data_1FX8
# 
_entry.id   1FX8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1FX8         
RCSB  RCSB011980   
WWPDB D_1000011980 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1FX8 
_pdbx_database_status.recvd_initial_deposition_date   2000-09-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fu, D.'          1 
'Libson, A.'      2 
'Miercke, L.J.W.' 3 
'Weitzman, C.'    4 
'Nollert, P.'     5 
'Stroud, R.M.'    6 
# 
_citation.id                        primary 
_citation.title                     'Structure of a glycerol-conducting channel and the basis for its selectivity.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            290 
_citation.page_first                481 
_citation.page_last                 486 
_citation.year                      2000 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11039922 
_citation.pdbx_database_id_DOI      10.1126/science.290.5491.481 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fu, D.'        1 
primary 'Libson, A.'    2 
primary 'Miercke, L.J.' 3 
primary 'Weitzman, C.'  4 
primary 'Nollert, P.'   5 
primary 'Krucinski, J.' 6 
primary 'Stroud, R.M.'  7 
# 
_cell.entry_id           1FX8 
_cell.length_a           96.760 
_cell.length_b           96.760 
_cell.length_c           184.322 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1FX8 
_symmetry.space_group_name_H-M             'I 4 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                97 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GLYCEROL UPTAKE FACILITATOR PROTEIN' 29799.842 1   ? ? ? ? 
2 non-polymer man B-OCTYLGLUCOSIDE                      292.369   3   ? ? ? ? 
3 non-polymer syn GLYCEROL                              92.094    3   ? ? ? ? 
4 water       nat water                                 18.015    111 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        GLPF 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTAGVSGAHLNPAVTIALWLFAC
FDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHHIVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILM
GLILALTDDGNGVPRGPLAPLLIGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGP
IVGAIVGAFAYRKLIGRHLPCDICVVEEKETTTPSEQKASL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTAGVSGAHLNPAVTIALWLFAC
FDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHHIVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILM
GLILALTDDGNGVPRGPLAPLLIGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGP
IVGAIVGAFAYRKLIGRHLPCDICVVEEKETTTPSEQKASL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLN n 
1 4   THR n 
1 5   SER n 
1 6   THR n 
1 7   LEU n 
1 8   LYS n 
1 9   GLY n 
1 10  GLN n 
1 11  CYS n 
1 12  ILE n 
1 13  ALA n 
1 14  GLU n 
1 15  PHE n 
1 16  LEU n 
1 17  GLY n 
1 18  THR n 
1 19  GLY n 
1 20  LEU n 
1 21  LEU n 
1 22  ILE n 
1 23  PHE n 
1 24  PHE n 
1 25  GLY n 
1 26  VAL n 
1 27  GLY n 
1 28  CYS n 
1 29  VAL n 
1 30  ALA n 
1 31  ALA n 
1 32  LEU n 
1 33  LYS n 
1 34  VAL n 
1 35  ALA n 
1 36  GLY n 
1 37  ALA n 
1 38  SER n 
1 39  PHE n 
1 40  GLY n 
1 41  GLN n 
1 42  TRP n 
1 43  GLU n 
1 44  ILE n 
1 45  SER n 
1 46  VAL n 
1 47  ILE n 
1 48  TRP n 
1 49  GLY n 
1 50  LEU n 
1 51  GLY n 
1 52  VAL n 
1 53  ALA n 
1 54  MET n 
1 55  ALA n 
1 56  ILE n 
1 57  TYR n 
1 58  LEU n 
1 59  THR n 
1 60  ALA n 
1 61  GLY n 
1 62  VAL n 
1 63  SER n 
1 64  GLY n 
1 65  ALA n 
1 66  HIS n 
1 67  LEU n 
1 68  ASN n 
1 69  PRO n 
1 70  ALA n 
1 71  VAL n 
1 72  THR n 
1 73  ILE n 
1 74  ALA n 
1 75  LEU n 
1 76  TRP n 
1 77  LEU n 
1 78  PHE n 
1 79  ALA n 
1 80  CYS n 
1 81  PHE n 
1 82  ASP n 
1 83  LYS n 
1 84  ARG n 
1 85  LYS n 
1 86  VAL n 
1 87  ILE n 
1 88  PRO n 
1 89  PHE n 
1 90  ILE n 
1 91  VAL n 
1 92  SER n 
1 93  GLN n 
1 94  VAL n 
1 95  ALA n 
1 96  GLY n 
1 97  ALA n 
1 98  PHE n 
1 99  CYS n 
1 100 ALA n 
1 101 ALA n 
1 102 ALA n 
1 103 LEU n 
1 104 VAL n 
1 105 TYR n 
1 106 GLY n 
1 107 LEU n 
1 108 TYR n 
1 109 TYR n 
1 110 ASN n 
1 111 LEU n 
1 112 PHE n 
1 113 PHE n 
1 114 ASP n 
1 115 PHE n 
1 116 GLU n 
1 117 GLN n 
1 118 THR n 
1 119 HIS n 
1 120 HIS n 
1 121 ILE n 
1 122 VAL n 
1 123 ARG n 
1 124 GLY n 
1 125 SER n 
1 126 VAL n 
1 127 GLU n 
1 128 SER n 
1 129 VAL n 
1 130 ASP n 
1 131 LEU n 
1 132 ALA n 
1 133 GLY n 
1 134 THR n 
1 135 PHE n 
1 136 SER n 
1 137 THR n 
1 138 TYR n 
1 139 PRO n 
1 140 ASN n 
1 141 PRO n 
1 142 HIS n 
1 143 ILE n 
1 144 ASN n 
1 145 PHE n 
1 146 VAL n 
1 147 GLN n 
1 148 ALA n 
1 149 PHE n 
1 150 ALA n 
1 151 VAL n 
1 152 GLU n 
1 153 MET n 
1 154 VAL n 
1 155 ILE n 
1 156 THR n 
1 157 ALA n 
1 158 ILE n 
1 159 LEU n 
1 160 MET n 
1 161 GLY n 
1 162 LEU n 
1 163 ILE n 
1 164 LEU n 
1 165 ALA n 
1 166 LEU n 
1 167 THR n 
1 168 ASP n 
1 169 ASP n 
1 170 GLY n 
1 171 ASN n 
1 172 GLY n 
1 173 VAL n 
1 174 PRO n 
1 175 ARG n 
1 176 GLY n 
1 177 PRO n 
1 178 LEU n 
1 179 ALA n 
1 180 PRO n 
1 181 LEU n 
1 182 LEU n 
1 183 ILE n 
1 184 GLY n 
1 185 LEU n 
1 186 LEU n 
1 187 ILE n 
1 188 ALA n 
1 189 VAL n 
1 190 ILE n 
1 191 GLY n 
1 192 ALA n 
1 193 SER n 
1 194 MET n 
1 195 GLY n 
1 196 PRO n 
1 197 LEU n 
1 198 THR n 
1 199 GLY n 
1 200 PHE n 
1 201 ALA n 
1 202 MET n 
1 203 ASN n 
1 204 PRO n 
1 205 ALA n 
1 206 ARG n 
1 207 ASP n 
1 208 PHE n 
1 209 GLY n 
1 210 PRO n 
1 211 LYS n 
1 212 VAL n 
1 213 PHE n 
1 214 ALA n 
1 215 TRP n 
1 216 LEU n 
1 217 ALA n 
1 218 GLY n 
1 219 TRP n 
1 220 GLY n 
1 221 ASN n 
1 222 VAL n 
1 223 ALA n 
1 224 PHE n 
1 225 THR n 
1 226 GLY n 
1 227 GLY n 
1 228 ARG n 
1 229 ASP n 
1 230 ILE n 
1 231 PRO n 
1 232 TYR n 
1 233 PHE n 
1 234 LEU n 
1 235 VAL n 
1 236 PRO n 
1 237 LEU n 
1 238 PHE n 
1 239 GLY n 
1 240 PRO n 
1 241 ILE n 
1 242 VAL n 
1 243 GLY n 
1 244 ALA n 
1 245 ILE n 
1 246 VAL n 
1 247 GLY n 
1 248 ALA n 
1 249 PHE n 
1 250 ALA n 
1 251 TYR n 
1 252 ARG n 
1 253 LYS n 
1 254 LEU n 
1 255 ILE n 
1 256 GLY n 
1 257 ARG n 
1 258 HIS n 
1 259 LEU n 
1 260 PRO n 
1 261 CYS n 
1 262 ASP n 
1 263 ILE n 
1 264 CYS n 
1 265 VAL n 
1 266 VAL n 
1 267 GLU n 
1 268 GLU n 
1 269 LYS n 
1 270 GLU n 
1 271 THR n 
1 272 THR n 
1 273 THR n 
1 274 PRO n 
1 275 SER n 
1 276 GLU n 
1 277 GLN n 
1 278 LYS n 
1 279 ALA n 
1 280 SER n 
1 281 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    GLPF_ECOLI 
_struct_ref.db_name                    UNP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P11244 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MSQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTAGVSGAHLNPAVTIALWLFAC
FDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHHIVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILM
GLILALTDDGNGVPRGPLAPLLIGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGP
IVGAIVGAFAYRKLIGRHLPCDICVVEEKETTTPSEQKASL
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1FX8 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 281 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P11244 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  281 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       281 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                               'C4 H7 N O4'     133.103 
BOG saccharide          . B-OCTYLGLUCOSIDE ?                               'C14 H28 O6'     292.369 
CYS 'L-peptide linking' y CYSTEINE         ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL         'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE        ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE    ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1FX8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   66.00 
_exptl_crystal.density_Matthews      3.62 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              8.9 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;GLPF at 15-20 mg/ml, 28%(w/v) PEG2K, 
100mM Bicine, 15% (v/v) glycerol, 35mM n-octyl-beta-D-glucoside, 
300mM MgCl2, 5mM DTT, pH 8.9, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM' 
_diffrn_detector.pdbx_collection_date   1999-09-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_wavelength             1.1 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1FX8 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   19141 
_reflns.number_all                   19141 
_reflns.percent_possible_obs         90.9 
_reflns.pdbx_Rmerge_I_obs            0.0740000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.26 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   57.7 
_reflns_shell.Rmerge_I_obs           0.3930000 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1FX8 
_refine.ls_number_reflns_obs                     18716 
_refine.ls_number_reflns_all                     18716 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    82.8 
_refine.ls_R_factor_obs                          0.1970000 
_refine.ls_R_factor_all                          0.1970000 
_refine.ls_R_factor_R_work                       0.1970000 
_refine.ls_R_factor_R_free                       0.2230000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1966 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1895 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         78 
_refine_hist.number_atoms_solvent             111 
_refine_hist.number_atoms_total               2084 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.2   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1FX8 
_struct.title                     'CRYSTAL STRUCTURE OF THE E. COLI GLYCEROL FACILITATOR (GLPF) WITH SUBSTRATE GLYCEROL' 
_struct.pdbx_descriptor           'GLYCEROL FACILITATOR (GLPF)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1FX8 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            'glycerol-conducting membrane channel protein, MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological assembly is a tetramer generated by a crystallographic four-fold axis' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 6   ? ALA A 35  ? THR A 6   ALA A 35  1 ? 30 
HELX_P HELX_P2  2  GLY A 40  ? GLY A 64  ? GLY A 40  GLY A 64  1 ? 25 
HELX_P HELX_P3  3  ASN A 68  ? ALA A 79  ? ASN A 68  ALA A 79  1 ? 12 
HELX_P HELX_P4  4  ASP A 82  ? ARG A 84  ? ASP A 82  ARG A 84  5 ? 3  
HELX_P HELX_P5  5  LYS A 85  ? TYR A 109 ? LYS A 85  TYR A 109 1 ? 25 
HELX_P HELX_P6  6  TYR A 108 ? HIS A 119 ? TYR A 108 HIS A 119 1 ? 12 
HELX_P HELX_P7  7  SER A 125 ? GLU A 127 ? SER A 125 GLU A 127 5 ? 3  
HELX_P HELX_P8  8  SER A 128 ? GLY A 133 ? SER A 128 GLY A 133 1 ? 6  
HELX_P HELX_P9  9  ASN A 144 ? ASP A 168 ? ASN A 144 ASP A 168 1 ? 25 
HELX_P HELX_P10 10 ARG A 175 ? PRO A 177 ? ARG A 175 PRO A 177 5 ? 3  
HELX_P HELX_P11 11 LEU A 178 ? GLY A 199 ? LEU A 178 GLY A 199 1 ? 22 
HELX_P HELX_P12 12 ASN A 203 ? ALA A 217 ? ASN A 203 ALA A 217 1 ? 15 
HELX_P HELX_P13 13 ASN A 221 ? GLY A 226 ? ASN A 221 GLY A 226 1 ? 6  
HELX_P HELX_P14 14 PHE A 233 ? GLY A 239 ? PHE A 233 GLY A 239 1 ? 7  
HELX_P HELX_P15 15 PRO A 240 ? ILE A 255 ? PRO A 240 ILE A 255 1 ? 16 
HELX_P HELX_P16 16 GLY A 256 ? LEU A 259 ? GLY A 256 LEU A 259 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE BOG A 473' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE BOG A 474' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE BOG A 475' 
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL A 662' 
AC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 661' 
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL A 663' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 TYR A 105 ? TYR A 105 . ? 1_555  ? 
2  AC1 12 TYR A 109 ? TYR A 109 . ? 1_555  ? 
3  AC1 12 PHE A 113 ? PHE A 113 . ? 1_555  ? 
4  AC1 12 ARG A 123 ? ARG A 123 . ? 1_555  ? 
5  AC1 12 LEU A 216 ? LEU A 216 . ? 1_555  ? 
6  AC1 12 ALA A 217 ? ALA A 217 . ? 1_555  ? 
7  AC1 12 GLY A 218 ? GLY A 218 . ? 1_555  ? 
8  AC1 12 HOH H .   ? HOH A 337 . ? 1_555  ? 
9  AC1 12 HOH H .   ? HOH A 340 . ? 1_555  ? 
10 AC1 12 HOH H .   ? HOH A 357 . ? 1_555  ? 
11 AC1 12 HOH H .   ? HOH A 403 . ? 1_555  ? 
12 AC1 12 BOG D .   ? BOG A 475 . ? 1_555  ? 
13 AC2 6  VAL A 126 ? VAL A 126 . ? 15_456 ? 
14 AC2 6  GLU A 127 ? GLU A 127 . ? 15_456 ? 
15 AC2 6  PHE A 208 ? PHE A 208 . ? 1_555  ? 
16 AC2 6  ASN A 221 ? ASN A 221 . ? 1_555  ? 
17 AC2 6  LEU A 237 ? LEU A 237 . ? 1_555  ? 
18 AC2 6  HOH H .   ? HOH A 320 . ? 1_555  ? 
19 AC3 5  TYR A 105 ? TYR A 105 . ? 1_555  ? 
20 AC3 5  GLY A 106 ? GLY A 106 . ? 1_555  ? 
21 AC3 5  PHE A 213 ? PHE A 213 . ? 1_555  ? 
22 AC3 5  HOH H .   ? HOH A 403 . ? 1_555  ? 
23 AC3 5  BOG B .   ? BOG A 473 . ? 1_555  ? 
24 AC4 7  TRP A 48  ? TRP A 48  . ? 1_555  ? 
25 AC4 7  GLY A 199 ? GLY A 199 . ? 1_555  ? 
26 AC4 7  PHE A 200 ? PHE A 200 . ? 1_555  ? 
27 AC4 7  ALA A 201 ? ALA A 201 . ? 1_555  ? 
28 AC4 7  ARG A 206 ? ARG A 206 . ? 1_555  ? 
29 AC4 7  HOH H .   ? HOH A 330 . ? 1_555  ? 
30 AC4 7  HOH H .   ? HOH A 349 . ? 1_555  ? 
31 AC5 10 TYR A 138 ? TYR A 138 . ? 1_555  ? 
32 AC5 10 PRO A 139 ? PRO A 139 . ? 1_555  ? 
33 AC5 10 ASN A 140 ? ASN A 140 . ? 1_555  ? 
34 AC5 10 PRO A 141 ? PRO A 141 . ? 1_555  ? 
35 AC5 10 PRO A 196 ? PRO A 196 . ? 1_555  ? 
36 AC5 10 GLY A 199 ? GLY A 199 . ? 1_555  ? 
37 AC5 10 HOH H .   ? HOH A 354 . ? 1_555  ? 
38 AC5 10 HOH H .   ? HOH A 360 . ? 1_555  ? 
39 AC5 10 HOH H .   ? HOH A 372 . ? 1_555  ? 
40 AC5 10 HOH H .   ? HOH A 383 . ? 1_555  ? 
41 AC6 6  HIS A 66  ? HIS A 66  . ? 1_555  ? 
42 AC6 6  LEU A 67  ? LEU A 67  . ? 1_555  ? 
43 AC6 6  ASN A 68  ? ASN A 68  . ? 1_555  ? 
44 AC6 6  ILE A 187 ? ILE A 187 . ? 1_555  ? 
45 AC6 6  ASN A 203 ? ASN A 203 . ? 1_555  ? 
46 AC6 6  HOH H .   ? HOH A 349 . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          1FX8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1FX8 
_atom_sites.fract_transf_matrix[1][1]   0.010335 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010335 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005425 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . THR A 1 6   ? 31.155 71.280 179.465 1.00 48.52  ? 6   THR A N     1 
ATOM   2    C CA    . THR A 1 6   ? 30.059 72.204 179.046 1.00 49.75  ? 6   THR A CA    1 
ATOM   3    C C     . THR A 1 6   ? 29.536 71.824 177.666 1.00 48.71  ? 6   THR A C     1 
ATOM   4    O O     . THR A 1 6   ? 30.303 71.402 176.798 1.00 49.39  ? 6   THR A O     1 
ATOM   5    C CB    . THR A 1 6   ? 30.538 73.671 178.998 1.00 49.98  ? 6   THR A CB    1 
ATOM   6    O OG1   . THR A 1 6   ? 29.438 74.517 178.644 1.00 51.71  ? 6   THR A OG1   1 
ATOM   7    C CG2   . THR A 1 6   ? 31.640 73.845 177.966 1.00 51.05  ? 6   THR A CG2   1 
ATOM   8    N N     . LEU A 1 7   ? 28.232 71.980 177.465 1.00 46.45  ? 7   LEU A N     1 
ATOM   9    C CA    . LEU A 1 7   ? 27.622 71.630 176.190 1.00 44.95  ? 7   LEU A CA    1 
ATOM   10   C C     . LEU A 1 7   ? 28.251 72.399 175.037 1.00 44.36  ? 7   LEU A C     1 
ATOM   11   O O     . LEU A 1 7   ? 28.457 71.849 173.958 1.00 44.89  ? 7   LEU A O     1 
ATOM   12   C CB    . LEU A 1 7   ? 26.114 71.890 176.223 1.00 42.14  ? 7   LEU A CB    1 
ATOM   13   C CG    . LEU A 1 7   ? 25.347 71.458 174.967 1.00 41.88  ? 7   LEU A CG    1 
ATOM   14   C CD1   . LEU A 1 7   ? 25.576 69.973 174.706 1.00 40.37  ? 7   LEU A CD1   1 
ATOM   15   C CD2   . LEU A 1 7   ? 23.862 71.747 175.141 1.00 41.27  ? 7   LEU A CD2   1 
ATOM   16   N N     . LYS A 1 8   ? 28.553 73.671 175.263 1.00 43.77  ? 8   LYS A N     1 
ATOM   17   C CA    . LYS A 1 8   ? 29.164 74.485 174.224 1.00 44.17  ? 8   LYS A CA    1 
ATOM   18   C C     . LYS A 1 8   ? 30.514 73.883 173.822 1.00 42.78  ? 8   LYS A C     1 
ATOM   19   O O     . LYS A 1 8   ? 30.880 73.875 172.645 1.00 41.06  ? 8   LYS A O     1 
ATOM   20   C CB    . LYS A 1 8   ? 29.358 75.922 174.719 1.00 45.34  ? 8   LYS A CB    1 
ATOM   21   C CG    . LYS A 1 8   ? 29.949 76.851 173.668 1.00 50.06  ? 8   LYS A CG    1 
ATOM   22   C CD    . LYS A 1 8   ? 30.131 78.269 174.192 1.00 53.53  ? 8   LYS A CD    1 
ATOM   23   C CE    . LYS A 1 8   ? 30.787 79.162 173.144 1.00 55.53  ? 8   LYS A CE    1 
ATOM   24   N NZ    . LYS A 1 8   ? 30.950 80.573 173.605 1.00 58.02  ? 8   LYS A NZ    1 
ATOM   25   N N     . GLY A 1 9   ? 31.244 73.377 174.812 1.00 41.36  ? 9   GLY A N     1 
ATOM   26   C CA    . GLY A 1 9   ? 32.540 72.781 174.549 1.00 40.80  ? 9   GLY A CA    1 
ATOM   27   C C     . GLY A 1 9   ? 32.426 71.459 173.815 1.00 40.60  ? 9   GLY A C     1 
ATOM   28   O O     . GLY A 1 9   ? 33.295 71.108 173.018 1.00 41.15  ? 9   GLY A O     1 
ATOM   29   N N     . GLN A 1 10  ? 31.349 70.726 174.081 1.00 39.03  ? 10  GLN A N     1 
ATOM   30   C CA    . GLN A 1 10  ? 31.119 69.440 173.442 1.00 37.76  ? 10  GLN A CA    1 
ATOM   31   C C     . GLN A 1 10  ? 30.667 69.612 171.998 1.00 37.62  ? 10  GLN A C     1 
ATOM   32   O O     . GLN A 1 10  ? 30.989 68.792 171.137 1.00 36.43  ? 10  GLN A O     1 
ATOM   33   C CB    . GLN A 1 10  ? 30.068 68.647 174.210 1.00 36.54  ? 10  GLN A CB    1 
ATOM   34   C CG    . GLN A 1 10  ? 30.462 68.332 175.631 1.00 35.45  ? 10  GLN A CG    1 
ATOM   35   C CD    . GLN A 1 10  ? 29.482 67.400 176.285 1.00 36.32  ? 10  GLN A CD    1 
ATOM   36   O OE1   . GLN A 1 10  ? 28.281 67.653 176.277 1.00 36.92  ? 10  GLN A OE1   1 
ATOM   37   N NE2   . GLN A 1 10  ? 29.985 66.308 176.852 1.00 36.93  ? 10  GLN A NE2   1 
ATOM   38   N N     . CYS A 1 11  ? 29.912 70.674 171.741 1.00 36.32  ? 11  CYS A N     1 
ATOM   39   C CA    . CYS A 1 11  ? 29.444 70.945 170.392 1.00 36.71  ? 11  CYS A CA    1 
ATOM   40   C C     . CYS A 1 11  ? 30.618 71.388 169.528 1.00 36.06  ? 11  CYS A C     1 
ATOM   41   O O     . CYS A 1 11  ? 30.648 71.129 168.327 1.00 36.66  ? 11  CYS A O     1 
ATOM   42   C CB    . CYS A 1 11  ? 28.365 72.027 170.406 1.00 37.02  ? 11  CYS A CB    1 
ATOM   43   S SG    . CYS A 1 11  ? 26.787 71.454 171.046 1.00 41.15  ? 11  CYS A SG    1 
ATOM   44   N N     . ILE A 1 12  ? 31.583 72.063 170.140 1.00 34.58  ? 12  ILE A N     1 
ATOM   45   C CA    . ILE A 1 12  ? 32.755 72.513 169.402 1.00 34.57  ? 12  ILE A CA    1 
ATOM   46   C C     . ILE A 1 12  ? 33.592 71.296 169.011 1.00 33.54  ? 12  ILE A C     1 
ATOM   47   O O     . ILE A 1 12  ? 34.088 71.206 167.887 1.00 32.32  ? 12  ILE A O     1 
ATOM   48   C CB    . ILE A 1 12  ? 33.615 73.486 170.246 1.00 34.21  ? 12  ILE A CB    1 
ATOM   49   C CG1   . ILE A 1 12  ? 32.895 74.832 170.371 1.00 34.89  ? 12  ILE A CG1   1 
ATOM   50   C CG2   . ILE A 1 12  ? 34.988 73.675 169.606 1.00 33.93  ? 12  ILE A CG2   1 
ATOM   51   C CD1   . ILE A 1 12  ? 33.627 75.852 171.223 1.00 33.23  ? 12  ILE A CD1   1 
ATOM   52   N N     . ALA A 1 13  ? 33.733 70.357 169.943 1.00 31.66  ? 13  ALA A N     1 
ATOM   53   C CA    . ALA A 1 13  ? 34.506 69.146 169.699 1.00 31.31  ? 13  ALA A CA    1 
ATOM   54   C C     . ALA A 1 13  ? 33.843 68.291 168.617 1.00 30.25  ? 13  ALA A C     1 
ATOM   55   O O     . ALA A 1 13  ? 34.523 67.732 167.762 1.00 30.16  ? 13  ALA A O     1 
ATOM   56   C CB    . ALA A 1 13  ? 34.651 68.350 170.990 1.00 31.47  ? 13  ALA A CB    1 
ATOM   57   N N     . GLU A 1 14  ? 32.518 68.191 168.658 1.00 29.59  ? 14  GLU A N     1 
ATOM   58   C CA    . GLU A 1 14  ? 31.789 67.416 167.662 1.00 29.71  ? 14  GLU A CA    1 
ATOM   59   C C     . GLU A 1 14  ? 31.946 68.061 166.288 1.00 28.54  ? 14  GLU A C     1 
ATOM   60   O O     . GLU A 1 14  ? 32.027 67.370 165.274 1.00 29.12  ? 14  GLU A O     1 
ATOM   61   C CB    . GLU A 1 14  ? 30.307 67.326 168.031 1.00 29.91  ? 14  GLU A CB    1 
ATOM   62   C CG    . GLU A 1 14  ? 30.007 66.389 169.196 1.00 31.82  ? 14  GLU A CG    1 
ATOM   63   C CD    . GLU A 1 14  ? 30.205 64.918 168.849 1.00 32.79  ? 14  GLU A CD    1 
ATOM   64   O OE1   . GLU A 1 14  ? 29.556 64.431 167.895 1.00 32.55  ? 14  GLU A OE1   1 
ATOM   65   O OE2   . GLU A 1 14  ? 31.002 64.244 169.538 1.00 34.16  ? 14  GLU A OE2   1 
ATOM   66   N N     . PHE A 1 15  ? 31.991 69.388 166.264 1.00 26.57  ? 15  PHE A N     1 
ATOM   67   C CA    . PHE A 1 15  ? 32.158 70.144 165.024 1.00 26.93  ? 15  PHE A CA    1 
ATOM   68   C C     . PHE A 1 15  ? 33.550 69.863 164.438 1.00 28.38  ? 15  PHE A C     1 
ATOM   69   O O     . PHE A 1 15  ? 33.689 69.556 163.257 1.00 29.83  ? 15  PHE A O     1 
ATOM   70   C CB    . PHE A 1 15  ? 32.006 71.642 165.316 1.00 25.59  ? 15  PHE A CB    1 
ATOM   71   C CG    . PHE A 1 15  ? 32.313 72.536 164.148 1.00 22.15  ? 15  PHE A CG    1 
ATOM   72   C CD1   . PHE A 1 15  ? 31.307 72.927 163.271 1.00 22.10  ? 15  PHE A CD1   1 
ATOM   73   C CD2   . PHE A 1 15  ? 33.604 72.998 163.935 1.00 21.59  ? 15  PHE A CD2   1 
ATOM   74   C CE1   . PHE A 1 15  ? 31.581 73.774 162.193 1.00 20.92  ? 15  PHE A CE1   1 
ATOM   75   C CE2   . PHE A 1 15  ? 33.893 73.847 162.859 1.00 25.11  ? 15  PHE A CE2   1 
ATOM   76   C CZ    . PHE A 1 15  ? 32.875 74.235 161.985 1.00 22.43  ? 15  PHE A CZ    1 
ATOM   77   N N     . LEU A 1 16  ? 34.573 69.963 165.282 1.00 27.81  ? 16  LEU A N     1 
ATOM   78   C CA    . LEU A 1 16  ? 35.952 69.736 164.867 1.00 28.60  ? 16  LEU A CA    1 
ATOM   79   C C     . LEU A 1 16  ? 36.234 68.285 164.490 1.00 28.15  ? 16  LEU A C     1 
ATOM   80   O O     . LEU A 1 16  ? 36.908 68.015 163.496 1.00 27.63  ? 16  LEU A O     1 
ATOM   81   C CB    . LEU A 1 16  ? 36.913 70.145 165.986 1.00 28.07  ? 16  LEU A CB    1 
ATOM   82   C CG    . LEU A 1 16  ? 37.000 71.622 166.354 1.00 31.15  ? 16  LEU A CG    1 
ATOM   83   C CD1   . LEU A 1 16  ? 37.889 71.781 167.575 1.00 31.59  ? 16  LEU A CD1   1 
ATOM   84   C CD2   . LEU A 1 16  ? 37.547 72.415 165.183 1.00 31.00  ? 16  LEU A CD2   1 
ATOM   85   N N     . GLY A 1 17  ? 35.730 67.361 165.302 1.00 27.66  ? 17  GLY A N     1 
ATOM   86   C CA    . GLY A 1 17  ? 35.948 65.953 165.050 1.00 26.36  ? 17  GLY A CA    1 
ATOM   87   C C     . GLY A 1 17  ? 35.313 65.494 163.755 1.00 26.58  ? 17  GLY A C     1 
ATOM   88   O O     . GLY A 1 17  ? 35.931 64.771 162.978 1.00 26.32  ? 17  GLY A O     1 
ATOM   89   N N     . THR A 1 18  ? 34.076 65.913 163.516 1.00 25.52  ? 18  THR A N     1 
ATOM   90   C CA    . THR A 1 18  ? 33.380 65.522 162.303 1.00 26.64  ? 18  THR A CA    1 
ATOM   91   C C     . THR A 1 18  ? 34.062 66.168 161.106 1.00 26.37  ? 18  THR A C     1 
ATOM   92   O O     . THR A 1 18  ? 34.162 65.562 160.040 1.00 26.34  ? 18  THR A O     1 
ATOM   93   C CB    . THR A 1 18  ? 31.898 65.955 162.337 1.00 28.56  ? 18  THR A CB    1 
ATOM   94   O OG1   . THR A 1 18  ? 31.297 65.499 163.557 1.00 29.72  ? 18  THR A OG1   1 
ATOM   95   C CG2   . THR A 1 18  ? 31.140 65.355 161.149 1.00 27.27  ? 18  THR A CG2   1 
ATOM   96   N N     . GLY A 1 19  ? 34.525 67.402 161.291 1.00 25.91  ? 19  GLY A N     1 
ATOM   97   C CA    . GLY A 1 19  ? 35.202 68.110 160.221 1.00 24.55  ? 19  GLY A CA    1 
ATOM   98   C C     . GLY A 1 19  ? 36.530 67.445 159.905 1.00 26.12  ? 19  GLY A C     1 
ATOM   99   O O     . GLY A 1 19  ? 36.929 67.345 158.744 1.00 24.36  ? 19  GLY A O     1 
ATOM   100  N N     . LEU A 1 20  ? 37.210 66.977 160.948 1.00 24.77  ? 20  LEU A N     1 
ATOM   101  C CA    . LEU A 1 20  ? 38.503 66.315 160.792 1.00 25.52  ? 20  LEU A CA    1 
ATOM   102  C C     . LEU A 1 20  ? 38.396 65.048 159.941 1.00 25.34  ? 20  LEU A C     1 
ATOM   103  O O     . LEU A 1 20  ? 39.187 64.858 159.014 1.00 24.98  ? 20  LEU A O     1 
ATOM   104  C CB    . LEU A 1 20  ? 39.083 65.954 162.162 1.00 25.09  ? 20  LEU A CB    1 
ATOM   105  C CG    . LEU A 1 20  ? 40.599 66.026 162.389 1.00 27.86  ? 20  LEU A CG    1 
ATOM   106  C CD1   . LEU A 1 20  ? 41.077 64.694 162.920 1.00 28.23  ? 20  LEU A CD1   1 
ATOM   107  C CD2   . LEU A 1 20  ? 41.338 66.391 161.114 1.00 27.78  ? 20  LEU A CD2   1 
ATOM   108  N N     . LEU A 1 21  ? 37.431 64.178 160.235 1.00 24.09  ? 21  LEU A N     1 
ATOM   109  C CA    . LEU A 1 21  ? 37.335 62.967 159.436 1.00 25.58  ? 21  LEU A CA    1 
ATOM   110  C C     . LEU A 1 21  ? 36.876 63.234 158.001 1.00 24.59  ? 21  LEU A C     1 
ATOM   111  O O     . LEU A 1 21  ? 37.218 62.477 157.095 1.00 23.38  ? 21  LEU A O     1 
ATOM   112  C CB    . LEU A 1 21  ? 36.477 61.882 160.123 1.00 24.84  ? 21  LEU A CB    1 
ATOM   113  C CG    . LEU A 1 21  ? 34.966 61.731 160.367 1.00 29.56  ? 21  LEU A CG    1 
ATOM   114  C CD1   . LEU A 1 21  ? 34.532 62.540 161.558 1.00 31.08  ? 21  LEU A CD1   1 
ATOM   115  C CD2   . LEU A 1 21  ? 34.192 62.065 159.123 1.00 27.69  ? 21  LEU A CD2   1 
ATOM   116  N N     . ILE A 1 22  ? 36.132 64.315 157.781 1.00 23.50  ? 22  ILE A N     1 
ATOM   117  C CA    . ILE A 1 22  ? 35.703 64.643 156.424 1.00 23.33  ? 22  ILE A CA    1 
ATOM   118  C C     . ILE A 1 22  ? 36.913 65.192 155.668 1.00 22.85  ? 22  ILE A C     1 
ATOM   119  O O     . ILE A 1 22  ? 37.083 64.923 154.478 1.00 22.93  ? 22  ILE A O     1 
ATOM   120  C CB    . ILE A 1 22  ? 34.547 65.693 156.400 1.00 22.78  ? 22  ILE A CB    1 
ATOM   121  C CG1   . ILE A 1 22  ? 33.199 64.986 156.275 1.00 25.71  ? 22  ILE A CG1   1 
ATOM   122  C CG2   . ILE A 1 22  ? 34.679 66.618 155.198 1.00 23.77  ? 22  ILE A CG2   1 
ATOM   123  C CD1   . ILE A 1 22  ? 32.816 64.193 157.463 1.00 26.99  ? 22  ILE A CD1   1 
ATOM   124  N N     . PHE A 1 23  ? 37.752 65.949 156.373 1.00 22.67  ? 23  PHE A N     1 
ATOM   125  C CA    . PHE A 1 23  ? 38.956 66.539 155.792 1.00 22.42  ? 23  PHE A CA    1 
ATOM   126  C C     . PHE A 1 23  ? 39.852 65.437 155.232 1.00 19.90  ? 23  PHE A C     1 
ATOM   127  O O     . PHE A 1 23  ? 40.251 65.482 154.075 1.00 20.58  ? 23  PHE A O     1 
ATOM   128  C CB    . PHE A 1 23  ? 39.723 67.344 156.852 1.00 21.43  ? 23  PHE A CB    1 
ATOM   129  C CG    . PHE A 1 23  ? 40.959 68.021 156.322 1.00 24.13  ? 23  PHE A CG    1 
ATOM   130  C CD1   . PHE A 1 23  ? 40.869 69.223 155.627 1.00 25.94  ? 23  PHE A CD1   1 
ATOM   131  C CD2   . PHE A 1 23  ? 42.213 67.442 156.493 1.00 25.01  ? 23  PHE A CD2   1 
ATOM   132  C CE1   . PHE A 1 23  ? 42.014 69.838 155.111 1.00 25.62  ? 23  PHE A CE1   1 
ATOM   133  C CE2   . PHE A 1 23  ? 43.363 68.050 155.980 1.00 23.76  ? 23  PHE A CE2   1 
ATOM   134  C CZ    . PHE A 1 23  ? 43.261 69.247 155.290 1.00 24.14  ? 23  PHE A CZ    1 
ATOM   135  N N     . PHE A 1 24  ? 40.159 64.448 156.065 1.00 19.46  ? 24  PHE A N     1 
ATOM   136  C CA    . PHE A 1 24  ? 40.996 63.322 155.658 1.00 18.53  ? 24  PHE A CA    1 
ATOM   137  C C     . PHE A 1 24  ? 40.265 62.486 154.611 1.00 18.93  ? 24  PHE A C     1 
ATOM   138  O O     . PHE A 1 24  ? 40.841 62.103 153.592 1.00 19.09  ? 24  PHE A O     1 
ATOM   139  C CB    . PHE A 1 24  ? 41.315 62.423 156.861 1.00 18.18  ? 24  PHE A CB    1 
ATOM   140  C CG    . PHE A 1 24  ? 42.247 63.043 157.869 1.00 17.82  ? 24  PHE A CG    1 
ATOM   141  C CD1   . PHE A 1 24  ? 42.026 62.866 159.236 1.00 17.83  ? 24  PHE A CD1   1 
ATOM   142  C CD2   . PHE A 1 24  ? 43.367 63.762 157.460 1.00 17.43  ? 24  PHE A CD2   1 
ATOM   143  C CE1   . PHE A 1 24  ? 42.914 63.399 160.196 1.00 17.92  ? 24  PHE A CE1   1 
ATOM   144  C CE2   . PHE A 1 24  ? 44.261 64.299 158.402 1.00 21.75  ? 24  PHE A CE2   1 
ATOM   145  C CZ    . PHE A 1 24  ? 44.030 64.114 159.777 1.00 19.13  ? 24  PHE A CZ    1 
ATOM   146  N N     . GLY A 1 25  ? 38.993 62.202 154.877 1.00 18.26  ? 25  GLY A N     1 
ATOM   147  C CA    . GLY A 1 25  ? 38.202 61.394 153.965 1.00 18.92  ? 25  GLY A CA    1 
ATOM   148  C C     . GLY A 1 25  ? 37.991 61.992 152.586 1.00 18.93  ? 25  GLY A C     1 
ATOM   149  O O     . GLY A 1 25  ? 38.345 61.383 151.582 1.00 21.55  ? 25  GLY A O     1 
ATOM   150  N N     . VAL A 1 26  ? 37.392 63.176 152.532 1.00 19.15  ? 26  VAL A N     1 
ATOM   151  C CA    . VAL A 1 26  ? 37.139 63.852 151.267 1.00 18.26  ? 26  VAL A CA    1 
ATOM   152  C C     . VAL A 1 26  ? 38.480 64.202 150.619 1.00 20.04  ? 26  VAL A C     1 
ATOM   153  O O     . VAL A 1 26  ? 38.614 64.208 149.388 1.00 19.30  ? 26  VAL A O     1 
ATOM   154  C CB    . VAL A 1 26  ? 36.286 65.134 151.495 1.00 19.13  ? 26  VAL A CB    1 
ATOM   155  C CG1   . VAL A 1 26  ? 36.115 65.914 150.188 1.00 17.27  ? 26  VAL A CG1   1 
ATOM   156  C CG2   . VAL A 1 26  ? 34.919 64.741 152.052 1.00 17.76  ? 26  VAL A CG2   1 
ATOM   157  N N     . GLY A 1 27  ? 39.481 64.469 151.458 1.00 19.41  ? 27  GLY A N     1 
ATOM   158  C CA    . GLY A 1 27  ? 40.798 64.789 150.944 1.00 18.47  ? 27  GLY A CA    1 
ATOM   159  C C     . GLY A 1 27  ? 41.402 63.665 150.106 1.00 20.91  ? 27  GLY A C     1 
ATOM   160  O O     . GLY A 1 27  ? 41.885 63.906 148.995 1.00 20.84  ? 27  GLY A O     1 
ATOM   161  N N     . CYS A 1 28  ? 41.376 62.433 150.617 1.00 19.58  ? 28  CYS A N     1 
ATOM   162  C CA    . CYS A 1 28  ? 41.957 61.315 149.877 1.00 18.66  ? 28  CYS A CA    1 
ATOM   163  C C     . CYS A 1 28  ? 41.157 60.976 148.621 1.00 18.84  ? 28  CYS A C     1 
ATOM   164  O O     . CYS A 1 28  ? 41.725 60.544 147.614 1.00 17.23  ? 28  CYS A O     1 
ATOM   165  C CB    . CYS A 1 28  ? 42.118 60.069 150.776 1.00 19.70  ? 28  CYS A CB    1 
ATOM   166  S SG    . CYS A 1 28  ? 40.621 59.099 151.186 1.00 23.15  ? 28  CYS A SG    1 
ATOM   167  N N     . VAL A 1 29  ? 39.843 61.178 148.662 1.00 16.86  ? 29  VAL A N     1 
ATOM   168  C CA    . VAL A 1 29  ? 39.047 60.885 147.478 1.00 16.75  ? 29  VAL A CA    1 
ATOM   169  C C     . VAL A 1 29  ? 39.314 61.947 146.410 1.00 18.20  ? 29  VAL A C     1 
ATOM   170  O O     . VAL A 1 29  ? 39.262 61.657 145.223 1.00 18.41  ? 29  VAL A O     1 
ATOM   171  C CB    . VAL A 1 29  ? 37.538 60.828 147.790 1.00 18.98  ? 29  VAL A CB    1 
ATOM   172  C CG1   . VAL A 1 29  ? 36.751 60.519 146.516 1.00 15.70  ? 29  VAL A CG1   1 
ATOM   173  C CG2   . VAL A 1 29  ? 37.269 59.751 148.833 1.00 15.80  ? 29  VAL A CG2   1 
ATOM   174  N N     . ALA A 1 30  ? 39.607 63.175 146.831 1.00 19.05  ? 30  ALA A N     1 
ATOM   175  C CA    . ALA A 1 30  ? 39.907 64.237 145.881 1.00 19.64  ? 30  ALA A CA    1 
ATOM   176  C C     . ALA A 1 30  ? 41.237 63.902 145.205 1.00 19.93  ? 30  ALA A C     1 
ATOM   177  O O     . ALA A 1 30  ? 41.396 64.082 143.991 1.00 20.74  ? 30  ALA A O     1 
ATOM   178  C CB    . ALA A 1 30  ? 40.008 65.580 146.598 1.00 20.65  ? 30  ALA A CB    1 
ATOM   179  N N     . ALA A 1 31  ? 42.190 63.407 145.994 1.00 17.81  ? 31  ALA A N     1 
ATOM   180  C CA    . ALA A 1 31  ? 43.505 63.025 145.467 1.00 17.74  ? 31  ALA A CA    1 
ATOM   181  C C     . ALA A 1 31  ? 43.330 61.970 144.384 1.00 19.09  ? 31  ALA A C     1 
ATOM   182  O O     . ALA A 1 31  ? 43.962 62.035 143.337 1.00 20.57  ? 31  ALA A O     1 
ATOM   183  C CB    . ALA A 1 31  ? 44.381 62.471 146.581 1.00 12.88  ? 31  ALA A CB    1 
ATOM   184  N N     . LEU A 1 32  ? 42.468 60.993 144.655 1.00 19.55  ? 32  LEU A N     1 
ATOM   185  C CA    . LEU A 1 32  ? 42.188 59.920 143.716 1.00 20.33  ? 32  LEU A CA    1 
ATOM   186  C C     . LEU A 1 32  ? 41.530 60.441 142.441 1.00 21.80  ? 32  LEU A C     1 
ATOM   187  O O     . LEU A 1 32  ? 41.973 60.146 141.332 1.00 22.88  ? 32  LEU A O     1 
ATOM   188  C CB    . LEU A 1 32  ? 41.259 58.884 144.362 1.00 21.03  ? 32  LEU A CB    1 
ATOM   189  C CG    . LEU A 1 32  ? 40.569 57.880 143.421 1.00 21.78  ? 32  LEU A CG    1 
ATOM   190  C CD1   . LEU A 1 32  ? 41.585 56.845 142.933 1.00 20.75  ? 32  LEU A CD1   1 
ATOM   191  C CD2   . LEU A 1 32  ? 39.410 57.193 144.149 1.00 20.46  ? 32  LEU A CD2   1 
ATOM   192  N N     . LYS A 1 33  ? 40.473 61.224 142.606 1.00 21.27  ? 33  LYS A N     1 
ATOM   193  C CA    . LYS A 1 33  ? 39.730 61.743 141.467 1.00 22.28  ? 33  LYS A CA    1 
ATOM   194  C C     . LYS A 1 33  ? 40.346 62.863 140.627 1.00 22.93  ? 33  LYS A C     1 
ATOM   195  O O     . LYS A 1 33  ? 40.285 62.809 139.398 1.00 25.14  ? 33  LYS A O     1 
ATOM   196  C CB    . LYS A 1 33  ? 38.326 62.146 141.925 1.00 23.25  ? 33  LYS A CB    1 
ATOM   197  C CG    . LYS A 1 33  ? 37.497 60.946 142.373 1.00 23.45  ? 33  LYS A CG    1 
ATOM   198  C CD    . LYS A 1 33  ? 36.095 61.343 142.770 1.00 25.69  ? 33  LYS A CD    1 
ATOM   199  C CE    . LYS A 1 33  ? 35.255 60.114 143.080 1.00 23.47  ? 33  LYS A CE    1 
ATOM   200  N NZ    . LYS A 1 33  ? 35.089 59.248 141.882 1.00 25.21  ? 33  LYS A NZ    1 
ATOM   201  N N     . VAL A 1 34  ? 40.944 63.867 141.257 1.00 20.82  ? 34  VAL A N     1 
ATOM   202  C CA    . VAL A 1 34  ? 41.518 64.966 140.485 1.00 20.72  ? 34  VAL A CA    1 
ATOM   203  C C     . VAL A 1 34  ? 43.033 65.118 140.564 1.00 20.95  ? 34  VAL A C     1 
ATOM   204  O O     . VAL A 1 34  ? 43.608 65.931 139.849 1.00 23.59  ? 34  VAL A O     1 
ATOM   205  C CB    . VAL A 1 34  ? 40.880 66.310 140.891 1.00 22.14  ? 34  VAL A CB    1 
ATOM   206  C CG1   . VAL A 1 34  ? 39.378 66.259 140.653 1.00 20.45  ? 34  VAL A CG1   1 
ATOM   207  C CG2   . VAL A 1 34  ? 41.177 66.609 142.367 1.00 20.67  ? 34  VAL A CG2   1 
ATOM   208  N N     . ALA A 1 35  ? 43.690 64.351 141.423 1.00 19.88  ? 35  ALA A N     1 
ATOM   209  C CA    . ALA A 1 35  ? 45.139 64.463 141.534 1.00 20.37  ? 35  ALA A CA    1 
ATOM   210  C C     . ALA A 1 35  ? 45.875 63.222 141.028 1.00 21.26  ? 35  ALA A C     1 
ATOM   211  O O     . ALA A 1 35  ? 47.085 63.108 141.181 1.00 23.28  ? 35  ALA A O     1 
ATOM   212  C CB    . ALA A 1 35  ? 45.532 64.763 142.973 1.00 17.99  ? 35  ALA A CB    1 
ATOM   213  N N     . GLY A 1 36  ? 45.137 62.290 140.437 1.00 22.22  ? 36  GLY A N     1 
ATOM   214  C CA    . GLY A 1 36  ? 45.754 61.093 139.898 1.00 23.76  ? 36  GLY A CA    1 
ATOM   215  C C     . GLY A 1 36  ? 46.457 60.149 140.861 1.00 25.32  ? 36  GLY A C     1 
ATOM   216  O O     . GLY A 1 36  ? 47.262 59.330 140.431 1.00 26.93  ? 36  GLY A O     1 
ATOM   217  N N     . ALA A 1 37  ? 46.160 60.243 142.152 1.00 25.41  ? 37  ALA A N     1 
ATOM   218  C CA    . ALA A 1 37  ? 46.788 59.370 143.141 1.00 25.97  ? 37  ALA A CA    1 
ATOM   219  C C     . ALA A 1 37  ? 46.326 57.922 142.955 1.00 27.18  ? 37  ALA A C     1 
ATOM   220  O O     . ALA A 1 37  ? 45.182 57.683 142.567 1.00 27.53  ? 37  ALA A O     1 
ATOM   221  C CB    . ALA A 1 37  ? 46.438 59.850 144.545 1.00 22.89  ? 37  ALA A CB    1 
ATOM   222  N N     . SER A 1 38  ? 47.210 56.960 143.225 1.00 28.16  ? 38  SER A N     1 
ATOM   223  C CA    . SER A 1 38  ? 46.857 55.545 143.096 1.00 30.08  ? 38  SER A CA    1 
ATOM   224  C C     . SER A 1 38  ? 46.268 55.024 144.397 1.00 29.55  ? 38  SER A C     1 
ATOM   225  O O     . SER A 1 38  ? 46.984 54.800 145.369 1.00 31.54  ? 38  SER A O     1 
ATOM   226  C CB    . SER A 1 38  ? 48.081 54.709 142.736 1.00 29.88  ? 38  SER A CB    1 
ATOM   227  O OG    . SER A 1 38  ? 48.566 55.081 141.469 1.00 38.88  ? 38  SER A OG    1 
ATOM   228  N N     . PHE A 1 39  ? 44.960 54.826 144.406 1.00 30.51  ? 39  PHE A N     1 
ATOM   229  C CA    . PHE A 1 39  ? 44.261 54.352 145.596 1.00 32.61  ? 39  PHE A CA    1 
ATOM   230  C C     . PHE A 1 39  ? 43.248 53.259 145.268 1.00 32.19  ? 39  PHE A C     1 
ATOM   231  O O     . PHE A 1 39  ? 42.323 53.484 144.493 1.00 33.19  ? 39  PHE A O     1 
ATOM   232  C CB    . PHE A 1 39  ? 43.492 55.505 146.253 1.00 31.87  ? 39  PHE A CB    1 
ATOM   233  C CG    . PHE A 1 39  ? 44.354 56.501 146.972 1.00 30.80  ? 39  PHE A CG    1 
ATOM   234  C CD1   . PHE A 1 39  ? 44.011 57.849 146.969 1.00 29.78  ? 39  PHE A CD1   1 
ATOM   235  C CD2   . PHE A 1 39  ? 45.456 56.096 147.714 1.00 30.63  ? 39  PHE A CD2   1 
ATOM   236  C CE1   . PHE A 1 39  ? 44.746 58.780 147.698 1.00 27.68  ? 39  PHE A CE1   1 
ATOM   237  C CE2   . PHE A 1 39  ? 46.197 57.023 148.447 1.00 30.66  ? 39  PHE A CE2   1 
ATOM   238  C CZ    . PHE A 1 39  ? 45.836 58.368 148.436 1.00 28.11  ? 39  PHE A CZ    1 
ATOM   239  N N     . GLY A 1 40  ? 43.419 52.084 145.858 1.00 31.32  ? 40  GLY A N     1 
ATOM   240  C CA    . GLY A 1 40  ? 42.453 51.021 145.639 1.00 32.62  ? 40  GLY A CA    1 
ATOM   241  C C     . GLY A 1 40  ? 41.339 51.138 146.676 1.00 30.80  ? 40  GLY A C     1 
ATOM   242  O O     . GLY A 1 40  ? 41.367 52.035 147.525 1.00 28.16  ? 40  GLY A O     1 
ATOM   243  N N     . GLN A 1 41  ? 40.363 50.236 146.621 1.00 28.59  ? 41  GLN A N     1 
ATOM   244  C CA    . GLN A 1 41  ? 39.251 50.264 147.569 1.00 27.43  ? 41  GLN A CA    1 
ATOM   245  C C     . GLN A 1 41  ? 39.754 50.147 149.014 1.00 24.92  ? 41  GLN A C     1 
ATOM   246  O O     . GLN A 1 41  ? 39.258 50.832 149.910 1.00 23.32  ? 41  GLN A O     1 
ATOM   247  C CB    . GLN A 1 41  ? 38.268 49.124 147.272 1.00 27.72  ? 41  GLN A CB    1 
ATOM   248  C CG    . GLN A 1 41  ? 36.985 49.164 148.085 1.00 26.83  ? 41  GLN A CG    1 
ATOM   249  C CD    . GLN A 1 41  ? 36.205 50.443 147.862 1.00 26.75  ? 41  GLN A CD    1 
ATOM   250  O OE1   . GLN A 1 41  ? 36.182 50.974 146.755 1.00 29.28  ? 41  GLN A OE1   1 
ATOM   251  N NE2   . GLN A 1 41  ? 35.549 50.940 148.910 1.00 25.55  ? 41  GLN A NE2   1 
ATOM   252  N N     . TRP A 1 42  ? 40.737 49.283 149.238 1.00 22.08  ? 42  TRP A N     1 
ATOM   253  C CA    . TRP A 1 42  ? 41.288 49.101 150.576 1.00 24.31  ? 42  TRP A CA    1 
ATOM   254  C C     . TRP A 1 42  ? 41.982 50.363 151.106 1.00 25.13  ? 42  TRP A C     1 
ATOM   255  O O     . TRP A 1 42  ? 41.790 50.748 152.258 1.00 24.85  ? 42  TRP A O     1 
ATOM   256  C CB    . TRP A 1 42  ? 42.276 47.924 150.594 1.00 23.09  ? 42  TRP A CB    1 
ATOM   257  C CG    . TRP A 1 42  ? 43.134 47.887 151.831 1.00 23.95  ? 42  TRP A CG    1 
ATOM   258  C CD1   . TRP A 1 42  ? 44.481 48.122 151.900 1.00 23.23  ? 42  TRP A CD1   1 
ATOM   259  C CD2   . TRP A 1 42  ? 42.693 47.689 153.184 1.00 22.72  ? 42  TRP A CD2   1 
ATOM   260  N NE1   . TRP A 1 42  ? 44.900 48.087 153.209 1.00 23.79  ? 42  TRP A NE1   1 
ATOM   261  C CE2   . TRP A 1 42  ? 43.826 47.826 154.017 1.00 22.02  ? 42  TRP A CE2   1 
ATOM   262  C CE3   . TRP A 1 42  ? 41.448 47.415 153.773 1.00 23.81  ? 42  TRP A CE3   1 
ATOM   263  C CZ2   . TRP A 1 42  ? 43.755 47.698 155.413 1.00 21.66  ? 42  TRP A CZ2   1 
ATOM   264  C CZ3   . TRP A 1 42  ? 41.378 47.289 155.167 1.00 22.54  ? 42  TRP A CZ3   1 
ATOM   265  C CH2   . TRP A 1 42  ? 42.527 47.432 155.967 1.00 20.38  ? 42  TRP A CH2   1 
ATOM   266  N N     . GLU A 1 43  ? 42.792 50.996 150.265 1.00 26.12  ? 43  GLU A N     1 
ATOM   267  C CA    . GLU A 1 43  ? 43.509 52.200 150.665 1.00 27.97  ? 43  GLU A CA    1 
ATOM   268  C C     . GLU A 1 43  ? 42.539 53.312 151.051 1.00 27.23  ? 43  GLU A C     1 
ATOM   269  O O     . GLU A 1 43  ? 42.701 53.966 152.082 1.00 27.82  ? 43  GLU A O     1 
ATOM   270  C CB    . GLU A 1 43  ? 44.419 52.681 149.530 1.00 30.61  ? 43  GLU A CB    1 
ATOM   271  C CG    . GLU A 1 43  ? 45.610 51.772 149.232 1.00 32.32  ? 43  GLU A CG    1 
ATOM   272  C CD    . GLU A 1 43  ? 45.213 50.490 148.518 1.00 35.82  ? 43  GLU A CD    1 
ATOM   273  O OE1   . GLU A 1 43  ? 44.427 50.573 147.549 1.00 35.17  ? 43  GLU A OE1   1 
ATOM   274  O OE2   . GLU A 1 43  ? 45.697 49.405 148.913 1.00 35.70  ? 43  GLU A OE2   1 
ATOM   275  N N     . ILE A 1 44  ? 41.531 53.521 150.214 1.00 24.55  ? 44  ILE A N     1 
ATOM   276  C CA    . ILE A 1 44  ? 40.531 54.543 150.467 1.00 22.95  ? 44  ILE A CA    1 
ATOM   277  C C     . ILE A 1 44  ? 39.805 54.237 151.770 1.00 21.39  ? 44  ILE A C     1 
ATOM   278  O O     . ILE A 1 44  ? 39.531 55.129 152.570 1.00 20.48  ? 44  ILE A O     1 
ATOM   279  C CB    . ILE A 1 44  ? 39.508 54.600 149.316 1.00 24.13  ? 44  ILE A CB    1 
ATOM   280  C CG1   . ILE A 1 44  ? 40.181 55.154 148.058 1.00 24.61  ? 44  ILE A CG1   1 
ATOM   281  C CG2   . ILE A 1 44  ? 38.305 55.453 149.721 1.00 22.25  ? 44  ILE A CG2   1 
ATOM   282  C CD1   . ILE A 1 44  ? 40.760 56.542 148.246 1.00 27.63  ? 44  ILE A CD1   1 
ATOM   283  N N     . SER A 1 45  ? 39.503 52.964 151.980 1.00 18.90  ? 45  SER A N     1 
ATOM   284  C CA    . SER A 1 45  ? 38.806 52.549 153.182 1.00 19.74  ? 45  SER A CA    1 
ATOM   285  C C     . SER A 1 45  ? 39.644 52.700 154.452 1.00 17.89  ? 45  SER A C     1 
ATOM   286  O O     . SER A 1 45  ? 39.142 53.168 155.471 1.00 16.96  ? 45  SER A O     1 
ATOM   287  C CB    . SER A 1 45  ? 38.324 51.103 153.025 1.00 18.90  ? 45  SER A CB    1 
ATOM   288  O OG    . SER A 1 45  ? 37.408 51.020 151.941 1.00 18.91  ? 45  SER A OG    1 
ATOM   289  N N     . VAL A 1 46  ? 40.917 52.327 154.396 1.00 18.11  ? 46  VAL A N     1 
ATOM   290  C CA    . VAL A 1 46  ? 41.767 52.428 155.582 1.00 19.97  ? 46  VAL A CA    1 
ATOM   291  C C     . VAL A 1 46  ? 42.076 53.893 155.929 1.00 19.50  ? 46  VAL A C     1 
ATOM   292  O O     . VAL A 1 46  ? 42.195 54.252 157.098 1.00 19.33  ? 46  VAL A O     1 
ATOM   293  C CB    . VAL A 1 46  ? 43.085 51.594 155.410 1.00 21.05  ? 46  VAL A CB    1 
ATOM   294  C CG1   . VAL A 1 46  ? 44.058 52.296 154.484 1.00 21.15  ? 46  VAL A CG1   1 
ATOM   295  C CG2   . VAL A 1 46  ? 43.712 51.338 156.766 1.00 22.99  ? 46  VAL A CG2   1 
ATOM   296  N N     . ILE A 1 47  ? 42.184 54.745 154.919 1.00 18.71  ? 47  ILE A N     1 
ATOM   297  C CA    . ILE A 1 47  ? 42.435 56.154 155.183 1.00 19.96  ? 47  ILE A CA    1 
ATOM   298  C C     . ILE A 1 47  ? 41.214 56.761 155.893 1.00 21.60  ? 47  ILE A C     1 
ATOM   299  O O     . ILE A 1 47  ? 41.356 57.504 156.865 1.00 21.30  ? 47  ILE A O     1 
ATOM   300  C CB    . ILE A 1 47  ? 42.705 56.937 153.880 1.00 19.52  ? 47  ILE A CB    1 
ATOM   301  C CG1   . ILE A 1 47  ? 44.000 56.436 153.236 1.00 18.67  ? 47  ILE A CG1   1 
ATOM   302  C CG2   . ILE A 1 47  ? 42.809 58.438 154.183 1.00 20.05  ? 47  ILE A CG2   1 
ATOM   303  C CD1   . ILE A 1 47  ? 44.168 56.855 151.789 1.00 15.71  ? 47  ILE A CD1   1 
ATOM   304  N N     . TRP A 1 48  ? 40.015 56.443 155.407 1.00 20.67  ? 48  TRP A N     1 
ATOM   305  C CA    . TRP A 1 48  ? 38.801 56.952 156.033 1.00 19.76  ? 48  TRP A CA    1 
ATOM   306  C C     . TRP A 1 48  ? 38.750 56.477 157.477 1.00 20.34  ? 48  TRP A C     1 
ATOM   307  O O     . TRP A 1 48  ? 38.508 57.267 158.393 1.00 21.49  ? 48  TRP A O     1 
ATOM   308  C CB    . TRP A 1 48  ? 37.551 56.449 155.313 1.00 17.46  ? 48  TRP A CB    1 
ATOM   309  C CG    . TRP A 1 48  ? 37.020 57.380 154.273 1.00 19.35  ? 48  TRP A CG    1 
ATOM   310  C CD1   . TRP A 1 48  ? 37.150 57.260 152.919 1.00 17.76  ? 48  TRP A CD1   1 
ATOM   311  C CD2   . TRP A 1 48  ? 36.237 58.560 154.499 1.00 18.23  ? 48  TRP A CD2   1 
ATOM   312  N NE1   . TRP A 1 48  ? 36.492 58.288 152.288 1.00 18.82  ? 48  TRP A NE1   1 
ATOM   313  C CE2   . TRP A 1 48  ? 35.921 59.100 153.233 1.00 17.24  ? 48  TRP A CE2   1 
ATOM   314  C CE3   . TRP A 1 48  ? 35.767 59.210 155.652 1.00 16.38  ? 48  TRP A CE3   1 
ATOM   315  C CZ2   . TRP A 1 48  ? 35.156 60.268 153.082 1.00 17.67  ? 48  TRP A CZ2   1 
ATOM   316  C CZ3   . TRP A 1 48  ? 35.004 60.370 155.502 1.00 18.16  ? 48  TRP A CZ3   1 
ATOM   317  C CH2   . TRP A 1 48  ? 34.706 60.884 154.223 1.00 16.85  ? 48  TRP A CH2   1 
ATOM   318  N N     . GLY A 1 49  ? 38.986 55.181 157.669 1.00 18.02  ? 49  GLY A N     1 
ATOM   319  C CA    . GLY A 1 49  ? 38.955 54.602 158.998 1.00 19.39  ? 49  GLY A CA    1 
ATOM   320  C C     . GLY A 1 49  ? 39.942 55.215 159.975 1.00 21.01  ? 49  GLY A C     1 
ATOM   321  O O     . GLY A 1 49  ? 39.559 55.562 161.094 1.00 21.40  ? 49  GLY A O     1 
ATOM   322  N N     . LEU A 1 50  ? 41.205 55.336 159.565 1.00 19.61  ? 50  LEU A N     1 
ATOM   323  C CA    . LEU A 1 50  ? 42.231 55.917 160.421 1.00 21.67  ? 50  LEU A CA    1 
ATOM   324  C C     . LEU A 1 50  ? 41.930 57.388 160.655 1.00 23.01  ? 50  LEU A C     1 
ATOM   325  O O     . LEU A 1 50  ? 42.226 57.927 161.721 1.00 24.00  ? 50  LEU A O     1 
ATOM   326  C CB    . LEU A 1 50  ? 43.615 55.747 159.790 1.00 22.79  ? 50  LEU A CB    1 
ATOM   327  C CG    . LEU A 1 50  ? 44.096 54.292 159.769 1.00 24.63  ? 50  LEU A CG    1 
ATOM   328  C CD1   . LEU A 1 50  ? 45.388 54.167 158.983 1.00 25.03  ? 50  LEU A CD1   1 
ATOM   329  C CD2   . LEU A 1 50  ? 44.286 53.811 161.202 1.00 24.20  ? 50  LEU A CD2   1 
ATOM   330  N N     . GLY A 1 51  ? 41.346 58.034 159.652 1.00 22.67  ? 51  GLY A N     1 
ATOM   331  C CA    . GLY A 1 51  ? 40.978 59.428 159.796 1.00 22.96  ? 51  GLY A CA    1 
ATOM   332  C C     . GLY A 1 51  ? 39.941 59.538 160.903 1.00 22.72  ? 51  GLY A C     1 
ATOM   333  O O     . GLY A 1 51  ? 39.997 60.446 161.739 1.00 22.27  ? 51  GLY A O     1 
ATOM   334  N N     . VAL A 1 52  ? 38.990 58.609 160.912 1.00 22.55  ? 52  VAL A N     1 
ATOM   335  C CA    . VAL A 1 52  ? 37.958 58.600 161.941 1.00 23.83  ? 52  VAL A CA    1 
ATOM   336  C C     . VAL A 1 52  ? 38.589 58.339 163.308 1.00 24.32  ? 52  VAL A C     1 
ATOM   337  O O     . VAL A 1 52  ? 38.223 58.977 164.294 1.00 25.31  ? 52  VAL A O     1 
ATOM   338  C CB    . VAL A 1 52  ? 36.877 57.518 161.666 1.00 24.41  ? 52  VAL A CB    1 
ATOM   339  C CG1   . VAL A 1 52  ? 36.000 57.314 162.908 1.00 22.73  ? 52  VAL A CG1   1 
ATOM   340  C CG2   . VAL A 1 52  ? 36.008 57.944 160.493 1.00 22.16  ? 52  VAL A CG2   1 
ATOM   341  N N     . ALA A 1 53  ? 39.540 57.411 163.367 1.00 22.25  ? 53  ALA A N     1 
ATOM   342  C CA    . ALA A 1 53  ? 40.201 57.092 164.632 1.00 23.72  ? 53  ALA A CA    1 
ATOM   343  C C     . ALA A 1 53  ? 40.826 58.343 165.260 1.00 22.75  ? 53  ALA A C     1 
ATOM   344  O O     . ALA A 1 53  ? 40.666 58.587 166.453 1.00 21.56  ? 53  ALA A O     1 
ATOM   345  C CB    . ALA A 1 53  ? 41.269 56.027 164.417 1.00 24.25  ? 53  ALA A CB    1 
ATOM   346  N N     . MET A 1 54  ? 41.538 59.122 164.451 1.00 21.54  ? 54  MET A N     1 
ATOM   347  C CA    . MET A 1 54  ? 42.176 60.350 164.921 1.00 23.82  ? 54  MET A CA    1 
ATOM   348  C C     . MET A 1 54  ? 41.144 61.348 165.443 1.00 23.30  ? 54  MET A C     1 
ATOM   349  O O     . MET A 1 54  ? 41.366 62.004 166.458 1.00 24.53  ? 54  MET A O     1 
ATOM   350  C CB    . MET A 1 54  ? 42.973 61.004 163.789 1.00 24.97  ? 54  MET A CB    1 
ATOM   351  C CG    . MET A 1 54  ? 44.116 60.161 163.257 1.00 28.43  ? 54  MET A CG    1 
ATOM   352  S SD    . MET A 1 54  ? 45.394 59.826 164.500 1.00 34.67  ? 54  MET A SD    1 
ATOM   353  C CE    . MET A 1 54  ? 45.679 58.069 164.249 1.00 31.37  ? 54  MET A CE    1 
ATOM   354  N N     . ALA A 1 55  ? 40.021 61.461 164.738 1.00 22.88  ? 55  ALA A N     1 
ATOM   355  C CA    . ALA A 1 55  ? 38.954 62.375 165.132 1.00 22.94  ? 55  ALA A CA    1 
ATOM   356  C C     . ALA A 1 55  ? 38.416 61.967 166.498 1.00 22.88  ? 55  ALA A C     1 
ATOM   357  O O     . ALA A 1 55  ? 38.065 62.817 167.314 1.00 22.80  ? 55  ALA A O     1 
ATOM   358  C CB    . ALA A 1 55  ? 37.836 62.360 164.094 1.00 20.42  ? 55  ALA A CB    1 
ATOM   359  N N     . ILE A 1 56  ? 38.362 60.661 166.740 1.00 23.24  ? 56  ILE A N     1 
ATOM   360  C CA    . ILE A 1 56  ? 37.889 60.128 168.011 1.00 24.11  ? 56  ILE A CA    1 
ATOM   361  C C     . ILE A 1 56  ? 38.905 60.445 169.115 1.00 27.08  ? 56  ILE A C     1 
ATOM   362  O O     . ILE A 1 56  ? 38.538 60.908 170.193 1.00 27.82  ? 56  ILE A O     1 
ATOM   363  C CB    . ILE A 1 56  ? 37.659 58.595 167.910 1.00 23.55  ? 56  ILE A CB    1 
ATOM   364  C CG1   . ILE A 1 56  ? 36.497 58.316 166.951 1.00 24.03  ? 56  ILE A CG1   1 
ATOM   365  C CG2   . ILE A 1 56  ? 37.356 58.003 169.284 1.00 22.39  ? 56  ILE A CG2   1 
ATOM   366  C CD1   . ILE A 1 56  ? 36.200 56.830 166.721 1.00 18.25  ? 56  ILE A CD1   1 
ATOM   367  N N     . TYR A 1 57  ? 40.183 60.208 168.842 1.00 27.98  ? 57  TYR A N     1 
ATOM   368  C CA    . TYR A 1 57  ? 41.228 60.485 169.822 1.00 29.69  ? 57  TYR A CA    1 
ATOM   369  C C     . TYR A 1 57  ? 41.235 61.950 170.239 1.00 31.33  ? 57  TYR A C     1 
ATOM   370  O O     . TYR A 1 57  ? 41.557 62.292 171.384 1.00 31.48  ? 57  TYR A O     1 
ATOM   371  C CB    . TYR A 1 57  ? 42.610 60.137 169.252 1.00 28.44  ? 57  TYR A CB    1 
ATOM   372  C CG    . TYR A 1 57  ? 42.955 58.666 169.312 1.00 28.81  ? 57  TYR A CG    1 
ATOM   373  C CD1   . TYR A 1 57  ? 42.962 57.980 170.535 1.00 27.15  ? 57  TYR A CD1   1 
ATOM   374  C CD2   . TYR A 1 57  ? 43.274 57.956 168.149 1.00 25.63  ? 57  TYR A CD2   1 
ATOM   375  C CE1   . TYR A 1 57  ? 43.278 56.618 170.597 1.00 26.53  ? 57  TYR A CE1   1 
ATOM   376  C CE2   . TYR A 1 57  ? 43.590 56.597 168.199 1.00 26.04  ? 57  TYR A CE2   1 
ATOM   377  C CZ    . TYR A 1 57  ? 43.588 55.937 169.427 1.00 27.56  ? 57  TYR A CZ    1 
ATOM   378  O OH    . TYR A 1 57  ? 43.879 54.594 169.478 1.00 27.74  ? 57  TYR A OH    1 
ATOM   379  N N     . LEU A 1 58  ? 40.886 62.808 169.292 1.00 31.04  ? 58  LEU A N     1 
ATOM   380  C CA    . LEU A 1 58  ? 40.875 64.243 169.506 1.00 31.79  ? 58  LEU A CA    1 
ATOM   381  C C     . LEU A 1 58  ? 39.690 64.718 170.342 1.00 32.05  ? 58  LEU A C     1 
ATOM   382  O O     . LEU A 1 58  ? 39.828 65.623 171.166 1.00 32.35  ? 58  LEU A O     1 
ATOM   383  C CB    . LEU A 1 58  ? 40.837 64.949 168.144 1.00 31.44  ? 58  LEU A CB    1 
ATOM   384  C CG    . LEU A 1 58  ? 41.171 66.434 167.924 1.00 32.18  ? 58  LEU A CG    1 
ATOM   385  C CD1   . LEU A 1 58  ? 40.117 67.041 166.996 1.00 29.20  ? 58  LEU A CD1   1 
ATOM   386  C CD2   . LEU A 1 58  ? 41.227 67.191 169.231 1.00 32.34  ? 58  LEU A CD2   1 
ATOM   387  N N     . THR A 1 59  ? 38.537 64.090 170.144 1.00 30.02  ? 59  THR A N     1 
ATOM   388  C CA    . THR A 1 59  ? 37.326 64.528 170.814 1.00 30.72  ? 59  THR A CA    1 
ATOM   389  C C     . THR A 1 59  ? 36.684 63.626 171.861 1.00 32.29  ? 59  THR A C     1 
ATOM   390  O O     . THR A 1 59  ? 35.791 64.071 172.584 1.00 33.35  ? 59  THR A O     1 
ATOM   391  C CB    . THR A 1 59  ? 36.244 64.861 169.760 1.00 29.89  ? 59  THR A CB    1 
ATOM   392  O OG1   . THR A 1 59  ? 35.850 63.659 169.085 1.00 28.60  ? 59  THR A OG1   1 
ATOM   393  C CG2   . THR A 1 59  ? 36.786 65.849 168.735 1.00 27.96  ? 59  THR A CG2   1 
ATOM   394  N N     . ALA A 1 60  ? 37.114 62.375 171.952 1.00 32.90  ? 60  ALA A N     1 
ATOM   395  C CA    . ALA A 1 60  ? 36.518 61.459 172.918 1.00 34.81  ? 60  ALA A CA    1 
ATOM   396  C C     . ALA A 1 60  ? 36.528 62.016 174.340 1.00 36.19  ? 60  ALA A C     1 
ATOM   397  O O     . ALA A 1 60  ? 35.532 61.931 175.052 1.00 37.36  ? 60  ALA A O     1 
ATOM   398  C CB    . ALA A 1 60  ? 37.230 60.116 172.877 1.00 34.43  ? 60  ALA A CB    1 
ATOM   399  N N     . GLY A 1 61  ? 37.649 62.600 174.743 1.00 38.26  ? 61  GLY A N     1 
ATOM   400  C CA    . GLY A 1 61  ? 37.756 63.137 176.088 1.00 39.01  ? 61  GLY A CA    1 
ATOM   401  C C     . GLY A 1 61  ? 36.836 64.298 176.412 1.00 39.59  ? 61  GLY A C     1 
ATOM   402  O O     . GLY A 1 61  ? 36.612 64.595 177.583 1.00 41.71  ? 61  GLY A O     1 
ATOM   403  N N     . VAL A 1 62  ? 36.299 64.955 175.389 1.00 38.22  ? 62  VAL A N     1 
ATOM   404  C CA    . VAL A 1 62  ? 35.415 66.097 175.602 1.00 37.30  ? 62  VAL A CA    1 
ATOM   405  C C     . VAL A 1 62  ? 33.936 65.768 175.411 1.00 37.61  ? 62  VAL A C     1 
ATOM   406  O O     . VAL A 1 62  ? 33.147 65.851 176.350 1.00 37.31  ? 62  VAL A O     1 
ATOM   407  C CB    . VAL A 1 62  ? 35.772 67.271 174.651 1.00 36.37  ? 62  VAL A CB    1 
ATOM   408  C CG1   . VAL A 1 62  ? 34.798 68.413 174.843 1.00 36.50  ? 62  VAL A CG1   1 
ATOM   409  C CG2   . VAL A 1 62  ? 37.186 67.748 174.912 1.00 37.18  ? 62  VAL A CG2   1 
ATOM   410  N N     . SER A 1 63  ? 33.569 65.384 174.195 1.00 37.19  ? 63  SER A N     1 
ATOM   411  C CA    . SER A 1 63  ? 32.178 65.087 173.878 1.00 37.18  ? 63  SER A CA    1 
ATOM   412  C C     . SER A 1 63  ? 31.796 63.616 173.860 1.00 36.84  ? 63  SER A C     1 
ATOM   413  O O     . SER A 1 63  ? 30.610 63.292 173.871 1.00 37.13  ? 63  SER A O     1 
ATOM   414  C CB    . SER A 1 63  ? 31.831 65.686 172.521 1.00 38.03  ? 63  SER A CB    1 
ATOM   415  O OG    . SER A 1 63  ? 32.645 65.108 171.515 1.00 39.11  ? 63  SER A OG    1 
ATOM   416  N N     . GLY A 1 64  ? 32.786 62.729 173.825 1.00 37.28  ? 64  GLY A N     1 
ATOM   417  C CA    . GLY A 1 64  ? 32.493 61.306 173.770 1.00 35.86  ? 64  GLY A CA    1 
ATOM   418  C C     . GLY A 1 64  ? 32.627 60.815 172.334 1.00 36.00  ? 64  GLY A C     1 
ATOM   419  O O     . GLY A 1 64  ? 32.430 59.638 172.034 1.00 35.05  ? 64  GLY A O     1 
ATOM   420  N N     . ALA A 1 65  ? 32.950 61.749 171.443 1.00 35.48  ? 65  ALA A N     1 
ATOM   421  C CA    . ALA A 1 65  ? 33.159 61.481 170.026 1.00 34.48  ? 65  ALA A CA    1 
ATOM   422  C C     . ALA A 1 65  ? 32.073 60.721 169.265 1.00 34.74  ? 65  ALA A C     1 
ATOM   423  O O     . ALA A 1 65  ? 32.310 59.607 168.804 1.00 33.12  ? 65  ALA A O     1 
ATOM   424  C CB    . ALA A 1 65  ? 34.502 60.776 169.836 1.00 33.93  ? 65  ALA A CB    1 
ATOM   425  N N     . HIS A 1 66  ? 30.893 61.320 169.122 1.00 33.33  ? 66  HIS A N     1 
ATOM   426  C CA    . HIS A 1 66  ? 29.827 60.683 168.356 1.00 33.04  ? 66  HIS A CA    1 
ATOM   427  C C     . HIS A 1 66  ? 30.192 60.911 166.890 1.00 32.27  ? 66  HIS A C     1 
ATOM   428  O O     . HIS A 1 66  ? 30.346 59.962 166.127 1.00 32.43  ? 66  HIS A O     1 
ATOM   429  C CB    . HIS A 1 66  ? 28.465 61.325 168.643 1.00 34.48  ? 66  HIS A CB    1 
ATOM   430  C CG    . HIS A 1 66  ? 27.961 61.094 170.033 1.00 36.54  ? 66  HIS A CG    1 
ATOM   431  N ND1   . HIS A 1 66  ? 26.674 61.405 170.415 1.00 37.77  ? 66  HIS A ND1   1 
ATOM   432  C CD2   . HIS A 1 66  ? 28.574 60.608 171.140 1.00 37.22  ? 66  HIS A CD2   1 
ATOM   433  C CE1   . HIS A 1 66  ? 26.515 61.122 171.695 1.00 38.57  ? 66  HIS A CE1   1 
ATOM   434  N NE2   . HIS A 1 66  ? 27.654 60.638 172.159 1.00 39.48  ? 66  HIS A NE2   1 
ATOM   435  N N     . LEU A 1 67  ? 30.321 62.183 166.516 1.00 29.91  ? 67  LEU A N     1 
ATOM   436  C CA    . LEU A 1 67  ? 30.696 62.585 165.164 1.00 29.97  ? 67  LEU A CA    1 
ATOM   437  C C     . LEU A 1 67  ? 29.819 61.917 164.126 1.00 29.62  ? 67  LEU A C     1 
ATOM   438  O O     . LEU A 1 67  ? 30.247 61.711 162.986 1.00 29.36  ? 67  LEU A O     1 
ATOM   439  C CB    . LEU A 1 67  ? 32.155 62.200 164.895 1.00 29.61  ? 67  LEU A CB    1 
ATOM   440  C CG    . LEU A 1 67  ? 33.164 62.459 166.019 1.00 29.58  ? 67  LEU A CG    1 
ATOM   441  C CD1   . LEU A 1 67  ? 34.524 61.956 165.587 1.00 29.51  ? 67  LEU A CD1   1 
ATOM   442  C CD2   . LEU A 1 67  ? 33.219 63.938 166.360 1.00 27.80  ? 67  LEU A CD2   1 
ATOM   443  N N     . ASN A 1 68  ? 28.594 61.590 164.517 1.00 27.80  ? 68  ASN A N     1 
ATOM   444  C CA    . ASN A 1 68  ? 27.668 60.892 163.632 1.00 27.83  ? 68  ASN A CA    1 
ATOM   445  C C     . ASN A 1 68  ? 26.251 60.965 164.212 1.00 28.07  ? 68  ASN A C     1 
ATOM   446  O O     . ASN A 1 68  ? 25.995 60.458 165.306 1.00 27.32  ? 68  ASN A O     1 
ATOM   447  C CB    . ASN A 1 68  ? 28.104 59.419 163.522 1.00 25.33  ? 68  ASN A CB    1 
ATOM   448  C CG    . ASN A 1 68  ? 27.283 58.629 162.520 1.00 24.85  ? 68  ASN A CG    1 
ATOM   449  O OD1   . ASN A 1 68  ? 26.159 59.003 162.181 1.00 23.84  ? 68  ASN A OD1   1 
ATOM   450  N ND2   . ASN A 1 68  ? 27.838 57.514 162.051 1.00 25.08  ? 68  ASN A ND2   1 
ATOM   451  N N     . PRO A 1 69  ? 25.316 61.595 163.488 1.00 26.55  ? 69  PRO A N     1 
ATOM   452  C CA    . PRO A 1 69  ? 23.932 61.714 163.959 1.00 28.78  ? 69  PRO A CA    1 
ATOM   453  C C     . PRO A 1 69  ? 23.277 60.367 164.301 1.00 30.20  ? 69  PRO A C     1 
ATOM   454  O O     . PRO A 1 69  ? 22.508 60.265 165.259 1.00 30.41  ? 69  PRO A O     1 
ATOM   455  C CB    . PRO A 1 69  ? 23.230 62.412 162.791 1.00 27.07  ? 69  PRO A CB    1 
ATOM   456  C CG    . PRO A 1 69  ? 24.323 63.277 162.214 1.00 26.76  ? 69  PRO A CG    1 
ATOM   457  C CD    . PRO A 1 69  ? 25.519 62.350 162.236 1.00 27.08  ? 69  PRO A CD    1 
ATOM   458  N N     . ALA A 1 70  ? 23.573 59.337 163.515 1.00 30.46  ? 70  ALA A N     1 
ATOM   459  C CA    . ALA A 1 70  ? 22.986 58.022 163.751 1.00 29.53  ? 70  ALA A CA    1 
ATOM   460  C C     . ALA A 1 70  ? 23.469 57.464 165.080 1.00 29.67  ? 70  ALA A C     1 
ATOM   461  O O     . ALA A 1 70  ? 22.720 56.806 165.795 1.00 31.27  ? 70  ALA A O     1 
ATOM   462  C CB    . ALA A 1 70  ? 23.342 57.069 162.616 1.00 28.38  ? 70  ALA A CB    1 
ATOM   463  N N     . VAL A 1 71  ? 24.726 57.728 165.408 1.00 29.89  ? 71  VAL A N     1 
ATOM   464  C CA    . VAL A 1 71  ? 25.289 57.255 166.662 1.00 29.57  ? 71  VAL A CA    1 
ATOM   465  C C     . VAL A 1 71  ? 24.703 58.042 167.839 1.00 31.81  ? 71  VAL A C     1 
ATOM   466  O O     . VAL A 1 71  ? 24.391 57.467 168.886 1.00 32.01  ? 71  VAL A O     1 
ATOM   467  C CB    . VAL A 1 71  ? 26.829 57.375 166.644 1.00 28.50  ? 71  VAL A CB    1 
ATOM   468  C CG1   . VAL A 1 71  ? 27.405 57.235 168.056 1.00 25.85  ? 71  VAL A CG1   1 
ATOM   469  C CG2   . VAL A 1 71  ? 27.407 56.293 165.726 1.00 25.19  ? 71  VAL A CG2   1 
ATOM   470  N N     . THR A 1 72  ? 24.541 59.350 167.663 1.00 31.49  ? 72  THR A N     1 
ATOM   471  C CA    . THR A 1 72  ? 23.981 60.183 168.720 1.00 33.34  ? 72  THR A CA    1 
ATOM   472  C C     . THR A 1 72  ? 22.563 59.728 169.066 1.00 35.01  ? 72  THR A C     1 
ATOM   473  O O     . THR A 1 72  ? 22.232 59.528 170.237 1.00 35.81  ? 72  THR A O     1 
ATOM   474  C CB    . THR A 1 72  ? 23.954 61.663 168.300 1.00 32.37  ? 72  THR A CB    1 
ATOM   475  O OG1   . THR A 1 72  ? 25.292 62.178 168.307 1.00 30.66  ? 72  THR A OG1   1 
ATOM   476  C CG2   . THR A 1 72  ? 23.090 62.479 169.253 1.00 31.42  ? 72  THR A CG2   1 
ATOM   477  N N     . ILE A 1 73  ? 21.736 59.557 168.040 1.00 34.69  ? 73  ILE A N     1 
ATOM   478  C CA    . ILE A 1 73  ? 20.359 59.124 168.224 1.00 35.07  ? 73  ILE A CA    1 
ATOM   479  C C     . ILE A 1 73  ? 20.283 57.735 168.869 1.00 38.05  ? 73  ILE A C     1 
ATOM   480  O O     . ILE A 1 73  ? 19.453 57.496 169.748 1.00 38.71  ? 73  ILE A O     1 
ATOM   481  C CB    . ILE A 1 73  ? 19.608 59.108 166.869 1.00 31.72  ? 73  ILE A CB    1 
ATOM   482  C CG1   . ILE A 1 73  ? 19.466 60.538 166.345 1.00 29.78  ? 73  ILE A CG1   1 
ATOM   483  C CG2   . ILE A 1 73  ? 18.248 58.452 167.024 1.00 29.81  ? 73  ILE A CG2   1 
ATOM   484  C CD1   . ILE A 1 73  ? 18.826 60.638 164.982 1.00 28.00  ? 73  ILE A CD1   1 
ATOM   485  N N     . ALA A 1 74  ? 21.150 56.823 168.440 1.00 38.29  ? 74  ALA A N     1 
ATOM   486  C CA    . ALA A 1 74  ? 21.150 55.474 168.993 1.00 40.04  ? 74  ALA A CA    1 
ATOM   487  C C     . ALA A 1 74  ? 21.610 55.460 170.451 1.00 40.46  ? 74  ALA A C     1 
ATOM   488  O O     . ALA A 1 74  ? 21.087 54.697 171.259 1.00 41.73  ? 74  ALA A O     1 
ATOM   489  C CB    . ALA A 1 74  ? 22.037 54.555 168.151 1.00 39.04  ? 74  ALA A CB    1 
ATOM   490  N N     . LEU A 1 75  ? 22.588 56.295 170.785 1.00 41.01  ? 75  LEU A N     1 
ATOM   491  C CA    . LEU A 1 75  ? 23.092 56.351 172.155 1.00 41.70  ? 75  LEU A CA    1 
ATOM   492  C C     . LEU A 1 75  ? 22.048 56.996 173.060 1.00 43.38  ? 75  LEU A C     1 
ATOM   493  O O     . LEU A 1 75  ? 22.053 56.805 174.277 1.00 42.31  ? 75  LEU A O     1 
ATOM   494  C CB    . LEU A 1 75  ? 24.402 57.143 172.215 1.00 39.43  ? 75  LEU A CB    1 
ATOM   495  C CG    . LEU A 1 75  ? 25.623 56.506 171.545 1.00 36.68  ? 75  LEU A CG    1 
ATOM   496  C CD1   . LEU A 1 75  ? 26.825 57.419 171.712 1.00 35.61  ? 75  LEU A CD1   1 
ATOM   497  C CD2   . LEU A 1 75  ? 25.908 55.152 172.168 1.00 36.40  ? 75  LEU A CD2   1 
ATOM   498  N N     . TRP A 1 76  ? 21.160 57.773 172.452 1.00 44.36  ? 76  TRP A N     1 
ATOM   499  C CA    . TRP A 1 76  ? 20.089 58.428 173.185 1.00 45.11  ? 76  TRP A CA    1 
ATOM   500  C C     . TRP A 1 76  ? 19.023 57.378 173.491 1.00 45.60  ? 76  TRP A C     1 
ATOM   501  O O     . TRP A 1 76  ? 18.504 57.306 174.603 1.00 47.12  ? 76  TRP A O     1 
ATOM   502  C CB    . TRP A 1 76  ? 19.500 59.569 172.344 1.00 43.65  ? 76  TRP A CB    1 
ATOM   503  C CG    . TRP A 1 76  ? 18.134 60.012 172.771 1.00 44.69  ? 76  TRP A CG    1 
ATOM   504  C CD1   . TRP A 1 76  ? 17.744 60.385 174.029 1.00 44.51  ? 76  TRP A CD1   1 
ATOM   505  C CD2   . TRP A 1 76  ? 16.969 60.128 171.938 1.00 43.81  ? 76  TRP A CD2   1 
ATOM   506  N NE1   . TRP A 1 76  ? 16.409 60.719 174.030 1.00 43.11  ? 76  TRP A NE1   1 
ATOM   507  C CE2   . TRP A 1 76  ? 15.909 60.570 172.764 1.00 42.81  ? 76  TRP A CE2   1 
ATOM   508  C CE3   . TRP A 1 76  ? 16.719 59.896 170.578 1.00 43.08  ? 76  TRP A CE3   1 
ATOM   509  C CZ2   . TRP A 1 76  ? 14.618 60.790 172.273 1.00 42.00  ? 76  TRP A CZ2   1 
ATOM   510  C CZ3   . TRP A 1 76  ? 15.433 60.114 170.088 1.00 43.31  ? 76  TRP A CZ3   1 
ATOM   511  C CH2   . TRP A 1 76  ? 14.398 60.556 170.939 1.00 43.83  ? 76  TRP A CH2   1 
ATOM   512  N N     . LEU A 1 77  ? 18.721 56.549 172.499 1.00 45.26  ? 77  LEU A N     1 
ATOM   513  C CA    . LEU A 1 77  ? 17.715 55.510 172.651 1.00 45.10  ? 77  LEU A CA    1 
ATOM   514  C C     . LEU A 1 77  ? 18.172 54.271 173.420 1.00 45.81  ? 77  LEU A C     1 
ATOM   515  O O     . LEU A 1 77  ? 17.345 53.580 174.003 1.00 47.02  ? 77  LEU A O     1 
ATOM   516  C CB    . LEU A 1 77  ? 17.201 55.078 171.277 1.00 43.59  ? 77  LEU A CB    1 
ATOM   517  C CG    . LEU A 1 77  ? 16.540 56.163 170.426 1.00 44.14  ? 77  LEU A CG    1 
ATOM   518  C CD1   . LEU A 1 77  ? 16.133 55.575 169.082 1.00 43.19  ? 77  LEU A CD1   1 
ATOM   519  C CD2   . LEU A 1 77  ? 15.329 56.725 171.155 1.00 44.46  ? 77  LEU A CD2   1 
ATOM   520  N N     . PHE A 1 78  ? 19.471 53.984 173.435 1.00 46.82  ? 78  PHE A N     1 
ATOM   521  C CA    . PHE A 1 78  ? 19.949 52.791 174.131 1.00 47.36  ? 78  PHE A CA    1 
ATOM   522  C C     . PHE A 1 78  ? 21.126 52.980 175.079 1.00 48.21  ? 78  PHE A C     1 
ATOM   523  O O     . PHE A 1 78  ? 21.647 51.999 175.608 1.00 49.12  ? 78  PHE A O     1 
ATOM   524  C CB    . PHE A 1 78  ? 20.332 51.700 173.123 1.00 48.27  ? 78  PHE A CB    1 
ATOM   525  C CG    . PHE A 1 78  ? 19.243 51.352 172.156 1.00 48.28  ? 78  PHE A CG    1 
ATOM   526  C CD1   . PHE A 1 78  ? 19.079 52.079 170.984 1.00 48.59  ? 78  PHE A CD1   1 
ATOM   527  C CD2   . PHE A 1 78  ? 18.376 50.297 172.419 1.00 49.31  ? 78  PHE A CD2   1 
ATOM   528  C CE1   . PHE A 1 78  ? 18.065 51.761 170.084 1.00 49.10  ? 78  PHE A CE1   1 
ATOM   529  C CE2   . PHE A 1 78  ? 17.356 49.969 171.527 1.00 49.26  ? 78  PHE A CE2   1 
ATOM   530  C CZ    . PHE A 1 78  ? 17.203 50.704 170.357 1.00 48.96  ? 78  PHE A CZ    1 
ATOM   531  N N     . ALA A 1 79  ? 21.560 54.214 175.300 1.00 48.75  ? 79  ALA A N     1 
ATOM   532  C CA    . ALA A 1 79  ? 22.692 54.431 176.196 1.00 50.66  ? 79  ALA A CA    1 
ATOM   533  C C     . ALA A 1 79  ? 22.482 55.580 177.174 1.00 52.44  ? 79  ALA A C     1 
ATOM   534  O O     . ALA A 1 79  ? 23.436 56.071 177.779 1.00 53.68  ? 79  ALA A O     1 
ATOM   535  C CB    . ALA A 1 79  ? 23.961 54.657 175.385 1.00 50.13  ? 79  ALA A CB    1 
ATOM   536  N N     . CYS A 1 80  ? 21.232 56.010 177.322 1.00 53.86  ? 80  CYS A N     1 
ATOM   537  C CA    . CYS A 1 80  ? 20.891 57.091 178.242 1.00 55.07  ? 80  CYS A CA    1 
ATOM   538  C C     . CYS A 1 80  ? 21.586 58.422 177.945 1.00 53.31  ? 80  CYS A C     1 
ATOM   539  O O     . CYS A 1 80  ? 21.804 59.227 178.850 1.00 54.23  ? 80  CYS A O     1 
ATOM   540  C CB    . CYS A 1 80  ? 21.198 56.661 179.683 1.00 57.03  ? 80  CYS A CB    1 
ATOM   541  S SG    . CYS A 1 80  ? 20.281 55.193 180.237 1.00 64.28  ? 80  CYS A SG    1 
ATOM   542  N N     . PHE A 1 81  ? 21.935 58.655 176.683 1.00 50.85  ? 81  PHE A N     1 
ATOM   543  C CA    . PHE A 1 81  ? 22.579 59.910 176.304 1.00 47.00  ? 81  PHE A CA    1 
ATOM   544  C C     . PHE A 1 81  ? 21.528 61.008 176.474 1.00 47.43  ? 81  PHE A C     1 
ATOM   545  O O     . PHE A 1 81  ? 20.385 60.841 176.053 1.00 47.02  ? 81  PHE A O     1 
ATOM   546  C CB    . PHE A 1 81  ? 23.050 59.854 174.845 1.00 40.78  ? 81  PHE A CB    1 
ATOM   547  C CG    . PHE A 1 81  ? 23.700 61.122 174.368 1.00 34.86  ? 81  PHE A CG    1 
ATOM   548  C CD1   . PHE A 1 81  ? 24.979 61.458 174.778 1.00 32.05  ? 81  PHE A CD1   1 
ATOM   549  C CD2   . PHE A 1 81  ? 23.015 61.996 173.533 1.00 33.01  ? 81  PHE A CD2   1 
ATOM   550  C CE1   . PHE A 1 81  ? 25.569 62.649 174.362 1.00 31.70  ? 81  PHE A CE1   1 
ATOM   551  C CE2   . PHE A 1 81  ? 23.593 63.186 173.112 1.00 31.62  ? 81  PHE A CE2   1 
ATOM   552  C CZ    . PHE A 1 81  ? 24.872 63.515 173.528 1.00 31.36  ? 81  PHE A CZ    1 
ATOM   553  N N     . ASP A 1 82  ? 21.918 62.121 177.089 1.00 48.45  ? 82  ASP A N     1 
ATOM   554  C CA    . ASP A 1 82  ? 21.001 63.234 177.333 1.00 50.03  ? 82  ASP A CA    1 
ATOM   555  C C     . ASP A 1 82  ? 20.296 63.731 176.068 1.00 49.45  ? 82  ASP A C     1 
ATOM   556  O O     . ASP A 1 82  ? 20.931 64.249 175.151 1.00 48.72  ? 82  ASP A O     1 
ATOM   557  C CB    . ASP A 1 82  ? 21.755 64.386 178.012 1.00 51.92  ? 82  ASP A CB    1 
ATOM   558  C CG    . ASP A 1 82  ? 20.843 65.545 178.387 1.00 55.55  ? 82  ASP A CG    1 
ATOM   559  O OD1   . ASP A 1 82  ? 19.716 65.295 178.869 1.00 56.67  ? 82  ASP A OD1   1 
ATOM   560  O OD2   . ASP A 1 82  ? 21.254 66.710 178.211 1.00 58.57  ? 82  ASP A OD2   1 
ATOM   561  N N     . LYS A 1 83  ? 18.974 63.586 176.039 1.00 49.71  ? 83  LYS A N     1 
ATOM   562  C CA    . LYS A 1 83  ? 18.181 63.999 174.886 1.00 51.37  ? 83  LYS A CA    1 
ATOM   563  C C     . LYS A 1 83  ? 18.271 65.488 174.572 1.00 50.88  ? 83  LYS A C     1 
ATOM   564  O O     . LYS A 1 83  ? 18.019 65.904 173.441 1.00 50.47  ? 83  LYS A O     1 
ATOM   565  C CB    . LYS A 1 83  ? 16.713 63.612 175.082 1.00 53.51  ? 83  LYS A CB    1 
ATOM   566  C CG    . LYS A 1 83  ? 15.981 64.404 176.149 1.00 57.33  ? 83  LYS A CG    1 
ATOM   567  C CD    . LYS A 1 83  ? 14.519 63.982 176.225 1.00 61.23  ? 83  LYS A CD    1 
ATOM   568  C CE    . LYS A 1 83  ? 13.736 64.820 177.233 1.00 63.58  ? 83  LYS A CE    1 
ATOM   569  N NZ    . LYS A 1 83  ? 13.673 66.261 176.845 1.00 65.21  ? 83  LYS A NZ    1 
ATOM   570  N N     . ARG A 1 84  ? 18.623 66.294 175.567 1.00 50.95  ? 84  ARG A N     1 
ATOM   571  C CA    . ARG A 1 84  ? 18.741 67.734 175.359 1.00 51.55  ? 84  ARG A CA    1 
ATOM   572  C C     . ARG A 1 84  ? 19.977 68.085 174.532 1.00 50.50  ? 84  ARG A C     1 
ATOM   573  O O     . ARG A 1 84  ? 20.081 69.187 173.991 1.00 50.48  ? 84  ARG A O     1 
ATOM   574  C CB    . ARG A 1 84  ? 18.812 68.457 176.705 1.00 54.25  ? 84  ARG A CB    1 
ATOM   575  C CG    . ARG A 1 84  ? 17.533 68.388 177.521 1.00 59.10  ? 84  ARG A CG    1 
ATOM   576  C CD    . ARG A 1 84  ? 17.761 68.924 178.925 1.00 62.96  ? 84  ARG A CD    1 
ATOM   577  N NE    . ARG A 1 84  ? 18.747 68.126 179.651 1.00 66.99  ? 84  ARG A NE    1 
ATOM   578  C CZ    . ARG A 1 84  ? 19.156 68.383 180.890 1.00 69.20  ? 84  ARG A CZ    1 
ATOM   579  N NH1   . ARG A 1 84  ? 18.665 69.423 181.551 1.00 70.71  ? 84  ARG A NH1   1 
ATOM   580  N NH2   . ARG A 1 84  ? 20.055 67.598 181.471 1.00 69.75  ? 84  ARG A NH2   1 
ATOM   581  N N     . LYS A 1 85  ? 20.910 67.142 174.433 1.00 48.35  ? 85  LYS A N     1 
ATOM   582  C CA    . LYS A 1 85  ? 22.144 67.364 173.689 1.00 46.33  ? 85  LYS A CA    1 
ATOM   583  C C     . LYS A 1 85  ? 22.112 66.740 172.297 1.00 44.23  ? 85  LYS A C     1 
ATOM   584  O O     . LYS A 1 85  ? 23.021 66.951 171.497 1.00 43.50  ? 85  LYS A O     1 
ATOM   585  C CB    . LYS A 1 85  ? 23.318 66.795 174.482 1.00 47.60  ? 85  LYS A CB    1 
ATOM   586  C CG    . LYS A 1 85  ? 23.309 67.216 175.937 1.00 49.57  ? 85  LYS A CG    1 
ATOM   587  C CD    . LYS A 1 85  ? 24.215 66.335 176.774 1.00 51.89  ? 85  LYS A CD    1 
ATOM   588  C CE    . LYS A 1 85  ? 25.653 66.769 176.683 1.00 52.64  ? 85  LYS A CE    1 
ATOM   589  N NZ    . LYS A 1 85  ? 25.822 68.122 177.274 1.00 54.26  ? 85  LYS A NZ    1 
ATOM   590  N N     . VAL A 1 86  ? 21.062 65.978 172.011 1.00 42.08  ? 86  VAL A N     1 
ATOM   591  C CA    . VAL A 1 86  ? 20.922 65.317 170.719 1.00 40.94  ? 86  VAL A CA    1 
ATOM   592  C C     . VAL A 1 86  ? 20.949 66.279 169.531 1.00 40.76  ? 86  VAL A C     1 
ATOM   593  O O     . VAL A 1 86  ? 21.771 66.131 168.629 1.00 42.43  ? 86  VAL A O     1 
ATOM   594  C CB    . VAL A 1 86  ? 19.629 64.477 170.670 1.00 39.88  ? 86  VAL A CB    1 
ATOM   595  C CG1   . VAL A 1 86  ? 19.378 63.978 169.258 1.00 40.64  ? 86  VAL A CG1   1 
ATOM   596  C CG2   . VAL A 1 86  ? 19.751 63.297 171.620 1.00 39.46  ? 86  VAL A CG2   1 
ATOM   597  N N     . ILE A 1 87  ? 20.061 67.264 169.524 1.00 39.26  ? 87  ILE A N     1 
ATOM   598  C CA    . ILE A 1 87  ? 20.023 68.221 168.425 1.00 39.19  ? 87  ILE A CA    1 
ATOM   599  C C     . ILE A 1 87  ? 21.265 69.122 168.365 1.00 39.04  ? 87  ILE A C     1 
ATOM   600  O O     . ILE A 1 87  ? 21.758 69.433 167.281 1.00 39.08  ? 87  ILE A O     1 
ATOM   601  C CB    . ILE A 1 87  ? 18.742 69.078 168.494 1.00 38.91  ? 87  ILE A CB    1 
ATOM   602  C CG1   . ILE A 1 87  ? 17.520 68.166 168.337 1.00 38.76  ? 87  ILE A CG1   1 
ATOM   603  C CG2   . ILE A 1 87  ? 18.751 70.129 167.401 1.00 37.75  ? 87  ILE A CG2   1 
ATOM   604  C CD1   . ILE A 1 87  ? 16.195 68.868 168.493 1.00 41.40  ? 87  ILE A CD1   1 
ATOM   605  N N     . PRO A 1 88  ? 21.779 69.567 169.527 1.00 38.91  ? 88  PRO A N     1 
ATOM   606  C CA    . PRO A 1 88  ? 22.974 70.421 169.492 1.00 38.09  ? 88  PRO A CA    1 
ATOM   607  C C     . PRO A 1 88  ? 24.167 69.669 168.892 1.00 36.58  ? 88  PRO A C     1 
ATOM   608  O O     . PRO A 1 88  ? 24.990 70.249 168.185 1.00 37.98  ? 88  PRO A O     1 
ATOM   609  C CB    . PRO A 1 88  ? 23.189 70.774 170.964 1.00 37.02  ? 88  PRO A CB    1 
ATOM   610  C CG    . PRO A 1 88  ? 21.786 70.824 171.490 1.00 36.99  ? 88  PRO A CG    1 
ATOM   611  C CD    . PRO A 1 88  ? 21.164 69.588 170.869 1.00 39.07  ? 88  PRO A CD    1 
ATOM   612  N N     . PHE A 1 89  ? 24.254 68.376 169.185 1.00 34.10  ? 89  PHE A N     1 
ATOM   613  C CA    . PHE A 1 89  ? 25.329 67.549 168.658 1.00 33.04  ? 89  PHE A CA    1 
ATOM   614  C C     . PHE A 1 89  ? 25.163 67.384 167.153 1.00 32.32  ? 89  PHE A C     1 
ATOM   615  O O     . PHE A 1 89  ? 26.114 67.539 166.391 1.00 32.17  ? 89  PHE A O     1 
ATOM   616  C CB    . PHE A 1 89  ? 25.319 66.159 169.304 1.00 31.65  ? 89  PHE A CB    1 
ATOM   617  C CG    . PHE A 1 89  ? 26.229 66.029 170.489 1.00 32.57  ? 89  PHE A CG    1 
ATOM   618  C CD1   . PHE A 1 89  ? 26.931 64.845 170.707 1.00 32.03  ? 89  PHE A CD1   1 
ATOM   619  C CD2   . PHE A 1 89  ? 26.382 67.078 171.393 1.00 32.63  ? 89  PHE A CD2   1 
ATOM   620  C CE1   . PHE A 1 89  ? 27.775 64.703 171.807 1.00 33.14  ? 89  PHE A CE1   1 
ATOM   621  C CE2   . PHE A 1 89  ? 27.220 66.951 172.498 1.00 33.41  ? 89  PHE A CE2   1 
ATOM   622  C CZ    . PHE A 1 89  ? 27.920 65.760 172.707 1.00 33.90  ? 89  PHE A CZ    1 
ATOM   623  N N     . ILE A 1 90  ? 23.944 67.075 166.729 1.00 30.99  ? 90  ILE A N     1 
ATOM   624  C CA    . ILE A 1 90  ? 23.674 66.858 165.317 1.00 30.42  ? 90  ILE A CA    1 
ATOM   625  C C     . ILE A 1 90  ? 23.912 68.082 164.443 1.00 30.48  ? 90  ILE A C     1 
ATOM   626  O O     . ILE A 1 90  ? 24.396 67.952 163.319 1.00 29.53  ? 90  ILE A O     1 
ATOM   627  C CB    . ILE A 1 90  ? 22.244 66.323 165.112 1.00 27.70  ? 90  ILE A CB    1 
ATOM   628  C CG1   . ILE A 1 90  ? 22.126 64.949 165.775 1.00 27.08  ? 90  ILE A CG1   1 
ATOM   629  C CG2   . ILE A 1 90  ? 21.917 66.236 163.627 1.00 28.00  ? 90  ILE A CG2   1 
ATOM   630  C CD1   . ILE A 1 90  ? 20.761 64.314 165.664 1.00 28.31  ? 90  ILE A CD1   1 
ATOM   631  N N     . VAL A 1 91  ? 23.585 69.268 164.948 1.00 30.59  ? 91  VAL A N     1 
ATOM   632  C CA    . VAL A 1 91  ? 23.802 70.481 164.163 1.00 30.04  ? 91  VAL A CA    1 
ATOM   633  C C     . VAL A 1 91  ? 25.300 70.755 164.053 1.00 29.81  ? 91  VAL A C     1 
ATOM   634  O O     . VAL A 1 91  ? 25.776 71.232 163.019 1.00 29.99  ? 91  VAL A O     1 
ATOM   635  C CB    . VAL A 1 91  ? 23.091 71.705 164.796 1.00 30.09  ? 91  VAL A CB    1 
ATOM   636  C CG1   . VAL A 1 91  ? 23.430 72.979 164.019 1.00 26.20  ? 91  VAL A CG1   1 
ATOM   637  C CG2   . VAL A 1 91  ? 21.587 71.479 164.790 1.00 28.58  ? 91  VAL A CG2   1 
ATOM   638  N N     . SER A 1 92  ? 26.033 70.445 165.121 1.00 28.88  ? 92  SER A N     1 
ATOM   639  C CA    . SER A 1 92  ? 27.483 70.629 165.153 1.00 28.90  ? 92  SER A CA    1 
ATOM   640  C C     . SER A 1 92  ? 28.159 69.657 164.174 1.00 28.11  ? 92  SER A C     1 
ATOM   641  O O     . SER A 1 92  ? 29.083 70.021 163.447 1.00 26.59  ? 92  SER A O     1 
ATOM   642  C CB    . SER A 1 92  ? 28.015 70.369 166.568 1.00 30.11  ? 92  SER A CB    1 
ATOM   643  O OG    . SER A 1 92  ? 27.443 71.259 167.509 1.00 32.61  ? 92  SER A OG    1 
ATOM   644  N N     . GLN A 1 93  ? 27.691 68.414 164.167 1.00 26.46  ? 93  GLN A N     1 
ATOM   645  C CA    . GLN A 1 93  ? 28.243 67.401 163.280 1.00 25.91  ? 93  GLN A CA    1 
ATOM   646  C C     . GLN A 1 93  ? 28.085 67.808 161.815 1.00 25.38  ? 93  GLN A C     1 
ATOM   647  O O     . GLN A 1 93  ? 29.057 67.801 161.062 1.00 24.38  ? 93  GLN A O     1 
ATOM   648  C CB    . GLN A 1 93  ? 27.564 66.060 163.558 1.00 24.36  ? 93  GLN A CB    1 
ATOM   649  C CG    . GLN A 1 93  ? 27.935 65.492 164.925 1.00 23.71  ? 93  GLN A CG    1 
ATOM   650  C CD    . GLN A 1 93  ? 26.903 64.526 165.464 1.00 24.66  ? 93  GLN A CD    1 
ATOM   651  O OE1   . GLN A 1 93  ? 25.905 64.242 164.808 1.00 24.49  ? 93  GLN A OE1   1 
ATOM   652  N NE2   . GLN A 1 93  ? 27.138 64.015 166.672 1.00 21.56  ? 93  GLN A NE2   1 
ATOM   653  N N     . VAL A 1 94  ? 26.870 68.186 161.428 1.00 25.19  ? 94  VAL A N     1 
ATOM   654  C CA    . VAL A 1 94  ? 26.579 68.604 160.058 1.00 26.80  ? 94  VAL A CA    1 
ATOM   655  C C     . VAL A 1 94  ? 27.332 69.877 159.648 1.00 28.26  ? 94  VAL A C     1 
ATOM   656  O O     . VAL A 1 94  ? 27.764 70.008 158.502 1.00 29.13  ? 94  VAL A O     1 
ATOM   657  C CB    . VAL A 1 94  ? 25.068 68.867 159.858 1.00 27.43  ? 94  VAL A CB    1 
ATOM   658  C CG1   . VAL A 1 94  ? 24.792 69.169 158.400 1.00 26.08  ? 94  VAL A CG1   1 
ATOM   659  C CG2   . VAL A 1 94  ? 24.251 67.668 160.325 1.00 26.92  ? 94  VAL A CG2   1 
ATOM   660  N N     . ALA A 1 95  ? 27.477 70.820 160.575 1.00 28.57  ? 95  ALA A N     1 
ATOM   661  C CA    . ALA A 1 95  ? 28.184 72.063 160.275 1.00 27.81  ? 95  ALA A CA    1 
ATOM   662  C C     . ALA A 1 95  ? 29.670 71.795 160.058 1.00 27.37  ? 95  ALA A C     1 
ATOM   663  O O     . ALA A 1 95  ? 30.286 72.377 159.168 1.00 29.23  ? 95  ALA A O     1 
ATOM   664  C CB    . ALA A 1 95  ? 27.993 73.073 161.410 1.00 28.02  ? 95  ALA A CB    1 
ATOM   665  N N     . GLY A 1 96  ? 30.241 70.916 160.875 1.00 26.58  ? 96  GLY A N     1 
ATOM   666  C CA    . GLY A 1 96  ? 31.652 70.593 160.743 1.00 24.85  ? 96  GLY A CA    1 
ATOM   667  C C     . GLY A 1 96  ? 31.951 69.875 159.440 1.00 23.99  ? 96  GLY A C     1 
ATOM   668  O O     . GLY A 1 96  ? 32.958 70.141 158.789 1.00 25.36  ? 96  GLY A O     1 
ATOM   669  N N     . ALA A 1 97  ? 31.071 68.960 159.055 1.00 22.54  ? 97  ALA A N     1 
ATOM   670  C CA    . ALA A 1 97  ? 31.247 68.207 157.822 1.00 23.48  ? 97  ALA A CA    1 
ATOM   671  C C     . ALA A 1 97  ? 31.181 69.156 156.632 1.00 23.24  ? 97  ALA A C     1 
ATOM   672  O O     . ALA A 1 97  ? 31.983 69.056 155.708 1.00 23.69  ? 97  ALA A O     1 
ATOM   673  C CB    . ALA A 1 97  ? 30.166 67.123 157.704 1.00 20.59  ? 97  ALA A CB    1 
ATOM   674  N N     . PHE A 1 98  ? 30.223 70.078 156.670 1.00 23.88  ? 98  PHE A N     1 
ATOM   675  C CA    . PHE A 1 98  ? 30.043 71.059 155.606 1.00 23.88  ? 98  PHE A CA    1 
ATOM   676  C C     . PHE A 1 98  ? 31.284 71.931 155.437 1.00 24.87  ? 98  PHE A C     1 
ATOM   677  O O     . PHE A 1 98  ? 31.772 72.120 154.322 1.00 24.52  ? 98  PHE A O     1 
ATOM   678  C CB    . PHE A 1 98  ? 28.836 71.954 155.918 1.00 25.53  ? 98  PHE A CB    1 
ATOM   679  C CG    . PHE A 1 98  ? 28.672 73.110 154.967 1.00 25.63  ? 98  PHE A CG    1 
ATOM   680  C CD1   . PHE A 1 98  ? 28.022 72.942 153.750 1.00 25.12  ? 98  PHE A CD1   1 
ATOM   681  C CD2   . PHE A 1 98  ? 29.198 74.365 155.281 1.00 26.25  ? 98  PHE A CD2   1 
ATOM   682  C CE1   . PHE A 1 98  ? 27.897 74.006 152.854 1.00 26.72  ? 98  PHE A CE1   1 
ATOM   683  C CE2   . PHE A 1 98  ? 29.081 75.437 154.393 1.00 27.51  ? 98  PHE A CE2   1 
ATOM   684  C CZ    . PHE A 1 98  ? 28.430 75.258 153.178 1.00 26.61  ? 98  PHE A CZ    1 
ATOM   685  N N     . CYS A 1 99  ? 31.787 72.463 156.548 1.00 24.10  ? 99  CYS A N     1 
ATOM   686  C CA    . CYS A 1 99  ? 32.958 73.335 156.522 1.00 26.65  ? 99  CYS A CA    1 
ATOM   687  C C     . CYS A 1 99  ? 34.226 72.637 156.038 1.00 26.91  ? 99  CYS A C     1 
ATOM   688  O O     . CYS A 1 99  ? 34.998 73.211 155.269 1.00 27.34  ? 99  CYS A O     1 
ATOM   689  C CB    . CYS A 1 99  ? 33.201 73.939 157.913 1.00 29.24  ? 99  CYS A CB    1 
ATOM   690  S SG    . CYS A 1 99  ? 31.880 75.057 158.493 1.00 34.59  ? 99  CYS A SG    1 
ATOM   691  N N     . ALA A 1 100 ? 34.441 71.406 156.497 1.00 25.77  ? 100 ALA A N     1 
ATOM   692  C CA    . ALA A 1 100 ? 35.614 70.634 156.096 1.00 24.59  ? 100 ALA A CA    1 
ATOM   693  C C     . ALA A 1 100 ? 35.571 70.394 154.587 1.00 23.11  ? 100 ALA A C     1 
ATOM   694  O O     . ALA A 1 100 ? 36.585 70.503 153.904 1.00 23.00  ? 100 ALA A O     1 
ATOM   695  C CB    . ALA A 1 100 ? 35.652 69.299 156.849 1.00 22.03  ? 100 ALA A CB    1 
ATOM   696  N N     . ALA A 1 101 ? 34.392 70.065 154.071 1.00 22.79  ? 101 ALA A N     1 
ATOM   697  C CA    . ALA A 1 101 ? 34.236 69.836 152.639 1.00 24.11  ? 101 ALA A CA    1 
ATOM   698  C C     . ALA A 1 101 ? 34.658 71.098 151.881 1.00 24.62  ? 101 ALA A C     1 
ATOM   699  O O     . ALA A 1 101 ? 35.347 71.025 150.857 1.00 24.33  ? 101 ALA A O     1 
ATOM   700  C CB    . ALA A 1 101 ? 32.786 69.483 152.319 1.00 19.17  ? 101 ALA A CB    1 
ATOM   701  N N     . ALA A 1 102 ? 34.251 72.256 152.396 1.00 25.73  ? 102 ALA A N     1 
ATOM   702  C CA    . ALA A 1 102 ? 34.595 73.533 151.779 1.00 25.50  ? 102 ALA A CA    1 
ATOM   703  C C     . ALA A 1 102 ? 36.108 73.742 151.813 1.00 24.60  ? 102 ALA A C     1 
ATOM   704  O O     . ALA A 1 102 ? 36.705 74.176 150.827 1.00 23.43  ? 102 ALA A O     1 
ATOM   705  C CB    . ALA A 1 102 ? 33.891 74.674 152.507 1.00 26.31  ? 102 ALA A CB    1 
ATOM   706  N N     . LEU A 1 103 ? 36.721 73.431 152.951 1.00 23.45  ? 103 LEU A N     1 
ATOM   707  C CA    . LEU A 1 103 ? 38.165 73.579 153.101 1.00 23.82  ? 103 LEU A CA    1 
ATOM   708  C C     . LEU A 1 103 ? 38.923 72.678 152.120 1.00 23.26  ? 103 LEU A C     1 
ATOM   709  O O     . LEU A 1 103 ? 39.887 73.119 151.488 1.00 24.61  ? 103 LEU A O     1 
ATOM   710  C CB    . LEU A 1 103 ? 38.592 73.251 154.535 1.00 23.18  ? 103 LEU A CB    1 
ATOM   711  C CG    . LEU A 1 103 ? 40.101 73.326 154.837 1.00 25.16  ? 103 LEU A CG    1 
ATOM   712  C CD1   . LEU A 1 103 ? 40.646 74.705 154.460 1.00 22.90  ? 103 LEU A CD1   1 
ATOM   713  C CD2   . LEU A 1 103 ? 40.337 73.046 156.330 1.00 24.21  ? 103 LEU A CD2   1 
ATOM   714  N N     . VAL A 1 104 ? 38.496 71.423 151.989 1.00 19.78  ? 104 VAL A N     1 
ATOM   715  C CA    . VAL A 1 104 ? 39.163 70.510 151.064 1.00 21.04  ? 104 VAL A CA    1 
ATOM   716  C C     . VAL A 1 104 ? 39.026 71.016 149.619 1.00 22.01  ? 104 VAL A C     1 
ATOM   717  O O     . VAL A 1 104 ? 39.976 70.958 148.842 1.00 23.15  ? 104 VAL A O     1 
ATOM   718  C CB    . VAL A 1 104 ? 38.588 69.069 151.162 1.00 21.44  ? 104 VAL A CB    1 
ATOM   719  C CG1   . VAL A 1 104 ? 39.208 68.181 150.096 1.00 19.29  ? 104 VAL A CG1   1 
ATOM   720  C CG2   . VAL A 1 104 ? 38.870 68.487 152.540 1.00 20.00  ? 104 VAL A CG2   1 
ATOM   721  N N     . TYR A 1 105 ? 37.845 71.508 149.260 1.00 20.50  ? 105 TYR A N     1 
ATOM   722  C CA    . TYR A 1 105 ? 37.623 72.030 147.917 1.00 21.20  ? 105 TYR A CA    1 
ATOM   723  C C     . TYR A 1 105 ? 38.514 73.251 147.685 1.00 21.14  ? 105 TYR A C     1 
ATOM   724  O O     . TYR A 1 105 ? 39.028 73.461 146.586 1.00 20.17  ? 105 TYR A O     1 
ATOM   725  C CB    . TYR A 1 105 ? 36.158 72.433 147.737 1.00 21.56  ? 105 TYR A CB    1 
ATOM   726  C CG    . TYR A 1 105 ? 35.873 73.156 146.436 1.00 22.27  ? 105 TYR A CG    1 
ATOM   727  C CD1   . TYR A 1 105 ? 35.868 72.469 145.219 1.00 24.12  ? 105 TYR A CD1   1 
ATOM   728  C CD2   . TYR A 1 105 ? 35.585 74.520 146.426 1.00 23.54  ? 105 TYR A CD2   1 
ATOM   729  C CE1   . TYR A 1 105 ? 35.576 73.122 144.022 1.00 23.83  ? 105 TYR A CE1   1 
ATOM   730  C CE2   . TYR A 1 105 ? 35.296 75.189 145.235 1.00 23.36  ? 105 TYR A CE2   1 
ATOM   731  C CZ    . TYR A 1 105 ? 35.291 74.481 144.041 1.00 24.44  ? 105 TYR A CZ    1 
ATOM   732  O OH    . TYR A 1 105 ? 34.989 75.129 142.869 1.00 25.33  ? 105 TYR A OH    1 
ATOM   733  N N     . GLY A 1 106 ? 38.687 74.053 148.730 1.00 20.97  ? 106 GLY A N     1 
ATOM   734  C CA    . GLY A 1 106 ? 39.516 75.240 148.625 1.00 22.46  ? 106 GLY A CA    1 
ATOM   735  C C     . GLY A 1 106 ? 40.977 74.915 148.379 1.00 24.15  ? 106 GLY A C     1 
ATOM   736  O O     . GLY A 1 106 ? 41.661 75.621 147.643 1.00 25.91  ? 106 GLY A O     1 
ATOM   737  N N     . LEU A 1 107 ? 41.465 73.840 148.987 1.00 24.49  ? 107 LEU A N     1 
ATOM   738  C CA    . LEU A 1 107 ? 42.860 73.449 148.814 1.00 22.96  ? 107 LEU A CA    1 
ATOM   739  C C     . LEU A 1 107 ? 43.102 72.755 147.477 1.00 22.87  ? 107 LEU A C     1 
ATOM   740  O O     . LEU A 1 107 ? 44.165 72.913 146.882 1.00 22.51  ? 107 LEU A O     1 
ATOM   741  C CB    . LEU A 1 107 ? 43.294 72.546 149.970 1.00 22.07  ? 107 LEU A CB    1 
ATOM   742  C CG    . LEU A 1 107 ? 43.190 73.196 151.357 1.00 21.06  ? 107 LEU A CG    1 
ATOM   743  C CD1   . LEU A 1 107 ? 43.471 72.163 152.432 1.00 22.37  ? 107 LEU A CD1   1 
ATOM   744  C CD2   . LEU A 1 107 ? 44.174 74.357 151.460 1.00 20.33  ? 107 LEU A CD2   1 
ATOM   745  N N     . TYR A 1 108 ? 42.116 71.995 147.007 1.00 23.51  ? 108 TYR A N     1 
ATOM   746  C CA    . TYR A 1 108 ? 42.223 71.281 145.732 1.00 25.24  ? 108 TYR A CA    1 
ATOM   747  C C     . TYR A 1 108 ? 41.582 72.057 144.574 1.00 26.45  ? 108 TYR A C     1 
ATOM   748  O O     . TYR A 1 108 ? 41.567 71.580 143.443 1.00 27.47  ? 108 TYR A O     1 
ATOM   749  C CB    . TYR A 1 108 ? 41.550 69.903 145.820 1.00 23.72  ? 108 TYR A CB    1 
ATOM   750  C CG    . TYR A 1 108 ? 42.398 68.792 146.404 1.00 22.97  ? 108 TYR A CG    1 
ATOM   751  C CD1   . TYR A 1 108 ? 42.417 68.539 147.777 1.00 22.48  ? 108 TYR A CD1   1 
ATOM   752  C CD2   . TYR A 1 108 ? 43.152 67.964 145.572 1.00 22.43  ? 108 TYR A CD2   1 
ATOM   753  C CE1   . TYR A 1 108 ? 43.164 67.480 148.304 1.00 20.37  ? 108 TYR A CE1   1 
ATOM   754  C CE2   . TYR A 1 108 ? 43.896 66.911 146.082 1.00 20.23  ? 108 TYR A CE2   1 
ATOM   755  C CZ    . TYR A 1 108 ? 43.898 66.672 147.444 1.00 20.63  ? 108 TYR A CZ    1 
ATOM   756  O OH    . TYR A 1 108 ? 44.632 65.618 147.934 1.00 20.13  ? 108 TYR A OH    1 
ATOM   757  N N     . TYR A 1 109 ? 41.051 73.241 144.875 1.00 28.02  ? 109 TYR A N     1 
ATOM   758  C CA    . TYR A 1 109 ? 40.380 74.118 143.903 1.00 29.30  ? 109 TYR A CA    1 
ATOM   759  C C     . TYR A 1 109 ? 40.830 74.013 142.441 1.00 27.60  ? 109 TYR A C     1 
ATOM   760  O O     . TYR A 1 109 ? 40.051 73.623 141.573 1.00 28.35  ? 109 TYR A O     1 
ATOM   761  C CB    . TYR A 1 109 ? 40.527 75.579 144.346 1.00 32.01  ? 109 TYR A CB    1 
ATOM   762  C CG    . TYR A 1 109 ? 39.727 76.558 143.521 1.00 34.45  ? 109 TYR A CG    1 
ATOM   763  C CD1   . TYR A 1 109 ? 38.384 76.806 143.813 1.00 38.08  ? 109 TYR A CD1   1 
ATOM   764  C CD2   . TYR A 1 109 ? 40.307 77.235 142.446 1.00 36.05  ? 109 TYR A CD2   1 
ATOM   765  C CE1   . TYR A 1 109 ? 37.634 77.707 143.057 1.00 39.38  ? 109 TYR A CE1   1 
ATOM   766  C CE2   . TYR A 1 109 ? 39.568 78.136 141.680 1.00 38.36  ? 109 TYR A CE2   1 
ATOM   767  C CZ    . TYR A 1 109 ? 38.232 78.369 141.993 1.00 41.06  ? 109 TYR A CZ    1 
ATOM   768  O OH    . TYR A 1 109 ? 37.493 79.269 141.253 1.00 43.19  ? 109 TYR A OH    1 
ATOM   769  N N     . ASN A 1 110 ? 42.080 74.381 142.173 1.00 25.83  ? 110 ASN A N     1 
ATOM   770  C CA    . ASN A 1 110 ? 42.618 74.357 140.819 1.00 26.09  ? 110 ASN A CA    1 
ATOM   771  C C     . ASN A 1 110 ? 42.581 72.998 140.140 1.00 26.97  ? 110 ASN A C     1 
ATOM   772  O O     . ASN A 1 110 ? 42.355 72.913 138.931 1.00 27.57  ? 110 ASN A O     1 
ATOM   773  C CB    . ASN A 1 110 ? 44.060 74.876 140.797 1.00 27.92  ? 110 ASN A CB    1 
ATOM   774  C CG    . ASN A 1 110 ? 44.163 76.351 141.159 1.00 30.38  ? 110 ASN A CG    1 
ATOM   775  O OD1   . ASN A 1 110 ? 43.279 77.142 140.850 1.00 33.14  ? 110 ASN A OD1   1 
ATOM   776  N ND2   . ASN A 1 110 ? 45.258 76.726 141.804 1.00 34.44  ? 110 ASN A ND2   1 
ATOM   777  N N     . LEU A 1 111 ? 42.813 71.933 140.903 1.00 25.30  ? 111 LEU A N     1 
ATOM   778  C CA    . LEU A 1 111 ? 42.807 70.603 140.316 1.00 24.11  ? 111 LEU A CA    1 
ATOM   779  C C     . LEU A 1 111 ? 41.411 70.219 139.835 1.00 24.67  ? 111 LEU A C     1 
ATOM   780  O O     . LEU A 1 111 ? 41.267 69.503 138.842 1.00 25.18  ? 111 LEU A O     1 
ATOM   781  C CB    . LEU A 1 111 ? 43.357 69.570 141.311 1.00 21.77  ? 111 LEU A CB    1 
ATOM   782  C CG    . LEU A 1 111 ? 44.890 69.586 141.468 1.00 21.56  ? 111 LEU A CG    1 
ATOM   783  C CD1   . LEU A 1 111 ? 45.333 70.780 142.295 1.00 19.98  ? 111 LEU A CD1   1 
ATOM   784  C CD2   . LEU A 1 111 ? 45.353 68.294 142.134 1.00 22.06  ? 111 LEU A CD2   1 
ATOM   785  N N     . PHE A 1 112 ? 40.379 70.701 140.525 1.00 24.69  ? 112 PHE A N     1 
ATOM   786  C CA    . PHE A 1 112 ? 39.012 70.405 140.110 1.00 25.30  ? 112 PHE A CA    1 
ATOM   787  C C     . PHE A 1 112 ? 38.723 71.022 138.749 1.00 26.32  ? 112 PHE A C     1 
ATOM   788  O O     . PHE A 1 112 ? 38.243 70.341 137.842 1.00 27.63  ? 112 PHE A O     1 
ATOM   789  C CB    . PHE A 1 112 ? 37.995 70.943 141.120 1.00 25.01  ? 112 PHE A CB    1 
ATOM   790  C CG    . PHE A 1 112 ? 37.682 69.987 142.225 1.00 26.57  ? 112 PHE A CG    1 
ATOM   791  C CD1   . PHE A 1 112 ? 38.387 70.027 143.423 1.00 28.18  ? 112 PHE A CD1   1 
ATOM   792  C CD2   . PHE A 1 112 ? 36.692 69.026 142.060 1.00 27.35  ? 112 PHE A CD2   1 
ATOM   793  C CE1   . PHE A 1 112 ? 38.110 69.121 144.440 1.00 28.54  ? 112 PHE A CE1   1 
ATOM   794  C CE2   . PHE A 1 112 ? 36.406 68.114 143.068 1.00 27.94  ? 112 PHE A CE2   1 
ATOM   795  C CZ    . PHE A 1 112 ? 37.115 68.162 144.260 1.00 28.75  ? 112 PHE A CZ    1 
ATOM   796  N N     . PHE A 1 113 ? 39.019 72.310 138.599 1.00 26.53  ? 113 PHE A N     1 
ATOM   797  C CA    . PHE A 1 113 ? 38.760 72.977 137.333 1.00 28.34  ? 113 PHE A CA    1 
ATOM   798  C C     . PHE A 1 113 ? 39.619 72.466 136.182 1.00 28.28  ? 113 PHE A C     1 
ATOM   799  O O     . PHE A 1 113 ? 39.126 72.328 135.064 1.00 28.19  ? 113 PHE A O     1 
ATOM   800  C CB    . PHE A 1 113 ? 38.909 74.496 137.476 1.00 29.97  ? 113 PHE A CB    1 
ATOM   801  C CG    . PHE A 1 113 ? 37.779 75.140 138.236 1.00 32.52  ? 113 PHE A CG    1 
ATOM   802  C CD1   . PHE A 1 113 ? 37.812 75.222 139.628 1.00 34.58  ? 113 PHE A CD1   1 
ATOM   803  C CD2   . PHE A 1 113 ? 36.664 75.631 137.562 1.00 32.42  ? 113 PHE A CD2   1 
ATOM   804  C CE1   . PHE A 1 113 ? 36.754 75.784 140.338 1.00 34.38  ? 113 PHE A CE1   1 
ATOM   805  C CE2   . PHE A 1 113 ? 35.596 76.196 138.261 1.00 33.93  ? 113 PHE A CE2   1 
ATOM   806  C CZ    . PHE A 1 113 ? 35.641 76.274 139.652 1.00 34.69  ? 113 PHE A CZ    1 
ATOM   807  N N     . ASP A 1 114 ? 40.890 72.170 136.442 1.00 29.17  ? 114 ASP A N     1 
ATOM   808  C CA    . ASP A 1 114 ? 41.745 71.674 135.373 1.00 30.50  ? 114 ASP A CA    1 
ATOM   809  C C     . ASP A 1 114 ? 41.316 70.277 134.935 1.00 30.29  ? 114 ASP A C     1 
ATOM   810  O O     . ASP A 1 114 ? 41.419 69.931 133.760 1.00 29.83  ? 114 ASP A O     1 
ATOM   811  C CB    . ASP A 1 114 ? 43.211 71.691 135.805 1.00 36.17  ? 114 ASP A CB    1 
ATOM   812  C CG    . ASP A 1 114 ? 43.683 73.091 136.185 1.00 43.12  ? 114 ASP A CG    1 
ATOM   813  O OD1   . ASP A 1 114 ? 43.218 74.073 135.563 1.00 45.47  ? 114 ASP A OD1   1 
ATOM   814  O OD2   . ASP A 1 114 ? 44.527 73.217 137.099 1.00 47.89  ? 114 ASP A OD2   1 
ATOM   815  N N     . PHE A 1 115 ? 40.810 69.480 135.872 1.00 29.92  ? 115 PHE A N     1 
ATOM   816  C CA    . PHE A 1 115 ? 40.347 68.138 135.536 1.00 28.17  ? 115 PHE A CA    1 
ATOM   817  C C     . PHE A 1 115 ? 39.077 68.247 134.685 1.00 28.71  ? 115 PHE A C     1 
ATOM   818  O O     . PHE A 1 115 ? 38.946 67.586 133.655 1.00 29.04  ? 115 PHE A O     1 
ATOM   819  C CB    . PHE A 1 115 ? 40.040 67.336 136.802 1.00 26.06  ? 115 PHE A CB    1 
ATOM   820  C CG    . PHE A 1 115 ? 39.676 65.902 136.535 1.00 26.31  ? 115 PHE A CG    1 
ATOM   821  C CD1   . PHE A 1 115 ? 40.654 64.909 136.540 1.00 26.76  ? 115 PHE A CD1   1 
ATOM   822  C CD2   . PHE A 1 115 ? 38.353 65.544 136.272 1.00 25.66  ? 115 PHE A CD2   1 
ATOM   823  C CE1   . PHE A 1 115 ? 40.321 63.576 136.290 1.00 27.66  ? 115 PHE A CE1   1 
ATOM   824  C CE2   . PHE A 1 115 ? 37.999 64.218 136.020 1.00 26.18  ? 115 PHE A CE2   1 
ATOM   825  C CZ    . PHE A 1 115 ? 38.985 63.229 136.029 1.00 28.41  ? 115 PHE A CZ    1 
ATOM   826  N N     . GLU A 1 116 ? 38.136 69.076 135.122 1.00 28.70  ? 116 GLU A N     1 
ATOM   827  C CA    . GLU A 1 116 ? 36.891 69.255 134.373 1.00 31.64  ? 116 GLU A CA    1 
ATOM   828  C C     . GLU A 1 116 ? 37.181 69.800 132.975 1.00 32.29  ? 116 GLU A C     1 
ATOM   829  O O     . GLU A 1 116 ? 36.576 69.379 131.991 1.00 29.98  ? 116 GLU A O     1 
ATOM   830  C CB    . GLU A 1 116 ? 35.954 70.200 135.125 1.00 30.04  ? 116 GLU A CB    1 
ATOM   831  C CG    . GLU A 1 116 ? 35.603 69.693 136.513 1.00 33.64  ? 116 GLU A CG    1 
ATOM   832  C CD    . GLU A 1 116 ? 34.645 70.598 137.249 1.00 34.95  ? 116 GLU A CD    1 
ATOM   833  O OE1   . GLU A 1 116 ? 34.926 71.811 137.355 1.00 37.22  ? 116 GLU A OE1   1 
ATOM   834  O OE2   . GLU A 1 116 ? 33.611 70.094 137.729 1.00 34.23  ? 116 GLU A OE2   1 
ATOM   835  N N     . GLN A 1 117 ? 38.130 70.723 132.900 1.00 34.14  ? 117 GLN A N     1 
ATOM   836  C CA    . GLN A 1 117 ? 38.518 71.323 131.636 1.00 38.40  ? 117 GLN A CA    1 
ATOM   837  C C     . GLN A 1 117 ? 39.154 70.280 130.721 1.00 38.38  ? 117 GLN A C     1 
ATOM   838  O O     . GLN A 1 117 ? 38.792 70.162 129.552 1.00 39.68  ? 117 GLN A O     1 
ATOM   839  C CB    . GLN A 1 117 ? 39.513 72.454 131.891 1.00 40.97  ? 117 GLN A CB    1 
ATOM   840  C CG    . GLN A 1 117 ? 39.910 73.227 130.651 1.00 47.74  ? 117 GLN A CG    1 
ATOM   841  C CD    . GLN A 1 117 ? 41.007 74.236 130.933 1.00 52.42  ? 117 GLN A CD    1 
ATOM   842  O OE1   . GLN A 1 117 ? 40.889 75.060 131.842 1.00 53.48  ? 117 GLN A OE1   1 
ATOM   843  N NE2   . GLN A 1 117 ? 42.083 74.177 130.151 1.00 54.18  ? 117 GLN A NE2   1 
ATOM   844  N N     . THR A 1 118 ? 40.099 69.523 131.269 1.00 37.90  ? 118 THR A N     1 
ATOM   845  C CA    . THR A 1 118 ? 40.811 68.495 130.522 1.00 36.65  ? 118 THR A CA    1 
ATOM   846  C C     . THR A 1 118 ? 39.904 67.393 129.999 1.00 36.46  ? 118 THR A C     1 
ATOM   847  O O     . THR A 1 118 ? 40.037 66.967 128.854 1.00 36.89  ? 118 THR A O     1 
ATOM   848  C CB    . THR A 1 118 ? 41.920 67.855 131.392 1.00 36.90  ? 118 THR A CB    1 
ATOM   849  O OG1   . THR A 1 118 ? 42.965 68.809 131.603 1.00 38.03  ? 118 THR A OG1   1 
ATOM   850  C CG2   . THR A 1 118 ? 42.500 66.623 130.721 1.00 36.51  ? 118 THR A CG2   1 
ATOM   851  N N     . HIS A 1 119 ? 38.981 66.934 130.837 1.00 35.24  ? 119 HIS A N     1 
ATOM   852  C CA    . HIS A 1 119 ? 38.074 65.868 130.444 1.00 35.56  ? 119 HIS A CA    1 
ATOM   853  C C     . HIS A 1 119 ? 36.718 66.345 129.929 1.00 34.94  ? 119 HIS A C     1 
ATOM   854  O O     . HIS A 1 119 ? 35.789 65.551 129.782 1.00 32.87  ? 119 HIS A O     1 
ATOM   855  C CB    . HIS A 1 119 ? 37.899 64.910 131.617 1.00 38.61  ? 119 HIS A CB    1 
ATOM   856  C CG    . HIS A 1 119 ? 39.169 64.228 132.012 1.00 42.67  ? 119 HIS A CG    1 
ATOM   857  N ND1   . HIS A 1 119 ? 39.662 63.129 131.340 1.00 44.09  ? 119 HIS A ND1   1 
ATOM   858  C CD2   . HIS A 1 119 ? 40.087 64.531 132.961 1.00 43.45  ? 119 HIS A CD2   1 
ATOM   859  C CE1   . HIS A 1 119 ? 40.828 62.786 131.858 1.00 45.08  ? 119 HIS A CE1   1 
ATOM   860  N NE2   . HIS A 1 119 ? 41.109 63.622 132.843 1.00 44.98  ? 119 HIS A NE2   1 
ATOM   861  N N     . HIS A 1 120 ? 36.614 67.640 129.645 1.00 35.16  ? 120 HIS A N     1 
ATOM   862  C CA    . HIS A 1 120 ? 35.378 68.216 129.128 1.00 36.63  ? 120 HIS A CA    1 
ATOM   863  C C     . HIS A 1 120 ? 34.164 67.809 129.949 1.00 35.59  ? 120 HIS A C     1 
ATOM   864  O O     . HIS A 1 120 ? 33.186 67.289 129.415 1.00 36.95  ? 120 HIS A O     1 
ATOM   865  C CB    . HIS A 1 120 ? 35.174 67.792 127.670 1.00 39.13  ? 120 HIS A CB    1 
ATOM   866  C CG    . HIS A 1 120 ? 36.353 68.079 126.793 1.00 43.27  ? 120 HIS A CG    1 
ATOM   867  N ND1   . HIS A 1 120 ? 37.338 67.149 126.540 1.00 43.25  ? 120 HIS A ND1   1 
ATOM   868  C CD2   . HIS A 1 120 ? 36.733 69.213 126.155 1.00 43.87  ? 120 HIS A CD2   1 
ATOM   869  C CE1   . HIS A 1 120 ? 38.276 67.696 125.787 1.00 44.89  ? 120 HIS A CE1   1 
ATOM   870  N NE2   . HIS A 1 120 ? 37.933 68.948 125.541 1.00 45.76  ? 120 HIS A NE2   1 
ATOM   871  N N     . ILE A 1 121 ? 34.238 68.044 131.252 1.00 33.45  ? 121 ILE A N     1 
ATOM   872  C CA    . ILE A 1 121 ? 33.150 67.714 132.152 1.00 31.32  ? 121 ILE A CA    1 
ATOM   873  C C     . ILE A 1 121 ? 32.430 68.989 132.565 1.00 30.03  ? 121 ILE A C     1 
ATOM   874  O O     . ILE A 1 121 ? 33.056 69.950 133.009 1.00 29.48  ? 121 ILE A O     1 
ATOM   875  C CB    . ILE A 1 121 ? 33.673 67.013 133.422 1.00 33.05  ? 121 ILE A CB    1 
ATOM   876  C CG1   . ILE A 1 121 ? 34.275 65.654 133.053 1.00 32.55  ? 121 ILE A CG1   1 
ATOM   877  C CG2   . ILE A 1 121 ? 32.543 66.863 134.443 1.00 30.37  ? 121 ILE A CG2   1 
ATOM   878  C CD1   . ILE A 1 121 ? 35.097 65.038 134.157 1.00 33.66  ? 121 ILE A CD1   1 
ATOM   879  N N     . VAL A 1 122 ? 31.113 68.991 132.408 1.00 27.47  ? 122 VAL A N     1 
ATOM   880  C CA    . VAL A 1 122 ? 30.297 70.133 132.780 1.00 25.18  ? 122 VAL A CA    1 
ATOM   881  C C     . VAL A 1 122 ? 29.815 69.913 134.205 1.00 23.95  ? 122 VAL A C     1 
ATOM   882  O O     . VAL A 1 122 ? 29.037 68.998 134.475 1.00 23.44  ? 122 VAL A O     1 
ATOM   883  C CB    . VAL A 1 122 ? 29.069 70.270 131.852 1.00 26.20  ? 122 VAL A CB    1 
ATOM   884  C CG1   . VAL A 1 122 ? 28.146 71.384 132.365 1.00 24.16  ? 122 VAL A CG1   1 
ATOM   885  C CG2   . VAL A 1 122 ? 29.528 70.564 130.431 1.00 24.34  ? 122 VAL A CG2   1 
ATOM   886  N N     . ARG A 1 123 ? 30.279 70.743 135.127 1.00 24.20  ? 123 ARG A N     1 
ATOM   887  C CA    . ARG A 1 123 ? 29.864 70.582 136.508 1.00 23.59  ? 123 ARG A CA    1 
ATOM   888  C C     . ARG A 1 123 ? 28.367 70.842 136.601 1.00 24.69  ? 123 ARG A C     1 
ATOM   889  O O     . ARG A 1 123 ? 27.872 71.863 136.128 1.00 25.40  ? 123 ARG A O     1 
ATOM   890  C CB    . ARG A 1 123 ? 30.632 71.541 137.424 1.00 22.48  ? 123 ARG A CB    1 
ATOM   891  C CG    . ARG A 1 123 ? 30.429 71.238 138.904 1.00 22.19  ? 123 ARG A CG    1 
ATOM   892  C CD    . ARG A 1 123 ? 31.160 72.220 139.793 1.00 21.45  ? 123 ARG A CD    1 
ATOM   893  N NE    . ARG A 1 123 ? 32.598 72.235 139.545 1.00 20.90  ? 123 ARG A NE    1 
ATOM   894  C CZ    . ARG A 1 123 ? 33.455 73.000 140.214 1.00 21.44  ? 123 ARG A CZ    1 
ATOM   895  N NH1   . ARG A 1 123 ? 33.013 73.808 141.170 1.00 22.20  ? 123 ARG A NH1   1 
ATOM   896  N NH2   . ARG A 1 123 ? 34.750 72.963 139.928 1.00 19.87  ? 123 ARG A NH2   1 
ATOM   897  N N     . GLY A 1 124 ? 27.647 69.905 137.207 1.00 26.35  ? 124 GLY A N     1 
ATOM   898  C CA    . GLY A 1 124 ? 26.211 70.049 137.346 1.00 24.35  ? 124 GLY A CA    1 
ATOM   899  C C     . GLY A 1 124 ? 25.494 69.060 136.455 1.00 23.49  ? 124 GLY A C     1 
ATOM   900  O O     . GLY A 1 124 ? 24.317 68.777 136.659 1.00 23.02  ? 124 GLY A O     1 
ATOM   901  N N     . SER A 1 125 ? 26.205 68.543 135.459 1.00 22.07  ? 125 SER A N     1 
ATOM   902  C CA    . SER A 1 125 ? 25.636 67.565 134.538 1.00 26.32  ? 125 SER A CA    1 
ATOM   903  C C     . SER A 1 125 ? 25.602 66.189 135.206 1.00 26.11  ? 125 SER A C     1 
ATOM   904  O O     . SER A 1 125 ? 26.237 65.986 136.237 1.00 26.04  ? 125 SER A O     1 
ATOM   905  C CB    . SER A 1 125 ? 26.476 67.490 133.255 1.00 27.40  ? 125 SER A CB    1 
ATOM   906  O OG    . SER A 1 125 ? 27.777 66.984 133.520 1.00 29.92  ? 125 SER A OG    1 
ATOM   907  N N     . VAL A 1 126 ? 24.858 65.254 134.622 1.00 27.04  ? 126 VAL A N     1 
ATOM   908  C CA    . VAL A 1 126 ? 24.761 63.903 135.173 1.00 28.94  ? 126 VAL A CA    1 
ATOM   909  C C     . VAL A 1 126 ? 26.151 63.252 135.258 1.00 30.11  ? 126 VAL A C     1 
ATOM   910  O O     . VAL A 1 126 ? 26.445 62.508 136.197 1.00 29.42  ? 126 VAL A O     1 
ATOM   911  C CB    . VAL A 1 126 ? 23.830 63.007 134.307 1.00 29.38  ? 126 VAL A CB    1 
ATOM   912  C CG1   . VAL A 1 126 ? 23.943 61.551 134.746 1.00 29.47  ? 126 VAL A CG1   1 
ATOM   913  C CG2   . VAL A 1 126 ? 22.380 63.464 134.453 1.00 28.01  ? 126 VAL A CG2   1 
ATOM   914  N N     . GLU A 1 127 ? 27.002 63.559 134.282 1.00 29.48  ? 127 GLU A N     1 
ATOM   915  C CA    . GLU A 1 127 ? 28.349 63.017 134.229 1.00 30.40  ? 127 GLU A CA    1 
ATOM   916  C C     . GLU A 1 127 ? 29.275 63.590 135.299 1.00 30.62  ? 127 GLU A C     1 
ATOM   917  O O     . GLU A 1 127 ? 30.338 63.027 135.561 1.00 32.85  ? 127 GLU A O     1 
ATOM   918  C CB    . GLU A 1 127 ? 28.970 63.273 132.855 1.00 32.59  ? 127 GLU A CB    1 
ATOM   919  C CG    . GLU A 1 127 ? 28.164 62.734 131.680 1.00 41.27  ? 127 GLU A CG    1 
ATOM   920  C CD    . GLU A 1 127 ? 27.178 63.750 131.109 1.00 43.86  ? 127 GLU A CD    1 
ATOM   921  O OE1   . GLU A 1 127 ? 26.232 64.153 131.816 1.00 43.03  ? 127 GLU A OE1   1 
ATOM   922  O OE2   . GLU A 1 127 ? 27.360 64.146 129.940 1.00 47.97  ? 127 GLU A OE2   1 
ATOM   923  N N     . SER A 1 128 ? 28.890 64.707 135.909 1.00 28.14  ? 128 SER A N     1 
ATOM   924  C CA    . SER A 1 128 ? 29.731 65.319 136.935 1.00 26.13  ? 128 SER A CA    1 
ATOM   925  C C     . SER A 1 128 ? 29.502 64.680 138.303 1.00 24.68  ? 128 SER A C     1 
ATOM   926  O O     . SER A 1 128 ? 30.208 64.992 139.261 1.00 24.28  ? 128 SER A O     1 
ATOM   927  C CB    . SER A 1 128 ? 29.475 66.834 137.017 1.00 23.65  ? 128 SER A CB    1 
ATOM   928  O OG    . SER A 1 128 ? 28.223 67.118 137.617 1.00 22.94  ? 128 SER A OG    1 
ATOM   929  N N     . VAL A 1 129 ? 28.510 63.798 138.389 1.00 24.81  ? 129 VAL A N     1 
ATOM   930  C CA    . VAL A 1 129 ? 28.201 63.097 139.640 1.00 26.81  ? 129 VAL A CA    1 
ATOM   931  C C     . VAL A 1 129 ? 29.426 62.319 140.132 1.00 27.41  ? 129 VAL A C     1 
ATOM   932  O O     . VAL A 1 129 ? 29.624 62.155 141.337 1.00 26.83  ? 129 VAL A O     1 
ATOM   933  C CB    . VAL A 1 129 ? 27.011 62.112 139.457 1.00 25.15  ? 129 VAL A CB    1 
ATOM   934  C CG1   . VAL A 1 129 ? 26.815 61.266 140.713 1.00 27.43  ? 129 VAL A CG1   1 
ATOM   935  C CG2   . VAL A 1 129 ? 25.741 62.896 139.166 1.00 26.81  ? 129 VAL A CG2   1 
ATOM   936  N N     . ASP A 1 130 ? 30.246 61.849 139.194 1.00 27.86  ? 130 ASP A N     1 
ATOM   937  C CA    . ASP A 1 130 ? 31.450 61.111 139.541 1.00 29.05  ? 130 ASP A CA    1 
ATOM   938  C C     . ASP A 1 130 ? 32.364 62.001 140.385 1.00 27.56  ? 130 ASP A C     1 
ATOM   939  O O     . ASP A 1 130 ? 32.815 61.595 141.454 1.00 27.02  ? 130 ASP A O     1 
ATOM   940  C CB    . ASP A 1 130 ? 32.175 60.647 138.272 1.00 33.66  ? 130 ASP A CB    1 
ATOM   941  C CG    . ASP A 1 130 ? 33.384 59.763 138.573 1.00 39.53  ? 130 ASP A CG    1 
ATOM   942  O OD1   . ASP A 1 130 ? 34.461 60.293 138.929 1.00 40.93  ? 130 ASP A OD1   1 
ATOM   943  O OD2   . ASP A 1 130 ? 33.252 58.527 138.462 1.00 43.77  ? 130 ASP A OD2   1 
ATOM   944  N N     . LEU A 1 131 ? 32.638 63.213 139.911 1.00 26.64  ? 131 LEU A N     1 
ATOM   945  C CA    . LEU A 1 131 ? 33.480 64.135 140.669 1.00 27.35  ? 131 LEU A CA    1 
ATOM   946  C C     . LEU A 1 131 ? 32.799 64.558 141.964 1.00 26.91  ? 131 LEU A C     1 
ATOM   947  O O     . LEU A 1 131 ? 33.465 64.790 142.974 1.00 27.54  ? 131 LEU A O     1 
ATOM   948  C CB    . LEU A 1 131 ? 33.811 65.389 139.856 1.00 28.81  ? 131 LEU A CB    1 
ATOM   949  C CG    . LEU A 1 131 ? 35.081 65.375 139.008 1.00 31.78  ? 131 LEU A CG    1 
ATOM   950  C CD1   . LEU A 1 131 ? 35.400 66.798 138.584 1.00 32.80  ? 131 LEU A CD1   1 
ATOM   951  C CD2   . LEU A 1 131 ? 36.243 64.817 139.808 1.00 32.23  ? 131 LEU A CD2   1 
ATOM   952  N N     . ALA A 1 132 ? 31.473 64.676 141.933 1.00 24.98  ? 132 ALA A N     1 
ATOM   953  C CA    . ALA A 1 132 ? 30.735 65.061 143.128 1.00 24.58  ? 132 ALA A CA    1 
ATOM   954  C C     . ALA A 1 132 ? 30.966 63.974 144.181 1.00 24.15  ? 132 ALA A C     1 
ATOM   955  O O     . ALA A 1 132 ? 30.871 64.230 145.387 1.00 21.91  ? 132 ALA A O     1 
ATOM   956  C CB    . ALA A 1 132 ? 29.247 65.203 142.814 1.00 24.56  ? 132 ALA A CB    1 
ATOM   957  N N     . GLY A 1 133 ? 31.271 62.764 143.706 1.00 22.86  ? 133 GLY A N     1 
ATOM   958  C CA    . GLY A 1 133 ? 31.545 61.643 144.591 1.00 20.65  ? 133 GLY A CA    1 
ATOM   959  C C     . GLY A 1 133 ? 32.724 61.940 145.505 1.00 22.02  ? 133 GLY A C     1 
ATOM   960  O O     . GLY A 1 133 ? 32.975 61.224 146.476 1.00 20.63  ? 133 GLY A O     1 
ATOM   961  N N     . THR A 1 134 ? 33.458 63.004 145.193 1.00 22.28  ? 134 THR A N     1 
ATOM   962  C CA    . THR A 1 134 ? 34.586 63.413 146.014 1.00 22.02  ? 134 THR A CA    1 
ATOM   963  C C     . THR A 1 134 ? 34.078 63.768 147.407 1.00 21.29  ? 134 THR A C     1 
ATOM   964  O O     . THR A 1 134 ? 34.687 63.407 148.413 1.00 23.44  ? 134 THR A O     1 
ATOM   965  C CB    . THR A 1 134 ? 35.289 64.684 145.453 1.00 23.12  ? 134 THR A CB    1 
ATOM   966  O OG1   . THR A 1 134 ? 35.978 64.378 144.234 1.00 21.17  ? 134 THR A OG1   1 
ATOM   967  C CG2   . THR A 1 134 ? 36.288 65.230 146.470 1.00 23.53  ? 134 THR A CG2   1 
ATOM   968  N N     . PHE A 1 135 ? 32.945 64.461 147.456 1.00 19.45  ? 135 PHE A N     1 
ATOM   969  C CA    . PHE A 1 135 ? 32.380 64.920 148.718 1.00 19.78  ? 135 PHE A CA    1 
ATOM   970  C C     . PHE A 1 135 ? 31.454 63.979 149.458 1.00 20.88  ? 135 PHE A C     1 
ATOM   971  O O     . PHE A 1 135 ? 31.527 63.879 150.682 1.00 22.08  ? 135 PHE A O     1 
ATOM   972  C CB    . PHE A 1 135 ? 31.664 66.260 148.511 1.00 19.24  ? 135 PHE A CB    1 
ATOM   973  C CG    . PHE A 1 135 ? 32.508 67.288 147.812 1.00 18.36  ? 135 PHE A CG    1 
ATOM   974  C CD1   . PHE A 1 135 ? 32.450 67.429 146.426 1.00 18.98  ? 135 PHE A CD1   1 
ATOM   975  C CD2   . PHE A 1 135 ? 33.407 68.068 148.530 1.00 19.77  ? 135 PHE A CD2   1 
ATOM   976  C CE1   . PHE A 1 135 ? 33.278 68.330 145.755 1.00 17.70  ? 135 PHE A CE1   1 
ATOM   977  C CE2   . PHE A 1 135 ? 34.248 68.977 147.876 1.00 22.07  ? 135 PHE A CE2   1 
ATOM   978  C CZ    . PHE A 1 135 ? 34.181 69.107 146.479 1.00 21.53  ? 135 PHE A CZ    1 
ATOM   979  N N     . SER A 1 136 ? 30.577 63.292 148.740 1.00 21.04  ? 136 SER A N     1 
ATOM   980  C CA    . SER A 1 136 ? 29.639 62.398 149.400 1.00 21.94  ? 136 SER A CA    1 
ATOM   981  C C     . SER A 1 136 ? 29.407 61.107 148.628 1.00 22.78  ? 136 SER A C     1 
ATOM   982  O O     . SER A 1 136 ? 30.070 60.836 147.626 1.00 22.74  ? 136 SER A O     1 
ATOM   983  C CB    . SER A 1 136 ? 28.308 63.120 149.638 1.00 22.76  ? 136 SER A CB    1 
ATOM   984  O OG    . SER A 1 136 ? 27.715 63.525 148.415 1.00 24.76  ? 136 SER A OG    1 
ATOM   985  N N     . THR A 1 137 ? 28.443 60.321 149.088 1.00 21.12  ? 137 THR A N     1 
ATOM   986  C CA    . THR A 1 137 ? 28.174 59.031 148.472 1.00 22.27  ? 137 THR A CA    1 
ATOM   987  C C     . THR A 1 137 ? 27.049 58.950 147.454 1.00 21.33  ? 137 THR A C     1 
ATOM   988  O O     . THR A 1 137 ? 26.051 59.661 147.525 1.00 21.53  ? 137 THR A O     1 
ATOM   989  C CB    . THR A 1 137 ? 27.917 57.972 149.552 1.00 21.27  ? 137 THR A CB    1 
ATOM   990  O OG1   . THR A 1 137 ? 26.708 58.292 150.250 1.00 23.02  ? 137 THR A OG1   1 
ATOM   991  C CG2   . THR A 1 137 ? 29.071 57.942 150.545 1.00 22.14  ? 137 THR A CG2   1 
ATOM   992  N N     . TYR A 1 138 ? 27.244 58.052 146.498 1.00 21.60  ? 138 TYR A N     1 
ATOM   993  C CA    . TYR A 1 138 ? 26.289 57.803 145.439 1.00 19.87  ? 138 TYR A CA    1 
ATOM   994  C C     . TYR A 1 138 ? 26.239 56.301 145.233 1.00 20.85  ? 138 TYR A C     1 
ATOM   995  O O     . TYR A 1 138 ? 27.225 55.604 145.475 1.00 22.86  ? 138 TYR A O     1 
ATOM   996  C CB    . TYR A 1 138 ? 26.716 58.549 144.180 1.00 18.71  ? 138 TYR A CB    1 
ATOM   997  C CG    . TYR A 1 138 ? 26.649 60.040 144.401 1.00 18.92  ? 138 TYR A CG    1 
ATOM   998  C CD1   . TYR A 1 138 ? 27.788 60.771 144.732 1.00 18.01  ? 138 TYR A CD1   1 
ATOM   999  C CD2   . TYR A 1 138 ? 25.421 60.709 144.375 1.00 20.42  ? 138 TYR A CD2   1 
ATOM   1000 C CE1   . TYR A 1 138 ? 27.708 62.137 145.040 1.00 18.83  ? 138 TYR A CE1   1 
ATOM   1001 C CE2   . TYR A 1 138 ? 25.331 62.069 144.682 1.00 19.12  ? 138 TYR A CE2   1 
ATOM   1002 C CZ    . TYR A 1 138 ? 26.474 62.771 145.014 1.00 18.75  ? 138 TYR A CZ    1 
ATOM   1003 O OH    . TYR A 1 138 ? 26.383 64.102 145.345 1.00 20.73  ? 138 TYR A OH    1 
ATOM   1004 N N     . PRO A 1 139 ? 25.084 55.776 144.803 1.00 19.77  ? 139 PRO A N     1 
ATOM   1005 C CA    . PRO A 1 139 ? 24.908 54.340 144.580 1.00 20.03  ? 139 PRO A CA    1 
ATOM   1006 C C     . PRO A 1 139 ? 25.613 53.749 143.373 1.00 22.53  ? 139 PRO A C     1 
ATOM   1007 O O     . PRO A 1 139 ? 25.816 54.419 142.356 1.00 22.35  ? 139 PRO A O     1 
ATOM   1008 C CB    . PRO A 1 139 ? 23.397 54.204 144.463 1.00 20.99  ? 139 PRO A CB    1 
ATOM   1009 C CG    . PRO A 1 139 ? 23.035 55.462 143.719 1.00 21.16  ? 139 PRO A CG    1 
ATOM   1010 C CD    . PRO A 1 139 ? 23.854 56.514 144.454 1.00 20.56  ? 139 PRO A CD    1 
ATOM   1011 N N     . ASN A 1 140 ? 25.983 52.479 143.503 1.00 23.54  ? 140 ASN A N     1 
ATOM   1012 C CA    . ASN A 1 140 ? 26.621 51.751 142.422 1.00 23.65  ? 140 ASN A CA    1 
ATOM   1013 C C     . ASN A 1 140 ? 25.596 51.725 141.283 1.00 25.49  ? 140 ASN A C     1 
ATOM   1014 O O     . ASN A 1 140 ? 24.392 51.625 141.520 1.00 25.75  ? 140 ASN A O     1 
ATOM   1015 C CB    . ASN A 1 140 ? 26.949 50.327 142.879 1.00 21.81  ? 140 ASN A CB    1 
ATOM   1016 C CG    . ASN A 1 140 ? 27.546 49.479 141.773 1.00 22.12  ? 140 ASN A CG    1 
ATOM   1017 O OD1   . ASN A 1 140 ? 26.845 49.058 140.852 1.00 22.07  ? 140 ASN A OD1   1 
ATOM   1018 N ND2   . ASN A 1 140 ? 28.853 49.228 141.853 1.00 21.18  ? 140 ASN A ND2   1 
ATOM   1019 N N     . PRO A 1 141 ? 26.060 51.824 140.034 1.00 26.62  ? 141 PRO A N     1 
ATOM   1020 C CA    . PRO A 1 141 ? 25.167 51.811 138.869 1.00 28.98  ? 141 PRO A CA    1 
ATOM   1021 C C     . PRO A 1 141 ? 24.186 50.633 138.816 1.00 30.06  ? 141 PRO A C     1 
ATOM   1022 O O     . PRO A 1 141 ? 23.065 50.777 138.342 1.00 31.59  ? 141 PRO A O     1 
ATOM   1023 C CB    . PRO A 1 141 ? 26.140 51.792 137.693 1.00 28.46  ? 141 PRO A CB    1 
ATOM   1024 C CG    . PRO A 1 141 ? 27.335 52.515 138.237 1.00 27.24  ? 141 PRO A CG    1 
ATOM   1025 C CD    . PRO A 1 141 ? 27.466 51.952 139.620 1.00 26.05  ? 141 PRO A CD    1 
ATOM   1026 N N     . HIS A 1 142 ? 24.600 49.477 139.317 1.00 31.56  ? 142 HIS A N     1 
ATOM   1027 C CA    . HIS A 1 142 ? 23.749 48.293 139.268 1.00 32.11  ? 142 HIS A CA    1 
ATOM   1028 C C     . HIS A 1 142 ? 22.709 48.112 140.372 1.00 32.10  ? 142 HIS A C     1 
ATOM   1029 O O     . HIS A 1 142 ? 22.015 47.099 140.394 1.00 33.73  ? 142 HIS A O     1 
ATOM   1030 C CB    . HIS A 1 142 ? 24.614 47.032 139.195 1.00 33.31  ? 142 HIS A CB    1 
ATOM   1031 C CG    . HIS A 1 142 ? 25.599 47.035 138.067 1.00 36.62  ? 142 HIS A CG    1 
ATOM   1032 N ND1   . HIS A 1 142 ? 26.891 47.497 138.207 1.00 38.93  ? 142 HIS A ND1   1 
ATOM   1033 C CD2   . HIS A 1 142 ? 25.484 46.626 136.781 1.00 38.44  ? 142 HIS A CD2   1 
ATOM   1034 C CE1   . HIS A 1 142 ? 27.530 47.368 137.058 1.00 39.08  ? 142 HIS A CE1   1 
ATOM   1035 N NE2   . HIS A 1 142 ? 26.700 46.841 136.176 1.00 40.23  ? 142 HIS A NE2   1 
ATOM   1036 N N     . ILE A 1 143 ? 22.588 49.062 141.292 1.00 32.16  ? 143 ILE A N     1 
ATOM   1037 C CA    . ILE A 1 143 ? 21.589 48.910 142.346 1.00 32.50  ? 143 ILE A CA    1 
ATOM   1038 C C     . ILE A 1 143 ? 20.682 50.123 142.453 1.00 32.60  ? 143 ILE A C     1 
ATOM   1039 O O     . ILE A 1 143 ? 21.077 51.228 142.100 1.00 32.90  ? 143 ILE A O     1 
ATOM   1040 C CB    . ILE A 1 143 ? 22.235 48.634 143.723 1.00 33.40  ? 143 ILE A CB    1 
ATOM   1041 C CG1   . ILE A 1 143 ? 23.018 49.852 144.203 1.00 30.64  ? 143 ILE A CG1   1 
ATOM   1042 C CG2   . ILE A 1 143 ? 23.150 47.414 143.627 1.00 35.17  ? 143 ILE A CG2   1 
ATOM   1043 C CD1   . ILE A 1 143 ? 23.484 49.719 145.628 1.00 31.41  ? 143 ILE A CD1   1 
ATOM   1044 N N     . ASN A 1 144 ? 19.462 49.907 142.939 1.00 32.76  ? 144 ASN A N     1 
ATOM   1045 C CA    . ASN A 1 144 ? 18.486 50.981 143.067 1.00 32.73  ? 144 ASN A CA    1 
ATOM   1046 C C     . ASN A 1 144 ? 18.333 51.507 144.490 1.00 33.06  ? 144 ASN A C     1 
ATOM   1047 O O     . ASN A 1 144 ? 19.050 51.089 145.402 1.00 34.45  ? 144 ASN A O     1 
ATOM   1048 C CB    . ASN A 1 144 ? 17.117 50.522 142.546 1.00 32.10  ? 144 ASN A CB    1 
ATOM   1049 C CG    . ASN A 1 144 ? 16.552 49.350 143.332 1.00 33.49  ? 144 ASN A CG    1 
ATOM   1050 O OD1   . ASN A 1 144 ? 16.749 49.246 144.546 1.00 33.12  ? 144 ASN A OD1   1 
ATOM   1051 N ND2   . ASN A 1 144 ? 15.828 48.471 142.644 1.00 33.37  ? 144 ASN A ND2   1 
ATOM   1052 N N     . PHE A 1 145 ? 17.379 52.421 144.660 1.00 31.73  ? 145 PHE A N     1 
ATOM   1053 C CA    . PHE A 1 145 ? 17.086 53.061 145.941 1.00 30.58  ? 145 PHE A CA    1 
ATOM   1054 C C     . PHE A 1 145 ? 16.926 52.103 147.118 1.00 30.34  ? 145 PHE A C     1 
ATOM   1055 O O     . PHE A 1 145 ? 17.644 52.206 148.108 1.00 30.58  ? 145 PHE A O     1 
ATOM   1056 C CB    . PHE A 1 145 ? 15.813 53.907 145.816 1.00 30.27  ? 145 PHE A CB    1 
ATOM   1057 C CG    . PHE A 1 145 ? 15.593 54.843 146.966 1.00 29.36  ? 145 PHE A CG    1 
ATOM   1058 C CD1   . PHE A 1 145 ? 16.246 56.069 147.015 1.00 30.40  ? 145 PHE A CD1   1 
ATOM   1059 C CD2   . PHE A 1 145 ? 14.750 54.494 148.011 1.00 30.97  ? 145 PHE A CD2   1 
ATOM   1060 C CE1   . PHE A 1 145 ? 16.068 56.940 148.089 1.00 30.02  ? 145 PHE A CE1   1 
ATOM   1061 C CE2   . PHE A 1 145 ? 14.560 55.357 149.097 1.00 32.66  ? 145 PHE A CE2   1 
ATOM   1062 C CZ    . PHE A 1 145 ? 15.224 56.586 149.132 1.00 31.71  ? 145 PHE A CZ    1 
ATOM   1063 N N     . VAL A 1 146 ? 15.970 51.183 147.018 1.00 30.12  ? 146 VAL A N     1 
ATOM   1064 C CA    . VAL A 1 146 ? 15.705 50.223 148.086 1.00 29.21  ? 146 VAL A CA    1 
ATOM   1065 C C     . VAL A 1 146 ? 16.918 49.347 148.392 1.00 28.79  ? 146 VAL A C     1 
ATOM   1066 O O     . VAL A 1 146 ? 17.214 49.058 149.551 1.00 28.79  ? 146 VAL A O     1 
ATOM   1067 C CB    . VAL A 1 146 ? 14.497 49.321 147.730 1.00 29.48  ? 146 VAL A CB    1 
ATOM   1068 C CG1   . VAL A 1 146 ? 14.303 48.250 148.790 1.00 29.33  ? 146 VAL A CG1   1 
ATOM   1069 C CG2   . VAL A 1 146 ? 13.241 50.171 147.613 1.00 31.28  ? 146 VAL A CG2   1 
ATOM   1070 N N     . GLN A 1 147 ? 17.620 48.925 147.351 1.00 28.97  ? 147 GLN A N     1 
ATOM   1071 C CA    . GLN A 1 147 ? 18.798 48.088 147.527 1.00 29.74  ? 147 GLN A CA    1 
ATOM   1072 C C     . GLN A 1 147 ? 19.902 48.871 148.239 1.00 28.62  ? 147 GLN A C     1 
ATOM   1073 O O     . GLN A 1 147 ? 20.581 48.341 149.119 1.00 28.00  ? 147 GLN A O     1 
ATOM   1074 C CB    . GLN A 1 147 ? 19.270 47.583 146.165 1.00 32.50  ? 147 GLN A CB    1 
ATOM   1075 C CG    . GLN A 1 147 ? 18.161 46.820 145.440 1.00 41.70  ? 147 GLN A CG    1 
ATOM   1076 C CD    . GLN A 1 147 ? 18.509 46.433 144.017 1.00 45.11  ? 147 GLN A CD    1 
ATOM   1077 O OE1   . GLN A 1 147 ? 18.728 47.289 143.153 1.00 43.79  ? 147 GLN A OE1   1 
ATOM   1078 N NE2   . GLN A 1 147 ? 18.555 45.131 143.764 1.00 48.60  ? 147 GLN A NE2   1 
ATOM   1079 N N     . ALA A 1 148 ? 20.066 50.137 147.866 1.00 25.84  ? 148 ALA A N     1 
ATOM   1080 C CA    . ALA A 1 148 ? 21.075 50.984 148.489 1.00 24.61  ? 148 ALA A CA    1 
ATOM   1081 C C     . ALA A 1 148 ? 20.704 51.245 149.952 1.00 25.15  ? 148 ALA A C     1 
ATOM   1082 O O     . ALA A 1 148 ? 21.575 51.349 150.816 1.00 24.18  ? 148 ALA A O     1 
ATOM   1083 C CB    . ALA A 1 148 ? 21.190 52.298 147.734 1.00 21.32  ? 148 ALA A CB    1 
ATOM   1084 N N     . PHE A 1 149 ? 19.405 51.344 150.223 1.00 25.19  ? 149 PHE A N     1 
ATOM   1085 C CA    . PHE A 1 149 ? 18.919 51.595 151.572 1.00 26.76  ? 149 PHE A CA    1 
ATOM   1086 C C     . PHE A 1 149 ? 19.235 50.408 152.489 1.00 26.28  ? 149 PHE A C     1 
ATOM   1087 O O     . PHE A 1 149 ? 19.629 50.586 153.642 1.00 24.03  ? 149 PHE A O     1 
ATOM   1088 C CB    . PHE A 1 149 ? 17.404 51.838 151.549 1.00 30.52  ? 149 PHE A CB    1 
ATOM   1089 C CG    . PHE A 1 149 ? 16.857 52.355 152.846 1.00 33.15  ? 149 PHE A CG    1 
ATOM   1090 C CD1   . PHE A 1 149 ? 16.740 53.723 153.070 1.00 34.29  ? 149 PHE A CD1   1 
ATOM   1091 C CD2   . PHE A 1 149 ? 16.493 51.476 153.861 1.00 34.58  ? 149 PHE A CD2   1 
ATOM   1092 C CE1   . PHE A 1 149 ? 16.267 54.212 154.288 1.00 35.29  ? 149 PHE A CE1   1 
ATOM   1093 C CE2   . PHE A 1 149 ? 16.020 51.954 155.084 1.00 35.69  ? 149 PHE A CE2   1 
ATOM   1094 C CZ    . PHE A 1 149 ? 15.908 53.325 155.296 1.00 35.03  ? 149 PHE A CZ    1 
ATOM   1095 N N     . ALA A 1 150 ? 19.058 49.197 151.967 1.00 24.88  ? 150 ALA A N     1 
ATOM   1096 C CA    . ALA A 1 150 ? 19.332 47.993 152.736 1.00 25.06  ? 150 ALA A CA    1 
ATOM   1097 C C     . ALA A 1 150 ? 20.820 47.914 153.070 1.00 25.56  ? 150 ALA A C     1 
ATOM   1098 O O     . ALA A 1 150 ? 21.195 47.543 154.187 1.00 26.80  ? 150 ALA A O     1 
ATOM   1099 C CB    . ALA A 1 150 ? 18.893 46.753 151.953 1.00 23.06  ? 150 ALA A CB    1 
ATOM   1100 N N     . VAL A 1 151 ? 21.668 48.266 152.106 1.00 25.51  ? 151 VAL A N     1 
ATOM   1101 C CA    . VAL A 1 151 ? 23.112 48.242 152.333 1.00 24.84  ? 151 VAL A CA    1 
ATOM   1102 C C     . VAL A 1 151 ? 23.490 49.153 153.501 1.00 25.02  ? 151 VAL A C     1 
ATOM   1103 O O     . VAL A 1 151 ? 24.106 48.704 154.466 1.00 26.06  ? 151 VAL A O     1 
ATOM   1104 C CB    . VAL A 1 151 ? 23.906 48.708 151.088 1.00 24.56  ? 151 VAL A CB    1 
ATOM   1105 C CG1   . VAL A 1 151 ? 25.400 48.697 151.402 1.00 21.53  ? 151 VAL A CG1   1 
ATOM   1106 C CG2   . VAL A 1 151 ? 23.602 47.806 149.887 1.00 22.72  ? 151 VAL A CG2   1 
ATOM   1107 N N     . GLU A 1 152 ? 23.123 50.428 153.414 1.00 24.50  ? 152 GLU A N     1 
ATOM   1108 C CA    . GLU A 1 152 ? 23.442 51.386 154.471 1.00 26.13  ? 152 GLU A CA    1 
ATOM   1109 C C     . GLU A 1 152 ? 22.885 50.958 155.828 1.00 26.64  ? 152 GLU A C     1 
ATOM   1110 O O     . GLU A 1 152 ? 23.533 51.142 156.861 1.00 26.21  ? 152 GLU A O     1 
ATOM   1111 C CB    . GLU A 1 152 ? 22.918 52.779 154.105 1.00 24.48  ? 152 GLU A CB    1 
ATOM   1112 C CG    . GLU A 1 152 ? 23.698 53.453 152.979 1.00 27.30  ? 152 GLU A CG    1 
ATOM   1113 C CD    . GLU A 1 152 ? 25.108 53.869 153.394 1.00 28.90  ? 152 GLU A CD    1 
ATOM   1114 O OE1   . GLU A 1 152 ? 25.947 54.106 152.500 1.00 30.70  ? 152 GLU A OE1   1 
ATOM   1115 O OE2   . GLU A 1 152 ? 25.377 53.973 154.609 1.00 27.00  ? 152 GLU A OE2   1 
ATOM   1116 N N     . MET A 1 153 ? 21.689 50.379 155.819 1.00 26.67  ? 153 MET A N     1 
ATOM   1117 C CA    . MET A 1 153 ? 21.047 49.916 157.049 1.00 28.84  ? 153 MET A CA    1 
ATOM   1118 C C     . MET A 1 153 ? 21.857 48.792 157.701 1.00 26.59  ? 153 MET A C     1 
ATOM   1119 O O     . MET A 1 153 ? 22.147 48.826 158.897 1.00 25.86  ? 153 MET A O     1 
ATOM   1120 C CB    . MET A 1 153 ? 19.630 49.423 156.738 1.00 33.21  ? 153 MET A CB    1 
ATOM   1121 C CG    . MET A 1 153 ? 18.802 49.070 157.956 1.00 40.56  ? 153 MET A CG    1 
ATOM   1122 S SD    . MET A 1 153 ? 17.175 48.401 157.497 1.00 50.55  ? 153 MET A SD    1 
ATOM   1123 C CE    . MET A 1 153 ? 17.588 46.636 157.343 1.00 45.65  ? 153 MET A CE    1 
ATOM   1124 N N     . VAL A 1 154 ? 22.226 47.797 156.904 1.00 24.23  ? 154 VAL A N     1 
ATOM   1125 C CA    . VAL A 1 154 ? 22.998 46.673 157.400 1.00 22.46  ? 154 VAL A CA    1 
ATOM   1126 C C     . VAL A 1 154 ? 24.380 47.087 157.902 1.00 24.57  ? 154 VAL A C     1 
ATOM   1127 O O     . VAL A 1 154 ? 24.777 46.715 159.009 1.00 25.16  ? 154 VAL A O     1 
ATOM   1128 C CB    . VAL A 1 154 ? 23.154 45.580 156.302 1.00 23.10  ? 154 VAL A CB    1 
ATOM   1129 C CG1   . VAL A 1 154 ? 24.189 44.532 156.725 1.00 18.59  ? 154 VAL A CG1   1 
ATOM   1130 C CG2   . VAL A 1 154 ? 21.800 44.913 156.043 1.00 20.74  ? 154 VAL A CG2   1 
ATOM   1131 N N     . ILE A 1 155 ? 25.115 47.867 157.115 1.00 21.74  ? 155 ILE A N     1 
ATOM   1132 C CA    . ILE A 1 155 ? 26.450 48.242 157.561 1.00 22.71  ? 155 ILE A CA    1 
ATOM   1133 C C     . ILE A 1 155 ? 26.476 49.185 158.756 1.00 23.05  ? 155 ILE A C     1 
ATOM   1134 O O     . ILE A 1 155 ? 27.403 49.127 159.562 1.00 23.47  ? 155 ILE A O     1 
ATOM   1135 C CB    . ILE A 1 155 ? 27.311 48.841 156.412 1.00 20.76  ? 155 ILE A CB    1 
ATOM   1136 C CG1   . ILE A 1 155 ? 26.698 50.145 155.906 1.00 20.19  ? 155 ILE A CG1   1 
ATOM   1137 C CG2   . ILE A 1 155 ? 27.455 47.807 155.287 1.00 19.79  ? 155 ILE A CG2   1 
ATOM   1138 C CD1   . ILE A 1 155 ? 27.576 50.872 154.919 1.00 21.66  ? 155 ILE A CD1   1 
ATOM   1139 N N     . THR A 1 156 ? 25.473 50.049 158.891 1.00 23.27  ? 156 THR A N     1 
ATOM   1140 C CA    . THR A 1 156 ? 25.464 50.954 160.035 1.00 24.54  ? 156 THR A CA    1 
ATOM   1141 C C     . THR A 1 156 ? 25.093 50.180 161.297 1.00 23.80  ? 156 THR A C     1 
ATOM   1142 O O     . THR A 1 156 ? 25.578 50.483 162.381 1.00 25.36  ? 156 THR A O     1 
ATOM   1143 C CB    . THR A 1 156 ? 24.489 52.128 159.841 1.00 24.57  ? 156 THR A CB    1 
ATOM   1144 O OG1   . THR A 1 156 ? 24.736 52.752 158.574 1.00 22.24  ? 156 THR A OG1   1 
ATOM   1145 C CG2   . THR A 1 156 ? 24.705 53.163 160.935 1.00 20.54  ? 156 THR A CG2   1 
ATOM   1146 N N     . ALA A 1 157 ? 24.245 49.168 161.151 1.00 25.29  ? 157 ALA A N     1 
ATOM   1147 C CA    . ALA A 1 157 ? 23.861 48.339 162.289 1.00 26.35  ? 157 ALA A CA    1 
ATOM   1148 C C     . ALA A 1 157 ? 25.132 47.651 162.786 1.00 28.54  ? 157 ALA A C     1 
ATOM   1149 O O     . ALA A 1 157 ? 25.389 47.563 163.988 1.00 30.67  ? 157 ALA A O     1 
ATOM   1150 C CB    . ALA A 1 157 ? 22.841 47.304 161.860 1.00 24.97  ? 157 ALA A CB    1 
ATOM   1151 N N     . ILE A 1 158 ? 25.927 47.157 161.842 1.00 28.85  ? 158 ILE A N     1 
ATOM   1152 C CA    . ILE A 1 158 ? 27.183 46.499 162.167 1.00 27.62  ? 158 ILE A CA    1 
ATOM   1153 C C     . ILE A 1 158 ? 28.115 47.510 162.838 1.00 28.09  ? 158 ILE A C     1 
ATOM   1154 O O     . ILE A 1 158 ? 28.773 47.196 163.828 1.00 27.31  ? 158 ILE A O     1 
ATOM   1155 C CB    . ILE A 1 158 ? 27.854 45.941 160.891 1.00 26.22  ? 158 ILE A CB    1 
ATOM   1156 C CG1   . ILE A 1 158 ? 27.081 44.713 160.403 1.00 26.81  ? 158 ILE A CG1   1 
ATOM   1157 C CG2   . ILE A 1 158 ? 29.311 45.602 161.160 1.00 26.91  ? 158 ILE A CG2   1 
ATOM   1158 C CD1   . ILE A 1 158 ? 27.656 44.071 159.159 1.00 25.35  ? 158 ILE A CD1   1 
ATOM   1159 N N     . LEU A 1 159 ? 28.159 48.726 162.299 1.00 27.74  ? 159 LEU A N     1 
ATOM   1160 C CA    . LEU A 1 159 ? 29.008 49.776 162.854 1.00 28.25  ? 159 LEU A CA    1 
ATOM   1161 C C     . LEU A 1 159 ? 28.658 50.061 164.314 1.00 28.96  ? 159 LEU A C     1 
ATOM   1162 O O     . LEU A 1 159 ? 29.525 50.022 165.191 1.00 27.53  ? 159 LEU A O     1 
ATOM   1163 C CB    . LEU A 1 159 ? 28.866 51.070 162.040 1.00 27.98  ? 159 LEU A CB    1 
ATOM   1164 C CG    . LEU A 1 159 ? 29.678 52.267 162.554 1.00 28.08  ? 159 LEU A CG    1 
ATOM   1165 C CD1   . LEU A 1 159 ? 31.170 51.980 162.415 1.00 26.29  ? 159 LEU A CD1   1 
ATOM   1166 C CD2   . LEU A 1 159 ? 29.308 53.513 161.778 1.00 28.00  ? 159 LEU A CD2   1 
ATOM   1167 N N     . MET A 1 160 ? 27.385 50.353 164.562 1.00 29.02  ? 160 MET A N     1 
ATOM   1168 C CA    . MET A 1 160 ? 26.908 50.652 165.905 1.00 30.53  ? 160 MET A CA    1 
ATOM   1169 C C     . MET A 1 160 ? 27.166 49.477 166.848 1.00 32.16  ? 160 MET A C     1 
ATOM   1170 O O     . MET A 1 160 ? 27.731 49.645 167.934 1.00 32.04  ? 160 MET A O     1 
ATOM   1171 C CB    . MET A 1 160 ? 25.409 50.962 165.866 1.00 29.85  ? 160 MET A CB    1 
ATOM   1172 C CG    . MET A 1 160 ? 24.873 51.605 167.130 1.00 32.59  ? 160 MET A CG    1 
ATOM   1173 S SD    . MET A 1 160 ? 25.647 53.210 167.470 1.00 35.82  ? 160 MET A SD    1 
ATOM   1174 C CE    . MET A 1 160 ? 26.713 52.785 168.839 1.00 37.15  ? 160 MET A CE    1 
ATOM   1175 N N     . GLY A 1 161 ? 26.749 48.287 166.423 1.00 32.05  ? 161 GLY A N     1 
ATOM   1176 C CA    . GLY A 1 161 ? 26.938 47.103 167.238 1.00 32.89  ? 161 GLY A CA    1 
ATOM   1177 C C     . GLY A 1 161 ? 28.383 46.845 167.630 1.00 34.21  ? 161 GLY A C     1 
ATOM   1178 O O     . GLY A 1 161 ? 28.660 46.509 168.785 1.00 35.28  ? 161 GLY A O     1 
ATOM   1179 N N     . LEU A 1 162 ? 29.307 46.992 166.682 1.00 31.70  ? 162 LEU A N     1 
ATOM   1180 C CA    . LEU A 1 162 ? 30.718 46.758 166.975 1.00 31.54  ? 162 LEU A CA    1 
ATOM   1181 C C     . LEU A 1 162 ? 31.344 47.902 167.759 1.00 30.36  ? 162 LEU A C     1 
ATOM   1182 O O     . LEU A 1 162 ? 32.316 47.700 168.487 1.00 29.11  ? 162 LEU A O     1 
ATOM   1183 C CB    . LEU A 1 162 ? 31.508 46.494 165.688 1.00 30.58  ? 162 LEU A CB    1 
ATOM   1184 C CG    . LEU A 1 162 ? 31.569 45.029 165.237 1.00 30.11  ? 162 LEU A CG    1 
ATOM   1185 C CD1   . LEU A 1 162 ? 32.369 44.212 166.248 1.00 29.04  ? 162 LEU A CD1   1 
ATOM   1186 C CD2   . LEU A 1 162 ? 30.169 44.468 165.088 1.00 29.53  ? 162 LEU A CD2   1 
ATOM   1187 N N     . ILE A 1 163 ? 30.797 49.104 167.612 1.00 30.84  ? 163 ILE A N     1 
ATOM   1188 C CA    . ILE A 1 163 ? 31.318 50.229 168.374 1.00 31.91  ? 163 ILE A CA    1 
ATOM   1189 C C     . ILE A 1 163 ? 30.997 49.949 169.842 1.00 31.34  ? 163 ILE A C     1 
ATOM   1190 O O     . ILE A 1 163 ? 31.840 50.138 170.715 1.00 31.18  ? 163 ILE A O     1 
ATOM   1191 C CB    . ILE A 1 163 ? 30.678 51.571 167.950 1.00 31.28  ? 163 ILE A CB    1 
ATOM   1192 C CG1   . ILE A 1 163 ? 31.289 52.038 166.623 1.00 32.05  ? 163 ILE A CG1   1 
ATOM   1193 C CG2   . ILE A 1 163 ? 30.894 52.622 169.039 1.00 29.47  ? 163 ILE A CG2   1 
ATOM   1194 C CD1   . ILE A 1 163 ? 30.738 53.364 166.119 1.00 31.04  ? 163 ILE A CD1   1 
ATOM   1195 N N     . LEU A 1 164 ? 29.781 49.475 170.102 1.00 30.75  ? 164 LEU A N     1 
ATOM   1196 C CA    . LEU A 1 164 ? 29.375 49.151 171.468 1.00 31.65  ? 164 LEU A CA    1 
ATOM   1197 C C     . LEU A 1 164 ? 30.225 48.012 172.020 1.00 31.33  ? 164 LEU A C     1 
ATOM   1198 O O     . LEU A 1 164 ? 30.667 48.063 173.164 1.00 32.79  ? 164 LEU A O     1 
ATOM   1199 C CB    . LEU A 1 164 ? 27.890 48.763 171.516 1.00 29.07  ? 164 LEU A CB    1 
ATOM   1200 C CG    . LEU A 1 164 ? 26.911 49.883 171.160 1.00 28.17  ? 164 LEU A CG    1 
ATOM   1201 C CD1   . LEU A 1 164 ? 25.488 49.369 171.237 1.00 28.40  ? 164 LEU A CD1   1 
ATOM   1202 C CD2   . LEU A 1 164 ? 27.107 51.054 172.109 1.00 27.51  ? 164 LEU A CD2   1 
ATOM   1203 N N     . ALA A 1 165 ? 30.461 46.992 171.201 1.00 32.02  ? 165 ALA A N     1 
ATOM   1204 C CA    . ALA A 1 165 ? 31.267 45.850 171.618 1.00 31.34  ? 165 ALA A CA    1 
ATOM   1205 C C     . ALA A 1 165 ? 32.712 46.248 171.921 1.00 32.13  ? 165 ALA A C     1 
ATOM   1206 O O     . ALA A 1 165 ? 33.290 45.805 172.916 1.00 33.18  ? 165 ALA A O     1 
ATOM   1207 C CB    . ALA A 1 165 ? 31.244 44.778 170.543 1.00 31.36  ? 165 ALA A CB    1 
ATOM   1208 N N     . LEU A 1 166 ? 33.296 47.081 171.063 1.00 31.25  ? 166 LEU A N     1 
ATOM   1209 C CA    . LEU A 1 166 ? 34.678 47.516 171.247 1.00 31.35  ? 166 LEU A CA    1 
ATOM   1210 C C     . LEU A 1 166 ? 34.855 48.444 172.448 1.00 31.60  ? 166 LEU A C     1 
ATOM   1211 O O     . LEU A 1 166 ? 35.937 48.514 173.027 1.00 31.38  ? 166 LEU A O     1 
ATOM   1212 C CB    . LEU A 1 166 ? 35.189 48.212 169.975 1.00 30.18  ? 166 LEU A CB    1 
ATOM   1213 C CG    . LEU A 1 166 ? 35.439 47.326 168.745 1.00 29.59  ? 166 LEU A CG    1 
ATOM   1214 C CD1   . LEU A 1 166 ? 35.717 48.207 167.531 1.00 27.30  ? 166 LEU A CD1   1 
ATOM   1215 C CD2   . LEU A 1 166 ? 36.613 46.381 169.010 1.00 26.33  ? 166 LEU A CD2   1 
ATOM   1216 N N     . THR A 1 167 ? 33.797 49.158 172.817 1.00 31.81  ? 167 THR A N     1 
ATOM   1217 C CA    . THR A 1 167 ? 33.860 50.074 173.951 1.00 34.03  ? 167 THR A CA    1 
ATOM   1218 C C     . THR A 1 167 ? 33.239 49.505 175.230 1.00 36.16  ? 167 THR A C     1 
ATOM   1219 O O     . THR A 1 167 ? 33.279 50.150 176.276 1.00 36.67  ? 167 THR A O     1 
ATOM   1220 C CB    . THR A 1 167 ? 33.150 51.405 173.639 1.00 33.07  ? 167 THR A CB    1 
ATOM   1221 O OG1   . THR A 1 167 ? 31.786 51.145 173.286 1.00 31.54  ? 167 THR A OG1   1 
ATOM   1222 C CG2   . THR A 1 167 ? 33.850 52.131 172.495 1.00 33.54  ? 167 THR A CG2   1 
ATOM   1223 N N     . ASP A 1 168 ? 32.667 48.307 175.145 1.00 37.76  ? 168 ASP A N     1 
ATOM   1224 C CA    . ASP A 1 168 ? 32.041 47.673 176.306 1.00 38.55  ? 168 ASP A CA    1 
ATOM   1225 C C     . ASP A 1 168 ? 33.080 46.944 177.160 1.00 38.79  ? 168 ASP A C     1 
ATOM   1226 O O     . ASP A 1 168 ? 33.485 45.823 176.843 1.00 37.44  ? 168 ASP A O     1 
ATOM   1227 C CB    . ASP A 1 168 ? 30.953 46.701 175.836 1.00 40.11  ? 168 ASP A CB    1 
ATOM   1228 C CG    . ASP A 1 168 ? 30.347 45.905 176.974 1.00 40.23  ? 168 ASP A CG    1 
ATOM   1229 O OD1   . ASP A 1 168 ? 30.500 46.319 178.139 1.00 41.90  ? 168 ASP A OD1   1 
ATOM   1230 O OD2   . ASP A 1 168 ? 29.710 44.868 176.700 1.00 40.43  ? 168 ASP A OD2   1 
ATOM   1231 N N     . ASP A 1 169 ? 33.502 47.585 178.249 1.00 39.52  ? 169 ASP A N     1 
ATOM   1232 C CA    . ASP A 1 169 ? 34.514 47.005 179.128 1.00 41.34  ? 169 ASP A CA    1 
ATOM   1233 C C     . ASP A 1 169 ? 34.110 45.723 179.851 1.00 41.90  ? 169 ASP A C     1 
ATOM   1234 O O     . ASP A 1 169 ? 34.948 45.057 180.455 1.00 42.17  ? 169 ASP A O     1 
ATOM   1235 C CB    . ASP A 1 169 ? 34.994 48.045 180.138 1.00 42.86  ? 169 ASP A CB    1 
ATOM   1236 C CG    . ASP A 1 169 ? 35.894 49.093 179.506 1.00 46.40  ? 169 ASP A CG    1 
ATOM   1237 O OD1   . ASP A 1 169 ? 36.791 48.711 178.720 1.00 47.22  ? 169 ASP A OD1   1 
ATOM   1238 O OD2   . ASP A 1 169 ? 35.718 50.295 179.798 1.00 47.40  ? 169 ASP A OD2   1 
ATOM   1239 N N     . GLY A 1 170 ? 32.833 45.370 179.785 1.00 42.50  ? 170 GLY A N     1 
ATOM   1240 C CA    . GLY A 1 170 ? 32.387 44.149 180.428 1.00 43.27  ? 170 GLY A CA    1 
ATOM   1241 C C     . GLY A 1 170 ? 32.433 43.001 179.437 1.00 44.36  ? 170 GLY A C     1 
ATOM   1242 O O     . GLY A 1 170 ? 31.989 41.889 179.728 1.00 44.76  ? 170 GLY A O     1 
ATOM   1243 N N     . ASN A 1 171 ? 32.980 43.275 178.256 1.00 44.24  ? 171 ASN A N     1 
ATOM   1244 C CA    . ASN A 1 171 ? 33.078 42.273 177.201 1.00 43.02  ? 171 ASN A CA    1 
ATOM   1245 C C     . ASN A 1 171 ? 34.531 41.904 176.946 1.00 42.39  ? 171 ASN A C     1 
ATOM   1246 O O     . ASN A 1 171 ? 35.222 42.588 176.196 1.00 43.34  ? 171 ASN A O     1 
ATOM   1247 C CB    . ASN A 1 171 ? 32.471 42.816 175.906 1.00 43.51  ? 171 ASN A CB    1 
ATOM   1248 C CG    . ASN A 1 171 ? 32.308 41.746 174.846 1.00 43.69  ? 171 ASN A CG    1 
ATOM   1249 O OD1   . ASN A 1 171 ? 33.136 40.842 174.722 1.00 43.94  ? 171 ASN A OD1   1 
ATOM   1250 N ND2   . ASN A 1 171 ? 31.242 41.850 174.066 1.00 45.36  ? 171 ASN A ND2   1 
ATOM   1251 N N     . GLY A 1 172 ? 34.992 40.819 177.555 1.00 40.94  ? 172 GLY A N     1 
ATOM   1252 C CA    . GLY A 1 172 ? 36.368 40.409 177.358 1.00 40.27  ? 172 GLY A CA    1 
ATOM   1253 C C     . GLY A 1 172 ? 37.338 41.412 177.957 1.00 40.52  ? 172 GLY A C     1 
ATOM   1254 O O     . GLY A 1 172 ? 36.962 42.203 178.822 1.00 40.44  ? 172 GLY A O     1 
ATOM   1255 N N     . VAL A 1 173 ? 38.584 41.384 177.497 1.00 39.76  ? 173 VAL A N     1 
ATOM   1256 C CA    . VAL A 1 173 ? 39.602 42.294 178.005 1.00 40.03  ? 173 VAL A CA    1 
ATOM   1257 C C     . VAL A 1 173 ? 39.410 43.696 177.438 1.00 40.94  ? 173 VAL A C     1 
ATOM   1258 O O     . VAL A 1 173 ? 39.364 43.883 176.220 1.00 40.54  ? 173 VAL A O     1 
ATOM   1259 C CB    . VAL A 1 173 ? 41.019 41.795 177.649 1.00 39.81  ? 173 VAL A CB    1 
ATOM   1260 C CG1   . VAL A 1 173 ? 42.066 42.722 178.238 1.00 39.57  ? 173 VAL A CG1   1 
ATOM   1261 C CG2   . VAL A 1 173 ? 41.215 40.382 178.172 1.00 39.42  ? 173 VAL A CG2   1 
ATOM   1262 N N     . PRO A 1 174 ? 39.289 44.701 178.322 1.00 41.13  ? 174 PRO A N     1 
ATOM   1263 C CA    . PRO A 1 174 ? 39.100 46.104 177.924 1.00 40.35  ? 174 PRO A CA    1 
ATOM   1264 C C     . PRO A 1 174 ? 40.157 46.558 176.914 1.00 39.35  ? 174 PRO A C     1 
ATOM   1265 O O     . PRO A 1 174 ? 41.340 46.245 177.072 1.00 38.19  ? 174 PRO A O     1 
ATOM   1266 C CB    . PRO A 1 174 ? 39.215 46.853 179.251 1.00 40.22  ? 174 PRO A CB    1 
ATOM   1267 C CG    . PRO A 1 174 ? 38.682 45.858 180.247 1.00 40.49  ? 174 PRO A CG    1 
ATOM   1268 C CD    . PRO A 1 174 ? 39.324 44.568 179.791 1.00 40.37  ? 174 PRO A CD    1 
ATOM   1269 N N     . ARG A 1 175 ? 39.733 47.294 175.886 1.00 38.04  ? 175 ARG A N     1 
ATOM   1270 C CA    . ARG A 1 175 ? 40.663 47.772 174.865 1.00 37.66  ? 175 ARG A CA    1 
ATOM   1271 C C     . ARG A 1 175 ? 41.429 49.004 175.301 1.00 36.99  ? 175 ARG A C     1 
ATOM   1272 O O     . ARG A 1 175 ? 42.523 49.263 174.804 1.00 38.96  ? 175 ARG A O     1 
ATOM   1273 C CB    . ARG A 1 175 ? 39.942 48.104 173.552 1.00 37.59  ? 175 ARG A CB    1 
ATOM   1274 C CG    . ARG A 1 175 ? 39.455 46.908 172.756 1.00 36.88  ? 175 ARG A CG    1 
ATOM   1275 C CD    . ARG A 1 175 ? 38.074 46.515 173.201 1.00 37.30  ? 175 ARG A CD    1 
ATOM   1276 N NE    . ARG A 1 175 ? 38.035 45.133 173.640 1.00 38.36  ? 175 ARG A NE    1 
ATOM   1277 C CZ    . ARG A 1 175 ? 37.041 44.604 174.338 1.00 36.68  ? 175 ARG A CZ    1 
ATOM   1278 N NH1   . ARG A 1 175 ? 35.998 45.350 174.677 1.00 35.33  ? 175 ARG A NH1   1 
ATOM   1279 N NH2   . ARG A 1 175 ? 37.103 43.334 174.704 1.00 38.13  ? 175 ARG A NH2   1 
ATOM   1280 N N     . GLY A 1 176 ? 40.853 49.772 176.217 1.00 35.84  ? 176 GLY A N     1 
ATOM   1281 C CA    . GLY A 1 176 ? 41.523 50.976 176.666 1.00 35.09  ? 176 GLY A CA    1 
ATOM   1282 C C     . GLY A 1 176 ? 41.806 51.929 175.513 1.00 34.15  ? 176 GLY A C     1 
ATOM   1283 O O     . GLY A 1 176 ? 40.910 52.228 174.721 1.00 34.65  ? 176 GLY A O     1 
ATOM   1284 N N     . PRO A 1 177 ? 43.049 52.411 175.380 1.00 32.73  ? 177 PRO A N     1 
ATOM   1285 C CA    . PRO A 1 177 ? 43.424 53.338 174.308 1.00 33.30  ? 177 PRO A CA    1 
ATOM   1286 C C     . PRO A 1 177 ? 43.380 52.770 172.885 1.00 33.67  ? 177 PRO A C     1 
ATOM   1287 O O     . PRO A 1 177 ? 43.527 53.514 171.920 1.00 36.13  ? 177 PRO A O     1 
ATOM   1288 C CB    . PRO A 1 177 ? 44.827 53.781 174.720 1.00 33.70  ? 177 PRO A CB    1 
ATOM   1289 C CG    . PRO A 1 177 ? 45.379 52.550 175.369 1.00 30.78  ? 177 PRO A CG    1 
ATOM   1290 C CD    . PRO A 1 177 ? 44.215 52.083 176.222 1.00 31.82  ? 177 PRO A CD    1 
ATOM   1291 N N     . LEU A 1 178 ? 43.172 51.462 172.757 1.00 33.70  ? 178 LEU A N     1 
ATOM   1292 C CA    . LEU A 1 178 ? 43.105 50.803 171.452 1.00 32.81  ? 178 LEU A CA    1 
ATOM   1293 C C     . LEU A 1 178 ? 41.747 50.949 170.772 1.00 32.28  ? 178 LEU A C     1 
ATOM   1294 O O     . LEU A 1 178 ? 41.639 50.815 169.553 1.00 32.29  ? 178 LEU A O     1 
ATOM   1295 C CB    . LEU A 1 178 ? 43.384 49.305 171.593 1.00 34.41  ? 178 LEU A CB    1 
ATOM   1296 C CG    . LEU A 1 178 ? 44.799 48.733 171.540 1.00 37.89  ? 178 LEU A CG    1 
ATOM   1297 C CD1   . LEU A 1 178 ? 44.728 47.236 171.817 1.00 37.35  ? 178 LEU A CD1   1 
ATOM   1298 C CD2   . LEU A 1 178 ? 45.425 48.993 170.174 1.00 38.17  ? 178 LEU A CD2   1 
ATOM   1299 N N     . ALA A 1 179 ? 40.715 51.202 171.572 1.00 30.11  ? 179 ALA A N     1 
ATOM   1300 C CA    . ALA A 1 179 ? 39.348 51.320 171.077 1.00 28.72  ? 179 ALA A CA    1 
ATOM   1301 C C     . ALA A 1 179 ? 39.153 52.183 169.823 1.00 28.10  ? 179 ALA A C     1 
ATOM   1302 O O     . ALA A 1 179 ? 38.597 51.714 168.830 1.00 28.99  ? 179 ALA A O     1 
ATOM   1303 C CB    . ALA A 1 179 ? 38.433 51.806 172.205 1.00 27.45  ? 179 ALA A CB    1 
ATOM   1304 N N     . PRO A 1 180 ? 39.594 53.453 169.854 1.00 27.48  ? 180 PRO A N     1 
ATOM   1305 C CA    . PRO A 1 180 ? 39.430 54.320 168.679 1.00 25.42  ? 180 PRO A CA    1 
ATOM   1306 C C     . PRO A 1 180 ? 40.060 53.720 167.427 1.00 24.98  ? 180 PRO A C     1 
ATOM   1307 O O     . PRO A 1 180 ? 39.430 53.679 166.372 1.00 22.33  ? 180 PRO A O     1 
ATOM   1308 C CB    . PRO A 1 180 ? 40.110 55.616 169.112 1.00 26.24  ? 180 PRO A CB    1 
ATOM   1309 C CG    . PRO A 1 180 ? 39.863 55.635 170.595 1.00 26.58  ? 180 PRO A CG    1 
ATOM   1310 C CD    . PRO A 1 180 ? 40.185 54.208 170.975 1.00 27.71  ? 180 PRO A CD    1 
ATOM   1311 N N     . LEU A 1 181 ? 41.299 53.248 167.553 1.00 25.29  ? 181 LEU A N     1 
ATOM   1312 C CA    . LEU A 1 181 ? 42.010 52.641 166.427 1.00 25.63  ? 181 LEU A CA    1 
ATOM   1313 C C     . LEU A 1 181 ? 41.215 51.471 165.868 1.00 25.57  ? 181 LEU A C     1 
ATOM   1314 O O     . LEU A 1 181 ? 41.034 51.357 164.657 1.00 27.17  ? 181 LEU A O     1 
ATOM   1315 C CB    . LEU A 1 181 ? 43.393 52.145 166.858 1.00 24.87  ? 181 LEU A CB    1 
ATOM   1316 C CG    . LEU A 1 181 ? 44.181 51.356 165.798 1.00 25.76  ? 181 LEU A CG    1 
ATOM   1317 C CD1   . LEU A 1 181 ? 44.571 52.283 164.648 1.00 24.36  ? 181 LEU A CD1   1 
ATOM   1318 C CD2   . LEU A 1 181 ? 45.434 50.743 166.419 1.00 23.70  ? 181 LEU A CD2   1 
ATOM   1319 N N     . LEU A 1 182 ? 40.736 50.604 166.753 1.00 25.29  ? 182 LEU A N     1 
ATOM   1320 C CA    . LEU A 1 182 ? 39.959 49.447 166.323 1.00 26.07  ? 182 LEU A CA    1 
ATOM   1321 C C     . LEU A 1 182 ? 38.673 49.871 165.612 1.00 24.94  ? 182 LEU A C     1 
ATOM   1322 O O     . LEU A 1 182 ? 38.235 49.216 164.668 1.00 25.07  ? 182 LEU A O     1 
ATOM   1323 C CB    . LEU A 1 182 ? 39.650 48.532 167.524 1.00 25.08  ? 182 LEU A CB    1 
ATOM   1324 C CG    . LEU A 1 182 ? 40.899 47.949 168.214 1.00 26.69  ? 182 LEU A CG    1 
ATOM   1325 C CD1   . LEU A 1 182 ? 40.507 47.130 169.423 1.00 26.09  ? 182 LEU A CD1   1 
ATOM   1326 C CD2   . LEU A 1 182 ? 41.683 47.086 167.227 1.00 27.52  ? 182 LEU A CD2   1 
ATOM   1327 N N     . ILE A 1 183 ? 38.071 50.966 166.056 1.00 24.82  ? 183 ILE A N     1 
ATOM   1328 C CA    . ILE A 1 183 ? 36.851 51.441 165.410 1.00 25.88  ? 183 ILE A CA    1 
ATOM   1329 C C     . ILE A 1 183 ? 37.213 51.916 163.999 1.00 26.13  ? 183 ILE A C     1 
ATOM   1330 O O     . ILE A 1 183 ? 36.431 51.763 163.060 1.00 26.49  ? 183 ILE A O     1 
ATOM   1331 C CB    . ILE A 1 183 ? 36.209 52.608 166.195 1.00 25.93  ? 183 ILE A CB    1 
ATOM   1332 C CG1   . ILE A 1 183 ? 35.781 52.120 167.584 1.00 25.36  ? 183 ILE A CG1   1 
ATOM   1333 C CG2   . ILE A 1 183 ? 35.013 53.164 165.417 1.00 22.48  ? 183 ILE A CG2   1 
ATOM   1334 C CD1   . ILE A 1 183 ? 35.248 53.218 168.491 1.00 24.51  ? 183 ILE A CD1   1 
ATOM   1335 N N     . GLY A 1 184 ? 38.403 52.496 163.864 1.00 25.18  ? 184 GLY A N     1 
ATOM   1336 C CA    . GLY A 1 184 ? 38.861 52.952 162.569 1.00 24.03  ? 184 GLY A CA    1 
ATOM   1337 C C     . GLY A 1 184 ? 39.035 51.764 161.633 1.00 24.42  ? 184 GLY A C     1 
ATOM   1338 O O     . GLY A 1 184 ? 38.632 51.818 160.472 1.00 22.92  ? 184 GLY A O     1 
ATOM   1339 N N     . LEU A 1 185 ? 39.632 50.686 162.139 1.00 25.03  ? 185 LEU A N     1 
ATOM   1340 C CA    . LEU A 1 185 ? 39.846 49.483 161.338 1.00 24.68  ? 185 LEU A CA    1 
ATOM   1341 C C     . LEU A 1 185 ? 38.513 48.825 160.996 1.00 24.65  ? 185 LEU A C     1 
ATOM   1342 O O     . LEU A 1 185 ? 38.384 48.167 159.962 1.00 24.79  ? 185 LEU A O     1 
ATOM   1343 C CB    . LEU A 1 185 ? 40.753 48.490 162.080 1.00 23.94  ? 185 LEU A CB    1 
ATOM   1344 C CG    . LEU A 1 185 ? 42.205 48.933 162.291 1.00 26.57  ? 185 LEU A CG    1 
ATOM   1345 C CD1   . LEU A 1 185 ? 42.983 47.819 162.993 1.00 25.64  ? 185 LEU A CD1   1 
ATOM   1346 C CD2   . LEU A 1 185 ? 42.858 49.274 160.946 1.00 25.08  ? 185 LEU A CD2   1 
ATOM   1347 N N     . LEU A 1 186 ? 37.523 49.007 161.866 1.00 22.30  ? 186 LEU A N     1 
ATOM   1348 C CA    . LEU A 1 186 ? 36.202 48.445 161.632 1.00 22.34  ? 186 LEU A CA    1 
ATOM   1349 C C     . LEU A 1 186 ? 35.603 49.125 160.401 1.00 22.47  ? 186 LEU A C     1 
ATOM   1350 O O     . LEU A 1 186 ? 35.045 48.470 159.522 1.00 21.52  ? 186 LEU A O     1 
ATOM   1351 C CB    . LEU A 1 186 ? 35.301 48.681 162.847 1.00 21.61  ? 186 LEU A CB    1 
ATOM   1352 C CG    . LEU A 1 186 ? 33.811 48.414 162.612 1.00 24.06  ? 186 LEU A CG    1 
ATOM   1353 C CD1   . LEU A 1 186 ? 33.578 46.936 162.328 1.00 21.60  ? 186 LEU A CD1   1 
ATOM   1354 C CD2   . LEU A 1 186 ? 33.021 48.865 163.836 1.00 27.43  ? 186 LEU A CD2   1 
ATOM   1355 N N     . ILE A 1 187 ? 35.728 50.449 160.354 1.00 21.57  ? 187 ILE A N     1 
ATOM   1356 C CA    . ILE A 1 187 ? 35.229 51.240 159.238 1.00 20.06  ? 187 ILE A CA    1 
ATOM   1357 C C     . ILE A 1 187 ? 35.980 50.842 157.970 1.00 20.05  ? 187 ILE A C     1 
ATOM   1358 O O     . ILE A 1 187 ? 35.399 50.784 156.883 1.00 21.32  ? 187 ILE A O     1 
ATOM   1359 C CB    . ILE A 1 187 ? 35.411 52.749 159.530 1.00 21.10  ? 187 ILE A CB    1 
ATOM   1360 C CG1   . ILE A 1 187 ? 34.396 53.176 160.595 1.00 21.57  ? 187 ILE A CG1   1 
ATOM   1361 C CG2   . ILE A 1 187 ? 35.234 53.573 158.264 1.00 20.72  ? 187 ILE A CG2   1 
ATOM   1362 C CD1   . ILE A 1 187 ? 34.694 54.506 161.232 1.00 24.03  ? 187 ILE A CD1   1 
ATOM   1363 N N     . ALA A 1 188 ? 37.268 50.550 158.116 1.00 18.38  ? 188 ALA A N     1 
ATOM   1364 C CA    . ALA A 1 188 ? 38.080 50.140 156.987 1.00 18.90  ? 188 ALA A CA    1 
ATOM   1365 C C     . ALA A 1 188 ? 37.565 48.829 156.372 1.00 19.23  ? 188 ALA A C     1 
ATOM   1366 O O     . ALA A 1 188 ? 37.434 48.733 155.155 1.00 19.86  ? 188 ALA A O     1 
ATOM   1367 C CB    . ALA A 1 188 ? 39.529 49.981 157.419 1.00 17.78  ? 188 ALA A CB    1 
ATOM   1368 N N     . VAL A 1 189 ? 37.266 47.825 157.198 1.00 19.02  ? 189 VAL A N     1 
ATOM   1369 C CA    . VAL A 1 189 ? 36.777 46.559 156.651 1.00 20.16  ? 189 VAL A CA    1 
ATOM   1370 C C     . VAL A 1 189 ? 35.354 46.676 156.094 1.00 18.75  ? 189 VAL A C     1 
ATOM   1371 O O     . VAL A 1 189 ? 34.997 45.957 155.163 1.00 19.32  ? 189 VAL A O     1 
ATOM   1372 C CB    . VAL A 1 189 ? 36.866 45.385 157.686 1.00 19.88  ? 189 VAL A CB    1 
ATOM   1373 C CG1   . VAL A 1 189 ? 38.303 45.209 158.133 1.00 22.03  ? 189 VAL A CG1   1 
ATOM   1374 C CG2   . VAL A 1 189 ? 35.982 45.645 158.878 1.00 23.02  ? 189 VAL A CG2   1 
ATOM   1375 N N     . ILE A 1 190 ? 34.543 47.576 156.650 1.00 17.72  ? 190 ILE A N     1 
ATOM   1376 C CA    . ILE A 1 190 ? 33.192 47.775 156.123 1.00 18.33  ? 190 ILE A CA    1 
ATOM   1377 C C     . ILE A 1 190 ? 33.334 48.428 154.735 1.00 19.95  ? 190 ILE A C     1 
ATOM   1378 O O     . ILE A 1 190 ? 32.676 48.029 153.778 1.00 18.38  ? 190 ILE A O     1 
ATOM   1379 C CB    . ILE A 1 190 ? 32.343 48.713 157.032 1.00 19.85  ? 190 ILE A CB    1 
ATOM   1380 C CG1   . ILE A 1 190 ? 31.945 47.985 158.324 1.00 21.34  ? 190 ILE A CG1   1 
ATOM   1381 C CG2   . ILE A 1 190 ? 31.088 49.168 156.293 1.00 15.54  ? 190 ILE A CG2   1 
ATOM   1382 C CD1   . ILE A 1 190 ? 31.300 48.883 159.359 1.00 20.36  ? 190 ILE A CD1   1 
ATOM   1383 N N     . GLY A 1 191 ? 34.212 49.425 154.637 1.00 19.21  ? 191 GLY A N     1 
ATOM   1384 C CA    . GLY A 1 191 ? 34.416 50.107 153.375 1.00 21.17  ? 191 GLY A CA    1 
ATOM   1385 C C     . GLY A 1 191 ? 34.977 49.215 152.287 1.00 22.75  ? 191 GLY A C     1 
ATOM   1386 O O     . GLY A 1 191 ? 34.635 49.362 151.116 1.00 23.51  ? 191 GLY A O     1 
ATOM   1387 N N     . ALA A 1 192 ? 35.842 48.283 152.670 1.00 23.74  ? 192 ALA A N     1 
ATOM   1388 C CA    . ALA A 1 192 ? 36.449 47.372 151.711 1.00 23.82  ? 192 ALA A CA    1 
ATOM   1389 C C     . ALA A 1 192 ? 35.486 46.289 151.239 1.00 23.39  ? 192 ALA A C     1 
ATOM   1390 O O     . ALA A 1 192 ? 35.507 45.897 150.074 1.00 23.06  ? 192 ALA A O     1 
ATOM   1391 C CB    . ALA A 1 192 ? 37.677 46.732 152.322 1.00 23.57  ? 192 ALA A CB    1 
ATOM   1392 N N     . SER A 1 193 ? 34.634 45.812 152.140 1.00 23.42  ? 193 SER A N     1 
ATOM   1393 C CA    . SER A 1 193 ? 33.699 44.746 151.796 1.00 22.50  ? 193 SER A CA    1 
ATOM   1394 C C     . SER A 1 193 ? 32.352 45.193 151.235 1.00 22.66  ? 193 SER A C     1 
ATOM   1395 O O     . SER A 1 193 ? 31.732 44.463 150.464 1.00 21.73  ? 193 SER A O     1 
ATOM   1396 C CB    . SER A 1 193 ? 33.463 43.848 153.015 1.00 24.19  ? 193 SER A CB    1 
ATOM   1397 O OG    . SER A 1 193 ? 32.942 44.586 154.107 1.00 25.17  ? 193 SER A OG    1 
ATOM   1398 N N     . MET A 1 194 ? 31.910 46.393 151.602 1.00 22.77  ? 194 MET A N     1 
ATOM   1399 C CA    . MET A 1 194 ? 30.614 46.897 151.156 1.00 22.67  ? 194 MET A CA    1 
ATOM   1400 C C     . MET A 1 194 ? 30.657 48.251 150.463 1.00 23.02  ? 194 MET A C     1 
ATOM   1401 O O     . MET A 1 194 ? 29.666 48.675 149.861 1.00 23.00  ? 194 MET A O     1 
ATOM   1402 C CB    . MET A 1 194 ? 29.666 46.998 152.354 1.00 23.36  ? 194 MET A CB    1 
ATOM   1403 C CG    . MET A 1 194 ? 29.238 45.670 152.950 1.00 23.76  ? 194 MET A CG    1 
ATOM   1404 S SD    . MET A 1 194 ? 28.178 44.703 151.854 1.00 29.50  ? 194 MET A SD    1 
ATOM   1405 C CE    . MET A 1 194 ? 28.970 43.072 151.963 1.00 24.94  ? 194 MET A CE    1 
ATOM   1406 N N     . GLY A 1 195 ? 31.799 48.929 150.562 1.00 21.72  ? 195 GLY A N     1 
ATOM   1407 C CA    . GLY A 1 195 ? 31.955 50.242 149.966 1.00 18.54  ? 195 GLY A CA    1 
ATOM   1408 C C     . GLY A 1 195 ? 31.602 50.367 148.493 1.00 19.91  ? 195 GLY A C     1 
ATOM   1409 O O     . GLY A 1 195 ? 31.025 51.375 148.090 1.00 20.32  ? 195 GLY A O     1 
ATOM   1410 N N     . PRO A 1 196 ? 31.942 49.381 147.654 1.00 19.30  ? 196 PRO A N     1 
ATOM   1411 C CA    . PRO A 1 196 ? 31.596 49.511 146.232 1.00 20.74  ? 196 PRO A CA    1 
ATOM   1412 C C     . PRO A 1 196 ? 30.099 49.670 145.957 1.00 22.02  ? 196 PRO A C     1 
ATOM   1413 O O     . PRO A 1 196 ? 29.710 50.108 144.871 1.00 22.68  ? 196 PRO A O     1 
ATOM   1414 C CB    . PRO A 1 196 ? 32.164 48.231 145.624 1.00 20.62  ? 196 PRO A CB    1 
ATOM   1415 C CG    . PRO A 1 196 ? 33.386 47.993 146.470 1.00 19.51  ? 196 PRO A CG    1 
ATOM   1416 C CD    . PRO A 1 196 ? 32.868 48.256 147.870 1.00 18.24  ? 196 PRO A CD    1 
ATOM   1417 N N     . LEU A 1 197 ? 29.261 49.330 146.936 1.00 20.11  ? 197 LEU A N     1 
ATOM   1418 C CA    . LEU A 1 197 ? 27.816 49.427 146.752 1.00 22.19  ? 197 LEU A CA    1 
ATOM   1419 C C     . LEU A 1 197 ? 27.190 50.802 146.991 1.00 22.50  ? 197 LEU A C     1 
ATOM   1420 O O     . LEU A 1 197 ? 26.371 51.248 146.189 1.00 21.73  ? 197 LEU A O     1 
ATOM   1421 C CB    . LEU A 1 197 ? 27.100 48.380 147.621 1.00 22.32  ? 197 LEU A CB    1 
ATOM   1422 C CG    . LEU A 1 197 ? 27.361 46.913 147.259 1.00 22.28  ? 197 LEU A CG    1 
ATOM   1423 C CD1   . LEU A 1 197 ? 26.593 45.995 148.197 1.00 20.70  ? 197 LEU A CD1   1 
ATOM   1424 C CD2   . LEU A 1 197 ? 26.945 46.661 145.819 1.00 22.81  ? 197 LEU A CD2   1 
ATOM   1425 N N     . THR A 1 198 ? 27.563 51.475 148.079 1.00 22.68  ? 198 THR A N     1 
ATOM   1426 C CA    . THR A 1 198 ? 26.981 52.781 148.378 1.00 24.03  ? 198 THR A CA    1 
ATOM   1427 C C     . THR A 1 198 ? 27.952 53.798 148.978 1.00 23.14  ? 198 THR A C     1 
ATOM   1428 O O     . THR A 1 198 ? 27.524 54.845 149.476 1.00 22.18  ? 198 THR A O     1 
ATOM   1429 C CB    . THR A 1 198 ? 25.778 52.653 149.352 1.00 26.01  ? 198 THR A CB    1 
ATOM   1430 O OG1   . THR A 1 198 ? 26.231 52.130 150.609 1.00 27.83  ? 198 THR A OG1   1 
ATOM   1431 C CG2   . THR A 1 198 ? 24.712 51.729 148.776 1.00 23.33  ? 198 THR A CG2   1 
ATOM   1432 N N     . GLY A 1 199 ? 29.247 53.492 148.933 1.00 20.76  ? 199 GLY A N     1 
ATOM   1433 C CA    . GLY A 1 199 ? 30.239 54.400 149.486 1.00 18.30  ? 199 GLY A CA    1 
ATOM   1434 C C     . GLY A 1 199 ? 30.233 54.452 151.004 1.00 19.52  ? 199 GLY A C     1 
ATOM   1435 O O     . GLY A 1 199 ? 30.674 55.442 151.595 1.00 17.35  ? 199 GLY A O     1 
ATOM   1436 N N     . PHE A 1 200 ? 29.772 53.367 151.629 1.00 17.96  ? 200 PHE A N     1 
ATOM   1437 C CA    . PHE A 1 200 ? 29.673 53.246 153.085 1.00 18.84  ? 200 PHE A CA    1 
ATOM   1438 C C     . PHE A 1 200 ? 29.542 54.563 153.840 1.00 21.25  ? 200 PHE A C     1 
ATOM   1439 O O     . PHE A 1 200 ? 30.398 54.925 154.649 1.00 21.53  ? 200 PHE A O     1 
ATOM   1440 C CB    . PHE A 1 200 ? 30.827 52.387 153.673 1.00 18.69  ? 200 PHE A CB    1 
ATOM   1441 C CG    . PHE A 1 200 ? 32.231 52.890 153.376 1.00 18.90  ? 200 PHE A CG    1 
ATOM   1442 C CD1   . PHE A 1 200 ? 33.112 53.164 154.422 1.00 17.91  ? 200 PHE A CD1   1 
ATOM   1443 C CD2   . PHE A 1 200 ? 32.691 53.032 152.062 1.00 18.39  ? 200 PHE A CD2   1 
ATOM   1444 C CE1   . PHE A 1 200 ? 34.430 53.573 154.171 1.00 17.93  ? 200 PHE A CE1   1 
ATOM   1445 C CE2   . PHE A 1 200 ? 33.999 53.437 151.798 1.00 16.94  ? 200 PHE A CE2   1 
ATOM   1446 C CZ    . PHE A 1 200 ? 34.875 53.710 152.853 1.00 17.41  ? 200 PHE A CZ    1 
ATOM   1447 N N     . ALA A 1 201 ? 28.445 55.273 153.576 1.00 21.21  ? 201 ALA A N     1 
ATOM   1448 C CA    . ALA A 1 201 ? 28.187 56.551 154.233 1.00 21.58  ? 201 ALA A CA    1 
ATOM   1449 C C     . ALA A 1 201 ? 28.057 56.358 155.745 1.00 20.38  ? 201 ALA A C     1 
ATOM   1450 O O     . ALA A 1 201 ? 28.826 56.929 156.502 1.00 20.20  ? 201 ALA A O     1 
ATOM   1451 C CB    . ALA A 1 201 ? 26.919 57.187 153.665 1.00 20.02  ? 201 ALA A CB    1 
ATOM   1452 N N     . MET A 1 202 ? 27.073 55.566 156.169 1.00 22.19  ? 202 MET A N     1 
ATOM   1453 C CA    . MET A 1 202 ? 26.840 55.259 157.591 1.00 23.26  ? 202 MET A CA    1 
ATOM   1454 C C     . MET A 1 202 ? 26.732 56.451 158.534 1.00 23.31  ? 202 MET A C     1 
ATOM   1455 O O     . MET A 1 202 ? 26.662 56.266 159.749 1.00 25.09  ? 202 MET A O     1 
ATOM   1456 C CB    . MET A 1 202 ? 27.970 54.370 158.128 1.00 23.69  ? 202 MET A CB    1 
ATOM   1457 C CG    . MET A 1 202 ? 28.240 53.104 157.331 1.00 24.85  ? 202 MET A CG    1 
ATOM   1458 S SD    . MET A 1 202 ? 29.503 52.080 158.106 1.00 28.57  ? 202 MET A SD    1 
ATOM   1459 C CE    . MET A 1 202 ? 30.958 53.118 157.925 1.00 17.57  ? 202 MET A CE    1 
ATOM   1460 N N     . ASN A 1 203 ? 26.687 57.659 157.991 1.00 22.37  ? 203 ASN A N     1 
ATOM   1461 C CA    . ASN A 1 203 ? 26.692 58.858 158.820 1.00 20.36  ? 203 ASN A CA    1 
ATOM   1462 C C     . ASN A 1 203 ? 25.979 59.998 158.089 1.00 22.70  ? 203 ASN A C     1 
ATOM   1463 O O     . ASN A 1 203 ? 26.500 60.531 157.109 1.00 23.19  ? 203 ASN A O     1 
ATOM   1464 C CB    . ASN A 1 203 ? 28.165 59.209 159.076 1.00 19.12  ? 203 ASN A CB    1 
ATOM   1465 C CG    . ASN A 1 203 ? 28.358 60.428 159.950 1.00 20.03  ? 203 ASN A CG    1 
ATOM   1466 O OD1   . ASN A 1 203 ? 27.583 61.379 159.907 1.00 21.38  ? 203 ASN A OD1   1 
ATOM   1467 N ND2   . ASN A 1 203 ? 29.434 60.417 160.730 1.00 20.75  ? 203 ASN A ND2   1 
ATOM   1468 N N     . PRO A 1 204 ? 24.775 60.387 158.557 1.00 23.78  ? 204 PRO A N     1 
ATOM   1469 C CA    . PRO A 1 204 ? 23.993 61.468 157.938 1.00 23.92  ? 204 PRO A CA    1 
ATOM   1470 C C     . PRO A 1 204 ? 24.750 62.791 157.780 1.00 24.71  ? 204 PRO A C     1 
ATOM   1471 O O     . PRO A 1 204 ? 24.648 63.455 156.743 1.00 25.09  ? 204 PRO A O     1 
ATOM   1472 C CB    . PRO A 1 204 ? 22.788 61.599 158.867 1.00 24.04  ? 204 PRO A CB    1 
ATOM   1473 C CG    . PRO A 1 204 ? 22.601 60.186 159.364 1.00 24.75  ? 204 PRO A CG    1 
ATOM   1474 C CD    . PRO A 1 204 ? 24.027 59.771 159.670 1.00 23.04  ? 204 PRO A CD    1 
ATOM   1475 N N     . ALA A 1 205 ? 25.501 63.179 158.804 1.00 23.53  ? 205 ALA A N     1 
ATOM   1476 C CA    . ALA A 1 205 ? 26.263 64.423 158.743 1.00 24.69  ? 205 ALA A CA    1 
ATOM   1477 C C     . ALA A 1 205 ? 27.370 64.324 157.695 1.00 26.29  ? 205 ALA A C     1 
ATOM   1478 O O     . ALA A 1 205 ? 27.584 65.255 156.913 1.00 27.08  ? 205 ALA A O     1 
ATOM   1479 C CB    . ALA A 1 205 ? 26.869 64.738 160.110 1.00 23.80  ? 205 ALA A CB    1 
ATOM   1480 N N     . ARG A 1 206 ? 28.072 63.195 157.686 1.00 24.76  ? 206 ARG A N     1 
ATOM   1481 C CA    . ARG A 1 206 ? 29.158 62.984 156.737 1.00 25.56  ? 206 ARG A CA    1 
ATOM   1482 C C     . ARG A 1 206 ? 28.678 63.094 155.290 1.00 23.90  ? 206 ARG A C     1 
ATOM   1483 O O     . ARG A 1 206 ? 29.435 63.496 154.413 1.00 21.59  ? 206 ARG A O     1 
ATOM   1484 C CB    . ARG A 1 206 ? 29.818 61.609 156.975 1.00 23.76  ? 206 ARG A CB    1 
ATOM   1485 C CG    . ARG A 1 206 ? 30.744 61.126 155.847 1.00 22.17  ? 206 ARG A CG    1 
ATOM   1486 C CD    . ARG A 1 206 ? 29.960 60.348 154.793 1.00 23.87  ? 206 ARG A CD    1 
ATOM   1487 N NE    . ARG A 1 206 ? 30.786 59.856 153.690 1.00 23.13  ? 206 ARG A NE    1 
ATOM   1488 C CZ    . ARG A 1 206 ? 31.265 60.619 152.709 1.00 23.81  ? 206 ARG A CZ    1 
ATOM   1489 N NH1   . ARG A 1 206 ? 31.009 61.919 152.689 1.00 21.09  ? 206 ARG A NH1   1 
ATOM   1490 N NH2   . ARG A 1 206 ? 31.982 60.078 151.732 1.00 22.02  ? 206 ARG A NH2   1 
ATOM   1491 N N     . ASP A 1 207 ? 27.419 62.752 155.043 1.00 23.86  ? 207 ASP A N     1 
ATOM   1492 C CA    . ASP A 1 207 ? 26.905 62.810 153.679 1.00 26.75  ? 207 ASP A CA    1 
ATOM   1493 C C     . ASP A 1 207 ? 26.159 64.090 153.294 1.00 25.53  ? 207 ASP A C     1 
ATOM   1494 O O     . ASP A 1 207 ? 26.459 64.695 152.267 1.00 27.69  ? 207 ASP A O     1 
ATOM   1495 C CB    . ASP A 1 207 ? 25.995 61.615 153.406 1.00 25.76  ? 207 ASP A CB    1 
ATOM   1496 C CG    . ASP A 1 207 ? 25.792 61.379 151.930 1.00 28.86  ? 207 ASP A CG    1 
ATOM   1497 O OD1   . ASP A 1 207 ? 26.656 60.722 151.311 1.00 29.30  ? 207 ASP A OD1   1 
ATOM   1498 O OD2   . ASP A 1 207 ? 24.780 61.866 151.384 1.00 30.72  ? 207 ASP A OD2   1 
ATOM   1499 N N     . PHE A 1 208 ? 25.194 64.496 154.114 1.00 24.45  ? 208 PHE A N     1 
ATOM   1500 C CA    . PHE A 1 208 ? 24.395 65.687 153.831 1.00 25.86  ? 208 PHE A CA    1 
ATOM   1501 C C     . PHE A 1 208 ? 25.197 66.986 153.799 1.00 25.58  ? 208 PHE A C     1 
ATOM   1502 O O     . PHE A 1 208 ? 25.049 67.791 152.879 1.00 27.87  ? 208 PHE A O     1 
ATOM   1503 C CB    . PHE A 1 208 ? 23.263 65.812 154.851 1.00 28.00  ? 208 PHE A CB    1 
ATOM   1504 C CG    . PHE A 1 208 ? 22.196 66.789 154.450 1.00 29.53  ? 208 PHE A CG    1 
ATOM   1505 C CD1   . PHE A 1 208 ? 21.335 66.501 153.396 1.00 29.84  ? 208 PHE A CD1   1 
ATOM   1506 C CD2   . PHE A 1 208 ? 22.061 68.004 155.115 1.00 28.13  ? 208 PHE A CD2   1 
ATOM   1507 C CE1   . PHE A 1 208 ? 20.356 67.409 153.009 1.00 29.87  ? 208 PHE A CE1   1 
ATOM   1508 C CE2   . PHE A 1 208 ? 21.086 68.918 154.735 1.00 28.13  ? 208 PHE A CE2   1 
ATOM   1509 C CZ    . PHE A 1 208 ? 20.234 68.620 153.683 1.00 28.84  ? 208 PHE A CZ    1 
ATOM   1510 N N     . GLY A 1 209 ? 26.038 67.195 154.807 1.00 25.17  ? 209 GLY A N     1 
ATOM   1511 C CA    . GLY A 1 209 ? 26.851 68.399 154.850 1.00 22.35  ? 209 GLY A CA    1 
ATOM   1512 C C     . GLY A 1 209 ? 27.607 68.629 153.550 1.00 22.34  ? 209 GLY A C     1 
ATOM   1513 O O     . GLY A 1 209 ? 27.446 69.676 152.922 1.00 21.10  ? 209 GLY A O     1 
ATOM   1514 N N     . PRO A 1 210 ? 28.455 67.673 153.126 1.00 22.09  ? 210 PRO A N     1 
ATOM   1515 C CA    . PRO A 1 210 ? 29.222 67.811 151.881 1.00 21.47  ? 210 PRO A CA    1 
ATOM   1516 C C     . PRO A 1 210 ? 28.338 67.859 150.635 1.00 21.35  ? 210 PRO A C     1 
ATOM   1517 O O     . PRO A 1 210 ? 28.717 68.449 149.625 1.00 20.13  ? 210 PRO A O     1 
ATOM   1518 C CB    . PRO A 1 210 ? 30.141 66.591 151.905 1.00 22.05  ? 210 PRO A CB    1 
ATOM   1519 C CG    . PRO A 1 210 ? 30.384 66.393 153.381 1.00 20.60  ? 210 PRO A CG    1 
ATOM   1520 C CD    . PRO A 1 210 ? 28.990 66.571 153.947 1.00 21.84  ? 210 PRO A CD    1 
ATOM   1521 N N     . LYS A 1 211 ? 27.171 67.225 150.702 1.00 22.73  ? 211 LYS A N     1 
ATOM   1522 C CA    . LYS A 1 211 ? 26.243 67.245 149.578 1.00 24.86  ? 211 LYS A CA    1 
ATOM   1523 C C     . LYS A 1 211 ? 25.731 68.671 149.413 1.00 24.33  ? 211 LYS A C     1 
ATOM   1524 O O     . LYS A 1 211 ? 25.631 69.184 148.300 1.00 24.65  ? 211 LYS A O     1 
ATOM   1525 C CB    . LYS A 1 211 ? 25.058 66.301 149.820 1.00 24.38  ? 211 LYS A CB    1 
ATOM   1526 C CG    . LYS A 1 211 ? 25.163 64.977 149.080 1.00 25.92  ? 211 LYS A CG    1 
ATOM   1527 C CD    . LYS A 1 211 ? 23.895 64.141 149.225 1.00 22.50  ? 211 LYS A CD    1 
ATOM   1528 C CE    . LYS A 1 211 ? 23.969 62.882 148.377 1.00 22.14  ? 211 LYS A CE    1 
ATOM   1529 N NZ    . LYS A 1 211 ? 25.204 62.092 148.645 1.00 21.40  ? 211 LYS A NZ    1 
ATOM   1530 N N     . VAL A 1 212 ? 25.406 69.310 150.530 1.00 24.32  ? 212 VAL A N     1 
ATOM   1531 C CA    . VAL A 1 212 ? 24.923 70.685 150.491 1.00 24.64  ? 212 VAL A CA    1 
ATOM   1532 C C     . VAL A 1 212 ? 26.025 71.591 149.948 1.00 23.34  ? 212 VAL A C     1 
ATOM   1533 O O     . VAL A 1 212 ? 25.750 72.556 149.233 1.00 23.57  ? 212 VAL A O     1 
ATOM   1534 C CB    . VAL A 1 212 ? 24.486 71.173 151.900 1.00 24.41  ? 212 VAL A CB    1 
ATOM   1535 C CG1   . VAL A 1 212 ? 24.133 72.650 151.860 1.00 23.36  ? 212 VAL A CG1   1 
ATOM   1536 C CG2   . VAL A 1 212 ? 23.287 70.364 152.377 1.00 22.93  ? 212 VAL A CG2   1 
ATOM   1537 N N     . PHE A 1 213 ? 27.277 71.281 150.278 1.00 23.36  ? 213 PHE A N     1 
ATOM   1538 C CA    . PHE A 1 213 ? 28.373 72.091 149.780 1.00 22.89  ? 213 PHE A CA    1 
ATOM   1539 C C     . PHE A 1 213 ? 28.549 71.932 148.270 1.00 22.46  ? 213 PHE A C     1 
ATOM   1540 O O     . PHE A 1 213 ? 28.694 72.916 147.550 1.00 23.59  ? 213 PHE A O     1 
ATOM   1541 C CB    . PHE A 1 213 ? 29.698 71.738 150.454 1.00 23.09  ? 213 PHE A CB    1 
ATOM   1542 C CG    . PHE A 1 213 ? 30.863 72.469 149.855 1.00 23.75  ? 213 PHE A CG    1 
ATOM   1543 C CD1   . PHE A 1 213 ? 31.061 73.819 150.126 1.00 23.11  ? 213 PHE A CD1   1 
ATOM   1544 C CD2   . PHE A 1 213 ? 31.674 71.849 148.906 1.00 23.53  ? 213 PHE A CD2   1 
ATOM   1545 C CE1   . PHE A 1 213 ? 32.040 74.548 149.451 1.00 24.82  ? 213 PHE A CE1   1 
ATOM   1546 C CE2   . PHE A 1 213 ? 32.652 72.567 148.228 1.00 23.01  ? 213 PHE A CE2   1 
ATOM   1547 C CZ    . PHE A 1 213 ? 32.834 73.919 148.499 1.00 23.38  ? 213 PHE A CZ    1 
ATOM   1548 N N     . ALA A 1 214 ? 28.557 70.692 147.797 1.00 21.88  ? 214 ALA A N     1 
ATOM   1549 C CA    . ALA A 1 214 ? 28.728 70.433 146.372 1.00 24.02  ? 214 ALA A CA    1 
ATOM   1550 C C     . ALA A 1 214 ? 27.600 71.113 145.592 1.00 23.89  ? 214 ALA A C     1 
ATOM   1551 O O     . ALA A 1 214 ? 27.790 71.586 144.469 1.00 22.50  ? 214 ALA A O     1 
ATOM   1552 C CB    . ALA A 1 214 ? 28.735 68.920 146.110 1.00 20.73  ? 214 ALA A CB    1 
ATOM   1553 N N     . TRP A 1 215 ? 26.425 71.143 146.209 1.00 24.71  ? 215 TRP A N     1 
ATOM   1554 C CA    . TRP A 1 215 ? 25.237 71.768 145.641 1.00 24.49  ? 215 TRP A CA    1 
ATOM   1555 C C     . TRP A 1 215 ? 25.536 73.257 145.437 1.00 24.85  ? 215 TRP A C     1 
ATOM   1556 O O     . TRP A 1 215 ? 25.305 73.803 144.358 1.00 24.40  ? 215 TRP A O     1 
ATOM   1557 C CB    . TRP A 1 215 ? 24.077 71.565 146.620 1.00 25.49  ? 215 TRP A CB    1 
ATOM   1558 C CG    . TRP A 1 215 ? 22.783 72.211 146.254 1.00 28.00  ? 215 TRP A CG    1 
ATOM   1559 C CD1   . TRP A 1 215 ? 21.936 71.858 145.236 1.00 28.76  ? 215 TRP A CD1   1 
ATOM   1560 C CD2   . TRP A 1 215 ? 22.139 73.272 146.962 1.00 26.99  ? 215 TRP A CD2   1 
ATOM   1561 N NE1   . TRP A 1 215 ? 20.799 72.631 145.277 1.00 27.16  ? 215 TRP A NE1   1 
ATOM   1562 C CE2   . TRP A 1 215 ? 20.897 73.509 146.327 1.00 26.91  ? 215 TRP A CE2   1 
ATOM   1563 C CE3   . TRP A 1 215 ? 22.489 74.048 148.076 1.00 25.66  ? 215 TRP A CE3   1 
ATOM   1564 C CZ2   . TRP A 1 215 ? 20.003 74.484 146.771 1.00 24.80  ? 215 TRP A CZ2   1 
ATOM   1565 C CZ3   . TRP A 1 215 ? 21.596 75.020 148.519 1.00 25.77  ? 215 TRP A CZ3   1 
ATOM   1566 C CH2   . TRP A 1 215 ? 20.369 75.227 147.865 1.00 24.37  ? 215 TRP A CH2   1 
ATOM   1567 N N     . LEU A 1 216 ? 26.074 73.895 146.476 1.00 24.85  ? 216 LEU A N     1 
ATOM   1568 C CA    . LEU A 1 216 ? 26.429 75.314 146.437 1.00 25.93  ? 216 LEU A CA    1 
ATOM   1569 C C     . LEU A 1 216 ? 27.636 75.615 145.553 1.00 26.11  ? 216 LEU A C     1 
ATOM   1570 O O     . LEU A 1 216 ? 27.753 76.714 145.015 1.00 26.41  ? 216 LEU A O     1 
ATOM   1571 C CB    . LEU A 1 216 ? 26.756 75.825 147.846 1.00 28.17  ? 216 LEU A CB    1 
ATOM   1572 C CG    . LEU A 1 216 ? 25.655 75.956 148.897 1.00 33.05  ? 216 LEU A CG    1 
ATOM   1573 C CD1   . LEU A 1 216 ? 26.280 76.295 150.242 1.00 32.86  ? 216 LEU A CD1   1 
ATOM   1574 C CD2   . LEU A 1 216 ? 24.660 77.046 148.475 1.00 35.46  ? 216 LEU A CD2   1 
ATOM   1575 N N     . ALA A 1 217 ? 28.544 74.650 145.415 1.00 23.88  ? 217 ALA A N     1 
ATOM   1576 C CA    . ALA A 1 217 ? 29.752 74.871 144.629 1.00 21.33  ? 217 ALA A CA    1 
ATOM   1577 C C     . ALA A 1 217 ? 29.633 74.626 143.126 1.00 21.79  ? 217 ALA A C     1 
ATOM   1578 O O     . ALA A 1 217 ? 30.646 74.581 142.421 1.00 21.42  ? 217 ALA A O     1 
ATOM   1579 C CB    . ALA A 1 217 ? 30.898 74.042 145.204 1.00 21.58  ? 217 ALA A CB    1 
ATOM   1580 N N     . GLY A 1 218 ? 28.414 74.445 142.630 1.00 20.28  ? 218 GLY A N     1 
ATOM   1581 C CA    . GLY A 1 218 ? 28.260 74.258 141.198 1.00 20.87  ? 218 GLY A CA    1 
ATOM   1582 C C     . GLY A 1 218 ? 27.770 72.926 140.671 1.00 21.39  ? 218 GLY A C     1 
ATOM   1583 O O     . GLY A 1 218 ? 27.557 72.792 139.467 1.00 23.57  ? 218 GLY A O     1 
ATOM   1584 N N     . TRP A 1 219 ? 27.591 71.936 141.535 1.00 19.75  ? 219 TRP A N     1 
ATOM   1585 C CA    . TRP A 1 219 ? 27.116 70.646 141.057 1.00 22.69  ? 219 TRP A CA    1 
ATOM   1586 C C     . TRP A 1 219 ? 25.600 70.649 140.915 1.00 25.07  ? 219 TRP A C     1 
ATOM   1587 O O     . TRP A 1 219 ? 25.022 69.809 140.221 1.00 25.60  ? 219 TRP A O     1 
ATOM   1588 C CB    . TRP A 1 219 ? 27.598 69.524 141.986 1.00 22.64  ? 219 TRP A CB    1 
ATOM   1589 C CG    . TRP A 1 219 ? 28.978 69.041 141.598 1.00 22.71  ? 219 TRP A CG    1 
ATOM   1590 C CD1   . TRP A 1 219 ? 29.279 68.124 140.630 1.00 18.40  ? 219 TRP A CD1   1 
ATOM   1591 C CD2   . TRP A 1 219 ? 30.235 69.539 142.083 1.00 20.13  ? 219 TRP A CD2   1 
ATOM   1592 N NE1   . TRP A 1 219 ? 30.639 68.028 140.477 1.00 20.10  ? 219 TRP A NE1   1 
ATOM   1593 C CE2   . TRP A 1 219 ? 31.251 68.884 141.353 1.00 21.22  ? 219 TRP A CE2   1 
ATOM   1594 C CE3   . TRP A 1 219 ? 30.599 70.477 143.056 1.00 21.12  ? 219 TRP A CE3   1 
ATOM   1595 C CZ2   . TRP A 1 219 ? 32.618 69.139 141.566 1.00 20.83  ? 219 TRP A CZ2   1 
ATOM   1596 C CZ3   . TRP A 1 219 ? 31.967 70.732 143.271 1.00 22.27  ? 219 TRP A CZ3   1 
ATOM   1597 C CH2   . TRP A 1 219 ? 32.953 70.064 142.525 1.00 20.91  ? 219 TRP A CH2   1 
ATOM   1598 N N     . GLY A 1 220 ? 24.961 71.613 141.568 1.00 26.34  ? 220 GLY A N     1 
ATOM   1599 C CA    . GLY A 1 220 ? 23.519 71.735 141.480 1.00 27.90  ? 220 GLY A CA    1 
ATOM   1600 C C     . GLY A 1 220 ? 22.712 70.589 142.054 1.00 28.93  ? 220 GLY A C     1 
ATOM   1601 O O     . GLY A 1 220 ? 23.141 69.892 142.977 1.00 29.26  ? 220 GLY A O     1 
ATOM   1602 N N     . ASN A 1 221 ? 21.528 70.395 141.481 1.00 28.06  ? 221 ASN A N     1 
ATOM   1603 C CA    . ASN A 1 221 ? 20.599 69.369 141.922 1.00 26.27  ? 221 ASN A CA    1 
ATOM   1604 C C     . ASN A 1 221 ? 21.132 67.930 141.911 1.00 25.80  ? 221 ASN A C     1 
ATOM   1605 O O     . ASN A 1 221 ? 20.774 67.145 142.790 1.00 24.87  ? 221 ASN A O     1 
ATOM   1606 C CB    . ASN A 1 221 ? 19.316 69.456 141.095 1.00 25.46  ? 221 ASN A CB    1 
ATOM   1607 C CG    . ASN A 1 221 ? 18.146 68.774 141.768 1.00 25.18  ? 221 ASN A CG    1 
ATOM   1608 O OD1   . ASN A 1 221 ? 17.458 67.956 141.162 1.00 25.23  ? 221 ASN A OD1   1 
ATOM   1609 N ND2   . ASN A 1 221 ? 17.910 69.114 143.031 1.00 25.60  ? 221 ASN A ND2   1 
ATOM   1610 N N     . VAL A 1 222 ? 21.969 67.573 140.933 1.00 25.75  ? 222 VAL A N     1 
ATOM   1611 C CA    . VAL A 1 222 ? 22.508 66.206 140.887 1.00 26.39  ? 222 VAL A CA    1 
ATOM   1612 C C     . VAL A 1 222 ? 23.278 65.837 142.158 1.00 24.31  ? 222 VAL A C     1 
ATOM   1613 O O     . VAL A 1 222 ? 23.431 64.662 142.469 1.00 23.92  ? 222 VAL A O     1 
ATOM   1614 C CB    . VAL A 1 222 ? 23.442 65.958 139.665 1.00 25.46  ? 222 VAL A CB    1 
ATOM   1615 C CG1   . VAL A 1 222 ? 22.657 66.064 138.376 1.00 27.69  ? 222 VAL A CG1   1 
ATOM   1616 C CG2   . VAL A 1 222 ? 24.598 66.923 139.676 1.00 26.11  ? 222 VAL A CG2   1 
ATOM   1617 N N     . ALA A 1 223 ? 23.756 66.834 142.894 1.00 23.85  ? 223 ALA A N     1 
ATOM   1618 C CA    . ALA A 1 223 ? 24.480 66.564 144.134 1.00 24.82  ? 223 ALA A CA    1 
ATOM   1619 C C     . ALA A 1 223 ? 23.558 65.827 145.100 1.00 26.61  ? 223 ALA A C     1 
ATOM   1620 O O     . ALA A 1 223 ? 24.011 65.001 145.902 1.00 26.85  ? 223 ALA A O     1 
ATOM   1621 C CB    . ALA A 1 223 ? 24.957 67.863 144.770 1.00 19.26  ? 223 ALA A CB    1 
ATOM   1622 N N     . PHE A 1 224 ? 22.264 66.126 145.009 1.00 26.91  ? 224 PHE A N     1 
ATOM   1623 C CA    . PHE A 1 224 ? 21.261 65.517 145.879 1.00 29.08  ? 224 PHE A CA    1 
ATOM   1624 C C     . PHE A 1 224 ? 20.631 64.249 145.316 1.00 28.83  ? 224 PHE A C     1 
ATOM   1625 O O     . PHE A 1 224 ? 20.356 63.305 146.056 1.00 30.09  ? 224 PHE A O     1 
ATOM   1626 C CB    . PHE A 1 224 ? 20.147 66.525 146.177 1.00 29.11  ? 224 PHE A CB    1 
ATOM   1627 C CG    . PHE A 1 224 ? 20.545 67.596 147.145 1.00 32.17  ? 224 PHE A CG    1 
ATOM   1628 C CD1   . PHE A 1 224 ? 20.320 68.937 146.851 1.00 30.97  ? 224 PHE A CD1   1 
ATOM   1629 C CD2   . PHE A 1 224 ? 21.144 67.266 148.357 1.00 32.70  ? 224 PHE A CD2   1 
ATOM   1630 C CE1   . PHE A 1 224 ? 20.686 69.937 147.751 1.00 32.85  ? 224 PHE A CE1   1 
ATOM   1631 C CE2   . PHE A 1 224 ? 21.515 68.258 149.266 1.00 33.64  ? 224 PHE A CE2   1 
ATOM   1632 C CZ    . PHE A 1 224 ? 21.286 69.598 148.961 1.00 32.97  ? 224 PHE A CZ    1 
ATOM   1633 N N     . THR A 1 225 ? 20.409 64.238 144.008 1.00 27.55  ? 225 THR A N     1 
ATOM   1634 C CA    . THR A 1 225 ? 19.770 63.118 143.335 1.00 28.93  ? 225 THR A CA    1 
ATOM   1635 C C     . THR A 1 225 ? 20.723 62.056 142.798 1.00 30.51  ? 225 THR A C     1 
ATOM   1636 O O     . THR A 1 225 ? 20.342 60.897 142.650 1.00 30.01  ? 225 THR A O     1 
ATOM   1637 C CB    . THR A 1 225 ? 18.942 63.613 142.137 1.00 30.48  ? 225 THR A CB    1 
ATOM   1638 O OG1   . THR A 1 225 ? 19.835 64.025 141.092 1.00 28.60  ? 225 THR A OG1   1 
ATOM   1639 C CG2   . THR A 1 225 ? 18.055 64.801 142.539 1.00 27.22  ? 225 THR A CG2   1 
ATOM   1640 N N     . GLY A 1 226 ? 21.952 62.453 142.486 1.00 31.68  ? 226 GLY A N     1 
ATOM   1641 C CA    . GLY A 1 226 ? 22.903 61.509 141.936 1.00 35.19  ? 226 GLY A CA    1 
ATOM   1642 C C     . GLY A 1 226 ? 22.484 61.136 140.523 1.00 38.51  ? 226 GLY A C     1 
ATOM   1643 O O     . GLY A 1 226 ? 23.032 60.211 139.919 1.00 38.37  ? 226 GLY A O     1 
ATOM   1644 N N     . GLY A 1 227 ? 21.503 61.866 139.996 1.00 40.52  ? 227 GLY A N     1 
ATOM   1645 C CA    . GLY A 1 227 ? 21.012 61.603 138.655 1.00 42.43  ? 227 GLY A CA    1 
ATOM   1646 C C     . GLY A 1 227 ? 20.024 60.451 138.636 1.00 44.75  ? 227 GLY A C     1 
ATOM   1647 O O     . GLY A 1 227 ? 19.852 59.791 137.617 1.00 46.94  ? 227 GLY A O     1 
ATOM   1648 N N     . ARG A 1 228 ? 19.369 60.206 139.764 1.00 46.44  ? 228 ARG A N     1 
ATOM   1649 C CA    . ARG A 1 228 ? 18.403 59.116 139.859 1.00 49.11  ? 228 ARG A CA    1 
ATOM   1650 C C     . ARG A 1 228 ? 16.992 59.672 140.058 1.00 51.06  ? 228 ARG A C     1 
ATOM   1651 O O     . ARG A 1 228 ? 16.821 60.785 140.554 1.00 51.00  ? 228 ARG A O     1 
ATOM   1652 C CB    . ARG A 1 228 ? 18.774 58.204 141.032 1.00 47.28  ? 228 ARG A CB    1 
ATOM   1653 C CG    . ARG A 1 228 ? 20.257 57.842 141.088 1.00 47.63  ? 228 ARG A CG    1 
ATOM   1654 C CD    . ARG A 1 228 ? 20.641 56.768 140.087 1.00 45.89  ? 228 ARG A CD    1 
ATOM   1655 N NE    . ARG A 1 228 ? 20.086 55.476 140.476 1.00 49.32  ? 228 ARG A NE    1 
ATOM   1656 C CZ    . ARG A 1 228 ? 20.796 54.361 140.636 1.00 47.29  ? 228 ARG A CZ    1 
ATOM   1657 N NH1   . ARG A 1 228 ? 22.107 54.357 140.437 1.00 46.44  ? 228 ARG A NH1   1 
ATOM   1658 N NH2   . ARG A 1 228 ? 20.189 53.247 141.013 1.00 47.49  ? 228 ARG A NH2   1 
ATOM   1659 N N     . ASP A 1 229 ? 15.984 58.896 139.670 1.00 54.23  ? 229 ASP A N     1 
ATOM   1660 C CA    . ASP A 1 229 ? 14.595 59.327 139.816 1.00 56.76  ? 229 ASP A CA    1 
ATOM   1661 C C     . ASP A 1 229 ? 14.263 59.635 141.267 1.00 55.87  ? 229 ASP A C     1 
ATOM   1662 O O     . ASP A 1 229 ? 13.714 60.696 141.567 1.00 58.05  ? 229 ASP A O     1 
ATOM   1663 C CB    . ASP A 1 229 ? 13.640 58.266 139.262 1.00 60.10  ? 229 ASP A CB    1 
ATOM   1664 C CG    . ASP A 1 229 ? 13.534 58.317 137.744 1.00 64.07  ? 229 ASP A CG    1 
ATOM   1665 O OD1   . ASP A 1 229 ? 12.935 57.392 137.152 1.00 66.60  ? 229 ASP A OD1   1 
ATOM   1666 O OD2   . ASP A 1 229 ? 14.044 59.291 137.144 1.00 64.99  ? 229 ASP A OD2   1 
ATOM   1667 N N     . ILE A 1 230 ? 14.583 58.714 142.171 1.00 53.17  ? 230 ILE A N     1 
ATOM   1668 C CA    . ILE A 1 230 ? 14.330 58.957 143.586 1.00 50.72  ? 230 ILE A CA    1 
ATOM   1669 C C     . ILE A 1 230 ? 15.573 59.666 144.123 1.00 48.65  ? 230 ILE A C     1 
ATOM   1670 O O     . ILE A 1 230 ? 16.679 59.139 144.024 1.00 49.71  ? 230 ILE A O     1 
ATOM   1671 C CB    . ILE A 1 230 ? 14.113 57.643 144.360 1.00 51.40  ? 230 ILE A CB    1 
ATOM   1672 C CG1   . ILE A 1 230 ? 12.979 56.839 143.717 1.00 53.02  ? 230 ILE A CG1   1 
ATOM   1673 C CG2   . ILE A 1 230 ? 13.760 57.950 145.809 1.00 51.41  ? 230 ILE A CG2   1 
ATOM   1674 C CD1   . ILE A 1 230 ? 12.685 55.516 144.403 1.00 53.13  ? 230 ILE A CD1   1 
ATOM   1675 N N     . PRO A 1 231 ? 15.406 60.875 144.691 1.00 45.80  ? 231 PRO A N     1 
ATOM   1676 C CA    . PRO A 1 231 ? 16.537 61.644 145.234 1.00 42.31  ? 231 PRO A CA    1 
ATOM   1677 C C     . PRO A 1 231 ? 17.372 60.778 146.164 1.00 39.14  ? 231 PRO A C     1 
ATOM   1678 O O     . PRO A 1 231 ? 16.927 60.402 147.248 1.00 39.93  ? 231 PRO A O     1 
ATOM   1679 C CB    . PRO A 1 231 ? 15.851 62.803 145.955 1.00 42.77  ? 231 PRO A CB    1 
ATOM   1680 C CG    . PRO A 1 231 ? 14.545 62.201 146.390 1.00 44.36  ? 231 PRO A CG    1 
ATOM   1681 C CD    . PRO A 1 231 ? 14.124 61.424 145.167 1.00 45.11  ? 231 PRO A CD    1 
ATOM   1682 N N     . TYR A 1 232 ? 18.594 60.475 145.747 1.00 35.54  ? 232 TYR A N     1 
ATOM   1683 C CA    . TYR A 1 232 ? 19.449 59.600 146.532 1.00 33.06  ? 232 TYR A CA    1 
ATOM   1684 C C     . TYR A 1 232 ? 19.822 60.026 147.952 1.00 32.07  ? 232 TYR A C     1 
ATOM   1685 O O     . TYR A 1 232 ? 19.948 59.170 148.828 1.00 32.46  ? 232 TYR A O     1 
ATOM   1686 C CB    . TYR A 1 232 ? 20.730 59.285 145.765 1.00 31.09  ? 232 TYR A CB    1 
ATOM   1687 C CG    . TYR A 1 232 ? 21.537 58.215 146.447 1.00 30.51  ? 232 TYR A CG    1 
ATOM   1688 C CD1   . TYR A 1 232 ? 21.090 56.890 146.463 1.00 29.59  ? 232 TYR A CD1   1 
ATOM   1689 C CD2   . TYR A 1 232 ? 22.714 58.527 147.128 1.00 27.85  ? 232 TYR A CD2   1 
ATOM   1690 C CE1   . TYR A 1 232 ? 21.790 55.905 147.139 1.00 28.86  ? 232 TYR A CE1   1 
ATOM   1691 C CE2   . TYR A 1 232 ? 23.426 57.545 147.814 1.00 27.54  ? 232 TYR A CE2   1 
ATOM   1692 C CZ    . TYR A 1 232 ? 22.958 56.238 147.814 1.00 27.43  ? 232 TYR A CZ    1 
ATOM   1693 O OH    . TYR A 1 232 ? 23.644 55.260 148.490 1.00 27.13  ? 232 TYR A OH    1 
ATOM   1694 N N     . PHE A 1 233 ? 19.994 61.325 148.183 1.00 29.80  ? 233 PHE A N     1 
ATOM   1695 C CA    . PHE A 1 233 ? 20.393 61.819 149.496 1.00 30.19  ? 233 PHE A CA    1 
ATOM   1696 C C     . PHE A 1 233 ? 19.577 61.243 150.644 1.00 31.01  ? 233 PHE A C     1 
ATOM   1697 O O     . PHE A 1 233 ? 20.042 61.196 151.783 1.00 31.17  ? 233 PHE A O     1 
ATOM   1698 C CB    . PHE A 1 233 ? 20.352 63.356 149.527 1.00 31.40  ? 233 PHE A CB    1 
ATOM   1699 C CG    . PHE A 1 233 ? 18.986 63.937 149.781 1.00 33.29  ? 233 PHE A CG    1 
ATOM   1700 C CD1   . PHE A 1 233 ? 18.549 64.176 151.083 1.00 33.60  ? 233 PHE A CD1   1 
ATOM   1701 C CD2   . PHE A 1 233 ? 18.144 64.261 148.720 1.00 34.30  ? 233 PHE A CD2   1 
ATOM   1702 C CE1   . PHE A 1 233 ? 17.288 64.732 151.328 1.00 35.84  ? 233 PHE A CE1   1 
ATOM   1703 C CE2   . PHE A 1 233 ? 16.880 64.818 148.950 1.00 35.93  ? 233 PHE A CE2   1 
ATOM   1704 C CZ    . PHE A 1 233 ? 16.452 65.054 150.259 1.00 34.81  ? 233 PHE A CZ    1 
ATOM   1705 N N     . LEU A 1 234 ? 18.364 60.793 150.349 1.00 32.84  ? 234 LEU A N     1 
ATOM   1706 C CA    . LEU A 1 234 ? 17.507 60.224 151.381 1.00 33.54  ? 234 LEU A CA    1 
ATOM   1707 C C     . LEU A 1 234 ? 18.098 58.964 152.006 1.00 32.45  ? 234 LEU A C     1 
ATOM   1708 O O     . LEU A 1 234 ? 17.947 58.735 153.207 1.00 32.69  ? 234 LEU A O     1 
ATOM   1709 C CB    . LEU A 1 234 ? 16.115 59.920 150.810 1.00 35.06  ? 234 LEU A CB    1 
ATOM   1710 C CG    . LEU A 1 234 ? 15.249 61.139 150.462 1.00 36.15  ? 234 LEU A CG    1 
ATOM   1711 C CD1   . LEU A 1 234 ? 13.920 60.673 149.906 1.00 34.87  ? 234 LEU A CD1   1 
ATOM   1712 C CD2   . LEU A 1 234 ? 15.028 61.996 151.704 1.00 35.80  ? 234 LEU A CD2   1 
ATOM   1713 N N     . VAL A 1 235 ? 18.776 58.152 151.198 1.00 31.19  ? 235 VAL A N     1 
ATOM   1714 C CA    . VAL A 1 235 ? 19.368 56.918 151.703 1.00 30.40  ? 235 VAL A CA    1 
ATOM   1715 C C     . VAL A 1 235 ? 20.444 57.143 152.765 1.00 29.49  ? 235 VAL A C     1 
ATOM   1716 O O     . VAL A 1 235 ? 20.358 56.588 153.860 1.00 29.41  ? 235 VAL A O     1 
ATOM   1717 C CB    . VAL A 1 235 ? 19.967 56.064 150.565 1.00 30.21  ? 235 VAL A CB    1 
ATOM   1718 C CG1   . VAL A 1 235 ? 20.696 54.866 151.155 1.00 30.12  ? 235 VAL A CG1   1 
ATOM   1719 C CG2   . VAL A 1 235 ? 18.860 55.593 149.621 1.00 28.99  ? 235 VAL A CG2   1 
ATOM   1720 N N     . PRO A 1 236 ? 21.474 57.954 152.458 1.00 29.40  ? 236 PRO A N     1 
ATOM   1721 C CA    . PRO A 1 236 ? 22.537 58.206 153.440 1.00 29.27  ? 236 PRO A CA    1 
ATOM   1722 C C     . PRO A 1 236 ? 22.012 58.978 154.646 1.00 29.48  ? 236 PRO A C     1 
ATOM   1723 O O     . PRO A 1 236 ? 22.687 59.095 155.669 1.00 28.82  ? 236 PRO A O     1 
ATOM   1724 C CB    . PRO A 1 236 ? 23.554 59.026 152.651 1.00 28.40  ? 236 PRO A CB    1 
ATOM   1725 C CG    . PRO A 1 236 ? 23.300 58.640 151.233 1.00 28.19  ? 236 PRO A CG    1 
ATOM   1726 C CD    . PRO A 1 236 ? 21.804 58.582 151.169 1.00 28.32  ? 236 PRO A CD    1 
ATOM   1727 N N     . LEU A 1 237 ? 20.799 59.503 154.518 1.00 29.88  ? 237 LEU A N     1 
ATOM   1728 C CA    . LEU A 1 237 ? 20.188 60.278 155.587 1.00 31.64  ? 237 LEU A CA    1 
ATOM   1729 C C     . LEU A 1 237 ? 19.435 59.391 156.580 1.00 32.84  ? 237 LEU A C     1 
ATOM   1730 O O     . LEU A 1 237 ? 19.673 59.458 157.787 1.00 33.40  ? 237 LEU A O     1 
ATOM   1731 C CB    . LEU A 1 237 ? 19.240 61.317 154.983 1.00 32.77  ? 237 LEU A CB    1 
ATOM   1732 C CG    . LEU A 1 237 ? 18.826 62.532 155.819 1.00 34.26  ? 237 LEU A CG    1 
ATOM   1733 C CD1   . LEU A 1 237 ? 20.056 63.349 156.202 1.00 33.46  ? 237 LEU A CD1   1 
ATOM   1734 C CD2   . LEU A 1 237 ? 17.862 63.392 155.011 1.00 33.41  ? 237 LEU A CD2   1 
ATOM   1735 N N     . PHE A 1 238 ? 18.552 58.537 156.070 1.00 33.01  ? 238 PHE A N     1 
ATOM   1736 C CA    . PHE A 1 238 ? 17.751 57.670 156.929 1.00 33.79  ? 238 PHE A CA    1 
ATOM   1737 C C     . PHE A 1 238 ? 18.242 56.236 157.110 1.00 32.46  ? 238 PHE A C     1 
ATOM   1738 O O     . PHE A 1 238 ? 18.060 55.651 158.177 1.00 31.55  ? 238 PHE A O     1 
ATOM   1739 C CB    . PHE A 1 238 ? 16.303 57.667 156.431 1.00 35.54  ? 238 PHE A CB    1 
ATOM   1740 C CG    . PHE A 1 238 ? 15.681 59.033 156.412 1.00 39.10  ? 238 PHE A CG    1 
ATOM   1741 C CD1   . PHE A 1 238 ? 15.474 59.703 155.213 1.00 39.27  ? 238 PHE A CD1   1 
ATOM   1742 C CD2   . PHE A 1 238 ? 15.336 59.668 157.602 1.00 40.97  ? 238 PHE A CD2   1 
ATOM   1743 C CE1   . PHE A 1 238 ? 14.932 60.987 155.198 1.00 42.23  ? 238 PHE A CE1   1 
ATOM   1744 C CE2   . PHE A 1 238 ? 14.795 60.950 157.598 1.00 42.12  ? 238 PHE A CE2   1 
ATOM   1745 C CZ    . PHE A 1 238 ? 14.593 61.609 156.393 1.00 41.91  ? 238 PHE A CZ    1 
ATOM   1746 N N     . GLY A 1 239 ? 18.851 55.668 156.074 1.00 31.80  ? 239 GLY A N     1 
ATOM   1747 C CA    . GLY A 1 239 ? 19.360 54.310 156.182 1.00 29.99  ? 239 GLY A CA    1 
ATOM   1748 C C     . GLY A 1 239 ? 20.251 54.142 157.403 1.00 29.92  ? 239 GLY A C     1 
ATOM   1749 O O     . GLY A 1 239 ? 20.083 53.193 158.170 1.00 31.44  ? 239 GLY A O     1 
ATOM   1750 N N     . PRO A 1 240 ? 21.222 55.049 157.610 1.00 28.74  ? 240 PRO A N     1 
ATOM   1751 C CA    . PRO A 1 240 ? 22.112 54.944 158.771 1.00 28.86  ? 240 PRO A CA    1 
ATOM   1752 C C     . PRO A 1 240 ? 21.369 55.013 160.107 1.00 28.78  ? 240 PRO A C     1 
ATOM   1753 O O     . PRO A 1 240 ? 21.647 54.231 161.020 1.00 29.73  ? 240 PRO A O     1 
ATOM   1754 C CB    . PRO A 1 240 ? 23.069 56.114 158.574 1.00 26.70  ? 240 PRO A CB    1 
ATOM   1755 C CG    . PRO A 1 240 ? 23.159 56.213 157.082 1.00 25.62  ? 240 PRO A CG    1 
ATOM   1756 C CD    . PRO A 1 240 ? 21.721 56.056 156.656 1.00 26.10  ? 240 PRO A CD    1 
ATOM   1757 N N     . ILE A 1 241 ? 20.430 55.946 160.225 1.00 29.37  ? 241 ILE A N     1 
ATOM   1758 C CA    . ILE A 1 241 ? 19.667 56.090 161.464 1.00 30.40  ? 241 ILE A CA    1 
ATOM   1759 C C     . ILE A 1 241 ? 18.862 54.820 161.729 1.00 31.60  ? 241 ILE A C     1 
ATOM   1760 O O     . ILE A 1 241 ? 18.929 54.241 162.817 1.00 31.51  ? 241 ILE A O     1 
ATOM   1761 C CB    . ILE A 1 241 ? 18.710 57.299 161.394 1.00 31.42  ? 241 ILE A CB    1 
ATOM   1762 C CG1   . ILE A 1 241 ? 19.518 58.583 161.191 1.00 30.64  ? 241 ILE A CG1   1 
ATOM   1763 C CG2   . ILE A 1 241 ? 17.895 57.411 162.689 1.00 32.02  ? 241 ILE A CG2   1 
ATOM   1764 C CD1   . ILE A 1 241 ? 18.661 59.802 160.937 1.00 30.33  ? 241 ILE A CD1   1 
ATOM   1765 N N     . VAL A 1 242 ? 18.114 54.385 160.721 1.00 32.42  ? 242 VAL A N     1 
ATOM   1766 C CA    . VAL A 1 242 ? 17.307 53.178 160.828 1.00 33.11  ? 242 VAL A CA    1 
ATOM   1767 C C     . VAL A 1 242 ? 18.193 51.952 160.979 1.00 34.28  ? 242 VAL A C     1 
ATOM   1768 O O     . VAL A 1 242 ? 17.694 50.848 161.194 1.00 39.46  ? 242 VAL A O     1 
ATOM   1769 C CB    . VAL A 1 242 ? 16.424 52.985 159.581 1.00 32.35  ? 242 VAL A CB    1 
ATOM   1770 C CG1   . VAL A 1 242 ? 15.664 51.669 159.670 1.00 32.01  ? 242 VAL A CG1   1 
ATOM   1771 C CG2   . VAL A 1 242 ? 15.463 54.146 159.446 1.00 32.41  ? 242 VAL A CG2   1 
ATOM   1772 N N     . GLY A 1 243 ? 19.505 52.141 160.865 1.00 33.08  ? 243 GLY A N     1 
ATOM   1773 C CA    . GLY A 1 243 ? 20.425 51.021 160.990 1.00 29.10  ? 243 GLY A CA    1 
ATOM   1774 C C     . GLY A 1 243 ? 21.180 51.001 162.309 1.00 28.73  ? 243 GLY A C     1 
ATOM   1775 O O     . GLY A 1 243 ? 21.415 49.938 162.884 1.00 26.79  ? 243 GLY A O     1 
ATOM   1776 N N     . ALA A 1 244 ? 21.573 52.174 162.789 1.00 27.21  ? 244 ALA A N     1 
ATOM   1777 C CA    . ALA A 1 244 ? 22.289 52.261 164.054 1.00 28.73  ? 244 ALA A CA    1 
ATOM   1778 C C     . ALA A 1 244 ? 21.381 51.803 165.211 1.00 28.27  ? 244 ALA A C     1 
ATOM   1779 O O     . ALA A 1 244 ? 21.851 51.219 166.193 1.00 26.38  ? 244 ALA A O     1 
ATOM   1780 C CB    . ALA A 1 244 ? 22.771 53.700 164.286 1.00 26.37  ? 244 ALA A CB    1 
ATOM   1781 N N     . ILE A 1 245 ? 20.083 52.067 165.087 1.00 26.95  ? 245 ILE A N     1 
ATOM   1782 C CA    . ILE A 1 245 ? 19.125 51.669 166.113 1.00 30.12  ? 245 ILE A CA    1 
ATOM   1783 C C     . ILE A 1 245 ? 19.016 50.141 166.179 1.00 30.25  ? 245 ILE A C     1 
ATOM   1784 O O     . ILE A 1 245 ? 19.007 49.555 167.262 1.00 31.68  ? 245 ILE A O     1 
ATOM   1785 C CB    . ILE A 1 245 ? 17.732 52.290 165.836 1.00 31.30  ? 245 ILE A CB    1 
ATOM   1786 C CG1   . ILE A 1 245 ? 17.811 53.815 165.982 1.00 29.97  ? 245 ILE A CG1   1 
ATOM   1787 C CG2   . ILE A 1 245 ? 16.702 51.714 166.792 1.00 33.59  ? 245 ILE A CG2   1 
ATOM   1788 C CD1   . ILE A 1 245 ? 16.554 54.542 165.545 1.00 32.21  ? 245 ILE A CD1   1 
ATOM   1789 N N     . VAL A 1 246 ? 18.944 49.499 165.017 1.00 30.93  ? 246 VAL A N     1 
ATOM   1790 C CA    . VAL A 1 246 ? 18.862 48.048 164.951 1.00 29.57  ? 246 VAL A CA    1 
ATOM   1791 C C     . VAL A 1 246 ? 20.139 47.458 165.531 1.00 30.81  ? 246 VAL A C     1 
ATOM   1792 O O     . VAL A 1 246 ? 20.100 46.492 166.298 1.00 30.95  ? 246 VAL A O     1 
ATOM   1793 C CB    . VAL A 1 246 ? 18.725 47.557 163.499 1.00 28.91  ? 246 VAL A CB    1 
ATOM   1794 C CG1   . VAL A 1 246 ? 18.732 46.037 163.467 1.00 27.79  ? 246 VAL A CG1   1 
ATOM   1795 C CG2   . VAL A 1 246 ? 17.448 48.098 162.881 1.00 28.25  ? 246 VAL A CG2   1 
ATOM   1796 N N     . GLY A 1 247 ? 21.270 48.047 165.155 1.00 31.12  ? 247 GLY A N     1 
ATOM   1797 C CA    . GLY A 1 247 ? 22.550 47.570 165.640 1.00 32.18  ? 247 GLY A CA    1 
ATOM   1798 C C     . GLY A 1 247 ? 22.658 47.663 167.149 1.00 33.89  ? 247 GLY A C     1 
ATOM   1799 O O     . GLY A 1 247 ? 23.053 46.702 167.808 1.00 34.52  ? 247 GLY A O     1 
ATOM   1800 N N     . ALA A 1 248 ? 22.309 48.821 167.700 1.00 34.70  ? 248 ALA A N     1 
ATOM   1801 C CA    . ALA A 1 248 ? 22.367 49.024 169.145 1.00 36.23  ? 248 ALA A CA    1 
ATOM   1802 C C     . ALA A 1 248 ? 21.454 48.016 169.847 1.00 37.01  ? 248 ALA A C     1 
ATOM   1803 O O     . ALA A 1 248 ? 21.846 47.390 170.834 1.00 36.61  ? 248 ALA A O     1 
ATOM   1804 C CB    . ALA A 1 248 ? 21.949 50.450 169.488 1.00 33.53  ? 248 ALA A CB    1 
ATOM   1805 N N     . PHE A 1 249 ? 20.243 47.856 169.321 1.00 38.56  ? 249 PHE A N     1 
ATOM   1806 C CA    . PHE A 1 249 ? 19.275 46.924 169.882 1.00 39.02  ? 249 PHE A CA    1 
ATOM   1807 C C     . PHE A 1 249 ? 19.839 45.507 169.883 1.00 38.80  ? 249 PHE A C     1 
ATOM   1808 O O     . PHE A 1 249 ? 19.855 44.831 170.914 1.00 38.95  ? 249 PHE A O     1 
ATOM   1809 C CB    . PHE A 1 249 ? 17.978 46.957 169.065 1.00 41.43  ? 249 PHE A CB    1 
ATOM   1810 C CG    . PHE A 1 249 ? 16.895 46.048 169.598 1.00 43.40  ? 249 PHE A CG    1 
ATOM   1811 C CD1   . PHE A 1 249 ? 16.221 46.359 170.775 1.00 43.65  ? 249 PHE A CD1   1 
ATOM   1812 C CD2   . PHE A 1 249 ? 16.556 44.878 168.925 1.00 44.38  ? 249 PHE A CD2   1 
ATOM   1813 C CE1   . PHE A 1 249 ? 15.223 45.515 171.274 1.00 44.67  ? 249 PHE A CE1   1 
ATOM   1814 C CE2   . PHE A 1 249 ? 15.560 44.028 169.416 1.00 44.50  ? 249 PHE A CE2   1 
ATOM   1815 C CZ    . PHE A 1 249 ? 14.893 44.348 170.592 1.00 44.33  ? 249 PHE A CZ    1 
ATOM   1816 N N     . ALA A 1 250 ? 20.309 45.067 168.721 1.00 38.50  ? 250 ALA A N     1 
ATOM   1817 C CA    . ALA A 1 250 ? 20.864 43.726 168.568 1.00 38.43  ? 250 ALA A CA    1 
ATOM   1818 C C     . ALA A 1 250 ? 22.012 43.422 169.524 1.00 38.65  ? 250 ALA A C     1 
ATOM   1819 O O     . ALA A 1 250 ? 22.137 42.296 170.010 1.00 38.74  ? 250 ALA A O     1 
ATOM   1820 C CB    . ALA A 1 250 ? 21.329 43.516 167.132 1.00 38.75  ? 250 ALA A CB    1 
ATOM   1821 N N     . TYR A 1 251 ? 22.852 44.416 169.795 1.00 37.82  ? 251 TYR A N     1 
ATOM   1822 C CA    . TYR A 1 251 ? 23.983 44.198 170.685 1.00 37.84  ? 251 TYR A CA    1 
ATOM   1823 C C     . TYR A 1 251 ? 23.554 43.864 172.109 1.00 38.68  ? 251 TYR A C     1 
ATOM   1824 O O     . TYR A 1 251 ? 23.995 42.869 172.681 1.00 37.13  ? 251 TYR A O     1 
ATOM   1825 C CB    . TYR A 1 251 ? 24.903 45.422 170.725 1.00 35.00  ? 251 TYR A CB    1 
ATOM   1826 C CG    . TYR A 1 251 ? 26.102 45.190 171.617 1.00 33.73  ? 251 TYR A CG    1 
ATOM   1827 C CD1   . TYR A 1 251 ? 27.124 44.322 171.226 1.00 34.23  ? 251 TYR A CD1   1 
ATOM   1828 C CD2   . TYR A 1 251 ? 26.178 45.774 172.884 1.00 34.11  ? 251 TYR A CD2   1 
ATOM   1829 C CE1   . TYR A 1 251 ? 28.188 44.034 172.072 1.00 34.15  ? 251 TYR A CE1   1 
ATOM   1830 C CE2   . TYR A 1 251 ? 27.239 45.493 173.742 1.00 33.73  ? 251 TYR A CE2   1 
ATOM   1831 C CZ    . TYR A 1 251 ? 28.237 44.622 173.329 1.00 34.74  ? 251 TYR A CZ    1 
ATOM   1832 O OH    . TYR A 1 251 ? 29.281 44.325 174.172 1.00 34.99  ? 251 TYR A OH    1 
ATOM   1833 N N     . ARG A 1 252 ? 22.699 44.706 172.677 1.00 40.90  ? 252 ARG A N     1 
ATOM   1834 C CA    . ARG A 1 252 ? 22.225 44.513 174.042 1.00 43.05  ? 252 ARG A CA    1 
ATOM   1835 C C     . ARG A 1 252 ? 21.426 43.228 174.219 1.00 43.84  ? 252 ARG A C     1 
ATOM   1836 O O     . ARG A 1 252 ? 21.556 42.543 175.233 1.00 42.10  ? 252 ARG A O     1 
ATOM   1837 C CB    . ARG A 1 252 ? 21.377 45.712 174.475 1.00 43.21  ? 252 ARG A CB    1 
ATOM   1838 C CG    . ARG A 1 252 ? 22.116 47.038 174.381 1.00 44.27  ? 252 ARG A CG    1 
ATOM   1839 C CD    . ARG A 1 252 ? 21.617 48.022 175.422 1.00 45.75  ? 252 ARG A CD    1 
ATOM   1840 N NE    . ARG A 1 252 ? 22.310 49.307 175.355 1.00 47.89  ? 252 ARG A NE    1 
ATOM   1841 C CZ    . ARG A 1 252 ? 23.630 49.459 175.420 1.00 47.54  ? 252 ARG A CZ    1 
ATOM   1842 N NH1   . ARG A 1 252 ? 24.424 48.401 175.552 1.00 47.32  ? 252 ARG A NH1   1 
ATOM   1843 N NH2   . ARG A 1 252 ? 24.157 50.675 175.358 1.00 47.22  ? 252 ARG A NH2   1 
ATOM   1844 N N     . LYS A 1 253 ? 20.607 42.903 173.227 1.00 45.40  ? 253 LYS A N     1 
ATOM   1845 C CA    . LYS A 1 253 ? 19.778 41.705 173.278 1.00 47.53  ? 253 LYS A CA    1 
ATOM   1846 C C     . LYS A 1 253 ? 20.536 40.403 173.014 1.00 47.47  ? 253 LYS A C     1 
ATOM   1847 O O     . LYS A 1 253 ? 20.321 39.403 173.698 1.00 47.81  ? 253 LYS A O     1 
ATOM   1848 C CB    . LYS A 1 253 ? 18.634 41.829 172.271 1.00 49.89  ? 253 LYS A CB    1 
ATOM   1849 C CG    . LYS A 1 253 ? 17.591 42.879 172.619 1.00 54.54  ? 253 LYS A CG    1 
ATOM   1850 C CD    . LYS A 1 253 ? 16.607 42.358 173.657 1.00 59.52  ? 253 LYS A CD    1 
ATOM   1851 C CE    . LYS A 1 253 ? 15.466 43.343 173.885 1.00 61.67  ? 253 LYS A CE    1 
ATOM   1852 N NZ    . LYS A 1 253 ? 14.337 42.737 174.649 1.00 63.31  ? 253 LYS A NZ    1 
ATOM   1853 N N     . LEU A 1 254 ? 21.429 40.418 172.032 1.00 47.49  ? 254 LEU A N     1 
ATOM   1854 C CA    . LEU A 1 254 ? 22.169 39.216 171.669 1.00 47.77  ? 254 LEU A CA    1 
ATOM   1855 C C     . LEU A 1 254 ? 23.554 39.028 172.292 1.00 48.47  ? 254 LEU A C     1 
ATOM   1856 O O     . LEU A 1 254 ? 24.017 37.896 172.431 1.00 49.03  ? 254 LEU A O     1 
ATOM   1857 C CB    . LEU A 1 254 ? 22.284 39.144 170.143 1.00 47.01  ? 254 LEU A CB    1 
ATOM   1858 C CG    . LEU A 1 254 ? 20.950 39.147 169.393 1.00 45.56  ? 254 LEU A CG    1 
ATOM   1859 C CD1   . LEU A 1 254 ? 21.187 39.364 167.912 1.00 44.95  ? 254 LEU A CD1   1 
ATOM   1860 C CD2   . LEU A 1 254 ? 20.228 37.834 169.640 1.00 45.81  ? 254 LEU A CD2   1 
ATOM   1861 N N     . ILE A 1 255 ? 24.217 40.116 172.670 1.00 49.62  ? 255 ILE A N     1 
ATOM   1862 C CA    . ILE A 1 255 ? 25.556 40.010 173.248 1.00 50.36  ? 255 ILE A CA    1 
ATOM   1863 C C     . ILE A 1 255 ? 25.637 40.507 174.686 1.00 52.24  ? 255 ILE A C     1 
ATOM   1864 O O     . ILE A 1 255 ? 26.110 39.793 175.570 1.00 53.38  ? 255 ILE A O     1 
ATOM   1865 C CB    . ILE A 1 255 ? 26.600 40.789 172.391 1.00 49.34  ? 255 ILE A CB    1 
ATOM   1866 C CG1   . ILE A 1 255 ? 26.676 40.185 170.987 1.00 47.36  ? 255 ILE A CG1   1 
ATOM   1867 C CG2   . ILE A 1 255 ? 27.975 40.755 173.058 1.00 47.08  ? 255 ILE A CG2   1 
ATOM   1868 C CD1   . ILE A 1 255 ? 27.115 38.740 170.958 1.00 46.63  ? 255 ILE A CD1   1 
ATOM   1869 N N     . GLY A 1 256 ? 25.184 41.736 174.913 1.00 54.04  ? 256 GLY A N     1 
ATOM   1870 C CA    . GLY A 1 256 ? 25.222 42.305 176.247 1.00 56.28  ? 256 GLY A CA    1 
ATOM   1871 C C     . GLY A 1 256 ? 24.439 41.501 177.266 1.00 57.94  ? 256 GLY A C     1 
ATOM   1872 O O     . GLY A 1 256 ? 24.915 41.263 178.372 1.00 57.92  ? 256 GLY A O     1 
ATOM   1873 N N     . ARG A 1 257 ? 23.236 41.079 176.891 1.00 61.15  ? 257 ARG A N     1 
ATOM   1874 C CA    . ARG A 1 257 ? 22.376 40.303 177.779 1.00 63.99  ? 257 ARG A CA    1 
ATOM   1875 C C     . ARG A 1 257 ? 22.976 38.942 178.102 1.00 66.03  ? 257 ARG A C     1 
ATOM   1876 O O     . ARG A 1 257 ? 22.394 38.164 178.858 1.00 67.11  ? 257 ARG A O     1 
ATOM   1877 C CB    . ARG A 1 257 ? 20.998 40.124 177.145 1.00 63.43  ? 257 ARG A CB    1 
ATOM   1878 N N     . HIS A 1 258 ? 24.141 38.656 177.527 1.00 67.17  ? 258 HIS A N     1 
ATOM   1879 C CA    . HIS A 1 258 ? 24.809 37.383 177.758 1.00 67.88  ? 258 HIS A CA    1 
ATOM   1880 C C     . HIS A 1 258 ? 26.200 37.573 178.352 1.00 68.16  ? 258 HIS A C     1 
ATOM   1881 O O     . HIS A 1 258 ? 27.026 36.663 178.327 1.00 67.97  ? 258 HIS A O     1 
ATOM   1882 C CB    . HIS A 1 258 ? 24.886 36.600 176.446 1.00 68.70  ? 258 HIS A CB    1 
ATOM   1883 C CG    . HIS A 1 258 ? 23.546 36.204 175.906 1.00 70.17  ? 258 HIS A CG    1 
ATOM   1884 N ND1   . HIS A 1 258 ? 23.344 35.868 174.585 1.00 71.26  ? 258 HIS A ND1   1 
ATOM   1885 C CD2   . HIS A 1 258 ? 22.339 36.091 176.511 1.00 70.34  ? 258 HIS A CD2   1 
ATOM   1886 C CE1   . HIS A 1 258 ? 22.070 35.568 174.398 1.00 71.24  ? 258 HIS A CE1   1 
ATOM   1887 N NE2   . HIS A 1 258 ? 21.439 35.695 175.551 1.00 70.73  ? 258 HIS A NE2   1 
ATOM   1888 N N     . LEU A 1 259 ? 26.447 38.764 178.891 1.00 68.76  ? 259 LEU A N     1 
ATOM   1889 C CA    . LEU A 1 259 ? 27.727 39.085 179.514 1.00 69.62  ? 259 LEU A CA    1 
ATOM   1890 C C     . LEU A 1 259 ? 27.559 39.197 181.029 1.00 70.60  ? 259 LEU A C     1 
ATOM   1891 O O     . LEU A 1 259 ? 28.290 38.495 181.761 1.00 70.42  ? 259 LEU A O     1 
ATOM   1892 C CB    . LEU A 1 259 ? 28.278 40.402 178.961 1.00 69.15  ? 259 LEU A CB    1 
ATOM   1893 C CG    . LEU A 1 259 ? 28.787 40.418 177.516 1.00 68.49  ? 259 LEU A CG    1 
ATOM   1894 C CD1   . LEU A 1 259 ? 29.127 41.843 177.117 1.00 67.91  ? 259 LEU A CD1   1 
ATOM   1895 C CD2   . LEU A 1 259 ? 30.006 39.520 177.382 1.00 67.98  ? 259 LEU A CD2   1 
HETATM 1896 C C1    . BOG B 2 .   ? 31.916 78.264 143.981 1.00 50.67  ? 473 BOG A C1    1 
HETATM 1897 O O1    . BOG B 2 .   ? 32.219 77.654 145.233 1.00 51.95  ? 473 BOG A O1    1 
HETATM 1898 C C2    . BOG B 2 .   ? 32.617 77.497 142.848 1.00 50.39  ? 473 BOG A C2    1 
HETATM 1899 O O2    . BOG B 2 .   ? 34.028 77.619 142.988 1.00 46.88  ? 473 BOG A O2    1 
HETATM 1900 C C3    . BOG B 2 .   ? 32.136 77.996 141.455 1.00 51.21  ? 473 BOG A C3    1 
HETATM 1901 O O3    . BOG B 2 .   ? 32.651 77.210 140.377 1.00 51.13  ? 473 BOG A O3    1 
HETATM 1902 C C4    . BOG B 2 .   ? 30.613 78.054 141.370 1.00 51.46  ? 473 BOG A C4    1 
HETATM 1903 O O4    . BOG B 2 .   ? 30.180 78.588 140.107 1.00 53.34  ? 473 BOG A O4    1 
HETATM 1904 C C5    . BOG B 2 .   ? 30.063 78.870 142.552 1.00 51.29  ? 473 BOG A C5    1 
HETATM 1905 O O5    . BOG B 2 .   ? 30.500 78.279 143.789 1.00 51.81  ? 473 BOG A O5    1 
HETATM 1906 C C6    . BOG B 2 .   ? 28.536 78.843 142.506 1.00 49.74  ? 473 BOG A C6    1 
HETATM 1907 O O6    . BOG B 2 .   ? 28.097 77.492 142.546 1.00 46.14  ? 473 BOG A O6    1 
HETATM 1908 C "C1'" . BOG B 2 .   ? 31.867 78.457 146.360 1.00 51.97  ? 473 BOG A "C1'" 1 
HETATM 1909 C "C2'" . BOG B 2 .   ? 31.152 77.623 147.426 1.00 52.51  ? 473 BOG A "C2'" 1 
HETATM 1910 C "C3'" . BOG B 2 .   ? 30.976 78.446 148.716 1.00 53.53  ? 473 BOG A "C3'" 1 
HETATM 1911 C "C4'" . BOG B 2 .   ? 30.085 77.700 149.718 1.00 54.10  ? 473 BOG A "C4'" 1 
HETATM 1912 C "C5'" . BOG B 2 .   ? 30.119 78.338 151.116 1.00 52.81  ? 473 BOG A "C5'" 1 
HETATM 1913 C "C6'" . BOG B 2 .   ? 31.429 78.046 151.873 1.00 51.55  ? 473 BOG A "C6'" 1 
HETATM 1914 C "C7'" . BOG B 2 .   ? 31.252 78.462 153.340 1.00 52.74  ? 473 BOG A "C7'" 1 
HETATM 1915 C "C8'" . BOG B 2 .   ? 32.408 77.997 154.233 1.00 51.59  ? 473 BOG A "C8'" 1 
HETATM 1916 C C1    . BOG C 2 .   ? 16.277 69.982 149.370 1.00 65.62  ? 474 BOG A C1    1 
HETATM 1917 O O1    . BOG C 2 .   ? 16.872 69.757 150.657 1.00 67.96  ? 474 BOG A O1    1 
HETATM 1918 C C2    . BOG C 2 .   ? 16.968 71.152 148.619 1.00 64.56  ? 474 BOG A C2    1 
HETATM 1919 O O2    . BOG C 2 .   ? 17.039 72.351 149.393 1.00 64.75  ? 474 BOG A O2    1 
HETATM 1920 C C3    . BOG C 2 .   ? 16.193 71.408 147.328 1.00 63.77  ? 474 BOG A C3    1 
HETATM 1921 O O3    . BOG C 2 .   ? 16.762 72.486 146.584 1.00 61.11  ? 474 BOG A O3    1 
HETATM 1922 C C4    . BOG C 2 .   ? 16.136 70.136 146.471 1.00 63.98  ? 474 BOG A C4    1 
HETATM 1923 O O4    . BOG C 2 .   ? 15.252 70.333 145.375 1.00 65.48  ? 474 BOG A O4    1 
HETATM 1924 C C5    . BOG C 2 .   ? 15.781 68.834 147.253 1.00 64.04  ? 474 BOG A C5    1 
HETATM 1925 O O5    . BOG C 2 .   ? 16.358 68.788 148.578 1.00 64.37  ? 474 BOG A O5    1 
HETATM 1926 C C6    . BOG C 2 .   ? 16.281 67.563 146.495 1.00 63.88  ? 474 BOG A C6    1 
HETATM 1927 O O6    . BOG C 2 .   ? 15.859 67.475 145.131 1.00 62.14  ? 474 BOG A O6    1 
HETATM 1928 C "C1'" . BOG C 2 .   ? 16.160 68.783 151.420 1.00 68.44  ? 474 BOG A "C1'" 1 
HETATM 1929 C "C2'" . BOG C 2 .   ? 16.593 68.841 152.894 1.00 70.29  ? 474 BOG A "C2'" 1 
HETATM 1930 C "C3'" . BOG C 2 .   ? 15.748 67.880 153.757 1.00 71.56  ? 474 BOG A "C3'" 1 
HETATM 1931 C "C4'" . BOG C 2 .   ? 16.149 67.952 155.244 1.00 71.66  ? 474 BOG A "C4'" 1 
HETATM 1932 C "C5'" . BOG C 2 .   ? 17.531 67.335 155.493 1.00 72.56  ? 474 BOG A "C5'" 1 
HETATM 1933 C "C6'" . BOG C 2 .   ? 17.955 67.467 156.966 1.00 72.87  ? 474 BOG A "C6'" 1 
HETATM 1934 C "C7'" . BOG C 2 .   ? 19.328 66.810 157.185 1.00 73.08  ? 474 BOG A "C7'" 1 
HETATM 1935 C "C8'" . BOG C 2 .   ? 19.858 67.078 158.596 1.00 73.32  ? 474 BOG A "C8'" 1 
HETATM 1936 C C1    . BOG D 2 .   ? 37.388 78.388 150.576 1.00 93.19  ? 475 BOG A C1    1 
HETATM 1937 O O1    . BOG D 2 .   ? 37.923 77.676 151.684 1.00 93.62  ? 475 BOG A O1    1 
HETATM 1938 C C2    . BOG D 2 .   ? 38.396 78.378 149.394 1.00 93.50  ? 475 BOG A C2    1 
HETATM 1939 O O2    . BOG D 2 .   ? 39.642 78.994 149.748 1.00 93.89  ? 475 BOG A O2    1 
HETATM 1940 C C3    . BOG D 2 .   ? 37.773 79.053 148.157 1.00 93.53  ? 475 BOG A C3    1 
HETATM 1941 O O3    . BOG D 2 .   ? 38.652 79.015 147.030 1.00 94.16  ? 475 BOG A O3    1 
HETATM 1942 C C4    . BOG D 2 .   ? 36.423 78.409 147.832 1.00 93.70  ? 475 BOG A C4    1 
HETATM 1943 O O4    . BOG D 2 .   ? 35.807 79.083 146.737 1.00 94.70  ? 475 BOG A O4    1 
HETATM 1944 C C5    . BOG D 2 .   ? 35.536 78.468 149.087 1.00 93.66  ? 475 BOG A C5    1 
HETATM 1945 O O5    . BOG D 2 .   ? 36.152 77.798 150.185 1.00 92.81  ? 475 BOG A O5    1 
HETATM 1946 C C6    . BOG D 2 .   ? 34.183 77.836 148.829 1.00 93.96  ? 475 BOG A C6    1 
HETATM 1947 O O6    . BOG D 2 .   ? 34.337 76.443 148.589 1.00 94.56  ? 475 BOG A O6    1 
HETATM 1948 C "C1'" . BOG D 2 .   ? 37.095 77.653 152.852 1.00 94.58  ? 475 BOG A "C1'" 1 
HETATM 1949 C "C2'" . BOG D 2 .   ? 38.032 77.805 154.052 1.00 95.90  ? 475 BOG A "C2'" 1 
HETATM 1950 C "C3'" . BOG D 2 .   ? 37.436 77.356 155.391 1.00 97.40  ? 475 BOG A "C3'" 1 
HETATM 1951 C "C4'" . BOG D 2 .   ? 38.545 77.497 156.447 1.00 98.96  ? 475 BOG A "C4'" 1 
HETATM 1952 C "C5'" . BOG D 2 .   ? 38.221 76.758 157.743 1.00 99.72  ? 475 BOG A "C5'" 1 
HETATM 1953 C "C6'" . BOG D 2 .   ? 39.495 76.689 158.599 1.00 101.23 ? 475 BOG A "C6'" 1 
HETATM 1954 C "C7'" . BOG D 2 .   ? 39.306 75.755 159.804 1.00 101.65 ? 475 BOG A "C7'" 1 
HETATM 1955 C "C8'" . BOG D 2 .   ? 40.622 75.603 160.587 1.00 102.51 ? 475 BOG A "C8'" 1 
HETATM 1956 C C1    . GOL E 3 .   ? 33.300 57.101 153.039 1.00 33.07  ? 662 GOL A C1    1 
HETATM 1957 O O1    . GOL E 3 .   ? 32.419 57.156 151.932 1.00 33.07  ? 662 GOL A O1    1 
HETATM 1958 C C2    . GOL E 3 .   ? 32.630 56.808 154.401 1.00 33.07  ? 662 GOL A C2    1 
HETATM 1959 O O2    . GOL E 3 .   ? 31.521 57.608 154.712 1.00 33.07  ? 662 GOL A O2    1 
HETATM 1960 C C3    . GOL E 3 .   ? 33.704 56.866 155.503 1.00 33.07  ? 662 GOL A C3    1 
HETATM 1961 O O3    . GOL E 3 .   ? 33.215 56.806 156.849 1.00 27.07  ? 662 GOL A O3    1 
HETATM 1962 C C1    . GOL F 3 .   ? 31.340 53.664 145.200 1.00 69.58  ? 661 GOL A C1    1 
HETATM 1963 O O1    . GOL F 3 .   ? 31.229 54.676 146.180 1.00 71.12  ? 661 GOL A O1    1 
HETATM 1964 C C2    . GOL F 3 .   ? 30.332 53.915 144.083 1.00 69.35  ? 661 GOL A C2    1 
HETATM 1965 O O2    . GOL F 3 .   ? 29.037 53.844 144.638 1.00 67.95  ? 661 GOL A O2    1 
HETATM 1966 C C3    . GOL F 3 .   ? 30.513 52.844 142.998 1.00 69.82  ? 661 GOL A C3    1 
HETATM 1967 O O3    . GOL F 3 .   ? 29.682 53.082 141.866 1.00 71.85  ? 661 GOL A O3    1 
HETATM 1968 C C1    . GOL G 3 .   ? 31.878 56.880 161.386 1.00 46.23  ? 663 GOL A C1    1 
HETATM 1969 O O1    . GOL G 3 .   ? 31.166 57.921 160.723 1.00 50.65  ? 663 GOL A O1    1 
HETATM 1970 C C2    . GOL G 3 .   ? 31.895 57.121 162.891 1.00 46.55  ? 663 GOL A C2    1 
HETATM 1971 O O2    . GOL G 3 .   ? 30.600 56.907 163.432 1.00 44.80  ? 663 GOL A O2    1 
HETATM 1972 C C3    . GOL G 3 .   ? 32.376 58.544 163.148 1.00 47.07  ? 663 GOL A C3    1 
HETATM 1973 O O3    . GOL G 3 .   ? 32.375 58.855 164.534 1.00 51.59  ? 663 GOL A O3    1 
HETATM 1974 O O     . HOH H 4 .   ? 48.333 48.348 153.806 0.25 38.46  ? 300 HOH A O     1 
HETATM 1975 O O     . HOH H 4 .   ? 48.358 48.324 149.404 0.25 25.00  ? 301 HOH A O     1 
HETATM 1976 O O     . HOH H 4 .   ? 48.413 48.365 151.493 0.25 23.36  ? 302 HOH A O     1 
HETATM 1977 O O     . HOH H 4 .   ? 24.692 72.951 138.211 0.25 31.35  ? 303 HOH A O     1 
HETATM 1978 O O     . HOH H 4 .   ? 17.902 67.556 138.070 1.00 40.10  ? 304 HOH A O     1 
HETATM 1979 O O     . HOH H 4 .   ? 31.670 38.977 174.020 1.00 47.91  ? 305 HOH A O     1 
HETATM 1980 O O     . HOH H 4 .   ? 42.934 70.969 167.180 1.00 43.59  ? 308 HOH A O     1 
HETATM 1981 O O     . HOH H 4 .   ? 36.479 50.301 144.089 1.00 46.61  ? 309 HOH A O     1 
HETATM 1982 O O     . HOH H 4 .   ? 39.072 49.816 143.689 1.00 19.49  ? 310 HOH A O     1 
HETATM 1983 O O     . HOH H 4 .   ? 39.109 63.255 179.497 1.00 49.31  ? 311 HOH A O     1 
HETATM 1984 O O     . HOH H 4 .   ? 14.306 68.017 173.776 1.00 58.41  ? 312 HOH A O     1 
HETATM 1985 O O     . HOH H 4 .   ? 18.110 67.905 171.635 1.00 40.21  ? 313 HOH A O     1 
HETATM 1986 O O     . HOH H 4 .   ? 29.745 66.810 131.053 1.00 34.30  ? 314 HOH A O     1 
HETATM 1987 O O     . HOH H 4 .   ? 33.524 61.277 149.617 1.00 19.26  ? 315 HOH A O     1 
HETATM 1988 O O     . HOH H 4 .   ? 39.191 58.377 139.841 1.00 43.58  ? 316 HOH A O     1 
HETATM 1989 O O     . HOH H 4 .   ? 45.513 48.088 178.033 1.00 55.26  ? 317 HOH A O     1 
HETATM 1990 O O     . HOH H 4 .   ? 22.357 62.896 152.404 1.00 29.66  ? 318 HOH A O     1 
HETATM 1991 O O     . HOH H 4 .   ? 19.345 72.902 151.652 1.00 40.67  ? 319 HOH A O     1 
HETATM 1992 O O     . HOH H 4 .   ? 18.055 71.484 144.118 1.00 18.41  ? 320 HOH A O     1 
HETATM 1993 O O     . HOH H 4 .   ? 29.717 74.795 167.004 1.00 50.20  ? 321 HOH A O     1 
HETATM 1994 O O     . HOH H 4 .   ? 42.803 62.223 138.707 1.00 37.30  ? 322 HOH A O     1 
HETATM 1995 O O     . HOH H 4 .   ? 38.870 60.674 138.358 1.00 40.93  ? 323 HOH A O     1 
HETATM 1996 O O     . HOH H 4 .   ? 47.809 53.873 147.830 1.00 31.34  ? 324 HOH A O     1 
HETATM 1997 O O     . HOH H 4 .   ? 37.585 53.545 145.155 1.00 44.32  ? 325 HOH A O     1 
HETATM 1998 O O     . HOH H 4 .   ? 33.547 53.366 148.411 1.00 37.70  ? 326 HOH A O     1 
HETATM 1999 O O     . HOH H 4 .   ? 38.729 60.208 157.780 1.00 23.37  ? 327 HOH A O     1 
HETATM 2000 O O     . HOH H 4 .   ? 34.565 62.126 135.720 1.00 40.00  ? 328 HOH A O     1 
HETATM 2001 O O     . HOH H 4 .   ? 47.339 51.357 146.637 1.00 36.17  ? 329 HOH A O     1 
HETATM 2002 O O     . HOH H 4 .   ? 34.413 57.650 150.049 1.00 33.92  ? 330 HOH A O     1 
HETATM 2003 O O     . HOH H 4 .   ? 14.668 66.019 170.851 1.00 45.38  ? 331 HOH A O     1 
HETATM 2004 O O     . HOH H 4 .   ? 20.266 51.877 181.102 1.00 55.10  ? 332 HOH A O     1 
HETATM 2005 O O     . HOH H 4 .   ? 23.796 73.637 160.416 1.00 49.08  ? 333 HOH A O     1 
HETATM 2006 O O     . HOH H 4 .   ? 25.362 74.644 156.807 1.00 66.20  ? 334 HOH A O     1 
HETATM 2007 O O     . HOH H 4 .   ? 24.907 72.284 155.889 1.00 46.91  ? 335 HOH A O     1 
HETATM 2008 O O     . HOH H 4 .   ? 44.100 74.283 144.055 1.00 36.05  ? 336 HOH A O     1 
HETATM 2009 O O     . HOH H 4 .   ? 34.829 79.841 141.695 1.00 62.55  ? 337 HOH A O     1 
HETATM 2010 O O     . HOH H 4 .   ? 38.951 62.814 128.174 1.00 61.97  ? 339 HOH A O     1 
HETATM 2011 O O     . HOH H 4 .   ? 31.735 75.490 138.292 1.00 44.26  ? 340 HOH A O     1 
HETATM 2012 O O     . HOH H 4 .   ? 36.678 61.253 133.070 1.00 65.45  ? 341 HOH A O     1 
HETATM 2013 O O     . HOH H 4 .   ? 14.972 67.103 142.167 1.00 41.27  ? 342 HOH A O     1 
HETATM 2014 O O     . HOH H 4 .   ? 28.493 65.315 146.612 1.00 18.88  ? 343 HOH A O     1 
HETATM 2015 O O     . HOH H 4 .   ? 25.047 56.013 150.570 1.00 26.16  ? 344 HOH A O     1 
HETATM 2016 O O     . HOH H 4 .   ? 24.443 57.925 141.064 1.00 35.75  ? 345 HOH A O     1 
HETATM 2017 O O     . HOH H 4 .   ? 38.537 50.179 177.552 1.00 35.35  ? 346 HOH A O     1 
HETATM 2018 O O     . HOH H 4 .   ? 36.704 47.682 175.903 1.00 40.07  ? 347 HOH A O     1 
HETATM 2019 O O     . HOH H 4 .   ? 35.200 42.616 180.876 1.00 46.22  ? 348 HOH A O     1 
HETATM 2020 O O     . HOH H 4 .   ? 31.139 57.741 157.677 1.00 30.49  ? 349 HOH A O     1 
HETATM 2021 O O     . HOH H 4 .   ? 25.489 74.899 142.008 1.00 36.79  ? 350 HOH A O     1 
HETATM 2022 O O     . HOH H 4 .   ? 17.141 54.352 141.935 1.00 19.21  ? 351 HOH A O     1 
HETATM 2023 O O     . HOH H 4 .   ? 28.570 50.842 150.819 1.00 19.87  ? 352 HOH A O     1 
HETATM 2024 O O     . HOH H 4 .   ? 22.375 69.090 138.545 1.00 28.89  ? 353 HOH A O     1 
HETATM 2025 O O     . HOH H 4 .   ? 30.984 52.271 139.736 1.00 66.88  ? 354 HOH A O     1 
HETATM 2026 O O     . HOH H 4 .   ? 40.501 71.245 161.912 1.00 58.10  ? 355 HOH A O     1 
HETATM 2027 O O     . HOH H 4 .   ? 43.171 73.776 162.550 1.00 68.20  ? 356 HOH A O     1 
HETATM 2028 O O     . HOH H 4 .   ? 26.011 77.688 141.202 1.00 45.22  ? 357 HOH A O     1 
HETATM 2029 O O     . HOH H 4 .   ? 35.724 56.187 144.976 1.00 60.54  ? 358 HOH A O     1 
HETATM 2030 O O     . HOH H 4 .   ? 28.113 57.798 140.871 1.00 34.83  ? 359 HOH A O     1 
HETATM 2031 O O     . HOH H 4 .   ? 28.588 55.436 141.174 1.00 41.67  ? 360 HOH A O     1 
HETATM 2032 O O     . HOH H 4 .   ? 50.940 56.440 141.632 1.00 54.68  ? 361 HOH A O     1 
HETATM 2033 O O     . HOH H 4 .   ? 32.567 63.531 136.881 1.00 25.97  ? 362 HOH A O     1 
HETATM 2034 O O     . HOH H 4 .   ? 47.870 51.617 143.947 1.00 49.55  ? 363 HOH A O     1 
HETATM 2035 O O     . HOH H 4 .   ? 29.587 54.285 173.799 1.00 63.70  ? 364 HOH A O     1 
HETATM 2036 O O     . HOH H 4 .   ? 24.234 74.395 168.280 1.00 59.71  ? 365 HOH A O     1 
HETATM 2037 O O     . HOH H 4 .   ? 46.545 56.383 139.030 1.00 64.89  ? 366 HOH A O     1 
HETATM 2038 O O     . HOH H 4 .   ? 43.745 64.780 134.487 1.00 46.66  ? 367 HOH A O     1 
HETATM 2039 O O     . HOH H 4 .   ? 28.588 75.217 137.755 1.00 35.43  ? 368 HOH A O     1 
HETATM 2040 O O     . HOH H 4 .   ? 46.334 64.560 137.782 1.00 68.31  ? 369 HOH A O     1 
HETATM 2041 O O     . HOH H 4 .   ? 36.257 61.057 137.458 1.00 57.63  ? 370 HOH A O     1 
HETATM 2042 O O     . HOH H 4 .   ? 24.488 55.574 139.735 1.00 46.89  ? 371 HOH A O     1 
HETATM 2043 O O     . HOH H 4 .   ? 31.907 50.341 142.452 1.00 51.44  ? 372 HOH A O     1 
HETATM 2044 O O     . HOH H 4 .   ? 13.709 45.917 144.299 1.00 51.13  ? 373 HOH A O     1 
HETATM 2045 O O     . HOH H 4 .   ? 34.942 76.081 165.914 1.00 45.90  ? 374 HOH A O     1 
HETATM 2046 O O     . HOH H 4 .   ? 44.889 76.271 146.773 1.00 59.21  ? 375 HOH A O     1 
HETATM 2047 O O     . HOH H 4 .   ? 29.689 49.709 174.964 1.00 46.66  ? 376 HOH A O     1 
HETATM 2048 O O     . HOH H 4 .   ? 33.286 56.197 170.588 1.00 43.73  ? 377 HOH A O     1 
HETATM 2049 O O     . HOH H 4 .   ? 10.283 62.113 152.594 1.00 68.52  ? 378 HOH A O     1 
HETATM 2050 O O     . HOH H 4 .   ? 32.469 58.428 147.587 1.00 34.83  ? 379 HOH A O     1 
HETATM 2051 O O     . HOH H 4 .   ? 15.004 47.560 166.783 1.00 64.62  ? 380 HOH A O     1 
HETATM 2052 O O     . HOH H 4 .   ? 24.836 45.856 176.435 1.00 44.63  ? 381 HOH A O     1 
HETATM 2053 O O     . HOH H 4 .   ? 17.591 36.115 173.132 1.00 62.20  ? 382 HOH A O     1 
HETATM 2054 O O     . HOH H 4 .   ? 30.039 57.112 146.320 1.00 26.21  ? 383 HOH A O     1 
HETATM 2055 O O     . HOH H 4 .   ? 29.897 59.294 142.124 1.00 31.80  ? 384 HOH A O     1 
HETATM 2056 O O     . HOH H 4 .   ? 32.255 58.386 142.626 1.00 46.30  ? 385 HOH A O     1 
HETATM 2057 O O     . HOH H 4 .   ? 43.628 58.276 140.312 1.00 42.00  ? 386 HOH A O     1 
HETATM 2058 O O     . HOH H 4 .   ? 43.612 71.922 164.810 1.00 47.42  ? 387 HOH A O     1 
HETATM 2059 O O     . HOH H 4 .   ? 37.022 57.424 140.830 1.00 35.52  ? 388 HOH A O     1 
HETATM 2060 O O     . HOH H 4 .   ? 35.512 56.977 138.540 1.00 51.29  ? 389 HOH A O     1 
HETATM 2061 O O     . HOH H 4 .   ? 44.891 50.563 142.826 1.00 51.87  ? 390 HOH A O     1 
HETATM 2062 O O     . HOH H 4 .   ? 40.325 61.179 173.556 1.00 33.09  ? 391 HOH A O     1 
HETATM 2063 O O     . HOH H 4 .   ? 15.640 64.030 169.374 1.00 52.28  ? 392 HOH A O     1 
HETATM 2064 O O     . HOH H 4 .   ? 27.200 75.497 177.506 1.00 48.74  ? 393 HOH A O     1 
HETATM 2065 O O     . HOH H 4 .   ? 25.106 75.060 172.069 1.00 47.21  ? 394 HOH A O     1 
HETATM 2066 O O     . HOH H 4 .   ? 43.669 67.231 135.007 1.00 35.58  ? 395 HOH A O     1 
HETATM 2067 O O     . HOH H 4 .   ? 33.121 72.752 128.980 1.00 51.37  ? 396 HOH A O     1 
HETATM 2068 O O     . HOH H 4 .   ? 31.349 73.106 134.179 1.00 39.46  ? 397 HOH A O     1 
HETATM 2069 O O     . HOH H 4 .   ? 39.990 42.442 173.890 1.00 30.51  ? 398 HOH A O     1 
HETATM 2070 O O     . HOH H 4 .   ? 35.544 56.124 172.382 1.00 53.95  ? 399 HOH A O     1 
HETATM 2071 O O     . HOH H 4 .   ? 12.617 65.965 151.758 1.00 61.50  ? 400 HOH A O     1 
HETATM 2072 O O     . HOH H 4 .   ? 18.365 51.120 163.345 1.00 43.33  ? 401 HOH A O     1 
HETATM 2073 O O     . HOH H 4 .   ? 30.448 39.547 181.318 1.00 64.07  ? 402 HOH A O     1 
HETATM 2074 O O     . HOH H 4 .   ? 34.650 77.025 156.106 1.00 54.20  ? 403 HOH A O     1 
HETATM 2075 O O     . HOH H 4 .   ? 36.978 72.799 159.803 1.00 48.70  ? 404 HOH A O     1 
HETATM 2076 O O     . HOH H 4 .   ? 35.938 72.058 181.920 1.00 64.17  ? 405 HOH A O     1 
HETATM 2077 O O     . HOH H 4 .   ? 34.332 73.375 179.000 1.00 47.32  ? 406 HOH A O     1 
HETATM 2078 O O     . HOH H 4 .   ? 37.259 53.084 175.476 1.00 57.10  ? 407 HOH A O     1 
HETATM 2079 O O     . HOH H 4 .   ? 40.467 58.322 173.937 1.00 46.95  ? 408 HOH A O     1 
HETATM 2080 O O     . HOH H 4 .   ? 44.661 69.379 134.154 1.00 41.28  ? 409 HOH A O     1 
HETATM 2081 O O     . HOH H 4 .   ? 33.657 74.161 136.623 1.00 58.51  ? 410 HOH A O     1 
HETATM 2082 O O     . HOH H 4 .   ? 38.819 70.918 159.944 1.00 47.56  ? 411 HOH A O     1 
HETATM 2083 O O     . HOH H 4 .   ? 32.502 67.910 137.928 1.00 34.77  ? 412 HOH A O     1 
HETATM 2084 O O     . HOH H 4 .   ? 17.284 41.080 167.214 1.00 59.10  ? 436 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   GLN 3   3   ?   ?   ?   A . n 
A 1 4   THR 4   4   ?   ?   ?   A . n 
A 1 5   SER 5   5   ?   ?   ?   A . n 
A 1 6   THR 6   6   6   THR THR A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   LYS 8   8   8   LYS LYS A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  GLN 10  10  10  GLN GLN A . n 
A 1 11  CYS 11  11  11  CYS CYS A . n 
A 1 12  ILE 12  12  12  ILE ILE A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  PHE 15  15  15  PHE PHE A . n 
A 1 16  LEU 16  16  16  LEU LEU A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  PHE 23  23  23  PHE PHE A . n 
A 1 24  PHE 24  24  24  PHE PHE A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  VAL 26  26  26  VAL VAL A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  CYS 28  28  28  CYS CYS A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  VAL 34  34  34  VAL VAL A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  PHE 39  39  39  PHE PHE A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  GLN 41  41  41  GLN GLN A . n 
A 1 42  TRP 42  42  42  TRP TRP A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  ILE 44  44  44  ILE ILE A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  TRP 48  48  48  TRP TRP A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  ALA 53  53  53  ALA ALA A . n 
A 1 54  MET 54  54  54  MET MET A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  TYR 57  57  57  TYR TYR A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  VAL 62  62  62  VAL VAL A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  HIS 66  66  66  HIS HIS A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  THR 72  72  72  THR THR A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  TRP 76  76  76  TRP TRP A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  CYS 80  80  80  CYS CYS A . n 
A 1 81  PHE 81  81  81  PHE PHE A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  LYS 83  83  83  LYS LYS A . n 
A 1 84  ARG 84  84  84  ARG ARG A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  VAL 86  86  86  VAL VAL A . n 
A 1 87  ILE 87  87  87  ILE ILE A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  GLN 93  93  93  GLN GLN A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  PHE 98  98  98  PHE PHE A . n 
A 1 99  CYS 99  99  99  CYS CYS A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 TYR 108 108 108 TYR TYR A . n 
A 1 109 TYR 109 109 109 TYR TYR A . n 
A 1 110 ASN 110 110 110 ASN ASN A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 PHE 113 113 113 PHE PHE A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 PHE 115 115 115 PHE PHE A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 HIS 119 119 119 HIS HIS A . n 
A 1 120 HIS 120 120 120 HIS HIS A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 SER 128 128 128 SER SER A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 ALA 132 132 132 ALA ALA A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 THR 134 134 134 THR THR A . n 
A 1 135 PHE 135 135 135 PHE PHE A . n 
A 1 136 SER 136 136 136 SER SER A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 TYR 138 138 138 TYR TYR A . n 
A 1 139 PRO 139 139 139 PRO PRO A . n 
A 1 140 ASN 140 140 140 ASN ASN A . n 
A 1 141 PRO 141 141 141 PRO PRO A . n 
A 1 142 HIS 142 142 142 HIS HIS A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 VAL 146 146 146 VAL VAL A . n 
A 1 147 GLN 147 147 147 GLN GLN A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 PHE 149 149 149 PHE PHE A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 GLU 152 152 152 GLU GLU A . n 
A 1 153 MET 153 153 153 MET MET A . n 
A 1 154 VAL 154 154 154 VAL VAL A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 MET 160 160 160 MET MET A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 ALA 165 165 165 ALA ALA A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 THR 167 167 167 THR THR A . n 
A 1 168 ASP 168 168 168 ASP ASP A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 ASN 171 171 171 ASN ASN A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 PRO 174 174 174 PRO PRO A . n 
A 1 175 ARG 175 175 175 ARG ARG A . n 
A 1 176 GLY 176 176 176 GLY GLY A . n 
A 1 177 PRO 177 177 177 PRO PRO A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 PRO 180 180 180 PRO PRO A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 ILE 183 183 183 ILE ILE A . n 
A 1 184 GLY 184 184 184 GLY GLY A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 ILE 190 190 190 ILE ILE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 SER 193 193 193 SER SER A . n 
A 1 194 MET 194 194 194 MET MET A . n 
A 1 195 GLY 195 195 195 GLY GLY A . n 
A 1 196 PRO 196 196 196 PRO PRO A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 MET 202 202 202 MET MET A . n 
A 1 203 ASN 203 203 203 ASN ASN A . n 
A 1 204 PRO 204 204 204 PRO PRO A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 ASP 207 207 207 ASP ASP A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 GLY 209 209 209 GLY GLY A . n 
A 1 210 PRO 210 210 210 PRO PRO A . n 
A 1 211 LYS 211 211 211 LYS LYS A . n 
A 1 212 VAL 212 212 212 VAL VAL A . n 
A 1 213 PHE 213 213 213 PHE PHE A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 TRP 215 215 215 TRP TRP A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 ALA 217 217 217 ALA ALA A . n 
A 1 218 GLY 218 218 218 GLY GLY A . n 
A 1 219 TRP 219 219 219 TRP TRP A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 ASN 221 221 221 ASN ASN A . n 
A 1 222 VAL 222 222 222 VAL VAL A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 PHE 224 224 224 PHE PHE A . n 
A 1 225 THR 225 225 225 THR THR A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 ARG 228 228 228 ARG ARG A . n 
A 1 229 ASP 229 229 229 ASP ASP A . n 
A 1 230 ILE 230 230 230 ILE ILE A . n 
A 1 231 PRO 231 231 231 PRO PRO A . n 
A 1 232 TYR 232 232 232 TYR TYR A . n 
A 1 233 PHE 233 233 233 PHE PHE A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 VAL 235 235 235 VAL VAL A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 LEU 237 237 237 LEU LEU A . n 
A 1 238 PHE 238 238 238 PHE PHE A . n 
A 1 239 GLY 239 239 239 GLY GLY A . n 
A 1 240 PRO 240 240 240 PRO PRO A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 VAL 242 242 242 VAL VAL A . n 
A 1 243 GLY 243 243 243 GLY GLY A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ILE 245 245 245 ILE ILE A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLY 247 247 247 GLY GLY A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 PHE 249 249 249 PHE PHE A . n 
A 1 250 ALA 250 250 250 ALA ALA A . n 
A 1 251 TYR 251 251 251 TYR TYR A . n 
A 1 252 ARG 252 252 252 ARG ARG A . n 
A 1 253 LYS 253 253 253 LYS LYS A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 ILE 255 255 255 ILE ILE A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 ARG 257 257 257 ARG ALA A . n 
A 1 258 HIS 258 258 258 HIS HIS A . n 
A 1 259 LEU 259 259 259 LEU LEU A . n 
A 1 260 PRO 260 260 ?   ?   ?   A . n 
A 1 261 CYS 261 261 ?   ?   ?   A . n 
A 1 262 ASP 262 262 ?   ?   ?   A . n 
A 1 263 ILE 263 263 ?   ?   ?   A . n 
A 1 264 CYS 264 264 ?   ?   ?   A . n 
A 1 265 VAL 265 265 ?   ?   ?   A . n 
A 1 266 VAL 266 266 ?   ?   ?   A . n 
A 1 267 GLU 267 267 ?   ?   ?   A . n 
A 1 268 GLU 268 268 ?   ?   ?   A . n 
A 1 269 LYS 269 269 ?   ?   ?   A . n 
A 1 270 GLU 270 270 ?   ?   ?   A . n 
A 1 271 THR 271 271 ?   ?   ?   A . n 
A 1 272 THR 272 272 ?   ?   ?   A . n 
A 1 273 THR 273 273 ?   ?   ?   A . n 
A 1 274 PRO 274 274 ?   ?   ?   A . n 
A 1 275 SER 275 275 ?   ?   ?   A . n 
A 1 276 GLU 276 276 ?   ?   ?   A . n 
A 1 277 GLN 277 277 ?   ?   ?   A . n 
A 1 278 LYS 278 278 ?   ?   ?   A . n 
A 1 279 ALA 279 279 ?   ?   ?   A . n 
A 1 280 SER 280 280 ?   ?   ?   A . n 
A 1 281 LEU 281 281 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 17560 ? 
1 MORE         -144  ? 
1 'SSA (A^2)'  36340 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000  1.0000000000 
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000  0.0000000000 96.7600000000 0.0000000000  
-1.0000000000 0.0000000000 96.7600000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_655 -y+1,x,z    0.0000000000  -1.0000000000 0.0000000000 96.7600000000 1.0000000000  0.0000000000 
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_565 y,-x+1,z    0.0000000000  1.0000000000  0.0000000000 0.0000000000  -1.0000000000 0.0000000000 
0.0000000000 96.7600000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 300 ? H HOH . 
2 1 A HOH 301 ? H HOH . 
3 1 A HOH 302 ? H HOH . 
4 1 A HOH 303 ? H HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-11-01 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHARP  phasing          .         ? 1 
CNS    refinement       .         ? 2 
MOSFLM 'data reduction' .         ? 3 
CCP4   'data scaling'   '(SCALA)' ? 4 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     304 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     304 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   15_456 
_pdbx_validate_symm_contact.dist              1.83 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              21 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              21 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              21 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                133.26 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            17.96 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 VAL A 62  ? ? -102.80 -63.18 
2 1 ASN A 68  ? ? -165.84 117.91 
3 1 TYR A 109 ? ? -28.10  -65.10 
4 1 THR A 198 ? ? -142.53 12.22  
5 1 PHE A 200 ? ? 25.43   62.99  
6 1 MET A 202 ? ? 52.13   8.23   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ARG 257 ? CG  ? A ARG 257 CG  
2 1 Y 1 A ARG 257 ? CD  ? A ARG 257 CD  
3 1 Y 1 A ARG 257 ? NE  ? A ARG 257 NE  
4 1 Y 1 A ARG 257 ? CZ  ? A ARG 257 CZ  
5 1 Y 1 A ARG 257 ? NH1 ? A ARG 257 NH1 
6 1 Y 1 A ARG 257 ? NH2 ? A ARG 257 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A SER 2   ? A SER 2   
3  1 Y 1 A GLN 3   ? A GLN 3   
4  1 Y 1 A THR 4   ? A THR 4   
5  1 Y 1 A SER 5   ? A SER 5   
6  1 Y 1 A PRO 260 ? A PRO 260 
7  1 Y 1 A CYS 261 ? A CYS 261 
8  1 Y 1 A ASP 262 ? A ASP 262 
9  1 Y 1 A ILE 263 ? A ILE 263 
10 1 Y 1 A CYS 264 ? A CYS 264 
11 1 Y 1 A VAL 265 ? A VAL 265 
12 1 Y 1 A VAL 266 ? A VAL 266 
13 1 Y 1 A GLU 267 ? A GLU 267 
14 1 Y 1 A GLU 268 ? A GLU 268 
15 1 Y 1 A LYS 269 ? A LYS 269 
16 1 Y 1 A GLU 270 ? A GLU 270 
17 1 Y 1 A THR 271 ? A THR 271 
18 1 Y 1 A THR 272 ? A THR 272 
19 1 Y 1 A THR 273 ? A THR 273 
20 1 Y 1 A PRO 274 ? A PRO 274 
21 1 Y 1 A SER 275 ? A SER 275 
22 1 Y 1 A GLU 276 ? A GLU 276 
23 1 Y 1 A GLN 277 ? A GLN 277 
24 1 Y 1 A LYS 278 ? A LYS 278 
25 1 Y 1 A ALA 279 ? A ALA 279 
26 1 Y 1 A SER 280 ? A SER 280 
27 1 Y 1 A LEU 281 ? A LEU 281 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 B-OCTYLGLUCOSIDE BOG 
3 GLYCEROL         GOL 
4 water            HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 BOG 1   473 473 BOG BOG A . 
C 2 BOG 1   474 474 BOG BOG A . 
D 2 BOG 1   475 475 BOG BOG A . 
E 3 GOL 1   662 662 GOL CRY A . 
F 3 GOL 1   661 661 GOL CRY A . 
G 3 GOL 1   663 663 GOL CRY A . 
H 4 HOH 1   300 300 HOH HOH A . 
H 4 HOH 2   301 301 HOH HOH A . 
H 4 HOH 3   302 302 HOH HOH A . 
H 4 HOH 4   303 303 HOH HOH A . 
H 4 HOH 5   304 304 HOH HOH A . 
H 4 HOH 6   305 305 HOH HOH A . 
H 4 HOH 7   308 308 HOH HOH A . 
H 4 HOH 8   309 309 HOH HOH A . 
H 4 HOH 9   310 310 HOH HOH A . 
H 4 HOH 10  311 311 HOH HOH A . 
H 4 HOH 11  312 312 HOH HOH A . 
H 4 HOH 12  313 313 HOH HOH A . 
H 4 HOH 13  314 314 HOH HOH A . 
H 4 HOH 14  315 315 HOH HOH A . 
H 4 HOH 15  316 316 HOH HOH A . 
H 4 HOH 16  317 317 HOH HOH A . 
H 4 HOH 17  318 318 HOH HOH A . 
H 4 HOH 18  319 319 HOH HOH A . 
H 4 HOH 19  320 320 HOH HOH A . 
H 4 HOH 20  321 321 HOH HOH A . 
H 4 HOH 21  322 322 HOH HOH A . 
H 4 HOH 22  323 323 HOH HOH A . 
H 4 HOH 23  324 324 HOH HOH A . 
H 4 HOH 24  325 325 HOH HOH A . 
H 4 HOH 25  326 326 HOH HOH A . 
H 4 HOH 26  327 327 HOH HOH A . 
H 4 HOH 27  328 328 HOH HOH A . 
H 4 HOH 28  329 329 HOH HOH A . 
H 4 HOH 29  330 330 HOH HOH A . 
H 4 HOH 30  331 331 HOH HOH A . 
H 4 HOH 31  332 332 HOH HOH A . 
H 4 HOH 32  333 333 HOH HOH A . 
H 4 HOH 33  334 334 HOH HOH A . 
H 4 HOH 34  335 335 HOH HOH A . 
H 4 HOH 35  336 336 HOH HOH A . 
H 4 HOH 36  337 337 HOH HOH A . 
H 4 HOH 37  339 339 HOH HOH A . 
H 4 HOH 38  340 340 HOH HOH A . 
H 4 HOH 39  341 341 HOH HOH A . 
H 4 HOH 40  342 342 HOH HOH A . 
H 4 HOH 41  343 343 HOH HOH A . 
H 4 HOH 42  344 344 HOH HOH A . 
H 4 HOH 43  345 345 HOH HOH A . 
H 4 HOH 44  346 346 HOH HOH A . 
H 4 HOH 45  347 347 HOH HOH A . 
H 4 HOH 46  348 348 HOH HOH A . 
H 4 HOH 47  349 349 HOH HOH A . 
H 4 HOH 48  350 350 HOH HOH A . 
H 4 HOH 49  351 351 HOH HOH A . 
H 4 HOH 50  352 352 HOH HOH A . 
H 4 HOH 51  353 353 HOH HOH A . 
H 4 HOH 52  354 354 HOH HOH A . 
H 4 HOH 53  355 355 HOH HOH A . 
H 4 HOH 54  356 356 HOH HOH A . 
H 4 HOH 55  357 357 HOH HOH A . 
H 4 HOH 56  358 358 HOH HOH A . 
H 4 HOH 57  359 359 HOH HOH A . 
H 4 HOH 58  360 360 HOH HOH A . 
H 4 HOH 59  361 361 HOH HOH A . 
H 4 HOH 60  362 362 HOH HOH A . 
H 4 HOH 61  363 363 HOH HOH A . 
H 4 HOH 62  364 364 HOH HOH A . 
H 4 HOH 63  365 365 HOH HOH A . 
H 4 HOH 64  366 366 HOH HOH A . 
H 4 HOH 65  367 367 HOH HOH A . 
H 4 HOH 66  368 368 HOH HOH A . 
H 4 HOH 67  369 369 HOH HOH A . 
H 4 HOH 68  370 370 HOH HOH A . 
H 4 HOH 69  371 371 HOH HOH A . 
H 4 HOH 70  372 372 HOH HOH A . 
H 4 HOH 71  373 373 HOH HOH A . 
H 4 HOH 72  374 374 HOH HOH A . 
H 4 HOH 73  375 375 HOH HOH A . 
H 4 HOH 74  376 376 HOH HOH A . 
H 4 HOH 75  377 377 HOH HOH A . 
H 4 HOH 76  378 378 HOH HOH A . 
H 4 HOH 77  379 379 HOH HOH A . 
H 4 HOH 78  380 380 HOH HOH A . 
H 4 HOH 79  381 381 HOH HOH A . 
H 4 HOH 80  382 382 HOH HOH A . 
H 4 HOH 81  383 383 HOH HOH A . 
H 4 HOH 82  384 384 HOH HOH A . 
H 4 HOH 83  385 385 HOH HOH A . 
H 4 HOH 84  386 386 HOH HOH A . 
H 4 HOH 85  387 387 HOH HOH A . 
H 4 HOH 86  388 388 HOH HOH A . 
H 4 HOH 87  389 389 HOH HOH A . 
H 4 HOH 88  390 390 HOH HOH A . 
H 4 HOH 89  391 391 HOH HOH A . 
H 4 HOH 90  392 392 HOH HOH A . 
H 4 HOH 91  393 393 HOH HOH A . 
H 4 HOH 92  394 394 HOH HOH A . 
H 4 HOH 93  395 395 HOH HOH A . 
H 4 HOH 94  396 396 HOH HOH A . 
H 4 HOH 95  397 397 HOH HOH A . 
H 4 HOH 96  398 398 HOH HOH A . 
H 4 HOH 97  399 399 HOH HOH A . 
H 4 HOH 98  400 400 HOH HOH A . 
H 4 HOH 99  401 401 HOH HOH A . 
H 4 HOH 100 402 402 HOH HOH A . 
H 4 HOH 101 403 403 HOH HOH A . 
H 4 HOH 102 404 404 HOH HOH A . 
H 4 HOH 103 405 405 HOH HOH A . 
H 4 HOH 104 406 406 HOH HOH A . 
H 4 HOH 105 407 407 HOH HOH A . 
H 4 HOH 106 408 408 HOH HOH A . 
H 4 HOH 107 409 409 HOH HOH A . 
H 4 HOH 108 410 410 HOH HOH A . 
H 4 HOH 109 411 411 HOH HOH A . 
H 4 HOH 110 412 412 HOH HOH A . 
H 4 HOH 111 436 436 HOH HOH A . 
#