C C     1 
ATOM   7562  O O     . LYS C 1 198 ? -5.065  44.568  31.064  1.00 23.49  ? 198 LYS C O     1 
ATOM   7563  C CB    . LYS C 1 198 ? -2.614  44.821  29.303  1.00 31.60  ? 198 LYS C CB    1 
ATOM   7564  C CG    . LYS C 1 198 ? -2.655  46.192  28.704  1.00 43.61  ? 198 LYS C CG    1 
ATOM   7565  C CD    . LYS C 1 198 ? -2.508  45.924  27.224  1.00 53.52  ? 198 LYS C CD    1 
ATOM   7566  C CE    . LYS C 1 198 ? -2.491  47.230  26.459  1.00 59.45  ? 198 LYS C CE    1 
ATOM   7567  N NZ    . LYS C 1 198 ? -2.483  46.931  25.041  1.00 64.54  ? 198 LYS C NZ    1 
ATOM   7568  H H     . LYS C 1 198 ? -3.541  42.814  30.904  1.00 0.00   ? 198 LYS C H     1 
ATOM   7569  H HZ1   . LYS C 1 198 ? -3.334  46.381  24.806  1.00 0.00   ? 198 LYS C HZ1   1 
ATOM   7570  H HZ2   . LYS C 1 198 ? -2.484  47.818  24.498  1.00 0.00   ? 198 LYS C HZ2   1 
ATOM   7571  H HZ3   . LYS C 1 198 ? -1.637  46.376  24.804  1.00 0.00   ? 198 LYS C HZ3   1 
ATOM   7572  N N     . ASP C 1 199 ? -4.072  46.359  32.026  1.00 25.66  ? 199 ASP C N     1 
ATOM   7573  C CA    . ASP C 1 199 ? -5.261  46.956  32.630  1.00 22.23  ? 199 ASP C CA    1 
ATOM   7574  C C     . ASP C 1 199 ? -5.983  45.955  33.500  1.00 18.98  ? 199 ASP C C     1 
ATOM   7575  O O     . ASP C 1 199 ? -7.130  45.544  33.315  1.00 19.54  ? 199 ASP C O     1 
ATOM   7576  C CB    . ASP C 1 199 ? -6.258  47.485  31.590  1.00 29.06  ? 199 ASP C CB    1 
ATOM   7577  C CG    . ASP C 1 199 ? -5.719  48.511  30.604  1.00 35.21  ? 199 ASP C CG    1 
ATOM   7578  O OD1   . ASP C 1 199 ? -4.816  49.285  30.948  1.00 38.06  ? 199 ASP C OD1   1 
ATOM   7579  O OD2   . ASP C 1 199 ? -6.217  48.518  29.473  1.00 37.10  ? 199 ASP C OD2   1 
ATOM   7580  H H     . ASP C 1 199 ? -3.215  46.779  32.237  1.00 0.00   ? 199 ASP C H     1 
ATOM   7581  N N     . VAL C 1 200 ? -5.238  45.550  34.506  1.00 16.56  ? 200 VAL C N     1 
ATOM   7582  C CA    . VAL C 1 200 ? -5.797  44.640  35.467  1.00 14.65  ? 200 VAL C CA    1 
ATOM   7583  C C     . VAL C 1 200 ? -6.830  45.417  36.300  1.00 17.72  ? 200 VAL C C     1 
ATOM   7584  O O     . VAL C 1 200 ? -6.708  46.635  36.531  1.00 20.54  ? 200 VAL C O     1 
ATOM   7585  C CB    . VAL C 1 200 ? -4.622  44.080  36.290  1.00 10.75  ? 200 VAL C CB    1 
ATOM   7586  C CG1   . VAL C 1 200 ? -5.070  43.069  37.326  1.00 13.07  ? 200 VAL C CG1   1 
ATOM   7587  C CG2   . VAL C 1 200 ? -3.743  43.284  35.367  1.00 7.88   ? 200 VAL C CG2   1 
ATOM   7588  H H     . VAL C 1 200 ? -4.360  45.956  34.656  1.00 0.00   ? 200 VAL C H     1 
ATOM   7589  N N     . LYS C 1 201 ? -7.895  44.689  36.660  1.00 14.55  ? 201 LYS C N     1 
ATOM   7590  C CA    . LYS C 1 201 ? -8.952  45.157  37.541  1.00 14.90  ? 201 LYS C CA    1 
ATOM   7591  C C     . LYS C 1 201 ? -9.257  43.994  38.467  1.00 10.31  ? 201 LYS C C     1 
ATOM   7592  O O     . LYS C 1 201 ? -9.297  42.849  38.040  1.00 4.52   ? 201 LYS C O     1 
ATOM   7593  C CB    . LYS C 1 201 ? -10.256 45.509  36.816  1.00 12.08  ? 201 LYS C CB    1 
ATOM   7594  C CG    . LYS C 1 201 ? -10.321 46.923  36.238  1.00 21.37  ? 201 LYS C CG    1 
ATOM   7595  C CD    . LYS C 1 201 ? -10.327 46.809  34.713  1.00 31.29  ? 201 LYS C CD    1 
ATOM   7596  C CE    . LYS C 1 201 ? -10.545 48.145  34.031  1.00 39.77  ? 201 LYS C CE    1 
ATOM   7597  N NZ    . LYS C 1 201 ? -11.967 48.401  33.808  1.00 48.26  ? 201 LYS C NZ    1 
ATOM   7598  H H     . LYS C 1 201 ? -7.963  43.758  36.361  1.00 0.00   ? 201 LYS C H     1 
ATOM   7599  H HZ1   . LYS C 1 201 ? -12.481 48.344  34.710  1.00 0.00   ? 201 LYS C HZ1   1 
ATOM   7600  H HZ2   . LYS C 1 201 ? -12.096 49.347  33.391  1.00 0.00   ? 201 LYS C HZ2   1 
ATOM   7601  H HZ3   . LYS C 1 201 ? -12.357 47.693  33.153  1.00 0.00   ? 201 LYS C HZ3   1 
ATOM   7602  N N     . ILE C 1 202 ? -9.530  44.261  39.726  1.00 9.67   ? 202 ILE C N     1 
ATOM   7603  C CA    . ILE C 1 202 ? -9.729  43.225  40.707  1.00 13.13  ? 202 ILE C CA    1 
ATOM   7604  C C     . ILE C 1 202 ? -11.188 42.774  40.692  1.00 15.02  ? 202 ILE C C     1 
ATOM   7605  O O     . ILE C 1 202 ? -12.100 43.508  40.299  1.00 16.18  ? 202 ILE C O     1 
ATOM   7606  C CB    . ILE C 1 202 ? -9.258  43.836  42.051  1.00 9.97   ? 202 ILE C CB    1 
ATOM   7607  C CG1   . ILE C 1 202 ? -9.292  42.852  43.211  1.00 11.80  ? 202 ILE C CG1   1 
ATOM   7608  C CG2   . ILE C 1 202 ? -10.173 44.970  42.368  1.00 9.61   ? 202 ILE C CG2   1 
ATOM   7609  C CD1   . ILE C 1 202 ? -8.560  43.448  44.434  1.00 8.30   ? 202 ILE C CD1   1 
ATOM   7610  H H     . ILE C 1 202 ? -9.838  45.159  39.939  1.00 0.00   ? 202 ILE C H     1 
ATOM   7611  N N     . LYS C 1 203 ? -11.434 41.523  41.073  1.00 19.38  ? 203 LYS C N     1 
ATOM   7612  C CA    . LYS C 1 203 ? -12.790 40.997  41.192  1.00 21.40  ? 203 LYS C CA    1 
ATOM   7613  C C     . LYS C 1 203 ? -13.535 41.832  42.212  1.00 19.36  ? 203 LYS C C     1 
ATOM   7614  O O     . LYS C 1 203 ? -12.942 42.270  43.208  1.00 18.72  ? 203 LYS C O     1 
ATOM   7615  C CB    . LYS C 1 203 ? -12.853 39.571  41.718  1.00 28.10  ? 203 LYS C CB    1 
ATOM   7616  C CG    . LYS C 1 203 ? -12.525 38.399  40.820  1.00 34.23  ? 203 LYS C CG    1 
ATOM   7617  C CD    . LYS C 1 203 ? -13.129 37.217  41.565  1.00 44.42  ? 203 LYS C CD    1 
ATOM   7618  C CE    . LYS C 1 203 ? -12.883 35.881  40.890  1.00 52.21  ? 203 LYS C CE    1 
ATOM   7619  N NZ    . LYS C 1 203 ? -13.580 34.835  41.627  1.00 58.94  ? 203 LYS C NZ    1 
ATOM   7620  H H     . LYS C 1 203 ? -10.670 40.953  41.285  1.00 0.00   ? 203 LYS C H     1 
ATOM   7621  H HZ1   . LYS C 1 203 ? -14.599 35.040  41.635  1.00 0.00   ? 203 LYS C HZ1   1 
ATOM   7622  H HZ2   . LYS C 1 203 ? -13.414 33.917  41.169  1.00 0.00   ? 203 LYS C HZ2   1 
ATOM   7623  H HZ3   . LYS C 1 203 ? -13.222 34.801  42.603  1.00 0.00   ? 203 LYS C HZ3   1 
ATOM   7624  N N     . LYS C 1 204 ? -14.827 42.006  41.967  1.00 18.38  ? 204 LYS C N     1 
ATOM   7625  C CA    . LYS C 1 204 ? -15.656 42.836  42.818  1.00 22.45  ? 204 LYS C CA    1 
ATOM   7626  C C     . LYS C 1 204 ? -15.883 42.268  44.199  1.00 16.87  ? 204 LYS C C     1 
ATOM   7627  O O     . LYS C 1 204 ? -15.874 42.995  45.195  1.00 14.76  ? 204 LYS C O     1 
ATOM   7628  C CB    . LYS C 1 204 ? -17.004 43.060  42.171  1.00 31.14  ? 204 LYS C CB    1 
ATOM   7629  C CG    . LYS C 1 204 ? -17.444 44.477  42.464  1.00 42.49  ? 204 LYS C CG    1 
ATOM   7630  C CD    . LYS C 1 204 ? -18.900 44.707  42.100  1.00 54.00  ? 204 LYS C CD    1 
ATOM   7631  C CE    . LYS C 1 204 ? -19.233 46.176  42.357  1.00 58.98  ? 204 LYS C CE    1 
ATOM   7632  N NZ    . LYS C 1 204 ? -20.615 46.444  42.008  1.00 62.97  ? 204 LYS C NZ    1 
ATOM   7633  H H     . LYS C 1 204 ? -15.203 41.633  41.147  1.00 0.00   ? 204 LYS C H     1 
ATOM   7634  H HZ1   . LYS C 1 204 ? -21.229 45.814  42.565  1.00 0.00   ? 204 LYS C HZ1   1 
ATOM   7635  H HZ2   . LYS C 1 204 ? -20.849 47.436  42.218  1.00 0.00   ? 204 LYS C HZ2   1 
ATOM   7636  H HZ3   . LYS C 1 204 ? -20.758 46.244  40.997  1.00 0.00   ? 204 LYS C HZ3   1 
ATOM   7637  N N     . LYS C 1 205 ? -16.101 40.966  44.253  1.00 21.58  ? 205 LYS C N     1 
ATOM   7638  C CA    . LYS C 1 205 ? -16.281 40.246  45.497  1.00 23.05  ? 205 LYS C CA    1 
ATOM   7639  C C     . LYS C 1 205 ? -15.456 38.981  45.355  1.00 22.85  ? 205 LYS C C     1 
ATOM   7640  O O     . LYS C 1 205 ? -15.491 38.352  44.285  1.00 26.36  ? 205 LYS C O     1 
ATOM   7641  C CB    . LYS C 1 205 ? -17.728 39.886  45.697  1.00 26.20  ? 205 LYS C CB    1 
ATOM   7642  C CG    . LYS C 1 205 ? -17.940 39.549  47.152  1.00 31.24  ? 205 LYS C CG    1 
ATOM   7643  C CD    . LYS C 1 205 ? -19.407 39.436  47.478  1.00 40.04  ? 205 LYS C CD    1 
ATOM   7644  C CE    . LYS C 1 205 ? -19.427 39.335  48.992  1.00 46.85  ? 205 LYS C CE    1 
ATOM   7645  N NZ    . LYS C 1 205 ? -20.770 39.526  49.497  1.00 55.58  ? 205 LYS C NZ    1 
ATOM   7646  H H     . LYS C 1 205 ? -16.103 40.439  43.429  1.00 0.00   ? 205 LYS C H     1 
ATOM   7647  H HZ1   . LYS C 1 205 ? -21.142 40.425  49.126  1.00 0.00   ? 205 LYS C HZ1   1 
ATOM   7648  H HZ2   . LYS C 1 205 ? -21.377 38.744  49.177  1.00 0.00   ? 205 LYS C HZ2   1 
ATOM   7649  H HZ3   . LYS C 1 205 ? -20.760 39.561  50.537  1.00 0.00   ? 205 LYS C HZ3   1 
ATOM   7650  N N     . GLY C 1 206 ? -14.766 38.581  46.423  1.00 18.15  ? 206 GLY C N     1 
ATOM   7651  C CA    . GLY C 1 206 ? -13.865 37.447  46.391  1.00 16.23  ? 206 GLY C CA    1 
ATOM   7652  C C     . GLY C 1 206 ? -14.373 36.328  47.292  1.00 20.97  ? 206 GLY C C     1 
ATOM   7653  O O     . GLY C 1 206 ? -15.512 36.386  47.786  1.00 17.94  ? 206 GLY C O     1 
ATOM   7654  H H     . GLY C 1 206 ? -15.000 38.947  47.294  1.00 0.00   ? 206 GLY C H     1 
ATOM   7655  N N     . LYS C 1 207 ? -13.545 35.304  47.530  1.00 18.23  ? 207 LYS C N     1 
ATOM   7656  C CA    . LYS C 1 207 ? -13.936 34.188  48.358  1.00 22.05  ? 207 LYS C CA    1 
ATOM   7657  C C     . LYS C 1 207 ? -12.799 33.649  49.207  1.00 16.71  ? 207 LYS C C     1 
ATOM   7658  O O     . LYS C 1 207 ? -12.791 32.493  49.632  1.00 16.82  ? 207 LYS C O     1 
ATOM   7659  C CB    . LYS C 1 207 ? -14.492 33.087  47.468  1.00 31.41  ? 207 LYS C CB    1 
ATOM   7660  C CG    . LYS C 1 207 ? -15.491 32.298  48.301  1.00 45.98  ? 207 LYS C CG    1 
ATOM   7661  C CD    . LYS C 1 207 ? -16.047 31.106  47.564  1.00 52.83  ? 207 LYS C CD    1 
ATOM   7662  C CE    . LYS C 1 207 ? -17.019 30.404  48.491  1.00 55.29  ? 207 LYS C CE    1 
ATOM   7663  N NZ    . LYS C 1 207 ? -17.827 29.517  47.679  1.00 62.09  ? 207 LYS C NZ    1 
ATOM   7664  H H     . LYS C 1 207 ? -12.670 35.280  47.107  1.00 0.00   ? 207 LYS C H     1 
ATOM   7665  H HZ1   . LYS C 1 207 ? -18.262 30.074  46.914  1.00 0.00   ? 207 LYS C HZ1   1 
ATOM   7666  H HZ2   . LYS C 1 207 ? -17.231 28.776  47.256  1.00 0.00   ? 207 LYS C HZ2   1 
ATOM   7667  H HZ3   . LYS C 1 207 ? -18.581 29.087  48.247  1.00 0.00   ? 207 LYS C HZ3   1 
ATOM   7668  N N     . ILE C 1 208 ? -11.823 34.494  49.508  1.00 15.05  ? 208 ILE C N     1 
ATOM   7669  C CA    . ILE C 1 208 ? -10.659 34.137  50.307  1.00 6.72   ? 208 ILE C CA    1 
ATOM   7670  C C     . ILE C 1 208 ? -10.533 35.331  51.232  1.00 2.00   ? 208 ILE C C     1 
ATOM   7671  O O     . ILE C 1 208 ? -10.746 36.472  50.804  1.00 2.20   ? 208 ILE C O     1 
ATOM   7672  C CB    . ILE C 1 208 ? -9.359  34.050  49.471  1.00 7.85   ? 208 ILE C CB    1 
ATOM   7673  C CG1   . ILE C 1 208 ? -9.456  33.075  48.320  1.00 5.44   ? 208 ILE C CG1   1 
ATOM   7674  C CG2   . ILE C 1 208 ? -8.245  33.605  50.392  1.00 4.70   ? 208 ILE C CG2   1 
ATOM   7675  C CD1   . ILE C 1 208 ? -9.463  31.579  48.658  1.00 7.92   ? 208 ILE C CD1   1 
ATOM   7676  H H     . ILE C 1 208 ? -11.877 35.429  49.219  1.00 0.00   ? 208 ILE C H     1 
ATOM   7677  N N     . TYR C 1 209 ? -10.230 35.080  52.493  1.00 3.22   ? 209 TYR C N     1 
ATOM   7678  C CA    . TYR C 1 209 ? -9.962  36.142  53.444  1.00 2.00   ? 209 TYR C CA    1 
ATOM   7679  C C     . TYR C 1 209 ? -8.538  35.872  53.944  1.00 4.75   ? 209 TYR C C     1 
ATOM   7680  O O     . TYR C 1 209 ? -8.130  34.707  54.092  1.00 4.64   ? 209 TYR C O     1 
ATOM   7681  C CB    . TYR C 1 209 ? -11.024 36.098  54.582  1.00 5.81   ? 209 TYR C CB    1 
ATOM   7682  C CG    . TYR C 1 209 ? -11.005 34.976  55.616  1.00 2.51   ? 209 TYR C CG    1 
ATOM   7683  C CD1   . TYR C 1 209 ? -11.679 33.786  55.432  1.00 9.32   ? 209 TYR C CD1   1 
ATOM   7684  C CD2   . TYR C 1 209 ? -10.278 35.168  56.773  1.00 12.41  ? 209 TYR C CD2   1 
ATOM   7685  C CE1   . TYR C 1 209 ? -11.593 32.764  56.368  1.00 6.71   ? 209 TYR C CE1   1 
ATOM   7686  C CE2   . TYR C 1 209 ? -10.178 34.150  57.706  1.00 11.32  ? 209 TYR C CE2   1 
ATOM   7687  C CZ    . TYR C 1 209 ? -10.801 32.948  57.488  1.00 7.92   ? 209 TYR C CZ    1 
ATOM   7688  O OH    . TYR C 1 209 ? -10.569 31.920  58.383  1.00 10.43  ? 209 TYR C OH    1 
ATOM   7689  H H     . TYR C 1 209 ? -10.115 34.146  52.781  1.00 0.00   ? 209 TYR C H     1 
ATOM   7690  H HH    . TYR C 1 209 ? -11.234 31.235  58.243  1.00 0.00   ? 209 TYR C HH    1 
ATOM   7691  N N     . SER C 1 210 ? -7.727  36.884  54.211  1.00 8.38   ? 210 SER C N     1 
ATOM   7692  C CA    . SER C 1 210 ? -6.334  36.657  54.559  1.00 11.84  ? 210 SER C CA    1 
ATOM   7693  C C     . SER C 1 210 ? -5.883  37.495  55.725  1.00 7.13   ? 210 SER C C     1 
ATOM   7694  O O     . SER C 1 210 ? -5.847  38.719  55.614  1.00 5.18   ? 210 SER C O     1 
ATOM   7695  C CB    . SER C 1 210 ? -5.492  36.957  53.320  1.00 8.44   ? 210 SER C CB    1 
ATOM   7696  O OG    . SER C 1 210 ? -4.124  36.566  53.352  1.00 12.06  ? 210 SER C OG    1 
ATOM   7697  H H     . SER C 1 210 ? -8.029  37.810  54.082  1.00 0.00   ? 210 SER C H     1 
ATOM   7698  H HG    . SER C 1 210 ? -3.959  36.140  54.200  1.00 0.00   ? 210 SER C HG    1 
ATOM   7699  N N     . LEU C 1 211 ? -5.561  36.875  56.857  1.00 10.65  ? 211 LEU C N     1 
ATOM   7700  C CA    . LEU C 1 211 ? -4.969  37.609  57.963  1.00 11.82  ? 211 LEU C CA    1 
ATOM   7701  C C     . LEU C 1 211 ? -4.372  36.606  58.932  1.00 8.26   ? 211 LEU C C     1 
ATOM   7702  O O     . LEU C 1 211 ? -4.657  35.421  58.818  1.00 11.04  ? 211 LEU C O     1 
ATOM   7703  C CB    . LEU C 1 211 ? -5.997  38.464  58.702  1.00 12.42  ? 211 LEU C CB    1 
ATOM   7704  C CG    . LEU C 1 211 ? -7.035  37.890  59.619  1.00 12.21  ? 211 LEU C CG    1 
ATOM   7705  C CD1   . LEU C 1 211 ? -7.698  39.056  60.303  1.00 10.11  ? 211 LEU C CD1   1 
ATOM   7706  C CD2   . LEU C 1 211 ? -8.053  37.070  58.879  1.00 15.97  ? 211 LEU C CD2   1 
ATOM   7707  H H     . LEU C 1 211 ? -5.642  35.894  56.941  1.00 0.00   ? 211 LEU C H     1 
ATOM   7708  N N     . ASN C 1 212 ? -3.551  37.015  59.895  1.00 7.66   ? 212 ASN C N     1 
ATOM   7709  C CA    . ASN C 1 212 ? -2.906  36.109  60.822  1.00 7.54   ? 212 ASN C CA    1 
ATOM   7710  C C     . ASN C 1 212 ? -3.801  35.810  62.010  1.00 9.35   ? 212 ASN C C     1 
ATOM   7711  O O     . ASN C 1 212 ? -3.788  36.524  63.027  1.00 11.63  ? 212 ASN C O     1 
ATOM   7712  C CB    . ASN C 1 212 ? -1.630  36.744  61.295  1.00 10.78  ? 212 ASN C CB    1 
ATOM   7713  C CG    . ASN C 1 212 ? -0.692  35.768  61.971  1.00 8.11   ? 212 ASN C CG    1 
ATOM   7714  O OD1   . ASN C 1 212 ? -1.047  34.713  62.520  1.00 2.00   ? 212 ASN C OD1   1 
ATOM   7715  N ND2   . ASN C 1 212 ? 0.575   36.155  61.896  1.00 13.86  ? 212 ASN C ND2   1 
ATOM   7716  H H     . ASN C 1 212 ? -3.415  37.978  60.021  1.00 0.00   ? 212 ASN C H     1 
ATOM   7717  H HD21  . ASN C 1 212 ? 1.259   35.565  62.262  1.00 0.00   ? 212 ASN C HD21  1 
ATOM   7718  H HD22  . ASN C 1 212 ? 0.804   37.000  61.445  1.00 0.00   ? 212 ASN C HD22  1 
ATOM   7719  N N     . GLU C 1 213 ? -4.605  34.747  61.943  1.00 12.40  ? 213 GLU C N     1 
ATOM   7720  C CA    . GLU C 1 213 ? -5.588  34.495  63.001  1.00 13.36  ? 213 GLU C CA    1 
ATOM   7721  C C     . GLU C 1 213 ? -5.038  34.144  64.370  1.00 15.10  ? 213 GLU C C     1 
ATOM   7722  O O     . GLU C 1 213 ? -5.743  34.070  65.373  1.00 19.80  ? 213 GLU C O     1 
ATOM   7723  C CB    . GLU C 1 213 ? -6.523  33.416  62.563  1.00 5.69   ? 213 GLU C CB    1 
ATOM   7724  C CG    . GLU C 1 213 ? -7.506  33.971  61.571  1.00 7.48   ? 213 GLU C CG    1 
ATOM   7725  C CD    . GLU C 1 213 ? -8.704  33.073  61.428  1.00 14.01  ? 213 GLU C CD    1 
ATOM   7726  O OE1   . GLU C 1 213 ? -9.439  32.917  62.412  1.00 16.06  ? 213 GLU C OE1   1 
ATOM   7727  O OE2   . GLU C 1 213 ? -8.877  32.530  60.339  1.00 14.65  ? 213 GLU C OE2   1 
ATOM   7728  H H     . GLU C 1 213 ? -4.572  34.191  61.138  1.00 0.00   ? 213 GLU C H     1 
ATOM   7729  N N     . ALA C 1 214 ? -3.744  33.978  64.419  1.00 13.55  ? 214 ALA C N     1 
ATOM   7730  C CA    . ALA C 1 214 ? -3.041  33.805  65.661  1.00 18.18  ? 214 ALA C CA    1 
ATOM   7731  C C     . ALA C 1 214 ? -3.216  34.983  66.600  1.00 22.11  ? 214 ALA C C     1 
ATOM   7732  O O     . ALA C 1 214 ? -3.138  34.829  67.817  1.00 26.81  ? 214 ALA C O     1 
ATOM   7733  C CB    . ALA C 1 214 ? -1.618  33.712  65.383  1.00 24.10  ? 214 ALA C CB    1 
ATOM   7734  H H     . ALA C 1 214 ? -3.224  33.937  63.591  1.00 0.00   ? 214 ALA C H     1 
ATOM   7735  N N     . TYR C 1 215 ? -3.410  36.200  66.085  1.00 21.71  ? 215 TYR C N     1 
ATOM   7736  C CA    . TYR C 1 215 ? -3.605  37.345  66.959  1.00 21.53  ? 215 TYR C CA    1 
ATOM   7737  C C     . TYR C 1 215 ? -5.019  37.403  67.505  1.00 20.92  ? 215 TYR C C     1 
ATOM   7738  O O     . TYR C 1 215 ? -5.305  38.390  68.173  1.00 21.19  ? 215 TYR C O     1 
ATOM   7739  C CB    . TYR C 1 215 ? -3.406  38.674  66.260  1.00 22.36  ? 215 TYR C CB    1 
ATOM   7740  C CG    . TYR C 1 215 ? -2.042  38.921  65.686  1.00 25.07  ? 215 TYR C CG    1 
ATOM   7741  C CD1   . TYR C 1 215 ? -0.978  39.098  66.535  1.00 24.18  ? 215 TYR C CD1   1 
ATOM   7742  C CD2   . TYR C 1 215 ? -1.919  39.044  64.318  1.00 28.51  ? 215 TYR C CD2   1 
ATOM   7743  C CE1   . TYR C 1 215 ? 0.229   39.451  65.996  1.00 26.12  ? 215 TYR C CE1   1 
ATOM   7744  C CE2   . TYR C 1 215 ? -0.709  39.387  63.777  1.00 26.14  ? 215 TYR C CE2   1 
ATOM   7745  C CZ    . TYR C 1 215 ? 0.343   39.596  64.631  1.00 27.15  ? 215 TYR C CZ    1 
ATOM   7746  O OH    . TYR C 1 215 ? 1.568   39.956  64.119  1.00 32.47  ? 215 TYR C OH    1 
ATOM   7747  H H     . TYR C 1 215 ? -3.473  36.309  65.113  1.00 0.00   ? 215 TYR C H     1 
ATOM   7748  H HH    . TYR C 1 215 ? 1.479   40.224  63.192  1.00 0.00   ? 215 TYR C HH    1 
ATOM   7749  N N     . ALA C 1 216 ? -5.909  36.427  67.302  1.00 18.16  ? 216 ALA C N     1 
ATOM   7750  C CA    . ALA C 1 216 ? -7.308  36.545  67.663  1.00 17.52  ? 216 ALA C CA    1 
ATOM   7751  C C     . ALA C 1 216 ? -7.639  37.111  69.027  1.00 15.02  ? 216 ALA C C     1 
ATOM   7752  O O     . ALA C 1 216 ? -8.558  37.908  69.167  1.00 16.81  ? 216 ALA C O     1 
ATOM   7753  C CB    . ALA C 1 216 ? -7.960  35.191  67.539  1.00 16.38  ? 216 ALA C CB    1 
ATOM   7754  H H     . ALA C 1 216 ? -5.600  35.576  66.926  1.00 0.00   ? 216 ALA C H     1 
ATOM   7755  N N     . LYS C 1 217 ? -6.820  36.816  70.013  1.00 15.58  ? 217 LYS C N     1 
ATOM   7756  C CA    . LYS C 1 217 ? -6.991  37.289  71.371  1.00 19.48  ? 217 LYS C CA    1 
ATOM   7757  C C     . LYS C 1 217 ? -6.927  38.813  71.485  1.00 21.98  ? 217 LYS C C     1 
ATOM   7758  O O     . LYS C 1 217 ? -7.511  39.395  72.396  1.00 28.61  ? 217 LYS C O     1 
ATOM   7759  C CB    . LYS C 1 217 ? -5.905  36.626  72.178  1.00 21.66  ? 217 LYS C CB    1 
ATOM   7760  C CG    . LYS C 1 217 ? -5.776  36.816  73.667  1.00 26.80  ? 217 LYS C CG    1 
ATOM   7761  C CD    . LYS C 1 217 ? -4.401  36.246  73.960  1.00 35.16  ? 217 LYS C CD    1 
ATOM   7762  C CE    . LYS C 1 217 ? -4.062  36.269  75.446  1.00 42.80  ? 217 LYS C CE    1 
ATOM   7763  N NZ    . LYS C 1 217 ? -2.698  35.802  75.669  1.00 46.33  ? 217 LYS C NZ    1 
ATOM   7764  H H     . LYS C 1 217 ? -6.031  36.297  69.784  1.00 0.00   ? 217 LYS C H     1 
ATOM   7765  H HZ1   . LYS C 1 217 ? -2.592  34.838  75.292  1.00 0.00   ? 217 LYS C HZ1   1 
ATOM   7766  H HZ2   . LYS C 1 217 ? -2.031  36.435  75.183  1.00 0.00   ? 217 LYS C HZ2   1 
ATOM   7767  H HZ3   . LYS C 1 217 ? -2.490  35.803  76.688  1.00 0.00   ? 217 LYS C HZ3   1 
ATOM   7768  N N     . ASP C 1 218 ? -6.233  39.481  70.566  1.00 21.94  ? 218 ASP C N     1 
ATOM   7769  C CA    . ASP C 1 218 ? -5.990  40.910  70.577  1.00 18.09  ? 218 ASP C CA    1 
ATOM   7770  C C     . ASP C 1 218 ? -6.747  41.611  69.464  1.00 19.53  ? 218 ASP C C     1 
ATOM   7771  O O     . ASP C 1 218 ? -6.376  42.733  69.102  1.00 22.86  ? 218 ASP C O     1 
ATOM   7772  C CB    . ASP C 1 218 ? -4.497  41.207  70.374  1.00 22.08  ? 218 ASP C CB    1 
ATOM   7773  C CG    . ASP C 1 218 ? -3.503  40.779  71.446  1.00 26.10  ? 218 ASP C CG    1 
ATOM   7774  O OD1   . ASP C 1 218 ? -3.761  41.019  72.628  1.00 32.47  ? 218 ASP C OD1   1 
ATOM   7775  O OD2   . ASP C 1 218 ? -2.455  40.231  71.088  1.00 26.65  ? 218 ASP C OD2   1 
ATOM   7776  H H     . ASP C 1 218 ? -5.905  38.978  69.802  1.00 0.00   ? 218 ASP C H     1 
ATOM   7777  N N     . PHE C 1 219 ? -7.751  41.031  68.829  1.00 20.45  ? 219 PHE C N     1 
ATOM   7778  C CA    . PHE C 1 219 ? -8.427  41.741  67.762  1.00 21.82  ? 219 PHE C CA    1 
ATOM   7779  C C     . PHE C 1 219 ? -9.560  42.583  68.299  1.00 27.49  ? 219 PHE C C     1 
ATOM   7780  O O     . PHE C 1 219 ? -10.228 42.193  69.268  1.00 30.20  ? 219 PHE C O     1 
ATOM   7781  C CB    . PHE C 1 219 ? -9.025  40.798  66.761  1.00 20.17  ? 219 PHE C CB    1 
ATOM   7782  C CG    . PHE C 1 219 ? -8.060  40.180  65.791  1.00 14.10  ? 219 PHE C CG    1 
ATOM   7783  C CD1   . PHE C 1 219 ? -6.961  40.888  65.339  1.00 20.72  ? 219 PHE C CD1   1 
ATOM   7784  C CD2   . PHE C 1 219 ? -8.323  38.907  65.338  1.00 15.05  ? 219 PHE C CD2   1 
ATOM   7785  C CE1   . PHE C 1 219 ? -6.126  40.313  64.406  1.00 15.82  ? 219 PHE C CE1   1 
ATOM   7786  C CE2   . PHE C 1 219 ? -7.488  38.343  64.404  1.00 16.57  ? 219 PHE C CE2   1 
ATOM   7787  C CZ    . PHE C 1 219 ? -6.398  39.050  63.934  1.00 21.43  ? 219 PHE C CZ    1 
ATOM   7788  H H     . PHE C 1 219 ? -8.121  40.188  69.165  1.00 0.00   ? 219 PHE C H     1 
ATOM   7789  N N     . ASP C 1 220 ? -9.820  43.737  67.695  1.00 28.99  ? 220 ASP C N     1 
ATOM   7790  C CA    . ASP C 1 220 ? -10.964 44.502  68.130  1.00 32.25  ? 220 ASP C CA    1 
ATOM   7791  C C     . ASP C 1 220 ? -12.227 43.827  67.564  1.00 30.62  ? 220 ASP C C     1 
ATOM   7792  O O     . ASP C 1 220 ? -12.212 43.336  66.423  1.00 30.47  ? 220 ASP C O     1 
ATOM   7793  C CB    . ASP C 1 220 ? -10.855 45.968  67.650  1.00 36.37  ? 220 ASP C CB    1 
ATOM   7794  C CG    . ASP C 1 220 ? -11.043 46.216  66.163  1.00 42.17  ? 220 ASP C CG    1 
ATOM   7795  O OD1   . ASP C 1 220 ? -12.182 46.226  65.696  1.00 44.13  ? 220 ASP C OD1   1 
ATOM   7796  O OD2   . ASP C 1 220 ? -10.043 46.409  65.475  1.00 52.27  ? 220 ASP C OD2   1 
ATOM   7797  H H     . ASP C 1 220 ? -9.262  44.020  66.936  1.00 0.00   ? 220 ASP C H     1 
ATOM   7798  N N     . PRO C 1 221 ? -13.363 43.832  68.285  1.00 28.90  ? 221 PRO C N     1 
ATOM   7799  C CA    . PRO C 1 221 ? -14.620 43.205  67.896  1.00 24.28  ? 221 PRO C CA    1 
ATOM   7800  C C     . PRO C 1 221 ? -15.089 43.341  66.463  1.00 20.51  ? 221 PRO C C     1 
ATOM   7801  O O     . PRO C 1 221 ? -15.743 42.418  65.979  1.00 19.87  ? 221 PRO C O     1 
ATOM   7802  C CB    . PRO C 1 221 ? -15.631 43.758  68.872  1.00 26.22  ? 221 PRO C CB    1 
ATOM   7803  C CG    . PRO C 1 221 ? -14.925 44.899  69.556  1.00 30.21  ? 221 PRO C CG    1 
ATOM   7804  C CD    . PRO C 1 221 ? -13.503 44.391  69.623  1.00 28.37  ? 221 PRO C CD    1 
ATOM   7805  N N     . ALA C 1 222 ? -14.827 44.445  65.752  1.00 14.19  ? 222 ALA C N     1 
ATOM   7806  C CA    . ALA C 1 222 ? -15.207 44.534  64.348  1.00 11.78  ? 222 ALA C CA    1 
ATOM   7807  C C     . ALA C 1 222 ? -14.511 43.446  63.538  1.00 15.09  ? 222 ALA C C     1 
ATOM   7808  O O     . ALA C 1 222 ? -15.175 42.729  62.787  1.00 16.96  ? 222 ALA C O     1 
ATOM   7809  C CB    . ALA C 1 222 ? -14.803 45.849  63.709  1.00 3.05   ? 222 ALA C CB    1 
ATOM   7810  H H     . ALA C 1 222 ? -14.296 45.159  66.154  1.00 0.00   ? 222 ALA C H     1 
ATOM   7811  N N     . VAL C 1 223 ? -13.212 43.204  63.725  1.00 16.31  ? 223 VAL C N     1 
ATOM   7812  C CA    . VAL C 1 223 ? -12.579 42.237  62.846  1.00 20.46  ? 223 VAL C CA    1 
ATOM   7813  C C     . VAL C 1 223 ? -12.963 40.854  63.338  1.00 23.15  ? 223 VAL C C     1 
ATOM   7814  O O     . VAL C 1 223 ? -13.229 39.973  62.510  1.00 25.60  ? 223 VAL C O     1 
ATOM   7815  C CB    . VAL C 1 223 ? -10.972 42.459  62.732  1.00 15.02  ? 223 VAL C CB    1 
ATOM   7816  C CG1   . VAL C 1 223 ? -10.471 43.543  63.640  1.00 15.64  ? 223 VAL C CG1   1 
ATOM   7817  C CG2   . VAL C 1 223 ? -10.219 41.201  63.059  1.00 15.81  ? 223 VAL C CG2   1 
ATOM   7818  H H     . VAL C 1 223 ? -12.751 43.569  64.506  1.00 0.00   ? 223 VAL C H     1 
ATOM   7819  N N     . THR C 1 224 ? -13.122 40.674  64.644  1.00 24.06  ? 224 THR C N     1 
ATOM   7820  C CA    . THR C 1 224 ? -13.522 39.388  65.185  1.00 25.62  ? 224 THR C CA    1 
ATOM   7821  C C     . THR C 1 224 ? -14.914 39.003  64.677  1.00 24.52  ? 224 THR C C     1 
ATOM   7822  O O     . THR C 1 224 ? -15.154 37.847  64.317  1.00 30.13  ? 224 THR C O     1 
ATOM   7823  C CB    . THR C 1 224 ? -13.475 39.479  66.710  1.00 27.87  ? 224 THR C CB    1 
ATOM   7824  O OG1   . THR C 1 224 ? -12.612 40.560  67.082  1.00 38.09  ? 224 THR C OG1   1 
ATOM   7825  C CG2   . THR C 1 224 ? -12.910 38.216  67.305  1.00 29.76  ? 224 THR C CG2   1 
ATOM   7826  H H     . THR C 1 224 ? -12.916 41.393  65.281  1.00 0.00   ? 224 THR C H     1 
ATOM   7827  H HG1   . THR C 1 224 ? -11.955 40.270  67.730  1.00 0.00   ? 224 THR C HG1   1 
ATOM   7828  N N     . GLU C 1 225 ? -15.837 39.949  64.534  1.00 26.40  ? 225 GLU C N     1 
ATOM   7829  C CA    . GLU C 1 225 ? -17.155 39.683  63.967  1.00 23.49  ? 225 GLU C CA    1 
ATOM   7830  C C     . GLU C 1 225 ? -17.019 39.431  62.477  1.00 20.45  ? 225 GLU C C     1 
ATOM   7831  O O     . GLU C 1 225 ? -17.629 38.496  61.955  1.00 22.59  ? 225 GLU C O     1 
ATOM   7832  C CB    . GLU C 1 225 ? -18.108 40.873  64.160  1.00 30.72  ? 225 GLU C CB    1 
ATOM   7833  C CG    . GLU C 1 225 ? -19.585 40.552  63.888  1.00 35.62  ? 225 GLU C CG    1 
ATOM   7834  C CD    . GLU C 1 225 ? -20.525 41.752  63.837  1.00 40.45  ? 225 GLU C CD    1 
ATOM   7835  O OE1   . GLU C 1 225 ? -20.653 42.473  64.826  1.00 43.58  ? 225 GLU C OE1   1 
ATOM   7836  O OE2   . GLU C 1 225 ? -21.152 41.953  62.795  1.00 47.02  ? 225 GLU C OE2   1 
ATOM   7837  H H     . GLU C 1 225 ? -15.624 40.860  64.824  1.00 0.00   ? 225 GLU C H     1 
ATOM   7838  N N     . TYR C 1 226 ? -16.191 40.207  61.779  1.00 20.17  ? 226 TYR C N     1 
ATOM   7839  C CA    . TYR C 1 226 ? -16.056 40.076  60.348  1.00 18.11  ? 226 TYR C CA    1 
ATOM   7840  C C     . TYR C 1 226 ? -15.546 38.711  59.974  1.00 17.19  ? 226 TYR C C     1 
ATOM   7841  O O     . TYR C 1 226 ? -16.037 38.135  59.005  1.00 19.46  ? 226 TYR C O     1 
ATOM   7842  C CB    . TYR C 1 226 ? -15.105 41.124  59.769  1.00 16.17  ? 226 TYR C CB    1 
ATOM   7843  C CG    . TYR C 1 226 ? -15.041 41.029  58.240  1.00 13.98  ? 226 TYR C CG    1 
ATOM   7844  C CD1   . TYR C 1 226 ? -16.166 41.296  57.511  1.00 9.28   ? 226 TYR C CD1   1 
ATOM   7845  C CD2   . TYR C 1 226 ? -13.888 40.602  57.602  1.00 9.95   ? 226 TYR C CD2   1 
ATOM   7846  C CE1   . TYR C 1 226 ? -16.145 41.083  56.158  1.00 10.89  ? 226 TYR C CE1   1 
ATOM   7847  C CE2   . TYR C 1 226 ? -13.869 40.398  56.243  1.00 9.52   ? 226 TYR C CE2   1 
ATOM   7848  C CZ    . TYR C 1 226 ? -15.024 40.613  55.539  1.00 9.35   ? 226 TYR C CZ    1 
ATOM   7849  O OH    . TYR C 1 226 ? -15.104 40.283  54.197  1.00 14.87  ? 226 TYR C OH    1 
ATOM   7850  H H     . TYR C 1 226 ? -15.671 40.892  62.247  1.00 0.00   ? 226 TYR C H     1 
ATOM   7851  H HH    . TYR C 1 226 ? -16.043 40.303  53.952  1.00 0.00   ? 226 TYR C HH    1 
ATOM   7852  N N     . ILE C 1 227 ? -14.615 38.143  60.727  1.00 19.24  ? 227 ILE C N     1 
ATOM   7853  C CA    . ILE C 1 227 ? -14.081 36.835  60.378  1.00 23.24  ? 227 ILE C CA    1 
ATOM   7854  C C     . ILE C 1 227 ? -15.100 35.724  60.596  1.00 26.83  ? 227 ILE C C     1 
ATOM   7855  O O     . ILE C 1 227 ? -15.260 34.807  59.773  1.00 27.06  ? 227 ILE C O     1 
ATOM   7856  C CB    . ILE C 1 227 ? -12.821 36.585  61.213  1.00 24.75  ? 227 ILE C CB    1 
ATOM   7857  C CG1   . ILE C 1 227 ? -11.742 37.579  60.823  1.00 24.21  ? 227 ILE C CG1   1 
ATOM   7858  C CG2   . ILE C 1 227 ? -12.325 35.163  60.984  1.00 23.75  ? 227 ILE C CG2   1 
ATOM   7859  C CD1   . ILE C 1 227 ? -10.722 37.682  61.971  1.00 32.33  ? 227 ILE C CD1   1 
ATOM   7860  H H     . ILE C 1 227 ? -14.276 38.632  61.506  1.00 0.00   ? 227 ILE C H     1 
ATOM   7861  N N     . GLN C 1 228 ? -15.828 35.800  61.706  1.00 28.21  ? 228 GLN C N     1 
ATOM   7862  C CA    . GLN C 1 228 ? -16.819 34.792  62.020  1.00 28.92  ? 228 GLN C CA    1 
ATOM   7863  C C     . GLN C 1 228 ? -17.894 34.779  60.957  1.00 26.01  ? 228 GLN C C     1 
ATOM   7864  O O     . GLN C 1 228 ? -18.424 33.742  60.579  1.00 26.42  ? 228 GLN C O     1 
ATOM   7865  C CB    . GLN C 1 228 ? -17.399 35.113  63.348  1.00 39.14  ? 228 GLN C CB    1 
ATOM   7866  C CG    . GLN C 1 228 ? -18.341 34.051  63.863  1.00 51.87  ? 228 GLN C CG    1 
ATOM   7867  C CD    . GLN C 1 228 ? -18.594 34.317  65.331  1.00 61.91  ? 228 GLN C CD    1 
ATOM   7868  O OE1   . GLN C 1 228 ? -19.615 34.888  65.722  1.00 67.46  ? 228 GLN C OE1   1 
ATOM   7869  N NE2   . GLN C 1 228 ? -17.648 33.927  66.186  1.00 62.37  ? 228 GLN C NE2   1 
ATOM   7870  H H     . GLN C 1 228 ? -15.686 36.555  62.318  1.00 0.00   ? 228 GLN C H     1 
ATOM   7871  H HE21  . GLN C 1 228 ? -17.807 34.143  67.127  1.00 0.00   ? 228 GLN C HE21  1 
ATOM   7872  H HE22  . GLN C 1 228 ? -16.852 33.472  65.846  1.00 0.00   ? 228 GLN C HE22  1 
ATOM   7873  N N     . ARG C 1 229 ? -18.144 35.953  60.422  1.00 26.72  ? 229 ARG C N     1 
ATOM   7874  C CA    . ARG C 1 229 ? -19.072 36.156  59.336  1.00 28.06  ? 229 ARG C CA    1 
ATOM   7875  C C     . ARG C 1 229 ? -18.604 35.491  58.033  1.00 26.43  ? 229 ARG C C     1 
ATOM   7876  O O     . ARG C 1 229 ? -19.393 35.253  57.109  1.00 28.15  ? 229 ARG C O     1 
ATOM   7877  C CB    . ARG C 1 229 ? -19.199 37.651  59.225  1.00 34.30  ? 229 ARG C CB    1 
ATOM   7878  C CG    . ARG C 1 229 ? -20.246 38.155  58.304  1.00 43.62  ? 229 ARG C CG    1 
ATOM   7879  C CD    . ARG C 1 229 ? -20.183 39.665  58.241  1.00 51.22  ? 229 ARG C CD    1 
ATOM   7880  N NE    . ARG C 1 229 ? -21.252 40.068  57.352  1.00 55.08  ? 229 ARG C NE    1 
ATOM   7881  C CZ    . ARG C 1 229 ? -22.458 40.367  57.821  1.00 56.92  ? 229 ARG C CZ    1 
ATOM   7882  N NH1   . ARG C 1 229 ? -22.706 40.482  59.133  1.00 58.95  ? 229 ARG C NH1   1 
ATOM   7883  N NH2   . ARG C 1 229 ? -23.415 40.604  56.935  1.00 60.57  ? 229 ARG C NH2   1 
ATOM   7884  H H     . ARG C 1 229 ? -17.720 36.746  60.814  1.00 0.00   ? 229 ARG C H     1 
ATOM   7885  H HE    . ARG C 1 229 ? -21.082 40.117  56.387  1.00 0.00   ? 229 ARG C HE    1 
ATOM   7886  H HH11  . ARG C 1 229 ? -21.975 40.346  59.801  1.00 0.00   ? 229 ARG C HH11  1 
ATOM   7887  H HH12  . ARG C 1 229 ? -23.629 40.705  59.446  1.00 0.00   ? 229 ARG C HH12  1 
ATOM   7888  H HH21  . ARG C 1 229 ? -23.211 40.545  55.958  1.00 0.00   ? 229 ARG C HH21  1 
ATOM   7889  H HH22  . ARG C 1 229 ? -24.340 40.824  57.242  1.00 0.00   ? 229 ARG C HH22  1 
ATOM   7890  N N     . LYS C 1 230 ? -17.314 35.188  57.896  1.00 24.16  ? 230 LYS C N     1 
ATOM   7891  C CA    . LYS C 1 230 ? -16.822 34.537  56.698  1.00 21.15  ? 230 LYS C CA    1 
ATOM   7892  C C     . LYS C 1 230 ? -16.721 33.044  56.882  1.00 18.61  ? 230 LYS C C     1 
ATOM   7893  O O     . LYS C 1 230 ? -16.660 32.309  55.894  1.00 21.93  ? 230 LYS C O     1 
ATOM   7894  C CB    . LYS C 1 230 ? -15.430 35.054  56.289  1.00 22.45  ? 230 LYS C CB    1 
ATOM   7895  C CG    . LYS C 1 230 ? -15.199 36.571  56.269  1.00 22.80  ? 230 LYS C CG    1 
ATOM   7896  C CD    . LYS C 1 230 ? -16.374 37.367  55.730  1.00 21.44  ? 230 LYS C CD    1 
ATOM   7897  C CE    . LYS C 1 230 ? -16.574 37.018  54.282  1.00 22.21  ? 230 LYS C CE    1 
ATOM   7898  N NZ    . LYS C 1 230 ? -17.851 37.521  53.843  1.00 29.61  ? 230 LYS C NZ    1 
ATOM   7899  H H     . LYS C 1 230 ? -16.681 35.481  58.579  1.00 0.00   ? 230 LYS C H     1 
ATOM   7900  H HZ1   . LYS C 1 230 ? -18.614 37.098  54.408  1.00 0.00   ? 230 LYS C HZ1   1 
ATOM   7901  H HZ2   . LYS C 1 230 ? -17.872 38.556  53.948  1.00 0.00   ? 230 LYS C HZ2   1 
ATOM   7902  H HZ3   . LYS C 1 230 ? -17.983 37.277  52.841  1.00 0.00   ? 230 LYS C HZ3   1 
ATOM   7903  N N     . LYS C 1 231 ? -16.656 32.565  58.118  1.00 13.70  ? 231 LYS C N     1 
ATOM   7904  C CA    . LYS C 1 231 ? -16.569 31.131  58.359  1.00 14.61  ? 231 LYS C CA    1 
ATOM   7905  C C     . LYS C 1 231 ? -17.934 30.522  58.579  1.00 17.81  ? 231 LYS C C     1 
ATOM   7906  O O     . LYS C 1 231 ? -18.126 29.330  58.379  1.00 22.73  ? 231 LYS C O     1 
ATOM   7907  C CB    . LYS C 1 231 ? -15.776 30.822  59.582  1.00 10.28  ? 231 LYS C CB    1 
ATOM   7908  C CG    . LYS C 1 231 ? -14.352 31.262  59.498  1.00 8.56   ? 231 LYS C CG    1 
ATOM   7909  C CD    . LYS C 1 231 ? -13.890 31.163  60.925  1.00 12.48  ? 231 LYS C CD    1 
ATOM   7910  C CE    . LYS C 1 231 ? -12.406 31.337  60.958  1.00 6.72   ? 231 LYS C CE    1 
ATOM   7911  N NZ    . LYS C 1 231 ? -12.068 31.692  62.318  1.00 19.11  ? 231 LYS C NZ    1 
ATOM   7912  H H     . LYS C 1 231 ? -16.651 33.196  58.868  1.00 0.00   ? 231 LYS C H     1 
ATOM   7913  H HZ1   . LYS C 1 231 ? -12.452 30.978  62.967  1.00 0.00   ? 231 LYS C HZ1   1 
ATOM   7914  H HZ2   . LYS C 1 231 ? -11.035 31.727  62.419  1.00 0.00   ? 231 LYS C HZ2   1 
ATOM   7915  H HZ3   . LYS C 1 231 ? -12.476 32.623  62.539  1.00 0.00   ? 231 LYS C HZ3   1 
ATOM   7916  N N     . PHE C 1 232 ? -18.874 31.311  59.077  1.00 19.17  ? 232 PHE C N     1 
ATOM   7917  C CA    . PHE C 1 232 ? -20.226 30.878  59.358  1.00 19.19  ? 232 PHE C CA    1 
ATOM   7918  C C     . PHE C 1 232 ? -21.096 31.970  58.766  1.00 21.91  ? 232 PHE C C     1 
ATOM   7919  O O     . PHE C 1 232 ? -21.473 32.910  59.471  1.00 18.28  ? 232 PHE C O     1 
ATOM   7920  C CB    . PHE C 1 232 ? -20.474 30.798  60.859  1.00 13.85  ? 232 PHE C CB    1 
ATOM   7921  C CG    . PHE C 1 232 ? -19.536 29.859  61.591  1.00 18.23  ? 232 PHE C CG    1 
ATOM   7922  C CD1   . PHE C 1 232 ? -19.816 28.507  61.654  1.00 16.61  ? 232 PHE C CD1   1 
ATOM   7923  C CD2   . PHE C 1 232 ? -18.418 30.378  62.216  1.00 20.69  ? 232 PHE C CD2   1 
ATOM   7924  C CE1   . PHE C 1 232 ? -18.984 27.681  62.383  1.00 16.02  ? 232 PHE C CE1   1 
ATOM   7925  C CE2   . PHE C 1 232 ? -17.587 29.543  62.926  1.00 16.16  ? 232 PHE C CE2   1 
ATOM   7926  C CZ    . PHE C 1 232 ? -17.881 28.197  63.016  1.00 18.26  ? 232 PHE C CZ    1 
ATOM   7927  H H     . PHE C 1 232 ? -18.668 32.245  59.292  1.00 0.00   ? 232 PHE C H     1 
ATOM   7928  N N     . PRO C 1 233 ? -21.390 31.951  57.461  1.00 28.02  ? 233 PRO C N     1 
ATOM   7929  C CA    . PRO C 1 233 ? -22.067 33.040  56.792  1.00 34.02  ? 233 PRO C CA    1 
ATOM   7930  C C     . PRO C 1 233 ? -23.457 33.280  57.392  1.00 39.31  ? 233 PRO C C     1 
ATOM   7931  O O     . PRO C 1 233 ? -24.250 32.331  57.482  1.00 39.71  ? 233 PRO C O     1 
ATOM   7932  C CB    . PRO C 1 233 ? -22.055 32.596  55.345  1.00 32.48  ? 233 PRO C CB    1 
ATOM   7933  C CG    . PRO C 1 233 ? -20.819 31.763  55.267  1.00 28.74  ? 233 PRO C CG    1 
ATOM   7934  C CD    . PRO C 1 233 ? -21.029 30.915  56.504  1.00 29.22  ? 233 PRO C CD    1 
ATOM   7935  N N     . PRO C 1 234 ? -23.797 34.499  57.845  1.00 42.66  ? 234 PRO C N     1 
ATOM   7936  C CA    . PRO C 1 234 ? -25.111 34.878  58.339  1.00 44.25  ? 234 PRO C CA    1 
ATOM   7937  C C     . PRO C 1 234 ? -26.011 34.979  57.127  1.00 45.67  ? 234 PRO C C     1 
ATOM   7938  O O     . PRO C 1 234 ? -26.167 36.044  56.537  1.00 49.06  ? 234 PRO C O     1 
ATOM   7939  C CB    . PRO C 1 234 ? -24.881 36.193  59.037  1.00 43.15  ? 234 PRO C CB    1 
ATOM   7940  C CG    . PRO C 1 234 ? -23.410 36.193  59.334  1.00 44.51  ? 234 PRO C CG    1 
ATOM   7941  C CD    . PRO C 1 234 ? -22.879 35.606  58.043  1.00 44.93  ? 234 PRO C CD    1 
ATOM   7942  N N     . ASP C 1 235 ? -26.486 33.810  56.733  1.00 47.52  ? 235 ASP C N     1 
ATOM   7943  C CA    . ASP C 1 235 ? -27.367 33.478  55.623  1.00 52.20  ? 235 ASP C CA    1 
ATOM   7944  C C     . ASP C 1 235 ? -26.841 32.081  55.332  1.00 55.26  ? 235 ASP C C     1 
ATOM   7945  O O     . ASP C 1 235 ? -26.695 31.325  56.307  1.00 56.85  ? 235 ASP C O     1 
ATOM   7946  C CB    . ASP C 1 235 ? -27.228 34.399  54.351  1.00 54.13  ? 235 ASP C CB    1 
ATOM   7947  C CG    . ASP C 1 235 ? -25.914 34.567  53.585  1.00 55.28  ? 235 ASP C CG    1 
ATOM   7948  O OD1   . ASP C 1 235 ? -24.842 34.314  54.124  1.00 60.69  ? 235 ASP C OD1   1 
ATOM   7949  O OD2   . ASP C 1 235 ? -25.963 34.974  52.427  1.00 56.40  ? 235 ASP C OD2   1 
ATOM   7950  H H     . ASP C 1 235 ? -26.177 33.036  57.260  1.00 0.00   ? 235 ASP C H     1 
ATOM   7951  N N     . ASN C 1 236 ? -26.548 31.629  54.111  1.00 58.03  ? 236 ASN C N     1 
ATOM   7952  C CA    . ASN C 1 236 ? -25.959 30.312  53.960  1.00 62.31  ? 236 ASN C CA    1 
ATOM   7953  C C     . ASN C 1 236 ? -25.234 30.185  52.651  1.00 60.31  ? 236 ASN C C     1 
ATOM   7954  O O     . ASN C 1 236 ? -25.605 29.509  51.696  1.00 62.11  ? 236 ASN C O     1 
ATOM   7955  C CB    . ASN C 1 236 ? -27.009 29.216  54.048  1.00 70.53  ? 236 ASN C CB    1 
ATOM   7956  C CG    . ASN C 1 236 ? -26.486 28.169  55.016  1.00 76.90  ? 236 ASN C CG    1 
ATOM   7957  O OD1   . ASN C 1 236 ? -25.843 27.192  54.645  1.00 83.76  ? 236 ASN C OD1   1 
ATOM   7958  N ND2   . ASN C 1 236 ? -26.706 28.341  56.312  1.00 78.66  ? 236 ASN C ND2   1 
ATOM   7959  H H     . ASN C 1 236 ? -26.710 32.164  53.304  1.00 0.00   ? 236 ASN C H     1 
ATOM   7960  H HD21  . ASN C 1 236 ? -26.401 27.632  56.911  1.00 0.00   ? 236 ASN C HD21  1 
ATOM   7961  H HD22  . ASN C 1 236 ? -27.164 29.159  56.602  1.00 0.00   ? 236 ASN C HD22  1 
ATOM   7962  N N     . SER C 1 237 ? -24.236 31.048  52.638  1.00 58.69  ? 237 SER C N     1 
ATOM   7963  C CA    . SER C 1 237 ? -23.262 31.086  51.576  1.00 53.78  ? 237 SER C CA    1 
ATOM   7964  C C     . SER C 1 237 ? -22.218 30.073  52.009  1.00 51.26  ? 237 SER C C     1 
ATOM   7965  O O     . SER C 1 237 ? -22.200 29.627  53.170  1.00 52.66  ? 237 SER C O     1 
ATOM   7966  C CB    . SER C 1 237 ? -22.690 32.479  51.518  1.00 52.94  ? 237 SER C CB    1 
ATOM   7967  O OG    . SER C 1 237 ? -23.786 33.380  51.419  1.00 55.77  ? 237 SER C OG    1 
ATOM   7968  H H     . SER C 1 237 ? -24.088 31.648  53.391  1.00 0.00   ? 237 SER C H     1 
ATOM   7969  H HG    . SER C 1 237 ? -23.872 33.525  50.467  1.00 0.00   ? 237 SER C HG    1 
ATOM   7970  N N     . ALA C 1 238 ? -21.372 29.641  51.092  1.00 46.26  ? 238 ALA C N     1 
ATOM   7971  C CA    . ALA C 1 238 ? -20.282 28.772  51.469  1.00 41.53  ? 238 ALA C CA    1 
ATOM   7972  C C     . ALA C 1 238 ? -19.332 29.636  52.292  1.00 36.94  ? 238 ALA C C     1 
ATOM   7973  O O     . ALA C 1 238 ? -19.274 30.828  51.996  1.00 40.25  ? 238 ALA C O     1 
ATOM   7974  C CB    . ALA C 1 238 ? -19.590 28.274  50.216  1.00 42.64  ? 238 ALA C CB    1 
ATOM   7975  H H     . ALA C 1 238 ? -21.471 29.943  50.164  1.00 0.00   ? 238 ALA C H     1 
ATOM   7976  N N     . PRO C 1 239 ? -18.618 29.158  53.326  1.00 33.37  ? 239 PRO C N     1 
ATOM   7977  C CA    . PRO C 1 239 ? -17.494 29.857  53.951  1.00 31.80  ? 239 PRO C CA    1 
ATOM   7978  C C     . PRO C 1 239 ? -16.400 30.326  52.988  1.00 28.40  ? 239 PRO C C     1 
ATOM   7979  O O     . PRO C 1 239 ? -16.198 29.769  51.897  1.00 28.67  ? 239 PRO C O     1 
ATOM   7980  C CB    . PRO C 1 239 ? -16.981 28.873  54.981  1.00 29.00  ? 239 PRO C CB    1 
ATOM   7981  C CG    . PRO C 1 239 ? -18.234 28.146  55.380  1.00 29.03  ? 239 PRO C CG    1 
ATOM   7982  C CD    . PRO C 1 239 ? -18.889 27.912  54.035  1.00 32.85  ? 239 PRO C CD    1 
ATOM   7983  N N     . TYR C 1 240 ? -15.681 31.376  53.355  1.00 28.35  ? 240 TYR C N     1 
ATOM   7984  C CA    . TYR C 1 240 ? -14.563 31.842  52.544  1.00 27.23  ? 240 TYR C CA    1 
ATOM   7985  C C     . TYR C 1 240 ? -13.357 30.965  52.842  1.00 23.92  ? 240 TYR C C     1 
ATOM   7986  O O     . TYR C 1 240 ? -13.190 30.596  54.005  1.00 24.02  ? 240 TYR C O     1 
ATOM   7987  C CB    . TYR C 1 240 ? -14.191 33.278  52.875  1.00 22.10  ? 240 TYR C CB    1 
ATOM   7988  C CG    . TYR C 1 240 ? -14.925 34.350  52.092  1.00 21.03  ? 240 TYR C CG    1 
ATOM   7989  C CD1   . TYR C 1 240 ? -16.236 34.194  51.679  1.00 19.80  ? 240 TYR C CD1   1 
ATOM   7990  C CD2   . TYR C 1 240 ? -14.250 35.521  51.837  1.00 21.62  ? 240 TYR C CD2   1 
ATOM   7991  C CE1   . TYR C 1 240 ? -16.891 35.230  51.038  1.00 16.75  ? 240 TYR C CE1   1 
ATOM   7992  C CE2   . TYR C 1 240 ? -14.899 36.566  51.218  1.00 21.52  ? 240 TYR C CE2   1 
ATOM   7993  C CZ    . TYR C 1 240 ? -16.220 36.425  50.849  1.00 23.19  ? 240 TYR C CZ    1 
ATOM   7994  O OH    . TYR C 1 240 ? -16.878 37.513  50.308  1.00 14.09  ? 240 TYR C OH    1 
ATOM   7995  H H     . TYR C 1 240 ? -15.874 31.798  54.216  1.00 0.00   ? 240 TYR C H     1 
ATOM   7996  H HH    . TYR C 1 240 ? -17.419 37.194  49.573  1.00 0.00   ? 240 TYR C HH    1 
ATOM   7997  N N     . GLY C 1 241 ? -12.509 30.615  51.872  1.00 16.47  ? 241 GLY C N     1 
ATOM   7998  C CA    . GLY C 1 241 ? -11.322 29.849  52.169  1.00 11.85  ? 241 GLY C CA    1 
ATOM   7999  C C     . GLY C 1 241 ? -10.301 30.759  52.841  1.00 14.64  ? 241 GLY C C     1 
ATOM   8000  O O     . GLY C 1 241 ? -10.397 31.987  52.697  1.00 19.63  ? 241 GLY C O     1 
ATOM   8001  H H     . GLY C 1 241 ? -12.609 31.034  50.992  1.00 0.00   ? 241 GLY C H     1 
ATOM   8002  N N     . ALA C 1 242 ? -9.329  30.208  53.581  1.00 16.00  ? 242 ALA C N     1 
ATOM   8003  C CA    . ALA C 1 242 ? -8.318  31.009  54.246  1.00 18.35  ? 242 ALA C CA    1 
ATOM   8004  C C     . ALA C 1 242 ? -6.902  30.782  53.687  1.00 19.12  ? 242 ALA C C     1 
ATOM   8005  O O     . ALA C 1 242 ? -6.469  29.635  53.631  1.00 20.56  ? 242 ALA C O     1 
ATOM   8006  C CB    . ALA C 1 242 ? -8.338  30.679  55.740  1.00 13.74  ? 242 ALA C CB    1 
ATOM   8007  H H     . ALA C 1 242 ? -9.236  29.233  53.631  1.00 0.00   ? 242 ALA C H     1 
ATOM   8008  N N     . ARG C 1 243 ? -6.140  31.801  53.247  1.00 16.98  ? 243 ARG C N     1 
ATOM   8009  C CA    . ARG C 1 243 ? -4.761  31.660  52.779  1.00 13.91  ? 243 ARG C CA    1 
ATOM   8010  C C     . ARG C 1 243 ? -3.953  32.747  53.468  1.00 12.86  ? 243 ARG C C     1 
ATOM   8011  O O     . ARG C 1 243 ? -4.412  33.886  53.534  1.00 16.49  ? 243 ARG C O     1 
ATOM   8012  C CB    . ARG C 1 243 ? -4.596  31.893  51.280  1.00 9.42   ? 243 ARG C CB    1 
ATOM   8013  C CG    . ARG C 1 243 ? -5.214  30.841  50.394  1.00 12.33  ? 243 ARG C CG    1 
ATOM   8014  C CD    . ARG C 1 243 ? -4.616  29.487  50.722  1.00 14.78  ? 243 ARG C CD    1 
ATOM   8015  N NE    . ARG C 1 243 ? -5.114  28.459  49.832  1.00 16.01  ? 243 ARG C NE    1 
ATOM   8016  C CZ    . ARG C 1 243 ? -6.330  27.927  49.988  1.00 18.53  ? 243 ARG C CZ    1 
ATOM   8017  N NH1   . ARG C 1 243 ? -7.122  28.286  50.993  1.00 18.06  ? 243 ARG C NH1   1 
ATOM   8018  N NH2   . ARG C 1 243 ? -6.769  27.000  49.125  1.00 23.89  ? 243 ARG C NH2   1 
ATOM   8019  H H     . ARG C 1 243 ? -6.484  32.716  53.320  1.00 0.00   ? 243 ARG C H     1 
ATOM   8020  H HE    . ARG C 1 243 ? -4.545  28.146  49.099  1.00 0.00   ? 243 ARG C HE    1 
ATOM   8021  H HH11  . ARG C 1 243 ? -6.823  28.967  51.661  1.00 0.00   ? 243 ARG C HH11  1 
ATOM   8022  H HH12  . ARG C 1 243 ? -8.024  27.863  51.085  1.00 0.00   ? 243 ARG C HH12  1 
ATOM   8023  H HH21  . ARG C 1 243 ? -6.184  26.709  48.368  1.00 0.00   ? 243 ARG C HH21  1 
ATOM   8024  H HH22  . ARG C 1 243 ? -7.676  26.597  49.242  1.00 0.00   ? 243 ARG C HH22  1 
ATOM   8025  N N     . TYR C 1 244 ? -2.793  32.481  54.047  1.00 9.10   ? 244 TYR C N     1 
ATOM   8026  C CA    . TYR C 1 244 ? -1.937  33.509  54.602  1.00 8.55   ? 244 TYR C CA    1 
ATOM   8027  C C     . TYR C 1 244 ? -0.510  33.004  54.441  1.00 9.60   ? 244 TYR C C     1 
ATOM   8028  O O     . TYR C 1 244 ? 0.005   32.228  55.242  1.00 11.41  ? 244 TYR C O     1 
ATOM   8029  C CB    . TYR C 1 244 ? -2.219  33.747  56.077  1.00 2.26   ? 244 TYR C CB    1 
ATOM   8030  C CG    . TYR C 1 244 ? -1.550  35.009  56.579  1.00 2.00   ? 244 TYR C CG    1 
ATOM   8031  C CD1   . TYR C 1 244 ? -2.055  36.231  56.204  1.00 3.91   ? 244 TYR C CD1   1 
ATOM   8032  C CD2   . TYR C 1 244 ? -0.448  34.937  57.400  1.00 3.89   ? 244 TYR C CD2   1 
ATOM   8033  C CE1   . TYR C 1 244 ? -1.462  37.388  56.656  1.00 5.61   ? 244 TYR C CE1   1 
ATOM   8034  C CE2   . TYR C 1 244 ? 0.156   36.096  57.854  1.00 7.67   ? 244 TYR C CE2   1 
ATOM   8035  C CZ    . TYR C 1 244 ? -0.370  37.320  57.486  1.00 6.98   ? 244 TYR C CZ    1 
ATOM   8036  O OH    . TYR C 1 244 ? 0.198   38.501  57.951  1.00 14.08  ? 244 TYR C OH    1 
ATOM   8037  H H     . TYR C 1 244 ? -2.505  31.552  54.082  1.00 0.00   ? 244 TYR C H     1 
ATOM   8038  H HH    . TYR C 1 244 ? -0.353  39.234  57.661  1.00 0.00   ? 244 TYR C HH    1 
ATOM   8039  N N     . VAL C 1 245 ? 0.131   33.423  53.355  1.00 9.29   ? 245 VAL C N     1 
ATOM   8040  C CA    . VAL C 1 245 ? 1.520   33.096  53.071  1.00 7.22   ? 245 VAL C CA    1 
ATOM   8041  C C     . VAL C 1 245 ? 2.411   33.778  54.094  1.00 11.04  ? 245 VAL C C     1 
ATOM   8042  O O     . VAL C 1 245 ? 3.460   33.258  54.482  1.00 17.21  ? 245 VAL C O     1 
ATOM   8043  C CB    . VAL C 1 245 ? 1.872   33.575  51.673  1.00 2.94   ? 245 VAL C CB    1 
ATOM   8044  C CG1   . VAL C 1 245 ? 3.326   33.292  51.384  1.00 2.00   ? 245 VAL C CG1   1 
ATOM   8045  C CG2   . VAL C 1 245 ? 0.967   32.891  50.673  1.00 2.00   ? 245 VAL C CG2   1 
ATOM   8046  H H     . VAL C 1 245 ? -0.402  33.908  52.696  1.00 0.00   ? 245 VAL C H     1 
ATOM   8047  N N     . GLY C 1 246 ? 2.043   34.987  54.496  1.00 10.03  ? 246 GLY C N     1 
ATOM   8048  C CA    . GLY C 1 246 ? 2.798   35.671  55.521  1.00 7.08   ? 246 GLY C CA    1 
ATOM   8049  C C     . GLY C 1 246 ? 3.796   36.703  55.027  1.00 7.59   ? 246 GLY C C     1 
ATOM   8050  O O     . GLY C 1 246 ? 4.608   37.185  55.815  1.00 6.21   ? 246 GLY C O     1 
ATOM   8051  H H     . GLY C 1 246 ? 1.286   35.432  54.075  1.00 0.00   ? 246 GLY C H     1 
ATOM   8052  N N     . SER C 1 247 ? 3.788   37.067  53.752  1.00 6.91   ? 247 SER C N     1 
ATOM   8053  C CA    . SER C 1 247 ? 4.661   38.117  53.307  1.00 7.71   ? 247 SER C CA    1 
ATOM   8054  C C     . SER C 1 247 ? 3.699   38.905  52.462  1.00 6.69   ? 247 SER C C     1 
ATOM   8055  O O     . SER C 1 247 ? 3.007   38.362  51.595  1.00 8.08   ? 247 SER C O     1 
ATOM   8056  C CB    . SER C 1 247 ? 5.818   37.540  52.494  1.00 14.34  ? 247 SER C CB    1 
ATOM   8057  O OG    . SER C 1 247 ? 5.572   37.211  51.131  1.00 23.39  ? 247 SER C OG    1 
ATOM   8058  H H     . SER C 1 247 ? 3.177   36.683  53.094  1.00 0.00   ? 247 SER C H     1 
ATOM   8059  H HG    . SER C 1 247 ? 6.377   36.732  50.848  1.00 0.00   ? 247 SER C HG    1 
ATOM   8060  N N     . MET C 1 248 ? 3.628   40.195  52.738  1.00 7.21   ? 248 MET C N     1 
ATOM   8061  C CA    . MET C 1 248 ? 2.666   41.058  52.094  1.00 7.12   ? 248 MET C CA    1 
ATOM   8062  C C     . MET C 1 248 ? 2.626   40.950  50.580  1.00 8.04   ? 248 MET C C     1 
ATOM   8063  O O     . MET C 1 248 ? 1.539   40.870  50.014  1.00 11.82  ? 248 MET C O     1 
ATOM   8064  C CB    . MET C 1 248 ? 2.962   42.486  52.507  1.00 5.67   ? 248 MET C CB    1 
ATOM   8065  C CG    . MET C 1 248 ? 1.980   43.469  51.942  1.00 4.15   ? 248 MET C CG    1 
ATOM   8066  S SD    . MET C 1 248 ? 2.552   45.128  52.288  1.00 14.74  ? 248 MET C SD    1 
ATOM   8067  C CE    . MET C 1 248 ? 0.970   45.883  52.564  1.00 13.58  ? 248 MET C CE    1 
ATOM   8068  H H     . MET C 1 248 ? 4.176   40.543  53.470  1.00 0.00   ? 248 MET C H     1 
ATOM   8069  N N     . VAL C 1 249 ? 3.754   40.837  49.895  1.00 8.17   ? 249 VAL C N     1 
ATOM   8070  C CA    . VAL C 1 249 ? 3.763   40.820  48.435  1.00 10.24  ? 249 VAL C CA    1 
ATOM   8071  C C     . VAL C 1 249 ? 3.035   39.610  47.890  1.00 10.08  ? 249 VAL C C     1 
ATOM   8072  O O     . VAL C 1 249 ? 2.334   39.719  46.877  1.00 11.06  ? 249 VAL C O     1 
ATOM   8073  C CB    . VAL C 1 249 ? 5.212   40.818  47.909  1.00 12.75  ? 249 VAL C CB    1 
ATOM   8074  C CG1   . VAL C 1 249 ? 5.261   40.937  46.396  1.00 15.97  ? 249 VAL C CG1   1 
ATOM   8075  C CG2   . VAL C 1 249 ? 5.924   42.015  48.465  1.00 12.79  ? 249 VAL C CG2   1 
ATOM   8076  H H     . VAL C 1 249 ? 4.586   40.710  50.390  1.00 0.00   ? 249 VAL C H     1 
ATOM   8077  N N     . ALA C 1 250 ? 3.168   38.470  48.587  1.00 9.34   ? 250 ALA C N     1 
ATOM   8078  C CA    . ALA C 1 250 ? 2.561   37.230  48.147  1.00 8.52   ? 250 ALA C CA    1 
ATOM   8079  C C     . ALA C 1 250 ? 1.067   37.235  48.395  1.00 7.31   ? 250 ALA C C     1 
ATOM   8080  O O     . ALA C 1 250 ? 0.273   36.858  47.514  1.00 9.59   ? 250 ALA C O     1 
ATOM   8081  C CB    . ALA C 1 250 ? 3.173   36.059  48.879  1.00 7.44   ? 250 ALA C CB    1 
ATOM   8082  H H     . ALA C 1 250 ? 3.636   38.474  49.448  1.00 0.00   ? 250 ALA C H     1 
ATOM   8083  N N     . ASP C 1 251 ? 0.677   37.734  49.573  1.00 6.18   ? 251 ASP C N     1 
ATOM   8084  C CA    . ASP C 1 251 ? -0.731  37.851  49.927  1.00 5.67   ? 251 ASP C CA    1 
ATOM   8085  C C     . ASP C 1 251 ? -1.496  38.915  49.156  1.00 8.03   ? 251 ASP C C     1 
ATOM   8086  O O     . ASP C 1 251 ? -2.577  38.618  48.638  1.00 4.78   ? 251 ASP C O     1 
ATOM   8087  C CB    . ASP C 1 251 ? -0.824  38.115  51.416  1.00 2.74   ? 251 ASP C CB    1 
ATOM   8088  C CG    . ASP C 1 251 ? -0.494  36.863  52.216  1.00 2.00   ? 251 ASP C CG    1 
ATOM   8089  O OD1   . ASP C 1 251 ? -0.721  35.758  51.752  1.00 3.22   ? 251 ASP C OD1   1 
ATOM   8090  O OD2   . ASP C 1 251 ? -0.012  36.977  53.329  1.00 8.39   ? 251 ASP C OD2   1 
ATOM   8091  H H     . ASP C 1 251 ? 1.365   38.055  50.195  1.00 0.00   ? 251 ASP C H     1 
ATOM   8092  N N     . VAL C 1 252 ? -0.976  40.136  48.983  1.00 7.18   ? 252 VAL C N     1 
ATOM   8093  C CA    . VAL C 1 252 ? -1.648  41.131  48.167  1.00 5.06   ? 252 VAL C CA    1 
ATOM   8094  C C     . VAL C 1 252 ? -1.587  40.731  46.696  1.00 9.31   ? 252 VAL C C     1 
ATOM   8095  O O     . VAL C 1 252 ? -2.481  41.106  45.924  1.00 13.79  ? 252 VAL C O     1 
ATOM   8096  C CB    . VAL C 1 252 ? -1.002  42.495  48.383  1.00 6.20   ? 252 VAL C CB    1 
ATOM   8097  C CG1   . VAL C 1 252 ? -1.673  43.576  47.536  1.00 7.26   ? 252 VAL C CG1   1 
ATOM   8098  C CG2   . VAL C 1 252 ? -1.211  42.906  49.836  1.00 6.30   ? 252 VAL C CG2   1 
ATOM   8099  H H     . VAL C 1 252 ? -0.148  40.367  49.447  1.00 0.00   ? 252 VAL C H     1 
ATOM   8100  N N     . HIS C 1 253 ? -0.599  39.968  46.228  1.00 3.68   ? 253 HIS C N     1 
ATOM   8101  C CA    . HIS C 1 253 ? -0.638  39.588  44.837  1.00 5.87   ? 253 HIS C CA    1 
ATOM   8102  C C     . HIS C 1 253 ? -1.730  38.563  44.645  1.00 7.68   ? 253 HIS C C     1 
ATOM   8103  O O     . HIS C 1 253 ? -2.374  38.602  43.592  1.00 10.74  ? 253 HIS C O     1 
ATOM   8104  C CB    . HIS C 1 253 ? 0.677   38.980  44.341  1.00 8.79   ? 253 HIS C CB    1 
ATOM   8105  C CG    . HIS C 1 253 ? 0.673   38.711  42.836  1.00 9.76   ? 253 HIS C CG    1 
ATOM   8106  N ND1   . HIS C 1 253 ? 0.680   39.674  41.915  1.00 8.78   ? 253 HIS C ND1   1 
ATOM   8107  C CD2   . HIS C 1 253 ? 0.516   37.492  42.219  1.00 12.97  ? 253 HIS C CD2   1 
ATOM   8108  C CE1   . HIS C 1 253 ? 0.508   39.090  40.758  1.00 16.44  ? 253 HIS C CE1   1 
ATOM   8109  N NE2   . HIS C 1 253 ? 0.404   37.788  40.955  1.00 17.11  ? 253 HIS C NE2   1 
ATOM   8110  H H     . HIS C 1 253 ? 0.181   39.731  46.784  1.00 0.00   ? 253 HIS C H     1 
ATOM   8111  H HD1   . HIS C 1 253 ? 0.667   40.638  42.084  1.00 0.00   ? 253 HIS C HD1   1 
ATOM   8112  H HE2   . HIS C 1 253 ? 0.230   37.143  40.240  1.00 0.00   ? 253 HIS C HE2   1 
ATOM   8113  N N     . ARG C 1 254 ? -1.961  37.628  45.573  1.00 5.79   ? 254 ARG C N     1 
ATOM   8114  C CA    . ARG C 1 254 ? -3.056  36.666  45.424  1.00 3.65   ? 254 ARG C CA    1 
ATOM   8115  C C     . ARG C 1 254 ? -4.342  37.458  45.460  1.00 5.15   ? 254 ARG C C     1 
ATOM   8116  O O     . ARG C 1 254 ? -5.156  37.239  44.569  1.00 10.67  ? 254 ARG C O     1 
ATOM   8117  C CB    . ARG C 1 254 ? -3.126  35.664  46.554  1.00 2.00   ? 254 ARG C CB    1 
ATOM   8118  C CG    . ARG C 1 254 ? -4.137  34.513  46.437  1.00 2.00   ? 254 ARG C CG    1 
ATOM   8119  C CD    . ARG C 1 254 ? -4.128  33.730  47.751  1.00 2.00   ? 254 ARG C CD    1 
ATOM   8120  N NE    . ARG C 1 254 ? -4.375  34.663  48.846  1.00 6.49   ? 254 ARG C NE    1 
ATOM   8121  C CZ    . ARG C 1 254 ? -3.507  34.909  49.837  1.00 2.00   ? 254 ARG C CZ    1 
ATOM   8122  N NH1   . ARG C 1 254 ? -2.378  34.249  49.980  1.00 2.48   ? 254 ARG C NH1   1 
ATOM   8123  N NH2   . ARG C 1 254 ? -3.812  35.821  50.745  1.00 7.69   ? 254 ARG C NH2   1 
ATOM   8124  H H     . ARG C 1 254 ? -1.390  37.588  46.371  1.00 0.00   ? 254 ARG C H     1 
ATOM   8125  H HE    . ARG C 1 254 ? -5.232  35.139  48.862  1.00 0.00   ? 254 ARG C HE    1 
ATOM   8126  H HH11  . ARG C 1 254 ? -2.127  33.532  49.330  1.00 0.00   ? 254 ARG C HH11  1 
ATOM   8127  H HH12  . ARG C 1 254 ? -1.772  34.457  50.744  1.00 0.00   ? 254 ARG C HH12  1 
ATOM   8128  H HH21  . ARG C 1 254 ? -4.682  36.311  50.686  1.00 0.00   ? 254 ARG C HH21  1 
ATOM   8129  H HH22  . ARG C 1 254 ? -3.175  36.019  51.490  1.00 0.00   ? 254 ARG C HH22  1 
ATOM   8130  N N     . THR C 1 255 ? -4.541  38.381  46.416  1.00 5.62   ? 255 THR C N     1 
ATOM   8131  C CA    . THR C 1 255 ? -5.729  39.218  46.462  1.00 6.17   ? 255 THR C CA    1 
ATOM   8132  C C     . THR C 1 255 ? -5.972  39.897  45.127  1.00 6.61   ? 255 THR C C     1 
ATOM   8133  O O     . THR C 1 255 ? -7.097  39.803  44.629  1.00 10.15  ? 255 THR C O     1 
ATOM   8134  C CB    . THR C 1 255 ? -5.566  40.257  47.574  1.00 4.23   ? 255 THR C CB    1 
ATOM   8135  O OG1   . THR C 1 255 ? -5.439  39.537  48.793  1.00 6.17   ? 255 THR C OG1   1 
ATOM   8136  C CG2   . THR C 1 255 ? -6.749  41.170  47.710  1.00 6.45   ? 255 THR C CG2   1 
ATOM   8137  H H     . THR C 1 255 ? -3.920  38.459  47.174  1.00 0.00   ? 255 THR C H     1 
ATOM   8138  H HG1   . THR C 1 255 ? -6.205  38.950  48.896  1.00 0.00   ? 255 THR C HG1   1 
ATOM   8139  N N     . LEU C 1 256 ? -4.975  40.502  44.488  1.00 5.65   ? 256 LEU C N     1 
ATOM   8140  C CA    . LEU C 1 256 ? -5.189  41.122  43.196  1.00 10.46  ? 256 LEU C CA    1 
ATOM   8141  C C     . LEU C 1 256 ? -5.678  40.132  42.137  1.00 12.45  ? 256 LEU C C     1 
ATOM   8142  O O     . LEU C 1 256 ? -6.651  40.368  41.427  1.00 9.93   ? 256 LEU C O     1 
ATOM   8143  C CB    . LEU C 1 256 ? -3.902  41.756  42.707  1.00 14.29  ? 256 LEU C CB    1 
ATOM   8144  C CG    . LEU C 1 256 ? -3.994  42.549  41.398  1.00 16.56  ? 256 LEU C CG    1 
ATOM   8145  C CD1   . LEU C 1 256 ? -4.673  43.873  41.665  1.00 16.22  ? 256 LEU C CD1   1 
ATOM   8146  C CD2   . LEU C 1 256 ? -2.608  42.797  40.832  1.00 17.69  ? 256 LEU C CD2   1 
ATOM   8147  H H     . LEU C 1 256 ? -4.085  40.529  44.900  1.00 0.00   ? 256 LEU C H     1 
ATOM   8148  N N     . VAL C 1 257 ? -5.053  38.967  42.053  1.00 14.37  ? 257 VAL C N     1 
ATOM   8149  C CA    . VAL C 1 257 ? -5.339  38.031  40.977  1.00 14.86  ? 257 VAL C CA    1 
ATOM   8150  C C     . VAL C 1 257 ? -6.593  37.188  41.148  1.00 16.15  ? 257 VAL C C     1 
ATOM   8151  O O     . VAL C 1 257 ? -7.296  36.854  40.188  1.00 17.19  ? 257 VAL C O     1 
ATOM   8152  C CB    . VAL C 1 257 ? -4.039  37.173  40.817  1.00 13.53  ? 257 VAL C CB    1 
ATOM   8153  C CG1   . VAL C 1 257 ? -4.190  35.942  39.933  1.00 10.84  ? 257 VAL C CG1   1 
ATOM   8154  C CG2   . VAL C 1 257 ? -3.028  38.080  40.152  1.00 12.27  ? 257 VAL C CG2   1 
ATOM   8155  H H     . VAL C 1 257 ? -4.396  38.726  42.740  1.00 0.00   ? 257 VAL C H     1 
ATOM   8156  N N     . TYR C 1 258 ? -6.868  36.845  42.393  1.00 16.84  ? 258 TYR C N     1 
ATOM   8157  C CA    . TYR C 1 258 ? -7.929  35.928  42.703  1.00 20.24  ? 258 TYR C CA    1 
ATOM   8158  C C     . TYR C 1 258 ? -9.071  36.620  43.445  1.00 16.64  ? 258 TYR C C     1 
ATOM   8159  O O     . TYR C 1 258 ? -10.144 36.043  43.612  1.00 25.27  ? 258 TYR C O     1 
ATOM   8160  C CB    . TYR C 1 258 ? -7.276  34.783  43.504  1.00 23.44  ? 258 TYR C CB    1 
ATOM   8161  C CG    . TYR C 1 258 ? -8.159  33.562  43.709  1.00 38.84  ? 258 TYR C CG    1 
ATOM   8162  C CD1   . TYR C 1 258 ? -8.438  32.704  42.650  1.00 44.77  ? 258 TYR C CD1   1 
ATOM   8163  C CD2   . TYR C 1 258 ? -8.758  33.354  44.939  1.00 40.61  ? 258 TYR C CD2   1 
ATOM   8164  C CE1   . TYR C 1 258 ? -9.356  31.677  42.810  1.00 45.40  ? 258 TYR C CE1   1 
ATOM   8165  C CE2   . TYR C 1 258 ? -9.688  32.340  45.089  1.00 45.54  ? 258 TYR C CE2   1 
ATOM   8166  C CZ    . TYR C 1 258 ? -9.990  31.512  44.029  1.00 46.89  ? 258 TYR C CZ    1 
ATOM   8167  O OH    . TYR C 1 258 ? -10.944 30.520  44.196  1.00 49.88  ? 258 TYR C OH    1 
ATOM   8168  H H     . TYR C 1 258 ? -6.348  37.240  43.116  1.00 0.00   ? 258 TYR C H     1 
ATOM   8169  H HH    . TYR C 1 258 ? -11.314 30.603  45.079  1.00 0.00   ? 258 TYR C HH    1 
ATOM   8170  N N     . GLY C 1 259 ? -8.953  37.853  43.887  1.00 14.71  ? 259 GLY C N     1 
ATOM   8171  C CA    . GLY C 1 259 ? -10.017 38.527  44.602  1.00 7.50   ? 259 GLY C CA    1 
ATOM   8172  C C     . GLY C 1 259 ? -10.031 38.110  46.061  1.00 5.83   ? 259 GLY C C     1 
ATOM   8173  O O     . GLY C 1 259 ? -9.516  37.052  46.445  1.00 3.31   ? 259 GLY C O     1 
ATOM   8174  H H     . GLY C 1 259 ? -8.110  38.330  43.760  1.00 0.00   ? 259 GLY C H     1 
ATOM   8175  N N     . GLY C 1 260 ? -10.628 38.927  46.911  1.00 5.98   ? 260 GLY C N     1 
ATOM   8176  C CA    . GLY C 1 260 ? -10.750 38.567  48.303  1.00 5.08   ? 260 GLY C CA    1 
ATOM   8177  C C     . GLY C 1 260 ? -10.474 39.796  49.096  1.00 3.51   ? 260 GLY C C     1 
ATOM   8178  O O     . GLY C 1 260 ? -10.699 40.904  48.596  1.00 2.00   ? 260 GLY C O     1 
ATOM   8179  H H     . GLY C 1 260 ? -10.986 39.794  46.614  1.00 0.00   ? 260 GLY C H     1 
ATOM   8180  N N     . ILE C 1 261 ? -9.980  39.597  50.311  1.00 7.56   ? 261 ILE C N     1 
ATOM   8181  C CA    . ILE C 1 261 ? -9.656  40.705  51.184  1.00 8.59   ? 261 ILE C CA    1 
ATOM   8182  C C     . ILE C 1 261 ? -8.445  40.311  52.028  1.00 10.83  ? 261 ILE C C     1 
ATOM   8183  O O     . ILE C 1 261 ? -8.309  39.164  52.457  1.00 14.57  ? 261 ILE C O     1 
ATOM   8184  C CB    . ILE C 1 261 ? -10.902 41.015  52.049  1.00 5.46   ? 261 ILE C CB    1 
ATOM   8185  C CG1   . ILE C 1 261 ? -10.663 42.320  52.781  1.00 5.46   ? 261 ILE C CG1   1 
ATOM   8186  C CG2   . ILE C 1 261 ? -11.227 39.830  52.945  1.00 2.00   ? 261 ILE C CG2   1 
ATOM   8187  C CD1   . ILE C 1 261 ? -11.632 42.692  53.901  1.00 10.91  ? 261 ILE C CD1   1 
ATOM   8188  H H     . ILE C 1 261 ? -9.792  38.684  50.627  1.00 0.00   ? 261 ILE C H     1 
ATOM   8189  N N     . PHE C 1 262 ? -7.522  41.224  52.293  1.00 14.63  ? 262 PHE C N     1 
ATOM   8190  C CA    . PHE C 1 262 ? -6.322  40.955  53.069  1.00 13.49  ? 262 PHE C CA    1 
ATOM   8191  C C     . PHE C 1 262 ? -6.398  41.906  54.258  1.00 13.23  ? 262 PHE C C     1 
ATOM   8192  O O     . PHE C 1 262 ? -6.765  43.075  54.070  1.00 18.97  ? 262 PHE C O     1 
ATOM   8193  C CB    . PHE C 1 262 ? -5.118  41.211  52.152  1.00 6.08   ? 262 PHE C CB    1 
ATOM   8194  C CG    . PHE C 1 262 ? -3.821  41.389  52.914  1.00 13.49  ? 262 PHE C CG    1 
ATOM   8195  C CD1   . PHE C 1 262 ? -3.142  40.286  53.400  1.00 11.66  ? 262 PHE C CD1   1 
ATOM   8196  C CD2   . PHE C 1 262 ? -3.361  42.669  53.187  1.00 12.75  ? 262 PHE C CD2   1 
ATOM   8197  C CE1   . PHE C 1 262 ? -2.026  40.478  54.188  1.00 11.26  ? 262 PHE C CE1   1 
ATOM   8198  C CE2   . PHE C 1 262 ? -2.251  42.853  53.989  1.00 5.59   ? 262 PHE C CE2   1 
ATOM   8199  C CZ    . PHE C 1 262 ? -1.586  41.753  54.488  1.00 9.51   ? 262 PHE C CZ    1 
ATOM   8200  H H     . PHE C 1 262 ? -7.662  42.145  51.982  1.00 0.00   ? 262 PHE C H     1 
ATOM   8201  N N     . LEU C 1 263 ? -6.085  41.486  55.475  1.00 8.15   ? 263 LEU C N     1 
ATOM   8202  C CA    . LEU C 1 263 ? -6.234  42.369  56.594  1.00 5.51   ? 263 LEU C CA    1 
ATOM   8203  C C     . LEU C 1 263 ? -5.039  42.280  57.515  1.00 10.10  ? 263 LEU C C     1 
ATOM   8204  O O     . LEU C 1 263 ? -4.630  41.179  57.913  1.00 11.82  ? 263 LEU C O     1 
ATOM   8205  C CB    . LEU C 1 263 ? -7.474  42.028  57.429  1.00 6.07   ? 263 LEU C CB    1 
ATOM   8206  C CG    . LEU C 1 263 ? -8.872  41.821  56.860  1.00 3.42   ? 263 LEU C CG    1 
ATOM   8207  C CD1   . LEU C 1 263 ? -9.050  40.478  56.187  1.00 2.00   ? 263 LEU C CD1   1 
ATOM   8208  C CD2   . LEU C 1 263 ? -9.822  41.864  58.021  1.00 4.35   ? 263 LEU C CD2   1 
ATOM   8209  H H     . LEU C 1 263 ? -5.737  40.586  55.632  1.00 0.00   ? 263 LEU C H     1 
ATOM   8210  N N     . TYR C 1 264 ? -4.427  43.416  57.833  1.00 8.07   ? 264 TYR C N     1 
ATOM   8211  C CA    . TYR C 1 264 ? -3.457  43.465  58.904  1.00 13.50  ? 264 TYR C CA    1 
ATOM   8212  C C     . TYR C 1 264 ? -3.820  44.729  59.691  1.00 15.34  ? 264 TYR C C     1 
ATOM   8213  O O     . TYR C 1 264 ? -3.269  45.825  59.490  1.00 12.53  ? 264 TYR C O     1 
ATOM   8214  C CB    . TYR C 1 264 ? -2.040  43.584  58.374  1.00 18.00  ? 264 TYR C CB    1 
ATOM   8215  C CG    . TYR C 1 264 ? -0.955  42.976  59.281  1.00 20.67  ? 264 TYR C CG    1 
ATOM   8216  C CD1   . TYR C 1 264 ? -0.966  43.094  60.669  1.00 20.75  ? 264 TYR C CD1   1 
ATOM   8217  C CD2   . TYR C 1 264 ? 0.040   42.248  58.666  1.00 19.11  ? 264 TYR C CD2   1 
ATOM   8218  C CE1   . TYR C 1 264 ? -0.019  42.446  61.430  1.00 15.99  ? 264 TYR C CE1   1 
ATOM   8219  C CE2   . TYR C 1 264 ? 0.989   41.612  59.411  1.00 17.26  ? 264 TYR C CE2   1 
ATOM   8220  C CZ    . TYR C 1 264 ? 0.942   41.705  60.778  1.00 18.02  ? 264 TYR C CZ    1 
ATOM   8221  O OH    . TYR C 1 264 ? 1.892   41.005  61.483  1.00 20.91  ? 264 TYR C OH    1 
ATOM   8222  H H     . TYR C 1 264 ? -4.640  44.228  57.331  1.00 0.00   ? 264 TYR C H     1 
ATOM   8223  H HH    . TYR C 1 264 ? 2.758   41.089  61.062  1.00 0.00   ? 264 TYR C HH    1 
ATOM   8224  N N     . PRO C 1 265 ? -4.828  44.622  60.561  1.00 15.05  ? 265 PRO C N     1 
ATOM   8225  C CA    . PRO C 1 265 ? -5.326  45.724  61.364  1.00 15.08  ? 265 PRO C CA    1 
ATOM   8226  C C     . PRO C 1 265 ? -4.405  46.065  62.527  1.00 17.55  ? 265 PRO C C     1 
ATOM   8227  O O     . PRO C 1 265 ? -3.401  45.382  62.769  1.00 17.43  ? 265 PRO C O     1 
ATOM   8228  C CB    . PRO C 1 265 ? -6.678  45.240  61.797  1.00 8.20   ? 265 PRO C CB    1 
ATOM   8229  C CG    . PRO C 1 265 ? -6.456  43.785  62.033  1.00 10.20  ? 265 PRO C CG    1 
ATOM   8230  C CD    . PRO C 1 265 ? -5.587  43.399  60.847  1.00 14.67  ? 265 PRO C CD    1 
ATOM   8231  N N     . ALA C 1 266 ? -4.752  47.127  63.254  1.00 18.01  ? 266 ALA C N     1 
ATOM   8232  C CA    . ALA C 1 266 ? -4.063  47.398  64.504  1.00 19.35  ? 266 ALA C CA    1 
ATOM   8233  C C     . ALA C 1 266 ? -4.469  46.271  65.462  1.00 23.06  ? 266 ALA C C     1 
ATOM   8234  O O     . ALA C 1 266 ? -5.458  45.565  65.234  1.00 23.26  ? 266 ALA C O     1 
ATOM   8235  C CB    . ALA C 1 266 ? -4.522  48.728  65.088  1.00 19.65  ? 266 ALA C CB    1 
ATOM   8236  H H     . ALA C 1 266 ? -5.539  47.655  63.001  1.00 0.00   ? 266 ALA C H     1 
ATOM   8237  N N     . ASN C 1 267 ? -3.744  46.005  66.528  1.00 27.59  ? 267 ASN C N     1 
ATOM   8238  C CA    . ASN C 1 267 ? -4.117  44.977  67.494  1.00 34.48  ? 267 ASN C CA    1 
ATOM   8239  C C     . ASN C 1 267 ? -3.454  45.452  68.763  1.00 37.56  ? 267 ASN C C     1 
ATOM   8240  O O     . ASN C 1 267 ? -2.383  46.060  68.644  1.00 40.32  ? 267 ASN C O     1 
ATOM   8241  C CB    . ASN C 1 267 ? -3.580  43.577  67.101  1.00 35.45  ? 267 ASN C CB    1 
ATOM   8242  C CG    . ASN C 1 267 ? -2.085  43.308  67.207  1.00 37.07  ? 267 ASN C CG    1 
ATOM   8243  O OD1   . ASN C 1 267 ? -1.352  43.267  66.229  1.00 36.81  ? 267 ASN C OD1   1 
ATOM   8244  N ND2   . ASN C 1 267 ? -1.544  43.027  68.370  1.00 44.72  ? 267 ASN C ND2   1 
ATOM   8245  H H     . ASN C 1 267 ? -2.915  46.513  66.676  1.00 0.00   ? 267 ASN C H     1 
ATOM   8246  H HD21  . ASN C 1 267 ? -0.574  42.875  68.356  1.00 0.00   ? 267 ASN C HD21  1 
ATOM   8247  H HD22  . ASN C 1 267 ? -2.095  42.948  69.176  1.00 0.00   ? 267 ASN C HD22  1 
ATOM   8248  N N     . LYS C 1 268 ? -3.946  45.286  69.986  1.00 42.14  ? 268 LYS C N     1 
ATOM   8249  C CA    . LYS C 1 268 ? -3.212  45.829  71.121  1.00 48.05  ? 268 LYS C CA    1 
ATOM   8250  C C     . LYS C 1 268 ? -1.911  45.062  71.346  1.00 50.63  ? 268 LYS C C     1 
ATOM   8251  O O     . LYS C 1 268 ? -1.883  43.911  71.784  1.00 52.32  ? 268 LYS C O     1 
ATOM   8252  C CB    . LYS C 1 268 ? -4.039  45.791  72.396  1.00 51.79  ? 268 LYS C CB    1 
ATOM   8253  C CG    . LYS C 1 268 ? -3.309  46.613  73.468  1.00 56.91  ? 268 LYS C CG    1 
ATOM   8254  C CD    . LYS C 1 268 ? -3.161  48.094  73.081  1.00 60.85  ? 268 LYS C CD    1 
ATOM   8255  C CE    . LYS C 1 268 ? -2.203  48.780  74.050  1.00 63.40  ? 268 LYS C CE    1 
ATOM   8256  N NZ    . LYS C 1 268 ? -2.308  50.226  73.993  1.00 58.57  ? 268 LYS C NZ    1 
ATOM   8257  H H     . LYS C 1 268 ? -4.770  44.762  70.122  1.00 0.00   ? 268 LYS C H     1 
ATOM   8258  H HZ1   . LYS C 1 268 ? -2.118  50.551  73.023  1.00 0.00   ? 268 LYS C HZ1   1 
ATOM   8259  H HZ2   . LYS C 1 268 ? -3.269  50.513  74.272  1.00 0.00   ? 268 LYS C HZ2   1 
ATOM   8260  H HZ3   . LYS C 1 268 ? -1.620  50.646  74.649  1.00 0.00   ? 268 LYS C HZ3   1 
ATOM   8261  N N     . LYS C 1 269 ? -0.880  45.771  70.899  1.00 50.15  ? 269 LYS C N     1 
ATOM   8262  C CA    . LYS C 1 269 ? 0.545   45.445  70.893  1.00 50.62  ? 269 LYS C CA    1 
ATOM   8263  C C     . LYS C 1 269 ? 1.034   46.242  69.680  1.00 44.81  ? 269 LYS C C     1 
ATOM   8264  O O     . LYS C 1 269 ? 2.132   46.778  69.690  1.00 45.16  ? 269 LYS C O     1 
ATOM   8265  C CB    . LYS C 1 269 ? 0.878   43.943  70.654  1.00 60.29  ? 269 LYS C CB    1 
ATOM   8266  C CG    . LYS C 1 269 ? 2.391   43.666  70.593  1.00 72.10  ? 269 LYS C CG    1 
ATOM   8267  C CD    . LYS C 1 269 ? 2.766   42.202  70.349  1.00 80.86  ? 269 LYS C CD    1 
ATOM   8268  C CE    . LYS C 1 269 ? 4.046   42.153  69.498  1.00 85.18  ? 269 LYS C CE    1 
ATOM   8269  N NZ    . LYS C 1 269 ? 4.911   41.030  69.828  1.00 88.16  ? 269 LYS C NZ    1 
ATOM   8270  H H     . LYS C 1 269 ? -1.112  46.617  70.467  1.00 0.00   ? 269 LYS C H     1 
ATOM   8271  H HZ1   . LYS C 1 269 ? 4.338   40.174  69.959  1.00 0.00   ? 269 LYS C HZ1   1 
ATOM   8272  H HZ2   . LYS C 1 269 ? 5.594   40.886  69.056  1.00 0.00   ? 269 LYS C HZ2   1 
ATOM   8273  H HZ3   . LYS C 1 269 ? 5.424   41.244  70.708  1.00 0.00   ? 269 LYS C HZ3   1 
ATOM   8274  N N     . SER C 1 270 ? 0.251   46.351  68.606  1.00 37.94  ? 270 SER C N     1 
ATOM   8275  C CA    . SER C 1 270 ? 0.575   47.181  67.470  1.00 32.91  ? 270 SER C CA    1 
ATOM   8276  C C     . SER C 1 270 ? -0.585  48.178  67.332  1.00 30.91  ? 270 SER C C     1 
ATOM   8277  O O     . SER C 1 270 ? -1.362  48.062  66.377  1.00 33.00  ? 270 SER C O     1 
ATOM   8278  C CB    . SER C 1 270 ? 0.716   46.278  66.241  1.00 34.54  ? 270 SER C CB    1 
ATOM   8279  O OG    . SER C 1 270 ? 1.522   45.135  66.502  1.00 37.37  ? 270 SER C OG    1 
ATOM   8280  H H     . SER C 1 270 ? -0.514  45.751  68.518  1.00 0.00   ? 270 SER C H     1 
ATOM   8281  H HG    . SER C 1 270 ? 2.402   45.454  66.710  1.00 0.00   ? 270 SER C HG    1 
ATOM   8282  N N     . PRO C 1 271 ? -0.800  49.174  68.223  1.00 24.87  ? 271 PRO C N     1 
ATOM   8283  C CA    . PRO C 1 271 ? -1.908  50.148  68.176  1.00 20.62  ? 271 PRO C CA    1 
ATOM   8284  C C     . PRO C 1 271 ? -1.980  50.940  66.885  1.00 16.59  ? 271 PRO C C     1 
ATOM   8285  O O     . PRO C 1 271 ? -3.041  51.429  66.484  1.00 17.31  ? 271 PRO C O     1 
ATOM   8286  C CB    . PRO C 1 271 ? -1.691  51.069  69.344  1.00 19.97  ? 271 PRO C CB    1 
ATOM   8287  C CG    . PRO C 1 271 ? -0.729  50.325  70.212  1.00 22.88  ? 271 PRO C CG    1 
ATOM   8288  C CD    . PRO C 1 271 ? 0.173   49.626  69.201  1.00 24.15  ? 271 PRO C CD    1 
ATOM   8289  N N     . ASN C 1 272 ? -0.828  51.112  66.252  1.00 13.69  ? 272 ASN C N     1 
ATOM   8290  C CA    . ASN C 1 272 ? -0.808  51.870  65.031  1.00 14.57  ? 272 ASN C CA    1 
ATOM   8291  C C     . ASN C 1 272 ? -0.692  50.987  63.828  1.00 16.29  ? 272 ASN C C     1 
ATOM   8292  O O     . ASN C 1 272 ? -0.680  51.467  62.697  1.00 21.40  ? 272 ASN C O     1 
ATOM   8293  C CB    . ASN C 1 272 ? 0.335   52.853  65.041  1.00 17.78  ? 272 ASN C CB    1 
ATOM   8294  C CG    . ASN C 1 272 ? 0.030   54.095  65.867  1.00 20.31  ? 272 ASN C CG    1 
ATOM   8295  O OD1   . ASN C 1 272 ? 0.412   54.205  67.029  1.00 16.68  ? 272 ASN C OD1   1 
ATOM   8296  N ND2   . ASN C 1 272 ? -0.668  55.083  65.340  1.00 26.71  ? 272 ASN C ND2   1 
ATOM   8297  H H     . ASN C 1 272 ? 0.014   50.790  66.627  1.00 0.00   ? 272 ASN C H     1 
ATOM   8298  H HD21  . ASN C 1 272 ? -0.810  55.870  65.905  1.00 0.00   ? 272 ASN C HD21  1 
ATOM   8299  H HD22  . ASN C 1 272 ? -0.982  54.995  64.418  1.00 0.00   ? 272 ASN C HD22  1 
ATOM   8300  N N     . GLY C 1 273 ? -0.668  49.679  64.036  1.00 16.74  ? 273 GLY C N     1 
ATOM   8301  C CA    . GLY C 1 273 ? -0.554  48.740  62.942  1.00 13.22  ? 273 GLY C CA    1 
ATOM   8302  C C     . GLY C 1 273 ? 0.833   48.176  62.995  1.00 12.91  ? 273 GLY C C     1 
ATOM   8303  O O     . GLY C 1 273 ? 1.580   48.460  63.945  1.00 14.95  ? 273 GLY C O     1 
ATOM   8304  H H     . GLY C 1 273 ? -0.690  49.323  64.946  1.00 0.00   ? 273 GLY C H     1 
ATOM   8305  N N     . LYS C 1 274 ? 1.162   47.369  61.998  1.00 11.32  ? 274 LYS C N     1 
ATOM   8306  C CA    . LYS C 1 274 ? 2.457   46.751  61.909  1.00 14.14  ? 274 LYS C CA    1 
ATOM   8307  C C     . LYS C 1 274 ? 3.124   47.004  60.577  1.00 10.96  ? 274 LYS C C     1 
ATOM   8308  O O     . LYS C 1 274 ? 4.343   47.182  60.513  1.00 13.84  ? 274 LYS C O     1 
ATOM   8309  C CB    . LYS C 1 274 ? 2.304   45.267  62.143  1.00 16.18  ? 274 LYS C CB    1 
ATOM   8310  C CG    . LYS C 1 274 ? 3.632   44.721  62.587  1.00 27.65  ? 274 LYS C CG    1 
ATOM   8311  C CD    . LYS C 1 274 ? 3.282   43.461  63.309  1.00 41.05  ? 274 LYS C CD    1 
ATOM   8312  C CE    . LYS C 1 274 ? 4.509   42.917  64.013  1.00 51.36  ? 274 LYS C CE    1 
ATOM   8313  N NZ    . LYS C 1 274 ? 4.206   41.586  64.516  1.00 59.62  ? 274 LYS C NZ    1 
ATOM   8314  H H     . LYS C 1 274 ? 0.496   47.173  61.315  1.00 0.00   ? 274 LYS C H     1 
ATOM   8315  H HZ1   . LYS C 1 274 ? 3.398   41.610  65.169  1.00 0.00   ? 274 LYS C HZ1   1 
ATOM   8316  H HZ2   . LYS C 1 274 ? 3.954   40.982  63.707  1.00 0.00   ? 274 LYS C HZ2   1 
ATOM   8317  H HZ3   . LYS C 1 274 ? 5.038   41.192  64.998  1.00 0.00   ? 274 LYS C HZ3   1 
ATOM   8318  N N     . LEU C 1 275 ? 2.397   47.008  59.469  1.00 10.24  ? 275 LEU C N     1 
ATOM   8319  C CA    . LEU C 1 275 ? 3.049   47.289  58.196  1.00 10.74  ? 275 LEU C CA    1 
ATOM   8320  C C     . LEU C 1 275 ? 3.311   48.779  58.049  1.00 12.93  ? 275 LEU C C     1 
ATOM   8321  O O     . LEU C 1 275 ? 2.565   49.606  58.586  1.00 16.72  ? 275 LEU C O     1 
ATOM   8322  C CB    . LEU C 1 275 ? 2.179   46.797  57.073  1.00 10.04  ? 275 LEU C CB    1 
ATOM   8323  C CG    . LEU C 1 275 ? 1.839   45.331  57.141  1.00 6.23   ? 275 LEU C CG    1 
ATOM   8324  C CD1   . LEU C 1 275 ? 0.933   45.014  55.988  1.00 14.43  ? 275 LEU C CD1   1 
ATOM   8325  C CD2   . LEU C 1 275 ? 3.073   44.477  57.053  1.00 12.51  ? 275 LEU C CD2   1 
ATOM   8326  H H     . LEU C 1 275 ? 1.422   46.898  59.513  1.00 0.00   ? 275 LEU C H     1 
ATOM   8327  N N     . ARG C 1 276 ? 4.377   49.166  57.354  1.00 9.98   ? 276 ARG C N     1 
ATOM   8328  C CA    . ARG C 1 276 ? 4.749   50.558  57.268  1.00 8.54   ? 276 ARG C CA    1 
ATOM   8329  C C     . ARG C 1 276 ? 3.986   51.238  56.186  1.00 9.45   ? 276 ARG C C     1 
ATOM   8330  O O     . ARG C 1 276 ? 3.862   50.709  55.081  1.00 16.32  ? 276 ARG C O     1 
ATOM   8331  C CB    . ARG C 1 276 ? 6.210   50.750  56.952  1.00 3.75   ? 276 ARG C CB    1 
ATOM   8332  C CG    . ARG C 1 276 ? 7.096   50.704  58.161  1.00 12.54  ? 276 ARG C CG    1 
ATOM   8333  C CD    . ARG C 1 276 ? 7.167   49.357  58.833  1.00 17.13  ? 276 ARG C CD    1 
ATOM   8334  N NE    . ARG C 1 276 ? 7.632   48.392  57.861  1.00 25.41  ? 276 ARG C NE    1 
ATOM   8335  C CZ    . ARG C 1 276 ? 8.455   47.391  58.154  1.00 24.46  ? 276 ARG C CZ    1 
ATOM   8336  N NH1   . ARG C 1 276 ? 8.930   47.222  59.386  1.00 28.68  ? 276 ARG C NH1   1 
ATOM   8337  N NH2   . ARG C 1 276 ? 8.806   46.561  57.172  1.00 27.96  ? 276 ARG C NH2   1 
ATOM   8338  H H     . ARG C 1 276 ? 4.898   48.496  56.886  1.00 0.00   ? 276 ARG C H     1 
ATOM   8339  H HE    . ARG C 1 276 ? 7.355   48.492  56.927  1.00 0.00   ? 276 ARG C HE    1 
ATOM   8340  H HH11  . ARG C 1 276 ? 8.672   47.850  60.121  1.00 0.00   ? 276 ARG C HH11  1 
ATOM   8341  H HH12  . ARG C 1 276 ? 9.537   46.452  59.579  1.00 0.00   ? 276 ARG C HH12  1 
ATOM   8342  H HH21  . ARG C 1 276 ? 8.453   46.710  56.248  1.00 0.00   ? 276 ARG C HH21  1 
ATOM   8343  H HH22  . ARG C 1 276 ? 9.422   45.796  57.358  1.00 0.00   ? 276 ARG C HH22  1 
ATOM   8344  N N     . LEU C 1 277 ? 3.611   52.470  56.495  1.00 7.58   ? 277 LEU C N     1 
ATOM   8345  C CA    . LEU C 1 277 ? 2.815   53.312  55.636  1.00 4.88   ? 277 LEU C CA    1 
ATOM   8346  C C     . LEU C 1 277 ? 3.534   53.570  54.352  1.00 5.72   ? 277 LEU C C     1 
ATOM   8347  O O     . LEU C 1 277 ? 3.058   53.102  53.322  1.00 7.50   ? 277 LEU C O     1 
ATOM   8348  C CB    . LEU C 1 277 ? 2.525   54.649  56.307  1.00 2.00   ? 277 LEU C CB    1 
ATOM   8349  C CG    . LEU C 1 277 ? 1.769   55.725  55.577  1.00 2.95   ? 277 LEU C CG    1 
ATOM   8350  C CD1   . LEU C 1 277 ? 0.346   55.261  55.286  1.00 12.79  ? 277 LEU C CD1   1 
ATOM   8351  C CD2   . LEU C 1 277 ? 1.761   56.972  56.432  1.00 2.00   ? 277 LEU C CD2   1 
ATOM   8352  H H     . LEU C 1 277 ? 3.830   52.786  57.388  1.00 0.00   ? 277 LEU C H     1 
ATOM   8353  N N     . LEU C 1 278 ? 4.735   54.150  54.430  1.00 7.88   ? 278 LEU C N     1 
ATOM   8354  C CA    . LEU C 1 278 ? 5.326   54.704  53.230  1.00 6.12   ? 278 LEU C CA    1 
ATOM   8355  C C     . LEU C 1 278 ? 5.766   53.759  52.131  1.00 5.99   ? 278 LEU C C     1 
ATOM   8356  O O     . LEU C 1 278 ? 5.570   54.039  50.954  1.00 7.11   ? 278 LEU C O     1 
ATOM   8357  C CB    . LEU C 1 278 ? 6.496   55.633  53.665  1.00 5.98   ? 278 LEU C CB    1 
ATOM   8358  C CG    . LEU C 1 278 ? 6.164   57.058  54.173  1.00 5.72   ? 278 LEU C CG    1 
ATOM   8359  C CD1   . LEU C 1 278 ? 7.414   57.917  54.239  1.00 2.00   ? 278 LEU C CD1   1 
ATOM   8360  C CD2   . LEU C 1 278 ? 5.249   57.757  53.177  1.00 6.56   ? 278 LEU C CD2   1 
ATOM   8361  H H     . LEU C 1 278 ? 5.185   54.242  55.293  1.00 0.00   ? 278 LEU C H     1 
ATOM   8362  N N     . TYR C 1 279 ? 6.332   52.609  52.463  1.00 5.56   ? 279 TYR C N     1 
ATOM   8363  C CA    . TYR C 1 279 ? 6.833   51.700  51.447  1.00 4.47   ? 279 TYR C CA    1 
ATOM   8364  C C     . TYR C 1 279 ? 6.203   50.328  51.499  1.00 7.18   ? 279 TYR C C     1 
ATOM   8365  O O     . TYR C 1 279 ? 6.725   49.424  50.863  1.00 8.96   ? 279 TYR C O     1 
ATOM   8366  C CB    . TYR C 1 279 ? 8.354   51.529  51.567  1.00 10.63  ? 279 TYR C CB    1 
ATOM   8367  C CG    . TYR C 1 279 ? 8.887   51.415  52.989  1.00 5.07   ? 279 TYR C CG    1 
ATOM   8368  C CD1   . TYR C 1 279 ? 8.839   50.234  53.687  1.00 2.00   ? 279 TYR C CD1   1 
ATOM   8369  C CD2   . TYR C 1 279 ? 9.346   52.575  53.566  1.00 3.43   ? 279 TYR C CD2   1 
ATOM   8370  C CE1   . TYR C 1 279 ? 9.236   50.229  54.993  1.00 9.81   ? 279 TYR C CE1   1 
ATOM   8371  C CE2   . TYR C 1 279 ? 9.738   52.576  54.878  1.00 5.34   ? 279 TYR C CE2   1 
ATOM   8372  C CZ    . TYR C 1 279 ? 9.725   51.392  55.563  1.00 9.87   ? 279 TYR C CZ    1 
ATOM   8373  O OH    . TYR C 1 279 ? 10.315  51.354  56.820  1.00 16.06  ? 279 TYR C OH    1 
ATOM   8374  H H     . TYR C 1 279 ? 6.397   52.357  53.403  1.00 0.00   ? 279 TYR C H     1 
ATOM   8375  H HH    . TYR C 1 279 ? 10.941  50.607  56.800  1.00 0.00   ? 279 TYR C HH    1 
ATOM   8376  N N     . GLU C 1 280 ? 5.135   50.111  52.275  1.00 6.65   ? 280 GLU C N     1 
ATOM   8377  C CA    . GLU C 1 280 ? 4.432   48.847  52.257  1.00 7.12   ? 280 GLU C CA    1 
ATOM   8378  C C     . GLU C 1 280 ? 2.969   49.118  51.970  1.00 7.54   ? 280 GLU C C     1 
ATOM   8379  O O     . GLU C 1 280 ? 2.455   48.724  50.922  1.00 11.02  ? 280 GLU C O     1 
ATOM   8380  C CB    . GLU C 1 280 ? 4.556   48.124  53.597  1.00 9.98   ? 280 GLU C CB    1 
ATOM   8381  C CG    . GLU C 1 280 ? 5.979   47.813  54.005  1.00 12.56  ? 280 GLU C CG    1 
ATOM   8382  C CD    . GLU C 1 280 ? 6.089   46.681  55.004  1.00 14.54  ? 280 GLU C CD    1 
ATOM   8383  O OE1   . GLU C 1 280 ? 6.019   46.921  56.193  1.00 14.95  ? 280 GLU C OE1   1 
ATOM   8384  O OE2   . GLU C 1 280 ? 6.257   45.543  54.599  1.00 17.31  ? 280 GLU C OE2   1 
ATOM   8385  H H     . GLU C 1 280 ? 4.778   50.836  52.822  1.00 0.00   ? 280 GLU C H     1 
ATOM   8386  N N     . CYS C 1 281 ? 2.262   49.855  52.826  1.00 6.57   ? 281 CYS C N     1 
ATOM   8387  C CA    . CYS C 1 281 ? 0.838   50.096  52.619  1.00 7.71   ? 281 CYS C CA    1 
ATOM   8388  C C     . CYS C 1 281 ? 0.506   51.005  51.453  1.00 5.95   ? 281 CYS C C     1 
ATOM   8389  O O     . CYS C 1 281 ? -0.336  50.657  50.615  1.00 8.29   ? 281 CYS C O     1 
ATOM   8390  C CB    . CYS C 1 281 ? 0.181   50.736  53.807  1.00 5.55   ? 281 CYS C CB    1 
ATOM   8391  S SG    . CYS C 1 281 ? 0.396   49.793  55.303  1.00 10.74  ? 281 CYS C SG    1 
ATOM   8392  H H     . CYS C 1 281 ? 2.691   50.199  53.636  1.00 0.00   ? 281 CYS C H     1 
ATOM   8393  N N     . ASN C 1 282 ? 1.097   52.189  51.359  1.00 3.05   ? 282 ASN C N     1 
ATOM   8394  C CA    . ASN C 1 282 ? 0.760   53.085  50.267  1.00 4.52   ? 282 ASN C CA    1 
ATOM   8395  C C     . ASN C 1 282 ? 1.017   52.473  48.901  1.00 6.11   ? 282 ASN C C     1 
ATOM   8396  O O     . ASN C 1 282 ? 0.061   52.446  48.132  1.00 10.76  ? 282 ASN C O     1 
ATOM   8397  C CB    . ASN C 1 282 ? 1.516   54.404  50.398  1.00 5.05   ? 282 ASN C CB    1 
ATOM   8398  C CG    . ASN C 1 282 ? 0.739   55.490  51.135  1.00 9.26   ? 282 ASN C CG    1 
ATOM   8399  O OD1   . ASN C 1 282 ? 1.261   56.528  51.562  1.00 11.55  ? 282 ASN C OD1   1 
ATOM   8400  N ND2   . ASN C 1 282 ? -0.562  55.379  51.325  1.00 11.49  ? 282 ASN C ND2   1 
ATOM   8401  H H     . ASN C 1 282 ? 1.794   52.444  51.999  1.00 0.00   ? 282 ASN C H     1 
ATOM   8402  H HD21  . ASN C 1 282 ? -0.982  56.116  51.835  1.00 0.00   ? 282 ASN C HD21  1 
ATOM   8403  H HD22  . ASN C 1 282 ? -1.060  54.615  50.984  1.00 0.00   ? 282 ASN C HD22  1 
ATOM   8404  N N     . PRO C 1 283 ? 2.123   51.847  48.504  1.00 10.11  ? 283 PRO C N     1 
ATOM   8405  C CA    . PRO C 1 283 ? 2.254   51.215  47.189  1.00 10.64  ? 283 PRO C CA    1 
ATOM   8406  C C     . PRO C 1 283 ? 1.168   50.172  46.880  1.00 9.29   ? 283 PRO C C     1 
ATOM   8407  O O     . PRO C 1 283 ? 0.656   50.084  45.760  1.00 7.83   ? 283 PRO C O     1 
ATOM   8408  C CB    . PRO C 1 283 ? 3.658   50.642  47.226  1.00 8.49   ? 283 PRO C CB    1 
ATOM   8409  C CG    . PRO C 1 283 ? 4.394   51.519  48.195  1.00 6.63   ? 283 PRO C CG    1 
ATOM   8410  C CD    . PRO C 1 283 ? 3.349   51.673  49.275  1.00 8.76   ? 283 PRO C CD    1 
ATOM   8411  N N     . MET C 1 284 ? 0.769   49.368  47.867  1.00 10.72  ? 284 MET C N     1 
ATOM   8412  C CA    . MET C 1 284 ? -0.247  48.363  47.652  1.00 8.55   ? 284 MET C CA    1 
ATOM   8413  C C     . MET C 1 284 ? -1.619  49.010  47.544  1.00 9.66   ? 284 MET C C     1 
ATOM   8414  O O     . MET C 1 284 ? -2.441  48.605  46.712  1.00 10.82  ? 284 MET C O     1 
ATOM   8415  C CB    . MET C 1 284 ? -0.211  47.360  48.803  1.00 11.85  ? 284 MET C CB    1 
ATOM   8416  C CG    . MET C 1 284 ? 1.123   46.636  48.837  1.00 5.69   ? 284 MET C CG    1 
ATOM   8417  S SD    . MET C 1 284 ? 1.468   45.915  47.222  1.00 13.20  ? 284 MET C SD    1 
ATOM   8418  C CE    . MET C 1 284 ? 2.683   44.720  47.656  1.00 2.60   ? 284 MET C CE    1 
ATOM   8419  H H     . MET C 1 284 ? 1.179   49.444  48.755  1.00 0.00   ? 284 MET C H     1 
ATOM   8420  N N     . ALA C 1 285 ? -1.904  50.049  48.319  1.00 6.86   ? 285 ALA C N     1 
ATOM   8421  C CA    . ALA C 1 285 ? -3.175  50.745  48.245  1.00 2.00   ? 285 ALA C CA    1 
ATOM   8422  C C     . ALA C 1 285 ? -3.330  51.353  46.877  1.00 4.73   ? 285 ALA C C     1 
ATOM   8423  O O     . ALA C 1 285 ? -4.401  51.268  46.286  1.00 11.49  ? 285 ALA C O     1 
ATOM   8424  C CB    . ALA C 1 285 ? -3.254  51.878  49.217  1.00 5.16   ? 285 ALA C CB    1 
ATOM   8425  H H     . ALA C 1 285 ? -1.222  50.362  48.946  1.00 0.00   ? 285 ALA C H     1 
ATOM   8426  N N     . TYR C 1 286 ? -2.253  51.892  46.313  1.00 6.99   ? 286 TYR C N     1 
ATOM   8427  C CA    . TYR C 1 286 ? -2.322  52.514  45.011  1.00 3.37   ? 286 TYR C CA    1 
ATOM   8428  C C     . TYR C 1 286 ? -2.595  51.473  43.955  1.00 4.18   ? 286 TYR C C     1 
ATOM   8429  O O     . TYR C 1 286 ? -3.385  51.717  43.051  1.00 9.49   ? 286 TYR C O     1 
ATOM   8430  C CB    . TYR C 1 286 ? -1.023  53.222  44.778  1.00 5.99   ? 286 TYR C CB    1 
ATOM   8431  C CG    . TYR C 1 286 ? -0.998  54.117  43.539  1.00 11.14  ? 286 TYR C CG    1 
ATOM   8432  C CD1   . TYR C 1 286 ? -1.492  55.422  43.571  1.00 7.53   ? 286 TYR C CD1   1 
ATOM   8433  C CD2   . TYR C 1 286 ? -0.453  53.592  42.377  1.00 6.80   ? 286 TYR C CD2   1 
ATOM   8434  C CE1   . TYR C 1 286 ? -1.432  56.192  42.422  1.00 6.25   ? 286 TYR C CE1   1 
ATOM   8435  C CE2   . TYR C 1 286 ? -0.390  54.360  41.238  1.00 5.16   ? 286 TYR C CE2   1 
ATOM   8436  C CZ    . TYR C 1 286 ? -0.869  55.650  41.272  1.00 4.83   ? 286 TYR C CZ    1 
ATOM   8437  O OH    . TYR C 1 286 ? -0.755  56.389  40.111  1.00 10.74  ? 286 TYR C OH    1 
ATOM   8438  H H     . TYR C 1 286 ? -1.407  51.898  46.808  1.00 0.00   ? 286 TYR C H     1 
ATOM   8439  H HH    . TYR C 1 286 ? 0.173   56.631  39.997  1.00 0.00   ? 286 TYR C HH    1 
ATOM   8440  N N     . VAL C 1 287 ? -1.986  50.296  44.058  1.00 7.69   ? 287 VAL C N     1 
ATOM   8441  C CA    . VAL C 1 287 ? -2.230  49.224  43.115  1.00 7.66   ? 287 VAL C CA    1 
ATOM   8442  C C     . VAL C 1 287 ? -3.676  48.735  43.279  1.00 9.82   ? 287 VAL C C     1 
ATOM   8443  O O     . VAL C 1 287 ? -4.394  48.543  42.292  1.00 6.11   ? 287 VAL C O     1 
ATOM   8444  C CB    . VAL C 1 287 ? -1.215  48.091  43.383  1.00 7.79   ? 287 VAL C CB    1 
ATOM   8445  C CG1   . VAL C 1 287 ? -1.577  46.836  42.604  1.00 2.00   ? 287 VAL C CG1   1 
ATOM   8446  C CG2   . VAL C 1 287 ? 0.174   48.561  42.940  1.00 8.30   ? 287 VAL C CG2   1 
ATOM   8447  H H     . VAL C 1 287 ? -1.320  50.168  44.769  1.00 0.00   ? 287 VAL C H     1 
ATOM   8448  N N     . MET C 1 288 ? -4.154  48.591  44.512  1.00 10.02  ? 288 MET C N     1 
ATOM   8449  C CA    . MET C 1 288 ? -5.510  48.146  44.742  1.00 12.12  ? 288 MET C CA    1 
ATOM   8450  C C     . MET C 1 288 ? -6.474  49.133  44.142  1.00 13.68  ? 288 MET C C     1 
ATOM   8451  O O     . MET C 1 288 ? -7.323  48.727  43.350  1.00 15.94  ? 288 MET C O     1 
ATOM   8452  C CB    . MET C 1 288 ? -5.813  48.018  46.225  1.00 11.81  ? 288 MET C CB    1 
ATOM   8453  C CG    . MET C 1 288 ? -5.333  46.686  46.739  1.00 15.31  ? 288 MET C CG    1 
ATOM   8454  S SD    . MET C 1 288 ? -5.984  45.405  45.656  1.00 13.20  ? 288 MET C SD    1 
ATOM   8455  C CE    . MET C 1 288 ? -4.725  44.168  45.648  1.00 14.94  ? 288 MET C CE    1 
ATOM   8456  H H     . MET C 1 288 ? -3.583  48.812  45.270  1.00 0.00   ? 288 MET C H     1 
ATOM   8457  N N     . GLU C 1 289 ? -6.297  50.425  44.407  1.00 12.74  ? 289 GLU C N     1 
ATOM   8458  C CA    . GLU C 1 289 ? -7.217  51.429  43.926  1.00 14.98  ? 289 GLU C CA    1 
ATOM   8459  C C     . GLU C 1 289 ? -7.236  51.619  42.426  1.00 16.06  ? 289 GLU C C     1 
ATOM   8460  O O     . GLU C 1 289 ? -8.293  51.874  41.853  1.00 17.35  ? 289 GLU C O     1 
ATOM   8461  C CB    . GLU C 1 289 ? -6.910  52.741  44.555  1.00 20.37  ? 289 GLU C CB    1 
ATOM   8462  C CG    . GLU C 1 289 ? -7.564  52.796  45.931  1.00 24.21  ? 289 GLU C CG    1 
ATOM   8463  C CD    . GLU C 1 289 ? -7.734  54.204  46.476  1.00 21.01  ? 289 GLU C CD    1 
ATOM   8464  O OE1   . GLU C 1 289 ? -7.882  55.128  45.676  1.00 22.52  ? 289 GLU C OE1   1 
ATOM   8465  O OE2   . GLU C 1 289 ? -7.724  54.371  47.695  1.00 20.62  ? 289 GLU C OE2   1 
ATOM   8466  H H     . GLU C 1 289 ? -5.497  50.699  44.893  1.00 0.00   ? 289 GLU C H     1 
ATOM   8467  N N     . LYS C 1 290 ? -6.106  51.496  41.754  1.00 11.36  ? 290 LYS C N     1 
ATOM   8468  C CA    . LYS C 1 290 ? -6.088  51.614  40.316  1.00 8.87   ? 290 LYS C CA    1 
ATOM   8469  C C     . LYS C 1 290 ? -6.619  50.340  39.696  1.00 9.50   ? 290 LYS C C     1 
ATOM   8470  O O     . LYS C 1 290 ? -6.980  50.328  38.523  1.00 9.46   ? 290 LYS C O     1 
ATOM   8471  C CB    . LYS C 1 290 ? -4.667  51.854  39.860  1.00 14.06  ? 290 LYS C CB    1 
ATOM   8472  C CG    . LYS C 1 290 ? -4.162  53.247  40.159  1.00 15.59  ? 290 LYS C CG    1 
ATOM   8473  C CD    . LYS C 1 290 ? -4.916  54.208  39.273  1.00 21.00  ? 290 LYS C CD    1 
ATOM   8474  C CE    . LYS C 1 290 ? -4.542  55.604  39.716  1.00 31.74  ? 290 LYS C CE    1 
ATOM   8475  N NZ    . LYS C 1 290 ? -5.064  56.605  38.799  1.00 36.87  ? 290 LYS C NZ    1 
ATOM   8476  H H     . LYS C 1 290 ? -5.264  51.348  42.240  1.00 0.00   ? 290 LYS C H     1 
ATOM   8477  H HZ1   . LYS C 1 290 ? -4.685  56.434  37.846  1.00 0.00   ? 290 LYS C HZ1   1 
ATOM   8478  H HZ2   . LYS C 1 290 ? -6.101  56.545  38.767  1.00 0.00   ? 290 LYS C HZ2   1 
ATOM   8479  H HZ3   . LYS C 1 290 ? -4.781  57.555  39.114  1.00 0.00   ? 290 LYS C HZ3   1 
ATOM   8480  N N     . ALA C 1 291 ? -6.602  49.225  40.430  1.00 8.32   ? 291 ALA C N     1 
ATOM   8481  C CA    . ALA C 1 291 ? -7.172  47.986  39.943  1.00 9.89   ? 291 ALA C CA    1 
ATOM   8482  C C     . ALA C 1 291 ? -8.663  47.912  40.288  1.00 14.33  ? 291 ALA C C     1 
ATOM   8483  O O     . ALA C 1 291 ? -9.303  46.882  40.087  1.00 17.23  ? 291 ALA C O     1 
ATOM   8484  C CB    . ALA C 1 291 ? -6.466  46.803  40.583  1.00 4.21   ? 291 ALA C CB    1 
ATOM   8485  H H     . ALA C 1 291 ? -6.144  49.213  41.298  1.00 0.00   ? 291 ALA C H     1 
ATOM   8486  N N     . GLY C 1 292 ? -9.273  48.967  40.828  1.00 14.56  ? 292 GLY C N     1 
ATOM   8487  C CA    . GLY C 1 292 ? -10.681 48.999  41.195  1.00 12.96  ? 292 GLY C CA    1 
ATOM   8488  C C     . GLY C 1 292 ? -10.971 48.347  42.536  1.00 8.27   ? 292 GLY C C     1 
ATOM   8489  O O     . GLY C 1 292 ? -12.056 47.799  42.761  1.00 11.30  ? 292 GLY C O     1 
ATOM   8490  H H     . GLY C 1 292 ? -8.741  49.770  41.000  1.00 0.00   ? 292 GLY C H     1 
ATOM   8491  N N     . GLY C 1 293 ? -10.018 48.400  43.443  1.00 6.60   ? 293 GLY C N     1 
ATOM   8492  C CA    . GLY C 1 293 ? -10.180 47.774  44.736  1.00 6.28   ? 293 GLY C CA    1 
ATOM   8493  C C     . GLY C 1 293 ? -10.194 48.860  45.772  1.00 5.02   ? 293 GLY C C     1 
ATOM   8494  O O     . GLY C 1 293 ? -10.222 50.046  45.447  1.00 7.33   ? 293 GLY C O     1 
ATOM   8495  H H     . GLY C 1 293 ? -9.224  48.940  43.281  1.00 0.00   ? 293 GLY C H     1 
ATOM   8496  N N     . MET C 1 294 ? -10.139 48.499  47.031  1.00 7.54   ? 294 MET C N     1 
ATOM   8497  C CA    . MET C 1 294 ? -10.156 49.491  48.071  1.00 5.44   ? 294 MET C CA    1 
ATOM   8498  C C     . MET C 1 294 ? -9.064  49.157  49.046  1.00 8.25   ? 294 MET C C     1 
ATOM   8499  O O     . MET C 1 294 ? -8.641  48.007  49.106  1.00 6.42   ? 294 MET C O     1 
ATOM   8500  C CB    . MET C 1 294 ? -11.475 49.451  48.754  1.00 13.79  ? 294 MET C CB    1 
ATOM   8501  C CG    . MET C 1 294 ? -12.557 50.232  48.039  1.00 15.72  ? 294 MET C CG    1 
ATOM   8502  S SD    . MET C 1 294 ? -14.000 50.267  49.114  1.00 18.20  ? 294 MET C SD    1 
ATOM   8503  C CE    . MET C 1 294 ? -15.093 49.797  47.816  1.00 12.33  ? 294 MET C CE    1 
ATOM   8504  H H     . MET C 1 294 ? -10.028 47.554  47.272  1.00 0.00   ? 294 MET C H     1 
ATOM   8505  N N     . ALA C 1 295 ? -8.577  50.141  49.789  1.00 13.45  ? 295 ALA C N     1 
ATOM   8506  C CA    . ALA C 1 295 ? -7.559  49.961  50.810  1.00 12.75  ? 295 ALA C CA    1 
ATOM   8507  C C     . ALA C 1 295 ? -7.865  50.996  51.890  1.00 13.38  ? 295 ALA C C     1 
ATOM   8508  O O     . ALA C 1 295 ? -7.987  52.205  51.625  1.00 9.37   ? 295 ALA C O     1 
ATOM   8509  C CB    . ALA C 1 295 ? -6.196  50.224  50.229  1.00 8.77   ? 295 ALA C CB    1 
ATOM   8510  H H     . ALA C 1 295 ? -8.942  51.048  49.665  1.00 0.00   ? 295 ALA C H     1 
ATOM   8511  N N     . THR C 1 296 ? -7.996  50.531  53.124  1.00 13.83  ? 296 THR C N     1 
ATOM   8512  C CA    . THR C 1 296 ? -8.434  51.389  54.198  1.00 13.54  ? 296 THR C CA    1 
ATOM   8513  C C     . THR C 1 296 ? -7.711  51.068  55.486  1.00 9.19   ? 296 THR C C     1 
ATOM   8514  O O     . THR C 1 296 ? -7.155  49.990  55.687  1.00 17.95  ? 296 THR C O     1 
ATOM   8515  C CB    . THR C 1 296 ? -9.960  51.198  54.323  1.00 12.16  ? 296 THR C CB    1 
ATOM   8516  O OG1   . THR C 1 296 ? -10.380 52.131  55.290  1.00 19.41  ? 296 THR C OG1   1 
ATOM   8517  C CG2   . THR C 1 296 ? -10.391 49.811  54.766  1.00 15.62  ? 296 THR C CG2   1 
ATOM   8518  H H     . THR C 1 296 ? -7.786  49.597  53.337  1.00 0.00   ? 296 THR C H     1 
ATOM   8519  H HG1   . THR C 1 296 ? -10.843 52.845  54.835  1.00 0.00   ? 296 THR C HG1   1 
ATOM   8520  N N     . THR C 1 297 ? -7.676  52.035  56.361  1.00 12.98  ? 297 THR C N     1 
ATOM   8521  C CA    . THR C 1 297 ? -7.145  51.827  57.681  1.00 17.74  ? 297 THR C CA    1 
ATOM   8522  C C     . THR C 1 297 ? -8.328  51.399  58.540  1.00 20.70  ? 297 THR C C     1 
ATOM   8523  O O     . THR C 1 297 ? -8.181  50.860  59.644  1.00 26.61  ? 297 THR C O     1 
ATOM   8524  C CB    . THR C 1 297 ? -6.507  53.160  58.163  1.00 14.05  ? 297 THR C CB    1 
ATOM   8525  O OG1   . THR C 1 297 ? -7.505  54.182  58.208  1.00 20.96  ? 297 THR C OG1   1 
ATOM   8526  C CG2   . THR C 1 297 ? -5.413  53.607  57.220  1.00 11.17  ? 297 THR C CG2   1 
ATOM   8527  H H     . THR C 1 297 ? -8.027  52.921  56.135  1.00 0.00   ? 297 THR C H     1 
ATOM   8528  H HG1   . THR C 1 297 ? -7.043  55.026  58.148  1.00 0.00   ? 297 THR C HG1   1 
ATOM   8529  N N     . GLY C 1 298 ? -9.533  51.594  58.003  1.00 18.51  ? 298 GLY C N     1 
ATOM   8530  C CA    . GLY C 1 298 ? -10.753 51.423  58.730  1.00 21.70  ? 298 GLY C CA    1 
ATOM   8531  C C     . GLY C 1 298 ? -11.319 52.834  58.902  1.00 24.38  ? 298 GLY C C     1 
ATOM   8532  O O     . GLY C 1 298 ? -12.427 53.124  58.478  1.00 24.38  ? 298 GLY C O     1 
ATOM   8533  H H     . GLY C 1 298 ? -9.617  51.874  57.068  1.00 0.00   ? 298 GLY C H     1 
ATOM   8534  N N     . LYS C 1 299 ? -10.545 53.768  59.453  1.00 27.12  ? 299 LYS C N     1 
ATOM   8535  C CA    . LYS C 1 299 ? -11.027 55.119  59.697  1.00 27.11  ? 299 LYS C CA    1 
ATOM   8536  C C     . LYS C 1 299 ? -10.896 56.020  58.501  1.00 25.78  ? 299 LYS C C     1 
ATOM   8537  O O     . LYS C 1 299 ? -11.579 57.030  58.469  1.00 30.80  ? 299 LYS C O     1 
ATOM   8538  C CB    . LYS C 1 299 ? -10.277 55.756  60.853  1.00 36.37  ? 299 LYS C CB    1 
ATOM   8539  C CG    . LYS C 1 299 ? -10.517 55.001  62.168  1.00 50.93  ? 299 LYS C CG    1 
ATOM   8540  C CD    . LYS C 1 299 ? -9.620  55.481  63.315  1.00 56.88  ? 299 LYS C CD    1 
ATOM   8541  C CE    . LYS C 1 299 ? -9.806  54.580  64.543  1.00 61.99  ? 299 LYS C CE    1 
ATOM   8542  N NZ    . LYS C 1 299 ? -9.026  55.028  65.687  1.00 65.80  ? 299 LYS C NZ    1 
ATOM   8543  H H     . LYS C 1 299 ? -9.625  53.534  59.686  1.00 0.00   ? 299 LYS C H     1 
ATOM   8544  H HZ1   . LYS C 1 299 ? -8.014  55.047  65.444  1.00 0.00   ? 299 LYS C HZ1   1 
ATOM   8545  H HZ2   . LYS C 1 299 ? -9.331  55.985  65.959  1.00 0.00   ? 299 LYS C HZ2   1 
ATOM   8546  H HZ3   . LYS C 1 299 ? -9.179  54.380  66.484  1.00 0.00   ? 299 LYS C HZ3   1 
ATOM   8547  N N     . GLU C 1 300 ? -10.022 55.762  57.528  1.00 25.89  ? 300 GLU C N     1 
ATOM   8548  C CA    . GLU C 1 300 ? -9.875  56.594  56.341  1.00 21.96  ? 300 GLU C CA    1 
ATOM   8549  C C     . GLU C 1 300 ? -9.117  55.772  55.328  1.00 19.29  ? 300 GLU C C     1 
ATOM   8550  O O     . GLU C 1 300 ? -8.546  54.728  55.645  1.00 19.94  ? 300 GLU C O     1 
ATOM   8551  C CB    . GLU C 1 300 ? -9.079  57.878  56.619  1.00 26.72  ? 300 GLU C CB    1 
ATOM   8552  C CG    . GLU C 1 300 ? -7.618  57.656  56.992  1.00 37.97  ? 300 GLU C CG    1 
ATOM   8553  C CD    . GLU C 1 300 ? -7.065  58.569  58.090  1.00 42.08  ? 300 GLU C CD    1 
ATOM   8554  O OE1   . GLU C 1 300 ? -7.246  59.790  58.040  1.00 45.00  ? 300 GLU C OE1   1 
ATOM   8555  O OE2   . GLU C 1 300 ? -6.419  58.043  58.999  1.00 45.70  ? 300 GLU C OE2   1 
ATOM   8556  H H     . GLU C 1 300 ? -9.457  54.961  57.584  1.00 0.00   ? 300 GLU C H     1 
ATOM   8557  N N     . ALA C 1 301 ? -9.105  56.240  54.094  1.00 15.65  ? 301 ALA C N     1 
ATOM   8558  C CA    . ALA C 1 301 ? -8.380  55.575  53.034  1.00 14.94  ? 301 ALA C CA    1 
ATOM   8559  C C     . ALA C 1 301 ? -6.901  55.782  53.327  1.00 15.23  ? 301 ALA C C     1 
ATOM   8560  O O     . ALA C 1 301 ? -6.472  56.889  53.691  1.00 14.96  ? 301 ALA C O     1 
ATOM   8561  C CB    . ALA C 1 301 ? -8.677  56.192  51.673  1.00 13.67  ? 301 ALA C CB    1 
ATOM   8562  H H     . ALA C 1 301 ? -9.505  57.113  53.910  1.00 0.00   ? 301 ALA C H     1 
ATOM   8563  N N     . VAL C 1 302 ? -6.142  54.697  53.107  1.00 15.99  ? 302 VAL C N     1 
ATOM   8564  C CA    . VAL C 1 302 ? -4.706  54.665  53.337  1.00 11.22  ? 302 VAL C CA    1 
ATOM   8565  C C     . VAL C 1 302 ? -4.071  55.747  52.490  1.00 8.32   ? 302 VAL C C     1 
ATOM   8566  O O     . VAL C 1 302 ? -3.291  56.549  52.999  1.00 12.20  ? 302 VAL C O     1 
ATOM   8567  C CB    . VAL C 1 302 ? -4.133  53.255  52.969  1.00 11.96  ? 302 VAL C CB    1 
ATOM   8568  C CG1   . VAL C 1 302 ? -2.608  53.236  53.091  1.00 8.32   ? 302 VAL C CG1   1 
ATOM   8569  C CG2   . VAL C 1 302 ? -4.618  52.214  53.964  1.00 2.00   ? 302 VAL C CG2   1 
ATOM   8570  H H     . VAL C 1 302 ? -6.575  53.914  52.706  1.00 0.00   ? 302 VAL C H     1 
ATOM   8571  N N     . LEU C 1 303 ? -4.449  55.862  51.219  1.00 5.44   ? 303 LEU C N     1 
ATOM   8572  C CA    . LEU C 1 303 ? -3.869  56.890  50.381  1.00 3.60   ? 303 LEU C CA    1 
ATOM   8573  C C     . LEU C 1 303 ? -4.031  58.318  50.850  1.00 5.73   ? 303 LEU C C     1 
ATOM   8574  O O     . LEU C 1 303 ? -3.347  59.209  50.343  1.00 10.28  ? 303 LEU C O     1 
ATOM   8575  C CB    . LEU C 1 303 ? -4.430  56.770  48.974  1.00 4.71   ? 303 LEU C CB    1 
ATOM   8576  C CG    . LEU C 1 303 ? -3.847  55.636  48.129  1.00 7.39   ? 303 LEU C CG    1 
ATOM   8577  C CD1   . LEU C 1 303 ? -4.257  55.784  46.676  1.00 9.72   ? 303 LEU C CD1   1 
ATOM   8578  C CD2   . LEU C 1 303 ? -2.344  55.700  48.183  1.00 2.00   ? 303 LEU C CD2   1 
ATOM   8579  H H     . LEU C 1 303 ? -5.123  55.245  50.851  1.00 0.00   ? 303 LEU C H     1 
ATOM   8580  N N     . ASP C 1 304 ? -4.898  58.587  51.810  1.00 7.61   ? 304 ASP C N     1 
ATOM   8581  C CA    . ASP C 1 304 ? -5.125  59.946  52.225  1.00 6.71   ? 304 ASP C CA    1 
ATOM   8582  C C     . ASP C 1 304 ? -4.531  60.185  53.580  1.00 6.60   ? 304 ASP C C     1 
ATOM   8583  O O     . ASP C 1 304 ? -4.690  61.314  54.042  1.00 13.84  ? 304 ASP C O     1 
ATOM   8584  C CB    . ASP C 1 304 ? -6.623  60.258  52.278  1.00 7.80   ? 304 ASP C CB    1 
ATOM   8585  C CG    . ASP C 1 304 ? -7.363  60.175  50.944  1.00 15.31  ? 304 ASP C CG    1 
ATOM   8586  O OD1   . ASP C 1 304 ? -6.766  60.507  49.920  1.00 14.26  ? 304 ASP C OD1   1 
ATOM   8587  O OD2   . ASP C 1 304 ? -8.541  59.780  50.931  1.00 16.83  ? 304 ASP C OD2   1 
ATOM   8588  H H     . ASP C 1 304 ? -5.311  57.873  52.336  1.00 0.00   ? 304 ASP C H     1 
ATOM   8589  N N     . VAL C 1 305 ? -3.835  59.276  54.276  1.00 6.85   ? 305 VAL C N     1 
ATOM   8590  C CA    . VAL C 1 305 ? -3.336  59.677  55.587  1.00 9.99   ? 305 VAL C CA    1 
ATOM   8591  C C     . VAL C 1 305 ? -2.068  60.500  55.332  1.00 15.06  ? 305 VAL C C     1 
ATOM   8592  O O     . VAL C 1 305 ? -1.380  60.314  54.320  1.00 17.04  ? 305 VAL C O     1 
ATOM   8593  C CB    . VAL C 1 305 ? -3.039  58.434  56.572  1.00 5.85   ? 305 VAL C CB    1 
ATOM   8594  C CG1   . VAL C 1 305 ? -3.821  57.216  56.167  1.00 2.00   ? 305 VAL C CG1   1 
ATOM   8595  C CG2   . VAL C 1 305 ? -1.603  58.051  56.588  1.00 13.42  ? 305 VAL C CG2   1 
ATOM   8596  H H     . VAL C 1 305 ? -3.555  58.434  53.855  1.00 0.00   ? 305 VAL C H     1 
ATOM   8597  N N     . ILE C 1 306 ? -1.719  61.443  56.196  1.00 18.03  ? 306 ILE C N     1 
ATOM   8598  C CA    . ILE C 1 306 ? -0.531  62.257  56.005  1.00 21.73  ? 306 ILE C CA    1 
ATOM   8599  C C     . ILE C 1 306 ? 0.589   61.681  56.878  1.00 22.93  ? 306 ILE C C     1 
ATOM   8600  O O     . ILE C 1 306 ? 0.377   61.419  58.072  1.00 25.02  ? 306 ILE C O     1 
ATOM   8601  C CB    . ILE C 1 306 ? -0.958  63.727  56.332  1.00 24.25  ? 306 ILE C CB    1 
ATOM   8602  C CG1   . ILE C 1 306 ? -1.448  64.249  54.989  1.00 27.87  ? 306 ILE C CG1   1 
ATOM   8603  C CG2   . ILE C 1 306 ? 0.123   64.624  56.946  1.00 25.92  ? 306 ILE C CG2   1 
ATOM   8604  C CD1   . ILE C 1 306 ? -1.726  65.755  54.874  1.00 34.30  ? 306 ILE C CD1   1 
ATOM   8605  H H     . ILE C 1 306 ? -2.245  61.562  57.011  1.00 0.00   ? 306 ILE C H     1 
ATOM   8606  N N     . PRO C 1 307 ? 1.744   61.322  56.297  1.00 19.01  ? 307 PRO C N     1 
ATOM   8607  C CA    . PRO C 1 307 ? 2.871   60.787  57.022  1.00 17.73  ? 307 PRO C CA    1 
ATOM   8608  C C     . PRO C 1 307 ? 3.465   61.872  57.900  1.00 16.95  ? 307 PRO C C     1 
ATOM   8609  O O     . PRO C 1 307 ? 3.483   63.040  57.522  1.00 21.67  ? 307 PRO C O     1 
ATOM   8610  C CB    . PRO C 1 307 ? 3.830   60.312  55.953  1.00 15.85  ? 307 PRO C CB    1 
ATOM   8611  C CG    . PRO C 1 307 ? 2.978   60.221  54.720  1.00 17.47  ? 307 PRO C CG    1 
ATOM   8612  C CD    . PRO C 1 307 ? 2.060   61.405  54.880  1.00 14.18  ? 307 PRO C CD    1 
ATOM   8613  N N     . THR C 1 308 ? 3.950   61.532  59.078  1.00 20.75  ? 308 THR C N     1 
ATOM   8614  C CA    . THR C 1 308 ? 4.658   62.486  59.912  1.00 24.04  ? 308 THR C CA    1 
ATOM   8615  C C     . THR C 1 308 ? 6.081   61.978  60.016  1.00 23.14  ? 308 THR C C     1 
ATOM   8616  O O     . THR C 1 308 ? 7.024   62.751  60.154  1.00 24.22  ? 308 THR C O     1 
ATOM   8617  C CB    . THR C 1 308 ? 4.028   62.542  61.294  1.00 26.02  ? 308 THR C CB    1 
ATOM   8618  O OG1   . THR C 1 308 ? 2.622   62.448  61.127  1.00 34.19  ? 308 THR C OG1   1 
ATOM   8619  C CG2   . THR C 1 308 ? 4.311   63.840  62.006  1.00 32.41  ? 308 THR C CG2   1 
ATOM   8620  H H     . THR C 1 308 ? 3.863   60.603  59.379  1.00 0.00   ? 308 THR C H     1 
ATOM   8621  H HG1   . THR C 1 308 ? 2.373   61.847  60.418  1.00 0.00   ? 308 THR C HG1   1 
ATOM   8622  N N     . ASP C 1 309 ? 6.274   60.654  59.964  1.00 24.44  ? 309 ASP C N     1 
ATOM   8623  C CA    . ASP C 1 309 ? 7.586   60.041  60.023  1.00 26.40  ? 309 ASP C CA    1 
ATOM   8624  C C     . ASP C 1 309 ? 7.720   59.067  58.855  1.00 24.97  ? 309 ASP C C     1 
ATOM   8625  O O     . ASP C 1 309 ? 6.713   58.521  58.413  1.00 21.78  ? 309 ASP C O     1 
ATOM   8626  C CB    . ASP C 1 309 ? 7.740   59.314  61.352  1.00 27.60  ? 309 ASP C CB    1 
ATOM   8627  C CG    . ASP C 1 309 ? 7.694   60.253  62.504  1.00 31.49  ? 309 ASP C CG    1 
ATOM   8628  O OD1   . ASP C 1 309 ? 8.619   61.035  62.598  1.00 40.05  ? 309 ASP C OD1   1 
ATOM   8629  O OD2   . ASP C 1 309 ? 6.738   60.244  63.284  1.00 32.59  ? 309 ASP C OD2   1 
ATOM   8630  H H     . ASP C 1 309 ? 5.520   60.044  59.782  1.00 0.00   ? 309 ASP C H     1 
ATOM   8631  N N     . ILE C 1 310 ? 8.924   58.803  58.362  1.00 22.49  ? 310 ILE C N     1 
ATOM   8632  C CA    . ILE C 1 310 ? 9.098   57.897  57.230  1.00 23.62  ? 310 ILE C CA    1 
ATOM   8633  C C     . ILE C 1 310 ? 8.839   56.411  57.503  1.00 23.09  ? 310 ILE C C     1 
ATOM   8634  O O     . ILE C 1 310 ? 8.315   55.686  56.653  1.00 24.47  ? 310 ILE C O     1 
ATOM   8635  C CB    . ILE C 1 310 ? 10.527  58.103  56.623  1.00 24.03  ? 310 ILE C CB    1 
ATOM   8636  C CG1   . ILE C 1 310 ? 11.633  57.961  57.660  1.00 21.83  ? 310 ILE C CG1   1 
ATOM   8637  C CG2   . ILE C 1 310 ? 10.563  59.505  55.983  1.00 16.44  ? 310 ILE C CG2   1 
ATOM   8638  C CD1   . ILE C 1 310 ? 13.050  57.876  57.052  1.00 26.86  ? 310 ILE C CD1   1 
ATOM   8639  H H     . ILE C 1 310 ? 9.679   59.300  58.730  1.00 0.00   ? 310 ILE C H     1 
ATOM   8640  N N     . HIS C 1 311 ? 9.156   55.937  58.711  1.00 21.38  ? 311 HIS C N     1 
ATOM   8641  C CA    . HIS C 1 311 ? 8.972   54.528  59.061  1.00 21.62  ? 311 HIS C CA    1 
ATOM   8642  C C     . HIS C 1 311 ? 7.732   54.401  59.942  1.00 25.09  ? 311 HIS C C     1 
ATOM   8643  O O     . HIS C 1 311 ? 7.745   53.812  61.033  1.00 28.70  ? 311 HIS C O     1 
ATOM   8644  C CB    . HIS C 1 311 ? 10.222  54.025  59.794  1.00 21.98  ? 311 HIS C CB    1 
ATOM   8645  C CG    . HIS C 1 311 ? 11.483  54.050  58.941  1.00 21.51  ? 311 HIS C CG    1 
ATOM   8646  N ND1   . HIS C 1 311 ? 11.508  53.642  57.679  1.00 21.46  ? 311 HIS C ND1   1 
ATOM   8647  C CD2   . HIS C 1 311 ? 12.702  54.580  59.270  1.00 18.18  ? 311 HIS C CD2   1 
ATOM   8648  C CE1   . HIS C 1 311 ? 12.692  53.909  57.206  1.00 22.43  ? 311 HIS C CE1   1 
ATOM   8649  N NE2   . HIS C 1 311 ? 13.389  54.467  58.166  1.00 23.22  ? 311 HIS C NE2   1 
ATOM   8650  H H     . HIS C 1 311 ? 9.403   56.583  59.409  1.00 0.00   ? 311 HIS C H     1 
ATOM   8651  H HD1   . HIS C 1 311 ? 10.805  53.156  57.195  1.00 0.00   ? 311 HIS C HD1   1 
ATOM   8652  H HE2   . HIS C 1 311 ? 14.342  54.665  58.053  1.00 0.00   ? 311 HIS C HE2   1 
ATOM   8653  N N     . GLN C 1 312 ? 6.655   55.032  59.503  1.00 24.59  ? 312 GLN C N     1 
ATOM   8654  C CA    . GLN C 1 312 ? 5.440   55.063  60.286  1.00 23.19  ? 312 GLN C CA    1 
ATOM   8655  C C     . GLN C 1 312 ? 4.673   53.760  60.075  1.00 23.27  ? 312 GLN C C     1 
ATOM   8656  O O     . GLN C 1 312 ? 4.637   53.295  58.935  1.00 25.80  ? 312 GLN C O     1 
ATOM   8657  C CB    . GLN C 1 312 ? 4.680   56.255  59.799  1.00 18.46  ? 312 GLN C CB    1 
ATOM   8658  C CG    . GLN C 1 312 ? 3.412   56.596  60.530  1.00 19.51  ? 312 GLN C CG    1 
ATOM   8659  C CD    . GLN C 1 312 ? 2.714   57.760  59.852  1.00 17.68  ? 312 GLN C CD    1 
ATOM   8660  O OE1   . GLN C 1 312 ? 3.303   58.815  59.626  1.00 16.87  ? 312 GLN C OE1   1 
ATOM   8661  N NE2   . GLN C 1 312 ? 1.458   57.633  59.475  1.00 17.54  ? 312 GLN C NE2   1 
ATOM   8662  H H     . GLN C 1 312 ? 6.652   55.398  58.590  1.00 0.00   ? 312 GLN C H     1 
ATOM   8663  H HE21  . GLN C 1 312 ? 1.018   58.418  59.093  1.00 0.00   ? 312 GLN C HE21  1 
ATOM   8664  H HE22  . GLN C 1 312 ? 1.025   56.763  59.612  1.00 0.00   ? 312 GLN C HE22  1 
ATOM   8665  N N     . ARG C 1 313 ? 4.088   53.131  61.097  1.00 22.28  ? 313 ARG C N     1 
ATOM   8666  C CA    . ARG C 1 313 ? 3.244   51.950  60.931  1.00 18.46  ? 313 ARG C CA    1 
ATOM   8667  C C     . ARG C 1 313 ? 1.832   52.442  60.632  1.00 17.87  ? 313 ARG C C     1 
ATOM   8668  O O     . ARG C 1 313 ? 1.532   53.589  60.990  1.00 21.32  ? 313 ARG C O     1 
ATOM   8669  C CB    . ARG C 1 313 ? 3.163   51.141  62.181  1.00 16.99  ? 313 ARG C CB    1 
ATOM   8670  C CG    . ARG C 1 313 ? 4.185   50.088  62.443  1.00 20.20  ? 313 ARG C CG    1 
ATOM   8671  C CD    . ARG C 1 313 ? 5.569   50.565  62.766  1.00 29.13  ? 313 ARG C CD    1 
ATOM   8672  N NE    . ARG C 1 313 ? 6.277   49.578  63.574  1.00 37.66  ? 313 ARG C NE    1 
ATOM   8673  C CZ    . ARG C 1 313 ? 6.696   48.393  63.110  1.00 44.12  ? 313 ARG C CZ    1 
ATOM   8674  N NH1   . ARG C 1 313 ? 6.536   47.992  61.848  1.00 44.66  ? 313 ARG C NH1   1 
ATOM   8675  N NH2   . ARG C 1 313 ? 7.319   47.571  63.943  1.00 51.71  ? 313 ARG C NH2   1 
ATOM   8676  H H     . ARG C 1 313 ? 4.157   53.520  61.991  1.00 0.00   ? 313 ARG C H     1 
ATOM   8677  H HE    . ARG C 1 313 ? 6.472   49.796  64.508  1.00 0.00   ? 313 ARG C HE    1 
ATOM   8678  H HH11  . ARG C 1 313 ? 6.083   48.586  61.184  1.00 0.00   ? 313 ARG C HH11  1 
ATOM   8679  H HH12  . ARG C 1 313 ? 6.870   47.093  61.566  1.00 0.00   ? 313 ARG C HH12  1 
ATOM   8680  H HH21  . ARG C 1 313 ? 7.465   47.842  64.894  1.00 0.00   ? 313 ARG C HH21  1 
ATOM   8681  H HH22  . ARG C 1 313 ? 7.635   46.680  63.621  1.00 0.00   ? 313 ARG C HH22  1 
ATOM   8682  N N     . ALA C 1 314 ? 0.977   51.624  60.003  1.00 16.35  ? 314 ALA C N     1 
ATOM   8683  C CA    . ALA C 1 314 ? -0.421  51.932  59.703  1.00 8.83   ? 314 ALA C CA    1 
ATOM   8684  C C     . ALA C 1 314 ? -1.257  50.638  59.613  1.00 13.54  ? 314 ALA C C     1 
ATOM   8685  O O     . ALA C 1 314 ? -0.704  49.584  59.251  1.00 6.00   ? 314 ALA C O     1 
ATOM   8686  C CB    . ALA C 1 314 ? -0.547  52.644  58.362  1.00 6.51   ? 314 ALA C CB    1 
ATOM   8687  H H     . ALA C 1 314 ? 1.306   50.752  59.688  1.00 0.00   ? 314 ALA C H     1 
ATOM   8688  N N     . PRO C 1 315 ? -2.568  50.613  59.962  1.00 10.15  ? 315 PRO C N     1 
ATOM   8689  C CA    . PRO C 1 315 ? -3.482  49.517  59.691  1.00 7.50   ? 315 PRO C CA    1 
ATOM   8690  C C     . PRO C 1 315 ? -3.831  49.443  58.224  1.00 6.26   ? 315 PRO C C     1 
ATOM   8691  O O     . PRO C 1 315 ? -3.802  50.453  57.530  1.00 6.53   ? 315 PRO C O     1 
ATOM   8692  C CB    . PRO C 1 315 ? -4.700  49.790  60.518  1.00 4.09   ? 315 PRO C CB    1 
ATOM   8693  C CG    . PRO C 1 315 ? -4.174  50.693  61.591  1.00 8.73   ? 315 PRO C CG    1 
ATOM   8694  C CD    . PRO C 1 315 ? -3.241  51.594  60.795  1.00 7.61   ? 315 PRO C CD    1 
ATOM   8695  N N     . ILE C 1 316 ? -4.183  48.276  57.733  1.00 5.33   ? 316 ILE C N     1 
ATOM   8696  C CA    . ILE C 1 316 ? -4.628  48.198  56.374  1.00 10.91  ? 316 ILE C CA    1 
ATOM   8697  C C     . ILE C 1 316 ? -5.511  46.980  56.191  1.00 11.61  ? 316 ILE C C     1 
ATOM   8698  O O     . ILE C 1 316 ? -5.258  45.882  56.711  1.00 11.20  ? 316 ILE C O     1 
ATOM   8699  C CB    . ILE C 1 316 ? -3.414  48.136  55.408  1.00 13.36  ? 316 ILE C CB    1 
ATOM   8700  C CG1   . ILE C 1 316 ? -3.968  48.283  53.992  1.00 15.98  ? 316 ILE C CG1   1 
ATOM   8701  C CG2   . ILE C 1 316 ? -2.618  46.836  55.555  1.00 11.55  ? 316 ILE C CG2   1 
ATOM   8702  C CD1   . ILE C 1 316 ? -2.978  48.728  52.918  1.00 19.64  ? 316 ILE C CD1   1 
ATOM   8703  H H     . ILE C 1 316 ? -4.112  47.452  58.259  1.00 0.00   ? 316 ILE C H     1 
ATOM   8704  N N     . ILE C 1 317 ? -6.605  47.227  55.503  1.00 8.52   ? 317 ILE C N     1 
ATOM   8705  C CA    . ILE C 1 317 ? -7.486  46.172  55.068  1.00 4.57   ? 317 ILE C CA    1 
ATOM   8706  C C     . ILE C 1 317 ? -7.574  46.481  53.589  1.00 4.17   ? 317 ILE C C     1 
ATOM   8707  O O     . ILE C 1 317 ? -7.888  47.635  53.260  1.00 6.55   ? 317 ILE C O     1 
ATOM   8708  C CB    . ILE C 1 317 ? -8.847  46.316  55.714  1.00 2.00   ? 317 ILE C CB    1 
ATOM   8709  C CG1   . ILE C 1 317 ? -8.763  45.975  57.186  1.00 4.24   ? 317 ILE C CG1   1 
ATOM   8710  C CG2   . ILE C 1 317 ? -9.830  45.458  54.972  1.00 2.00   ? 317 ILE C CG2   1 
ATOM   8711  C CD1   . ILE C 1 317 ? -8.433  47.168  58.118  1.00 4.77   ? 317 ILE C CD1   1 
ATOM   8712  H H     . ILE C 1 317 ? -6.819  48.146  55.237  1.00 0.00   ? 317 ILE C H     1 
ATOM   8713  N N     . LEU C 1 318 ? -7.310  45.582  52.656  1.00 2.77   ? 318 LEU C N     1 
ATOM   8714  C CA    . LEU C 1 318 ? -7.462  45.975  51.265  1.00 4.10   ? 318 LEU C CA    1 
ATOM   8715  C C     . LEU C 1 318 ? -7.977  44.869  50.387  1.00 2.10   ? 318 LEU C C     1 
ATOM   8716  O O     . LEU C 1 318 ? -7.923  43.708  50.788  1.00 8.62   ? 318 LEU C O     1 
ATOM   8717  C CB    . LEU C 1 318 ? -6.117  46.502  50.719  1.00 5.12   ? 318 LEU C CB    1 
ATOM   8718  C CG    . LEU C 1 318 ? -4.778  45.862  50.942  1.00 4.98   ? 318 LEU C CG    1 
ATOM   8719  C CD1   . LEU C 1 318 ? -4.660  44.481  50.349  1.00 11.35  ? 318 LEU C CD1   1 
ATOM   8720  C CD2   . LEU C 1 318 ? -3.795  46.703  50.205  1.00 7.89   ? 318 LEU C CD2   1 
ATOM   8721  H H     . LEU C 1 318 ? -7.102  44.650  52.885  1.00 0.00   ? 318 LEU C H     1 
ATOM   8722  N N     . GLY C 1 319 ? -8.501  45.127  49.216  1.00 4.82   ? 319 GLY C N     1 
ATOM   8723  C CA    . GLY C 1 319 ? -8.935  44.033  48.379  1.00 6.54   ? 319 GLY C CA    1 
ATOM   8724  C C     . GLY C 1 319 ? -10.161 44.411  47.581  1.00 8.84   ? 319 GLY C C     1 
ATOM   8725  O O     . GLY C 1 319 ? -10.365 45.597  47.271  1.00 9.88   ? 319 GLY C O     1 
ATOM   8726  H H     . GLY C 1 319 ? -8.673  46.049  48.936  1.00 0.00   ? 319 GLY C H     1 
ATOM   8727  N N     . SER C 1 320 ? -10.966 43.402  47.260  1.00 5.78   ? 320 SER C N     1 
ATOM   8728  C CA    . SER C 1 320 ? -12.130 43.563  46.446  1.00 4.40   ? 320 SER C CA    1 
ATOM   8729  C C     . SER C 1 320 ? -13.072 44.562  47.059  1.00 10.39  ? 320 SER C C     1 
ATOM   8730  O O     . SER C 1 320 ? -13.292 44.518  48.278  1.00 16.61  ? 320 SER C O     1 
ATOM   8731  C CB    . SER C 1 320 ? -12.808 42.228  46.306  1.00 3.04   ? 320 SER C CB    1 
ATOM   8732  O OG    . SER C 1 320 ? -11.999 41.255  45.652  1.00 5.57   ? 320 SER C OG    1 
ATOM   8733  H H     . SER C 1 320 ? -10.776 42.508  47.604  1.00 0.00   ? 320 SER C H     1 
ATOM   8734  H HG    . SER C 1 320 ? -11.794 41.705  44.813  1.00 0.00   ? 320 SER C HG    1 
ATOM   8735  N N     . PRO C 1 321 ? -13.660 45.456  46.260  1.00 10.31  ? 321 PRO C N     1 
ATOM   8736  C CA    . PRO C 1 321 ? -14.508 46.519  46.746  1.00 11.47  ? 321 PRO C CA    1 
ATOM   8737  C C     . PRO C 1 321 ? -15.642 45.993  47.618  1.00 13.88  ? 321 PRO C C     1 
ATOM   8738  O O     . PRO C 1 321 ? -15.780 46.408  48.775  1.00 14.73  ? 321 PRO C O     1 
ATOM   8739  C CB    . PRO C 1 321 ? -14.958 47.226  45.470  1.00 8.07   ? 321 PRO C CB    1 
ATOM   8740  C CG    . PRO C 1 321 ? -14.845 46.190  44.389  1.00 8.96   ? 321 PRO C CG    1 
ATOM   8741  C CD    . PRO C 1 321 ? -13.584 45.456  44.800  1.00 7.78   ? 321 PRO C CD    1 
ATOM   8742  N N     . ASP C 1 322 ? -16.400 45.004  47.154  1.00 16.33  ? 322 ASP C N     1 
ATOM   8743  C CA    . ASP C 1 322 ? -17.518 44.511  47.947  1.00 19.85  ? 322 ASP C CA    1 
ATOM   8744  C C     . ASP C 1 322 ? -17.064 43.955  49.293  1.00 21.20  ? 322 ASP C C     1 
ATOM   8745  O O     . ASP C 1 322 ? -17.641 44.322  50.320  1.00 29.76  ? 322 ASP C O     1 
ATOM   8746  C CB    . ASP C 1 322 ? -18.281 43.430  47.175  1.00 18.64  ? 322 ASP C CB    1 
ATOM   8747  C CG    . ASP C 1 322 ? -19.209 43.900  46.048  1.00 24.09  ? 322 ASP C CG    1 
ATOM   8748  O OD1   . ASP C 1 322 ? -19.206 45.074  45.650  1.00 26.40  ? 322 ASP C OD1   1 
ATOM   8749  O OD2   . ASP C 1 322 ? -19.966 43.061  45.566  1.00 21.19  ? 322 ASP C OD2   1 
ATOM   8750  H H     . ASP C 1 322 ? -16.200 44.596  46.286  1.00 0.00   ? 322 ASP C H     1 
ATOM   8751  N N     . ASP C 1 323 ? -15.980 43.178  49.358  1.00 16.34  ? 323 ASP C N     1 
ATOM   8752  C CA    . ASP C 1 323 ? -15.503 42.616  50.617  1.00 13.45  ? 323 ASP C CA    1 
ATOM   8753  C C     . ASP C 1 323 ? -15.035 43.688  51.593  1.00 13.49  ? 323 ASP C C     1 
ATOM   8754  O O     . ASP C 1 323 ? -15.316 43.619  52.801  1.00 14.38  ? 323 ASP C O     1 
ATOM   8755  C CB    . ASP C 1 323 ? -14.326 41.698  50.399  1.00 14.67  ? 323 ASP C CB    1 
ATOM   8756  C CG    . ASP C 1 323 ? -14.607 40.478  49.551  1.00 16.37  ? 323 ASP C CG    1 
ATOM   8757  O OD1   . ASP C 1 323 ? -15.191 39.520  50.038  1.00 13.63  ? 323 ASP C OD1   1 
ATOM   8758  O OD2   . ASP C 1 323 ? -14.220 40.486  48.394  1.00 18.05  ? 323 ASP C OD2   1 
ATOM   8759  H H     . ASP C 1 323 ? -15.443 43.068  48.551  1.00 0.00   ? 323 ASP C H     1 
ATOM   8760  N N     . VAL C 1 324 ? -14.332 44.710  51.083  1.00 7.35   ? 324 VAL C N     1 
ATOM   8761  C CA    . VAL C 1 324 ? -13.832 45.749  51.953  1.00 8.13   ? 324 VAL C CA    1 
ATOM   8762  C C     . VAL C 1 324 ? -15.005 46.548  52.501  1.00 10.84  ? 324 VAL C C     1 
ATOM   8763  O O     . VAL C 1 324 ? -14.998 46.937  53.677  1.00 7.85   ? 324 VAL C O     1 
ATOM   8764  C CB    . VAL C 1 324 ? -12.850 46.651  51.176  1.00 10.50  ? 324 VAL C CB    1 
ATOM   8765  C CG1   . VAL C 1 324 ? -12.322 47.790  52.054  1.00 8.26   ? 324 VAL C CG1   1 
ATOM   8766  C CG2   . VAL C 1 324 ? -11.622 45.848  50.788  1.00 8.26   ? 324 VAL C CG2   1 
ATOM   8767  H H     . VAL C 1 324 ? -14.161 44.757  50.117  1.00 0.00   ? 324 VAL C H     1 
ATOM   8768  N N     . LEU C 1 325 ? -16.064 46.740  51.710  1.00 13.93  ? 325 LEU C N     1 
ATOM   8769  C CA    . LEU C 1 325 ? -17.233 47.510  52.146  1.00 16.70  ? 325 LEU C CA    1 
ATOM   8770  C C     . LEU C 1 325 ? -18.002 46.824  53.270  1.00 16.38  ? 325 LEU C C     1 
ATOM   8771  O O     . LEU C 1 325 ? -18.388 47.441  54.276  1.00 15.30  ? 325 LEU C O     1 
ATOM   8772  C CB    . LEU C 1 325 ? -18.107 47.751  50.919  1.00 8.23   ? 325 LEU C CB    1 
ATOM   8773  C CG    . LEU C 1 325 ? -18.355 49.172  50.401  1.00 9.67   ? 325 LEU C CG    1 
ATOM   8774  C CD1   . LEU C 1 325 ? -17.248 50.125  50.760  1.00 2.00   ? 325 LEU C CD1   1 
ATOM   8775  C CD2   . LEU C 1 325 ? -18.496 49.100  48.894  1.00 8.42   ? 325 LEU C CD2   1 
ATOM   8776  H H     . LEU C 1 325 ? -16.042 46.381  50.796  1.00 0.00   ? 325 LEU C H     1 
ATOM   8777  N N     . GLU C 1 326 ? -18.140 45.510  53.113  1.00 13.86  ? 326 GLU C N     1 
ATOM   8778  C CA    . GLU C 1 326 ? -18.730 44.671  54.131  1.00 16.18  ? 326 GLU C CA    1 
ATOM   8779  C C     . GLU C 1 326 ? -17.868 44.727  55.388  1.00 18.20  ? 326 GLU C C     1 
ATOM   8780  O O     . GLU C 1 326 ? -18.438 44.671  56.482  1.00 20.41  ? 326 GLU C O     1 
ATOM   8781  C CB    . GLU C 1 326 ? -18.815 43.259  53.626  1.00 15.76  ? 326 GLU C CB    1 
ATOM   8782  C CG    . GLU C 1 326 ? -19.629 42.313  54.502  1.00 16.21  ? 326 GLU C CG    1 
ATOM   8783  C CD    . GLU C 1 326 ? -19.370 40.842  54.205  1.00 15.48  ? 326 GLU C CD    1 
ATOM   8784  O OE1   . GLU C 1 326 ? -19.496 40.400  53.059  1.00 17.55  ? 326 GLU C OE1   1 
ATOM   8785  O OE2   . GLU C 1 326 ? -19.031 40.135  55.145  1.00 18.50  ? 326 GLU C OE2   1 
ATOM   8786  H H     . GLU C 1 326 ? -17.841 45.093  52.272  1.00 0.00   ? 326 GLU C H     1 
ATOM   8787  N N     . PHE C 1 327 ? -16.527 44.793  55.313  1.00 18.22  ? 327 PHE C N     1 
ATOM   8788  C CA    . PHE C 1 327 ? -15.729 44.995  56.522  1.00 19.87  ? 327 PHE C CA    1 
ATOM   8789  C C     . PHE C 1 327 ? -16.045 46.367  57.083  1.00 21.18  ? 327 PHE C C     1 
ATOM   8790  O O     . PHE C 1 327 ? -16.217 46.511  58.296  1.00 24.07  ? 327 PHE C O     1 
ATOM   8791  C CB    . PHE C 1 327 ? -14.200 44.967  56.286  1.00 22.63  ? 327 PHE C CB    1 
ATOM   8792  C CG    . PHE C 1 327 ? -13.369 45.362  57.533  1.00 20.60  ? 327 PHE C CG    1 
ATOM   8793  C CD1   . PHE C 1 327 ? -13.273 44.510  58.628  1.00 18.83  ? 327 PHE C CD1   1 
ATOM   8794  C CD2   . PHE C 1 327 ? -12.791 46.621  57.620  1.00 18.29  ? 327 PHE C CD2   1 
ATOM   8795  C CE1   . PHE C 1 327 ? -12.649 44.928  59.791  1.00 20.79  ? 327 PHE C CE1   1 
ATOM   8796  C CE2   . PHE C 1 327 ? -12.176 47.036  58.796  1.00 19.30  ? 327 PHE C CE2   1 
ATOM   8797  C CZ    . PHE C 1 327 ? -12.104 46.191  59.884  1.00 18.58  ? 327 PHE C CZ    1 
ATOM   8798  H H     . PHE C 1 327 ? -16.085 44.623  54.453  1.00 0.00   ? 327 PHE C H     1 
ATOM   8799  N N     . LEU C 1 328 ? -16.120 47.390  56.242  1.00 21.28  ? 328 LEU C N     1 
ATOM   8800  C CA    . LEU C 1 328 ? -16.345 48.725  56.727  1.00 22.28  ? 328 LEU C CA    1 
ATOM   8801  C C     . LEU C 1 328 ? -17.674 48.850  57.430  1.00 24.47  ? 328 LEU C C     1 
ATOM   8802  O O     . LEU C 1 328 ? -17.732 49.521  58.459  1.00 22.34  ? 328 LEU C O     1 
ATOM   8803  C CB    . LEU C 1 328 ? -16.264 49.667  55.578  1.00 18.25  ? 328 LEU C CB    1 
ATOM   8804  C CG    . LEU C 1 328 ? -14.817 49.996  55.236  1.00 18.92  ? 328 LEU C CG    1 
ATOM   8805  C CD1   . LEU C 1 328 ? -14.768 50.818  53.953  1.00 18.68  ? 328 LEU C CD1   1 
ATOM   8806  C CD2   . LEU C 1 328 ? -14.184 50.801  56.367  1.00 13.22  ? 328 LEU C CD2   1 
ATOM   8807  H H     . LEU C 1 328 ? -16.016 47.227  55.283  1.00 0.00   ? 328 LEU C H     1 
ATOM   8808  N N     . LYS C 1 329 ? -18.728 48.169  56.973  1.00 25.95  ? 329 LYS C N     1 
ATOM   8809  C CA    . LYS C 1 329 ? -19.993 48.148  57.687  1.00 31.44  ? 329 LYS C CA    1 
ATOM   8810  C C     . LYS C 1 329 ? -19.884 47.544  59.075  1.00 32.49  ? 329 LYS C C     1 
ATOM   8811  O O     . LYS C 1 329 ? -20.293 48.211  60.029  1.00 34.34  ? 329 LYS C O     1 
ATOM   8812  C CB    . LYS C 1 329 ? -21.038 47.384  56.893  1.00 34.01  ? 329 LYS C CB    1 
ATOM   8813  C CG    . LYS C 1 329 ? -21.646 48.410  55.943  1.00 45.07  ? 329 LYS C CG    1 
ATOM   8814  C CD    . LYS C 1 329 ? -22.881 47.868  55.252  1.00 54.56  ? 329 LYS C CD    1 
ATOM   8815  C CE    . LYS C 1 329 ? -23.682 49.034  54.680  1.00 59.63  ? 329 LYS C CE    1 
ATOM   8816  N NZ    . LYS C 1 329 ? -24.957 48.614  54.116  1.00 63.79  ? 329 LYS C NZ    1 
ATOM   8817  H H     . LYS C 1 329 ? -18.635 47.689  56.134  1.00 0.00   ? 329 LYS C H     1 
ATOM   8818  H HZ1   . LYS C 1 329 ? -25.490 48.077  54.828  1.00 0.00   ? 329 LYS C HZ1   1 
ATOM   8819  H HZ2   . LYS C 1 329 ? -25.511 49.448  53.844  1.00 0.00   ? 329 LYS C HZ2   1 
ATOM   8820  H HZ3   . LYS C 1 329 ? -24.800 48.033  53.269  1.00 0.00   ? 329 LYS C HZ3   1 
ATOM   8821  N N     . VAL C 1 330 ? -19.264 46.379  59.300  1.00 34.31  ? 330 VAL C N     1 
ATOM   8822  C CA    . VAL C 1 330 ? -19.143 45.853  60.660  1.00 34.42  ? 330 VAL C CA    1 
ATOM   8823  C C     . VAL C 1 330 ? -18.201 46.738  61.481  1.00 34.28  ? 330 VAL C C     1 
ATOM   8824  O O     . VAL C 1 330 ? -18.343 46.826  62.711  1.00 34.44  ? 330 VAL C O     1 
ATOM   8825  C CB    . VAL C 1 330 ? -18.606 44.366  60.707  1.00 32.69  ? 330 VAL C CB    1 
ATOM   8826  C CG1   . VAL C 1 330 ? -19.424 43.555  59.729  1.00 33.04  ? 330 VAL C CG1   1 
ATOM   8827  C CG2   . VAL C 1 330 ? -17.134 44.248  60.372  1.00 38.29  ? 330 VAL C CG2   1 
ATOM   8828  H H     . VAL C 1 330 ? -18.855 45.911  58.548  1.00 0.00   ? 330 VAL C H     1 
ATOM   8829  N N     . TYR C 1 331 ? -17.259 47.423  60.827  1.00 34.78  ? 331 TYR C N     1 
ATOM   8830  C CA    . TYR C 1 331 ? -16.353 48.308  61.523  1.00 39.48  ? 331 TYR C CA    1 
ATOM   8831  C C     . TYR C 1 331 ? -17.140 49.470  62.076  1.00 38.91  ? 331 TYR C C     1 
ATOM   8832  O O     . TYR C 1 331 ? -17.122 49.690  63.287  1.00 40.52  ? 331 TYR C O     1 
ATOM   8833  C CB    . TYR C 1 331 ? -15.269 48.851  60.600  1.00 41.29  ? 331 TYR C CB    1 
ATOM   8834  C CG    . TYR C 1 331 ? -14.186 49.577  61.385  1.00 43.72  ? 331 TYR C CG    1 
ATOM   8835  C CD1   . TYR C 1 331 ? -13.381 48.862  62.246  1.00 45.78  ? 331 TYR C CD1   1 
ATOM   8836  C CD2   . TYR C 1 331 ? -14.046 50.944  61.265  1.00 44.12  ? 331 TYR C CD2   1 
ATOM   8837  C CE1   . TYR C 1 331 ? -12.442 49.514  63.011  1.00 50.80  ? 331 TYR C CE1   1 
ATOM   8838  C CE2   . TYR C 1 331 ? -13.109 51.604  62.032  1.00 48.94  ? 331 TYR C CE2   1 
ATOM   8839  C CZ    . TYR C 1 331 ? -12.315 50.884  62.898  1.00 49.84  ? 331 TYR C CZ    1 
ATOM   8840  O OH    . TYR C 1 331 ? -11.367 51.544  63.661  1.00 53.61  ? 331 TYR C OH    1 
ATOM   8841  H H     . TYR C 1 331 ? -17.147 47.281  59.862  1.00 0.00   ? 331 TYR C H     1 
ATOM   8842  H HH    . TYR C 1 331 ? -10.906 50.923  64.232  1.00 0.00   ? 331 TYR C HH    1 
ATOM   8843  N N     . GLU C 1 332 ? -17.914 50.140  61.242  1.00 42.01  ? 332 GLU C N     1 
ATOM   8844  C CA    . GLU C 1 332 ? -18.660 51.299  61.684  1.00 50.81  ? 332 GLU C CA    1 
ATOM   8845  C C     . GLU C 1 332 ? -19.727 50.939  62.697  1.00 49.29  ? 332 GLU C C     1 
ATOM   8846  O O     . GLU C 1 332 ? -20.036 51.706  63.608  1.00 52.08  ? 332 GLU C O     1 
ATOM   8847  C CB    . GLU C 1 332 ? -19.248 51.998  60.448  1.00 60.10  ? 332 GLU C CB    1 
ATOM   8848  C CG    . GLU C 1 332 ? -18.054 52.588  59.666  1.00 71.99  ? 332 GLU C CG    1 
ATOM   8849  C CD    . GLU C 1 332 ? -18.345 53.510  58.484  1.00 77.72  ? 332 GLU C CD    1 
ATOM   8850  O OE1   . GLU C 1 332 ? -18.764 53.028  57.427  1.00 79.69  ? 332 GLU C OE1   1 
ATOM   8851  O OE2   . GLU C 1 332 ? -18.119 54.716  58.622  1.00 81.34  ? 332 GLU C OE2   1 
ATOM   8852  H H     . GLU C 1 332 ? -17.980 49.854  60.312  1.00 0.00   ? 332 GLU C H     1 
ATOM   8853  N N     . LYS C 1 333 ? -20.239 49.719  62.645  1.00 49.15  ? 333 LYS C N     1 
ATOM   8854  C CA    . LYS C 1 333 ? -21.170 49.211  63.643  1.00 47.55  ? 333 LYS C CA    1 
ATOM   8855  C C     . LYS C 1 333 ? -20.561 49.209  65.048  1.00 44.33  ? 333 LYS C C     1 
ATOM   8856  O O     . LYS C 1 333 ? -21.250 48.923  66.023  1.00 42.78  ? 333 LYS C O     1 
ATOM   8857  C CB    . LYS C 1 333 ? -21.554 47.806  63.204  1.00 52.33  ? 333 LYS C CB    1 
ATOM   8858  C CG    . LYS C 1 333 ? -22.610 46.996  63.939  1.00 57.45  ? 333 LYS C CG    1 
ATOM   8859  C CD    . LYS C 1 333 ? -22.649 45.629  63.258  1.00 62.61  ? 333 LYS C CD    1 
ATOM   8860  C CE    . LYS C 1 333 ? -23.742 44.732  63.810  1.00 66.10  ? 333 LYS C CE    1 
ATOM   8861  N NZ    . LYS C 1 333 ? -23.766 43.474  63.089  1.00 67.76  ? 333 LYS C NZ    1 
ATOM   8862  H H     . LYS C 1 333 ? -20.024 49.166  61.863  1.00 0.00   ? 333 LYS C H     1 
ATOM   8863  H HZ1   . LYS C 1 333 ? -23.896 43.657  62.074  1.00 0.00   ? 333 LYS C HZ1   1 
ATOM   8864  H HZ2   . LYS C 1 333 ? -22.867 42.978  63.244  1.00 0.00   ? 333 LYS C HZ2   1 
ATOM   8865  H HZ3   . LYS C 1 333 ? -24.550 42.890  63.445  1.00 0.00   ? 333 LYS C HZ3   1 
ATOM   8866  N N     . HIS C 1 334 ? -19.272 49.469  65.242  1.00 43.95  ? 334 HIS C N     1 
ATOM   8867  C CA    . HIS C 1 334 ? -18.661 49.443  66.554  1.00 45.93  ? 334 HIS C CA    1 
ATOM   8868  C C     . HIS C 1 334 ? -17.834 50.703  66.738  1.00 50.51  ? 334 HIS C C     1 
ATOM   8869  O O     . HIS C 1 334 ? -16.675 50.613  67.154  1.00 51.12  ? 334 HIS C O     1 
ATOM   8870  C CB    . HIS C 1 334 ? -17.729 48.246  66.705  1.00 44.14  ? 334 HIS C CB    1 
ATOM   8871  C CG    . HIS C 1 334 ? -18.314 46.857  66.595  1.00 39.03  ? 334 HIS C CG    1 
ATOM   8872  N ND1   . HIS C 1 334 ? -18.656 46.317  65.438  1.00 39.23  ? 334 HIS C ND1   1 
ATOM   8873  C CD2   . HIS C 1 334 ? -18.440 45.924  67.588  1.00 36.58  ? 334 HIS C CD2   1 
ATOM   8874  C CE1   . HIS C 1 334 ? -18.984 45.076  65.679  1.00 37.33  ? 334 HIS C CE1   1 
ATOM   8875  N NE2   . HIS C 1 334 ? -18.845 44.850  66.966  1.00 35.52  ? 334 HIS C NE2   1 
ATOM   8876  H H     . HIS C 1 334 ? -18.714 49.799  64.504  1.00 0.00   ? 334 HIS C H     1 
ATOM   8877  H HD1   . HIS C 1 334 ? -18.636 46.743  64.549  1.00 0.00   ? 334 HIS C HD1   1 
ATOM   8878  H HE2   . HIS C 1 334 ? -19.041 43.989  67.395  1.00 0.00   ? 334 HIS C HE2   1 
ATOM   8879  N N     . SER C 1 335 ? -18.352 51.873  66.383  1.00 57.82  ? 335 SER C N     1 
ATOM   8880  C CA    . SER C 1 335 ? -17.644 53.129  66.554  1.00 61.43  ? 335 SER C CA    1 
ATOM   8881  C C     . SER C 1 335 ? -18.556 54.106  67.303  1.00 64.67  ? 335 SER C C     1 
ATOM   8882  O O     . SER C 1 335 ? -18.040 54.899  68.088  1.00 65.75  ? 335 SER C O     1 
ATOM   8883  C CB    . SER C 1 335 ? -17.265 53.655  65.171  1.00 61.88  ? 335 SER C CB    1 
ATOM   8884  O OG    . SER C 1 335 ? -16.529 52.669  64.450  1.00 63.07  ? 335 SER C OG    1 
ATOM   8885  H H     . SER C 1 335 ? -19.275 51.971  66.067  1.00 0.00   ? 335 SER C H     1 
ATOM   8886  H HG    . SER C 1 335 ? -16.300 52.007  65.113  1.00 0.00   ? 335 SER C HG    1 
ATOM   8887  N N     . ASP D 1 9   ? 34.959  22.895  49.040  1.00 57.41  ? 9   ASP D N     1 
ATOM   8888  C CA    . ASP D 1 9   ? 34.565  21.872  49.942  1.00 56.19  ? 9   ASP D CA    1 
ATOM   8889  C C     . ASP D 1 9   ? 33.237  21.253  49.512  1.00 50.37  ? 9   ASP D C     1 
ATOM   8890  O O     . ASP D 1 9   ? 32.887  20.242  50.112  1.00 47.01  ? 9   ASP D O     1 
ATOM   8891  C CB    . ASP D 1 9   ? 34.507  22.549  51.325  1.00 65.40  ? 9   ASP D CB    1 
ATOM   8892  C CG    . ASP D 1 9   ? 34.517  21.674  52.590  1.00 72.61  ? 9   ASP D CG    1 
ATOM   8893  O OD1   . ASP D 1 9   ? 34.263  20.465  52.518  1.00 77.78  ? 9   ASP D OD1   1 
ATOM   8894  O OD2   . ASP D 1 9   ? 34.785  22.211  53.669  1.00 76.20  ? 9   ASP D OD2   1 
ATOM   8895  N N     . VAL D 1 10  ? 32.484  21.791  48.533  1.00 41.11  ? 10  VAL D N     1 
ATOM   8896  C CA    . VAL D 1 10  ? 31.180  21.224  48.165  1.00 33.83  ? 10  VAL D CA    1 
ATOM   8897  C C     . VAL D 1 10  ? 31.010  19.702  48.025  1.00 33.60  ? 10  VAL D C     1 
ATOM   8898  O O     . VAL D 1 10  ? 31.958  18.964  47.726  1.00 35.29  ? 10  VAL D O     1 
ATOM   8899  C CB    . VAL D 1 10  ? 30.655  21.815  46.825  1.00 26.60  ? 10  VAL D CB    1 
ATOM   8900  C CG1   . VAL D 1 10  ? 30.297  23.257  46.974  1.00 23.33  ? 10  VAL D CG1   1 
ATOM   8901  C CG2   . VAL D 1 10  ? 31.709  21.714  45.772  1.00 25.69  ? 10  VAL D CG2   1 
ATOM   8902  H H     . VAL D 1 10  ? 32.755  22.621  48.087  1.00 0.00   ? 10  VAL D H     1 
ATOM   8903  N N     . VAL D 1 11  ? 29.788  19.234  48.317  1.00 28.62  ? 11  VAL D N     1 
ATOM   8904  C CA    . VAL D 1 11  ? 29.345  17.889  47.940  1.00 27.04  ? 11  VAL D CA    1 
ATOM   8905  C C     . VAL D 1 11  ? 28.067  18.221  47.171  1.00 22.49  ? 11  VAL D C     1 
ATOM   8906  O O     . VAL D 1 11  ? 27.266  19.060  47.587  1.00 15.65  ? 11  VAL D O     1 
ATOM   8907  C CB    . VAL D 1 11  ? 28.949  16.938  49.105  1.00 27.22  ? 11  VAL D CB    1 
ATOM   8908  C CG1   . VAL D 1 11  ? 28.530  15.607  48.538  1.00 25.63  ? 11  VAL D CG1   1 
ATOM   8909  C CG2   . VAL D 1 11  ? 30.123  16.575  49.967  1.00 33.38  ? 11  VAL D CG2   1 
ATOM   8910  H H     . VAL D 1 11  ? 29.144  19.816  48.770  1.00 0.00   ? 11  VAL D H     1 
ATOM   8911  N N     . THR D 1 12  ? 27.928  17.657  45.989  1.00 17.60  ? 12  THR D N     1 
ATOM   8912  C CA    . THR D 1 12  ? 26.779  17.910  45.174  1.00 13.97  ? 12  THR D CA    1 
ATOM   8913  C C     . THR D 1 12  ? 25.757  16.802  45.446  1.00 17.65  ? 12  THR D C     1 
ATOM   8914  O O     . THR D 1 12  ? 26.054  15.869  46.226  1.00 19.24  ? 12  THR D O     1 
ATOM   8915  C CB    . THR D 1 12  ? 27.298  17.958  43.719  1.00 9.92   ? 12  THR D CB    1 
ATOM   8916  O OG1   . THR D 1 12  ? 27.949  16.730  43.472  1.00 13.74  ? 12  THR D OG1   1 
ATOM   8917  C CG2   . THR D 1 12  ? 28.281  19.087  43.470  1.00 8.59   ? 12  THR D CG2   1 
ATOM   8918  H H     . THR D 1 12  ? 28.574  17.003  45.661  1.00 0.00   ? 12  THR D H     1 
ATOM   8919  H HG1   . THR D 1 12  ? 28.339  16.798  42.584  1.00 0.00   ? 12  THR D HG1   1 
ATOM   8920  N N     . LEU D 1 13  ? 24.561  16.837  44.825  1.00 13.52  ? 13  LEU D N     1 
ATOM   8921  C CA    . LEU D 1 13  ? 23.635  15.735  44.998  1.00 13.32  ? 13  LEU D CA    1 
ATOM   8922  C C     . LEU D 1 13  ? 24.212  14.532  44.264  1.00 12.87  ? 13  LEU D C     1 
ATOM   8923  O O     . LEU D 1 13  ? 24.215  13.427  44.807  1.00 15.39  ? 13  LEU D O     1 
ATOM   8924  C CB    . LEU D 1 13  ? 22.253  16.096  44.437  1.00 15.26  ? 13  LEU D CB    1 
ATOM   8925  C CG    . LEU D 1 13  ? 21.111  15.075  44.495  1.00 11.62  ? 13  LEU D CG    1 
ATOM   8926  C CD1   . LEU D 1 13  ? 20.712  14.783  45.926  1.00 14.44  ? 13  LEU D CD1   1 
ATOM   8927  C CD2   . LEU D 1 13  ? 19.893  15.654  43.792  1.00 14.57  ? 13  LEU D CD2   1 
ATOM   8928  H H     . LEU D 1 13  ? 24.297  17.651  44.341  1.00 0.00   ? 13  LEU D H     1 
ATOM   8929  N N     . THR D 1 14  ? 24.791  14.713  43.074  1.00 11.23  ? 14  THR D N     1 
ATOM   8930  C CA    . THR D 1 14  ? 25.356  13.622  42.306  1.00 5.75   ? 14  THR D CA    1 
ATOM   8931  C C     . THR D 1 14  ? 26.436  12.892  43.077  1.00 8.69   ? 14  THR D C     1 
ATOM   8932  O O     . THR D 1 14  ? 26.443  11.665  43.117  1.00 10.50  ? 14  THR D O     1 
ATOM   8933  C CB    . THR D 1 14  ? 25.930  14.183  41.029  1.00 7.22   ? 14  THR D CB    1 
ATOM   8934  O OG1   . THR D 1 14  ? 25.009  15.147  40.513  1.00 12.99  ? 14  THR D OG1   1 
ATOM   8935  C CG2   . THR D 1 14  ? 26.181  13.065  40.029  1.00 9.97   ? 14  THR D CG2   1 
ATOM   8936  H H     . THR D 1 14  ? 24.811  15.608  42.678  1.00 0.00   ? 14  THR D H     1 
ATOM   8937  H HG1   . THR D 1 14  ? 24.187  14.674  40.275  1.00 0.00   ? 14  THR D HG1   1 
ATOM   8938  N N     . ARG D 1 15  ? 27.354  13.620  43.712  1.00 11.89  ? 15  ARG D N     1 
ATOM   8939  C CA    . ARG D 1 15  ? 28.386  12.987  44.496  1.00 12.22  ? 15  ARG D CA    1 
ATOM   8940  C C     . ARG D 1 15  ? 27.793  12.355  45.739  1.00 13.43  ? 15  ARG D C     1 
ATOM   8941  O O     . ARG D 1 15  ? 28.090  11.189  45.991  1.00 9.89   ? 15  ARG D O     1 
ATOM   8942  C CB    . ARG D 1 15  ? 29.431  13.994  44.910  1.00 21.30  ? 15  ARG D CB    1 
ATOM   8943  C CG    . ARG D 1 15  ? 30.559  13.317  45.679  1.00 32.63  ? 15  ARG D CG    1 
ATOM   8944  C CD    . ARG D 1 15  ? 31.667  14.256  46.088  1.00 40.19  ? 15  ARG D CD    1 
ATOM   8945  N NE    . ARG D 1 15  ? 32.306  14.819  44.910  1.00 46.75  ? 15  ARG D NE    1 
ATOM   8946  C CZ    . ARG D 1 15  ? 32.966  15.977  44.970  1.00 47.15  ? 15  ARG D CZ    1 
ATOM   8947  N NH1   . ARG D 1 15  ? 33.064  16.675  46.107  1.00 48.17  ? 15  ARG D NH1   1 
ATOM   8948  N NH2   . ARG D 1 15  ? 33.535  16.440  43.862  1.00 45.31  ? 15  ARG D NH2   1 
ATOM   8949  H H     . ARG D 1 15  ? 27.344  14.598  43.640  1.00 0.00   ? 15  ARG D H     1 
ATOM   8950  H HE    . ARG D 1 15  ? 32.264  14.344  44.053  1.00 0.00   ? 15  ARG D HE    1 
ATOM   8951  H HH11  . ARG D 1 15  ? 32.653  16.341  46.949  1.00 0.00   ? 15  ARG D HH11  1 
ATOM   8952  H HH12  . ARG D 1 15  ? 33.537  17.552  46.118  1.00 0.00   ? 15  ARG D HH12  1 
ATOM   8953  H HH21  . ARG D 1 15  ? 33.478  15.913  43.017  1.00 0.00   ? 15  ARG D HH21  1 
ATOM   8954  H HH22  . ARG D 1 15  ? 34.031  17.308  43.878  1.00 0.00   ? 15  ARG D HH22  1 
ATOM   8955  N N     . PHE D 1 16  ? 26.955  13.062  46.513  1.00 11.39  ? 16  PHE D N     1 
ATOM   8956  C CA    . PHE D 1 16  ? 26.360  12.493  47.721  1.00 9.81   ? 16  PHE D CA    1 
ATOM   8957  C C     . PHE D 1 16  ? 25.649  11.177  47.429  1.00 8.30   ? 16  PHE D C     1 
ATOM   8958  O O     . PHE D 1 16  ? 25.913  10.181  48.100  1.00 12.03  ? 16  PHE D O     1 
ATOM   8959  C CB    . PHE D 1 16  ? 25.377  13.489  48.306  1.00 11.10  ? 16  PHE D CB    1 
ATOM   8960  C CG    . PHE D 1 16  ? 24.624  12.942  49.507  1.00 14.56  ? 16  PHE D CG    1 
ATOM   8961  C CD1   . PHE D 1 16  ? 25.148  13.108  50.763  1.00 14.44  ? 16  PHE D CD1   1 
ATOM   8962  C CD2   . PHE D 1 16  ? 23.408  12.301  49.340  1.00 14.12  ? 16  PHE D CD2   1 
ATOM   8963  C CE1   . PHE D 1 16  ? 24.451  12.649  51.853  1.00 15.63  ? 16  PHE D CE1   1 
ATOM   8964  C CE2   . PHE D 1 16  ? 22.723  11.829  50.429  1.00 12.60  ? 16  PHE D CE2   1 
ATOM   8965  C CZ    . PHE D 1 16  ? 23.239  12.012  51.687  1.00 18.51  ? 16  PHE D CZ    1 
ATOM   8966  H H     . PHE D 1 16  ? 26.713  13.977  46.260  1.00 0.00   ? 16  PHE D H     1 
ATOM   8967  N N     . VAL D 1 17  ? 24.761  11.166  46.439  1.00 4.38   ? 17  VAL D N     1 
ATOM   8968  C CA    . VAL D 1 17  ? 24.051  9.973   45.995  1.00 8.97   ? 17  VAL D CA    1 
ATOM   8969  C C     . VAL D 1 17  ? 25.038  8.906   45.546  1.00 10.42  ? 17  VAL D C     1 
ATOM   8970  O O     . VAL D 1 17  ? 24.904  7.775   46.009  1.00 12.50  ? 17  VAL D O     1 
ATOM   8971  C CB    . VAL D 1 17  ? 23.049  10.392  44.848  1.00 10.42  ? 17  VAL D CB    1 
ATOM   8972  C CG1   . VAL D 1 17  ? 22.584  9.262   43.933  1.00 2.00   ? 17  VAL D CG1   1 
ATOM   8973  C CG2   . VAL D 1 17  ? 21.800  10.913  45.561  1.00 5.32   ? 17  VAL D CG2   1 
ATOM   8974  H H     . VAL D 1 17  ? 24.587  12.010  45.978  1.00 0.00   ? 17  VAL D H     1 
ATOM   8975  N N     . MET D 1 18  ? 26.058  9.183   44.718  1.00 12.40  ? 18  MET D N     1 
ATOM   8976  C CA    . MET D 1 18  ? 27.019  8.158   44.307  1.00 10.71  ? 18  MET D CA    1 
ATOM   8977  C C     . MET D 1 18  ? 27.798  7.599   45.479  1.00 13.44  ? 18  MET D C     1 
ATOM   8978  O O     . MET D 1 18  ? 27.799  6.378   45.613  1.00 13.11  ? 18  MET D O     1 
ATOM   8979  C CB    . MET D 1 18  ? 28.002  8.715   43.309  1.00 12.01  ? 18  MET D CB    1 
ATOM   8980  C CG    . MET D 1 18  ? 28.911  7.688   42.664  1.00 10.93  ? 18  MET D CG    1 
ATOM   8981  S SD    . MET D 1 18  ? 28.060  6.444   41.683  1.00 14.15  ? 18  MET D SD    1 
ATOM   8982  C CE    . MET D 1 18  ? 29.066  5.066   42.108  1.00 12.68  ? 18  MET D CE    1 
ATOM   8983  H H     . MET D 1 18  ? 26.167  10.100  44.388  1.00 0.00   ? 18  MET D H     1 
ATOM   8984  N N     . GLU D 1 19  ? 28.423  8.416   46.341  1.00 17.91  ? 19  GLU D N     1 
ATOM   8985  C CA    . GLU D 1 19  ? 29.146  7.963   47.536  1.00 21.05  ? 19  GLU D CA    1 
ATOM   8986  C C     . GLU D 1 19  ? 28.272  7.053   48.393  1.00 20.68  ? 19  GLU D C     1 
ATOM   8987  O O     . GLU D 1 19  ? 28.709  6.026   48.927  1.00 22.18  ? 19  GLU D O     1 
ATOM   8988  C CB    . GLU D 1 19  ? 29.576  9.126   48.449  1.00 27.95  ? 19  GLU D CB    1 
ATOM   8989  C CG    . GLU D 1 19  ? 30.505  10.175  47.835  1.00 43.30  ? 19  GLU D CG    1 
ATOM   8990  C CD    . GLU D 1 19  ? 30.963  11.353  48.711  1.00 49.66  ? 19  GLU D CD    1 
ATOM   8991  O OE1   . GLU D 1 19  ? 30.109  12.116  49.177  1.00 50.58  ? 19  GLU D OE1   1 
ATOM   8992  O OE2   . GLU D 1 19  ? 32.177  11.531  48.886  1.00 49.59  ? 19  GLU D OE2   1 
ATOM   8993  H H     . GLU D 1 19  ? 28.415  9.372   46.148  1.00 0.00   ? 19  GLU D H     1 
ATOM   8994  N N     . GLU D 1 20  ? 26.991  7.405   48.502  1.00 19.16  ? 20  GLU D N     1 
ATOM   8995  C CA    . GLU D 1 20  ? 26.055  6.666   49.314  1.00 16.60  ? 20  GLU D CA    1 
ATOM   8996  C C     . GLU D 1 20  ? 25.672  5.341   48.683  1.00 19.33  ? 20  GLU D C     1 
ATOM   8997  O O     . GLU D 1 20  ? 25.414  4.385   49.418  1.00 18.45  ? 20  GLU D O     1 
ATOM   8998  C CB    . GLU D 1 20  ? 24.865  7.571   49.525  1.00 20.09  ? 20  GLU D CB    1 
ATOM   8999  C CG    . GLU D 1 20  ? 24.433  7.775   50.974  1.00 23.50  ? 20  GLU D CG    1 
ATOM   9000  C CD    . GLU D 1 20  ? 25.505  8.233   51.961  1.00 25.44  ? 20  GLU D CD    1 
ATOM   9001  O OE1   . GLU D 1 20  ? 26.146  9.270   51.755  1.00 31.23  ? 20  GLU D OE1   1 
ATOM   9002  O OE2   . GLU D 1 20  ? 25.683  7.543   52.963  1.00 26.57  ? 20  GLU D OE2   1 
ATOM   9003  H H     . GLU D 1 20  ? 26.694  8.228   48.053  1.00 0.00   ? 20  GLU D H     1 
ATOM   9004  N N     . GLY D 1 21  ? 25.662  5.221   47.352  1.00 19.45  ? 21  GLY D N     1 
ATOM   9005  C CA    . GLY D 1 21  ? 25.365  3.971   46.658  1.00 17.39  ? 21  GLY D CA    1 
ATOM   9006  C C     . GLY D 1 21  ? 26.490  2.977   46.835  1.00 19.59  ? 21  GLY D C     1 
ATOM   9007  O O     . GLY D 1 21  ? 26.286  1.772   47.041  1.00 24.17  ? 21  GLY D O     1 
ATOM   9008  H H     . GLY D 1 21  ? 25.841  6.023   46.811  1.00 0.00   ? 21  GLY D H     1 
ATOM   9009  N N     . ARG D 1 22  ? 27.698  3.506   46.781  1.00 19.78  ? 22  ARG D N     1 
ATOM   9010  C CA    . ARG D 1 22  ? 28.918  2.776   47.026  1.00 21.35  ? 22  ARG D CA    1 
ATOM   9011  C C     . ARG D 1 22  ? 28.932  2.267   48.453  1.00 21.99  ? 22  ARG D C     1 
ATOM   9012  O O     . ARG D 1 22  ? 29.061  1.063   48.634  1.00 25.33  ? 22  ARG D O     1 
ATOM   9013  C CB    . ARG D 1 22  ? 30.091  3.696   46.768  1.00 19.27  ? 22  ARG D CB    1 
ATOM   9014  C CG    . ARG D 1 22  ? 30.421  3.793   45.295  1.00 24.03  ? 22  ARG D CG    1 
ATOM   9015  C CD    . ARG D 1 22  ? 31.337  4.970   44.937  1.00 35.20  ? 22  ARG D CD    1 
ATOM   9016  N NE    . ARG D 1 22  ? 32.409  5.257   45.890  1.00 48.15  ? 22  ARG D NE    1 
ATOM   9017  C CZ    . ARG D 1 22  ? 33.708  4.962   45.701  1.00 50.50  ? 22  ARG D CZ    1 
ATOM   9018  N NH1   . ARG D 1 22  ? 34.142  4.276   44.644  1.00 51.06  ? 22  ARG D NH1   1 
ATOM   9019  N NH2   . ARG D 1 22  ? 34.595  5.338   46.629  1.00 52.44  ? 22  ARG D NH2   1 
ATOM   9020  H H     . ARG D 1 22  ? 27.761  4.445   46.501  1.00 0.00   ? 22  ARG D H     1 
ATOM   9021  H HE    . ARG D 1 22  ? 32.162  5.693   46.733  1.00 0.00   ? 22  ARG D HE    1 
ATOM   9022  H HH11  . ARG D 1 22  ? 33.495  3.956   43.953  1.00 0.00   ? 22  ARG D HH11  1 
ATOM   9023  H HH12  . ARG D 1 22  ? 35.118  4.082   44.540  1.00 0.00   ? 22  ARG D HH12  1 
ATOM   9024  H HH21  . ARG D 1 22  ? 34.281  5.824   47.445  1.00 0.00   ? 22  ARG D HH21  1 
ATOM   9025  H HH22  . ARG D 1 22  ? 35.566  5.130   46.512  1.00 0.00   ? 22  ARG D HH22  1 
ATOM   9026  N N     . LYS D 1 23  ? 28.763  3.071   49.503  1.00 24.51  ? 23  LYS D N     1 
ATOM   9027  C CA    . LYS D 1 23  ? 28.713  2.550   50.873  1.00 25.81  ? 23  LYS D CA    1 
ATOM   9028  C C     . LYS D 1 23  ? 27.672  1.444   51.017  1.00 25.47  ? 23  LYS D C     1 
ATOM   9029  O O     . LYS D 1 23  ? 27.946  0.377   51.558  1.00 24.82  ? 23  LYS D O     1 
ATOM   9030  C CB    . LYS D 1 23  ? 28.333  3.614   51.895  1.00 25.23  ? 23  LYS D CB    1 
ATOM   9031  C CG    . LYS D 1 23  ? 29.273  4.791   52.003  1.00 32.83  ? 23  LYS D CG    1 
ATOM   9032  C CD    . LYS D 1 23  ? 28.639  5.784   52.954  1.00 38.21  ? 23  LYS D CD    1 
ATOM   9033  C CE    . LYS D 1 23  ? 29.414  7.086   52.903  1.00 42.58  ? 23  LYS D CE    1 
ATOM   9034  N NZ    . LYS D 1 23  ? 28.722  8.111   53.664  1.00 49.02  ? 23  LYS D NZ    1 
ATOM   9035  H H     . LYS D 1 23  ? 28.702  4.040   49.348  1.00 0.00   ? 23  LYS D H     1 
ATOM   9036  H HZ1   . LYS D 1 23  ? 28.628  7.803   54.653  1.00 0.00   ? 23  LYS D HZ1   1 
ATOM   9037  H HZ2   . LYS D 1 23  ? 29.266  8.996   53.627  1.00 0.00   ? 23  LYS D HZ2   1 
ATOM   9038  H HZ3   . LYS D 1 23  ? 27.778  8.267   53.257  1.00 0.00   ? 23  LYS D HZ3   1 
ATOM   9039  N N     . ALA D 1 24  ? 26.476  1.638   50.474  1.00 25.64  ? 24  ALA D N     1 
ATOM   9040  C CA    . ALA D 1 24  ? 25.431  0.643   50.621  1.00 28.96  ? 24  ALA D CA    1 
ATOM   9041  C C     . ALA D 1 24  ? 25.581  -0.593  49.743  1.00 30.74  ? 24  ALA D C     1 
ATOM   9042  O O     . ALA D 1 24  ? 24.759  -1.507  49.822  1.00 30.63  ? 24  ALA D O     1 
ATOM   9043  C CB    . ALA D 1 24  ? 24.093  1.301   50.338  1.00 26.44  ? 24  ALA D CB    1 
ATOM   9044  H H     . ALA D 1 24  ? 26.288  2.466   49.986  1.00 0.00   ? 24  ALA D H     1 
ATOM   9045  N N     . ARG D 1 25  ? 26.615  -0.612  48.896  1.00 32.44  ? 25  ARG D N     1 
ATOM   9046  C CA    . ARG D 1 25  ? 26.959  -1.720  48.026  1.00 34.33  ? 25  ARG D CA    1 
ATOM   9047  C C     . ARG D 1 25  ? 25.834  -2.156  47.097  1.00 34.09  ? 25  ARG D C     1 
ATOM   9048  O O     . ARG D 1 25  ? 25.573  -3.347  46.872  1.00 36.05  ? 25  ARG D O     1 
ATOM   9049  C CB    . ARG D 1 25  ? 27.442  -2.901  48.897  1.00 40.62  ? 25  ARG D CB    1 
ATOM   9050  C CG    . ARG D 1 25  ? 28.716  -2.563  49.659  1.00 53.86  ? 25  ARG D CG    1 
ATOM   9051  C CD    . ARG D 1 25  ? 29.240  -3.690  50.534  1.00 63.74  ? 25  ARG D CD    1 
ATOM   9052  N NE    . ARG D 1 25  ? 30.372  -3.197  51.315  1.00 74.55  ? 25  ARG D NE    1 
ATOM   9053  C CZ    . ARG D 1 25  ? 31.011  -3.939  52.233  1.00 80.37  ? 25  ARG D CZ    1 
ATOM   9054  N NH1   . ARG D 1 25  ? 30.665  -5.211  52.485  1.00 84.87  ? 25  ARG D NH1   1 
ATOM   9055  N NH2   . ARG D 1 25  ? 32.024  -3.396  52.912  1.00 79.63  ? 25  ARG D NH2   1 
ATOM   9056  H H     . ARG D 1 25  ? 27.190  0.177   48.839  1.00 0.00   ? 25  ARG D H     1 
ATOM   9057  H HE    . ARG D 1 25  ? 30.688  -2.283  51.160  1.00 0.00   ? 25  ARG D HE    1 
ATOM   9058  H HH11  . ARG D 1 25  ? 29.905  -5.633  51.990  1.00 0.00   ? 25  ARG D HH11  1 
ATOM   9059  H HH12  . ARG D 1 25  ? 31.147  -5.733  53.188  1.00 0.00   ? 25  ARG D HH12  1 
ATOM   9060  H HH21  . ARG D 1 25  ? 32.294  -2.451  52.737  1.00 0.00   ? 25  ARG D HH21  1 
ATOM   9061  H HH22  . ARG D 1 25  ? 32.498  -3.933  53.609  1.00 0.00   ? 25  ARG D HH22  1 
ATOM   9062  N N     . GLY D 1 26  ? 25.167  -1.160  46.517  1.00 29.86  ? 26  GLY D N     1 
ATOM   9063  C CA    . GLY D 1 26  ? 24.071  -1.442  45.611  1.00 26.51  ? 26  GLY D CA    1 
ATOM   9064  C C     . GLY D 1 26  ? 24.581  -1.760  44.217  1.00 24.61  ? 26  GLY D C     1 
ATOM   9065  O O     . GLY D 1 26  ? 25.769  -1.584  43.927  1.00 30.33  ? 26  GLY D O     1 
ATOM   9066  H H     . GLY D 1 26  ? 25.493  -0.244  46.637  1.00 0.00   ? 26  GLY D H     1 
ATOM   9067  N N     . THR D 1 27  ? 23.725  -2.224  43.317  1.00 19.95  ? 27  THR D N     1 
ATOM   9068  C CA    . THR D 1 27  ? 24.148  -2.457  41.952  1.00 19.92  ? 27  THR D CA    1 
ATOM   9069  C C     . THR D 1 27  ? 24.247  -1.130  41.221  1.00 19.66  ? 27  THR D C     1 
ATOM   9070  O O     . THR D 1 27  ? 24.893  -1.030  40.180  1.00 25.59  ? 27  THR D O     1 
ATOM   9071  C CB    . THR D 1 27  ? 23.158  -3.336  41.205  1.00 19.68  ? 27  THR D CB    1 
ATOM   9072  O OG1   . THR D 1 27  ? 21.921  -2.651  41.147  1.00 21.86  ? 27  THR D OG1   1 
ATOM   9073  C CG2   . THR D 1 27  ? 22.989  -4.675  41.877  1.00 25.14  ? 27  THR D CG2   1 
ATOM   9074  H H     . THR D 1 27  ? 22.771  -2.361  43.539  1.00 0.00   ? 27  THR D H     1 
ATOM   9075  H HG1   . THR D 1 27  ? 21.470  -2.572  42.015  1.00 0.00   ? 27  THR D HG1   1 
ATOM   9076  N N     . GLY D 1 28  ? 23.565  -0.095  41.693  1.00 17.97  ? 28  GLY D N     1 
ATOM   9077  C CA    . GLY D 1 28  ? 23.662  1.203   41.061  1.00 16.33  ? 28  GLY D CA    1 
ATOM   9078  C C     . GLY D 1 28  ? 22.343  1.588   40.423  1.00 16.91  ? 28  GLY D C     1 
ATOM   9079  O O     . GLY D 1 28  ? 22.222  2.675   39.855  1.00 20.84  ? 28  GLY D O     1 
ATOM   9080  H H     . GLY D 1 28  ? 22.865  -0.265  42.369  1.00 0.00   ? 28  GLY D H     1 
ATOM   9081  N N     . GLU D 1 29  ? 21.299  0.785   40.575  1.00 14.11  ? 29  GLU D N     1 
ATOM   9082  C CA    . GLU D 1 29  ? 20.020  1.033   39.951  1.00 15.52  ? 29  GLU D CA    1 
ATOM   9083  C C     . GLU D 1 29  ? 19.305  2.136   40.704  1.00 17.03  ? 29  GLU D C     1 
ATOM   9084  O O     . GLU D 1 29  ? 18.774  3.069   40.092  1.00 17.18  ? 29  GLU D O     1 
ATOM   9085  C CB    . GLU D 1 29  ? 19.213  -0.240  39.993  1.00 20.22  ? 29  GLU D CB    1 
ATOM   9086  C CG    . GLU D 1 29  ? 18.048  -0.227  39.041  1.00 22.99  ? 29  GLU D CG    1 
ATOM   9087  C CD    . GLU D 1 29  ? 17.153  -1.429  39.197  1.00 26.18  ? 29  GLU D CD    1 
ATOM   9088  O OE1   . GLU D 1 29  ? 16.413  -1.467  40.170  1.00 32.53  ? 29  GLU D OE1   1 
ATOM   9089  O OE2   . GLU D 1 29  ? 17.195  -2.319  38.355  1.00 25.22  ? 29  GLU D OE2   1 
ATOM   9090  H H     . GLU D 1 29  ? 21.347  0.015   41.198  1.00 0.00   ? 29  GLU D H     1 
ATOM   9091  N N     . LEU D 1 30  ? 19.288  2.099   42.038  1.00 16.13  ? 30  LEU D N     1 
ATOM   9092  C CA    . LEU D 1 30  ? 18.688  3.180   42.794  1.00 11.46  ? 30  LEU D CA    1 
ATOM   9093  C C     . LEU D 1 30  ? 19.410  4.490   42.504  1.00 14.31  ? 30  LEU D C     1 
ATOM   9094  O O     . LEU D 1 30  ? 18.778  5.546   42.447  1.00 18.49  ? 30  LEU D O     1 
ATOM   9095  C CB    . LEU D 1 30  ? 18.756  2.909   44.295  1.00 11.11  ? 30  LEU D CB    1 
ATOM   9096  C CG    . LEU D 1 30  ? 18.029  3.914   45.186  1.00 7.74   ? 30  LEU D CG    1 
ATOM   9097  C CD1   . LEU D 1 30  ? 16.580  4.045   44.773  1.00 2.00   ? 30  LEU D CD1   1 
ATOM   9098  C CD2   . LEU D 1 30  ? 18.064  3.435   46.606  1.00 7.39   ? 30  LEU D CD2   1 
ATOM   9099  H H     . LEU D 1 30  ? 19.641  1.293   42.500  1.00 0.00   ? 30  LEU D H     1 
ATOM   9100  N N     . THR D 1 31  ? 20.721  4.434   42.259  1.00 10.92  ? 31  THR D N     1 
ATOM   9101  C CA    . THR D 1 31  ? 21.484  5.611   41.942  1.00 8.54   ? 31  THR D CA    1 
ATOM   9102  C C     . THR D 1 31  ? 21.079  6.102   40.575  1.00 4.77   ? 31  THR D C     1 
ATOM   9103  O O     . THR D 1 31  ? 20.980  7.313   40.390  1.00 11.44  ? 31  THR D O     1 
ATOM   9104  C CB    . THR D 1 31  ? 22.976  5.301   41.960  1.00 3.16   ? 31  THR D CB    1 
ATOM   9105  O OG1   . THR D 1 31  ? 23.265  4.784   43.251  1.00 10.88  ? 31  THR D OG1   1 
ATOM   9106  C CG2   . THR D 1 31  ? 23.816  6.517   41.745  1.00 2.00   ? 31  THR D CG2   1 
ATOM   9107  H H     . THR D 1 31  ? 21.164  3.564   42.320  1.00 0.00   ? 31  THR D H     1 
ATOM   9108  H HG1   . THR D 1 31  ? 22.723  3.997   43.413  1.00 0.00   ? 31  THR D HG1   1 
ATOM   9109  N N     . GLN D 1 32  ? 20.781  5.242   39.599  1.00 4.58   ? 32  GLN D N     1 
ATOM   9110  C CA    . GLN D 1 32  ? 20.317  5.790   38.325  1.00 7.22   ? 32  GLN D CA    1 
ATOM   9111  C C     . GLN D 1 32  ? 18.935  6.389   38.489  1.00 6.40   ? 32  GLN D C     1 
ATOM   9112  O O     . GLN D 1 32  ? 18.726  7.515   38.040  1.00 9.00   ? 32  GLN D O     1 
ATOM   9113  C CB    . GLN D 1 32  ? 20.257  4.719   37.237  1.00 5.68   ? 32  GLN D CB    1 
ATOM   9114  C CG    . GLN D 1 32  ? 21.638  4.266   36.762  1.00 12.20  ? 32  GLN D CG    1 
ATOM   9115  C CD    . GLN D 1 32  ? 22.460  5.271   35.967  1.00 15.31  ? 32  GLN D CD    1 
ATOM   9116  O OE1   . GLN D 1 32  ? 23.041  4.881   34.956  1.00 21.13  ? 32  GLN D OE1   1 
ATOM   9117  N NE2   . GLN D 1 32  ? 22.656  6.547   36.313  1.00 15.38  ? 32  GLN D NE2   1 
ATOM   9118  H H     . GLN D 1 32  ? 20.902  4.277   39.714  1.00 0.00   ? 32  GLN D H     1 
ATOM   9119  H HE21  . GLN D 1 32  ? 23.240  7.071   35.730  1.00 0.00   ? 32  GLN D HE21  1 
ATOM   9120  H HE22  . GLN D 1 32  ? 22.265  6.923   37.133  1.00 0.00   ? 32  GLN D HE22  1 
ATOM   9121  N N     . LEU D 1 33  ? 17.987  5.754   39.178  1.00 9.19   ? 33  LEU D N     1 
ATOM   9122  C CA    . LEU D 1 33  ? 16.678  6.349   39.405  1.00 9.76   ? 33  LEU D CA    1 
ATOM   9123  C C     . LEU D 1 33  ? 16.815  7.737   40.026  1.00 6.48   ? 33  LEU D C     1 
ATOM   9124  O O     . LEU D 1 33  ? 16.353  8.711   39.425  1.00 10.52  ? 33  LEU D O     1 
ATOM   9125  C CB    . LEU D 1 33  ? 15.871  5.460   40.350  1.00 11.02  ? 33  LEU D CB    1 
ATOM   9126  C CG    . LEU D 1 33  ? 14.397  5.663   40.582  1.00 10.34  ? 33  LEU D CG    1 
ATOM   9127  C CD1   . LEU D 1 33  ? 13.922  4.378   41.217  1.00 6.52   ? 33  LEU D CD1   1 
ATOM   9128  C CD2   . LEU D 1 33  ? 14.088  6.838   41.499  1.00 2.00   ? 33  LEU D CD2   1 
ATOM   9129  H H     . LEU D 1 33  ? 18.194  4.878   39.569  1.00 0.00   ? 33  LEU D H     1 
ATOM   9130  N N     . LEU D 1 34  ? 17.485  7.848   41.182  1.00 4.15   ? 34  LEU D N     1 
ATOM   9131  C CA    . LEU D 1 34  ? 17.647  9.115   41.899  1.00 2.00   ? 34  LEU D CA    1 
ATOM   9132  C C     . LEU D 1 34  ? 18.350  10.132  41.050  1.00 4.17   ? 34  LEU D C     1 
ATOM   9133  O O     . LEU D 1 34  ? 17.997  11.316  41.163  1.00 6.32   ? 34  LEU D O     1 
ATOM   9134  C CB    . LEU D 1 34  ? 18.444  8.917   43.180  1.00 3.62   ? 34  LEU D CB    1 
ATOM   9135  C CG    . LEU D 1 34  ? 17.766  8.246   44.391  1.00 3.18   ? 34  LEU D CG    1 
ATOM   9136  C CD1   . LEU D 1 34  ? 18.794  7.882   45.438  1.00 2.07   ? 34  LEU D CD1   1 
ATOM   9137  C CD2   . LEU D 1 34  ? 16.809  9.209   45.035  1.00 5.47   ? 34  LEU D CD2   1 
ATOM   9138  H H     . LEU D 1 34  ? 17.897  7.056   41.573  1.00 0.00   ? 34  LEU D H     1 
ATOM   9139  N N     . ASN D 1 35  ? 19.255  9.748   40.130  1.00 6.41   ? 35  ASN D N     1 
ATOM   9140  C CA    . ASN D 1 35  ? 19.929  10.702  39.229  1.00 8.51   ? 35  ASN D CA    1 
ATOM   9141  C C     . ASN D 1 35  ? 18.997  11.249  38.170  1.00 7.75   ? 35  ASN D C     1 
ATOM   9142  O O     . ASN D 1 35  ? 19.081  12.418  37.790  1.00 2.00   ? 35  ASN D O     1 
ATOM   9143  C CB    . ASN D 1 35  ? 21.068  10.128  38.375  1.00 14.68  ? 35  ASN D CB    1 
ATOM   9144  C CG    . ASN D 1 35  ? 22.371  9.838   39.081  1.00 18.79  ? 35  ASN D CG    1 
ATOM   9145  O OD1   . ASN D 1 35  ? 23.211  9.108   38.549  1.00 26.00  ? 35  ASN D OD1   1 
ATOM   9146  N ND2   . ASN D 1 35  ? 22.620  10.387  40.261  1.00 26.56  ? 35  ASN D ND2   1 
ATOM   9147  H H     . ASN D 1 35  ? 19.469  8.794   40.060  1.00 0.00   ? 35  ASN D H     1 
ATOM   9148  H HD21  . ASN D 1 35  ? 23.440  10.098  40.710  1.00 0.00   ? 35  ASN D HD21  1 
ATOM   9149  H HD22  . ASN D 1 35  ? 22.010  11.031  40.658  1.00 0.00   ? 35  ASN D HD22  1 
ATOM   9150  N N     . SER D 1 36  ? 18.156  10.368  37.618  1.00 10.70  ? 36  SER D N     1 
ATOM   9151  C CA    . SER D 1 36  ? 17.138  10.665  36.627  1.00 10.12  ? 36  SER D CA    1 
ATOM   9152  C C     . SER D 1 36  ? 16.128  11.660  37.178  1.00 7.07   ? 36  SER D C     1 
ATOM   9153  O O     . SER D 1 36  ? 15.746  12.645  36.545  1.00 9.97   ? 36  SER D O     1 
ATOM   9154  C CB    . SER D 1 36  ? 16.463  9.346   36.260  1.00 9.19   ? 36  SER D CB    1 
ATOM   9155  O OG    . SER D 1 36  ? 17.435  8.383   35.849  1.00 11.13  ? 36  SER D OG    1 
ATOM   9156  H H     . SER D 1 36  ? 18.242  9.417   37.862  1.00 0.00   ? 36  SER D H     1 
ATOM   9157  H HG    . SER D 1 36  ? 17.030  7.872   35.146  1.00 0.00   ? 36  SER D HG    1 
ATOM   9158  N N     . LEU D 1 37  ? 15.734  11.450  38.419  1.00 7.32   ? 37  LEU D N     1 
ATOM   9159  C CA    . LEU D 1 37  ? 14.798  12.308  39.101  1.00 10.14  ? 37  LEU D CA    1 
ATOM   9160  C C     . LEU D 1 37  ? 15.407  13.687  39.335  1.00 11.37  ? 37  LEU D C     1 
ATOM   9161  O O     . LEU D 1 37  ? 14.755  14.698  39.103  1.00 16.02  ? 37  LEU D O     1 
ATOM   9162  C CB    . LEU D 1 37  ? 14.447  11.606  40.383  1.00 10.38  ? 37  LEU D CB    1 
ATOM   9163  C CG    . LEU D 1 37  ? 13.315  12.070  41.252  1.00 11.08  ? 37  LEU D CG    1 
ATOM   9164  C CD1   . LEU D 1 37  ? 12.085  12.340  40.435  1.00 9.75   ? 37  LEU D CD1   1 
ATOM   9165  C CD2   . LEU D 1 37  ? 13.035  10.978  42.252  1.00 8.56   ? 37  LEU D CD2   1 
ATOM   9166  H H     . LEU D 1 37  ? 16.065  10.648  38.880  1.00 0.00   ? 37  LEU D H     1 
ATOM   9167  N N     . CYS D 1 38  ? 16.674  13.777  39.743  1.00 13.64  ? 38  CYS D N     1 
ATOM   9168  C CA    . CYS D 1 38  ? 17.361  15.045  39.907  1.00 11.56  ? 38  CYS D CA    1 
ATOM   9169  C C     . CYS D 1 38  ? 17.286  15.834  38.617  1.00 10.65  ? 38  CYS D C     1 
ATOM   9170  O O     . CYS D 1 38  ? 16.845  16.982  38.631  1.00 8.59   ? 38  CYS D O     1 
ATOM   9171  C CB    . CYS D 1 38  ? 18.797  14.776  40.292  1.00 15.07  ? 38  CYS D CB    1 
ATOM   9172  S SG    . CYS D 1 38  ? 19.889  16.218  40.290  1.00 26.85  ? 38  CYS D SG    1 
ATOM   9173  H H     . CYS D 1 38  ? 17.120  12.954  40.034  1.00 0.00   ? 38  CYS D H     1 
ATOM   9174  N N     . THR D 1 39  ? 17.550  15.216  37.466  1.00 9.82   ? 39  THR D N     1 
ATOM   9175  C CA    . THR D 1 39  ? 17.421  15.929  36.192  1.00 9.66   ? 39  THR D CA    1 
ATOM   9176  C C     . THR D 1 39  ? 15.981  16.418  35.994  1.00 7.81   ? 39  THR D C     1 
ATOM   9177  O O     . THR D 1 39  ? 15.760  17.616  35.775  1.00 8.23   ? 39  THR D O     1 
ATOM   9178  C CB    . THR D 1 39  ? 17.869  14.976  35.045  1.00 8.23   ? 39  THR D CB    1 
ATOM   9179  O OG1   . THR D 1 39  ? 19.230  14.660  35.353  1.00 7.48   ? 39  THR D OG1   1 
ATOM   9180  C CG2   . THR D 1 39  ? 17.780  15.552  33.647  1.00 2.50   ? 39  THR D CG2   1 
ATOM   9181  H H     . THR D 1 39  ? 17.755  14.256  37.477  1.00 0.00   ? 39  THR D H     1 
ATOM   9182  H HG1   . THR D 1 39  ? 19.302  14.539  36.309  1.00 0.00   ? 39  THR D HG1   1 
ATOM   9183  N N     . ALA D 1 40  ? 14.981  15.550  36.161  1.00 6.99   ? 40  ALA D N     1 
ATOM   9184  C CA    . ALA D 1 40  ? 13.584  15.944  35.961  1.00 4.64   ? 40  ALA D CA    1 
ATOM   9185  C C     . ALA D 1 40  ? 13.159  17.108  36.842  1.00 3.97   ? 40  ALA D C     1 
ATOM   9186  O O     . ALA D 1 40  ? 12.433  17.995  36.382  1.00 9.18   ? 40  ALA D O     1 
ATOM   9187  C CB    . ALA D 1 40  ? 12.677  14.773  36.252  1.00 2.00   ? 40  ALA D CB    1 
ATOM   9188  H H     . ALA D 1 40  ? 15.170  14.630  36.444  1.00 0.00   ? 40  ALA D H     1 
ATOM   9189  N N     . VAL D 1 41  ? 13.659  17.178  38.079  1.00 5.17   ? 41  VAL D N     1 
ATOM   9190  C CA    . VAL D 1 41  ? 13.360  18.265  39.006  1.00 4.06   ? 41  VAL D CA    1 
ATOM   9191  C C     . VAL D 1 41  ? 14.034  19.515  38.482  1.00 7.38   ? 41  VAL D C     1 
ATOM   9192  O O     . VAL D 1 41  ? 13.437  20.589  38.579  1.00 13.80  ? 41  VAL D O     1 
ATOM   9193  C CB    . VAL D 1 41  ? 13.884  17.916  40.426  1.00 4.96   ? 41  VAL D CB    1 
ATOM   9194  C CG1   . VAL D 1 41  ? 13.878  19.134  41.355  1.00 7.27   ? 41  VAL D CG1   1 
ATOM   9195  C CG2   . VAL D 1 41  ? 12.970  16.849  41.011  1.00 3.21   ? 41  VAL D CG2   1 
ATOM   9196  H H     . VAL D 1 41  ? 14.253  16.458  38.380  1.00 0.00   ? 41  VAL D H     1 
ATOM   9197  N N     . LYS D 1 42  ? 15.233  19.457  37.895  1.00 5.77   ? 42  LYS D N     1 
ATOM   9198  C CA    . LYS D 1 42  ? 15.859  20.652  37.344  1.00 6.39   ? 42  LYS D CA    1 
ATOM   9199  C C     . LYS D 1 42  ? 15.146  21.109  36.077  1.00 9.00   ? 42  LYS D C     1 
ATOM   9200  O O     . LYS D 1 42  ? 15.084  22.319  35.811  1.00 12.30  ? 42  LYS D O     1 
ATOM   9201  C CB    . LYS D 1 42  ? 17.336  20.415  36.990  1.00 8.74   ? 42  LYS D CB    1 
ATOM   9202  C CG    . LYS D 1 42  ? 18.260  20.199  38.165  1.00 4.04   ? 42  LYS D CG    1 
ATOM   9203  C CD    . LYS D 1 42  ? 19.698  20.252  37.713  1.00 12.65  ? 42  LYS D CD    1 
ATOM   9204  C CE    . LYS D 1 42  ? 20.090  19.022  36.932  1.00 10.93  ? 42  LYS D CE    1 
ATOM   9205  N NZ    . LYS D 1 42  ? 21.414  19.217  36.404  1.00 7.59   ? 42  LYS D NZ    1 
ATOM   9206  H H     . LYS D 1 42  ? 15.702  18.593  37.846  1.00 0.00   ? 42  LYS D H     1 
ATOM   9207  H HZ1   . LYS D 1 42  ? 22.069  19.432  37.181  1.00 0.00   ? 42  LYS D HZ1   1 
ATOM   9208  H HZ2   . LYS D 1 42  ? 21.733  18.360  35.912  1.00 0.00   ? 42  LYS D HZ2   1 
ATOM   9209  H HZ3   . LYS D 1 42  ? 21.398  20.017  35.738  1.00 0.00   ? 42  LYS D HZ3   1 
ATOM   9210  N N     . ALA D 1 43  ? 14.554  20.192  35.306  1.00 7.74   ? 43  ALA D N     1 
ATOM   9211  C CA    . ALA D 1 43  ? 13.861  20.559  34.082  1.00 5.75   ? 43  ALA D CA    1 
ATOM   9212  C C     . ALA D 1 43  ? 12.583  21.275  34.396  1.00 3.87   ? 43  ALA D C     1 
ATOM   9213  O O     . ALA D 1 43  ? 12.275  22.298  33.778  1.00 6.12   ? 43  ALA D O     1 
ATOM   9214  C CB    . ALA D 1 43  ? 13.526  19.336  33.288  1.00 5.57   ? 43  ALA D CB    1 
ATOM   9215  H H     . ALA D 1 43  ? 14.628  19.249  35.567  1.00 0.00   ? 43  ALA D H     1 
ATOM   9216  N N     . ILE D 1 44  ? 11.840  20.726  35.363  1.00 8.08   ? 44  ILE D N     1 
ATOM   9217  C CA    . ILE D 1 44  ? 10.640  21.361  35.918  1.00 6.12   ? 44  ILE D CA    1 
ATOM   9218  C C     . ILE D 1 44  ? 10.942  22.737  36.510  1.00 11.55  ? 44  ILE D C     1 
ATOM   9219  O O     . ILE D 1 44  ? 10.195  23.684  36.215  1.00 14.83  ? 44  ILE D O     1 
ATOM   9220  C CB    . ILE D 1 44  ? 9.999   20.489  37.040  1.00 5.27   ? 44  ILE D CB    1 
ATOM   9221  C CG1   . ILE D 1 44  ? 9.505   19.181  36.453  1.00 2.00   ? 44  ILE D CG1   1 
ATOM   9222  C CG2   . ILE D 1 44  ? 8.810   21.220  37.676  1.00 3.86   ? 44  ILE D CG2   1 
ATOM   9223  C CD1   . ILE D 1 44  ? 9.181   18.170  37.545  1.00 3.22   ? 44  ILE D CD1   1 
ATOM   9224  H H     . ILE D 1 44  ? 12.102  19.836  35.691  1.00 0.00   ? 44  ILE D H     1 
ATOM   9225  N N     . SER D 1 45  ? 11.985  22.934  37.337  1.00 11.26  ? 45  SER D N     1 
ATOM   9226  C CA    . SER D 1 45  ? 12.244  24.258  37.915  1.00 9.80   ? 45  SER D CA    1 
ATOM   9227  C C     . SER D 1 45  ? 12.421  25.327  36.846  1.00 9.85   ? 45  SER D C     1 
ATOM   9228  O O     . SER D 1 45  ? 11.917  26.448  36.952  1.00 15.10  ? 45  SER D O     1 
ATOM   9229  C CB    . SER D 1 45  ? 13.479  24.206  38.768  1.00 5.26   ? 45  SER D CB    1 
ATOM   9230  O OG    . SER D 1 45  ? 13.565  25.399  39.530  1.00 11.72  ? 45  SER D OG    1 
ATOM   9231  H H     . SER D 1 45  ? 12.568  22.183  37.584  1.00 0.00   ? 45  SER D H     1 
ATOM   9232  H HG    . SER D 1 45  ? 14.273  25.965  39.169  1.00 0.00   ? 45  SER D HG    1 
ATOM   9233  N N     . SER D 1 46  ? 13.056  24.983  35.745  1.00 7.70   ? 46  SER D N     1 
ATOM   9234  C CA    . SER D 1 46  ? 13.230  25.934  34.679  1.00 8.34   ? 46  SER D CA    1 
ATOM   9235  C C     . SER D 1 46  ? 11.865  26.344  34.139  1.00 11.08  ? 46  SER D C     1 
ATOM   9236  O O     . SER D 1 46  ? 11.526  27.527  34.024  1.00 20.56  ? 46  SER D O     1 
ATOM   9237  C CB    . SER D 1 46  ? 14.119  25.216  33.692  1.00 5.26   ? 46  SER D CB    1 
ATOM   9238  O OG    . SER D 1 46  ? 14.274  25.853  32.441  1.00 11.95  ? 46  SER D OG    1 
ATOM   9239  H H     . SER D 1 46  ? 13.483  24.105  35.679  1.00 0.00   ? 46  SER D H     1 
ATOM   9240  H HG    . SER D 1 46  ? 15.156  25.653  32.126  1.00 0.00   ? 46  SER D HG    1 
ATOM   9241  N N     . ALA D 1 47  ? 10.989  25.376  33.930  1.00 12.10  ? 47  ALA D N     1 
ATOM   9242  C CA    . ALA D 1 47  ? 9.696   25.624  33.344  1.00 11.73  ? 47  ALA D CA    1 
ATOM   9243  C C     . ALA D 1 47  ? 8.789   26.422  34.270  1.00 12.27  ? 47  ALA D C     1 
ATOM   9244  O O     . ALA D 1 47  ? 8.060   27.311  33.819  1.00 12.78  ? 47  ALA D O     1 
ATOM   9245  C CB    . ALA D 1 47  ? 9.044   24.287  33.016  1.00 14.41  ? 47  ALA D CB    1 
ATOM   9246  H H     . ALA D 1 47  ? 11.226  24.465  34.205  1.00 0.00   ? 47  ALA D H     1 
ATOM   9247  N N     . VAL D 1 48  ? 8.828   26.118  35.569  1.00 13.35  ? 48  VAL D N     1 
ATOM   9248  C CA    . VAL D 1 48  ? 8.031   26.799  36.589  1.00 6.58   ? 48  VAL D CA    1 
ATOM   9249  C C     . VAL D 1 48  ? 8.441   28.254  36.627  1.00 5.94   ? 48  VAL D C     1 
ATOM   9250  O O     . VAL D 1 48  ? 7.604   29.151  36.653  1.00 5.03   ? 48  VAL D O     1 
ATOM   9251  C CB    . VAL D 1 48  ? 8.268   26.130  37.968  1.00 6.00   ? 48  VAL D CB    1 
ATOM   9252  C CG1   . VAL D 1 48  ? 7.559   26.832  39.084  1.00 3.21   ? 48  VAL D CG1   1 
ATOM   9253  C CG2   . VAL D 1 48  ? 7.678   24.745  37.927  1.00 3.64   ? 48  VAL D CG2   1 
ATOM   9254  H H     . VAL D 1 48  ? 9.447   25.416  35.858  1.00 0.00   ? 48  VAL D H     1 
ATOM   9255  N N     . ARG D 1 49  ? 9.737   28.507  36.548  1.00 8.18   ? 49  ARG D N     1 
ATOM   9256  C CA    . ARG D 1 49  ? 10.240  29.856  36.583  1.00 7.14   ? 49  ARG D CA    1 
ATOM   9257  C C     . ARG D 1 49  ? 10.005  30.654  35.312  1.00 9.73   ? 49  ARG D C     1 
ATOM   9258  O O     . ARG D 1 49  ? 10.422  31.810  35.206  1.00 12.64  ? 49  ARG D O     1 
ATOM   9259  C CB    . ARG D 1 49  ? 11.715  29.792  36.909  1.00 9.48   ? 49  ARG D CB    1 
ATOM   9260  C CG    . ARG D 1 49  ? 12.105  29.855  38.385  1.00 5.52   ? 49  ARG D CG    1 
ATOM   9261  C CD    . ARG D 1 49  ? 11.764  28.595  39.106  1.00 2.00   ? 49  ARG D CD    1 
ATOM   9262  N NE    . ARG D 1 49  ? 12.588  28.546  40.285  1.00 8.03   ? 49  ARG D NE    1 
ATOM   9263  C CZ    . ARG D 1 49  ? 12.167  29.008  41.460  1.00 8.54   ? 49  ARG D CZ    1 
ATOM   9264  N NH1   . ARG D 1 49  ? 10.929  29.473  41.607  1.00 12.59  ? 49  ARG D NH1   1 
ATOM   9265  N NH2   . ARG D 1 49  ? 12.985  28.963  42.520  1.00 5.05   ? 49  ARG D NH2   1 
ATOM   9266  H H     . ARG D 1 49  ? 10.383  27.767  36.532  1.00 0.00   ? 49  ARG D H     1 
ATOM   9267  H HE    . ARG D 1 49  ? 13.479  28.146  40.222  1.00 0.00   ? 49  ARG D HE    1 
ATOM   9268  H HH11  . ARG D 1 49  ? 10.290  29.473  40.837  1.00 0.00   ? 49  ARG D HH11  1 
ATOM   9269  H HH12  . ARG D 1 49  ? 10.628  29.812  42.497  1.00 0.00   ? 49  ARG D HH12  1 
ATOM   9270  H HH21  . ARG D 1 49  ? 13.904  28.577  42.429  1.00 0.00   ? 49  ARG D HH21  1 
ATOM   9271  H HH22  . ARG D 1 49  ? 12.668  29.305  43.404  1.00 0.00   ? 49  ARG D HH22  1 
ATOM   9272  N N     . LYS D 1 50  ? 9.351   30.055  34.324  1.00 12.15  ? 50  LYS D N     1 
ATOM   9273  C CA    . LYS D 1 50  ? 8.933   30.685  33.077  1.00 11.84  ? 50  LYS D CA    1 
ATOM   9274  C C     . LYS D 1 50  ? 10.012  31.010  32.072  1.00 11.20  ? 50  LYS D C     1 
ATOM   9275  O O     . LYS D 1 50  ? 9.892   31.864  31.184  1.00 13.92  ? 50  LYS D O     1 
ATOM   9276  C CB    . LYS D 1 50  ? 8.118   31.941  33.424  1.00 17.66  ? 50  LYS D CB    1 
ATOM   9277  C CG    . LYS D 1 50  ? 6.597   31.709  33.433  1.00 23.13  ? 50  LYS D CG    1 
ATOM   9278  C CD    . LYS D 1 50  ? 6.077   30.675  34.421  1.00 25.99  ? 50  LYS D CD    1 
ATOM   9279  C CE    . LYS D 1 50  ? 4.596   30.422  34.249  1.00 25.32  ? 50  LYS D CE    1 
ATOM   9280  N NZ    . LYS D 1 50  ? 4.324   29.960  32.900  1.00 24.60  ? 50  LYS D NZ    1 
ATOM   9281  H H     . LYS D 1 50  ? 9.129   29.110  34.438  1.00 0.00   ? 50  LYS D H     1 
ATOM   9282  H HZ1   . LYS D 1 50  ? 4.876   29.098  32.713  1.00 0.00   ? 50  LYS D HZ1   1 
ATOM   9283  H HZ2   . LYS D 1 50  ? 3.310   29.748  32.812  1.00 0.00   ? 50  LYS D HZ2   1 
ATOM   9284  H HZ3   . LYS D 1 50  ? 4.584   30.698  32.216  1.00 0.00   ? 50  LYS D HZ3   1 
ATOM   9285  N N     . ALA D 1 51  ? 11.091  30.239  32.119  1.00 13.19  ? 51  ALA D N     1 
ATOM   9286  C CA    . ALA D 1 51  ? 12.154  30.395  31.141  1.00 14.61  ? 51  ALA D CA    1 
ATOM   9287  C C     . ALA D 1 51  ? 11.594  30.007  29.775  1.00 16.46  ? 51  ALA D C     1 
ATOM   9288  O O     . ALA D 1 51  ? 11.069  28.912  29.571  1.00 25.11  ? 51  ALA D O     1 
ATOM   9289  C CB    . ALA D 1 51  ? 13.339  29.475  31.440  1.00 7.85   ? 51  ALA D CB    1 
ATOM   9290  H H     . ALA D 1 51  ? 11.135  29.500  32.764  1.00 0.00   ? 51  ALA D H     1 
ATOM   9291  N N     . GLY D 1 52  ? 11.528  30.990  28.896  1.00 16.61  ? 52  GLY D N     1 
ATOM   9292  C CA    . GLY D 1 52  ? 11.126  30.744  27.524  1.00 15.05  ? 52  GLY D CA    1 
ATOM   9293  C C     . GLY D 1 52  ? 9.767   31.340  27.181  1.00 15.22  ? 52  GLY D C     1 
ATOM   9294  O O     . GLY D 1 52  ? 9.421   31.376  25.990  1.00 16.56  ? 52  GLY D O     1 
ATOM   9295  H H     . GLY D 1 52  ? 11.502  31.891  29.248  1.00 0.00   ? 52  GLY D H     1 
ATOM   9296  N N     . ILE D 1 53  ? 9.011   31.878  28.168  1.00 12.24  ? 53  ILE D N     1 
ATOM   9297  C CA    . ILE D 1 53  ? 7.695   32.442  27.877  1.00 11.60  ? 53  ILE D CA    1 
ATOM   9298  C C     . ILE D 1 53  ? 7.713   33.461  26.769  1.00 9.81   ? 53  ILE D C     1 
ATOM   9299  O O     . ILE D 1 53  ? 6.704   33.581  26.077  1.00 11.34  ? 53  ILE D O     1 
ATOM   9300  C CB    . ILE D 1 53  ? 6.955   33.226  29.003  1.00 11.46  ? 53  ILE D CB    1 
ATOM   9301  C CG1   . ILE D 1 53  ? 7.933   33.935  29.886  1.00 12.14  ? 53  ILE D CG1   1 
ATOM   9302  C CG2   . ILE D 1 53  ? 6.048   32.295  29.754  1.00 8.10   ? 53  ILE D CG2   1 
ATOM   9303  C CD1   . ILE D 1 53  ? 7.220   35.200  30.322  1.00 12.90  ? 53  ILE D CD1   1 
ATOM   9304  H H     . ILE D 1 53  ? 9.322   31.828  29.098  1.00 0.00   ? 53  ILE D H     1 
ATOM   9305  N N     . ALA D 1 54  ? 8.794   34.195  26.534  1.00 4.61   ? 54  ALA D N     1 
ATOM   9306  C CA    . ALA D 1 54  ? 8.786   35.106  25.415  1.00 9.70   ? 54  ALA D CA    1 
ATOM   9307  C C     . ALA D 1 54  ? 8.383   34.423  24.107  1.00 13.21  ? 54  ALA D C     1 
ATOM   9308  O O     . ALA D 1 54  ? 7.631   34.986  23.304  1.00 11.99  ? 54  ALA D O     1 
ATOM   9309  C CB    . ALA D 1 54  ? 10.126  35.685  25.194  1.00 6.01   ? 54  ALA D CB    1 
ATOM   9310  H H     . ALA D 1 54  ? 9.559   34.134  27.131  1.00 0.00   ? 54  ALA D H     1 
ATOM   9311  N N     . HIS D 1 55  ? 8.787   33.171  23.869  1.00 13.37  ? 55  HIS D N     1 
ATOM   9312  C CA    . HIS D 1 55  ? 8.428   32.529  22.616  1.00 13.90  ? 55  HIS D CA    1 
ATOM   9313  C C     . HIS D 1 55  ? 6.938   32.279  22.557  1.00 16.43  ? 55  HIS D C     1 
ATOM   9314  O O     . HIS D 1 55  ? 6.342   32.466  21.495  1.00 19.88  ? 55  HIS D O     1 
ATOM   9315  C CB    . HIS D 1 55  ? 9.194   31.215  22.451  1.00 10.09  ? 55  HIS D CB    1 
ATOM   9316  C CG    . HIS D 1 55  ? 10.614  31.460  21.946  1.00 13.98  ? 55  HIS D CG    1 
ATOM   9317  N ND1   . HIS D 1 55  ? 10.938  31.496  20.655  1.00 15.49  ? 55  HIS D ND1   1 
ATOM   9318  C CD2   . HIS D 1 55  ? 11.713  31.818  22.676  1.00 13.87  ? 55  HIS D CD2   1 
ATOM   9319  C CE1   . HIS D 1 55  ? 12.184  31.902  20.571  1.00 12.73  ? 55  HIS D CE1   1 
ATOM   9320  N NE2   . HIS D 1 55  ? 12.632  32.098  21.792  1.00 13.97  ? 55  HIS D NE2   1 
ATOM   9321  H H     . HIS D 1 55  ? 9.274   32.675  24.560  1.00 0.00   ? 55  HIS D H     1 
ATOM   9322  H HD1   . HIS D 1 55  ? 10.485  30.978  19.950  1.00 0.00   ? 55  HIS D HD1   1 
ATOM   9323  H HE2   . HIS D 1 55  ? 13.554  32.352  22.040  1.00 0.00   ? 55  HIS D HE2   1 
ATOM   9324  N N     . LEU D 1 56  ? 6.312   31.981  23.699  1.00 16.17  ? 56  LEU D N     1 
ATOM   9325  C CA    . LEU D 1 56  ? 4.882   31.739  23.726  1.00 19.50  ? 56  LEU D CA    1 
ATOM   9326  C C     . LEU D 1 56  ? 4.164   33.062  23.529  1.00 19.87  ? 56  LEU D C     1 
ATOM   9327  O O     . LEU D 1 56  ? 3.058   33.111  22.993  1.00 26.71  ? 56  LEU D O     1 
ATOM   9328  C CB    . LEU D 1 56  ? 4.418   31.177  25.053  1.00 20.33  ? 56  LEU D CB    1 
ATOM   9329  C CG    . LEU D 1 56  ? 5.245   30.116  25.736  1.00 31.87  ? 56  LEU D CG    1 
ATOM   9330  C CD1   . LEU D 1 56  ? 4.498   29.690  26.985  1.00 32.69  ? 56  LEU D CD1   1 
ATOM   9331  C CD2   . LEU D 1 56  ? 5.506   28.931  24.808  1.00 32.89  ? 56  LEU D CD2   1 
ATOM   9332  H H     . LEU D 1 56  ? 6.799   32.009  24.548  1.00 0.00   ? 56  LEU D H     1 
ATOM   9333  N N     . TYR D 1 57  ? 4.758   34.154  23.998  1.00 13.00  ? 57  TYR D N     1 
ATOM   9334  C CA    . TYR D 1 57  ? 4.184   35.456  23.833  1.00 9.15   ? 57  TYR D CA    1 
ATOM   9335  C C     . TYR D 1 57  ? 4.619   36.114  22.531  1.00 12.67  ? 57  TYR D C     1 
ATOM   9336  O O     . TYR D 1 57  ? 4.474   37.329  22.331  1.00 14.02  ? 57  TYR D O     1 
ATOM   9337  C CB    . TYR D 1 57  ? 4.557   36.287  25.063  1.00 13.43  ? 57  TYR D CB    1 
ATOM   9338  C CG    . TYR D 1 57  ? 3.618   36.009  26.235  1.00 12.19  ? 57  TYR D CG    1 
ATOM   9339  C CD1   . TYR D 1 57  ? 3.639   34.825  26.935  1.00 9.85   ? 57  TYR D CD1   1 
ATOM   9340  C CD2   . TYR D 1 57  ? 2.652   36.941  26.532  1.00 19.81  ? 57  TYR D CD2   1 
ATOM   9341  C CE1   . TYR D 1 57  ? 2.666   34.553  27.883  1.00 17.45  ? 57  TYR D CE1   1 
ATOM   9342  C CE2   . TYR D 1 57  ? 1.673   36.670  27.460  1.00 18.62  ? 57  TYR D CE2   1 
ATOM   9343  C CZ    . TYR D 1 57  ? 1.675   35.473  28.125  1.00 16.47  ? 57  TYR D CZ    1 
ATOM   9344  O OH    . TYR D 1 57  ? 0.656   35.220  29.029  1.00 17.49  ? 57  TYR D OH    1 
ATOM   9345  H H     . TYR D 1 57  ? 5.614   34.076  24.467  1.00 0.00   ? 57  TYR D H     1 
ATOM   9346  H HH    . TYR D 1 57  ? 0.032   35.954  28.972  1.00 0.00   ? 57  TYR D HH    1 
ATOM   9347  N N     . GLY D 1 58  ? 5.176   35.302  21.635  1.00 12.81  ? 58  GLY D N     1 
ATOM   9348  C CA    . GLY D 1 58  ? 5.412   35.693  20.259  1.00 15.99  ? 58  GLY D CA    1 
ATOM   9349  C C     . GLY D 1 58  ? 6.594   36.563  19.992  1.00 14.83  ? 58  GLY D C     1 
ATOM   9350  O O     . GLY D 1 58  ? 6.572   37.385  19.074  1.00 17.49  ? 58  GLY D O     1 
ATOM   9351  H H     . GLY D 1 58  ? 5.403   34.385  21.882  1.00 0.00   ? 58  GLY D H     1 
ATOM   9352  N N     . ILE D 1 59  ? 7.669   36.378  20.744  1.00 16.56  ? 59  ILE D N     1 
ATOM   9353  C CA    . ILE D 1 59  ? 8.848   37.186  20.515  1.00 15.94  ? 59  ILE D CA    1 
ATOM   9354  C C     . ILE D 1 59  ? 9.439   36.904  19.140  1.00 17.82  ? 59  ILE D C     1 
ATOM   9355  O O     . ILE D 1 59  ? 10.085  37.768  18.553  1.00 15.23  ? 59  ILE D O     1 
ATOM   9356  C CB    . ILE D 1 59  ? 9.882   36.908  21.628  1.00 15.93  ? 59  ILE D CB    1 
ATOM   9357  C CG1   . ILE D 1 59  ? 10.899  38.041  21.587  1.00 16.28  ? 59  ILE D CG1   1 
ATOM   9358  C CG2   . ILE D 1 59  ? 10.526  35.531  21.475  1.00 16.23  ? 59  ILE D CG2   1 
ATOM   9359  C CD1   . ILE D 1 59  ? 12.093  37.957  22.555  1.00 12.13  ? 59  ILE D CD1   1 
ATOM   9360  H H     . ILE D 1 59  ? 7.604   35.782  21.516  1.00 0.00   ? 59  ILE D H     1 
ATOM   9361  N N     . ALA D 1 60  ? 9.204   35.695  18.615  1.00 20.61  ? 60  ALA D N     1 
ATOM   9362  C CA    . ALA D 1 60  ? 9.714   35.315  17.314  1.00 24.04  ? 60  ALA D CA    1 
ATOM   9363  C C     . ALA D 1 60  ? 8.594   35.172  16.287  1.00 29.77  ? 60  ALA D C     1 
ATOM   9364  O O     . ALA D 1 60  ? 8.743   34.428  15.311  1.00 32.65  ? 60  ALA D O     1 
ATOM   9365  C CB    . ALA D 1 60  ? 10.447  33.999  17.451  1.00 25.94  ? 60  ALA D CB    1 
ATOM   9366  H H     . ALA D 1 60  ? 8.550   35.103  19.038  1.00 0.00   ? 60  ALA D H     1 
ATOM   9367  N N     . GLY D 1 61  ? 7.471   35.866  16.453  1.00 33.61  ? 61  GLY D N     1 
ATOM   9368  C CA    . GLY D 1 61  ? 6.344   35.686  15.556  1.00 41.06  ? 61  GLY D CA    1 
ATOM   9369  C C     . GLY D 1 61  ? 5.236   34.854  16.208  1.00 45.22  ? 61  GLY D C     1 
ATOM   9370  O O     . GLY D 1 61  ? 5.508   34.164  17.202  1.00 46.95  ? 61  GLY D O     1 
ATOM   9371  H H     . GLY D 1 61  ? 7.332   36.447  17.228  1.00 0.00   ? 61  GLY D H     1 
ATOM   9372  N N     . LYS D 1 71  ? -3.640  21.733  33.462  1.00 33.02  ? 71  LYS D N     1 
ATOM   9373  C CA    . LYS D 1 71  ? -2.833  22.894  33.102  1.00 32.10  ? 71  LYS D CA    1 
ATOM   9374  C C     . LYS D 1 71  ? -1.670  22.336  32.295  1.00 31.32  ? 71  LYS D C     1 
ATOM   9375  O O     . LYS D 1 71  ? -1.281  21.208  32.586  1.00 37.44  ? 71  LYS D O     1 
ATOM   9376  C CB    . LYS D 1 71  ? -2.326  23.593  34.387  1.00 36.07  ? 71  LYS D CB    1 
ATOM   9377  C CG    . LYS D 1 71  ? -1.244  24.672  34.331  1.00 36.84  ? 71  LYS D CG    1 
ATOM   9378  C CD    . LYS D 1 71  ? -1.653  25.875  33.493  1.00 42.98  ? 71  LYS D CD    1 
ATOM   9379  C CE    . LYS D 1 71  ? -0.397  26.588  32.990  1.00 44.74  ? 71  LYS D CE    1 
ATOM   9380  N NZ    . LYS D 1 71  ? -0.682  27.400  31.816  1.00 51.01  ? 71  LYS D NZ    1 
ATOM   9381  H HZ1   . LYS D 1 71  ? -1.049  26.795  31.054  1.00 0.00   ? 71  LYS D HZ1   1 
ATOM   9382  H HZ2   . LYS D 1 71  ? -1.394  28.119  32.057  1.00 0.00   ? 71  LYS D HZ2   1 
ATOM   9383  H HZ3   . LYS D 1 71  ? 0.191   27.867  31.500  1.00 0.00   ? 71  LYS D HZ3   1 
ATOM   9384  N N     . LYS D 1 72  ? -1.072  23.002  31.309  1.00 24.56  ? 72  LYS D N     1 
ATOM   9385  C CA    . LYS D 1 72  ? 0.061   22.438  30.591  1.00 23.12  ? 72  LYS D CA    1 
ATOM   9386  C C     . LYS D 1 72  ? 1.284   22.324  31.469  1.00 20.28  ? 72  LYS D C     1 
ATOM   9387  O O     . LYS D 1 72  ? 2.073   21.410  31.283  1.00 22.86  ? 72  LYS D O     1 
ATOM   9388  C CB    . LYS D 1 72  ? 0.438   23.277  29.402  1.00 25.95  ? 72  LYS D CB    1 
ATOM   9389  C CG    . LYS D 1 72  ? -0.523  22.946  28.301  1.00 36.16  ? 72  LYS D CG    1 
ATOM   9390  C CD    . LYS D 1 72  ? -0.205  23.656  26.999  1.00 41.26  ? 72  LYS D CD    1 
ATOM   9391  C CE    . LYS D 1 72  ? -1.117  23.089  25.919  1.00 47.20  ? 72  LYS D CE    1 
ATOM   9392  N NZ    . LYS D 1 72  ? -0.827  21.682  25.649  1.00 48.52  ? 72  LYS D NZ    1 
ATOM   9393  H H     . LYS D 1 72  ? -1.407  23.872  31.023  1.00 0.00   ? 72  LYS D H     1 
ATOM   9394  H HZ1   . LYS D 1 72  ? 0.163   21.594  25.344  1.00 0.00   ? 72  LYS D HZ1   1 
ATOM   9395  H HZ2   . LYS D 1 72  ? -0.981  21.114  26.506  1.00 0.00   ? 72  LYS D HZ2   1 
ATOM   9396  H HZ3   . LYS D 1 72  ? -1.452  21.346  24.890  1.00 0.00   ? 72  LYS D HZ3   1 
ATOM   9397  N N     . LEU D 1 73  ? 1.465   23.186  32.460  1.00 17.19  ? 73  LEU D N     1 
ATOM   9398  C CA    . LEU D 1 73  ? 2.609   23.080  33.326  1.00 15.04  ? 73  LEU D CA    1 
ATOM   9399  C C     . LEU D 1 73  ? 2.568   21.776  34.094  1.00 15.70  ? 73  LEU D C     1 
ATOM   9400  O O     . LEU D 1 73  ? 3.559   21.050  34.030  1.00 20.93  ? 73  LEU D O     1 
ATOM   9401  C CB    . LEU D 1 73  ? 2.639   24.293  34.253  1.00 13.70  ? 73  LEU D CB    1 
ATOM   9402  C CG    . LEU D 1 73  ? 3.894   24.524  35.123  1.00 18.55  ? 73  LEU D CG    1 
ATOM   9403  C CD1   . LEU D 1 73  ? 5.176   24.260  34.370  1.00 16.34  ? 73  LEU D CD1   1 
ATOM   9404  C CD2   . LEU D 1 73  ? 3.874   25.988  35.579  1.00 18.39  ? 73  LEU D CD2   1 
ATOM   9405  H H     . LEU D 1 73  ? 0.906   23.978  32.520  1.00 0.00   ? 73  LEU D H     1 
ATOM   9406  N N     . ASP D 1 74  ? 1.483   21.355  34.739  1.00 16.95  ? 74  ASP D N     1 
ATOM   9407  C CA    . ASP D 1 74  ? 1.595   20.083  35.440  1.00 17.49  ? 74  ASP D CA    1 
ATOM   9408  C C     . ASP D 1 74  ? 1.444   18.869  34.549  1.00 13.48  ? 74  ASP D C     1 
ATOM   9409  O O     . ASP D 1 74  ? 1.695   17.760  35.006  1.00 16.85  ? 74  ASP D O     1 
ATOM   9410  C CB    . ASP D 1 74  ? 0.584   20.013  36.607  1.00 16.28  ? 74  ASP D CB    1 
ATOM   9411  C CG    . ASP D 1 74  ? -0.844  20.407  36.349  1.00 16.32  ? 74  ASP D CG    1 
ATOM   9412  O OD1   . ASP D 1 74  ? -1.304  20.352  35.215  1.00 24.66  ? 74  ASP D OD1   1 
ATOM   9413  O OD2   . ASP D 1 74  ? -1.513  20.756  37.306  1.00 20.27  ? 74  ASP D OD2   1 
ATOM   9414  H H     . ASP D 1 74  ? 0.668   21.885  34.771  1.00 0.00   ? 74  ASP D H     1 
ATOM   9415  N N     . VAL D 1 75  ? 1.062   18.999  33.284  1.00 8.82   ? 75  VAL D N     1 
ATOM   9416  C CA    . VAL D 1 75  ? 1.062   17.852  32.374  1.00 9.33   ? 75  VAL D CA    1 
ATOM   9417  C C     . VAL D 1 75  ? 2.492   17.709  31.884  1.00 8.18   ? 75  VAL D C     1 
ATOM   9418  O O     . VAL D 1 75  ? 2.962   16.579  31.739  1.00 14.13  ? 75  VAL D O     1 
ATOM   9419  C CB    . VAL D 1 75  ? 0.090   18.097  31.193  1.00 10.22  ? 75  VAL D CB    1 
ATOM   9420  C CG1   . VAL D 1 75  ? 0.318   17.184  29.994  1.00 6.39   ? 75  VAL D CG1   1 
ATOM   9421  C CG2   . VAL D 1 75  ? -1.297  17.818  31.735  1.00 13.08  ? 75  VAL D CG2   1 
ATOM   9422  H H     . VAL D 1 75  ? 0.847   19.886  32.932  1.00 0.00   ? 75  VAL D H     1 
ATOM   9423  N N     . LEU D 1 76  ? 3.211   18.816  31.662  1.00 9.32   ? 76  LEU D N     1 
ATOM   9424  C CA    . LEU D 1 76  ? 4.619   18.793  31.281  1.00 9.10   ? 76  LEU D CA    1 
ATOM   9425  C C     . LEU D 1 76  ? 5.388   18.193  32.436  1.00 9.92   ? 76  LEU D C     1 
ATOM   9426  O O     . LEU D 1 76  ? 6.098   17.224  32.172  1.00 14.05  ? 76  LEU D O     1 
ATOM   9427  C CB    . LEU D 1 76  ? 5.172   20.197  31.004  1.00 5.40   ? 76  LEU D CB    1 
ATOM   9428  C CG    . LEU D 1 76  ? 6.655   20.340  30.635  1.00 7.32   ? 76  LEU D CG    1 
ATOM   9429  C CD1   . LEU D 1 76  ? 7.009   19.473  29.449  1.00 3.66   ? 76  LEU D CD1   1 
ATOM   9430  C CD2   . LEU D 1 76  ? 6.939   21.788  30.284  1.00 9.40   ? 76  LEU D CD2   1 
ATOM   9431  H H     . LEU D 1 76  ? 2.787   19.691  31.771  1.00 0.00   ? 76  LEU D H     1 
ATOM   9432  N N     . SER D 1 77  ? 5.252   18.669  33.681  1.00 4.41   ? 77  SER D N     1 
ATOM   9433  C CA    . SER D 1 77  ? 5.904   18.085  34.840  1.00 5.48   ? 77  SER D CA    1 
ATOM   9434  C C     . SER D 1 77  ? 5.784   16.567  34.933  1.00 12.34  ? 77  SER D C     1 
ATOM   9435  O O     . SER D 1 77  ? 6.769   15.848  35.120  1.00 17.72  ? 77  SER D O     1 
ATOM   9436  C CB    . SER D 1 77  ? 5.319   18.734  36.058  1.00 2.68   ? 77  SER D CB    1 
ATOM   9437  O OG    . SER D 1 77  ? 5.539   20.127  35.908  1.00 5.43   ? 77  SER D OG    1 
ATOM   9438  H H     . SER D 1 77  ? 4.761   19.508  33.838  1.00 0.00   ? 77  SER D H     1 
ATOM   9439  H HG    . SER D 1 77  ? 6.210   20.377  36.551  1.00 0.00   ? 77  SER D HG    1 
ATOM   9440  N N     . ASN D 1 78  ? 4.582   16.059  34.702  1.00 12.10  ? 78  ASN D N     1 
ATOM   9441  C CA    . ASN D 1 78  ? 4.310   14.639  34.691  1.00 13.21  ? 78  ASN D CA    1 
ATOM   9442  C C     . ASN D 1 78  ? 5.082   13.996  33.545  1.00 13.67  ? 78  ASN D C     1 
ATOM   9443  O O     . ASN D 1 78  ? 5.614   12.894  33.683  1.00 12.48  ? 78  ASN D O     1 
ATOM   9444  C CB    . ASN D 1 78  ? 2.798   14.421  34.520  1.00 13.21  ? 78  ASN D CB    1 
ATOM   9445  C CG    . ASN D 1 78  ? 2.315   12.988  34.726  1.00 15.49  ? 78  ASN D CG    1 
ATOM   9446  O OD1   . ASN D 1 78  ? 2.675   12.290  35.681  1.00 11.77  ? 78  ASN D OD1   1 
ATOM   9447  N ND2   . ASN D 1 78  ? 1.458   12.502  33.830  1.00 12.88  ? 78  ASN D ND2   1 
ATOM   9448  H H     . ASN D 1 78  ? 3.844   16.676  34.512  1.00 0.00   ? 78  ASN D H     1 
ATOM   9449  H HD21  . ASN D 1 78  ? 1.151   11.588  33.976  1.00 0.00   ? 78  ASN D HD21  1 
ATOM   9450  H HD22  . ASN D 1 78  ? 1.182   13.053  33.063  1.00 0.00   ? 78  ASN D HD22  1 
ATOM   9451  N N     . ASP D 1 79  ? 5.218   14.675  32.408  1.00 7.93   ? 79  ASP D N     1 
ATOM   9452  C CA    . ASP D 1 79  ? 5.920   14.079  31.303  1.00 6.42   ? 79  ASP D CA    1 
ATOM   9453  C C     . ASP D 1 79  ? 7.398   14.046  31.515  1.00 8.61   ? 79  ASP D C     1 
ATOM   9454  O O     . ASP D 1 79  ? 8.055   13.090  31.118  1.00 11.57  ? 79  ASP D O     1 
ATOM   9455  C CB    . ASP D 1 79  ? 5.595   14.834  30.061  1.00 6.06   ? 79  ASP D CB    1 
ATOM   9456  C CG    . ASP D 1 79  ? 4.219   14.495  29.510  1.00 10.59  ? 79  ASP D CG    1 
ATOM   9457  O OD1   . ASP D 1 79  ? 3.642   13.436  29.814  1.00 14.80  ? 79  ASP D OD1   1 
ATOM   9458  O OD2   . ASP D 1 79  ? 3.735   15.311  28.737  1.00 15.46  ? 79  ASP D OD2   1 
ATOM   9459  H H     . ASP D 1 79  ? 4.828   15.569  32.307  1.00 0.00   ? 79  ASP D H     1 
ATOM   9460  N N     . LEU D 1 80  ? 7.910   15.048  32.213  1.00 10.24  ? 80  LEU D N     1 
ATOM   9461  C CA    . LEU D 1 80  ? 9.311   15.070  32.546  1.00 9.43   ? 80  LEU D CA    1 
ATOM   9462  C C     . LEU D 1 80  ? 9.606   13.982  33.564  1.00 8.17   ? 80  LEU D C     1 
ATOM   9463  O O     . LEU D 1 80  ? 10.462  13.148  33.276  1.00 14.23  ? 80  LEU D O     1 
ATOM   9464  C CB    . LEU D 1 80  ? 9.653   16.463  33.058  1.00 8.42   ? 80  LEU D CB    1 
ATOM   9465  C CG    . LEU D 1 80  ? 9.739   17.514  31.959  1.00 4.18   ? 80  LEU D CG    1 
ATOM   9466  C CD1   . LEU D 1 80  ? 9.935   18.899  32.523  1.00 3.04   ? 80  LEU D CD1   1 
ATOM   9467  C CD2   . LEU D 1 80  ? 10.932  17.184  31.096  1.00 7.77   ? 80  LEU D CD2   1 
ATOM   9468  H H     . LEU D 1 80  ? 7.329   15.782  32.494  1.00 0.00   ? 80  LEU D H     1 
ATOM   9469  N N     . VAL D 1 81  ? 8.922   13.867  34.703  1.00 4.67   ? 81  VAL D N     1 
ATOM   9470  C CA    . VAL D 1 81  ? 9.202   12.815  35.672  1.00 4.76   ? 81  VAL D CA    1 
ATOM   9471  C C     . VAL D 1 81  ? 9.060   11.431  35.085  1.00 5.84   ? 81  VAL D C     1 
ATOM   9472  O O     . VAL D 1 81  ? 9.932   10.596  35.267  1.00 11.80  ? 81  VAL D O     1 
ATOM   9473  C CB    . VAL D 1 81  ? 8.262   12.894  36.881  1.00 2.53   ? 81  VAL D CB    1 
ATOM   9474  C CG1   . VAL D 1 81  ? 8.656   11.850  37.919  1.00 2.00   ? 81  VAL D CG1   1 
ATOM   9475  C CG2   . VAL D 1 81  ? 8.396   14.249  37.526  1.00 5.46   ? 81  VAL D CG2   1 
ATOM   9476  H H     . VAL D 1 81  ? 8.203   14.508  34.880  1.00 0.00   ? 81  VAL D H     1 
ATOM   9477  N N     . MET D 1 82  ? 7.974   11.175  34.371  1.00 10.01  ? 82  MET D N     1 
ATOM   9478  C CA    . MET D 1 82  ? 7.660   9.874   33.796  1.00 10.87  ? 82  MET D CA    1 
ATOM   9479  C C     . MET D 1 82  ? 8.707   9.379   32.808  1.00 9.44   ? 82  MET D C     1 
ATOM   9480  O O     . MET D 1 82  ? 9.265   8.286   32.951  1.00 10.77  ? 82  MET D O     1 
ATOM   9481  C CB    . MET D 1 82  ? 6.323   9.940   33.072  1.00 10.30  ? 82  MET D CB    1 
ATOM   9482  C CG    . MET D 1 82  ? 5.583   8.626   32.963  1.00 15.50  ? 82  MET D CG    1 
ATOM   9483  S SD    . MET D 1 82  ? 4.721   8.214   34.506  1.00 21.45  ? 82  MET D SD    1 
ATOM   9484  C CE    . MET D 1 82  ? 3.194   8.975   34.105  1.00 14.14  ? 82  MET D CE    1 
ATOM   9485  H H     . MET D 1 82  ? 7.327   11.901  34.241  1.00 0.00   ? 82  MET D H     1 
ATOM   9486  N N     . ASN D 1 83  ? 9.012   10.184  31.804  1.00 4.37   ? 83  ASN D N     1 
ATOM   9487  C CA    . ASN D 1 83  ? 9.954   9.768   30.805  1.00 13.77  ? 83  ASN D CA    1 
ATOM   9488  C C     . ASN D 1 83  ? 11.346  9.658   31.373  1.00 15.24  ? 83  ASN D C     1 
ATOM   9489  O O     . ASN D 1 83  ? 12.071  8.776   30.920  1.00 17.33  ? 83  ASN D O     1 
ATOM   9490  C CB    . ASN D 1 83  ? 9.945   10.743  29.655  1.00 23.06  ? 83  ASN D CB    1 
ATOM   9491  C CG    . ASN D 1 83  ? 8.620   10.588  28.924  1.00 36.12  ? 83  ASN D CG    1 
ATOM   9492  O OD1   . ASN D 1 83  ? 8.242   9.485   28.524  1.00 44.73  ? 83  ASN D OD1   1 
ATOM   9493  N ND2   . ASN D 1 83  ? 7.800   11.609  28.749  1.00 37.77  ? 83  ASN D ND2   1 
ATOM   9494  H H     . ASN D 1 83  ? 8.615   11.082  31.757  1.00 0.00   ? 83  ASN D H     1 
ATOM   9495  H HD21  . ASN D 1 83  ? 7.025   11.492  28.165  1.00 0.00   ? 83  ASN D HD21  1 
ATOM   9496  H HD22  . ASN D 1 83  ? 8.039   12.481  29.139  1.00 0.00   ? 83  ASN D HD22  1 
ATOM   9497  N N     . MET D 1 84  ? 11.738  10.460  32.379  1.00 12.91  ? 84  MET D N     1 
ATOM   9498  C CA    . MET D 1 84  ? 13.063  10.337  32.949  1.00 11.69  ? 84  MET D CA    1 
ATOM   9499  C C     . MET D 1 84  ? 13.184  9.085   33.794  1.00 11.84  ? 84  MET D C     1 
ATOM   9500  O O     . MET D 1 84  ? 14.228  8.434   33.757  1.00 10.77  ? 84  MET D O     1 
ATOM   9501  C CB    . MET D 1 84  ? 13.429  11.571  33.801  1.00 7.66   ? 84  MET D CB    1 
ATOM   9502  C CG    . MET D 1 84  ? 13.905  12.749  32.945  1.00 2.00   ? 84  MET D CG    1 
ATOM   9503  S SD    . MET D 1 84  ? 15.168  12.420  31.679  1.00 10.09  ? 84  MET D SD    1 
ATOM   9504  C CE    . MET D 1 84  ? 16.529  12.044  32.742  1.00 7.54   ? 84  MET D CE    1 
ATOM   9505  H H     . MET D 1 84  ? 11.154  11.184  32.695  1.00 0.00   ? 84  MET D H     1 
ATOM   9506  N N     . LEU D 1 85  ? 12.149  8.679   34.522  1.00 12.47  ? 85  LEU D N     1 
ATOM   9507  C CA    . LEU D 1 85  ? 12.197  7.453   35.292  1.00 12.14  ? 85  LEU D CA    1 
ATOM   9508  C C     . LEU D 1 85  ? 12.103  6.178   34.455  1.00 16.30  ? 85  LEU D C     1 
ATOM   9509  O O     . LEU D 1 85  ? 12.804  5.210   34.784  1.00 18.33  ? 85  LEU D O     1 
ATOM   9510  C CB    . LEU D 1 85  ? 11.083  7.467   36.300  1.00 13.20  ? 85  LEU D CB    1 
ATOM   9511  C CG    . LEU D 1 85  ? 11.141  8.512   37.381  1.00 10.95  ? 85  LEU D CG    1 
ATOM   9512  C CD1   . LEU D 1 85  ? 9.855   8.402   38.159  1.00 19.54  ? 85  LEU D CD1   1 
ATOM   9513  C CD2   . LEU D 1 85  ? 12.325  8.316   38.298  1.00 12.35  ? 85  LEU D CD2   1 
ATOM   9514  H H     . LEU D 1 85  ? 11.345  9.245   34.553  1.00 0.00   ? 85  LEU D H     1 
ATOM   9515  N N     . LYS D 1 86  ? 11.270  6.066   33.400  1.00 14.73  ? 86  LYS D N     1 
ATOM   9516  C CA    . LYS D 1 86  ? 11.254  4.884   32.526  1.00 12.10  ? 86  LYS D CA    1 
ATOM   9517  C C     . LYS D 1 86  ? 12.641  4.634   31.957  1.00 14.38  ? 86  LYS D C     1 
ATOM   9518  O O     . LYS D 1 86  ? 13.177  3.532   32.048  1.00 16.17  ? 86  LYS D O     1 
ATOM   9519  C CB    . LYS D 1 86  ? 10.313  5.080   31.367  1.00 8.48   ? 86  LYS D CB    1 
ATOM   9520  C CG    . LYS D 1 86  ? 8.875   5.134   31.804  1.00 14.64  ? 86  LYS D CG    1 
ATOM   9521  C CD    . LYS D 1 86  ? 8.064   5.363   30.550  1.00 22.49  ? 86  LYS D CD    1 
ATOM   9522  C CE    . LYS D 1 86  ? 6.567   5.361   30.804  1.00 23.19  ? 86  LYS D CE    1 
ATOM   9523  N NZ    . LYS D 1 86  ? 5.869   5.626   29.558  1.00 28.26  ? 86  LYS D NZ    1 
ATOM   9524  H H     . LYS D 1 86  ? 10.652  6.808   33.220  1.00 0.00   ? 86  LYS D H     1 
ATOM   9525  H HZ1   . LYS D 1 86  ? 6.184   6.545   29.184  1.00 0.00   ? 86  LYS D HZ1   1 
ATOM   9526  H HZ2   . LYS D 1 86  ? 6.103   4.877   28.876  1.00 0.00   ? 86  LYS D HZ2   1 
ATOM   9527  H HZ3   . LYS D 1 86  ? 4.843   5.639   29.734  1.00 0.00   ? 86  LYS D HZ3   1 
ATOM   9528  N N     . SER D 1 87  ? 13.289  5.684   31.447  1.00 17.66  ? 87  SER D N     1 
ATOM   9529  C CA    . SER D 1 87  ? 14.639  5.604   30.919  1.00 17.14  ? 87  SER D CA    1 
ATOM   9530  C C     . SER D 1 87  ? 15.700  5.365   31.977  1.00 15.13  ? 87  SER D C     1 
ATOM   9531  O O     . SER D 1 87  ? 16.891  5.252   31.650  1.00 16.43  ? 87  SER D O     1 
ATOM   9532  C CB    . SER D 1 87  ? 14.958  6.895   30.200  1.00 21.67  ? 87  SER D CB    1 
ATOM   9533  O OG    . SER D 1 87  ? 13.887  7.224   29.334  1.00 31.21  ? 87  SER D OG    1 
ATOM   9534  H H     . SER D 1 87  ? 12.840  6.556   31.370  1.00 0.00   ? 87  SER D H     1 
ATOM   9535  H HG    . SER D 1 87  ? 13.664  6.493   28.744  1.00 0.00   ? 87  SER D HG    1 
ATOM   9536  N N     . SER D 1 88  ? 15.370  5.313   33.261  1.00 10.95  ? 88  SER D N     1 
ATOM   9537  C CA    . SER D 1 88  ? 16.410  5.093   34.229  1.00 9.92   ? 88  SER D CA    1 
ATOM   9538  C C     . SER D 1 88  ? 16.724  3.613   34.251  1.00 12.37  ? 88  SER D C     1 
ATOM   9539  O O     . SER D 1 88  ? 17.777  3.181   34.726  1.00 18.38  ? 88  SER D O     1 
ATOM   9540  C CB    . SER D 1 88  ? 15.929  5.555   35.589  1.00 13.60  ? 88  SER D CB    1 
ATOM   9541  O OG    . SER D 1 88  ? 14.910  4.740   36.138  1.00 2.89   ? 88  SER D OG    1 
ATOM   9542  H H     . SER D 1 88  ? 14.444  5.364   33.580  1.00 0.00   ? 88  SER D H     1 
ATOM   9543  H HG    . SER D 1 88  ? 15.132  4.642   37.071  1.00 0.00   ? 88  SER D HG    1 
ATOM   9544  N N     . PHE D 1 89  ? 15.768  2.828   33.762  1.00 15.61  ? 89  PHE D N     1 
ATOM   9545  C CA    . PHE D 1 89  ? 15.757  1.378   33.756  1.00 16.40  ? 89  PHE D CA    1 
ATOM   9546  C C     . PHE D 1 89  ? 15.639  0.852   35.179  1.00 16.68  ? 89  PHE D C     1 
ATOM   9547  O O     . PHE D 1 89  ? 15.934  -0.306  35.470  1.00 18.10  ? 89  PHE D O     1 
ATOM   9548  C CB    . PHE D 1 89  ? 17.027  0.848   33.062  1.00 15.35  ? 89  PHE D CB    1 
ATOM   9549  C CG    . PHE D 1 89  ? 16.929  0.899   31.548  1.00 20.21  ? 89  PHE D CG    1 
ATOM   9550  C CD1   . PHE D 1 89  ? 16.846  2.100   30.884  1.00 24.94  ? 89  PHE D CD1   1 
ATOM   9551  C CD2   . PHE D 1 89  ? 16.857  -0.280  30.834  1.00 26.19  ? 89  PHE D CD2   1 
ATOM   9552  C CE1   . PHE D 1 89  ? 16.649  2.119   29.520  1.00 27.25  ? 89  PHE D CE1   1 
ATOM   9553  C CE2   . PHE D 1 89  ? 16.673  -0.254  29.469  1.00 27.57  ? 89  PHE D CE2   1 
ATOM   9554  C CZ    . PHE D 1 89  ? 16.560  0.947   28.809  1.00 28.93  ? 89  PHE D CZ    1 
ATOM   9555  H H     . PHE D 1 89  ? 14.964  3.241   33.383  1.00 0.00   ? 89  PHE D H     1 
ATOM   9556  N N     . ALA D 1 90  ? 15.129  1.667   36.102  1.00 14.29  ? 90  ALA D N     1 
ATOM   9557  C CA    . ALA D 1 90  ? 15.055  1.252   37.489  1.00 13.36  ? 90  ALA D CA    1 
ATOM   9558  C C     . ALA D 1 90  ? 13.634  1.080   37.979  1.00 14.21  ? 90  ALA D C     1 
ATOM   9559  O O     . ALA D 1 90  ? 13.418  0.629   39.108  1.00 21.76  ? 90  ALA D O     1 
ATOM   9560  C CB    . ALA D 1 90  ? 15.736  2.278   38.371  1.00 4.63   ? 90  ALA D CB    1 
ATOM   9561  H H     . ALA D 1 90  ? 14.766  2.534   35.820  1.00 0.00   ? 90  ALA D H     1 
ATOM   9562  N N     . THR D 1 91  ? 12.623  1.316   37.172  1.00 15.89  ? 91  THR D N     1 
ATOM   9563  C CA    . THR D 1 91  ? 11.262  1.300   37.683  1.00 17.18  ? 91  THR D CA    1 
ATOM   9564  C C     . THR D 1 91  ? 10.405  0.223   37.031  1.00 17.94  ? 91  THR D C     1 
ATOM   9565  O O     . THR D 1 91  ? 10.790  -0.307  35.983  1.00 20.12  ? 91  THR D O     1 
ATOM   9566  C CB    . THR D 1 91  ? 10.665  2.703   37.454  1.00 15.16  ? 91  THR D CB    1 
ATOM   9567  O OG1   . THR D 1 91  ? 10.702  2.910   36.044  1.00 8.07   ? 91  THR D OG1   1 
ATOM   9568  C CG2   . THR D 1 91  ? 11.413  3.803   38.187  1.00 5.62   ? 91  THR D CG2   1 
ATOM   9569  H H     . THR D 1 91  ? 12.728  1.393   36.200  1.00 0.00   ? 91  THR D H     1 
ATOM   9570  H HG1   . THR D 1 91  ? 11.247  3.677   35.817  1.00 0.00   ? 91  THR D HG1   1 
ATOM   9571  N N     . CYS D 1 92  ? 9.308   -0.214  37.657  1.00 18.39  ? 92  CYS D N     1 
ATOM   9572  C CA    . CYS D 1 92  ? 8.395   -1.115  36.979  1.00 17.38  ? 92  CYS D CA    1 
ATOM   9573  C C     . CYS D 1 92  ? 6.949   -0.661  37.095  1.00 14.92  ? 92  CYS D C     1 
ATOM   9574  O O     . CYS D 1 92  ? 6.153   -1.016  36.220  1.00 18.26  ? 92  CYS D O     1 
ATOM   9575  C CB    . CYS D 1 92  ? 8.563   -2.558  37.521  1.00 12.75  ? 92  CYS D CB    1 
ATOM   9576  S SG    . CYS D 1 92  ? 8.308   -2.805  39.288  1.00 16.06  ? 92  CYS D SG    1 
ATOM   9577  H H     . CYS D 1 92  ? 9.152   0.041   38.589  1.00 0.00   ? 92  CYS D H     1 
ATOM   9578  N N     . VAL D 1 93  ? 6.548   0.156   38.085  1.00 15.01  ? 93  VAL D N     1 
ATOM   9579  C CA    . VAL D 1 93  ? 5.174   0.659   38.230  1.00 12.06  ? 93  VAL D CA    1 
ATOM   9580  C C     . VAL D 1 93  ? 5.347   2.079   38.710  1.00 7.84   ? 93  VAL D C     1 
ATOM   9581  O O     . VAL D 1 93  ? 6.104   2.334   39.655  1.00 8.32   ? 93  VAL D O     1 
ATOM   9582  C CB    . VAL D 1 93  ? 4.339   -0.129  39.289  1.00 15.11  ? 93  VAL D CB    1 
ATOM   9583  C CG1   . VAL D 1 93  ? 2.955   0.496   39.461  1.00 13.94  ? 93  VAL D CG1   1 
ATOM   9584  C CG2   . VAL D 1 93  ? 4.137   -1.563  38.816  1.00 11.77  ? 93  VAL D CG2   1 
ATOM   9585  H H     . VAL D 1 93  ? 7.201   0.509   38.724  1.00 0.00   ? 93  VAL D H     1 
ATOM   9586  N N     . LEU D 1 94  ? 4.692   3.006   38.029  1.00 4.81   ? 94  LEU D N     1 
ATOM   9587  C CA    . LEU D 1 94  ? 4.797   4.408   38.345  1.00 6.02   ? 94  LEU D CA    1 
ATOM   9588  C C     . LEU D 1 94  ? 3.405   4.875   38.642  1.00 3.48   ? 94  LEU D C     1 
ATOM   9589  O O     . LEU D 1 94  ? 2.541   4.725   37.781  1.00 3.47   ? 94  LEU D O     1 
ATOM   9590  C CB    . LEU D 1 94  ? 5.315   5.214   37.167  1.00 2.00   ? 94  LEU D CB    1 
ATOM   9591  C CG    . LEU D 1 94  ? 6.680   4.851   36.655  1.00 4.45   ? 94  LEU D CG    1 
ATOM   9592  C CD1   . LEU D 1 94  ? 6.905   5.593   35.369  1.00 9.77   ? 94  LEU D CD1   1 
ATOM   9593  C CD2   . LEU D 1 94  ? 7.757   5.227   37.641  1.00 2.54   ? 94  LEU D CD2   1 
ATOM   9594  H H     . LEU D 1 94  ? 4.085   2.733   37.306  1.00 0.00   ? 94  LEU D H     1 
ATOM   9595  N N     . VAL D 1 95  ? 3.156   5.448   39.811  1.00 4.43   ? 95  VAL D N     1 
ATOM   9596  C CA    . VAL D 1 95  ? 1.846   5.987   40.119  1.00 6.11   ? 95  VAL D CA    1 
ATOM   9597  C C     . VAL D 1 95  ? 1.950   7.506   40.127  1.00 5.94   ? 95  VAL D C     1 
ATOM   9598  O O     . VAL D 1 95  ? 2.653   8.111   40.922  1.00 5.96   ? 95  VAL D O     1 
ATOM   9599  C CB    . VAL D 1 95  ? 1.384   5.441   41.495  1.00 4.61   ? 95  VAL D CB    1 
ATOM   9600  C CG1   . VAL D 1 95  ? 0.053   6.021   41.933  1.00 2.00   ? 95  VAL D CG1   1 
ATOM   9601  C CG2   . VAL D 1 95  ? 1.199   3.947   41.366  1.00 3.38   ? 95  VAL D CG2   1 
ATOM   9602  H H     . VAL D 1 95  ? 3.881   5.580   40.454  1.00 0.00   ? 95  VAL D H     1 
ATOM   9603  N N     . SER D 1 96  ? 1.274   8.184   39.239  1.00 12.52  ? 96  SER D N     1 
ATOM   9604  C CA    . SER D 1 96  ? 1.242   9.622   39.224  1.00 12.87  ? 96  SER D CA    1 
ATOM   9605  C C     . SER D 1 96  ? -0.135  10.123  39.657  1.00 14.14  ? 96  SER D C     1 
ATOM   9606  O O     . SER D 1 96  ? -1.166  9.566   39.250  1.00 15.71  ? 96  SER D O     1 
ATOM   9607  C CB    . SER D 1 96  ? 1.495   10.124  37.843  1.00 8.84   ? 96  SER D CB    1 
ATOM   9608  O OG    . SER D 1 96  ? 1.552   11.533  37.968  1.00 2.00   ? 96  SER D OG    1 
ATOM   9609  H H     . SER D 1 96  ? 0.674   7.692   38.641  1.00 0.00   ? 96  SER D H     1 
ATOM   9610  H HG    . SER D 1 96  ? 2.297   11.798  37.406  1.00 0.00   ? 96  SER D HG    1 
ATOM   9611  N N     . GLU D 1 97  ? -0.163  11.236  40.398  1.00 15.53  ? 97  GLU D N     1 
ATOM   9612  C CA    . GLU D 1 97  ? -1.371  11.961  40.791  1.00 16.93  ? 97  GLU D CA    1 
ATOM   9613  C C     . GLU D 1 97  ? -2.196  12.263  39.550  1.00 16.08  ? 97  GLU D C     1 
ATOM   9614  O O     . GLU D 1 97  ? -3.405  12.071  39.512  1.00 20.87  ? 97  GLU D O     1 
ATOM   9615  C CB    . GLU D 1 97  ? -0.996  13.290  41.474  1.00 17.64  ? 97  GLU D CB    1 
ATOM   9616  C CG    . GLU D 1 97  ? -2.082  14.157  42.129  1.00 24.37  ? 97  GLU D CG    1 
ATOM   9617  C CD    . GLU D 1 97  ? -3.025  14.879  41.177  1.00 37.93  ? 97  GLU D CD    1 
ATOM   9618  O OE1   . GLU D 1 97  ? -2.581  15.743  40.446  1.00 46.03  ? 97  GLU D OE1   1 
ATOM   9619  O OE2   . GLU D 1 97  ? -4.217  14.563  41.155  1.00 46.34  ? 97  GLU D OE2   1 
ATOM   9620  H H     . GLU D 1 97  ? 0.717   11.575  40.677  1.00 0.00   ? 97  GLU D H     1 
ATOM   9621  N N     . GLU D 1 98  ? -1.506  12.718  38.521  1.00 16.00  ? 98  GLU D N     1 
ATOM   9622  C CA    . GLU D 1 98  ? -2.083  13.089  37.252  1.00 16.57  ? 98  GLU D CA    1 
ATOM   9623  C C     . GLU D 1 98  ? -2.721  11.970  36.455  1.00 15.95  ? 98  GLU D C     1 
ATOM   9624  O O     . GLU D 1 98  ? -3.379  12.236  35.452  1.00 15.55  ? 98  GLU D O     1 
ATOM   9625  C CB    . GLU D 1 98  ? -0.988  13.717  36.441  1.00 18.36  ? 98  GLU D CB    1 
ATOM   9626  C CG    . GLU D 1 98  ? -0.853  15.224  36.592  1.00 24.68  ? 98  GLU D CG    1 
ATOM   9627  C CD    . GLU D 1 98  ? -1.893  15.987  35.786  1.00 27.50  ? 98  GLU D CD    1 
ATOM   9628  O OE1   . GLU D 1 98  ? -2.295  15.511  34.716  1.00 28.81  ? 98  GLU D OE1   1 
ATOM   9629  O OE2   . GLU D 1 98  ? -2.295  17.063  36.232  1.00 33.93  ? 98  GLU D OE2   1 
ATOM   9630  H H     . GLU D 1 98  ? -0.528  12.722  38.596  1.00 0.00   ? 98  GLU D H     1 
ATOM   9631  N N     . ASP D 1 99  ? -2.510  10.710  36.811  1.00 15.05  ? 99  ASP D N     1 
ATOM   9632  C CA    . ASP D 1 99  ? -3.046  9.625   36.016  1.00 18.39  ? 99  ASP D CA    1 
ATOM   9633  C C     . ASP D 1 99  ? -3.861  8.698   36.867  1.00 18.11  ? 99  ASP D C     1 
ATOM   9634  O O     . ASP D 1 99  ? -3.462  8.214   37.938  1.00 18.17  ? 99  ASP D O     1 
ATOM   9635  C CB    . ASP D 1 99  ? -1.958  8.785   35.353  1.00 22.53  ? 99  ASP D CB    1 
ATOM   9636  C CG    . ASP D 1 99  ? -1.155  9.538   34.303  1.00 24.52  ? 99  ASP D CG    1 
ATOM   9637  O OD1   . ASP D 1 99  ? -1.710  9.918   33.271  1.00 28.66  ? 99  ASP D OD1   1 
ATOM   9638  O OD2   . ASP D 1 99  ? 0.032   9.743   34.521  1.00 26.13  ? 99  ASP D OD2   1 
ATOM   9639  H H     . ASP D 1 99  ? -2.107  10.491  37.677  1.00 0.00   ? 99  ASP D H     1 
ATOM   9640  N N     . LYS D 1 100 ? -5.040  8.485   36.292  1.00 22.59  ? 100 LYS D N     1 
ATOM   9641  C CA    . LYS D 1 100 ? -6.063  7.624   36.858  1.00 22.71  ? 100 LYS D CA    1 
ATOM   9642  C C     . LYS D 1 100 ? -5.559  6.236   37.260  1.00 18.43  ? 100 LYS D C     1 
ATOM   9643  O O     . LYS D 1 100 ? -5.839  5.772   38.366  1.00 15.12  ? 100 LYS D O     1 
ATOM   9644  C CB    . LYS D 1 100 ? -7.206  7.508   35.841  1.00 24.74  ? 100 LYS D CB    1 
ATOM   9645  C CG    . LYS D 1 100 ? -8.468  6.874   36.432  1.00 30.22  ? 100 LYS D CG    1 
ATOM   9646  C CD    . LYS D 1 100 ? -9.618  6.899   35.454  1.00 35.97  ? 100 LYS D CD    1 
ATOM   9647  C CE    . LYS D 1 100 ? -10.854 6.346   36.142  1.00 42.50  ? 100 LYS D CE    1 
ATOM   9648  N NZ    . LYS D 1 100 ? -11.981 6.461   35.232  1.00 49.48  ? 100 LYS D NZ    1 
ATOM   9649  H H     . LYS D 1 100 ? -5.265  9.016   35.493  1.00 0.00   ? 100 LYS D H     1 
ATOM   9650  H HZ1   . LYS D 1 100 ? -12.120 7.460   34.977  1.00 0.00   ? 100 LYS D HZ1   1 
ATOM   9651  H HZ2   . LYS D 1 100 ? -11.787 5.911   34.371  1.00 0.00   ? 100 LYS D HZ2   1 
ATOM   9652  H HZ3   . LYS D 1 100 ? -12.842 6.096   35.689  1.00 0.00   ? 100 LYS D HZ3   1 
ATOM   9653  N N     . HIS D 1 101 ? -4.766  5.571   36.426  1.00 17.68  ? 101 HIS D N     1 
ATOM   9654  C CA    . HIS D 1 101 ? -4.312  4.216   36.715  1.00 18.00  ? 101 HIS D CA    1 
ATOM   9655  C C     . HIS D 1 101 ? -2.815  4.251   36.852  1.00 12.64  ? 101 HIS D C     1 
ATOM   9656  O O     . HIS D 1 101 ? -2.196  5.229   36.468  1.00 10.04  ? 101 HIS D O     1 
ATOM   9657  C CB    . HIS D 1 101 ? -4.627  3.226   35.588  1.00 19.09  ? 101 HIS D CB    1 
ATOM   9658  C CG    . HIS D 1 101 ? -6.099  3.112   35.229  1.00 28.46  ? 101 HIS D CG    1 
ATOM   9659  N ND1   . HIS D 1 101 ? -6.987  2.453   35.966  1.00 30.08  ? 101 HIS D ND1   1 
ATOM   9660  C CD2   . HIS D 1 101 ? -6.741  3.683   34.151  1.00 30.13  ? 101 HIS D CD2   1 
ATOM   9661  C CE1   . HIS D 1 101 ? -8.151  2.615   35.374  1.00 34.13  ? 101 HIS D CE1   1 
ATOM   9662  N NE2   . HIS D 1 101 ? -7.994  3.360   34.296  1.00 30.03  ? 101 HIS D NE2   1 
ATOM   9663  H H     . HIS D 1 101 ? -4.313  6.062   35.709  1.00 0.00   ? 101 HIS D H     1 
ATOM   9664  H HD1   . HIS D 1 101 ? -6.838  1.995   36.822  1.00 0.00   ? 101 HIS D HD1   1 
ATOM   9665  H HE2   . HIS D 1 101 ? -8.722  3.645   33.699  1.00 0.00   ? 101 HIS D HE2   1 
ATOM   9666  N N     . ALA D 1 102 ? -2.258  3.175   37.373  1.00 13.24  ? 102 ALA D N     1 
ATOM   9667  C CA    . ALA D 1 102 ? -0.831  3.038   37.494  1.00 16.16  ? 102 ALA D CA    1 
ATOM   9668  C C     . ALA D 1 102 ? -0.263  2.815   36.108  1.00 18.08  ? 102 ALA D C     1 
ATOM   9669  O O     . ALA D 1 102 ? -0.947  2.254   35.242  1.00 20.53  ? 102 ALA D O     1 
ATOM   9670  C CB    . ALA D 1 102 ? -0.499  1.833   38.337  1.00 16.57  ? 102 ALA D CB    1 
ATOM   9671  H H     . ALA D 1 102 ? -2.807  2.418   37.650  1.00 0.00   ? 102 ALA D H     1 
ATOM   9672  N N     . ILE D 1 103 ? 0.961   3.257   35.867  1.00 18.41  ? 103 ILE D N     1 
ATOM   9673  C CA    . ILE D 1 103 ? 1.656   3.013   34.615  1.00 16.14  ? 103 ILE D CA    1 
ATOM   9674  C C     . ILE D 1 103 ? 2.568   1.796   34.800  1.00 13.91  ? 103 ILE D C     1 
ATOM   9675  O O     . ILE D 1 103 ? 3.267   1.695   35.815  1.00 9.13   ? 103 ILE D O     1 
ATOM   9676  C CB    . ILE D 1 103 ? 2.436   4.295   34.276  1.00 22.53  ? 103 ILE D CB    1 
ATOM   9677  C CG1   . ILE D 1 103 ? 1.423   5.377   33.873  1.00 26.86  ? 103 ILE D CG1   1 
ATOM   9678  C CG2   . ILE D 1 103 ? 3.450   4.054   33.163  1.00 24.20  ? 103 ILE D CG2   1 
ATOM   9679  C CD1   . ILE D 1 103 ? 0.726   6.158   35.024  1.00 27.19  ? 103 ILE D CD1   1 
ATOM   9680  H H     . ILE D 1 103 ? 1.419   3.775   36.561  1.00 0.00   ? 103 ILE D H     1 
ATOM   9681  N N     . ILE D 1 104 ? 2.587   0.816   33.896  1.00 14.65  ? 104 ILE D N     1 
ATOM   9682  C CA    . ILE D 1 104 ? 3.493   -0.304  34.087  1.00 15.98  ? 104 ILE D CA    1 
ATOM   9683  C C     . ILE D 1 104 ? 4.632   -0.053  33.105  1.00 19.25  ? 104 ILE D C     1 
ATOM   9684  O O     . ILE D 1 104 ? 4.376   0.401   31.988  1.00 19.78  ? 104 ILE D O     1 
ATOM   9685  C CB    . ILE D 1 104 ? 2.809   -1.658  33.788  1.00 12.63  ? 104 ILE D CB    1 
ATOM   9686  C CG1   . ILE D 1 104 ? 1.483   -1.830  34.521  1.00 8.79   ? 104 ILE D CG1   1 
ATOM   9687  C CG2   . ILE D 1 104 ? 3.787   -2.744  34.234  1.00 9.25   ? 104 ILE D CG2   1 
ATOM   9688  C CD1   . ILE D 1 104 ? 1.564   -1.702  36.052  1.00 5.75   ? 104 ILE D CD1   1 
ATOM   9689  H H     . ILE D 1 104 ? 2.157   0.922   33.025  1.00 0.00   ? 104 ILE D H     1 
ATOM   9690  N N     . VAL D 1 105 ? 5.899   -0.266  33.472  1.00 22.37  ? 105 VAL D N     1 
ATOM   9691  C CA    . VAL D 1 105 ? 6.986   0.035   32.562  1.00 18.67  ? 105 VAL D CA    1 
ATOM   9692  C C     . VAL D 1 105 ? 7.115   -1.138  31.601  1.00 20.93  ? 105 VAL D C     1 
ATOM   9693  O O     . VAL D 1 105 ? 6.800   -2.291  31.900  1.00 23.69  ? 105 VAL D O     1 
ATOM   9694  C CB    . VAL D 1 105 ? 8.278   0.280   33.385  1.00 17.80  ? 105 VAL D CB    1 
ATOM   9695  C CG1   . VAL D 1 105 ? 9.442   0.663   32.491  1.00 14.83  ? 105 VAL D CG1   1 
ATOM   9696  C CG2   . VAL D 1 105 ? 8.072   1.452   34.311  1.00 9.72   ? 105 VAL D CG2   1 
ATOM   9697  H H     . VAL D 1 105 ? 6.079   -0.733  34.313  1.00 0.00   ? 105 VAL D H     1 
ATOM   9698  N N     . GLU D 1 106 ? 7.540   -0.805  30.393  1.00 20.63  ? 106 GLU D N     1 
ATOM   9699  C CA    . GLU D 1 106 ? 7.765   -1.761  29.329  1.00 20.51  ? 106 GLU D CA    1 
ATOM   9700  C C     . GLU D 1 106 ? 8.738   -2.794  29.847  1.00 22.65  ? 106 GLU D C     1 
ATOM   9701  O O     . GLU D 1 106 ? 9.706   -2.384  30.495  1.00 23.03  ? 106 GLU D O     1 
ATOM   9702  C CB    . GLU D 1 106 ? 8.400   -1.107  28.105  1.00 22.73  ? 106 GLU D CB    1 
ATOM   9703  C CG    . GLU D 1 106 ? 7.595   0.015   27.442  1.00 37.24  ? 106 GLU D CG    1 
ATOM   9704  C CD    . GLU D 1 106 ? 7.833   1.440   27.948  1.00 41.12  ? 106 GLU D CD    1 
ATOM   9705  O OE1   . GLU D 1 106 ? 7.375   1.791   29.048  1.00 42.24  ? 106 GLU D OE1   1 
ATOM   9706  O OE2   . GLU D 1 106 ? 8.469   2.201   27.209  1.00 40.01  ? 106 GLU D OE2   1 
ATOM   9707  H H     . GLU D 1 106 ? 7.755   0.132   30.252  1.00 0.00   ? 106 GLU D H     1 
ATOM   9708  N N     . PRO D 1 107 ? 8.603   -4.097  29.558  1.00 25.40  ? 107 PRO D N     1 
ATOM   9709  C CA    . PRO D 1 107 ? 9.414   -5.150  30.143  1.00 24.02  ? 107 PRO D CA    1 
ATOM   9710  C C     . PRO D 1 107 ? 10.912  -4.964  29.948  1.00 25.70  ? 107 PRO D C     1 
ATOM   9711  O O     . PRO D 1 107 ? 11.694  -5.322  30.831  1.00 28.91  ? 107 PRO D O     1 
ATOM   9712  C CB    . PRO D 1 107 ? 8.843   -6.394  29.513  1.00 25.00  ? 107 PRO D CB    1 
ATOM   9713  C CG    . PRO D 1 107 ? 8.348   -5.914  28.174  1.00 22.95  ? 107 PRO D CG    1 
ATOM   9714  C CD    . PRO D 1 107 ? 7.652   -4.654  28.601  1.00 24.21  ? 107 PRO D CD    1 
ATOM   9715  N N     . GLU D 1 108 ? 11.338  -4.360  28.834  1.00 25.41  ? 108 GLU D N     1 
ATOM   9716  C CA    . GLU D 1 108 ? 12.754  -4.120  28.613  1.00 30.05  ? 108 GLU D CA    1 
ATOM   9717  C C     . GLU D 1 108 ? 13.329  -2.960  29.417  1.00 29.42  ? 108 GLU D C     1 
ATOM   9718  O O     . GLU D 1 108 ? 14.545  -2.789  29.400  1.00 34.53  ? 108 GLU D O     1 
ATOM   9719  C CB    . GLU D 1 108 ? 13.049  -3.847  27.138  1.00 33.22  ? 108 GLU D CB    1 
ATOM   9720  C CG    . GLU D 1 108 ? 12.439  -2.599  26.502  1.00 41.29  ? 108 GLU D CG    1 
ATOM   9721  C CD    . GLU D 1 108 ? 11.162  -2.776  25.671  1.00 48.59  ? 108 GLU D CD    1 
ATOM   9722  O OE1   . GLU D 1 108 ? 10.418  -3.750  25.859  1.00 48.55  ? 108 GLU D OE1   1 
ATOM   9723  O OE2   . GLU D 1 108 ? 10.913  -1.905  24.828  1.00 50.55  ? 108 GLU D OE2   1 
ATOM   9724  H H     . GLU D 1 108 ? 10.693  -4.076  28.162  1.00 0.00   ? 108 GLU D H     1 
ATOM   9725  N N     . LYS D 1 109 ? 12.529  -2.127  30.088  1.00 24.70  ? 109 LYS D N     1 
ATOM   9726  C CA    . LYS D 1 109 ? 13.055  -1.030  30.885  1.00 20.12  ? 109 LYS D CA    1 
ATOM   9727  C C     . LYS D 1 109 ? 12.770  -1.190  32.361  1.00 20.57  ? 109 LYS D C     1 
ATOM   9728  O O     . LYS D 1 109 ? 13.069  -0.283  33.142  1.00 23.22  ? 109 LYS D O     1 
ATOM   9729  C CB    . LYS D 1 109 ? 12.464  0.281   30.451  1.00 16.88  ? 109 LYS D CB    1 
ATOM   9730  C CG    . LYS D 1 109 ? 12.920  0.630   29.088  1.00 13.87  ? 109 LYS D CG    1 
ATOM   9731  C CD    . LYS D 1 109 ? 12.212  1.853   28.631  1.00 14.17  ? 109 LYS D CD    1 
ATOM   9732  C CE    . LYS D 1 109 ? 12.940  2.157   27.348  1.00 20.03  ? 109 LYS D CE    1 
ATOM   9733  N NZ    . LYS D 1 109 ? 12.110  2.920   26.438  1.00 25.40  ? 109 LYS D NZ    1 
ATOM   9734  H H     . LYS D 1 109 ? 11.569  -2.291  30.118  1.00 0.00   ? 109 LYS D H     1 
ATOM   9735  H HZ1   . LYS D 1 109 ? 11.824  3.809   26.895  1.00 0.00   ? 109 LYS D HZ1   1 
ATOM   9736  H HZ2   . LYS D 1 109 ? 12.645  3.127   25.571  1.00 0.00   ? 109 LYS D HZ2   1 
ATOM   9737  H HZ3   . LYS D 1 109 ? 11.262  2.366   26.199  1.00 0.00   ? 109 LYS D HZ3   1 
ATOM   9738  N N     . ARG D 1 110 ? 12.205  -2.333  32.764  1.00 20.56  ? 110 ARG D N     1 
ATOM   9739  C CA    . ARG D 1 110 ? 11.848  -2.532  34.157  1.00 19.44  ? 110 ARG D CA    1 
ATOM   9740  C C     . ARG D 1 110 ? 13.053  -2.779  35.033  1.00 17.29  ? 110 ARG D C     1 
ATOM   9741  O O     . ARG D 1 110 ? 13.985  -3.497  34.655  1.00 21.01  ? 110 ARG D O     1 
ATOM   9742  C CB    . ARG D 1 110 ? 10.931  -3.730  34.393  1.00 19.55  ? 110 ARG D CB    1 
ATOM   9743  C CG    . ARG D 1 110 ? 9.539   -3.580  33.885  1.00 21.41  ? 110 ARG D CG    1 
ATOM   9744  C CD    . ARG D 1 110 ? 8.688   -4.779  34.250  1.00 18.63  ? 110 ARG D CD    1 
ATOM   9745  N NE    . ARG D 1 110 ? 7.471   -4.636  33.472  1.00 19.53  ? 110 ARG D NE    1 
ATOM   9746  C CZ    . ARG D 1 110 ? 6.866   -5.653  32.859  1.00 17.46  ? 110 ARG D CZ    1 
ATOM   9747  N NH1   . ARG D 1 110 ? 7.234   -6.914  33.034  1.00 14.78  ? 110 ARG D NH1   1 
ATOM   9748  N NH2   . ARG D 1 110 ? 5.812   -5.395  32.097  1.00 24.71  ? 110 ARG D NH2   1 
ATOM   9749  H H     . ARG D 1 110 ? 12.122  -3.079  32.141  1.00 0.00   ? 110 ARG D H     1 
ATOM   9750  H HE    . ARG D 1 110 ? 7.057   -3.750  33.413  1.00 0.00   ? 110 ARG D HE    1 
ATOM   9751  H HH11  . ARG D 1 110 ? 7.988   -7.138  33.651  1.00 0.00   ? 110 ARG D HH11  1 
ATOM   9752  H HH12  . ARG D 1 110 ? 6.748   -7.641  32.551  1.00 0.00   ? 110 ARG D HH12  1 
ATOM   9753  H HH21  . ARG D 1 110 ? 5.489   -4.454  31.993  1.00 0.00   ? 110 ARG D HH21  1 
ATOM   9754  H HH22  . ARG D 1 110 ? 5.345   -6.141  31.624  1.00 0.00   ? 110 ARG D HH22  1 
ATOM   9755  N N     . GLY D 1 111 ? 12.978  -2.208  36.229  1.00 12.98  ? 111 GLY D N     1 
ATOM   9756  C CA    . GLY D 1 111 ? 13.959  -2.389  37.285  1.00 6.77   ? 111 GLY D CA    1 
ATOM   9757  C C     . GLY D 1 111 ? 13.173  -2.839  38.484  1.00 6.74   ? 111 GLY D C     1 
ATOM   9758  O O     . GLY D 1 111 ? 12.083  -3.389  38.326  1.00 11.02  ? 111 GLY D O     1 
ATOM   9759  H H     . GLY D 1 111 ? 12.185  -1.666  36.407  1.00 0.00   ? 111 GLY D H     1 
ATOM   9760  N N     . LYS D 1 112 ? 13.611  -2.615  39.709  1.00 7.56   ? 112 LYS D N     1 
ATOM   9761  C CA    . LYS D 1 112 ? 12.803  -3.132  40.801  1.00 6.69   ? 112 LYS D CA    1 
ATOM   9762  C C     . LYS D 1 112 ? 12.014  -2.127  41.622  1.00 8.68   ? 112 LYS D C     1 
ATOM   9763  O O     . LYS D 1 112 ? 11.414  -2.487  42.651  1.00 2.36   ? 112 LYS D O     1 
ATOM   9764  C CB    . LYS D 1 112 ? 13.716  -3.955  41.697  1.00 11.44  ? 112 LYS D CB    1 
ATOM   9765  C CG    . LYS D 1 112 ? 14.910  -3.291  42.314  1.00 14.79  ? 112 LYS D CG    1 
ATOM   9766  C CD    . LYS D 1 112 ? 15.843  -4.392  42.795  1.00 23.52  ? 112 LYS D CD    1 
ATOM   9767  C CE    . LYS D 1 112 ? 17.186  -3.836  43.243  1.00 22.56  ? 112 LYS D CE    1 
ATOM   9768  N NZ    . LYS D 1 112 ? 17.907  -3.314  42.098  1.00 30.61  ? 112 LYS D NZ    1 
ATOM   9769  H H     . LYS D 1 112 ? 14.465  -2.174  39.872  1.00 0.00   ? 112 LYS D H     1 
ATOM   9770  H HZ1   . LYS D 1 112 ? 18.051  -4.075  41.404  1.00 0.00   ? 112 LYS D HZ1   1 
ATOM   9771  H HZ2   . LYS D 1 112 ? 17.352  -2.551  41.661  1.00 0.00   ? 112 LYS D HZ2   1 
ATOM   9772  H HZ3   . LYS D 1 112 ? 18.828  -2.941  42.404  1.00 0.00   ? 112 LYS D HZ3   1 
ATOM   9773  N N     . TYR D 1 113 ? 11.963  -0.867  41.171  1.00 5.06   ? 113 TYR D N     1 
ATOM   9774  C CA    . TYR D 1 113 ? 11.317  0.167   41.946  1.00 3.42   ? 113 TYR D CA    1 
ATOM   9775  C C     . TYR D 1 113 ? 9.970   0.721   41.465  1.00 8.30   ? 113 TYR D C     1 
ATOM   9776  O O     . TYR D 1 113 ? 9.699   0.900   40.265  1.00 6.84   ? 113 TYR D O     1 
ATOM   9777  C CB    . TYR D 1 113 ? 12.337  1.277   42.093  1.00 7.27   ? 113 TYR D CB    1 
ATOM   9778  C CG    . TYR D 1 113 ? 13.561  0.848   42.887  1.00 9.51   ? 113 TYR D CG    1 
ATOM   9779  C CD1   . TYR D 1 113 ? 13.421  0.655   44.240  1.00 10.01  ? 113 TYR D CD1   1 
ATOM   9780  C CD2   . TYR D 1 113 ? 14.781  0.632   42.280  1.00 8.55   ? 113 TYR D CD2   1 
ATOM   9781  C CE1   . TYR D 1 113 ? 14.485  0.236   45.001  1.00 5.85   ? 113 TYR D CE1   1 
ATOM   9782  C CE2   . TYR D 1 113 ? 15.852  0.189   43.036  1.00 6.78   ? 113 TYR D CE2   1 
ATOM   9783  C CZ    . TYR D 1 113 ? 15.679  -0.012  44.390  1.00 8.06   ? 113 TYR D CZ    1 
ATOM   9784  O OH    . TYR D 1 113 ? 16.675  -0.501  45.196  1.00 12.23  ? 113 TYR D OH    1 
ATOM   9785  H H     . TYR D 1 113 ? 12.364  -0.618  40.311  1.00 0.00   ? 113 TYR D H     1 
ATOM   9786  H HH    . TYR D 1 113 ? 17.448  -0.783  44.659  1.00 0.00   ? 113 TYR D HH    1 
ATOM   9787  N N     . VAL D 1 114 ? 9.070   0.904   42.441  1.00 6.07   ? 114 VAL D N     1 
ATOM   9788  C CA    . VAL D 1 114 ? 7.759   1.502   42.263  1.00 4.10   ? 114 VAL D CA    1 
ATOM   9789  C C     . VAL D 1 114 ? 7.881   2.932   42.757  1.00 4.93   ? 114 VAL D C     1 
ATOM   9790  O O     . VAL D 1 114 ? 8.292   3.187   43.902  1.00 3.51   ? 114 VAL D O     1 
ATOM   9791  C CB    . VAL D 1 114 ? 6.712   0.790   43.103  1.00 4.25   ? 114 VAL D CB    1 
ATOM   9792  C CG1   . VAL D 1 114 ? 5.367   1.433   42.810  1.00 3.95   ? 114 VAL D CG1   1 
ATOM   9793  C CG2   . VAL D 1 114 ? 6.695   -0.720  42.793  1.00 3.90   ? 114 VAL D CG2   1 
ATOM   9794  H H     . VAL D 1 114 ? 9.340   0.666   43.350  1.00 0.00   ? 114 VAL D H     1 
ATOM   9795  N N     . VAL D 1 115 ? 7.556   3.892   41.918  1.00 4.10   ? 115 VAL D N     1 
ATOM   9796  C CA    . VAL D 1 115 ? 7.687   5.274   42.340  1.00 3.33   ? 115 VAL D CA    1 
ATOM   9797  C C     . VAL D 1 115 ? 6.292   5.878   42.389  1.00 4.77   ? 115 VAL D C     1 
ATOM   9798  O O     . VAL D 1 115 ? 5.504   5.683   41.461  1.00 4.43   ? 115 VAL D O     1 
ATOM   9799  C CB    . VAL D 1 115 ? 8.560   6.051   41.349  1.00 2.00   ? 115 VAL D CB    1 
ATOM   9800  C CG1   . VAL D 1 115 ? 9.015   7.323   42.014  1.00 2.00   ? 115 VAL D CG1   1 
ATOM   9801  C CG2   . VAL D 1 115 ? 9.777   5.277   40.948  1.00 3.10   ? 115 VAL D CG2   1 
ATOM   9802  H H     . VAL D 1 115 ? 7.106   3.679   41.074  1.00 0.00   ? 115 VAL D H     1 
ATOM   9803  N N     . CYS D 1 116 ? 5.934   6.589   43.447  1.00 8.71   ? 116 CYS D N     1 
ATOM   9804  C CA    . CYS D 1 116 ? 4.632   7.251   43.527  1.00 8.80   ? 116 CYS D CA    1 
ATOM   9805  C C     . CYS D 1 116 ? 4.921   8.754   43.600  1.00 9.69   ? 116 CYS D C     1 
ATOM   9806  O O     . CYS D 1 116 ? 5.724   9.164   44.459  1.00 12.68  ? 116 CYS D O     1 
ATOM   9807  C CB    . CYS D 1 116 ? 3.908   6.743   44.773  1.00 5.72   ? 116 CYS D CB    1 
ATOM   9808  S SG    . CYS D 1 116 ? 3.649   4.944   44.779  1.00 11.48  ? 116 CYS D SG    1 
ATOM   9809  H H     . CYS D 1 116 ? 6.560   6.710   44.193  1.00 0.00   ? 116 CYS D H     1 
ATOM   9810  N N     . PHE D 1 117 ? 4.355   9.613   42.735  1.00 6.53   ? 117 PHE D N     1 
ATOM   9811  C CA    . PHE D 1 117 ? 4.731   11.008  42.737  1.00 6.52   ? 117 PHE D CA    1 
ATOM   9812  C C     . PHE D 1 117 ? 3.623   11.984  42.415  1.00 6.40   ? 117 PHE D C     1 
ATOM   9813  O O     . PHE D 1 117 ? 2.663   11.662  41.711  1.00 8.58   ? 117 PHE D O     1 
ATOM   9814  C CB    . PHE D 1 117 ? 5.891   11.232  41.749  1.00 6.86   ? 117 PHE D CB    1 
ATOM   9815  C CG    . PHE D 1 117 ? 5.638   10.871  40.285  1.00 3.29   ? 117 PHE D CG    1 
ATOM   9816  C CD1   . PHE D 1 117 ? 5.818   9.561   39.854  1.00 2.00   ? 117 PHE D CD1   1 
ATOM   9817  C CD2   . PHE D 1 117 ? 5.294   11.855  39.394  1.00 2.00   ? 117 PHE D CD2   1 
ATOM   9818  C CE1   . PHE D 1 117 ? 5.684   9.239   38.521  1.00 2.00   ? 117 PHE D CE1   1 
ATOM   9819  C CE2   . PHE D 1 117 ? 5.113   11.518  38.074  1.00 3.14   ? 117 PHE D CE2   1 
ATOM   9820  C CZ    . PHE D 1 117 ? 5.316   10.223  37.633  1.00 5.87   ? 117 PHE D CZ    1 
ATOM   9821  H H     . PHE D 1 117 ? 3.648   9.321   42.118  1.00 0.00   ? 117 PHE D H     1 
ATOM   9822  N N     . ASP D 1 118 ? 3.688   13.190  42.962  1.00 6.81   ? 118 ASP D N     1 
ATOM   9823  C CA    . ASP D 1 118 ? 2.750   14.225  42.582  1.00 5.66   ? 118 ASP D CA    1 
ATOM   9824  C C     . ASP D 1 118 ? 3.664   15.155  41.812  1.00 5.84   ? 118 ASP D C     1 
ATOM   9825  O O     . ASP D 1 118 ? 4.516   15.777  42.435  1.00 7.08   ? 118 ASP D O     1 
ATOM   9826  C CB    . ASP D 1 118 ? 2.177   14.927  43.810  1.00 3.20   ? 118 ASP D CB    1 
ATOM   9827  C CG    . ASP D 1 118 ? 1.235   16.087  43.525  1.00 8.73   ? 118 ASP D CG    1 
ATOM   9828  O OD1   . ASP D 1 118 ? 0.956   16.387  42.359  1.00 12.12  ? 118 ASP D OD1   1 
ATOM   9829  O OD2   . ASP D 1 118 ? 0.768   16.709  44.486  1.00 6.53   ? 118 ASP D OD2   1 
ATOM   9830  H H     . ASP D 1 118 ? 4.389   13.378  43.622  1.00 0.00   ? 118 ASP D H     1 
ATOM   9831  N N     . PRO D 1 119 ? 3.593   15.277  40.489  1.00 6.16   ? 119 PRO D N     1 
ATOM   9832  C CA    . PRO D 1 119 ? 4.596   15.979  39.710  1.00 4.13   ? 119 PRO D CA    1 
ATOM   9833  C C     . PRO D 1 119 ? 4.596   17.488  39.886  1.00 5.85   ? 119 PRO D C     1 
ATOM   9834  O O     . PRO D 1 119 ? 5.640   18.079  39.665  1.00 2.00   ? 119 PRO D O     1 
ATOM   9835  C CB    . PRO D 1 119 ? 4.318   15.519  38.300  1.00 4.97   ? 119 PRO D CB    1 
ATOM   9836  C CG    . PRO D 1 119 ? 2.825   15.310  38.307  1.00 2.00   ? 119 PRO D CG    1 
ATOM   9837  C CD    . PRO D 1 119 ? 2.575   14.673  39.648  1.00 2.00   ? 119 PRO D CD    1 
ATOM   9838  N N     . LEU D 1 120 ? 3.493   18.175  40.201  1.00 6.09   ? 120 LEU D N     1 
ATOM   9839  C CA    . LEU D 1 120 ? 3.585   19.587  40.500  1.00 8.07   ? 120 LEU D CA    1 
ATOM   9840  C C     . LEU D 1 120 ? 2.494   19.928  41.493  1.00 13.45  ? 120 LEU D C     1 
ATOM   9841  O O     . LEU D 1 120 ? 1.414   20.440  41.194  1.00 19.44  ? 120 LEU D O     1 
ATOM   9842  C CB    . LEU D 1 120 ? 3.433   20.384  39.225  1.00 8.66   ? 120 LEU D CB    1 
ATOM   9843  C CG    . LEU D 1 120 ? 3.762   21.846  39.248  1.00 5.32   ? 120 LEU D CG    1 
ATOM   9844  C CD1   . LEU D 1 120 ? 5.171   22.027  39.772  1.00 2.60   ? 120 LEU D CD1   1 
ATOM   9845  C CD2   . LEU D 1 120 ? 3.693   22.409  37.850  1.00 2.09   ? 120 LEU D CD2   1 
ATOM   9846  H H     . LEU D 1 120 ? 2.617   17.739  40.241  1.00 0.00   ? 120 LEU D H     1 
ATOM   9847  N N     . ASP D 1 121 ? 2.775   19.620  42.748  1.00 18.77  ? 121 ASP D N     1 
ATOM   9848  C CA    . ASP D 1 121 ? 1.831   19.822  43.828  1.00 24.99  ? 121 ASP D CA    1 
ATOM   9849  C C     . ASP D 1 121 ? 1.365   21.255  43.990  1.00 21.51  ? 121 ASP D C     1 
ATOM   9850  O O     . ASP D 1 121 ? 2.151   22.156  44.200  1.00 18.64  ? 121 ASP D O     1 
ATOM   9851  C CB    . ASP D 1 121 ? 2.432   19.363  45.184  1.00 28.87  ? 121 ASP D CB    1 
ATOM   9852  C CG    . ASP D 1 121 ? 1.458   19.507  46.372  1.00 34.62  ? 121 ASP D CG    1 
ATOM   9853  O OD1   . ASP D 1 121 ? 0.566   18.660  46.517  1.00 36.83  ? 121 ASP D OD1   1 
ATOM   9854  O OD2   . ASP D 1 121 ? 1.580   20.472  47.137  1.00 27.31  ? 121 ASP D OD2   1 
ATOM   9855  H H     . ASP D 1 121 ? 3.671   19.271  42.931  1.00 0.00   ? 121 ASP D H     1 
ATOM   9856  N N     . GLY D 1 122 ? 0.068   21.441  43.945  1.00 26.17  ? 122 GLY D N     1 
ATOM   9857  C CA    . GLY D 1 122 ? -0.484  22.739  44.236  1.00 28.95  ? 122 GLY D CA    1 
ATOM   9858  C C     . GLY D 1 122 ? -0.459  23.632  43.018  1.00 32.55  ? 122 GLY D C     1 
ATOM   9859  O O     . GLY D 1 122 ? -0.487  24.871  43.156  1.00 31.77  ? 122 GLY D O     1 
ATOM   9860  H H     . GLY D 1 122 ? -0.516  20.697  43.689  1.00 0.00   ? 122 GLY D H     1 
ATOM   9861  N N     . SER D 1 123 ? -0.475  23.054  41.809  1.00 31.83  ? 123 SER D N     1 
ATOM   9862  C CA    . SER D 1 123 ? -0.533  23.841  40.592  1.00 36.99  ? 123 SER D CA    1 
ATOM   9863  C C     . SER D 1 123 ? -1.930  24.408  40.284  1.00 44.49  ? 123 SER D C     1 
ATOM   9864  O O     . SER D 1 123 ? -2.602  24.054  39.304  1.00 46.81  ? 123 SER D O     1 
ATOM   9865  C CB    . SER D 1 123 ? -0.027  22.950  39.489  1.00 36.03  ? 123 SER D CB    1 
ATOM   9866  O OG    . SER D 1 123 ? -0.699  21.702  39.620  1.00 38.03  ? 123 SER D OG    1 
ATOM   9867  H H     . SER D 1 123 ? -0.419  22.077  41.715  1.00 0.00   ? 123 SER D H     1 
ATOM   9868  H HG    . SER D 1 123 ? -1.593  21.887  39.302  1.00 0.00   ? 123 SER D HG    1 
ATOM   9869  N N     . SER D 1 124 ? -2.419  25.184  41.250  1.00 50.17  ? 124 SER D N     1 
ATOM   9870  C CA    . SER D 1 124 ? -3.621  26.008  41.201  1.00 54.43  ? 124 SER D CA    1 
ATOM   9871  C C     . SER D 1 124 ? -3.111  27.371  41.674  1.00 57.81  ? 124 SER D C     1 
ATOM   9872  O O     . SER D 1 124 ? -3.378  28.445  41.128  1.00 61.16  ? 124 SER D O     1 
ATOM   9873  C CB    . SER D 1 124 ? -4.722  25.486  42.160  1.00 52.89  ? 124 SER D CB    1 
ATOM   9874  O OG    . SER D 1 124 ? -4.335  24.902  43.413  1.00 46.86  ? 124 SER D OG    1 
ATOM   9875  H H     . SER D 1 124 ? -2.014  25.114  42.131  1.00 0.00   ? 124 SER D H     1 
ATOM   9876  H HG    . SER D 1 124 ? -3.978  25.580  44.011  1.00 0.00   ? 124 SER D HG    1 
ATOM   9877  N N     . ASN D 1 125 ? -2.195  27.303  42.645  1.00 58.88  ? 125 ASN D N     1 
ATOM   9878  C CA    . ASN D 1 125 ? -1.552  28.464  43.231  1.00 58.62  ? 125 ASN D CA    1 
ATOM   9879  C C     . ASN D 1 125 ? -0.588  29.097  42.232  1.00 55.52  ? 125 ASN D C     1 
ATOM   9880  O O     . ASN D 1 125 ? -0.233  30.259  42.380  1.00 57.03  ? 125 ASN D O     1 
ATOM   9881  C CB    . ASN D 1 125 ? -0.838  27.989  44.510  1.00 62.13  ? 125 ASN D CB    1 
ATOM   9882  C CG    . ASN D 1 125 ? -1.769  27.303  45.513  1.00 63.09  ? 125 ASN D CG    1 
ATOM   9883  O OD1   . ASN D 1 125 ? -2.531  26.397  45.156  1.00 62.39  ? 125 ASN D OD1   1 
ATOM   9884  N ND2   . ASN D 1 125 ? -1.852  27.684  46.777  1.00 62.36  ? 125 ASN D ND2   1 
ATOM   9885  H H     . ASN D 1 125 ? -1.947  26.431  43.050  1.00 0.00   ? 125 ASN D H     1 
ATOM   9886  H HD21  . ASN D 1 125 ? -2.490  27.225  47.368  1.00 0.00   ? 125 ASN D HD21  1 
ATOM   9887  H HD22  . ASN D 1 125 ? -1.294  28.415  47.096  1.00 0.00   ? 125 ASN D HD22  1 
ATOM   9888  N N     . ILE D 1 126 ? -0.219  28.412  41.143  1.00 50.40  ? 126 ILE D N     1 
ATOM   9889  C CA    . ILE D 1 126 ? 0.677   28.970  40.154  1.00 48.70  ? 126 ILE D CA    1 
ATOM   9890  C C     . ILE D 1 126 ? 0.163   30.204  39.424  1.00 52.12  ? 126 ILE D C     1 
ATOM   9891  O O     . ILE D 1 126 ? 0.990   31.031  39.042  1.00 58.38  ? 126 ILE D O     1 
ATOM   9892  C CB    . ILE D 1 126 ? 1.049   27.829  39.165  1.00 46.09  ? 126 ILE D CB    1 
ATOM   9893  C CG1   . ILE D 1 126 ? 2.525   27.764  39.335  1.00 43.92  ? 126 ILE D CG1   1 
ATOM   9894  C CG2   . ILE D 1 126 ? 0.643   27.999  37.712  1.00 40.71  ? 126 ILE D CG2   1 
ATOM   9895  C CD1   . ILE D 1 126 ? 3.110   26.410  38.918  1.00 47.92  ? 126 ILE D CD1   1 
ATOM   9896  H H     . ILE D 1 126 ? -0.504  27.497  41.067  1.00 0.00   ? 126 ILE D H     1 
ATOM   9897  N N     . ASP D 1 127 ? -1.154  30.448  39.267  1.00 54.44  ? 127 ASP D N     1 
ATOM   9898  C CA    . ASP D 1 127 ? -1.658  31.690  38.638  1.00 53.88  ? 127 ASP D CA    1 
ATOM   9899  C C     . ASP D 1 127 ? -1.253  32.889  39.499  1.00 49.08  ? 127 ASP D C     1 
ATOM   9900  O O     . ASP D 1 127 ? -0.820  33.960  39.074  1.00 45.60  ? 127 ASP D O     1 
ATOM   9901  C CB    . ASP D 1 127 ? -3.195  31.696  38.542  1.00 60.60  ? 127 ASP D CB    1 
ATOM   9902  C CG    . ASP D 1 127 ? -3.850  30.752  37.536  1.00 65.11  ? 127 ASP D CG    1 
ATOM   9903  O OD1   . ASP D 1 127 ? -4.051  29.579  37.871  1.00 67.07  ? 127 ASP D OD1   1 
ATOM   9904  O OD2   . ASP D 1 127 ? -4.225  31.214  36.451  1.00 67.21  ? 127 ASP D OD2   1 
ATOM   9905  H H     . ASP D 1 127 ? -1.795  29.772  39.593  1.00 0.00   ? 127 ASP D H     1 
ATOM   9906  N N     . CYS D 1 128 ? -1.431  32.625  40.791  1.00 46.60  ? 128 CYS D N     1 
ATOM   9907  C CA    . CYS D 1 128 ? -1.149  33.556  41.860  1.00 43.06  ? 128 CYS D CA    1 
ATOM   9908  C C     . CYS D 1 128 ? 0.344   33.521  42.209  1.00 39.50  ? 128 CYS D C     1 
ATOM   9909  O O     . CYS D 1 128 ? 0.782   34.321  43.051  1.00 40.46  ? 128 CYS D O     1 
ATOM   9910  C CB    . CYS D 1 128 ? -2.060  33.159  43.040  1.00 45.39  ? 128 CYS D CB    1 
ATOM   9911  S SG    . CYS D 1 128 ? -3.819  32.983  42.567  1.00 54.17  ? 128 CYS D SG    1 
ATOM   9912  H H     . CYS D 1 128 ? -1.764  31.740  41.032  1.00 0.00   ? 128 CYS D H     1 
ATOM   9913  N N     . LEU D 1 129 ? 1.103   32.640  41.514  1.00 29.81  ? 129 LEU D N     1 
ATOM   9914  C CA    . LEU D 1 129 ? 2.537   32.421  41.584  1.00 25.14  ? 129 LEU D CA    1 
ATOM   9915  C C     . LEU D 1 129 ? 3.104   32.003  42.925  1.00 24.18  ? 129 LEU D C     1 
ATOM   9916  O O     . LEU D 1 129 ? 4.274   32.274  43.255  1.00 22.79  ? 129 LEU D O     1 
ATOM   9917  C CB    . LEU D 1 129 ? 3.301   33.663  41.143  1.00 19.29  ? 129 LEU D CB    1 
ATOM   9918  C CG    . LEU D 1 129 ? 3.152   34.207  39.766  1.00 17.23  ? 129 LEU D CG    1 
ATOM   9919  C CD1   . LEU D 1 129 ? 4.006   35.461  39.715  1.00 21.21  ? 129 LEU D CD1   1 
ATOM   9920  C CD2   . LEU D 1 129 ? 3.581   33.223  38.716  1.00 12.69  ? 129 LEU D CD2   1 
ATOM   9921  H H     . LEU D 1 129 ? 0.653   32.058  40.878  1.00 0.00   ? 129 LEU D H     1 
ATOM   9922  N N     . VAL D 1 130 ? 2.316   31.321  43.736  1.00 22.38  ? 130 VAL D N     1 
ATOM   9923  C CA    . VAL D 1 130 ? 2.903   30.935  44.996  1.00 27.63  ? 130 VAL D CA    1 
ATOM   9924  C C     . VAL D 1 130 ? 3.520   29.570  44.762  1.00 29.11  ? 130 VAL D C     1 
ATOM   9925  O O     . VAL D 1 130 ? 3.280   28.898  43.750  1.00 28.83  ? 130 VAL D O     1 
ATOM   9926  C CB    . VAL D 1 130 ? 1.901   30.822  46.170  1.00 32.75  ? 130 VAL D CB    1 
ATOM   9927  C CG1   . VAL D 1 130 ? 2.570   31.684  47.257  1.00 34.38  ? 130 VAL D CG1   1 
ATOM   9928  C CG2   . VAL D 1 130 ? 0.455   31.254  45.869  1.00 31.83  ? 130 VAL D CG2   1 
ATOM   9929  H H     . VAL D 1 130 ? 1.488   30.930  43.402  1.00 0.00   ? 130 VAL D H     1 
ATOM   9930  N N     . SER D 1 131 ? 4.356   29.225  45.735  1.00 30.10  ? 131 SER D N     1 
ATOM   9931  C CA    . SER D 1 131 ? 5.102   27.997  45.783  1.00 26.01  ? 131 SER D CA    1 
ATOM   9932  C C     . SER D 1 131 ? 4.312   26.755  45.401  1.00 22.29  ? 131 SER D C     1 
ATOM   9933  O O     . SER D 1 131 ? 3.209   26.480  45.884  1.00 25.70  ? 131 SER D O     1 
ATOM   9934  C CB    . SER D 1 131 ? 5.675   27.886  47.205  1.00 27.64  ? 131 SER D CB    1 
ATOM   9935  O OG    . SER D 1 131 ? 6.338   29.086  47.622  1.00 34.48  ? 131 SER D OG    1 
ATOM   9936  H H     . SER D 1 131 ? 4.555   29.857  46.455  1.00 0.00   ? 131 SER D H     1 
ATOM   9937  H HG    . SER D 1 131 ? 6.812   28.918  48.450  1.00 0.00   ? 131 SER D HG    1 
ATOM   9938  N N     . VAL D 1 132 ? 4.959   26.020  44.523  1.00 15.89  ? 132 VAL D N     1 
ATOM   9939  C CA    . VAL D 1 132 ? 4.468   24.766  44.016  1.00 11.37  ? 132 VAL D CA    1 
ATOM   9940  C C     . VAL D 1 132 ? 5.597   23.741  44.305  1.00 10.06  ? 132 VAL D C     1 
ATOM   9941  O O     . VAL D 1 132 ? 6.642   24.123  44.849  1.00 8.29   ? 132 VAL D O     1 
ATOM   9942  C CB    . VAL D 1 132 ? 4.151   25.182  42.560  1.00 11.63  ? 132 VAL D CB    1 
ATOM   9943  C CG1   . VAL D 1 132 ? 5.406   25.214  41.767  1.00 2.00   ? 132 VAL D CG1   1 
ATOM   9944  C CG2   . VAL D 1 132 ? 3.158   24.258  41.931  1.00 11.99  ? 132 VAL D CG2   1 
ATOM   9945  H H     . VAL D 1 132 ? 5.846   26.316  44.233  1.00 0.00   ? 132 VAL D H     1 
ATOM   9946  N N     . GLY D 1 133 ? 5.531   22.446  44.041  1.00 7.03   ? 133 GLY D N     1 
ATOM   9947  C CA    . GLY D 1 133 ? 6.636   21.541  44.353  1.00 2.92   ? 133 GLY D CA    1 
ATOM   9948  C C     . GLY D 1 133 ? 6.450   20.184  43.698  1.00 3.18   ? 133 GLY D C     1 
ATOM   9949  O O     . GLY D 1 133 ? 5.431   19.979  43.040  1.00 6.64   ? 133 GLY D O     1 
ATOM   9950  H H     . GLY D 1 133 ? 4.716   22.061  43.651  1.00 0.00   ? 133 GLY D H     1 
ATOM   9951  N N     . THR D 1 134 ? 7.402   19.258  43.797  1.00 4.93   ? 134 THR D N     1 
ATOM   9952  C CA    . THR D 1 134 ? 7.226   17.907  43.273  1.00 5.85   ? 134 THR D CA    1 
ATOM   9953  C C     . THR D 1 134 ? 7.408   16.974  44.463  1.00 6.82   ? 134 THR D C     1 
ATOM   9954  O O     . THR D 1 134 ? 8.312   17.274  45.254  1.00 9.11   ? 134 THR D O     1 
ATOM   9955  C CB    . THR D 1 134 ? 8.269   17.648  42.196  1.00 2.91   ? 134 THR D CB    1 
ATOM   9956  O OG1   . THR D 1 134 ? 7.949   18.542  41.150  1.00 2.00   ? 134 THR D OG1   1 
ATOM   9957  C CG2   . THR D 1 134 ? 8.281   16.243  41.664  1.00 2.00   ? 134 THR D CG2   1 
ATOM   9958  H H     . THR D 1 134 ? 8.232   19.470  44.266  1.00 0.00   ? 134 THR D H     1 
ATOM   9959  H HG1   . THR D 1 134 ? 8.754   19.011  40.907  1.00 0.00   ? 134 THR D HG1   1 
ATOM   9960  N N     . ILE D 1 135 ? 6.634   15.888  44.655  1.00 4.14   ? 135 ILE D N     1 
ATOM   9961  C CA    . ILE D 1 135 ? 6.702   15.035  45.845  1.00 2.82   ? 135 ILE D CA    1 
ATOM   9962  C C     . ILE D 1 135 ? 6.847   13.606  45.385  1.00 2.00   ? 135 ILE D C     1 
ATOM   9963  O O     . ILE D 1 135 ? 6.133   13.227  44.461  1.00 3.04   ? 135 ILE D O     1 
ATOM   9964  C CB    . ILE D 1 135 ? 5.402   15.170  46.696  1.00 8.82   ? 135 ILE D CB    1 
ATOM   9965  C CG1   . ILE D 1 135 ? 5.232   16.574  47.219  1.00 2.00   ? 135 ILE D CG1   1 
ATOM   9966  C CG2   . ILE D 1 135 ? 5.468   14.221  47.895  1.00 5.01   ? 135 ILE D CG2   1 
ATOM   9967  C CD1   . ILE D 1 135 ? 3.842   16.728  47.889  1.00 2.00   ? 135 ILE D CD1   1 
ATOM   9968  H H     . ILE D 1 135 ? 5.998   15.628  43.951  1.00 0.00   ? 135 ILE D H     1 
ATOM   9969  N N     . PHE D 1 136 ? 7.711   12.778  45.957  1.00 9.41   ? 136 PHE D N     1 
ATOM   9970  C CA    . PHE D 1 136 ? 7.888   11.389  45.499  1.00 11.89  ? 136 PHE D CA    1 
ATOM   9971  C C     . PHE D 1 136 ? 8.222   10.441  46.646  1.00 11.85  ? 136 PHE D C     1 
ATOM   9972  O O     . PHE D 1 136 ? 8.764   10.863  47.671  1.00 12.81  ? 136 PHE D O     1 
ATOM   9973  C CB    . PHE D 1 136 ? 9.021   11.290  44.444  1.00 12.96  ? 136 PHE D CB    1 
ATOM   9974  C CG    . PHE D 1 136 ? 10.392  11.789  44.926  1.00 18.65  ? 136 PHE D CG    1 
ATOM   9975  C CD1   . PHE D 1 136 ? 10.658  13.147  44.975  1.00 17.25  ? 136 PHE D CD1   1 
ATOM   9976  C CD2   . PHE D 1 136 ? 11.325  10.885  45.402  1.00 9.65   ? 136 PHE D CD2   1 
ATOM   9977  C CE1   . PHE D 1 136 ? 11.828  13.585  45.548  1.00 18.04  ? 136 PHE D CE1   1 
ATOM   9978  C CE2   . PHE D 1 136 ? 12.481  11.331  45.985  1.00 15.10  ? 136 PHE D CE2   1 
ATOM   9979  C CZ    . PHE D 1 136 ? 12.732  12.680  46.062  1.00 20.83  ? 136 PHE D CZ    1 
ATOM   9980  H H     . PHE D 1 136 ? 8.202   13.059  46.759  1.00 0.00   ? 136 PHE D H     1 
ATOM   9981  N N     . GLY D 1 137 ? 7.927   9.155   46.510  1.00 12.39  ? 137 GLY D N     1 
ATOM   9982  C CA    . GLY D 1 137 ? 8.276   8.134   47.476  1.00 6.34   ? 137 GLY D CA    1 
ATOM   9983  C C     . GLY D 1 137 ? 8.627   6.919   46.637  1.00 7.64   ? 137 GLY D C     1 
ATOM   9984  O O     . GLY D 1 137 ? 8.020   6.700   45.581  1.00 11.84  ? 137 GLY D O     1 
ATOM   9985  H H     . GLY D 1 137 ? 7.429   8.869   45.711  1.00 0.00   ? 137 GLY D H     1 
ATOM   9986  N N     . ILE D 1 138 ? 9.597   6.118   47.040  1.00 3.65   ? 138 ILE D N     1 
ATOM   9987  C CA    . ILE D 1 138 ? 10.075  5.075   46.162  1.00 5.31   ? 138 ILE D CA    1 
ATOM   9988  C C     . ILE D 1 138 ? 10.019  3.780   46.908  1.00 3.25   ? 138 ILE D C     1 
ATOM   9989  O O     . ILE D 1 138 ? 10.418  3.726   48.072  1.00 2.28   ? 138 ILE D O     1 
ATOM   9990  C CB    . ILE D 1 138 ? 11.517  5.399   45.744  1.00 9.08   ? 138 ILE D CB    1 
ATOM   9991  C CG1   . ILE D 1 138 ? 11.560  6.714   45.002  1.00 3.30   ? 138 ILE D CG1   1 
ATOM   9992  C CG2   . ILE D 1 138 ? 12.059  4.262   44.886  1.00 9.18   ? 138 ILE D CG2   1 
ATOM   9993  C CD1   . ILE D 1 138 ? 12.984  7.141   44.654  1.00 8.44   ? 138 ILE D CD1   1 
ATOM   9994  H H     . ILE D 1 138 ? 10.016  6.232   47.918  1.00 0.00   ? 138 ILE D H     1 
ATOM   9995  N N     . TYR D 1 139 ? 9.553   2.723   46.277  1.00 3.48   ? 139 TYR D N     1 
ATOM   9996  C CA    . TYR D 1 139 ? 9.389   1.448   46.941  1.00 7.10   ? 139 TYR D CA    1 
ATOM   9997  C C     . TYR D 1 139 ? 10.103  0.408   46.130  1.00 8.42   ? 139 TYR D C     1 
ATOM   9998  O O     . TYR D 1 139 ? 10.405  0.623   44.962  1.00 10.26  ? 139 TYR D O     1 
ATOM   9999  C CB    . TYR D 1 139 ? 7.926   1.024   47.032  1.00 5.77   ? 139 TYR D CB    1 
ATOM   10000 C CG    . TYR D 1 139 ? 7.036   1.857   47.930  1.00 4.05   ? 139 TYR D CG    1 
ATOM   10001 C CD1   . TYR D 1 139 ? 6.965   1.563   49.269  1.00 3.97   ? 139 TYR D CD1   1 
ATOM   10002 C CD2   . TYR D 1 139 ? 6.209   2.826   47.395  1.00 7.39   ? 139 TYR D CD2   1 
ATOM   10003 C CE1   . TYR D 1 139 ? 6.039   2.195   50.065  1.00 3.72   ? 139 TYR D CE1   1 
ATOM   10004 C CE2   . TYR D 1 139 ? 5.277   3.463   48.197  1.00 9.56   ? 139 TYR D CE2   1 
ATOM   10005 C CZ    . TYR D 1 139 ? 5.188   3.126   49.532  1.00 10.67  ? 139 TYR D CZ    1 
ATOM   10006 O OH    . TYR D 1 139 ? 4.221   3.702   50.349  1.00 11.29  ? 139 TYR D OH    1 
ATOM   10007 H H     . TYR D 1 139 ? 9.405   2.767   45.312  1.00 0.00   ? 139 TYR D H     1 
ATOM   10008 H HH    . TYR D 1 139 ? 3.472   3.097   50.439  1.00 0.00   ? 139 TYR D HH    1 
ATOM   10009 N N     . ARG D 1 140 ? 10.360  -0.742  46.720  1.00 13.73  ? 140 ARG D N     1 
ATOM   10010 C CA    . ARG D 1 140 ? 11.031  -1.838  46.055  1.00 17.50  ? 140 ARG D CA    1 
ATOM   10011 C C     . ARG D 1 140 ? 9.926   -2.839  45.865  1.00 16.22  ? 140 ARG D C     1 
ATOM   10012 O O     . ARG D 1 140 ? 9.117   -2.996  46.776  1.00 17.80  ? 140 ARG D O     1 
ATOM   10013 C CB    . ARG D 1 140 ? 12.071  -2.396  46.960  1.00 21.00  ? 140 ARG D CB    1 
ATOM   10014 C CG    . ARG D 1 140 ? 12.976  -3.468  46.404  1.00 31.08  ? 140 ARG D CG    1 
ATOM   10015 C CD    . ARG D 1 140 ? 13.832  -4.004  47.549  1.00 37.32  ? 140 ARG D CD    1 
ATOM   10016 N NE    . ARG D 1 140 ? 14.782  -3.014  48.068  1.00 46.39  ? 140 ARG D NE    1 
ATOM   10017 C CZ    . ARG D 1 140 ? 14.677  -2.425  49.276  1.00 47.99  ? 140 ARG D CZ    1 
ATOM   10018 N NH1   . ARG D 1 140 ? 13.652  -2.651  50.115  1.00 49.55  ? 140 ARG D NH1   1 
ATOM   10019 N NH2   . ARG D 1 140 ? 15.626  -1.568  49.649  1.00 48.40  ? 140 ARG D NH2   1 
ATOM   10020 H H     . ARG D 1 140 ? 9.998   -0.933  47.605  1.00 0.00   ? 140 ARG D H     1 
ATOM   10021 H HE    . ARG D 1 140 ? 15.543  -2.764  47.504  1.00 0.00   ? 140 ARG D HE    1 
ATOM   10022 H HH11  . ARG D 1 140 ? 12.919  -3.279  49.857  1.00 0.00   ? 140 ARG D HH11  1 
ATOM   10023 H HH12  . ARG D 1 140 ? 13.618  -2.186  51.000  1.00 0.00   ? 140 ARG D HH12  1 
ATOM   10024 H HH21  . ARG D 1 140 ? 16.393  -1.371  49.041  1.00 0.00   ? 140 ARG D HH21  1 
ATOM   10025 H HH22  . ARG D 1 140 ? 15.554  -1.112  50.534  1.00 0.00   ? 140 ARG D HH22  1 
ATOM   10026 N N     . LYS D 1 141 ? 9.873   -3.497  44.722  1.00 15.59  ? 141 LYS D N     1 
ATOM   10027 C CA    . LYS D 1 141 ? 8.834   -4.453  44.446  1.00 12.91  ? 141 LYS D CA    1 
ATOM   10028 C C     . LYS D 1 141 ? 9.145   -5.670  45.300  1.00 12.96  ? 141 LYS D C     1 
ATOM   10029 O O     . LYS D 1 141 ? 10.265  -6.198  45.319  1.00 11.71  ? 141 LYS D O     1 
ATOM   10030 C CB    . LYS D 1 141 ? 8.849   -4.764  42.952  1.00 10.19  ? 141 LYS D CB    1 
ATOM   10031 C CG    . LYS D 1 141 ? 7.841   -5.837  42.536  1.00 9.15   ? 141 LYS D CG    1 
ATOM   10032 C CD    . LYS D 1 141 ? 7.670   -5.790  41.031  1.00 15.17  ? 141 LYS D CD    1 
ATOM   10033 C CE    . LYS D 1 141 ? 7.049   -7.083  40.505  1.00 17.91  ? 141 LYS D CE    1 
ATOM   10034 N NZ    . LYS D 1 141 ? 5.733   -7.354  41.058  1.00 16.90  ? 141 LYS D NZ    1 
ATOM   10035 H H     . LYS D 1 141 ? 10.601  -3.384  44.079  1.00 0.00   ? 141 LYS D H     1 
ATOM   10036 H HZ1   . LYS D 1 141 ? 5.780   -7.317  42.096  1.00 0.00   ? 141 LYS D HZ1   1 
ATOM   10037 H HZ2   . LYS D 1 141 ? 5.063   -6.639  40.715  1.00 0.00   ? 141 LYS D HZ2   1 
ATOM   10038 H HZ3   . LYS D 1 141 ? 5.414   -8.297  40.763  1.00 0.00   ? 141 LYS D HZ3   1 
ATOM   10039 N N     . LYS D 1 142 ? 8.112   -5.992  46.062  1.00 13.64  ? 142 LYS D N     1 
ATOM   10040 C CA    . LYS D 1 142 ? 8.116   -7.040  47.042  1.00 17.64  ? 142 LYS D CA    1 
ATOM   10041 C C     . LYS D 1 142 ? 7.615   -8.370  46.517  1.00 20.41  ? 142 LYS D C     1 
ATOM   10042 O O     . LYS D 1 142 ? 7.718   -9.358  47.257  1.00 22.69  ? 142 LYS D O     1 
ATOM   10043 C CB    . LYS D 1 142 ? 7.270   -6.615  48.235  1.00 19.75  ? 142 LYS D CB    1 
ATOM   10044 C CG    . LYS D 1 142 ? 7.778   -5.345  48.923  1.00 28.21  ? 142 LYS D CG    1 
ATOM   10045 C CD    . LYS D 1 142 ? 8.498   -5.548  50.257  1.00 36.05  ? 142 LYS D CD    1 
ATOM   10046 C CE    . LYS D 1 142 ? 9.960   -5.999  50.147  1.00 45.19  ? 142 LYS D CE    1 
ATOM   10047 N NZ    . LYS D 1 142 ? 10.561  -6.134  51.466  1.00 45.07  ? 142 LYS D NZ    1 
ATOM   10048 H H     . LYS D 1 142 ? 7.289   -5.469  45.946  1.00 0.00   ? 142 LYS D H     1 
ATOM   10049 H HZ1   . LYS D 1 142 ? 10.487  -5.232  51.979  1.00 0.00   ? 142 LYS D HZ1   1 
ATOM   10050 H HZ2   . LYS D 1 142 ? 10.039  -6.861  51.997  1.00 0.00   ? 142 LYS D HZ2   1 
ATOM   10051 H HZ3   . LYS D 1 142 ? 11.557  -6.418  51.382  1.00 0.00   ? 142 LYS D HZ3   1 
ATOM   10052 N N     . SER D 1 143 ? 7.093   -8.517  45.303  1.00 21.86  ? 143 SER D N     1 
ATOM   10053 C CA    . SER D 1 143 ? 6.684   -9.835  44.871  1.00 20.77  ? 143 SER D CA    1 
ATOM   10054 C C     . SER D 1 143 ? 7.118   -10.151 43.465  1.00 21.58  ? 143 SER D C     1 
ATOM   10055 O O     . SER D 1 143 ? 7.348   -9.281  42.632  1.00 22.17  ? 143 SER D O     1 
ATOM   10056 C CB    . SER D 1 143 ? 5.183   -9.982  44.947  1.00 21.12  ? 143 SER D CB    1 
ATOM   10057 O OG    . SER D 1 143 ? 4.489   -9.455  43.815  1.00 28.15  ? 143 SER D OG    1 
ATOM   10058 H H     . SER D 1 143 ? 6.939   -7.753  44.712  1.00 0.00   ? 143 SER D H     1 
ATOM   10059 H HG    . SER D 1 143 ? 3.545   -9.577  43.951  1.00 0.00   ? 143 SER D HG    1 
ATOM   10060 N N     . THR D 1 144 ? 7.229   -11.450 43.276  1.00 20.92  ? 144 THR D N     1 
ATOM   10061 C CA    . THR D 1 144 ? 7.589   -12.109 42.045  1.00 21.28  ? 144 THR D CA    1 
ATOM   10062 C C     . THR D 1 144 ? 6.636   -11.937 40.870  1.00 23.95  ? 144 THR D C     1 
ATOM   10063 O O     . THR D 1 144 ? 7.024   -12.178 39.729  1.00 25.91  ? 144 THR D O     1 
ATOM   10064 C CB    . THR D 1 144 ? 7.758   -13.511 42.503  1.00 19.93  ? 144 THR D CB    1 
ATOM   10065 O OG1   . THR D 1 144 ? 8.890   -13.369 43.360  1.00 24.30  ? 144 THR D OG1   1 
ATOM   10066 C CG2   . THR D 1 144 ? 7.872   -14.582 41.441  1.00 27.77  ? 144 THR D CG2   1 
ATOM   10067 H H     . THR D 1 144 ? 7.168   -12.031 44.066  1.00 0.00   ? 144 THR D H     1 
ATOM   10068 H HG1   . THR D 1 144 ? 9.593   -13.918 42.997  1.00 0.00   ? 144 THR D HG1   1 
ATOM   10069 N N     . ASP D 1 145 ? 5.401   -11.492 41.088  1.00 25.19  ? 145 ASP D N     1 
ATOM   10070 C CA    . ASP D 1 145 ? 4.382   -11.497 40.047  1.00 24.20  ? 145 ASP D CA    1 
ATOM   10071 C C     . ASP D 1 145 ? 4.568   -10.407 39.005  1.00 23.22  ? 145 ASP D C     1 
ATOM   10072 O O     . ASP D 1 145 ? 5.239   -9.408  39.248  1.00 23.65  ? 145 ASP D O     1 
ATOM   10073 C CB    . ASP D 1 145 ? 2.983   -11.320 40.658  1.00 27.20  ? 145 ASP D CB    1 
ATOM   10074 C CG    . ASP D 1 145 ? 2.569   -12.288 41.754  1.00 30.67  ? 145 ASP D CG    1 
ATOM   10075 O OD1   . ASP D 1 145 ? 2.719   -13.496 41.597  1.00 39.53  ? 145 ASP D OD1   1 
ATOM   10076 O OD2   . ASP D 1 145 ? 2.083   -11.821 42.777  1.00 36.12  ? 145 ASP D OD2   1 
ATOM   10077 H H     . ASP D 1 145 ? 5.248   -10.930 41.876  1.00 0.00   ? 145 ASP D H     1 
ATOM   10078 N N     . GLU D 1 146 ? 3.888   -10.564 37.864  1.00 23.11  ? 146 GLU D N     1 
ATOM   10079 C CA    . GLU D 1 146 ? 3.893   -9.588  36.783  1.00 24.60  ? 146 GLU D CA    1 
ATOM   10080 C C     . GLU D 1 146 ? 3.387   -8.286  37.390  1.00 20.56  ? 146 GLU D C     1 
ATOM   10081 O O     . GLU D 1 146 ? 2.419   -8.302  38.169  1.00 22.45  ? 146 GLU D O     1 
ATOM   10082 C CB    . GLU D 1 146 ? 2.978   -10.101 35.662  1.00 32.25  ? 146 GLU D CB    1 
ATOM   10083 C CG    . GLU D 1 146 ? 2.975   -9.367  34.309  1.00 44.34  ? 146 GLU D CG    1 
ATOM   10084 C CD    . GLU D 1 146 ? 1.823   -8.387  34.071  1.00 51.14  ? 146 GLU D CD    1 
ATOM   10085 O OE1   . GLU D 1 146 ? 0.734   -8.835  33.699  1.00 53.14  ? 146 GLU D OE1   1 
ATOM   10086 O OE2   . GLU D 1 146 ? 2.014   -7.180  34.237  1.00 52.51  ? 146 GLU D OE2   1 
ATOM   10087 H H     . GLU D 1 146 ? 3.353   -11.371 37.762  1.00 0.00   ? 146 GLU D H     1 
ATOM   10088 N N     . PRO D 1 147 ? 4.054   -7.159  37.149  1.00 16.84  ? 147 PRO D N     1 
ATOM   10089 C CA    . PRO D 1 147 ? 3.809   -5.924  37.863  1.00 16.03  ? 147 PRO D CA    1 
ATOM   10090 C C     . PRO D 1 147 ? 2.423   -5.385  37.648  1.00 17.31  ? 147 PRO D C     1 
ATOM   10091 O O     . PRO D 1 147 ? 1.801   -5.574  36.603  1.00 21.19  ? 147 PRO D O     1 
ATOM   10092 C CB    . PRO D 1 147 ? 4.883   -5.019  37.384  1.00 13.69  ? 147 PRO D CB    1 
ATOM   10093 C CG    . PRO D 1 147 ? 5.151   -5.502  35.997  1.00 17.03  ? 147 PRO D CG    1 
ATOM   10094 C CD    . PRO D 1 147 ? 5.101   -7.005  36.159  1.00 16.46  ? 147 PRO D CD    1 
ATOM   10095 N N     . SER D 1 148 ? 1.908   -4.729  38.668  1.00 18.54  ? 148 SER D N     1 
ATOM   10096 C CA    . SER D 1 148 ? 0.556   -4.212  38.622  1.00 20.70  ? 148 SER D CA    1 
ATOM   10097 C C     . SER D 1 148 ? 0.406   -3.078  39.624  1.00 18.74  ? 148 SER D C     1 
ATOM   10098 O O     . SER D 1 148 ? 1.325   -2.836  40.405  1.00 20.42  ? 148 SER D O     1 
ATOM   10099 C CB    . SER D 1 148 ? -0.378  -5.358  38.941  1.00 17.56  ? 148 SER D CB    1 
ATOM   10100 O OG    . SER D 1 148 ? 0.196   -6.122  39.991  1.00 31.16  ? 148 SER D OG    1 
ATOM   10101 H H     . SER D 1 148 ? 2.444   -4.492  39.449  1.00 0.00   ? 148 SER D H     1 
ATOM   10102 H HG    . SER D 1 148 ? 0.974   -6.564  39.610  1.00 0.00   ? 148 SER D HG    1 
ATOM   10103 N N     . GLU D 1 149 ? -0.723  -2.389  39.662  1.00 20.20  ? 149 GLU D N     1 
ATOM   10104 C CA    . GLU D 1 149 ? -1.006  -1.398  40.684  1.00 23.62  ? 149 GLU D CA    1 
ATOM   10105 C C     . GLU D 1 149 ? -0.768  -1.987  42.063  1.00 21.16  ? 149 GLU D C     1 
ATOM   10106 O O     . GLU D 1 149 ? -0.335  -1.263  42.952  1.00 26.20  ? 149 GLU D O     1 
ATOM   10107 C CB    . GLU D 1 149 ? -2.464  -0.928  40.717  1.00 33.96  ? 149 GLU D CB    1 
ATOM   10108 C CG    . GLU D 1 149 ? -3.187  -0.357  39.491  1.00 42.85  ? 149 GLU D CG    1 
ATOM   10109 C CD    . GLU D 1 149 ? -4.485  0.413   39.792  1.00 48.20  ? 149 GLU D CD    1 
ATOM   10110 O OE1   . GLU D 1 149 ? -5.236  0.040   40.703  1.00 50.90  ? 149 GLU D OE1   1 
ATOM   10111 O OE2   . GLU D 1 149 ? -4.749  1.398   39.097  1.00 47.91  ? 149 GLU D OE2   1 
ATOM   10112 H H     . GLU D 1 149 ? -1.345  -2.480  38.905  1.00 0.00   ? 149 GLU D H     1 
ATOM   10113 N N     . LYS D 1 150 ? -0.945  -3.290  42.298  1.00 19.97  ? 150 LYS D N     1 
ATOM   10114 C CA    . LYS D 1 150 ? -0.829  -3.825  43.655  1.00 21.58  ? 150 LYS D CA    1 
ATOM   10115 C C     . LYS D 1 150 ? 0.534   -3.629  44.289  1.00 19.55  ? 150 LYS D C     1 
ATOM   10116 O O     . LYS D 1 150 ? 0.659   -3.516  45.506  1.00 18.50  ? 150 LYS D O     1 
ATOM   10117 C CB    . LYS D 1 150 ? -1.159  -5.307  43.683  1.00 26.79  ? 150 LYS D CB    1 
ATOM   10118 C CG    . LYS D 1 150 ? -2.439  -5.744  42.953  1.00 37.67  ? 150 LYS D CG    1 
ATOM   10119 C CD    . LYS D 1 150 ? -3.785  -5.116  43.378  1.00 48.60  ? 150 LYS D CD    1 
ATOM   10120 C CE    . LYS D 1 150 ? -4.249  -3.804  42.685  1.00 54.60  ? 150 LYS D CE    1 
ATOM   10121 N NZ    . LYS D 1 150 ? -4.411  -3.914  41.240  1.00 58.17  ? 150 LYS D NZ    1 
ATOM   10122 H H     . LYS D 1 150 ? -1.158  -3.888  41.556  1.00 0.00   ? 150 LYS D H     1 
ATOM   10123 H HZ1   . LYS D 1 150 ? -5.108  -4.654  41.019  1.00 0.00   ? 150 LYS D HZ1   1 
ATOM   10124 H HZ2   . LYS D 1 150 ? -4.729  -3.004  40.849  1.00 0.00   ? 150 LYS D HZ2   1 
ATOM   10125 H HZ3   . LYS D 1 150 ? -3.493  -4.166  40.819  1.00 0.00   ? 150 LYS D HZ3   1 
ATOM   10126 N N     . ASP D 1 151 ? 1.555   -3.461  43.447  1.00 18.58  ? 151 ASP D N     1 
ATOM   10127 C CA    . ASP D 1 151 ? 2.923   -3.244  43.895  1.00 18.06  ? 151 ASP D CA    1 
ATOM   10128 C C     . ASP D 1 151 ? 3.129   -1.897  44.563  1.00 18.01  ? 151 ASP D C     1 
ATOM   10129 O O     . ASP D 1 151 ? 4.012   -1.707  45.402  1.00 16.39  ? 151 ASP D O     1 
ATOM   10130 C CB    . ASP D 1 151 ? 3.864   -3.388  42.690  1.00 15.10  ? 151 ASP D CB    1 
ATOM   10131 C CG    . ASP D 1 151 ? 3.855   -4.802  42.112  1.00 15.07  ? 151 ASP D CG    1 
ATOM   10132 O OD1   . ASP D 1 151 ? 3.698   -5.754  42.872  1.00 12.91  ? 151 ASP D OD1   1 
ATOM   10133 O OD2   . ASP D 1 151 ? 4.001   -4.964  40.900  1.00 10.26  ? 151 ASP D OD2   1 
ATOM   10134 H H     . ASP D 1 151 ? 1.369   -3.418  42.485  1.00 0.00   ? 151 ASP D H     1 
ATOM   10135 N N     . ALA D 1 152 ? 2.284   -0.955  44.154  1.00 17.82  ? 152 ALA D N     1 
ATOM   10136 C CA    . ALA D 1 152 ? 2.309   0.392   44.689  1.00 12.33  ? 152 ALA D CA    1 
ATOM   10137 C C     . ALA D 1 152 ? 1.488   0.424   45.965  1.00 9.23   ? 152 ALA D C     1 
ATOM   10138 O O     . ALA D 1 152 ? 1.581   1.381   46.731  1.00 11.36  ? 152 ALA D O     1 
ATOM   10139 C CB    . ALA D 1 152 ? 1.701   1.337   43.686  1.00 2.28   ? 152 ALA D CB    1 
ATOM   10140 H H     . ALA D 1 152 ? 1.586   -1.180  43.505  1.00 0.00   ? 152 ALA D H     1 
ATOM   10141 N N     . LEU D 1 153 ? 0.693   -0.609  46.275  1.00 10.96  ? 153 LEU D N     1 
ATOM   10142 C CA    . LEU D 1 153 ? -0.176  -0.563  47.433  1.00 8.96   ? 153 LEU D CA    1 
ATOM   10143 C C     . LEU D 1 153 ? 0.533   -1.035  48.689  1.00 11.95  ? 153 LEU D C     1 
ATOM   10144 O O     . LEU D 1 153 ? 0.161   -1.989  49.369  1.00 12.37  ? 153 LEU D O     1 
ATOM   10145 C CB    . LEU D 1 153 ? -1.395  -1.408  47.142  1.00 6.33   ? 153 LEU D CB    1 
ATOM   10146 C CG    . LEU D 1 153 ? -2.317  -0.999  46.018  1.00 4.12   ? 153 LEU D CG    1 
ATOM   10147 C CD1   . LEU D 1 153 ? -3.486  -1.927  46.081  1.00 10.60  ? 153 LEU D CD1   1 
ATOM   10148 C CD2   . LEU D 1 153 ? -2.824  0.435   46.146  1.00 5.75   ? 153 LEU D CD2   1 
ATOM   10149 H H     . LEU D 1 153 ? 0.739   -1.439  45.758  1.00 0.00   ? 153 LEU D H     1 
ATOM   10150 N N     . GLN D 1 154 ? 1.595   -0.322  49.044  1.00 15.46  ? 154 GLN D N     1 
ATOM   10151 C CA    . GLN D 1 154 ? 2.450   -0.658  50.169  1.00 12.63  ? 154 GLN D CA    1 
ATOM   10152 C C     . GLN D 1 154 ? 2.381   0.466   51.193  1.00 13.31  ? 154 GLN D C     1 
ATOM   10153 O O     . GLN D 1 154 ? 2.392   1.631   50.789  1.00 14.07  ? 154 GLN D O     1 
ATOM   10154 C CB    . GLN D 1 154 ? 3.880   -0.798  49.709  1.00 10.32  ? 154 GLN D CB    1 
ATOM   10155 C CG    . GLN D 1 154 ? 4.195   -1.889  48.703  1.00 9.75   ? 154 GLN D CG    1 
ATOM   10156 C CD    . GLN D 1 154 ? 5.696   -2.151  48.619  1.00 15.34  ? 154 GLN D CD    1 
ATOM   10157 O OE1   . GLN D 1 154 ? 6.266   -2.465  47.578  1.00 17.40  ? 154 GLN D OE1   1 
ATOM   10158 N NE2   . GLN D 1 154 ? 6.449   -1.998  49.701  1.00 5.63   ? 154 GLN D NE2   1 
ATOM   10159 H H     . GLN D 1 154 ? 1.769   0.516   48.563  1.00 0.00   ? 154 GLN D H     1 
ATOM   10160 H HE21  . GLN D 1 154 ? 7.376   -2.331  49.656  1.00 0.00   ? 154 GLN D HE21  1 
ATOM   10161 H HE22  . GLN D 1 154 ? 6.048   -1.583  50.478  1.00 0.00   ? 154 GLN D HE22  1 
ATOM   10162 N N     . PRO D 1 155 ? 2.328   0.223   52.497  1.00 13.45  ? 155 PRO D N     1 
ATOM   10163 C CA    . PRO D 1 155 ? 2.255   1.271   53.495  1.00 13.77  ? 155 PRO D CA    1 
ATOM   10164 C C     . PRO D 1 155 ? 3.598   1.960   53.487  1.00 15.18  ? 155 PRO D C     1 
ATOM   10165 O O     . PRO D 1 155 ? 4.621   1.294   53.277  1.00 17.07  ? 155 PRO D O     1 
ATOM   10166 C CB    . PRO D 1 155 ? 1.914   0.528   54.779  1.00 12.48  ? 155 PRO D CB    1 
ATOM   10167 C CG    . PRO D 1 155 ? 2.603   -0.790  54.585  1.00 11.53  ? 155 PRO D CG    1 
ATOM   10168 C CD    . PRO D 1 155 ? 2.351   -1.095  53.113  1.00 13.16  ? 155 PRO D CD    1 
ATOM   10169 N N     . GLY D 1 156 ? 3.628   3.268   53.739  1.00 16.97  ? 156 GLY D N     1 
ATOM   10170 C CA    . GLY D 1 156 ? 4.830   4.099   53.700  1.00 11.57  ? 156 GLY D CA    1 
ATOM   10171 C C     . GLY D 1 156 ? 6.004   3.621   54.535  1.00 13.40  ? 156 GLY D C     1 
ATOM   10172 O O     . GLY D 1 156 ? 7.165   4.006   54.322  1.00 14.23  ? 156 GLY D O     1 
ATOM   10173 H H     . GLY D 1 156 ? 2.772   3.701   53.944  1.00 0.00   ? 156 GLY D H     1 
ATOM   10174 N N     . ARG D 1 157 ? 5.731   2.755   55.496  1.00 15.11  ? 157 ARG D N     1 
ATOM   10175 C CA    . ARG D 1 157 ? 6.746   2.128   56.318  1.00 14.36  ? 157 ARG D CA    1 
ATOM   10176 C C     . ARG D 1 157 ? 7.751   1.372   55.461  1.00 14.08  ? 157 ARG D C     1 
ATOM   10177 O O     . ARG D 1 157 ? 8.910   1.196   55.832  1.00 17.58  ? 157 ARG D O     1 
ATOM   10178 C CB    . ARG D 1 157 ? 6.068   1.169   57.285  1.00 16.42  ? 157 ARG D CB    1 
ATOM   10179 C CG    . ARG D 1 157 ? 6.987   0.869   58.446  1.00 23.46  ? 157 ARG D CG    1 
ATOM   10180 C CD    . ARG D 1 157 ? 7.266   2.131   59.261  1.00 26.25  ? 157 ARG D CD    1 
ATOM   10181 N NE    . ARG D 1 157 ? 6.244   2.307   60.279  1.00 30.09  ? 157 ARG D NE    1 
ATOM   10182 C CZ    . ARG D 1 157 ? 6.231   3.369   61.081  1.00 30.88  ? 157 ARG D CZ    1 
ATOM   10183 N NH1   . ARG D 1 157 ? 7.134   4.336   60.960  1.00 35.77  ? 157 ARG D NH1   1 
ATOM   10184 N NH2   . ARG D 1 157 ? 5.296   3.477   62.020  1.00 33.33  ? 157 ARG D NH2   1 
ATOM   10185 H H     . ARG D 1 157 ? 4.787   2.553   55.676  1.00 0.00   ? 157 ARG D H     1 
ATOM   10186 H HE    . ARG D 1 157 ? 5.559   1.618   60.390  1.00 0.00   ? 157 ARG D HE    1 
ATOM   10187 H HH11  . ARG D 1 157 ? 7.844   4.288   60.257  1.00 0.00   ? 157 ARG D HH11  1 
ATOM   10188 H HH12  . ARG D 1 157 ? 7.098   5.122   61.577  1.00 0.00   ? 157 ARG D HH12  1 
ATOM   10189 H HH21  . ARG D 1 157 ? 4.609   2.757   62.120  1.00 0.00   ? 157 ARG D HH21  1 
ATOM   10190 H HH22  . ARG D 1 157 ? 5.279   4.273   62.624  1.00 0.00   ? 157 ARG D HH22  1 
ATOM   10191 N N     . ASN D 1 158 ? 7.319   0.943   54.286  1.00 13.10  ? 158 ASN D N     1 
ATOM   10192 C CA    . ASN D 1 158 ? 8.165   0.217   53.364  1.00 13.24  ? 158 ASN D CA    1 
ATOM   10193 C C     . ASN D 1 158 ? 8.900   1.118   52.398  1.00 13.96  ? 158 ASN D C     1 
ATOM   10194 O O     . ASN D 1 158 ? 9.433   0.606   51.401  1.00 18.52  ? 158 ASN D O     1 
ATOM   10195 C CB    . ASN D 1 158 ? 7.353   -0.760  52.523  1.00 13.60  ? 158 ASN D CB    1 
ATOM   10196 C CG    . ASN D 1 158 ? 6.770   -1.962  53.234  1.00 14.83  ? 158 ASN D CG    1 
ATOM   10197 O OD1   . ASN D 1 158 ? 6.947   -2.184  54.432  1.00 15.66  ? 158 ASN D OD1   1 
ATOM   10198 N ND2   . ASN D 1 158 ? 6.041   -2.805  52.514  1.00 10.02  ? 158 ASN D ND2   1 
ATOM   10199 H H     . ASN D 1 158 ? 6.390   1.124   54.036  1.00 0.00   ? 158 ASN D H     1 
ATOM   10200 H HD21  . ASN D 1 158 ? 5.633   -3.545  53.017  1.00 0.00   ? 158 ASN D HD21  1 
ATOM   10201 H HD22  . ASN D 1 158 ? 5.947   -2.705  51.552  1.00 0.00   ? 158 ASN D HD22  1 
ATOM   10202 N N     . LEU D 1 159 ? 8.892   2.444   52.555  1.00 13.35  ? 159 LEU D N     1 
ATOM   10203 C CA    . LEU D 1 159 ? 9.624   3.291   51.622  1.00 13.83  ? 159 LEU D CA    1 
ATOM   10204 C C     . LEU D 1 159 ? 11.125  3.113   51.787  1.00 10.06  ? 159 LEU D C     1 
ATOM   10205 O O     . LEU D 1 159 ? 11.609  2.947   52.909  1.00 13.29  ? 159 LEU D O     1 
ATOM   10206 C CB    . LEU D 1 159 ? 9.297   4.770   51.832  1.00 7.67   ? 159 LEU D CB    1 
ATOM   10207 C CG    . LEU D 1 159 ? 7.993   5.286   51.289  1.00 9.49   ? 159 LEU D CG    1 
ATOM   10208 C CD1   . LEU D 1 159 ? 7.767   6.657   51.830  1.00 4.13   ? 159 LEU D CD1   1 
ATOM   10209 C CD2   . LEU D 1 159 ? 8.021   5.371   49.774  1.00 6.24   ? 159 LEU D CD2   1 
ATOM   10210 H H     . LEU D 1 159 ? 8.455   2.855   53.328  1.00 0.00   ? 159 LEU D H     1 
ATOM   10211 N N     . VAL D 1 160 ? 11.800  3.127   50.632  1.00 6.00   ? 160 VAL D N     1 
ATOM   10212 C CA    . VAL D 1 160 ? 13.243  3.103   50.507  1.00 5.00   ? 160 VAL D CA    1 
ATOM   10213 C C     . VAL D 1 160 ? 13.726  4.540   50.629  1.00 8.96   ? 160 VAL D C     1 
ATOM   10214 O O     . VAL D 1 160 ? 14.625  4.807   51.421  1.00 14.53  ? 160 VAL D O     1 
ATOM   10215 C CB    . VAL D 1 160 ? 13.686  2.550   49.127  1.00 7.06   ? 160 VAL D CB    1 
ATOM   10216 C CG1   . VAL D 1 160 ? 15.203  2.601   49.035  1.00 10.86  ? 160 VAL D CG1   1 
ATOM   10217 C CG2   . VAL D 1 160 ? 13.286  1.091   48.949  1.00 5.19   ? 160 VAL D CG2   1 
ATOM   10218 H H     . VAL D 1 160 ? 11.264  3.170   49.811  1.00 0.00   ? 160 VAL D H     1 
ATOM   10219 N N     . ALA D 1 161 ? 13.206  5.495   49.852  1.00 9.38   ? 161 ALA D N     1 
ATOM   10220 C CA    . ALA D 1 161 ? 13.609  6.894   49.919  1.00 8.63   ? 161 ALA D CA    1 
ATOM   10221 C C     . ALA D 1 161 ? 12.377  7.719   49.549  1.00 11.00  ? 161 ALA D C     1 
ATOM   10222 O O     . ALA D 1 161 ? 11.505  7.226   48.815  1.00 15.78  ? 161 ALA D O     1 
ATOM   10223 C CB    . ALA D 1 161 ? 14.707  7.207   48.905  1.00 3.82   ? 161 ALA D CB    1 
ATOM   10224 H H     . ALA D 1 161 ? 12.469  5.281   49.242  1.00 0.00   ? 161 ALA D H     1 
ATOM   10225 N N     . ALA D 1 162 ? 12.261  8.949   50.017  1.00 6.82   ? 162 ALA D N     1 
ATOM   10226 C CA    . ALA D 1 162 ? 11.137  9.816   49.716  1.00 6.43   ? 162 ALA D CA    1 
ATOM   10227 C C     . ALA D 1 162 ? 11.622  11.241  49.837  1.00 6.89   ? 162 ALA D C     1 
ATOM   10228 O O     . ALA D 1 162 ? 12.659  11.518  50.468  1.00 12.48  ? 162 ALA D O     1 
ATOM   10229 C CB    . ALA D 1 162 ? 10.029  9.647   50.706  1.00 2.00   ? 162 ALA D CB    1 
ATOM   10230 H H     . ALA D 1 162 ? 12.975  9.323   50.581  1.00 0.00   ? 162 ALA D H     1 
ATOM   10231 N N     . GLY D 1 163 ? 10.936  12.175  49.214  1.00 8.61   ? 163 GLY D N     1 
ATOM   10232 C CA    . GLY D 1 163 ? 11.336  13.556  49.335  1.00 5.14   ? 163 GLY D CA    1 
ATOM   10233 C C     . GLY D 1 163 ? 10.398  14.435  48.554  1.00 7.05   ? 163 GLY D C     1 
ATOM   10234 O O     . GLY D 1 163 ? 9.300   13.996  48.173  1.00 2.00   ? 163 GLY D O     1 
ATOM   10235 H H     . GLY D 1 163 ? 10.116  11.970  48.713  1.00 0.00   ? 163 GLY D H     1 
ATOM   10236 N N     . TYR D 1 164 ? 10.854  15.659  48.300  1.00 4.72   ? 164 TYR D N     1 
ATOM   10237 C CA    . TYR D 1 164 ? 10.104  16.648  47.575  1.00 4.29   ? 164 TYR D CA    1 
ATOM   10238 C C     . TYR D 1 164 ? 11.070  17.687  47.072  1.00 4.53   ? 164 TYR D C     1 
ATOM   10239 O O     . TYR D 1 164 ? 12.210  17.738  47.518  1.00 5.97   ? 164 TYR D O     1 
ATOM   10240 C CB    . TYR D 1 164 ? 9.074   17.358  48.447  1.00 3.81   ? 164 TYR D CB    1 
ATOM   10241 C CG    . TYR D 1 164 ? 9.616   18.079  49.677  1.00 4.56   ? 164 TYR D CG    1 
ATOM   10242 C CD1   . TYR D 1 164 ? 9.683   17.350  50.842  1.00 13.28  ? 164 TYR D CD1   1 
ATOM   10243 C CD2   . TYR D 1 164 ? 9.964   19.427  49.686  1.00 6.07   ? 164 TYR D CD2   1 
ATOM   10244 C CE1   . TYR D 1 164 ? 10.051  17.949  52.021  1.00 6.94   ? 164 TYR D CE1   1 
ATOM   10245 C CE2   . TYR D 1 164 ? 10.338  20.036  50.874  1.00 7.10   ? 164 TYR D CE2   1 
ATOM   10246 C CZ    . TYR D 1 164 ? 10.357  19.282  52.031  1.00 6.54   ? 164 TYR D CZ    1 
ATOM   10247 O OH    . TYR D 1 164 ? 10.665  19.863  53.245  1.00 7.52   ? 164 TYR D OH    1 
ATOM   10248 H H     . TYR D 1 164 ? 11.768  15.898  48.574  1.00 0.00   ? 164 TYR D H     1 
ATOM   10249 H HH    . TYR D 1 164 ? 10.294  19.250  53.896  1.00 0.00   ? 164 TYR D HH    1 
ATOM   10250 N N     . ALA D 1 165 ? 10.635  18.545  46.181  1.00 4.32   ? 165 ALA D N     1 
ATOM   10251 C CA    . ALA D 1 165 ? 11.460  19.635  45.704  1.00 6.52   ? 165 ALA D CA    1 
ATOM   10252 C C     . ALA D 1 165 ? 10.543  20.830  45.848  1.00 6.18   ? 165 ALA D C     1 
ATOM   10253 O O     . ALA D 1 165 ? 9.378   20.713  45.466  1.00 7.88   ? 165 ALA D O     1 
ATOM   10254 C CB    . ALA D 1 165 ? 11.813  19.464  44.235  1.00 2.00   ? 165 ALA D CB    1 
ATOM   10255 H H     . ALA D 1 165 ? 9.705   18.492  45.874  1.00 0.00   ? 165 ALA D H     1 
ATOM   10256 N N     . LEU D 1 166 ? 10.942  21.950  46.418  1.00 6.48   ? 166 LEU D N     1 
ATOM   10257 C CA    . LEU D 1 166 ? 10.048  23.099  46.559  1.00 8.32   ? 166 LEU D CA    1 
ATOM   10258 C C     . LEU D 1 166 ? 10.468  24.121  45.524  1.00 8.05   ? 166 LEU D C     1 
ATOM   10259 O O     . LEU D 1 166 ? 11.657  24.435  45.468  1.00 8.56   ? 166 LEU D O     1 
ATOM   10260 C CB    . LEU D 1 166 ? 10.194  23.661  47.981  1.00 4.43   ? 166 LEU D CB    1 
ATOM   10261 C CG    . LEU D 1 166 ? 9.664   25.035  48.350  1.00 9.06   ? 166 LEU D CG    1 
ATOM   10262 C CD1   . LEU D 1 166 ? 8.171   25.116  48.127  1.00 4.24   ? 166 LEU D CD1   1 
ATOM   10263 C CD2   . LEU D 1 166 ? 9.979   25.289  49.809  1.00 4.66   ? 166 LEU D CD2   1 
ATOM   10264 H H     . LEU D 1 166 ? 11.875  22.027  46.707  1.00 0.00   ? 166 LEU D H     1 
ATOM   10265 N N     . TYR D 1 167 ? 9.600   24.668  44.683  1.00 6.71   ? 167 TYR D N     1 
ATOM   10266 C CA    . TYR D 1 167 ? 10.040  25.667  43.726  1.00 6.67   ? 167 TYR D CA    1 
ATOM   10267 C C     . TYR D 1 167 ? 9.497   26.955  44.316  1.00 8.86   ? 167 TYR D C     1 
ATOM   10268 O O     . TYR D 1 167 ? 8.480   27.485  43.866  1.00 9.06   ? 167 TYR D O     1 
ATOM   10269 C CB    . TYR D 1 167 ? 9.440   25.414  42.324  1.00 5.66   ? 167 TYR D CB    1 
ATOM   10270 C CG    . TYR D 1 167 ? 9.670   24.009  41.781  1.00 3.92   ? 167 TYR D CG    1 
ATOM   10271 C CD1   . TYR D 1 167 ? 10.899  23.627  41.294  1.00 7.38   ? 167 TYR D CD1   1 
ATOM   10272 C CD2   . TYR D 1 167 ? 8.662   23.093  41.864  1.00 2.00   ? 167 TYR D CD2   1 
ATOM   10273 C CE1   . TYR D 1 167 ? 11.147  22.319  40.953  1.00 2.00   ? 167 TYR D CE1   1 
ATOM   10274 C CE2   . TYR D 1 167 ? 8.897   21.791  41.511  1.00 2.87   ? 167 TYR D CE2   1 
ATOM   10275 C CZ    . TYR D 1 167 ? 10.139  21.410  41.082  1.00 3.61   ? 167 TYR D CZ    1 
ATOM   10276 O OH    . TYR D 1 167 ? 10.356  20.084  40.771  1.00 2.80   ? 167 TYR D OH    1 
ATOM   10277 H H     . TYR D 1 167 ? 8.646   24.441  44.743  1.00 0.00   ? 167 TYR D H     1 
ATOM   10278 H HH    . TYR D 1 167 ? 11.153  20.028  40.231  1.00 0.00   ? 167 TYR D HH    1 
ATOM   10279 N N     . GLY D 1 168 ? 10.142  27.378  45.404  1.00 11.20  ? 168 GLY D N     1 
ATOM   10280 C CA    . GLY D 1 168 ? 9.763   28.565  46.156  1.00 4.09   ? 168 GLY D CA    1 
ATOM   10281 C C     . GLY D 1 168 ? 10.590  29.729  45.676  1.00 9.09   ? 168 GLY D C     1 
ATOM   10282 O O     . GLY D 1 168 ? 10.745  29.884  44.457  1.00 8.83   ? 168 GLY D O     1 
ATOM   10283 H H     . GLY D 1 168 ? 10.983  26.932  45.639  1.00 0.00   ? 168 GLY D H     1 
ATOM   10284 N N     . SER D 1 169 ? 11.178  30.523  46.585  1.00 4.82   ? 169 SER D N     1 
ATOM   10285 C CA    . SER D 1 169 ? 11.986  31.615  46.092  1.00 2.00   ? 169 SER D CA    1 
ATOM   10286 C C     . SER D 1 169 ? 13.295  31.101  45.488  1.00 4.70   ? 169 SER D C     1 
ATOM   10287 O O     . SER D 1 169 ? 13.855  31.751  44.605  1.00 8.76   ? 169 SER D O     1 
ATOM   10288 C CB    . SER D 1 169 ? 12.226  32.586  47.230  1.00 2.93   ? 169 SER D CB    1 
ATOM   10289 O OG    . SER D 1 169 ? 12.678  32.040  48.458  1.00 6.63   ? 169 SER D OG    1 
ATOM   10290 H H     . SER D 1 169 ? 11.041  30.398  47.549  1.00 0.00   ? 169 SER D H     1 
ATOM   10291 H HG    . SER D 1 169 ? 12.452  32.702  49.131  1.00 0.00   ? 169 SER D HG    1 
ATOM   10292 N N     . ALA D 1 170 ? 13.812  29.938  45.919  1.00 6.97   ? 170 ALA D N     1 
ATOM   10293 C CA    . ALA D 1 170 ? 14.970  29.261  45.327  1.00 6.05   ? 170 ALA D CA    1 
ATOM   10294 C C     . ALA D 1 170 ? 14.547  27.814  45.189  1.00 8.10   ? 170 ALA D C     1 
ATOM   10295 O O     . ALA D 1 170 ? 13.578  27.437  45.869  1.00 12.59  ? 170 ALA D O     1 
ATOM   10296 C CB    . ALA D 1 170 ? 16.166  29.262  46.225  1.00 3.01   ? 170 ALA D CB    1 
ATOM   10297 H H     . ALA D 1 170 ? 13.344  29.458  46.634  1.00 0.00   ? 170 ALA D H     1 
ATOM   10298 N N     . THR D 1 171 ? 15.155  26.943  44.399  1.00 2.13   ? 171 THR D N     1 
ATOM   10299 C CA    . THR D 1 171 ? 14.678  25.570  44.311  1.00 2.30   ? 171 THR D CA    1 
ATOM   10300 C C     . THR D 1 171 ? 15.413  24.653  45.274  1.00 4.68   ? 171 THR D C     1 
ATOM   10301 O O     . THR D 1 171 ? 16.637  24.580  45.258  1.00 4.36   ? 171 THR D O     1 
ATOM   10302 C CB    . THR D 1 171 ? 14.859  25.104  42.885  1.00 2.00   ? 171 THR D CB    1 
ATOM   10303 O OG1   . THR D 1 171 ? 14.123  26.027  42.077  1.00 7.98   ? 171 THR D OG1   1 
ATOM   10304 C CG2   . THR D 1 171 ? 14.425  23.684  42.680  1.00 2.00   ? 171 THR D CG2   1 
ATOM   10305 H H     . THR D 1 171 ? 15.937  27.202  43.871  1.00 0.00   ? 171 THR D H     1 
ATOM   10306 H HG1   . THR D 1 171 ? 13.269  25.661  41.821  1.00 0.00   ? 171 THR D HG1   1 
ATOM   10307 N N     . MET D 1 172 ? 14.744  23.899  46.127  1.00 9.74   ? 172 MET D N     1 
ATOM   10308 C CA    . MET D 1 172 ? 15.444  23.040  47.051  1.00 7.45   ? 172 MET D CA    1 
ATOM   10309 C C     . MET D 1 172 ? 14.928  21.609  46.966  1.00 8.71   ? 172 MET D C     1 
ATOM   10310 O O     . MET D 1 172 ? 13.725  21.416  46.754  1.00 11.50  ? 172 MET D O     1 
ATOM   10311 C CB    . MET D 1 172 ? 15.254  23.606  48.442  1.00 9.26   ? 172 MET D CB    1 
ATOM   10312 C CG    . MET D 1 172 ? 15.935  22.705  49.462  1.00 18.61  ? 172 MET D CG    1 
ATOM   10313 S SD    . MET D 1 172 ? 16.293  23.483  51.037  1.00 26.06  ? 172 MET D SD    1 
ATOM   10314 C CE    . MET D 1 172 ? 17.563  24.558  50.455  1.00 16.17  ? 172 MET D CE    1 
ATOM   10315 H H     . MET D 1 172 ? 13.763  23.890  46.106  1.00 0.00   ? 172 MET D H     1 
ATOM   10316 N N     . LEU D 1 173 ? 15.787  20.611  47.154  1.00 5.54   ? 173 LEU D N     1 
ATOM   10317 C CA    . LEU D 1 173 ? 15.374  19.217  47.138  1.00 5.70   ? 173 LEU D CA    1 
ATOM   10318 C C     . LEU D 1 173 ? 15.662  18.679  48.541  1.00 6.36   ? 173 LEU D C     1 
ATOM   10319 O O     . LEU D 1 173 ? 16.751  18.890  49.085  1.00 8.72   ? 173 LEU D O     1 
ATOM   10320 C CB    . LEU D 1 173 ? 16.172  18.496  46.072  1.00 3.05   ? 173 LEU D CB    1 
ATOM   10321 C CG    . LEU D 1 173 ? 15.695  17.159  45.573  1.00 8.45   ? 173 LEU D CG    1 
ATOM   10322 C CD1   . LEU D 1 173 ? 16.121  17.007  44.126  1.00 13.73  ? 173 LEU D CD1   1 
ATOM   10323 C CD2   . LEU D 1 173 ? 16.291  16.040  46.398  1.00 8.66   ? 173 LEU D CD2   1 
ATOM   10324 H H     . LEU D 1 173 ? 16.720  20.819  47.380  1.00 0.00   ? 173 LEU D H     1 
ATOM   10325 N N     . VAL D 1 174 ? 14.698  18.064  49.216  1.00 4.36   ? 174 VAL D N     1 
ATOM   10326 C CA    . VAL D 1 174 ? 14.931  17.501  50.532  1.00 3.06   ? 174 VAL D CA    1 
ATOM   10327 C C     . VAL D 1 174 ? 14.840  16.012  50.276  1.00 2.65   ? 174 VAL D C     1 
ATOM   10328 O O     . VAL D 1 174 ? 13.796  15.568  49.811  1.00 2.58   ? 174 VAL D O     1 
ATOM   10329 C CB    . VAL D 1 174 ? 13.846  17.945  51.507  1.00 3.05   ? 174 VAL D CB    1 
ATOM   10330 C CG1   . VAL D 1 174 ? 13.861  17.080  52.753  1.00 2.00   ? 174 VAL D CG1   1 
ATOM   10331 C CG2   . VAL D 1 174 ? 14.065  19.387  51.842  1.00 2.00   ? 174 VAL D CG2   1 
ATOM   10332 H H     . VAL D 1 174 ? 13.834  17.906  48.779  1.00 0.00   ? 174 VAL D H     1 
ATOM   10333 N N     . LEU D 1 175 ? 15.893  15.237  50.524  1.00 6.05   ? 175 LEU D N     1 
ATOM   10334 C CA    . LEU D 1 175 ? 15.878  13.806  50.307  1.00 4.79   ? 175 LEU D CA    1 
ATOM   10335 C C     . LEU D 1 175 ? 15.905  13.096  51.643  1.00 5.71   ? 175 LEU D C     1 
ATOM   10336 O O     . LEU D 1 175 ? 16.665  13.470  52.540  1.00 12.78  ? 175 LEU D O     1 
ATOM   10337 C CB    . LEU D 1 175 ? 17.080  13.447  49.470  1.00 6.65   ? 175 LEU D CB    1 
ATOM   10338 C CG    . LEU D 1 175 ? 17.391  11.977  49.208  1.00 6.14   ? 175 LEU D CG    1 
ATOM   10339 C CD1   . LEU D 1 175 ? 16.247  11.319  48.454  1.00 4.17   ? 175 LEU D CD1   1 
ATOM   10340 C CD2   . LEU D 1 175 ? 18.687  11.896  48.424  1.00 5.85   ? 175 LEU D CD2   1 
ATOM   10341 H H     . LEU D 1 175 ? 16.711  15.639  50.891  1.00 0.00   ? 175 LEU D H     1 
ATOM   10342 N N     . ALA D 1 176 ? 15.055  12.109  51.831  1.00 5.07   ? 176 ALA D N     1 
ATOM   10343 C CA    . ALA D 1 176 ? 15.045  11.391  53.069  1.00 3.68   ? 176 ALA D CA    1 
ATOM   10344 C C     . ALA D 1 176 ? 15.198  9.930   52.698  1.00 4.35   ? 176 ALA D C     1 
ATOM   10345 O O     . ALA D 1 176 ? 14.445  9.350   51.904  1.00 4.94   ? 176 ALA D O     1 
ATOM   10346 C CB    . ALA D 1 176 ? 13.731  11.623  53.778  1.00 3.72   ? 176 ALA D CB    1 
ATOM   10347 H H     . ALA D 1 176 ? 14.454  11.817  51.116  1.00 0.00   ? 176 ALA D H     1 
ATOM   10348 N N     . MET D 1 177 ? 16.275  9.365   53.208  1.00 4.60   ? 177 MET D N     1 
ATOM   10349 C CA    . MET D 1 177 ? 16.568  7.951   53.051  1.00 12.01  ? 177 MET D CA    1 
ATOM   10350 C C     . MET D 1 177 ? 16.754  7.448   54.470  1.00 12.46  ? 177 MET D C     1 
ATOM   10351 O O     . MET D 1 177 ? 16.774  8.247   55.416  1.00 13.88  ? 177 MET D O     1 
ATOM   10352 C CB    . MET D 1 177 ? 17.851  7.741   52.263  1.00 12.34  ? 177 MET D CB    1 
ATOM   10353 C CG    . MET D 1 177 ? 17.657  8.157   50.825  1.00 13.96  ? 177 MET D CG    1 
ATOM   10354 S SD    . MET D 1 177 ? 19.084  7.853   49.775  1.00 21.17  ? 177 MET D SD    1 
ATOM   10355 C CE    . MET D 1 177 ? 20.308  8.674   50.741  1.00 16.82  ? 177 MET D CE    1 
ATOM   10356 H H     . MET D 1 177 ? 16.820  9.893   53.832  1.00 0.00   ? 177 MET D H     1 
ATOM   10357 N N     . ASP D 1 178 ? 17.025  6.162   54.642  1.00 17.96  ? 178 ASP D N     1 
ATOM   10358 C CA    . ASP D 1 178 ? 17.159  5.544   55.956  1.00 23.83  ? 178 ASP D CA    1 
ATOM   10359 C C     . ASP D 1 178 ? 18.181  6.186   56.892  1.00 23.58  ? 178 ASP D C     1 
ATOM   10360 O O     . ASP D 1 178 ? 18.090  6.067   58.112  1.00 24.16  ? 178 ASP D O     1 
ATOM   10361 C CB    . ASP D 1 178 ? 17.491  4.067   55.716  1.00 31.81  ? 178 ASP D CB    1 
ATOM   10362 C CG    . ASP D 1 178 ? 17.457  3.138   56.930  1.00 40.79  ? 178 ASP D CG    1 
ATOM   10363 O OD1   . ASP D 1 178 ? 16.369  2.903   57.467  1.00 45.29  ? 178 ASP D OD1   1 
ATOM   10364 O OD2   . ASP D 1 178 ? 18.521  2.643   57.322  1.00 42.79  ? 178 ASP D OD2   1 
ATOM   10365 H H     . ASP D 1 178 ? 17.059  5.579   53.851  1.00 0.00   ? 178 ASP D H     1 
ATOM   10366 N N     . CYS D 1 179 ? 19.191  6.858   56.349  1.00 25.91  ? 179 CYS D N     1 
ATOM   10367 C CA    . CYS D 1 179 ? 20.231  7.485   57.151  1.00 27.96  ? 179 CYS D CA    1 
ATOM   10368 C C     . CYS D 1 179 ? 19.831  8.854   57.696  1.00 26.92  ? 179 CYS D C     1 
ATOM   10369 O O     . CYS D 1 179 ? 20.385  9.271   58.714  1.00 26.44  ? 179 CYS D O     1 
ATOM   10370 C CB    . CYS D 1 179 ? 21.524  7.659   56.332  1.00 27.43  ? 179 CYS D CB    1 
ATOM   10371 S SG    . CYS D 1 179 ? 21.468  8.917   55.009  1.00 31.26  ? 179 CYS D SG    1 
ATOM   10372 H H     . CYS D 1 179 ? 19.211  6.965   55.381  1.00 0.00   ? 179 CYS D H     1 
ATOM   10373 N N     . GLY D 1 180 ? 18.907  9.576   57.048  1.00 25.51  ? 180 GLY D N     1 
ATOM   10374 C CA    . GLY D 1 180 ? 18.551  10.918  57.479  1.00 23.47  ? 180 GLY D CA    1 
ATOM   10375 C C     . GLY D 1 180 ? 17.879  11.719  56.374  1.00 20.14  ? 180 GLY D C     1 
ATOM   10376 O O     . GLY D 1 180 ? 17.575  11.191  55.295  1.00 24.72  ? 180 GLY D O     1 
ATOM   10377 H H     . GLY D 1 180 ? 18.385  9.202   56.306  1.00 0.00   ? 180 GLY D H     1 
ATOM   10378 N N     . VAL D 1 181 ? 17.648  12.999  56.656  1.00 13.26  ? 181 VAL D N     1 
ATOM   10379 C CA    . VAL D 1 181 ? 16.991  13.927  55.760  1.00 6.99   ? 181 VAL D CA    1 
ATOM   10380 C C     . VAL D 1 181 ? 18.079  14.900  55.390  1.00 9.55   ? 181 VAL D C     1 
ATOM   10381 O O     . VAL D 1 181 ? 18.775  15.361  56.299  1.00 8.44   ? 181 VAL D O     1 
ATOM   10382 C CB    . VAL D 1 181 ? 15.887  14.647  56.496  1.00 2.60   ? 181 VAL D CB    1 
ATOM   10383 C CG1   . VAL D 1 181 ? 15.236  15.663  55.605  1.00 5.78   ? 181 VAL D CG1   1 
ATOM   10384 C CG2   . VAL D 1 181 ? 14.852  13.649  56.919  1.00 3.72   ? 181 VAL D CG2   1 
ATOM   10385 H H     . VAL D 1 181 ? 17.981  13.360  57.502  1.00 0.00   ? 181 VAL D H     1 
ATOM   10386 N N     . ASN D 1 182 ? 18.277  15.246  54.125  1.00 11.03  ? 182 ASN D N     1 
ATOM   10387 C CA    . ASN D 1 182 ? 19.357  16.137  53.730  1.00 9.41   ? 182 ASN D CA    1 
ATOM   10388 C C     . ASN D 1 182 ? 18.833  17.163  52.769  1.00 4.59   ? 182 ASN D C     1 
ATOM   10389 O O     . ASN D 1 182 ? 18.249  16.765  51.772  1.00 6.02   ? 182 ASN D O     1 
ATOM   10390 C CB    . ASN D 1 182 ? 20.466  15.375  53.032  1.00 15.57  ? 182 ASN D CB    1 
ATOM   10391 C CG    . ASN D 1 182 ? 21.441  14.715  53.983  1.00 16.36  ? 182 ASN D CG    1 
ATOM   10392 O OD1   . ASN D 1 182 ? 21.456  13.510  54.175  1.00 17.12  ? 182 ASN D OD1   1 
ATOM   10393 N ND2   . ASN D 1 182 ? 22.329  15.443  54.621  1.00 11.90  ? 182 ASN D ND2   1 
ATOM   10394 H H     . ASN D 1 182 ? 17.687  14.897  53.420  1.00 0.00   ? 182 ASN D H     1 
ATOM   10395 H HD21  . ASN D 1 182 ? 23.004  14.966  55.164  1.00 0.00   ? 182 ASN D HD21  1 
ATOM   10396 H HD22  . ASN D 1 182 ? 22.318  16.409  54.453  1.00 0.00   ? 182 ASN D HD22  1 
ATOM   10397 N N     . CYS D 1 183 ? 19.029  18.445  53.008  1.00 6.22   ? 183 CYS D N     1 
ATOM   10398 C CA    . CYS D 1 183 ? 18.491  19.495  52.169  1.00 7.81   ? 183 CYS D CA    1 
ATOM   10399 C C     . CYS D 1 183 ? 19.557  19.961  51.167  1.00 7.83   ? 183 CYS D C     1 
ATOM   10400 O O     . CYS D 1 183 ? 20.712  20.181  51.556  1.00 8.60   ? 183 CYS D O     1 
ATOM   10401 C CB    . CYS D 1 183 ? 18.046  20.662  53.064  1.00 13.39  ? 183 CYS D CB    1 
ATOM   10402 S SG    . CYS D 1 183 ? 16.756  20.452  54.337  1.00 23.24  ? 183 CYS D SG    1 
ATOM   10403 H H     . CYS D 1 183 ? 19.654  18.702  53.719  1.00 0.00   ? 183 CYS D H     1 
ATOM   10404 N N     . PHE D 1 184 ? 19.244  20.156  49.883  1.00 7.28   ? 184 PHE D N     1 
ATOM   10405 C CA    . PHE D 1 184 ? 20.194  20.551  48.849  1.00 2.23   ? 184 PHE D CA    1 
ATOM   10406 C C     . PHE D 1 184 ? 19.633  21.761  48.151  1.00 3.48   ? 184 PHE D C     1 
ATOM   10407 O O     . PHE D 1 184 ? 18.447  21.754  47.858  1.00 2.76   ? 184 PHE D O     1 
ATOM   10408 C CB    . PHE D 1 184 ? 20.368  19.491  47.763  1.00 5.55   ? 184 PHE D CB    1 
ATOM   10409 C CG    . PHE D 1 184 ? 20.941  18.146  48.201  1.00 5.77   ? 184 PHE D CG    1 
ATOM   10410 C CD1   . PHE D 1 184 ? 20.162  17.250  48.908  1.00 9.21   ? 184 PHE D CD1   1 
ATOM   10411 C CD2   . PHE D 1 184 ? 22.257  17.844  47.931  1.00 7.98   ? 184 PHE D CD2   1 
ATOM   10412 C CE1   . PHE D 1 184 ? 20.727  16.092  49.398  1.00 6.04   ? 184 PHE D CE1   1 
ATOM   10413 C CE2   . PHE D 1 184 ? 22.811  16.684  48.404  1.00 2.00   ? 184 PHE D CE2   1 
ATOM   10414 C CZ    . PHE D 1 184 ? 22.055  15.824  49.155  1.00 8.14   ? 184 PHE D CZ    1 
ATOM   10415 H H     . PHE D 1 184 ? 18.320  20.006  49.589  1.00 0.00   ? 184 PHE D H     1 
ATOM   10416 N N     . MET D 1 185 ? 20.413  22.774  47.808  1.00 5.40   ? 185 MET D N     1 
ATOM   10417 C CA    . MET D 1 185 ? 19.928  23.980  47.159  1.00 3.54   ? 185 MET D CA    1 
ATOM   10418 C C     . MET D 1 185 ? 20.386  23.956  45.711  1.00 6.36   ? 185 MET D C     1 
ATOM   10419 O O     . MET D 1 185 ? 21.537  23.616  45.412  1.00 3.91   ? 185 MET D O     1 
ATOM   10420 C CB    . MET D 1 185 ? 20.511  25.212  47.810  1.00 8.99   ? 185 MET D CB    1 
ATOM   10421 C CG    . MET D 1 185 ? 19.952  26.552  47.345  1.00 9.32   ? 185 MET D CG    1 
ATOM   10422 S SD    . MET D 1 185 ? 18.471  26.907  48.310  1.00 20.89  ? 185 MET D SD    1 
ATOM   10423 C CE    . MET D 1 185 ? 19.219  27.751  49.682  1.00 9.33   ? 185 MET D CE    1 
ATOM   10424 H H     . MET D 1 185 ? 21.382  22.669  47.904  1.00 0.00   ? 185 MET D H     1 
ATOM   10425 N N     . LEU D 1 186 ? 19.513  24.271  44.769  1.00 6.58   ? 186 LEU D N     1 
ATOM   10426 C CA    . LEU D 1 186 ? 19.910  24.322  43.383  1.00 4.60   ? 186 LEU D CA    1 
ATOM   10427 C C     . LEU D 1 186 ? 20.637  25.632  43.170  1.00 4.69   ? 186 LEU D C     1 
ATOM   10428 O O     . LEU D 1 186 ? 20.151  26.715  43.479  1.00 2.00   ? 186 LEU D O     1 
ATOM   10429 C CB    . LEU D 1 186 ? 18.693  24.279  42.438  1.00 2.00   ? 186 LEU D CB    1 
ATOM   10430 C CG    . LEU D 1 186 ? 18.959  24.364  40.926  1.00 3.21   ? 186 LEU D CG    1 
ATOM   10431 C CD1   . LEU D 1 186 ? 19.466  23.049  40.409  1.00 2.00   ? 186 LEU D CD1   1 
ATOM   10432 C CD2   . LEU D 1 186 ? 17.685  24.667  40.169  1.00 3.74   ? 186 LEU D CD2   1 
ATOM   10433 H H     . LEU D 1 186 ? 18.607  24.557  45.015  1.00 0.00   ? 186 LEU D H     1 
ATOM   10434 N N     . ASP D 1 187 ? 21.860  25.545  42.691  1.00 10.67  ? 187 ASP D N     1 
ATOM   10435 C CA    . ASP D 1 187 ? 22.484  26.726  42.167  1.00 8.95   ? 187 ASP D CA    1 
ATOM   10436 C C     . ASP D 1 187 ? 22.051  26.674  40.699  1.00 8.92   ? 187 ASP D C     1 
ATOM   10437 O O     . ASP D 1 187 ? 22.532  25.788  39.972  1.00 12.50  ? 187 ASP D O     1 
ATOM   10438 C CB    . ASP D 1 187 ? 24.001  26.630  42.295  1.00 15.66  ? 187 ASP D CB    1 
ATOM   10439 C CG    . ASP D 1 187 ? 24.773  27.834  41.731  1.00 18.43  ? 187 ASP D CG    1 
ATOM   10440 O OD1   . ASP D 1 187 ? 24.226  28.617  40.947  1.00 5.48   ? 187 ASP D OD1   1 
ATOM   10441 O OD2   . ASP D 1 187 ? 25.948  27.980  42.075  1.00 14.69  ? 187 ASP D OD2   1 
ATOM   10442 H H     . ASP D 1 187 ? 22.346  24.704  42.749  1.00 0.00   ? 187 ASP D H     1 
ATOM   10443 N N     . PRO D 1 188 ? 21.214  27.581  40.170  1.00 5.97   ? 188 PRO D N     1 
ATOM   10444 C CA    . PRO D 1 188 ? 20.779  27.565  38.787  1.00 7.72   ? 188 PRO D CA    1 
ATOM   10445 C C     . PRO D 1 188 ? 21.858  27.897  37.776  1.00 10.33  ? 188 PRO D C     1 
ATOM   10446 O O     . PRO D 1 188 ? 21.845  27.387  36.663  1.00 17.18  ? 188 PRO D O     1 
ATOM   10447 C CB    . PRO D 1 188 ? 19.599  28.517  38.732  1.00 2.00   ? 188 PRO D CB    1 
ATOM   10448 C CG    . PRO D 1 188 ? 19.816  29.434  39.877  1.00 3.70   ? 188 PRO D CG    1 
ATOM   10449 C CD    . PRO D 1 188 ? 20.361  28.484  40.925  1.00 5.95   ? 188 PRO D CD    1 
ATOM   10450 N N     . ALA D 1 189 ? 22.854  28.674  38.180  1.00 12.70  ? 189 ALA D N     1 
ATOM   10451 C CA    . ALA D 1 189 ? 23.946  29.080  37.308  1.00 11.20  ? 189 ALA D CA    1 
ATOM   10452 C C     . ALA D 1 189 ? 24.838  27.947  36.848  1.00 10.66  ? 189 ALA D C     1 
ATOM   10453 O O     . ALA D 1 189 ? 25.641  28.160  35.956  1.00 11.87  ? 189 ALA D O     1 
ATOM   10454 C CB    . ALA D 1 189 ? 24.838  30.090  37.999  1.00 8.30   ? 189 ALA D CB    1 
ATOM   10455 H H     . ALA D 1 189 ? 22.816  29.016  39.091  1.00 0.00   ? 189 ALA D H     1 
ATOM   10456 N N     . ILE D 1 190 ? 24.814  26.784  37.501  1.00 12.19  ? 190 ILE D N     1 
ATOM   10457 C CA    . ILE D 1 190 ? 25.529  25.608  37.009  1.00 11.17  ? 190 ILE D CA    1 
ATOM   10458 C C     . ILE D 1 190 ? 24.612  24.399  37.069  1.00 12.40  ? 190 ILE D C     1 
ATOM   10459 O O     . ILE D 1 190 ? 25.035  23.294  36.749  1.00 16.35  ? 190 ILE D O     1 
ATOM   10460 C CB    . ILE D 1 190 ? 26.805  25.271  37.838  1.00 9.50   ? 190 ILE D CB    1 
ATOM   10461 C CG1   . ILE D 1 190 ? 26.484  25.069  39.306  1.00 7.53   ? 190 ILE D CG1   1 
ATOM   10462 C CG2   . ILE D 1 190 ? 27.810  26.400  37.653  1.00 12.51  ? 190 ILE D CG2   1 
ATOM   10463 C CD1   . ILE D 1 190 ? 27.730  24.796  40.148  1.00 2.00   ? 190 ILE D CD1   1 
ATOM   10464 H H     . ILE D 1 190 ? 24.280  26.698  38.312  1.00 0.00   ? 190 ILE D H     1 
ATOM   10465 N N     . GLY D 1 191 ? 23.358  24.546  37.494  1.00 11.94  ? 191 GLY D N     1 
ATOM   10466 C CA    . GLY D 1 191 ? 22.451  23.421  37.570  1.00 13.25  ? 191 GLY D CA    1 
ATOM   10467 C C     . GLY D 1 191 ? 23.016  22.365  38.493  1.00 12.84  ? 191 GLY D C     1 
ATOM   10468 O O     . GLY D 1 191 ? 23.183  21.202  38.128  1.00 14.94  ? 191 GLY D O     1 
ATOM   10469 H H     . GLY D 1 191 ? 22.997  25.438  37.641  1.00 0.00   ? 191 GLY D H     1 
ATOM   10470 N N     . GLU D 1 192 ? 23.283  22.725  39.735  1.00 10.18  ? 192 GLU D N     1 
ATOM   10471 C CA    . GLU D 1 192 ? 23.893  21.748  40.590  1.00 8.95   ? 192 GLU D CA    1 
ATOM   10472 C C     . GLU D 1 192 ? 23.248  21.914  41.923  1.00 6.35   ? 192 GLU D C     1 
ATOM   10473 O O     . GLU D 1 192 ? 23.033  23.050  42.349  1.00 4.23   ? 192 GLU D O     1 
ATOM   10474 C CB    . GLU D 1 192 ? 25.407  22.029  40.611  1.00 9.20   ? 192 GLU D CB    1 
ATOM   10475 C CG    . GLU D 1 192 ? 26.320  20.857  40.947  1.00 7.55   ? 192 GLU D CG    1 
ATOM   10476 C CD    . GLU D 1 192 ? 26.180  19.634  40.048  1.00 14.15  ? 192 GLU D CD    1 
ATOM   10477 O OE1   . GLU D 1 192 ? 26.341  19.760  38.837  1.00 12.48  ? 192 GLU D OE1   1 
ATOM   10478 O OE2   . GLU D 1 192 ? 25.924  18.543  40.560  1.00 20.43  ? 192 GLU D OE2   1 
ATOM   10479 H H     . GLU D 1 192 ? 23.050  23.612  40.087  1.00 0.00   ? 192 GLU D H     1 
ATOM   10480 N N     . PHE D 1 193 ? 22.892  20.791  42.528  1.00 9.18   ? 193 PHE D N     1 
ATOM   10481 C CA    . PHE D 1 193 ? 22.272  20.801  43.835  1.00 9.85   ? 193 PHE D CA    1 
ATOM   10482 C C     . PHE D 1 193 ? 23.404  20.655  44.829  1.00 11.00  ? 193 PHE D C     1 
ATOM   10483 O O     . PHE D 1 193 ? 24.093  19.639  44.867  1.00 14.44  ? 193 PHE D O     1 
ATOM   10484 C CB    . PHE D 1 193 ? 21.302  19.630  44.014  1.00 11.58  ? 193 PHE D CB    1 
ATOM   10485 C CG    . PHE D 1 193 ? 19.916  19.852  43.434  1.00 8.56   ? 193 PHE D CG    1 
ATOM   10486 C CD1   . PHE D 1 193 ? 19.019  20.668  44.104  1.00 13.18  ? 193 PHE D CD1   1 
ATOM   10487 C CD2   . PHE D 1 193 ? 19.547  19.229  42.256  1.00 11.76  ? 193 PHE D CD2   1 
ATOM   10488 C CE1   . PHE D 1 193 ? 17.753  20.854  43.587  1.00 8.40   ? 193 PHE D CE1   1 
ATOM   10489 C CE2   . PHE D 1 193 ? 18.283  19.424  41.743  1.00 5.20   ? 193 PHE D CE2   1 
ATOM   10490 C CZ    . PHE D 1 193 ? 17.395  20.242  42.406  1.00 8.81   ? 193 PHE D CZ    1 
ATOM   10491 H H     . PHE D 1 193 ? 23.099  19.919  42.125  1.00 0.00   ? 193 PHE D H     1 
ATOM   10492 N N     . ILE D 1 194 ? 23.640  21.698  45.597  1.00 10.09  ? 194 ILE D N     1 
ATOM   10493 C CA    . ILE D 1 194 ? 24.701  21.761  46.566  1.00 6.69   ? 194 ILE D CA    1 
ATOM   10494 C C     . ILE D 1 194 ? 24.147  21.303  47.906  1.00 5.54   ? 194 ILE D C     1 
ATOM   10495 O O     . ILE D 1 194 ? 23.028  21.694  48.253  1.00 6.75   ? 194 ILE D O     1 
ATOM   10496 C CB    . ILE D 1 194 ? 25.181  23.247  46.493  1.00 7.50   ? 194 ILE D CB    1 
ATOM   10497 C CG1   . ILE D 1 194 ? 26.331  23.343  45.516  1.00 12.52  ? 194 ILE D CG1   1 
ATOM   10498 C CG2   . ILE D 1 194 ? 25.781  23.751  47.806  1.00 13.94  ? 194 ILE D CG2   1 
ATOM   10499 C CD1   . ILE D 1 194 ? 26.035  23.081  44.053  1.00 14.19  ? 194 ILE D CD1   1 
ATOM   10500 H H     . ILE D 1 194 ? 23.049  22.471  45.505  1.00 0.00   ? 194 ILE D H     1 
ATOM   10501 N N     . LEU D 1 195 ? 24.852  20.491  48.698  1.00 6.39   ? 195 LEU D N     1 
ATOM   10502 C CA    . LEU D 1 195 ? 24.386  20.067  50.008  1.00 5.35   ? 195 LEU D CA    1 
ATOM   10503 C C     . LEU D 1 195 ? 24.600  21.220  50.932  1.00 8.38   ? 195 LEU D C     1 
ATOM   10504 O O     . LEU D 1 195 ? 25.715  21.524  51.362  1.00 13.13  ? 195 LEU D O     1 
ATOM   10505 C CB    . LEU D 1 195 ? 25.169  18.888  50.553  1.00 3.26   ? 195 LEU D CB    1 
ATOM   10506 C CG    . LEU D 1 195 ? 24.749  18.338  51.912  1.00 5.79   ? 195 LEU D CG    1 
ATOM   10507 C CD1   . LEU D 1 195 ? 23.365  17.788  51.848  1.00 6.06   ? 195 LEU D CD1   1 
ATOM   10508 C CD2   . LEU D 1 195 ? 25.636  17.172  52.296  1.00 11.74  ? 195 LEU D CD2   1 
ATOM   10509 H H     . LEU D 1 195 ? 25.725  20.164  48.387  1.00 0.00   ? 195 LEU D H     1 
ATOM   10510 N N     . VAL D 1 196 ? 23.503  21.884  51.201  1.00 9.37   ? 196 VAL D N     1 
ATOM   10511 C CA    . VAL D 1 196 ? 23.562  23.010  52.098  1.00 13.83  ? 196 VAL D CA    1 
ATOM   10512 C C     . VAL D 1 196 ? 23.198  22.604  53.513  1.00 18.34  ? 196 VAL D C     1 
ATOM   10513 O O     . VAL D 1 196 ? 23.448  23.415  54.400  1.00 25.00  ? 196 VAL D O     1 
ATOM   10514 C CB    . VAL D 1 196 ? 22.632  24.192  51.632  1.00 11.21  ? 196 VAL D CB    1 
ATOM   10515 C CG1   . VAL D 1 196 ? 23.182  24.657  50.296  1.00 2.00   ? 196 VAL D CG1   1 
ATOM   10516 C CG2   . VAL D 1 196 ? 21.157  23.811  51.486  1.00 9.68   ? 196 VAL D CG2   1 
ATOM   10517 H H     . VAL D 1 196 ? 22.662  21.609  50.795  1.00 0.00   ? 196 VAL D H     1 
ATOM   10518 N N     . ASP D 1 197 ? 22.614  21.441  53.833  1.00 16.72  ? 197 ASP D N     1 
ATOM   10519 C CA    . ASP D 1 197 ? 22.400  21.086  55.236  1.00 17.45  ? 197 ASP D CA    1 
ATOM   10520 C C     . ASP D 1 197 ? 22.275  19.580  55.379  1.00 16.41  ? 197 ASP D C     1 
ATOM   10521 O O     . ASP D 1 197 ? 21.561  18.923  54.620  1.00 17.58  ? 197 ASP D O     1 
ATOM   10522 C CB    . ASP D 1 197 ? 21.144  21.758  55.782  1.00 21.24  ? 197 ASP D CB    1 
ATOM   10523 C CG    . ASP D 1 197 ? 21.034  21.816  57.305  1.00 27.01  ? 197 ASP D CG    1 
ATOM   10524 O OD1   . ASP D 1 197 ? 21.894  21.264  58.012  1.00 34.66  ? 197 ASP D OD1   1 
ATOM   10525 O OD2   . ASP D 1 197 ? 20.071  22.426  57.786  1.00 22.97  ? 197 ASP D OD2   1 
ATOM   10526 H H     . ASP D 1 197 ? 22.337  20.826  53.120  1.00 0.00   ? 197 ASP D H     1 
ATOM   10527 N N     . LYS D 1 198 ? 22.940  19.040  56.397  1.00 20.19  ? 198 LYS D N     1 
ATOM   10528 C CA    . LYS D 1 198 ? 23.156  17.603  56.542  1.00 23.83  ? 198 LYS D CA    1 
ATOM   10529 C C     . LYS D 1 198 ? 22.404  17.034  57.697  1.00 20.89  ? 198 LYS D C     1 
ATOM   10530 O O     . LYS D 1 198 ? 22.351  17.685  58.735  1.00 21.23  ? 198 LYS D O     1 
ATOM   10531 C CB    . LYS D 1 198 ? 24.610  17.245  56.808  1.00 30.57  ? 198 LYS D CB    1 
ATOM   10532 C CG    . LYS D 1 198 ? 25.624  17.800  55.833  1.00 38.30  ? 198 LYS D CG    1 
ATOM   10533 C CD    . LYS D 1 198 ? 26.991  17.671  56.464  1.00 48.29  ? 198 LYS D CD    1 
ATOM   10534 C CE    . LYS D 1 198 ? 27.786  18.961  56.240  1.00 56.55  ? 198 LYS D CE    1 
ATOM   10535 N NZ    . LYS D 1 198 ? 29.084  18.852  56.880  1.00 62.86  ? 198 LYS D NZ    1 
ATOM   10536 H H     . LYS D 1 198 ? 23.196  19.596  57.163  1.00 0.00   ? 198 LYS D H     1 
ATOM   10537 H HZ1   . LYS D 1 198 ? 28.974  18.398  57.811  1.00 0.00   ? 198 LYS D HZ1   1 
ATOM   10538 H HZ2   . LYS D 1 198 ? 29.698  18.249  56.294  1.00 0.00   ? 198 LYS D HZ2   1 
ATOM   10539 H HZ3   . LYS D 1 198 ? 29.525  19.787  57.003  1.00 0.00   ? 198 LYS D HZ3   1 
ATOM   10540 N N     . ASP D 1 199 ? 21.807  15.868  57.486  1.00 24.71  ? 199 ASP D N     1 
ATOM   10541 C CA    . ASP D 1 199 ? 21.077  15.158  58.520  1.00 31.06  ? 199 ASP D CA    1 
ATOM   10542 C C     . ASP D 1 199 ? 20.267  16.067  59.482  1.00 29.17  ? 199 ASP D C     1 
ATOM   10543 O O     . ASP D 1 199 ? 20.536  16.276  60.672  1.00 30.47  ? 199 ASP D O     1 
ATOM   10544 C CB    . ASP D 1 199 ? 22.172  14.303  59.152  1.00 39.93  ? 199 ASP D CB    1 
ATOM   10545 C CG    . ASP D 1 199 ? 21.688  13.331  60.206  1.00 52.12  ? 199 ASP D CG    1 
ATOM   10546 O OD1   . ASP D 1 199 ? 21.243  12.245  59.818  1.00 59.93  ? 199 ASP D OD1   1 
ATOM   10547 O OD2   . ASP D 1 199 ? 21.767  13.656  61.396  1.00 60.56  ? 199 ASP D OD2   1 
ATOM   10548 H H     . ASP D 1 199 ? 21.837  15.467  56.597  1.00 0.00   ? 199 ASP D H     1 
ATOM   10549 N N     . VAL D 1 200 ? 19.264  16.660  58.822  1.00 25.88  ? 200 VAL D N     1 
ATOM   10550 C CA    . VAL D 1 200 ? 18.302  17.629  59.358  1.00 20.03  ? 200 VAL D CA    1 
ATOM   10551 C C     . VAL D 1 200 ? 17.403  17.121  60.476  1.00 17.47  ? 200 VAL D C     1 
ATOM   10552 O O     . VAL D 1 200 ? 16.749  16.103  60.304  1.00 19.88  ? 200 VAL D O     1 
ATOM   10553 C CB    . VAL D 1 200 ? 17.381  18.151  58.220  1.00 15.64  ? 200 VAL D CB    1 
ATOM   10554 C CG1   . VAL D 1 200 ? 16.428  19.225  58.749  1.00 16.61  ? 200 VAL D CG1   1 
ATOM   10555 C CG2   . VAL D 1 200 ? 18.220  18.762  57.114  1.00 15.02  ? 200 VAL D CG2   1 
ATOM   10556 H H     . VAL D 1 200 ? 19.140  16.392  57.892  1.00 0.00   ? 200 VAL D H     1 
ATOM   10557 N N     . LYS D 1 201 ? 17.243  17.840  61.587  1.00 19.50  ? 201 LYS D N     1 
ATOM   10558 C CA    . LYS D 1 201 ? 16.327  17.443  62.637  1.00 15.25  ? 201 LYS D CA    1 
ATOM   10559 C C     . LYS D 1 201 ? 15.351  18.566  62.923  1.00 15.12  ? 201 LYS D C     1 
ATOM   10560 O O     . LYS D 1 201 ? 15.712  19.744  62.939  1.00 15.74  ? 201 LYS D O     1 
ATOM   10561 C CB    . LYS D 1 201 ? 17.109  17.085  63.894  1.00 19.18  ? 201 LYS D CB    1 
ATOM   10562 C CG    . LYS D 1 201 ? 17.055  15.579  64.197  1.00 26.49  ? 201 LYS D CG    1 
ATOM   10563 C CD    . LYS D 1 201 ? 17.496  14.740  63.005  1.00 29.47  ? 201 LYS D CD    1 
ATOM   10564 C CE    . LYS D 1 201 ? 17.336  13.268  63.238  1.00 33.51  ? 201 LYS D CE    1 
ATOM   10565 N NZ    . LYS D 1 201 ? 18.594  12.703  63.664  1.00 37.63  ? 201 LYS D NZ    1 
ATOM   10566 H H     . LYS D 1 201 ? 17.700  18.698  61.680  1.00 0.00   ? 201 LYS D H     1 
ATOM   10567 H HZ1   . LYS D 1 201 ? 18.952  13.246  64.474  1.00 0.00   ? 201 LYS D HZ1   1 
ATOM   10568 H HZ2   . LYS D 1 201 ? 18.440  11.712  63.942  1.00 0.00   ? 201 LYS D HZ2   1 
ATOM   10569 H HZ3   . LYS D 1 201 ? 19.281  12.746  62.884  1.00 0.00   ? 201 LYS D HZ3   1 
ATOM   10570 N N     . ILE D 1 202 ? 14.095  18.195  63.126  1.00 13.89  ? 202 ILE D N     1 
ATOM   10571 C CA    . ILE D 1 202 ? 13.024  19.138  63.379  1.00 15.38  ? 202 ILE D CA    1 
ATOM   10572 C C     . ILE D 1 202 ? 13.103  19.668  64.818  1.00 17.66  ? 202 ILE D C     1 
ATOM   10573 O O     . ILE D 1 202 ? 13.740  19.076  65.695  1.00 23.89  ? 202 ILE D O     1 
ATOM   10574 C CB    . ILE D 1 202 ? 11.687  18.367  63.032  1.00 14.01  ? 202 ILE D CB    1 
ATOM   10575 C CG1   . ILE D 1 202 ? 10.532  19.337  62.891  1.00 9.66   ? 202 ILE D CG1   1 
ATOM   10576 C CG2   . ILE D 1 202 ? 11.318  17.383  64.132  1.00 10.06  ? 202 ILE D CG2   1 
ATOM   10577 C CD1   . ILE D 1 202 ? 9.520   18.780  61.892  1.00 9.80   ? 202 ILE D CD1   1 
ATOM   10578 H H     . ILE D 1 202 ? 13.897  17.237  63.173  1.00 0.00   ? 202 ILE D H     1 
ATOM   10579 N N     . LYS D 1 203 ? 12.587  20.860  65.088  1.00 18.57  ? 203 LYS D N     1 
ATOM   10580 C CA    . LYS D 1 203 ? 12.481  21.363  66.457  1.00 21.07  ? 203 LYS D CA    1 
ATOM   10581 C C     . LYS D 1 203 ? 11.442  20.511  67.188  1.00 18.02  ? 203 LYS D C     1 
ATOM   10582 O O     . LYS D 1 203 ? 10.461  20.094  66.558  1.00 17.78  ? 203 LYS D O     1 
ATOM   10583 C CB    . LYS D 1 203 ? 11.980  22.799  66.512  1.00 22.41  ? 203 LYS D CB    1 
ATOM   10584 C CG    . LYS D 1 203 ? 12.940  23.941  66.333  1.00 31.22  ? 203 LYS D CG    1 
ATOM   10585 C CD    . LYS D 1 203 ? 12.021  25.142  66.408  1.00 37.23  ? 203 LYS D CD    1 
ATOM   10586 C CE    . LYS D 1 203 ? 12.782  26.459  66.454  1.00 46.45  ? 203 LYS D CE    1 
ATOM   10587 N NZ    . LYS D 1 203 ? 11.858  27.577  66.354  1.00 53.20  ? 203 LYS D NZ    1 
ATOM   10588 H H     . LYS D 1 203 ? 12.222  21.384  64.349  1.00 0.00   ? 203 LYS D H     1 
ATOM   10589 H HZ1   . LYS D 1 203 ? 11.322  27.489  65.466  1.00 0.00   ? 203 LYS D HZ1   1 
ATOM   10590 H HZ2   . LYS D 1 203 ? 11.199  27.568  67.158  1.00 0.00   ? 203 LYS D HZ2   1 
ATOM   10591 H HZ3   . LYS D 1 203 ? 12.389  28.469  66.352  1.00 0.00   ? 203 LYS D HZ3   1 
ATOM   10592 N N     . LYS D 1 204 ? 11.594  20.246  68.484  1.00 18.44  ? 204 LYS D N     1 
ATOM   10593 C CA    . LYS D 1 204 ? 10.635  19.460  69.243  1.00 20.03  ? 204 LYS D CA    1 
ATOM   10594 C C     . LYS D 1 204 ? 9.271   20.086  69.293  1.00 19.81  ? 204 LYS D C     1 
ATOM   10595 O O     . LYS D 1 204 ? 8.260   19.368  69.264  1.00 20.29  ? 204 LYS D O     1 
ATOM   10596 C CB    . LYS D 1 204 ? 11.012  19.299  70.673  1.00 29.18  ? 204 LYS D CB    1 
ATOM   10597 C CG    . LYS D 1 204 ? 11.924  18.182  71.074  1.00 44.02  ? 204 LYS D CG    1 
ATOM   10598 C CD    . LYS D 1 204 ? 11.998  18.450  72.573  1.00 56.86  ? 204 LYS D CD    1 
ATOM   10599 C CE    . LYS D 1 204 ? 12.806  17.409  73.338  1.00 67.13  ? 204 LYS D CE    1 
ATOM   10600 N NZ    . LYS D 1 204 ? 12.947  17.780  74.740  1.00 69.70  ? 204 LYS D NZ    1 
ATOM   10601 H H     . LYS D 1 204 ? 12.412  20.557  68.924  1.00 0.00   ? 204 LYS D H     1 
ATOM   10602 H HZ1   . LYS D 1 204 ? 12.005  17.926  75.155  1.00 0.00   ? 204 LYS D HZ1   1 
ATOM   10603 H HZ2   . LYS D 1 204 ? 13.430  17.005  75.237  1.00 0.00   ? 204 LYS D HZ2   1 
ATOM   10604 H HZ3   . LYS D 1 204 ? 13.508  18.652  74.815  1.00 0.00   ? 204 LYS D HZ3   1 
ATOM   10605 N N     . LYS D 1 205 ? 9.247   21.413  69.355  1.00 15.69  ? 205 LYS D N     1 
ATOM   10606 C CA    . LYS D 1 205 ? 8.019   22.142  69.507  1.00 16.21  ? 205 LYS D CA    1 
ATOM   10607 C C     . LYS D 1 205 ? 8.192   23.438  68.738  1.00 17.58  ? 205 LYS D C     1 
ATOM   10608 O O     . LYS D 1 205 ? 9.257   24.035  68.815  1.00 17.16  ? 205 LYS D O     1 
ATOM   10609 C CB    . LYS D 1 205 ? 7.793   22.447  70.954  1.00 17.77  ? 205 LYS D CB    1 
ATOM   10610 C CG    . LYS D 1 205 ? 6.325   22.670  71.262  1.00 29.61  ? 205 LYS D CG    1 
ATOM   10611 C CD    . LYS D 1 205 ? 6.197   23.452  72.554  1.00 31.40  ? 205 LYS D CD    1 
ATOM   10612 C CE    . LYS D 1 205 ? 4.743   23.534  72.983  1.00 34.27  ? 205 LYS D CE    1 
ATOM   10613 N NZ    . LYS D 1 205 ? 4.616   24.535  74.025  1.00 37.12  ? 205 LYS D NZ    1 
ATOM   10614 H H     . LYS D 1 205 ? 10.064  21.936  69.227  1.00 0.00   ? 205 LYS D H     1 
ATOM   10615 H HZ1   . LYS D 1 205 ? 5.240   24.284  74.820  1.00 0.00   ? 205 LYS D HZ1   1 
ATOM   10616 H HZ2   . LYS D 1 205 ? 4.894   25.460  73.638  1.00 0.00   ? 205 LYS D HZ2   1 
ATOM   10617 H HZ3   . LYS D 1 205 ? 3.628   24.575  74.350  1.00 0.00   ? 205 LYS D HZ3   1 
ATOM   10618 N N     . GLY D 1 206 ? 7.186   23.898  68.016  1.00 18.01  ? 206 GLY D N     1 
ATOM   10619 C CA    . GLY D 1 206 ? 7.314   25.092  67.222  1.00 19.81  ? 206 GLY D CA    1 
ATOM   10620 C C     . GLY D 1 206 ? 6.284   26.085  67.711  1.00 21.51  ? 206 GLY D C     1 
ATOM   10621 O O     . GLY D 1 206 ? 5.646   25.859  68.744  1.00 22.17  ? 206 GLY D O     1 
ATOM   10622 H H     . GLY D 1 206 ? 6.284   23.553  68.164  1.00 0.00   ? 206 GLY D H     1 
ATOM   10623 N N     . LYS D 1 207 ? 6.129   27.196  67.010  1.00 19.41  ? 207 LYS D N     1 
ATOM   10624 C CA    . LYS D 1 207 ? 5.174   28.236  67.329  1.00 18.79  ? 207 LYS D CA    1 
ATOM   10625 C C     . LYS D 1 207 ? 4.260   28.551  66.163  1.00 16.92  ? 207 LYS D C     1 
ATOM   10626 O O     . LYS D 1 207 ? 3.737   29.669  66.112  1.00 20.43  ? 207 LYS D O     1 
ATOM   10627 C CB    . LYS D 1 207 ? 5.891   29.512  67.723  1.00 24.90  ? 207 LYS D CB    1 
ATOM   10628 C CG    . LYS D 1 207 ? 6.433   29.377  69.119  1.00 44.83  ? 207 LYS D CG    1 
ATOM   10629 C CD    . LYS D 1 207 ? 6.996   30.713  69.553  1.00 59.75  ? 207 LYS D CD    1 
ATOM   10630 C CE    . LYS D 1 207 ? 6.901   30.899  71.079  1.00 69.08  ? 207 LYS D CE    1 
ATOM   10631 N NZ    . LYS D 1 207 ? 7.450   32.200  71.447  1.00 74.22  ? 207 LYS D NZ    1 
ATOM   10632 H H     . LYS D 1 207 ? 6.728   27.362  66.257  1.00 0.00   ? 207 LYS D H     1 
ATOM   10633 H HZ1   . LYS D 1 207 ? 6.955   32.951  70.923  1.00 0.00   ? 207 LYS D HZ1   1 
ATOM   10634 H HZ2   . LYS D 1 207 ? 7.343   32.358  72.469  1.00 0.00   ? 207 LYS D HZ2   1 
ATOM   10635 H HZ3   . LYS D 1 207 ? 8.459   32.225  71.193  1.00 0.00   ? 207 LYS D HZ3   1 
ATOM   10636 N N     . ILE D 1 208 ? 4.051   27.670  65.183  1.00 10.66  ? 208 ILE D N     1 
ATOM   10637 C CA    . ILE D 1 208 ? 3.154   27.950  64.079  1.00 5.69   ? 208 ILE D CA    1 
ATOM   10638 C C     . ILE D 1 208 ? 2.228   26.740  63.971  1.00 10.41  ? 208 ILE D C     1 
ATOM   10639 O O     . ILE D 1 208 ? 2.623   25.606  64.288  1.00 7.38   ? 208 ILE D O     1 
ATOM   10640 C CB    . ILE D 1 208 ? 3.948   28.146  62.761  1.00 6.04   ? 208 ILE D CB    1 
ATOM   10641 C CG1   . ILE D 1 208 ? 5.029   29.231  62.854  1.00 4.54   ? 208 ILE D CG1   1 
ATOM   10642 C CG2   . ILE D 1 208 ? 2.978   28.583  61.689  1.00 3.60   ? 208 ILE D CG2   1 
ATOM   10643 C CD1   . ILE D 1 208 ? 4.636   30.714  62.902  1.00 4.42   ? 208 ILE D CD1   1 
ATOM   10644 H H     . ILE D 1 208 ? 4.462   26.784  65.211  1.00 0.00   ? 208 ILE D H     1 
ATOM   10645 N N     . TYR D 1 209 ? 0.953   26.993  63.671  1.00 9.01   ? 209 TYR D N     1 
ATOM   10646 C CA    . TYR D 1 209 ? 0.022   25.931  63.379  1.00 7.82   ? 209 TYR D CA    1 
ATOM   10647 C C     . TYR D 1 209 ? -0.462  26.264  61.957  1.00 7.81   ? 209 TYR D C     1 
ATOM   10648 O O     . TYR D 1 209 ? -0.625  27.437  61.597  1.00 5.81   ? 209 TYR D O     1 
ATOM   10649 C CB    . TYR D 1 209 ? -1.099  25.921  64.454  1.00 7.06   ? 209 TYR D CB    1 
ATOM   10650 C CG    . TYR D 1 209 ? -2.143  27.034  64.468  1.00 3.44   ? 209 TYR D CG    1 
ATOM   10651 C CD1   . TYR D 1 209 ? -3.283  26.911  63.716  1.00 3.17   ? 209 TYR D CD1   1 
ATOM   10652 C CD2   . TYR D 1 209 ? -1.928  28.195  65.171  1.00 4.85   ? 209 TYR D CD2   1 
ATOM   10653 C CE1   . TYR D 1 209 ? -4.159  27.978  63.619  1.00 8.13   ? 209 TYR D CE1   1 
ATOM   10654 C CE2   . TYR D 1 209 ? -2.801  29.264  65.086  1.00 6.56   ? 209 TYR D CE2   1 
ATOM   10655 C CZ    . TYR D 1 209 ? -3.913  29.149  64.294  1.00 6.22   ? 209 TYR D CZ    1 
ATOM   10656 O OH    . TYR D 1 209 ? -4.791  30.215  64.175  1.00 12.73  ? 209 TYR D OH    1 
ATOM   10657 H H     . TYR D 1 209 ? 0.658   27.927  63.572  1.00 0.00   ? 209 TYR D H     1 
ATOM   10658 H HH    . TYR D 1 209 ? -5.579  29.906  63.733  1.00 0.00   ? 209 TYR D HH    1 
ATOM   10659 N N     . SER D 1 210 ? -0.642  25.283  61.083  1.00 7.33   ? 210 SER D N     1 
ATOM   10660 C CA    . SER D 1 210 ? -1.010  25.551  59.708  1.00 5.65   ? 210 SER D CA    1 
ATOM   10661 C C     . SER D 1 210 ? -2.194  24.690  59.305  1.00 5.59   ? 210 SER D C     1 
ATOM   10662 O O     . SER D 1 210 ? -2.125  23.453  59.391  1.00 13.06  ? 210 SER D O     1 
ATOM   10663 C CB    . SER D 1 210 ? 0.225   25.259  58.871  1.00 2.36   ? 210 SER D CB    1 
ATOM   10664 O OG    . SER D 1 210 ? 0.167   25.731  57.543  1.00 6.23   ? 210 SER D OG    1 
ATOM   10665 H H     . SER D 1 210 ? -0.465  24.354  61.333  1.00 0.00   ? 210 SER D H     1 
ATOM   10666 H HG    . SER D 1 210 ? 0.232   26.688  57.642  1.00 0.00   ? 210 SER D HG    1 
ATOM   10667 N N     . LEU D 1 211 ? -3.317  25.279  58.908  1.00 5.08   ? 211 LEU D N     1 
ATOM   10668 C CA    . LEU D 1 211 ? -4.465  24.540  58.363  1.00 7.95   ? 211 LEU D CA    1 
ATOM   10669 C C     . LEU D 1 211 ? -5.409  25.539  57.729  1.00 5.58   ? 211 LEU D C     1 
ATOM   10670 O O     . LEU D 1 211 ? -5.253  26.730  57.987  1.00 10.17  ? 211 LEU D O     1 
ATOM   10671 C CB    . LEU D 1 211 ? -5.286  23.778  59.407  1.00 2.00   ? 211 LEU D CB    1 
ATOM   10672 C CG    . LEU D 1 211 ? -6.259  24.503  60.308  1.00 2.39   ? 211 LEU D CG    1 
ATOM   10673 C CD1   . LEU D 1 211 ? -7.036  23.489  61.073  1.00 5.15   ? 211 LEU D CD1   1 
ATOM   10674 C CD2   . LEU D 1 211 ? -5.531  25.408  61.258  1.00 10.72  ? 211 LEU D CD2   1 
ATOM   10675 H H     . LEU D 1 211 ? -3.390  26.255  58.970  1.00 0.00   ? 211 LEU D H     1 
ATOM   10676 N N     . ASN D 1 212 ? -6.352  25.143  56.888  1.00 3.62   ? 212 ASN D N     1 
ATOM   10677 C CA    . ASN D 1 212 ? -7.265  26.099  56.295  1.00 5.31   ? 212 ASN D CA    1 
ATOM   10678 C C     . ASN D 1 212 ? -8.438  26.245  57.226  1.00 10.15  ? 212 ASN D C     1 
ATOM   10679 O O     . ASN D 1 212 ? -9.205  25.294  57.431  1.00 12.01  ? 212 ASN D O     1 
ATOM   10680 C CB    . ASN D 1 212 ? -7.772  25.609  54.965  1.00 2.60   ? 212 ASN D CB    1 
ATOM   10681 C CG    . ASN D 1 212 ? -8.710  26.546  54.263  1.00 2.00   ? 212 ASN D CG    1 
ATOM   10682 O OD1   . ASN D 1 212 ? -9.119  27.590  54.771  1.00 5.58   ? 212 ASN D OD1   1 
ATOM   10683 N ND2   . ASN D 1 212 ? -9.066  26.176  53.049  1.00 5.17   ? 212 ASN D ND2   1 
ATOM   10684 H H     . ASN D 1 212 ? -6.470  24.181  56.706  1.00 0.00   ? 212 ASN D H     1 
ATOM   10685 H HD21  . ASN D 1 212 ? -9.660  26.726  52.491  1.00 0.00   ? 212 ASN D HD21  1 
ATOM   10686 H HD22  . ASN D 1 212 ? -8.675  25.347  52.690  1.00 0.00   ? 212 ASN D HD22  1 
ATOM   10687 N N     . GLU D 1 213 ? -8.606  27.438  57.772  1.00 12.04  ? 213 GLU D N     1 
ATOM   10688 C CA    . GLU D 1 213 ? -9.719  27.665  58.676  1.00 16.68  ? 213 GLU D CA    1 
ATOM   10689 C C     . GLU D 1 213 ? -11.059 28.065  58.033  1.00 19.52  ? 213 GLU D C     1 
ATOM   10690 O O     . GLU D 1 213 ? -11.939 28.553  58.742  1.00 25.77  ? 213 GLU D O     1 
ATOM   10691 C CB    . GLU D 1 213 ? -9.282  28.711  59.731  1.00 14.49  ? 213 GLU D CB    1 
ATOM   10692 C CG    . GLU D 1 213 ? -8.143  28.218  60.603  1.00 14.13  ? 213 GLU D CG    1 
ATOM   10693 C CD    . GLU D 1 213 ? -7.982  28.967  61.919  1.00 17.93  ? 213 GLU D CD    1 
ATOM   10694 O OE1   . GLU D 1 213 ? -8.954  29.012  62.670  1.00 12.48  ? 213 GLU D OE1   1 
ATOM   10695 O OE2   . GLU D 1 213 ? -6.891  29.480  62.197  1.00 10.87  ? 213 GLU D OE2   1 
ATOM   10696 H H     . GLU D 1 213 ? -7.959  28.158  57.583  1.00 0.00   ? 213 GLU D H     1 
ATOM   10697 N N     . ALA D 1 214 ? -11.306 27.900  56.726  1.00 21.87  ? 214 ALA D N     1 
ATOM   10698 C CA    . ALA D 1 214 ? -12.648 28.050  56.131  1.00 24.44  ? 214 ALA D CA    1 
ATOM   10699 C C     . ALA D 1 214 ? -13.547 26.981  56.695  1.00 26.25  ? 214 ALA D C     1 
ATOM   10700 O O     . ALA D 1 214 ? -14.687 27.192  57.123  1.00 31.01  ? 214 ALA D O     1 
ATOM   10701 C CB    . ALA D 1 214 ? -12.790 27.742  54.663  1.00 28.17  ? 214 ALA D CB    1 
ATOM   10702 H H     . ALA D 1 214 ? -10.539 27.756  56.133  1.00 0.00   ? 214 ALA D H     1 
ATOM   10703 N N     . TYR D 1 215 ? -12.949 25.793  56.763  1.00 26.80  ? 215 TYR D N     1 
ATOM   10704 C CA    . TYR D 1 215 ? -13.643 24.604  57.217  1.00 28.34  ? 215 TYR D CA    1 
ATOM   10705 C C     . TYR D 1 215 ? -14.109 24.694  58.658  1.00 24.43  ? 215 TYR D C     1 
ATOM   10706 O O     . TYR D 1 215 ? -14.670 23.718  59.134  1.00 26.49  ? 215 TYR D O     1 
ATOM   10707 C CB    . TYR D 1 215 ? -12.769 23.354  57.123  1.00 30.72  ? 215 TYR D CB    1 
ATOM   10708 C CG    . TYR D 1 215 ? -12.092 23.096  55.800  1.00 34.41  ? 215 TYR D CG    1 
ATOM   10709 C CD1   . TYR D 1 215 ? -12.813 23.197  54.625  1.00 37.58  ? 215 TYR D CD1   1 
ATOM   10710 C CD2   . TYR D 1 215 ? -10.752 22.746  55.801  1.00 37.33  ? 215 TYR D CD2   1 
ATOM   10711 C CE1   . TYR D 1 215 ? -12.192 22.934  53.423  1.00 40.46  ? 215 TYR D CE1   1 
ATOM   10712 C CE2   . TYR D 1 215 ? -10.127 22.485  54.602  1.00 40.80  ? 215 TYR D CE2   1 
ATOM   10713 C CZ    . TYR D 1 215 ? -10.862 22.574  53.427  1.00 42.48  ? 215 TYR D CZ    1 
ATOM   10714 O OH    . TYR D 1 215 ? -10.269 22.266  52.217  1.00 45.37  ? 215 TYR D OH    1 
ATOM   10715 H H     . TYR D 1 215 ? -11.998 25.724  56.538  1.00 0.00   ? 215 TYR D H     1 
ATOM   10716 H HH    . TYR D 1 215 ? -9.332  22.508  52.268  1.00 0.00   ? 215 TYR D HH    1 
ATOM   10717 N N     . ALA D 1 216 ? -13.920 2