data_1FZB
# 
_entry.id   1FZB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1FZB         
WWPDB D_1000173465 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1FZB 
_pdbx_database_status.recvd_initial_deposition_date   1997-08-05 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Spraggon, G.'    1 
'Everse, S.J.'    2 
'Doolittle, R.F.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structures of fragment D from human fibrinogen and its crosslinked counterpart from fibrin.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            389 
_citation.page_first                455 
_citation.page_last                 462 
_citation.year                      1997 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9333233 
_citation.pdbx_database_id_DOI      10.1038/38947 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Spraggon, G.'    1 ? 
primary 'Everse, S.J.'    2 ? 
primary 'Doolittle, R.F.' 3 ? 
# 
_cell.entry_id           1FZB 
_cell.length_a           93.820 
_cell.length_b           95.500 
_cell.length_c           113.760 
_cell.angle_alpha        90.00 
_cell.angle_beta         96.08 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1FZB 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat FIBRINOGEN                               10244.963 2 ? ? 'DOUBLE FRAGMENT D' ? 
2 polymer     nat FIBRINOGEN                               37691.992 2 ? ? 'DOUBLE FRAGMENT D' ? 
3 polymer     nat FIBRINOGEN                               36223.281 2 ? ? 'DOUBLE FRAGMENT D' ? 
4 polymer     man 'PEPTIDE LIGAND GPRG'                    426.490   2 ? ? ?                   
'BOUND PEPTIDE CAUSES THE FIBRIN CLOT CONFORMATION' 
5 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2 ? ? ?                   ? 
6 non-polymer syn 'CALCIUM ION'                            40.078    2 ? ? ?                   ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;VSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
KDLLPSR
;
;VSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
KDLLPSR
;
A,D ? 
2 'polypeptide(L)' no no 
;DNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEE
IIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYW
LGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGM
FFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMK
IRPFFPQQ
;
;DNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEE
IIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYW
LGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGM
FFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMK
IRPFFPQQ
;
B,E ? 
3 'polypeptide(L)' no no 
;KMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLY
FIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALR
VELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCA
EQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHLGGAK
;
;KMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLY
FIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALR
VELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCA
EQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHLGGAK
;
C,F ? 
4 'polypeptide(L)' no no GPRP GPRP G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   SER n 
1 3   GLU n 
1 4   ASP n 
1 5   LEU n 
1 6   ARG n 
1 7   SER n 
1 8   ARG n 
1 9   ILE n 
1 10  GLU n 
1 11  VAL n 
1 12  LEU n 
1 13  LYS n 
1 14  ARG n 
1 15  LYS n 
1 16  VAL n 
1 17  ILE n 
1 18  GLU n 
1 19  LYS n 
1 20  VAL n 
1 21  GLN n 
1 22  HIS n 
1 23  ILE n 
1 24  GLN n 
1 25  LEU n 
1 26  LEU n 
1 27  GLN n 
1 28  LYS n 
1 29  ASN n 
1 30  VAL n 
1 31  ARG n 
1 32  ALA n 
1 33  GLN n 
1 34  LEU n 
1 35  VAL n 
1 36  ASP n 
1 37  MET n 
1 38  LYS n 
1 39  ARG n 
1 40  LEU n 
1 41  GLU n 
1 42  VAL n 
1 43  ASP n 
1 44  ILE n 
1 45  ASP n 
1 46  ILE n 
1 47  LYS n 
1 48  ILE n 
1 49  ARG n 
1 50  SER n 
1 51  CYS n 
1 52  ARG n 
1 53  GLY n 
1 54  SER n 
1 55  CYS n 
1 56  SER n 
1 57  ARG n 
1 58  ALA n 
1 59  LEU n 
1 60  ALA n 
1 61  ARG n 
1 62  GLU n 
1 63  VAL n 
1 64  ASP n 
1 65  LEU n 
1 66  LYS n 
1 67  ASP n 
1 68  TYR n 
1 69  GLU n 
1 70  ASP n 
1 71  GLN n 
1 72  GLN n 
1 73  LYS n 
1 74  GLN n 
1 75  LEU n 
1 76  GLU n 
1 77  GLN n 
1 78  VAL n 
1 79  ILE n 
1 80  ALA n 
1 81  LYS n 
1 82  ASP n 
1 83  LEU n 
1 84  LEU n 
1 85  PRO n 
1 86  SER n 
1 87  ARG n 
2 1   ASP n 
2 2   ASN n 
2 3   GLU n 
2 4   ASN n 
2 5   VAL n 
2 6   VAL n 
2 7   ASN n 
2 8   GLU n 
2 9   TYR n 
2 10  SER n 
2 11  SER n 
2 12  GLU n 
2 13  LEU n 
2 14  GLU n 
2 15  LYS n 
2 16  HIS n 
2 17  GLN n 
2 18  LEU n 
2 19  TYR n 
2 20  ILE n 
2 21  ASP n 
2 22  GLU n 
2 23  THR n 
2 24  VAL n 
2 25  ASN n 
2 26  SER n 
2 27  ASN n 
2 28  ILE n 
2 29  PRO n 
2 30  THR n 
2 31  ASN n 
2 32  LEU n 
2 33  ARG n 
2 34  VAL n 
2 35  LEU n 
2 36  ARG n 
2 37  SER n 
2 38  ILE n 
2 39  LEU n 
2 40  GLU n 
2 41  ASN n 
2 42  LEU n 
2 43  ARG n 
2 44  SER n 
2 45  LYS n 
2 46  ILE n 
2 47  GLN n 
2 48  LYS n 
2 49  LEU n 
2 50  GLU n 
2 51  SER n 
2 52  ASP n 
2 53  VAL n 
2 54  SER n 
2 55  ALA n 
2 56  GLN n 
2 57  MET n 
2 58  GLU n 
2 59  TYR n 
2 60  CYS n 
2 61  ARG n 
2 62  THR n 
2 63  PRO n 
2 64  CYS n 
2 65  THR n 
2 66  VAL n 
2 67  SER n 
2 68  CYS n 
2 69  ASN n 
2 70  ILE n 
2 71  PRO n 
2 72  VAL n 
2 73  VAL n 
2 74  SER n 
2 75  GLY n 
2 76  LYS n 
2 77  GLU n 
2 78  CYS n 
2 79  GLU n 
2 80  GLU n 
2 81  ILE n 
2 82  ILE n 
2 83  ARG n 
2 84  LYS n 
2 85  GLY n 
2 86  GLY n 
2 87  GLU n 
2 88  THR n 
2 89  SER n 
2 90  GLU n 
2 91  MET n 
2 92  TYR n 
2 93  LEU n 
2 94  ILE n 
2 95  GLN n 
2 96  PRO n 
2 97  ASP n 
2 98  SER n 
2 99  SER n 
2 100 VAL n 
2 101 LYS n 
2 102 PRO n 
2 103 TYR n 
2 104 ARG n 
2 105 VAL n 
2 106 TYR n 
2 107 CYS n 
2 108 ASP n 
2 109 MET n 
2 110 ASN n 
2 111 THR n 
2 112 GLU n 
2 113 ASN n 
2 114 GLY n 
2 115 GLY n 
2 116 TRP n 
2 117 THR n 
2 118 VAL n 
2 119 ILE n 
2 120 GLN n 
2 121 ASN n 
2 122 ARG n 
2 123 GLN n 
2 124 ASP n 
2 125 GLY n 
2 126 SER n 
2 127 VAL n 
2 128 ASP n 
2 129 PHE n 
2 130 GLY n 
2 131 ARG n 
2 132 LYS n 
2 133 TRP n 
2 134 ASP n 
2 135 PRO n 
2 136 TYR n 
2 137 LYS n 
2 138 GLN n 
2 139 GLY n 
2 140 PHE n 
2 141 GLY n 
2 142 ASN n 
2 143 VAL n 
2 144 ALA n 
2 145 THR n 
2 146 ASN n 
2 147 THR n 
2 148 ASP n 
2 149 GLY n 
2 150 LYS n 
2 151 ASN n 
2 152 TYR n 
2 153 CYS n 
2 154 GLY n 
2 155 LEU n 
2 156 PRO n 
2 157 GLY n 
2 158 GLU n 
2 159 TYR n 
2 160 TRP n 
2 161 LEU n 
2 162 GLY n 
2 163 ASN n 
2 164 ASP n 
2 165 LYS n 
2 166 ILE n 
2 167 SER n 
2 168 GLN n 
2 169 LEU n 
2 170 THR n 
2 171 ARG n 
2 172 MET n 
2 173 GLY n 
2 174 PRO n 
2 175 THR n 
2 176 GLU n 
2 177 LEU n 
2 178 LEU n 
2 179 ILE n 
2 180 GLU n 
2 181 MET n 
2 182 GLU n 
2 183 ASP n 
2 184 TRP n 
2 185 LYS n 
2 186 GLY n 
2 187 ASP n 
2 188 LYS n 
2 189 VAL n 
2 190 LYS n 
2 191 ALA n 
2 192 HIS n 
2 193 TYR n 
2 194 GLY n 
2 195 GLY n 
2 196 PHE n 
2 197 THR n 
2 198 VAL n 
2 199 GLN n 
2 200 ASN n 
2 201 GLU n 
2 202 ALA n 
2 203 ASN n 
2 204 LYS n 
2 205 TYR n 
2 206 GLN n 
2 207 ILE n 
2 208 SER n 
2 209 VAL n 
2 210 ASN n 
2 211 LYS n 
2 212 TYR n 
2 213 ARG n 
2 214 GLY n 
2 215 THR n 
2 216 ALA n 
2 217 GLY n 
2 218 ASN n 
2 219 ALA n 
2 220 LEU n 
2 221 MET n 
2 222 ASP n 
2 223 GLY n 
2 224 ALA n 
2 225 SER n 
2 226 GLN n 
2 227 LEU n 
2 228 MET n 
2 229 GLY n 
2 230 GLU n 
2 231 ASN n 
2 232 ARG n 
2 233 THR n 
2 234 MET n 
2 235 THR n 
2 236 ILE n 
2 237 HIS n 
2 238 ASN n 
2 239 GLY n 
2 240 MET n 
2 241 PHE n 
2 242 PHE n 
2 243 SER n 
2 244 THR n 
2 245 TYR n 
2 246 ASP n 
2 247 ARG n 
2 248 ASP n 
2 249 ASN n 
2 250 ASP n 
2 251 GLY n 
2 252 TRP n 
2 253 LEU n 
2 254 THR n 
2 255 SER n 
2 256 ASP n 
2 257 PRO n 
2 258 ARG n 
2 259 LYS n 
2 260 GLN n 
2 261 CYS n 
2 262 SER n 
2 263 LYS n 
2 264 GLU n 
2 265 ASP n 
2 266 GLY n 
2 267 GLY n 
2 268 GLY n 
2 269 TRP n 
2 270 TRP n 
2 271 TYR n 
2 272 ASN n 
2 273 ARG n 
2 274 CYS n 
2 275 HIS n 
2 276 ALA n 
2 277 ALA n 
2 278 ASN n 
2 279 PRO n 
2 280 ASN n 
2 281 GLY n 
2 282 ARG n 
2 283 TYR n 
2 284 TYR n 
2 285 TRP n 
2 286 GLY n 
2 287 GLY n 
2 288 GLN n 
2 289 TYR n 
2 290 THR n 
2 291 TRP n 
2 292 ASP n 
2 293 MET n 
2 294 ALA n 
2 295 LYS n 
2 296 HIS n 
2 297 GLY n 
2 298 THR n 
2 299 ASP n 
2 300 ASP n 
2 301 GLY n 
2 302 VAL n 
2 303 VAL n 
2 304 TRP n 
2 305 MET n 
2 306 ASN n 
2 307 TRP n 
2 308 LYS n 
2 309 GLY n 
2 310 SER n 
2 311 TRP n 
2 312 TYR n 
2 313 SER n 
2 314 MET n 
2 315 ARG n 
2 316 LYS n 
2 317 MET n 
2 318 SER n 
2 319 MET n 
2 320 LYS n 
2 321 ILE n 
2 322 ARG n 
2 323 PRO n 
2 324 PHE n 
2 325 PHE n 
2 326 PRO n 
2 327 GLN n 
2 328 GLN n 
3 1   LYS n 
3 2   MET n 
3 3   LEU n 
3 4   GLU n 
3 5   GLU n 
3 6   ILE n 
3 7   MET n 
3 8   LYS n 
3 9   TYR n 
3 10  GLU n 
3 11  ALA n 
3 12  SER n 
3 13  ILE n 
3 14  LEU n 
3 15  THR n 
3 16  HIS n 
3 17  ASP n 
3 18  SER n 
3 19  SER n 
3 20  ILE n 
3 21  ARG n 
3 22  TYR n 
3 23  LEU n 
3 24  GLN n 
3 25  GLU n 
3 26  ILE n 
3 27  TYR n 
3 28  ASN n 
3 29  SER n 
3 30  ASN n 
3 31  ASN n 
3 32  GLN n 
3 33  LYS n 
3 34  ILE n 
3 35  VAL n 
3 36  ASN n 
3 37  LEU n 
3 38  LYS n 
3 39  GLU n 
3 40  LYS n 
3 41  VAL n 
3 42  ALA n 
3 43  GLN n 
3 44  LEU n 
3 45  GLU n 
3 46  ALA n 
3 47  GLN n 
3 48  CYS n 
3 49  GLN n 
3 50  GLU n 
3 51  PRO n 
3 52  CYS n 
3 53  LYS n 
3 54  ASP n 
3 55  THR n 
3 56  VAL n 
3 57  GLN n 
3 58  ILE n 
3 59  HIS n 
3 60  ASP n 
3 61  ILE n 
3 62  THR n 
3 63  GLY n 
3 64  LYS n 
3 65  ASP n 
3 66  CYS n 
3 67  GLN n 
3 68  ASP n 
3 69  ILE n 
3 70  ALA n 
3 71  ASN n 
3 72  LYS n 
3 73  GLY n 
3 74  ALA n 
3 75  LYS n 
3 76  GLN n 
3 77  SER n 
3 78  GLY n 
3 79  LEU n 
3 80  TYR n 
3 81  PHE n 
3 82  ILE n 
3 83  LYS n 
3 84  PRO n 
3 85  LEU n 
3 86  LYS n 
3 87  ALA n 
3 88  ASN n 
3 89  GLN n 
3 90  GLN n 
3 91  PHE n 
3 92  LEU n 
3 93  VAL n 
3 94  TYR n 
3 95  CYS n 
3 96  GLU n 
3 97  ILE n 
3 98  ASP n 
3 99  GLY n 
3 100 SER n 
3 101 GLY n 
3 102 ASN n 
3 103 GLY n 
3 104 TRP n 
3 105 THR n 
3 106 VAL n 
3 107 PHE n 
3 108 GLN n 
3 109 LYS n 
3 110 ARG n 
3 111 LEU n 
3 112 ASP n 
3 113 GLY n 
3 114 SER n 
3 115 VAL n 
3 116 ASP n 
3 117 PHE n 
3 118 LYS n 
3 119 LYS n 
3 120 ASN n 
3 121 TRP n 
3 122 ILE n 
3 123 GLN n 
3 124 TYR n 
3 125 LYS n 
3 126 GLU n 
3 127 GLY n 
3 128 PHE n 
3 129 GLY n 
3 130 HIS n 
3 131 LEU n 
3 132 SER n 
3 133 PRO n 
3 134 THR n 
3 135 GLY n 
3 136 THR n 
3 137 THR n 
3 138 GLU n 
3 139 PHE n 
3 140 TRP n 
3 141 LEU n 
3 142 GLY n 
3 143 ASN n 
3 144 GLU n 
3 145 LYS n 
3 146 ILE n 
3 147 HIS n 
3 148 LEU n 
3 149 ILE n 
3 150 SER n 
3 151 THR n 
3 152 GLN n 
3 153 SER n 
3 154 ALA n 
3 155 ILE n 
3 156 PRO n 
3 157 TYR n 
3 158 ALA n 
3 159 LEU n 
3 160 ARG n 
3 161 VAL n 
3 162 GLU n 
3 163 LEU n 
3 164 GLU n 
3 165 ASP n 
3 166 TRP n 
3 167 ASN n 
3 168 GLY n 
3 169 ARG n 
3 170 THR n 
3 171 SER n 
3 172 THR n 
3 173 ALA n 
3 174 ASP n 
3 175 TYR n 
3 176 ALA n 
3 177 MET n 
3 178 PHE n 
3 179 LYS n 
3 180 VAL n 
3 181 GLY n 
3 182 PRO n 
3 183 GLU n 
3 184 ALA n 
3 185 ASP n 
3 186 LYS n 
3 187 TYR n 
3 188 ARG n 
3 189 LEU n 
3 190 THR n 
3 191 TYR n 
3 192 ALA n 
3 193 TYR n 
3 194 PHE n 
3 195 ALA n 
3 196 GLY n 
3 197 GLY n 
3 198 ASP n 
3 199 ALA n 
3 200 GLY n 
3 201 ASP n 
3 202 ALA n 
3 203 PHE n 
3 204 ASP n 
3 205 GLY n 
3 206 PHE n 
3 207 ASP n 
3 208 PHE n 
3 209 GLY n 
3 210 ASP n 
3 211 ASP n 
3 212 PRO n 
3 213 SER n 
3 214 ASP n 
3 215 LYS n 
3 216 PHE n 
3 217 PHE n 
3 218 THR n 
3 219 SER n 
3 220 HIS n 
3 221 ASN n 
3 222 GLY n 
3 223 MET n 
3 224 GLN n 
3 225 PHE n 
3 226 SER n 
3 227 THR n 
3 228 TRP n 
3 229 ASP n 
3 230 ASN n 
3 231 ASP n 
3 232 ASN n 
3 233 ASP n 
3 234 LYS n 
3 235 PHE n 
3 236 GLU n 
3 237 GLY n 
3 238 ASN n 
3 239 CYS n 
3 240 ALA n 
3 241 GLU n 
3 242 GLN n 
3 243 ASP n 
3 244 GLY n 
3 245 SER n 
3 246 GLY n 
3 247 TRP n 
3 248 TRP n 
3 249 MET n 
3 250 ASN n 
3 251 LYS n 
3 252 CYS n 
3 253 HIS n 
3 254 ALA n 
3 255 GLY n 
3 256 HIS n 
3 257 LEU n 
3 258 ASN n 
3 259 GLY n 
3 260 VAL n 
3 261 TYR n 
3 262 TYR n 
3 263 GLN n 
3 264 GLY n 
3 265 GLY n 
3 266 THR n 
3 267 TYR n 
3 268 SER n 
3 269 LYS n 
3 270 ALA n 
3 271 SER n 
3 272 THR n 
3 273 PRO n 
3 274 ASN n 
3 275 GLY n 
3 276 TYR n 
3 277 ASP n 
3 278 ASN n 
3 279 GLY n 
3 280 ILE n 
3 281 ILE n 
3 282 TRP n 
3 283 ALA n 
3 284 THR n 
3 285 TRP n 
3 286 LYS n 
3 287 THR n 
3 288 ARG n 
3 289 TRP n 
3 290 TYR n 
3 291 SER n 
3 292 MET n 
3 293 LYS n 
3 294 LYS n 
3 295 THR n 
3 296 THR n 
3 297 MET n 
3 298 LYS n 
3 299 ILE n 
3 300 ILE n 
3 301 PRO n 
3 302 PHE n 
3 303 ASN n 
3 304 ARG n 
3 305 LEU n 
3 306 THR n 
3 307 ILE n 
3 308 GLY n 
3 309 GLU n 
3 310 GLY n 
3 311 GLN n 
3 312 GLN n 
3 313 HIS n 
3 314 HIS n 
3 315 LEU n 
3 316 GLY n 
3 317 GLY n 
3 318 ALA n 
3 319 LYS n 
4 1   GLY n 
4 2   PRO n 
4 3   ARG n 
4 4   PRO n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? human 'Homo sapiens' 9606 Homo ? ? BLOOD ? ? ? ? ? ? ? BLOOD ? ? ? ? ? 
2 1 sample ? ? human 'Homo sapiens' 9606 Homo ? ? BLOOD ? ? ? ? ? ? ? BLOOD ? ? ? ? ? 
3 1 sample ? ? human 'Homo sapiens' 9606 Homo ? ? BLOOD ? ? ? ? ? ? ? BLOOD ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP FIBA_HUMAN 1 P02671 1 
;MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDSDWPFCSDEDWNYKCPSGCRMKGLIDEVNQD
FTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSANNRDNTYNRVSEDLRSRIEVLKRKVIEKVQHIQLLQKNVR
AQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLPSRDRQHLPLIKMKPVPDLVPGNFKSQ
LQKVPPEWKALTDMPQMRMELERPGGNEITRGGSTSYGTGSETESPRNPSSAGSWNSGSSGPGSTGNRNPGSSGTGGTAT
WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSAGHWTSESSVSGSTGQWHSESGSFRPDSPGS
GNARPNNPDWGTFEEVSGNVSPGTRREYHTEKLVTSKGDKELRTGKEKVTSGSTTTTRRSCSKTVTKTVIGPDGHKEVTK
EVVTSEDGSDCPEAMDLGTLSGIGTLDGFRHRHPDEAAFFDTASTGKTFPGFFSPMLGEFVSETESRGSESGIFTNTKES
SSHHPGIAEFPSRGKSSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPVRDCDDVLQTHP
SGTQSGIFNIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQR
GSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGSVEEGAEYTSHNNMQFSTFDRDADQWEENCA
EVYGGGWWYNNCQAANLNGIYYPGGSYDPRNNSPYEIENGVVWVSFRGADYSLRAVRMKIRPLVTQ
;
? 
2 UNP FIBB_HUMAN 2 P02675 1 
;MKRMVSWSFHKLKTMKHLLLLLLCVFLVKSQGVNDNEEGFFSARGHRPLDKKREEAPSLRPAPPPISGGGYRARPAKAAA
TQKKVERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQERPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQK
QVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKE
CEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPG
EYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIH
NGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKM
SMKIRPFFPQQ
;
? 
3 UNP FIBG_HUMAN 3 P02679 1 
;MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKT
SEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRIMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQ
CQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEG
FGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFD
FGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKT
RWYSMKKTTMKIIPFNRLTIGEGQQHHLGGAKQAGDV
;
? 
4 PDB 1FZB       4 1FZB   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1FZB A 1 ? 87  ? P02671 130 ? 216 ? 111 197 
2 2 1FZB B 1 ? 328 ? P02675 164 ? 491 ? 134 461 
3 3 1FZB C 1 ? 319 ? P02679 111 ? 432 ? 88  406 
4 1 1FZB D 1 ? 87  ? P02671 130 ? 216 ? 111 197 
5 2 1FZB E 1 ? 328 ? P02675 164 ? 491 ? 134 461 
6 3 1FZB F 1 ? 319 ? P02679 111 ? 432 ? 88  406 
7 4 1FZB G 1 ? 4   ? 1FZB   1   ? 4   ? 1   4   
8 4 1FZB H 1 ? 4   ? 1FZB   1   ? 4   ? 1   4   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 1FZB LYS C 1 ? UNP P02679 ILE 114 conflict 88 1 
6 1FZB LYS F 1 ? UNP P02679 ILE 114 conflict 88 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CA  non-polymer                  . 'CALCIUM ION'                            ? 'Ca 2'           40.078  
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1FZB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   5 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.99 
_exptl_crystal.density_percent_sol   58.93 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'13-14% PEG 3350, 50 MM TRIS PH 7.0, 10 MM CALCIUM CHLORIDE 1MM SODIUM AZIDE 5MM GLY-PRO-ARG-PRO-AMIDE' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           297 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   1996-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1FZB 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.9 
_reflns.number_obs                   40637 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         88.8 
_reflns.pdbx_Rmerge_I_obs            0.192 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.0 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1FZB 
_refine.ls_number_reflns_obs                     40637 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               10000000.00 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.0 
_refine.ls_d_res_high                            2.9 
_refine.ls_percent_reflns_obs                    88.8 
_refine.ls_R_factor_obs                          0.241 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.241 
_refine.ls_R_factor_R_free                       0.318 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5. 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               30.81 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'FIBRINOGEN FRAGMENT D' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11387 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               11417 
_refine_hist.d_res_high                       2.9 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.54  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   RESTRAINED 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.665601 
_struct_ncs_oper.matrix[1][2]   0.189776 
_struct_ncs_oper.matrix[1][3]   -0.721775 
_struct_ncs_oper.matrix[2][1]   0.138671 
_struct_ncs_oper.matrix[2][2]   -0.981736 
_struct_ncs_oper.matrix[2][3]   -0.130249 
_struct_ncs_oper.matrix[3][1]   -0.733311 
_struct_ncs_oper.matrix[3][2]   -0.013395 
_struct_ncs_oper.matrix[3][3]   -0.679761 
_struct_ncs_oper.vector[1]      90.65773 
_struct_ncs_oper.vector[2]      1.50171 
_struct_ncs_oper.vector[3]      242.26517 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  1FZB 
_struct.title                     'CRYSTAL STRUCTURE OF CROSSLINKED FRAGMENT D' 
_struct.pdbx_descriptor           'FIBRINOGEN, PEPTIDE LIGAND GPRG' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1FZB 
_struct_keywords.pdbx_keywords   'BLOOD COAGULATION' 
_struct_keywords.text            'BLOOD COAGULATION, PLASMA, PLATELET, FIBRINOGEN, FIBRIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 5 ? 
L N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 10  ? CYS A 51  ? GLU A 120 CYS A 161 1 ? 42 
HELX_P HELX_P2  2  LEU A 65  ? ILE A 79  ? LEU A 175 ILE A 189 1 ? 15 
HELX_P HELX_P3  3  VAL B 24  ? TYR B 59  ? VAL B 157 TYR B 192 1 ? 36 
HELX_P HELX_P4  4  CYS B 78  ? ARG B 83  ? CYS B 211 ARG B 216 1 ? 6  
HELX_P HELX_P5  5  TRP B 133 ? GLN B 138 ? TRP B 266 GLN B 271 1 ? 6  
HELX_P HELX_P6  6  ASN B 163 ? THR B 170 ? ASN B 296 THR B 303 1 ? 8  
HELX_P HELX_P7  7  GLU B 201 ? ASN B 203 ? GLU B 334 ASN B 336 5 ? 3  
HELX_P HELX_P8  8  ALA B 219 ? ASP B 222 ? ALA B 352 ASP B 355 1 ? 4  
HELX_P HELX_P9  9  GLY B 229 ? THR B 235 ? GLY B 362 THR B 368 1 ? 7  
HELX_P HELX_P10 10 TRP B 285 ? GLY B 287 ? TRP B 418 GLY B 420 5 ? 3  
HELX_P HELX_P11 11 MET B 305 ? LYS B 308 ? MET B 438 LYS B 441 1 ? 4  
HELX_P HELX_P12 12 MET C 2   ? GLU C 5   ? MET C 89  GLU C 92  1 ? 4  
HELX_P HELX_P13 13 HIS C 16  ? SER C 19  ? HIS C 103 SER C 106 5 ? 4  
HELX_P HELX_P14 14 TYR C 22  ? GLN C 47  ? TYR C 109 GLN C 134 5 ? 26 
HELX_P HELX_P15 15 CYS C 66  ? LYS C 72  ? CYS C 153 LYS C 159 1 ? 7  
HELX_P HELX_P16 16 TRP C 121 ? GLU C 126 ? TRP C 208 GLU C 213 1 ? 6  
HELX_P HELX_P17 17 ASN C 143 ? THR C 151 ? ASN C 230 THR C 238 1 ? 9  
HELX_P HELX_P18 18 GLU C 183 ? ASP C 185 ? GLU C 270 ASP C 272 5 ? 3  
HELX_P HELX_P19 19 ALA C 202 ? ASP C 204 ? ALA C 289 ASP C 291 5 ? 3  
HELX_P HELX_P20 20 ASP C 214 ? THR C 218 ? ASP C 301 THR C 305 1 ? 5  
HELX_P HELX_P21 21 CYS C 239 ? ASP C 243 ? CYS C 326 ASP C 330 1 ? 5  
HELX_P HELX_P22 22 PHE C 302 ? ARG C 304 ? PHE C 389 ARG C 391 5 ? 3  
HELX_P HELX_P23 23 LYS D 13  ? GLY D 53  ? LYS D 123 GLY D 163 1 ? 41 
HELX_P HELX_P24 24 LEU D 65  ? ILE D 79  ? LEU D 175 ILE D 189 1 ? 15 
HELX_P HELX_P25 25 VAL E 24  ? ARG E 61  ? VAL E 157 ARG E 194 1 ? 38 
HELX_P HELX_P26 26 CYS E 78  ? ARG E 83  ? CYS E 211 ARG E 216 1 ? 6  
HELX_P HELX_P27 27 TRP E 133 ? GLN E 138 ? TRP E 266 GLN E 271 1 ? 6  
HELX_P HELX_P28 28 ASN E 163 ? THR E 170 ? ASN E 296 THR E 303 1 ? 8  
HELX_P HELX_P29 29 GLU E 201 ? ASN E 203 ? GLU E 334 ASN E 336 5 ? 3  
HELX_P HELX_P30 30 ALA E 219 ? ASP E 222 ? ALA E 352 ASP E 355 1 ? 4  
HELX_P HELX_P31 31 GLY E 229 ? THR E 235 ? GLY E 362 THR E 368 1 ? 7  
HELX_P HELX_P32 32 TRP E 285 ? GLY E 287 ? TRP E 418 GLY E 420 5 ? 3  
HELX_P HELX_P33 33 MET E 305 ? LYS E 308 ? MET E 438 LYS E 441 1 ? 4  
HELX_P HELX_P34 34 MET F 2   ? GLU F 5   ? MET F 89  GLU F 92  1 ? 4  
HELX_P HELX_P35 35 HIS F 16  ? SER F 19  ? HIS F 103 SER F 106 5 ? 4  
HELX_P HELX_P36 36 TYR F 22  ? GLN F 47  ? TYR F 109 GLN F 134 5 ? 26 
HELX_P HELX_P37 37 CYS F 66  ? LYS F 72  ? CYS F 153 LYS F 159 1 ? 7  
HELX_P HELX_P38 38 TRP F 121 ? GLU F 126 ? TRP F 208 GLU F 213 1 ? 6  
HELX_P HELX_P39 39 ASN F 143 ? ALA F 154 ? ASN F 230 ALA F 241 1 ? 12 
HELX_P HELX_P40 40 GLU F 183 ? ASP F 185 ? GLU F 270 ASP F 272 5 ? 3  
HELX_P HELX_P41 41 ALA F 202 ? ASP F 204 ? ALA F 289 ASP F 291 5 ? 3  
HELX_P HELX_P42 42 SER F 213 ? THR F 218 ? SER F 300 THR F 305 5 ? 6  
HELX_P HELX_P43 43 CYS F 239 ? ASP F 243 ? CYS F 326 ASP F 330 1 ? 5  
HELX_P HELX_P44 44 PHE F 302 ? ARG F 304 ? PHE F 389 ARG F 391 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ? ? A CYS 51  SG ? ? ? 1_555 C CYS 48  SG  ? ? A CYS 161 C CYS 135 1_555 ? ? ? ? ? ? ? 2.007 ? ? 
disulf2  disulf ? ? A CYS 55  SG ? ? ? 1_555 B CYS 60  SG  ? ? A CYS 165 B CYS 193 1_555 ? ? ? ? ? ? ? 2.022 ? ? 
disulf3  disulf ? ? B CYS 64  SG ? ? ? 1_555 C CYS 52  SG  ? ? B CYS 197 C CYS 139 1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf4  disulf ? ? B CYS 68  SG ? ? ? 1_555 B CYS 153 SG  ? ? B CYS 201 B CYS 286 1_555 ? ? ? ? ? ? ? 2.022 ? ? 
disulf5  disulf ? ? B CYS 78  SG ? ? ? 1_555 B CYS 107 SG  ? ? B CYS 211 B CYS 240 1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf6  disulf ? ? B CYS 261 SG ? ? ? 1_555 B CYS 274 SG  ? ? B CYS 394 B CYS 407 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf7  disulf ? ? C CYS 66  SG ? ? ? 1_555 C CYS 95  SG  ? ? C CYS 153 C CYS 182 1_555 ? ? ? ? ? ? ? 2.023 ? ? 
disulf8  disulf ? ? C CYS 239 SG ? ? ? 1_555 C CYS 252 SG  ? ? C CYS 326 C CYS 339 1_555 ? ? ? ? ? ? ? 2.024 ? ? 
disulf9  disulf ? ? D CYS 51  SG ? ? ? 1_555 F CYS 48  SG  ? ? D CYS 161 F CYS 135 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf10 disulf ? ? D CYS 55  SG ? ? ? 1_555 E CYS 60  SG  ? ? D CYS 165 E CYS 193 1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf11 disulf ? ? E CYS 64  SG ? ? ? 1_555 F CYS 52  SG  ? ? E CYS 197 F CYS 139 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf12 disulf ? ? E CYS 68  SG ? ? ? 1_555 E CYS 153 SG  ? ? E CYS 201 E CYS 286 1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf13 disulf ? ? E CYS 78  SG ? ? ? 1_555 E CYS 107 SG  ? ? E CYS 211 E CYS 240 1_555 ? ? ? ? ? ? ? 2.025 ? ? 
disulf14 disulf ? ? E CYS 261 SG ? ? ? 1_555 E CYS 274 SG  ? ? E CYS 394 E CYS 407 1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf15 disulf ? ? F CYS 66  SG ? ? ? 1_555 F CYS 95  SG  ? ? F CYS 153 F CYS 182 1_555 ? ? ? ? ? ? ? 2.016 ? ? 
disulf16 disulf ? ? F CYS 239 SG ? ? ? 1_555 F CYS 252 SG  ? ? F CYS 326 F CYS 339 1_555 ? ? ? ? ? ? ? 2.013 ? ? 
metalc1  metalc ? ? J CA  .   CA ? ? ? 1_555 C ASP 231 OD1 ? ? C CA  1   C ASP 318 1_555 ? ? ? ? ? ? ? 2.554 ? ? 
metalc2  metalc ? ? J CA  .   CA ? ? ? 1_555 C ASP 233 OD1 ? ? C CA  1   C ASP 320 1_555 ? ? ? ? ? ? ? 2.534 ? ? 
metalc3  metalc ? ? J CA  .   CA ? ? ? 1_555 C PHE 235 O   ? ? C CA  1   C PHE 322 1_555 ? ? ? ? ? ? ? 2.395 ? ? 
metalc4  metalc ? ? L CA  .   CA ? ? ? 1_555 F ASP 231 OD1 ? ? F CA  1   F ASP 318 1_555 ? ? ? ? ? ? ? 2.672 ? ? 
metalc5  metalc ? ? L CA  .   CA ? ? ? 1_555 F ASP 233 OD1 ? ? F CA  1   F ASP 320 1_555 ? ? ? ? ? ? ? 2.397 ? ? 
metalc6  metalc ? ? L CA  .   CA ? ? ? 1_555 F PHE 235 O   ? ? F CA  1   F PHE 322 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc7  metalc ? ? L CA  .   CA ? ? ? 1_555 F GLY 237 N   ? ? F CA  1   F GLY 324 1_555 ? ? ? ? ? ? ? 3.362 ? ? 
metalc8  metalc ? ? L CA  .   CA ? ? ? 1_555 F ASN 238 N   ? ? F CA  1   F ASN 325 1_555 ? ? ? ? ? ? ? 3.226 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 2 ? 
D ? 6 ? 
E ? 2 ? 
F ? 5 ? 
G ? 2 ? 
H ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
H 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU B 90  ? ILE B 94  ? GLU B 223 ILE B 227 
A 2 TYR B 103 ? CYS B 107 ? TYR B 236 CYS B 240 
B 1 THR B 117 ? ARG B 122 ? THR B 250 ARG B 255 
B 2 LYS B 316 ? ILE B 321 ? LYS B 449 ILE B 454 
B 3 LEU B 177 ? GLU B 182 ? LEU B 310 GLU B 315 
B 4 LYS B 188 ? TYR B 193 ? LYS B 321 TYR B 326 
B 5 TYR B 212 ? GLY B 214 ? TYR B 345 GLY B 347 
C 1 GLY B 195 ? VAL B 198 ? GLY B 328 VAL B 331 
C 2 ILE B 207 ? ASN B 210 ? ILE B 340 ASN B 343 
D 1 GLY C 78  ? ILE C 82  ? GLY C 165 ILE C 169 
D 2 PHE C 91  ? ILE C 97  ? PHE C 178 ILE C 184 
D 3 GLY C 103 ? ARG C 110 ? GLY C 190 ARG C 197 
D 4 LYS C 294 ? PRO C 301 ? LYS C 381 PRO C 388 
D 5 TYR C 157 ? GLU C 164 ? TYR C 244 GLU C 251 
D 6 THR C 170 ? ALA C 176 ? THR C 257 ALA C 263 
E 1 GLU E 90  ? ILE E 94  ? GLU E 223 ILE E 227 
E 2 TYR E 103 ? CYS E 107 ? TYR E 236 CYS E 240 
F 1 THR E 117 ? ARG E 122 ? THR E 250 ARG E 255 
F 2 LYS E 316 ? ILE E 321 ? LYS E 449 ILE E 454 
F 3 LEU E 177 ? GLU E 182 ? LEU E 310 GLU E 315 
F 4 LYS E 188 ? TYR E 193 ? LYS E 321 TYR E 326 
F 5 TYR E 212 ? GLY E 214 ? TYR E 345 GLY E 347 
G 1 GLY E 195 ? VAL E 198 ? GLY E 328 VAL E 331 
G 2 ILE E 207 ? ASN E 210 ? ILE E 340 ASN E 343 
H 1 GLY F 78  ? ILE F 82  ? GLY F 165 ILE F 169 
H 2 PHE F 91  ? ILE F 97  ? PHE F 178 ILE F 184 
H 3 GLY F 103 ? ARG F 110 ? GLY F 190 ARG F 197 
H 4 LYS F 294 ? PRO F 301 ? LYS F 381 PRO F 388 
H 5 TYR F 157 ? GLU F 164 ? TYR F 244 GLU F 251 
H 6 THR F 170 ? TYR F 175 ? THR F 257 TYR F 262 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU B 90  ? O GLU B 223 N CYS B 107 ? N CYS B 240 
B 1 2 O THR B 117 ? O THR B 250 N ILE B 321 ? N ILE B 454 
B 2 3 O LYS B 316 ? O LYS B 449 N GLU B 182 ? N GLU B 315 
B 3 4 O LEU B 177 ? O LEU B 310 N TYR B 193 ? N TYR B 326 
B 4 5 O HIS B 192 ? O HIS B 325 N ARG B 213 ? N ARG B 346 
C 1 2 O GLY B 195 ? O GLY B 328 N ASN B 210 ? N ASN B 343 
D 1 2 O GLY C 78  ? O GLY C 165 N CYS C 95  ? N CYS C 182 
D 2 3 O TYR C 94  ? O TYR C 181 N VAL C 106 ? N VAL C 193 
D 3 4 O THR C 105 ? O THR C 192 N ILE C 299 ? N ILE C 386 
D 4 5 O LYS C 294 ? O LYS C 381 N GLU C 164 ? N GLU C 251 
D 5 6 O LEU C 159 ? O LEU C 246 N TYR C 175 ? N TYR C 262 
E 1 2 O GLU E 90  ? O GLU E 223 N CYS E 107 ? N CYS E 240 
F 1 2 O THR E 117 ? O THR E 250 N ILE E 321 ? N ILE E 454 
F 2 3 O LYS E 316 ? O LYS E 449 N GLU E 182 ? N GLU E 315 
F 3 4 O LEU E 177 ? O LEU E 310 N TYR E 193 ? N TYR E 326 
F 4 5 O HIS E 192 ? O HIS E 325 N ARG E 213 ? N ARG E 346 
G 1 2 O GLY E 195 ? O GLY E 328 N ASN E 210 ? N ASN E 343 
H 1 2 O GLY F 78  ? O GLY F 165 N CYS F 95  ? N CYS F 182 
H 2 3 O TYR F 94  ? O TYR F 181 N VAL F 106 ? N VAL F 193 
H 3 4 O THR F 105 ? O THR F 192 N ILE F 299 ? N ILE F 386 
H 4 5 O LYS F 294 ? O LYS F 381 N GLU F 164 ? N GLU F 251 
H 5 6 O LEU F 159 ? O LEU F 246 N TYR F 175 ? N TYR F 262 
# 
_database_PDB_matrix.entry_id          1FZB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1FZB 
_atom_sites.fract_transf_matrix[1][1]   0.010659 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001135 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010471 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008840 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . GLU A 1 3   ? -1.290  -12.054 0.233   1.00 120.17 ? 113 GLU A N   1 
ATOM   2     C  CA  . GLU A 1 3   ? -0.463  -11.277 1.201   1.00 119.90 ? 113 GLU A CA  1 
ATOM   3     C  C   . GLU A 1 3   ? 0.359   -12.190 2.110   1.00 123.72 ? 113 GLU A C   1 
ATOM   4     O  O   . GLU A 1 3   ? 0.856   -11.752 3.150   1.00 125.65 ? 113 GLU A O   1 
ATOM   5     C  CB  . GLU A 1 3   ? -1.354  -10.359 2.051   1.00 119.35 ? 113 GLU A CB  1 
ATOM   6     C  CG  . GLU A 1 3   ? -1.881  -9.103  1.337   1.00 118.05 ? 113 GLU A CG  1 
ATOM   7     C  CD  . GLU A 1 3   ? -2.942  -9.394  0.281   1.00 116.25 ? 113 GLU A CD  1 
ATOM   8     O  OE1 . GLU A 1 3   ? -4.086  -9.733  0.657   1.00 115.36 ? 113 GLU A OE1 1 
ATOM   9     O  OE2 . GLU A 1 3   ? -2.636  -9.262  -0.924  1.00 114.76 ? 113 GLU A OE2 1 
ATOM   10    N  N   . ASP A 1 4   ? 0.501   -13.455 1.712   1.00 126.97 ? 114 ASP A N   1 
ATOM   11    C  CA  . ASP A 1 4   ? 1.261   -14.434 2.493   1.00 129.89 ? 114 ASP A CA  1 
ATOM   12    C  C   . ASP A 1 4   ? 2.387   -15.098 1.681   1.00 131.10 ? 114 ASP A C   1 
ATOM   13    O  O   . ASP A 1 4   ? 2.580   -16.318 1.752   1.00 130.59 ? 114 ASP A O   1 
ATOM   14    C  CB  . ASP A 1 4   ? 0.320   -15.500 3.082   1.00 130.74 ? 114 ASP A CB  1 
ATOM   15    C  CG  . ASP A 1 4   ? 0.798   -16.029 4.435   1.00 132.05 ? 114 ASP A CG  1 
ATOM   16    O  OD1 . ASP A 1 4   ? 0.413   -15.446 5.474   1.00 131.75 ? 114 ASP A OD1 1 
ATOM   17    O  OD2 . ASP A 1 4   ? 1.547   -17.029 4.462   1.00 133.62 ? 114 ASP A OD2 1 
ATOM   18    N  N   . LEU A 1 5   ? 3.100   -14.294 0.888   1.00 132.47 ? 115 LEU A N   1 
ATOM   19    C  CA  . LEU A 1 5   ? 4.229   -14.781 0.080   1.00 132.19 ? 115 LEU A CA  1 
ATOM   20    C  C   . LEU A 1 5   ? 5.542   -14.339 0.753   1.00 133.07 ? 115 LEU A C   1 
ATOM   21    O  O   . LEU A 1 5   ? 6.048   -15.022 1.655   1.00 134.70 ? 115 LEU A O   1 
ATOM   22    C  CB  . LEU A 1 5   ? 4.156   -14.260 -1.373  1.00 130.36 ? 115 LEU A CB  1 
ATOM   23    C  CG  . LEU A 1 5   ? 3.193   -14.926 -2.368  1.00 127.89 ? 115 LEU A CG  1 
ATOM   24    C  CD1 . LEU A 1 5   ? 1.782   -14.384 -2.187  1.00 126.39 ? 115 LEU A CD1 1 
ATOM   25    C  CD2 . LEU A 1 5   ? 3.667   -14.687 -3.791  1.00 125.37 ? 115 LEU A CD2 1 
ATOM   26    N  N   . ARG A 1 6   ? 6.091   -13.211 0.296   1.00 131.26 ? 116 ARG A N   1 
ATOM   27    C  CA  . ARG A 1 6   ? 7.318   -12.637 0.860   1.00 126.05 ? 116 ARG A CA  1 
ATOM   28    C  C   . ARG A 1 6   ? 6.939   -11.394 1.671   1.00 124.03 ? 116 ARG A C   1 
ATOM   29    O  O   . ARG A 1 6   ? 7.790   -10.579 2.035   1.00 123.13 ? 116 ARG A O   1 
ATOM   30    C  CB  . ARG A 1 6   ? 8.323   -12.277 -0.246  1.00 123.14 ? 116 ARG A CB  1 
ATOM   31    C  CG  . ARG A 1 6   ? 9.105   -13.463 -0.811  1.00 119.74 ? 116 ARG A CG  1 
ATOM   32    C  CD  . ARG A 1 6   ? 9.986   -14.121 0.248   1.00 115.57 ? 116 ARG A CD  1 
ATOM   33    N  NE  . ARG A 1 6   ? 10.811  -15.186 -0.315  1.00 111.51 ? 116 ARG A NE  1 
ATOM   34    C  CZ  . ARG A 1 6   ? 11.481  -16.080 0.404   1.00 110.11 ? 116 ARG A CZ  1 
ATOM   35    N  NH1 . ARG A 1 6   ? 11.430  -16.048 1.729   1.00 107.66 ? 116 ARG A NH1 1 
ATOM   36    N  NH2 . ARG A 1 6   ? 12.205  -17.009 -0.205  1.00 112.39 ? 116 ARG A NH2 1 
ATOM   37    N  N   . SER A 1 7   ? 5.640   -11.263 1.932   1.00 122.16 ? 117 SER A N   1 
ATOM   38    C  CA  . SER A 1 7   ? 5.090   -10.156 2.706   1.00 120.04 ? 117 SER A CA  1 
ATOM   39    C  C   . SER A 1 7   ? 5.407   -10.397 4.191   1.00 118.84 ? 117 SER A C   1 
ATOM   40    O  O   . SER A 1 7   ? 5.272   -9.498  5.029   1.00 117.15 ? 117 SER A O   1 
ATOM   41    C  CB  . SER A 1 7   ? 3.571   -10.078 2.492   1.00 118.72 ? 117 SER A CB  1 
ATOM   42    O  OG  . SER A 1 7   ? 3.233   -10.093 1.111   1.00 115.95 ? 117 SER A OG  1 
ATOM   43    N  N   . ARG A 1 8   ? 5.832   -11.624 4.495   1.00 117.24 ? 118 ARG A N   1 
ATOM   44    C  CA  . ARG A 1 8   ? 6.184   -12.025 5.850   1.00 113.67 ? 118 ARG A CA  1 
ATOM   45    C  C   . ARG A 1 8   ? 7.678   -11.960 6.131   1.00 109.84 ? 118 ARG A C   1 
ATOM   46    O  O   . ARG A 1 8   ? 8.163   -12.588 7.071   1.00 109.63 ? 118 ARG A O   1 
ATOM   47    C  CB  . ARG A 1 8   ? 5.652   -13.427 6.160   1.00 115.21 ? 118 ARG A CB  1 
ATOM   48    C  CG  . ARG A 1 8   ? 4.171   -13.466 6.468   1.00 115.41 ? 118 ARG A CG  1 
ATOM   49    C  CD  . ARG A 1 8   ? 3.762   -14.839 6.936   1.00 117.60 ? 118 ARG A CD  1 
ATOM   50    N  NE  . ARG A 1 8   ? 2.367   -14.865 7.361   1.00 120.13 ? 118 ARG A NE  1 
ATOM   51    C  CZ  . ARG A 1 8   ? 1.937   -14.490 8.564   1.00 120.39 ? 118 ARG A CZ  1 
ATOM   52    N  NH1 . ARG A 1 8   ? 2.798   -14.052 9.477   1.00 120.06 ? 118 ARG A NH1 1 
ATOM   53    N  NH2 . ARG A 1 8   ? 0.645   -14.572 8.860   1.00 120.70 ? 118 ARG A NH2 1 
ATOM   54    N  N   . ILE A 1 9   ? 8.414   -11.234 5.295   1.00 107.56 ? 119 ILE A N   1 
ATOM   55    C  CA  . ILE A 1 9   ? 9.844   -11.076 5.511   1.00 105.72 ? 119 ILE A CA  1 
ATOM   56    C  C   . ILE A 1 9   ? 9.995   -10.218 6.766   1.00 106.20 ? 119 ILE A C   1 
ATOM   57    O  O   . ILE A 1 9   ? 10.751  -10.567 7.675   1.00 105.49 ? 119 ILE A O   1 
ATOM   58    C  CB  . ILE A 1 9   ? 10.537  -10.383 4.322   1.00 104.12 ? 119 ILE A CB  1 
ATOM   59    C  CG1 . ILE A 1 9   ? 10.469  -11.279 3.087   1.00 104.13 ? 119 ILE A CG1 1 
ATOM   60    C  CG2 . ILE A 1 9   ? 11.994  -10.085 4.656   1.00 102.40 ? 119 ILE A CG2 1 
ATOM   61    C  CD1 . ILE A 1 9   ? 11.043  -10.636 1.834   1.00 103.79 ? 119 ILE A CD1 1 
ATOM   62    N  N   . GLU A 1 10  ? 9.247   -9.113  6.818   1.00 107.12 ? 120 GLU A N   1 
ATOM   63    C  CA  . GLU A 1 10  ? 9.271   -8.211  7.972   1.00 110.73 ? 120 GLU A CA  1 
ATOM   64    C  C   . GLU A 1 10  ? 8.525   -8.812  9.171   1.00 109.45 ? 120 GLU A C   1 
ATOM   65    O  O   . GLU A 1 10  ? 8.799   -8.450  10.320  1.00 106.18 ? 120 GLU A O   1 
ATOM   66    C  CB  . GLU A 1 10  ? 8.697   -6.832  7.620   1.00 114.95 ? 120 GLU A CB  1 
ATOM   67    C  CG  . GLU A 1 10  ? 9.605   -5.975  6.745   1.00 118.91 ? 120 GLU A CG  1 
ATOM   68    C  CD  . GLU A 1 10  ? 9.118   -4.538  6.619   1.00 121.29 ? 120 GLU A CD  1 
ATOM   69    O  OE1 . GLU A 1 10  ? 8.128   -4.296  5.897   1.00 123.39 ? 120 GLU A OE1 1 
ATOM   70    O  OE2 . GLU A 1 10  ? 9.733   -3.646  7.242   1.00 122.04 ? 120 GLU A OE2 1 
ATOM   71    N  N   . VAL A 1 11  ? 7.576   -9.715  8.897   1.00 109.82 ? 121 VAL A N   1 
ATOM   72    C  CA  . VAL A 1 11  ? 6.820   -10.407 9.952   1.00 109.29 ? 121 VAL A CA  1 
ATOM   73    C  C   . VAL A 1 11  ? 7.768   -11.523 10.397  1.00 104.17 ? 121 VAL A C   1 
ATOM   74    O  O   . VAL A 1 11  ? 7.418   -12.707 10.452  1.00 102.68 ? 121 VAL A O   1 
ATOM   75    C  CB  . VAL A 1 11  ? 5.482   -11.018 9.421   1.00 111.89 ? 121 VAL A CB  1 
ATOM   76    C  CG1 . VAL A 1 11  ? 4.659   -11.591 10.577  1.00 113.34 ? 121 VAL A CG1 1 
ATOM   77    C  CG2 . VAL A 1 11  ? 4.667   -9.963  8.675   1.00 113.60 ? 121 VAL A CG2 1 
ATOM   78    N  N   . LEU A 1 12  ? 8.990   -11.098 10.697  1.00 100.67 ? 122 LEU A N   1 
ATOM   79    C  CA  . LEU A 1 12  ? 10.076  -11.962 11.100  1.00 96.95  ? 122 LEU A CA  1 
ATOM   80    C  C   . LEU A 1 12  ? 11.224  -11.062 11.551  1.00 96.99  ? 122 LEU A C   1 
ATOM   81    O  O   . LEU A 1 12  ? 11.975  -11.424 12.455  1.00 97.77  ? 122 LEU A O   1 
ATOM   82    C  CB  . LEU A 1 12  ? 10.490  -12.821 9.899   1.00 92.27  ? 122 LEU A CB  1 
ATOM   83    C  CG  . LEU A 1 12  ? 11.731  -13.715 9.863   1.00 89.98  ? 122 LEU A CG  1 
ATOM   84    C  CD1 . LEU A 1 12  ? 12.954  -12.922 9.412   1.00 88.88  ? 122 LEU A CD1 1 
ATOM   85    C  CD2 . LEU A 1 12  ? 11.937  -14.406 11.210  1.00 89.29  ? 122 LEU A CD2 1 
ATOM   86    N  N   . LYS A 1 13  ? 11.325  -9.872  10.954  1.00 93.47  ? 123 LYS A N   1 
ATOM   87    C  CA  . LYS A 1 13  ? 12.389  -8.928  11.291  1.00 92.07  ? 123 LYS A CA  1 
ATOM   88    C  C   . LYS A 1 13  ? 12.309  -8.268  12.664  1.00 93.94  ? 123 LYS A C   1 
ATOM   89    O  O   . LYS A 1 13  ? 13.302  -8.265  13.390  1.00 93.27  ? 123 LYS A O   1 
ATOM   90    C  CB  . LYS A 1 13  ? 12.564  -7.877  10.198  1.00 92.69  ? 123 LYS A CB  1 
ATOM   91    C  CG  . LYS A 1 13  ? 13.172  -8.445  8.925   1.00 95.29  ? 123 LYS A CG  1 
ATOM   92    C  CD  . LYS A 1 13  ? 14.486  -9.177  9.211   1.00 94.70  ? 123 LYS A CD  1 
ATOM   93    C  CE  . LYS A 1 13  ? 15.001  -9.915  7.982   1.00 93.26  ? 123 LYS A CE  1 
ATOM   94    N  NZ  . LYS A 1 13  ? 16.246  -10.693 8.244   1.00 91.00  ? 123 LYS A NZ  1 
ATOM   95    N  N   . ARG A 1 14  ? 11.155  -7.704  13.028  1.00 96.81  ? 124 ARG A N   1 
ATOM   96    C  CA  . ARG A 1 14  ? 11.009  -7.077  14.350  1.00 99.22  ? 124 ARG A CA  1 
ATOM   97    C  C   . ARG A 1 14  ? 11.358  -8.116  15.420  1.00 98.39  ? 124 ARG A C   1 
ATOM   98    O  O   . ARG A 1 14  ? 11.821  -7.767  16.508  1.00 96.84  ? 124 ARG A O   1 
ATOM   99    C  CB  . ARG A 1 14  ? 9.585   -6.537  14.558  1.00 102.37 ? 124 ARG A CB  1 
ATOM   100   C  CG  . ARG A 1 14  ? 9.210   -6.157  16.006  1.00 108.16 ? 124 ARG A CG  1 
ATOM   101   C  CD  . ARG A 1 14  ? 9.977   -4.949  16.569  1.00 112.82 ? 124 ARG A CD  1 
ATOM   102   N  NE  . ARG A 1 14  ? 9.485   -4.566  17.903  1.00 115.66 ? 124 ARG A NE  1 
ATOM   103   C  CZ  . ARG A 1 14  ? 9.936   -3.539  18.632  1.00 116.96 ? 124 ARG A CZ  1 
ATOM   104   N  NH1 . ARG A 1 14  ? 10.911  -2.760  18.178  1.00 116.61 ? 124 ARG A NH1 1 
ATOM   105   N  NH2 . ARG A 1 14  ? 9.403   -3.283  19.825  1.00 117.32 ? 124 ARG A NH2 1 
ATOM   106   N  N   . LYS A 1 15  ? 11.166  -9.391  15.075  1.00 97.12  ? 125 LYS A N   1 
ATOM   107   C  CA  . LYS A 1 15  ? 11.475  -10.504 15.968  1.00 95.66  ? 125 LYS A CA  1 
ATOM   108   C  C   . LYS A 1 15  ? 12.992  -10.556 16.174  1.00 91.57  ? 125 LYS A C   1 
ATOM   109   O  O   . LYS A 1 15  ? 13.469  -10.439 17.306  1.00 90.55  ? 125 LYS A O   1 
ATOM   110   C  CB  . LYS A 1 15  ? 10.977  -11.822 15.367  1.00 96.12  ? 125 LYS A CB  1 
ATOM   111   C  CG  . LYS A 1 15  ? 9.481   -11.857 15.077  1.00 98.15  ? 125 LYS A CG  1 
ATOM   112   C  CD  . LYS A 1 15  ? 9.081   -13.175 14.405  1.00 97.83  ? 125 LYS A CD  1 
ATOM   113   C  CE  . LYS A 1 15  ? 7.578   -13.272 14.158  1.00 97.15  ? 125 LYS A CE  1 
ATOM   114   N  NZ  . LYS A 1 15  ? 7.078   -12.198 13.258  1.00 93.98  ? 125 LYS A NZ  1 
ATOM   115   N  N   . VAL A 1 16  ? 13.739  -10.685 15.073  1.00 87.15  ? 126 VAL A N   1 
ATOM   116   C  CA  . VAL A 1 16  ? 15.207  -10.731 15.109  1.00 86.49  ? 126 VAL A CA  1 
ATOM   117   C  C   . VAL A 1 16  ? 15.726  -9.472  15.793  1.00 85.14  ? 126 VAL A C   1 
ATOM   118   O  O   . VAL A 1 16  ? 16.784  -9.489  16.431  1.00 84.34  ? 126 VAL A O   1 
ATOM   119   C  CB  . VAL A 1 16  ? 15.831  -10.828 13.676  1.00 87.42  ? 126 VAL A CB  1 
ATOM   120   C  CG1 . VAL A 1 16  ? 17.362  -10.738 13.736  1.00 87.76  ? 126 VAL A CG1 1 
ATOM   121   C  CG2 . VAL A 1 16  ? 15.425  -12.132 13.009  1.00 86.12  ? 126 VAL A CG2 1 
ATOM   122   N  N   . ILE A 1 17  ? 14.968  -8.386  15.657  1.00 86.63  ? 127 ILE A N   1 
ATOM   123   C  CA  . ILE A 1 17  ? 15.328  -7.124  16.281  1.00 91.32  ? 127 ILE A CA  1 
ATOM   124   C  C   . ILE A 1 17  ? 15.052  -7.206  17.782  1.00 94.44  ? 127 ILE A C   1 
ATOM   125   O  O   . ILE A 1 17  ? 15.982  -7.101  18.573  1.00 97.54  ? 127 ILE A O   1 
ATOM   126   C  CB  . ILE A 1 17  ? 14.589  -5.922  15.641  1.00 91.38  ? 127 ILE A CB  1 
ATOM   127   C  CG1 . ILE A 1 17  ? 15.086  -5.697  14.206  1.00 92.27  ? 127 ILE A CG1 1 
ATOM   128   C  CG2 . ILE A 1 17  ? 14.803  -4.663  16.467  1.00 91.83  ? 127 ILE A CG2 1 
ATOM   129   C  CD1 . ILE A 1 17  ? 16.600  -5.476  14.080  1.00 91.92  ? 127 ILE A CD1 1 
ATOM   130   N  N   . GLU A 1 18  ? 13.800  -7.454  18.169  1.00 93.84  ? 128 GLU A N   1 
ATOM   131   C  CA  . GLU A 1 18  ? 13.443  -7.573  19.586  1.00 92.12  ? 128 GLU A CA  1 
ATOM   132   C  C   . GLU A 1 18  ? 14.397  -8.510  20.329  1.00 87.91  ? 128 GLU A C   1 
ATOM   133   O  O   . GLU A 1 18  ? 14.704  -8.288  21.505  1.00 87.34  ? 128 GLU A O   1 
ATOM   134   C  CB  . GLU A 1 18  ? 12.011  -8.093  19.747  1.00 95.78  ? 128 GLU A CB  1 
ATOM   135   C  CG  . GLU A 1 18  ? 10.915  -7.052  19.557  1.00 99.17  ? 128 GLU A CG  1 
ATOM   136   C  CD  . GLU A 1 18  ? 10.662  -6.190  20.799  1.00 99.90  ? 128 GLU A CD  1 
ATOM   137   O  OE1 . GLU A 1 18  ? 11.609  -5.541  21.297  1.00 98.27  ? 128 GLU A OE1 1 
ATOM   138   O  OE2 . GLU A 1 18  ? 9.501   -6.140  21.267  1.00 101.00 ? 128 GLU A OE2 1 
ATOM   139   N  N   . LYS A 1 19  ? 14.884  -9.534  19.625  1.00 84.83  ? 129 LYS A N   1 
ATOM   140   C  CA  . LYS A 1 19  ? 15.803  -10.519 20.200  1.00 83.62  ? 129 LYS A CA  1 
ATOM   141   C  C   . LYS A 1 19  ? 17.273  -10.071 20.264  1.00 78.27  ? 129 LYS A C   1 
ATOM   142   O  O   . LYS A 1 19  ? 17.928  -10.253 21.294  1.00 75.62  ? 129 LYS A O   1 
ATOM   143   C  CB  . LYS A 1 19  ? 15.710  -11.860 19.453  1.00 87.76  ? 129 LYS A CB  1 
ATOM   144   C  CG  . LYS A 1 19  ? 14.317  -12.480 19.319  1.00 91.01  ? 129 LYS A CG  1 
ATOM   145   C  CD  . LYS A 1 19  ? 13.629  -12.725 20.649  1.00 97.02  ? 129 LYS A CD  1 
ATOM   146   C  CE  . LYS A 1 19  ? 12.745  -11.549 21.041  1.00 101.80 ? 129 LYS A CE  1 
ATOM   147   N  NZ  . LYS A 1 19  ? 11.751  -11.200 19.980  1.00 103.59 ? 129 LYS A NZ  1 
ATOM   148   N  N   . VAL A 1 20  ? 17.806  -9.526  19.168  1.00 77.78  ? 130 VAL A N   1 
ATOM   149   C  CA  . VAL A 1 20  ? 19.202  -9.083  19.166  1.00 81.61  ? 130 VAL A CA  1 
ATOM   150   C  C   . VAL A 1 20  ? 19.419  -8.008  20.230  1.00 85.44  ? 130 VAL A C   1 
ATOM   151   O  O   . VAL A 1 20  ? 20.516  -7.885  20.787  1.00 84.21  ? 130 VAL A O   1 
ATOM   152   C  CB  . VAL A 1 20  ? 19.677  -8.577  17.761  1.00 81.18  ? 130 VAL A CB  1 
ATOM   153   C  CG1 . VAL A 1 20  ? 18.876  -7.386  17.308  1.00 79.96  ? 130 VAL A CG1 1 
ATOM   154   C  CG2 . VAL A 1 20  ? 21.163  -8.224  17.794  1.00 81.29  ? 130 VAL A CG2 1 
ATOM   155   N  N   . GLN A 1 21  ? 18.348  -7.278  20.544  1.00 91.77  ? 131 GLN A N   1 
ATOM   156   C  CA  . GLN A 1 21  ? 18.384  -6.217  21.552  1.00 96.42  ? 131 GLN A CA  1 
ATOM   157   C  C   . GLN A 1 21  ? 18.485  -6.841  22.945  1.00 96.56  ? 131 GLN A C   1 
ATOM   158   O  O   . GLN A 1 21  ? 19.166  -6.313  23.822  1.00 98.24  ? 131 GLN A O   1 
ATOM   159   C  CB  . GLN A 1 21  ? 17.140  -5.313  21.464  1.00 100.87 ? 131 GLN A CB  1 
ATOM   160   C  CG  . GLN A 1 21  ? 16.781  -4.788  20.057  1.00 104.97 ? 131 GLN A CG  1 
ATOM   161   C  CD  . GLN A 1 21  ? 17.926  -4.079  19.330  1.00 107.00 ? 131 GLN A CD  1 
ATOM   162   O  OE1 . GLN A 1 21  ? 18.835  -4.723  18.790  1.00 107.61 ? 131 GLN A OE1 1 
ATOM   163   N  NE2 . GLN A 1 21  ? 17.859  -2.748  19.274  1.00 106.40 ? 131 GLN A NE2 1 
ATOM   164   N  N   . HIS A 1 22  ? 17.793  -7.958  23.149  1.00 93.39  ? 132 HIS A N   1 
ATOM   165   C  CA  . HIS A 1 22  ? 17.849  -8.659  24.424  1.00 88.54  ? 132 HIS A CA  1 
ATOM   166   C  C   . HIS A 1 22  ? 19.279  -9.140  24.627  1.00 80.85  ? 132 HIS A C   1 
ATOM   167   O  O   . HIS A 1 22  ? 19.783  -9.184  25.747  1.00 79.45  ? 132 HIS A O   1 
ATOM   168   C  CB  . HIS A 1 22  ? 16.895  -9.855  24.427  1.00 93.63  ? 132 HIS A CB  1 
ATOM   169   C  CG  . HIS A 1 22  ? 15.468  -9.488  24.697  1.00 97.98  ? 132 HIS A CG  1 
ATOM   170   N  ND1 . HIS A 1 22  ? 14.415  -9.999  23.970  1.00 99.51  ? 132 HIS A ND1 1 
ATOM   171   C  CD2 . HIS A 1 22  ? 14.920  -8.669  25.626  1.00 100.67 ? 132 HIS A CD2 1 
ATOM   172   C  CE1 . HIS A 1 22  ? 13.279  -9.511  24.439  1.00 100.77 ? 132 HIS A CE1 1 
ATOM   173   N  NE2 . HIS A 1 22  ? 13.558  -8.701  25.445  1.00 101.50 ? 132 HIS A NE2 1 
ATOM   174   N  N   . ILE A 1 23  ? 19.927  -9.495  23.526  1.00 74.85  ? 133 ILE A N   1 
ATOM   175   C  CA  . ILE A 1 23  ? 21.297  -9.954  23.571  1.00 70.10  ? 133 ILE A CA  1 
ATOM   176   C  C   . ILE A 1 23  ? 22.142  -8.757  23.950  1.00 69.71  ? 133 ILE A C   1 
ATOM   177   O  O   . ILE A 1 23  ? 22.962  -8.827  24.867  1.00 67.62  ? 133 ILE A O   1 
ATOM   178   C  CB  . ILE A 1 23  ? 21.728  -10.511 22.207  1.00 68.53  ? 133 ILE A CB  1 
ATOM   179   C  CG1 . ILE A 1 23  ? 20.774  -11.633 21.805  1.00 67.86  ? 133 ILE A CG1 1 
ATOM   180   C  CG2 . ILE A 1 23  ? 23.165  -11.011 22.255  1.00 65.97  ? 133 ILE A CG2 1 
ATOM   181   C  CD1 . ILE A 1 23  ? 20.483  -12.604 22.932  1.00 71.49  ? 133 ILE A CD1 1 
ATOM   182   N  N   . GLN A 1 24  ? 21.886  -7.635  23.288  1.00 74.03  ? 134 GLN A N   1 
ATOM   183   C  CA  . GLN A 1 24  ? 22.623  -6.406  23.567  1.00 77.81  ? 134 GLN A CA  1 
ATOM   184   C  C   . GLN A 1 24  ? 22.479  -5.977  25.029  1.00 76.22  ? 134 GLN A C   1 
ATOM   185   O  O   . GLN A 1 24  ? 23.398  -5.396  25.609  1.00 76.43  ? 134 GLN A O   1 
ATOM   186   C  CB  . GLN A 1 24  ? 22.179  -5.274  22.632  1.00 80.68  ? 134 GLN A CB  1 
ATOM   187   C  CG  . GLN A 1 24  ? 22.533  -5.503  21.159  1.00 82.07  ? 134 GLN A CG  1 
ATOM   188   C  CD  . GLN A 1 24  ? 22.368  -4.248  20.309  1.00 83.67  ? 134 GLN A CD  1 
ATOM   189   O  OE1 . GLN A 1 24  ? 21.628  -3.328  20.680  1.00 82.34  ? 134 GLN A OE1 1 
ATOM   190   N  NE2 . GLN A 1 24  ? 23.070  -4.198  19.166  1.00 85.41  ? 134 GLN A NE2 1 
ATOM   191   N  N   . LEU A 1 25  ? 21.329  -6.283  25.623  1.00 74.83  ? 135 LEU A N   1 
ATOM   192   C  CA  . LEU A 1 25  ? 21.072  -5.944  27.014  1.00 71.51  ? 135 LEU A CA  1 
ATOM   193   C  C   . LEU A 1 25  ? 21.913  -6.868  27.883  1.00 67.53  ? 135 LEU A C   1 
ATOM   194   O  O   . LEU A 1 25  ? 22.505  -6.430  28.862  1.00 66.96  ? 135 LEU A O   1 
ATOM   195   C  CB  . LEU A 1 25  ? 19.591  -6.147  27.346  1.00 76.94  ? 135 LEU A CB  1 
ATOM   196   C  CG  . LEU A 1 25  ? 18.823  -5.225  28.312  1.00 79.76  ? 135 LEU A CG  1 
ATOM   197   C  CD1 . LEU A 1 25  ? 19.517  -5.099  29.661  1.00 79.36  ? 135 LEU A CD1 1 
ATOM   198   C  CD2 . LEU A 1 25  ? 18.630  -3.855  27.676  1.00 81.65  ? 135 LEU A CD2 1 
ATOM   199   N  N   . LEU A 1 26  ? 21.978  -8.142  27.501  1.00 68.01  ? 136 LEU A N   1 
ATOM   200   C  CA  . LEU A 1 26  ? 22.738  -9.138  28.255  1.00 68.60  ? 136 LEU A CA  1 
ATOM   201   C  C   . LEU A 1 26  ? 24.233  -8.882  28.325  1.00 68.33  ? 136 LEU A C   1 
ATOM   202   O  O   . LEU A 1 26  ? 24.809  -8.861  29.413  1.00 67.08  ? 136 LEU A O   1 
ATOM   203   C  CB  . LEU A 1 26  ? 22.495  -10.549 27.717  1.00 66.86  ? 136 LEU A CB  1 
ATOM   204   C  CG  . LEU A 1 26  ? 21.189  -11.231 28.117  1.00 65.12  ? 136 LEU A CG  1 
ATOM   205   C  CD1 . LEU A 1 26  ? 21.307  -12.713 27.815  1.00 66.83  ? 136 LEU A CD1 1 
ATOM   206   C  CD2 . LEU A 1 26  ? 20.919  -11.029 29.596  1.00 63.57  ? 136 LEU A CD2 1 
ATOM   207   N  N   . GLN A 1 27  ? 24.861  -8.701  27.171  1.00 66.54  ? 137 GLN A N   1 
ATOM   208   C  CA  . GLN A 1 27  ? 26.291  -8.462  27.138  1.00 69.97  ? 137 GLN A CA  1 
ATOM   209   C  C   . GLN A 1 27  ? 26.738  -7.327  28.079  1.00 69.02  ? 137 GLN A C   1 
ATOM   210   O  O   . GLN A 1 27  ? 27.860  -7.345  28.607  1.00 65.34  ? 137 GLN A O   1 
ATOM   211   C  CB  . GLN A 1 27  ? 26.725  -8.211  25.705  1.00 75.25  ? 137 GLN A CB  1 
ATOM   212   C  CG  . GLN A 1 27  ? 25.854  -7.221  24.992  1.00 78.97  ? 137 GLN A CG  1 
ATOM   213   C  CD  . GLN A 1 27  ? 25.911  -7.394  23.500  1.00 82.46  ? 137 GLN A CD  1 
ATOM   214   O  OE1 . GLN A 1 27  ? 26.056  -6.423  22.754  1.00 84.88  ? 137 GLN A OE1 1 
ATOM   215   N  NE2 . GLN A 1 27  ? 25.783  -8.638  23.046  1.00 85.27  ? 137 GLN A NE2 1 
ATOM   216   N  N   . LYS A 1 28  ? 25.847  -6.370  28.328  1.00 70.92  ? 138 LYS A N   1 
ATOM   217   C  CA  . LYS A 1 28  ? 26.171  -5.265  29.218  1.00 74.32  ? 138 LYS A CA  1 
ATOM   218   C  C   . LYS A 1 28  ? 25.843  -5.623  30.662  1.00 74.40  ? 138 LYS A C   1 
ATOM   219   O  O   . LYS A 1 28  ? 26.352  -4.997  31.587  1.00 79.28  ? 138 LYS A O   1 
ATOM   220   C  CB  . LYS A 1 28  ? 25.461  -3.972  28.791  1.00 77.90  ? 138 LYS A CB  1 
ATOM   221   C  CG  . LYS A 1 28  ? 23.962  -3.941  29.004  1.00 85.32  ? 138 LYS A CG  1 
ATOM   222   C  CD  . LYS A 1 28  ? 23.335  -2.811  28.206  1.00 90.75  ? 138 LYS A CD  1 
ATOM   223   C  CE  . LYS A 1 28  ? 21.828  -2.790  28.363  1.00 93.89  ? 138 LYS A CE  1 
ATOM   224   N  NZ  . LYS A 1 28  ? 21.162  -1.882  27.381  1.00 95.08  ? 138 LYS A NZ  1 
ATOM   225   N  N   . ASN A 1 29  ? 24.983  -6.618  30.857  1.00 69.47  ? 139 ASN A N   1 
ATOM   226   C  CA  . ASN A 1 29  ? 24.621  -7.054  32.203  1.00 66.35  ? 139 ASN A CA  1 
ATOM   227   C  C   . ASN A 1 29  ? 25.664  -8.026  32.748  1.00 62.75  ? 139 ASN A C   1 
ATOM   228   O  O   . ASN A 1 29  ? 25.874  -8.107  33.956  1.00 66.92  ? 139 ASN A O   1 
ATOM   229   C  CB  . ASN A 1 29  ? 23.227  -7.685  32.230  1.00 67.71  ? 139 ASN A CB  1 
ATOM   230   C  CG  . ASN A 1 29  ? 22.131  -6.673  32.521  1.00 69.12  ? 139 ASN A CG  1 
ATOM   231   O  OD1 . ASN A 1 29  ? 22.390  -5.475  32.672  1.00 68.09  ? 139 ASN A OD1 1 
ATOM   232   N  ND2 . ASN A 1 29  ? 20.895  -7.155  32.613  1.00 71.10  ? 139 ASN A ND2 1 
ATOM   233   N  N   . VAL A 1 30  ? 26.302  -8.780  31.862  1.00 55.19  ? 140 VAL A N   1 
ATOM   234   C  CA  . VAL A 1 30  ? 27.341  -9.699  32.292  1.00 48.42  ? 140 VAL A CA  1 
ATOM   235   C  C   . VAL A 1 30  ? 28.635  -8.913  32.306  1.00 49.57  ? 140 VAL A C   1 
ATOM   236   O  O   . VAL A 1 30  ? 29.547  -9.218  33.070  1.00 54.96  ? 140 VAL A O   1 
ATOM   237   C  CB  . VAL A 1 30  ? 27.483  -10.901 31.360  1.00 52.41  ? 140 VAL A CB  1 
ATOM   238   C  CG1 . VAL A 1 30  ? 26.227  -11.750 31.414  1.00 49.23  ? 140 VAL A CG1 1 
ATOM   239   C  CG2 . VAL A 1 30  ? 27.776  -10.440 29.948  1.00 59.97  ? 140 VAL A CG2 1 
ATOM   240   N  N   . ARG A 1 31  ? 28.715  -7.912  31.434  1.00 49.01  ? 141 ARG A N   1 
ATOM   241   C  CA  . ARG A 1 31  ? 29.875  -7.039  31.369  1.00 48.35  ? 141 ARG A CA  1 
ATOM   242   C  C   . ARG A 1 31  ? 30.062  -6.553  32.816  1.00 44.09  ? 141 ARG A C   1 
ATOM   243   O  O   . ARG A 1 31  ? 31.128  -6.706  33.414  1.00 48.04  ? 141 ARG A O   1 
ATOM   244   C  CB  . ARG A 1 31  ? 29.561  -5.861  30.440  1.00 56.76  ? 141 ARG A CB  1 
ATOM   245   C  CG  . ARG A 1 31  ? 30.691  -5.427  29.538  1.00 66.84  ? 141 ARG A CG  1 
ATOM   246   C  CD  . ARG A 1 31  ? 31.772  -4.699  30.320  1.00 75.80  ? 141 ARG A CD  1 
ATOM   247   N  NE  . ARG A 1 31  ? 33.106  -5.082  29.867  1.00 84.76  ? 141 ARG A NE  1 
ATOM   248   C  CZ  . ARG A 1 31  ? 33.635  -6.293  30.026  1.00 88.42  ? 141 ARG A CZ  1 
ATOM   249   N  NH1 . ARG A 1 31  ? 32.949  -7.258  30.630  1.00 90.10  ? 141 ARG A NH1 1 
ATOM   250   N  NH2 . ARG A 1 31  ? 34.856  -6.544  29.578  1.00 89.72  ? 141 ARG A NH2 1 
ATOM   251   N  N   . ALA A 1 32  ? 28.960  -6.097  33.400  1.00 36.81  ? 142 ALA A N   1 
ATOM   252   C  CA  . ALA A 1 32  ? 28.928  -5.607  34.765  1.00 35.13  ? 142 ALA A CA  1 
ATOM   253   C  C   . ALA A 1 32  ? 29.149  -6.747  35.740  1.00 38.73  ? 142 ALA A C   1 
ATOM   254   O  O   . ALA A 1 32  ? 29.914  -6.600  36.697  1.00 40.83  ? 142 ALA A O   1 
ATOM   255   C  CB  . ALA A 1 32  ? 27.597  -4.932  35.055  1.00 35.61  ? 142 ALA A CB  1 
ATOM   256   N  N   . GLN A 1 33  ? 28.478  -7.877  35.516  1.00 39.16  ? 143 GLN A N   1 
ATOM   257   C  CA  . GLN A 1 33  ? 28.640  -9.023  36.408  1.00 37.72  ? 143 GLN A CA  1 
ATOM   258   C  C   . GLN A 1 33  ? 30.117  -9.385  36.496  1.00 39.45  ? 143 GLN A C   1 
ATOM   259   O  O   . GLN A 1 33  ? 30.656  -9.556  37.584  1.00 42.94  ? 143 GLN A O   1 
ATOM   260   C  CB  . GLN A 1 33  ? 27.820  -10.227 35.939  1.00 38.01  ? 143 GLN A CB  1 
ATOM   261   C  CG  . GLN A 1 33  ? 27.895  -11.445 36.878  1.00 34.03  ? 143 GLN A CG  1 
ATOM   262   C  CD  . GLN A 1 33  ? 26.527  -11.938 37.376  1.00 27.49  ? 143 GLN A CD  1 
ATOM   263   O  OE1 . GLN A 1 33  ? 26.159  -13.090 37.178  1.00 17.37  ? 143 GLN A OE1 1 
ATOM   264   N  NE2 . GLN A 1 33  ? 25.790  -11.069 38.046  1.00 30.64  ? 143 GLN A NE2 1 
ATOM   265   N  N   . LEU A 1 34  ? 30.781  -9.441  35.348  1.00 38.79  ? 144 LEU A N   1 
ATOM   266   C  CA  . LEU A 1 34  ? 32.198  -9.742  35.318  1.00 39.59  ? 144 LEU A CA  1 
ATOM   267   C  C   . LEU A 1 34  ? 32.923  -8.756  36.226  1.00 40.23  ? 144 LEU A C   1 
ATOM   268   O  O   . LEU A 1 34  ? 33.625  -9.136  37.176  1.00 38.51  ? 144 LEU A O   1 
ATOM   269   C  CB  . LEU A 1 34  ? 32.722  -9.600  33.898  1.00 42.11  ? 144 LEU A CB  1 
ATOM   270   C  CG  . LEU A 1 34  ? 33.114  -10.914 33.232  1.00 44.44  ? 144 LEU A CG  1 
ATOM   271   C  CD1 . LEU A 1 34  ? 33.850  -10.596 31.945  1.00 48.12  ? 144 LEU A CD1 1 
ATOM   272   C  CD2 . LEU A 1 34  ? 34.007  -11.741 34.153  1.00 44.98  ? 144 LEU A CD2 1 
ATOM   273   N  N   . VAL A 1 35  ? 32.707  -7.480  35.936  1.00 39.22  ? 145 VAL A N   1 
ATOM   274   C  CA  . VAL A 1 35  ? 33.301  -6.398  36.691  1.00 38.65  ? 145 VAL A CA  1 
ATOM   275   C  C   . VAL A 1 35  ? 33.107  -6.604  38.189  1.00 35.91  ? 145 VAL A C   1 
ATOM   276   O  O   . VAL A 1 35  ? 34.056  -6.476  38.961  1.00 41.61  ? 145 VAL A O   1 
ATOM   277   C  CB  . VAL A 1 35  ? 32.675  -5.045  36.278  1.00 41.77  ? 145 VAL A CB  1 
ATOM   278   C  CG1 . VAL A 1 35  ? 33.011  -3.963  37.298  1.00 39.92  ? 145 VAL A CG1 1 
ATOM   279   C  CG2 . VAL A 1 35  ? 33.161  -4.636  34.882  1.00 43.29  ? 145 VAL A CG2 1 
ATOM   280   N  N   . ASP A 1 36  ? 31.886  -6.947  38.589  1.00 32.71  ? 146 ASP A N   1 
ATOM   281   C  CA  . ASP A 1 36  ? 31.572  -7.153  39.997  1.00 39.05  ? 146 ASP A CA  1 
ATOM   282   C  C   . ASP A 1 36  ? 32.359  -8.282  40.624  1.00 43.63  ? 146 ASP A C   1 
ATOM   283   O  O   . ASP A 1 36  ? 32.845  -8.177  41.756  1.00 46.37  ? 146 ASP A O   1 
ATOM   284   C  CB  . ASP A 1 36  ? 30.089  -7.431  40.181  1.00 41.24  ? 146 ASP A CB  1 
ATOM   285   C  CG  . ASP A 1 36  ? 29.406  -6.364  41.002  1.00 50.10  ? 146 ASP A CG  1 
ATOM   286   O  OD1 . ASP A 1 36  ? 29.147  -5.274  40.438  1.00 51.97  ? 146 ASP A OD1 1 
ATOM   287   O  OD2 . ASP A 1 36  ? 29.151  -6.604  42.210  1.00 54.81  ? 146 ASP A OD2 1 
ATOM   288   N  N   . MET A 1 37  ? 32.476  -9.370  39.881  1.00 40.59  ? 147 MET A N   1 
ATOM   289   C  CA  . MET A 1 37  ? 33.193  -10.527 40.352  1.00 36.39  ? 147 MET A CA  1 
ATOM   290   C  C   . MET A 1 37  ? 34.633  -10.243 40.639  1.00 35.64  ? 147 MET A C   1 
ATOM   291   O  O   . MET A 1 37  ? 35.071  -10.443 41.763  1.00 34.72  ? 147 MET A O   1 
ATOM   292   C  CB  . MET A 1 37  ? 33.070  -11.654 39.357  1.00 40.90  ? 147 MET A CB  1 
ATOM   293   C  CG  . MET A 1 37  ? 31.711  -12.286 39.406  1.00 47.87  ? 147 MET A CG  1 
ATOM   294   S  SD  . MET A 1 37  ? 31.257  -12.602 41.118  1.00 52.62  ? 147 MET A SD  1 
ATOM   295   C  CE  . MET A 1 37  ? 32.344  -13.954 41.490  1.00 54.04  ? 147 MET A CE  1 
ATOM   296   N  N   . LYS A 1 38  ? 35.359  -9.754  39.639  1.00 37.07  ? 148 LYS A N   1 
ATOM   297   C  CA  . LYS A 1 38  ? 36.783  -9.434  39.799  1.00 41.13  ? 148 LYS A CA  1 
ATOM   298   C  C   . LYS A 1 38  ? 36.985  -8.591  41.063  1.00 42.19  ? 148 LYS A C   1 
ATOM   299   O  O   . LYS A 1 38  ? 37.789  -8.913  41.945  1.00 40.14  ? 148 LYS A O   1 
ATOM   300   C  CB  . LYS A 1 38  ? 37.284  -8.657  38.571  1.00 44.34  ? 148 LYS A CB  1 
ATOM   301   C  CG  . LYS A 1 38  ? 38.800  -8.459  38.535  1.00 49.06  ? 148 LYS A CG  1 
ATOM   302   C  CD  . LYS A 1 38  ? 39.265  -7.735  37.268  1.00 51.75  ? 148 LYS A CD  1 
ATOM   303   C  CE  . LYS A 1 38  ? 40.805  -7.616  37.212  1.00 51.63  ? 148 LYS A CE  1 
ATOM   304   N  NZ  . LYS A 1 38  ? 41.355  -6.982  35.964  1.00 51.09  ? 148 LYS A NZ  1 
ATOM   305   N  N   . ARG A 1 39  ? 36.172  -7.552  41.158  1.00 41.09  ? 149 ARG A N   1 
ATOM   306   C  CA  . ARG A 1 39  ? 36.178  -6.620  42.265  1.00 39.29  ? 149 ARG A CA  1 
ATOM   307   C  C   . ARG A 1 39  ? 35.956  -7.321  43.614  1.00 37.77  ? 149 ARG A C   1 
ATOM   308   O  O   . ARG A 1 39  ? 36.630  -7.027  44.599  1.00 45.40  ? 149 ARG A O   1 
ATOM   309   C  CB  . ARG A 1 39  ? 35.082  -5.598  41.982  1.00 38.74  ? 149 ARG A CB  1 
ATOM   310   C  CG  . ARG A 1 39  ? 35.060  -4.391  42.842  1.00 40.53  ? 149 ARG A CG  1 
ATOM   311   C  CD  . ARG A 1 39  ? 34.360  -3.281  42.102  1.00 42.85  ? 149 ARG A CD  1 
ATOM   312   N  NE  . ARG A 1 39  ? 35.199  -2.726  41.042  1.00 45.02  ? 149 ARG A NE  1 
ATOM   313   C  CZ  . ARG A 1 39  ? 34.798  -1.814  40.158  1.00 41.73  ? 149 ARG A CZ  1 
ATOM   314   N  NH1 . ARG A 1 39  ? 33.559  -1.341  40.174  1.00 37.42  ? 149 ARG A NH1 1 
ATOM   315   N  NH2 . ARG A 1 39  ? 35.662  -1.320  39.292  1.00 45.74  ? 149 ARG A NH2 1 
ATOM   316   N  N   . LEU A 1 40  ? 35.034  -8.272  43.637  1.00 28.20  ? 150 LEU A N   1 
ATOM   317   C  CA  . LEU A 1 40  ? 34.709  -9.013  44.851  1.00 21.57  ? 150 LEU A CA  1 
ATOM   318   C  C   . LEU A 1 40  ? 35.709  -10.107 45.219  1.00 21.33  ? 150 LEU A C   1 
ATOM   319   O  O   . LEU A 1 40  ? 35.888  -10.441 46.377  1.00 17.47  ? 150 LEU A O   1 
ATOM   320   C  CB  . LEU A 1 40  ? 33.332  -9.631  44.699  1.00 25.94  ? 150 LEU A CB  1 
ATOM   321   C  CG  . LEU A 1 40  ? 32.872  -10.573 45.807  1.00 28.25  ? 150 LEU A CG  1 
ATOM   322   C  CD1 . LEU A 1 40  ? 32.770  -9.824  47.114  1.00 34.11  ? 150 LEU A CD1 1 
ATOM   323   C  CD2 . LEU A 1 40  ? 31.519  -11.156 45.435  1.00 27.12  ? 150 LEU A CD2 1 
ATOM   324   N  N   . GLU A 1 41  ? 36.298  -10.735 44.220  1.00 25.07  ? 151 GLU A N   1 
ATOM   325   C  CA  . GLU A 1 41  ? 37.271  -11.772 44.481  1.00 22.66  ? 151 GLU A CA  1 
ATOM   326   C  C   . GLU A 1 41  ? 38.345  -11.060 45.275  1.00 22.73  ? 151 GLU A C   1 
ATOM   327   O  O   . GLU A 1 41  ? 38.761  -11.509 46.335  1.00 24.53  ? 151 GLU A O   1 
ATOM   328   C  CB  . GLU A 1 41  ? 37.837  -12.273 43.158  1.00 32.50  ? 151 GLU A CB  1 
ATOM   329   C  CG  . GLU A 1 41  ? 38.910  -13.361 43.278  1.00 43.90  ? 151 GLU A CG  1 
ATOM   330   C  CD  . GLU A 1 41  ? 38.480  -14.716 42.696  1.00 50.07  ? 151 GLU A CD  1 
ATOM   331   O  OE1 . GLU A 1 41  ? 37.473  -14.777 41.949  1.00 48.13  ? 151 GLU A OE1 1 
ATOM   332   O  OE2 . GLU A 1 41  ? 39.155  -15.731 42.991  1.00 56.45  ? 151 GLU A OE2 1 
ATOM   333   N  N   . VAL A 1 42  ? 38.709  -9.886  44.782  1.00 18.30  ? 152 VAL A N   1 
ATOM   334   C  CA  . VAL A 1 42  ? 39.719  -9.054  45.396  1.00 18.26  ? 152 VAL A CA  1 
ATOM   335   C  C   . VAL A 1 42  ? 39.353  -8.698  46.813  1.00 19.65  ? 152 VAL A C   1 
ATOM   336   O  O   . VAL A 1 42  ? 40.110  -8.946  47.753  1.00 26.30  ? 152 VAL A O   1 
ATOM   337   C  CB  . VAL A 1 42  ? 39.856  -7.755  44.627  1.00 20.06  ? 152 VAL A CB  1 
ATOM   338   C  CG1 . VAL A 1 42  ? 40.565  -6.710  45.449  1.00 23.89  ? 152 VAL A CG1 1 
ATOM   339   C  CG2 . VAL A 1 42  ? 40.581  -7.999  43.356  1.00 24.85  ? 152 VAL A CG2 1 
ATOM   340   N  N   . ASP A 1 43  ? 38.194  -8.084  46.956  1.00 16.63  ? 153 ASP A N   1 
ATOM   341   C  CA  . ASP A 1 43  ? 37.733  -7.660  48.255  1.00 20.86  ? 153 ASP A CA  1 
ATOM   342   C  C   . ASP A 1 43  ? 37.896  -8.811  49.239  1.00 23.73  ? 153 ASP A C   1 
ATOM   343   O  O   . ASP A 1 43  ? 38.548  -8.690  50.276  1.00 27.19  ? 153 ASP A O   1 
ATOM   344   C  CB  . ASP A 1 43  ? 36.282  -7.225  48.150  1.00 23.47  ? 153 ASP A CB  1 
ATOM   345   C  CG  . ASP A 1 43  ? 35.833  -6.456  49.344  1.00 27.91  ? 153 ASP A CG  1 
ATOM   346   O  OD1 . ASP A 1 43  ? 36.079  -5.244  49.390  1.00 33.72  ? 153 ASP A OD1 1 
ATOM   347   O  OD2 . ASP A 1 43  ? 35.246  -7.063  50.250  1.00 30.26  ? 153 ASP A OD2 1 
ATOM   348   N  N   . ILE A 1 44  ? 37.415  -9.969  48.834  1.00 22.10  ? 154 ILE A N   1 
ATOM   349   C  CA  . ILE A 1 44  ? 37.502  -11.153 49.668  1.00 21.57  ? 154 ILE A CA  1 
ATOM   350   C  C   . ILE A 1 44  ? 38.925  -11.522 49.990  1.00 16.48  ? 154 ILE A C   1 
ATOM   351   O  O   . ILE A 1 44  ? 39.259  -11.782 51.125  1.00 15.00  ? 154 ILE A O   1 
ATOM   352   C  CB  . ILE A 1 44  ? 36.857  -12.344 48.981  1.00 21.50  ? 154 ILE A CB  1 
ATOM   353   C  CG1 . ILE A 1 44  ? 35.360  -12.108 48.888  1.00 16.47  ? 154 ILE A CG1 1 
ATOM   354   C  CG2 . ILE A 1 44  ? 37.203  -13.635 49.714  1.00 18.80  ? 154 ILE A CG2 1 
ATOM   355   C  CD1 . ILE A 1 44  ? 34.691  -13.061 48.001  1.00 19.88  ? 154 ILE A CD1 1 
ATOM   356   N  N   . ASP A 1 45  ? 39.756  -11.592 48.972  1.00 16.16  ? 155 ASP A N   1 
ATOM   357   C  CA  . ASP A 1 45  ? 41.139  -11.946 49.183  1.00 19.29  ? 155 ASP A CA  1 
ATOM   358   C  C   . ASP A 1 45  ? 41.740  -11.030 50.257  1.00 23.37  ? 155 ASP A C   1 
ATOM   359   O  O   . ASP A 1 45  ? 42.392  -11.498 51.193  1.00 26.02  ? 155 ASP A O   1 
ATOM   360   C  CB  . ASP A 1 45  ? 41.865  -11.834 47.849  1.00 26.68  ? 155 ASP A CB  1 
ATOM   361   C  CG  . ASP A 1 45  ? 43.345  -11.685 48.006  1.00 35.83  ? 155 ASP A CG  1 
ATOM   362   O  OD1 . ASP A 1 45  ? 43.997  -12.659 48.435  1.00 37.97  ? 155 ASP A OD1 1 
ATOM   363   O  OD2 . ASP A 1 45  ? 43.850  -10.576 47.715  1.00 42.30  ? 155 ASP A OD2 1 
ATOM   364   N  N   . ILE A 1 46  ? 41.407  -9.744  50.168  1.00 16.59  ? 156 ILE A N   1 
ATOM   365   C  CA  . ILE A 1 46  ? 41.886  -8.723  51.088  1.00 13.89  ? 156 ILE A CA  1 
ATOM   366   C  C   . ILE A 1 46  ? 41.274  -8.865  52.470  1.00 22.94  ? 156 ILE A C   1 
ATOM   367   O  O   . ILE A 1 46  ? 41.950  -8.706  53.490  1.00 24.49  ? 156 ILE A O   1 
ATOM   368   C  CB  . ILE A 1 46  ? 41.547  -7.306  50.544  1.00 14.84  ? 156 ILE A CB  1 
ATOM   369   C  CG1 . ILE A 1 46  ? 42.546  -6.887  49.484  1.00 17.01  ? 156 ILE A CG1 1 
ATOM   370   C  CG2 . ILE A 1 46  ? 41.562  -6.274  51.622  1.00 6.97   ? 156 ILE A CG2 1 
ATOM   371   C  CD1 . ILE A 1 46  ? 42.386  -5.455  49.075  1.00 13.39  ? 156 ILE A CD1 1 
ATOM   372   N  N   . LYS A 1 47  ? 39.975  -9.111  52.517  1.00 26.74  ? 157 LYS A N   1 
ATOM   373   C  CA  . LYS A 1 47  ? 39.326  -9.237  53.810  1.00 25.75  ? 157 LYS A CA  1 
ATOM   374   C  C   . LYS A 1 47  ? 39.708  -10.488 54.561  1.00 20.00  ? 157 LYS A C   1 
ATOM   375   O  O   . LYS A 1 47  ? 39.602  -10.551 55.771  1.00 23.17  ? 157 LYS A O   1 
ATOM   376   C  CB  . LYS A 1 47  ? 37.814  -9.081  53.689  1.00 31.14  ? 157 LYS A CB  1 
ATOM   377   C  CG  . LYS A 1 47  ? 37.417  -7.618  53.484  1.00 43.09  ? 157 LYS A CG  1 
ATOM   378   C  CD  . LYS A 1 47  ? 35.918  -7.404  53.423  1.00 45.57  ? 157 LYS A CD  1 
ATOM   379   C  CE  . LYS A 1 47  ? 35.584  -5.929  53.350  1.00 47.02  ? 157 LYS A CE  1 
ATOM   380   N  NZ  . LYS A 1 47  ? 36.296  -5.258  52.233  1.00 45.81  ? 157 LYS A NZ  1 
ATOM   381   N  N   . ILE A 1 48  ? 40.196  -11.490 53.858  1.00 21.30  ? 158 ILE A N   1 
ATOM   382   C  CA  . ILE A 1 48  ? 40.601  -12.693 54.554  1.00 19.42  ? 158 ILE A CA  1 
ATOM   383   C  C   . ILE A 1 48  ? 41.982  -12.462 55.141  1.00 21.96  ? 158 ILE A C   1 
ATOM   384   O  O   . ILE A 1 48  ? 42.216  -12.792 56.295  1.00 19.45  ? 158 ILE A O   1 
ATOM   385   C  CB  . ILE A 1 48  ? 40.589  -13.928 53.645  1.00 20.24  ? 158 ILE A CB  1 
ATOM   386   C  CG1 . ILE A 1 48  ? 39.142  -14.339 53.348  1.00 17.61  ? 158 ILE A CG1 1 
ATOM   387   C  CG2 . ILE A 1 48  ? 41.342  -15.073 54.296  1.00 16.30  ? 158 ILE A CG2 1 
ATOM   388   C  CD1 . ILE A 1 48  ? 38.986  -15.398 52.250  1.00 8.07   ? 158 ILE A CD1 1 
ATOM   389   N  N   . ARG A 1 49  ? 42.886  -11.843 54.384  1.00 21.06  ? 159 ARG A N   1 
ATOM   390   C  CA  . ARG A 1 49  ? 44.205  -11.621 54.939  1.00 20.27  ? 159 ARG A CA  1 
ATOM   391   C  C   . ARG A 1 49  ? 44.020  -10.743 56.152  1.00 21.02  ? 159 ARG A C   1 
ATOM   392   O  O   . ARG A 1 49  ? 44.652  -10.963 57.165  1.00 24.05  ? 159 ARG A O   1 
ATOM   393   C  CB  . ARG A 1 49  ? 45.174  -11.012 53.925  1.00 19.90  ? 159 ARG A CB  1 
ATOM   394   C  CG  . ARG A 1 49  ? 44.744  -9.676  53.372  1.00 43.30  ? 159 ARG A CG  1 
ATOM   395   C  CD  . ARG A 1 49  ? 45.748  -9.060  52.391  1.00 51.25  ? 159 ARG A CD  1 
ATOM   396   N  NE  . ARG A 1 49  ? 45.825  -9.803  51.137  1.00 54.13  ? 159 ARG A NE  1 
ATOM   397   C  CZ  . ARG A 1 49  ? 46.542  -10.908 50.972  1.00 53.84  ? 159 ARG A CZ  1 
ATOM   398   N  NH1 . ARG A 1 49  ? 47.246  -11.399 51.990  1.00 51.59  ? 159 ARG A NH1 1 
ATOM   399   N  NH2 . ARG A 1 49  ? 46.572  -11.509 49.787  1.00 52.06  ? 159 ARG A NH2 1 
ATOM   400   N  N   . SER A 1 50  ? 43.036  -9.851  56.108  1.00 22.47  ? 160 SER A N   1 
ATOM   401   C  CA  . SER A 1 50  ? 42.790  -8.948  57.240  1.00 21.87  ? 160 SER A CA  1 
ATOM   402   C  C   . SER A 1 50  ? 42.282  -9.710  58.432  1.00 20.59  ? 160 SER A C   1 
ATOM   403   O  O   . SER A 1 50  ? 42.312  -9.242  59.563  1.00 27.40  ? 160 SER A O   1 
ATOM   404   C  CB  . SER A 1 50  ? 41.765  -7.881  56.881  1.00 25.49  ? 160 SER A CB  1 
ATOM   405   O  OG  . SER A 1 50  ? 40.461  -8.404  56.908  1.00 27.44  ? 160 SER A OG  1 
ATOM   406   N  N   . CYS A 1 51  ? 41.767  -10.889 58.160  1.00 21.56  ? 161 CYS A N   1 
ATOM   407   C  CA  . CYS A 1 51  ? 41.246  -11.714 59.209  1.00 13.54  ? 161 CYS A CA  1 
ATOM   408   C  C   . CYS A 1 51  ? 42.389  -12.462 59.891  1.00 18.24  ? 161 CYS A C   1 
ATOM   409   O  O   . CYS A 1 51  ? 42.202  -13.091 60.935  1.00 27.33  ? 161 CYS A O   1 
ATOM   410   C  CB  . CYS A 1 51  ? 40.221  -12.659 58.613  1.00 5.26   ? 161 CYS A CB  1 
ATOM   411   S  SG  . CYS A 1 51  ? 38.741  -12.801 59.627  1.00 25.17  ? 161 CYS A SG  1 
ATOM   412   N  N   . ARG A 1 52  ? 43.596  -12.308 59.346  1.00 19.86  ? 162 ARG A N   1 
ATOM   413   C  CA  . ARG A 1 52  ? 44.781  -12.968 59.882  1.00 17.78  ? 162 ARG A CA  1 
ATOM   414   C  C   . ARG A 1 52  ? 45.164  -12.384 61.217  1.00 23.84  ? 162 ARG A C   1 
ATOM   415   O  O   . ARG A 1 52  ? 45.538  -13.117 62.134  1.00 35.09  ? 162 ARG A O   1 
ATOM   416   C  CB  . ARG A 1 52  ? 45.954  -12.853 58.914  1.00 20.29  ? 162 ARG A CB  1 
ATOM   417   C  CG  . ARG A 1 52  ? 47.227  -13.522 59.372  1.00 32.94  ? 162 ARG A CG  1 
ATOM   418   C  CD  . ARG A 1 52  ? 48.350  -13.373 58.361  1.00 45.65  ? 162 ARG A CD  1 
ATOM   419   N  NE  . ARG A 1 52  ? 48.119  -14.130 57.128  1.00 59.48  ? 162 ARG A NE  1 
ATOM   420   C  CZ  . ARG A 1 52  ? 48.516  -13.731 55.913  1.00 72.21  ? 162 ARG A CZ  1 
ATOM   421   N  NH1 . ARG A 1 52  ? 49.163  -12.572 55.756  1.00 72.68  ? 162 ARG A NH1 1 
ATOM   422   N  NH2 . ARG A 1 52  ? 48.289  -14.501 54.849  1.00 74.68  ? 162 ARG A NH2 1 
ATOM   423   N  N   . GLY A 1 53  ? 45.014  -11.069 61.349  1.00 25.47  ? 163 GLY A N   1 
ATOM   424   C  CA  . GLY A 1 53  ? 45.364  -10.397 62.596  1.00 19.71  ? 163 GLY A CA  1 
ATOM   425   C  C   . GLY A 1 53  ? 44.351  -10.451 63.729  1.00 16.19  ? 163 GLY A C   1 
ATOM   426   O  O   . GLY A 1 53  ? 44.456  -9.698  64.706  1.00 14.80  ? 163 GLY A O   1 
ATOM   427   N  N   . SER A 1 54  ? 43.359  -11.326 63.612  1.00 19.47  ? 164 SER A N   1 
ATOM   428   C  CA  . SER A 1 54  ? 42.345  -11.442 64.655  1.00 16.57  ? 164 SER A CA  1 
ATOM   429   C  C   . SER A 1 54  ? 42.047  -12.905 64.940  1.00 20.10  ? 164 SER A C   1 
ATOM   430   O  O   . SER A 1 54  ? 41.984  -13.308 66.102  1.00 20.05  ? 164 SER A O   1 
ATOM   431   C  CB  . SER A 1 54  ? 41.044  -10.754 64.231  1.00 11.17  ? 164 SER A CB  1 
ATOM   432   O  OG  . SER A 1 54  ? 41.269  -9.459  63.707  1.00 24.44  ? 164 SER A OG  1 
ATOM   433   N  N   . CYS A 1 55  ? 41.898  -13.691 63.872  1.00 17.05  ? 165 CYS A N   1 
ATOM   434   C  CA  . CYS A 1 55  ? 41.564  -15.091 64.004  1.00 21.26  ? 165 CYS A CA  1 
ATOM   435   C  C   . CYS A 1 55  ? 42.773  -15.991 64.225  1.00 27.31  ? 165 CYS A C   1 
ATOM   436   O  O   . CYS A 1 55  ? 43.907  -15.631 63.867  1.00 24.09  ? 165 CYS A O   1 
ATOM   437   C  CB  . CYS A 1 55  ? 40.774  -15.538 62.778  1.00 18.15  ? 165 CYS A CB  1 
ATOM   438   S  SG  . CYS A 1 55  ? 39.350  -14.453 62.458  1.00 27.42  ? 165 CYS A SG  1 
ATOM   439   N  N   . SER A 1 56  ? 42.508  -17.159 64.821  1.00 26.35  ? 166 SER A N   1 
ATOM   440   C  CA  . SER A 1 56  ? 43.520  -18.165 65.088  1.00 25.31  ? 166 SER A CA  1 
ATOM   441   C  C   . SER A 1 56  ? 44.211  -18.615 63.799  1.00 36.42  ? 166 SER A C   1 
ATOM   442   O  O   . SER A 1 56  ? 45.426  -18.867 63.819  1.00 39.15  ? 166 SER A O   1 
ATOM   443   C  CB  . SER A 1 56  ? 42.893  -19.386 65.754  1.00 26.73  ? 166 SER A CB  1 
ATOM   444   O  OG  . SER A 1 56  ? 42.052  -20.079 64.844  1.00 32.34  ? 166 SER A OG  1 
ATOM   445   N  N   . ARG A 1 57  ? 43.451  -18.701 62.693  1.00 34.59  ? 167 ARG A N   1 
ATOM   446   C  CA  . ARG A 1 57  ? 43.987  -19.144 61.388  1.00 32.72  ? 167 ARG A CA  1 
ATOM   447   C  C   . ARG A 1 57  ? 43.555  -18.255 60.219  1.00 28.07  ? 167 ARG A C   1 
ATOM   448   O  O   . ARG A 1 57  ? 42.666  -17.441 60.364  1.00 33.60  ? 167 ARG A O   1 
ATOM   449   C  CB  . ARG A 1 57  ? 43.540  -20.590 61.098  1.00 37.02  ? 167 ARG A CB  1 
ATOM   450   C  CG  . ARG A 1 57  ? 44.653  -21.535 60.659  1.00 47.25  ? 167 ARG A CG  1 
ATOM   451   C  CD  . ARG A 1 57  ? 44.246  -22.461 59.491  1.00 57.01  ? 167 ARG A CD  1 
ATOM   452   N  NE  . ARG A 1 57  ? 45.155  -22.302 58.343  1.00 64.58  ? 167 ARG A NE  1 
ATOM   453   C  CZ  . ARG A 1 57  ? 44.998  -22.862 57.139  1.00 64.04  ? 167 ARG A CZ  1 
ATOM   454   N  NH1 . ARG A 1 57  ? 43.957  -23.644 56.887  1.00 61.27  ? 167 ARG A NH1 1 
ATOM   455   N  NH2 . ARG A 1 57  ? 45.889  -22.623 56.175  1.00 63.60  ? 167 ARG A NH2 1 
ATOM   456   N  N   . ALA A 1 58  ? 44.170  -18.433 59.055  1.00 26.22  ? 168 ALA A N   1 
ATOM   457   C  CA  . ALA A 1 58  ? 43.821  -17.657 57.864  1.00 29.04  ? 168 ALA A CA  1 
ATOM   458   C  C   . ALA A 1 58  ? 44.035  -18.477 56.577  1.00 29.39  ? 168 ALA A C   1 
ATOM   459   O  O   . ALA A 1 58  ? 45.154  -18.863 56.244  1.00 36.79  ? 168 ALA A O   1 
ATOM   460   C  CB  . ALA A 1 58  ? 44.616  -16.343 57.821  1.00 29.45  ? 168 ALA A CB  1 
ATOM   461   N  N   . LEU A 1 59  ? 42.945  -18.737 55.866  1.00 27.62  ? 169 LEU A N   1 
ATOM   462   C  CA  . LEU A 1 59  ? 42.960  -19.522 54.636  1.00 24.83  ? 169 LEU A CA  1 
ATOM   463   C  C   . LEU A 1 59  ? 44.053  -19.087 53.676  1.00 17.30  ? 169 LEU A C   1 
ATOM   464   O  O   . LEU A 1 59  ? 44.079  -17.962 53.233  1.00 13.59  ? 169 LEU A O   1 
ATOM   465   C  CB  . LEU A 1 59  ? 41.584  -19.437 53.954  1.00 24.41  ? 169 LEU A CB  1 
ATOM   466   C  CG  . LEU A 1 59  ? 41.128  -20.597 53.066  1.00 25.94  ? 169 LEU A CG  1 
ATOM   467   C  CD1 . LEU A 1 59  ? 41.801  -20.573 51.715  1.00 27.32  ? 169 LEU A CD1 1 
ATOM   468   C  CD2 . LEU A 1 59  ? 41.405  -21.919 53.778  1.00 29.85  ? 169 LEU A CD2 1 
ATOM   469   N  N   . ALA A 1 60  ? 44.982  -19.978 53.375  1.00 29.39  ? 170 ALA A N   1 
ATOM   470   C  CA  . ALA A 1 60  ? 46.057  -19.644 52.437  1.00 36.79  ? 170 ALA A CA  1 
ATOM   471   C  C   . ALA A 1 60  ? 45.454  -19.570 51.036  1.00 40.37  ? 170 ALA A C   1 
ATOM   472   O  O   . ALA A 1 60  ? 44.964  -20.580 50.502  1.00 42.71  ? 170 ALA A O   1 
ATOM   473   C  CB  . ALA A 1 60  ? 47.157  -20.701 52.486  1.00 38.74  ? 170 ALA A CB  1 
ATOM   474   N  N   . ARG A 1 61  ? 45.454  -18.366 50.468  1.00 40.87  ? 171 ARG A N   1 
ATOM   475   C  CA  . ARG A 1 61  ? 44.901  -18.145 49.143  1.00 46.32  ? 171 ARG A CA  1 
ATOM   476   C  C   . ARG A 1 61  ? 45.823  -17.413 48.195  1.00 58.39  ? 171 ARG A C   1 
ATOM   477   O  O   . ARG A 1 61  ? 47.039  -17.325 48.383  1.00 62.93  ? 171 ARG A O   1 
ATOM   478   C  CB  . ARG A 1 61  ? 43.606  -17.348 49.222  1.00 41.03  ? 171 ARG A CB  1 
ATOM   479   C  CG  . ARG A 1 61  ? 42.488  -18.023 49.927  1.00 42.16  ? 171 ARG A CG  1 
ATOM   480   C  CD  . ARG A 1 61  ? 41.354  -17.052 50.164  1.00 38.15  ? 171 ARG A CD  1 
ATOM   481   N  NE  . ARG A 1 61  ? 40.586  -16.836 48.953  1.00 38.10  ? 171 ARG A NE  1 
ATOM   482   C  CZ  . ARG A 1 61  ? 40.777  -15.823 48.124  1.00 41.37  ? 171 ARG A CZ  1 
ATOM   483   N  NH1 . ARG A 1 61  ? 41.721  -14.925 48.387  1.00 41.13  ? 171 ARG A NH1 1 
ATOM   484   N  NH2 . ARG A 1 61  ? 40.033  -15.721 47.026  1.00 41.20  ? 171 ARG A NH2 1 
ATOM   485   N  N   . GLU A 1 62  ? 45.168  -16.837 47.198  1.00 69.93  ? 172 GLU A N   1 
ATOM   486   C  CA  . GLU A 1 62  ? 45.767  -16.088 46.110  1.00 82.32  ? 172 GLU A CA  1 
ATOM   487   C  C   . GLU A 1 62  ? 44.586  -15.621 45.248  1.00 85.20  ? 172 GLU A C   1 
ATOM   488   O  O   . GLU A 1 62  ? 43.422  -15.805 45.616  1.00 87.55  ? 172 GLU A O   1 
ATOM   489   C  CB  . GLU A 1 62  ? 46.672  -17.015 45.282  1.00 89.69  ? 172 GLU A CB  1 
ATOM   490   C  CG  . GLU A 1 62  ? 46.200  -18.491 45.189  1.00 97.48  ? 172 GLU A CG  1 
ATOM   491   C  CD  . GLU A 1 62  ? 44.692  -18.650 44.951  1.00 104.36 ? 172 GLU A CD  1 
ATOM   492   O  OE1 . GLU A 1 62  ? 44.213  -18.327 43.838  1.00 108.82 ? 172 GLU A OE1 1 
ATOM   493   O  OE2 . GLU A 1 62  ? 43.986  -19.088 45.892  1.00 104.35 ? 172 GLU A OE2 1 
ATOM   494   N  N   . VAL A 1 63  ? 44.881  -15.069 44.080  1.00 85.08  ? 173 VAL A N   1 
ATOM   495   C  CA  . VAL A 1 63  ? 43.836  -14.612 43.177  1.00 87.41  ? 173 VAL A CA  1 
ATOM   496   C  C   . VAL A 1 63  ? 44.333  -14.709 41.753  1.00 88.95  ? 173 VAL A C   1 
ATOM   497   O  O   . VAL A 1 63  ? 45.534  -14.609 41.494  1.00 94.12  ? 173 VAL A O   1 
ATOM   498   C  CB  . VAL A 1 63  ? 43.403  -13.158 43.468  1.00 90.55  ? 173 VAL A CB  1 
ATOM   499   C  CG1 . VAL A 1 63  ? 42.281  -13.140 44.495  1.00 90.86  ? 173 VAL A CG1 1 
ATOM   500   C  CG2 . VAL A 1 63  ? 44.600  -12.336 43.964  1.00 93.48  ? 173 VAL A CG2 1 
ATOM   501   N  N   . ASP A 1 64  ? 43.406  -14.920 40.830  1.00 86.71  ? 174 ASP A N   1 
ATOM   502   C  CA  . ASP A 1 64  ? 43.768  -15.036 39.431  1.00 85.10  ? 174 ASP A CA  1 
ATOM   503   C  C   . ASP A 1 64  ? 42.847  -14.171 38.591  1.00 79.54  ? 174 ASP A C   1 
ATOM   504   O  O   . ASP A 1 64  ? 41.805  -14.632 38.127  1.00 77.03  ? 174 ASP A O   1 
ATOM   505   C  CB  . ASP A 1 64  ? 43.680  -16.498 38.989  1.00 90.37  ? 174 ASP A CB  1 
ATOM   506   C  CG  . ASP A 1 64  ? 44.265  -16.729 37.609  1.00 94.32  ? 174 ASP A CG  1 
ATOM   507   O  OD1 . ASP A 1 64  ? 45.496  -16.935 37.518  1.00 94.77  ? 174 ASP A OD1 1 
ATOM   508   O  OD2 . ASP A 1 64  ? 43.492  -16.710 36.621  1.00 96.42  ? 174 ASP A OD2 1 
ATOM   509   N  N   . LEU A 1 65  ? 43.233  -12.910 38.410  1.00 74.79  ? 175 LEU A N   1 
ATOM   510   C  CA  . LEU A 1 65  ? 42.444  -11.964 37.619  1.00 70.85  ? 175 LEU A CA  1 
ATOM   511   C  C   . LEU A 1 65  ? 42.618  -12.252 36.141  1.00 69.46  ? 175 LEU A C   1 
ATOM   512   O  O   . LEU A 1 65  ? 42.007  -11.615 35.285  1.00 67.54  ? 175 LEU A O   1 
ATOM   513   C  CB  . LEU A 1 65  ? 42.866  -10.517 37.904  1.00 70.72  ? 175 LEU A CB  1 
ATOM   514   C  CG  . LEU A 1 65  ? 42.749  -9.989  39.337  1.00 72.56  ? 175 LEU A CG  1 
ATOM   515   C  CD1 . LEU A 1 65  ? 41.560  -10.662 40.057  1.00 71.29  ? 175 LEU A CD1 1 
ATOM   516   C  CD2 . LEU A 1 65  ? 44.056  -10.249 40.082  1.00 73.27  ? 175 LEU A CD2 1 
ATOM   517   N  N   . LYS A 1 66  ? 43.462  -13.230 35.858  1.00 71.70  ? 176 LYS A N   1 
ATOM   518   C  CA  . LYS A 1 66  ? 43.759  -13.633 34.500  1.00 71.10  ? 176 LYS A CA  1 
ATOM   519   C  C   . LYS A 1 66  ? 42.504  -14.191 33.873  1.00 64.42  ? 176 LYS A C   1 
ATOM   520   O  O   . LYS A 1 66  ? 42.019  -13.640 32.886  1.00 65.32  ? 176 LYS A O   1 
ATOM   521   C  CB  . LYS A 1 66  ? 44.897  -14.659 34.492  1.00 76.12  ? 176 LYS A CB  1 
ATOM   522   C  CG  . LYS A 1 66  ? 46.210  -14.120 35.093  1.00 82.14  ? 176 LYS A CG  1 
ATOM   523   C  CD  . LYS A 1 66  ? 46.088  -13.807 36.602  1.00 81.51  ? 176 LYS A CD  1 
ATOM   524   C  CE  . LYS A 1 66  ? 46.959  -12.623 37.036  1.00 77.39  ? 176 LYS A CE  1 
ATOM   525   N  NZ  . LYS A 1 66  ? 46.668  -12.204 38.444  1.00 74.98  ? 176 LYS A NZ  1 
ATOM   526   N  N   . ASP A 1 67  ? 41.942  -15.232 34.482  1.00 56.57  ? 177 ASP A N   1 
ATOM   527   C  CA  . ASP A 1 67  ? 40.724  -15.820 33.953  1.00 54.98  ? 177 ASP A CA  1 
ATOM   528   C  C   . ASP A 1 67  ? 39.698  -14.715 33.762  1.00 49.98  ? 177 ASP A C   1 
ATOM   529   O  O   . ASP A 1 67  ? 39.009  -14.672 32.744  1.00 46.57  ? 177 ASP A O   1 
ATOM   530   C  CB  . ASP A 1 67  ? 40.168  -16.893 34.883  1.00 58.66  ? 177 ASP A CB  1 
ATOM   531   C  CG  . ASP A 1 67  ? 39.139  -17.778 34.190  1.00 63.47  ? 177 ASP A CG  1 
ATOM   532   O  OD1 . ASP A 1 67  ? 39.337  -18.125 32.997  1.00 61.46  ? 177 ASP A OD1 1 
ATOM   533   O  OD2 . ASP A 1 67  ? 38.132  -18.131 34.832  1.00 66.37  ? 177 ASP A OD2 1 
ATOM   534   N  N   . TYR A 1 68  ? 39.668  -13.786 34.716  1.00 50.13  ? 178 TYR A N   1 
ATOM   535   C  CA  . TYR A 1 68  ? 38.768  -12.633 34.682  1.00 48.64  ? 178 TYR A CA  1 
ATOM   536   C  C   . TYR A 1 68  ? 39.126  -11.712 33.526  1.00 50.94  ? 178 TYR A C   1 
ATOM   537   O  O   . TYR A 1 68  ? 38.249  -11.266 32.789  1.00 49.54  ? 178 TYR A O   1 
ATOM   538   C  CB  . TYR A 1 68  ? 38.853  -11.838 35.986  1.00 42.93  ? 178 TYR A CB  1 
ATOM   539   C  CG  . TYR A 1 68  ? 37.971  -12.370 37.079  1.00 40.16  ? 178 TYR A CG  1 
ATOM   540   C  CD1 . TYR A 1 68  ? 36.590  -12.283 36.980  1.00 40.06  ? 178 TYR A CD1 1 
ATOM   541   C  CD2 . TYR A 1 68  ? 38.511  -12.981 38.199  1.00 39.48  ? 178 TYR A CD2 1 
ATOM   542   C  CE1 . TYR A 1 68  ? 35.767  -12.794 37.962  1.00 38.55  ? 178 TYR A CE1 1 
ATOM   543   C  CE2 . TYR A 1 68  ? 37.699  -13.495 39.189  1.00 41.74  ? 178 TYR A CE2 1 
ATOM   544   C  CZ  . TYR A 1 68  ? 36.322  -13.402 39.066  1.00 40.20  ? 178 TYR A CZ  1 
ATOM   545   O  OH  . TYR A 1 68  ? 35.496  -13.943 40.032  1.00 41.99  ? 178 TYR A OH  1 
ATOM   546   N  N   . GLU A 1 69  ? 40.418  -11.428 33.374  1.00 51.71  ? 179 GLU A N   1 
ATOM   547   C  CA  . GLU A 1 69  ? 40.883  -10.561 32.306  1.00 50.14  ? 179 GLU A CA  1 
ATOM   548   C  C   . GLU A 1 69  ? 40.596  -11.117 30.927  1.00 49.50  ? 179 GLU A C   1 
ATOM   549   O  O   . GLU A 1 69  ? 39.889  -10.477 30.148  1.00 44.54  ? 179 GLU A O   1 
ATOM   550   C  CB  . GLU A 1 69  ? 42.365  -10.251 32.472  1.00 51.54  ? 179 GLU A CB  1 
ATOM   551   C  CG  . GLU A 1 69  ? 42.599  -9.071  33.390  1.00 59.78  ? 179 GLU A CG  1 
ATOM   552   C  CD  . GLU A 1 69  ? 43.829  -9.227  34.255  1.00 66.94  ? 179 GLU A CD  1 
ATOM   553   O  OE1 . GLU A 1 69  ? 44.805  -9.869  33.804  1.00 68.50  ? 179 GLU A OE1 1 
ATOM   554   O  OE2 . GLU A 1 69  ? 43.817  -8.705  35.394  1.00 71.53  ? 179 GLU A OE2 1 
ATOM   555   N  N   . ASP A 1 70  ? 41.079  -12.325 30.638  1.00 51.95  ? 180 ASP A N   1 
ATOM   556   C  CA  . ASP A 1 70  ? 40.854  -12.901 29.318  1.00 56.02  ? 180 ASP A CA  1 
ATOM   557   C  C   . ASP A 1 70  ? 39.380  -13.143 29.001  1.00 58.60  ? 180 ASP A C   1 
ATOM   558   O  O   . ASP A 1 70  ? 39.017  -13.303 27.844  1.00 59.28  ? 180 ASP A O   1 
ATOM   559   C  CB  . ASP A 1 70  ? 41.715  -14.147 29.071  1.00 57.51  ? 180 ASP A CB  1 
ATOM   560   C  CG  . ASP A 1 70  ? 41.227  -15.361 29.817  1.00 60.88  ? 180 ASP A CG  1 
ATOM   561   O  OD1 . ASP A 1 70  ? 40.252  -16.002 29.363  1.00 65.84  ? 180 ASP A OD1 1 
ATOM   562   O  OD2 . ASP A 1 70  ? 41.844  -15.694 30.844  1.00 62.66  ? 180 ASP A OD2 1 
ATOM   563   N  N   . GLN A 1 71  ? 38.534  -13.182 30.026  1.00 59.11  ? 181 GLN A N   1 
ATOM   564   C  CA  . GLN A 1 71  ? 37.099  -13.343 29.801  1.00 63.93  ? 181 GLN A CA  1 
ATOM   565   C  C   . GLN A 1 71  ? 36.527  -11.982 29.398  1.00 68.63  ? 181 GLN A C   1 
ATOM   566   O  O   . GLN A 1 71  ? 35.693  -11.900 28.497  1.00 69.56  ? 181 GLN A O   1 
ATOM   567   C  CB  . GLN A 1 71  ? 36.375  -13.830 31.057  1.00 61.53  ? 181 GLN A CB  1 
ATOM   568   C  CG  . GLN A 1 71  ? 36.396  -15.320 31.281  1.00 56.17  ? 181 GLN A CG  1 
ATOM   569   C  CD  . GLN A 1 71  ? 35.567  -15.719 32.478  1.00 55.27  ? 181 GLN A CD  1 
ATOM   570   O  OE1 . GLN A 1 71  ? 35.891  -15.395 33.616  1.00 59.57  ? 181 GLN A OE1 1 
ATOM   571   N  NE2 . GLN A 1 71  ? 34.482  -16.417 32.225  1.00 55.62  ? 181 GLN A NE2 1 
ATOM   572   N  N   . GLN A 1 72  ? 36.965  -10.927 30.091  1.00 73.95  ? 182 GLN A N   1 
ATOM   573   C  CA  . GLN A 1 72  ? 36.527  -9.557  29.811  1.00 75.52  ? 182 GLN A CA  1 
ATOM   574   C  C   . GLN A 1 72  ? 36.815  -9.299  28.343  1.00 76.73  ? 182 GLN A C   1 
ATOM   575   O  O   . GLN A 1 72  ? 35.990  -8.748  27.616  1.00 77.94  ? 182 GLN A O   1 
ATOM   576   C  CB  . GLN A 1 72  ? 37.327  -8.536  30.635  1.00 78.34  ? 182 GLN A CB  1 
ATOM   577   C  CG  . GLN A 1 72  ? 37.146  -8.587  32.145  1.00 78.94  ? 182 GLN A CG  1 
ATOM   578   C  CD  . GLN A 1 72  ? 38.142  -7.687  32.877  1.00 80.37  ? 182 GLN A CD  1 
ATOM   579   O  OE1 . GLN A 1 72  ? 38.021  -6.459  32.856  1.00 80.45  ? 182 GLN A OE1 1 
ATOM   580   N  NE2 . GLN A 1 72  ? 39.141  -8.297  33.512  1.00 79.45  ? 182 GLN A NE2 1 
ATOM   581   N  N   . LYS A 1 73  ? 37.987  -9.747  27.911  1.00 76.67  ? 183 LYS A N   1 
ATOM   582   C  CA  . LYS A 1 73  ? 38.423  -9.575  26.540  1.00 76.97  ? 183 LYS A CA  1 
ATOM   583   C  C   . LYS A 1 73  ? 37.578  -10.326 25.517  1.00 74.70  ? 183 LYS A C   1 
ATOM   584   O  O   . LYS A 1 73  ? 37.339  -9.817  24.426  1.00 77.31  ? 183 LYS A O   1 
ATOM   585   C  CB  . LYS A 1 73  ? 39.902  -9.931  26.438  1.00 77.78  ? 183 LYS A CB  1 
ATOM   586   C  CG  . LYS A 1 73  ? 40.772  -8.924  27.191  1.00 79.92  ? 183 LYS A CG  1 
ATOM   587   C  CD  . LYS A 1 73  ? 41.869  -9.583  28.016  1.00 81.59  ? 183 LYS A CD  1 
ATOM   588   C  CE  . LYS A 1 73  ? 42.576  -8.567  28.926  1.00 84.26  ? 183 LYS A CE  1 
ATOM   589   N  NZ  . LYS A 1 73  ? 41.690  -7.948  29.971  1.00 84.36  ? 183 LYS A NZ  1 
ATOM   590   N  N   . GLN A 1 74  ? 37.091  -11.508 25.880  1.00 72.80  ? 184 GLN A N   1 
ATOM   591   C  CA  . GLN A 1 74  ? 36.256  -12.279 24.965  1.00 74.53  ? 184 GLN A CA  1 
ATOM   592   C  C   . GLN A 1 74  ? 34.896  -11.615 24.845  1.00 74.68  ? 184 GLN A C   1 
ATOM   593   O  O   . GLN A 1 74  ? 34.274  -11.676 23.793  1.00 80.15  ? 184 GLN A O   1 
ATOM   594   C  CB  . GLN A 1 74  ? 36.066  -13.724 25.441  1.00 76.86  ? 184 GLN A CB  1 
ATOM   595   C  CG  . GLN A 1 74  ? 37.336  -14.436 25.925  1.00 81.98  ? 184 GLN A CG  1 
ATOM   596   C  CD  . GLN A 1 74  ? 38.527  -14.313 24.968  1.00 83.66  ? 184 GLN A CD  1 
ATOM   597   O  OE1 . GLN A 1 74  ? 38.936  -15.294 24.337  1.00 86.53  ? 184 GLN A OE1 1 
ATOM   598   N  NE2 . GLN A 1 74  ? 39.111  -13.116 24.890  1.00 81.38  ? 184 GLN A NE2 1 
ATOM   599   N  N   . LEU A 1 75  ? 34.442  -10.980 25.923  1.00 72.31  ? 185 LEU A N   1 
ATOM   600   C  CA  . LEU A 1 75  ? 33.149  -10.303 25.933  1.00 72.92  ? 185 LEU A CA  1 
ATOM   601   C  C   . LEU A 1 75  ? 33.183  -9.104  25.000  1.00 78.10  ? 185 LEU A C   1 
ATOM   602   O  O   . LEU A 1 75  ? 32.302  -8.939  24.157  1.00 80.77  ? 185 LEU A O   1 
ATOM   603   C  CB  . LEU A 1 75  ? 32.798  -9.827  27.343  1.00 71.46  ? 185 LEU A CB  1 
ATOM   604   C  CG  . LEU A 1 75  ? 31.438  -10.224 27.923  1.00 70.69  ? 185 LEU A CG  1 
ATOM   605   C  CD1 . LEU A 1 75  ? 31.067  -9.245  29.025  1.00 69.98  ? 185 LEU A CD1 1 
ATOM   606   C  CD2 . LEU A 1 75  ? 30.366  -10.230 26.847  1.00 69.38  ? 185 LEU A CD2 1 
ATOM   607   N  N   . GLU A 1 76  ? 34.210  -8.270  25.167  1.00 81.80  ? 186 GLU A N   1 
ATOM   608   C  CA  . GLU A 1 76  ? 34.400  -7.067  24.356  1.00 83.69  ? 186 GLU A CA  1 
ATOM   609   C  C   . GLU A 1 76  ? 34.591  -7.448  22.891  1.00 86.46  ? 186 GLU A C   1 
ATOM   610   O  O   . GLU A 1 76  ? 34.065  -6.794  21.989  1.00 87.98  ? 186 GLU A O   1 
ATOM   611   C  CB  . GLU A 1 76  ? 35.613  -6.285  24.863  1.00 84.77  ? 186 GLU A CB  1 
ATOM   612   C  CG  . GLU A 1 76  ? 35.566  -5.959  26.352  1.00 87.01  ? 186 GLU A CG  1 
ATOM   613   C  CD  . GLU A 1 76  ? 34.442  -5.001  26.735  1.00 90.61  ? 186 GLU A CD  1 
ATOM   614   O  OE1 . GLU A 1 76  ? 33.255  -5.354  26.576  1.00 91.43  ? 186 GLU A OE1 1 
ATOM   615   O  OE2 . GLU A 1 76  ? 34.746  -3.892  27.223  1.00 93.04  ? 186 GLU A OE2 1 
ATOM   616   N  N   . GLN A 1 77  ? 35.330  -8.532  22.677  1.00 87.30  ? 187 GLN A N   1 
ATOM   617   C  CA  . GLN A 1 77  ? 35.606  -9.074  21.351  1.00 87.34  ? 187 GLN A CA  1 
ATOM   618   C  C   . GLN A 1 77  ? 34.296  -9.377  20.610  1.00 84.34  ? 187 GLN A C   1 
ATOM   619   O  O   . GLN A 1 77  ? 34.269  -9.429  19.381  1.00 86.64  ? 187 GLN A O   1 
ATOM   620   C  CB  . GLN A 1 77  ? 36.444  -10.345 21.521  1.00 90.16  ? 187 GLN A CB  1 
ATOM   621   C  CG  . GLN A 1 77  ? 36.612  -11.221 20.305  1.00 93.59  ? 187 GLN A CG  1 
ATOM   622   C  CD  . GLN A 1 77  ? 37.265  -12.536 20.675  1.00 97.77  ? 187 GLN A CD  1 
ATOM   623   O  OE1 . GLN A 1 77  ? 38.488  -12.619 20.795  1.00 99.19  ? 187 GLN A OE1 1 
ATOM   624   N  NE2 . GLN A 1 77  ? 36.448  -13.564 20.905  1.00 101.04 ? 187 GLN A NE2 1 
ATOM   625   N  N   . VAL A 1 78  ? 33.215  -9.539  21.372  1.00 79.49  ? 188 VAL A N   1 
ATOM   626   C  CA  . VAL A 1 78  ? 31.890  -9.834  20.829  1.00 75.57  ? 188 VAL A CA  1 
ATOM   627   C  C   . VAL A 1 78  ? 30.995  -8.602  20.822  1.00 75.59  ? 188 VAL A C   1 
ATOM   628   O  O   . VAL A 1 78  ? 30.336  -8.315  19.825  1.00 77.76  ? 188 VAL A O   1 
ATOM   629   C  CB  . VAL A 1 78  ? 31.194  -10.940 21.640  1.00 72.55  ? 188 VAL A CB  1 
ATOM   630   C  CG1 . VAL A 1 78  ? 29.786  -11.163 21.133  1.00 69.86  ? 188 VAL A CG1 1 
ATOM   631   C  CG2 . VAL A 1 78  ? 31.990  -12.225 21.556  1.00 73.29  ? 188 VAL A CG2 1 
ATOM   632   N  N   . ILE A 1 79  ? 30.949  -7.900  21.951  1.00 76.22  ? 189 ILE A N   1 
ATOM   633   C  CA  . ILE A 1 79  ? 30.147  -6.686  22.094  1.00 77.76  ? 189 ILE A CA  1 
ATOM   634   C  C   . ILE A 1 79  ? 30.420  -5.701  20.945  1.00 83.34  ? 189 ILE A C   1 
ATOM   635   O  O   . ILE A 1 79  ? 29.524  -4.982  20.502  1.00 82.96  ? 189 ILE A O   1 
ATOM   636   C  CB  . ILE A 1 79  ? 30.439  -6.004  23.454  1.00 75.13  ? 189 ILE A CB  1 
ATOM   637   C  CG1 . ILE A 1 79  ? 29.969  -6.898  24.597  1.00 71.99  ? 189 ILE A CG1 1 
ATOM   638   C  CG2 . ILE A 1 79  ? 29.757  -4.658  23.544  1.00 76.81  ? 189 ILE A CG2 1 
ATOM   639   C  CD1 . ILE A 1 79  ? 30.206  -6.312  25.965  1.00 67.53  ? 189 ILE A CD1 1 
ATOM   640   N  N   . ALA A 1 80  ? 31.651  -5.712  20.438  1.00 89.79  ? 190 ALA A N   1 
ATOM   641   C  CA  . ALA A 1 80  ? 32.063  -4.838  19.336  1.00 94.75  ? 190 ALA A CA  1 
ATOM   642   C  C   . ALA A 1 80  ? 31.552  -5.336  17.976  1.00 96.03  ? 190 ALA A C   1 
ATOM   643   O  O   . ALA A 1 80  ? 32.243  -5.222  16.954  1.00 94.91  ? 190 ALA A O   1 
ATOM   644   C  CB  . ALA A 1 80  ? 33.585  -4.721  19.313  1.00 95.35  ? 190 ALA A CB  1 
ATOM   645   N  N   . LYS A 1 81  ? 30.324  -5.848  17.965  1.00 96.97  ? 191 LYS A N   1 
ATOM   646   C  CA  . LYS A 1 81  ? 29.723  -6.380  16.755  1.00 97.47  ? 191 LYS A CA  1 
ATOM   647   C  C   . LYS A 1 81  ? 28.316  -5.812  16.636  1.00 94.75  ? 191 LYS A C   1 
ATOM   648   O  O   . LYS A 1 81  ? 27.480  -6.024  17.516  1.00 94.20  ? 191 LYS A O   1 
ATOM   649   C  CB  . LYS A 1 81  ? 29.693  -7.911  16.847  1.00 102.06 ? 191 LYS A CB  1 
ATOM   650   C  CG  . LYS A 1 81  ? 29.645  -8.649  15.514  1.00 105.82 ? 191 LYS A CG  1 
ATOM   651   C  CD  . LYS A 1 81  ? 30.119  -10.099 15.662  1.00 107.94 ? 191 LYS A CD  1 
ATOM   652   C  CE  . LYS A 1 81  ? 31.603  -10.166 16.015  1.00 109.53 ? 191 LYS A CE  1 
ATOM   653   N  NZ  . LYS A 1 81  ? 32.097  -11.561 16.181  1.00 110.93 ? 191 LYS A NZ  1 
ATOM   654   N  N   . ASP A 1 82  ? 28.074  -5.060  15.565  1.00 93.13  ? 192 ASP A N   1 
ATOM   655   C  CA  . ASP A 1 82  ? 26.768  -4.445  15.326  1.00 95.03  ? 192 ASP A CA  1 
ATOM   656   C  C   . ASP A 1 82  ? 25.683  -5.469  14.998  1.00 94.89  ? 192 ASP A C   1 
ATOM   657   O  O   . ASP A 1 82  ? 25.770  -6.192  13.997  1.00 95.31  ? 192 ASP A O   1 
ATOM   658   C  CB  . ASP A 1 82  ? 26.859  -3.401  14.203  1.00 99.78  ? 192 ASP A CB  1 
ATOM   659   C  CG  . ASP A 1 82  ? 25.549  -2.646  13.990  1.00 103.74 ? 192 ASP A CG  1 
ATOM   660   O  OD1 . ASP A 1 82  ? 24.972  -2.152  14.987  1.00 106.00 ? 192 ASP A OD1 1 
ATOM   661   O  OD2 . ASP A 1 82  ? 25.098  -2.544  12.825  1.00 104.05 ? 192 ASP A OD2 1 
ATOM   662   N  N   . LEU A 1 83  ? 24.653  -5.499  15.844  1.00 94.62  ? 193 LEU A N   1 
ATOM   663   C  CA  . LEU A 1 83  ? 23.520  -6.410  15.691  1.00 92.49  ? 193 LEU A CA  1 
ATOM   664   C  C   . LEU A 1 83  ? 23.967  -7.864  15.626  1.00 92.84  ? 193 LEU A C   1 
ATOM   665   O  O   . LEU A 1 83  ? 22.852  -8.593  15.066  1.00 116.71 ? 193 LEU A O   1 
ATOM   666   C  CB  . LEU A 1 83  ? 22.695  -6.050  14.445  1.00 90.24  ? 193 LEU A CB  1 
ATOM   667   C  CG  . LEU A 1 83  ? 21.578  -4.996  14.540  1.00 86.23  ? 193 LEU A CG  1 
ATOM   668   C  CD1 . LEU A 1 83  ? 22.056  -3.692  15.160  1.00 83.15  ? 193 LEU A CD1 1 
ATOM   669   C  CD2 . LEU A 1 83  ? 21.018  -4.747  13.146  1.00 87.79  ? 193 LEU A CD2 1 
ATOM   670   N  N   . LYS B 2 15  ? 19.408  -10.240 -4.836  1.00 124.10 ? 148 LYS B N   1 
ATOM   671   C  CA  . LYS B 2 15  ? 18.136  -9.526  -5.159  1.00 123.48 ? 148 LYS B CA  1 
ATOM   672   C  C   . LYS B 2 15  ? 17.752  -8.500  -4.073  1.00 125.97 ? 148 LYS B C   1 
ATOM   673   O  O   . LYS B 2 15  ? 18.484  -8.336  -3.088  1.00 124.77 ? 148 LYS B O   1 
ATOM   674   C  CB  . LYS B 2 15  ? 17.009  -10.545 -5.371  1.00 118.20 ? 148 LYS B CB  1 
ATOM   675   C  CG  . LYS B 2 15  ? 17.210  -11.475 -6.564  1.00 111.49 ? 148 LYS B CG  1 
ATOM   676   C  CD  . LYS B 2 15  ? 16.077  -12.474 -6.654  1.00 107.62 ? 148 LYS B CD  1 
ATOM   677   C  CE  . LYS B 2 15  ? 16.195  -13.372 -7.868  1.00 103.49 ? 148 LYS B CE  1 
ATOM   678   N  NZ  . LYS B 2 15  ? 15.095  -14.383 -7.919  1.00 102.63 ? 148 LYS B NZ  1 
ATOM   679   N  N   . HIS B 2 16  ? 16.616  -7.814  -4.273  1.00 129.08 ? 149 HIS B N   1 
ATOM   680   C  CA  . HIS B 2 16  ? 16.088  -6.788  -3.351  1.00 131.73 ? 149 HIS B CA  1 
ATOM   681   C  C   . HIS B 2 16  ? 16.223  -7.165  -1.869  1.00 130.40 ? 149 HIS B C   1 
ATOM   682   O  O   . HIS B 2 16  ? 15.292  -7.711  -1.264  1.00 128.45 ? 149 HIS B O   1 
ATOM   683   C  CB  . HIS B 2 16  ? 14.608  -6.488  -3.655  1.00 134.49 ? 149 HIS B CB  1 
ATOM   684   C  CG  . HIS B 2 16  ? 14.374  -5.745  -4.936  1.00 137.05 ? 149 HIS B CG  1 
ATOM   685   N  ND1 . HIS B 2 16  ? 13.243  -4.986  -5.155  1.00 138.50 ? 149 HIS B ND1 1 
ATOM   686   C  CD2 . HIS B 2 16  ? 15.110  -5.655  -6.069  1.00 138.91 ? 149 HIS B CD2 1 
ATOM   687   C  CE1 . HIS B 2 16  ? 13.293  -4.462  -6.367  1.00 140.12 ? 149 HIS B CE1 1 
ATOM   688   N  NE2 . HIS B 2 16  ? 14.416  -4.852  -6.942  1.00 140.37 ? 149 HIS B NE2 1 
ATOM   689   N  N   . GLN B 2 17  ? 17.371  -6.815  -1.289  1.00 131.77 ? 150 GLN B N   1 
ATOM   690   C  CA  . GLN B 2 17  ? 17.690  -7.103  0.109   1.00 133.88 ? 150 GLN B CA  1 
ATOM   691   C  C   . GLN B 2 17  ? 17.573  -8.605  0.387   1.00 133.68 ? 150 GLN B C   1 
ATOM   692   O  O   . GLN B 2 17  ? 16.562  -9.067  0.927   1.00 135.19 ? 150 GLN B O   1 
ATOM   693   C  CB  . GLN B 2 17  ? 16.776  -6.317  1.067   1.00 136.85 ? 150 GLN B CB  1 
ATOM   694   C  CG  . GLN B 2 17  ? 16.661  -4.812  0.808   1.00 140.26 ? 150 GLN B CG  1 
ATOM   695   C  CD  . GLN B 2 17  ? 15.543  -4.464  -0.164  1.00 143.42 ? 150 GLN B CD  1 
ATOM   696   O  OE1 . GLN B 2 17  ? 15.731  -3.669  -1.083  1.00 145.83 ? 150 GLN B OE1 1 
ATOM   697   N  NE2 . GLN B 2 17  ? 14.372  -5.063  0.035   1.00 143.54 ? 150 GLN B NE2 1 
ATOM   698   N  N   . LEU B 2 18  ? 18.601  -9.365  0.010   1.00 131.14 ? 151 LEU B N   1 
ATOM   699   C  CA  . LEU B 2 18  ? 18.603  -10.816 0.217   1.00 128.21 ? 151 LEU B CA  1 
ATOM   700   C  C   . LEU B 2 18  ? 18.463  -11.244 1.681   1.00 125.98 ? 151 LEU B C   1 
ATOM   701   O  O   . LEU B 2 18  ? 18.124  -12.399 1.957   1.00 127.31 ? 151 LEU B O   1 
ATOM   702   C  CB  . LEU B 2 18  ? 19.854  -11.456 -0.398  1.00 127.93 ? 151 LEU B CB  1 
ATOM   703   C  CG  . LEU B 2 18  ? 19.864  -11.670 -1.916  1.00 128.12 ? 151 LEU B CG  1 
ATOM   704   C  CD1 . LEU B 2 18  ? 21.212  -12.229 -2.360  1.00 128.34 ? 151 LEU B CD1 1 
ATOM   705   C  CD2 . LEU B 2 18  ? 18.740  -12.620 -2.315  1.00 128.17 ? 151 LEU B CD2 1 
ATOM   706   N  N   . TYR B 2 19  ? 18.708  -10.305 2.600   1.00 122.28 ? 152 TYR B N   1 
ATOM   707   C  CA  . TYR B 2 19  ? 18.616  -10.533 4.048   1.00 117.46 ? 152 TYR B CA  1 
ATOM   708   C  C   . TYR B 2 19  ? 19.249  -11.846 4.476   1.00 115.55 ? 152 TYR B C   1 
ATOM   709   O  O   . TYR B 2 19  ? 18.549  -12.785 4.868   1.00 115.81 ? 152 TYR B O   1 
ATOM   710   C  CB  . TYR B 2 19  ? 17.158  -10.488 4.516   1.00 114.57 ? 152 TYR B CB  1 
ATOM   711   C  CG  . TYR B 2 19  ? 16.561  -9.105  4.578   1.00 113.13 ? 152 TYR B CG  1 
ATOM   712   C  CD1 . TYR B 2 19  ? 17.344  -7.970  4.367   1.00 113.78 ? 152 TYR B CD1 1 
ATOM   713   C  CD2 . TYR B 2 19  ? 15.212  -8.929  4.865   1.00 113.39 ? 152 TYR B CD2 1 
ATOM   714   C  CE1 . TYR B 2 19  ? 16.797  -6.692  4.441   1.00 115.94 ? 152 TYR B CE1 1 
ATOM   715   C  CE2 . TYR B 2 19  ? 14.652  -7.659  4.945   1.00 116.16 ? 152 TYR B CE2 1 
ATOM   716   C  CZ  . TYR B 2 19  ? 15.448  -6.540  4.731   1.00 117.25 ? 152 TYR B CZ  1 
ATOM   717   O  OH  . TYR B 2 19  ? 14.898  -5.274  4.804   1.00 118.59 ? 152 TYR B OH  1 
ATOM   718   N  N   . ILE B 2 20  ? 20.574  -11.911 4.396   1.00 112.23 ? 153 ILE B N   1 
ATOM   719   C  CA  . ILE B 2 20  ? 21.299  -13.126 4.763   1.00 106.91 ? 153 ILE B CA  1 
ATOM   720   C  C   . ILE B 2 20  ? 21.575  -13.203 6.276   1.00 100.17 ? 153 ILE B C   1 
ATOM   721   O  O   . ILE B 2 20  ? 22.708  -13.409 6.729   1.00 95.87  ? 153 ILE B O   1 
ATOM   722   C  CB  . ILE B 2 20  ? 22.593  -13.302 3.891   1.00 106.79 ? 153 ILE B CB  1 
ATOM   723   C  CG1 . ILE B 2 20  ? 22.230  -13.239 2.397   1.00 103.24 ? 153 ILE B CG1 1 
ATOM   724   C  CG2 . ILE B 2 20  ? 23.264  -14.656 4.163   1.00 108.71 ? 153 ILE B CG2 1 
ATOM   725   C  CD1 . ILE B 2 20  ? 21.223  -14.298 1.937   1.00 100.62 ? 153 ILE B CD1 1 
ATOM   726   N  N   . ASP B 2 21  ? 20.510  -13.016 7.052   1.00 94.91  ? 154 ASP B N   1 
ATOM   727   C  CA  . ASP B 2 21  ? 20.596  -13.102 8.497   1.00 90.61  ? 154 ASP B CA  1 
ATOM   728   C  C   . ASP B 2 21  ? 20.544  -14.587 8.848   1.00 91.68  ? 154 ASP B C   1 
ATOM   729   O  O   . ASP B 2 21  ? 20.089  -14.973 9.928   1.00 89.38  ? 154 ASP B O   1 
ATOM   730   C  CB  . ASP B 2 21  ? 19.455  -12.318 9.157   1.00 87.71  ? 154 ASP B CB  1 
ATOM   731   C  CG  . ASP B 2 21  ? 19.633  -10.799 9.036   1.00 84.67  ? 154 ASP B CG  1 
ATOM   732   O  OD1 . ASP B 2 21  ? 19.647  -10.279 7.896   1.00 80.48  ? 154 ASP B OD1 1 
ATOM   733   O  OD2 . ASP B 2 21  ? 19.754  -10.121 10.085  1.00 83.80  ? 154 ASP B OD2 1 
ATOM   734   N  N   . GLU B 2 22  ? 20.949  -15.408 7.873   1.00 95.68  ? 155 GLU B N   1 
ATOM   735   C  CA  . GLU B 2 22  ? 21.034  -16.863 8.009   1.00 100.45 ? 155 GLU B CA  1 
ATOM   736   C  C   . GLU B 2 22  ? 22.485  -17.144 8.422   1.00 101.71 ? 155 GLU B C   1 
ATOM   737   O  O   . GLU B 2 22  ? 22.834  -18.257 8.833   1.00 103.42 ? 155 GLU B O   1 
ATOM   738   C  CB  . GLU B 2 22  ? 20.692  -17.571 6.687   1.00 102.13 ? 155 GLU B CB  1 
ATOM   739   C  CG  . GLU B 2 22  ? 21.730  -17.410 5.575   1.00 104.98 ? 155 GLU B CG  1 
ATOM   740   C  CD  . GLU B 2 22  ? 22.561  -18.667 5.324   1.00 107.58 ? 155 GLU B CD  1 
ATOM   741   O  OE1 . GLU B 2 22  ? 22.786  -19.457 6.273   1.00 108.80 ? 155 GLU B OE1 1 
ATOM   742   O  OE2 . GLU B 2 22  ? 22.994  -18.858 4.163   1.00 108.80 ? 155 GLU B OE2 1 
ATOM   743   N  N   . THR B 2 23  ? 23.333  -16.127 8.251   1.00 100.41 ? 156 THR B N   1 
ATOM   744   C  CA  . THR B 2 23  ? 24.740  -16.185 8.646   1.00 95.75  ? 156 THR B CA  1 
ATOM   745   C  C   . THR B 2 23  ? 24.680  -16.043 10.174  1.00 91.70  ? 156 THR B C   1 
ATOM   746   O  O   . THR B 2 23  ? 25.569  -16.491 10.906  1.00 89.81  ? 156 THR B O   1 
ATOM   747   C  CB  . THR B 2 23  ? 25.536  -14.997 8.054   1.00 95.67  ? 156 THR B CB  1 
ATOM   748   O  OG1 . THR B 2 23  ? 25.214  -14.842 6.666   1.00 94.79  ? 156 THR B OG1 1 
ATOM   749   C  CG2 . THR B 2 23  ? 27.032  -15.244 8.187   1.00 96.22  ? 156 THR B CG2 1 
ATOM   750   N  N   . VAL B 2 24  ? 23.599  -15.401 10.621  1.00 86.98  ? 157 VAL B N   1 
ATOM   751   C  CA  . VAL B 2 24  ? 23.284  -15.182 12.024  1.00 78.59  ? 157 VAL B CA  1 
ATOM   752   C  C   . VAL B 2 24  ? 23.110  -16.565 12.666  1.00 77.97  ? 157 VAL B C   1 
ATOM   753   O  O   . VAL B 2 24  ? 23.318  -16.721 13.865  1.00 77.70  ? 157 VAL B O   1 
ATOM   754   C  CB  . VAL B 2 24  ? 21.984  -14.323 12.151  1.00 74.94  ? 157 VAL B CB  1 
ATOM   755   C  CG1 . VAL B 2 24  ? 21.447  -14.345 13.557  1.00 72.23  ? 157 VAL B CG1 1 
ATOM   756   C  CG2 . VAL B 2 24  ? 22.258  -12.879 11.702  1.00 72.77  ? 157 VAL B CG2 1 
ATOM   757   N  N   . ASN B 2 25  ? 22.773  -17.565 11.842  1.00 79.66  ? 158 ASN B N   1 
ATOM   758   C  CA  . ASN B 2 25  ? 22.592  -18.960 12.285  1.00 80.31  ? 158 ASN B CA  1 
ATOM   759   C  C   . ASN B 2 25  ? 23.954  -19.655 12.429  1.00 78.16  ? 158 ASN B C   1 
ATOM   760   O  O   . ASN B 2 25  ? 24.041  -20.881 12.564  1.00 75.45  ? 158 ASN B O   1 
ATOM   761   C  CB  . ASN B 2 25  ? 21.711  -19.757 11.298  1.00 83.74  ? 158 ASN B CB  1 
ATOM   762   C  CG  . ASN B 2 25  ? 20.253  -19.288 11.279  1.00 86.72  ? 158 ASN B CG  1 
ATOM   763   O  OD1 . ASN B 2 25  ? 19.585  -19.231 12.318  1.00 86.46  ? 158 ASN B OD1 1 
ATOM   764   N  ND2 . ASN B 2 25  ? 19.749  -18.976 10.088  1.00 89.58  ? 158 ASN B ND2 1 
ATOM   765   N  N   . SER B 2 26  ? 25.011  -18.854 12.340  1.00 78.63  ? 159 SER B N   1 
ATOM   766   C  CA  . SER B 2 26  ? 26.387  -19.312 12.484  1.00 81.86  ? 159 SER B CA  1 
ATOM   767   C  C   . SER B 2 26  ? 27.012  -18.249 13.366  1.00 83.27  ? 159 SER B C   1 
ATOM   768   O  O   . SER B 2 26  ? 27.959  -18.505 14.110  1.00 84.84  ? 159 SER B O   1 
ATOM   769   C  CB  . SER B 2 26  ? 27.096  -19.331 11.132  1.00 83.46  ? 159 SER B CB  1 
ATOM   770   O  OG  . SER B 2 26  ? 26.395  -20.140 10.211  1.00 84.05  ? 159 SER B OG  1 
ATOM   771   N  N   . ASN B 2 27  ? 26.419  -17.060 13.289  1.00 82.72  ? 160 ASN B N   1 
ATOM   772   C  CA  . ASN B 2 27  ? 26.838  -15.891 14.041  1.00 83.02  ? 160 ASN B CA  1 
ATOM   773   C  C   . ASN B 2 27  ? 26.432  -16.012 15.513  1.00 82.73  ? 160 ASN B C   1 
ATOM   774   O  O   . ASN B 2 27  ? 27.293  -16.030 16.398  1.00 81.74  ? 160 ASN B O   1 
ATOM   775   C  CB  . ASN B 2 27  ? 26.204  -14.653 13.418  1.00 82.79  ? 160 ASN B CB  1 
ATOM   776   C  CG  . ASN B 2 27  ? 26.875  -13.381 13.847  1.00 86.09  ? 160 ASN B CG  1 
ATOM   777   O  OD1 . ASN B 2 27  ? 27.896  -12.984 13.281  1.00 88.11  ? 160 ASN B OD1 1 
ATOM   778   N  ND2 . ASN B 2 27  ? 26.304  -12.720 14.850  1.00 86.11  ? 160 ASN B ND2 1 
ATOM   779   N  N   . ILE B 2 28  ? 25.124  -16.104 15.766  1.00 80.05  ? 161 ILE B N   1 
ATOM   780   C  CA  . ILE B 2 28  ? 24.591  -16.235 17.126  1.00 77.35  ? 161 ILE B CA  1 
ATOM   781   C  C   . ILE B 2 28  ? 25.167  -17.422 17.891  1.00 77.93  ? 161 ILE B C   1 
ATOM   782   O  O   . ILE B 2 28  ? 25.556  -17.278 19.047  1.00 73.91  ? 161 ILE B O   1 
ATOM   783   C  CB  . ILE B 2 28  ? 23.048  -16.311 17.142  1.00 76.08  ? 161 ILE B CB  1 
ATOM   784   C  CG1 . ILE B 2 28  ? 22.452  -14.990 16.671  1.00 75.53  ? 161 ILE B CG1 1 
ATOM   785   C  CG2 . ILE B 2 28  ? 22.548  -16.612 18.531  1.00 78.11  ? 161 ILE B CG2 1 
ATOM   786   C  CD1 . ILE B 2 28  ? 22.898  -13.806 17.457  1.00 74.86  ? 161 ILE B CD1 1 
ATOM   787   N  N   . PRO B 2 29  ? 25.216  -18.610 17.259  1.00 83.59  ? 162 PRO B N   1 
ATOM   788   C  CA  . PRO B 2 29  ? 25.750  -19.833 17.878  1.00 88.16  ? 162 PRO B CA  1 
ATOM   789   C  C   . PRO B 2 29  ? 27.131  -19.651 18.518  1.00 90.39  ? 162 PRO B C   1 
ATOM   790   O  O   . PRO B 2 29  ? 27.339  -20.018 19.679  1.00 93.19  ? 162 PRO B O   1 
ATOM   791   C  CB  . PRO B 2 29  ? 25.806  -20.803 16.701  1.00 89.11  ? 162 PRO B CB  1 
ATOM   792   C  CG  . PRO B 2 29  ? 24.594  -20.422 15.927  1.00 88.09  ? 162 PRO B CG  1 
ATOM   793   C  CD  . PRO B 2 29  ? 24.671  -18.913 15.921  1.00 85.29  ? 162 PRO B CD  1 
ATOM   794   N  N   . THR B 2 30  ? 28.074  -19.104 17.753  1.00 91.47  ? 163 THR B N   1 
ATOM   795   C  CA  . THR B 2 30  ? 29.417  -18.860 18.265  1.00 90.27  ? 163 THR B CA  1 
ATOM   796   C  C   . THR B 2 30  ? 29.353  -17.781 19.339  1.00 90.00  ? 163 THR B C   1 
ATOM   797   O  O   . THR B 2 30  ? 29.908  -17.957 20.425  1.00 90.08  ? 163 THR B O   1 
ATOM   798   C  CB  . THR B 2 30  ? 30.387  -18.399 17.161  1.00 88.17  ? 163 THR B CB  1 
ATOM   799   O  OG1 . THR B 2 30  ? 29.903  -17.186 16.567  1.00 84.58  ? 163 THR B OG1 1 
ATOM   800   C  CG2 . THR B 2 30  ? 30.525  -19.476 16.099  1.00 90.62  ? 163 THR B CG2 1 
ATOM   801   N  N   . ASN B 2 31  ? 28.642  -16.688 19.052  1.00 85.79  ? 164 ASN B N   1 
ATOM   802   C  CA  . ASN B 2 31  ? 28.524  -15.602 20.021  1.00 83.99  ? 164 ASN B CA  1 
ATOM   803   C  C   . ASN B 2 31  ? 27.671  -15.969 21.237  1.00 85.34  ? 164 ASN B C   1 
ATOM   804   O  O   . ASN B 2 31  ? 27.240  -15.099 22.003  1.00 90.00  ? 164 ASN B O   1 
ATOM   805   C  CB  . ASN B 2 31  ? 28.038  -14.298 19.364  1.00 81.05  ? 164 ASN B CB  1 
ATOM   806   C  CG  . ASN B 2 31  ? 26.579  -14.342 18.928  1.00 77.71  ? 164 ASN B CG  1 
ATOM   807   O  OD1 . ASN B 2 31  ? 26.253  -13.920 17.819  1.00 78.06  ? 164 ASN B OD1 1 
ATOM   808   N  ND2 . ASN B 2 31  ? 25.693  -14.794 19.810  1.00 75.02  ? 164 ASN B ND2 1 
ATOM   809   N  N   . LEU B 2 32  ? 27.378  -17.257 21.374  1.00 81.96  ? 165 LEU B N   1 
ATOM   810   C  CA  . LEU B 2 32  ? 26.608  -17.740 22.504  1.00 78.25  ? 165 LEU B CA  1 
ATOM   811   C  C   . LEU B 2 32  ? 27.402  -18.836 23.175  1.00 78.42  ? 165 LEU B C   1 
ATOM   812   O  O   . LEU B 2 32  ? 27.165  -19.155 24.339  1.00 78.01  ? 165 LEU B O   1 
ATOM   813   C  CB  . LEU B 2 32  ? 25.234  -18.241 22.073  1.00 75.84  ? 165 LEU B CB  1 
ATOM   814   C  CG  . LEU B 2 32  ? 24.116  -17.465 22.773  1.00 70.20  ? 165 LEU B CG  1 
ATOM   815   C  CD1 . LEU B 2 32  ? 24.187  -15.984 22.404  1.00 63.59  ? 165 LEU B CD1 1 
ATOM   816   C  CD2 . LEU B 2 32  ? 22.772  -18.051 22.399  1.00 67.38  ? 165 LEU B CD2 1 
ATOM   817   N  N   . ARG B 2 33  ? 28.349  -19.404 22.430  1.00 80.57  ? 166 ARG B N   1 
ATOM   818   C  CA  . ARG B 2 33  ? 29.229  -20.448 22.952  1.00 87.02  ? 166 ARG B CA  1 
ATOM   819   C  C   . ARG B 2 33  ? 30.080  -19.793 24.037  1.00 83.71  ? 166 ARG B C   1 
ATOM   820   O  O   . ARG B 2 33  ? 30.426  -20.423 25.048  1.00 78.58  ? 166 ARG B O   1 
ATOM   821   C  CB  . ARG B 2 33  ? 30.147  -20.984 21.844  1.00 93.60  ? 166 ARG B CB  1 
ATOM   822   C  CG  . ARG B 2 33  ? 31.114  -22.079 22.304  1.00 101.25 ? 166 ARG B CG  1 
ATOM   823   C  CD  . ARG B 2 33  ? 32.042  -22.523 21.175  1.00 107.34 ? 166 ARG B CD  1 
ATOM   824   N  NE  . ARG B 2 33  ? 32.749  -23.765 21.497  1.00 112.83 ? 166 ARG B NE  1 
ATOM   825   C  CZ  . ARG B 2 33  ? 32.401  -24.971 21.047  1.00 115.76 ? 166 ARG B CZ  1 
ATOM   826   N  NH1 . ARG B 2 33  ? 31.349  -25.113 20.247  1.00 116.83 ? 166 ARG B NH1 1 
ATOM   827   N  NH2 . ARG B 2 33  ? 33.100  -26.042 21.408  1.00 117.51 ? 166 ARG B NH2 1 
ATOM   828   N  N   . VAL B 2 34  ? 30.418  -18.461 23.962  1.00 82.97  ? 167 VAL B N   1 
ATOM   829   C  CA  . VAL B 2 34  ? 31.185  -17.736 24.977  1.00 79.79  ? 167 VAL B CA  1 
ATOM   830   C  C   . VAL B 2 34  ? 30.279  -17.291 26.106  1.00 76.94  ? 167 VAL B C   1 
ATOM   831   O  O   . VAL B 2 34  ? 30.518  -17.646 27.266  1.00 76.76  ? 167 VAL B O   1 
ATOM   832   C  CB  . VAL B 2 34  ? 31.942  -16.488 24.412  1.00 78.88  ? 167 VAL B CB  1 
ATOM   833   C  CG1 . VAL B 2 34  ? 33.191  -16.914 23.600  1.00 73.41  ? 167 VAL B CG1 1 
ATOM   834   C  CG2 . VAL B 2 34  ? 30.986  -15.632 23.579  1.00 75.55  ? 167 VAL B CG2 1 
ATOM   835   N  N   . LEU B 2 35  ? 29.238  -16.599 25.592  1.00 71.25  ? 168 LEU B N   1 
ATOM   836   C  CA  . LEU B 2 35  ? 28.337  -16.099 26.621  1.00 73.75  ? 168 LEU B CA  1 
ATOM   837   C  C   . LEU B 2 35  ? 27.912  -17.162 27.633  1.00 75.21  ? 168 LEU B C   1 
ATOM   838   O  O   . LEU B 2 35  ? 27.485  -16.839 28.740  1.00 78.74  ? 168 LEU B O   1 
ATOM   839   C  CB  . LEU B 2 35  ? 27.120  -15.429 25.981  1.00 77.62  ? 168 LEU B CB  1 
ATOM   840   C  CG  . LEU B 2 35  ? 26.377  -14.415 26.860  1.00 76.50  ? 168 LEU B CG  1 
ATOM   841   C  CD1 . LEU B 2 35  ? 25.949  -13.206 26.049  1.00 71.76  ? 168 LEU B CD1 1 
ATOM   842   C  CD2 . LEU B 2 35  ? 25.189  -15.069 27.539  1.00 77.62  ? 168 LEU B CD2 1 
ATOM   843   N  N   . ARG B 2 36  ? 28.025  -18.430 27.259  1.00 75.17  ? 169 ARG B N   1 
ATOM   844   C  CA  . ARG B 2 36  ? 27.682  -19.489 28.184  1.00 78.15  ? 169 ARG B CA  1 
ATOM   845   C  C   . ARG B 2 36  ? 28.912  -19.782 29.035  1.00 76.52  ? 169 ARG B C   1 
ATOM   846   O  O   . ARG B 2 36  ? 28.897  -19.575 30.245  1.00 79.22  ? 169 ARG B O   1 
ATOM   847   C  CB  . ARG B 2 36  ? 27.238  -20.749 27.437  1.00 86.08  ? 169 ARG B CB  1 
ATOM   848   C  CG  . ARG B 2 36  ? 26.702  -21.851 28.357  1.00 95.83  ? 169 ARG B CG  1 
ATOM   849   C  CD  . ARG B 2 36  ? 26.320  -23.116 27.585  1.00 102.99 ? 169 ARG B CD  1 
ATOM   850   N  NE  . ARG B 2 36  ? 25.806  -24.177 28.455  1.00 107.84 ? 169 ARG B NE  1 
ATOM   851   C  CZ  . ARG B 2 36  ? 26.521  -25.215 28.889  1.00 110.91 ? 169 ARG B CZ  1 
ATOM   852   N  NH1 . ARG B 2 36  ? 27.798  -25.351 28.542  1.00 112.37 ? 169 ARG B NH1 1 
ATOM   853   N  NH2 . ARG B 2 36  ? 25.953  -26.124 29.675  1.00 112.18 ? 169 ARG B NH2 1 
ATOM   854   N  N   . SER B 2 37  ? 29.999  -20.166 28.369  1.00 73.36  ? 170 SER B N   1 
ATOM   855   C  CA  . SER B 2 37  ? 31.267  -20.528 29.015  1.00 75.59  ? 170 SER B CA  1 
ATOM   856   C  C   . SER B 2 37  ? 31.711  -19.640 30.163  1.00 70.83  ? 170 SER B C   1 
ATOM   857   O  O   . SER B 2 37  ? 32.355  -20.115 31.105  1.00 69.23  ? 170 SER B O   1 
ATOM   858   C  CB  . SER B 2 37  ? 32.394  -20.571 27.986  1.00 79.69  ? 170 SER B CB  1 
ATOM   859   O  OG  . SER B 2 37  ? 32.721  -19.261 27.552  1.00 81.79  ? 170 SER B OG  1 
ATOM   860   N  N   . ILE B 2 38  ? 31.412  -18.349 30.048  1.00 65.94  ? 171 ILE B N   1 
ATOM   861   C  CA  . ILE B 2 38  ? 31.787  -17.383 31.074  1.00 64.28  ? 171 ILE B CA  1 
ATOM   862   C  C   . ILE B 2 38  ? 30.742  -17.284 32.163  1.00 61.66  ? 171 ILE B C   1 
ATOM   863   O  O   . ILE B 2 38  ? 31.069  -17.335 33.345  1.00 64.18  ? 171 ILE B O   1 
ATOM   864   C  CB  . ILE B 2 38  ? 32.023  -15.977 30.497  1.00 68.71  ? 171 ILE B CB  1 
ATOM   865   C  CG1 . ILE B 2 38  ? 30.712  -15.372 29.989  1.00 69.14  ? 171 ILE B CG1 1 
ATOM   866   C  CG2 . ILE B 2 38  ? 33.071  -16.040 29.376  1.00 74.29  ? 171 ILE B CG2 1 
ATOM   867   C  CD1 . ILE B 2 38  ? 30.813  -13.900 29.655  1.00 72.37  ? 171 ILE B CD1 1 
ATOM   868   N  N   . LEU B 2 39  ? 29.482  -17.177 31.763  1.00 58.78  ? 172 LEU B N   1 
ATOM   869   C  CA  . LEU B 2 39  ? 28.399  -17.085 32.721  1.00 57.90  ? 172 LEU B CA  1 
ATOM   870   C  C   . LEU B 2 39  ? 28.356  -18.329 33.604  1.00 59.56  ? 172 LEU B C   1 
ATOM   871   O  O   . LEU B 2 39  ? 27.737  -18.319 34.653  1.00 57.19  ? 172 LEU B O   1 
ATOM   872   C  CB  . LEU B 2 39  ? 27.072  -16.879 31.995  1.00 59.13  ? 172 LEU B CB  1 
ATOM   873   C  CG  . LEU B 2 39  ? 25.866  -16.450 32.831  1.00 61.37  ? 172 LEU B CG  1 
ATOM   874   C  CD1 . LEU B 2 39  ? 26.118  -15.161 33.536  1.00 62.57  ? 172 LEU B CD1 1 
ATOM   875   C  CD2 . LEU B 2 39  ? 24.674  -16.288 31.948  1.00 66.85  ? 172 LEU B CD2 1 
ATOM   876   N  N   . GLU B 2 40  ? 29.047  -19.386 33.185  1.00 65.88  ? 173 GLU B N   1 
ATOM   877   C  CA  . GLU B 2 40  ? 29.105  -20.623 33.958  1.00 70.22  ? 173 GLU B CA  1 
ATOM   878   C  C   . GLU B 2 40  ? 30.390  -20.666 34.779  1.00 64.77  ? 173 GLU B C   1 
ATOM   879   O  O   . GLU B 2 40  ? 30.418  -21.241 35.869  1.00 63.07  ? 173 GLU B O   1 
ATOM   880   C  CB  . GLU B 2 40  ? 29.006  -21.865 33.049  1.00 79.99  ? 173 GLU B CB  1 
ATOM   881   C  CG  . GLU B 2 40  ? 27.690  -21.970 32.253  1.00 84.35  ? 173 GLU B CG  1 
ATOM   882   C  CD  . GLU B 2 40  ? 27.229  -23.406 32.000  1.00 85.20  ? 173 GLU B CD  1 
ATOM   883   O  OE1 . GLU B 2 40  ? 28.090  -24.306 31.879  1.00 88.76  ? 173 GLU B OE1 1 
ATOM   884   O  OE2 . GLU B 2 40  ? 25.998  -23.629 31.919  1.00 80.69  ? 173 GLU B OE2 1 
ATOM   885   N  N   . ASN B 2 41  ? 31.449  -20.058 34.249  1.00 60.60  ? 174 ASN B N   1 
ATOM   886   C  CA  . ASN B 2 41  ? 32.731  -20.015 34.937  1.00 57.08  ? 174 ASN B CA  1 
ATOM   887   C  C   . ASN B 2 41  ? 32.569  -19.176 36.187  1.00 54.60  ? 174 ASN B C   1 
ATOM   888   O  O   . ASN B 2 41  ? 33.309  -19.335 37.154  1.00 49.77  ? 174 ASN B O   1 
ATOM   889   C  CB  . ASN B 2 41  ? 33.806  -19.399 34.058  1.00 58.30  ? 174 ASN B CB  1 
ATOM   890   C  CG  . ASN B 2 41  ? 35.206  -19.788 34.494  1.00 62.73  ? 174 ASN B CG  1 
ATOM   891   O  OD1 . ASN B 2 41  ? 36.126  -19.830 33.679  1.00 64.70  ? 174 ASN B OD1 1 
ATOM   892   N  ND2 . ASN B 2 41  ? 35.371  -20.104 35.775  1.00 64.92  ? 174 ASN B ND2 1 
ATOM   893   N  N   . LEU B 2 42  ? 31.601  -18.265 36.159  1.00 53.33  ? 175 LEU B N   1 
ATOM   894   C  CA  . LEU B 2 42  ? 31.314  -17.414 37.311  1.00 47.93  ? 175 LEU B CA  1 
ATOM   895   C  C   . LEU B 2 42  ? 30.471  -18.189 38.329  1.00 47.18  ? 175 LEU B C   1 
ATOM   896   O  O   . LEU B 2 42  ? 30.598  -17.973 39.531  1.00 46.32  ? 175 LEU B O   1 
ATOM   897   C  CB  . LEU B 2 42  ? 30.595  -16.136 36.879  1.00 45.07  ? 175 LEU B CB  1 
ATOM   898   C  CG  . LEU B 2 42  ? 31.327  -15.309 35.816  1.00 47.48  ? 175 LEU B CG  1 
ATOM   899   C  CD1 . LEU B 2 42  ? 30.590  -13.999 35.590  1.00 41.66  ? 175 LEU B CD1 1 
ATOM   900   C  CD2 . LEU B 2 42  ? 32.791  -15.053 36.209  1.00 50.21  ? 175 LEU B CD2 1 
ATOM   901   N  N   . ARG B 2 43  ? 29.780  -18.883 37.798  1.00 46.90  ? 176 ARG B N   1 
ATOM   902   C  CA  . ARG B 2 43  ? 28.891  -19.728 38.566  1.00 41.43  ? 176 ARG B CA  1 
ATOM   903   C  C   . ARG B 2 43  ? 29.719  -20.703 39.410  1.00 40.75  ? 176 ARG B C   1 
ATOM   904   O  O   . ARG B 2 43  ? 29.308  -21.085 40.506  1.00 37.58  ? 176 ARG B O   1 
ATOM   905   C  CB  . ARG B 2 43  ? 27.981  -20.439 37.560  1.00 47.79  ? 176 ARG B CB  1 
ATOM   906   C  CG  . ARG B 2 43  ? 26.756  -21.121 38.100  1.00 45.76  ? 176 ARG B CG  1 
ATOM   907   C  CD  . ARG B 2 43  ? 27.113  -22.565 38.449  1.00 61.77  ? 176 ARG B CD  1 
ATOM   908   N  NE  . ARG B 2 43  ? 25.941  -23.441 38.429  1.00 69.85  ? 176 ARG B NE  1 
ATOM   909   C  CZ  . ARG B 2 43  ? 25.165  -23.605 37.354  1.00 75.84  ? 176 ARG B CZ  1 
ATOM   910   N  NH1 . ARG B 2 43  ? 25.455  -22.954 36.200  1.00 76.46  ? 176 ARG B NH1 1 
ATOM   911   N  NH2 . ARG B 2 43  ? 24.063  -24.381 37.455  1.00 83.50  ? 176 ARG B NH2 1 
ATOM   912   N  N   . SER B 2 44  ? 30.870  -21.162 38.962  1.00 40.91  ? 177 SER B N   1 
ATOM   913   C  CA  . SER B 2 44  ? 31.854  -21.991 39.631  1.00 51.54  ? 177 SER B CA  1 
ATOM   914   C  C   . SER B 2 44  ? 32.717  -21.186 40.585  1.00 44.63  ? 177 SER B C   1 
ATOM   915   O  O   . SER B 2 44  ? 32.980  -21.618 41.703  1.00 43.93  ? 177 SER B O   1 
ATOM   916   C  CB  . SER B 2 44  ? 32.742  -22.701 38.607  1.00 65.26  ? 177 SER B CB  1 
ATOM   917   O  OG  . SER B 2 44  ? 33.554  -21.781 37.886  1.00 73.84  ? 177 SER B OG  1 
ATOM   918   N  N   . LYS B 2 45  ? 33.137  -20.004 40.159  1.00 39.53  ? 178 LYS B N   1 
ATOM   919   C  CA  . LYS B 2 45  ? 33.994  -19.202 41.004  1.00 41.28  ? 178 LYS B CA  1 
ATOM   920   C  C   . LYS B 2 45  ? 33.338  -18.900 42.307  1.00 36.82  ? 178 LYS B C   1 
ATOM   921   O  O   . LYS B 2 45  ? 33.987  -18.921 43.354  1.00 42.50  ? 178 LYS B O   1 
ATOM   922   C  CB  . LYS B 2 45  ? 34.420  -17.929 40.303  1.00 45.55  ? 178 LYS B CB  1 
ATOM   923   C  CG  . LYS B 2 45  ? 35.460  -18.217 39.265  1.00 53.30  ? 178 LYS B CG  1 
ATOM   924   C  CD  . LYS B 2 45  ? 35.786  -17.019 38.414  1.00 55.52  ? 178 LYS B CD  1 
ATOM   925   C  CE  . LYS B 2 45  ? 36.854  -17.393 37.405  1.00 59.80  ? 178 LYS B CE  1 
ATOM   926   N  NZ  . LYS B 2 45  ? 38.084  -17.953 38.065  1.00 63.23  ? 178 LYS B NZ  1 
ATOM   927   N  N   . ILE B 2 46  ? 32.026  -18.736 42.264  1.00 28.50  ? 179 ILE B N   1 
ATOM   928   C  CA  . ILE B 2 46  ? 31.294  -18.422 43.478  1.00 30.88  ? 179 ILE B CA  1 
ATOM   929   C  C   . ILE B 2 46  ? 31.435  -19.510 44.532  1.00 34.28  ? 179 ILE B C   1 
ATOM   930   O  O   . ILE B 2 46  ? 31.767  -19.229 45.685  1.00 37.86  ? 179 ILE B O   1 
ATOM   931   C  CB  . ILE B 2 46  ? 29.797  -18.181 43.204  1.00 28.55  ? 179 ILE B CB  1 
ATOM   932   C  CG1 . ILE B 2 46  ? 29.621  -17.046 42.199  1.00 27.70  ? 179 ILE B CG1 1 
ATOM   933   C  CG2 . ILE B 2 46  ? 29.072  -17.806 44.491  1.00 24.97  ? 179 ILE B CG2 1 
ATOM   934   C  CD1 . ILE B 2 46  ? 28.194  -16.819 41.819  1.00 31.14  ? 179 ILE B CD1 1 
ATOM   935   N  N   . GLN B 2 47  ? 31.218  -20.753 44.134  1.00 35.85  ? 180 GLN B N   1 
ATOM   936   C  CA  . GLN B 2 47  ? 31.308  -21.829 45.089  1.00 36.30  ? 180 GLN B CA  1 
ATOM   937   C  C   . GLN B 2 47  ? 32.641  -21.860 45.807  1.00 32.87  ? 180 GLN B C   1 
ATOM   938   O  O   . GLN B 2 47  ? 32.665  -22.084 47.012  1.00 36.23  ? 180 GLN B O   1 
ATOM   939   C  CB  . GLN B 2 47  ? 31.011  -23.179 44.441  1.00 49.45  ? 180 GLN B CB  1 
ATOM   940   C  CG  . GLN B 2 47  ? 30.638  -24.257 45.465  1.00 64.85  ? 180 GLN B CG  1 
ATOM   941   C  CD  . GLN B 2 47  ? 29.534  -23.794 46.436  1.00 71.30  ? 180 GLN B CD  1 
ATOM   942   O  OE1 . GLN B 2 47  ? 28.483  -23.290 46.013  1.00 74.75  ? 180 GLN B OE1 1 
ATOM   943   N  NE2 . GLN B 2 47  ? 29.781  -23.952 47.741  1.00 70.18  ? 180 GLN B NE2 1 
ATOM   944   N  N   . LYS B 2 48  ? 33.742  -21.591 45.104  1.00 34.61  ? 181 LYS B N   1 
ATOM   945   C  CA  . LYS B 2 48  ? 35.044  -21.626 45.763  1.00 34.13  ? 181 LYS B CA  1 
ATOM   946   C  C   . LYS B 2 48  ? 35.101  -20.590 46.861  1.00 32.98  ? 181 LYS B C   1 
ATOM   947   O  O   . LYS B 2 48  ? 35.444  -20.900 48.003  1.00 33.50  ? 181 LYS B O   1 
ATOM   948   C  CB  . LYS B 2 48  ? 36.191  -21.388 44.790  1.00 34.84  ? 181 LYS B CB  1 
ATOM   949   C  CG  . LYS B 2 48  ? 37.552  -21.113 45.483  1.00 38.90  ? 181 LYS B CG  1 
ATOM   950   C  CD  . LYS B 2 48  ? 38.304  -22.361 45.993  1.00 37.46  ? 181 LYS B CD  1 
ATOM   951   C  CE  . LYS B 2 48  ? 37.559  -23.101 47.083  1.00 44.71  ? 181 LYS B CE  1 
ATOM   952   N  NZ  . LYS B 2 48  ? 38.471  -23.783 48.054  1.00 50.40  ? 181 LYS B NZ  1 
ATOM   953   N  N   . LEU B 2 49  ? 34.747  -19.360 46.509  1.00 27.76  ? 182 LEU B N   1 
ATOM   954   C  CA  . LEU B 2 49  ? 34.747  -18.263 47.473  1.00 30.61  ? 182 LEU B CA  1 
ATOM   955   C  C   . LEU B 2 49  ? 33.779  -18.528 48.644  1.00 25.69  ? 182 LEU B C   1 
ATOM   956   O  O   . LEU B 2 49  ? 34.052  -18.205 49.791  1.00 20.07  ? 182 LEU B O   1 
ATOM   957   C  CB  . LEU B 2 49  ? 34.413  -16.946 46.765  1.00 32.73  ? 182 LEU B CB  1 
ATOM   958   C  CG  . LEU B 2 49  ? 35.315  -16.590 45.580  1.00 34.49  ? 182 LEU B CG  1 
ATOM   959   C  CD1 . LEU B 2 49  ? 34.864  -15.267 44.996  1.00 30.70  ? 182 LEU B CD1 1 
ATOM   960   C  CD2 . LEU B 2 49  ? 36.801  -16.536 45.996  1.00 39.85  ? 182 LEU B CD2 1 
ATOM   961   N  N   . GLU B 2 50  ? 32.654  -19.150 48.344  1.00 18.89  ? 183 GLU B N   1 
ATOM   962   C  CA  . GLU B 2 50  ? 31.683  -19.487 49.357  1.00 14.87  ? 183 GLU B CA  1 
ATOM   963   C  C   . GLU B 2 50  ? 32.452  -20.364 50.328  1.00 15.35  ? 183 GLU B C   1 
ATOM   964   O  O   . GLU B 2 50  ? 32.501  -20.111 51.521  1.00 17.11  ? 183 GLU B O   1 
ATOM   965   C  CB  . GLU B 2 50  ? 30.572  -20.284 48.697  1.00 25.06  ? 183 GLU B CB  1 
ATOM   966   C  CG  . GLU B 2 50  ? 29.193  -20.057 49.242  1.00 36.10  ? 183 GLU B CG  1 
ATOM   967   C  CD  . GLU B 2 50  ? 28.121  -20.391 48.214  1.00 39.72  ? 183 GLU B CD  1 
ATOM   968   O  OE1 . GLU B 2 50  ? 27.926  -19.579 47.298  1.00 37.01  ? 183 GLU B OE1 1 
ATOM   969   O  OE2 . GLU B 2 50  ? 27.481  -21.460 48.309  1.00 48.48  ? 183 GLU B OE2 1 
ATOM   970   N  N   . SER B 2 51  ? 33.148  -21.339 49.777  1.00 18.58  ? 184 SER B N   1 
ATOM   971   C  CA  . SER B 2 51  ? 33.943  -22.238 50.573  1.00 21.69  ? 184 SER B CA  1 
ATOM   972   C  C   . SER B 2 51  ? 34.996  -21.456 51.322  1.00 21.61  ? 184 SER B C   1 
ATOM   973   O  O   . SER B 2 51  ? 35.070  -21.518 52.550  1.00 27.94  ? 184 SER B O   1 
ATOM   974   C  CB  . SER B 2 51  ? 34.632  -23.272 49.684  1.00 26.03  ? 184 SER B CB  1 
ATOM   975   O  OG  . SER B 2 51  ? 35.478  -24.103 50.460  1.00 30.71  ? 184 SER B OG  1 
ATOM   976   N  N   . ASP B 2 52  ? 35.793  -20.698 50.582  1.00 22.86  ? 185 ASP B N   1 
ATOM   977   C  CA  . ASP B 2 52  ? 36.859  -19.922 51.192  1.00 29.12  ? 185 ASP B CA  1 
ATOM   978   C  C   . ASP B 2 52  ? 36.420  -19.121 52.413  1.00 29.53  ? 185 ASP B C   1 
ATOM   979   O  O   . ASP B 2 52  ? 37.112  -19.114 53.437  1.00 30.00  ? 185 ASP B O   1 
ATOM   980   C  CB  . ASP B 2 52  ? 37.530  -19.028 50.153  1.00 28.69  ? 185 ASP B CB  1 
ATOM   981   C  CG  . ASP B 2 52  ? 38.376  -19.814 49.181  1.00 38.22  ? 185 ASP B CG  1 
ATOM   982   O  OD1 . ASP B 2 52  ? 38.262  -21.049 49.148  1.00 47.11  ? 185 ASP B OD1 1 
ATOM   983   O  OD2 . ASP B 2 52  ? 39.178  -19.207 48.459  1.00 42.68  ? 185 ASP B OD2 1 
ATOM   984   N  N   . VAL B 2 53  ? 35.248  -18.502 52.322  1.00 24.78  ? 186 VAL B N   1 
ATOM   985   C  CA  . VAL B 2 53  ? 34.718  -17.709 53.424  1.00 21.78  ? 186 VAL B CA  1 
ATOM   986   C  C   . VAL B 2 53  ? 34.332  -18.617 54.589  1.00 23.01  ? 186 VAL B C   1 
ATOM   987   O  O   . VAL B 2 53  ? 34.719  -18.358 55.731  1.00 28.51  ? 186 VAL B O   1 
ATOM   988   C  CB  . VAL B 2 53  ? 33.507  -16.859 52.980  1.00 27.71  ? 186 VAL B CB  1 
ATOM   989   C  CG1 . VAL B 2 53  ? 32.895  -16.141 54.164  1.00 26.98  ? 186 VAL B CG1 1 
ATOM   990   C  CG2 . VAL B 2 53  ? 33.950  -15.824 51.956  1.00 27.38  ? 186 VAL B CG2 1 
ATOM   991   N  N   . SER B 2 54  ? 33.591  -19.687 54.308  1.00 21.76  ? 187 SER B N   1 
ATOM   992   C  CA  . SER B 2 54  ? 33.209  -20.617 55.362  1.00 17.51  ? 187 SER B CA  1 
ATOM   993   C  C   . SER B 2 54  ? 34.441  -21.006 56.145  1.00 10.09  ? 187 SER B C   1 
ATOM   994   O  O   . SER B 2 54  ? 34.490  -20.815 57.355  1.00 8.74   ? 187 SER B O   1 
ATOM   995   C  CB  . SER B 2 54  ? 32.584  -21.879 54.789  1.00 25.40  ? 187 SER B CB  1 
ATOM   996   O  OG  . SER B 2 54  ? 31.256  -21.635 54.401  1.00 38.28  ? 187 SER B OG  1 
ATOM   997   N  N   . ALA B 2 55  ? 35.457  -21.498 55.448  1.00 9.62   ? 188 ALA B N   1 
ATOM   998   C  CA  . ALA B 2 55  ? 36.692  -21.907 56.123  1.00 17.83  ? 188 ALA B CA  1 
ATOM   999   C  C   . ALA B 2 55  ? 37.219  -20.862 57.110  1.00 17.74  ? 188 ALA B C   1 
ATOM   1000  O  O   . ALA B 2 55  ? 37.481  -21.164 58.283  1.00 15.03  ? 188 ALA B O   1 
ATOM   1001  C  CB  . ALA B 2 55  ? 37.765  -22.259 55.108  1.00 16.62  ? 188 ALA B CB  1 
ATOM   1002  N  N   . GLN B 2 56  ? 37.304  -19.621 56.643  1.00 23.55  ? 189 GLN B N   1 
ATOM   1003  C  CA  . GLN B 2 56  ? 37.801  -18.526 57.456  1.00 25.34  ? 189 GLN B CA  1 
ATOM   1004  C  C   . GLN B 2 56  ? 36.935  -18.268 58.678  1.00 28.30  ? 189 GLN B C   1 
ATOM   1005  O  O   . GLN B 2 56  ? 37.453  -17.983 59.773  1.00 27.61  ? 189 GLN B O   1 
ATOM   1006  C  CB  . GLN B 2 56  ? 37.946  -17.267 56.619  1.00 22.99  ? 189 GLN B CB  1 
ATOM   1007  C  CG  . GLN B 2 56  ? 38.812  -16.234 57.276  1.00 20.30  ? 189 GLN B CG  1 
ATOM   1008  C  CD  . GLN B 2 56  ? 40.136  -16.806 57.710  1.00 19.29  ? 189 GLN B CD  1 
ATOM   1009  O  OE1 . GLN B 2 56  ? 40.457  -16.832 58.893  1.00 21.22  ? 189 GLN B OE1 1 
ATOM   1010  N  NE2 . GLN B 2 56  ? 40.903  -17.291 56.756  1.00 19.93  ? 189 GLN B NE2 1 
ATOM   1011  N  N   . MET B 2 57  ? 35.618  -18.376 58.496  1.00 26.79  ? 190 MET B N   1 
ATOM   1012  C  CA  . MET B 2 57  ? 34.699  -18.189 59.609  1.00 25.44  ? 190 MET B CA  1 
ATOM   1013  C  C   . MET B 2 57  ? 34.960  -19.281 60.638  1.00 18.52  ? 190 MET B C   1 
ATOM   1014  O  O   . MET B 2 57  ? 34.769  -19.073 61.836  1.00 21.03  ? 190 MET B O   1 
ATOM   1015  C  CB  . MET B 2 57  ? 33.253  -18.252 59.152  1.00 31.19  ? 190 MET B CB  1 
ATOM   1016  C  CG  . MET B 2 57  ? 32.871  -17.154 58.203  1.00 37.05  ? 190 MET B CG  1 
ATOM   1017  S  SD  . MET B 2 57  ? 31.188  -16.568 58.523  1.00 43.66  ? 190 MET B SD  1 
ATOM   1018  C  CE  . MET B 2 57  ? 31.525  -15.485 59.948  1.00 44.49  ? 190 MET B CE  1 
ATOM   1019  N  N   . GLU B 2 58  ? 35.378  -20.452 60.167  1.00 17.01  ? 191 GLU B N   1 
ATOM   1020  C  CA  . GLU B 2 58  ? 35.685  -21.542 61.073  1.00 24.70  ? 191 GLU B CA  1 
ATOM   1021  C  C   . GLU B 2 58  ? 36.971  -21.210 61.795  1.00 24.37  ? 191 GLU B C   1 
ATOM   1022  O  O   . GLU B 2 58  ? 37.090  -21.412 63.005  1.00 28.80  ? 191 GLU B O   1 
ATOM   1023  C  CB  . GLU B 2 58  ? 35.847  -22.851 60.318  1.00 29.05  ? 191 GLU B CB  1 
ATOM   1024  C  CG  . GLU B 2 58  ? 34.854  -23.884 60.762  1.00 36.98  ? 191 GLU B CG  1 
ATOM   1025  C  CD  . GLU B 2 58  ? 33.440  -23.455 60.492  1.00 46.68  ? 191 GLU B CD  1 
ATOM   1026  O  OE1 . GLU B 2 58  ? 33.217  -22.764 59.483  1.00 54.98  ? 191 GLU B OE1 1 
ATOM   1027  O  OE2 . GLU B 2 58  ? 32.544  -23.812 61.277  1.00 51.96  ? 191 GLU B OE2 1 
ATOM   1028  N  N   . TYR B 2 59  ? 37.923  -20.658 61.056  1.00 21.56  ? 192 TYR B N   1 
ATOM   1029  C  CA  . TYR B 2 59  ? 39.206  -20.291 61.646  1.00 20.89  ? 192 TYR B CA  1 
ATOM   1030  C  C   . TYR B 2 59  ? 39.024  -19.222 62.696  1.00 16.32  ? 192 TYR B C   1 
ATOM   1031  O  O   . TYR B 2 59  ? 39.806  -19.131 63.628  1.00 12.62  ? 192 TYR B O   1 
ATOM   1032  C  CB  . TYR B 2 59  ? 40.154  -19.755 60.581  1.00 19.38  ? 192 TYR B CB  1 
ATOM   1033  C  CG  . TYR B 2 59  ? 40.528  -20.747 59.516  1.00 13.62  ? 192 TYR B CG  1 
ATOM   1034  C  CD1 . TYR B 2 59  ? 40.433  -22.118 59.743  1.00 8.83   ? 192 TYR B CD1 1 
ATOM   1035  C  CD2 . TYR B 2 59  ? 40.958  -20.319 58.269  1.00 15.87  ? 192 TYR B CD2 1 
ATOM   1036  C  CE1 . TYR B 2 59  ? 40.754  -23.034 58.758  1.00 6.42   ? 192 TYR B CE1 1 
ATOM   1037  C  CE2 . TYR B 2 59  ? 41.274  -21.238 57.267  1.00 16.17  ? 192 TYR B CE2 1 
ATOM   1038  C  CZ  . TYR B 2 59  ? 41.165  -22.590 57.524  1.00 14.65  ? 192 TYR B CZ  1 
ATOM   1039  O  OH  . TYR B 2 59  ? 41.427  -23.498 56.529  1.00 23.64  ? 192 TYR B OH  1 
ATOM   1040  N  N   . CYS B 2 60  ? 37.974  -18.427 62.541  1.00 15.81  ? 193 CYS B N   1 
ATOM   1041  C  CA  . CYS B 2 60  ? 37.713  -17.331 63.453  1.00 22.16  ? 193 CYS B CA  1 
ATOM   1042  C  C   . CYS B 2 60  ? 36.962  -17.655 64.710  1.00 29.82  ? 193 CYS B C   1 
ATOM   1043  O  O   . CYS B 2 60  ? 36.772  -16.779 65.555  1.00 34.86  ? 193 CYS B O   1 
ATOM   1044  C  CB  . CYS B 2 60  ? 37.013  -16.213 62.712  1.00 23.22  ? 193 CYS B CB  1 
ATOM   1045  S  SG  . CYS B 2 60  ? 38.052  -15.565 61.377  1.00 31.21  ? 193 CYS B SG  1 
ATOM   1046  N  N   . ARG B 2 61  ? 36.511  -18.898 64.840  1.00 37.56  ? 194 ARG B N   1 
ATOM   1047  C  CA  . ARG B 2 61  ? 35.782  -19.291 66.044  1.00 44.40  ? 194 ARG B CA  1 
ATOM   1048  C  C   . ARG B 2 61  ? 36.765  -19.097 67.184  1.00 38.19  ? 194 ARG B C   1 
ATOM   1049  O  O   . ARG B 2 61  ? 36.414  -18.635 68.270  1.00 36.54  ? 194 ARG B O   1 
ATOM   1050  C  CB  . ARG B 2 61  ? 35.349  -20.754 65.965  1.00 50.01  ? 194 ARG B CB  1 
ATOM   1051  C  CG  . ARG B 2 61  ? 34.248  -21.027 64.974  1.00 52.44  ? 194 ARG B CG  1 
ATOM   1052  C  CD  . ARG B 2 61  ? 33.987  -22.524 64.878  1.00 57.80  ? 194 ARG B CD  1 
ATOM   1053  N  NE  . ARG B 2 61  ? 32.923  -22.828 63.927  1.00 62.05  ? 194 ARG B NE  1 
ATOM   1054  C  CZ  . ARG B 2 61  ? 31.629  -22.658 64.177  1.00 64.60  ? 194 ARG B CZ  1 
ATOM   1055  N  NH1 . ARG B 2 61  ? 31.231  -22.195 65.352  1.00 66.05  ? 194 ARG B NH1 1 
ATOM   1056  N  NH2 . ARG B 2 61  ? 30.732  -22.910 63.236  1.00 68.54  ? 194 ARG B NH2 1 
ATOM   1057  N  N   . THR B 2 62  ? 38.017  -19.408 66.879  1.00 37.51  ? 195 THR B N   1 
ATOM   1058  C  CA  . THR B 2 62  ? 39.116  -19.282 67.813  1.00 34.35  ? 195 THR B CA  1 
ATOM   1059  C  C   . THR B 2 62  ? 40.007  -18.129 67.317  1.00 29.34  ? 195 THR B C   1 
ATOM   1060  O  O   . THR B 2 62  ? 40.308  -18.028 66.134  1.00 22.97  ? 195 THR B O   1 
ATOM   1061  C  CB  . THR B 2 62  ? 39.866  -20.638 67.939  1.00 36.29  ? 195 THR B CB  1 
ATOM   1062  O  OG1 . THR B 2 62  ? 41.230  -20.422 68.306  1.00 37.65  ? 195 THR B OG1 1 
ATOM   1063  C  CG2 . THR B 2 62  ? 39.799  -21.422 66.637  1.00 41.22  ? 195 THR B CG2 1 
ATOM   1064  N  N   . PRO B 2 63  ? 40.344  -17.187 68.212  1.00 28.49  ? 196 PRO B N   1 
ATOM   1065  C  CA  . PRO B 2 63  ? 41.177  -16.009 67.935  1.00 26.97  ? 196 PRO B CA  1 
ATOM   1066  C  C   . PRO B 2 63  ? 42.686  -16.176 68.014  1.00 26.54  ? 196 PRO B C   1 
ATOM   1067  O  O   . PRO B 2 63  ? 43.202  -17.173 68.505  1.00 25.57  ? 196 PRO B O   1 
ATOM   1068  C  CB  . PRO B 2 63  ? 40.716  -15.024 68.998  1.00 26.00  ? 196 PRO B CB  1 
ATOM   1069  C  CG  . PRO B 2 63  ? 40.517  -15.916 70.178  1.00 27.19  ? 196 PRO B CG  1 
ATOM   1070  C  CD  . PRO B 2 63  ? 39.785  -17.114 69.575  1.00 30.17  ? 196 PRO B CD  1 
ATOM   1071  N  N   . CYS B 2 64  ? 43.388  -15.155 67.546  1.00 27.03  ? 197 CYS B N   1 
ATOM   1072  C  CA  . CYS B 2 64  ? 44.834  -15.159 67.577  1.00 26.91  ? 197 CYS B CA  1 
ATOM   1073  C  C   . CYS B 2 64  ? 45.240  -14.563 68.903  1.00 24.15  ? 197 CYS B C   1 
ATOM   1074  O  O   . CYS B 2 64  ? 44.525  -13.735 69.466  1.00 25.44  ? 197 CYS B O   1 
ATOM   1075  C  CB  . CYS B 2 64  ? 45.390  -14.343 66.426  1.00 23.56  ? 197 CYS B CB  1 
ATOM   1076  S  SG  . CYS B 2 64  ? 44.891  -12.616 66.483  1.00 29.22  ? 197 CYS B SG  1 
ATOM   1077  N  N   . THR B 2 65  ? 46.382  -14.995 69.410  1.00 19.04  ? 198 THR B N   1 
ATOM   1078  C  CA  . THR B 2 65  ? 46.836  -14.500 70.690  1.00 25.04  ? 198 THR B CA  1 
ATOM   1079  C  C   . THR B 2 65  ? 48.304  -14.165 70.705  1.00 30.05  ? 198 THR B C   1 
ATOM   1080  O  O   . THR B 2 65  ? 49.073  -14.652 69.876  1.00 34.51  ? 198 THR B O   1 
ATOM   1081  C  CB  . THR B 2 65  ? 46.620  -15.526 71.773  1.00 27.92  ? 198 THR B CB  1 
ATOM   1082  O  OG1 . THR B 2 65  ? 47.116  -16.777 71.303  1.00 34.68  ? 198 THR B OG1 1 
ATOM   1083  C  CG2 . THR B 2 65  ? 45.158  -15.655 72.121  1.00 37.13  ? 198 THR B CG2 1 
ATOM   1084  N  N   . VAL B 2 66  ? 48.686  -13.408 71.730  1.00 25.74  ? 199 VAL B N   1 
ATOM   1085  C  CA  . VAL B 2 66  ? 50.048  -12.956 71.927  1.00 20.91  ? 199 VAL B CA  1 
ATOM   1086  C  C   . VAL B 2 66  ? 50.293  -12.799 73.421  1.00 24.25  ? 199 VAL B C   1 
ATOM   1087  O  O   . VAL B 2 66  ? 49.376  -12.525 74.199  1.00 24.70  ? 199 VAL B O   1 
ATOM   1088  C  CB  . VAL B 2 66  ? 50.277  -11.570 71.270  1.00 22.68  ? 199 VAL B CB  1 
ATOM   1089  C  CG1 . VAL B 2 66  ? 50.168  -11.660 69.775  1.00 21.90  ? 199 VAL B CG1 1 
ATOM   1090  C  CG2 . VAL B 2 66  ? 49.256  -10.553 71.804  1.00 24.85  ? 199 VAL B CG2 1 
ATOM   1091  N  N   . SER B 2 67  ? 51.545  -12.947 73.814  1.00 20.90  ? 200 SER B N   1 
ATOM   1092  C  CA  . SER B 2 67  ? 51.908  -12.798 75.201  1.00 23.39  ? 200 SER B CA  1 
ATOM   1093  C  C   . SER B 2 67  ? 53.004  -11.736 75.269  1.00 26.10  ? 200 SER B C   1 
ATOM   1094  O  O   . SER B 2 67  ? 54.202  -12.030 75.283  1.00 33.69  ? 200 SER B O   1 
ATOM   1095  C  CB  . SER B 2 67  ? 52.372  -14.143 75.740  1.00 28.78  ? 200 SER B CB  1 
ATOM   1096  O  OG  . SER B 2 67  ? 51.291  -15.064 75.770  1.00 33.68  ? 200 SER B OG  1 
ATOM   1097  N  N   . CYS B 2 68  ? 52.576  -10.487 75.309  1.00 20.48  ? 201 CYS B N   1 
ATOM   1098  C  CA  . CYS B 2 68  ? 53.496  -9.380  75.317  1.00 20.62  ? 201 CYS B CA  1 
ATOM   1099  C  C   . CYS B 2 68  ? 53.928  -8.904  76.667  1.00 24.95  ? 201 CYS B C   1 
ATOM   1100  O  O   . CYS B 2 68  ? 53.364  -7.938  77.198  1.00 26.55  ? 201 CYS B O   1 
ATOM   1101  C  CB  . CYS B 2 68  ? 52.908  -8.226  74.522  1.00 23.03  ? 201 CYS B CB  1 
ATOM   1102  S  SG  . CYS B 2 68  ? 52.649  -8.703  72.788  1.00 27.66  ? 201 CYS B SG  1 
ATOM   1103  N  N   . ASN B 2 69  ? 54.959  -9.570  77.197  1.00 25.90  ? 202 ASN B N   1 
ATOM   1104  C  CA  . ASN B 2 69  ? 55.557  -9.228  78.492  1.00 26.63  ? 202 ASN B CA  1 
ATOM   1105  C  C   . ASN B 2 69  ? 56.056  -7.807  78.452  1.00 26.66  ? 202 ASN B C   1 
ATOM   1106  O  O   . ASN B 2 69  ? 56.537  -7.337  77.428  1.00 31.52  ? 202 ASN B O   1 
ATOM   1107  C  CB  . ASN B 2 69  ? 56.693  -10.173 78.845  1.00 25.09  ? 202 ASN B CB  1 
ATOM   1108  C  CG  . ASN B 2 69  ? 56.189  -11.528 79.277  1.00 27.88  ? 202 ASN B CG  1 
ATOM   1109  O  OD1 . ASN B 2 69  ? 55.085  -11.646 79.829  1.00 32.16  ? 202 ASN B OD1 1 
ATOM   1110  N  ND2 . ASN B 2 69  ? 56.986  -12.563 79.034  1.00 23.67  ? 202 ASN B ND2 1 
ATOM   1111  N  N   . ILE B 2 70  ? 55.949  -7.130  79.580  1.00 23.90  ? 203 ILE B N   1 
ATOM   1112  C  CA  . ILE B 2 70  ? 56.292  -5.733  79.647  1.00 21.41  ? 203 ILE B CA  1 
ATOM   1113  C  C   . ILE B 2 70  ? 57.682  -5.353  80.140  1.00 26.60  ? 203 ILE B C   1 
ATOM   1114  O  O   . ILE B 2 70  ? 58.095  -5.745  81.230  1.00 30.29  ? 203 ILE B O   1 
ATOM   1115  C  CB  . ILE B 2 70  ? 55.215  -5.026  80.452  1.00 17.01  ? 203 ILE B CB  1 
ATOM   1116  C  CG1 . ILE B 2 70  ? 53.838  -5.420  79.868  1.00 15.48  ? 203 ILE B CG1 1 
ATOM   1117  C  CG2 . ILE B 2 70  ? 55.436  -3.528  80.410  1.00 15.35  ? 203 ILE B CG2 1 
ATOM   1118  C  CD1 . ILE B 2 70  ? 52.631  -4.841  80.577  1.00 6.89   ? 203 ILE B CD1 1 
ATOM   1119  N  N   . PRO B 2 71  ? 58.416  -4.562  79.339  1.00 21.25  ? 204 PRO B N   1 
ATOM   1120  C  CA  . PRO B 2 71  ? 59.765  -4.082  79.629  1.00 22.16  ? 204 PRO B CA  1 
ATOM   1121  C  C   . PRO B 2 71  ? 59.759  -3.293  80.920  1.00 28.76  ? 204 PRO B C   1 
ATOM   1122  O  O   . PRO B 2 71  ? 58.746  -2.675  81.268  1.00 30.89  ? 204 PRO B O   1 
ATOM   1123  C  CB  . PRO B 2 71  ? 60.050  -3.167  78.453  1.00 23.74  ? 204 PRO B CB  1 
ATOM   1124  C  CG  . PRO B 2 71  ? 59.307  -3.824  77.350  1.00 27.18  ? 204 PRO B CG  1 
ATOM   1125  C  CD  . PRO B 2 71  ? 57.988  -4.096  78.014  1.00 25.14  ? 204 PRO B CD  1 
ATOM   1126  N  N   . VAL B 2 72  ? 60.884  -3.282  81.630  1.00 29.97  ? 205 VAL B N   1 
ATOM   1127  C  CA  . VAL B 2 72  ? 60.906  -2.551  82.892  1.00 23.48  ? 205 VAL B CA  1 
ATOM   1128  C  C   . VAL B 2 72  ? 60.982  -1.057  82.661  1.00 22.05  ? 205 VAL B C   1 
ATOM   1129  O  O   . VAL B 2 72  ? 60.275  -0.297  83.302  1.00 18.66  ? 205 VAL B O   1 
ATOM   1130  C  CB  . VAL B 2 72  ? 62.016  -3.035  83.830  1.00 18.85  ? 205 VAL B CB  1 
ATOM   1131  C  CG1 . VAL B 2 72  ? 62.087  -2.142  85.041  1.00 16.65  ? 205 VAL B CG1 1 
ATOM   1132  C  CG2 . VAL B 2 72  ? 61.724  -4.473  84.273  1.00 9.86   ? 205 VAL B CG2 1 
ATOM   1133  N  N   . VAL B 2 73  ? 61.771  -0.641  81.677  1.00 29.46  ? 206 VAL B N   1 
ATOM   1134  C  CA  . VAL B 2 73  ? 61.894  0.783   81.375  1.00 29.25  ? 206 VAL B CA  1 
ATOM   1135  C  C   . VAL B 2 73  ? 60.604  1.368   80.790  1.00 30.46  ? 206 VAL B C   1 
ATOM   1136  O  O   . VAL B 2 73  ? 59.880  0.723   80.017  1.00 35.70  ? 206 VAL B O   1 
ATOM   1137  C  CB  . VAL B 2 73  ? 63.027  1.081   80.373  1.00 31.79  ? 206 VAL B CB  1 
ATOM   1138  C  CG1 . VAL B 2 73  ? 63.418  2.532   80.475  1.00 30.39  ? 206 VAL B CG1 1 
ATOM   1139  C  CG2 . VAL B 2 73  ? 64.235  0.186   80.614  1.00 40.77  ? 206 VAL B CG2 1 
ATOM   1140  N  N   . SER B 2 74  ? 60.354  2.622   81.130  1.00 29.07  ? 207 SER B N   1 
ATOM   1141  C  CA  . SER B 2 74  ? 59.183  3.329   80.657  1.00 25.36  ? 207 SER B CA  1 
ATOM   1142  C  C   . SER B 2 74  ? 59.432  4.820   80.763  1.00 31.98  ? 207 SER B C   1 
ATOM   1143  O  O   . SER B 2 74  ? 60.354  5.257   81.447  1.00 33.62  ? 207 SER B O   1 
ATOM   1144  C  CB  . SER B 2 74  ? 57.984  2.953   81.511  1.00 22.23  ? 207 SER B CB  1 
ATOM   1145  O  OG  . SER B 2 74  ? 56.824  3.650   81.112  1.00 18.08  ? 207 SER B OG  1 
ATOM   1146  N  N   . GLY B 2 75  ? 58.590  5.596   80.089  1.00 38.14  ? 208 GLY B N   1 
ATOM   1147  C  CA  . GLY B 2 75  ? 58.704  7.044   80.108  1.00 38.13  ? 208 GLY B CA  1 
ATOM   1148  C  C   . GLY B 2 75  ? 57.540  7.700   79.395  1.00 30.85  ? 208 GLY B C   1 
ATOM   1149  O  O   . GLY B 2 75  ? 56.569  7.036   79.056  1.00 25.09  ? 208 GLY B O   1 
ATOM   1150  N  N   . LYS B 2 76  ? 57.632  9.009   79.187  1.00 31.62  ? 209 LYS B N   1 
ATOM   1151  C  CA  . LYS B 2 76  ? 56.591  9.760   78.494  1.00 33.29  ? 209 LYS B CA  1 
ATOM   1152  C  C   . LYS B 2 76  ? 56.396  9.200   77.092  1.00 29.79  ? 209 LYS B C   1 
ATOM   1153  O  O   . LYS B 2 76  ? 55.277  9.182   76.573  1.00 14.67  ? 209 LYS B O   1 
ATOM   1154  C  CB  . LYS B 2 76  ? 56.960  11.244  78.387  1.00 36.91  ? 209 LYS B CB  1 
ATOM   1155  C  CG  . LYS B 2 76  ? 56.855  12.027  79.672  1.00 43.69  ? 209 LYS B CG  1 
ATOM   1156  C  CD  . LYS B 2 76  ? 57.128  13.504  79.434  1.00 50.75  ? 209 LYS B CD  1 
ATOM   1157  C  CE  . LYS B 2 76  ? 58.590  13.788  79.071  1.00 56.10  ? 209 LYS B CE  1 
ATOM   1158  N  NZ  . LYS B 2 76  ? 59.504  13.725  80.251  1.00 61.50  ? 209 LYS B NZ  1 
ATOM   1159  N  N   . GLU B 2 77  ? 57.495  8.730   76.497  1.00 31.57  ? 210 GLU B N   1 
ATOM   1160  C  CA  . GLU B 2 77  ? 57.478  8.187   75.147  1.00 26.13  ? 210 GLU B CA  1 
ATOM   1161  C  C   . GLU B 2 77  ? 58.802  7.523   74.773  1.00 20.85  ? 210 GLU B C   1 
ATOM   1162  O  O   . GLU B 2 77  ? 59.751  7.548   75.548  1.00 21.84  ? 210 GLU B O   1 
ATOM   1163  C  CB  . GLU B 2 77  ? 57.117  9.298   74.169  1.00 28.79  ? 210 GLU B CB  1 
ATOM   1164  C  CG  . GLU B 2 77  ? 57.817  10.614  74.468  1.00 33.11  ? 210 GLU B CG  1 
ATOM   1165  C  CD  . GLU B 2 77  ? 59.286  10.535  74.199  1.00 37.09  ? 210 GLU B CD  1 
ATOM   1166  O  OE1 . GLU B 2 77  ? 59.625  10.137  73.068  1.00 42.80  ? 210 GLU B OE1 1 
ATOM   1167  O  OE2 . GLU B 2 77  ? 60.087  10.849  75.104  1.00 40.61  ? 210 GLU B OE2 1 
ATOM   1168  N  N   . CYS B 2 78  ? 58.863  6.968   73.563  1.00 23.92  ? 211 CYS B N   1 
ATOM   1169  C  CA  . CYS B 2 78  ? 60.032  6.246   73.068  1.00 24.03  ? 211 CYS B CA  1 
ATOM   1170  C  C   . CYS B 2 78  ? 61.351  6.936   73.304  1.00 24.65  ? 211 CYS B C   1 
ATOM   1171  O  O   . CYS B 2 78  ? 62.262  6.338   73.867  1.00 33.32  ? 211 CYS B O   1 
ATOM   1172  C  CB  . CYS B 2 78  ? 59.879  5.921   71.588  1.00 29.02  ? 211 CYS B CB  1 
ATOM   1173  S  SG  . CYS B 2 78  ? 58.497  4.796   71.225  1.00 33.55  ? 211 CYS B SG  1 
ATOM   1174  N  N   . GLU B 2 79  ? 61.436  8.201   72.906  1.00 19.02  ? 212 GLU B N   1 
ATOM   1175  C  CA  . GLU B 2 79  ? 62.655  8.988   73.066  1.00 20.02  ? 212 GLU B CA  1 
ATOM   1176  C  C   . GLU B 2 79  ? 63.119  8.922   74.510  1.00 21.43  ? 212 GLU B C   1 
ATOM   1177  O  O   . GLU B 2 79  ? 64.211  8.400   74.807  1.00 21.91  ? 212 GLU B O   1 
ATOM   1178  C  CB  . GLU B 2 79  ? 62.419  10.441  72.611  1.00 22.74  ? 212 GLU B CB  1 
ATOM   1179  C  CG  . GLU B 2 79  ? 63.163  11.535  73.373  1.00 34.22  ? 212 GLU B CG  1 
ATOM   1180  C  CD  . GLU B 2 79  ? 64.626  11.672  72.973  1.00 45.55  ? 212 GLU B CD  1 
ATOM   1181  O  OE1 . GLU B 2 79  ? 65.023  11.132  71.916  1.00 49.34  ? 212 GLU B OE1 1 
ATOM   1182  O  OE2 . GLU B 2 79  ? 65.384  12.332  73.725  1.00 52.41  ? 212 GLU B OE2 1 
ATOM   1183  N  N   . GLU B 2 80  ? 62.259  9.360   75.420  1.00 7.60   ? 213 GLU B N   1 
ATOM   1184  C  CA  . GLU B 2 80  ? 62.642  9.338   76.815  1.00 13.20  ? 213 GLU B CA  1 
ATOM   1185  C  C   . GLU B 2 80  ? 63.156  7.947   77.227  1.00 16.23  ? 213 GLU B C   1 
ATOM   1186  O  O   . GLU B 2 80  ? 64.208  7.819   77.855  1.00 13.83  ? 213 GLU B O   1 
ATOM   1187  C  CB  . GLU B 2 80  ? 61.491  9.798   77.701  1.00 9.76   ? 213 GLU B CB  1 
ATOM   1188  C  CG  . GLU B 2 80  ? 61.939  9.963   79.111  1.00 20.41  ? 213 GLU B CG  1 
ATOM   1189  C  CD  . GLU B 2 80  ? 60.914  10.639  79.978  1.00 32.21  ? 213 GLU B CD  1 
ATOM   1190  O  OE1 . GLU B 2 80  ? 59.760  10.170  80.022  1.00 33.02  ? 213 GLU B OE1 1 
ATOM   1191  O  OE2 . GLU B 2 80  ? 61.272  11.636  80.646  1.00 40.06  ? 213 GLU B OE2 1 
ATOM   1192  N  N   . ILE B 2 81  ? 62.461  6.916   76.766  1.00 11.85  ? 214 ILE B N   1 
ATOM   1193  C  CA  . ILE B 2 81  ? 62.834  5.558   77.065  1.00 11.89  ? 214 ILE B CA  1 
ATOM   1194  C  C   . ILE B 2 81  ? 64.255  5.241   76.603  1.00 11.83  ? 214 ILE B C   1 
ATOM   1195  O  O   . ILE B 2 81  ? 65.073  4.714   77.361  1.00 12.29  ? 214 ILE B O   1 
ATOM   1196  C  CB  . ILE B 2 81  ? 61.881  4.602   76.380  1.00 8.57   ? 214 ILE B CB  1 
ATOM   1197  C  CG1 . ILE B 2 81  ? 60.470  4.825   76.935  1.00 12.86  ? 214 ILE B CG1 1 
ATOM   1198  C  CG2 . ILE B 2 81  ? 62.392  3.165   76.515  1.00 3.68   ? 214 ILE B CG2 1 
ATOM   1199  C  CD1 . ILE B 2 81  ? 59.403  3.866   76.416  1.00 8.96   ? 214 ILE B CD1 1 
ATOM   1200  N  N   . ILE B 2 82  ? 64.562  5.566   75.361  1.00 8.03   ? 215 ILE B N   1 
ATOM   1201  C  CA  . ILE B 2 82  ? 65.875  5.244   74.865  1.00 13.25  ? 215 ILE B CA  1 
ATOM   1202  C  C   . ILE B 2 82  ? 66.911  5.941   75.712  1.00 22.46  ? 215 ILE B C   1 
ATOM   1203  O  O   . ILE B 2 82  ? 67.988  5.403   75.969  1.00 25.95  ? 215 ILE B O   1 
ATOM   1204  C  CB  . ILE B 2 82  ? 66.033  5.604   73.395  1.00 13.75  ? 215 ILE B CB  1 
ATOM   1205  C  CG1 . ILE B 2 82  ? 67.265  4.905   72.844  1.00 16.93  ? 215 ILE B CG1 1 
ATOM   1206  C  CG2 . ILE B 2 82  ? 66.171  7.106   73.215  1.00 13.98  ? 215 ILE B CG2 1 
ATOM   1207  C  CD1 . ILE B 2 82  ? 67.396  4.988   71.362  1.00 16.99  ? 215 ILE B CD1 1 
ATOM   1208  N  N   . ARG B 2 83  ? 66.550  7.120   76.198  1.00 27.26  ? 216 ARG B N   1 
ATOM   1209  C  CA  . ARG B 2 83  ? 67.443  7.877   77.042  1.00 28.03  ? 216 ARG B CA  1 
ATOM   1210  C  C   . ARG B 2 83  ? 67.587  7.175   78.371  1.00 32.46  ? 216 ARG B C   1 
ATOM   1211  O  O   . ARG B 2 83  ? 68.671  7.177   78.950  1.00 40.53  ? 216 ARG B O   1 
ATOM   1212  C  CB  . ARG B 2 83  ? 66.912  9.281   77.272  1.00 36.88  ? 216 ARG B CB  1 
ATOM   1213  C  CG  . ARG B 2 83  ? 67.226  10.256  76.161  1.00 48.61  ? 216 ARG B CG  1 
ATOM   1214  C  CD  . ARG B 2 83  ? 66.870  11.677  76.575  1.00 57.78  ? 216 ARG B CD  1 
ATOM   1215  N  NE  . ARG B 2 83  ? 65.432  11.837  76.778  1.00 65.56  ? 216 ARG B NE  1 
ATOM   1216  C  CZ  . ARG B 2 83  ? 64.862  12.889  77.357  1.00 69.33  ? 216 ARG B CZ  1 
ATOM   1217  N  NH1 . ARG B 2 83  ? 65.608  13.890  77.807  1.00 73.22  ? 216 ARG B NH1 1 
ATOM   1218  N  NH2 . ARG B 2 83  ? 63.541  12.950  77.459  1.00 69.74  ? 216 ARG B NH2 1 
ATOM   1219  N  N   . LYS B 2 84  ? 66.499  6.566   78.852  1.00 27.73  ? 217 LYS B N   1 
ATOM   1220  C  CA  . LYS B 2 84  ? 66.516  5.856   80.129  1.00 23.20  ? 217 LYS B CA  1 
ATOM   1221  C  C   . LYS B 2 84  ? 67.095  4.452   79.998  1.00 28.40  ? 217 LYS B C   1 
ATOM   1222  O  O   . LYS B 2 84  ? 66.749  3.563   80.773  1.00 37.73  ? 217 LYS B O   1 
ATOM   1223  C  CB  . LYS B 2 84  ? 65.113  5.805   80.738  1.00 20.58  ? 217 LYS B CB  1 
ATOM   1224  C  CG  . LYS B 2 84  ? 64.509  7.184   80.991  1.00 24.95  ? 217 LYS B CG  1 
ATOM   1225  C  CD  . LYS B 2 84  ? 63.025  7.175   81.371  1.00 22.58  ? 217 LYS B CD  1 
ATOM   1226  C  CE  . LYS B 2 84  ? 62.817  6.818   82.826  1.00 30.34  ? 217 LYS B CE  1 
ATOM   1227  N  NZ  . LYS B 2 84  ? 61.428  7.039   83.370  1.00 31.99  ? 217 LYS B NZ  1 
ATOM   1228  N  N   . GLY B 2 85  ? 67.960  4.265   78.998  1.00 27.91  ? 218 GLY B N   1 
ATOM   1229  C  CA  . GLY B 2 85  ? 68.618  2.990   78.758  1.00 27.09  ? 218 GLY B CA  1 
ATOM   1230  C  C   . GLY B 2 85  ? 67.927  1.940   77.899  1.00 34.26  ? 218 GLY B C   1 
ATOM   1231  O  O   . GLY B 2 85  ? 68.589  0.976   77.514  1.00 42.45  ? 218 GLY B O   1 
ATOM   1232  N  N   . GLY B 2 86  ? 66.626  2.093   77.612  1.00 30.26  ? 219 GLY B N   1 
ATOM   1233  C  CA  . GLY B 2 86  ? 65.904  1.109   76.804  1.00 29.19  ? 219 GLY B CA  1 
ATOM   1234  C  C   . GLY B 2 86  ? 66.394  1.155   75.379  1.00 25.80  ? 219 GLY B C   1 
ATOM   1235  O  O   . GLY B 2 86  ? 66.169  2.142   74.691  1.00 29.36  ? 219 GLY B O   1 
ATOM   1236  N  N   . GLU B 2 87  ? 67.033  0.093   74.908  1.00 27.07  ? 220 GLU B N   1 
ATOM   1237  C  CA  . GLU B 2 87  ? 67.581  0.147   73.563  1.00 35.40  ? 220 GLU B CA  1 
ATOM   1238  C  C   . GLU B 2 87  ? 67.167  -0.890  72.535  1.00 34.24  ? 220 GLU B C   1 
ATOM   1239  O  O   . GLU B 2 87  ? 67.658  -0.875  71.411  1.00 36.20  ? 220 GLU B O   1 
ATOM   1240  C  CB  . GLU B 2 87  ? 69.103  0.277   73.630  1.00 43.60  ? 220 GLU B CB  1 
ATOM   1241  C  CG  . GLU B 2 87  ? 69.793  -0.739  74.526  1.00 55.82  ? 220 GLU B CG  1 
ATOM   1242  C  CD  . GLU B 2 87  ? 71.127  -0.232  75.091  1.00 62.56  ? 220 GLU B CD  1 
ATOM   1243  O  OE1 . GLU B 2 87  ? 71.371  1.003   75.067  1.00 65.17  ? 220 GLU B OE1 1 
ATOM   1244  O  OE2 . GLU B 2 87  ? 71.921  -1.073  75.581  1.00 62.37  ? 220 GLU B OE2 1 
ATOM   1245  N  N   . THR B 2 88  ? 66.263  -1.782  72.896  1.00 30.99  ? 221 THR B N   1 
ATOM   1246  C  CA  . THR B 2 88  ? 65.808  -2.761  71.934  1.00 25.06  ? 221 THR B CA  1 
ATOM   1247  C  C   . THR B 2 88  ? 64.516  -2.250  71.300  1.00 22.72  ? 221 THR B C   1 
ATOM   1248  O  O   . THR B 2 88  ? 63.720  -1.598  71.963  1.00 18.89  ? 221 THR B O   1 
ATOM   1249  C  CB  . THR B 2 88  ? 65.586  -4.156  72.579  1.00 23.53  ? 221 THR B CB  1 
ATOM   1250  O  OG1 . THR B 2 88  ? 65.288  -4.014  73.968  1.00 23.78  ? 221 THR B OG1 1 
ATOM   1251  C  CG2 . THR B 2 88  ? 66.817  -5.001  72.459  1.00 29.45  ? 221 THR B CG2 1 
ATOM   1252  N  N   . SER B 2 89  ? 64.371  -2.431  69.995  1.00 15.74  ? 222 SER B N   1 
ATOM   1253  C  CA  . SER B 2 89  ? 63.150  -2.018  69.349  1.00 14.40  ? 222 SER B CA  1 
ATOM   1254  C  C   . SER B 2 89  ? 62.110  -3.055  69.768  1.00 17.00  ? 222 SER B C   1 
ATOM   1255  O  O   . SER B 2 89  ? 62.305  -4.250  69.549  1.00 25.58  ? 222 SER B O   1 
ATOM   1256  C  CB  . SER B 2 89  ? 63.319  -2.047  67.832  1.00 18.20  ? 222 SER B CB  1 
ATOM   1257  O  OG  . SER B 2 89  ? 64.188  -1.024  67.394  1.00 26.89  ? 222 SER B OG  1 
ATOM   1258  N  N   . GLU B 2 90  ? 61.043  -2.617  70.421  1.00 14.78  ? 223 GLU B N   1 
ATOM   1259  C  CA  . GLU B 2 90  ? 59.996  -3.533  70.856  1.00 21.65  ? 223 GLU B CA  1 
ATOM   1260  C  C   . GLU B 2 90  ? 58.784  -2.820  71.442  1.00 22.46  ? 223 GLU B C   1 
ATOM   1261  O  O   . GLU B 2 90  ? 58.693  -1.598  71.393  1.00 26.79  ? 223 GLU B O   1 
ATOM   1262  C  CB  . GLU B 2 90  ? 60.548  -4.536  71.863  1.00 23.39  ? 223 GLU B CB  1 
ATOM   1263  C  CG  . GLU B 2 90  ? 61.344  -3.908  72.969  1.00 29.87  ? 223 GLU B CG  1 
ATOM   1264  C  CD  . GLU B 2 90  ? 61.540  -4.839  74.155  1.00 35.63  ? 223 GLU B CD  1 
ATOM   1265  O  OE1 . GLU B 2 90  ? 60.561  -5.520  74.540  1.00 37.89  ? 223 GLU B OE1 1 
ATOM   1266  O  OE2 . GLU B 2 90  ? 62.657  -4.868  74.724  1.00 39.77  ? 223 GLU B OE2 1 
ATOM   1267  N  N   . MET B 2 91  ? 57.831  -3.584  71.958  1.00 23.38  ? 224 MET B N   1 
ATOM   1268  C  CA  . MET B 2 91  ? 56.658  -2.975  72.544  1.00 24.03  ? 224 MET B CA  1 
ATOM   1269  C  C   . MET B 2 91  ? 57.009  -2.477  73.919  1.00 22.24  ? 224 MET B C   1 
ATOM   1270  O  O   . MET B 2 91  ? 57.487  -3.227  74.753  1.00 26.17  ? 224 MET B O   1 
ATOM   1271  C  CB  . MET B 2 91  ? 55.503  -3.965  72.664  1.00 30.87  ? 224 MET B CB  1 
ATOM   1272  C  CG  . MET B 2 91  ? 54.214  -3.332  73.183  1.00 35.84  ? 224 MET B CG  1 
ATOM   1273  S  SD  . MET B 2 91  ? 53.466  -4.285  74.500  1.00 41.22  ? 224 MET B SD  1 
ATOM   1274  C  CE  . MET B 2 91  ? 53.909  -3.343  75.897  1.00 39.99  ? 224 MET B CE  1 
ATOM   1275  N  N   . TYR B 2 92  ? 56.776  -1.194  74.138  1.00 23.99  ? 225 TYR B N   1 
ATOM   1276  C  CA  . TYR B 2 92  ? 57.038  -0.560  75.411  1.00 16.33  ? 225 TYR B CA  1 
ATOM   1277  C  C   . TYR B 2 92  ? 55.752  0.053   75.921  1.00 18.54  ? 225 TYR B C   1 
ATOM   1278  O  O   . TYR B 2 92  ? 54.789  0.303   75.171  1.00 14.87  ? 225 TYR B O   1 
ATOM   1279  C  CB  . TYR B 2 92  ? 58.077  0.557   75.271  1.00 14.68  ? 225 TYR B CB  1 
ATOM   1280  C  CG  . TYR B 2 92  ? 59.492  0.095   75.067  1.00 17.75  ? 225 TYR B CG  1 
ATOM   1281  C  CD1 . TYR B 2 92  ? 59.988  -0.133  73.791  1.00 23.75  ? 225 TYR B CD1 1 
ATOM   1282  C  CD2 . TYR B 2 92  ? 60.333  -0.113  76.149  1.00 17.08  ? 225 TYR B CD2 1 
ATOM   1283  C  CE1 . TYR B 2 92  ? 61.292  -0.561  73.596  1.00 27.28  ? 225 TYR B CE1 1 
ATOM   1284  C  CE2 . TYR B 2 92  ? 61.640  -0.539  75.976  1.00 21.25  ? 225 TYR B CE2 1 
ATOM   1285  C  CZ  . TYR B 2 92  ? 62.119  -0.763  74.697  1.00 27.68  ? 225 TYR B CZ  1 
ATOM   1286  O  OH  . TYR B 2 92  ? 63.421  -1.182  74.517  1.00 29.73  ? 225 TYR B OH  1 
ATOM   1287  N  N   . LEU B 2 93  ? 55.752  0.326   77.213  1.00 21.40  ? 226 LEU B N   1 
ATOM   1288  C  CA  . LEU B 2 93  ? 54.601  0.924   77.842  1.00 21.22  ? 226 LEU B CA  1 
ATOM   1289  C  C   . LEU B 2 93  ? 54.957  2.374   78.121  1.00 24.86  ? 226 LEU B C   1 
ATOM   1290  O  O   . LEU B 2 93  ? 55.949  2.646   78.789  1.00 25.92  ? 226 LEU B O   1 
ATOM   1291  C  CB  . LEU B 2 93  ? 54.306  0.175   79.133  1.00 21.88  ? 226 LEU B CB  1 
ATOM   1292  C  CG  . LEU B 2 93  ? 53.016  0.528   79.856  1.00 26.63  ? 226 LEU B CG  1 
ATOM   1293  C  CD1 . LEU B 2 93  ? 51.841  0.582   78.896  1.00 29.44  ? 226 LEU B CD1 1 
ATOM   1294  C  CD2 . LEU B 2 93  ? 52.784  -0.503  80.919  1.00 20.36  ? 226 LEU B CD2 1 
ATOM   1295  N  N   . ILE B 2 94  ? 54.183  3.308   77.574  1.00 26.58  ? 227 ILE B N   1 
ATOM   1296  C  CA  . ILE B 2 94  ? 54.466  4.727   77.801  1.00 23.85  ? 227 ILE B CA  1 
ATOM   1297  C  C   . ILE B 2 94  ? 53.289  5.466   78.421  1.00 29.08  ? 227 ILE B C   1 
ATOM   1298  O  O   . ILE B 2 94  ? 52.151  5.005   78.373  1.00 30.07  ? 227 ILE B O   1 
ATOM   1299  C  CB  . ILE B 2 94  ? 54.849  5.474   76.501  1.00 15.34  ? 227 ILE B CB  1 
ATOM   1300  C  CG1 . ILE B 2 94  ? 53.636  5.579   75.589  1.00 18.85  ? 227 ILE B CG1 1 
ATOM   1301  C  CG2 . ILE B 2 94  ? 55.976  4.760   75.786  1.00 2.70   ? 227 ILE B CG2 1 
ATOM   1302  C  CD1 . ILE B 2 94  ? 53.802  6.579   74.506  1.00 19.64  ? 227 ILE B CD1 1 
ATOM   1303  N  N   . GLN B 2 95  ? 53.587  6.621   79.000  1.00 34.48  ? 228 GLN B N   1 
ATOM   1304  C  CA  . GLN B 2 95  ? 52.583  7.473   79.610  1.00 38.08  ? 228 GLN B CA  1 
ATOM   1305  C  C   . GLN B 2 95  ? 53.084  8.893   79.402  1.00 37.20  ? 228 GLN B C   1 
ATOM   1306  O  O   . GLN B 2 95  ? 53.965  9.354   80.115  1.00 39.27  ? 228 GLN B O   1 
ATOM   1307  C  CB  . GLN B 2 95  ? 52.453  7.161   81.087  1.00 40.32  ? 228 GLN B CB  1 
ATOM   1308  C  CG  . GLN B 2 95  ? 51.487  8.067   81.802  1.00 43.34  ? 228 GLN B CG  1 
ATOM   1309  C  CD  . GLN B 2 95  ? 51.298  7.676   83.243  1.00 45.47  ? 228 GLN B CD  1 
ATOM   1310  O  OE1 . GLN B 2 95  ? 50.192  7.754   83.771  1.00 46.93  ? 228 GLN B OE1 1 
ATOM   1311  N  NE2 . GLN B 2 95  ? 52.373  7.230   83.888  1.00 45.99  ? 228 GLN B NE2 1 
ATOM   1312  N  N   . PRO B 2 96  ? 52.551  9.589   78.386  1.00 33.84  ? 229 PRO B N   1 
ATOM   1313  C  CA  . PRO B 2 96  ? 52.909  10.963  78.015  1.00 37.47  ? 229 PRO B CA  1 
ATOM   1314  C  C   . PRO B 2 96  ? 52.511  12.001  79.046  1.00 44.81  ? 229 PRO B C   1 
ATOM   1315  O  O   . PRO B 2 96  ? 53.358  12.715  79.583  1.00 45.51  ? 229 PRO B O   1 
ATOM   1316  C  CB  . PRO B 2 96  ? 52.140  11.172  76.714  1.00 31.88  ? 229 PRO B CB  1 
ATOM   1317  C  CG  . PRO B 2 96  ? 51.917  9.775   76.211  1.00 32.97  ? 229 PRO B CG  1 
ATOM   1318  C  CD  . PRO B 2 96  ? 51.549  9.059   77.453  1.00 31.18  ? 229 PRO B CD  1 
ATOM   1319  N  N   . ASP B 2 97  ? 51.206  12.137  79.248  1.00 55.94  ? 230 ASP B N   1 
ATOM   1320  C  CA  . ASP B 2 97  ? 50.675  13.074  80.222  1.00 63.44  ? 230 ASP B CA  1 
ATOM   1321  C  C   . ASP B 2 97  ? 50.430  12.292  81.498  1.00 64.68  ? 230 ASP B C   1 
ATOM   1322  O  O   . ASP B 2 97  ? 49.800  11.236  81.481  1.00 65.36  ? 230 ASP B O   1 
ATOM   1323  C  CB  . ASP B 2 97  ? 49.371  13.703  79.720  1.00 69.95  ? 230 ASP B CB  1 
ATOM   1324  C  CG  . ASP B 2 97  ? 48.686  14.581  80.769  1.00 76.44  ? 230 ASP B CG  1 
ATOM   1325  O  OD1 . ASP B 2 97  ? 49.312  14.957  81.792  1.00 77.26  ? 230 ASP B OD1 1 
ATOM   1326  O  OD2 . ASP B 2 97  ? 47.497  14.902  80.558  1.00 80.18  ? 230 ASP B OD2 1 
ATOM   1327  N  N   . SER B 2 98  ? 50.916  12.840  82.605  1.00 66.68  ? 231 SER B N   1 
ATOM   1328  C  CA  . SER B 2 98  ? 50.784  12.227  83.918  1.00 69.37  ? 231 SER B CA  1 
ATOM   1329  C  C   . SER B 2 98  ? 49.328  12.021  84.378  1.00 67.38  ? 231 SER B C   1 
ATOM   1330  O  O   . SER B 2 98  ? 49.072  11.763  85.554  1.00 66.84  ? 231 SER B O   1 
ATOM   1331  C  CB  . SER B 2 98  ? 51.567  13.063  84.942  1.00 75.26  ? 231 SER B CB  1 
ATOM   1332  O  OG  . SER B 2 98  ? 52.904  13.288  84.505  1.00 79.07  ? 231 SER B OG  1 
ATOM   1333  N  N   . SER B 2 99  ? 48.380  12.122  83.451  1.00 67.55  ? 232 SER B N   1 
ATOM   1334  C  CA  . SER B 2 99  ? 46.968  11.931  83.773  1.00 67.22  ? 232 SER B CA  1 
ATOM   1335  C  C   . SER B 2 99  ? 46.407  10.763  82.971  1.00 66.42  ? 232 SER B C   1 
ATOM   1336  O  O   . SER B 2 99  ? 45.446  10.110  83.370  1.00 71.71  ? 232 SER B O   1 
ATOM   1337  C  CB  . SER B 2 99  ? 46.172  13.193  83.442  1.00 67.51  ? 232 SER B CB  1 
ATOM   1338  O  OG  . SER B 2 99  ? 45.945  13.305  82.050  1.00 67.07  ? 232 SER B OG  1 
ATOM   1339  N  N   . VAL B 2 100 ? 47.019  10.514  81.827  1.00 62.13  ? 233 VAL B N   1 
ATOM   1340  C  CA  . VAL B 2 100 ? 46.591  9.447   80.955  1.00 60.90  ? 233 VAL B CA  1 
ATOM   1341  C  C   . VAL B 2 100 ? 46.916  8.072   81.506  1.00 52.68  ? 233 VAL B C   1 
ATOM   1342  O  O   . VAL B 2 100 ? 47.904  7.881   82.210  1.00 46.52  ? 233 VAL B O   1 
ATOM   1343  C  CB  . VAL B 2 100 ? 47.254  9.584   79.566  1.00 69.65  ? 233 VAL B CB  1 
ATOM   1344  C  CG1 . VAL B 2 100 ? 47.131  11.018  79.070  1.00 74.37  ? 233 VAL B CG1 1 
ATOM   1345  C  CG2 . VAL B 2 100 ? 48.725  9.159   79.612  1.00 70.83  ? 233 VAL B CG2 1 
ATOM   1346  N  N   . LYS B 2 101 ? 46.044  7.122   81.214  1.00 47.57  ? 234 LYS B N   1 
ATOM   1347  C  CA  . LYS B 2 101 ? 46.269  5.753   81.620  1.00 48.84  ? 234 LYS B CA  1 
ATOM   1348  C  C   . LYS B 2 101 ? 47.347  5.319   80.639  1.00 47.24  ? 234 LYS B C   1 
ATOM   1349  O  O   . LYS B 2 101 ? 47.188  5.482   79.428  1.00 51.72  ? 234 LYS B O   1 
ATOM   1350  C  CB  . LYS B 2 101 ? 44.995  4.923   81.433  1.00 55.19  ? 234 LYS B CB  1 
ATOM   1351  C  CG  . LYS B 2 101 ? 45.148  3.436   81.745  1.00 60.90  ? 234 LYS B CG  1 
ATOM   1352  C  CD  . LYS B 2 101 ? 45.882  3.195   83.074  1.00 70.00  ? 234 LYS B CD  1 
ATOM   1353  C  CE  . LYS B 2 101 ? 45.224  3.904   84.274  1.00 76.04  ? 234 LYS B CE  1 
ATOM   1354  N  NZ  . LYS B 2 101 ? 46.057  3.865   85.529  1.00 79.61  ? 234 LYS B NZ  1 
ATOM   1355  N  N   . PRO B 2 102 ? 48.493  4.839   81.147  1.00 41.58  ? 235 PRO B N   1 
ATOM   1356  C  CA  . PRO B 2 102 ? 49.593  4.400   80.279  1.00 39.03  ? 235 PRO B CA  1 
ATOM   1357  C  C   . PRO B 2 102 ? 49.156  3.354   79.256  1.00 39.99  ? 235 PRO B C   1 
ATOM   1358  O  O   . PRO B 2 102 ? 48.262  2.547   79.519  1.00 39.08  ? 235 PRO B O   1 
ATOM   1359  C  CB  . PRO B 2 102 ? 50.609  3.842   81.271  1.00 35.29  ? 235 PRO B CB  1 
ATOM   1360  C  CG  . PRO B 2 102 ? 49.766  3.435   82.436  1.00 36.94  ? 235 PRO B CG  1 
ATOM   1361  C  CD  . PRO B 2 102 ? 48.800  4.566   82.558  1.00 38.16  ? 235 PRO B CD  1 
ATOM   1362  N  N   . TYR B 2 103 ? 49.790  3.382   78.086  1.00 40.16  ? 236 TYR B N   1 
ATOM   1363  C  CA  . TYR B 2 103 ? 49.448  2.469   77.005  1.00 29.27  ? 236 TYR B CA  1 
ATOM   1364  C  C   . TYR B 2 103 ? 50.619  1.860   76.248  1.00 28.55  ? 236 TYR B C   1 
ATOM   1365  O  O   . TYR B 2 103 ? 51.735  2.400   76.205  1.00 25.47  ? 236 TYR B O   1 
ATOM   1366  C  CB  . TYR B 2 103 ? 48.512  3.160   76.016  1.00 21.78  ? 236 TYR B CB  1 
ATOM   1367  C  CG  . TYR B 2 103 ? 49.055  4.432   75.401  1.00 21.11  ? 236 TYR B CG  1 
ATOM   1368  C  CD1 . TYR B 2 103 ? 48.843  5.674   75.998  1.00 23.59  ? 236 TYR B CD1 1 
ATOM   1369  C  CD2 . TYR B 2 103 ? 49.727  4.401   74.189  1.00 25.18  ? 236 TYR B CD2 1 
ATOM   1370  C  CE1 . TYR B 2 103 ? 49.282  6.848   75.389  1.00 23.68  ? 236 TYR B CE1 1 
ATOM   1371  C  CE2 . TYR B 2 103 ? 50.170  5.571   73.572  1.00 25.56  ? 236 TYR B CE2 1 
ATOM   1372  C  CZ  . TYR B 2 103 ? 49.945  6.786   74.171  1.00 23.86  ? 236 TYR B CZ  1 
ATOM   1373  O  OH  . TYR B 2 103 ? 50.383  7.934   73.541  1.00 25.46  ? 236 TYR B OH  1 
ATOM   1374  N  N   . ARG B 2 104 ? 50.349  0.714   75.644  1.00 26.94  ? 237 ARG B N   1 
ATOM   1375  C  CA  . ARG B 2 104 ? 51.370  0.014   74.896  1.00 24.41  ? 237 ARG B CA  1 
ATOM   1376  C  C   . ARG B 2 104 ? 51.573  0.712   73.582  1.00 24.58  ? 237 ARG B C   1 
ATOM   1377  O  O   . ARG B 2 104 ? 50.633  1.278   73.021  1.00 29.30  ? 237 ARG B O   1 
ATOM   1378  C  CB  . ARG B 2 104 ? 50.940  -1.422  74.656  1.00 21.16  ? 237 ARG B CB  1 
ATOM   1379  C  CG  . ARG B 2 104 ? 50.515  -2.104  75.919  1.00 17.98  ? 237 ARG B CG  1 
ATOM   1380  C  CD  . ARG B 2 104 ? 50.043  -3.491  75.659  1.00 22.98  ? 237 ARG B CD  1 
ATOM   1381  N  NE  . ARG B 2 104 ? 49.774  -4.226  76.893  1.00 27.87  ? 237 ARG B NE  1 
ATOM   1382  C  CZ  . ARG B 2 104 ? 48.889  -3.853  77.812  1.00 31.98  ? 237 ARG B CZ  1 
ATOM   1383  N  NH1 . ARG B 2 104 ? 48.183  -2.725  77.663  1.00 30.78  ? 237 ARG B NH1 1 
ATOM   1384  N  NH2 . ARG B 2 104 ? 48.632  -4.672  78.827  1.00 34.12  ? 237 ARG B NH2 1 
ATOM   1385  N  N   . VAL B 2 105 ? 52.803  0.644   73.090  1.00 23.74  ? 238 VAL B N   1 
ATOM   1386  C  CA  . VAL B 2 105 ? 53.179  1.260   71.823  1.00 15.93  ? 238 VAL B CA  1 
ATOM   1387  C  C   . VAL B 2 105 ? 54.455  0.581   71.346  1.00 15.04  ? 238 VAL B C   1 
ATOM   1388  O  O   . VAL B 2 105 ? 55.192  0.024   72.154  1.00 17.05  ? 238 VAL B O   1 
ATOM   1389  C  CB  . VAL B 2 105 ? 53.460  2.778   72.020  1.00 15.77  ? 238 VAL B CB  1 
ATOM   1390  C  CG1 . VAL B 2 105 ? 54.960  3.053   72.216  1.00 14.74  ? 238 VAL B CG1 1 
ATOM   1391  C  CG2 . VAL B 2 105 ? 52.925  3.568   70.848  1.00 19.56  ? 238 VAL B CG2 1 
ATOM   1392  N  N   . TYR B 2 106 ? 54.721  0.596   70.047  1.00 15.95  ? 239 TYR B N   1 
ATOM   1393  C  CA  . TYR B 2 106 ? 55.957  -0.007  69.584  1.00 11.93  ? 239 TYR B CA  1 
ATOM   1394  C  C   . TYR B 2 106 ? 56.989  1.082   69.421  1.00 15.60  ? 239 TYR B C   1 
ATOM   1395  O  O   . TYR B 2 106 ? 56.670  2.142   68.896  1.00 23.63  ? 239 TYR B O   1 
ATOM   1396  C  CB  . TYR B 2 106 ? 55.759  -0.728  68.280  1.00 11.74  ? 239 TYR B CB  1 
ATOM   1397  C  CG  . TYR B 2 106 ? 56.968  -1.548  67.925  1.00 19.21  ? 239 TYR B CG  1 
ATOM   1398  C  CD1 . TYR B 2 106 ? 57.154  -2.841  68.441  1.00 17.36  ? 239 TYR B CD1 1 
ATOM   1399  C  CD2 . TYR B 2 106 ? 57.936  -1.030  67.086  1.00 19.53  ? 239 TYR B CD2 1 
ATOM   1400  C  CE1 . TYR B 2 106 ? 58.278  -3.581  68.116  1.00 15.21  ? 239 TYR B CE1 1 
ATOM   1401  C  CE2 . TYR B 2 106 ? 59.052  -1.752  66.764  1.00 19.57  ? 239 TYR B CE2 1 
ATOM   1402  C  CZ  . TYR B 2 106 ? 59.230  -3.018  67.273  1.00 19.52  ? 239 TYR B CZ  1 
ATOM   1403  O  OH  . TYR B 2 106 ? 60.391  -3.672  66.932  1.00 25.19  ? 239 TYR B OH  1 
ATOM   1404  N  N   . CYS B 2 107 ? 58.203  0.853   69.923  1.00 15.63  ? 240 CYS B N   1 
ATOM   1405  C  CA  . CYS B 2 107 ? 59.278  1.838   69.832  1.00 9.78   ? 240 CYS B CA  1 
ATOM   1406  C  C   . CYS B 2 107 ? 60.388  1.371   68.935  1.00 17.49  ? 240 CYS B C   1 
ATOM   1407  O  O   . CYS B 2 107 ? 61.007  0.339   69.190  1.00 14.05  ? 240 CYS B O   1 
ATOM   1408  C  CB  . CYS B 2 107 ? 59.904  2.105   71.192  1.00 17.86  ? 240 CYS B CB  1 
ATOM   1409  S  SG  . CYS B 2 107 ? 58.955  3.165   72.336  1.00 22.90  ? 240 CYS B SG  1 
ATOM   1410  N  N   . ASP B 2 108 ? 60.630  2.126   67.873  1.00 25.10  ? 241 ASP B N   1 
ATOM   1411  C  CA  . ASP B 2 108 ? 61.714  1.799   66.966  1.00 29.81  ? 241 ASP B CA  1 
ATOM   1412  C  C   . ASP B 2 108 ? 62.954  2.421   67.594  1.00 30.97  ? 241 ASP B C   1 
ATOM   1413  O  O   . ASP B 2 108 ? 63.169  3.636   67.531  1.00 23.30  ? 241 ASP B O   1 
ATOM   1414  C  CB  . ASP B 2 108 ? 61.477  2.388   65.581  1.00 31.39  ? 241 ASP B CB  1 
ATOM   1415  C  CG  . ASP B 2 108 ? 62.595  2.055   64.605  1.00 30.56  ? 241 ASP B CG  1 
ATOM   1416  O  OD1 . ASP B 2 108 ? 63.748  1.798   65.034  1.00 28.02  ? 241 ASP B OD1 1 
ATOM   1417  O  OD2 . ASP B 2 108 ? 62.318  2.063   63.388  1.00 33.74  ? 241 ASP B OD2 1 
ATOM   1418  N  N   . MET B 2 109 ? 63.786  1.564   68.165  1.00 32.04  ? 242 MET B N   1 
ATOM   1419  C  CA  . MET B 2 109 ? 64.985  2.020   68.818  1.00 28.80  ? 242 MET B CA  1 
ATOM   1420  C  C   . MET B 2 109 ? 66.207  2.043   67.935  1.00 31.54  ? 242 MET B C   1 
ATOM   1421  O  O   . MET B 2 109 ? 67.314  2.117   68.437  1.00 36.96  ? 242 MET B O   1 
ATOM   1422  C  CB  . MET B 2 109 ? 65.230  1.179   70.061  1.00 29.05  ? 242 MET B CB  1 
ATOM   1423  C  CG  . MET B 2 109 ? 64.086  1.270   71.033  1.00 32.12  ? 242 MET B CG  1 
ATOM   1424  S  SD  . MET B 2 109 ? 63.673  2.990   71.227  1.00 33.88  ? 242 MET B SD  1 
ATOM   1425  C  CE  . MET B 2 109 ? 63.145  3.062   72.893  1.00 28.98  ? 242 MET B CE  1 
ATOM   1426  N  N   . ASN B 2 110 ? 66.031  1.982   66.623  1.00 34.72  ? 243 ASN B N   1 
ATOM   1427  C  CA  . ASN B 2 110 ? 67.189  2.022   65.739  1.00 43.89  ? 243 ASN B CA  1 
ATOM   1428  C  C   . ASN B 2 110 ? 66.878  2.249   64.278  1.00 47.90  ? 243 ASN B C   1 
ATOM   1429  O  O   . ASN B 2 110 ? 66.708  1.305   63.514  1.00 59.94  ? 243 ASN B O   1 
ATOM   1430  C  CB  . ASN B 2 110 ? 68.079  0.774   65.909  1.00 51.33  ? 243 ASN B CB  1 
ATOM   1431  C  CG  . ASN B 2 110 ? 67.281  -0.511  66.062  1.00 59.16  ? 243 ASN B CG  1 
ATOM   1432  O  OD1 . ASN B 2 110 ? 66.238  -0.691  65.430  1.00 61.28  ? 243 ASN B OD1 1 
ATOM   1433  N  ND2 . ASN B 2 110 ? 67.768  -1.413  66.914  1.00 64.59  ? 243 ASN B ND2 1 
ATOM   1434  N  N   . THR B 2 111 ? 66.799  3.508   63.886  1.00 39.19  ? 244 THR B N   1 
ATOM   1435  C  CA  . THR B 2 111 ? 66.533  3.816   62.500  1.00 40.94  ? 244 THR B CA  1 
ATOM   1436  C  C   . THR B 2 111 ? 67.287  5.082   62.224  1.00 53.11  ? 244 THR B C   1 
ATOM   1437  O  O   . THR B 2 111 ? 68.219  5.113   61.413  1.00 63.78  ? 244 THR B O   1 
ATOM   1438  C  CB  . THR B 2 111 ? 65.054  4.045   62.235  1.00 28.55  ? 244 THR B CB  1 
ATOM   1439  O  OG1 . THR B 2 111 ? 64.359  4.033   63.477  1.00 36.29  ? 244 THR B OG1 1 
ATOM   1440  C  CG2 . THR B 2 111 ? 64.496  2.974   61.349  1.00 19.82  ? 244 THR B CG2 1 
ATOM   1441  N  N   . GLU B 2 112 ? 66.905  6.131   62.923  1.00 46.17  ? 245 GLU B N   1 
ATOM   1442  C  CA  . GLU B 2 112 ? 67.573  7.390   62.735  1.00 51.96  ? 245 GLU B CA  1 
ATOM   1443  C  C   . GLU B 2 112 ? 67.925  7.759   64.136  1.00 57.37  ? 245 GLU B C   1 
ATOM   1444  O  O   . GLU B 2 112 ? 67.433  8.751   64.670  1.00 66.48  ? 245 GLU B O   1 
ATOM   1445  C  CB  . GLU B 2 112 ? 66.618  8.412   62.129  1.00 53.68  ? 245 GLU B CB  1 
ATOM   1446  C  CG  . GLU B 2 112 ? 66.045  8.007   60.774  1.00 61.00  ? 245 GLU B CG  1 
ATOM   1447  C  CD  . GLU B 2 112 ? 67.022  8.218   59.624  1.00 65.10  ? 245 GLU B CD  1 
ATOM   1448  O  OE1 . GLU B 2 112 ? 67.397  9.391   59.375  1.00 68.84  ? 245 GLU B OE1 1 
ATOM   1449  O  OE2 . GLU B 2 112 ? 67.398  7.218   58.958  1.00 63.68  ? 245 GLU B OE2 1 
ATOM   1450  N  N   . ASN B 2 113 ? 68.750  6.907   64.740  1.00 55.83  ? 246 ASN B N   1 
ATOM   1451  C  CA  . ASN B 2 113 ? 69.202  7.066   66.122  1.00 55.08  ? 246 ASN B CA  1 
ATOM   1452  C  C   . ASN B 2 113 ? 68.145  6.597   67.130  1.00 49.92  ? 246 ASN B C   1 
ATOM   1453  O  O   . ASN B 2 113 ? 68.330  6.763   68.329  1.00 50.97  ? 246 ASN B O   1 
ATOM   1454  C  CB  . ASN B 2 113 ? 69.587  8.523   66.432  1.00 63.19  ? 246 ASN B CB  1 
ATOM   1455  C  CG  . ASN B 2 113 ? 70.755  9.019   65.602  1.00 68.26  ? 246 ASN B CG  1 
ATOM   1456  O  OD1 . ASN B 2 113 ? 71.705  9.577   66.145  1.00 69.62  ? 246 ASN B OD1 1 
ATOM   1457  N  ND2 . ASN B 2 113 ? 70.681  8.844   64.279  1.00 70.14  ? 246 ASN B ND2 1 
ATOM   1458  N  N   . GLY B 2 114 ? 67.029  6.051   66.645  1.00 48.63  ? 247 GLY B N   1 
ATOM   1459  C  CA  . GLY B 2 114 ? 65.977  5.569   67.535  1.00 39.56  ? 247 GLY B CA  1 
ATOM   1460  C  C   . GLY B 2 114 ? 65.173  6.618   68.304  1.00 34.15  ? 247 GLY B C   1 
ATOM   1461  O  O   . GLY B 2 114 ? 65.462  7.811   68.245  1.00 35.97  ? 247 GLY B O   1 
ATOM   1462  N  N   . GLY B 2 115 ? 64.171  6.162   69.055  1.00 35.08  ? 248 GLY B N   1 
ATOM   1463  C  CA  . GLY B 2 115 ? 63.323  7.065   69.831  1.00 29.17  ? 248 GLY B CA  1 
ATOM   1464  C  C   . GLY B 2 115 ? 62.008  7.328   69.114  1.00 18.04  ? 248 GLY B C   1 
ATOM   1465  O  O   . GLY B 2 115 ? 61.224  8.211   69.470  1.00 14.54  ? 248 GLY B O   1 
ATOM   1466  N  N   . TRP B 2 116 ? 61.753  6.505   68.113  1.00 13.03  ? 249 TRP B N   1 
ATOM   1467  C  CA  . TRP B 2 116 ? 60.570  6.647   67.310  1.00 14.74  ? 249 TRP B CA  1 
ATOM   1468  C  C   . TRP B 2 116 ? 59.357  5.918   67.830  1.00 9.68   ? 249 TRP B C   1 
ATOM   1469  O  O   . TRP B 2 116 ? 59.304  4.691   67.880  1.00 7.42   ? 249 TRP B O   1 
ATOM   1470  C  CB  . TRP B 2 116 ? 60.862  6.195   65.891  1.00 21.18  ? 249 TRP B CB  1 
ATOM   1471  C  CG  . TRP B 2 116 ? 61.913  6.986   65.244  1.00 25.99  ? 249 TRP B CG  1 
ATOM   1472  C  CD1 . TRP B 2 116 ? 63.224  6.628   65.060  1.00 23.06  ? 249 TRP B CD1 1 
ATOM   1473  C  CD2 . TRP B 2 116 ? 61.757  8.281   64.667  1.00 30.76  ? 249 TRP B CD2 1 
ATOM   1474  N  NE1 . TRP B 2 116 ? 63.898  7.627   64.400  1.00 26.07  ? 249 TRP B NE1 1 
ATOM   1475  C  CE2 . TRP B 2 116 ? 63.025  8.658   64.145  1.00 31.71  ? 249 TRP B CE2 1 
ATOM   1476  C  CE3 . TRP B 2 116 ? 60.670  9.166   64.535  1.00 27.57  ? 249 TRP B CE3 1 
ATOM   1477  C  CZ2 . TRP B 2 116 ? 63.234  9.896   63.497  1.00 29.07  ? 249 TRP B CZ2 1 
ATOM   1478  C  CZ3 . TRP B 2 116 ? 60.873  10.395  63.891  1.00 29.07  ? 249 TRP B CZ3 1 
ATOM   1479  C  CH2 . TRP B 2 116 ? 62.149  10.746  63.381  1.00 30.51  ? 249 TRP B CH2 1 
ATOM   1480  N  N   . THR B 2 117 ? 58.375  6.699   68.225  1.00 9.71   ? 250 THR B N   1 
ATOM   1481  C  CA  . THR B 2 117 ? 57.140  6.131   68.697  1.00 8.14   ? 250 THR B CA  1 
ATOM   1482  C  C   . THR B 2 117 ? 56.364  5.805   67.433  1.00 11.75  ? 250 THR B C   1 
ATOM   1483  O  O   . THR B 2 117 ? 55.953  6.709   66.688  1.00 13.96  ? 250 THR B O   1 
ATOM   1484  C  CB  . THR B 2 117 ? 56.339  7.133   69.524  1.00 7.52   ? 250 THR B CB  1 
ATOM   1485  O  OG1 . THR B 2 117 ? 57.097  7.522   70.672  1.00 12.10  ? 250 THR B OG1 1 
ATOM   1486  C  CG2 . THR B 2 117 ? 55.048  6.509   69.972  1.00 8.90   ? 250 THR B CG2 1 
ATOM   1487  N  N   . VAL B 2 118 ? 56.230  4.512   67.159  1.00 6.01   ? 251 VAL B N   1 
ATOM   1488  C  CA  . VAL B 2 118 ? 55.501  4.067   65.987  1.00 11.39  ? 251 VAL B CA  1 
ATOM   1489  C  C   . VAL B 2 118 ? 54.055  4.477   66.172  1.00 12.16  ? 251 VAL B C   1 
ATOM   1490  O  O   . VAL B 2 118 ? 53.467  4.185   67.221  1.00 10.05  ? 251 VAL B O   1 
ATOM   1491  C  CB  . VAL B 2 118 ? 55.599  2.559   65.817  1.00 13.66  ? 251 VAL B CB  1 
ATOM   1492  C  CG1 . VAL B 2 118 ? 54.944  2.150   64.526  1.00 12.04  ? 251 VAL B CG1 1 
ATOM   1493  C  CG2 . VAL B 2 118 ? 57.059  2.133   65.825  1.00 16.52  ? 251 VAL B CG2 1 
ATOM   1494  N  N   . ILE B 2 119 ? 53.529  5.218   65.192  1.00 11.19  ? 252 ILE B N   1 
ATOM   1495  C  CA  . ILE B 2 119 ? 52.152  5.733   65.208  1.00 13.98  ? 252 ILE B CA  1 
ATOM   1496  C  C   . ILE B 2 119 ? 51.147  5.055   64.239  1.00 19.26  ? 252 ILE B C   1 
ATOM   1497  O  O   . ILE B 2 119 ? 49.938  5.154   64.403  1.00 16.35  ? 252 ILE B O   1 
ATOM   1498  C  CB  . ILE B 2 119 ? 52.184  7.269   65.028  1.00 17.34  ? 252 ILE B CB  1 
ATOM   1499  C  CG1 . ILE B 2 119 ? 51.537  7.912   66.231  1.00 25.61  ? 252 ILE B CG1 1 
ATOM   1500  C  CG2 . ILE B 2 119 ? 51.596  7.738   63.713  1.00 17.53  ? 252 ILE B CG2 1 
ATOM   1501  C  CD1 . ILE B 2 119 ? 52.300  7.614   67.478  1.00 30.58  ? 252 ILE B CD1 1 
ATOM   1502  N  N   . GLN B 2 120 ? 51.669  4.327   63.260  1.00 22.74  ? 253 GLN B N   1 
ATOM   1503  C  CA  . GLN B 2 120 ? 50.867  3.627   62.272  1.00 19.72  ? 253 GLN B CA  1 
ATOM   1504  C  C   . GLN B 2 120 ? 51.850  2.689   61.585  1.00 18.29  ? 253 GLN B C   1 
ATOM   1505  O  O   . GLN B 2 120 ? 52.999  3.047   61.363  1.00 24.47  ? 253 GLN B O   1 
ATOM   1506  C  CB  . GLN B 2 120 ? 50.280  4.629   61.267  1.00 22.03  ? 253 GLN B CB  1 
ATOM   1507  C  CG  . GLN B 2 120 ? 49.443  4.035   60.109  1.00 24.68  ? 253 GLN B CG  1 
ATOM   1508  C  CD  . GLN B 2 120 ? 50.257  3.654   58.868  1.00 24.39  ? 253 GLN B CD  1 
ATOM   1509  O  OE1 . GLN B 2 120 ? 49.708  3.191   57.880  1.00 21.23  ? 253 GLN B OE1 1 
ATOM   1510  N  NE2 . GLN B 2 120 ? 51.566  3.847   58.926  1.00 24.15  ? 253 GLN B NE2 1 
ATOM   1511  N  N   . ASN B 2 121 ? 51.394  1.496   61.232  1.00 18.17  ? 254 ASN B N   1 
ATOM   1512  C  CA  . ASN B 2 121 ? 52.252  0.534   60.570  1.00 18.34  ? 254 ASN B CA  1 
ATOM   1513  C  C   . ASN B 2 121 ? 51.494  -0.429  59.637  1.00 19.63  ? 254 ASN B C   1 
ATOM   1514  O  O   . ASN B 2 121 ? 50.463  -0.991  59.998  1.00 16.92  ? 254 ASN B O   1 
ATOM   1515  C  CB  . ASN B 2 121 ? 53.028  -0.234  61.638  1.00 17.38  ? 254 ASN B CB  1 
ATOM   1516  C  CG  . ASN B 2 121 ? 53.968  -1.268  61.057  1.00 16.44  ? 254 ASN B CG  1 
ATOM   1517  O  OD1 . ASN B 2 121 ? 54.795  -0.968  60.200  1.00 17.15  ? 254 ASN B OD1 1 
ATOM   1518  N  ND2 . ASN B 2 121 ? 53.832  -2.504  61.517  1.00 17.24  ? 254 ASN B ND2 1 
ATOM   1519  N  N   . ARG B 2 122 ? 51.984  -0.552  58.411  1.00 19.03  ? 255 ARG B N   1 
ATOM   1520  C  CA  . ARG B 2 122 ? 51.419  -1.457  57.417  1.00 17.76  ? 255 ARG B CA  1 
ATOM   1521  C  C   . ARG B 2 122 ? 52.597  -2.349  57.001  1.00 24.70  ? 255 ARG B C   1 
ATOM   1522  O  O   . ARG B 2 122 ? 53.747  -1.878  56.926  1.00 26.61  ? 255 ARG B O   1 
ATOM   1523  C  CB  . ARG B 2 122 ? 50.916  -0.682  56.198  1.00 16.08  ? 255 ARG B CB  1 
ATOM   1524  C  CG  . ARG B 2 122 ? 49.955  0.443   56.505  1.00 19.27  ? 255 ARG B CG  1 
ATOM   1525  C  CD  . ARG B 2 122 ? 48.733  -0.002  57.334  1.00 16.50  ? 255 ARG B CD  1 
ATOM   1526  N  NE  . ARG B 2 122 ? 47.864  -0.973  56.665  1.00 16.21  ? 255 ARG B NE  1 
ATOM   1527  C  CZ  . ARG B 2 122 ? 47.107  -0.711  55.605  1.00 15.70  ? 255 ARG B CZ  1 
ATOM   1528  N  NH1 . ARG B 2 122 ? 47.087  0.496   55.062  1.00 10.69  ? 255 ARG B NH1 1 
ATOM   1529  N  NH2 . ARG B 2 122 ? 46.375  -1.673  55.076  1.00 24.23  ? 255 ARG B NH2 1 
ATOM   1530  N  N   . GLN B 2 123 ? 52.326  -3.632  56.758  1.00 27.19  ? 256 GLN B N   1 
ATOM   1531  C  CA  . GLN B 2 123 ? 53.383  -4.567  56.363  1.00 28.85  ? 256 GLN B CA  1 
ATOM   1532  C  C   . GLN B 2 123 ? 52.956  -5.929  55.833  1.00 32.35  ? 256 GLN B C   1 
ATOM   1533  O  O   . GLN B 2 123 ? 53.775  -6.628  55.240  1.00 37.28  ? 256 GLN B O   1 
ATOM   1534  C  CB  . GLN B 2 123 ? 54.350  -4.802  57.516  1.00 26.43  ? 256 GLN B CB  1 
ATOM   1535  C  CG  . GLN B 2 123 ? 53.764  -5.606  58.642  1.00 17.67  ? 256 GLN B CG  1 
ATOM   1536  C  CD  . GLN B 2 123 ? 54.562  -5.472  59.930  1.00 16.77  ? 256 GLN B CD  1 
ATOM   1537  O  OE1 . GLN B 2 123 ? 54.122  -5.927  60.980  1.00 23.71  ? 256 GLN B OE1 1 
ATOM   1538  N  NE2 . GLN B 2 123 ? 55.739  -4.844  59.855  1.00 18.18  ? 256 GLN B NE2 1 
ATOM   1539  N  N   . ASP B 2 124 ? 51.702  -6.322  56.040  1.00 31.07  ? 257 ASP B N   1 
ATOM   1540  C  CA  . ASP B 2 124 ? 51.252  -7.625  55.557  1.00 29.62  ? 257 ASP B CA  1 
ATOM   1541  C  C   . ASP B 2 124 ? 49.731  -7.767  55.352  1.00 36.32  ? 257 ASP B C   1 
ATOM   1542  O  O   . ASP B 2 124 ? 49.221  -8.875  55.117  1.00 41.45  ? 257 ASP B O   1 
ATOM   1543  C  CB  . ASP B 2 124 ? 51.760  -8.707  56.502  1.00 26.66  ? 257 ASP B CB  1 
ATOM   1544  C  CG  . ASP B 2 124 ? 51.266  -8.515  57.913  1.00 32.34  ? 257 ASP B CG  1 
ATOM   1545  O  OD1 . ASP B 2 124 ? 50.401  -7.638  58.129  1.00 39.10  ? 257 ASP B OD1 1 
ATOM   1546  O  OD2 . ASP B 2 124 ? 51.723  -9.246  58.813  1.00 35.62  ? 257 ASP B OD2 1 
ATOM   1547  N  N   . GLY B 2 125 ? 49.016  -6.651  55.471  1.00 34.70  ? 258 GLY B N   1 
ATOM   1548  C  CA  . GLY B 2 125 ? 47.578  -6.653  55.288  1.00 30.29  ? 258 GLY B CA  1 
ATOM   1549  C  C   . GLY B 2 125 ? 46.778  -7.469  56.278  1.00 25.41  ? 258 GLY B C   1 
ATOM   1550  O  O   . GLY B 2 125 ? 45.678  -7.894  55.952  1.00 21.15  ? 258 GLY B O   1 
ATOM   1551  N  N   . SER B 2 126 ? 47.279  -7.633  57.497  1.00 24.78  ? 259 SER B N   1 
ATOM   1552  C  CA  . SER B 2 126 ? 46.568  -8.410  58.512  1.00 28.01  ? 259 SER B CA  1 
ATOM   1553  C  C   . SER B 2 126 ? 45.475  -7.687  59.333  1.00 29.45  ? 259 SER B C   1 
ATOM   1554  O  O   . SER B 2 126 ? 44.842  -8.318  60.189  1.00 31.15  ? 259 SER B O   1 
ATOM   1555  C  CB  . SER B 2 126 ? 47.578  -9.016  59.473  1.00 21.54  ? 259 SER B CB  1 
ATOM   1556  O  OG  . SER B 2 126 ? 48.194  -7.990  60.216  1.00 25.89  ? 259 SER B OG  1 
ATOM   1557  N  N   . VAL B 2 127 ? 45.272  -6.384  59.094  1.00 26.74  ? 260 VAL B N   1 
ATOM   1558  C  CA  . VAL B 2 127 ? 44.277  -5.583  59.830  1.00 24.69  ? 260 VAL B CA  1 
ATOM   1559  C  C   . VAL B 2 127 ? 43.358  -4.714  58.955  1.00 21.98  ? 260 VAL B C   1 
ATOM   1560  O  O   . VAL B 2 127 ? 43.823  -3.999  58.069  1.00 15.45  ? 260 VAL B O   1 
ATOM   1561  C  CB  . VAL B 2 127 ? 44.958  -4.621  60.834  1.00 26.20  ? 260 VAL B CB  1 
ATOM   1562  C  CG1 . VAL B 2 127 ? 43.899  -3.781  61.582  1.00 30.02  ? 260 VAL B CG1 1 
ATOM   1563  C  CG2 . VAL B 2 127 ? 45.852  -5.379  61.795  1.00 27.65  ? 260 VAL B CG2 1 
ATOM   1564  N  N   . ASP B 2 128 ? 42.054  -4.744  59.241  1.00 25.27  ? 261 ASP B N   1 
ATOM   1565  C  CA  . ASP B 2 128 ? 41.100  -3.929  58.485  1.00 21.23  ? 261 ASP B CA  1 
ATOM   1566  C  C   . ASP B 2 128 ? 41.333  -2.508  58.925  1.00 19.70  ? 261 ASP B C   1 
ATOM   1567  O  O   . ASP B 2 128 ? 41.307  -2.203  60.124  1.00 21.16  ? 261 ASP B O   1 
ATOM   1568  C  CB  . ASP B 2 128 ? 39.639  -4.304  58.774  1.00 21.50  ? 261 ASP B CB  1 
ATOM   1569  C  CG  . ASP B 2 128 ? 38.655  -3.454  57.974  1.00 29.60  ? 261 ASP B CG  1 
ATOM   1570  O  OD1 . ASP B 2 128 ? 39.101  -2.841  56.975  1.00 29.15  ? 261 ASP B OD1 1 
ATOM   1571  O  OD2 . ASP B 2 128 ? 37.451  -3.375  58.337  1.00 35.96  ? 261 ASP B OD2 1 
ATOM   1572  N  N   . PHE B 2 129 ? 41.622  -1.655  57.957  1.00 15.37  ? 262 PHE B N   1 
ATOM   1573  C  CA  . PHE B 2 129 ? 41.864  -0.263  58.270  1.00 17.59  ? 262 PHE B CA  1 
ATOM   1574  C  C   . PHE B 2 129 ? 40.687  0.559   57.895  1.00 18.57  ? 262 PHE B C   1 
ATOM   1575  O  O   . PHE B 2 129 ? 40.649  1.744   58.188  1.00 21.71  ? 262 PHE B O   1 
ATOM   1576  C  CB  . PHE B 2 129 ? 43.108  0.264   57.578  1.00 14.92  ? 262 PHE B CB  1 
ATOM   1577  C  CG  . PHE B 2 129 ? 44.352  0.114   58.386  1.00 17.58  ? 262 PHE B CG  1 
ATOM   1578  C  CD1 . PHE B 2 129 ? 44.967  -1.118  58.520  1.00 18.11  ? 262 PHE B CD1 1 
ATOM   1579  C  CD2 . PHE B 2 129 ? 44.937  1.212   58.978  1.00 16.65  ? 262 PHE B CD2 1 
ATOM   1580  C  CE1 . PHE B 2 129 ? 46.162  -1.247  59.238  1.00 13.70  ? 262 PHE B CE1 1 
ATOM   1581  C  CE2 . PHE B 2 129 ? 46.130  1.086   59.692  1.00 10.57  ? 262 PHE B CE2 1 
ATOM   1582  C  CZ  . PHE B 2 129 ? 46.736  -0.142  59.816  1.00 8.71   ? 262 PHE B CZ  1 
ATOM   1583  N  N   . GLY B 2 130 ? 39.758  -0.070  57.183  1.00 23.71  ? 263 GLY B N   1 
ATOM   1584  C  CA  . GLY B 2 130 ? 38.542  0.608   56.782  1.00 18.65  ? 263 GLY B CA  1 
ATOM   1585  C  C   . GLY B 2 130 ? 37.635  0.535   57.978  1.00 15.07  ? 263 GLY B C   1 
ATOM   1586  O  O   . GLY B 2 130 ? 36.878  -0.425  58.125  1.00 23.16  ? 263 GLY B O   1 
ATOM   1587  N  N   . ARG B 2 131 ? 37.822  1.490   58.881  1.00 12.85  ? 264 ARG B N   1 
ATOM   1588  C  CA  . ARG B 2 131 ? 37.053  1.590   60.109  1.00 15.36  ? 264 ARG B CA  1 
ATOM   1589  C  C   . ARG B 2 131 ? 36.416  2.982   60.247  1.00 18.47  ? 264 ARG B C   1 
ATOM   1590  O  O   . ARG B 2 131 ? 36.853  3.965   59.623  1.00 16.32  ? 264 ARG B O   1 
ATOM   1591  C  CB  . ARG B 2 131 ? 37.930  1.289   61.316  1.00 16.77  ? 264 ARG B CB  1 
ATOM   1592  C  CG  . ARG B 2 131 ? 38.810  0.093   61.134  1.00 18.22  ? 264 ARG B CG  1 
ATOM   1593  C  CD  . ARG B 2 131 ? 39.319  -0.449  62.456  1.00 20.91  ? 264 ARG B CD  1 
ATOM   1594  N  NE  . ARG B 2 131 ? 39.921  -1.758  62.237  1.00 16.26  ? 264 ARG B NE  1 
ATOM   1595  C  CZ  . ARG B 2 131 ? 40.029  -2.688  63.167  1.00 12.11  ? 264 ARG B CZ  1 
ATOM   1596  N  NH1 . ARG B 2 131 ? 39.585  -2.450  64.388  1.00 18.04  ? 264 ARG B NH1 1 
ATOM   1597  N  NH2 . ARG B 2 131 ? 40.543  -3.861  62.863  1.00 11.61  ? 264 ARG B NH2 1 
ATOM   1598  N  N   . LYS B 2 132 ? 35.364  3.047   61.054  1.00 22.07  ? 265 LYS B N   1 
ATOM   1599  C  CA  . LYS B 2 132 ? 34.637  4.286   61.249  1.00 22.71  ? 265 LYS B CA  1 
ATOM   1600  C  C   . LYS B 2 132 ? 35.424  5.268   62.095  1.00 21.84  ? 265 LYS B C   1 
ATOM   1601  O  O   . LYS B 2 132 ? 36.583  5.026   62.425  1.00 19.37  ? 265 LYS B O   1 
ATOM   1602  C  CB  . LYS B 2 132 ? 33.286  4.006   61.889  1.00 27.24  ? 265 LYS B CB  1 
ATOM   1603  C  CG  . LYS B 2 132 ? 32.405  3.051   61.110  1.00 35.06  ? 265 LYS B CG  1 
ATOM   1604  C  CD  . LYS B 2 132 ? 31.119  2.785   61.900  1.00 41.29  ? 265 LYS B CD  1 
ATOM   1605  C  CE  . LYS B 2 132 ? 30.322  1.592   61.378  1.00 43.15  ? 265 LYS B CE  1 
ATOM   1606  N  NZ  . LYS B 2 132 ? 29.790  1.809   60.010  1.00 43.32  ? 265 LYS B NZ  1 
ATOM   1607  N  N   . TRP B 2 133 ? 34.781  6.375   62.451  1.00 23.81  ? 266 TRP B N   1 
ATOM   1608  C  CA  . TRP B 2 133 ? 35.416  7.404   63.252  1.00 23.12  ? 266 TRP B CA  1 
ATOM   1609  C  C   . TRP B 2 133 ? 35.996  6.927   64.591  1.00 26.47  ? 266 TRP B C   1 
ATOM   1610  O  O   . TRP B 2 133 ? 37.198  7.082   64.821  1.00 29.24  ? 266 TRP B O   1 
ATOM   1611  C  CB  . TRP B 2 133 ? 34.446  8.545   63.484  1.00 24.23  ? 266 TRP B CB  1 
ATOM   1612  C  CG  . TRP B 2 133 ? 35.052  9.692   64.209  1.00 26.30  ? 266 TRP B CG  1 
ATOM   1613  C  CD1 . TRP B 2 133 ? 34.987  9.949   65.554  1.00 26.39  ? 266 TRP B CD1 1 
ATOM   1614  C  CD2 . TRP B 2 133 ? 35.777  10.775  63.625  1.00 26.64  ? 266 TRP B CD2 1 
ATOM   1615  N  NE1 . TRP B 2 133 ? 35.626  11.134  65.840  1.00 26.94  ? 266 TRP B NE1 1 
ATOM   1616  C  CE2 . TRP B 2 133 ? 36.118  11.665  64.674  1.00 25.59  ? 266 TRP B CE2 1 
ATOM   1617  C  CE3 . TRP B 2 133 ? 36.157  11.092  62.316  1.00 25.19  ? 266 TRP B CE3 1 
ATOM   1618  C  CZ2 . TRP B 2 133 ? 36.824  12.855  64.451  1.00 18.12  ? 266 TRP B CZ2 1 
ATOM   1619  C  CZ3 . TRP B 2 133 ? 36.854  12.274  62.097  1.00 23.79  ? 266 TRP B CZ3 1 
ATOM   1620  C  CH2 . TRP B 2 133 ? 37.179  13.141  63.164  1.00 16.63  ? 266 TRP B CH2 1 
ATOM   1621  N  N   . ASP B 2 134 ? 35.172  6.334   65.458  1.00 21.97  ? 267 ASP B N   1 
ATOM   1622  C  CA  . ASP B 2 134 ? 35.654  5.877   66.762  1.00 29.27  ? 267 ASP B CA  1 
ATOM   1623  C  C   . ASP B 2 134 ? 36.937  5.062   66.856  1.00 29.43  ? 267 ASP B C   1 
ATOM   1624  O  O   . ASP B 2 134 ? 37.774  5.346   67.711  1.00 30.68  ? 267 ASP B O   1 
ATOM   1625  C  CB  . ASP B 2 134 ? 34.557  5.190   67.552  1.00 36.60  ? 267 ASP B CB  1 
ATOM   1626  C  CG  . ASP B 2 134 ? 33.760  6.159   68.364  1.00 48.63  ? 267 ASP B CG  1 
ATOM   1627  O  OD1 . ASP B 2 134 ? 32.925  6.865   67.757  1.00 56.88  ? 267 ASP B OD1 1 
ATOM   1628  O  OD2 . ASP B 2 134 ? 33.986  6.230   69.599  1.00 51.85  ? 267 ASP B OD2 1 
ATOM   1629  N  N   . PRO B 2 135 ? 37.089  4.007   66.032  1.00 25.70  ? 268 PRO B N   1 
ATOM   1630  C  CA  . PRO B 2 135 ? 38.294  3.171   66.053  1.00 24.15  ? 268 PRO B CA  1 
ATOM   1631  C  C   . PRO B 2 135 ? 39.550  3.977   65.758  1.00 26.87  ? 268 PRO B C   1 
ATOM   1632  O  O   . PRO B 2 135 ? 40.614  3.740   66.329  1.00 29.46  ? 268 PRO B O   1 
ATOM   1633  C  CB  . PRO B 2 135 ? 38.013  2.158   64.953  1.00 22.23  ? 268 PRO B CB  1 
ATOM   1634  C  CG  . PRO B 2 135 ? 36.558  1.971   65.066  1.00 23.63  ? 268 PRO B CG  1 
ATOM   1635  C  CD  . PRO B 2 135 ? 36.073  3.395   65.163  1.00 23.63  ? 268 PRO B CD  1 
ATOM   1636  N  N   . TYR B 2 136 ? 39.430  4.929   64.854  1.00 23.03  ? 269 TYR B N   1 
ATOM   1637  C  CA  . TYR B 2 136 ? 40.560  5.758   64.554  1.00 21.19  ? 269 TYR B CA  1 
ATOM   1638  C  C   . TYR B 2 136 ? 40.903  6.636   65.760  1.00 21.29  ? 269 TYR B C   1 
ATOM   1639  O  O   . TYR B 2 136 ? 42.067  6.891   66.035  1.00 30.87  ? 269 TYR B O   1 
ATOM   1640  C  CB  . TYR B 2 136 ? 40.277  6.578   63.311  1.00 20.71  ? 269 TYR B CB  1 
ATOM   1641  C  CG  . TYR B 2 136 ? 40.697  5.865   62.053  1.00 22.92  ? 269 TYR B CG  1 
ATOM   1642  C  CD1 . TYR B 2 136 ? 42.048  5.762   61.719  1.00 26.86  ? 269 TYR B CD1 1 
ATOM   1643  C  CD2 . TYR B 2 136 ? 39.763  5.270   61.208  1.00 22.17  ? 269 TYR B CD2 1 
ATOM   1644  C  CE1 . TYR B 2 136 ? 42.472  5.085   60.570  1.00 25.55  ? 269 TYR B CE1 1 
ATOM   1645  C  CE2 . TYR B 2 136 ? 40.171  4.581   60.048  1.00 26.98  ? 269 TYR B CE2 1 
ATOM   1646  C  CZ  . TYR B 2 136 ? 41.537  4.496   59.734  1.00 28.70  ? 269 TYR B CZ  1 
ATOM   1647  O  OH  . TYR B 2 136 ? 41.974  3.869   58.577  1.00 22.52  ? 269 TYR B OH  1 
ATOM   1648  N  N   . LYS B 2 137 ? 39.892  7.027   66.525  1.00 23.40  ? 270 LYS B N   1 
ATOM   1649  C  CA  . LYS B 2 137 ? 40.096  7.861   67.693  1.00 22.48  ? 270 LYS B CA  1 
ATOM   1650  C  C   . LYS B 2 137 ? 40.804  7.088   68.783  1.00 26.65  ? 270 LYS B C   1 
ATOM   1651  O  O   . LYS B 2 137 ? 41.843  7.523   69.292  1.00 37.43  ? 270 LYS B O   1 
ATOM   1652  C  CB  . LYS B 2 137 ? 38.752  8.368   68.201  1.00 26.95  ? 270 LYS B CB  1 
ATOM   1653  C  CG  . LYS B 2 137 ? 38.860  9.238   69.436  1.00 38.88  ? 270 LYS B CG  1 
ATOM   1654  C  CD  . LYS B 2 137 ? 37.593  10.054  69.713  1.00 44.56  ? 270 LYS B CD  1 
ATOM   1655  C  CE  . LYS B 2 137 ? 36.470  9.209   70.271  1.00 49.35  ? 270 LYS B CE  1 
ATOM   1656  N  NZ  . LYS B 2 137 ? 35.237  10.018  70.486  1.00 54.58  ? 270 LYS B NZ  1 
ATOM   1657  N  N   . GLN B 2 138 ? 40.250  5.926   69.122  1.00 28.71  ? 271 GLN B N   1 
ATOM   1658  C  CA  . GLN B 2 138 ? 40.797  5.064   70.174  1.00 32.22  ? 271 GLN B CA  1 
ATOM   1659  C  C   . GLN B 2 138 ? 42.093  4.400   69.729  1.00 29.47  ? 271 GLN B C   1 
ATOM   1660  O  O   . GLN B 2 138 ? 43.085  4.357   70.459  1.00 28.57  ? 271 GLN B O   1 
ATOM   1661  C  CB  . GLN B 2 138 ? 39.805  3.946   70.538  1.00 43.86  ? 271 GLN B CB  1 
ATOM   1662  C  CG  . GLN B 2 138 ? 38.308  4.278   70.433  1.00 58.70  ? 271 GLN B CG  1 
ATOM   1663  C  CD  . GLN B 2 138 ? 37.741  5.030   71.634  1.00 68.93  ? 271 GLN B CD  1 
ATOM   1664  O  OE1 . GLN B 2 138 ? 38.478  5.650   72.415  1.00 75.03  ? 271 GLN B OE1 1 
ATOM   1665  N  NE2 . GLN B 2 138 ? 36.417  4.980   71.785  1.00 70.89  ? 271 GLN B NE2 1 
ATOM   1666  N  N   . GLY B 2 139 ? 42.077  3.929   68.494  1.00 24.74  ? 272 GLY B N   1 
ATOM   1667  C  CA  . GLY B 2 139 ? 43.207  3.224   67.951  1.00 16.90  ? 272 GLY B CA  1 
ATOM   1668  C  C   . GLY B 2 139 ? 42.717  1.799   67.785  1.00 20.77  ? 272 GLY B C   1 
ATOM   1669  O  O   . GLY B 2 139 ? 41.761  1.378   68.425  1.00 22.90  ? 272 GLY B O   1 
ATOM   1670  N  N   . PHE B 2 140 ? 43.368  1.044   66.922  1.00 19.19  ? 273 PHE B N   1 
ATOM   1671  C  CA  . PHE B 2 140 ? 42.970  -0.328  66.684  1.00 18.49  ? 273 PHE B CA  1 
ATOM   1672  C  C   . PHE B 2 140 ? 44.157  -1.098  66.138  1.00 25.45  ? 273 PHE B C   1 
ATOM   1673  O  O   . PHE B 2 140 ? 45.182  -0.513  65.790  1.00 29.71  ? 273 PHE B O   1 
ATOM   1674  C  CB  . PHE B 2 140 ? 41.833  -0.354  65.663  1.00 12.58  ? 273 PHE B CB  1 
ATOM   1675  C  CG  . PHE B 2 140 ? 42.183  0.286   64.340  1.00 7.89   ? 273 PHE B CG  1 
ATOM   1676  C  CD1 . PHE B 2 140 ? 41.959  1.643   64.127  1.00 9.67   ? 273 PHE B CD1 1 
ATOM   1677  C  CD2 . PHE B 2 140 ? 42.706  -0.473  63.296  1.00 5.85   ? 273 PHE B CD2 1 
ATOM   1678  C  CE1 . PHE B 2 140 ? 42.247  2.232   62.891  1.00 6.91   ? 273 PHE B CE1 1 
ATOM   1679  C  CE2 . PHE B 2 140 ? 42.991  0.107   62.064  1.00 2.70   ? 273 PHE B CE2 1 
ATOM   1680  C  CZ  . PHE B 2 140 ? 42.761  1.459   61.861  1.00 2.70   ? 273 PHE B CZ  1 
ATOM   1681  N  N   . GLY B 2 141 ? 44.009  -2.412  66.050  1.00 28.11  ? 274 GLY B N   1 
ATOM   1682  C  CA  . GLY B 2 141 ? 45.080  -3.220  65.505  1.00 24.09  ? 274 GLY B CA  1 
ATOM   1683  C  C   . GLY B 2 141 ? 45.932  -3.879  66.542  1.00 17.94  ? 274 GLY B C   1 
ATOM   1684  O  O   . GLY B 2 141 ? 45.608  -3.876  67.719  1.00 18.17  ? 274 GLY B O   1 
ATOM   1685  N  N   . ASN B 2 142 ? 47.020  -4.470  66.082  1.00 16.68  ? 275 ASN B N   1 
ATOM   1686  C  CA  . ASN B 2 142 ? 47.948  -5.160  66.962  1.00 19.31  ? 275 ASN B CA  1 
ATOM   1687  C  C   . ASN B 2 142 ? 49.259  -4.412  67.053  1.00 19.99  ? 275 ASN B C   1 
ATOM   1688  O  O   . ASN B 2 142 ? 49.982  -4.297  66.069  1.00 17.49  ? 275 ASN B O   1 
ATOM   1689  C  CB  . ASN B 2 142 ? 48.204  -6.564  66.445  1.00 20.62  ? 275 ASN B CB  1 
ATOM   1690  C  CG  . ASN B 2 142 ? 46.955  -7.416  66.456  1.00 27.51  ? 275 ASN B CG  1 
ATOM   1691  O  OD1 . ASN B 2 142 ? 46.371  -7.660  67.507  1.00 29.86  ? 275 ASN B OD1 1 
ATOM   1692  N  ND2 . ASN B 2 142 ? 46.540  -7.877  65.281  1.00 25.80  ? 275 ASN B ND2 1 
ATOM   1693  N  N   . VAL B 2 143 ? 49.575  -3.918  68.245  1.00 19.16  ? 276 VAL B N   1 
ATOM   1694  C  CA  . VAL B 2 143 ? 50.809  -3.165  68.459  1.00 18.05  ? 276 VAL B CA  1 
ATOM   1695  C  C   . VAL B 2 143 ? 52.073  -3.973  68.210  1.00 21.91  ? 276 VAL B C   1 
ATOM   1696  O  O   . VAL B 2 143 ? 52.983  -3.557  67.474  1.00 22.93  ? 276 VAL B O   1 
ATOM   1697  C  CB  . VAL B 2 143 ? 50.858  -2.591  69.871  1.00 13.81  ? 276 VAL B CB  1 
ATOM   1698  C  CG1 . VAL B 2 143 ? 52.239  -2.007  70.170  1.00 12.83  ? 276 VAL B CG1 1 
ATOM   1699  C  CG2 . VAL B 2 143 ? 49.823  -1.513  69.983  1.00 20.91  ? 276 VAL B CG2 1 
ATOM   1700  N  N   . ALA B 2 144 ? 52.141  -5.129  68.846  1.00 20.01  ? 277 ALA B N   1 
ATOM   1701  C  CA  . ALA B 2 144 ? 53.305  -5.960  68.681  1.00 18.46  ? 277 ALA B CA  1 
ATOM   1702  C  C   . ALA B 2 144 ? 52.933  -7.402  68.842  1.00 19.07  ? 277 ALA B C   1 
ATOM   1703  O  O   . ALA B 2 144 ? 51.911  -7.723  69.456  1.00 22.05  ? 277 ALA B O   1 
ATOM   1704  C  CB  . ALA B 2 144 ? 54.379  -5.568  69.681  1.00 8.30   ? 277 ALA B CB  1 
ATOM   1705  N  N   . THR B 2 145 ? 53.779  -8.261  68.283  1.00 18.11  ? 278 THR B N   1 
ATOM   1706  C  CA  . THR B 2 145 ? 53.597  -9.702  68.338  1.00 20.46  ? 278 THR B CA  1 
ATOM   1707  C  C   . THR B 2 145 ? 54.869  -10.379 68.781  1.00 24.39  ? 278 THR B C   1 
ATOM   1708  O  O   . THR B 2 145 ? 55.953  -9.826  68.629  1.00 26.12  ? 278 THR B O   1 
ATOM   1709  C  CB  . THR B 2 145 ? 53.265  -10.264 66.977  1.00 25.24  ? 278 THR B CB  1 
ATOM   1710  O  OG1 . THR B 2 145 ? 54.372  -10.054 66.093  1.00 25.16  ? 278 THR B OG1 1 
ATOM   1711  C  CG2 . THR B 2 145 ? 52.012  -9.596  66.424  1.00 31.40  ? 278 THR B CG2 1 
ATOM   1712  N  N   . ASN B 2 146 ? 54.735  -11.607 69.271  1.00 32.92  ? 279 ASN B N   1 
ATOM   1713  C  CA  . ASN B 2 146 ? 55.874  -12.394 69.742  1.00 37.65  ? 279 ASN B CA  1 
ATOM   1714  C  C   . ASN B 2 146 ? 56.790  -12.759 68.606  1.00 45.10  ? 279 ASN B C   1 
ATOM   1715  O  O   . ASN B 2 146 ? 56.348  -12.959 67.479  1.00 47.03  ? 279 ASN B O   1 
ATOM   1716  C  CB  . ASN B 2 146 ? 55.387  -13.649 70.446  1.00 31.36  ? 279 ASN B CB  1 
ATOM   1717  C  CG  . ASN B 2 146 ? 54.421  -13.327 71.563  1.00 38.46  ? 279 ASN B CG  1 
ATOM   1718  O  OD1 . ASN B 2 146 ? 53.205  -13.548 71.439  1.00 38.45  ? 279 ASN B OD1 1 
ATOM   1719  N  ND2 . ASN B 2 146 ? 54.943  -12.736 72.644  1.00 35.72  ? 279 ASN B ND2 1 
ATOM   1720  N  N   . THR B 2 147 ? 58.078  -12.809 68.894  1.00 54.07  ? 280 THR B N   1 
ATOM   1721  C  CA  . THR B 2 147 ? 59.048  -13.149 67.871  1.00 70.15  ? 280 THR B CA  1 
ATOM   1722  C  C   . THR B 2 147 ? 58.896  -14.627 67.499  1.00 78.44  ? 280 THR B C   1 
ATOM   1723  O  O   . THR B 2 147 ? 57.813  -15.074 67.113  1.00 83.60  ? 280 THR B O   1 
ATOM   1724  C  CB  . THR B 2 147 ? 60.470  -12.869 68.373  1.00 77.28  ? 280 THR B CB  1 
ATOM   1725  O  OG1 . THR B 2 147 ? 60.808  -13.819 69.394  1.00 79.00  ? 280 THR B OG1 1 
ATOM   1726  C  CG2 . THR B 2 147 ? 60.557  -11.449 68.953  1.00 81.98  ? 280 THR B CG2 1 
ATOM   1727  N  N   . ASP B 2 148 ? 59.989  -15.375 67.592  1.00 81.00  ? 281 ASP B N   1 
ATOM   1728  C  CA  . ASP B 2 148 ? 59.979  -16.798 67.291  1.00 83.32  ? 281 ASP B CA  1 
ATOM   1729  C  C   . ASP B 2 148 ? 59.203  -17.478 68.405  1.00 86.69  ? 281 ASP B C   1 
ATOM   1730  O  O   . ASP B 2 148 ? 58.261  -18.233 68.169  1.00 92.49  ? 281 ASP B O   1 
ATOM   1731  C  CB  . ASP B 2 148 ? 61.414  -17.323 67.270  1.00 80.30  ? 281 ASP B CB  1 
ATOM   1732  C  CG  . ASP B 2 148 ? 62.184  -16.944 68.517  1.00 78.02  ? 281 ASP B CG  1 
ATOM   1733  O  OD1 . ASP B 2 148 ? 62.751  -15.835 68.538  1.00 79.40  ? 281 ASP B OD1 1 
ATOM   1734  O  OD2 . ASP B 2 148 ? 62.198  -17.738 69.481  1.00 73.99  ? 281 ASP B OD2 1 
ATOM   1735  N  N   . GLY B 2 149 ? 59.597  -17.150 69.625  1.00 85.25  ? 282 GLY B N   1 
ATOM   1736  C  CA  . GLY B 2 149 ? 58.973  -17.704 70.800  1.00 87.62  ? 282 GLY B CA  1 
ATOM   1737  C  C   . GLY B 2 149 ? 59.636  -17.087 72.011  1.00 88.28  ? 282 GLY B C   1 
ATOM   1738  O  O   . GLY B 2 149 ? 59.736  -17.734 73.053  1.00 95.72  ? 282 GLY B O   1 
ATOM   1739  N  N   . LYS B 2 150 ? 60.120  -15.851 71.863  1.00 80.97  ? 283 LYS B N   1 
ATOM   1740  C  CA  . LYS B 2 150 ? 60.779  -15.130 72.956  1.00 73.12  ? 283 LYS B CA  1 
ATOM   1741  C  C   . LYS B 2 150 ? 59.760  -14.693 73.978  1.00 66.20  ? 283 LYS B C   1 
ATOM   1742  O  O   . LYS B 2 150 ? 58.564  -14.709 73.706  1.00 67.13  ? 283 LYS B O   1 
ATOM   1743  C  CB  . LYS B 2 150 ? 61.520  -13.901 72.436  1.00 74.62  ? 283 LYS B CB  1 
ATOM   1744  C  CG  . LYS B 2 150 ? 63.040  -14.027 72.454  1.00 74.65  ? 283 LYS B CG  1 
ATOM   1745  C  CD  . LYS B 2 150 ? 63.554  -15.121 71.520  1.00 75.90  ? 283 LYS B CD  1 
ATOM   1746  C  CE  . LYS B 2 150 ? 64.349  -16.192 72.266  1.00 75.81  ? 283 LYS B CE  1 
ATOM   1747  N  NZ  . LYS B 2 150 ? 63.497  -17.003 73.190  1.00 76.60  ? 283 LYS B NZ  1 
ATOM   1748  N  N   . ASN B 2 151 ? 60.233  -14.311 75.157  1.00 58.85  ? 284 ASN B N   1 
ATOM   1749  C  CA  . ASN B 2 151 ? 59.339  -13.870 76.227  1.00 58.28  ? 284 ASN B CA  1 
ATOM   1750  C  C   . ASN B 2 151 ? 58.676  -12.545 75.883  1.00 48.65  ? 284 ASN B C   1 
ATOM   1751  O  O   . ASN B 2 151 ? 57.650  -12.194 76.463  1.00 44.66  ? 284 ASN B O   1 
ATOM   1752  C  CB  . ASN B 2 151 ? 60.096  -13.704 77.562  1.00 67.80  ? 284 ASN B CB  1 
ATOM   1753  C  CG  . ASN B 2 151 ? 60.365  -15.031 78.272  1.00 76.06  ? 284 ASN B CG  1 
ATOM   1754  O  OD1 . ASN B 2 151 ? 61.495  -15.522 78.277  1.00 81.38  ? 284 ASN B OD1 1 
ATOM   1755  N  ND2 . ASN B 2 151 ? 59.335  -15.596 78.903  1.00 79.48  ? 284 ASN B ND2 1 
ATOM   1756  N  N   . TYR B 2 152 ? 59.232  -11.837 74.902  1.00 44.56  ? 285 TYR B N   1 
ATOM   1757  C  CA  . TYR B 2 152 ? 58.708  -10.528 74.526  1.00 37.95  ? 285 TYR B CA  1 
ATOM   1758  C  C   . TYR B 2 152 ? 58.240  -10.307 73.094  1.00 32.33  ? 285 TYR B C   1 
ATOM   1759  O  O   . TYR B 2 152 ? 58.588  -11.043 72.168  1.00 34.08  ? 285 TYR B O   1 
ATOM   1760  C  CB  . TYR B 2 152 ? 59.735  -9.465  74.866  1.00 39.54  ? 285 TYR B CB  1 
ATOM   1761  C  CG  . TYR B 2 152 ? 60.982  -9.517  74.016  1.00 47.05  ? 285 TYR B CG  1 
ATOM   1762  C  CD1 . TYR B 2 152 ? 61.969  -10.473 74.247  1.00 47.20  ? 285 TYR B CD1 1 
ATOM   1763  C  CD2 . TYR B 2 152 ? 61.201  -8.569  73.017  1.00 49.30  ? 285 TYR B CD2 1 
ATOM   1764  C  CE1 . TYR B 2 152 ? 63.143  -10.474 73.509  1.00 51.50  ? 285 TYR B CE1 1 
ATOM   1765  C  CE2 . TYR B 2 152 ? 62.369  -8.560  72.277  1.00 51.04  ? 285 TYR B CE2 1 
ATOM   1766  C  CZ  . TYR B 2 152 ? 63.336  -9.508  72.526  1.00 53.88  ? 285 TYR B CZ  1 
ATOM   1767  O  OH  . TYR B 2 152 ? 64.500  -9.465  71.797  1.00 60.77  ? 285 TYR B OH  1 
ATOM   1768  N  N   . CYS B 2 153 ? 57.501  -9.218  72.927  1.00 27.28  ? 286 CYS B N   1 
ATOM   1769  C  CA  . CYS B 2 153 ? 56.948  -8.835  71.639  1.00 24.88  ? 286 CYS B CA  1 
ATOM   1770  C  C   . CYS B 2 153 ? 57.825  -7.818  70.914  1.00 26.55  ? 286 CYS B C   1 
ATOM   1771  O  O   . CYS B 2 153 ? 57.596  -6.604  70.967  1.00 24.04  ? 286 CYS B O   1 
ATOM   1772  C  CB  . CYS B 2 153 ? 55.513  -8.327  71.825  1.00 21.13  ? 286 CYS B CB  1 
ATOM   1773  S  SG  . CYS B 2 153 ? 54.387  -9.648  72.368  1.00 21.56  ? 286 CYS B SG  1 
ATOM   1774  N  N   . GLY B 2 154 ? 58.832  -8.338  70.223  1.00 26.69  ? 287 GLY B N   1 
ATOM   1775  C  CA  . GLY B 2 154 ? 59.748  -7.486  69.489  1.00 24.13  ? 287 GLY B CA  1 
ATOM   1776  C  C   . GLY B 2 154 ? 59.316  -7.104  68.082  1.00 24.94  ? 287 GLY B C   1 
ATOM   1777  O  O   . GLY B 2 154 ? 60.016  -6.356  67.412  1.00 25.51  ? 287 GLY B O   1 
ATOM   1778  N  N   . LEU B 2 155 ? 58.172  -7.605  67.629  1.00 26.62  ? 288 LEU B N   1 
ATOM   1779  C  CA  . LEU B 2 155 ? 57.684  -7.294  66.298  1.00 22.91  ? 288 LEU B CA  1 
ATOM   1780  C  C   . LEU B 2 155 ? 56.473  -6.410  66.351  1.00 21.80  ? 288 LEU B C   1 
ATOM   1781  O  O   . LEU B 2 155 ? 55.573  -6.620  67.157  1.00 21.88  ? 288 LEU B O   1 
ATOM   1782  C  CB  . LEU B 2 155 ? 57.286  -8.567  65.586  1.00 25.86  ? 288 LEU B CB  1 
ATOM   1783  C  CG  . LEU B 2 155 ? 58.429  -9.494  65.245  1.00 27.52  ? 288 LEU B CG  1 
ATOM   1784  C  CD1 . LEU B 2 155 ? 57.881  -10.849 64.811  1.00 28.19  ? 288 LEU B CD1 1 
ATOM   1785  C  CD2 . LEU B 2 155 ? 59.265  -8.831  64.162  1.00 25.81  ? 288 LEU B CD2 1 
ATOM   1786  N  N   . PRO B 2 156 ? 56.424  -5.410  65.475  1.00 20.14  ? 289 PRO B N   1 
ATOM   1787  C  CA  . PRO B 2 156 ? 55.283  -4.504  65.436  1.00 21.37  ? 289 PRO B CA  1 
ATOM   1788  C  C   . PRO B 2 156 ? 54.214  -5.133  64.546  1.00 24.85  ? 289 PRO B C   1 
ATOM   1789  O  O   . PRO B 2 156 ? 54.527  -5.754  63.536  1.00 25.95  ? 289 PRO B O   1 
ATOM   1790  C  CB  . PRO B 2 156 ? 55.867  -3.294  64.745  1.00 17.27  ? 289 PRO B CB  1 
ATOM   1791  C  CG  . PRO B 2 156 ? 56.749  -3.930  63.706  1.00 12.09  ? 289 PRO B CG  1 
ATOM   1792  C  CD  . PRO B 2 156 ? 57.434  -5.036  64.468  1.00 17.95  ? 289 PRO B CD  1 
ATOM   1793  N  N   . GLY B 2 157 ? 52.962  -5.064  64.960  1.00 26.42  ? 290 GLY B N   1 
ATOM   1794  C  CA  . GLY B 2 157 ? 51.926  -5.588  64.099  1.00 28.26  ? 290 GLY B CA  1 
ATOM   1795  C  C   . GLY B 2 157 ? 51.383  -4.381  63.359  1.00 27.75  ? 290 GLY B C   1 
ATOM   1796  O  O   . GLY B 2 157 ? 51.896  -3.271  63.474  1.00 30.44  ? 290 GLY B O   1 
ATOM   1797  N  N   . GLU B 2 158 ? 50.370  -4.585  62.546  1.00 22.43  ? 291 GLU B N   1 
ATOM   1798  C  CA  . GLU B 2 158 ? 49.792  -3.443  61.879  1.00 21.52  ? 291 GLU B CA  1 
ATOM   1799  C  C   . GLU B 2 158 ? 48.854  -2.780  62.907  1.00 19.88  ? 291 GLU B C   1 
ATOM   1800  O  O   . GLU B 2 158 ? 48.085  -3.461  63.612  1.00 13.21  ? 291 GLU B O   1 
ATOM   1801  C  CB  . GLU B 2 158 ? 49.020  -3.865  60.617  1.00 19.56  ? 291 GLU B CB  1 
ATOM   1802  C  CG  . GLU B 2 158 ? 49.880  -4.456  59.517  1.00 16.11  ? 291 GLU B CG  1 
ATOM   1803  C  CD  . GLU B 2 158 ? 49.146  -4.613  58.211  1.00 18.25  ? 291 GLU B CD  1 
ATOM   1804  O  OE1 . GLU B 2 158 ? 47.900  -4.697  58.199  1.00 21.13  ? 291 GLU B OE1 1 
ATOM   1805  O  OE2 . GLU B 2 158 ? 49.829  -4.623  57.175  1.00 21.61  ? 291 GLU B OE2 1 
ATOM   1806  N  N   . TYR B 2 159 ? 48.964  -1.463  63.026  1.00 12.32  ? 292 TYR B N   1 
ATOM   1807  C  CA  . TYR B 2 159 ? 48.120  -0.744  63.942  1.00 10.48  ? 292 TYR B CA  1 
ATOM   1808  C  C   . TYR B 2 159 ? 48.010  0.747   63.669  1.00 16.81  ? 292 TYR B C   1 
ATOM   1809  O  O   . TYR B 2 159 ? 48.660  1.295   62.770  1.00 16.30  ? 292 TYR B O   1 
ATOM   1810  C  CB  . TYR B 2 159 ? 48.546  -1.010  65.388  1.00 8.36   ? 292 TYR B CB  1 
ATOM   1811  C  CG  . TYR B 2 159 ? 49.791  -0.282  65.857  1.00 10.68  ? 292 TYR B CG  1 
ATOM   1812  C  CD1 . TYR B 2 159 ? 51.071  -0.768  65.578  1.00 7.33   ? 292 TYR B CD1 1 
ATOM   1813  C  CD2 . TYR B 2 159 ? 49.681  0.857   66.659  1.00 17.03  ? 292 TYR B CD2 1 
ATOM   1814  C  CE1 . TYR B 2 159 ? 52.196  -0.151  66.095  1.00 7.73   ? 292 TYR B CE1 1 
ATOM   1815  C  CE2 . TYR B 2 159 ? 50.805  1.489   67.183  1.00 16.27  ? 292 TYR B CE2 1 
ATOM   1816  C  CZ  . TYR B 2 159 ? 52.062  0.983   66.904  1.00 17.10  ? 292 TYR B CZ  1 
ATOM   1817  O  OH  . TYR B 2 159 ? 53.169  1.613   67.466  1.00 16.39  ? 292 TYR B OH  1 
ATOM   1818  N  N   . TRP B 2 160 ? 47.104  1.366   64.412  1.00 16.75  ? 293 TRP B N   1 
ATOM   1819  C  CA  . TRP B 2 160 ? 46.837  2.780   64.330  1.00 17.06  ? 293 TRP B CA  1 
ATOM   1820  C  C   . TRP B 2 160 ? 46.710  3.177   65.793  1.00 18.48  ? 293 TRP B C   1 
ATOM   1821  O  O   . TRP B 2 160 ? 45.825  2.692   66.496  1.00 25.37  ? 293 TRP B O   1 
ATOM   1822  C  CB  . TRP B 2 160 ? 45.531  3.031   63.582  1.00 15.59  ? 293 TRP B CB  1 
ATOM   1823  C  CG  . TRP B 2 160 ? 45.142  4.465   63.604  1.00 21.15  ? 293 TRP B CG  1 
ATOM   1824  C  CD1 . TRP B 2 160 ? 44.239  5.068   64.445  1.00 22.74  ? 293 TRP B CD1 1 
ATOM   1825  C  CD2 . TRP B 2 160 ? 45.700  5.506   62.803  1.00 19.65  ? 293 TRP B CD2 1 
ATOM   1826  N  NE1 . TRP B 2 160 ? 44.220  6.422   64.218  1.00 21.33  ? 293 TRP B NE1 1 
ATOM   1827  C  CE2 . TRP B 2 160 ? 45.108  6.714   63.213  1.00 21.81  ? 293 TRP B CE2 1 
ATOM   1828  C  CE3 . TRP B 2 160 ? 46.654  5.536   61.780  1.00 19.50  ? 293 TRP B CE3 1 
ATOM   1829  C  CZ2 . TRP B 2 160 ? 45.443  7.936   62.636  1.00 18.71  ? 293 TRP B CZ2 1 
ATOM   1830  C  CZ3 . TRP B 2 160 ? 46.986  6.754   61.213  1.00 18.57  ? 293 TRP B CZ3 1 
ATOM   1831  C  CH2 . TRP B 2 160 ? 46.384  7.932   61.642  1.00 18.05  ? 293 TRP B CH2 1 
ATOM   1832  N  N   . LEU B 2 161 ? 47.590  4.062   66.249  1.00 18.08  ? 294 LEU B N   1 
ATOM   1833  C  CA  . LEU B 2 161 ? 47.602  4.464   67.641  1.00 15.49  ? 294 LEU B CA  1 
ATOM   1834  C  C   . LEU B 2 161 ? 46.323  5.125   68.102  1.00 17.76  ? 294 LEU B C   1 
ATOM   1835  O  O   . LEU B 2 161 ? 45.986  5.060   69.283  1.00 16.90  ? 294 LEU B O   1 
ATOM   1836  C  CB  . LEU B 2 161 ? 48.807  5.365   67.936  1.00 14.63  ? 294 LEU B CB  1 
ATOM   1837  C  CG  . LEU B 2 161 ? 49.194  5.328   69.430  1.00 13.39  ? 294 LEU B CG  1 
ATOM   1838  C  CD1 . LEU B 2 161 ? 49.711  3.945   69.796  1.00 9.97   ? 294 LEU B CD1 1 
ATOM   1839  C  CD2 . LEU B 2 161 ? 50.238  6.371   69.796  1.00 2.70   ? 294 LEU B CD2 1 
ATOM   1840  N  N   . GLY B 2 162 ? 45.571  5.673   67.154  1.00 19.92  ? 295 GLY B N   1 
ATOM   1841  C  CA  . GLY B 2 162 ? 44.356  6.359   67.507  1.00 20.49  ? 295 GLY B CA  1 
ATOM   1842  C  C   . GLY B 2 162 ? 44.660  7.846   67.550  1.00 24.27  ? 295 GLY B C   1 
ATOM   1843  O  O   . GLY B 2 162 ? 45.666  8.274   68.121  1.00 25.49  ? 295 GLY B O   1 
ATOM   1844  N  N   . ASN B 2 163 ? 43.776  8.632   66.952  1.00 18.04  ? 296 ASN B N   1 
ATOM   1845  C  CA  . ASN B 2 163 ? 43.909  10.072  66.880  1.00 16.72  ? 296 ASN B CA  1 
ATOM   1846  C  C   . ASN B 2 163 ? 44.113  10.849  68.173  1.00 21.04  ? 296 ASN B C   1 
ATOM   1847  O  O   . ASN B 2 163 ? 44.846  11.846  68.192  1.00 21.52  ? 296 ASN B O   1 
ATOM   1848  C  CB  . ASN B 2 163 ? 42.712  10.653  66.157  1.00 20.38  ? 296 ASN B CB  1 
ATOM   1849  C  CG  . ASN B 2 163 ? 42.673  10.270  64.713  1.00 25.34  ? 296 ASN B CG  1 
ATOM   1850  O  OD1 . ASN B 2 163 ? 41.613  10.171  64.125  1.00 34.26  ? 296 ASN B OD1 1 
ATOM   1851  N  ND2 . ASN B 2 163 ? 43.824  10.032  64.135  1.00 22.02  ? 296 ASN B ND2 1 
ATOM   1852  N  N   . ASP B 2 164 ? 43.433  10.450  69.239  1.00 14.40  ? 297 ASP B N   1 
ATOM   1853  C  CA  . ASP B 2 164 ? 43.591  11.167  70.479  1.00 16.41  ? 297 ASP B CA  1 
ATOM   1854  C  C   . ASP B 2 164 ? 45.002  11.142  71.005  1.00 21.44  ? 297 ASP B C   1 
ATOM   1855  O  O   . ASP B 2 164 ? 45.570  12.182  71.311  1.00 25.27  ? 297 ASP B O   1 
ATOM   1856  C  CB  . ASP B 2 164 ? 42.638  10.639  71.521  1.00 16.23  ? 297 ASP B CB  1 
ATOM   1857  C  CG  . ASP B 2 164 ? 41.241  11.135  71.306  1.00 21.56  ? 297 ASP B CG  1 
ATOM   1858  O  OD1 . ASP B 2 164 ? 41.063  12.051  70.480  1.00 24.68  ? 297 ASP B OD1 1 
ATOM   1859  O  OD2 . ASP B 2 164 ? 40.324  10.611  71.967  1.00 25.55  ? 297 ASP B OD2 1 
ATOM   1860  N  N   . LYS B 2 165 ? 45.576  9.949   71.070  1.00 22.98  ? 298 LYS B N   1 
ATOM   1861  C  CA  . LYS B 2 165 ? 46.934  9.766   71.566  1.00 17.68  ? 298 LYS B CA  1 
ATOM   1862  C  C   . LYS B 2 165 ? 47.913  10.533  70.700  1.00 17.96  ? 298 LYS B C   1 
ATOM   1863  O  O   . LYS B 2 165 ? 48.799  11.214  71.202  1.00 13.97  ? 298 LYS B O   1 
ATOM   1864  C  CB  . LYS B 2 165 ? 47.290  8.288   71.554  1.00 18.37  ? 298 LYS B CB  1 
ATOM   1865  C  CG  . LYS B 2 165 ? 46.405  7.405   72.414  1.00 15.88  ? 298 LYS B CG  1 
ATOM   1866  C  CD  . LYS B 2 165 ? 46.781  5.955   72.206  1.00 15.03  ? 298 LYS B CD  1 
ATOM   1867  C  CE  . LYS B 2 165 ? 45.844  5.000   72.894  1.00 19.42  ? 298 LYS B CE  1 
ATOM   1868  N  NZ  . LYS B 2 165 ? 46.020  5.092   74.347  1.00 28.89  ? 298 LYS B NZ  1 
ATOM   1869  N  N   . ILE B 2 166 ? 47.738  10.424  69.391  1.00 19.55  ? 299 ILE B N   1 
ATOM   1870  C  CA  . ILE B 2 166 ? 48.590  11.121  68.437  1.00 16.02  ? 299 ILE B CA  1 
ATOM   1871  C  C   . ILE B 2 166 ? 48.526  12.612  68.684  1.00 17.12  ? 299 ILE B C   1 
ATOM   1872  O  O   . ILE B 2 166 ? 49.538  13.267  68.867  1.00 18.17  ? 299 ILE B O   1 
ATOM   1873  C  CB  . ILE B 2 166 ? 48.133  10.828  67.025  1.00 15.47  ? 299 ILE B CB  1 
ATOM   1874  C  CG1 . ILE B 2 166 ? 48.401  9.350   66.732  1.00 14.77  ? 299 ILE B CG1 1 
ATOM   1875  C  CG2 . ILE B 2 166 ? 48.825  11.759  66.057  1.00 16.35  ? 299 ILE B CG2 1 
ATOM   1876  C  CD1 . ILE B 2 166 ? 47.604  8.750   65.611  1.00 13.34  ? 299 ILE B CD1 1 
ATOM   1877  N  N   . SER B 2 167 ? 47.311  13.134  68.700  1.00 16.52  ? 300 SER B N   1 
ATOM   1878  C  CA  . SER B 2 167 ? 47.097  14.539  68.960  1.00 19.30  ? 300 SER B CA  1 
ATOM   1879  C  C   . SER B 2 167 ? 47.885  14.964  70.200  1.00 21.85  ? 300 SER B C   1 
ATOM   1880  O  O   . SER B 2 167 ? 48.819  15.753  70.092  1.00 27.46  ? 300 SER B O   1 
ATOM   1881  C  CB  . SER B 2 167 ? 45.613  14.802  69.173  1.00 18.03  ? 300 SER B CB  1 
ATOM   1882  O  OG  . SER B 2 167 ? 45.400  16.179  69.399  1.00 16.30  ? 300 SER B OG  1 
ATOM   1883  N  N   . GLN B 2 168 ? 47.545  14.386  71.353  1.00 19.01  ? 301 GLN B N   1 
ATOM   1884  C  CA  . GLN B 2 168 ? 48.197  14.680  72.628  1.00 23.81  ? 301 GLN B CA  1 
ATOM   1885  C  C   . GLN B 2 168 ? 49.713  14.690  72.497  1.00 25.00  ? 301 GLN B C   1 
ATOM   1886  O  O   . GLN B 2 168 ? 50.390  15.604  72.973  1.00 26.88  ? 301 GLN B O   1 
ATOM   1887  C  CB  . GLN B 2 168 ? 47.802  13.629  73.667  1.00 27.16  ? 301 GLN B CB  1 
ATOM   1888  C  CG  . GLN B 2 168 ? 48.128  13.977  75.127  1.00 39.34  ? 301 GLN B CG  1 
ATOM   1889  C  CD  . GLN B 2 168 ? 49.637  13.974  75.472  1.00 47.24  ? 301 GLN B CD  1 
ATOM   1890  O  OE1 . GLN B 2 168 ? 50.086  14.675  76.397  1.00 52.13  ? 301 GLN B OE1 1 
ATOM   1891  N  NE2 . GLN B 2 168 ? 50.414  13.181  74.737  1.00 47.32  ? 301 GLN B NE2 1 
ATOM   1892  N  N   . LEU B 2 169 ? 50.235  13.652  71.864  1.00 21.80  ? 302 LEU B N   1 
ATOM   1893  C  CA  . LEU B 2 169 ? 51.661  13.508  71.690  1.00 21.12  ? 302 LEU B CA  1 
ATOM   1894  C  C   . LEU B 2 169 ? 52.316  14.637  70.925  1.00 21.69  ? 302 LEU B C   1 
ATOM   1895  O  O   . LEU B 2 169 ? 53.290  15.226  71.384  1.00 31.85  ? 302 LEU B O   1 
ATOM   1896  C  CB  . LEU B 2 169 ? 51.973  12.193  70.978  1.00 20.58  ? 302 LEU B CB  1 
ATOM   1897  C  CG  . LEU B 2 169 ? 51.890  10.884  71.767  1.00 19.01  ? 302 LEU B CG  1 
ATOM   1898  C  CD1 . LEU B 2 169 ? 52.359  9.694   70.895  1.00 5.36   ? 302 LEU B CD1 1 
ATOM   1899  C  CD2 . LEU B 2 169 ? 52.733  11.002  73.026  1.00 15.00  ? 302 LEU B CD2 1 
ATOM   1900  N  N   . THR B 2 170 ? 51.823  14.891  69.723  1.00 15.94  ? 303 THR B N   1 
ATOM   1901  C  CA  . THR B 2 170 ? 52.378  15.921  68.874  1.00 19.39  ? 303 THR B CA  1 
ATOM   1902  C  C   . THR B 2 170 ? 52.280  17.272  69.538  1.00 24.14  ? 303 THR B C   1 
ATOM   1903  O  O   . THR B 2 170 ? 53.021  18.189  69.190  1.00 24.32  ? 303 THR B O   1 
ATOM   1904  C  CB  . THR B 2 170 ? 51.637  15.968  67.525  1.00 26.89  ? 303 THR B CB  1 
ATOM   1905  O  OG1 . THR B 2 170 ? 50.287  16.412  67.719  1.00 29.23  ? 303 THR B OG1 1 
ATOM   1906  C  CG2 . THR B 2 170 ? 51.598  14.589  66.893  1.00 31.11  ? 303 THR B CG2 1 
ATOM   1907  N  N   . ARG B 2 171 ? 51.394  17.366  70.530  1.00 27.31  ? 304 ARG B N   1 
ATOM   1908  C  CA  . ARG B 2 171 ? 51.154  18.610  71.246  1.00 32.96  ? 304 ARG B CA  1 
ATOM   1909  C  C   . ARG B 2 171 ? 51.894  18.816  72.559  1.00 32.56  ? 304 ARG B C   1 
ATOM   1910  O  O   . ARG B 2 171 ? 51.600  19.750  73.296  1.00 40.71  ? 304 ARG B O   1 
ATOM   1911  C  CB  . ARG B 2 171 ? 49.646  18.831  71.420  1.00 36.36  ? 304 ARG B CB  1 
ATOM   1912  C  CG  . ARG B 2 171 ? 48.927  19.106  70.093  1.00 35.59  ? 304 ARG B CG  1 
ATOM   1913  C  CD  . ARG B 2 171 ? 47.509  19.608  70.295  1.00 43.02  ? 304 ARG B CD  1 
ATOM   1914  N  NE  . ARG B 2 171 ? 46.624  18.560  70.802  1.00 54.24  ? 304 ARG B NE  1 
ATOM   1915  C  CZ  . ARG B 2 171 ? 45.828  18.681  71.867  1.00 62.49  ? 304 ARG B CZ  1 
ATOM   1916  N  NH1 . ARG B 2 171 ? 45.788  19.816  72.567  1.00 68.79  ? 304 ARG B NH1 1 
ATOM   1917  N  NH2 . ARG B 2 171 ? 45.076  17.652  72.245  1.00 62.58  ? 304 ARG B NH2 1 
ATOM   1918  N  N   . MET B 2 172 ? 52.838  17.938  72.865  1.00 33.41  ? 305 MET B N   1 
ATOM   1919  C  CA  . MET B 2 172 ? 53.639  18.075  74.080  1.00 35.26  ? 305 MET B CA  1 
ATOM   1920  C  C   . MET B 2 172 ? 54.834  18.968  73.735  1.00 37.00  ? 305 MET B C   1 
ATOM   1921  O  O   . MET B 2 172 ? 55.556  19.447  74.609  1.00 39.77  ? 305 MET B O   1 
ATOM   1922  C  CB  . MET B 2 172 ? 54.156  16.722  74.546  1.00 31.74  ? 305 MET B CB  1 
ATOM   1923  C  CG  . MET B 2 172 ? 53.113  15.774  75.042  1.00 35.67  ? 305 MET B CG  1 
ATOM   1924  S  SD  . MET B 2 172 ? 53.925  14.209  75.373  1.00 43.40  ? 305 MET B SD  1 
ATOM   1925  C  CE  . MET B 2 172 ? 54.308  14.427  77.112  1.00 37.62  ? 305 MET B CE  1 
ATOM   1926  N  N   . GLY B 2 173 ? 55.039  19.170  72.441  1.00 36.04  ? 306 GLY B N   1 
ATOM   1927  C  CA  . GLY B 2 173 ? 56.135  19.988  71.980  1.00 33.08  ? 306 GLY B CA  1 
ATOM   1928  C  C   . GLY B 2 173 ? 56.465  19.644  70.548  1.00 31.15  ? 306 GLY B C   1 
ATOM   1929  O  O   . GLY B 2 173 ? 55.772  18.836  69.919  1.00 27.15  ? 306 GLY B O   1 
ATOM   1930  N  N   . PRO B 2 174 ? 57.547  20.226  70.010  1.00 28.42  ? 307 PRO B N   1 
ATOM   1931  C  CA  . PRO B 2 174 ? 58.004  19.999  68.636  1.00 26.99  ? 307 PRO B CA  1 
ATOM   1932  C  C   . PRO B 2 174 ? 58.224  18.522  68.393  1.00 21.24  ? 307 PRO B C   1 
ATOM   1933  O  O   . PRO B 2 174 ? 59.125  17.929  68.974  1.00 22.84  ? 307 PRO B O   1 
ATOM   1934  C  CB  . PRO B 2 174 ? 59.333  20.751  68.592  1.00 27.23  ? 307 PRO B CB  1 
ATOM   1935  C  CG  . PRO B 2 174 ? 59.134  21.838  69.575  1.00 25.64  ? 307 PRO B CG  1 
ATOM   1936  C  CD  . PRO B 2 174 ? 58.477  21.114  70.718  1.00 25.97  ? 307 PRO B CD  1 
ATOM   1937  N  N   . THR B 2 175 ? 57.346  17.930  67.597  1.00 16.14  ? 308 THR B N   1 
ATOM   1938  C  CA  . THR B 2 175 ? 57.438  16.525  67.267  1.00 17.27  ? 308 THR B CA  1 
ATOM   1939  C  C   . THR B 2 175 ? 57.642  16.403  65.756  1.00 24.57  ? 308 THR B C   1 
ATOM   1940  O  O   . THR B 2 175 ? 57.078  17.162  64.979  1.00 27.29  ? 308 THR B O   1 
ATOM   1941  C  CB  . THR B 2 175 ? 56.196  15.769  67.773  1.00 16.43  ? 308 THR B CB  1 
ATOM   1942  O  OG1 . THR B 2 175 ? 55.022  16.439  67.323  1.00 24.20  ? 308 THR B OG1 1 
ATOM   1943  C  CG2 . THR B 2 175 ? 56.153  15.773  69.306  1.00 17.90  ? 308 THR B CG2 1 
ATOM   1944  N  N   . GLU B 2 176 ? 58.510  15.488  65.350  1.00 32.08  ? 309 GLU B N   1 
ATOM   1945  C  CA  . GLU B 2 176 ? 58.841  15.296  63.944  1.00 27.64  ? 309 GLU B CA  1 
ATOM   1946  C  C   . GLU B 2 176 ? 58.381  13.952  63.457  1.00 29.92  ? 309 GLU B C   1 
ATOM   1947  O  O   . GLU B 2 176 ? 58.666  12.920  64.062  1.00 40.52  ? 309 GLU B O   1 
ATOM   1948  C  CB  . GLU B 2 176 ? 60.346  15.402  63.763  1.00 26.72  ? 309 GLU B CB  1 
ATOM   1949  C  CG  . GLU B 2 176 ? 61.111  14.667  64.844  1.00 27.92  ? 309 GLU B CG  1 
ATOM   1950  C  CD  . GLU B 2 176 ? 62.592  14.661  64.605  1.00 39.13  ? 309 GLU B CD  1 
ATOM   1951  O  OE1 . GLU B 2 176 ? 62.979  14.689  63.415  1.00 39.95  ? 309 GLU B OE1 1 
ATOM   1952  O  OE2 . GLU B 2 176 ? 63.367  14.620  65.597  1.00 42.42  ? 309 GLU B OE2 1 
ATOM   1953  N  N   . LEU B 2 177 ? 57.714  13.970  62.317  1.00 26.02  ? 310 LEU B N   1 
ATOM   1954  C  CA  . LEU B 2 177 ? 57.175  12.767  61.709  1.00 18.71  ? 310 LEU B CA  1 
ATOM   1955  C  C   . LEU B 2 177 ? 58.106  12.158  60.692  1.00 15.72  ? 310 LEU B C   1 
ATOM   1956  O  O   . LEU B 2 177 ? 58.695  12.856  59.879  1.00 17.05  ? 310 LEU B O   1 
ATOM   1957  C  CB  . LEU B 2 177 ? 55.844  13.088  61.032  1.00 16.28  ? 310 LEU B CB  1 
ATOM   1958  C  CG  . LEU B 2 177 ? 55.256  12.038  60.096  1.00 17.40  ? 310 LEU B CG  1 
ATOM   1959  C  CD1 . LEU B 2 177 ? 54.932  10.764  60.855  1.00 22.63  ? 310 LEU B CD1 1 
ATOM   1960  C  CD2 . LEU B 2 177 ? 54.018  12.602  59.462  1.00 12.11  ? 310 LEU B CD2 1 
ATOM   1961  N  N   . LEU B 2 178 ? 58.204  10.839  60.737  1.00 12.99  ? 311 LEU B N   1 
ATOM   1962  C  CA  . LEU B 2 178 ? 59.028  10.099  59.807  1.00 12.93  ? 311 LEU B CA  1 
ATOM   1963  C  C   . LEU B 2 178 ? 58.163  9.033   59.194  1.00 11.35  ? 311 LEU B C   1 
ATOM   1964  O  O   . LEU B 2 178 ? 57.698  8.131   59.897  1.00 11.19  ? 311 LEU B O   1 
ATOM   1965  C  CB  . LEU B 2 178 ? 60.228  9.439   60.507  1.00 7.65   ? 311 LEU B CB  1 
ATOM   1966  C  CG  . LEU B 2 178 ? 60.967  8.382   59.675  1.00 3.55   ? 311 LEU B CG  1 
ATOM   1967  C  CD1 . LEU B 2 178 ? 61.349  8.895   58.277  1.00 2.70   ? 311 LEU B CD1 1 
ATOM   1968  C  CD2 . LEU B 2 178 ? 62.171  7.935   60.416  1.00 12.40  ? 311 LEU B CD2 1 
ATOM   1969  N  N   . ILE B 2 179 ? 58.022  9.105   57.876  1.00 2.70   ? 312 ILE B N   1 
ATOM   1970  C  CA  . ILE B 2 179 ? 57.220  8.161   57.141  1.00 10.33  ? 312 ILE B CA  1 
ATOM   1971  C  C   . ILE B 2 179 ? 58.061  7.355   56.178  1.00 18.11  ? 312 ILE B C   1 
ATOM   1972  O  O   . ILE B 2 179 ? 58.606  7.919   55.234  1.00 19.15  ? 312 ILE B O   1 
ATOM   1973  C  CB  . ILE B 2 179 ? 56.206  8.898   56.295  1.00 14.06  ? 312 ILE B CB  1 
ATOM   1974  C  CG1 . ILE B 2 179 ? 55.347  9.787   57.165  1.00 11.38  ? 312 ILE B CG1 1 
ATOM   1975  C  CG2 . ILE B 2 179 ? 55.345  7.927   55.541  1.00 22.55  ? 312 ILE B CG2 1 
ATOM   1976  C  CD1 . ILE B 2 179 ? 54.448  10.640  56.357  1.00 8.83   ? 312 ILE B CD1 1 
ATOM   1977  N  N   . GLU B 2 180 ? 58.120  6.036   56.380  1.00 26.32  ? 313 GLU B N   1 
ATOM   1978  C  CA  . GLU B 2 180 ? 58.871  5.136   55.487  1.00 26.17  ? 313 GLU B CA  1 
ATOM   1979  C  C   . GLU B 2 180 ? 57.924  4.210   54.738  1.00 25.51  ? 313 GLU B C   1 
ATOM   1980  O  O   . GLU B 2 180 ? 56.846  3.857   55.240  1.00 31.62  ? 313 GLU B O   1 
ATOM   1981  C  CB  . GLU B 2 180 ? 59.846  4.267   56.264  1.00 29.04  ? 313 GLU B CB  1 
ATOM   1982  C  CG  . GLU B 2 180 ? 60.833  5.029   57.087  1.00 32.49  ? 313 GLU B CG  1 
ATOM   1983  C  CD  . GLU B 2 180 ? 60.843  4.558   58.513  1.00 35.59  ? 313 GLU B CD  1 
ATOM   1984  O  OE1 . GLU B 2 180 ? 59.878  4.873   59.254  1.00 44.56  ? 313 GLU B OE1 1 
ATOM   1985  O  OE2 . GLU B 2 180 ? 61.802  3.859   58.882  1.00 28.30  ? 313 GLU B OE2 1 
ATOM   1986  N  N   . MET B 2 181 ? 58.351  3.781   53.557  1.00 17.57  ? 314 MET B N   1 
ATOM   1987  C  CA  . MET B 2 181 ? 57.542  2.891   52.741  1.00 19.83  ? 314 MET B CA  1 
ATOM   1988  C  C   . MET B 2 181 ? 58.457  2.070   51.868  1.00 24.88  ? 314 MET B C   1 
ATOM   1989  O  O   . MET B 2 181 ? 59.605  2.450   51.633  1.00 28.88  ? 314 MET B O   1 
ATOM   1990  C  CB  . MET B 2 181 ? 56.585  3.686   51.865  1.00 22.19  ? 314 MET B CB  1 
ATOM   1991  C  CG  . MET B 2 181 ? 57.307  4.620   50.914  1.00 25.37  ? 314 MET B CG  1 
ATOM   1992  S  SD  . MET B 2 181 ? 56.298  5.971   50.320  1.00 30.42  ? 314 MET B SD  1 
ATOM   1993  C  CE  . MET B 2 181 ? 56.142  6.960   51.820  1.00 30.14  ? 314 MET B CE  1 
ATOM   1994  N  N   . GLU B 2 182 ? 57.922  0.983   51.327  1.00 24.40  ? 315 GLU B N   1 
ATOM   1995  C  CA  . GLU B 2 182 ? 58.709  0.080   50.502  1.00 26.83  ? 315 GLU B CA  1 
ATOM   1996  C  C   . GLU B 2 182 ? 57.819  -0.646  49.516  1.00 20.83  ? 315 GLU B C   1 
ATOM   1997  O  O   . GLU B 2 182 ? 56.774  -1.151  49.893  1.00 17.69  ? 315 GLU B O   1 
ATOM   1998  C  CB  . GLU B 2 182 ? 59.427  -0.925  51.416  1.00 35.57  ? 315 GLU B CB  1 
ATOM   1999  C  CG  . GLU B 2 182 ? 60.139  -2.092  50.748  1.00 39.92  ? 315 GLU B CG  1 
ATOM   2000  C  CD  . GLU B 2 182 ? 60.685  -3.089  51.770  1.00 45.20  ? 315 GLU B CD  1 
ATOM   2001  O  OE1 . GLU B 2 182 ? 61.450  -2.686  52.680  1.00 44.63  ? 315 GLU B OE1 1 
ATOM   2002  O  OE2 . GLU B 2 182 ? 60.340  -4.281  51.667  1.00 49.37  ? 315 GLU B OE2 1 
ATOM   2003  N  N   . ASP B 2 183 ? 58.218  -0.643  48.248  1.00 23.65  ? 316 ASP B N   1 
ATOM   2004  C  CA  . ASP B 2 183 ? 57.481  -1.327  47.193  1.00 31.24  ? 316 ASP B CA  1 
ATOM   2005  C  C   . ASP B 2 183 ? 57.704  -2.836  47.289  1.00 34.75  ? 316 ASP B C   1 
ATOM   2006  O  O   . ASP B 2 183 ? 58.514  -3.313  48.095  1.00 38.75  ? 316 ASP B O   1 
ATOM   2007  C  CB  . ASP B 2 183 ? 57.922  -0.837  45.818  1.00 34.76  ? 316 ASP B CB  1 
ATOM   2008  C  CG  . ASP B 2 183 ? 59.310  -1.321  45.430  1.00 40.84  ? 316 ASP B CG  1 
ATOM   2009  O  OD1 . ASP B 2 183 ? 60.142  -1.654  46.307  1.00 43.35  ? 316 ASP B OD1 1 
ATOM   2010  O  OD2 . ASP B 2 183 ? 59.582  -1.357  44.220  1.00 44.39  ? 316 ASP B OD2 1 
ATOM   2011  N  N   . TRP B 2 184 ? 57.057  -3.577  46.406  1.00 30.73  ? 317 TRP B N   1 
ATOM   2012  C  CA  . TRP B 2 184 ? 57.170  -5.010  46.445  1.00 35.26  ? 317 TRP B CA  1 
ATOM   2013  C  C   . TRP B 2 184 ? 58.484  -5.571  45.947  1.00 41.33  ? 317 TRP B C   1 
ATOM   2014  O  O   . TRP B 2 184 ? 58.702  -6.772  45.979  1.00 47.87  ? 317 TRP B O   1 
ATOM   2015  C  CB  . TRP B 2 184 ? 55.977  -5.636  45.749  1.00 32.66  ? 317 TRP B CB  1 
ATOM   2016  C  CG  . TRP B 2 184 ? 54.710  -5.340  46.500  1.00 35.01  ? 317 TRP B CG  1 
ATOM   2017  C  CD1 . TRP B 2 184 ? 54.072  -4.143  46.565  1.00 35.24  ? 317 TRP B CD1 1 
ATOM   2018  C  CD2 . TRP B 2 184 ? 53.944  -6.244  47.320  1.00 32.81  ? 317 TRP B CD2 1 
ATOM   2019  N  NE1 . TRP B 2 184 ? 52.964  -4.237  47.367  1.00 31.39  ? 317 TRP B NE1 1 
ATOM   2020  C  CE2 . TRP B 2 184 ? 52.859  -5.514  47.843  1.00 29.38  ? 317 TRP B CE2 1 
ATOM   2021  C  CE3 . TRP B 2 184 ? 54.072  -7.595  47.663  1.00 28.35  ? 317 TRP B CE3 1 
ATOM   2022  C  CZ2 . TRP B 2 184 ? 51.907  -6.083  48.689  1.00 31.93  ? 317 TRP B CZ2 1 
ATOM   2023  C  CZ3 . TRP B 2 184 ? 53.120  -8.164  48.508  1.00 27.31  ? 317 TRP B CZ3 1 
ATOM   2024  C  CH2 . TRP B 2 184 ? 52.053  -7.405  49.009  1.00 31.34  ? 317 TRP B CH2 1 
ATOM   2025  N  N   . LYS B 2 185 ? 59.388  -4.702  45.539  1.00 41.14  ? 318 LYS B N   1 
ATOM   2026  C  CA  . LYS B 2 185 ? 60.675  -5.166  45.065  1.00 47.10  ? 318 LYS B CA  1 
ATOM   2027  C  C   . LYS B 2 185 ? 61.776  -4.833  46.047  1.00 47.97  ? 318 LYS B C   1 
ATOM   2028  O  O   . LYS B 2 185 ? 62.950  -4.805  45.686  1.00 50.02  ? 318 LYS B O   1 
ATOM   2029  C  CB  . LYS B 2 185 ? 60.996  -4.592  43.688  1.00 53.36  ? 318 LYS B CB  1 
ATOM   2030  C  CG  . LYS B 2 185 ? 60.141  -5.185  42.581  1.00 61.62  ? 318 LYS B CG  1 
ATOM   2031  C  CD  . LYS B 2 185 ? 60.530  -4.649  41.210  1.00 68.56  ? 318 LYS B CD  1 
ATOM   2032  C  CE  . LYS B 2 185 ? 59.656  -5.258  40.112  1.00 73.23  ? 318 LYS B CE  1 
ATOM   2033  N  NZ  . LYS B 2 185 ? 60.031  -4.767  38.752  1.00 76.30  ? 318 LYS B NZ  1 
ATOM   2034  N  N   . GLY B 2 186 ? 61.393  -4.532  47.279  1.00 47.17  ? 319 GLY B N   1 
ATOM   2035  C  CA  . GLY B 2 186 ? 62.384  -4.235  48.294  1.00 50.68  ? 319 GLY B CA  1 
ATOM   2036  C  C   . GLY B 2 186 ? 63.044  -2.870  48.307  1.00 53.40  ? 319 GLY B C   1 
ATOM   2037  O  O   . GLY B 2 186 ? 63.953  -2.642  49.110  1.00 55.82  ? 319 GLY B O   1 
ATOM   2038  N  N   . ASP B 2 187 ? 62.656  -1.976  47.406  1.00 53.12  ? 320 ASP B N   1 
ATOM   2039  C  CA  . ASP B 2 187 ? 63.237  -0.641  47.420  1.00 49.70  ? 320 ASP B CA  1 
ATOM   2040  C  C   . ASP B 2 187 ? 62.503  0.130   48.484  1.00 48.09  ? 320 ASP B C   1 
ATOM   2041  O  O   . ASP B 2 187 ? 61.300  -0.038  48.642  1.00 44.31  ? 320 ASP B O   1 
ATOM   2042  C  CB  . ASP B 2 187 ? 63.081  0.034   46.077  1.00 55.64  ? 320 ASP B CB  1 
ATOM   2043  C  CG  . ASP B 2 187 ? 64.028  -0.518  45.060  1.00 65.41  ? 320 ASP B CG  1 
ATOM   2044  O  OD1 . ASP B 2 187 ? 65.202  -0.755  45.430  1.00 70.98  ? 320 ASP B OD1 1 
ATOM   2045  O  OD2 . ASP B 2 187 ? 63.602  -0.733  43.903  1.00 69.21  ? 320 ASP B OD2 1 
ATOM   2046  N  N   . LYS B 2 188 ? 63.225  0.965   49.223  1.00 52.03  ? 321 LYS B N   1 
ATOM   2047  C  CA  . LYS B 2 188 ? 62.624  1.731   50.311  1.00 55.22  ? 321 LYS B CA  1 
ATOM   2048  C  C   . LYS B 2 188 ? 63.020  3.199   50.315  1.00 49.10  ? 321 LYS B C   1 
ATOM   2049  O  O   . LYS B 2 188 ? 64.179  3.551   50.101  1.00 54.07  ? 321 LYS B O   1 
ATOM   2050  C  CB  . LYS B 2 188 ? 62.986  1.082   51.662  1.00 64.81  ? 321 LYS B CB  1 
ATOM   2051  C  CG  . LYS B 2 188 ? 62.286  1.677   52.889  1.00 71.01  ? 321 LYS B CG  1 
ATOM   2052  C  CD  . LYS B 2 188 ? 61.995  0.584   53.925  1.00 78.38  ? 321 LYS B CD  1 
ATOM   2053  C  CE  . LYS B 2 188 ? 61.006  1.055   54.995  1.00 81.93  ? 321 LYS B CE  1 
ATOM   2054  N  NZ  . LYS B 2 188 ? 60.527  -0.051  55.894  1.00 82.71  ? 321 LYS B NZ  1 
ATOM   2055  N  N   . VAL B 2 189 ? 62.036  4.058   50.545  1.00 42.70  ? 322 VAL B N   1 
ATOM   2056  C  CA  . VAL B 2 189 ? 62.279  5.489   50.607  1.00 35.29  ? 322 VAL B CA  1 
ATOM   2057  C  C   . VAL B 2 189 ? 61.724  6.000   51.911  1.00 36.30  ? 322 VAL B C   1 
ATOM   2058  O  O   . VAL B 2 189 ? 61.127  5.253   52.694  1.00 35.44  ? 322 VAL B O   1 
ATOM   2059  C  CB  . VAL B 2 189 ? 61.577  6.266   49.468  1.00 32.26  ? 322 VAL B CB  1 
ATOM   2060  C  CG1 . VAL B 2 189 ? 62.154  5.899   48.141  1.00 33.48  ? 322 VAL B CG1 1 
ATOM   2061  C  CG2 . VAL B 2 189 ? 60.096  5.997   49.471  1.00 36.26  ? 322 VAL B CG2 1 
ATOM   2062  N  N   . LYS B 2 190 ? 61.917  7.290   52.131  1.00 37.40  ? 323 LYS B N   1 
ATOM   2063  C  CA  . LYS B 2 190 ? 61.410  7.919   53.327  1.00 35.92  ? 323 LYS B CA  1 
ATOM   2064  C  C   . LYS B 2 190 ? 60.957  9.351   53.054  1.00 35.28  ? 323 LYS B C   1 
ATOM   2065  O  O   . LYS B 2 190 ? 61.296  9.933   52.016  1.00 35.14  ? 323 LYS B O   1 
ATOM   2066  C  CB  . LYS B 2 190 ? 62.464  7.875   54.424  1.00 37.66  ? 323 LYS B CB  1 
ATOM   2067  C  CG  . LYS B 2 190 ? 63.796  8.482   54.036  1.00 46.10  ? 323 LYS B CG  1 
ATOM   2068  C  CD  . LYS B 2 190 ? 64.776  8.431   55.210  1.00 51.32  ? 323 LYS B CD  1 
ATOM   2069  C  CE  . LYS B 2 190 ? 66.078  9.144   54.889  1.00 57.38  ? 323 LYS B CE  1 
ATOM   2070  N  NZ  . LYS B 2 190 ? 67.089  8.962   55.965  1.00 59.78  ? 323 LYS B NZ  1 
ATOM   2071  N  N   . ALA B 2 191 ? 60.077  9.843   53.927  1.00 33.40  ? 324 ALA B N   1 
ATOM   2072  C  CA  . ALA B 2 191 ? 59.546  11.204  53.880  1.00 32.70  ? 324 ALA B CA  1 
ATOM   2073  C  C   . ALA B 2 191 ? 59.571  11.668  55.329  1.00 36.20  ? 324 ALA B C   1 
ATOM   2074  O  O   . ALA B 2 191 ? 58.938  11.062  56.201  1.00 39.25  ? 324 ALA B O   1 
ATOM   2075  C  CB  . ALA B 2 191 ? 58.135  11.229  53.327  1.00 31.53  ? 324 ALA B CB  1 
ATOM   2076  N  N   . HIS B 2 192 ? 60.347  12.719  55.575  1.00 36.27  ? 325 HIS B N   1 
ATOM   2077  C  CA  . HIS B 2 192 ? 60.543  13.258  56.907  1.00 31.38  ? 325 HIS B CA  1 
ATOM   2078  C  C   . HIS B 2 192 ? 60.021  14.688  57.022  1.00 25.87  ? 325 HIS B C   1 
ATOM   2079  O  O   . HIS B 2 192 ? 60.187  15.492  56.114  1.00 19.50  ? 325 HIS B O   1 
ATOM   2080  C  CB  . HIS B 2 192 ? 62.037  13.172  57.208  1.00 33.97  ? 325 HIS B CB  1 
ATOM   2081  C  CG  . HIS B 2 192 ? 62.421  13.637  58.571  1.00 40.90  ? 325 HIS B CG  1 
ATOM   2082  N  ND1 . HIS B 2 192 ? 63.251  12.903  59.389  1.00 43.38  ? 325 HIS B ND1 1 
ATOM   2083  C  CD2 . HIS B 2 192 ? 62.153  14.787  59.235  1.00 44.40  ? 325 HIS B CD2 1 
ATOM   2084  C  CE1 . HIS B 2 192 ? 63.483  13.584  60.496  1.00 46.49  ? 325 HIS B CE1 1 
ATOM   2085  N  NE2 . HIS B 2 192 ? 62.827  14.731  60.429  1.00 48.16  ? 325 HIS B NE2 1 
ATOM   2086  N  N   . TYR B 2 193 ? 59.364  14.989  58.138  1.00 26.38  ? 326 TYR B N   1 
ATOM   2087  C  CA  . TYR B 2 193 ? 58.816  16.314  58.365  1.00 28.50  ? 326 TYR B CA  1 
ATOM   2088  C  C   . TYR B 2 193 ? 59.222  16.811  59.731  1.00 28.92  ? 326 TYR B C   1 
ATOM   2089  O  O   . TYR B 2 193 ? 58.860  16.231  60.742  1.00 33.21  ? 326 TYR B O   1 
ATOM   2090  C  CB  . TYR B 2 193 ? 57.298  16.288  58.249  1.00 25.38  ? 326 TYR B CB  1 
ATOM   2091  C  CG  . TYR B 2 193 ? 56.812  16.003  56.857  1.00 24.09  ? 326 TYR B CG  1 
ATOM   2092  C  CD1 . TYR B 2 193 ? 56.725  14.702  56.376  1.00 25.57  ? 326 TYR B CD1 1 
ATOM   2093  C  CD2 . TYR B 2 193 ? 56.475  17.037  56.005  1.00 26.26  ? 326 TYR B CD2 1 
ATOM   2094  C  CE1 . TYR B 2 193 ? 56.316  14.447  55.067  1.00 25.05  ? 326 TYR B CE1 1 
ATOM   2095  C  CE2 . TYR B 2 193 ? 56.067  16.793  54.698  1.00 26.51  ? 326 TYR B CE2 1 
ATOM   2096  C  CZ  . TYR B 2 193 ? 55.991  15.508  54.234  1.00 21.89  ? 326 TYR B CZ  1 
ATOM   2097  O  OH  . TYR B 2 193 ? 55.609  15.309  52.933  1.00 20.75  ? 326 TYR B OH  1 
ATOM   2098  N  N   . GLY B 2 194 ? 59.978  17.898  59.756  1.00 29.03  ? 327 GLY B N   1 
ATOM   2099  C  CA  . GLY B 2 194 ? 60.442  18.453  61.017  1.00 31.86  ? 327 GLY B CA  1 
ATOM   2100  C  C   . GLY B 2 194 ? 59.328  18.940  61.923  1.00 31.59  ? 327 GLY B C   1 
ATOM   2101  O  O   . GLY B 2 194 ? 59.466  18.997  63.151  1.00 29.35  ? 327 GLY B O   1 
ATOM   2102  N  N   . GLY B 2 195 ? 58.225  19.336  61.304  1.00 32.68  ? 328 GLY B N   1 
ATOM   2103  C  CA  . GLY B 2 195 ? 57.095  19.816  62.071  1.00 28.63  ? 328 GLY B CA  1 
ATOM   2104  C  C   . GLY B 2 195 ? 55.903  18.934  61.801  1.00 23.33  ? 328 GLY B C   1 
ATOM   2105  O  O   . GLY B 2 195 ? 55.629  18.607  60.644  1.00 22.98  ? 328 GLY B O   1 
ATOM   2106  N  N   . PHE B 2 196 ? 55.237  18.508  62.869  1.00 16.51  ? 329 PHE B N   1 
ATOM   2107  C  CA  . PHE B 2 196 ? 54.075  17.649  62.742  1.00 16.97  ? 329 PHE B CA  1 
ATOM   2108  C  C   . PHE B 2 196 ? 53.110  17.855  63.874  1.00 18.90  ? 329 PHE B C   1 
ATOM   2109  O  O   . PHE B 2 196 ? 53.453  17.710  65.043  1.00 17.59  ? 329 PHE B O   1 
ATOM   2110  C  CB  . PHE B 2 196 ? 54.464  16.188  62.703  1.00 15.87  ? 329 PHE B CB  1 
ATOM   2111  C  CG  . PHE B 2 196 ? 53.284  15.266  62.676  1.00 18.46  ? 329 PHE B CG  1 
ATOM   2112  C  CD1 . PHE B 2 196 ? 52.356  15.338  61.654  1.00 16.35  ? 329 PHE B CD1 1 
ATOM   2113  C  CD2 . PHE B 2 196 ? 53.114  14.313  63.661  1.00 21.25  ? 329 PHE B CD2 1 
ATOM   2114  C  CE1 . PHE B 2 196 ? 51.276  14.473  61.611  1.00 13.78  ? 329 PHE B CE1 1 
ATOM   2115  C  CE2 . PHE B 2 196 ? 52.035  13.441  63.626  1.00 19.14  ? 329 PHE B CE2 1 
ATOM   2116  C  CZ  . PHE B 2 196 ? 51.115  13.522  62.597  1.00 14.52  ? 329 PHE B CZ  1 
ATOM   2117  N  N   . THR B 2 197 ? 51.869  18.117  63.515  1.00 22.75  ? 330 THR B N   1 
ATOM   2118  C  CA  . THR B 2 197 ? 50.870  18.367  64.530  1.00 26.20  ? 330 THR B CA  1 
ATOM   2119  C  C   . THR B 2 197 ? 49.472  17.879  64.155  1.00 25.80  ? 330 THR B C   1 
ATOM   2120  O  O   . THR B 2 197 ? 49.082  17.842  62.966  1.00 22.89  ? 330 THR B O   1 
ATOM   2121  C  CB  . THR B 2 197 ? 50.837  19.869  64.879  1.00 27.50  ? 330 THR B CB  1 
ATOM   2122  O  OG1 . THR B 2 197 ? 52.159  20.290  65.239  1.00 31.33  ? 330 THR B OG1 1 
ATOM   2123  C  CG2 . THR B 2 197 ? 49.906  20.139  66.047  1.00 32.08  ? 330 THR B CG2 1 
ATOM   2124  N  N   . VAL B 2 198 ? 48.763  17.419  65.183  1.00 15.61  ? 331 VAL B N   1 
ATOM   2125  C  CA  . VAL B 2 198 ? 47.406  16.953  65.025  1.00 13.38  ? 331 VAL B CA  1 
ATOM   2126  C  C   . VAL B 2 198 ? 46.561  17.492  66.159  1.00 14.44  ? 331 VAL B C   1 
ATOM   2127  O  O   . VAL B 2 198 ? 46.758  17.163  67.322  1.00 16.04  ? 331 VAL B O   1 
ATOM   2128  C  CB  . VAL B 2 198 ? 47.329  15.456  64.983  1.00 12.09  ? 331 VAL B CB  1 
ATOM   2129  C  CG1 . VAL B 2 198 ? 45.875  15.032  64.910  1.00 14.33  ? 331 VAL B CG1 1 
ATOM   2130  C  CG2 . VAL B 2 198 ? 48.070  14.955  63.767  1.00 7.45   ? 331 VAL B CG2 1 
ATOM   2131  N  N   . GLN B 2 199 ? 45.611  18.339  65.796  1.00 22.52  ? 332 GLN B N   1 
ATOM   2132  C  CA  . GLN B 2 199 ? 44.728  18.975  66.762  1.00 26.89  ? 332 GLN B CA  1 
ATOM   2133  C  C   . GLN B 2 199 ? 43.809  18.018  67.488  1.00 25.14  ? 332 GLN B C   1 
ATOM   2134  O  O   . GLN B 2 199 ? 43.739  16.839  67.150  1.00 25.84  ? 332 GLN B O   1 
ATOM   2135  C  CB  . GLN B 2 199 ? 43.911  20.064  66.062  1.00 28.35  ? 332 GLN B CB  1 
ATOM   2136  C  CG  . GLN B 2 199 ? 44.774  21.171  65.499  1.00 29.13  ? 332 GLN B CG  1 
ATOM   2137  C  CD  . GLN B 2 199 ? 45.722  21.744  66.537  1.00 35.36  ? 332 GLN B CD  1 
ATOM   2138  O  OE1 . GLN B 2 199 ? 46.843  22.146  66.216  1.00 33.19  ? 332 GLN B OE1 1 
ATOM   2139  N  NE2 . GLN B 2 199 ? 45.278  21.772  67.797  1.00 42.93  ? 332 GLN B NE2 1 
ATOM   2140  N  N   . ASN B 2 200 ? 43.127  18.524  68.510  1.00 21.72  ? 333 ASN B N   1 
ATOM   2141  C  CA  . ASN B 2 200 ? 42.184  17.701  69.265  1.00 18.08  ? 333 ASN B CA  1 
ATOM   2142  C  C   . ASN B 2 200 ? 41.034  17.321  68.366  1.00 13.84  ? 333 ASN B C   1 
ATOM   2143  O  O   . ASN B 2 200 ? 40.951  17.771  67.224  1.00 14.12  ? 333 ASN B O   1 
ATOM   2144  C  CB  . ASN B 2 200 ? 41.635  18.445  70.478  1.00 20.87  ? 333 ASN B CB  1 
ATOM   2145  C  CG  . ASN B 2 200 ? 41.007  19.760  70.114  1.00 24.77  ? 333 ASN B CG  1 
ATOM   2146  O  OD1 . ASN B 2 200 ? 40.967  20.141  68.945  1.00 24.10  ? 333 ASN B OD1 1 
ATOM   2147  N  ND2 . ASN B 2 200 ? 40.530  20.486  71.122  1.00 30.36  ? 333 ASN B ND2 1 
ATOM   2148  N  N   . GLU B 2 201 ? 40.140  16.498  68.888  1.00 18.90  ? 334 GLU B N   1 
ATOM   2149  C  CA  . GLU B 2 201 ? 38.985  16.058  68.115  1.00 22.29  ? 334 GLU B CA  1 
ATOM   2150  C  C   . GLU B 2 201 ? 38.142  17.265  67.729  1.00 18.04  ? 334 GLU B C   1 
ATOM   2151  O  O   . GLU B 2 201 ? 37.621  17.333  66.638  1.00 17.37  ? 334 GLU B O   1 
ATOM   2152  C  CB  . GLU B 2 201 ? 38.163  15.052  68.923  1.00 26.49  ? 334 GLU B CB  1 
ATOM   2153  C  CG  . GLU B 2 201 ? 37.053  14.380  68.127  1.00 33.96  ? 334 GLU B CG  1 
ATOM   2154  C  CD  . GLU B 2 201 ? 36.227  13.396  68.948  1.00 39.00  ? 334 GLU B CD  1 
ATOM   2155  O  OE1 . GLU B 2 201 ? 36.366  13.377  70.191  1.00 41.19  ? 334 GLU B OE1 1 
ATOM   2156  O  OE2 . GLU B 2 201 ? 35.430  12.643  68.344  1.00 34.97  ? 334 GLU B OE2 1 
ATOM   2157  N  N   . ALA B 2 202 ? 38.091  18.251  68.611  1.00 20.18  ? 335 ALA B N   1 
ATOM   2158  C  CA  . ALA B 2 202 ? 37.332  19.462  68.375  1.00 20.00  ? 335 ALA B CA  1 
ATOM   2159  C  C   . ALA B 2 202 ? 37.721  20.124  67.065  1.00 21.17  ? 335 ALA B C   1 
ATOM   2160  O  O   . ALA B 2 202 ? 36.862  20.657  66.369  1.00 24.21  ? 335 ALA B O   1 
ATOM   2161  C  CB  . ALA B 2 202 ? 37.536  20.431  69.517  1.00 24.89  ? 335 ALA B CB  1 
ATOM   2162  N  N   . ASN B 2 203 ? 39.014  20.127  66.743  1.00 24.06  ? 336 ASN B N   1 
ATOM   2163  C  CA  . ASN B 2 203 ? 39.474  20.741  65.499  1.00 25.41  ? 336 ASN B CA  1 
ATOM   2164  C  C   . ASN B 2 203 ? 39.601  19.685  64.424  1.00 25.53  ? 336 ASN B C   1 
ATOM   2165  O  O   . ASN B 2 203 ? 40.345  19.830  63.450  1.00 19.23  ? 336 ASN B O   1 
ATOM   2166  C  CB  . ASN B 2 203 ? 40.767  21.498  65.721  1.00 22.33  ? 336 ASN B CB  1 
ATOM   2167  C  CG  . ASN B 2 203 ? 40.579  22.666  66.661  1.00 28.36  ? 336 ASN B CG  1 
ATOM   2168  O  OD1 . ASN B 2 203 ? 40.540  23.815  66.230  1.00 38.47  ? 336 ASN B OD1 1 
ATOM   2169  N  ND2 . ASN B 2 203 ? 40.406  22.379  67.949  1.00 25.68  ? 336 ASN B ND2 1 
ATOM   2170  N  N   . LYS B 2 204 ? 38.821  18.627  64.629  1.00 26.70  ? 337 LYS B N   1 
ATOM   2171  C  CA  . LYS B 2 204 ? 38.741  17.486  63.740  1.00 27.09  ? 337 LYS B CA  1 
ATOM   2172  C  C   . LYS B 2 204 ? 40.110  16.907  63.410  1.00 21.32  ? 337 LYS B C   1 
ATOM   2173  O  O   . LYS B 2 204 ? 40.385  16.548  62.267  1.00 23.22  ? 337 LYS B O   1 
ATOM   2174  C  CB  . LYS B 2 204 ? 37.980  17.878  62.474  1.00 31.85  ? 337 LYS B CB  1 
ATOM   2175  C  CG  . LYS B 2 204 ? 36.623  18.498  62.743  1.00 42.74  ? 337 LYS B CG  1 
ATOM   2176  C  CD  . LYS B 2 204 ? 35.943  18.897  61.432  1.00 51.55  ? 337 LYS B CD  1 
ATOM   2177  C  CE  . LYS B 2 204 ? 34.721  19.819  61.626  1.00 57.10  ? 337 LYS B CE  1 
ATOM   2178  N  NZ  . LYS B 2 204 ? 35.047  21.257  61.981  1.00 60.95  ? 337 LYS B NZ  1 
ATOM   2179  N  N   . TYR B 2 205 ? 40.956  16.806  64.428  1.00 18.68  ? 338 TYR B N   1 
ATOM   2180  C  CA  . TYR B 2 205 ? 42.312  16.277  64.277  1.00 20.87  ? 338 TYR B CA  1 
ATOM   2181  C  C   . TYR B 2 205 ? 43.016  16.920  63.090  1.00 18.83  ? 338 TYR B C   1 
ATOM   2182  O  O   . TYR B 2 205 ? 43.651  16.236  62.293  1.00 18.49  ? 338 TYR B O   1 
ATOM   2183  C  CB  . TYR B 2 205 ? 42.269  14.753  64.091  1.00 26.65  ? 338 TYR B CB  1 
ATOM   2184  C  CG  . TYR B 2 205 ? 41.596  14.015  65.221  1.00 25.53  ? 338 TYR B CG  1 
ATOM   2185  C  CD1 . TYR B 2 205 ? 42.093  14.086  66.525  1.00 24.01  ? 338 TYR B CD1 1 
ATOM   2186  C  CD2 . TYR B 2 205 ? 40.439  13.286  64.996  1.00 23.10  ? 338 TYR B CD2 1 
ATOM   2187  C  CE1 . TYR B 2 205 ? 41.446  13.455  67.567  1.00 25.79  ? 338 TYR B CE1 1 
ATOM   2188  C  CE2 . TYR B 2 205 ? 39.781  12.647  66.036  1.00 24.02  ? 338 TYR B CE2 1 
ATOM   2189  C  CZ  . TYR B 2 205 ? 40.286  12.740  67.315  1.00 25.36  ? 338 TYR B CZ  1 
ATOM   2190  O  OH  . TYR B 2 205 ? 39.596  12.155  68.338  1.00 24.96  ? 338 TYR B OH  1 
ATOM   2191  N  N   . GLN B 2 206 ? 42.886  18.235  62.964  1.00 19.01  ? 339 GLN B N   1 
ATOM   2192  C  CA  . GLN B 2 206 ? 43.484  18.956  61.850  1.00 19.45  ? 339 GLN B CA  1 
ATOM   2193  C  C   . GLN B 2 206 ? 45.009  18.776  61.805  1.00 24.34  ? 339 GLN B C   1 
ATOM   2194  O  O   . GLN B 2 206 ? 45.735  19.075  62.772  1.00 21.11  ? 339 GLN B O   1 
ATOM   2195  C  CB  . GLN B 2 206 ? 43.087  20.433  61.941  1.00 20.03  ? 339 GLN B CB  1 
ATOM   2196  C  CG  . GLN B 2 206 ? 43.403  21.261  60.702  1.00 19.42  ? 339 GLN B CG  1 
ATOM   2197  C  CD  . GLN B 2 206 ? 42.733  22.629  60.716  1.00 20.92  ? 339 GLN B CD  1 
ATOM   2198  O  OE1 . GLN B 2 206 ? 42.326  23.138  59.658  1.00 20.96  ? 339 GLN B OE1 1 
ATOM   2199  N  NE2 . GLN B 2 206 ? 42.595  23.226  61.910  1.00 19.42  ? 339 GLN B NE2 1 
ATOM   2200  N  N   . ILE B 2 207 ? 45.483  18.281  60.668  1.00 23.60  ? 340 ILE B N   1 
ATOM   2201  C  CA  . ILE B 2 207 ? 46.913  18.020  60.465  1.00 29.36  ? 340 ILE B CA  1 
ATOM   2202  C  C   . ILE B 2 207 ? 47.728  19.222  59.978  1.00 30.72  ? 340 ILE B C   1 
ATOM   2203  O  O   . ILE B 2 207 ? 47.207  20.072  59.256  1.00 35.43  ? 340 ILE B O   1 
ATOM   2204  C  CB  . ILE B 2 207 ? 47.134  16.839  59.448  1.00 30.22  ? 340 ILE B CB  1 
ATOM   2205  C  CG1 . ILE B 2 207 ? 48.628  16.506  59.334  1.00 28.52  ? 340 ILE B CG1 1 
ATOM   2206  C  CG2 . ILE B 2 207 ? 46.590  17.209  58.083  1.00 23.68  ? 340 ILE B CG2 1 
ATOM   2207  C  CD1 . ILE B 2 207 ? 48.941  15.406  58.404  1.00 25.86  ? 340 ILE B CD1 1 
ATOM   2208  N  N   . SER B 2 208 ? 49.015  19.246  60.333  1.00 27.49  ? 341 SER B N   1 
ATOM   2209  C  CA  . SER B 2 208 ? 49.920  20.311  59.921  1.00 26.32  ? 341 SER B CA  1 
ATOM   2210  C  C   . SER B 2 208 ? 51.357  19.807  59.836  1.00 28.66  ? 341 SER B C   1 
ATOM   2211  O  O   . SER B 2 208 ? 51.860  19.176  60.774  1.00 32.73  ? 341 SER B O   1 
ATOM   2212  C  CB  . SER B 2 208 ? 49.844  21.468  60.906  1.00 30.80  ? 341 SER B CB  1 
ATOM   2213  O  OG  . SER B 2 208 ? 50.722  22.503  60.517  1.00 42.49  ? 341 SER B OG  1 
ATOM   2214  N  N   . VAL B 2 209 ? 52.022  20.097  58.720  1.00 25.37  ? 342 VAL B N   1 
ATOM   2215  C  CA  . VAL B 2 209 ? 53.409  19.660  58.536  1.00 29.16  ? 342 VAL B CA  1 
ATOM   2216  C  C   . VAL B 2 209 ? 54.346  20.719  57.902  1.00 28.89  ? 342 VAL B C   1 
ATOM   2217  O  O   . VAL B 2 209 ? 53.910  21.589  57.147  1.00 22.94  ? 342 VAL B O   1 
ATOM   2218  C  CB  . VAL B 2 209 ? 53.499  18.293  57.748  1.00 25.41  ? 342 VAL B CB  1 
ATOM   2219  C  CG1 . VAL B 2 209 ? 52.945  17.152  58.568  1.00 16.65  ? 342 VAL B CG1 1 
ATOM   2220  C  CG2 . VAL B 2 209 ? 52.750  18.383  56.451  1.00 26.31  ? 342 VAL B CG2 1 
ATOM   2221  N  N   . ASN B 2 210 ? 55.629  20.634  58.246  1.00 29.61  ? 343 ASN B N   1 
ATOM   2222  C  CA  . ASN B 2 210 ? 56.645  21.546  57.751  1.00 34.18  ? 343 ASN B CA  1 
ATOM   2223  C  C   . ASN B 2 210 ? 57.928  20.797  57.503  1.00 35.74  ? 343 ASN B C   1 
ATOM   2224  O  O   . ASN B 2 210 ? 58.020  19.602  57.724  1.00 50.60  ? 343 ASN B O   1 
ATOM   2225  C  CB  . ASN B 2 210 ? 56.967  22.606  58.792  1.00 46.29  ? 343 ASN B CB  1 
ATOM   2226  C  CG  . ASN B 2 210 ? 55.744  23.118  59.498  1.00 60.76  ? 343 ASN B CG  1 
ATOM   2227  O  OD1 . ASN B 2 210 ? 55.362  22.603  60.552  1.00 68.03  ? 343 ASN B OD1 1 
ATOM   2228  N  ND2 . ASN B 2 210 ? 55.105  24.133  58.916  1.00 68.06  ? 343 ASN B ND2 1 
ATOM   2229  N  N   . LYS B 2 211 ? 58.939  21.550  57.101  1.00 26.47  ? 344 LYS B N   1 
ATOM   2230  C  CA  . LYS B 2 211 ? 60.263  21.031  56.825  1.00 27.28  ? 344 LYS B CA  1 
ATOM   2231  C  C   . LYS B 2 211 ? 60.335  19.602  56.326  1.00 25.19  ? 344 LYS B C   1 
ATOM   2232  O  O   . LYS B 2 211 ? 60.760  18.704  57.043  1.00 28.27  ? 344 LYS B O   1 
ATOM   2233  C  CB  . LYS B 2 211 ? 61.177  21.199  58.041  1.00 37.70  ? 344 LYS B CB  1 
ATOM   2234  C  CG  . LYS B 2 211 ? 61.546  22.647  58.358  1.00 42.12  ? 344 LYS B CG  1 
ATOM   2235  C  CD  . LYS B 2 211 ? 60.824  23.185  59.615  1.00 46.31  ? 344 LYS B CD  1 
ATOM   2236  C  CE  . LYS B 2 211 ? 61.296  22.502  60.912  1.00 45.55  ? 344 LYS B CE  1 
ATOM   2237  N  NZ  . LYS B 2 211 ? 60.648  23.085  62.125  1.00 43.76  ? 344 LYS B NZ  1 
ATOM   2238  N  N   . TYR B 2 212 ? 59.880  19.380  55.104  1.00 24.91  ? 345 TYR B N   1 
ATOM   2239  C  CA  . TYR B 2 212 ? 59.977  18.045  54.537  1.00 29.83  ? 345 TYR B CA  1 
ATOM   2240  C  C   . TYR B 2 212 ? 61.397  17.852  54.034  1.00 28.42  ? 345 TYR B C   1 
ATOM   2241  O  O   . TYR B 2 212 ? 62.014  18.771  53.522  1.00 31.85  ? 345 TYR B O   1 
ATOM   2242  C  CB  . TYR B 2 212 ? 58.994  17.846  53.379  1.00 29.45  ? 345 TYR B CB  1 
ATOM   2243  C  CG  . TYR B 2 212 ? 59.378  16.754  52.397  1.00 28.36  ? 345 TYR B CG  1 
ATOM   2244  C  CD1 . TYR B 2 212 ? 59.038  15.426  52.621  1.00 27.55  ? 345 TYR B CD1 1 
ATOM   2245  C  CD2 . TYR B 2 212 ? 60.049  17.066  51.220  1.00 29.90  ? 345 TYR B CD2 1 
ATOM   2246  C  CE1 . TYR B 2 212 ? 59.356  14.431  51.681  1.00 32.52  ? 345 TYR B CE1 1 
ATOM   2247  C  CE2 . TYR B 2 212 ? 60.371  16.086  50.279  1.00 28.88  ? 345 TYR B CE2 1 
ATOM   2248  C  CZ  . TYR B 2 212 ? 60.020  14.771  50.507  1.00 30.43  ? 345 TYR B CZ  1 
ATOM   2249  O  OH  . TYR B 2 212 ? 60.299  13.811  49.551  1.00 23.58  ? 345 TYR B OH  1 
ATOM   2250  N  N   . ARG B 2 213 ? 61.889  16.636  54.168  1.00 29.61  ? 346 ARG B N   1 
ATOM   2251  C  CA  . ARG B 2 213 ? 63.211  16.281  53.729  1.00 31.78  ? 346 ARG B CA  1 
ATOM   2252  C  C   . ARG B 2 213 ? 63.104  14.794  53.490  1.00 30.39  ? 346 ARG B C   1 
ATOM   2253  O  O   . ARG B 2 213 ? 62.689  14.055  54.378  1.00 26.81  ? 346 ARG B O   1 
ATOM   2254  C  CB  . ARG B 2 213 ? 64.240  16.608  54.818  1.00 40.23  ? 346 ARG B CB  1 
ATOM   2255  C  CG  . ARG B 2 213 ? 63.847  16.130  56.217  1.00 56.53  ? 346 ARG B CG  1 
ATOM   2256  C  CD  . ARG B 2 213 ? 64.564  16.890  57.345  1.00 65.95  ? 346 ARG B CD  1 
ATOM   2257  N  NE  . ARG B 2 213 ? 66.012  16.732  57.276  1.00 71.59  ? 346 ARG B NE  1 
ATOM   2258  C  CZ  . ARG B 2 213 ? 66.637  15.559  57.252  1.00 75.52  ? 346 ARG B CZ  1 
ATOM   2259  N  NH1 . ARG B 2 213 ? 65.947  14.424  57.294  1.00 74.42  ? 346 ARG B NH1 1 
ATOM   2260  N  NH2 . ARG B 2 213 ? 67.960  15.524  57.162  1.00 80.84  ? 346 ARG B NH2 1 
ATOM   2261  N  N   . GLY B 2 214 ? 63.366  14.369  52.257  1.00 31.04  ? 347 GLY B N   1 
ATOM   2262  C  CA  . GLY B 2 214 ? 63.285  12.950  51.937  1.00 26.09  ? 347 GLY B CA  1 
ATOM   2263  C  C   . GLY B 2 214 ? 63.303  12.543  50.472  1.00 24.03  ? 347 GLY B C   1 
ATOM   2264  O  O   . GLY B 2 214 ? 63.199  13.359  49.560  1.00 28.67  ? 347 GLY B O   1 
ATOM   2265  N  N   . THR B 2 215 ? 63.397  11.246  50.252  1.00 25.91  ? 348 THR B N   1 
ATOM   2266  C  CA  . THR B 2 215 ? 63.438  10.694  48.915  1.00 25.15  ? 348 THR B CA  1 
ATOM   2267  C  C   . THR B 2 215 ? 62.085  10.265  48.372  1.00 24.72  ? 348 THR B C   1 
ATOM   2268  O  O   . THR B 2 215 ? 61.972  10.004  47.179  1.00 25.67  ? 348 THR B O   1 
ATOM   2269  C  CB  . THR B 2 215 ? 64.365  9.480   48.869  1.00 30.27  ? 348 THR B CB  1 
ATOM   2270  O  OG1 . THR B 2 215 ? 63.983  8.547   49.894  1.00 40.29  ? 348 THR B OG1 1 
ATOM   2271  C  CG2 . THR B 2 215 ? 65.798  9.903   49.105  1.00 31.01  ? 348 THR B CG2 1 
ATOM   2272  N  N   . ALA B 2 216 ? 61.058  10.232  49.227  1.00 27.20  ? 349 ALA B N   1 
ATOM   2273  C  CA  . ALA B 2 216 ? 59.712  9.783   48.827  1.00 28.07  ? 349 ALA B CA  1 
ATOM   2274  C  C   . ALA B 2 216 ? 58.858  10.717  47.989  1.00 25.20  ? 349 ALA B C   1 
ATOM   2275  O  O   . ALA B 2 216 ? 58.036  10.264  47.202  1.00 23.73  ? 349 ALA B O   1 
ATOM   2276  C  CB  . ALA B 2 216 ? 58.921  9.345   50.044  1.00 26.81  ? 349 ALA B CB  1 
ATOM   2277  N  N   . GLY B 2 217 ? 59.073  12.015  48.133  1.00 27.40  ? 350 GLY B N   1 
ATOM   2278  C  CA  . GLY B 2 217 ? 58.260  12.963  47.402  1.00 29.70  ? 350 GLY B CA  1 
ATOM   2279  C  C   . GLY B 2 217 ? 57.343  13.528  48.457  1.00 31.00  ? 350 GLY B C   1 
ATOM   2280  O  O   . GLY B 2 217 ? 56.842  12.796  49.314  1.00 30.41  ? 350 GLY B O   1 
ATOM   2281  N  N   . ASN B 2 218 ? 57.180  14.842  48.442  1.00 33.33  ? 351 ASN B N   1 
ATOM   2282  C  CA  . ASN B 2 218 ? 56.347  15.518  49.420  1.00 32.82  ? 351 ASN B CA  1 
ATOM   2283  C  C   . ASN B 2 218 ? 54.902  15.541  48.985  1.00 38.60  ? 351 ASN B C   1 
ATOM   2284  O  O   . ASN B 2 218 ? 54.389  16.565  48.523  1.00 39.65  ? 351 ASN B O   1 
ATOM   2285  C  CB  . ASN B 2 218 ? 56.839  16.936  49.628  1.00 30.62  ? 351 ASN B CB  1 
ATOM   2286  C  CG  . ASN B 2 218 ? 56.191  17.589  50.790  1.00 33.97  ? 351 ASN B CG  1 
ATOM   2287  O  OD1 . ASN B 2 218 ? 56.765  18.490  51.393  1.00 33.82  ? 351 ASN B OD1 1 
ATOM   2288  N  ND2 . ASN B 2 218 ? 54.986  17.137  51.137  1.00 33.22  ? 351 ASN B ND2 1 
ATOM   2289  N  N   . ALA B 2 219 ? 54.235  14.415  49.191  1.00 37.54  ? 352 ALA B N   1 
ATOM   2290  C  CA  . ALA B 2 219 ? 52.840  14.293  48.822  1.00 33.79  ? 352 ALA B CA  1 
ATOM   2291  C  C   . ALA B 2 219 ? 51.987  15.108  49.772  1.00 35.21  ? 352 ALA B C   1 
ATOM   2292  O  O   . ALA B 2 219 ? 50.992  15.708  49.364  1.00 35.33  ? 352 ALA B O   1 
ATOM   2293  C  CB  . ALA B 2 219 ? 52.420  12.844  48.847  1.00 32.51  ? 352 ALA B CB  1 
ATOM   2294  N  N   . LEU B 2 220 ? 52.452  15.225  51.009  1.00 32.24  ? 353 LEU B N   1 
ATOM   2295  C  CA  . LEU B 2 220 ? 51.701  15.938  52.021  1.00 31.41  ? 353 LEU B CA  1 
ATOM   2296  C  C   . LEU B 2 220 ? 51.554  17.450  51.893  1.00 26.17  ? 353 LEU B C   1 
ATOM   2297  O  O   . LEU B 2 220 ? 50.455  17.982  52.080  1.00 25.89  ? 353 LEU B O   1 
ATOM   2298  C  CB  . LEU B 2 220 ? 52.219  15.556  53.402  1.00 33.26  ? 353 LEU B CB  1 
ATOM   2299  C  CG  . LEU B 2 220 ? 52.062  14.070  53.736  1.00 34.34  ? 353 LEU B CG  1 
ATOM   2300  C  CD1 . LEU B 2 220 ? 52.398  13.849  55.196  1.00 36.39  ? 353 LEU B CD1 1 
ATOM   2301  C  CD2 . LEU B 2 220 ? 50.638  13.584  53.442  1.00 33.92  ? 353 LEU B CD2 1 
ATOM   2302  N  N   . MET B 2 221 ? 52.654  18.144  51.623  1.00 25.79  ? 354 MET B N   1 
ATOM   2303  C  CA  . MET B 2 221 ? 52.606  19.596  51.495  1.00 27.47  ? 354 MET B CA  1 
ATOM   2304  C  C   . MET B 2 221 ? 52.438  20.038  50.057  1.00 29.27  ? 354 MET B C   1 
ATOM   2305  O  O   . MET B 2 221 ? 51.659  20.944  49.772  1.00 29.50  ? 354 MET B O   1 
ATOM   2306  C  CB  . MET B 2 221 ? 53.870  20.245  52.031  1.00 24.35  ? 354 MET B CB  1 
ATOM   2307  C  CG  . MET B 2 221 ? 54.246  19.896  53.436  1.00 23.83  ? 354 MET B CG  1 
ATOM   2308  S  SD  . MET B 2 221 ? 55.451  21.121  54.052  1.00 32.79  ? 354 MET B SD  1 
ATOM   2309  C  CE  . MET B 2 221 ? 56.986  20.266  53.876  1.00 25.79  ? 354 MET B CE  1 
ATOM   2310  N  N   . ASP B 2 222 ? 53.175  19.393  49.157  1.00 30.55  ? 355 ASP B N   1 
ATOM   2311  C  CA  . ASP B 2 222 ? 53.141  19.742  47.744  1.00 33.13  ? 355 ASP B CA  1 
ATOM   2312  C  C   . ASP B 2 222 ? 52.129  18.997  46.881  1.00 36.34  ? 355 ASP B C   1 
ATOM   2313  O  O   . ASP B 2 222 ? 51.997  19.318  45.702  1.00 41.42  ? 355 ASP B O   1 
ATOM   2314  C  CB  . ASP B 2 222 ? 54.527  19.567  47.126  1.00 35.41  ? 355 ASP B CB  1 
ATOM   2315  C  CG  . ASP B 2 222 ? 55.570  20.500  47.724  1.00 43.88  ? 355 ASP B CG  1 
ATOM   2316  O  OD1 . ASP B 2 222 ? 55.203  21.534  48.325  1.00 45.33  ? 355 ASP B OD1 1 
ATOM   2317  O  OD2 . ASP B 2 222 ? 56.775  20.200  47.581  1.00 48.72  ? 355 ASP B OD2 1 
ATOM   2318  N  N   . GLY B 2 223 ? 51.423  18.010  47.434  1.00 31.13  ? 356 GLY B N   1 
ATOM   2319  C  CA  . GLY B 2 223 ? 50.470  17.267  46.626  1.00 26.71  ? 356 GLY B CA  1 
ATOM   2320  C  C   . GLY B 2 223 ? 51.158  16.440  45.545  1.00 27.94  ? 356 GLY B C   1 
ATOM   2321  O  O   . GLY B 2 223 ? 52.381  16.342  45.527  1.00 33.96  ? 356 GLY B O   1 
ATOM   2322  N  N   . ALA B 2 224 ? 50.383  15.891  44.611  1.00 25.78  ? 357 ALA B N   1 
ATOM   2323  C  CA  . ALA B 2 224 ? 50.925  15.042  43.541  1.00 28.81  ? 357 ALA B CA  1 
ATOM   2324  C  C   . ALA B 2 224 ? 51.816  15.713  42.498  1.00 35.40  ? 357 ALA B C   1 
ATOM   2325  O  O   . ALA B 2 224 ? 51.341  16.490  41.674  1.00 30.26  ? 357 ALA B O   1 
ATOM   2326  C  CB  . ALA B 2 224 ? 49.806  14.313  42.843  1.00 27.60  ? 357 ALA B CB  1 
ATOM   2327  N  N   . SER B 2 225 ? 53.091  15.326  42.474  1.00 43.28  ? 358 SER B N   1 
ATOM   2328  C  CA  . SER B 2 225 ? 54.049  15.894  41.528  1.00 46.61  ? 358 SER B CA  1 
ATOM   2329  C  C   . SER B 2 225 ? 53.602  15.706  40.078  1.00 52.28  ? 358 SER B C   1 
ATOM   2330  O  O   . SER B 2 225 ? 53.830  16.573  39.226  1.00 56.26  ? 358 SER B O   1 
ATOM   2331  C  CB  . SER B 2 225 ? 55.462  15.331  41.761  1.00 46.44  ? 358 SER B CB  1 
ATOM   2332  O  OG  . SER B 2 225 ? 55.512  13.930  41.584  1.00 50.39  ? 358 SER B OG  1 
ATOM   2333  N  N   . GLN B 2 226 ? 52.892  14.614  39.817  1.00 53.62  ? 359 GLN B N   1 
ATOM   2334  C  CA  . GLN B 2 226 ? 52.406  14.323  38.473  1.00 54.36  ? 359 GLN B CA  1 
ATOM   2335  C  C   . GLN B 2 226 ? 51.243  15.191  38.021  1.00 51.89  ? 359 GLN B C   1 
ATOM   2336  O  O   . GLN B 2 226 ? 51.166  15.554  36.860  1.00 53.82  ? 359 GLN B O   1 
ATOM   2337  C  CB  . GLN B 2 226 ? 52.035  12.843  38.330  1.00 60.06  ? 359 GLN B CB  1 
ATOM   2338  C  CG  . GLN B 2 226 ? 51.575  12.138  39.608  1.00 67.53  ? 359 GLN B CG  1 
ATOM   2339  C  CD  . GLN B 2 226 ? 52.736  11.713  40.503  1.00 71.11  ? 359 GLN B CD  1 
ATOM   2340  O  OE1 . GLN B 2 226 ? 53.266  10.615  40.364  1.00 75.23  ? 359 GLN B OE1 1 
ATOM   2341  N  NE2 . GLN B 2 226 ? 53.129  12.583  41.423  1.00 69.91  ? 359 GLN B NE2 1 
ATOM   2342  N  N   . LEU B 2 227 ? 50.347  15.531  38.939  1.00 51.48  ? 360 LEU B N   1 
ATOM   2343  C  CA  . LEU B 2 227 ? 49.187  16.348  38.610  1.00 48.71  ? 360 LEU B CA  1 
ATOM   2344  C  C   . LEU B 2 227 ? 49.527  17.792  38.345  1.00 50.89  ? 360 LEU B C   1 
ATOM   2345  O  O   . LEU B 2 227 ? 50.606  18.250  38.720  1.00 49.45  ? 360 LEU B O   1 
ATOM   2346  C  CB  . LEU B 2 227 ? 48.154  16.262  39.722  1.00 47.49  ? 360 LEU B CB  1 
ATOM   2347  C  CG  . LEU B 2 227 ? 47.371  14.958  39.678  1.00 46.67  ? 360 LEU B CG  1 
ATOM   2348  C  CD1 . LEU B 2 227 ? 46.347  14.926  40.808  1.00 48.52  ? 360 LEU B CD1 1 
ATOM   2349  C  CD2 . LEU B 2 227 ? 46.695  14.835  38.311  1.00 45.05  ? 360 LEU B CD2 1 
ATOM   2350  N  N   . MET B 2 228 ? 48.594  18.504  37.708  1.00 56.93  ? 361 MET B N   1 
ATOM   2351  C  CA  . MET B 2 228 ? 48.775  19.920  37.369  1.00 67.58  ? 361 MET B CA  1 
ATOM   2352  C  C   . MET B 2 228 ? 47.755  20.864  38.018  1.00 67.36  ? 361 MET B C   1 
ATOM   2353  O  O   . MET B 2 228 ? 46.571  20.538  38.095  1.00 70.65  ? 361 MET B O   1 
ATOM   2354  C  CB  . MET B 2 228 ? 48.725  20.109  35.851  1.00 74.17  ? 361 MET B CB  1 
ATOM   2355  C  CG  . MET B 2 228 ? 49.815  19.373  35.058  1.00 81.11  ? 361 MET B CG  1 
ATOM   2356  S  SD  . MET B 2 228 ? 51.507  20.048  35.190  1.00 86.64  ? 361 MET B SD  1 
ATOM   2357  C  CE  . MET B 2 228 ? 52.380  18.638  35.926  1.00 90.38  ? 361 MET B CE  1 
ATOM   2358  N  N   . GLY B 2 229 ? 48.238  22.025  38.474  1.00 64.74  ? 362 GLY B N   1 
ATOM   2359  C  CA  . GLY B 2 229 ? 47.412  23.056  39.097  1.00 64.47  ? 362 GLY B CA  1 
ATOM   2360  C  C   . GLY B 2 229 ? 46.188  22.647  39.900  1.00 66.90  ? 362 GLY B C   1 
ATOM   2361  O  O   . GLY B 2 229 ? 46.314  22.167  41.020  1.00 71.82  ? 362 GLY B O   1 
ATOM   2362  N  N   . GLU B 2 230 ? 45.006  22.878  39.332  1.00 68.00  ? 363 GLU B N   1 
ATOM   2363  C  CA  . GLU B 2 230 ? 43.718  22.538  39.948  1.00 71.98  ? 363 GLU B CA  1 
ATOM   2364  C  C   . GLU B 2 230 ? 43.740  21.178  40.651  1.00 67.93  ? 363 GLU B C   1 
ATOM   2365  O  O   . GLU B 2 230 ? 43.440  21.060  41.841  1.00 63.41  ? 363 GLU B O   1 
ATOM   2366  C  CB  . GLU B 2 230 ? 42.627  22.500  38.857  1.00 79.62  ? 363 GLU B CB  1 
ATOM   2367  C  CG  . GLU B 2 230 ? 41.263  21.897  39.294  1.00 86.08  ? 363 GLU B CG  1 
ATOM   2368  C  CD  . GLU B 2 230 ? 40.491  21.217  38.150  1.00 87.85  ? 363 GLU B CD  1 
ATOM   2369  O  OE1 . GLU B 2 230 ? 40.690  21.597  36.973  1.00 85.54  ? 363 GLU B OE1 1 
ATOM   2370  O  OE2 . GLU B 2 230 ? 39.684  20.297  38.430  1.00 91.17  ? 363 GLU B OE2 1 
ATOM   2371  N  N   . ASN B 2 231 ? 44.086  20.156  39.880  1.00 63.39  ? 364 ASN B N   1 
ATOM   2372  C  CA  . ASN B 2 231 ? 44.120  18.797  40.363  1.00 59.35  ? 364 ASN B CA  1 
ATOM   2373  C  C   . ASN B 2 231 ? 45.231  18.564  41.366  1.00 53.91  ? 364 ASN B C   1 
ATOM   2374  O  O   . ASN B 2 231 ? 45.038  17.850  42.343  1.00 58.38  ? 364 ASN B O   1 
ATOM   2375  C  CB  . ASN B 2 231 ? 44.250  17.831  39.184  1.00 63.82  ? 364 ASN B CB  1 
ATOM   2376  C  CG  . ASN B 2 231 ? 43.355  18.212  38.012  1.00 65.33  ? 364 ASN B CG  1 
ATOM   2377  O  OD1 . ASN B 2 231 ? 42.124  18.158  38.101  1.00 67.26  ? 364 ASN B OD1 1 
ATOM   2378  N  ND2 . ASN B 2 231 ? 43.978  18.607  36.905  1.00 64.65  ? 364 ASN B ND2 1 
ATOM   2379  N  N   . ARG B 2 232 ? 46.387  19.177  41.150  1.00 46.75  ? 365 ARG B N   1 
ATOM   2380  C  CA  . ARG B 2 232 ? 47.488  18.981  42.075  1.00 40.72  ? 365 ARG B CA  1 
ATOM   2381  C  C   . ARG B 2 232 ? 47.244  19.498  43.483  1.00 36.10  ? 365 ARG B C   1 
ATOM   2382  O  O   . ARG B 2 232 ? 47.523  18.802  44.443  1.00 36.06  ? 365 ARG B O   1 
ATOM   2383  C  CB  . ARG B 2 232 ? 48.779  19.578  41.541  1.00 43.32  ? 365 ARG B CB  1 
ATOM   2384  C  CG  . ARG B 2 232 ? 49.933  19.380  42.493  1.00 47.30  ? 365 ARG B CG  1 
ATOM   2385  C  CD  . ARG B 2 232 ? 51.271  19.589  41.840  1.00 55.83  ? 365 ARG B CD  1 
ATOM   2386  N  NE  . ARG B 2 232 ? 52.326  19.066  42.703  1.00 67.28  ? 365 ARG B NE  1 
ATOM   2387  C  CZ  . ARG B 2 232 ? 53.629  19.123  42.436  1.00 72.50  ? 365 ARG B CZ  1 
ATOM   2388  N  NH1 . ARG B 2 232 ? 54.060  19.690  41.312  1.00 73.72  ? 365 ARG B NH1 1 
ATOM   2389  N  NH2 . ARG B 2 232 ? 54.501  18.596  43.292  1.00 72.53  ? 365 ARG B NH2 1 
ATOM   2390  N  N   . THR B 2 233 ? 46.724  20.708  43.621  1.00 34.96  ? 366 THR B N   1 
ATOM   2391  C  CA  . THR B 2 233 ? 46.499  21.256  44.958  1.00 38.27  ? 366 THR B CA  1 
ATOM   2392  C  C   . THR B 2 233 ? 45.322  20.632  45.690  1.00 37.71  ? 366 THR B C   1 
ATOM   2393  O  O   . THR B 2 233 ? 45.220  20.748  46.915  1.00 36.75  ? 366 THR B O   1 
ATOM   2394  C  CB  . THR B 2 233 ? 46.342  22.807  44.966  1.00 40.75  ? 366 THR B CB  1 
ATOM   2395  O  OG1 . THR B 2 233 ? 44.967  23.167  44.792  1.00 44.92  ? 366 THR B OG1 1 
ATOM   2396  C  CG2 . THR B 2 233 ? 47.185  23.447  43.867  1.00 40.88  ? 366 THR B CG2 1 
ATOM   2397  N  N   . MET B 2 234 ? 44.428  19.983  44.948  1.00 35.52  ? 367 MET B N   1 
ATOM   2398  C  CA  . MET B 2 234 ? 43.279  19.356  45.569  1.00 42.43  ? 367 MET B CA  1 
ATOM   2399  C  C   . MET B 2 234 ? 43.662  18.021  46.179  1.00 35.69  ? 367 MET B C   1 
ATOM   2400  O  O   . MET B 2 234 ? 42.837  17.310  46.742  1.00 34.87  ? 367 MET B O   1 
ATOM   2401  C  CB  . MET B 2 234 ? 42.131  19.236  44.572  1.00 58.59  ? 367 MET B CB  1 
ATOM   2402  C  CG  . MET B 2 234 ? 41.325  20.548  44.420  1.00 73.63  ? 367 MET B CG  1 
ATOM   2403  S  SD  . MET B 2 234 ? 40.522  21.207  45.961  1.00 81.11  ? 367 MET B SD  1 
ATOM   2404  C  CE  . MET B 2 234 ? 41.816  22.328  46.593  1.00 80.62  ? 367 MET B CE  1 
ATOM   2405  N  N   . THR B 2 235 ? 44.951  17.723  46.110  1.00 31.24  ? 368 THR B N   1 
ATOM   2406  C  CA  . THR B 2 235 ? 45.492  16.500  46.667  1.00 29.43  ? 368 THR B CA  1 
ATOM   2407  C  C   . THR B 2 235 ? 46.451  16.805  47.819  1.00 31.36  ? 368 THR B C   1 
ATOM   2408  O  O   . THR B 2 235 ? 46.995  15.887  48.427  1.00 39.06  ? 368 THR B O   1 
ATOM   2409  C  CB  . THR B 2 235 ? 46.243  15.672  45.603  1.00 25.81  ? 368 THR B CB  1 
ATOM   2410  O  OG1 . THR B 2 235 ? 47.439  16.354  45.208  1.00 25.02  ? 368 THR B OG1 1 
ATOM   2411  C  CG2 . THR B 2 235 ? 45.372  15.436  44.390  1.00 16.47  ? 368 THR B CG2 1 
ATOM   2412  N  N   . ILE B 2 236 ? 46.680  18.088  48.096  1.00 26.63  ? 369 ILE B N   1 
ATOM   2413  C  CA  . ILE B 2 236 ? 47.567  18.494  49.185  1.00 18.60  ? 369 ILE B CA  1 
ATOM   2414  C  C   . ILE B 2 236 ? 46.844  18.157  50.479  1.00 17.59  ? 369 ILE B C   1 
ATOM   2415  O  O   . ILE B 2 236 ? 45.622  18.285  50.555  1.00 21.24  ? 369 ILE B O   1 
ATOM   2416  C  CB  . ILE B 2 236 ? 47.917  20.003  49.096  1.00 15.75  ? 369 ILE B CB  1 
ATOM   2417  C  CG1 . ILE B 2 236 ? 48.739  20.263  47.832  1.00 15.04  ? 369 ILE B CG1 1 
ATOM   2418  C  CG2 . ILE B 2 236 ? 48.712  20.446  50.301  1.00 11.10  ? 369 ILE B CG2 1 
ATOM   2419  C  CD1 . ILE B 2 236 ? 48.899  21.704  47.499  1.00 11.67  ? 369 ILE B CD1 1 
ATOM   2420  N  N   . HIS B 2 237 ? 47.582  17.656  51.463  1.00 12.80  ? 370 HIS B N   1 
ATOM   2421  C  CA  . HIS B 2 237 ? 46.990  17.268  52.744  1.00 14.82  ? 370 HIS B CA  1 
ATOM   2422  C  C   . HIS B 2 237 ? 47.222  18.229  53.892  1.00 12.91  ? 370 HIS B C   1 
ATOM   2423  O  O   . HIS B 2 237 ? 46.578  18.119  54.922  1.00 8.30   ? 370 HIS B O   1 
ATOM   2424  C  CB  . HIS B 2 237 ? 47.482  15.883  53.172  1.00 16.16  ? 370 HIS B CB  1 
ATOM   2425  C  CG  . HIS B 2 237 ? 47.177  14.798  52.189  1.00 16.87  ? 370 HIS B CG  1 
ATOM   2426  N  ND1 . HIS B 2 237 ? 45.956  14.164  52.136  1.00 19.40  ? 370 HIS B ND1 1 
ATOM   2427  C  CD2 . HIS B 2 237 ? 47.938  14.230  51.227  1.00 18.05  ? 370 HIS B CD2 1 
ATOM   2428  C  CE1 . HIS B 2 237 ? 45.977  13.251  51.184  1.00 20.94  ? 370 HIS B CE1 1 
ATOM   2429  N  NE2 . HIS B 2 237 ? 47.168  13.271  50.616  1.00 17.18  ? 370 HIS B NE2 1 
ATOM   2430  N  N   . ASN B 2 238 ? 48.170  19.141  53.749  1.00 16.48  ? 371 ASN B N   1 
ATOM   2431  C  CA  . ASN B 2 238 ? 48.430  20.087  54.825  1.00 23.09  ? 371 ASN B CA  1 
ATOM   2432  C  C   . ASN B 2 238 ? 47.153  20.895  55.097  1.00 24.98  ? 371 ASN B C   1 
ATOM   2433  O  O   . ASN B 2 238 ? 46.481  21.335  54.164  1.00 29.03  ? 371 ASN B O   1 
ATOM   2434  C  CB  . ASN B 2 238 ? 49.583  21.018  54.431  1.00 25.01  ? 371 ASN B CB  1 
ATOM   2435  C  CG  . ASN B 2 238 ? 50.319  21.588  55.633  1.00 25.17  ? 371 ASN B CG  1 
ATOM   2436  O  OD1 . ASN B 2 238 ? 49.826  21.573  56.765  1.00 23.38  ? 371 ASN B OD1 1 
ATOM   2437  N  ND2 . ASN B 2 238 ? 51.527  22.072  55.390  1.00 29.05  ? 371 ASN B ND2 1 
ATOM   2438  N  N   . GLY B 2 239 ? 46.784  21.029  56.363  1.00 16.43  ? 372 GLY B N   1 
ATOM   2439  C  CA  . GLY B 2 239 ? 45.598  21.797  56.692  1.00 23.64  ? 372 GLY B CA  1 
ATOM   2440  C  C   . GLY B 2 239 ? 44.263  21.069  56.611  1.00 27.43  ? 372 GLY B C   1 
ATOM   2441  O  O   . GLY B 2 239 ? 43.232  21.604  57.040  1.00 32.44  ? 372 GLY B O   1 
ATOM   2442  N  N   . MET B 2 240 ? 44.276  19.854  56.067  1.00 24.81  ? 373 MET B N   1 
ATOM   2443  C  CA  . MET B 2 240 ? 43.072  19.045  55.946  1.00 22.30  ? 373 MET B CA  1 
ATOM   2444  C  C   . MET B 2 240 ? 42.556  18.524  57.289  1.00 21.98  ? 373 MET B C   1 
ATOM   2445  O  O   . MET B 2 240 ? 43.240  18.602  58.322  1.00 25.05  ? 373 MET B O   1 
ATOM   2446  C  CB  . MET B 2 240 ? 43.317  17.864  55.016  1.00 20.03  ? 373 MET B CB  1 
ATOM   2447  C  CG  . MET B 2 240 ? 43.658  18.249  53.609  1.00 26.88  ? 373 MET B CG  1 
ATOM   2448  S  SD  . MET B 2 240 ? 42.662  19.615  53.064  1.00 37.42  ? 373 MET B SD  1 
ATOM   2449  C  CE  . MET B 2 240 ? 40.945  18.994  53.475  1.00 43.45  ? 373 MET B CE  1 
ATOM   2450  N  N   . PHE B 2 241 ? 41.314  18.047  57.284  1.00 23.43  ? 374 PHE B N   1 
ATOM   2451  C  CA  . PHE B 2 241 ? 40.722  17.481  58.490  1.00 19.92  ? 374 PHE B CA  1 
ATOM   2452  C  C   . PHE B 2 241 ? 40.696  15.968  58.325  1.00 17.54  ? 374 PHE B C   1 
ATOM   2453  O  O   . PHE B 2 241 ? 40.781  15.419  57.206  1.00 12.73  ? 374 PHE B O   1 
ATOM   2454  C  CB  . PHE B 2 241 ? 39.284  17.967  58.685  1.00 23.58  ? 374 PHE B CB  1 
ATOM   2455  C  CG  . PHE B 2 241 ? 39.149  19.442  58.873  1.00 29.03  ? 374 PHE B CG  1 
ATOM   2456  C  CD1 . PHE B 2 241 ? 39.852  20.101  59.882  1.00 35.21  ? 374 PHE B CD1 1 
ATOM   2457  C  CD2 . PHE B 2 241 ? 38.271  20.175  58.080  1.00 32.42  ? 374 PHE B CD2 1 
ATOM   2458  C  CE1 . PHE B 2 241 ? 39.681  21.475  60.105  1.00 35.92  ? 374 PHE B CE1 1 
ATOM   2459  C  CE2 . PHE B 2 241 ? 38.089  21.544  58.289  1.00 36.31  ? 374 PHE B CE2 1 
ATOM   2460  C  CZ  . PHE B 2 241 ? 38.799  22.195  59.309  1.00 36.92  ? 374 PHE B CZ  1 
ATOM   2461  N  N   . PHE B 2 242 ? 40.511  15.277  59.432  1.00 17.42  ? 375 PHE B N   1 
ATOM   2462  C  CA  . PHE B 2 242 ? 40.453  13.836  59.336  1.00 27.56  ? 375 PHE B CA  1 
ATOM   2463  C  C   . PHE B 2 242 ? 39.058  13.391  58.903  1.00 29.42  ? 375 PHE B C   1 
ATOM   2464  O  O   . PHE B 2 242 ? 38.059  13.996  59.315  1.00 34.88  ? 375 PHE B O   1 
ATOM   2465  C  CB  . PHE B 2 242 ? 40.807  13.217  60.662  1.00 32.17  ? 375 PHE B CB  1 
ATOM   2466  C  CG  . PHE B 2 242 ? 41.355  11.853  60.530  1.00 36.27  ? 375 PHE B CG  1 
ATOM   2467  C  CD1 . PHE B 2 242 ? 42.677  11.668  60.141  1.00 36.21  ? 375 PHE B CD1 1 
ATOM   2468  C  CD2 . PHE B 2 242 ? 40.549  10.737  60.756  1.00 39.57  ? 375 PHE B CD2 1 
ATOM   2469  C  CE1 . PHE B 2 242 ? 43.199  10.388  59.976  1.00 37.17  ? 375 PHE B CE1 1 
ATOM   2470  C  CE2 . PHE B 2 242 ? 41.061  9.449   60.594  1.00 41.22  ? 375 PHE B CE2 1 
ATOM   2471  C  CZ  . PHE B 2 242 ? 42.392  9.278   60.202  1.00 39.23  ? 375 PHE B CZ  1 
ATOM   2472  N  N   . SER B 2 243 ? 38.982  12.352  58.068  1.00 24.79  ? 376 SER B N   1 
ATOM   2473  C  CA  . SER B 2 243 ? 37.688  11.851  57.586  1.00 25.59  ? 376 SER B CA  1 
ATOM   2474  C  C   . SER B 2 243 ? 37.632  10.326  57.561  1.00 28.62  ? 376 SER B C   1 
ATOM   2475  O  O   . SER B 2 243 ? 38.505  9.680   56.991  1.00 33.07  ? 376 SER B O   1 
ATOM   2476  C  CB  . SER B 2 243 ? 37.395  12.343  56.164  1.00 24.07  ? 376 SER B CB  1 
ATOM   2477  O  OG  . SER B 2 243 ? 37.740  13.699  55.986  1.00 35.22  ? 376 SER B OG  1 
ATOM   2478  N  N   . THR B 2 244 ? 36.606  9.765   58.192  1.00 25.24  ? 377 THR B N   1 
ATOM   2479  C  CA  . THR B 2 244 ? 36.369  8.327   58.206  1.00 24.06  ? 377 THR B CA  1 
ATOM   2480  C  C   . THR B 2 244 ? 35.131  8.137   57.332  1.00 24.06  ? 377 THR B C   1 
ATOM   2481  O  O   . THR B 2 244 ? 34.359  9.062   57.153  1.00 16.94  ? 377 THR B O   1 
ATOM   2482  C  CB  . THR B 2 244 ? 36.075  7.844   59.604  1.00 27.28  ? 377 THR B CB  1 
ATOM   2483  O  OG1 . THR B 2 244 ? 35.128  8.733   60.224  1.00 32.21  ? 377 THR B OG1 1 
ATOM   2484  C  CG2 . THR B 2 244 ? 37.352  7.792   60.407  1.00 22.60  ? 377 THR B CG2 1 
ATOM   2485  N  N   . TYR B 2 245 ? 34.906  6.942   56.812  1.00 25.89  ? 378 TYR B N   1 
ATOM   2486  C  CA  . TYR B 2 245 ? 33.762  6.775   55.925  1.00 28.13  ? 378 TYR B CA  1 
ATOM   2487  C  C   . TYR B 2 245 ? 32.425  7.179   56.533  1.00 32.44  ? 378 TYR B C   1 
ATOM   2488  O  O   . TYR B 2 245 ? 31.498  7.578   55.820  1.00 34.16  ? 378 TYR B O   1 
ATOM   2489  C  CB  . TYR B 2 245 ? 33.715  5.370   55.272  1.00 35.44  ? 378 TYR B CB  1 
ATOM   2490  C  CG  . TYR B 2 245 ? 33.310  4.189   56.133  1.00 37.17  ? 378 TYR B CG  1 
ATOM   2491  C  CD1 . TYR B 2 245 ? 31.971  3.940   56.427  1.00 39.71  ? 378 TYR B CD1 1 
ATOM   2492  C  CD2 . TYR B 2 245 ? 34.264  3.321   56.646  1.00 40.81  ? 378 TYR B CD2 1 
ATOM   2493  C  CE1 . TYR B 2 245 ? 31.591  2.860   57.219  1.00 43.22  ? 378 TYR B CE1 1 
ATOM   2494  C  CE2 . TYR B 2 245 ? 33.900  2.232   57.442  1.00 44.45  ? 378 TYR B CE2 1 
ATOM   2495  C  CZ  . TYR B 2 245 ? 32.560  2.007   57.729  1.00 49.13  ? 378 TYR B CZ  1 
ATOM   2496  O  OH  . TYR B 2 245 ? 32.195  0.939   58.532  1.00 54.93  ? 378 TYR B OH  1 
ATOM   2497  N  N   . ASP B 2 246 ? 32.338  7.122   57.854  1.00 31.47  ? 379 ASP B N   1 
ATOM   2498  C  CA  . ASP B 2 246 ? 31.109  7.506   58.512  1.00 28.75  ? 379 ASP B CA  1 
ATOM   2499  C  C   . ASP B 2 246 ? 31.096  9.010   58.795  1.00 32.53  ? 379 ASP B C   1 
ATOM   2500  O  O   . ASP B 2 246 ? 30.054  9.660   58.697  1.00 37.92  ? 379 ASP B O   1 
ATOM   2501  C  CB  . ASP B 2 246 ? 30.896  6.684   59.782  1.00 26.54  ? 379 ASP B CB  1 
ATOM   2502  C  CG  . ASP B 2 246 ? 32.037  6.805   60.760  1.00 25.71  ? 379 ASP B CG  1 
ATOM   2503  O  OD1 . ASP B 2 246 ? 33.192  6.933   60.312  1.00 26.93  ? 379 ASP B OD1 1 
ATOM   2504  O  OD2 . ASP B 2 246 ? 31.770  6.757   61.980  1.00 21.50  ? 379 ASP B OD2 1 
ATOM   2505  N  N   . ARG B 2 247 ? 32.253  9.577   59.106  1.00 30.90  ? 380 ARG B N   1 
ATOM   2506  C  CA  . ARG B 2 247 ? 32.296  11.002  59.355  1.00 30.88  ? 380 ARG B CA  1 
ATOM   2507  C  C   . ARG B 2 247 ? 33.232  11.659  58.357  1.00 32.93  ? 380 ARG B C   1 
ATOM   2508  O  O   . ARG B 2 247 ? 34.446  11.484  58.435  1.00 34.34  ? 380 ARG B O   1 
ATOM   2509  C  CB  . ARG B 2 247 ? 32.765  11.292  60.768  1.00 30.70  ? 380 ARG B CB  1 
ATOM   2510  C  CG  . ARG B 2 247 ? 32.355  12.679  61.222  1.00 38.92  ? 380 ARG B CG  1 
ATOM   2511  C  CD  . ARG B 2 247 ? 33.170  13.186  62.423  1.00 47.48  ? 380 ARG B CD  1 
ATOM   2512  N  NE  . ARG B 2 247 ? 32.536  13.023  63.740  1.00 45.05  ? 380 ARG B NE  1 
ATOM   2513  C  CZ  . ARG B 2 247 ? 31.971  11.906  64.196  1.00 43.15  ? 380 ARG B CZ  1 
ATOM   2514  N  NH1 . ARG B 2 247 ? 31.916  10.807  63.460  1.00 46.37  ? 380 ARG B NH1 1 
ATOM   2515  N  NH2 . ARG B 2 247 ? 31.529  11.867  65.435  1.00 44.85  ? 380 ARG B NH2 1 
ATOM   2516  N  N   . ASP B 2 248 ? 32.679  12.441  57.435  1.00 37.74  ? 381 ASP B N   1 
ATOM   2517  C  CA  . ASP B 2 248 ? 33.513  13.094  56.423  1.00 45.62  ? 381 ASP B CA  1 
ATOM   2518  C  C   . ASP B 2 248 ? 33.737  14.615  56.522  1.00 38.28  ? 381 ASP B C   1 
ATOM   2519  O  O   . ASP B 2 248 ? 32.793  15.407  56.623  1.00 33.66  ? 381 ASP B O   1 
ATOM   2520  C  CB  . ASP B 2 248 ? 33.045  12.679  55.027  1.00 56.40  ? 381 ASP B CB  1 
ATOM   2521  C  CG  . ASP B 2 248 ? 32.693  13.851  54.155  1.00 61.49  ? 381 ASP B CG  1 
ATOM   2522  O  OD1 . ASP B 2 248 ? 33.617  14.484  53.605  1.00 65.14  ? 381 ASP B OD1 1 
ATOM   2523  O  OD2 . ASP B 2 248 ? 31.485  14.133  54.030  1.00 64.28  ? 381 ASP B OD2 1 
ATOM   2524  N  N   . ASN B 2 249 ? 35.005  15.000  56.415  1.00 35.37  ? 382 ASN B N   1 
ATOM   2525  C  CA  . ASN B 2 249 ? 35.422  16.389  56.514  1.00 32.16  ? 382 ASN B CA  1 
ATOM   2526  C  C   . ASN B 2 249 ? 36.510  16.684  55.491  1.00 33.05  ? 382 ASN B C   1 
ATOM   2527  O  O   . ASN B 2 249 ? 37.477  17.389  55.776  1.00 38.28  ? 382 ASN B O   1 
ATOM   2528  C  CB  . ASN B 2 249 ? 35.940  16.677  57.932  1.00 30.34  ? 382 ASN B CB  1 
ATOM   2529  C  CG  . ASN B 2 249 ? 34.899  16.379  59.019  1.00 32.00  ? 382 ASN B CG  1 
ATOM   2530  O  OD1 . ASN B 2 249 ? 33.921  17.116  59.190  1.00 32.96  ? 382 ASN B OD1 1 
ATOM   2531  N  ND2 . ASN B 2 249 ? 35.115  15.299  59.760  1.00 25.03  ? 382 ASN B ND2 1 
ATOM   2532  N  N   . ASP B 2 250 ? 36.354  16.120  54.301  1.00 34.67  ? 383 ASP B N   1 
ATOM   2533  C  CA  . ASP B 2 250 ? 37.313  16.335  53.218  1.00 40.22  ? 383 ASP B CA  1 
ATOM   2534  C  C   . ASP B 2 250 ? 36.953  17.579  52.393  1.00 40.09  ? 383 ASP B C   1 
ATOM   2535  O  O   . ASP B 2 250 ? 36.137  18.388  52.833  1.00 41.50  ? 383 ASP B O   1 
ATOM   2536  C  CB  . ASP B 2 250 ? 37.413  15.074  52.317  1.00 44.23  ? 383 ASP B CB  1 
ATOM   2537  C  CG  . ASP B 2 250 ? 36.110  14.743  51.532  1.00 44.85  ? 383 ASP B CG  1 
ATOM   2538  O  OD1 . ASP B 2 250 ? 35.085  15.453  51.632  1.00 39.72  ? 383 ASP B OD1 1 
ATOM   2539  O  OD2 . ASP B 2 250 ? 36.125  13.736  50.786  1.00 44.76  ? 383 ASP B OD2 1 
ATOM   2540  N  N   . GLY B 2 251 ? 37.599  17.754  51.239  1.00 39.87  ? 384 GLY B N   1 
ATOM   2541  C  CA  . GLY B 2 251 ? 37.285  18.870  50.354  1.00 44.70  ? 384 GLY B CA  1 
ATOM   2542  C  C   . GLY B 2 251 ? 36.276  18.374  49.323  1.00 51.81  ? 384 GLY B C   1 
ATOM   2543  O  O   . GLY B 2 251 ? 36.627  17.599  48.428  1.00 56.84  ? 384 GLY B O   1 
ATOM   2544  N  N   . TRP B 2 252 ? 35.020  18.804  49.432  1.00 58.27  ? 385 TRP B N   1 
ATOM   2545  C  CA  . TRP B 2 252 ? 33.993  18.339  48.507  1.00 57.45  ? 385 TRP B CA  1 
ATOM   2546  C  C   . TRP B 2 252 ? 32.660  19.096  48.494  1.00 57.33  ? 385 TRP B C   1 
ATOM   2547  O  O   . TRP B 2 252 ? 32.378  19.953  49.339  1.00 48.88  ? 385 TRP B O   1 
ATOM   2548  C  CB  . TRP B 2 252 ? 33.726  16.844  48.756  1.00 59.76  ? 385 TRP B CB  1 
ATOM   2549  C  CG  . TRP B 2 252 ? 32.970  16.486  50.038  1.00 61.69  ? 385 TRP B CG  1 
ATOM   2550  C  CD1 . TRP B 2 252 ? 32.236  15.354  50.256  1.00 61.28  ? 385 TRP B CD1 1 
ATOM   2551  C  CD2 . TRP B 2 252 ? 32.880  17.250  51.250  1.00 63.16  ? 385 TRP B CD2 1 
ATOM   2552  N  NE1 . TRP B 2 252 ? 31.698  15.366  51.513  1.00 57.64  ? 385 TRP B NE1 1 
ATOM   2553  C  CE2 . TRP B 2 252 ? 32.076  16.518  52.145  1.00 63.15  ? 385 TRP B CE2 1 
ATOM   2554  C  CE3 . TRP B 2 252 ? 33.404  18.481  51.670  1.00 71.89  ? 385 TRP B CE3 1 
ATOM   2555  C  CZ2 . TRP B 2 252 ? 31.781  16.979  53.440  1.00 74.66  ? 385 TRP B CZ2 1 
ATOM   2556  C  CZ3 . TRP B 2 252 ? 33.112  18.939  52.960  1.00 77.94  ? 385 TRP B CZ3 1 
ATOM   2557  C  CH2 . TRP B 2 252 ? 32.308  18.187  53.828  1.00 78.52  ? 385 TRP B CH2 1 
ATOM   2558  N  N   . LEU B 2 253 ? 31.859  18.770  47.483  1.00 68.32  ? 386 LEU B N   1 
ATOM   2559  C  CA  . LEU B 2 253 ? 30.523  19.328  47.288  1.00 76.09  ? 386 LEU B CA  1 
ATOM   2560  C  C   . LEU B 2 253 ? 29.585  18.306  47.910  1.00 75.19  ? 386 LEU B C   1 
ATOM   2561  O  O   . LEU B 2 253 ? 29.513  17.163  47.455  1.00 70.57  ? 386 LEU B O   1 
ATOM   2562  C  CB  . LEU B 2 253 ? 30.202  19.490  45.788  1.00 82.26  ? 386 LEU B CB  1 
ATOM   2563  C  CG  . LEU B 2 253 ? 30.113  18.274  44.845  1.00 86.24  ? 386 LEU B CG  1 
ATOM   2564  C  CD1 . LEU B 2 253 ? 29.558  18.706  43.501  1.00 86.05  ? 386 LEU B CD1 1 
ATOM   2565  C  CD2 . LEU B 2 253 ? 31.476  17.608  44.668  1.00 88.91  ? 386 LEU B CD2 1 
ATOM   2566  N  N   . THR B 2 254 ? 28.909  18.699  48.980  1.00 82.56  ? 387 THR B N   1 
ATOM   2567  C  CA  . THR B 2 254 ? 27.999  17.791  49.668  1.00 93.52  ? 387 THR B CA  1 
ATOM   2568  C  C   . THR B 2 254 ? 26.806  17.372  48.791  1.00 96.04  ? 387 THR B C   1 
ATOM   2569  O  O   . THR B 2 254 ? 25.648  17.711  49.065  1.00 95.21  ? 387 THR B O   1 
ATOM   2570  C  CB  . THR B 2 254 ? 27.522  18.397  51.010  1.00 97.92  ? 387 THR B CB  1 
ATOM   2571  O  OG1 . THR B 2 254 ? 28.636  19.011  51.677  1.00 99.96  ? 387 THR B OG1 1 
ATOM   2572  C  CG2 . THR B 2 254 ? 26.946  17.300  51.919  1.00 100.68 ? 387 THR B CG2 1 
ATOM   2573  N  N   . SER B 2 255 ? 27.119  16.646  47.720  1.00 98.72  ? 388 SER B N   1 
ATOM   2574  C  CA  . SER B 2 255 ? 26.125  16.141  46.784  1.00 100.83 ? 388 SER B CA  1 
ATOM   2575  C  C   . SER B 2 255 ? 25.594  14.842  47.377  1.00 102.95 ? 388 SER B C   1 
ATOM   2576  O  O   . SER B 2 255 ? 25.558  13.800  46.715  1.00 99.26  ? 388 SER B O   1 
ATOM   2577  C  CB  . SER B 2 255 ? 26.761  15.894  45.406  1.00 102.74 ? 388 SER B CB  1 
ATOM   2578  O  OG  . SER B 2 255 ? 27.870  15.013  45.488  1.00 105.11 ? 388 SER B OG  1 
ATOM   2579  N  N   . ASP B 2 256 ? 25.227  14.923  48.656  1.00 109.62 ? 389 ASP B N   1 
ATOM   2580  C  CA  . ASP B 2 256 ? 24.701  13.795  49.413  1.00 115.06 ? 389 ASP B CA  1 
ATOM   2581  C  C   . ASP B 2 256 ? 25.748  12.665  49.514  1.00 117.85 ? 389 ASP B C   1 
ATOM   2582  O  O   . ASP B 2 256 ? 26.935  12.915  49.273  1.00 119.77 ? 389 ASP B O   1 
ATOM   2583  C  CB  . ASP B 2 256 ? 23.346  13.376  48.822  1.00 115.97 ? 389 ASP B CB  1 
ATOM   2584  C  CG  . ASP B 2 256 ? 22.197  14.261  49.313  1.00 116.70 ? 389 ASP B CG  1 
ATOM   2585  O  OD1 . ASP B 2 256 ? 22.419  15.465  49.577  1.00 116.45 ? 389 ASP B OD1 1 
ATOM   2586  O  OD2 . ASP B 2 256 ? 21.067  13.745  49.450  1.00 116.36 ? 389 ASP B OD2 1 
ATOM   2587  N  N   . PRO B 2 257 ? 25.350  11.431  49.902  1.00 117.83 ? 390 PRO B N   1 
ATOM   2588  C  CA  . PRO B 2 257 ? 26.362  10.372  50.000  1.00 115.02 ? 390 PRO B CA  1 
ATOM   2589  C  C   . PRO B 2 257 ? 27.168  10.042  48.743  1.00 110.07 ? 390 PRO B C   1 
ATOM   2590  O  O   . PRO B 2 257 ? 27.954  9.094   48.751  1.00 108.26 ? 390 PRO B O   1 
ATOM   2591  C  CB  . PRO B 2 257 ? 25.542  9.169   50.471  1.00 118.28 ? 390 PRO B CB  1 
ATOM   2592  C  CG  . PRO B 2 257 ? 24.172  9.453   49.924  1.00 118.95 ? 390 PRO B CG  1 
ATOM   2593  C  CD  . PRO B 2 257 ? 24.033  10.892  50.291  1.00 118.81 ? 390 PRO B CD  1 
ATOM   2594  N  N   . ARG B 2 258 ? 27.015  10.848  47.693  1.00 107.13 ? 391 ARG B N   1 
ATOM   2595  C  CA  . ARG B 2 258 ? 27.723  10.633  46.429  1.00 105.14 ? 391 ARG B CA  1 
ATOM   2596  C  C   . ARG B 2 258 ? 29.254  10.622  46.587  1.00 97.71  ? 391 ARG B C   1 
ATOM   2597  O  O   . ARG B 2 258 ? 29.819  9.628   47.055  1.00 96.82  ? 391 ARG B O   1 
ATOM   2598  C  CB  . ARG B 2 258 ? 27.263  11.665  45.383  1.00 111.29 ? 391 ARG B CB  1 
ATOM   2599  C  CG  . ARG B 2 258 ? 27.589  11.295  43.931  1.00 118.12 ? 391 ARG B CG  1 
ATOM   2600  C  CD  . ARG B 2 258 ? 26.734  12.072  42.907  1.00 124.58 ? 391 ARG B CD  1 
ATOM   2601  N  NE  . ARG B 2 258 ? 27.128  11.780  41.520  1.00 128.67 ? 391 ARG B NE  1 
ATOM   2602  C  CZ  . ARG B 2 258 ? 26.414  12.094  40.435  1.00 129.70 ? 391 ARG B CZ  1 
ATOM   2603  N  NH1 . ARG B 2 258 ? 25.243  12.717  40.555  1.00 131.11 ? 391 ARG B NH1 1 
ATOM   2604  N  NH2 . ARG B 2 258 ? 26.881  11.796  39.221  1.00 127.46 ? 391 ARG B NH2 1 
ATOM   2605  N  N   . LYS B 2 259 ? 29.923  11.712  46.208  1.00 88.73  ? 392 LYS B N   1 
ATOM   2606  C  CA  . LYS B 2 259 ? 31.386  11.791  46.314  1.00 76.65  ? 392 LYS B CA  1 
ATOM   2607  C  C   . LYS B 2 259 ? 31.898  12.035  47.733  1.00 70.47  ? 392 LYS B C   1 
ATOM   2608  O  O   . LYS B 2 259 ? 31.544  13.017  48.382  1.00 75.28  ? 392 LYS B O   1 
ATOM   2609  C  CB  . LYS B 2 259 ? 31.959  12.866  45.375  1.00 70.05  ? 392 LYS B CB  1 
ATOM   2610  C  CG  . LYS B 2 259 ? 33.455  13.131  45.559  1.00 62.05  ? 392 LYS B CG  1 
ATOM   2611  C  CD  . LYS B 2 259 ? 33.753  14.614  45.409  1.00 55.84  ? 392 LYS B CD  1 
ATOM   2612  C  CE  . LYS B 2 259 ? 35.009  14.995  46.179  1.00 47.47  ? 392 LYS B CE  1 
ATOM   2613  N  NZ  . LYS B 2 259 ? 35.198  16.465  46.274  1.00 33.89  ? 392 LYS B NZ  1 
ATOM   2614  N  N   . GLN B 2 260 ? 32.725  11.109  48.195  1.00 60.66  ? 393 GLN B N   1 
ATOM   2615  C  CA  . GLN B 2 260 ? 33.354  11.161  49.497  1.00 52.53  ? 393 GLN B CA  1 
ATOM   2616  C  C   . GLN B 2 260 ? 34.672  10.487  49.220  1.00 50.20  ? 393 GLN B C   1 
ATOM   2617  O  O   . GLN B 2 260 ? 34.705  9.442   48.589  1.00 59.99  ? 393 GLN B O   1 
ATOM   2618  C  CB  . GLN B 2 260 ? 32.582  10.334  50.521  1.00 53.47  ? 393 GLN B CB  1 
ATOM   2619  C  CG  . GLN B 2 260 ? 31.222  10.875  50.901  1.00 57.35  ? 393 GLN B CG  1 
ATOM   2620  C  CD  . GLN B 2 260 ? 30.757  10.382  52.267  1.00 62.24  ? 393 GLN B CD  1 
ATOM   2621  O  OE1 . GLN B 2 260 ? 29.555  10.326  52.547  1.00 64.98  ? 393 GLN B OE1 1 
ATOM   2622  N  NE2 . GLN B 2 260 ? 31.710  10.046  53.135  1.00 63.11  ? 393 GLN B NE2 1 
ATOM   2623  N  N   . CYS B 2 261 ? 35.767  11.101  49.623  1.00 43.40  ? 394 CYS B N   1 
ATOM   2624  C  CA  . CYS B 2 261 ? 37.057  10.492  49.379  1.00 38.67  ? 394 CYS B CA  1 
ATOM   2625  C  C   . CYS B 2 261 ? 37.187  9.197   50.137  1.00 45.44  ? 394 CYS B C   1 
ATOM   2626  O  O   . CYS B 2 261 ? 37.657  8.200   49.602  1.00 54.26  ? 394 CYS B O   1 
ATOM   2627  C  CB  . CYS B 2 261 ? 38.149  11.435  49.796  1.00 34.98  ? 394 CYS B CB  1 
ATOM   2628  S  SG  . CYS B 2 261 ? 38.135  12.909  48.771  1.00 20.33  ? 394 CYS B SG  1 
ATOM   2629  N  N   . SER B 2 262 ? 36.793  9.231   51.404  1.00 50.30  ? 395 SER B N   1 
ATOM   2630  C  CA  . SER B 2 262 ? 36.835  8.056   52.275  1.00 52.72  ? 395 SER B CA  1 
ATOM   2631  C  C   . SER B 2 262 ? 35.515  7.311   52.107  1.00 57.08  ? 395 SER B C   1 
ATOM   2632  O  O   . SER B 2 262 ? 34.447  7.916   52.157  1.00 57.88  ? 395 SER B O   1 
ATOM   2633  C  CB  . SER B 2 262 ? 37.006  8.492   53.734  1.00 50.64  ? 395 SER B CB  1 
ATOM   2634  O  OG  . SER B 2 262 ? 37.001  7.390   54.616  1.00 48.71  ? 395 SER B OG  1 
ATOM   2635  N  N   . LYS B 2 263 ? 35.585  6.005   51.880  1.00 63.89  ? 396 LYS B N   1 
ATOM   2636  C  CA  . LYS B 2 263 ? 34.367  5.227   51.707  1.00 69.97  ? 396 LYS B CA  1 
ATOM   2637  C  C   . LYS B 2 263 ? 34.361  3.840   52.346  1.00 77.42  ? 396 LYS B C   1 
ATOM   2638  O  O   . LYS B 2 263 ? 35.119  3.586   53.286  1.00 83.83  ? 396 LYS B O   1 
ATOM   2639  C  CB  . LYS B 2 263 ? 33.992  5.159   50.233  1.00 73.46  ? 396 LYS B CB  1 
ATOM   2640  C  CG  . LYS B 2 263 ? 32.748  5.974   49.901  1.00 79.10  ? 396 LYS B CG  1 
ATOM   2641  C  CD  . LYS B 2 263 ? 31.466  5.415   50.573  1.00 79.39  ? 396 LYS B CD  1 
ATOM   2642  C  CE  . LYS B 2 263 ? 31.263  5.861   52.033  1.00 77.60  ? 396 LYS B CE  1 
ATOM   2643  N  NZ  . LYS B 2 263 ? 31.051  7.333   52.184  1.00 76.10  ? 396 LYS B NZ  1 
ATOM   2644  N  N   . GLU B 2 264 ? 33.463  2.971   51.882  1.00 79.89  ? 397 GLU B N   1 
ATOM   2645  C  CA  . GLU B 2 264 ? 33.341  1.610   52.413  1.00 84.20  ? 397 GLU B CA  1 
ATOM   2646  C  C   . GLU B 2 264 ? 34.681  0.870   52.437  1.00 83.92  ? 397 GLU B C   1 
ATOM   2647  O  O   . GLU B 2 264 ? 35.340  0.702   51.401  1.00 82.82  ? 397 GLU B O   1 
ATOM   2648  C  CB  . GLU B 2 264 ? 32.305  0.819   51.618  1.00 91.42  ? 397 GLU B CB  1 
ATOM   2649  C  CG  . GLU B 2 264 ? 30.904  1.429   51.653  1.00 98.60  ? 397 GLU B CG  1 
ATOM   2650  C  CD  . GLU B 2 264 ? 29.880  0.625   50.856  1.00 100.46 ? 397 GLU B CD  1 
ATOM   2651  O  OE1 . GLU B 2 264 ? 29.462  -0.451  51.344  1.00 102.73 ? 397 GLU B OE1 1 
ATOM   2652  O  OE2 . GLU B 2 264 ? 29.488  1.077   49.752  1.00 99.26  ? 397 GLU B OE2 1 
ATOM   2653  N  N   . ASP B 2 265 ? 35.070  0.449   53.642  1.00 82.04  ? 398 ASP B N   1 
ATOM   2654  C  CA  . ASP B 2 265 ? 36.334  -0.239  53.914  1.00 78.34  ? 398 ASP B CA  1 
ATOM   2655  C  C   . ASP B 2 265 ? 37.560  0.572   53.481  1.00 73.59  ? 398 ASP B C   1 
ATOM   2656  O  O   . ASP B 2 265 ? 38.693  0.090   53.545  1.00 72.23  ? 398 ASP B O   1 
ATOM   2657  C  CB  . ASP B 2 265 ? 36.367  -1.653  53.328  1.00 78.24  ? 398 ASP B CB  1 
ATOM   2658  C  CG  . ASP B 2 265 ? 37.135  -2.616  54.210  1.00 77.77  ? 398 ASP B CG  1 
ATOM   2659  O  OD1 . ASP B 2 265 ? 36.824  -2.664  55.422  1.00 77.28  ? 398 ASP B OD1 1 
ATOM   2660  O  OD2 . ASP B 2 265 ? 38.056  -3.300  53.712  1.00 76.29  ? 398 ASP B OD2 1 
ATOM   2661  N  N   . GLY B 2 266 ? 37.312  1.812   53.057  1.00 72.26  ? 399 GLY B N   1 
ATOM   2662  C  CA  . GLY B 2 266 ? 38.366  2.728   52.645  1.00 66.62  ? 399 GLY B CA  1 
ATOM   2663  C  C   . GLY B 2 266 ? 38.882  3.378   53.912  1.00 61.75  ? 399 GLY B C   1 
ATOM   2664  O  O   . GLY B 2 266 ? 38.097  3.625   54.838  1.00 67.79  ? 399 GLY B O   1 
ATOM   2665  N  N   . GLY B 2 267 ? 40.175  3.691   53.952  1.00 46.32  ? 400 GLY B N   1 
ATOM   2666  C  CA  . GLY B 2 267 ? 40.749  4.252   55.160  1.00 29.64  ? 400 GLY B CA  1 
ATOM   2667  C  C   . GLY B 2 267 ? 40.378  5.644   55.602  1.00 20.76  ? 400 GLY B C   1 
ATOM   2668  O  O   . GLY B 2 267 ? 39.949  6.461   54.809  1.00 18.23  ? 400 GLY B O   1 
ATOM   2669  N  N   . GLY B 2 268 ? 40.494  5.890   56.902  1.00 20.56  ? 401 GLY B N   1 
ATOM   2670  C  CA  . GLY B 2 268 ? 40.248  7.218   57.442  1.00 18.88  ? 401 GLY B CA  1 
ATOM   2671  C  C   . GLY B 2 268 ? 41.564  7.939   57.204  1.00 21.93  ? 401 GLY B C   1 
ATOM   2672  O  O   . GLY B 2 268 ? 42.628  7.331   57.349  1.00 20.66  ? 401 GLY B O   1 
ATOM   2673  N  N   . TRP B 2 269 ? 41.527  9.217   56.849  1.00 26.82  ? 402 TRP B N   1 
ATOM   2674  C  CA  . TRP B 2 269 ? 42.768  9.928   56.546  1.00 23.27  ? 402 TRP B CA  1 
ATOM   2675  C  C   . TRP B 2 269 ? 42.465  11.423  56.432  1.00 19.23  ? 402 TRP B C   1 
ATOM   2676  O  O   . TRP B 2 269 ? 41.337  11.846  56.674  1.00 20.59  ? 402 TRP B O   1 
ATOM   2677  C  CB  . TRP B 2 269 ? 43.301  9.365   55.215  1.00 21.32  ? 402 TRP B CB  1 
ATOM   2678  C  CG  . TRP B 2 269 ? 44.537  9.953   54.724  1.00 19.28  ? 402 TRP B CG  1 
ATOM   2679  C  CD1 . TRP B 2 269 ? 44.698  10.681  53.586  1.00 22.43  ? 402 TRP B CD1 1 
ATOM   2680  C  CD2 . TRP B 2 269 ? 45.810  9.915   55.365  1.00 19.21  ? 402 TRP B CD2 1 
ATOM   2681  N  NE1 . TRP B 2 269 ? 46.004  11.115  53.483  1.00 22.13  ? 402 TRP B NE1 1 
ATOM   2682  C  CE2 . TRP B 2 269 ? 46.704  10.655  54.566  1.00 19.41  ? 402 TRP B CE2 1 
ATOM   2683  C  CE3 . TRP B 2 269 ? 46.285  9.331   56.545  1.00 21.43  ? 402 TRP B CE3 1 
ATOM   2684  C  CZ2 . TRP B 2 269 ? 48.043  10.828  54.910  1.00 19.40  ? 402 TRP B CZ2 1 
ATOM   2685  C  CZ3 . TRP B 2 269 ? 47.623  9.504   56.887  1.00 18.55  ? 402 TRP B CZ3 1 
ATOM   2686  C  CH2 . TRP B 2 269 ? 48.482  10.245  56.074  1.00 18.05  ? 402 TRP B CH2 1 
ATOM   2687  N  N   . TRP B 2 270 ? 43.485  12.231  56.167  1.00 18.42  ? 403 TRP B N   1 
ATOM   2688  C  CA  . TRP B 2 270 ? 43.284  13.666  55.993  1.00 19.23  ? 403 TRP B CA  1 
ATOM   2689  C  C   . TRP B 2 270 ? 43.182  13.923  54.509  1.00 24.43  ? 403 TRP B C   1 
ATOM   2690  O  O   . TRP B 2 270 ? 44.167  14.318  53.877  1.00 21.78  ? 403 TRP B O   1 
ATOM   2691  C  CB  . TRP B 2 270 ? 44.440  14.474  56.550  1.00 15.09  ? 403 TRP B CB  1 
ATOM   2692  C  CG  . TRP B 2 270 ? 44.560  14.386  58.027  1.00 18.17  ? 403 TRP B CG  1 
ATOM   2693  C  CD1 . TRP B 2 270 ? 43.913  15.147  58.954  1.00 19.40  ? 403 TRP B CD1 1 
ATOM   2694  C  CD2 . TRP B 2 270 ? 45.423  13.520  58.754  1.00 16.47  ? 403 TRP B CD2 1 
ATOM   2695  N  NE1 . TRP B 2 270 ? 44.329  14.811  60.220  1.00 18.30  ? 403 TRP B NE1 1 
ATOM   2696  C  CE2 . TRP B 2 270 ? 45.261  13.817  60.124  1.00 15.43  ? 403 TRP B CE2 1 
ATOM   2697  C  CE3 . TRP B 2 270 ? 46.320  12.516  58.378  1.00 16.48  ? 403 TRP B CE3 1 
ATOM   2698  C  CZ2 . TRP B 2 270 ? 45.961  13.155  61.118  1.00 16.64  ? 403 TRP B CZ2 1 
ATOM   2699  C  CZ3 . TRP B 2 270 ? 47.012  11.852  59.363  1.00 21.19  ? 403 TRP B CZ3 1 
ATOM   2700  C  CH2 . TRP B 2 270 ? 46.832  12.172  60.721  1.00 18.39  ? 403 TRP B CH2 1 
ATOM   2701  N  N   . TYR B 2 271 ? 41.983  13.686  53.970  1.00 28.96  ? 404 TYR B N   1 
ATOM   2702  C  CA  . TYR B 2 271 ? 41.698  13.861  52.548  1.00 25.03  ? 404 TYR B CA  1 
ATOM   2703  C  C   . TYR B 2 271 ? 41.346  15.294  52.236  1.00 25.91  ? 404 TYR B C   1 
ATOM   2704  O  O   . TYR B 2 271 ? 40.657  15.965  53.016  1.00 25.70  ? 404 TYR B O   1 
ATOM   2705  C  CB  . TYR B 2 271 ? 40.520  12.992  52.113  1.00 21.80  ? 404 TYR B CB  1 
ATOM   2706  C  CG  . TYR B 2 271 ? 40.679  11.507  52.331  1.00 14.77  ? 404 TYR B CG  1 
ATOM   2707  C  CD1 . TYR B 2 271 ? 41.271  10.716  51.360  1.00 11.65  ? 404 TYR B CD1 1 
ATOM   2708  C  CD2 . TYR B 2 271 ? 40.195  10.889  53.488  1.00 14.53  ? 404 TYR B CD2 1 
ATOM   2709  C  CE1 . TYR B 2 271 ? 41.382  9.353   51.517  1.00 9.90   ? 404 TYR B CE1 1 
ATOM   2710  C  CE2 . TYR B 2 271 ? 40.295  9.523   53.665  1.00 11.19  ? 404 TYR B CE2 1 
ATOM   2711  C  CZ  . TYR B 2 271 ? 40.896  8.757   52.671  1.00 12.35  ? 404 TYR B CZ  1 
ATOM   2712  O  OH  . TYR B 2 271 ? 41.053  7.396   52.837  1.00 17.53  ? 404 TYR B OH  1 
ATOM   2713  N  N   . ASN B 2 272 ? 41.848  15.746  51.094  1.00 27.18  ? 405 ASN B N   1 
ATOM   2714  C  CA  . ASN B 2 272 ? 41.618  17.088  50.588  1.00 29.25  ? 405 ASN B CA  1 
ATOM   2715  C  C   . ASN B 2 272 ? 40.522  16.815  49.586  1.00 32.19  ? 405 ASN B C   1 
ATOM   2716  O  O   . ASN B 2 272 ? 39.526  16.196  49.948  1.00 33.75  ? 405 ASN B O   1 
ATOM   2717  C  CB  . ASN B 2 272 ? 42.883  17.558  49.888  1.00 29.48  ? 405 ASN B CB  1 
ATOM   2718  C  CG  . ASN B 2 272 ? 42.817  19.001  49.491  1.00 30.52  ? 405 ASN B CG  1 
ATOM   2719  O  OD1 . ASN B 2 272 ? 41.763  19.636  49.591  1.00 28.43  ? 405 ASN B OD1 1 
ATOM   2720  N  ND2 . ASN B 2 272 ? 43.943  19.536  49.029  1.00 34.92  ? 405 ASN B ND2 1 
ATOM   2721  N  N   . ARG B 2 273 ? 40.662  17.270  48.341  1.00 33.54  ? 406 ARG B N   1 
ATOM   2722  C  CA  . ARG B 2 273 ? 39.658  16.913  47.341  1.00 35.63  ? 406 ARG B CA  1 
ATOM   2723  C  C   . ARG B 2 273 ? 40.279  15.600  46.907  1.00 35.54  ? 406 ARG B C   1 
ATOM   2724  O  O   . ARG B 2 273 ? 40.760  15.412  45.775  1.00 32.46  ? 406 ARG B O   1 
ATOM   2725  C  CB  . ARG B 2 273 ? 39.535  17.920  46.193  1.00 48.39  ? 406 ARG B CB  1 
ATOM   2726  C  CG  . ARG B 2 273 ? 38.521  17.488  45.107  1.00 58.20  ? 406 ARG B CG  1 
ATOM   2727  C  CD  . ARG B 2 273 ? 38.188  18.585  44.076  1.00 65.99  ? 406 ARG B CD  1 
ATOM   2728  N  NE  . ARG B 2 273 ? 37.059  19.418  44.499  1.00 74.27  ? 406 ARG B NE  1 
ATOM   2729  C  CZ  . ARG B 2 273 ? 35.773  19.103  44.317  1.00 75.55  ? 406 ARG B CZ  1 
ATOM   2730  N  NH1 . ARG B 2 273 ? 35.439  17.969  43.711  1.00 76.29  ? 406 ARG B NH1 1 
ATOM   2731  N  NH2 . ARG B 2 273 ? 34.814  19.911  44.764  1.00 73.76  ? 406 ARG B NH2 1 
ATOM   2732  N  N   . CYS B 2 274 ? 40.428  14.797  47.958  1.00 36.86  ? 407 CYS B N   1 
ATOM   2733  C  CA  . CYS B 2 274 ? 40.982  13.462  48.010  1.00 33.06  ? 407 CYS B CA  1 
ATOM   2734  C  C   . CYS B 2 274 ? 42.453  13.347  48.413  1.00 30.81  ? 407 CYS B C   1 
ATOM   2735  O  O   . CYS B 2 274 ? 42.889  14.043  49.345  1.00 31.02  ? 407 CYS B O   1 
ATOM   2736  C  CB  . CYS B 2 274 ? 40.538  12.614  46.825  1.00 27.27  ? 407 CYS B CB  1 
ATOM   2737  S  SG  . CYS B 2 274 ? 38.741  12.231  46.949  1.00 28.80  ? 407 CYS B SG  1 
ATOM   2738  N  N   . HIS B 2 275 ? 43.241  12.544  47.721  1.00 26.64  ? 408 HIS B N   1 
ATOM   2739  C  CA  . HIS B 2 275 ? 44.596  12.371  48.190  1.00 25.75  ? 408 HIS B CA  1 
ATOM   2740  C  C   . HIS B 2 275 ? 45.712  12.378  47.185  1.00 29.78  ? 408 HIS B C   1 
ATOM   2741  O  O   . HIS B 2 275 ? 45.494  12.297  45.985  1.00 32.99  ? 408 HIS B O   1 
ATOM   2742  C  CB  . HIS B 2 275 ? 44.683  11.039  48.934  1.00 32.41  ? 408 HIS B CB  1 
ATOM   2743  C  CG  . HIS B 2 275 ? 44.674  9.847   48.025  1.00 37.86  ? 408 HIS B CG  1 
ATOM   2744  N  ND1 . HIS B 2 275 ? 43.535  9.406   47.384  1.00 44.01  ? 408 HIS B ND1 1 
ATOM   2745  C  CD2 . HIS B 2 275 ? 45.669  9.015   47.634  1.00 42.51  ? 408 HIS B CD2 1 
ATOM   2746  C  CE1 . HIS B 2 275 ? 43.827  8.356   46.639  1.00 46.90  ? 408 HIS B CE1 1 
ATOM   2747  N  NE2 . HIS B 2 275 ? 45.115  8.096   46.774  1.00 47.55  ? 408 HIS B NE2 1 
ATOM   2748  N  N   . ALA B 2 276 ? 46.918  12.329  47.745  1.00 33.45  ? 409 ALA B N   1 
ATOM   2749  C  CA  . ALA B 2 276 ? 48.188  12.270  47.033  1.00 28.62  ? 409 ALA B CA  1 
ATOM   2750  C  C   . ALA B 2 276 ? 48.954  11.107  47.689  1.00 31.59  ? 409 ALA B C   1 
ATOM   2751  O  O   . ALA B 2 276 ? 49.887  10.541  47.115  1.00 36.50  ? 409 ALA B O   1 
ATOM   2752  C  CB  . ALA B 2 276 ? 48.942  13.559  47.224  1.00 27.75  ? 409 ALA B CB  1 
ATOM   2753  N  N   . ALA B 2 277 ? 48.508  10.755  48.894  1.00 26.77  ? 410 ALA B N   1 
ATOM   2754  C  CA  . ALA B 2 277 ? 49.079  9.680   49.694  1.00 25.88  ? 410 ALA B CA  1 
ATOM   2755  C  C   . ALA B 2 277 ? 47.961  9.101   50.534  1.00 23.48  ? 410 ALA B C   1 
ATOM   2756  O  O   . ALA B 2 277 ? 47.128  9.849   51.048  1.00 22.46  ? 410 ALA B O   1 
ATOM   2757  C  CB  . ALA B 2 277 ? 50.165  10.216  50.606  1.00 21.62  ? 410 ALA B CB  1 
ATOM   2758  N  N   . ASN B 2 278 ? 47.947  7.775   50.657  1.00 20.96  ? 411 ASN B N   1 
ATOM   2759  C  CA  . ASN B 2 278 ? 46.944  7.079   51.445  1.00 20.52  ? 411 ASN B CA  1 
ATOM   2760  C  C   . ASN B 2 278 ? 47.545  5.863   52.143  1.00 21.84  ? 411 ASN B C   1 
ATOM   2761  O  O   . ASN B 2 278 ? 47.489  4.732   51.641  1.00 23.23  ? 411 ASN B O   1 
ATOM   2762  C  CB  . ASN B 2 278 ? 45.767  6.662   50.567  1.00 31.09  ? 411 ASN B CB  1 
ATOM   2763  C  CG  . ASN B 2 278 ? 44.516  6.414   51.375  1.00 35.82  ? 411 ASN B CG  1 
ATOM   2764  O  OD1 . ASN B 2 278 ? 44.444  6.770   52.566  1.00 31.26  ? 411 ASN B OD1 1 
ATOM   2765  N  ND2 . ASN B 2 278 ? 43.519  5.797   50.741  1.00 38.03  ? 411 ASN B ND2 1 
ATOM   2766  N  N   . PRO B 2 279 ? 48.176  6.092   53.296  1.00 22.38  ? 412 PRO B N   1 
ATOM   2767  C  CA  . PRO B 2 279 ? 48.824  5.071   54.130  1.00 22.46  ? 412 PRO B CA  1 
ATOM   2768  C  C   . PRO B 2 279 ? 47.814  4.112   54.769  1.00 26.25  ? 412 PRO B C   1 
ATOM   2769  O  O   . PRO B 2 279 ? 48.152  2.992   55.126  1.00 31.36  ? 412 PRO B O   1 
ATOM   2770  C  CB  . PRO B 2 279 ? 49.542  5.901   55.189  1.00 14.63  ? 412 PRO B CB  1 
ATOM   2771  C  CG  . PRO B 2 279 ? 49.759  7.226   54.501  1.00 12.78  ? 412 PRO B CG  1 
ATOM   2772  C  CD  . PRO B 2 279 ? 48.453  7.439   53.810  1.00 22.09  ? 412 PRO B CD  1 
ATOM   2773  N  N   . ASN B 2 280 ? 46.574  4.561   54.909  1.00 22.91  ? 413 ASN B N   1 
ATOM   2774  C  CA  . ASN B 2 280 ? 45.521  3.727   55.473  1.00 18.75  ? 413 ASN B CA  1 
ATOM   2775  C  C   . ASN B 2 280 ? 44.558  3.145   54.425  1.00 19.94  ? 413 ASN B C   1 
ATOM   2776  O  O   . ASN B 2 280 ? 43.498  2.611   54.744  1.00 17.63  ? 413 ASN B O   1 
ATOM   2777  C  CB  . ASN B 2 280 ? 44.785  4.536   56.514  1.00 21.08  ? 413 ASN B CB  1 
ATOM   2778  C  CG  . ASN B 2 280 ? 45.702  4.971   57.610  1.00 14.48  ? 413 ASN B CG  1 
ATOM   2779  O  OD1 . ASN B 2 280 ? 46.787  4.413   57.771  1.00 3.39   ? 413 ASN B OD1 1 
ATOM   2780  N  ND2 . ASN B 2 280 ? 45.281  5.964   58.377  1.00 15.02  ? 413 ASN B ND2 1 
ATOM   2781  N  N   . GLY B 2 281 ? 44.981  3.188   53.168  1.00 23.20  ? 414 GLY B N   1 
ATOM   2782  C  CA  . GLY B 2 281 ? 44.159  2.675   52.099  1.00 20.10  ? 414 GLY B CA  1 
ATOM   2783  C  C   . GLY B 2 281 ? 44.032  1.186   52.214  1.00 20.84  ? 414 GLY B C   1 
ATOM   2784  O  O   . GLY B 2 281 ? 44.287  0.630   53.270  1.00 21.46  ? 414 GLY B O   1 
ATOM   2785  N  N   . ARG B 2 282 ? 43.668  0.546   51.109  1.00 22.49  ? 415 ARG B N   1 
ATOM   2786  C  CA  . ARG B 2 282 ? 43.500  -0.894  51.085  1.00 23.19  ? 415 ARG B CA  1 
ATOM   2787  C  C   . ARG B 2 282 ? 44.769  -1.623  50.700  1.00 24.63  ? 415 ARG B C   1 
ATOM   2788  O  O   . ARG B 2 282 ? 45.493  -1.212  49.794  1.00 32.89  ? 415 ARG B O   1 
ATOM   2789  C  CB  . ARG B 2 282 ? 42.344  -1.265  50.176  1.00 27.44  ? 415 ARG B CB  1 
ATOM   2790  C  CG  . ARG B 2 282 ? 41.039  -0.714  50.693  1.00 30.62  ? 415 ARG B CG  1 
ATOM   2791  C  CD  . ARG B 2 282 ? 40.018  -1.810  50.798  1.00 33.46  ? 415 ARG B CD  1 
ATOM   2792  N  NE  . ARG B 2 282 ? 39.627  -2.265  49.471  1.00 37.27  ? 415 ARG B NE  1 
ATOM   2793  C  CZ  . ARG B 2 282 ? 38.771  -3.249  49.243  1.00 36.94  ? 415 ARG B CZ  1 
ATOM   2794  N  NH1 . ARG B 2 282 ? 38.211  -3.896  50.262  1.00 33.93  ? 415 ARG B NH1 1 
ATOM   2795  N  NH2 . ARG B 2 282 ? 38.471  -3.563  47.987  1.00 41.83  ? 415 ARG B NH2 1 
ATOM   2796  N  N   . TYR B 2 283 ? 45.024  -2.717  51.406  1.00 24.12  ? 416 TYR B N   1 
ATOM   2797  C  CA  . TYR B 2 283 ? 46.217  -3.506  51.185  1.00 23.86  ? 416 TYR B CA  1 
ATOM   2798  C  C   . TYR B 2 283 ? 46.107  -4.553  50.054  1.00 29.70  ? 416 TYR B C   1 
ATOM   2799  O  O   . TYR B 2 283 ? 45.770  -5.730  50.287  1.00 31.40  ? 416 TYR B O   1 
ATOM   2800  C  CB  . TYR B 2 283 ? 46.650  -4.145  52.508  1.00 14.91  ? 416 TYR B CB  1 
ATOM   2801  C  CG  . TYR B 2 283 ? 48.080  -4.590  52.521  1.00 18.02  ? 416 TYR B CG  1 
ATOM   2802  C  CD1 . TYR B 2 283 ? 48.431  -5.867  52.073  1.00 21.00  ? 416 TYR B CD1 1 
ATOM   2803  C  CD2 . TYR B 2 283 ? 49.093  -3.738  52.960  1.00 17.35  ? 416 TYR B CD2 1 
ATOM   2804  C  CE1 . TYR B 2 283 ? 49.749  -6.283  52.057  1.00 23.53  ? 416 TYR B CE1 1 
ATOM   2805  C  CE2 . TYR B 2 283 ? 50.424  -4.153  52.951  1.00 21.54  ? 416 TYR B CE2 1 
ATOM   2806  C  CZ  . TYR B 2 283 ? 50.738  -5.427  52.492  1.00 24.88  ? 416 TYR B CZ  1 
ATOM   2807  O  OH  . TYR B 2 283 ? 52.036  -5.855  52.434  1.00 31.87  ? 416 TYR B OH  1 
ATOM   2808  N  N   . TYR B 2 284 ? 46.373  -4.103  48.828  1.00 27.80  ? 417 TYR B N   1 
ATOM   2809  C  CA  . TYR B 2 284 ? 46.368  -4.985  47.674  1.00 28.15  ? 417 TYR B CA  1 
ATOM   2810  C  C   . TYR B 2 284 ? 47.704  -5.734  47.647  1.00 33.29  ? 417 TYR B C   1 
ATOM   2811  O  O   . TYR B 2 284 ? 48.774  -5.166  47.926  1.00 31.79  ? 417 TYR B O   1 
ATOM   2812  C  CB  . TYR B 2 284 ? 46.170  -4.202  46.383  1.00 22.79  ? 417 TYR B CB  1 
ATOM   2813  C  CG  . TYR B 2 284 ? 44.821  -3.526  46.292  1.00 21.33  ? 417 TYR B CG  1 
ATOM   2814  C  CD1 . TYR B 2 284 ? 44.631  -2.229  46.788  1.00 18.32  ? 417 TYR B CD1 1 
ATOM   2815  C  CD2 . TYR B 2 284 ? 43.725  -4.180  45.706  1.00 19.23  ? 417 TYR B CD2 1 
ATOM   2816  C  CE1 . TYR B 2 284 ? 43.385  -1.602  46.704  1.00 23.81  ? 417 TYR B CE1 1 
ATOM   2817  C  CE2 . TYR B 2 284 ? 42.477  -3.555  45.610  1.00 19.61  ? 417 TYR B CE2 1 
ATOM   2818  C  CZ  . TYR B 2 284 ? 42.311  -2.269  46.116  1.00 23.74  ? 417 TYR B CZ  1 
ATOM   2819  O  OH  . TYR B 2 284 ? 41.076  -1.656  46.074  1.00 23.84  ? 417 TYR B OH  1 
ATOM   2820  N  N   . TRP B 2 285 ? 47.622  -7.023  47.334  1.00 34.14  ? 418 TRP B N   1 
ATOM   2821  C  CA  . TRP B 2 285 ? 48.788  -7.878  47.285  1.00 28.86  ? 418 TRP B CA  1 
ATOM   2822  C  C   . TRP B 2 285 ? 49.532  -7.727  45.978  1.00 29.53  ? 418 TRP B C   1 
ATOM   2823  O  O   . TRP B 2 285 ? 48.925  -7.611  44.906  1.00 28.54  ? 418 TRP B O   1 
ATOM   2824  C  CB  . TRP B 2 285 ? 48.390  -9.329  47.509  1.00 30.91  ? 418 TRP B CB  1 
ATOM   2825  C  CG  . TRP B 2 285 ? 49.549  -10.153 47.881  1.00 37.22  ? 418 TRP B CG  1 
ATOM   2826  C  CD1 . TRP B 2 285 ? 50.382  -10.813 47.035  1.00 38.48  ? 418 TRP B CD1 1 
ATOM   2827  C  CD2 . TRP B 2 285 ? 50.095  -10.319 49.192  1.00 38.58  ? 418 TRP B CD2 1 
ATOM   2828  N  NE1 . TRP B 2 285 ? 51.427  -11.367 47.733  1.00 37.81  ? 418 TRP B NE1 1 
ATOM   2829  C  CE2 . TRP B 2 285 ? 51.274  -11.077 49.061  1.00 38.20  ? 418 TRP B CE2 1 
ATOM   2830  C  CE3 . TRP B 2 285 ? 49.709  -9.889  50.465  1.00 42.14  ? 418 TRP B CE3 1 
ATOM   2831  C  CZ2 . TRP B 2 285 ? 52.075  -11.413 50.156  1.00 39.62  ? 418 TRP B CZ2 1 
ATOM   2832  C  CZ3 . TRP B 2 285 ? 50.506  -10.222 51.553  1.00 37.24  ? 418 TRP B CZ3 1 
ATOM   2833  C  CH2 . TRP B 2 285 ? 51.676  -10.975 51.388  1.00 36.99  ? 418 TRP B CH2 1 
ATOM   2834  N  N   . GLY B 2 286 ? 50.856  -7.710  46.082  1.00 32.99  ? 419 GLY B N   1 
ATOM   2835  C  CA  . GLY B 2 286 ? 51.694  -7.549  44.912  1.00 40.58  ? 419 GLY B CA  1 
ATOM   2836  C  C   . GLY B 2 286 ? 51.896  -6.085  44.579  1.00 50.53  ? 419 GLY B C   1 
ATOM   2837  O  O   . GLY B 2 286 ? 52.724  -5.734  43.745  1.00 55.56  ? 419 GLY B O   1 
ATOM   2838  N  N   . GLY B 2 287 ? 51.115  -5.227  45.222  1.00 53.58  ? 420 GLY B N   1 
ATOM   2839  C  CA  . GLY B 2 287 ? 51.237  -3.799  44.999  1.00 53.99  ? 420 GLY B CA  1 
ATOM   2840  C  C   . GLY B 2 287 ? 50.790  -3.274  43.661  1.00 50.89  ? 420 GLY B C   1 
ATOM   2841  O  O   . GLY B 2 287 ? 51.127  -2.159  43.294  1.00 50.85  ? 420 GLY B O   1 
ATOM   2842  N  N   . GLN B 2 288 ? 50.015  -4.059  42.935  1.00 50.86  ? 421 GLN B N   1 
ATOM   2843  C  CA  . GLN B 2 288 ? 49.545  -3.621  41.633  1.00 53.08  ? 421 GLN B CA  1 
ATOM   2844  C  C   . GLN B 2 288 ? 48.053  -3.858  41.538  1.00 53.43  ? 421 GLN B C   1 
ATOM   2845  O  O   . GLN B 2 288 ? 47.585  -4.970  41.795  1.00 57.46  ? 421 GLN B O   1 
ATOM   2846  C  CB  . GLN B 2 288 ? 50.246  -4.419  40.532  1.00 58.21  ? 421 GLN B CB  1 
ATOM   2847  C  CG  . GLN B 2 288 ? 51.763  -4.237  40.453  1.00 62.71  ? 421 GLN B CG  1 
ATOM   2848  C  CD  . GLN B 2 288 ? 52.183  -3.163  39.451  1.00 65.13  ? 421 GLN B CD  1 
ATOM   2849  O  OE1 . GLN B 2 288 ? 51.339  -2.501  38.833  1.00 65.53  ? 421 GLN B OE1 1 
ATOM   2850  N  NE2 . GLN B 2 288 ? 53.497  -2.991  39.282  1.00 63.39  ? 421 GLN B NE2 1 
ATOM   2851  N  N   . TYR B 2 289 ? 47.299  -2.815  41.205  1.00 49.78  ? 422 TYR B N   1 
ATOM   2852  C  CA  . TYR B 2 289 ? 45.850  -2.960  41.070  1.00 46.22  ? 422 TYR B CA  1 
ATOM   2853  C  C   . TYR B 2 289 ? 45.253  -2.080  39.994  1.00 47.06  ? 422 TYR B C   1 
ATOM   2854  O  O   . TYR B 2 289 ? 45.934  -1.244  39.398  1.00 51.82  ? 422 TYR B O   1 
ATOM   2855  C  CB  . TYR B 2 289 ? 45.103  -2.780  42.406  1.00 42.98  ? 422 TYR B CB  1 
ATOM   2856  C  CG  . TYR B 2 289 ? 45.159  -1.398  43.029  1.00 39.21  ? 422 TYR B CG  1 
ATOM   2857  C  CD1 . TYR B 2 289 ? 46.363  -0.867  43.497  1.00 35.82  ? 422 TYR B CD1 1 
ATOM   2858  C  CD2 . TYR B 2 289 ? 44.004  -0.617  43.154  1.00 37.53  ? 422 TYR B CD2 1 
ATOM   2859  C  CE1 . TYR B 2 289 ? 46.419  0.411   44.072  1.00 32.71  ? 422 TYR B CE1 1 
ATOM   2860  C  CE2 . TYR B 2 289 ? 44.055  0.666   43.730  1.00 32.00  ? 422 TYR B CE2 1 
ATOM   2861  C  CZ  . TYR B 2 289 ? 45.268  1.171   44.184  1.00 29.24  ? 422 TYR B CZ  1 
ATOM   2862  O  OH  . TYR B 2 289 ? 45.341  2.428   44.749  1.00 29.37  ? 422 TYR B OH  1 
ATOM   2863  N  N   . THR B 2 290 ? 43.979  -2.322  39.716  1.00 50.62  ? 423 THR B N   1 
ATOM   2864  C  CA  . THR B 2 290 ? 43.257  -1.597  38.685  1.00 46.60  ? 423 THR B CA  1 
ATOM   2865  C  C   . THR B 2 290 ? 41.872  -1.221  39.184  1.00 41.29  ? 423 THR B C   1 
ATOM   2866  O  O   . THR B 2 290 ? 41.380  -1.758  40.175  1.00 39.92  ? 423 THR B O   1 
ATOM   2867  C  CB  . THR B 2 290 ? 43.135  -2.446  37.401  1.00 44.62  ? 423 THR B CB  1 
ATOM   2868  O  OG1 . THR B 2 290 ? 42.447  -3.666  37.696  1.00 47.26  ? 423 THR B OG1 1 
ATOM   2869  C  CG2 . THR B 2 290 ? 44.518  -2.786  36.843  1.00 43.81  ? 423 THR B CG2 1 
ATOM   2870  N  N   . TRP B 2 291 ? 41.245  -0.298  38.477  1.00 35.52  ? 424 TRP B N   1 
ATOM   2871  C  CA  . TRP B 2 291 ? 39.927  0.188   38.846  1.00 42.18  ? 424 TRP B CA  1 
ATOM   2872  C  C   . TRP B 2 291 ? 38.877  -0.914  38.971  1.00 40.86  ? 424 TRP B C   1 
ATOM   2873  O  O   . TRP B 2 291 ? 37.968  -0.810  39.796  1.00 32.26  ? 424 TRP B O   1 
ATOM   2874  C  CB  . TRP B 2 291 ? 39.481  1.239   37.841  1.00 49.67  ? 424 TRP B CB  1 
ATOM   2875  C  CG  . TRP B 2 291 ? 39.541  0.713   36.469  1.00 55.81  ? 424 TRP B CG  1 
ATOM   2876  C  CD1 . TRP B 2 291 ? 40.650  0.597   35.676  1.00 61.75  ? 424 TRP B CD1 1 
ATOM   2877  C  CD2 . TRP B 2 291 ? 38.469  0.115   35.754  1.00 55.71  ? 424 TRP B CD2 1 
ATOM   2878  N  NE1 . TRP B 2 291 ? 40.331  -0.058  34.509  1.00 62.43  ? 424 TRP B NE1 1 
ATOM   2879  C  CE2 . TRP B 2 291 ? 38.996  -0.365  34.533  1.00 56.83  ? 424 TRP B CE2 1 
ATOM   2880  C  CE3 . TRP B 2 291 ? 37.108  -0.074  36.030  1.00 54.39  ? 424 TRP B CE3 1 
ATOM   2881  C  CZ2 . TRP B 2 291 ? 38.213  -1.022  33.593  1.00 55.80  ? 424 TRP B CZ2 1 
ATOM   2882  C  CZ3 . TRP B 2 291 ? 36.330  -0.725  35.100  1.00 54.32  ? 424 TRP B CZ3 1 
ATOM   2883  C  CH2 . TRP B 2 291 ? 36.883  -1.195  33.891  1.00 55.81  ? 424 TRP B CH2 1 
ATOM   2884  N  N   . ASP B 2 292 ? 38.985  -1.956  38.148  1.00 40.71  ? 425 ASP B N   1 
ATOM   2885  C  CA  . ASP B 2 292 ? 38.034  -3.060  38.222  1.00 38.50  ? 425 ASP B CA  1 
ATOM   2886  C  C   . ASP B 2 292 ? 38.320  -3.962  39.404  1.00 40.07  ? 425 ASP B C   1 
ATOM   2887  O  O   . ASP B 2 292 ? 37.480  -4.766  39.805  1.00 45.42  ? 425 ASP B O   1 
ATOM   2888  C  CB  . ASP B 2 292 ? 37.920  -3.854  36.918  1.00 44.04  ? 425 ASP B CB  1 
ATOM   2889  C  CG  . ASP B 2 292 ? 39.254  -4.109  36.239  1.00 53.48  ? 425 ASP B CG  1 
ATOM   2890  O  OD1 . ASP B 2 292 ? 40.225  -3.361  36.459  1.00 57.53  ? 425 ASP B OD1 1 
ATOM   2891  O  OD2 . ASP B 2 292 ? 39.313  -5.053  35.425  1.00 60.79  ? 425 ASP B OD2 1 
ATOM   2892  N  N   . MET B 2 293 ? 39.513  -3.818  39.962  1.00 31.94  ? 426 MET B N   1 
ATOM   2893  C  CA  . MET B 2 293 ? 39.893  -4.568  41.146  1.00 30.07  ? 426 MET B CA  1 
ATOM   2894  C  C   . MET B 2 293 ? 39.401  -3.750  42.335  1.00 32.40  ? 426 MET B C   1 
ATOM   2895  O  O   . MET B 2 293 ? 38.861  -4.293  43.297  1.00 36.26  ? 426 MET B O   1 
ATOM   2896  C  CB  . MET B 2 293 ? 41.405  -4.708  41.228  1.00 25.08  ? 426 MET B CB  1 
ATOM   2897  C  CG  . MET B 2 293 ? 41.971  -5.620  40.200  1.00 30.09  ? 426 MET B CG  1 
ATOM   2898  S  SD  . MET B 2 293 ? 43.747  -5.618  40.281  1.00 35.59  ? 426 MET B SD  1 
ATOM   2899  C  CE  . MET B 2 293 ? 44.022  -6.194  41.888  1.00 31.31  ? 426 MET B CE  1 
ATOM   2900  N  N   . ALA B 2 294 ? 39.590  -2.435  42.252  1.00 30.00  ? 427 ALA B N   1 
ATOM   2901  C  CA  . ALA B 2 294 ? 39.184  -1.517  43.313  1.00 28.66  ? 427 ALA B CA  1 
ATOM   2902  C  C   . ALA B 2 294 ? 37.676  -1.565  43.532  1.00 24.12  ? 427 ALA B C   1 
ATOM   2903  O  O   . ALA B 2 294 ? 36.895  -1.488  42.581  1.00 19.57  ? 427 ALA B O   1 
ATOM   2904  C  CB  . ALA B 2 294 ? 39.649  -0.091  42.999  1.00 31.54  ? 427 ALA B CB  1 
ATOM   2905  N  N   . LYS B 2 295 ? 37.295  -1.677  44.802  1.00 27.60  ? 428 LYS B N   1 
ATOM   2906  C  CA  . LYS B 2 295 ? 35.902  -1.782  45.215  1.00 30.42  ? 428 LYS B CA  1 
ATOM   2907  C  C   . LYS B 2 295 ? 35.044  -0.719  44.607  1.00 33.79  ? 428 LYS B C   1 
ATOM   2908  O  O   . LYS B 2 295 ? 33.922  -0.986  44.196  1.00 33.25  ? 428 LYS B O   1 
ATOM   2909  C  CB  . LYS B 2 295 ? 35.793  -1.686  46.723  1.00 30.97  ? 428 LYS B CB  1 
ATOM   2910  C  CG  . LYS B 2 295 ? 34.477  -2.181  47.306  1.00 28.02  ? 428 LYS B CG  1 
ATOM   2911  C  CD  . LYS B 2 295 ? 34.558  -2.122  48.834  1.00 32.84  ? 428 LYS B CD  1 
ATOM   2912  C  CE  . LYS B 2 295 ? 33.514  -2.969  49.532  1.00 38.43  ? 428 LYS B CE  1 
ATOM   2913  N  NZ  . LYS B 2 295 ? 33.807  -3.052  51.006  1.00 41.17  ? 428 LYS B NZ  1 
ATOM   2914  N  N   . HIS B 2 296 ? 35.574  0.496   44.564  1.00 38.89  ? 429 HIS B N   1 
ATOM   2915  C  CA  . HIS B 2 296 ? 34.831  1.608   44.000  1.00 37.79  ? 429 HIS B CA  1 
ATOM   2916  C  C   . HIS B 2 296 ? 35.445  2.132   42.714  1.00 36.53  ? 429 HIS B C   1 
ATOM   2917  O  O   . HIS B 2 296 ? 35.053  3.182   42.235  1.00 33.57  ? 429 HIS B O   1 
ATOM   2918  C  CB  . HIS B 2 296 ? 34.713  2.723   45.032  1.00 39.43  ? 429 HIS B CB  1 
ATOM   2919  C  CG  . HIS B 2 296 ? 34.014  2.305   46.290  1.00 45.09  ? 429 HIS B CG  1 
ATOM   2920  N  ND1 . HIS B 2 296 ? 32.871  1.537   46.285  1.00 47.25  ? 429 HIS B ND1 1 
ATOM   2921  C  CD2 . HIS B 2 296 ? 34.303  2.535   47.594  1.00 46.95  ? 429 HIS B CD2 1 
ATOM   2922  C  CE1 . HIS B 2 296 ? 32.488  1.311   47.531  1.00 46.34  ? 429 HIS B CE1 1 
ATOM   2923  N  NE2 . HIS B 2 296 ? 33.340  1.906   48.345  1.00 43.20  ? 429 HIS B NE2 1 
ATOM   2924  N  N   . GLY B 2 297 ? 36.366  1.372   42.130  1.00 36.67  ? 430 GLY B N   1 
ATOM   2925  C  CA  . GLY B 2 297 ? 37.012  1.813   40.907  1.00 39.91  ? 430 GLY B CA  1 
ATOM   2926  C  C   . GLY B 2 297 ? 37.959  2.970   41.186  1.00 39.79  ? 430 GLY B C   1 
ATOM   2927  O  O   . GLY B 2 297 ? 38.416  3.658   40.268  1.00 35.34  ? 430 GLY B O   1 
ATOM   2928  N  N   . THR B 2 298 ? 38.274  3.165   42.464  1.00 39.14  ? 431 THR B N   1 
ATOM   2929  C  CA  . THR B 2 298 ? 39.161  4.242   42.881  1.00 40.88  ? 431 THR B CA  1 
ATOM   2930  C  C   . THR B 2 298 ? 40.573  3.809   43.294  1.00 39.58  ? 431 THR B C   1 
ATOM   2931  O  O   . THR B 2 298 ? 40.964  2.651   43.127  1.00 33.90  ? 431 THR B O   1 
ATOM   2932  C  CB  . THR B 2 298 ? 38.545  5.030   44.044  1.00 41.67  ? 431 THR B CB  1 
ATOM   2933  O  OG1 . THR B 2 298 ? 37.973  4.119   44.987  1.00 46.62  ? 431 THR B OG1 1 
ATOM   2934  C  CG2 . THR B 2 298 ? 37.494  5.979   43.543  1.00 41.36  ? 431 THR B CG2 1 
ATOM   2935  N  N   . ASP B 2 299 ? 41.322  4.777   43.823  1.00 35.98  ? 432 ASP B N   1 
ATOM   2936  C  CA  . ASP B 2 299 ? 42.680  4.595   44.308  1.00 29.09  ? 432 ASP B CA  1 
ATOM   2937  C  C   . ASP B 2 299 ? 42.719  4.022   45.723  1.00 30.62  ? 432 ASP B C   1 
ATOM   2938  O  O   . ASP B 2 299 ? 43.527  4.451   46.531  1.00 30.99  ? 432 ASP B O   1 
ATOM   2939  C  CB  . ASP B 2 299 ? 43.353  5.945   44.353  1.00 33.11  ? 432 ASP B CB  1 
ATOM   2940  C  CG  . ASP B 2 299 ? 44.546  6.026   43.466  1.00 37.75  ? 432 ASP B CG  1 
ATOM   2941  O  OD1 . ASP B 2 299 ? 45.287  5.017   43.334  1.00 33.73  ? 432 ASP B OD1 1 
ATOM   2942  O  OD2 . ASP B 2 299 ? 44.741  7.131   42.914  1.00 42.53  ? 432 ASP B OD2 1 
ATOM   2943  N  N   . ASP B 2 300 ? 41.853  3.053   46.010  1.00 32.43  ? 433 ASP B N   1 
ATOM   2944  C  CA  . ASP B 2 300 ? 41.737  2.399   47.316  1.00 25.18  ? 433 ASP B CA  1 
ATOM   2945  C  C   . ASP B 2 300 ? 43.043  2.135   48.057  1.00 23.64  ? 433 ASP B C   1 
ATOM   2946  O  O   . ASP B 2 300 ? 43.126  2.321   49.264  1.00 20.09  ? 433 ASP B O   1 
ATOM   2947  C  CB  . ASP B 2 300 ? 41.031  1.047   47.155  1.00 23.16  ? 433 ASP B CB  1 
ATOM   2948  C  CG  . ASP B 2 300 ? 39.533  1.139   47.287  1.00 32.87  ? 433 ASP B CG  1 
ATOM   2949  O  OD1 . ASP B 2 300 ? 39.046  1.660   48.315  1.00 29.57  ? 433 ASP B OD1 1 
ATOM   2950  O  OD2 . ASP B 2 300 ? 38.829  0.659   46.367  1.00 45.86  ? 433 ASP B OD2 1 
ATOM   2951  N  N   . GLY B 2 301 ? 44.054  1.702   47.321  1.00 21.43  ? 434 GLY B N   1 
ATOM   2952  C  CA  . GLY B 2 301 ? 45.329  1.333   47.909  1.00 28.48  ? 434 GLY B CA  1 
ATOM   2953  C  C   . GLY B 2 301 ? 46.134  2.156   48.893  1.00 25.57  ? 434 GLY B C   1 
ATOM   2954  O  O   . GLY B 2 301 ? 45.787  3.289   49.255  1.00 20.70  ? 434 GLY B O   1 
ATOM   2955  N  N   . VAL B 2 302 ? 47.218  1.520   49.347  1.00 20.57  ? 435 VAL B N   1 
ATOM   2956  C  CA  . VAL B 2 302 ? 48.164  2.112   50.285  1.00 20.18  ? 435 VAL B CA  1 
ATOM   2957  C  C   . VAL B 2 302 ? 49.151  2.820   49.383  1.00 24.62  ? 435 VAL B C   1 
ATOM   2958  O  O   . VAL B 2 302 ? 50.282  2.371   49.167  1.00 16.88  ? 435 VAL B O   1 
ATOM   2959  C  CB  . VAL B 2 302 ? 48.851  1.043   51.103  1.00 15.70  ? 435 VAL B CB  1 
ATOM   2960  C  CG1 . VAL B 2 302 ? 49.834  1.679   52.069  1.00 20.46  ? 435 VAL B CG1 1 
ATOM   2961  C  CG2 . VAL B 2 302 ? 47.806  0.246   51.848  1.00 13.46  ? 435 VAL B CG2 1 
ATOM   2962  N  N   . VAL B 2 303 ? 48.661  3.955   48.893  1.00 26.50  ? 436 VAL B N   1 
ATOM   2963  C  CA  . VAL B 2 303 ? 49.277  4.862   47.932  1.00 24.29  ? 436 VAL B CA  1 
ATOM   2964  C  C   . VAL B 2 303 ? 50.204  6.011   48.371  1.00 21.81  ? 436 VAL B C   1 
ATOM   2965  O  O   . VAL B 2 303 ? 50.096  6.554   49.459  1.00 24.98  ? 436 VAL B O   1 
ATOM   2966  C  CB  . VAL B 2 303 ? 48.103  5.468   47.095  1.00 23.03  ? 436 VAL B CB  1 
ATOM   2967  C  CG1 . VAL B 2 303 ? 48.493  6.735   46.362  1.00 22.17  ? 436 VAL B CG1 1 
ATOM   2968  C  CG2 . VAL B 2 303 ? 47.552  4.424   46.145  1.00 24.00  ? 436 VAL B CG2 1 
ATOM   2969  N  N   . TRP B 2 304 ? 51.106  6.378   47.472  1.00 20.73  ? 437 TRP B N   1 
ATOM   2970  C  CA  . TRP B 2 304 ? 52.016  7.499   47.648  1.00 21.76  ? 437 TRP B CA  1 
ATOM   2971  C  C   . TRP B 2 304 ? 52.358  7.886   46.220  1.00 27.90  ? 437 TRP B C   1 
ATOM   2972  O  O   . TRP B 2 304 ? 53.377  7.483   45.667  1.00 35.26  ? 437 TRP B O   1 
ATOM   2973  C  CB  . TRP B 2 304 ? 53.281  7.127   48.407  1.00 19.29  ? 437 TRP B CB  1 
ATOM   2974  C  CG  . TRP B 2 304 ? 54.054  8.346   48.794  1.00 20.48  ? 437 TRP B CG  1 
ATOM   2975  C  CD1 . TRP B 2 304 ? 54.993  9.002   48.042  1.00 27.27  ? 437 TRP B CD1 1 
ATOM   2976  C  CD2 . TRP B 2 304 ? 53.929  9.092   50.014  1.00 18.82  ? 437 TRP B CD2 1 
ATOM   2977  N  NE1 . TRP B 2 304 ? 55.461  10.115  48.726  1.00 25.81  ? 437 TRP B NE1 1 
ATOM   2978  C  CE2 . TRP B 2 304 ? 54.820  10.190  49.933  1.00 20.98  ? 437 TRP B CE2 1 
ATOM   2979  C  CE3 . TRP B 2 304 ? 53.151  8.940   51.165  1.00 19.00  ? 437 TRP B CE3 1 
ATOM   2980  C  CZ2 . TRP B 2 304 ? 54.949  11.120  50.955  1.00 20.80  ? 437 TRP B CZ2 1 
ATOM   2981  C  CZ3 . TRP B 2 304 ? 53.283  9.866   52.182  1.00 15.01  ? 437 TRP B CZ3 1 
ATOM   2982  C  CH2 . TRP B 2 304 ? 54.172  10.942  52.072  1.00 15.89  ? 437 TRP B CH2 1 
ATOM   2983  N  N   . MET B 2 305 ? 51.455  8.633   45.608  1.00 31.14  ? 438 MET B N   1 
ATOM   2984  C  CA  . MET B 2 305 ? 51.616  9.052   44.235  1.00 31.52  ? 438 MET B CA  1 
ATOM   2985  C  C   . MET B 2 305 ? 52.964  9.640   43.893  1.00 37.11  ? 438 MET B C   1 
ATOM   2986  O  O   . MET B 2 305 ? 53.535  9.295   42.872  1.00 42.33  ? 438 MET B O   1 
ATOM   2987  C  CB  . MET B 2 305 ? 50.509  10.016  43.847  1.00 28.56  ? 438 MET B CB  1 
ATOM   2988  C  CG  . MET B 2 305 ? 49.155  9.367   43.821  1.00 31.14  ? 438 MET B CG  1 
ATOM   2989  S  SD  . MET B 2 305 ? 47.933  10.452  43.127  1.00 34.92  ? 438 MET B SD  1 
ATOM   2990  C  CE  . MET B 2 305 ? 48.743  11.016  41.657  1.00 33.27  ? 438 MET B CE  1 
ATOM   2991  N  N   . ASN B 2 306 ? 53.499  10.496  44.754  1.00 35.89  ? 439 ASN B N   1 
ATOM   2992  C  CA  . ASN B 2 306 ? 54.789  11.107  44.476  1.00 31.66  ? 439 ASN B CA  1 
ATOM   2993  C  C   . ASN B 2 306 ? 55.907  10.113  44.203  1.00 31.36  ? 439 ASN B C   1 
ATOM   2994  O  O   . ASN B 2 306 ? 56.930  10.485  43.619  1.00 36.23  ? 439 ASN B O   1 
ATOM   2995  C  CB  . ASN B 2 306 ? 55.188  12.049  45.600  1.00 33.97  ? 439 ASN B CB  1 
ATOM   2996  C  CG  . ASN B 2 306 ? 54.369  13.299  45.601  1.00 36.18  ? 439 ASN B CG  1 
ATOM   2997  O  OD1 . ASN B 2 306 ? 54.919  14.408  45.554  1.00 43.14  ? 439 ASN B OD1 1 
ATOM   2998  N  ND2 . ASN B 2 306 ? 53.037  13.143  45.620  1.00 29.90  ? 439 ASN B ND2 1 
ATOM   2999  N  N   . TRP B 2 307 ? 55.707  8.857   44.601  1.00 25.48  ? 440 TRP B N   1 
ATOM   3000  C  CA  . TRP B 2 307 ? 56.708  7.828   44.384  1.00 30.20  ? 440 TRP B CA  1 
ATOM   3001  C  C   . TRP B 2 307 ? 56.347  6.828   43.286  1.00 28.76  ? 440 TRP B C   1 
ATOM   3002  O  O   . TRP B 2 307 ? 56.953  6.798   42.233  1.00 38.06  ? 440 TRP B O   1 
ATOM   3003  C  CB  . TRP B 2 307 ? 56.981  7.088   45.682  1.00 41.27  ? 440 TRP B CB  1 
ATOM   3004  C  CG  . TRP B 2 307 ? 58.187  6.213   45.597  1.00 51.19  ? 440 TRP B CG  1 
ATOM   3005  C  CD1 . TRP B 2 307 ? 59.321  6.448   44.867  1.00 53.08  ? 440 TRP B CD1 1 
ATOM   3006  C  CD2 . TRP B 2 307 ? 58.400  4.971   46.281  1.00 54.51  ? 440 TRP B CD2 1 
ATOM   3007  N  NE1 . TRP B 2 307 ? 60.226  5.431   45.057  1.00 55.63  ? 440 TRP B NE1 1 
ATOM   3008  C  CE2 . TRP B 2 307 ? 59.688  4.511   45.918  1.00 53.32  ? 440 TRP B CE2 1 
ATOM   3009  C  CE3 . TRP B 2 307 ? 57.629  4.204   47.166  1.00 55.95  ? 440 TRP B CE3 1 
ATOM   3010  C  CZ2 . TRP B 2 307 ? 60.221  3.319   46.406  1.00 53.32  ? 440 TRP B CZ2 1 
ATOM   3011  C  CZ3 . TRP B 2 307 ? 58.161  3.016   47.652  1.00 56.95  ? 440 TRP B CZ3 1 
ATOM   3012  C  CH2 . TRP B 2 307 ? 59.447  2.586   47.269  1.00 57.55  ? 440 TRP B CH2 1 
ATOM   3013  N  N   . LYS B 2 308 ? 55.376  5.981   43.557  1.00 27.15  ? 441 LYS B N   1 
ATOM   3014  C  CA  . LYS B 2 308 ? 54.932  4.977   42.607  1.00 24.93  ? 441 LYS B CA  1 
ATOM   3015  C  C   . LYS B 2 308 ? 53.615  5.412   41.951  1.00 27.69  ? 441 LYS B C   1 
ATOM   3016  O  O   . LYS B 2 308 ? 52.947  4.626   41.269  1.00 23.95  ? 441 LYS B O   1 
ATOM   3017  C  CB  . LYS B 2 308 ? 54.704  3.660   43.352  1.00 26.62  ? 441 LYS B CB  1 
ATOM   3018  C  CG  . LYS B 2 308 ? 55.945  3.049   43.934  1.00 32.60  ? 441 LYS B CG  1 
ATOM   3019  C  CD  . LYS B 2 308 ? 56.758  2.374   42.842  1.00 42.21  ? 441 LYS B CD  1 
ATOM   3020  C  CE  . LYS B 2 308 ? 58.015  1.728   43.394  1.00 45.01  ? 441 LYS B CE  1 
ATOM   3021  N  NZ  . LYS B 2 308 ? 58.789  1.071   42.308  1.00 43.92  ? 441 LYS B NZ  1 
ATOM   3022  N  N   . GLY B 2 309 ? 53.211  6.652   42.185  1.00 26.16  ? 442 GLY B N   1 
ATOM   3023  C  CA  . GLY B 2 309 ? 51.964  7.103   41.609  1.00 30.27  ? 442 GLY B CA  1 
ATOM   3024  C  C   . GLY B 2 309 ? 50.773  6.320   42.138  1.00 36.39  ? 442 GLY B C   1 
ATOM   3025  O  O   . GLY B 2 309 ? 50.871  5.597   43.144  1.00 40.30  ? 442 GLY B O   1 
ATOM   3026  N  N   . SER B 2 310 ? 49.641  6.494   41.463  1.00 35.97  ? 443 SER B N   1 
ATOM   3027  C  CA  . SER B 2 310 ? 48.399  5.825   41.803  1.00 37.60  ? 443 SER B CA  1 
ATOM   3028  C  C   . SER B 2 310 ? 48.490  4.383   41.355  1.00 40.54  ? 443 SER B C   1 
ATOM   3029  O  O   . SER B 2 310 ? 49.401  4.017   40.594  1.00 46.08  ? 443 SER B O   1 
ATOM   3030  C  CB  . SER B 2 310 ? 47.247  6.495   41.065  1.00 37.89  ? 443 SER B CB  1 
ATOM   3031  O  OG  . SER B 2 310 ? 47.136  7.852   41.446  1.00 39.65  ? 443 SER B OG  1 
ATOM   3032  N  N   . TRP B 2 311 ? 47.534  3.571   41.805  1.00 38.11  ? 444 TRP B N   1 
ATOM   3033  C  CA  . TRP B 2 311 ? 47.478  2.155   41.434  1.00 37.91  ? 444 TRP B CA  1 
ATOM   3034  C  C   . TRP B 2 311 ? 48.685  1.310   41.859  1.00 40.27  ? 444 TRP B C   1 
ATOM   3035  O  O   . TRP B 2 311 ? 49.120  0.408   41.134  1.00 44.25  ? 444 TRP B O   1 
ATOM   3036  C  CB  . TRP B 2 311 ? 47.220  2.007   39.929  1.00 32.79  ? 444 TRP B CB  1 
ATOM   3037  C  CG  . TRP B 2 311 ? 46.197  2.955   39.482  1.00 33.05  ? 444 TRP B CG  1 
ATOM   3038  C  CD1 . TRP B 2 311 ? 46.406  4.102   38.781  1.00 34.09  ? 444 TRP B CD1 1 
ATOM   3039  C  CD2 . TRP B 2 311 ? 44.809  2.949   39.841  1.00 35.13  ? 444 TRP B CD2 1 
ATOM   3040  N  NE1 . TRP B 2 311 ? 45.241  4.827   38.701  1.00 36.46  ? 444 TRP B NE1 1 
ATOM   3041  C  CE2 . TRP B 2 311 ? 44.244  4.140   39.342  1.00 33.65  ? 444 TRP B CE2 1 
ATOM   3042  C  CE3 . TRP B 2 311 ? 43.990  2.058   40.546  1.00 35.77  ? 444 TRP B CE3 1 
ATOM   3043  C  CZ2 . TRP B 2 311 ? 42.896  4.464   39.527  1.00 28.85  ? 444 TRP B CZ2 1 
ATOM   3044  C  CZ3 . TRP B 2 311 ? 42.650  2.383   40.731  1.00 32.26  ? 444 TRP B CZ3 1 
ATOM   3045  C  CH2 . TRP B 2 311 ? 42.119  3.576   40.224  1.00 28.64  ? 444 TRP B CH2 1 
ATOM   3046  N  N   . TYR B 2 312 ? 49.227  1.606   43.034  1.00 36.93  ? 445 TYR B N   1 
ATOM   3047  C  CA  . TYR B 2 312 ? 50.331  0.823   43.548  1.00 37.70  ? 445 TYR B CA  1 
ATOM   3048  C  C   . TYR B 2 312 ? 50.319  0.833   45.075  1.00 39.08  ? 445 TYR B C   1 
ATOM   3049  O  O   . TYR B 2 312 ? 50.665  1.853   45.675  1.00 43.33  ? 445 TYR B O   1 
ATOM   3050  C  CB  . TYR B 2 312 ? 51.687  1.313   43.008  1.00 31.18  ? 445 TYR B CB  1 
ATOM   3051  C  CG  . TYR B 2 312 ? 52.814  0.337   43.306  1.00 27.97  ? 445 TYR B CG  1 
ATOM   3052  C  CD1 . TYR B 2 312 ? 53.351  0.226   44.589  1.00 31.46  ? 445 TYR B CD1 1 
ATOM   3053  C  CD2 . TYR B 2 312 ? 53.313  -0.495  42.324  1.00 24.12  ? 445 TYR B CD2 1 
ATOM   3054  C  CE1 . TYR B 2 312 ? 54.356  -0.693  44.878  1.00 32.99  ? 445 TYR B CE1 1 
ATOM   3055  C  CE2 . TYR B 2 312 ? 54.317  -1.418  42.604  1.00 28.13  ? 445 TYR B CE2 1 
ATOM   3056  C  CZ  . TYR B 2 312 ? 54.834  -1.512  43.879  1.00 32.45  ? 445 TYR B CZ  1 
ATOM   3057  O  OH  . TYR B 2 312 ? 55.828  -2.425  44.157  1.00 40.49  ? 445 TYR B OH  1 
ATOM   3058  N  N   . SER B 2 313 ? 49.888  -0.280  45.689  1.00 35.30  ? 446 SER B N   1 
ATOM   3059  C  CA  . SER B 2 313 ? 49.850  -0.416  47.154  1.00 35.18  ? 446 SER B CA  1 
ATOM   3060  C  C   . SER B 2 313 ? 51.220  -0.939  47.636  1.00 31.28  ? 446 SER B C   1 
ATOM   3061  O  O   . SER B 2 313 ? 51.578  -2.085  47.399  1.00 34.48  ? 446 SER B O   1 
ATOM   3062  C  CB  . SER B 2 313 ? 48.693  -1.339  47.594  1.00 33.75  ? 446 SER B CB  1 
ATOM   3063  O  OG  . SER B 2 313 ? 48.954  -2.023  48.823  1.00 31.47  ? 446 SER B OG  1 
ATOM   3064  N  N   . MET B 2 314 ? 51.978  -0.083  48.312  1.00 27.72  ? 447 MET B N   1 
ATOM   3065  C  CA  . MET B 2 314 ? 53.304  -0.423  48.797  1.00 25.63  ? 447 MET B CA  1 
ATOM   3066  C  C   . MET B 2 314 ? 53.268  -1.702  49.600  1.00 30.00  ? 447 MET B C   1 
ATOM   3067  O  O   . MET B 2 314 ? 52.190  -2.130  50.028  1.00 28.76  ? 447 MET B O   1 
ATOM   3068  C  CB  . MET B 2 314 ? 53.805  0.691   49.697  1.00 24.53  ? 447 MET B CB  1 
ATOM   3069  C  CG  . MET B 2 314 ? 53.688  2.073   49.114  1.00 21.80  ? 447 MET B CG  1 
ATOM   3070  S  SD  . MET B 2 314 ? 54.722  2.233   47.653  1.00 35.68  ? 447 MET B SD  1 
ATOM   3071  C  CE  . MET B 2 314 ? 53.649  3.316   46.574  1.00 35.86  ? 447 MET B CE  1 
ATOM   3072  N  N   . ARG B 2 315 ? 54.433  -2.337  49.765  1.00 29.61  ? 448 ARG B N   1 
ATOM   3073  C  CA  . ARG B 2 315 ? 54.502  -3.549  50.571  1.00 29.72  ? 448 ARG B CA  1 
ATOM   3074  C  C   . ARG B 2 315 ? 54.510  -3.133  52.036  1.00 29.17  ? 448 ARG B C   1 
ATOM   3075  O  O   . ARG B 2 315 ? 53.829  -3.745  52.870  1.00 26.57  ? 448 ARG B O   1 
ATOM   3076  C  CB  . ARG B 2 315 ? 55.754  -4.386  50.293  1.00 38.04  ? 448 ARG B CB  1 
ATOM   3077  C  CG  . ARG B 2 315 ? 55.735  -5.701  51.104  1.00 44.36  ? 448 ARG B CG  1 
ATOM   3078  C  CD  . ARG B 2 315 ? 57.091  -6.276  51.417  1.00 48.88  ? 448 ARG B CD  1 
ATOM   3079  N  NE  . ARG B 2 315 ? 57.526  -7.253  50.428  1.00 57.57  ? 448 ARG B NE  1 
ATOM   3080  C  CZ  . ARG B 2 315 ? 58.282  -6.971  49.366  1.00 67.56  ? 448 ARG B CZ  1 
ATOM   3081  N  NH1 . ARG B 2 315 ? 58.689  -5.725  49.138  1.00 70.36  ? 448 ARG B NH1 1 
ATOM   3082  N  NH2 . ARG B 2 315 ? 58.673  -7.948  48.551  1.00 72.42  ? 448 ARG B NH2 1 
ATOM   3083  N  N   . LYS B 2 316 ? 55.282  -2.084  52.334  1.00 27.17  ? 449 LYS B N   1 
ATOM   3084  C  CA  . LYS B 2 316 ? 55.404  -1.563  53.694  1.00 22.63  ? 449 LYS B CA  1 
ATOM   3085  C  C   . LYS B 2 316 ? 55.259  -0.048  53.791  1.00 21.21  ? 449 LYS B C   1 
ATOM   3086  O  O   . LYS B 2 316 ? 55.746  0.687   52.939  1.00 19.72  ? 449 LYS B O   1 
ATOM   3087  C  CB  . LYS B 2 316 ? 56.710  -2.035  54.336  1.00 21.85  ? 449 LYS B CB  1 
ATOM   3088  C  CG  . LYS B 2 316 ? 56.659  -3.491  54.762  1.00 26.34  ? 449 LYS B CG  1 
ATOM   3089  C  CD  . LYS B 2 316 ? 57.777  -3.859  55.696  1.00 31.44  ? 449 LYS B CD  1 
ATOM   3090  C  CE  . LYS B 2 316 ? 59.077  -3.895  54.954  1.00 36.25  ? 449 LYS B CE  1 
ATOM   3091  N  NZ  . LYS B 2 316 ? 60.130  -4.436  55.834  1.00 40.91  ? 449 LYS B NZ  1 
ATOM   3092  N  N   . MET B 2 317 ? 54.551  0.401   54.824  1.00 21.90  ? 450 MET B N   1 
ATOM   3093  C  CA  . MET B 2 317 ? 54.302  1.818   55.049  1.00 25.87  ? 450 MET B CA  1 
ATOM   3094  C  C   . MET B 2 317 ? 54.180  2.051   56.551  1.00 26.77  ? 450 MET B C   1 
ATOM   3095  O  O   . MET B 2 317 ? 53.360  1.409   57.218  1.00 27.16  ? 450 MET B O   1 
ATOM   3096  C  CB  . MET B 2 317 ? 53.005  2.231   54.350  1.00 30.89  ? 450 MET B CB  1 
ATOM   3097  C  CG  . MET B 2 317 ? 52.464  3.618   54.732  1.00 29.80  ? 450 MET B CG  1 
ATOM   3098  S  SD  . MET B 2 317 ? 53.146  4.982   53.784  1.00 21.35  ? 450 MET B SD  1 
ATOM   3099  C  CE  . MET B 2 317 ? 52.743  4.505   52.210  1.00 15.63  ? 450 MET B CE  1 
ATOM   3100  N  N   . SER B 2 318 ? 54.953  3.003   57.073  1.00 19.08  ? 451 SER B N   1 
ATOM   3101  C  CA  . SER B 2 318 ? 54.934  3.284   58.507  1.00 14.08  ? 451 SER B CA  1 
ATOM   3102  C  C   . SER B 2 318 ? 55.022  4.764   58.819  1.00 14.15  ? 451 SER B C   1 
ATOM   3103  O  O   . SER B 2 318 ? 55.587  5.551   58.048  1.00 19.11  ? 451 SER B O   1 
ATOM   3104  C  CB  . SER B 2 318 ? 56.077  2.532   59.219  1.00 16.38  ? 451 SER B CB  1 
ATOM   3105  O  OG  . SER B 2 318 ? 57.354  2.815   58.643  1.00 19.15  ? 451 SER B OG  1 
ATOM   3106  N  N   . MET B 2 319 ? 54.481  5.121   59.978  1.00 8.54   ? 452 MET B N   1 
ATOM   3107  C  CA  . MET B 2 319 ? 54.475  6.498   60.443  1.00 11.58  ? 452 MET B CA  1 
ATOM   3108  C  C   . MET B 2 319 ? 54.894  6.498   61.889  1.00 12.33  ? 452 MET B C   1 
ATOM   3109  O  O   . MET B 2 319 ? 54.283  5.836   62.716  1.00 7.00   ? 452 MET B O   1 
ATOM   3110  C  CB  . MET B 2 319 ? 53.078  7.095   60.345  1.00 19.83  ? 452 MET B CB  1 
ATOM   3111  C  CG  . MET B 2 319 ? 52.539  7.262   58.944  1.00 15.01  ? 452 MET B CG  1 
ATOM   3112  S  SD  . MET B 2 319 ? 51.376  8.583   59.080  1.00 22.30  ? 452 MET B SD  1 
ATOM   3113  C  CE  . MET B 2 319 ? 49.828  7.670   59.526  1.00 30.40  ? 452 MET B CE  1 
ATOM   3114  N  N   . LYS B 2 320 ? 55.931  7.264   62.198  1.00 21.71  ? 453 LYS B N   1 
ATOM   3115  C  CA  . LYS B 2 320 ? 56.442  7.321   63.553  1.00 16.92  ? 453 LYS B CA  1 
ATOM   3116  C  C   . LYS B 2 320 ? 56.867  8.731   63.844  1.00 12.95  ? 453 LYS B C   1 
ATOM   3117  O  O   . LYS B 2 320 ? 57.209  9.491   62.929  1.00 12.71  ? 453 LYS B O   1 
ATOM   3118  C  CB  . LYS B 2 320 ? 57.609  6.352   63.706  1.00 20.27  ? 453 LYS B CB  1 
ATOM   3119  C  CG  . LYS B 2 320 ? 58.550  6.377   62.527  1.00 26.45  ? 453 LYS B CG  1 
ATOM   3120  C  CD  . LYS B 2 320 ? 59.582  5.271   62.574  1.00 22.53  ? 453 LYS B CD  1 
ATOM   3121  C  CE  . LYS B 2 320 ? 58.971  3.963   62.232  1.00 20.41  ? 453 LYS B CE  1 
ATOM   3122  N  NZ  . LYS B 2 320 ? 60.025  3.056   61.716  1.00 20.14  ? 453 LYS B NZ  1 
ATOM   3123  N  N   . ILE B 2 321 ? 56.828  9.069   65.129  1.00 6.45   ? 454 ILE B N   1 
ATOM   3124  C  CA  . ILE B 2 321 ? 57.167  10.395  65.599  1.00 7.69   ? 454 ILE B CA  1 
ATOM   3125  C  C   . ILE B 2 321 ? 58.293  10.408  66.624  1.00 15.29  ? 454 ILE B C   1 
ATOM   3126  O  O   . ILE B 2 321 ? 58.813  9.361   67.023  1.00 25.53  ? 454 ILE B O   1 
ATOM   3127  C  CB  . ILE B 2 321 ? 55.917  11.067  66.187  1.00 11.50  ? 454 ILE B CB  1 
ATOM   3128  C  CG1 . ILE B 2 321 ? 55.462  10.353  67.452  1.00 8.06   ? 454 ILE B CG1 1 
ATOM   3129  C  CG2 . ILE B 2 321 ? 54.752  10.972  65.192  1.00 13.91  ? 454 ILE B CG2 1 
ATOM   3130  C  CD1 . ILE B 2 321 ? 54.183  10.937  68.001  1.00 7.00   ? 454 ILE B CD1 1 
ATOM   3131  N  N   . ARG B 2 322 ? 58.669  11.601  67.055  1.00 16.11  ? 455 ARG B N   1 
ATOM   3132  C  CA  . ARG B 2 322 ? 59.736  11.756  68.025  1.00 22.17  ? 455 ARG B CA  1 
ATOM   3133  C  C   . ARG B 2 322 ? 59.786  13.220  68.324  1.00 26.34  ? 455 ARG B C   1 
ATOM   3134  O  O   . ARG B 2 322 ? 59.561  14.031  67.443  1.00 30.75  ? 455 ARG B O   1 
ATOM   3135  C  CB  . ARG B 2 322 ? 61.075  11.326  67.409  1.00 26.00  ? 455 ARG B CB  1 
ATOM   3136  C  CG  . ARG B 2 322 ? 62.298  11.490  68.321  1.00 23.92  ? 455 ARG B CG  1 
ATOM   3137  C  CD  . ARG B 2 322 ? 63.531  10.811  67.744  1.00 26.84  ? 455 ARG B CD  1 
ATOM   3138  N  NE  . ARG B 2 322 ? 64.189  11.621  66.729  1.00 30.48  ? 455 ARG B NE  1 
ATOM   3139  C  CZ  . ARG B 2 322 ? 65.108  11.158  65.886  1.00 38.46  ? 455 ARG B CZ  1 
ATOM   3140  N  NH1 . ARG B 2 322 ? 65.474  9.885   65.924  1.00 34.64  ? 455 ARG B NH1 1 
ATOM   3141  N  NH2 . ARG B 2 322 ? 65.701  11.979  65.032  1.00 42.91  ? 455 ARG B NH2 1 
ATOM   3142  N  N   . PRO B 2 323 ? 60.027  13.589  69.581  1.00 29.64  ? 456 PRO B N   1 
ATOM   3143  C  CA  . PRO B 2 323 ? 60.089  15.014  69.897  1.00 33.02  ? 456 PRO B CA  1 
ATOM   3144  C  C   . PRO B 2 323 ? 61.319  15.557  69.202  1.00 43.84  ? 456 PRO B C   1 
ATOM   3145  O  O   . PRO B 2 323 ? 62.347  14.877  69.136  1.00 44.95  ? 456 PRO B O   1 
ATOM   3146  C  CB  . PRO B 2 323 ? 60.242  15.019  71.412  1.00 30.98  ? 456 PRO B CB  1 
ATOM   3147  C  CG  . PRO B 2 323 ? 59.558  13.776  71.820  1.00 32.17  ? 456 PRO B CG  1 
ATOM   3148  C  CD  . PRO B 2 323 ? 60.066  12.786  70.807  1.00 33.04  ? 456 PRO B CD  1 
ATOM   3149  N  N   . PHE B 2 324 ? 61.204  16.765  68.664  1.00 58.05  ? 457 PHE B N   1 
ATOM   3150  C  CA  . PHE B 2 324 ? 62.294  17.373  67.928  1.00 71.21  ? 457 PHE B CA  1 
ATOM   3151  C  C   . PHE B 2 324 ? 63.579  17.610  68.720  1.00 80.21  ? 457 PHE B C   1 
ATOM   3152  O  O   . PHE B 2 324 ? 64.623  17.049  68.366  1.00 85.99  ? 457 PHE B O   1 
ATOM   3153  C  CB  . PHE B 2 324 ? 61.826  18.653  67.242  1.00 73.36  ? 457 PHE B CB  1 
ATOM   3154  C  CG  . PHE B 2 324 ? 62.558  18.958  65.956  1.00 80.36  ? 457 PHE B CG  1 
ATOM   3155  C  CD1 . PHE B 2 324 ? 63.808  18.396  65.688  1.00 85.02  ? 457 PHE B CD1 1 
ATOM   3156  C  CD2 . PHE B 2 324 ? 62.005  19.825  65.019  1.00 80.70  ? 457 PHE B CD2 1 
ATOM   3157  C  CE1 . PHE B 2 324 ? 64.496  18.695  64.512  1.00 86.34  ? 457 PHE B CE1 1 
ATOM   3158  C  CE2 . PHE B 2 324 ? 62.684  20.132  63.839  1.00 82.35  ? 457 PHE B CE2 1 
ATOM   3159  C  CZ  . PHE B 2 324 ? 63.933  19.565  63.586  1.00 84.74  ? 457 PHE B CZ  1 
ATOM   3160  N  N   . PHE B 2 325 ? 63.515  18.412  69.785  1.00 86.19  ? 458 PHE B N   1 
ATOM   3161  C  CA  . PHE B 2 325 ? 64.705  18.711  70.598  1.00 92.32  ? 458 PHE B CA  1 
ATOM   3162  C  C   . PHE B 2 325 ? 65.846  19.233  69.708  1.00 95.45  ? 458 PHE B C   1 
ATOM   3163  O  O   . PHE B 2 325 ? 66.881  18.576  69.551  1.00 94.73  ? 458 PHE B O   1 
ATOM   3164  C  CB  . PHE B 2 325 ? 65.191  17.460  71.351  1.00 93.85  ? 458 PHE B CB  1 
ATOM   3165  C  CG  . PHE B 2 325 ? 64.263  16.987  72.431  1.00 94.19  ? 458 PHE B CG  1 
ATOM   3166  C  CD1 . PHE B 2 325 ? 63.051  17.632  72.675  1.00 94.90  ? 458 PHE B CD1 1 
ATOM   3167  C  CD2 . PHE B 2 325 ? 64.611  15.890  73.217  1.00 95.09  ? 458 PHE B CD2 1 
ATOM   3168  C  CE1 . PHE B 2 325 ? 62.195  17.188  73.691  1.00 96.85  ? 458 PHE B CE1 1 
ATOM   3169  C  CE2 . PHE B 2 325 ? 63.767  15.434  74.237  1.00 96.54  ? 458 PHE B CE2 1 
ATOM   3170  C  CZ  . PHE B 2 325 ? 62.555  16.084  74.476  1.00 97.02  ? 458 PHE B CZ  1 
ATOM   3171  N  N   . PRO B 2 326 ? 65.654  20.408  69.086  1.00 99.34  ? 459 PRO B N   1 
ATOM   3172  C  CA  . PRO B 2 326 ? 66.679  20.991  68.213  1.00 101.57 ? 459 PRO B CA  1 
ATOM   3173  C  C   . PRO B 2 326 ? 67.879  21.547  68.986  1.00 102.14 ? 459 PRO B C   1 
ATOM   3174  O  O   . PRO B 2 326 ? 67.373  22.989  69.085  1.00 113.65 ? 459 PRO B O   1 
ATOM   3175  C  CB  . PRO B 2 326 ? 65.905  22.090  67.485  1.00 101.34 ? 459 PRO B CB  1 
ATOM   3176  C  CG  . PRO B 2 326 ? 64.941  22.559  68.534  1.00 100.53 ? 459 PRO B CG  1 
ATOM   3177  C  CD  . PRO B 2 326 ? 64.449  21.260  69.130  1.00 99.92  ? 459 PRO B CD  1 
ATOM   3178  N  N   . LYS C 3 1   ? 17.682  -24.916 -2.913  1.00 153.08 ? 88  LYS C N   1 
ATOM   3179  C  CA  . LYS C 3 1   ? 17.333  -25.122 -1.477  1.00 154.89 ? 88  LYS C CA  1 
ATOM   3180  C  C   . LYS C 3 1   ? 16.454  -24.000 -0.917  1.00 153.69 ? 88  LYS C C   1 
ATOM   3181  O  O   . LYS C 3 1   ? 16.857  -23.271 -0.008  1.00 152.93 ? 88  LYS C O   1 
ATOM   3182  C  CB  . LYS C 3 1   ? 18.606  -25.274 -0.638  1.00 158.12 ? 88  LYS C CB  1 
ATOM   3183  C  CG  . LYS C 3 1   ? 19.257  -26.647 -0.718  1.00 161.08 ? 88  LYS C CG  1 
ATOM   3184  C  CD  . LYS C 3 1   ? 18.396  -27.702 -0.041  1.00 163.38 ? 88  LYS C CD  1 
ATOM   3185  C  CE  . LYS C 3 1   ? 19.092  -29.050 0.016   1.00 164.08 ? 88  LYS C CE  1 
ATOM   3186  N  NZ  . LYS C 3 1   ? 18.258  -30.076 0.700   1.00 163.67 ? 88  LYS C NZ  1 
ATOM   3187  N  N   . MET C 3 2   ? 15.243  -23.883 -1.458  1.00 153.93 ? 89  MET C N   1 
ATOM   3188  C  CA  . MET C 3 2   ? 14.279  -22.860 -1.036  1.00 154.78 ? 89  MET C CA  1 
ATOM   3189  C  C   . MET C 3 2   ? 13.767  -23.175 0.379   1.00 152.31 ? 89  MET C C   1 
ATOM   3190  O  O   . MET C 3 2   ? 14.497  -22.973 1.356   1.00 153.70 ? 89  MET C O   1 
ATOM   3191  C  CB  . MET C 3 2   ? 13.129  -22.786 -2.053  1.00 157.90 ? 89  MET C CB  1 
ATOM   3192  C  CG  . MET C 3 2   ? 13.615  -22.588 -3.501  1.00 161.18 ? 89  MET C CG  1 
ATOM   3193  S  SD  . MET C 3 2   ? 12.357  -22.738 -4.808  1.00 163.13 ? 89  MET C SD  1 
ATOM   3194  C  CE  . MET C 3 2   ? 12.365  -21.067 -5.501  1.00 160.99 ? 89  MET C CE  1 
ATOM   3195  N  N   . LEU C 3 3   ? 12.528  -23.659 0.496   1.00 148.79 ? 90  LEU C N   1 
ATOM   3196  C  CA  . LEU C 3 3   ? 11.957  -24.032 1.800   1.00 144.40 ? 90  LEU C CA  1 
ATOM   3197  C  C   . LEU C 3 3   ? 12.633  -25.345 2.194   1.00 137.80 ? 90  LEU C C   1 
ATOM   3198  O  O   . LEU C 3 3   ? 11.981  -26.318 2.579   1.00 135.93 ? 90  LEU C O   1 
ATOM   3199  C  CB  . LEU C 3 3   ? 10.441  -24.252 1.685   1.00 146.45 ? 90  LEU C CB  1 
ATOM   3200  C  CG  . LEU C 3 3   ? 9.470   -23.069 1.578   1.00 146.98 ? 90  LEU C CG  1 
ATOM   3201  C  CD1 . LEU C 3 3   ? 8.074   -23.593 1.243   1.00 146.39 ? 90  LEU C CD1 1 
ATOM   3202  C  CD2 . LEU C 3 3   ? 9.451   -22.268 2.884   1.00 146.64 ? 90  LEU C CD2 1 
ATOM   3203  N  N   . GLU C 3 4   ? 13.957  -25.346 2.090   1.00 130.73 ? 91  GLU C N   1 
ATOM   3204  C  CA  . GLU C 3 4   ? 14.774  -26.512 2.357   1.00 126.46 ? 91  GLU C CA  1 
ATOM   3205  C  C   . GLU C 3 4   ? 15.945  -26.071 3.217   1.00 125.12 ? 91  GLU C C   1 
ATOM   3206  O  O   . GLU C 3 4   ? 16.237  -26.675 4.251   1.00 123.36 ? 91  GLU C O   1 
ATOM   3207  C  CB  . GLU C 3 4   ? 15.245  -27.070 1.012   1.00 126.46 ? 91  GLU C CB  1 
ATOM   3208  C  CG  . GLU C 3 4   ? 14.199  -26.858 -0.095  1.00 126.22 ? 91  GLU C CG  1 
ATOM   3209  C  CD  . GLU C 3 4   ? 14.416  -27.697 -1.322  1.00 127.26 ? 91  GLU C CD  1 
ATOM   3210  O  OE1 . GLU C 3 4   ? 15.443  -27.506 -2.010  1.00 128.48 ? 91  GLU C OE1 1 
ATOM   3211  O  OE2 . GLU C 3 4   ? 13.532  -28.536 -1.607  1.00 126.10 ? 91  GLU C OE2 1 
ATOM   3212  N  N   . GLU C 3 5   ? 16.620  -25.017 2.771   1.00 125.73 ? 92  GLU C N   1 
ATOM   3213  C  CA  . GLU C 3 5   ? 17.733  -24.450 3.518   1.00 127.18 ? 92  GLU C CA  1 
ATOM   3214  C  C   . GLU C 3 5   ? 17.062  -23.601 4.588   1.00 127.68 ? 92  GLU C C   1 
ATOM   3215  O  O   . GLU C 3 5   ? 17.456  -23.627 5.754   1.00 128.14 ? 92  GLU C O   1 
ATOM   3216  C  CB  . GLU C 3 5   ? 18.593  -23.560 2.620   1.00 130.06 ? 92  GLU C CB  1 
ATOM   3217  C  CG  . GLU C 3 5   ? 19.815  -22.963 3.308   1.00 132.96 ? 92  GLU C CG  1 
ATOM   3218  C  CD  . GLU C 3 5   ? 20.532  -21.936 2.445   1.00 135.07 ? 92  GLU C CD  1 
ATOM   3219  O  OE1 . GLU C 3 5   ? 21.298  -22.343 1.541   1.00 135.94 ? 92  GLU C OE1 1 
ATOM   3220  O  OE2 . GLU C 3 5   ? 20.328  -20.720 2.674   1.00 136.11 ? 92  GLU C OE2 1 
ATOM   3221  N  N   . ILE C 3 6   ? 16.021  -22.878 4.172   1.00 127.32 ? 93  ILE C N   1 
ATOM   3222  C  CA  . ILE C 3 6   ? 15.242  -22.013 5.060   1.00 126.48 ? 93  ILE C CA  1 
ATOM   3223  C  C   . ILE C 3 6   ? 14.371  -22.841 6.005   1.00 127.76 ? 93  ILE C C   1 
ATOM   3224  O  O   . ILE C 3 6   ? 14.013  -22.384 7.094   1.00 127.00 ? 93  ILE C O   1 
ATOM   3225  C  CB  . ILE C 3 6   ? 14.381  -20.989 4.252   1.00 123.57 ? 93  ILE C CB  1 
ATOM   3226  C  CG1 . ILE C 3 6   ? 15.306  -19.956 3.599   1.00 122.32 ? 93  ILE C CG1 1 
ATOM   3227  C  CG2 . ILE C 3 6   ? 13.347  -20.292 5.151   1.00 122.31 ? 93  ILE C CG2 1 
ATOM   3228  C  CD1 . ILE C 3 6   ? 14.589  -18.779 2.984   1.00 122.64 ? 93  ILE C CD1 1 
ATOM   3229  N  N   . MET C 3 7   ? 14.047  -24.064 5.592   1.00 128.73 ? 94  MET C N   1 
ATOM   3230  C  CA  . MET C 3 7   ? 13.250  -24.955 6.426   1.00 129.00 ? 94  MET C CA  1 
ATOM   3231  C  C   . MET C 3 7   ? 14.134  -25.358 7.613   1.00 125.87 ? 94  MET C C   1 
ATOM   3232  O  O   . MET C 3 7   ? 13.665  -25.500 8.748   1.00 127.60 ? 94  MET C O   1 
ATOM   3233  C  CB  . MET C 3 7   ? 12.823  -26.189 5.625   1.00 131.66 ? 94  MET C CB  1 
ATOM   3234  C  CG  . MET C 3 7   ? 11.706  -26.990 6.272   1.00 134.98 ? 94  MET C CG  1 
ATOM   3235  S  SD  . MET C 3 7   ? 10.312  -25.928 6.724   1.00 140.10 ? 94  MET C SD  1 
ATOM   3236  C  CE  . MET C 3 7   ? 9.531   -25.681 5.149   1.00 139.07 ? 94  MET C CE  1 
ATOM   3237  N  N   . LYS C 3 8   ? 15.427  -25.486 7.330   1.00 120.79 ? 95  LYS C N   1 
ATOM   3238  C  CA  . LYS C 3 8   ? 16.438  -25.846 8.314   1.00 116.07 ? 95  LYS C CA  1 
ATOM   3239  C  C   . LYS C 3 8   ? 16.756  -24.656 9.225   1.00 116.74 ? 95  LYS C C   1 
ATOM   3240  O  O   . LYS C 3 8   ? 17.448  -24.810 10.232  1.00 113.47 ? 95  LYS C O   1 
ATOM   3241  C  CB  . LYS C 3 8   ? 17.704  -26.291 7.576   1.00 112.06 ? 95  LYS C CB  1 
ATOM   3242  C  CG  . LYS C 3 8   ? 18.904  -26.577 8.457   1.00 111.49 ? 95  LYS C CG  1 
ATOM   3243  C  CD  . LYS C 3 8   ? 20.159  -26.780 7.618   1.00 113.59 ? 95  LYS C CD  1 
ATOM   3244  C  CE  . LYS C 3 8   ? 21.383  -27.040 8.491   1.00 115.60 ? 95  LYS C CE  1 
ATOM   3245  N  NZ  . LYS C 3 8   ? 21.676  -25.904 9.410   1.00 116.24 ? 95  LYS C NZ  1 
ATOM   3246  N  N   . TYR C 3 9   ? 16.234  -23.478 8.877   1.00 121.16 ? 96  TYR C N   1 
ATOM   3247  C  CA  . TYR C 3 9   ? 16.489  -22.256 9.645   1.00 126.11 ? 96  TYR C CA  1 
ATOM   3248  C  C   . TYR C 3 9   ? 15.285  -21.543 10.273  1.00 131.48 ? 96  TYR C C   1 
ATOM   3249  O  O   . TYR C 3 9   ? 15.462  -20.757 11.210  1.00 133.34 ? 96  TYR C O   1 
ATOM   3250  C  CB  . TYR C 3 9   ? 17.269  -21.245 8.796   1.00 125.98 ? 96  TYR C CB  1 
ATOM   3251  C  CG  . TYR C 3 9   ? 18.629  -21.721 8.329   1.00 126.56 ? 96  TYR C CG  1 
ATOM   3252  C  CD1 . TYR C 3 9   ? 19.367  -22.649 9.070   1.00 125.24 ? 96  TYR C CD1 1 
ATOM   3253  C  CD2 . TYR C 3 9   ? 19.176  -21.246 7.138   1.00 127.99 ? 96  TYR C CD2 1 
ATOM   3254  C  CE1 . TYR C 3 9   ? 20.612  -23.091 8.636   1.00 125.59 ? 96  TYR C CE1 1 
ATOM   3255  C  CE2 . TYR C 3 9   ? 20.420  -21.682 6.694   1.00 128.47 ? 96  TYR C CE2 1 
ATOM   3256  C  CZ  . TYR C 3 9   ? 21.133  -22.605 7.446   1.00 128.47 ? 96  TYR C CZ  1 
ATOM   3257  O  OH  . TYR C 3 9   ? 22.362  -23.043 7.006   1.00 130.71 ? 96  TYR C OH  1 
ATOM   3258  N  N   . GLU C 3 10  ? 14.078  -21.773 9.756   1.00 134.98 ? 97  GLU C N   1 
ATOM   3259  C  CA  . GLU C 3 10  ? 12.888  -21.116 10.315  1.00 136.70 ? 97  GLU C CA  1 
ATOM   3260  C  C   . GLU C 3 10  ? 12.466  -21.692 11.679  1.00 137.28 ? 97  GLU C C   1 
ATOM   3261  O  O   . GLU C 3 10  ? 11.599  -21.138 12.367  1.00 135.15 ? 97  GLU C O   1 
ATOM   3262  C  CB  . GLU C 3 10  ? 11.716  -21.137 9.320   1.00 136.02 ? 97  GLU C CB  1 
ATOM   3263  C  CG  . GLU C 3 10  ? 11.141  -22.510 8.996   1.00 133.81 ? 97  GLU C CG  1 
ATOM   3264  C  CD  . GLU C 3 10  ? 9.862   -22.422 8.175   1.00 132.24 ? 97  GLU C CD  1 
ATOM   3265  O  OE1 . GLU C 3 10  ? 9.869   -21.746 7.123   1.00 131.77 ? 97  GLU C OE1 1 
ATOM   3266  O  OE2 . GLU C 3 10  ? 8.847   -23.022 8.586   1.00 131.71 ? 97  GLU C OE2 1 
ATOM   3267  N  N   . ALA C 3 11  ? 13.107  -22.794 12.062  1.00 139.55 ? 98  ALA C N   1 
ATOM   3268  C  CA  . ALA C 3 11  ? 12.847  -23.458 13.335  1.00 141.90 ? 98  ALA C CA  1 
ATOM   3269  C  C   . ALA C 3 11  ? 14.160  -23.619 14.114  1.00 142.34 ? 98  ALA C C   1 
ATOM   3270  O  O   . ALA C 3 11  ? 14.147  -23.999 15.290  1.00 143.31 ? 98  ALA C O   1 
ATOM   3271  C  CB  . ALA C 3 11  ? 12.186  -24.821 13.100  1.00 143.55 ? 98  ALA C CB  1 
ATOM   3272  N  N   . SER C 3 12  ? 15.284  -23.314 13.454  1.00 141.19 ? 99  SER C N   1 
ATOM   3273  C  CA  . SER C 3 12  ? 16.624  -23.406 14.055  1.00 139.24 ? 99  SER C CA  1 
ATOM   3274  C  C   . SER C 3 12  ? 16.915  -22.206 14.965  1.00 138.08 ? 99  SER C C   1 
ATOM   3275  O  O   . SER C 3 12  ? 18.027  -22.056 15.485  1.00 138.84 ? 99  SER C O   1 
ATOM   3276  C  CB  . SER C 3 12  ? 17.702  -23.518 12.961  1.00 138.54 ? 99  SER C CB  1 
ATOM   3277  O  OG  . SER C 3 12  ? 18.996  -23.750 13.499  1.00 138.09 ? 99  SER C OG  1 
ATOM   3278  N  N   . ILE C 3 13  ? 15.912  -21.344 15.124  1.00 135.27 ? 100 ILE C N   1 
ATOM   3279  C  CA  . ILE C 3 13  ? 16.017  -20.166 15.978  1.00 133.91 ? 100 ILE C CA  1 
ATOM   3280  C  C   . ILE C 3 13  ? 15.453  -20.515 17.365  1.00 132.94 ? 100 ILE C C   1 
ATOM   3281  O  O   . ILE C 3 13  ? 15.576  -19.748 18.325  1.00 130.91 ? 100 ILE C O   1 
ATOM   3282  C  CB  . ILE C 3 13  ? 15.288  -18.951 15.347  1.00 132.70 ? 100 ILE C CB  1 
ATOM   3283  C  CG1 . ILE C 3 13  ? 13.774  -19.159 15.342  1.00 131.93 ? 100 ILE C CG1 1 
ATOM   3284  C  CG2 . ILE C 3 13  ? 15.792  -18.722 13.922  1.00 131.40 ? 100 ILE C CG2 1 
ATOM   3285  C  CD1 . ILE C 3 13  ? 13.061  -18.398 16.442  1.00 132.40 ? 100 ILE C CD1 1 
ATOM   3286  N  N   . LEU C 3 14  ? 14.811  -21.678 17.438  1.00 133.46 ? 101 LEU C N   1 
ATOM   3287  C  CA  . LEU C 3 14  ? 14.255  -22.196 18.679  1.00 133.63 ? 101 LEU C CA  1 
ATOM   3288  C  C   . LEU C 3 14  ? 15.205  -23.278 19.200  1.00 134.54 ? 101 LEU C C   1 
ATOM   3289  O  O   . LEU C 3 14  ? 15.028  -23.792 20.306  1.00 135.00 ? 101 LEU C O   1 
ATOM   3290  C  CB  . LEU C 3 14  ? 12.861  -22.794 18.457  1.00 133.26 ? 101 LEU C CB  1 
ATOM   3291  C  CG  . LEU C 3 14  ? 11.710  -21.882 18.020  1.00 132.13 ? 101 LEU C CG  1 
ATOM   3292  C  CD1 . LEU C 3 14  ? 11.744  -20.593 18.825  1.00 130.73 ? 101 LEU C CD1 1 
ATOM   3293  C  CD2 . LEU C 3 14  ? 11.788  -21.599 16.528  1.00 132.86 ? 101 LEU C CD2 1 
ATOM   3294  N  N   . THR C 3 15  ? 16.190  -23.639 18.375  1.00 135.14 ? 102 THR C N   1 
ATOM   3295  C  CA  . THR C 3 15  ? 17.199  -24.642 18.726  1.00 136.81 ? 102 THR C CA  1 
ATOM   3296  C  C   . THR C 3 15  ? 18.230  -23.979 19.640  1.00 138.66 ? 102 THR C C   1 
ATOM   3297  O  O   . THR C 3 15  ? 18.565  -24.506 20.706  1.00 138.88 ? 102 THR C O   1 
ATOM   3298  C  CB  . THR C 3 15  ? 17.936  -25.186 17.462  1.00 136.66 ? 102 THR C CB  1 
ATOM   3299  O  OG1 . THR C 3 15  ? 16.994  -25.811 16.582  1.00 138.57 ? 102 THR C OG1 1 
ATOM   3300  C  CG2 . THR C 3 15  ? 19.016  -26.206 17.845  1.00 135.88 ? 102 THR C CG2 1 
ATOM   3301  N  N   . HIS C 3 16  ? 18.714  -22.815 19.209  1.00 139.67 ? 103 HIS C N   1 
ATOM   3302  C  CA  . HIS C 3 16  ? 19.706  -22.043 19.954  1.00 139.94 ? 103 HIS C CA  1 
ATOM   3303  C  C   . HIS C 3 16  ? 19.064  -21.156 21.032  1.00 136.85 ? 103 HIS C C   1 
ATOM   3304  O  O   . HIS C 3 16  ? 19.756  -20.661 21.923  1.00 136.13 ? 103 HIS C O   1 
ATOM   3305  C  CB  . HIS C 3 16  ? 20.557  -21.199 18.989  1.00 144.30 ? 103 HIS C CB  1 
ATOM   3306  C  CG  . HIS C 3 16  ? 21.352  -22.010 18.005  1.00 148.94 ? 103 HIS C CG  1 
ATOM   3307  N  ND1 . HIS C 3 16  ? 20.877  -22.339 16.753  1.00 150.86 ? 103 HIS C ND1 1 
ATOM   3308  C  CD2 . HIS C 3 16  ? 22.590  -22.555 18.090  1.00 150.58 ? 103 HIS C CD2 1 
ATOM   3309  C  CE1 . HIS C 3 16  ? 21.787  -23.050 16.110  1.00 152.19 ? 103 HIS C CE1 1 
ATOM   3310  N  NE2 . HIS C 3 16  ? 22.836  -23.196 16.899  1.00 151.89 ? 103 HIS C NE2 1 
ATOM   3311  N  N   . ASP C 3 17  ? 17.742  -20.979 20.963  1.00 135.05 ? 104 ASP C N   1 
ATOM   3312  C  CA  . ASP C 3 17  ? 17.006  -20.166 21.937  1.00 133.86 ? 104 ASP C CA  1 
ATOM   3313  C  C   . ASP C 3 17  ? 17.097  -20.790 23.332  1.00 133.05 ? 104 ASP C C   1 
ATOM   3314  O  O   . ASP C 3 17  ? 16.794  -20.142 24.334  1.00 129.63 ? 104 ASP C O   1 
ATOM   3315  C  CB  . ASP C 3 17  ? 15.533  -20.012 21.516  1.00 133.19 ? 104 ASP C CB  1 
ATOM   3316  C  CG  . ASP C 3 17  ? 14.783  -18.964 22.343  1.00 132.14 ? 104 ASP C CG  1 
ATOM   3317  O  OD1 . ASP C 3 17  ? 15.290  -17.836 22.501  1.00 132.87 ? 104 ASP C OD1 1 
ATOM   3318  O  OD2 . ASP C 3 17  ? 13.674  -19.260 22.827  1.00 130.71 ? 104 ASP C OD2 1 
ATOM   3319  N  N   . SER C 3 18  ? 17.522  -22.051 23.383  1.00 134.97 ? 105 SER C N   1 
ATOM   3320  C  CA  . SER C 3 18  ? 17.685  -22.776 24.640  1.00 136.01 ? 105 SER C CA  1 
ATOM   3321  C  C   . SER C 3 18  ? 19.027  -22.398 25.267  1.00 133.99 ? 105 SER C C   1 
ATOM   3322  O  O   . SER C 3 18  ? 19.659  -23.197 25.972  1.00 136.58 ? 105 SER C O   1 
ATOM   3323  C  CB  . SER C 3 18  ? 17.609  -24.290 24.402  1.00 138.71 ? 105 SER C CB  1 
ATOM   3324  O  OG  . SER C 3 18  ? 16.315  -24.680 23.965  1.00 140.08 ? 105 SER C OG  1 
ATOM   3325  N  N   . SER C 3 19  ? 19.448  -21.167 24.982  1.00 129.88 ? 106 SER C N   1 
ATOM   3326  C  CA  . SER C 3 19  ? 20.695  -20.596 25.486  1.00 127.69 ? 106 SER C CA  1 
ATOM   3327  C  C   . SER C 3 19  ? 20.497  -19.088 25.732  1.00 124.69 ? 106 SER C C   1 
ATOM   3328  O  O   . SER C 3 19  ? 21.451  -18.304 25.720  1.00 122.88 ? 106 SER C O   1 
ATOM   3329  C  CB  . SER C 3 19  ? 21.842  -20.836 24.487  1.00 128.74 ? 106 SER C CB  1 
ATOM   3330  O  OG  . SER C 3 19  ? 22.126  -22.219 24.328  1.00 129.68 ? 106 SER C OG  1 
ATOM   3331  N  N   . ILE C 3 20  ? 19.239  -18.691 25.913  1.00 121.77 ? 107 ILE C N   1 
ATOM   3332  C  CA  . ILE C 3 20  ? 18.876  -17.301 26.175  1.00 119.37 ? 107 ILE C CA  1 
ATOM   3333  C  C   . ILE C 3 20  ? 18.108  -17.285 27.487  1.00 117.46 ? 107 ILE C C   1 
ATOM   3334  O  O   . ILE C 3 20  ? 18.440  -16.544 28.410  1.00 115.16 ? 107 ILE C O   1 
ATOM   3335  C  CB  . ILE C 3 20  ? 17.991  -16.711 25.046  1.00 121.60 ? 107 ILE C CB  1 
ATOM   3336  C  CG1 . ILE C 3 20  ? 18.842  -16.376 23.814  1.00 123.44 ? 107 ILE C CG1 1 
ATOM   3337  C  CG2 . ILE C 3 20  ? 17.266  -15.457 25.530  1.00 120.92 ? 107 ILE C CG2 1 
ATOM   3338  C  CD1 . ILE C 3 20  ? 19.319  -17.574 23.012  1.00 122.79 ? 107 ILE C CD1 1 
ATOM   3339  N  N   . ARG C 3 21  ? 17.060  -18.097 27.553  1.00 119.29 ? 108 ARG C N   1 
ATOM   3340  C  CA  . ARG C 3 21  ? 16.268  -18.208 28.764  1.00 122.20 ? 108 ARG C CA  1 
ATOM   3341  C  C   . ARG C 3 21  ? 17.148  -18.982 29.737  1.00 120.05 ? 108 ARG C C   1 
ATOM   3342  O  O   . ARG C 3 21  ? 17.130  -18.733 30.932  1.00 116.30 ? 108 ARG C O   1 
ATOM   3343  C  CB  . ARG C 3 21  ? 14.974  -18.984 28.497  1.00 129.00 ? 108 ARG C CB  1 
ATOM   3344  C  CG  . ARG C 3 21  ? 14.097  -18.425 27.371  1.00 136.08 ? 108 ARG C CG  1 
ATOM   3345  C  CD  . ARG C 3 21  ? 14.526  -18.912 25.985  1.00 143.35 ? 108 ARG C CD  1 
ATOM   3346  N  NE  . ARG C 3 21  ? 14.443  -20.367 25.855  1.00 150.34 ? 108 ARG C NE  1 
ATOM   3347  C  CZ  . ARG C 3 21  ? 13.338  -21.040 25.537  1.00 153.78 ? 108 ARG C CZ  1 
ATOM   3348  N  NH1 . ARG C 3 21  ? 12.201  -20.395 25.306  1.00 154.59 ? 108 ARG C NH1 1 
ATOM   3349  N  NH2 . ARG C 3 21  ? 13.364  -22.366 25.473  1.00 154.46 ? 108 ARG C NH2 1 
ATOM   3350  N  N   . TYR C 3 22  ? 17.938  -19.903 29.191  1.00 120.73 ? 109 TYR C N   1 
ATOM   3351  C  CA  . TYR C 3 22  ? 18.859  -20.732 29.958  1.00 120.69 ? 109 TYR C CA  1 
ATOM   3352  C  C   . TYR C 3 22  ? 20.037  -19.900 30.453  1.00 119.80 ? 109 TYR C C   1 
ATOM   3353  O  O   . TYR C 3 22  ? 20.543  -20.136 31.552  1.00 121.34 ? 109 TYR C O   1 
ATOM   3354  C  CB  . TYR C 3 22  ? 19.348  -21.902 29.096  1.00 125.34 ? 109 TYR C CB  1 
ATOM   3355  C  CG  . TYR C 3 22  ? 20.508  -22.699 29.667  1.00 129.57 ? 109 TYR C CG  1 
ATOM   3356  C  CD1 . TYR C 3 22  ? 20.340  -23.527 30.777  1.00 130.66 ? 109 TYR C CD1 1 
ATOM   3357  C  CD2 . TYR C 3 22  ? 21.773  -22.645 29.074  1.00 131.61 ? 109 TYR C CD2 1 
ATOM   3358  C  CE1 . TYR C 3 22  ? 21.404  -24.286 31.280  1.00 131.78 ? 109 TYR C CE1 1 
ATOM   3359  C  CE2 . TYR C 3 22  ? 22.841  -23.399 29.569  1.00 131.98 ? 109 TYR C CE2 1 
ATOM   3360  C  CZ  . TYR C 3 22  ? 22.650  -24.216 30.670  1.00 132.21 ? 109 TYR C CZ  1 
ATOM   3361  O  OH  . TYR C 3 22  ? 23.698  -24.965 31.154  1.00 132.40 ? 109 TYR C OH  1 
ATOM   3362  N  N   . LEU C 3 23  ? 20.478  -18.939 29.640  1.00 117.92 ? 110 LEU C N   1 
ATOM   3363  C  CA  . LEU C 3 23  ? 21.591  -18.075 30.025  1.00 116.58 ? 110 LEU C CA  1 
ATOM   3364  C  C   . LEU C 3 23  ? 21.150  -16.782 30.717  1.00 117.03 ? 110 LEU C C   1 
ATOM   3365  O  O   . LEU C 3 23  ? 21.751  -15.724 30.539  1.00 118.26 ? 110 LEU C O   1 
ATOM   3366  C  CB  . LEU C 3 23  ? 22.531  -17.787 28.843  1.00 114.08 ? 110 LEU C CB  1 
ATOM   3367  C  CG  . LEU C 3 23  ? 23.488  -18.918 28.431  1.00 113.93 ? 110 LEU C CG  1 
ATOM   3368  C  CD1 . LEU C 3 23  ? 24.474  -18.423 27.384  1.00 111.32 ? 110 LEU C CD1 1 
ATOM   3369  C  CD2 . LEU C 3 23  ? 24.246  -19.448 29.642  1.00 114.64 ? 110 LEU C CD2 1 
ATOM   3370  N  N   . GLN C 3 24  ? 20.067  -16.885 31.480  1.00 117.60 ? 111 GLN C N   1 
ATOM   3371  C  CA  . GLN C 3 24  ? 19.522  -15.782 32.272  1.00 118.55 ? 111 GLN C CA  1 
ATOM   3372  C  C   . GLN C 3 24  ? 19.095  -16.418 33.594  1.00 115.14 ? 111 GLN C C   1 
ATOM   3373  O  O   . GLN C 3 24  ? 18.669  -15.742 34.528  1.00 112.07 ? 111 GLN C O   1 
ATOM   3374  C  CB  . GLN C 3 24  ? 18.336  -15.102 31.577  1.00 124.62 ? 111 GLN C CB  1 
ATOM   3375  C  CG  . GLN C 3 24  ? 17.900  -13.797 32.259  1.00 129.45 ? 111 GLN C CG  1 
ATOM   3376  C  CD  . GLN C 3 24  ? 16.979  -12.936 31.404  1.00 132.18 ? 111 GLN C CD  1 
ATOM   3377  O  OE1 . GLN C 3 24  ? 17.339  -12.527 30.298  1.00 133.42 ? 111 GLN C OE1 1 
ATOM   3378  N  NE2 . GLN C 3 24  ? 15.795  -12.634 31.927  1.00 132.33 ? 111 GLN C NE2 1 
ATOM   3379  N  N   . GLU C 3 25  ? 19.177  -17.747 33.625  1.00 112.98 ? 112 GLU C N   1 
ATOM   3380  C  CA  . GLU C 3 25  ? 18.878  -18.543 34.804  1.00 106.81 ? 112 GLU C CA  1 
ATOM   3381  C  C   . GLU C 3 25  ? 20.152  -18.393 35.619  1.00 99.55  ? 112 GLU C C   1 
ATOM   3382  O  O   . GLU C 3 25  ? 20.106  -18.194 36.832  1.00 96.90  ? 112 GLU C O   1 
ATOM   3383  C  CB  . GLU C 3 25  ? 18.705  -20.026 34.434  1.00 111.00 ? 112 GLU C CB  1 
ATOM   3384  C  CG  . GLU C 3 25  ? 17.522  -20.346 33.521  1.00 116.26 ? 112 GLU C CG  1 
ATOM   3385  C  CD  . GLU C 3 25  ? 17.530  -21.779 32.974  1.00 118.89 ? 112 GLU C CD  1 
ATOM   3386  O  OE1 . GLU C 3 25  ? 18.453  -22.564 33.304  1.00 120.21 ? 112 GLU C OE1 1 
ATOM   3387  O  OE2 . GLU C 3 25  ? 16.607  -22.114 32.196  1.00 119.16 ? 112 GLU C OE2 1 
ATOM   3388  N  N   . ILE C 3 26  ? 21.286  -18.472 34.919  1.00 94.30  ? 113 ILE C N   1 
ATOM   3389  C  CA  . ILE C 3 26  ? 22.596  -18.346 35.537  1.00 92.52  ? 113 ILE C CA  1 
ATOM   3390  C  C   . ILE C 3 26  ? 22.852  -16.926 36.017  1.00 92.63  ? 113 ILE C C   1 
ATOM   3391  O  O   . ILE C 3 26  ? 23.283  -16.718 37.155  1.00 94.57  ? 113 ILE C O   1 
ATOM   3392  C  CB  . ILE C 3 26  ? 23.729  -18.758 34.582  1.00 92.22  ? 113 ILE C CB  1 
ATOM   3393  C  CG1 . ILE C 3 26  ? 23.623  -20.245 34.246  1.00 92.20  ? 113 ILE C CG1 1 
ATOM   3394  C  CG2 . ILE C 3 26  ? 25.070  -18.478 35.232  1.00 94.87  ? 113 ILE C CG2 1 
ATOM   3395  C  CD1 . ILE C 3 26  ? 24.827  -20.795 33.510  1.00 93.59  ? 113 ILE C CD1 1 
ATOM   3396  N  N   . TYR C 3 27  ? 22.594  -15.950 35.151  1.00 88.81  ? 114 TYR C N   1 
ATOM   3397  C  CA  . TYR C 3 27  ? 22.800  -14.557 35.521  1.00 87.41  ? 114 TYR C CA  1 
ATOM   3398  C  C   . TYR C 3 27  ? 21.952  -14.167 36.723  1.00 89.52  ? 114 TYR C C   1 
ATOM   3399  O  O   . TYR C 3 27  ? 22.394  -13.398 37.566  1.00 91.37  ? 114 TYR C O   1 
ATOM   3400  C  CB  . TYR C 3 27  ? 22.504  -13.623 34.352  1.00 86.33  ? 114 TYR C CB  1 
ATOM   3401  C  CG  . TYR C 3 27  ? 22.612  -12.153 34.710  1.00 86.20  ? 114 TYR C CG  1 
ATOM   3402  C  CD1 . TYR C 3 27  ? 21.513  -11.461 35.217  1.00 86.06  ? 114 TYR C CD1 1 
ATOM   3403  C  CD2 . TYR C 3 27  ? 23.810  -11.452 34.543  1.00 86.78  ? 114 TYR C CD2 1 
ATOM   3404  C  CE1 . TYR C 3 27  ? 21.597  -10.110 35.551  1.00 85.52  ? 114 TYR C CE1 1 
ATOM   3405  C  CE2 . TYR C 3 27  ? 23.903  -10.095 34.875  1.00 86.22  ? 114 TYR C CE2 1 
ATOM   3406  C  CZ  . TYR C 3 27  ? 22.790  -9.435  35.376  1.00 85.82  ? 114 TYR C CZ  1 
ATOM   3407  O  OH  . TYR C 3 27  ? 22.853  -8.098  35.688  1.00 86.30  ? 114 TYR C OH  1 
ATOM   3408  N  N   . ASN C 3 28  ? 20.730  -14.681 36.796  1.00 92.68  ? 115 ASN C N   1 
ATOM   3409  C  CA  . ASN C 3 28  ? 19.857  -14.372 37.924  1.00 94.61  ? 115 ASN C CA  1 
ATOM   3410  C  C   . ASN C 3 28  ? 20.224  -15.148 39.189  1.00 91.44  ? 115 ASN C C   1 
ATOM   3411  O  O   . ASN C 3 28  ? 19.933  -14.704 40.305  1.00 87.56  ? 115 ASN C O   1 
ATOM   3412  C  CB  . ASN C 3 28  ? 18.395  -14.624 37.555  1.00 103.32 ? 115 ASN C CB  1 
ATOM   3413  C  CG  . ASN C 3 28  ? 17.812  -13.514 36.699  1.00 109.01 ? 115 ASN C CG  1 
ATOM   3414  O  OD1 . ASN C 3 28  ? 18.486  -12.973 35.820  1.00 109.11 ? 115 ASN C OD1 1 
ATOM   3415  N  ND2 . ASN C 3 28  ? 16.554  -13.161 36.960  1.00 111.39 ? 115 ASN C ND2 1 
ATOM   3416  N  N   . SER C 3 29  ? 20.855  -16.307 39.008  1.00 88.96  ? 116 SER C N   1 
ATOM   3417  C  CA  . SER C 3 29  ? 21.267  -17.139 40.127  1.00 84.30  ? 116 SER C CA  1 
ATOM   3418  C  C   . SER C 3 29  ? 22.630  -16.687 40.614  1.00 80.53  ? 116 SER C C   1 
ATOM   3419  O  O   . SER C 3 29  ? 22.802  -16.436 41.804  1.00 83.25  ? 116 SER C O   1 
ATOM   3420  C  CB  . SER C 3 29  ? 21.307  -18.616 39.730  1.00 86.25  ? 116 SER C CB  1 
ATOM   3421  O  OG  . SER C 3 29  ? 22.335  -18.863 38.791  1.00 89.48  ? 116 SER C OG  1 
ATOM   3422  N  N   . ASN C 3 30  ? 23.588  -16.576 39.693  1.00 73.61  ? 117 ASN C N   1 
ATOM   3423  C  CA  . ASN C 3 30  ? 24.944  -16.143 40.033  1.00 72.73  ? 117 ASN C CA  1 
ATOM   3424  C  C   . ASN C 3 30  ? 24.866  -14.806 40.771  1.00 73.50  ? 117 ASN C C   1 
ATOM   3425  O  O   . ASN C 3 30  ? 25.424  -14.631 41.856  1.00 76.28  ? 117 ASN C O   1 
ATOM   3426  C  CB  . ASN C 3 30  ? 25.815  -16.009 38.766  1.00 66.49  ? 117 ASN C CB  1 
ATOM   3427  C  CG  . ASN C 3 30  ? 26.489  -17.312 38.366  1.00 64.60  ? 117 ASN C CG  1 
ATOM   3428  O  OD1 . ASN C 3 30  ? 27.543  -17.304 37.727  1.00 63.07  ? 117 ASN C OD1 1 
ATOM   3429  N  ND2 . ASN C 3 30  ? 25.890  -18.436 38.744  1.00 66.88  ? 117 ASN C ND2 1 
ATOM   3430  N  N   . ASN C 3 31  ? 24.106  -13.888 40.198  1.00 72.77  ? 118 ASN C N   1 
ATOM   3431  C  CA  . ASN C 3 31  ? 23.924  -12.571 40.775  1.00 75.30  ? 118 ASN C CA  1 
ATOM   3432  C  C   . ASN C 3 31  ? 23.500  -12.685 42.236  1.00 74.20  ? 118 ASN C C   1 
ATOM   3433  O  O   . ASN C 3 31  ? 24.136  -12.121 43.126  1.00 72.23  ? 118 ASN C O   1 
ATOM   3434  C  CB  . ASN C 3 31  ? 22.853  -11.830 39.983  1.00 77.91  ? 118 ASN C CB  1 
ATOM   3435  C  CG  . ASN C 3 31  ? 22.871  -10.350 40.229  1.00 77.81  ? 118 ASN C CG  1 
ATOM   3436  O  OD1 . ASN C 3 31  ? 23.171  -9.564  39.330  1.00 76.57  ? 118 ASN C OD1 1 
ATOM   3437  N  ND2 . ASN C 3 31  ? 22.547  -9.954  41.453  1.00 81.87  ? 118 ASN C ND2 1 
ATOM   3438  N  N   . GLN C 3 32  ? 22.439  -13.448 42.467  1.00 76.44  ? 119 GLN C N   1 
ATOM   3439  C  CA  . GLN C 3 32  ? 21.904  -13.666 43.807  1.00 76.94  ? 119 GLN C CA  1 
ATOM   3440  C  C   . GLN C 3 32  ? 22.940  -14.234 44.777  1.00 75.81  ? 119 GLN C C   1 
ATOM   3441  O  O   . GLN C 3 32  ? 23.006  -13.808 45.925  1.00 75.61  ? 119 GLN C O   1 
ATOM   3442  C  CB  . GLN C 3 32  ? 20.702  -14.606 43.736  1.00 80.72  ? 119 GLN C CB  1 
ATOM   3443  C  CG  . GLN C 3 32  ? 19.881  -14.673 45.011  1.00 81.78  ? 119 GLN C CG  1 
ATOM   3444  C  CD  . GLN C 3 32  ? 19.206  -13.361 45.331  1.00 84.84  ? 119 GLN C CD  1 
ATOM   3445  O  OE1 . GLN C 3 32  ? 19.568  -12.677 46.286  1.00 84.34  ? 119 GLN C OE1 1 
ATOM   3446  N  NE2 . GLN C 3 32  ? 18.222  -12.996 44.526  1.00 87.85  ? 119 GLN C NE2 1 
ATOM   3447  N  N   . LYS C 3 33  ? 23.734  -15.199 44.313  1.00 75.68  ? 120 LYS C N   1 
ATOM   3448  C  CA  . LYS C 3 33  ? 24.777  -15.835 45.126  1.00 75.55  ? 120 LYS C CA  1 
ATOM   3449  C  C   . LYS C 3 33  ? 25.686  -14.762 45.738  1.00 70.07  ? 120 LYS C C   1 
ATOM   3450  O  O   . LYS C 3 33  ? 25.943  -14.745 46.952  1.00 64.28  ? 120 LYS C O   1 
ATOM   3451  C  CB  . LYS C 3 33  ? 25.630  -16.777 44.254  1.00 81.42  ? 120 LYS C CB  1 
ATOM   3452  C  CG  . LYS C 3 33  ? 24.872  -17.885 43.501  1.00 88.02  ? 120 LYS C CG  1 
ATOM   3453  C  CD  . LYS C 3 33  ? 24.548  -19.102 44.374  1.00 93.93  ? 120 LYS C CD  1 
ATOM   3454  C  CE  . LYS C 3 33  ? 25.800  -19.904 44.788  1.00 97.92  ? 120 LYS C CE  1 
ATOM   3455  N  NZ  . LYS C 3 33  ? 26.507  -20.572 43.651  1.00 96.81  ? 120 LYS C NZ  1 
ATOM   3456  N  N   . ILE C 3 34  ? 26.145  -13.865 44.865  1.00 67.48  ? 121 ILE C N   1 
ATOM   3457  C  CA  . ILE C 3 34  ? 27.024  -12.760 45.221  1.00 61.84  ? 121 ILE C CA  1 
ATOM   3458  C  C   . ILE C 3 34  ? 26.361  -11.871 46.258  1.00 55.89  ? 121 ILE C C   1 
ATOM   3459  O  O   . ILE C 3 34  ? 26.964  -11.546 47.269  1.00 51.40  ? 121 ILE C O   1 
ATOM   3460  C  CB  . ILE C 3 34  ? 27.433  -11.947 43.955  1.00 63.56  ? 121 ILE C CB  1 
ATOM   3461  C  CG1 . ILE C 3 34  ? 28.779  -12.443 43.404  1.00 66.35  ? 121 ILE C CG1 1 
ATOM   3462  C  CG2 . ILE C 3 34  ? 27.540  -10.473 44.261  1.00 67.21  ? 121 ILE C CG2 1 
ATOM   3463  C  CD1 . ILE C 3 34  ? 28.752  -13.820 42.789  1.00 66.50  ? 121 ILE C CD1 1 
ATOM   3464  N  N   . VAL C 3 35  ? 25.105  -11.517 46.019  1.00 56.73  ? 122 VAL C N   1 
ATOM   3465  C  CA  . VAL C 3 35  ? 24.346  -10.688 46.949  1.00 58.26  ? 122 VAL C CA  1 
ATOM   3466  C  C   . VAL C 3 35  ? 24.507  -11.223 48.369  1.00 57.47  ? 122 VAL C C   1 
ATOM   3467  O  O   . VAL C 3 35  ? 24.806  -10.471 49.293  1.00 60.38  ? 122 VAL C O   1 
ATOM   3468  C  CB  . VAL C 3 35  ? 22.852  -10.691 46.587  1.00 60.23  ? 122 VAL C CB  1 
ATOM   3469  C  CG1 . VAL C 3 35  ? 22.051  -9.920  47.612  1.00 60.22  ? 122 VAL C CG1 1 
ATOM   3470  C  CG2 . VAL C 3 35  ? 22.651  -10.109 45.204  1.00 63.93  ? 122 VAL C CG2 1 
ATOM   3471  N  N   . ASN C 3 36  ? 24.350  -12.533 48.519  1.00 55.70  ? 123 ASN C N   1 
ATOM   3472  C  CA  . ASN C 3 36  ? 24.481  -13.168 49.812  1.00 54.83  ? 123 ASN C CA  1 
ATOM   3473  C  C   . ASN C 3 36  ? 25.955  -13.371 50.130  1.00 48.91  ? 123 ASN C C   1 
ATOM   3474  O  O   . ASN C 3 36  ? 26.360  -13.292 51.289  1.00 49.98  ? 123 ASN C O   1 
ATOM   3475  C  CB  . ASN C 3 36  ? 23.719  -14.499 49.840  1.00 60.56  ? 123 ASN C CB  1 
ATOM   3476  C  CG  . ASN C 3 36  ? 23.388  -14.971 51.273  1.00 65.54  ? 123 ASN C CG  1 
ATOM   3477  O  OD1 . ASN C 3 36  ? 24.035  -14.573 52.252  1.00 65.19  ? 123 ASN C OD1 1 
ATOM   3478  N  ND2 . ASN C 3 36  ? 22.376  -15.830 51.391  1.00 66.64  ? 123 ASN C ND2 1 
ATOM   3479  N  N   . LEU C 3 37  ? 26.765  -13.612 49.107  1.00 41.26  ? 124 LEU C N   1 
ATOM   3480  C  CA  . LEU C 3 37  ? 28.190  -13.803 49.336  1.00 41.30  ? 124 LEU C CA  1 
ATOM   3481  C  C   . LEU C 3 37  ? 28.750  -12.534 49.988  1.00 46.13  ? 124 LEU C C   1 
ATOM   3482  O  O   . LEU C 3 37  ? 29.508  -12.589 50.967  1.00 40.10  ? 124 LEU C O   1 
ATOM   3483  C  CB  . LEU C 3 37  ? 28.904  -14.116 48.029  1.00 34.64  ? 124 LEU C CB  1 
ATOM   3484  C  CG  . LEU C 3 37  ? 30.354  -14.556 48.183  1.00 34.06  ? 124 LEU C CG  1 
ATOM   3485  C  CD1 . LEU C 3 37  ? 30.427  -15.666 49.194  1.00 29.68  ? 124 LEU C CD1 1 
ATOM   3486  C  CD2 . LEU C 3 37  ? 30.908  -15.012 46.845  1.00 38.78  ? 124 LEU C CD2 1 
ATOM   3487  N  N   . LYS C 3 38  ? 28.303  -11.392 49.473  1.00 50.40  ? 125 LYS C N   1 
ATOM   3488  C  CA  . LYS C 3 38  ? 28.703  -10.090 49.992  1.00 51.90  ? 125 LYS C CA  1 
ATOM   3489  C  C   . LYS C 3 38  ? 28.337  -10.107 51.464  1.00 52.31  ? 125 LYS C C   1 
ATOM   3490  O  O   . LYS C 3 38  ? 29.132  -9.722  52.310  1.00 59.57  ? 125 LYS C O   1 
ATOM   3491  C  CB  . LYS C 3 38  ? 27.933  -8.957  49.297  1.00 51.63  ? 125 LYS C CB  1 
ATOM   3492  C  CG  . LYS C 3 38  ? 28.216  -8.756  47.809  1.00 47.86  ? 125 LYS C CG  1 
ATOM   3493  C  CD  . LYS C 3 38  ? 27.039  -8.074  47.120  1.00 46.46  ? 125 LYS C CD  1 
ATOM   3494  C  CE  . LYS C 3 38  ? 27.295  -6.609  46.797  1.00 47.88  ? 125 LYS C CE  1 
ATOM   3495  N  NZ  . LYS C 3 38  ? 28.196  -6.430  45.619  1.00 48.60  ? 125 LYS C NZ  1 
ATOM   3496  N  N   . GLU C 3 39  ? 27.143  -10.606 51.765  1.00 53.17  ? 126 GLU C N   1 
ATOM   3497  C  CA  . GLU C 3 39  ? 26.677  -10.694 53.147  1.00 55.55  ? 126 GLU C CA  1 
ATOM   3498  C  C   . GLU C 3 39  ? 27.555  -11.608 53.988  1.00 52.24  ? 126 GLU C C   1 
ATOM   3499  O  O   . GLU C 3 39  ? 27.865  -11.298 55.128  1.00 45.94  ? 126 GLU C O   1 
ATOM   3500  C  CB  . GLU C 3 39  ? 25.239  -11.214 53.205  1.00 66.71  ? 126 GLU C CB  1 
ATOM   3501  C  CG  . GLU C 3 39  ? 24.201  -10.281 52.616  1.00 74.90  ? 126 GLU C CG  1 
ATOM   3502  C  CD  . GLU C 3 39  ? 22.795  -10.853 52.690  1.00 79.77  ? 126 GLU C CD  1 
ATOM   3503  O  OE1 . GLU C 3 39  ? 22.226  -10.913 53.804  1.00 80.84  ? 126 GLU C OE1 1 
ATOM   3504  O  OE2 . GLU C 3 39  ? 22.255  -11.237 51.630  1.00 81.30  ? 126 GLU C OE2 1 
ATOM   3505  N  N   . LYS C 3 40  ? 27.947  -12.739 53.422  1.00 56.10  ? 127 LYS C N   1 
ATOM   3506  C  CA  . LYS C 3 40  ? 28.764  -13.690 54.147  1.00 61.34  ? 127 LYS C CA  1 
ATOM   3507  C  C   . LYS C 3 40  ? 30.104  -13.076 54.545  1.00 60.02  ? 127 LYS C C   1 
ATOM   3508  O  O   . LYS C 3 40  ? 30.464  -13.080 55.725  1.00 58.32  ? 127 LYS C O   1 
ATOM   3509  C  CB  . LYS C 3 40  ? 28.963  -14.952 53.305  1.00 69.08  ? 127 LYS C CB  1 
ATOM   3510  C  CG  . LYS C 3 40  ? 29.485  -16.167 54.072  1.00 79.55  ? 127 LYS C CG  1 
ATOM   3511  C  CD  . LYS C 3 40  ? 29.565  -17.405 53.164  1.00 87.90  ? 127 LYS C CD  1 
ATOM   3512  C  CE  . LYS C 3 40  ? 30.159  -18.630 53.869  1.00 89.89  ? 127 LYS C CE  1 
ATOM   3513  N  NZ  . LYS C 3 40  ? 30.208  -19.802 52.942  1.00 92.17  ? 127 LYS C NZ  1 
ATOM   3514  N  N   . VAL C 3 41  ? 30.815  -12.509 53.571  1.00 57.23  ? 128 VAL C N   1 
ATOM   3515  C  CA  . VAL C 3 41  ? 32.121  -11.899 53.827  1.00 52.83  ? 128 VAL C CA  1 
ATOM   3516  C  C   . VAL C 3 41  ? 31.987  -10.716 54.774  1.00 50.26  ? 128 VAL C C   1 
ATOM   3517  O  O   . VAL C 3 41  ? 32.960  -10.282 55.391  1.00 50.74  ? 128 VAL C O   1 
ATOM   3518  C  CB  . VAL C 3 41  ? 32.797  -11.432 52.528  1.00 49.20  ? 128 VAL C CB  1 
ATOM   3519  C  CG1 . VAL C 3 41  ? 32.596  -12.459 51.436  1.00 53.85  ? 128 VAL C CG1 1 
ATOM   3520  C  CG2 . VAL C 3 41  ? 32.264  -10.106 52.099  1.00 48.68  ? 128 VAL C CG2 1 
ATOM   3521  N  N   . ALA C 3 42  ? 30.772  -10.185 54.855  1.00 46.08  ? 129 ALA C N   1 
ATOM   3522  C  CA  . ALA C 3 42  ? 30.466  -9.063  55.729  1.00 44.07  ? 129 ALA C CA  1 
ATOM   3523  C  C   . ALA C 3 42  ? 30.501  -9.548  57.170  1.00 46.00  ? 129 ALA C C   1 
ATOM   3524  O  O   . ALA C 3 42  ? 30.921  -8.821  58.062  1.00 45.38  ? 129 ALA C O   1 
ATOM   3525  C  CB  . ALA C 3 42  ? 29.113  -8.510  55.407  1.00 43.47  ? 129 ALA C CB  1 
ATOM   3526  N  N   . GLN C 3 43  ? 30.028  -10.773 57.391  1.00 47.88  ? 130 GLN C N   1 
ATOM   3527  C  CA  . GLN C 3 43  ? 30.035  -11.384 58.712  1.00 43.76  ? 130 GLN C CA  1 
ATOM   3528  C  C   . GLN C 3 43  ? 31.506  -11.660 59.059  1.00 37.13  ? 130 GLN C C   1 
ATOM   3529  O  O   . GLN C 3 43  ? 31.947  -11.475 60.199  1.00 29.82  ? 130 GLN C O   1 
ATOM   3530  C  CB  . GLN C 3 43  ? 29.259  -12.705 58.687  1.00 52.60  ? 130 GLN C CB  1 
ATOM   3531  C  CG  . GLN C 3 43  ? 27.805  -12.595 58.279  1.00 61.02  ? 130 GLN C CG  1 
ATOM   3532  C  CD  . GLN C 3 43  ? 27.101  -13.953 58.215  1.00 70.64  ? 130 GLN C CD  1 
ATOM   3533  O  OE1 . GLN C 3 43  ? 25.873  -14.016 58.168  1.00 76.16  ? 130 GLN C OE1 1 
ATOM   3534  N  NE2 . GLN C 3 43  ? 27.876  -15.042 58.200  1.00 72.37  ? 130 GLN C NE2 1 
ATOM   3535  N  N   . LEU C 3 44  ? 32.261  -12.071 58.046  1.00 30.26  ? 131 LEU C N   1 
ATOM   3536  C  CA  . LEU C 3 44  ? 33.663  -12.373 58.225  1.00 27.10  ? 131 LEU C CA  1 
ATOM   3537  C  C   . LEU C 3 44  ? 34.411  -11.125 58.650  1.00 28.77  ? 131 LEU C C   1 
ATOM   3538  O  O   . LEU C 3 44  ? 35.190  -11.155 59.612  1.00 33.33  ? 131 LEU C O   1 
ATOM   3539  C  CB  . LEU C 3 44  ? 34.251  -12.922 56.931  1.00 26.94  ? 131 LEU C CB  1 
ATOM   3540  C  CG  . LEU C 3 44  ? 35.748  -13.223 56.965  1.00 25.58  ? 131 LEU C CG  1 
ATOM   3541  C  CD1 . LEU C 3 44  ? 36.022  -14.359 57.914  1.00 22.76  ? 131 LEU C CD1 1 
ATOM   3542  C  CD2 . LEU C 3 44  ? 36.222  -13.555 55.557  1.00 24.18  ? 131 LEU C CD2 1 
ATOM   3543  N  N   . GLU C 3 45  ? 34.148  -10.024 57.950  1.00 26.49  ? 132 GLU C N   1 
ATOM   3544  C  CA  . GLU C 3 45  ? 34.807  -8.754  58.247  1.00 27.23  ? 132 GLU C CA  1 
ATOM   3545  C  C   . GLU C 3 45  ? 34.588  -8.447  59.711  1.00 25.20  ? 132 GLU C C   1 
ATOM   3546  O  O   . GLU C 3 45  ? 35.495  -8.047  60.436  1.00 29.28  ? 132 GLU C O   1 
ATOM   3547  C  CB  . GLU C 3 45  ? 34.226  -7.613  57.408  1.00 29.03  ? 132 GLU C CB  1 
ATOM   3548  C  CG  . GLU C 3 45  ? 35.218  -6.470  57.208  1.00 38.19  ? 132 GLU C CG  1 
ATOM   3549  C  CD  . GLU C 3 45  ? 34.571  -5.169  56.751  1.00 43.05  ? 132 GLU C CD  1 
ATOM   3550  O  OE1 . GLU C 3 45  ? 33.482  -5.236  56.132  1.00 41.26  ? 132 GLU C OE1 1 
ATOM   3551  O  OE2 . GLU C 3 45  ? 35.151  -4.078  57.030  1.00 42.00  ? 132 GLU C OE2 1 
ATOM   3552  N  N   . ALA C 3 46  ? 33.372  -8.693  60.154  1.00 26.05  ? 133 ALA C N   1 
ATOM   3553  C  CA  . ALA C 3 46  ? 33.028  -8.448  61.534  1.00 28.05  ? 133 ALA C CA  1 
ATOM   3554  C  C   . ALA C 3 46  ? 33.919  -9.283  62.438  1.00 29.63  ? 133 ALA C C   1 
ATOM   3555  O  O   . ALA C 3 46  ? 34.567  -8.762  63.335  1.00 26.35  ? 133 ALA C O   1 
ATOM   3556  C  CB  . ALA C 3 46  ? 31.590  -8.807  61.763  1.00 27.55  ? 133 ALA C CB  1 
ATOM   3557  N  N   . GLN C 3 47  ? 33.980  -10.580 62.154  1.00 31.89  ? 134 GLN C N   1 
ATOM   3558  C  CA  . GLN C 3 47  ? 34.765  -11.502 62.948  1.00 33.85  ? 134 GLN C CA  1 
ATOM   3559  C  C   . GLN C 3 47  ? 36.149  -10.968 63.233  1.00 36.83  ? 134 GLN C C   1 
ATOM   3560  O  O   . GLN C 3 47  ? 36.606  -11.013 64.369  1.00 40.73  ? 134 GLN C O   1 
ATOM   3561  C  CB  . GLN C 3 47  ? 34.858  -12.858 62.251  1.00 46.08  ? 134 GLN C CB  1 
ATOM   3562  C  CG  . GLN C 3 47  ? 34.258  -13.997 63.057  1.00 56.55  ? 134 GLN C CG  1 
ATOM   3563  C  CD  . GLN C 3 47  ? 32.837  -13.707 63.485  1.00 64.04  ? 134 GLN C CD  1 
ATOM   3564  O  OE1 . GLN C 3 47  ? 31.938  -13.593 62.648  1.00 65.96  ? 134 GLN C OE1 1 
ATOM   3565  N  NE2 . GLN C 3 47  ? 32.625  -13.569 64.794  1.00 69.21  ? 134 GLN C NE2 1 
ATOM   3566  N  N   . CYS C 3 48  ? 36.815  -10.432 62.221  1.00 30.33  ? 135 CYS C N   1 
ATOM   3567  C  CA  . CYS C 3 48  ? 38.145  -9.915  62.461  1.00 24.37  ? 135 CYS C CA  1 
ATOM   3568  C  C   . CYS C 3 48  ? 38.244  -8.417  62.393  1.00 21.54  ? 135 CYS C C   1 
ATOM   3569  O  O   . CYS C 3 48  ? 38.363  -7.827  61.333  1.00 27.92  ? 135 CYS C O   1 
ATOM   3570  C  CB  . CYS C 3 48  ? 39.126  -10.541 61.510  1.00 26.44  ? 135 CYS C CB  1 
ATOM   3571  S  SG  . CYS C 3 48  ? 38.269  -10.881 59.973  1.00 28.01  ? 135 CYS C SG  1 
ATOM   3572  N  N   . GLN C 3 49  ? 38.146  -7.807  63.554  1.00 26.09  ? 136 GLN C N   1 
ATOM   3573  C  CA  . GLN C 3 49  ? 38.272  -6.374  63.702  1.00 27.76  ? 136 GLN C CA  1 
ATOM   3574  C  C   . GLN C 3 49  ? 39.114  -6.272  64.956  1.00 32.37  ? 136 GLN C C   1 
ATOM   3575  O  O   . GLN C 3 49  ? 39.994  -5.410  65.066  1.00 36.07  ? 136 GLN C O   1 
ATOM   3576  C  CB  . GLN C 3 49  ? 36.904  -5.736  63.907  1.00 28.56  ? 136 GLN C CB  1 
ATOM   3577  C  CG  . GLN C 3 49  ? 36.027  -5.736  62.655  1.00 37.68  ? 136 GLN C CG  1 
ATOM   3578  C  CD  . GLN C 3 49  ? 36.552  -4.818  61.558  1.00 42.06  ? 136 GLN C CD  1 
ATOM   3579  O  OE1 . GLN C 3 49  ? 36.958  -5.278  60.481  1.00 42.82  ? 136 GLN C OE1 1 
ATOM   3580  N  NE2 . GLN C 3 49  ? 36.541  -3.508  61.826  1.00 41.24  ? 136 GLN C NE2 1 
ATOM   3581  N  N   . GLU C 3 50  ? 38.890  -7.244  65.844  1.00 34.12  ? 137 GLU C N   1 
ATOM   3582  C  CA  . GLU C 3 50  ? 39.587  -7.377  67.117  1.00 40.20  ? 137 GLU C CA  1 
ATOM   3583  C  C   . GLU C 3 50  ? 41.035  -7.758  66.908  1.00 33.49  ? 137 GLU C C   1 
ATOM   3584  O  O   . GLU C 3 50  ? 41.362  -8.451  65.955  1.00 35.04  ? 137 GLU C O   1 
ATOM   3585  C  CB  . GLU C 3 50  ? 38.951  -8.496  67.927  1.00 52.17  ? 137 GLU C CB  1 
ATOM   3586  C  CG  . GLU C 3 50  ? 37.485  -8.298  68.238  1.00 64.42  ? 137 GLU C CG  1 
ATOM   3587  C  CD  . GLU C 3 50  ? 37.270  -7.483  69.501  1.00 73.84  ? 137 GLU C CD  1 
ATOM   3588  O  OE1 . GLU C 3 50  ? 37.382  -6.235  69.426  1.00 76.58  ? 137 GLU C OE1 1 
ATOM   3589  O  OE2 . GLU C 3 50  ? 36.990  -8.096  70.563  1.00 79.88  ? 137 GLU C OE2 1 
ATOM   3590  N  N   . PRO C 3 51  ? 41.926  -7.292  67.788  1.00 24.49  ? 138 PRO C N   1 
ATOM   3591  C  CA  . PRO C 3 51  ? 43.341  -7.618  67.671  1.00 21.59  ? 138 PRO C CA  1 
ATOM   3592  C  C   . PRO C 3 51  ? 43.562  -8.901  68.469  1.00 19.66  ? 138 PRO C C   1 
ATOM   3593  O  O   . PRO C 3 51  ? 42.676  -9.328  69.209  1.00 16.49  ? 138 PRO C O   1 
ATOM   3594  C  CB  . PRO C 3 51  ? 43.994  -6.423  68.329  1.00 20.47  ? 138 PRO C CB  1 
ATOM   3595  C  CG  . PRO C 3 51  ? 43.075  -6.162  69.455  1.00 23.55  ? 138 PRO C CG  1 
ATOM   3596  C  CD  . PRO C 3 51  ? 41.718  -6.259  68.812  1.00 22.90  ? 138 PRO C CD  1 
ATOM   3597  N  N   . CYS C 3 52  ? 44.716  -9.536  68.305  1.00 18.19  ? 139 CYS C N   1 
ATOM   3598  C  CA  . CYS C 3 52  ? 44.978  -10.758 69.045  1.00 15.44  ? 139 CYS C CA  1 
ATOM   3599  C  C   . CYS C 3 52  ? 44.882  -10.492 70.505  1.00 22.87  ? 139 CYS C C   1 
ATOM   3600  O  O   . CYS C 3 52  ? 45.040  -9.342  70.950  1.00 21.85  ? 139 CYS C O   1 
ATOM   3601  C  CB  . CYS C 3 52  ? 46.366  -11.293 68.783  1.00 13.68  ? 139 CYS C CB  1 
ATOM   3602  S  SG  . CYS C 3 52  ? 46.606  -11.671 67.049  1.00 19.88  ? 139 CYS C SG  1 
ATOM   3603  N  N   . LYS C 3 53  ? 44.662  -11.575 71.245  1.00 27.27  ? 140 LYS C N   1 
ATOM   3604  C  CA  . LYS C 3 53  ? 44.557  -11.501 72.681  1.00 29.73  ? 140 LYS C CA  1 
ATOM   3605  C  C   . LYS C 3 53  ? 45.927  -11.489 73.323  1.00 32.00  ? 140 LYS C C   1 
ATOM   3606  O  O   . LYS C 3 53  ? 46.758  -12.349 73.049  1.00 28.99  ? 140 LYS C O   1 
ATOM   3607  C  CB  . LYS C 3 53  ? 43.749  -12.664 73.213  1.00 31.15  ? 140 LYS C CB  1 
ATOM   3608  C  CG  . LYS C 3 53  ? 42.261  -12.426 73.174  1.00 45.77  ? 140 LYS C CG  1 
ATOM   3609  C  CD  . LYS C 3 53  ? 41.557  -13.191 74.301  1.00 58.89  ? 140 LYS C CD  1 
ATOM   3610  C  CE  . LYS C 3 53  ? 42.186  -12.890 75.680  1.00 66.00  ? 140 LYS C CE  1 
ATOM   3611  N  NZ  . LYS C 3 53  ? 41.446  -13.503 76.834  1.00 68.84  ? 140 LYS C NZ  1 
ATOM   3612  N  N   . ASP C 3 54  ? 46.192  -10.459 74.115  1.00 32.84  ? 141 ASP C N   1 
ATOM   3613  C  CA  . ASP C 3 54  ? 47.456  -10.393 74.804  1.00 28.97  ? 141 ASP C CA  1 
ATOM   3614  C  C   . ASP C 3 54  ? 47.191  -10.986 76.164  1.00 31.45  ? 141 ASP C C   1 
ATOM   3615  O  O   . ASP C 3 54  ? 46.375  -10.482 76.931  1.00 31.75  ? 141 ASP C O   1 
ATOM   3616  C  CB  . ASP C 3 54  ? 47.979  -8.967  74.924  1.00 28.48  ? 141 ASP C CB  1 
ATOM   3617  C  CG  . ASP C 3 54  ? 49.375  -8.915  75.511  1.00 26.67  ? 141 ASP C CG  1 
ATOM   3618  O  OD1 . ASP C 3 54  ? 49.919  -10.001 75.819  1.00 19.24  ? 141 ASP C OD1 1 
ATOM   3619  O  OD2 . ASP C 3 54  ? 49.921  -7.793  75.666  1.00 28.74  ? 141 ASP C OD2 1 
ATOM   3620  N  N   . THR C 3 55  ? 47.855  -12.102 76.419  1.00 35.62  ? 142 THR C N   1 
ATOM   3621  C  CA  . THR C 3 55  ? 47.728  -12.820 77.675  1.00 33.19  ? 142 THR C CA  1 
ATOM   3622  C  C   . THR C 3 55  ? 48.177  -11.997 78.885  1.00 35.24  ? 142 THR C C   1 
ATOM   3623  O  O   . THR C 3 55  ? 47.889  -12.389 80.013  1.00 42.81  ? 142 THR C O   1 
ATOM   3624  C  CB  . THR C 3 55  ? 48.528  -14.142 77.652  1.00 31.66  ? 142 THR C CB  1 
ATOM   3625  O  OG1 . THR C 3 55  ? 49.930  -13.851 77.638  1.00 34.76  ? 142 THR C OG1 1 
ATOM   3626  C  CG2 . THR C 3 55  ? 48.175  -14.972 76.420  1.00 23.26  ? 142 THR C CG2 1 
ATOM   3627  N  N   . VAL C 3 56  ? 48.909  -10.898 78.675  1.00 34.83  ? 143 VAL C N   1 
ATOM   3628  C  CA  . VAL C 3 56  ? 49.322  -10.080 79.822  1.00 34.79  ? 143 VAL C CA  1 
ATOM   3629  C  C   . VAL C 3 56  ? 48.280  -9.024  80.156  1.00 34.91  ? 143 VAL C C   1 
ATOM   3630  O  O   . VAL C 3 56  ? 47.933  -8.169  79.342  1.00 34.28  ? 143 VAL C O   1 
ATOM   3631  C  CB  . VAL C 3 56  ? 50.726  -9.447  79.679  1.00 33.57  ? 143 VAL C CB  1 
ATOM   3632  C  CG1 . VAL C 3 56  ? 51.709  -10.481 79.171  1.00 31.41  ? 143 VAL C CG1 1 
ATOM   3633  C  CG2 . VAL C 3 56  ? 50.694  -8.199  78.796  1.00 40.49  ? 143 VAL C CG2 1 
ATOM   3634  N  N   . GLN C 3 57  ? 47.709  -9.178  81.338  1.00 38.27  ? 144 GLN C N   1 
ATOM   3635  C  CA  . GLN C 3 57  ? 46.697  -8.277  81.828  1.00 45.59  ? 144 GLN C CA  1 
ATOM   3636  C  C   . GLN C 3 57  ? 47.295  -7.544  83.011  1.00 44.72  ? 144 GLN C C   1 
ATOM   3637  O  O   . GLN C 3 57  ? 48.227  -8.034  83.635  1.00 50.16  ? 144 GLN C O   1 
ATOM   3638  C  CB  . GLN C 3 57  ? 45.484  -9.078  82.298  1.00 54.49  ? 144 GLN C CB  1 
ATOM   3639  C  CG  . GLN C 3 57  ? 44.182  -8.746  81.578  1.00 65.57  ? 144 GLN C CG  1 
ATOM   3640  C  CD  . GLN C 3 57  ? 43.992  -9.570  80.323  1.00 71.73  ? 144 GLN C CD  1 
ATOM   3641  O  OE1 . GLN C 3 57  ? 43.475  -10.690 80.383  1.00 76.54  ? 144 GLN C OE1 1 
ATOM   3642  N  NE2 . GLN C 3 57  ? 44.411  -9.027  79.177  1.00 72.84  ? 144 GLN C NE2 1 
ATOM   3643  N  N   . ILE C 3 58  ? 46.774  -6.360  83.305  1.00 39.50  ? 145 ILE C N   1 
ATOM   3644  C  CA  . ILE C 3 58  ? 47.247  -5.578  84.439  1.00 35.56  ? 145 ILE C CA  1 
ATOM   3645  C  C   . ILE C 3 58  ? 46.077  -5.349  85.383  1.00 37.25  ? 145 ILE C C   1 
ATOM   3646  O  O   . ILE C 3 58  ? 44.922  -5.292  84.948  1.00 46.51  ? 145 ILE C O   1 
ATOM   3647  C  CB  . ILE C 3 58  ? 47.823  -4.222  83.992  1.00 32.49  ? 145 ILE C CB  1 
ATOM   3648  C  CG1 . ILE C 3 58  ? 49.065  -4.444  83.131  1.00 33.16  ? 145 ILE C CG1 1 
ATOM   3649  C  CG2 . ILE C 3 58  ? 48.180  -3.369  85.200  1.00 32.13  ? 145 ILE C CG2 1 
ATOM   3650  C  CD1 . ILE C 3 58  ? 49.617  -3.193  82.509  1.00 35.42  ? 145 ILE C CD1 1 
ATOM   3651  N  N   . HIS C 3 59  ? 46.362  -5.204  86.668  1.00 32.29  ? 146 HIS C N   1 
ATOM   3652  C  CA  . HIS C 3 59  ? 45.287  -4.993  87.597  1.00 39.05  ? 146 HIS C CA  1 
ATOM   3653  C  C   . HIS C 3 59  ? 44.974  -3.546  87.923  1.00 44.38  ? 146 HIS C C   1 
ATOM   3654  O  O   . HIS C 3 59  ? 45.851  -2.689  88.029  1.00 47.11  ? 146 HIS C O   1 
ATOM   3655  C  CB  . HIS C 3 59  ? 45.512  -5.839  88.824  1.00 44.22  ? 146 HIS C CB  1 
ATOM   3656  C  CG  . HIS C 3 59  ? 45.508  -7.304  88.529  1.00 49.30  ? 146 HIS C CG  1 
ATOM   3657  N  ND1 . HIS C 3 59  ? 46.549  -8.140  88.869  1.00 47.98  ? 146 HIS C ND1 1 
ATOM   3658  C  CD2 . HIS C 3 59  ? 44.593  -8.078  87.900  1.00 54.22  ? 146 HIS C CD2 1 
ATOM   3659  C  CE1 . HIS C 3 59  ? 46.276  -9.367  88.461  1.00 49.61  ? 146 HIS C CE1 1 
ATOM   3660  N  NE2 . HIS C 3 59  ? 45.095  -9.356  87.870  1.00 53.42  ? 146 HIS C NE2 1 
ATOM   3661  N  N   . ASP C 3 60  ? 43.686  -3.281  88.028  1.00 44.51  ? 147 ASP C N   1 
ATOM   3662  C  CA  . ASP C 3 60  ? 43.188  -1.950  88.308  1.00 49.93  ? 147 ASP C CA  1 
ATOM   3663  C  C   . ASP C 3 60  ? 43.446  -1.460  89.730  1.00 48.59  ? 147 ASP C C   1 
ATOM   3664  O  O   . ASP C 3 60  ? 43.112  -0.314  90.048  1.00 49.28  ? 147 ASP C O   1 
ATOM   3665  C  CB  . ASP C 3 60  ? 41.696  -1.923  88.011  1.00 59.59  ? 147 ASP C CB  1 
ATOM   3666  C  CG  . ASP C 3 60  ? 40.997  -3.219  88.430  1.00 68.42  ? 147 ASP C CG  1 
ATOM   3667  O  OD1 . ASP C 3 60  ? 41.336  -3.773  89.503  1.00 72.33  ? 147 ASP C OD1 1 
ATOM   3668  O  OD2 . ASP C 3 60  ? 40.128  -3.703  87.673  1.00 68.91  ? 147 ASP C OD2 1 
ATOM   3669  N  N   . ILE C 3 61  ? 44.023  -2.311  90.583  1.00 40.77  ? 148 ILE C N   1 
ATOM   3670  C  CA  . ILE C 3 61  ? 44.305  -1.910  91.963  1.00 40.94  ? 148 ILE C CA  1 
ATOM   3671  C  C   . ILE C 3 61  ? 45.692  -1.303  92.143  1.00 37.69  ? 148 ILE C C   1 
ATOM   3672  O  O   . ILE C 3 61  ? 46.690  -1.939  91.821  1.00 36.43  ? 148 ILE C O   1 
ATOM   3673  C  CB  . ILE C 3 61  ? 44.205  -3.073  92.932  1.00 40.02  ? 148 ILE C CB  1 
ATOM   3674  C  CG1 . ILE C 3 61  ? 43.653  -4.302  92.227  1.00 40.81  ? 148 ILE C CG1 1 
ATOM   3675  C  CG2 . ILE C 3 61  ? 43.361  -2.680  94.116  1.00 36.70  ? 148 ILE C CG2 1 
ATOM   3676  C  CD1 . ILE C 3 61  ? 43.633  -5.533  93.109  1.00 45.77  ? 148 ILE C CD1 1 
ATOM   3677  N  N   . THR C 3 62  ? 45.739  -0.088  92.684  1.00 34.25  ? 149 THR C N   1 
ATOM   3678  C  CA  . THR C 3 62  ? 46.984  0.633   92.933  1.00 35.73  ? 149 THR C CA  1 
ATOM   3679  C  C   . THR C 3 62  ? 47.213  0.681   94.440  1.00 39.94  ? 149 THR C C   1 
ATOM   3680  O  O   . THR C 3 62  ? 46.306  0.383   95.226  1.00 42.66  ? 149 THR C O   1 
ATOM   3681  C  CB  . THR C 3 62  ? 46.879  2.073   92.403  1.00 32.61  ? 149 THR C CB  1 
ATOM   3682  O  OG1 . THR C 3 62  ? 46.659  2.024   91.002  1.00 36.10  ? 149 THR C OG1 1 
ATOM   3683  C  CG2 . THR C 3 62  ? 48.139  2.886   92.667  1.00 40.47  ? 149 THR C CG2 1 
ATOM   3684  N  N   . GLY C 3 63  ? 48.423  1.067   94.832  1.00 41.32  ? 150 GLY C N   1 
ATOM   3685  C  CA  . GLY C 3 63  ? 48.771  1.175   96.233  1.00 39.01  ? 150 GLY C CA  1 
ATOM   3686  C  C   . GLY C 3 63  ? 50.173  1.726   96.378  1.00 36.02  ? 150 GLY C C   1 
ATOM   3687  O  O   . GLY C 3 63  ? 50.865  1.958   95.390  1.00 37.30  ? 150 GLY C O   1 
ATOM   3688  N  N   . LYS C 3 64  ? 50.590  1.944   97.616  1.00 35.00  ? 151 LYS C N   1 
ATOM   3689  C  CA  . LYS C 3 64  ? 51.916  2.472   97.893  1.00 38.84  ? 151 LYS C CA  1 
ATOM   3690  C  C   . LYS C 3 64  ? 52.922  1.354   97.630  1.00 35.39  ? 151 LYS C C   1 
ATOM   3691  O  O   . LYS C 3 64  ? 54.082  1.592   97.316  1.00 31.66  ? 151 LYS C O   1 
ATOM   3692  C  CB  . LYS C 3 64  ? 52.008  2.921   99.360  1.00 43.84  ? 151 LYS C CB  1 
ATOM   3693  C  CG  . LYS C 3 64  ? 50.711  3.498   99.962  1.00 52.45  ? 151 LYS C CG  1 
ATOM   3694  C  CD  . LYS C 3 64  ? 50.228  4.778   99.261  1.00 60.86  ? 151 LYS C CD  1 
ATOM   3695  C  CE  . LYS C 3 64  ? 48.787  5.137   99.658  1.00 66.71  ? 151 LYS C CE  1 
ATOM   3696  N  NZ  . LYS C 3 64  ? 47.774  4.133   99.178  1.00 70.52  ? 151 LYS C NZ  1 
ATOM   3697  N  N   . ASP C 3 65  ? 52.442  0.125   97.716  1.00 32.95  ? 152 ASP C N   1 
ATOM   3698  C  CA  . ASP C 3 65  ? 53.288  -1.030  97.520  1.00 35.87  ? 152 ASP C CA  1 
ATOM   3699  C  C   . ASP C 3 65  ? 52.406  -2.267  97.533  1.00 37.36  ? 152 ASP C C   1 
ATOM   3700  O  O   . ASP C 3 65  ? 51.259  -2.191  97.961  1.00 37.48  ? 152 ASP C O   1 
ATOM   3701  C  CB  . ASP C 3 65  ? 54.306  -1.109  98.651  1.00 40.16  ? 152 ASP C CB  1 
ATOM   3702  C  CG  . ASP C 3 65  ? 53.660  -1.365  99.994  1.00 44.74  ? 152 ASP C CG  1 
ATOM   3703  O  OD1 . ASP C 3 65  ? 52.617  -0.755  100.296 1.00 51.73  ? 152 ASP C OD1 1 
ATOM   3704  O  OD2 . ASP C 3 65  ? 54.195  -2.188  100.751 1.00 49.16  ? 152 ASP C OD2 1 
ATOM   3705  N  N   . CYS C 3 66  ? 52.964  -3.408  97.140  1.00 34.40  ? 153 CYS C N   1 
ATOM   3706  C  CA  . CYS C 3 66  ? 52.214  -4.657  97.081  1.00 36.38  ? 153 CYS C CA  1 
ATOM   3707  C  C   . CYS C 3 66  ? 51.483  -5.067  98.351  1.00 42.59  ? 153 CYS C C   1 
ATOM   3708  O  O   . CYS C 3 66  ? 50.440  -5.724  98.281  1.00 45.94  ? 153 CYS C O   1 
ATOM   3709  C  CB  . CYS C 3 66  ? 53.105  -5.798  96.613  1.00 33.78  ? 153 CYS C CB  1 
ATOM   3710  S  SG  . CYS C 3 66  ? 53.780  -5.577  94.933  1.00 25.66  ? 153 CYS C SG  1 
ATOM   3711  N  N   . GLN C 3 67  ? 52.035  -4.729  99.512  1.00 43.66  ? 154 GLN C N   1 
ATOM   3712  C  CA  . GLN C 3 67  ? 51.352  -5.071  100.754 1.00 45.74  ? 154 GLN C CA  1 
ATOM   3713  C  C   . GLN C 3 67  ? 50.117  -4.191  100.855 1.00 44.78  ? 154 GLN C C   1 
ATOM   3714  O  O   . GLN C 3 67  ? 49.029  -4.683  101.135 1.00 49.30  ? 154 GLN C O   1 
ATOM   3715  C  CB  . GLN C 3 67  ? 52.245  -4.877  101.986 1.00 46.99  ? 154 GLN C CB  1 
ATOM   3716  C  CG  . GLN C 3 67  ? 51.614  -5.375  103.284 1.00 42.92  ? 154 GLN C CG  1 
ATOM   3717  C  CD  . GLN C 3 67  ? 51.120  -6.816  103.180 1.00 45.25  ? 154 GLN C CD  1 
ATOM   3718  O  OE1 . GLN C 3 67  ? 51.909  -7.758  103.123 1.00 45.02  ? 154 GLN C OE1 1 
ATOM   3719  N  NE2 . GLN C 3 67  ? 49.808  -6.986  103.147 1.00 47.67  ? 154 GLN C NE2 1 
ATOM   3720  N  N   . ASP C 3 68  ? 50.281  -2.901  100.577 1.00 41.05  ? 155 ASP C N   1 
ATOM   3721  C  CA  . ASP C 3 68  ? 49.162  -1.975  100.615 1.00 44.21  ? 155 ASP C CA  1 
ATOM   3722  C  C   . ASP C 3 68  ? 48.074  -2.486  99.674  1.00 47.26  ? 155 ASP C C   1 
ATOM   3723  O  O   . ASP C 3 68  ? 46.880  -2.420  99.977  1.00 50.11  ? 155 ASP C O   1 
ATOM   3724  C  CB  . ASP C 3 68  ? 49.608  -0.593  100.171 1.00 49.75  ? 155 ASP C CB  1 
ATOM   3725  C  CG  . ASP C 3 68  ? 48.513  0.434   100.302 1.00 59.38  ? 155 ASP C CG  1 
ATOM   3726  O  OD1 . ASP C 3 68  ? 47.778  0.406   101.316 1.00 68.14  ? 155 ASP C OD1 1 
ATOM   3727  O  OD2 . ASP C 3 68  ? 48.389  1.273   99.390  1.00 60.61  ? 155 ASP C OD2 1 
ATOM   3728  N  N   . ILE C 3 69  ? 48.505  -3.004  98.529  1.00 49.55  ? 156 ILE C N   1 
ATOM   3729  C  CA  . ILE C 3 69  ? 47.595  -3.561  97.535  1.00 48.13  ? 156 ILE C CA  1 
ATOM   3730  C  C   . ILE C 3 69  ? 46.943  -4.828  98.099  1.00 48.19  ? 156 ILE C C   1 
ATOM   3731  O  O   . ILE C 3 69  ? 45.730  -5.031  97.976  1.00 45.45  ? 156 ILE C O   1 
ATOM   3732  C  CB  . ILE C 3 69  ? 48.343  -3.878  96.205  1.00 45.98  ? 156 ILE C CB  1 
ATOM   3733  C  CG1 . ILE C 3 69  ? 48.684  -2.572  95.478  1.00 45.47  ? 156 ILE C CG1 1 
ATOM   3734  C  CG2 . ILE C 3 69  ? 47.491  -4.755  95.305  1.00 46.27  ? 156 ILE C CG2 1 
ATOM   3735  C  CD1 . ILE C 3 69  ? 49.212  -2.748  94.073  1.00 41.60  ? 156 ILE C CD1 1 
ATOM   3736  N  N   . ALA C 3 70  ? 47.756  -5.660  98.744  1.00 46.68  ? 157 ALA C N   1 
ATOM   3737  C  CA  . ALA C 3 70  ? 47.266  -6.889  99.342  1.00 48.33  ? 157 ALA C CA  1 
ATOM   3738  C  C   . ALA C 3 70  ? 46.139  -6.556  100.324 1.00 51.90  ? 157 ALA C C   1 
ATOM   3739  O  O   . ALA C 3 70  ? 45.153  -7.283  100.423 1.00 55.79  ? 157 ALA C O   1 
ATOM   3740  C  CB  . ALA C 3 70  ? 48.401  -7.610  100.047 1.00 45.97  ? 157 ALA C CB  1 
ATOM   3741  N  N   . ASN C 3 71  ? 46.264  -5.419  101.000 1.00 51.02  ? 158 ASN C N   1 
ATOM   3742  C  CA  . ASN C 3 71  ? 45.260  -4.993  101.961 1.00 56.00  ? 158 ASN C CA  1 
ATOM   3743  C  C   . ASN C 3 71  ? 43.976  -4.611  101.260 1.00 60.39  ? 158 ASN C C   1 
ATOM   3744  O  O   . ASN C 3 71  ? 42.897  -5.043  101.657 1.00 63.21  ? 158 ASN C O   1 
ATOM   3745  C  CB  . ASN C 3 71  ? 45.772  -3.810  102.781 1.00 59.60  ? 158 ASN C CB  1 
ATOM   3746  C  CG  . ASN C 3 71  ? 47.022  -4.152  103.574 1.00 64.76  ? 158 ASN C CG  1 
ATOM   3747  O  OD1 . ASN C 3 71  ? 47.228  -5.306  103.964 1.00 65.03  ? 158 ASN C OD1 1 
ATOM   3748  N  ND2 . ASN C 3 71  ? 47.870  -3.149  103.811 1.00 66.66  ? 158 ASN C ND2 1 
ATOM   3749  N  N   . LYS C 3 72  ? 44.106  -3.824  100.196 1.00 61.91  ? 159 LYS C N   1 
ATOM   3750  C  CA  . LYS C 3 72  ? 42.959  -3.364  99.419  1.00 61.47  ? 159 LYS C CA  1 
ATOM   3751  C  C   . LYS C 3 72  ? 42.042  -4.517  99.021  1.00 59.27  ? 159 LYS C C   1 
ATOM   3752  O  O   . LYS C 3 72  ? 40.839  -4.326  98.843  1.00 65.02  ? 159 LYS C O   1 
ATOM   3753  C  CB  . LYS C 3 72  ? 43.425  -2.618  98.165  1.00 62.39  ? 159 LYS C CB  1 
ATOM   3754  C  CG  . LYS C 3 72  ? 44.358  -1.438  98.425  1.00 64.83  ? 159 LYS C CG  1 
ATOM   3755  C  CD  . LYS C 3 72  ? 43.674  -0.352  99.246  1.00 66.45  ? 159 LYS C CD  1 
ATOM   3756  C  CE  . LYS C 3 72  ? 44.586  0.849   99.467  1.00 70.36  ? 159 LYS C CE  1 
ATOM   3757  N  NZ  . LYS C 3 72  ? 44.911  1.528   98.184  1.00 75.70  ? 159 LYS C NZ  1 
ATOM   3758  N  N   . GLY C 3 73  ? 42.610  -5.710  98.879  1.00 52.66  ? 160 GLY C N   1 
ATOM   3759  C  CA  . GLY C 3 73  ? 41.794  -6.854  98.522  1.00 52.32  ? 160 GLY C CA  1 
ATOM   3760  C  C   . GLY C 3 73  ? 42.340  -7.697  97.391  1.00 54.09  ? 160 GLY C C   1 
ATOM   3761  O  O   . GLY C 3 73  ? 41.627  -8.522  96.815  1.00 50.00  ? 160 GLY C O   1 
ATOM   3762  N  N   . ALA C 3 74  ? 43.613  -7.499  97.072  1.00 58.27  ? 161 ALA C N   1 
ATOM   3763  C  CA  . ALA C 3 74  ? 44.252  -8.249  95.999  1.00 55.98  ? 161 ALA C CA  1 
ATOM   3764  C  C   . ALA C 3 74  ? 44.483  -9.687  96.434  1.00 52.99  ? 161 ALA C C   1 
ATOM   3765  O  O   . ALA C 3 74  ? 44.932  -9.951  97.543  1.00 53.03  ? 161 ALA C O   1 
ATOM   3766  C  CB  . ALA C 3 74  ? 45.558  -7.587  95.602  1.00 57.89  ? 161 ALA C CB  1 
ATOM   3767  N  N   . LYS C 3 75  ? 44.203  -10.617 95.541  1.00 49.45  ? 162 LYS C N   1 
ATOM   3768  C  CA  . LYS C 3 75  ? 44.356  -12.013 95.867  1.00 48.81  ? 162 LYS C CA  1 
ATOM   3769  C  C   . LYS C 3 75  ? 45.403  -12.730 95.032  1.00 45.97  ? 162 LYS C C   1 
ATOM   3770  O  O   . LYS C 3 75  ? 45.929  -13.751 95.456  1.00 51.45  ? 162 LYS C O   1 
ATOM   3771  C  CB  . LYS C 3 75  ? 43.009  -12.718 95.689  1.00 60.19  ? 162 LYS C CB  1 
ATOM   3772  C  CG  . LYS C 3 75  ? 42.578  -12.929 94.218  1.00 71.60  ? 162 LYS C CG  1 
ATOM   3773  C  CD  . LYS C 3 75  ? 42.351  -11.606 93.451  1.00 76.27  ? 162 LYS C CD  1 
ATOM   3774  C  CE  . LYS C 3 75  ? 41.993  -11.832 91.970  1.00 74.02  ? 162 LYS C CE  1 
ATOM   3775  N  NZ  . LYS C 3 75  ? 43.091  -12.405 91.124  1.00 69.21  ? 162 LYS C NZ  1 
ATOM   3776  N  N   . GLN C 3 76  ? 45.725  -12.188 93.863  1.00 43.49  ? 163 GLN C N   1 
ATOM   3777  C  CA  . GLN C 3 76  ? 46.671  -12.851 92.970  1.00 48.21  ? 163 GLN C CA  1 
ATOM   3778  C  C   . GLN C 3 76  ? 47.977  -12.138 92.609  1.00 47.86  ? 163 GLN C C   1 
ATOM   3779  O  O   . GLN C 3 76  ? 48.026  -10.916 92.411  1.00 46.82  ? 163 GLN C O   1 
ATOM   3780  C  CB  . GLN C 3 76  ? 45.949  -13.250 91.682  1.00 53.75  ? 163 GLN C CB  1 
ATOM   3781  C  CG  . GLN C 3 76  ? 46.562  -14.432 90.943  1.00 64.55  ? 163 GLN C CG  1 
ATOM   3782  C  CD  . GLN C 3 76  ? 45.528  -15.507 90.618  1.00 70.09  ? 163 GLN C CD  1 
ATOM   3783  O  OE1 . GLN C 3 76  ? 45.553  -16.611 91.185  1.00 72.06  ? 163 GLN C OE1 1 
ATOM   3784  N  NE2 . GLN C 3 76  ? 44.600  -15.183 89.717  1.00 69.05  ? 163 GLN C NE2 1 
ATOM   3785  N  N   . SER C 3 77  ? 49.031  -12.937 92.482  1.00 43.86  ? 164 SER C N   1 
ATOM   3786  C  CA  . SER C 3 77  ? 50.333  -12.425 92.110  1.00 43.01  ? 164 SER C CA  1 
ATOM   3787  C  C   . SER C 3 77  ? 50.291  -11.988 90.663  1.00 44.30  ? 164 SER C C   1 
ATOM   3788  O  O   . SER C 3 77  ? 50.073  -12.800 89.773  1.00 48.31  ? 164 SER C O   1 
ATOM   3789  C  CB  . SER C 3 77  ? 51.393  -13.499 92.262  1.00 40.27  ? 164 SER C CB  1 
ATOM   3790  O  OG  . SER C 3 77  ? 51.505  -13.878 93.608  1.00 40.58  ? 164 SER C OG  1 
ATOM   3791  N  N   . GLY C 3 78  ? 50.482  -10.696 90.438  1.00 42.64  ? 165 GLY C N   1 
ATOM   3792  C  CA  . GLY C 3 78  ? 50.477  -10.166 89.088  1.00 40.28  ? 165 GLY C CA  1 
ATOM   3793  C  C   . GLY C 3 78  ? 51.123  -8.797  88.999  1.00 39.56  ? 165 GLY C C   1 
ATOM   3794  O  O   . GLY C 3 78  ? 51.736  -8.318  89.951  1.00 43.16  ? 165 GLY C O   1 
ATOM   3795  N  N   . LEU C 3 79  ? 50.981  -8.161  87.848  1.00 33.94  ? 166 LEU C N   1 
ATOM   3796  C  CA  . LEU C 3 79  ? 51.551  -6.849  87.641  1.00 29.30  ? 166 LEU C CA  1 
ATOM   3797  C  C   . LEU C 3 79  ? 50.565  -5.808  88.146  1.00 30.70  ? 166 LEU C C   1 
ATOM   3798  O  O   . LEU C 3 79  ? 49.358  -5.993  88.026  1.00 31.04  ? 166 LEU C O   1 
ATOM   3799  C  CB  . LEU C 3 79  ? 51.849  -6.647  86.157  1.00 24.01  ? 166 LEU C CB  1 
ATOM   3800  C  CG  . LEU C 3 79  ? 52.642  -7.797  85.536  1.00 18.59  ? 166 LEU C CG  1 
ATOM   3801  C  CD1 . LEU C 3 79  ? 53.016  -7.479  84.117  1.00 16.47  ? 166 LEU C CD1 1 
ATOM   3802  C  CD2 . LEU C 3 79  ? 53.873  -8.049  86.361  1.00 19.55  ? 166 LEU C CD2 1 
ATOM   3803  N  N   . TYR C 3 80  ? 51.080  -4.739  88.747  1.00 30.48  ? 167 TYR C N   1 
ATOM   3804  C  CA  . TYR C 3 80  ? 50.228  -3.688  89.270  1.00 33.91  ? 167 TYR C CA  1 
ATOM   3805  C  C   . TYR C 3 80  ? 50.968  -2.365  89.185  1.00 37.87  ? 167 TYR C C   1 
ATOM   3806  O  O   . TYR C 3 80  ? 52.175  -2.325  88.972  1.00 35.41  ? 167 TYR C O   1 
ATOM   3807  C  CB  . TYR C 3 80  ? 49.888  -3.937  90.751  1.00 39.68  ? 167 TYR C CB  1 
ATOM   3808  C  CG  . TYR C 3 80  ? 49.056  -5.163  91.083  1.00 37.44  ? 167 TYR C CG  1 
ATOM   3809  C  CD1 . TYR C 3 80  ? 49.659  -6.413  91.280  1.00 38.47  ? 167 TYR C CD1 1 
ATOM   3810  C  CD2 . TYR C 3 80  ? 47.680  -5.059  91.270  1.00 35.48  ? 167 TYR C CD2 1 
ATOM   3811  C  CE1 . TYR C 3 80  ? 48.907  -7.529  91.656  1.00 40.15  ? 167 TYR C CE1 1 
ATOM   3812  C  CE2 . TYR C 3 80  ? 46.922  -6.164  91.648  1.00 37.62  ? 167 TYR C CE2 1 
ATOM   3813  C  CZ  . TYR C 3 80  ? 47.538  -7.393  91.836  1.00 42.44  ? 167 TYR C CZ  1 
ATOM   3814  O  OH  . TYR C 3 80  ? 46.783  -8.486  92.188  1.00 46.04  ? 167 TYR C OH  1 
ATOM   3815  N  N   . PHE C 3 81  ? 50.219  -1.281  89.353  1.00 39.13  ? 168 PHE C N   1 
ATOM   3816  C  CA  . PHE C 3 81  ? 50.789  0.046   89.353  1.00 32.24  ? 168 PHE C CA  1 
ATOM   3817  C  C   . PHE C 3 81  ? 50.799  0.525   90.770  1.00 38.37  ? 168 PHE C C   1 
ATOM   3818  O  O   . PHE C 3 81  ? 49.777  0.463   91.467  1.00 41.17  ? 168 PHE C O   1 
ATOM   3819  C  CB  . PHE C 3 81  ? 49.936  1.003   88.562  1.00 32.85  ? 168 PHE C CB  1 
ATOM   3820  C  CG  . PHE C 3 81  ? 50.330  1.106   87.160  1.00 29.60  ? 168 PHE C CG  1 
ATOM   3821  C  CD1 . PHE C 3 81  ? 51.521  1.706   86.827  1.00 32.53  ? 168 PHE C CD1 1 
ATOM   3822  C  CD2 . PHE C 3 81  ? 49.533  0.563   86.163  1.00 28.09  ? 168 PHE C CD2 1 
ATOM   3823  C  CE1 . PHE C 3 81  ? 51.924  1.762   85.506  1.00 41.16  ? 168 PHE C CE1 1 
ATOM   3824  C  CE2 . PHE C 3 81  ? 49.916  0.609   84.841  1.00 28.05  ? 168 PHE C CE2 1 
ATOM   3825  C  CZ  . PHE C 3 81  ? 51.114  1.206   84.500  1.00 36.47  ? 168 PHE C CZ  1 
ATOM   3826  N  N   . ILE C 3 82  ? 51.960  0.983   91.205  1.00 37.57  ? 169 ILE C N   1 
ATOM   3827  C  CA  . ILE C 3 82  ? 52.075  1.505   92.541  1.00 34.80  ? 169 ILE C CA  1 
ATOM   3828  C  C   . ILE C 3 82  ? 52.705  2.873   92.417  1.00 39.61  ? 169 ILE C C   1 
ATOM   3829  O  O   . ILE C 3 82  ? 53.382  3.170   91.421  1.00 38.76  ? 169 ILE C O   1 
ATOM   3830  C  CB  . ILE C 3 82  ? 52.928  0.597   93.428  1.00 31.78  ? 169 ILE C CB  1 
ATOM   3831  C  CG1 . ILE C 3 82  ? 54.376  0.581   92.942  1.00 21.65  ? 169 ILE C CG1 1 
ATOM   3832  C  CG2 . ILE C 3 82  ? 52.351  -0.793  93.426  1.00 29.71  ? 169 ILE C CG2 1 
ATOM   3833  C  CD1 . ILE C 3 82  ? 55.308  -0.200  93.828  1.00 15.74  ? 169 ILE C CD1 1 
ATOM   3834  N  N   . LYS C 3 83  ? 52.422  3.723   93.395  1.00 41.78  ? 170 LYS C N   1 
ATOM   3835  C  CA  . LYS C 3 83  ? 52.970  5.062   93.428  1.00 46.68  ? 170 LYS C CA  1 
ATOM   3836  C  C   . LYS C 3 83  ? 53.302  5.361   94.885  1.00 47.99  ? 170 LYS C C   1 
ATOM   3837  O  O   . LYS C 3 83  ? 52.410  5.621   95.692  1.00 52.59  ? 170 LYS C O   1 
ATOM   3838  C  CB  . LYS C 3 83  ? 51.957  6.075   92.877  1.00 48.21  ? 170 LYS C CB  1 
ATOM   3839  C  CG  . LYS C 3 83  ? 52.476  7.516   92.843  1.00 55.68  ? 170 LYS C CG  1 
ATOM   3840  C  CD  . LYS C 3 83  ? 51.363  8.535   92.592  1.00 57.88  ? 170 LYS C CD  1 
ATOM   3841  C  CE  . LYS C 3 83  ? 51.795  9.946   92.984  1.00 61.71  ? 170 LYS C CE  1 
ATOM   3842  N  NZ  . LYS C 3 83  ? 52.083  10.058  94.453  1.00 63.07  ? 170 LYS C NZ  1 
ATOM   3843  N  N   . PRO C 3 84  ? 54.584  5.229   95.258  1.00 46.72  ? 171 PRO C N   1 
ATOM   3844  C  CA  . PRO C 3 84  ? 55.062  5.484   96.620  1.00 50.91  ? 171 PRO C CA  1 
ATOM   3845  C  C   . PRO C 3 84  ? 54.773  6.918   97.028  1.00 51.53  ? 171 PRO C C   1 
ATOM   3846  O  O   . PRO C 3 84  ? 54.710  7.803   96.175  1.00 52.64  ? 171 PRO C O   1 
ATOM   3847  C  CB  . PRO C 3 84  ? 56.560  5.218   96.506  1.00 51.81  ? 171 PRO C CB  1 
ATOM   3848  C  CG  . PRO C 3 84  ? 56.619  4.146   95.485  1.00 50.05  ? 171 PRO C CG  1 
ATOM   3849  C  CD  . PRO C 3 84  ? 55.656  4.645   94.437  1.00 49.07  ? 171 PRO C CD  1 
ATOM   3850  N  N   . LEU C 3 85  ? 54.620  7.144   98.329  1.00 51.10  ? 172 LEU C N   1 
ATOM   3851  C  CA  . LEU C 3 85  ? 54.302  8.470   98.845  1.00 57.20  ? 172 LEU C CA  1 
ATOM   3852  C  C   . LEU C 3 85  ? 55.059  9.638   98.220  1.00 57.28  ? 172 LEU C C   1 
ATOM   3853  O  O   . LEU C 3 85  ? 54.459  10.541  97.631  1.00 55.56  ? 172 LEU C O   1 
ATOM   3854  C  CB  . LEU C 3 85  ? 54.434  8.482   100.368 1.00 59.51  ? 172 LEU C CB  1 
ATOM   3855  C  CG  . LEU C 3 85  ? 53.394  7.543   100.983 1.00 61.84  ? 172 LEU C CG  1 
ATOM   3856  C  CD1 . LEU C 3 85  ? 53.558  7.443   102.484 1.00 61.83  ? 172 LEU C CD1 1 
ATOM   3857  C  CD2 . LEU C 3 85  ? 52.009  8.048   100.621 1.00 65.47  ? 172 LEU C CD2 1 
ATOM   3858  N  N   . LYS C 3 86  ? 56.377  9.585   98.287  1.00 58.42  ? 173 LYS C N   1 
ATOM   3859  C  CA  . LYS C 3 86  ? 57.200  10.652  97.744  1.00 64.55  ? 173 LYS C CA  1 
ATOM   3860  C  C   . LYS C 3 86  ? 57.300  10.632  96.212  1.00 62.52  ? 173 LYS C C   1 
ATOM   3861  O  O   . LYS C 3 86  ? 57.761  11.599  95.613  1.00 62.98  ? 173 LYS C O   1 
ATOM   3862  C  CB  . LYS C 3 86  ? 58.587  10.583  98.388  1.00 69.36  ? 173 LYS C CB  1 
ATOM   3863  C  CG  . LYS C 3 86  ? 59.473  11.802  98.203  1.00 73.70  ? 173 LYS C CG  1 
ATOM   3864  C  CD  . LYS C 3 86  ? 60.770  11.642  99.004  1.00 78.07  ? 173 LYS C CD  1 
ATOM   3865  C  CE  . LYS C 3 86  ? 61.474  10.305  98.694  1.00 75.50  ? 173 LYS C CE  1 
ATOM   3866  N  NZ  . LYS C 3 86  ? 62.747  10.107  99.458  1.00 74.15  ? 173 LYS C NZ  1 
ATOM   3867  N  N   . ALA C 3 87  ? 56.824  9.559   95.580  1.00 60.83  ? 174 ALA C N   1 
ATOM   3868  C  CA  . ALA C 3 87  ? 56.885  9.427   94.116  1.00 61.34  ? 174 ALA C CA  1 
ATOM   3869  C  C   . ALA C 3 87  ? 55.967  10.378  93.362  1.00 62.42  ? 174 ALA C C   1 
ATOM   3870  O  O   . ALA C 3 87  ? 54.897  10.744  93.850  1.00 64.94  ? 174 ALA C O   1 
ATOM   3871  C  CB  . ALA C 3 87  ? 56.589  7.998   93.693  1.00 58.45  ? 174 ALA C CB  1 
ATOM   3872  N  N   . ASN C 3 88  ? 56.389  10.767  92.164  1.00 60.11  ? 175 ASN C N   1 
ATOM   3873  C  CA  . ASN C 3 88  ? 55.596  11.671  91.351  1.00 62.25  ? 175 ASN C CA  1 
ATOM   3874  C  C   . ASN C 3 88  ? 54.800  10.914  90.288  1.00 56.61  ? 175 ASN C C   1 
ATOM   3875  O  O   . ASN C 3 88  ? 53.611  11.175  90.079  1.00 59.32  ? 175 ASN C O   1 
ATOM   3876  C  CB  . ASN C 3 88  ? 56.478  12.770  90.731  1.00 67.78  ? 175 ASN C CB  1 
ATOM   3877  C  CG  . ASN C 3 88  ? 57.788  12.237  90.177  1.00 71.16  ? 175 ASN C CG  1 
ATOM   3878  O  OD1 . ASN C 3 88  ? 58.734  12.003  90.925  1.00 75.92  ? 175 ASN C OD1 1 
ATOM   3879  N  ND2 . ASN C 3 88  ? 57.855  12.065  88.860  1.00 70.09  ? 175 ASN C ND2 1 
ATOM   3880  N  N   . GLN C 3 89  ? 55.458  9.971   89.619  1.00 52.70  ? 176 GLN C N   1 
ATOM   3881  C  CA  . GLN C 3 89  ? 54.805  9.167   88.588  1.00 49.84  ? 176 GLN C CA  1 
ATOM   3882  C  C   . GLN C 3 89  ? 54.795  7.687   89.005  1.00 44.40  ? 176 GLN C C   1 
ATOM   3883  O  O   . GLN C 3 89  ? 55.813  7.140   89.458  1.00 40.13  ? 176 GLN C O   1 
ATOM   3884  C  CB  . GLN C 3 89  ? 55.477  9.356   87.210  1.00 55.73  ? 176 GLN C CB  1 
ATOM   3885  C  CG  . GLN C 3 89  ? 56.724  8.482   86.931  1.00 64.81  ? 176 GLN C CG  1 
ATOM   3886  C  CD  . GLN C 3 89  ? 58.062  9.175   87.218  1.00 72.33  ? 176 GLN C CD  1 
ATOM   3887  O  OE1 . GLN C 3 89  ? 58.486  10.070  86.476  1.00 74.93  ? 176 GLN C OE1 1 
ATOM   3888  N  NE2 . GLN C 3 89  ? 58.747  8.734   88.280  1.00 73.01  ? 176 GLN C NE2 1 
ATOM   3889  N  N   . GLN C 3 90  ? 53.625  7.060   88.877  1.00 44.03  ? 177 GLN C N   1 
ATOM   3890  C  CA  . GLN C 3 90  ? 53.433  5.653   89.228  1.00 38.32  ? 177 GLN C CA  1 
ATOM   3891  C  C   . GLN C 3 90  ? 54.247  4.717   88.349  1.00 31.02  ? 177 GLN C C   1 
ATOM   3892  O  O   . GLN C 3 90  ? 54.895  5.133   87.399  1.00 28.99  ? 177 GLN C O   1 
ATOM   3893  C  CB  . GLN C 3 90  ? 51.955  5.272   89.120  1.00 39.76  ? 177 GLN C CB  1 
ATOM   3894  C  CG  . GLN C 3 90  ? 51.417  5.213   87.699  1.00 41.23  ? 177 GLN C CG  1 
ATOM   3895  C  CD  . GLN C 3 90  ? 49.940  4.821   87.621  1.00 45.97  ? 177 GLN C CD  1 
ATOM   3896  O  OE1 . GLN C 3 90  ? 49.274  5.075   86.613  1.00 44.47  ? 177 GLN C OE1 1 
ATOM   3897  N  NE2 . GLN C 3 90  ? 49.425  4.205   88.682  1.00 51.96  ? 177 GLN C NE2 1 
ATOM   3898  N  N   . PHE C 3 91  ? 54.226  3.438   88.680  1.00 28.09  ? 178 PHE C N   1 
ATOM   3899  C  CA  . PHE C 3 91  ? 54.958  2.467   87.890  1.00 21.26  ? 178 PHE C CA  1 
ATOM   3900  C  C   . PHE C 3 91  ? 54.501  1.057   88.151  1.00 23.35  ? 178 PHE C C   1 
ATOM   3901  O  O   . PHE C 3 91  ? 53.856  0.756   89.161  1.00 29.11  ? 178 PHE C O   1 
ATOM   3902  C  CB  . PHE C 3 91  ? 56.465  2.593   88.093  1.00 15.92  ? 178 PHE C CB  1 
ATOM   3903  C  CG  . PHE C 3 91  ? 56.876  2.722   89.522  1.00 14.16  ? 178 PHE C CG  1 
ATOM   3904  C  CD1 . PHE C 3 91  ? 57.009  1.598   90.321  1.00 16.04  ? 178 PHE C CD1 1 
ATOM   3905  C  CD2 . PHE C 3 91  ? 57.153  3.971   90.068  1.00 19.24  ? 178 PHE C CD2 1 
ATOM   3906  C  CE1 . PHE C 3 91  ? 57.412  1.709   91.646  1.00 20.42  ? 178 PHE C CE1 1 
ATOM   3907  C  CE2 . PHE C 3 91  ? 57.557  4.098   91.387  1.00 20.96  ? 178 PHE C CE2 1 
ATOM   3908  C  CZ  . PHE C 3 91  ? 57.687  2.964   92.180  1.00 22.66  ? 178 PHE C CZ  1 
ATOM   3909  N  N   . LEU C 3 92  ? 54.824  0.204   87.197  1.00 22.98  ? 179 LEU C N   1 
ATOM   3910  C  CA  . LEU C 3 92  ? 54.455  -1.196  87.236  1.00 26.21  ? 179 LEU C CA  1 
ATOM   3911  C  C   . LEU C 3 92  ? 55.508  -1.995  87.959  1.00 29.38  ? 179 LEU C C   1 
ATOM   3912  O  O   . LEU C 3 92  ? 56.696  -1.777  87.767  1.00 33.63  ? 179 LEU C O   1 
ATOM   3913  C  CB  . LEU C 3 92  ? 54.306  -1.733  85.813  1.00 22.33  ? 179 LEU C CB  1 
ATOM   3914  C  CG  . LEU C 3 92  ? 53.630  -3.075  85.583  1.00 21.65  ? 179 LEU C CG  1 
ATOM   3915  C  CD1 . LEU C 3 92  ? 52.165  -2.940  85.949  1.00 22.38  ? 179 LEU C CD1 1 
ATOM   3916  C  CD2 . LEU C 3 92  ? 53.792  -3.494  84.129  1.00 18.85  ? 179 LEU C CD2 1 
ATOM   3917  N  N   . VAL C 3 93  ? 55.043  -2.946  88.758  1.00 29.75  ? 180 VAL C N   1 
ATOM   3918  C  CA  . VAL C 3 93  ? 55.881  -3.835  89.553  1.00 27.13  ? 180 VAL C CA  1 
ATOM   3919  C  C   . VAL C 3 93  ? 55.227  -5.210  89.565  1.00 25.73  ? 180 VAL C C   1 
ATOM   3920  O  O   . VAL C 3 93  ? 54.112  -5.373  89.076  1.00 21.21  ? 180 VAL C O   1 
ATOM   3921  C  CB  . VAL C 3 93  ? 55.973  -3.355  91.027  1.00 27.00  ? 180 VAL C CB  1 
ATOM   3922  C  CG1 . VAL C 3 93  ? 56.477  -1.939  91.080  1.00 31.62  ? 180 VAL C CG1 1 
ATOM   3923  C  CG2 . VAL C 3 93  ? 54.625  -3.464  91.722  1.00 25.36  ? 180 VAL C CG2 1 
ATOM   3924  N  N   . TYR C 3 94  ? 55.926  -6.200  90.108  1.00 28.56  ? 181 TYR C N   1 
ATOM   3925  C  CA  . TYR C 3 94  ? 55.353  -7.525  90.216  1.00 31.76  ? 181 TYR C CA  1 
ATOM   3926  C  C   . TYR C 3 94  ? 55.046  -7.810  91.681  1.00 32.16  ? 181 TYR C C   1 
ATOM   3927  O  O   . TYR C 3 94  ? 55.950  -7.837  92.522  1.00 37.54  ? 181 TYR C O   1 
ATOM   3928  C  CB  . TYR C 3 94  ? 56.293  -8.594  89.660  1.00 37.90  ? 181 TYR C CB  1 
ATOM   3929  C  CG  . TYR C 3 94  ? 55.709  -9.995  89.737  1.00 46.82  ? 181 TYR C CG  1 
ATOM   3930  C  CD1 . TYR C 3 94  ? 54.574  -10.348 88.984  1.00 53.00  ? 181 TYR C CD1 1 
ATOM   3931  C  CD2 . TYR C 3 94  ? 56.256  -10.954 90.591  1.00 46.17  ? 181 TYR C CD2 1 
ATOM   3932  C  CE1 . TYR C 3 94  ? 53.999  -11.621 89.089  1.00 55.61  ? 181 TYR C CE1 1 
ATOM   3933  C  CE2 . TYR C 3 94  ? 55.691  -12.229 90.704  1.00 52.05  ? 181 TYR C CE2 1 
ATOM   3934  C  CZ  . TYR C 3 94  ? 54.564  -12.560 89.955  1.00 58.11  ? 181 TYR C CZ  1 
ATOM   3935  O  OH  . TYR C 3 94  ? 54.000  -13.822 90.085  1.00 63.31  ? 181 TYR C OH  1 
ATOM   3936  N  N   . CYS C 3 95  ? 53.764  -7.984  91.984  1.00 29.70  ? 182 CYS C N   1 
ATOM   3937  C  CA  . CYS C 3 95  ? 53.321  -8.279  93.337  1.00 26.42  ? 182 CYS C CA  1 
ATOM   3938  C  C   . CYS C 3 95  ? 53.149  -9.780  93.539  1.00 30.24  ? 182 CYS C C   1 
ATOM   3939  O  O   . CYS C 3 95  ? 52.602  -10.463 92.687  1.00 31.45  ? 182 CYS C O   1 
ATOM   3940  C  CB  . CYS C 3 95  ? 52.000  -7.571  93.609  1.00 20.25  ? 182 CYS C CB  1 
ATOM   3941  S  SG  . CYS C 3 95  ? 52.174  -5.769  93.718  1.00 31.19  ? 182 CYS C SG  1 
ATOM   3942  N  N   . GLU C 3 96  ? 53.686  -10.299 94.634  1.00 34.69  ? 183 GLU C N   1 
ATOM   3943  C  CA  . GLU C 3 96  ? 53.549  -11.711 94.965  1.00 34.71  ? 183 GLU C CA  1 
ATOM   3944  C  C   . GLU C 3 96  ? 52.601  -11.767 96.172  1.00 39.14  ? 183 GLU C C   1 
ATOM   3945  O  O   . GLU C 3 96  ? 52.947  -11.306 97.262  1.00 43.90  ? 183 GLU C O   1 
ATOM   3946  C  CB  . GLU C 3 96  ? 54.910  -12.308 95.314  1.00 32.21  ? 183 GLU C CB  1 
ATOM   3947  C  CG  . GLU C 3 96  ? 54.850  -13.772 95.663  1.00 40.17  ? 183 GLU C CG  1 
ATOM   3948  C  CD  . GLU C 3 96  ? 56.198  -14.362 96.036  1.00 49.55  ? 183 GLU C CD  1 
ATOM   3949  O  OE1 . GLU C 3 96  ? 57.137  -14.274 95.215  1.00 52.41  ? 183 GLU C OE1 1 
ATOM   3950  O  OE2 . GLU C 3 96  ? 56.312  -14.937 97.144  1.00 54.79  ? 183 GLU C OE2 1 
ATOM   3951  N  N   . ILE C 3 97  ? 51.391  -12.282 95.967  1.00 39.96  ? 184 ILE C N   1 
ATOM   3952  C  CA  . ILE C 3 97  ? 50.403  -12.360 97.036  1.00 36.75  ? 184 ILE C CA  1 
ATOM   3953  C  C   . ILE C 3 97  ? 50.084  -13.773 97.489  1.00 40.57  ? 184 ILE C C   1 
ATOM   3954  O  O   . ILE C 3 97  ? 49.586  -14.581 96.711  1.00 40.55  ? 184 ILE C O   1 
ATOM   3955  C  CB  . ILE C 3 97  ? 49.100  -11.722 96.599  1.00 32.58  ? 184 ILE C CB  1 
ATOM   3956  C  CG1 . ILE C 3 97  ? 49.365  -10.312 96.108  1.00 30.79  ? 184 ILE C CG1 1 
ATOM   3957  C  CG2 . ILE C 3 97  ? 48.118  -11.707 97.751  1.00 34.53  ? 184 ILE C CG2 1 
ATOM   3958  C  CD1 . ILE C 3 97  ? 48.194  -9.697  95.451  1.00 30.60  ? 184 ILE C CD1 1 
ATOM   3959  N  N   . ASP C 3 98  ? 50.336  -14.064 98.759  1.00 48.92  ? 185 ASP C N   1 
ATOM   3960  C  CA  . ASP C 3 98  ? 50.028  -15.389 99.284  1.00 56.56  ? 185 ASP C CA  1 
ATOM   3961  C  C   . ASP C 3 98  ? 48.607  -15.407 99.868  1.00 64.36  ? 185 ASP C C   1 
ATOM   3962  O  O   . ASP C 3 98  ? 47.920  -14.378 99.893  1.00 67.81  ? 185 ASP C O   1 
ATOM   3963  C  CB  . ASP C 3 98  ? 51.066  -15.831 100.328 1.00 55.31  ? 185 ASP C CB  1 
ATOM   3964  C  CG  . ASP C 3 98  ? 51.214  -14.850 101.480 1.00 58.82  ? 185 ASP C CG  1 
ATOM   3965  O  OD1 . ASP C 3 98  ? 50.239  -14.167 101.862 1.00 56.78  ? 185 ASP C OD1 1 
ATOM   3966  O  OD2 . ASP C 3 98  ? 52.329  -14.781 102.027 1.00 66.54  ? 185 ASP C OD2 1 
ATOM   3967  N  N   . GLY C 3 99  ? 48.167  -16.579 100.319 1.00 67.20  ? 186 GLY C N   1 
ATOM   3968  C  CA  . GLY C 3 99  ? 46.841  -16.706 100.898 1.00 64.93  ? 186 GLY C CA  1 
ATOM   3969  C  C   . GLY C 3 99  ? 46.746  -16.103 102.289 1.00 62.68  ? 186 GLY C C   1 
ATOM   3970  O  O   . GLY C 3 99  ? 45.659  -15.759 102.751 1.00 62.68  ? 186 GLY C O   1 
ATOM   3971  N  N   . SER C 3 100 ? 47.887  -15.983 102.960 1.00 61.94  ? 187 SER C N   1 
ATOM   3972  C  CA  . SER C 3 100 ? 47.935  -15.416 104.302 1.00 62.66  ? 187 SER C CA  1 
ATOM   3973  C  C   . SER C 3 100 ? 47.732  -13.904 104.288 1.00 62.35  ? 187 SER C C   1 
ATOM   3974  O  O   . SER C 3 100 ? 47.571  -13.287 105.341 1.00 67.26  ? 187 SER C O   1 
ATOM   3975  C  CB  . SER C 3 100 ? 49.260  -15.761 104.964 1.00 65.65  ? 187 SER C CB  1 
ATOM   3976  O  OG  . SER C 3 100 ? 50.317  -15.506 104.063 1.00 67.74  ? 187 SER C OG  1 
ATOM   3977  N  N   . GLY C 3 101 ? 47.770  -13.310 103.098 1.00 60.67  ? 188 GLY C N   1 
ATOM   3978  C  CA  . GLY C 3 101 ? 47.548  -11.878 102.972 1.00 57.32  ? 188 GLY C CA  1 
ATOM   3979  C  C   . GLY C 3 101 ? 48.777  -11.014 102.808 1.00 51.88  ? 188 GLY C C   1 
ATOM   3980  O  O   . GLY C 3 101 ? 48.665  -9.790  102.774 1.00 49.05  ? 188 GLY C O   1 
ATOM   3981  N  N   . ASN C 3 102 ? 49.944  -11.642 102.717 1.00 49.27  ? 189 ASN C N   1 
ATOM   3982  C  CA  . ASN C 3 102 ? 51.193  -10.914 102.554 1.00 50.85  ? 189 ASN C CA  1 
ATOM   3983  C  C   . ASN C 3 102 ? 51.420  -10.496 101.108 1.00 53.15  ? 189 ASN C C   1 
ATOM   3984  O  O   . ASN C 3 102 ? 51.302  -11.315 100.195 1.00 55.89  ? 189 ASN C O   1 
ATOM   3985  C  CB  . ASN C 3 102 ? 52.362  -11.764 103.032 1.00 53.01  ? 189 ASN C CB  1 
ATOM   3986  C  CG  . ASN C 3 102 ? 52.225  -12.160 104.478 1.00 57.02  ? 189 ASN C CG  1 
ATOM   3987  O  OD1 . ASN C 3 102 ? 52.883  -11.595 105.359 1.00 60.05  ? 189 ASN C OD1 1 
ATOM   3988  N  ND2 . ASN C 3 102 ? 51.337  -13.110 104.744 1.00 55.37  ? 189 ASN C ND2 1 
ATOM   3989  N  N   . GLY C 3 103 ? 51.752  -9.219  100.919 1.00 52.52  ? 190 GLY C N   1 
ATOM   3990  C  CA  . GLY C 3 103 ? 51.991  -8.671  99.593  1.00 47.54  ? 190 GLY C CA  1 
ATOM   3991  C  C   . GLY C 3 103 ? 53.438  -8.278  99.345  1.00 44.95  ? 190 GLY C C   1 
ATOM   3992  O  O   . GLY C 3 103 ? 53.859  -7.141  99.604  1.00 46.12  ? 190 GLY C O   1 
ATOM   3993  N  N   . TRP C 3 104 ? 54.208  -9.241  98.859  1.00 37.55  ? 191 TRP C N   1 
ATOM   3994  C  CA  . TRP C 3 104 ? 55.611  -9.031  98.548  1.00 36.67  ? 191 TRP C CA  1 
ATOM   3995  C  C   . TRP C 3 104 ? 55.771  -8.217  97.276  1.00 40.71  ? 191 TRP C C   1 
ATOM   3996  O  O   . TRP C 3 104 ? 55.179  -8.519  96.239  1.00 43.15  ? 191 TRP C O   1 
ATOM   3997  C  CB  . TRP C 3 104 ? 56.297  -10.356 98.318  1.00 33.81  ? 191 TRP C CB  1 
ATOM   3998  C  CG  . TRP C 3 104 ? 56.404  -11.157 99.504  1.00 34.66  ? 191 TRP C CG  1 
ATOM   3999  C  CD1 . TRP C 3 104 ? 55.565  -12.145 99.907  1.00 34.59  ? 191 TRP C CD1 1 
ATOM   4000  C  CD2 . TRP C 3 104 ? 57.474  -11.129 100.425 1.00 41.29  ? 191 TRP C CD2 1 
ATOM   4001  N  NE1 . TRP C 3 104 ? 56.057  -12.757 101.023 1.00 40.42  ? 191 TRP C NE1 1 
ATOM   4002  C  CE2 . TRP C 3 104 ? 57.237  -12.152 101.367 1.00 44.45  ? 191 TRP C CE2 1 
ATOM   4003  C  CE3 . TRP C 3 104 ? 58.627  -10.341 100.548 1.00 42.97  ? 191 TRP C CE3 1 
ATOM   4004  C  CZ2 . TRP C 3 104 ? 58.116  -12.414 102.423 1.00 48.19  ? 191 TRP C CZ2 1 
ATOM   4005  C  CZ3 . TRP C 3 104 ? 59.499  -10.596 101.592 1.00 46.10  ? 191 TRP C CZ3 1 
ATOM   4006  C  CH2 . TRP C 3 104 ? 59.240  -11.628 102.518 1.00 49.45  ? 191 TRP C CH2 1 
ATOM   4007  N  N   . THR C 3 105 ? 56.582  -7.180  97.344  1.00 37.08  ? 192 THR C N   1 
ATOM   4008  C  CA  . THR C 3 105 ? 56.804  -6.379  96.163  1.00 32.49  ? 192 THR C CA  1 
ATOM   4009  C  C   . THR C 3 105 ? 58.240  -6.652  95.705  1.00 30.91  ? 192 THR C C   1 
ATOM   4010  O  O   . THR C 3 105 ? 59.211  -6.209  96.312  1.00 30.73  ? 192 THR C O   1 
ATOM   4011  C  CB  . THR C 3 105 ? 56.418  -4.880  96.409  1.00 30.58  ? 192 THR C CB  1 
ATOM   4012  O  OG1 . THR C 3 105 ? 57.319  -4.020  95.719  1.00 30.57  ? 192 THR C OG1 1 
ATOM   4013  C  CG2 . THR C 3 105 ? 56.337  -4.536  97.907  1.00 29.92  ? 192 THR C CG2 1 
ATOM   4014  N  N   . VAL C 3 106 ? 58.341  -7.493  94.683  1.00 26.36  ? 193 VAL C N   1 
ATOM   4015  C  CA  . VAL C 3 106 ? 59.608  -7.958  94.109  1.00 26.02  ? 193 VAL C CA  1 
ATOM   4016  C  C   . VAL C 3 106 ? 60.426  -6.974  93.261  1.00 26.50  ? 193 VAL C C   1 
ATOM   4017  O  O   . VAL C 3 106 ? 59.919  -6.419  92.287  1.00 28.05  ? 193 VAL C O   1 
ATOM   4018  C  CB  . VAL C 3 106 ? 59.339  -9.169  93.218  1.00 23.71  ? 193 VAL C CB  1 
ATOM   4019  C  CG1 . VAL C 3 106 ? 60.640  -9.833  92.822  1.00 25.00  ? 193 VAL C CG1 1 
ATOM   4020  C  CG2 . VAL C 3 106 ? 58.391  -10.123 93.905  1.00 25.24  ? 193 VAL C CG2 1 
ATOM   4021  N  N   . PHE C 3 107 ? 61.729  -6.898  93.515  1.00 23.89  ? 194 PHE C N   1 
ATOM   4022  C  CA  . PHE C 3 107 ? 62.572  -5.975  92.768  1.00 16.51  ? 194 PHE C CA  1 
ATOM   4023  C  C   . PHE C 3 107 ? 63.728  -6.575  92.013  1.00 15.68  ? 194 PHE C C   1 
ATOM   4024  O  O   . PHE C 3 107 ? 64.522  -5.857  91.428  1.00 24.31  ? 194 PHE C O   1 
ATOM   4025  C  CB  . PHE C 3 107 ? 63.060  -4.812  93.657  1.00 18.77  ? 194 PHE C CB  1 
ATOM   4026  C  CG  . PHE C 3 107 ? 64.125  -5.185  94.668  1.00 18.75  ? 194 PHE C CG  1 
ATOM   4027  C  CD1 . PHE C 3 107 ? 65.474  -5.123  94.322  1.00 21.79  ? 194 PHE C CD1 1 
ATOM   4028  C  CD2 . PHE C 3 107 ? 63.786  -5.511  95.982  1.00 16.20  ? 194 PHE C CD2 1 
ATOM   4029  C  CE1 . PHE C 3 107 ? 66.478  -5.371  95.263  1.00 19.93  ? 194 PHE C CE1 1 
ATOM   4030  C  CE2 . PHE C 3 107 ? 64.772  -5.762  96.925  1.00 21.22  ? 194 PHE C CE2 1 
ATOM   4031  C  CZ  . PHE C 3 107 ? 66.133  -5.688  96.562  1.00 19.14  ? 194 PHE C CZ  1 
ATOM   4032  N  N   . GLN C 3 108 ? 63.813  -7.891  91.986  1.00 15.04  ? 195 GLN C N   1 
ATOM   4033  C  CA  . GLN C 3 108 ? 64.893  -8.549  91.260  1.00 11.57  ? 195 GLN C CA  1 
ATOM   4034  C  C   . GLN C 3 108 ? 64.596  -10.038 91.151  1.00 14.65  ? 195 GLN C C   1 
ATOM   4035  O  O   . GLN C 3 108 ? 64.196  -10.671 92.120  1.00 22.21  ? 195 GLN C O   1 
ATOM   4036  C  CB  . GLN C 3 108 ? 66.215  -8.316  91.997  1.00 13.98  ? 195 GLN C CB  1 
ATOM   4037  C  CG  . GLN C 3 108 ? 66.974  -9.584  92.417  1.00 18.99  ? 195 GLN C CG  1 
ATOM   4038  C  CD  . GLN C 3 108 ? 67.989  -9.970  91.415  1.00 18.55  ? 195 GLN C CD  1 
ATOM   4039  O  OE1 . GLN C 3 108 ? 68.478  -11.092 91.399  1.00 12.70  ? 195 GLN C OE1 1 
ATOM   4040  N  NE2 . GLN C 3 108 ? 68.316  -9.028  90.545  1.00 22.21  ? 195 GLN C NE2 1 
ATOM   4041  N  N   . LYS C 3 109 ? 64.820  -10.612 89.985  1.00 14.77  ? 196 LYS C N   1 
ATOM   4042  C  CA  . LYS C 3 109 ? 64.557  -12.029 89.800  1.00 14.00  ? 196 LYS C CA  1 
ATOM   4043  C  C   . LYS C 3 109 ? 65.397  -12.549 88.658  1.00 10.43  ? 196 LYS C C   1 
ATOM   4044  O  O   . LYS C 3 109 ? 65.525  -11.917 87.630  1.00 12.31  ? 196 LYS C O   1 
ATOM   4045  C  CB  . LYS C 3 109 ? 63.057  -12.260 89.525  1.00 19.48  ? 196 LYS C CB  1 
ATOM   4046  C  CG  . LYS C 3 109 ? 62.688  -13.613 88.921  1.00 21.41  ? 196 LYS C CG  1 
ATOM   4047  C  CD  . LYS C 3 109 ? 62.873  -14.748 89.912  1.00 31.68  ? 196 LYS C CD  1 
ATOM   4048  C  CE  . LYS C 3 109 ? 61.810  -14.689 90.993  1.00 43.16  ? 196 LYS C CE  1 
ATOM   4049  N  NZ  . LYS C 3 109 ? 60.399  -14.767 90.479  1.00 41.72  ? 196 LYS C NZ  1 
ATOM   4050  N  N   . ARG C 3 110 ? 66.027  -13.684 88.877  1.00 13.91  ? 197 ARG C N   1 
ATOM   4051  C  CA  . ARG C 3 110 ? 66.849  -14.301 87.848  1.00 18.92  ? 197 ARG C CA  1 
ATOM   4052  C  C   . ARG C 3 110 ? 66.242  -15.682 87.737  1.00 18.47  ? 197 ARG C C   1 
ATOM   4053  O  O   . ARG C 3 110 ? 65.666  -16.163 88.716  1.00 23.35  ? 197 ARG C O   1 
ATOM   4054  C  CB  . ARG C 3 110 ? 68.302  -14.436 88.332  1.00 9.82   ? 197 ARG C CB  1 
ATOM   4055  C  CG  . ARG C 3 110 ? 68.875  -13.175 88.953  1.00 4.32   ? 197 ARG C CG  1 
ATOM   4056  C  CD  . ARG C 3 110 ? 69.089  -12.130 87.906  1.00 10.27  ? 197 ARG C CD  1 
ATOM   4057  N  NE  . ARG C 3 110 ? 70.022  -12.561 86.850  1.00 25.91  ? 197 ARG C NE  1 
ATOM   4058  C  CZ  . ARG C 3 110 ? 71.362  -12.482 86.892  1.00 16.52  ? 197 ARG C CZ  1 
ATOM   4059  N  NH1 . ARG C 3 110 ? 72.004  -11.992 87.954  1.00 8.60   ? 197 ARG C NH1 1 
ATOM   4060  N  NH2 . ARG C 3 110 ? 72.060  -12.861 85.828  1.00 4.10   ? 197 ARG C NH2 1 
ATOM   4061  N  N   . LEU C 3 111 ? 66.316  -16.305 86.561  1.00 12.65  ? 198 LEU C N   1 
ATOM   4062  C  CA  . LEU C 3 111 ? 65.786  -17.649 86.431  1.00 12.95  ? 198 LEU C CA  1 
ATOM   4063  C  C   . LEU C 3 111 ? 66.174  -18.401 85.183  1.00 13.87  ? 198 LEU C C   1 
ATOM   4064  O  O   . LEU C 3 111 ? 65.975  -19.611 85.111  1.00 18.61  ? 198 LEU C O   1 
ATOM   4065  C  CB  . LEU C 3 111 ? 64.263  -17.664 86.638  1.00 19.47  ? 198 LEU C CB  1 
ATOM   4066  C  CG  . LEU C 3 111 ? 63.397  -16.599 85.970  1.00 18.78  ? 198 LEU C CG  1 
ATOM   4067  C  CD1 . LEU C 3 111 ? 63.311  -16.844 84.483  1.00 12.26  ? 198 LEU C CD1 1 
ATOM   4068  C  CD2 . LEU C 3 111 ? 62.025  -16.649 86.581  1.00 21.99  ? 198 LEU C CD2 1 
ATOM   4069  N  N   . ASP C 3 112 ? 66.762  -17.718 84.214  1.00 14.74  ? 199 ASP C N   1 
ATOM   4070  C  CA  . ASP C 3 112 ? 67.149  -18.397 82.981  1.00 22.98  ? 199 ASP C CA  1 
ATOM   4071  C  C   . ASP C 3 112 ? 68.377  -17.792 82.303  1.00 27.28  ? 199 ASP C C   1 
ATOM   4072  O  O   . ASP C 3 112 ? 68.898  -18.340 81.342  1.00 29.05  ? 199 ASP C O   1 
ATOM   4073  C  CB  . ASP C 3 112 ? 65.958  -18.440 82.003  1.00 26.04  ? 199 ASP C CB  1 
ATOM   4074  C  CG  . ASP C 3 112 ? 65.275  -17.072 81.822  1.00 35.15  ? 199 ASP C CG  1 
ATOM   4075  O  OD1 . ASP C 3 112 ? 65.906  -16.049 82.150  1.00 36.61  ? 199 ASP C OD1 1 
ATOM   4076  O  OD2 . ASP C 3 112 ? 64.100  -17.012 81.360  1.00 33.72  ? 199 ASP C OD2 1 
ATOM   4077  N  N   . GLY C 3 113 ? 68.870  -16.686 82.837  1.00 27.77  ? 200 GLY C N   1 
ATOM   4078  C  CA  . GLY C 3 113 ? 70.009  -16.045 82.220  1.00 28.04  ? 200 GLY C CA  1 
ATOM   4079  C  C   . GLY C 3 113 ? 69.592  -15.385 80.915  1.00 33.62  ? 200 GLY C C   1 
ATOM   4080  O  O   . GLY C 3 113 ? 70.436  -14.999 80.100  1.00 32.97  ? 200 GLY C O   1 
ATOM   4081  N  N   . SER C 3 114 ? 68.283  -15.227 80.729  1.00 34.00  ? 201 SER C N   1 
ATOM   4082  C  CA  . SER C 3 114 ? 67.747  -14.625 79.516  1.00 34.20  ? 201 SER C CA  1 
ATOM   4083  C  C   . SER C 3 114 ? 68.066  -13.132 79.352  1.00 33.06  ? 201 SER C C   1 
ATOM   4084  O  O   . SER C 3 114 ? 68.029  -12.607 78.233  1.00 38.72  ? 201 SER C O   1 
ATOM   4085  C  CB  . SER C 3 114 ? 66.239  -14.824 79.473  1.00 33.93  ? 201 SER C CB  1 
ATOM   4086  O  OG  . SER C 3 114 ? 65.620  -14.124 80.544  1.00 34.81  ? 201 SER C OG  1 
ATOM   4087  N  N   . VAL C 3 115 ? 68.322  -12.447 80.464  1.00 26.84  ? 202 VAL C N   1 
ATOM   4088  C  CA  . VAL C 3 115 ? 68.632  -11.023 80.432  1.00 27.47  ? 202 VAL C CA  1 
ATOM   4089  C  C   . VAL C 3 115 ? 70.028  -10.769 80.945  1.00 31.49  ? 202 VAL C C   1 
ATOM   4090  O  O   . VAL C 3 115 ? 70.499  -11.439 81.859  1.00 37.76  ? 202 VAL C O   1 
ATOM   4091  C  CB  . VAL C 3 115 ? 67.643  -10.212 81.272  1.00 24.76  ? 202 VAL C CB  1 
ATOM   4092  C  CG1 . VAL C 3 115 ? 68.104  -8.780  81.390  1.00 21.92  ? 202 VAL C CG1 1 
ATOM   4093  C  CG2 . VAL C 3 115 ? 66.258  -10.288 80.656  1.00 26.02  ? 202 VAL C CG2 1 
ATOM   4094  N  N   . ASP C 3 116 ? 70.698  -9.808  80.335  1.00 32.62  ? 203 ASP C N   1 
ATOM   4095  C  CA  . ASP C 3 116 ? 72.046  -9.469  80.730  1.00 35.90  ? 203 ASP C CA  1 
ATOM   4096  C  C   . ASP C 3 116 ? 72.024  -8.381  81.789  1.00 36.46  ? 203 ASP C C   1 
ATOM   4097  O  O   . ASP C 3 116 ? 71.415  -7.329  81.587  1.00 39.13  ? 203 ASP C O   1 
ATOM   4098  C  CB  . ASP C 3 116 ? 72.841  -9.008  79.515  1.00 40.47  ? 203 ASP C CB  1 
ATOM   4099  C  CG  . ASP C 3 116 ? 74.270  -8.649  79.859  1.00 45.48  ? 203 ASP C CG  1 
ATOM   4100  O  OD1 . ASP C 3 116 ? 74.953  -9.433  80.554  1.00 46.44  ? 203 ASP C OD1 1 
ATOM   4101  O  OD2 . ASP C 3 116 ? 74.716  -7.566  79.435  1.00 49.95  ? 203 ASP C OD2 1 
ATOM   4102  N  N   . PHE C 3 117 ? 72.678  -8.648  82.920  1.00 34.13  ? 204 PHE C N   1 
ATOM   4103  C  CA  . PHE C 3 117 ? 72.756  -7.694  84.023  1.00 26.82  ? 204 PHE C CA  1 
ATOM   4104  C  C   . PHE C 3 117 ? 74.008  -6.821  83.995  1.00 20.19  ? 204 PHE C C   1 
ATOM   4105  O  O   . PHE C 3 117 ? 74.303  -6.113  84.948  1.00 11.86  ? 204 PHE C O   1 
ATOM   4106  C  CB  . PHE C 3 117 ? 72.600  -8.400  85.365  1.00 25.23  ? 204 PHE C CB  1 
ATOM   4107  C  CG  . PHE C 3 117 ? 71.171  -8.590  85.784  1.00 23.80  ? 204 PHE C CG  1 
ATOM   4108  C  CD1 . PHE C 3 117 ? 70.325  -9.431  85.070  1.00 27.87  ? 204 PHE C CD1 1 
ATOM   4109  C  CD2 . PHE C 3 117 ? 70.649  -7.887  86.854  1.00 23.16  ? 204 PHE C CD2 1 
ATOM   4110  C  CE1 . PHE C 3 117 ? 68.960  -9.568  85.414  1.00 23.94  ? 204 PHE C CE1 1 
ATOM   4111  C  CE2 . PHE C 3 117 ? 69.289  -8.017  87.205  1.00 28.34  ? 204 PHE C CE2 1 
ATOM   4112  C  CZ  . PHE C 3 117 ? 68.447  -8.861  86.476  1.00 24.20  ? 204 PHE C CZ  1 
ATOM   4113  N  N   . LYS C 3 118 ? 74.718  -6.853  82.872  1.00 16.07  ? 205 LYS C N   1 
ATOM   4114  C  CA  . LYS C 3 118 ? 75.908  -6.025  82.681  1.00 23.06  ? 205 LYS C CA  1 
ATOM   4115  C  C   . LYS C 3 118 ? 75.377  -4.681  82.174  1.00 17.94  ? 205 LYS C C   1 
ATOM   4116  O  O   . LYS C 3 118 ? 75.640  -4.282  81.042  1.00 22.14  ? 205 LYS C O   1 
ATOM   4117  C  CB  . LYS C 3 118 ? 76.807  -6.664  81.625  1.00 28.78  ? 205 LYS C CB  1 
ATOM   4118  C  CG  . LYS C 3 118 ? 78.017  -5.860  81.234  1.00 35.93  ? 205 LYS C CG  1 
ATOM   4119  C  CD  . LYS C 3 118 ? 78.933  -5.659  82.411  1.00 47.81  ? 205 LYS C CD  1 
ATOM   4120  C  CE  . LYS C 3 118 ? 80.307  -5.157  81.966  1.00 57.11  ? 205 LYS C CE  1 
ATOM   4121  N  NZ  . LYS C 3 118 ? 81.010  -6.130  81.082  1.00 63.64  ? 205 LYS C NZ  1 
ATOM   4122  N  N   . LYS C 3 119 ? 74.605  -4.001  83.005  1.00 4.73   ? 206 LYS C N   1 
ATOM   4123  C  CA  . LYS C 3 119 ? 74.013  -2.738  82.598  1.00 17.69  ? 206 LYS C CA  1 
ATOM   4124  C  C   . LYS C 3 119 ? 74.679  -1.529  83.255  1.00 23.40  ? 206 LYS C C   1 
ATOM   4125  O  O   . LYS C 3 119 ? 75.290  -1.661  84.317  1.00 30.44  ? 206 LYS C O   1 
ATOM   4126  C  CB  . LYS C 3 119 ? 72.489  -2.776  82.858  1.00 16.95  ? 206 LYS C CB  1 
ATOM   4127  C  CG  . LYS C 3 119 ? 71.784  -3.844  82.021  1.00 14.36  ? 206 LYS C CG  1 
ATOM   4128  C  CD  . LYS C 3 119 ? 72.093  -3.618  80.528  1.00 26.25  ? 206 LYS C CD  1 
ATOM   4129  C  CE  . LYS C 3 119 ? 71.720  -4.795  79.593  1.00 32.62  ? 206 LYS C CE  1 
ATOM   4130  N  NZ  . LYS C 3 119 ? 70.252  -5.082  79.507  1.00 41.52  ? 206 LYS C NZ  1 
ATOM   4131  N  N   . ASN C 3 120 ? 74.597  -0.365  82.610  1.00 21.63  ? 207 ASN C N   1 
ATOM   4132  C  CA  . ASN C 3 120 ? 75.208  0.832   83.162  1.00 21.27  ? 207 ASN C CA  1 
ATOM   4133  C  C   . ASN C 3 120 ? 74.434  1.447   84.312  1.00 23.17  ? 207 ASN C C   1 
ATOM   4134  O  O   . ASN C 3 120 ? 73.456  0.881   84.797  1.00 29.37  ? 207 ASN C O   1 
ATOM   4135  C  CB  . ASN C 3 120 ? 75.474  1.884   82.084  1.00 28.74  ? 207 ASN C CB  1 
ATOM   4136  C  CG  . ASN C 3 120 ? 74.213  2.536   81.557  1.00 34.27  ? 207 ASN C CG  1 
ATOM   4137  O  OD1 . ASN C 3 120 ? 73.277  2.817   82.306  1.00 36.00  ? 207 ASN C OD1 1 
ATOM   4138  N  ND2 . ASN C 3 120 ? 74.204  2.826   80.255  1.00 38.65  ? 207 ASN C ND2 1 
ATOM   4139  N  N   . TRP C 3 121 ? 74.846  2.653   84.687  1.00 22.01  ? 208 TRP C N   1 
ATOM   4140  C  CA  . TRP C 3 121 ? 74.251  3.373   85.788  1.00 19.83  ? 208 TRP C CA  1 
ATOM   4141  C  C   . TRP C 3 121 ? 72.785  3.699   85.584  1.00 20.66  ? 208 TRP C C   1 
ATOM   4142  O  O   . TRP C 3 121 ? 71.925  3.366   86.393  1.00 21.31  ? 208 TRP C O   1 
ATOM   4143  C  CB  . TRP C 3 121 ? 75.026  4.664   86.031  1.00 17.42  ? 208 TRP C CB  1 
ATOM   4144  C  CG  . TRP C 3 121 ? 74.510  5.382   87.221  1.00 19.03  ? 208 TRP C CG  1 
ATOM   4145  C  CD1 . TRP C 3 121 ? 73.686  6.466   87.235  1.00 20.17  ? 208 TRP C CD1 1 
ATOM   4146  C  CD2 . TRP C 3 121 ? 74.719  5.017   88.578  1.00 20.40  ? 208 TRP C CD2 1 
ATOM   4147  N  NE1 . TRP C 3 121 ? 73.358  6.793   88.525  1.00 23.02  ? 208 TRP C NE1 1 
ATOM   4148  C  CE2 . TRP C 3 121 ? 73.983  5.920   89.371  1.00 21.58  ? 208 TRP C CE2 1 
ATOM   4149  C  CE3 . TRP C 3 121 ? 75.456  4.010   89.204  1.00 25.02  ? 208 TRP C CE3 1 
ATOM   4150  C  CZ2 . TRP C 3 121 ? 73.963  5.847   90.766  1.00 30.23  ? 208 TRP C CZ2 1 
ATOM   4151  C  CZ3 . TRP C 3 121 ? 75.440  3.934   90.582  1.00 30.37  ? 208 TRP C CZ3 1 
ATOM   4152  C  CH2 . TRP C 3 121 ? 74.696  4.848   91.353  1.00 32.70  ? 208 TRP C CH2 1 
ATOM   4153  N  N   . ILE C 3 122 ? 72.526  4.407   84.511  1.00 18.73  ? 209 ILE C N   1 
ATOM   4154  C  CA  . ILE C 3 122 ? 71.194  4.840   84.186  1.00 23.84  ? 209 ILE C CA  1 
ATOM   4155  C  C   . ILE C 3 122 ? 70.258  3.655   84.129  1.00 27.60  ? 209 ILE C C   1 
ATOM   4156  O  O   . ILE C 3 122 ? 69.167  3.676   84.695  1.00 32.74  ? 209 ILE C O   1 
ATOM   4157  C  CB  . ILE C 3 122 ? 71.185  5.512   82.821  1.00 28.63  ? 209 ILE C CB  1 
ATOM   4158  C  CG1 . ILE C 3 122 ? 72.312  6.552   82.737  1.00 36.81  ? 209 ILE C CG1 1 
ATOM   4159  C  CG2 . ILE C 3 122 ? 69.816  6.101   82.544  1.00 27.02  ? 209 ILE C CG2 1 
ATOM   4160  C  CD1 . ILE C 3 122 ? 73.780  5.960   82.640  1.00 38.98  ? 209 ILE C CD1 1 
ATOM   4161  N  N   . GLN C 3 123 ? 70.713  2.603   83.462  1.00 22.70  ? 210 GLN C N   1 
ATOM   4162  C  CA  . GLN C 3 123 ? 69.905  1.409   83.301  1.00 22.68  ? 210 GLN C CA  1 
ATOM   4163  C  C   . GLN C 3 123 ? 69.577  0.754   84.629  1.00 25.28  ? 210 GLN C C   1 
ATOM   4164  O  O   . GLN C 3 123 ? 68.472  0.246   84.827  1.00 21.73  ? 210 GLN C O   1 
ATOM   4165  C  CB  . GLN C 3 123 ? 70.598  0.435   82.357  1.00 22.10  ? 210 GLN C CB  1 
ATOM   4166  C  CG  . GLN C 3 123 ? 70.782  1.000   80.963  1.00 26.51  ? 210 GLN C CG  1 
ATOM   4167  C  CD  . GLN C 3 123 ? 71.487  0.047   80.016  1.00 30.95  ? 210 GLN C CD  1 
ATOM   4168  O  OE1 . GLN C 3 123 ? 72.511  -0.538  80.360  1.00 30.41  ? 210 GLN C OE1 1 
ATOM   4169  N  NE2 . GLN C 3 123 ? 70.951  -0.097  78.804  1.00 34.76  ? 210 GLN C NE2 1 
ATOM   4170  N  N   . TYR C 3 124 ? 70.527  0.793   85.554  1.00 28.12  ? 211 TYR C N   1 
ATOM   4171  C  CA  . TYR C 3 124 ? 70.314  0.203   86.865  1.00 24.91  ? 211 TYR C CA  1 
ATOM   4172  C  C   . TYR C 3 124 ? 69.473  1.129   87.752  1.00 28.38  ? 211 TYR C C   1 
ATOM   4173  O  O   . TYR C 3 124 ? 68.879  0.689   88.755  1.00 31.46  ? 211 TYR C O   1 
ATOM   4174  C  CB  . TYR C 3 124 ? 71.661  -0.165  87.508  1.00 22.86  ? 211 TYR C CB  1 
ATOM   4175  C  CG  . TYR C 3 124 ? 72.026  -1.642  87.354  1.00 22.80  ? 211 TYR C CG  1 
ATOM   4176  C  CD1 . TYR C 3 124 ? 71.500  -2.597  88.215  1.00 25.12  ? 211 TYR C CD1 1 
ATOM   4177  C  CD2 . TYR C 3 124 ? 72.887  -2.080  86.351  1.00 21.88  ? 211 TYR C CD2 1 
ATOM   4178  C  CE1 . TYR C 3 124 ? 71.814  -3.933  88.088  1.00 25.04  ? 211 TYR C CE1 1 
ATOM   4179  C  CE2 . TYR C 3 124 ? 73.208  -3.429  86.219  1.00 21.42  ? 211 TYR C CE2 1 
ATOM   4180  C  CZ  . TYR C 3 124 ? 72.661  -4.342  87.092  1.00 23.96  ? 211 TYR C CZ  1 
ATOM   4181  O  OH  . TYR C 3 124 ? 72.927  -5.677  86.960  1.00 27.81  ? 211 TYR C OH  1 
ATOM   4182  N  N   . LYS C 3 125 ? 69.372  2.392   87.340  1.00 23.01  ? 212 LYS C N   1 
ATOM   4183  C  CA  . LYS C 3 125 ? 68.604  3.378   88.075  1.00 20.38  ? 212 LYS C CA  1 
ATOM   4184  C  C   . LYS C 3 125 ? 67.159  3.349   87.647  1.00 22.09  ? 212 LYS C C   1 
ATOM   4185  O  O   . LYS C 3 125 ? 66.261  3.484   88.479  1.00 26.48  ? 212 LYS C O   1 
ATOM   4186  C  CB  . LYS C 3 125 ? 69.143  4.791   87.827  1.00 19.08  ? 212 LYS C CB  1 
ATOM   4187  C  CG  . LYS C 3 125 ? 68.225  5.888   88.378  1.00 10.52  ? 212 LYS C CG  1 
ATOM   4188  C  CD  . LYS C 3 125 ? 68.624  7.237   87.888  1.00 11.12  ? 212 LYS C CD  1 
ATOM   4189  C  CE  . LYS C 3 125 ? 67.684  8.281   88.389  1.00 13.78  ? 212 LYS C CE  1 
ATOM   4190  N  NZ  . LYS C 3 125 ? 68.025  9.570   87.753  1.00 19.63  ? 212 LYS C NZ  1 
ATOM   4191  N  N   . GLU C 3 126 ? 66.946  3.191   86.342  1.00 18.28  ? 213 GLU C N   1 
ATOM   4192  C  CA  . GLU C 3 126 ? 65.608  3.206   85.775  1.00 20.43  ? 213 GLU C CA  1 
ATOM   4193  C  C   . GLU C 3 126 ? 64.949  1.845   85.687  1.00 18.17  ? 213 GLU C C   1 
ATOM   4194  O  O   . GLU C 3 126 ? 63.726  1.738   85.559  1.00 25.94  ? 213 GLU C O   1 
ATOM   4195  C  CB  . GLU C 3 126 ? 65.596  3.874   84.385  1.00 24.07  ? 213 GLU C CB  1 
ATOM   4196  C  CG  . GLU C 3 126 ? 65.874  5.385   84.351  1.00 25.29  ? 213 GLU C CG  1 
ATOM   4197  C  CD  . GLU C 3 126 ? 64.895  6.227   85.163  1.00 30.63  ? 213 GLU C CD  1 
ATOM   4198  O  OE1 . GLU C 3 126 ? 63.787  5.738   85.497  1.00 36.18  ? 213 GLU C OE1 1 
ATOM   4199  O  OE2 . GLU C 3 126 ? 65.231  7.396   85.455  1.00 33.31  ? 213 GLU C OE2 1 
ATOM   4200  N  N   . GLY C 3 127 ? 65.751  0.803   85.741  1.00 6.07   ? 214 GLY C N   1 
ATOM   4201  C  CA  . GLY C 3 127 ? 65.182  -0.524  85.650  1.00 13.08  ? 214 GLY C CA  1 
ATOM   4202  C  C   . GLY C 3 127 ? 65.312  -1.122  84.265  1.00 16.08  ? 214 GLY C C   1 
ATOM   4203  O  O   . GLY C 3 127 ? 65.325  -0.404  83.279  1.00 18.45  ? 214 GLY C O   1 
ATOM   4204  N  N   . PHE C 3 128 ? 65.405  -2.443  84.200  1.00 12.90  ? 215 PHE C N   1 
ATOM   4205  C  CA  . PHE C 3 128 ? 65.550  -3.157  82.944  1.00 13.20  ? 215 PHE C CA  1 
ATOM   4206  C  C   . PHE C 3 128 ? 65.067  -4.582  83.109  1.00 10.73  ? 215 PHE C C   1 
ATOM   4207  O  O   . PHE C 3 128 ? 64.802  -4.998  84.221  1.00 15.90  ? 215 PHE C O   1 
ATOM   4208  C  CB  . PHE C 3 128 ? 67.003  -3.110  82.444  1.00 21.68  ? 215 PHE C CB  1 
ATOM   4209  C  CG  . PHE C 3 128 ? 67.990  -3.737  83.366  1.00 19.88  ? 215 PHE C CG  1 
ATOM   4210  C  CD1 . PHE C 3 128 ? 68.589  -2.996  84.362  1.00 20.42  ? 215 PHE C CD1 1 
ATOM   4211  C  CD2 . PHE C 3 128 ? 68.357  -5.062  83.211  1.00 21.31  ? 215 PHE C CD2 1 
ATOM   4212  C  CE1 . PHE C 3 128 ? 69.551  -3.573  85.190  1.00 23.51  ? 215 PHE C CE1 1 
ATOM   4213  C  CE2 . PHE C 3 128 ? 69.316  -5.638  84.039  1.00 21.80  ? 215 PHE C CE2 1 
ATOM   4214  C  CZ  . PHE C 3 128 ? 69.912  -4.894  85.023  1.00 16.87  ? 215 PHE C CZ  1 
ATOM   4215  N  N   . GLY C 3 129 ? 65.022  -5.347  82.023  1.00 9.58   ? 216 GLY C N   1 
ATOM   4216  C  CA  . GLY C 3 129 ? 64.469  -6.697  82.082  1.00 13.64  ? 216 GLY C CA  1 
ATOM   4217  C  C   . GLY C 3 129 ? 62.957  -6.647  81.765  1.00 12.10  ? 216 GLY C C   1 
ATOM   4218  O  O   . GLY C 3 129 ? 62.452  -5.603  81.306  1.00 5.47   ? 216 GLY C O   1 
ATOM   4219  N  N   . HIS C 3 130 ? 62.230  -7.743  82.007  1.00 12.33  ? 217 HIS C N   1 
ATOM   4220  C  CA  . HIS C 3 130 ? 60.778  -7.772  81.727  1.00 12.55  ? 217 HIS C CA  1 
ATOM   4221  C  C   . HIS C 3 130 ? 59.886  -8.246  82.844  1.00 12.85  ? 217 HIS C C   1 
ATOM   4222  O  O   . HIS C 3 130 ? 60.225  -9.177  83.563  1.00 17.47  ? 217 HIS C O   1 
ATOM   4223  C  CB  . HIS C 3 130 ? 60.463  -8.617  80.507  1.00 16.92  ? 217 HIS C CB  1 
ATOM   4224  C  CG  . HIS C 3 130 ? 60.959  -8.030  79.226  1.00 22.76  ? 217 HIS C CG  1 
ATOM   4225  N  ND1 . HIS C 3 130 ? 62.253  -8.201  78.786  1.00 26.31  ? 217 HIS C ND1 1 
ATOM   4226  C  CD2 . HIS C 3 130 ? 60.341  -7.270  78.293  1.00 20.23  ? 217 HIS C CD2 1 
ATOM   4227  C  CE1 . HIS C 3 130 ? 62.413  -7.572  77.635  1.00 22.61  ? 217 HIS C CE1 1 
ATOM   4228  N  NE2 . HIS C 3 130 ? 61.267  -6.999  77.313  1.00 23.23  ? 217 HIS C NE2 1 
ATOM   4229  N  N   . LEU C 3 131 ? 58.723  -7.618  82.949  1.00 12.80  ? 218 LEU C N   1 
ATOM   4230  C  CA  . LEU C 3 131 ? 57.729  -7.951  83.964  1.00 14.43  ? 218 LEU C CA  1 
ATOM   4231  C  C   . LEU C 3 131 ? 56.701  -8.877  83.354  1.00 18.46  ? 218 LEU C C   1 
ATOM   4232  O  O   . LEU C 3 131 ? 56.251  -8.655  82.238  1.00 28.95  ? 218 LEU C O   1 
ATOM   4233  C  CB  . LEU C 3 131 ? 57.036  -6.676  84.478  1.00 7.83   ? 218 LEU C CB  1 
ATOM   4234  C  CG  . LEU C 3 131 ? 58.036  -5.716  85.158  1.00 12.01  ? 218 LEU C CG  1 
ATOM   4235  C  CD1 . LEU C 3 131 ? 57.397  -4.377  85.522  1.00 13.67  ? 218 LEU C CD1 1 
ATOM   4236  C  CD2 . LEU C 3 131 ? 58.589  -6.389  86.397  1.00 15.30  ? 218 LEU C CD2 1 
ATOM   4237  N  N   . SER C 3 132 ? 56.397  -9.958  84.056  1.00 17.80  ? 219 SER C N   1 
ATOM   4238  C  CA  . SER C 3 132 ? 55.392  -10.906 83.603  1.00 21.31  ? 219 SER C CA  1 
ATOM   4239  C  C   . SER C 3 132 ? 54.472  -11.128 84.776  1.00 28.15  ? 219 SER C C   1 
ATOM   4240  O  O   . SER C 3 132 ? 54.884  -10.992 85.930  1.00 33.39  ? 219 SER C O   1 
ATOM   4241  C  CB  . SER C 3 132 ? 56.024  -12.230 83.226  1.00 27.02  ? 219 SER C CB  1 
ATOM   4242  O  OG  . SER C 3 132 ? 56.529  -12.887 84.376  1.00 29.96  ? 219 SER C OG  1 
ATOM   4243  N  N   . PRO C 3 133 ? 53.205  -11.454 84.505  1.00 30.85  ? 220 PRO C N   1 
ATOM   4244  C  CA  . PRO C 3 133 ? 52.217  -11.699 85.559  1.00 33.11  ? 220 PRO C CA  1 
ATOM   4245  C  C   . PRO C 3 133 ? 52.395  -13.063 86.241  1.00 35.73  ? 220 PRO C C   1 
ATOM   4246  O  O   . PRO C 3 133 ? 51.721  -13.377 87.224  1.00 42.14  ? 220 PRO C O   1 
ATOM   4247  C  CB  . PRO C 3 133 ? 50.899  -11.601 84.806  1.00 29.96  ? 220 PRO C CB  1 
ATOM   4248  C  CG  . PRO C 3 133 ? 51.255  -12.139 83.493  1.00 27.80  ? 220 PRO C CG  1 
ATOM   4249  C  CD  . PRO C 3 133 ? 52.572  -11.496 83.181  1.00 26.62  ? 220 PRO C CD  1 
ATOM   4250  N  N   . THR C 3 134 ? 53.324  -13.860 85.727  1.00 34.71  ? 221 THR C N   1 
ATOM   4251  C  CA  . THR C 3 134 ? 53.610  -15.182 86.285  1.00 32.32  ? 221 THR C CA  1 
ATOM   4252  C  C   . THR C 3 134 ? 55.040  -15.250 86.767  1.00 34.80  ? 221 THR C C   1 
ATOM   4253  O  O   . THR C 3 134 ? 55.568  -16.340 86.950  1.00 37.18  ? 221 THR C O   1 
ATOM   4254  C  CB  . THR C 3 134 ? 53.453  -16.286 85.242  1.00 30.04  ? 221 THR C CB  1 
ATOM   4255  O  OG1 . THR C 3 134 ? 54.348  -16.043 84.148  1.00 30.74  ? 221 THR C OG1 1 
ATOM   4256  C  CG2 . THR C 3 134 ? 52.036  -16.324 84.738  1.00 35.20  ? 221 THR C CG2 1 
ATOM   4257  N  N   . GLY C 3 135 ? 55.670  -14.086 86.902  1.00 34.33  ? 222 GLY C N   1 
ATOM   4258  C  CA  . GLY C 3 135 ? 57.043  -14.013 87.363  1.00 36.42  ? 222 GLY C CA  1 
ATOM   4259  C  C   . GLY C 3 135 ? 57.956  -15.068 86.769  1.00 36.77  ? 222 GLY C C   1 
ATOM   4260  O  O   . GLY C 3 135 ? 58.803  -15.657 87.445  1.00 41.79  ? 222 GLY C O   1 
ATOM   4261  N  N   . THR C 3 136 ? 57.771  -15.329 85.492  1.00 31.82  ? 223 THR C N   1 
ATOM   4262  C  CA  . THR C 3 136 ? 58.575  -16.324 84.821  1.00 28.79  ? 223 THR C CA  1 
ATOM   4263  C  C   . THR C 3 136 ? 59.583  -15.655 83.911  1.00 24.79  ? 223 THR C C   1 
ATOM   4264  O  O   . THR C 3 136 ? 60.027  -16.244 82.935  1.00 17.96  ? 223 THR C O   1 
ATOM   4265  C  CB  . THR C 3 136 ? 57.655  -17.183 83.999  1.00 34.11  ? 223 THR C CB  1 
ATOM   4266  O  OG1 . THR C 3 136 ? 56.804  -16.338 83.208  1.00 29.12  ? 223 THR C OG1 1 
ATOM   4267  C  CG2 . THR C 3 136 ? 56.794  -18.011 84.919  1.00 39.56  ? 223 THR C CG2 1 
ATOM   4268  N  N   . THR C 3 137 ? 59.916  -14.408 84.232  1.00 27.77  ? 224 THR C N   1 
ATOM   4269  C  CA  . THR C 3 137 ? 60.837  -13.598 83.439  1.00 27.79  ? 224 THR C CA  1 
ATOM   4270  C  C   . THR C 3 137 ? 61.816  -12.822 84.332  1.00 22.29  ? 224 THR C C   1 
ATOM   4271  O  O   . THR C 3 137 ? 61.419  -12.276 85.366  1.00 28.11  ? 224 THR C O   1 
ATOM   4272  C  CB  . THR C 3 137 ? 60.038  -12.594 82.570  1.00 25.19  ? 224 THR C CB  1 
ATOM   4273  O  OG1 . THR C 3 137 ? 60.944  -11.745 81.861  1.00 41.25  ? 224 THR C OG1 1 
ATOM   4274  C  CG2 . THR C 3 137 ? 59.147  -11.738 83.425  1.00 9.81   ? 224 THR C CG2 1 
ATOM   4275  N  N   . GLU C 3 138 ? 63.092  -12.786 83.953  1.00 13.36  ? 225 GLU C N   1 
ATOM   4276  C  CA  . GLU C 3 138 ? 64.052  -12.048 84.765  1.00 14.68  ? 225 GLU C CA  1 
ATOM   4277  C  C   . GLU C 3 138 ? 64.134  -10.562 84.476  1.00 24.22  ? 225 GLU C C   1 
ATOM   4278  O  O   . GLU C 3 138 ? 63.909  -10.122 83.346  1.00 26.80  ? 225 GLU C O   1 
ATOM   4279  C  CB  . GLU C 3 138 ? 65.432  -12.691 84.796  1.00 2.70   ? 225 GLU C CB  1 
ATOM   4280  C  CG  . GLU C 3 138 ? 66.113  -12.975 83.514  1.00 4.78   ? 225 GLU C CG  1 
ATOM   4281  C  CD  . GLU C 3 138 ? 67.363  -13.833 83.761  1.00 23.40  ? 225 GLU C CD  1 
ATOM   4282  O  OE1 . GLU C 3 138 ? 67.195  -14.980 84.247  1.00 24.28  ? 225 GLU C OE1 1 
ATOM   4283  O  OE2 . GLU C 3 138 ? 68.510  -13.361 83.525  1.00 25.03  ? 225 GLU C OE2 1 
ATOM   4284  N  N   . PHE C 3 139 ? 64.432  -9.787  85.520  1.00 27.67  ? 226 PHE C N   1 
ATOM   4285  C  CA  . PHE C 3 139 ? 64.501  -8.333  85.409  1.00 24.31  ? 226 PHE C CA  1 
ATOM   4286  C  C   . PHE C 3 139 ? 65.104  -7.684  86.653  1.00 23.22  ? 226 PHE C C   1 
ATOM   4287  O  O   . PHE C 3 139 ? 65.239  -8.316  87.687  1.00 28.59  ? 226 PHE C O   1 
ATOM   4288  C  CB  . PHE C 3 139 ? 63.081  -7.785  85.293  1.00 24.14  ? 226 PHE C CB  1 
ATOM   4289  C  CG  . PHE C 3 139 ? 62.345  -7.765  86.608  1.00 18.54  ? 226 PHE C CG  1 
ATOM   4290  C  CD1 . PHE C 3 139 ? 61.660  -8.889  87.049  1.00 15.97  ? 226 PHE C CD1 1 
ATOM   4291  C  CD2 . PHE C 3 139 ? 62.352  -6.630  87.412  1.00 13.75  ? 226 PHE C CD2 1 
ATOM   4292  C  CE1 . PHE C 3 139 ? 60.987  -8.888  88.273  1.00 8.02   ? 226 PHE C CE1 1 
ATOM   4293  C  CE2 . PHE C 3 139 ? 61.684  -6.622  88.635  1.00 19.60  ? 226 PHE C CE2 1 
ATOM   4294  C  CZ  . PHE C 3 139 ? 60.998  -7.756  89.064  1.00 16.63  ? 226 PHE C CZ  1 
ATOM   4295  N  N   . TRP C 3 140 ? 65.295  -6.372  86.571  1.00 19.71  ? 227 TRP C N   1 
ATOM   4296  C  CA  . TRP C 3 140 ? 65.805  -5.562  87.662  1.00 15.50  ? 227 TRP C CA  1 
ATOM   4297  C  C   . TRP C 3 140 ? 64.854  -4.387  87.691  1.00 15.92  ? 227 TRP C C   1 
ATOM   4298  O  O   . TRP C 3 140 ? 64.634  -3.740  86.668  1.00 16.89  ? 227 TRP C O   1 
ATOM   4299  C  CB  . TRP C 3 140 ? 67.220  -5.062  87.381  1.00 16.96  ? 227 TRP C CB  1 
ATOM   4300  C  CG  . TRP C 3 140 ? 67.691  -4.166  88.444  1.00 21.79  ? 227 TRP C CG  1 
ATOM   4301  C  CD1 . TRP C 3 140 ? 67.752  -2.809  88.401  1.00 25.41  ? 227 TRP C CD1 1 
ATOM   4302  C  CD2 . TRP C 3 140 ? 68.101  -4.551  89.754  1.00 28.71  ? 227 TRP C CD2 1 
ATOM   4303  N  NE1 . TRP C 3 140 ? 68.173  -2.313  89.613  1.00 33.00  ? 227 TRP C NE1 1 
ATOM   4304  C  CE2 . TRP C 3 140 ? 68.396  -3.366  90.463  1.00 32.93  ? 227 TRP C CE2 1 
ATOM   4305  C  CE3 . TRP C 3 140 ? 68.250  -5.786  90.401  1.00 32.21  ? 227 TRP C CE3 1 
ATOM   4306  C  CZ2 . TRP C 3 140 ? 68.834  -3.377  91.792  1.00 34.44  ? 227 TRP C CZ2 1 
ATOM   4307  C  CZ3 . TRP C 3 140 ? 68.684  -5.798  91.714  1.00 31.43  ? 227 TRP C CZ3 1 
ATOM   4308  C  CH2 . TRP C 3 140 ? 68.971  -4.599  92.397  1.00 33.93  ? 227 TRP C CH2 1 
ATOM   4309  N  N   . LEU C 3 141 ? 64.321  -4.075  88.859  1.00 7.94   ? 228 LEU C N   1 
ATOM   4310  C  CA  . LEU C 3 141 ? 63.358  -3.000  88.934  1.00 12.32  ? 228 LEU C CA  1 
ATOM   4311  C  C   . LEU C 3 141 ? 63.846  -1.576  88.800  1.00 18.41  ? 228 LEU C C   1 
ATOM   4312  O  O   . LEU C 3 141 ? 63.105  -0.746  88.290  1.00 22.33  ? 228 LEU C O   1 
ATOM   4313  C  CB  . LEU C 3 141 ? 62.516  -3.136  90.186  1.00 19.75  ? 228 LEU C CB  1 
ATOM   4314  C  CG  . LEU C 3 141 ? 61.398  -2.104  90.313  1.00 17.07  ? 228 LEU C CG  1 
ATOM   4315  C  CD1 . LEU C 3 141 ? 60.460  -2.296  89.166  1.00 10.74  ? 228 LEU C CD1 1 
ATOM   4316  C  CD2 . LEU C 3 141 ? 60.661  -2.281  91.643  1.00 21.04  ? 228 LEU C CD2 1 
ATOM   4317  N  N   . GLY C 3 142 ? 65.049  -1.273  89.284  1.00 22.29  ? 229 GLY C N   1 
ATOM   4318  C  CA  . GLY C 3 142 ? 65.551  0.094   89.187  1.00 24.63  ? 229 GLY C CA  1 
ATOM   4319  C  C   . GLY C 3 142 ? 65.775  0.794   90.523  1.00 28.59  ? 229 GLY C C   1 
ATOM   4320  O  O   . GLY C 3 142 ? 64.812  1.083   91.267  1.00 27.79  ? 229 GLY C O   1 
ATOM   4321  N  N   . ASN C 3 143 ? 67.044  1.120   90.792  1.00 22.58  ? 230 ASN C N   1 
ATOM   4322  C  CA  . ASN C 3 143 ? 67.445  1.760   92.030  1.00 17.08  ? 230 ASN C CA  1 
ATOM   4323  C  C   . ASN C 3 143 ? 66.496  2.841   92.477  1.00 19.69  ? 230 ASN C C   1 
ATOM   4324  O  O   . ASN C 3 143 ? 66.095  2.878   93.630  1.00 24.55  ? 230 ASN C O   1 
ATOM   4325  C  CB  . ASN C 3 143 ? 68.821  2.373   91.886  1.00 23.91  ? 230 ASN C CB  1 
ATOM   4326  C  CG  . ASN C 3 143 ? 69.931  1.343   91.799  1.00 23.54  ? 230 ASN C CG  1 
ATOM   4327  O  OD1 . ASN C 3 143 ? 70.983  1.617   91.213  1.00 24.87  ? 230 ASN C OD1 1 
ATOM   4328  N  ND2 . ASN C 3 143 ? 69.724  0.172   92.402  1.00 14.60  ? 230 ASN C ND2 1 
ATOM   4329  N  N   . GLU C 3 144 ? 66.123  3.723   91.563  1.00 20.11  ? 231 GLU C N   1 
ATOM   4330  C  CA  . GLU C 3 144 ? 65.222  4.799   91.927  1.00 25.37  ? 231 GLU C CA  1 
ATOM   4331  C  C   . GLU C 3 144 ? 63.920  4.284   92.526  1.00 22.19  ? 231 GLU C C   1 
ATOM   4332  O  O   . GLU C 3 144 ? 63.559  4.665   93.636  1.00 24.43  ? 231 GLU C O   1 
ATOM   4333  C  CB  . GLU C 3 144 ? 64.939  5.701   90.731  1.00 29.38  ? 231 GLU C CB  1 
ATOM   4334  C  CG  . GLU C 3 144 ? 64.048  6.895   91.051  1.00 30.96  ? 231 GLU C CG  1 
ATOM   4335  C  CD  . GLU C 3 144 ? 64.709  7.960   91.924  1.00 41.38  ? 231 GLU C CD  1 
ATOM   4336  O  OE1 . GLU C 3 144 ? 65.893  7.823   92.295  1.00 44.79  ? 231 GLU C OE1 1 
ATOM   4337  O  OE2 . GLU C 3 144 ? 64.036  8.962   92.239  1.00 49.07  ? 231 GLU C OE2 1 
ATOM   4338  N  N   . LYS C 3 145 ? 63.249  3.372   91.832  1.00 18.61  ? 232 LYS C N   1 
ATOM   4339  C  CA  . LYS C 3 145 ? 61.983  2.841   92.330  1.00 22.66  ? 232 LYS C CA  1 
ATOM   4340  C  C   . LYS C 3 145 ? 62.171  2.120   93.646  1.00 22.88  ? 232 LYS C C   1 
ATOM   4341  O  O   . LYS C 3 145 ? 61.366  2.284   94.566  1.00 22.88  ? 232 LYS C O   1 
ATOM   4342  C  CB  . LYS C 3 145 ? 61.343  1.926   91.306  1.00 24.31  ? 232 LYS C CB  1 
ATOM   4343  C  CG  . LYS C 3 145 ? 61.126  2.609   89.984  1.00 31.05  ? 232 LYS C CG  1 
ATOM   4344  C  CD  . LYS C 3 145 ? 60.872  1.600   88.900  1.00 33.03  ? 232 LYS C CD  1 
ATOM   4345  C  CE  . LYS C 3 145 ? 60.864  2.235   87.528  1.00 34.64  ? 232 LYS C CE  1 
ATOM   4346  N  NZ  . LYS C 3 145 ? 60.582  1.213   86.476  1.00 37.52  ? 232 LYS C NZ  1 
ATOM   4347  N  N   . ILE C 3 146 ? 63.264  1.370   93.757  1.00 19.56  ? 233 ILE C N   1 
ATOM   4348  C  CA  . ILE C 3 146 ? 63.557  0.665   95.000  1.00 16.11  ? 233 ILE C CA  1 
ATOM   4349  C  C   . ILE C 3 146 ? 63.687  1.692   96.113  1.00 11.03  ? 233 ILE C C   1 
ATOM   4350  O  O   . ILE C 3 146 ? 63.126  1.540   97.187  1.00 16.16  ? 233 ILE C O   1 
ATOM   4351  C  CB  . ILE C 3 146 ? 64.880  -0.072  94.937  1.00 15.66  ? 233 ILE C CB  1 
ATOM   4352  C  CG1 . ILE C 3 146 ? 64.869  -1.121  93.818  1.00 17.83  ? 233 ILE C CG1 1 
ATOM   4353  C  CG2 . ILE C 3 146 ? 65.164  -0.697  96.278  1.00 16.44  ? 233 ILE C CG2 1 
ATOM   4354  C  CD1 . ILE C 3 146 ? 66.235  -1.760  93.549  1.00 13.34  ? 233 ILE C CD1 1 
ATOM   4355  N  N   . HIS C 3 147 ? 64.414  2.760   95.828  1.00 12.18  ? 234 HIS C N   1 
ATOM   4356  C  CA  . HIS C 3 147 ? 64.616  3.812   96.800  1.00 18.31  ? 234 HIS C CA  1 
ATOM   4357  C  C   . HIS C 3 147 ? 63.280  4.334   97.263  1.00 22.67  ? 234 HIS C C   1 
ATOM   4358  O  O   . HIS C 3 147 ? 62.986  4.340   98.461  1.00 31.36  ? 234 HIS C O   1 
ATOM   4359  C  CB  . HIS C 3 147 ? 65.432  4.965   96.209  1.00 13.70  ? 234 HIS C CB  1 
ATOM   4360  C  CG  . HIS C 3 147 ? 65.437  6.187   97.072  1.00 16.14  ? 234 HIS C CG  1 
ATOM   4361  N  ND1 . HIS C 3 147 ? 65.275  6.130   98.442  1.00 20.52  ? 234 HIS C ND1 1 
ATOM   4362  C  CD2 . HIS C 3 147 ? 65.565  7.497   96.765  1.00 17.11  ? 234 HIS C CD2 1 
ATOM   4363  C  CE1 . HIS C 3 147 ? 65.304  7.353   98.939  1.00 16.25  ? 234 HIS C CE1 1 
ATOM   4364  N  NE2 . HIS C 3 147 ? 65.480  8.201   97.943  1.00 13.35  ? 234 HIS C NE2 1 
ATOM   4365  N  N   . LEU C 3 148 ? 62.461  4.722   96.298  1.00 23.98  ? 235 LEU C N   1 
ATOM   4366  C  CA  . LEU C 3 148 ? 61.155  5.282   96.591  1.00 33.02  ? 235 LEU C CA  1 
ATOM   4367  C  C   . LEU C 3 148 ? 60.254  4.503   97.533  1.00 34.60  ? 235 LEU C C   1 
ATOM   4368  O  O   . LEU C 3 148 ? 59.640  5.089   98.420  1.00 40.23  ? 235 LEU C O   1 
ATOM   4369  C  CB  . LEU C 3 148 ? 60.404  5.601   95.302  1.00 32.26  ? 235 LEU C CB  1 
ATOM   4370  C  CG  . LEU C 3 148 ? 61.017  6.721   94.454  1.00 33.09  ? 235 LEU C CG  1 
ATOM   4371  C  CD1 . LEU C 3 148 ? 60.058  7.102   93.368  1.00 28.22  ? 235 LEU C CD1 1 
ATOM   4372  C  CD2 . LEU C 3 148 ? 61.328  7.943   95.289  1.00 36.53  ? 235 LEU C CD2 1 
ATOM   4373  N  N   . ILE C 3 149 ? 60.212  3.188   97.367  1.00 31.47  ? 236 ILE C N   1 
ATOM   4374  C  CA  . ILE C 3 149 ? 59.352  2.350   98.186  1.00 33.14  ? 236 ILE C CA  1 
ATOM   4375  C  C   . ILE C 3 149 ? 59.922  2.092   99.553  1.00 32.32  ? 236 ILE C C   1 
ATOM   4376  O  O   . ILE C 3 149 ? 59.210  2.186   100.552 1.00 35.80  ? 236 ILE C O   1 
ATOM   4377  C  CB  . ILE C 3 149 ? 59.107  0.986   97.538  1.00 38.68  ? 236 ILE C CB  1 
ATOM   4378  C  CG1 . ILE C 3 149 ? 58.648  1.166   96.093  1.00 39.25  ? 236 ILE C CG1 1 
ATOM   4379  C  CG2 . ILE C 3 149 ? 58.043  0.229   98.308  1.00 40.55  ? 236 ILE C CG2 1 
ATOM   4380  C  CD1 . ILE C 3 149 ? 58.689  -0.097  95.278  1.00 37.50  ? 236 ILE C CD1 1 
ATOM   4381  N  N   . SER C 3 150 ? 61.201  1.737   99.589  1.00 29.89  ? 237 SER C N   1 
ATOM   4382  C  CA  . SER C 3 150 ? 61.883  1.421   100.835 1.00 32.80  ? 237 SER C CA  1 
ATOM   4383  C  C   . SER C 3 150 ? 62.085  2.641   101.698 1.00 40.88  ? 237 SER C C   1 
ATOM   4384  O  O   . SER C 3 150 ? 62.596  2.543   102.816 1.00 50.76  ? 237 SER C O   1 
ATOM   4385  C  CB  . SER C 3 150 ? 63.231  0.781   100.538 1.00 34.91  ? 237 SER C CB  1 
ATOM   4386  O  OG  . SER C 3 150 ? 64.025  1.661   99.776  1.00 36.23  ? 237 SER C OG  1 
ATOM   4387  N  N   . THR C 3 151 ? 61.620  3.779   101.199 1.00 43.44  ? 238 THR C N   1 
ATOM   4388  C  CA  . THR C 3 151 ? 61.779  5.023   101.906 1.00 44.36  ? 238 THR C CA  1 
ATOM   4389  C  C   . THR C 3 151 ? 60.510  5.787   102.240 1.00 52.25  ? 238 THR C C   1 
ATOM   4390  O  O   . THR C 3 151 ? 60.500  6.568   103.182 1.00 57.18  ? 238 THR C O   1 
ATOM   4391  C  CB  . THR C 3 151 ? 62.804  5.856   101.181 1.00 34.90  ? 238 THR C CB  1 
ATOM   4392  O  OG1 . THR C 3 151 ? 64.086  5.292   101.469 1.00 13.44  ? 238 THR C OG1 1 
ATOM   4393  C  CG2 . THR C 3 151 ? 62.748  7.312   101.596 1.00 42.22  ? 238 THR C CG2 1 
ATOM   4394  N  N   . GLN C 3 152 ? 59.429  5.521   101.519 1.00 61.43  ? 239 GLN C N   1 
ATOM   4395  C  CA  . GLN C 3 152 ? 58.151  6.181   101.784 1.00 72.87  ? 239 GLN C CA  1 
ATOM   4396  C  C   . GLN C 3 152 ? 57.699  5.858   103.208 1.00 79.06  ? 239 GLN C C   1 
ATOM   4397  O  O   . GLN C 3 152 ? 57.916  4.747   103.695 1.00 76.48  ? 239 GLN C O   1 
ATOM   4398  C  CB  . GLN C 3 152 ? 57.088  5.688   100.806 1.00 80.98  ? 239 GLN C CB  1 
ATOM   4399  C  CG  . GLN C 3 152 ? 56.752  4.215   100.966 1.00 90.36  ? 239 GLN C CG  1 
ATOM   4400  C  CD  . GLN C 3 152 ? 55.692  3.760   100.013 1.00 93.74  ? 239 GLN C CD  1 
ATOM   4401  O  OE1 . GLN C 3 152 ? 55.836  2.731   99.364  1.00 96.91  ? 239 GLN C OE1 1 
ATOM   4402  N  NE2 . GLN C 3 152 ? 54.616  4.525   99.918  1.00 92.79  ? 239 GLN C NE2 1 
ATOM   4403  N  N   . SER C 3 153 ? 57.095  6.835   103.876 1.00 89.06  ? 240 SER C N   1 
ATOM   4404  C  CA  . SER C 3 153 ? 56.602  6.679   105.246 1.00 100.59 ? 240 SER C CA  1 
ATOM   4405  C  C   . SER C 3 153 ? 57.680  6.387   106.284 1.00 102.09 ? 240 SER C C   1 
ATOM   4406  O  O   . SER C 3 153 ? 57.510  6.707   107.460 1.00 103.68 ? 240 SER C O   1 
ATOM   4407  C  CB  . SER C 3 153 ? 55.515  5.596   105.321 1.00 106.09 ? 240 SER C CB  1 
ATOM   4408  O  OG  . SER C 3 153 ? 56.057  4.287   105.230 1.00 110.13 ? 240 SER C OG  1 
ATOM   4409  N  N   . ALA C 3 154 ? 58.777  5.778   105.848 1.00 103.93 ? 241 ALA C N   1 
ATOM   4410  C  CA  . ALA C 3 154 ? 59.876  5.426   106.733 1.00 108.89 ? 241 ALA C CA  1 
ATOM   4411  C  C   . ALA C 3 154 ? 59.380  4.482   107.836 1.00 109.90 ? 241 ALA C C   1 
ATOM   4412  O  O   . ALA C 3 154 ? 59.542  4.748   109.034 1.00 109.45 ? 241 ALA C O   1 
ATOM   4413  C  CB  . ALA C 3 154 ? 60.517  6.689   107.326 1.00 111.83 ? 241 ALA C CB  1 
ATOM   4414  N  N   . ILE C 3 155 ? 58.700  3.418   107.406 1.00 106.94 ? 242 ILE C N   1 
ATOM   4415  C  CA  . ILE C 3 155 ? 58.177  2.388   108.306 1.00 99.31  ? 242 ILE C CA  1 
ATOM   4416  C  C   . ILE C 3 155 ? 58.805  1.067   107.862 1.00 90.03  ? 242 ILE C C   1 
ATOM   4417  O  O   . ILE C 3 155 ? 58.674  0.663   106.701 1.00 91.22  ? 242 ILE C O   1 
ATOM   4418  C  CB  . ILE C 3 155 ? 56.635  2.312   108.271 1.00 104.43 ? 242 ILE C CB  1 
ATOM   4419  C  CG1 . ILE C 3 155 ? 56.042  3.638   108.758 1.00 106.82 ? 242 ILE C CG1 1 
ATOM   4420  C  CG2 . ILE C 3 155 ? 56.133  1.158   109.130 1.00 105.82 ? 242 ILE C CG2 1 
ATOM   4421  C  CD1 . ILE C 3 155 ? 56.575  4.104   110.106 1.00 106.69 ? 242 ILE C CD1 1 
ATOM   4422  N  N   . PRO C 3 156 ? 59.472  0.372   108.801 1.00 80.95  ? 243 PRO C N   1 
ATOM   4423  C  CA  . PRO C 3 156 ? 60.176  -0.898  108.653 1.00 75.09  ? 243 PRO C CA  1 
ATOM   4424  C  C   . PRO C 3 156 ? 59.838  -1.777  107.459 1.00 66.07  ? 243 PRO C C   1 
ATOM   4425  O  O   . PRO C 3 156 ? 58.723  -2.286  107.343 1.00 67.61  ? 243 PRO C O   1 
ATOM   4426  C  CB  . PRO C 3 156 ? 59.878  -1.590  109.976 1.00 80.05  ? 243 PRO C CB  1 
ATOM   4427  C  CG  . PRO C 3 156 ? 59.995  -0.482  110.929 1.00 84.18  ? 243 PRO C CG  1 
ATOM   4428  C  CD  . PRO C 3 156 ? 59.240  0.643   110.235 1.00 81.56  ? 243 PRO C CD  1 
ATOM   4429  N  N   . TYR C 3 157 ? 60.800  -1.904  106.550 1.00 51.71  ? 244 TYR C N   1 
ATOM   4430  C  CA  . TYR C 3 157 ? 60.652  -2.763  105.390 1.00 40.23  ? 244 TYR C CA  1 
ATOM   4431  C  C   . TYR C 3 157 ? 61.655  -3.895  105.562 1.00 38.23  ? 244 TYR C C   1 
ATOM   4432  O  O   . TYR C 3 157 ? 62.751  -3.695  106.080 1.00 40.64  ? 244 TYR C O   1 
ATOM   4433  C  CB  . TYR C 3 157 ? 60.923  -1.999  104.094 1.00 35.57  ? 244 TYR C CB  1 
ATOM   4434  C  CG  . TYR C 3 157 ? 59.660  -1.572  103.359 1.00 33.38  ? 244 TYR C CG  1 
ATOM   4435  C  CD1 . TYR C 3 157 ? 58.840  -2.508  102.743 1.00 33.50  ? 244 TYR C CD1 1 
ATOM   4436  C  CD2 . TYR C 3 157 ? 59.274  -0.232  103.307 1.00 35.76  ? 244 TYR C CD2 1 
ATOM   4437  C  CE1 . TYR C 3 157 ? 57.665  -2.127  102.099 1.00 33.84  ? 244 TYR C CE1 1 
ATOM   4438  C  CE2 . TYR C 3 157 ? 58.104  0.160   102.665 1.00 33.36  ? 244 TYR C CE2 1 
ATOM   4439  C  CZ  . TYR C 3 157 ? 57.303  -0.794  102.065 1.00 32.72  ? 244 TYR C CZ  1 
ATOM   4440  O  OH  . TYR C 3 157 ? 56.135  -0.418  101.442 1.00 24.95  ? 244 TYR C OH  1 
ATOM   4441  N  N   . ALA C 3 158 ? 61.266  -5.098  105.183 1.00 30.48  ? 245 ALA C N   1 
ATOM   4442  C  CA  . ALA C 3 158 ? 62.166  -6.220  105.318 1.00 30.28  ? 245 ALA C CA  1 
ATOM   4443  C  C   . ALA C 3 158 ? 62.490  -6.791  103.960 1.00 30.39  ? 245 ALA C C   1 
ATOM   4444  O  O   . ALA C 3 158 ? 61.611  -6.969  103.116 1.00 28.45  ? 245 ALA C O   1 
ATOM   4445  C  CB  . ALA C 3 158 ? 61.562  -7.288  106.205 1.00 33.45  ? 245 ALA C CB  1 
ATOM   4446  N  N   . LEU C 3 159 ? 63.766  -7.088  103.758 1.00 26.30  ? 246 LEU C N   1 
ATOM   4447  C  CA  . LEU C 3 159 ? 64.212  -7.645  102.509 1.00 20.49  ? 246 LEU C CA  1 
ATOM   4448  C  C   . LEU C 3 159 ? 64.342  -9.131  102.618 1.00 23.23  ? 246 LEU C C   1 
ATOM   4449  O  O   . LEU C 3 159 ? 64.909  -9.619  103.594 1.00 22.07  ? 246 LEU C O   1 
ATOM   4450  C  CB  . LEU C 3 159 ? 65.575  -7.096  102.172 1.00 13.18  ? 246 LEU C CB  1 
ATOM   4451  C  CG  . LEU C 3 159 ? 66.306  -7.910  101.120 1.00 10.77  ? 246 LEU C CG  1 
ATOM   4452  C  CD1 . LEU C 3 159 ? 65.632  -7.753  99.801  1.00 14.06  ? 246 LEU C CD1 1 
ATOM   4453  C  CD2 . LEU C 3 159 ? 67.720  -7.442  101.030 1.00 16.08  ? 246 LEU C CD2 1 
ATOM   4454  N  N   . ARG C 3 160 ? 63.824  -9.847  101.622 1.00 27.43  ? 247 ARG C N   1 
ATOM   4455  C  CA  . ARG C 3 160 ? 63.954  -11.300 101.581 1.00 30.73  ? 247 ARG C CA  1 
ATOM   4456  C  C   . ARG C 3 160 ? 64.593  -11.768 100.297 1.00 27.63  ? 247 ARG C C   1 
ATOM   4457  O  O   . ARG C 3 160 ? 64.101  -11.506 99.200  1.00 30.79  ? 247 ARG C O   1 
ATOM   4458  C  CB  . ARG C 3 160 ? 62.633  -12.048 101.741 1.00 34.18  ? 247 ARG C CB  1 
ATOM   4459  C  CG  . ARG C 3 160 ? 62.775  -13.534 101.345 1.00 37.03  ? 247 ARG C CG  1 
ATOM   4460  C  CD  . ARG C 3 160 ? 61.588  -14.385 101.705 1.00 37.80  ? 247 ARG C CD  1 
ATOM   4461  N  NE  . ARG C 3 160 ? 61.459  -14.512 103.147 1.00 41.67  ? 247 ARG C NE  1 
ATOM   4462  C  CZ  . ARG C 3 160 ? 60.431  -15.082 103.762 1.00 49.69  ? 247 ARG C CZ  1 
ATOM   4463  N  NH1 . ARG C 3 160 ? 59.429  -15.600 103.051 1.00 54.50  ? 247 ARG C NH1 1 
ATOM   4464  N  NH2 . ARG C 3 160 ? 60.383  -15.082 105.090 1.00 53.08  ? 247 ARG C NH2 1 
ATOM   4465  N  N   . VAL C 3 161 ? 65.691  -12.483 100.467 1.00 22.49  ? 248 VAL C N   1 
ATOM   4466  C  CA  . VAL C 3 161 ? 66.424  -13.070 99.368  1.00 22.59  ? 248 VAL C CA  1 
ATOM   4467  C  C   . VAL C 3 161 ? 65.915  -14.503 99.337  1.00 24.45  ? 248 VAL C C   1 
ATOM   4468  O  O   . VAL C 3 161 ? 65.582  -15.063 100.378 1.00 28.37  ? 248 VAL C O   1 
ATOM   4469  C  CB  . VAL C 3 161 ? 67.968  -13.131 99.671  1.00 23.35  ? 248 VAL C CB  1 
ATOM   4470  C  CG1 . VAL C 3 161 ? 68.739  -13.749 98.494  1.00 19.64  ? 248 VAL C CG1 1 
ATOM   4471  C  CG2 . VAL C 3 161 ? 68.522  -11.748 100.024 1.00 14.71  ? 248 VAL C CG2 1 
ATOM   4472  N  N   . GLU C 3 162 ? 65.817  -15.062 98.136  1.00 27.55  ? 249 GLU C N   1 
ATOM   4473  C  CA  . GLU C 3 162 ? 65.406  -16.440 97.917  1.00 25.01  ? 249 GLU C CA  1 
ATOM   4474  C  C   . GLU C 3 162 ? 66.360  -16.952 96.854  1.00 27.30  ? 249 GLU C C   1 
ATOM   4475  O  O   . GLU C 3 162 ? 66.517  -16.334 95.801  1.00 36.79  ? 249 GLU C O   1 
ATOM   4476  C  CB  . GLU C 3 162 ? 63.970  -16.535 97.390  1.00 29.69  ? 249 GLU C CB  1 
ATOM   4477  C  CG  . GLU C 3 162 ? 62.898  -15.986 98.319  1.00 43.24  ? 249 GLU C CG  1 
ATOM   4478  C  CD  . GLU C 3 162 ? 61.490  -16.483 97.964  1.00 52.40  ? 249 GLU C CD  1 
ATOM   4479  O  OE1 . GLU C 3 162 ? 61.195  -16.632 96.755  1.00 52.28  ? 249 GLU C OE1 1 
ATOM   4480  O  OE2 . GLU C 3 162 ? 60.677  -16.725 98.896  1.00 57.96  ? 249 GLU C OE2 1 
ATOM   4481  N  N   . LEU C 3 163 ? 67.094  -18.005 97.173  1.00 30.02  ? 250 LEU C N   1 
ATOM   4482  C  CA  . LEU C 3 163 ? 67.993  -18.598 96.198  1.00 34.67  ? 250 LEU C CA  1 
ATOM   4483  C  C   . LEU C 3 163 ? 67.521  -20.011 95.870  1.00 39.25  ? 250 LEU C C   1 
ATOM   4484  O  O   . LEU C 3 163 ? 66.659  -20.566 96.550  1.00 43.88  ? 250 LEU C O   1 
ATOM   4485  C  CB  . LEU C 3 163 ? 69.422  -18.680 96.732  1.00 31.04  ? 250 LEU C CB  1 
ATOM   4486  C  CG  . LEU C 3 163 ? 70.233  -17.421 97.034  1.00 30.24  ? 250 LEU C CG  1 
ATOM   4487  C  CD1 . LEU C 3 163 ? 70.025  -16.359 95.955  1.00 32.45  ? 250 LEU C CD1 1 
ATOM   4488  C  CD2 . LEU C 3 163 ? 69.831  -16.883 98.359  1.00 24.71  ? 250 LEU C CD2 1 
ATOM   4489  N  N   . GLU C 3 164 ? 68.034  -20.570 94.785  1.00 33.59  ? 251 GLU C N   1 
ATOM   4490  C  CA  . GLU C 3 164 ? 67.697  -21.937 94.434  1.00 30.91  ? 251 GLU C CA  1 
ATOM   4491  C  C   . GLU C 3 164 ? 68.825  -22.447 93.600  1.00 29.02  ? 251 GLU C C   1 
ATOM   4492  O  O   . GLU C 3 164 ? 69.188  -21.842 92.600  1.00 31.08  ? 251 GLU C O   1 
ATOM   4493  C  CB  . GLU C 3 164 ? 66.393  -22.071 93.650  1.00 29.25  ? 251 GLU C CB  1 
ATOM   4494  C  CG  . GLU C 3 164 ? 66.063  -23.533 93.382  1.00 30.52  ? 251 GLU C CG  1 
ATOM   4495  C  CD  . GLU C 3 164 ? 65.023  -23.713 92.326  1.00 38.39  ? 251 GLU C CD  1 
ATOM   4496  O  OE1 . GLU C 3 164 ? 63.942  -23.088 92.453  1.00 42.85  ? 251 GLU C OE1 1 
ATOM   4497  O  OE2 . GLU C 3 164 ? 65.293  -24.483 91.373  1.00 43.72  ? 251 GLU C OE2 1 
ATOM   4498  N  N   . ASP C 3 165 ? 69.433  -23.523 94.058  1.00 26.03  ? 252 ASP C N   1 
ATOM   4499  C  CA  . ASP C 3 165 ? 70.516  -24.097 93.314  1.00 31.02  ? 252 ASP C CA  1 
ATOM   4500  C  C   . ASP C 3 165 ? 69.925  -24.843 92.138  1.00 32.25  ? 252 ASP C C   1 
ATOM   4501  O  O   . ASP C 3 165 ? 68.701  -24.883 91.945  1.00 25.40  ? 252 ASP C O   1 
ATOM   4502  C  CB  . ASP C 3 165 ? 71.350  -25.038 94.190  1.00 36.16  ? 252 ASP C CB  1 
ATOM   4503  C  CG  . ASP C 3 165 ? 70.517  -26.113 94.879  1.00 41.30  ? 252 ASP C CG  1 
ATOM   4504  O  OD1 . ASP C 3 165 ? 69.503  -26.582 94.315  1.00 49.92  ? 252 ASP C OD1 1 
ATOM   4505  O  OD2 . ASP C 3 165 ? 70.884  -26.501 96.003  1.00 36.90  ? 252 ASP C OD2 1 
ATOM   4506  N  N   . TRP C 3 166 ? 70.810  -25.491 91.399  1.00 36.55  ? 253 TRP C N   1 
ATOM   4507  C  CA  . TRP C 3 166 ? 70.429  -26.252 90.231  1.00 43.67  ? 253 TRP C CA  1 
ATOM   4508  C  C   . TRP C 3 166 ? 69.911  -27.620 90.632  1.00 43.79  ? 253 TRP C C   1 
ATOM   4509  O  O   . TRP C 3 166 ? 69.822  -28.545 89.817  1.00 43.83  ? 253 TRP C O   1 
ATOM   4510  C  CB  . TRP C 3 166 ? 71.624  -26.343 89.289  1.00 47.03  ? 253 TRP C CB  1 
ATOM   4511  C  CG  . TRP C 3 166 ? 72.044  -24.986 88.847  1.00 47.14  ? 253 TRP C CG  1 
ATOM   4512  C  CD1 . TRP C 3 166 ? 72.743  -24.063 89.573  1.00 46.30  ? 253 TRP C CD1 1 
ATOM   4513  C  CD2 . TRP C 3 166 ? 71.734  -24.371 87.602  1.00 44.82  ? 253 TRP C CD2 1 
ATOM   4514  N  NE1 . TRP C 3 166 ? 72.885  -22.907 88.853  1.00 44.00  ? 253 TRP C NE1 1 
ATOM   4515  C  CE2 . TRP C 3 166 ? 72.274  -23.069 87.638  1.00 43.00  ? 253 TRP C CE2 1 
ATOM   4516  C  CE3 . TRP C 3 166 ? 71.046  -24.791 86.462  1.00 44.29  ? 253 TRP C CE3 1 
ATOM   4517  C  CZ2 . TRP C 3 166 ? 72.148  -22.183 86.577  1.00 46.33  ? 253 TRP C CZ2 1 
ATOM   4518  C  CZ3 . TRP C 3 166 ? 70.919  -23.915 85.412  1.00 47.17  ? 253 TRP C CZ3 1 
ATOM   4519  C  CH2 . TRP C 3 166 ? 71.469  -22.619 85.473  1.00 48.99  ? 253 TRP C CH2 1 
ATOM   4520  N  N   . ASN C 3 167 ? 69.550  -27.734 91.900  1.00 44.15  ? 254 ASN C N   1 
ATOM   4521  C  CA  . ASN C 3 167 ? 69.016  -28.972 92.402  1.00 46.88  ? 254 ASN C CA  1 
ATOM   4522  C  C   . ASN C 3 167 ? 67.686  -28.776 93.068  1.00 46.61  ? 254 ASN C C   1 
ATOM   4523  O  O   . ASN C 3 167 ? 67.256  -29.620 93.843  1.00 46.08  ? 254 ASN C O   1 
ATOM   4524  C  CB  . ASN C 3 167 ? 69.995  -29.655 93.335  1.00 49.72  ? 254 ASN C CB  1 
ATOM   4525  C  CG  . ASN C 3 167 ? 70.652  -30.833 92.683  1.00 58.06  ? 254 ASN C CG  1 
ATOM   4526  O  OD1 . ASN C 3 167 ? 70.017  -31.876 92.490  1.00 66.17  ? 254 ASN C OD1 1 
ATOM   4527  N  ND2 . ASN C 3 167 ? 71.910  -30.667 92.278  1.00 59.22  ? 254 ASN C ND2 1 
ATOM   4528  N  N   . GLY C 3 168 ? 67.040  -27.654 92.763  1.00 47.17  ? 255 GLY C N   1 
ATOM   4529  C  CA  . GLY C 3 168 ? 65.726  -27.381 93.317  1.00 51.99  ? 255 GLY C CA  1 
ATOM   4530  C  C   . GLY C 3 168 ? 65.690  -27.241 94.823  1.00 58.06  ? 255 GLY C C   1 
ATOM   4531  O  O   . GLY C 3 168 ? 64.645  -27.428 95.462  1.00 60.72  ? 255 GLY C O   1 
ATOM   4532  N  N   . ARG C 3 169 ? 66.856  -26.984 95.399  1.00 61.24  ? 256 ARG C N   1 
ATOM   4533  C  CA  . ARG C 3 169 ? 66.961  -26.769 96.828  1.00 61.79  ? 256 ARG C CA  1 
ATOM   4534  C  C   . ARG C 3 169 ? 66.975  -25.259 96.985  1.00 55.65  ? 256 ARG C C   1 
ATOM   4535  O  O   . ARG C 3 169 ? 67.727  -24.560 96.307  1.00 50.44  ? 256 ARG C O   1 
ATOM   4536  C  CB  . ARG C 3 169 ? 68.247  -27.379 97.369  1.00 71.53  ? 256 ARG C CB  1 
ATOM   4537  C  CG  . ARG C 3 169 ? 68.257  -28.893 97.346  1.00 84.46  ? 256 ARG C CG  1 
ATOM   4538  C  CD  . ARG C 3 169 ? 69.657  -29.445 97.556  1.00 93.85  ? 256 ARG C CD  1 
ATOM   4539  N  NE  . ARG C 3 169 ? 70.306  -28.898 98.748  1.00 103.55 ? 256 ARG C NE  1 
ATOM   4540  C  CZ  . ARG C 3 169 ? 69.940  -29.160 100.003 1.00 109.77 ? 256 ARG C CZ  1 
ATOM   4541  N  NH1 . ARG C 3 169 ? 68.916  -29.973 100.254 1.00 112.13 ? 256 ARG C NH1 1 
ATOM   4542  N  NH2 . ARG C 3 169 ? 70.597  -28.600 101.015 1.00 109.91 ? 256 ARG C NH2 1 
ATOM   4543  N  N   . THR C 3 170 ? 66.079  -24.754 97.820  1.00 54.55  ? 257 THR C N   1 
ATOM   4544  C  CA  . THR C 3 170 ? 65.971  -23.320 98.055  1.00 55.01  ? 257 THR C CA  1 
ATOM   4545  C  C   . THR C 3 170 ? 66.545  -22.910 99.428  1.00 56.84  ? 257 THR C C   1 
ATOM   4546  O  O   . THR C 3 170 ? 67.072  -23.742 100.167 1.00 62.64  ? 257 THR C O   1 
ATOM   4547  C  CB  . THR C 3 170 ? 64.484  -22.854 97.908  1.00 52.86  ? 257 THR C CB  1 
ATOM   4548  O  OG1 . THR C 3 170 ? 63.672  -23.495 98.900  1.00 54.96  ? 257 THR C OG1 1 
ATOM   4549  C  CG2 . THR C 3 170 ? 63.937  -23.214 96.527  1.00 47.49  ? 257 THR C CG2 1 
ATOM   4550  N  N   . SER C 3 171 ? 66.496  -21.615 99.731  1.00 54.71  ? 258 SER C N   1 
ATOM   4551  C  CA  . SER C 3 171 ? 66.979  -21.071 101.010 1.00 48.84  ? 258 SER C CA  1 
ATOM   4552  C  C   . SER C 3 171 ? 66.749  -19.564 101.055 1.00 43.86  ? 258 SER C C   1 
ATOM   4553  O  O   . SER C 3 171 ? 66.992  -18.859 100.081 1.00 42.94  ? 258 SER C O   1 
ATOM   4554  C  CB  . SER C 3 171 ? 68.464  -21.389 101.250 1.00 42.16  ? 258 SER C CB  1 
ATOM   4555  O  OG  . SER C 3 171 ? 69.300  -20.728 100.326 1.00 31.97  ? 258 SER C OG  1 
ATOM   4556  N  N   . THR C 3 172 ? 66.243  -19.075 102.173 1.00 38.42  ? 259 THR C N   1 
ATOM   4557  C  CA  . THR C 3 172 ? 65.995  -17.659 102.273 1.00 34.61  ? 259 THR C CA  1 
ATOM   4558  C  C   . THR C 3 172 ? 67.137  -16.980 102.989 1.00 32.65  ? 259 THR C C   1 
ATOM   4559  O  O   . THR C 3 172 ? 68.174  -17.579 103.226 1.00 28.25  ? 259 THR C O   1 
ATOM   4560  C  CB  . THR C 3 172 ? 64.699  -17.366 103.013 1.00 37.55  ? 259 THR C CB  1 
ATOM   4561  O  OG1 . THR C 3 172 ? 64.895  -17.578 104.414 1.00 36.55  ? 259 THR C OG1 1 
ATOM   4562  C  CG2 . THR C 3 172 ? 63.602  -18.272 102.506 1.00 39.78  ? 259 THR C CG2 1 
ATOM   4563  N  N   . ALA C 3 173 ? 66.919  -15.717 103.331 1.00 34.25  ? 260 ALA C N   1 
ATOM   4564  C  CA  . ALA C 3 173 ? 67.881  -14.879 104.025 1.00 33.94  ? 260 ALA C CA  1 
ATOM   4565  C  C   . ALA C 3 173 ? 67.143  -13.568 104.109 1.00 34.99  ? 260 ALA C C   1 
ATOM   4566  O  O   . ALA C 3 173 ? 66.798  -12.973 103.096 1.00 37.22  ? 260 ALA C O   1 
ATOM   4567  C  CB  . ALA C 3 173 ? 69.155  -14.720 103.214 1.00 32.97  ? 260 ALA C CB  1 
ATOM   4568  N  N   . ASP C 3 174 ? 66.849  -13.141 105.322 1.00 35.49  ? 261 ASP C N   1 
ATOM   4569  C  CA  . ASP C 3 174 ? 66.101  -11.916 105.502 1.00 34.27  ? 261 ASP C CA  1 
ATOM   4570  C  C   . ASP C 3 174 ? 66.931  -10.836 106.124 1.00 28.36  ? 261 ASP C C   1 
ATOM   4571  O  O   . ASP C 3 174 ? 68.003  -11.089 106.650 1.00 32.00  ? 261 ASP C O   1 
ATOM   4572  C  CB  . ASP C 3 174 ? 64.880  -12.220 106.340 1.00 36.41  ? 261 ASP C CB  1 
ATOM   4573  C  CG  . ASP C 3 174 ? 64.144  -13.430 105.831 1.00 45.21  ? 261 ASP C CG  1 
ATOM   4574  O  OD1 . ASP C 3 174 ? 64.588  -14.570 106.108 1.00 54.41  ? 261 ASP C OD1 1 
ATOM   4575  O  OD2 . ASP C 3 174 ? 63.158  -13.245 105.098 1.00 49.88  ? 261 ASP C OD2 1 
ATOM   4576  N  N   . TYR C 3 175 ? 66.460  -9.611  106.007 1.00 25.69  ? 262 TYR C N   1 
ATOM   4577  C  CA  . TYR C 3 175 ? 67.171  -8.466  106.556 1.00 29.01  ? 262 TYR C CA  1 
ATOM   4578  C  C   . TYR C 3 175 ? 66.139  -7.439  106.978 1.00 28.99  ? 262 TYR C C   1 
ATOM   4579  O  O   . TYR C 3 175 ? 65.304  -7.022  106.175 1.00 26.16  ? 262 TYR C O   1 
ATOM   4580  C  CB  . TYR C 3 175 ? 68.127  -7.893  105.508 1.00 22.95  ? 262 TYR C CB  1 
ATOM   4581  C  CG  . TYR C 3 175 ? 69.297  -8.808  105.235 1.00 19.76  ? 262 TYR C CG  1 
ATOM   4582  C  CD1 . TYR C 3 175 ? 70.452  -8.727  106.004 1.00 22.12  ? 262 TYR C CD1 1 
ATOM   4583  C  CD2 . TYR C 3 175 ? 69.246  -9.767  104.245 1.00 18.12  ? 262 TYR C CD2 1 
ATOM   4584  C  CE1 . TYR C 3 175 ? 71.521  -9.565  105.806 1.00 14.03  ? 262 TYR C CE1 1 
ATOM   4585  C  CE2 . TYR C 3 175 ? 70.327  -10.623 104.039 1.00 21.68  ? 262 TYR C CE2 1 
ATOM   4586  C  CZ  . TYR C 3 175 ? 71.465  -10.505 104.835 1.00 18.03  ? 262 TYR C CZ  1 
ATOM   4587  O  OH  . TYR C 3 175 ? 72.563  -11.322 104.670 1.00 25.91  ? 262 TYR C OH  1 
ATOM   4588  N  N   . ALA C 3 176 ? 66.154  -7.105  108.265 1.00 25.33  ? 263 ALA C N   1 
ATOM   4589  C  CA  . ALA C 3 176 ? 65.200  -6.151  108.819 1.00 26.91  ? 263 ALA C CA  1 
ATOM   4590  C  C   . ALA C 3 176 ? 65.666  -4.719  108.672 1.00 28.53  ? 263 ALA C C   1 
ATOM   4591  O  O   . ALA C 3 176 ? 66.871  -4.427  108.736 1.00 25.76  ? 263 ALA C O   1 
ATOM   4592  C  CB  . ALA C 3 176 ? 64.903  -6.461  110.278 1.00 26.12  ? 263 ALA C CB  1 
ATOM   4593  N  N   . MET C 3 177 ? 64.687  -3.836  108.486 1.00 28.19  ? 264 MET C N   1 
ATOM   4594  C  CA  . MET C 3 177 ? 64.931  -2.418  108.324 1.00 28.98  ? 264 MET C CA  1 
ATOM   4595  C  C   . MET C 3 177 ? 65.790  -2.188  107.106 1.00 26.61  ? 264 MET C C   1 
ATOM   4596  O  O   . MET C 3 177 ? 66.832  -1.528  107.161 1.00 22.29  ? 264 MET C O   1 
ATOM   4597  C  CB  . MET C 3 177 ? 65.609  -1.846  109.560 1.00 41.07  ? 264 MET C CB  1 
ATOM   4598  C  CG  . MET C 3 177 ? 64.659  -1.372  110.626 1.00 50.17  ? 264 MET C CG  1 
ATOM   4599  S  SD  . MET C 3 177 ? 63.790  -2.692  111.375 1.00 57.81  ? 264 MET C SD  1 
ATOM   4600  C  CE  . MET C 3 177 ? 64.709  -2.892  112.868 1.00 55.27  ? 264 MET C CE  1 
ATOM   4601  N  N   . PHE C 3 178 ? 65.369  -2.803  106.011 1.00 30.28  ? 265 PHE C N   1 
ATOM   4602  C  CA  . PHE C 3 178 ? 66.072  -2.678  104.756 1.00 28.30  ? 265 PHE C CA  1 
ATOM   4603  C  C   . PHE C 3 178 ? 65.701  -1.363  104.111 1.00 30.14  ? 265 PHE C C   1 
ATOM   4604  O  O   . PHE C 3 178 ? 64.557  -0.917  104.198 1.00 31.38  ? 265 PHE C O   1 
ATOM   4605  C  CB  . PHE C 3 178 ? 65.687  -3.806  103.832 1.00 26.20  ? 265 PHE C CB  1 
ATOM   4606  C  CG  . PHE C 3 178 ? 66.134  -3.597  102.430 1.00 29.94  ? 265 PHE C CG  1 
ATOM   4607  C  CD1 . PHE C 3 178 ? 67.373  -4.052  102.013 1.00 31.61  ? 265 PHE C CD1 1 
ATOM   4608  C  CD2 . PHE C 3 178 ? 65.308  -2.953  101.512 1.00 28.65  ? 265 PHE C CD2 1 
ATOM   4609  C  CE1 . PHE C 3 178 ? 67.787  -3.874  100.699 1.00 30.16  ? 265 PHE C CE1 1 
ATOM   4610  C  CE2 . PHE C 3 178 ? 65.709  -2.767  100.196 1.00 23.69  ? 265 PHE C CE2 1 
ATOM   4611  C  CZ  . PHE C 3 178 ? 66.949  -3.229  99.785  1.00 28.52  ? 265 PHE C CZ  1 
ATOM   4612  N  N   . LYS C 3 179 ? 66.667  -0.752  103.439 1.00 32.63  ? 266 LYS C N   1 
ATOM   4613  C  CA  . LYS C 3 179 ? 66.421  0.517   102.771 1.00 30.88  ? 266 LYS C CA  1 
ATOM   4614  C  C   . LYS C 3 179 ? 67.588  0.850   101.846 1.00 25.78  ? 266 LYS C C   1 
ATOM   4615  O  O   . LYS C 3 179 ? 68.713  0.376   102.055 1.00 21.43  ? 266 LYS C O   1 
ATOM   4616  C  CB  . LYS C 3 179 ? 66.214  1.631   103.808 1.00 33.45  ? 266 LYS C CB  1 
ATOM   4617  C  CG  . LYS C 3 179 ? 67.484  2.120   104.453 1.00 38.63  ? 266 LYS C CG  1 
ATOM   4618  C  CD  . LYS C 3 179 ? 67.198  2.735   105.797 1.00 49.84  ? 266 LYS C CD  1 
ATOM   4619  C  CE  . LYS C 3 179 ? 66.960  1.659   106.856 1.00 56.47  ? 266 LYS C CE  1 
ATOM   4620  N  NZ  . LYS C 3 179 ? 68.135  0.751   107.052 1.00 57.09  ? 266 LYS C NZ  1 
ATOM   4621  N  N   . VAL C 3 180 ? 67.287  1.631   100.809 1.00 16.25  ? 267 VAL C N   1 
ATOM   4622  C  CA  . VAL C 3 180 ? 68.260  2.083   99.806  1.00 20.99  ? 267 VAL C CA  1 
ATOM   4623  C  C   . VAL C 3 180 ? 68.151  3.615   99.642  1.00 24.76  ? 267 VAL C C   1 
ATOM   4624  O  O   . VAL C 3 180 ? 67.057  4.148   99.425  1.00 28.32  ? 267 VAL C O   1 
ATOM   4625  C  CB  . VAL C 3 180 ? 67.995  1.421   98.429  1.00 17.53  ? 267 VAL C CB  1 
ATOM   4626  C  CG1 . VAL C 3 180 ? 68.943  1.968   97.393  1.00 17.91  ? 267 VAL C CG1 1 
ATOM   4627  C  CG2 . VAL C 3 180 ? 68.158  -0.079  98.519  1.00 19.28  ? 267 VAL C CG2 1 
ATOM   4628  N  N   . GLY C 3 181 ? 69.275  4.321   99.688  1.00 21.57  ? 268 GLY C N   1 
ATOM   4629  C  CA  . GLY C 3 181 ? 69.204  5.765   99.585  1.00 19.23  ? 268 GLY C CA  1 
ATOM   4630  C  C   . GLY C 3 181 ? 68.930  6.341   98.211  1.00 22.31  ? 268 GLY C C   1 
ATOM   4631  O  O   . GLY C 3 181 ? 68.723  5.616   97.245  1.00 22.10  ? 268 GLY C O   1 
ATOM   4632  N  N   . PRO C 3 182 ? 68.883  7.672   98.110  1.00 14.47  ? 269 PRO C N   1 
ATOM   4633  C  CA  . PRO C 3 182 ? 68.644  8.391   96.869  1.00 9.87   ? 269 PRO C CA  1 
ATOM   4634  C  C   . PRO C 3 182 ? 69.892  8.340   95.986  1.00 12.10  ? 269 PRO C C   1 
ATOM   4635  O  O   . PRO C 3 182 ? 70.966  7.905   96.415  1.00 19.12  ? 269 PRO C O   1 
ATOM   4636  C  CB  . PRO C 3 182 ? 68.392  9.801   97.362  1.00 9.35   ? 269 PRO C CB  1 
ATOM   4637  C  CG  . PRO C 3 182 ? 69.312  9.907   98.509  1.00 9.09   ? 269 PRO C CG  1 
ATOM   4638  C  CD  . PRO C 3 182 ? 69.064  8.612   99.226  1.00 8.97   ? 269 PRO C CD  1 
ATOM   4639  N  N   . GLU C 3 183 ? 69.771  8.843   94.768  1.00 9.00   ? 270 GLU C N   1 
ATOM   4640  C  CA  . GLU C 3 183 ? 70.916  8.823   93.880  1.00 18.83  ? 270 GLU C CA  1 
ATOM   4641  C  C   . GLU C 3 183 ? 72.064  9.673   94.412  1.00 19.06  ? 270 GLU C C   1 
ATOM   4642  O  O   . GLU C 3 183 ? 73.232  9.386   94.186  1.00 24.24  ? 270 GLU C O   1 
ATOM   4643  C  CB  . GLU C 3 183 ? 70.504  9.304   92.508  1.00 24.23  ? 270 GLU C CB  1 
ATOM   4644  C  CG  . GLU C 3 183 ? 71.597  9.186   91.470  1.00 30.01  ? 270 GLU C CG  1 
ATOM   4645  C  CD  . GLU C 3 183 ? 71.120  9.578   90.084  1.00 33.30  ? 270 GLU C CD  1 
ATOM   4646  O  OE1 . GLU C 3 183 ? 70.051  10.241  89.988  1.00 30.56  ? 270 GLU C OE1 1 
ATOM   4647  O  OE2 . GLU C 3 183 ? 71.814  9.220   89.099  1.00 38.18  ? 270 GLU C OE2 1 
ATOM   4648  N  N   . ALA C 3 184 ? 71.715  10.707  95.149  1.00 17.67  ? 271 ALA C N   1 
ATOM   4649  C  CA  . ALA C 3 184 ? 72.715  11.593  95.713  1.00 24.54  ? 271 ALA C CA  1 
ATOM   4650  C  C   . ALA C 3 184 ? 73.575  10.826  96.686  1.00 25.83  ? 271 ALA C C   1 
ATOM   4651  O  O   . ALA C 3 184 ? 74.656  11.264  97.053  1.00 25.71  ? 271 ALA C O   1 
ATOM   4652  C  CB  . ALA C 3 184 ? 72.058  12.749  96.411  1.00 29.90  ? 271 ALA C CB  1 
ATOM   4653  N  N   . ASP C 3 185 ? 73.069  9.694   97.146  1.00 25.72  ? 272 ASP C N   1 
ATOM   4654  C  CA  . ASP C 3 185 ? 73.852  8.890   98.054  1.00 22.37  ? 272 ASP C CA  1 
ATOM   4655  C  C   . ASP C 3 185 ? 74.340  7.667   97.310  1.00 23.69  ? 272 ASP C C   1 
ATOM   4656  O  O   . ASP C 3 185 ? 74.849  6.723   97.916  1.00 17.31  ? 272 ASP C O   1 
ATOM   4657  C  CB  . ASP C 3 185 ? 73.039  8.475   99.256  1.00 19.59  ? 272 ASP C CB  1 
ATOM   4658  C  CG  . ASP C 3 185 ? 73.909  8.024   100.371 1.00 24.30  ? 272 ASP C CG  1 
ATOM   4659  O  OD1 . ASP C 3 185 ? 75.064  8.483   100.393 1.00 26.54  ? 272 ASP C OD1 1 
ATOM   4660  O  OD2 . ASP C 3 185 ? 73.466  7.209   101.205 1.00 28.50  ? 272 ASP C OD2 1 
ATOM   4661  N  N   . LYS C 3 186 ? 74.209  7.727   95.981  1.00 25.82  ? 273 LYS C N   1 
ATOM   4662  C  CA  . LYS C 3 186 ? 74.599  6.656   95.069  1.00 24.69  ? 273 LYS C CA  1 
ATOM   4663  C  C   . LYS C 3 186 ? 73.840  5.398   95.440  1.00 28.57  ? 273 LYS C C   1 
ATOM   4664  O  O   . LYS C 3 186 ? 74.404  4.296   95.431  1.00 32.30  ? 273 LYS C O   1 
ATOM   4665  C  CB  . LYS C 3 186 ? 76.108  6.404   95.120  1.00 19.64  ? 273 LYS C CB  1 
ATOM   4666  C  CG  . LYS C 3 186 ? 76.921  7.666   95.235  1.00 22.85  ? 273 LYS C CG  1 
ATOM   4667  C  CD  . LYS C 3 186 ? 76.519  8.668   94.174  1.00 26.06  ? 273 LYS C CD  1 
ATOM   4668  C  CE  . LYS C 3 186 ? 77.106  8.287   92.832  1.00 30.14  ? 273 LYS C CE  1 
ATOM   4669  N  NZ  . LYS C 3 186 ? 78.600  8.393   92.831  1.00 34.12  ? 273 LYS C NZ  1 
ATOM   4670  N  N   . TYR C 3 187 ? 72.582  5.594   95.843  1.00 25.26  ? 274 TYR C N   1 
ATOM   4671  C  CA  . TYR C 3 187 ? 71.680  4.507   96.223  1.00 26.62  ? 274 TYR C CA  1 
ATOM   4672  C  C   . TYR C 3 187 ? 72.258  3.545   97.253  1.00 30.42  ? 274 TYR C C   1 
ATOM   4673  O  O   . TYR C 3 187 ? 72.077  2.328   97.132  1.00 24.60  ? 274 TYR C O   1 
ATOM   4674  C  CB  . TYR C 3 187 ? 71.253  3.722   94.976  1.00 26.49  ? 274 TYR C CB  1 
ATOM   4675  C  CG  . TYR C 3 187 ? 70.460  4.556   93.986  1.00 37.64  ? 274 TYR C CG  1 
ATOM   4676  C  CD1 . TYR C 3 187 ? 69.189  5.052   94.319  1.00 39.17  ? 274 TYR C CD1 1 
ATOM   4677  C  CD2 . TYR C 3 187 ? 70.975  4.855   92.721  1.00 32.46  ? 274 TYR C CD2 1 
ATOM   4678  C  CE1 . TYR C 3 187 ? 68.461  5.807   93.428  1.00 33.45  ? 274 TYR C CE1 1 
ATOM   4679  C  CE2 . TYR C 3 187 ? 70.254  5.615   91.829  1.00 29.89  ? 274 TYR C CE2 1 
ATOM   4680  C  CZ  . TYR C 3 187 ? 68.999  6.083   92.186  1.00 34.73  ? 274 TYR C CZ  1 
ATOM   4681  O  OH  . TYR C 3 187 ? 68.272  6.817   91.278  1.00 41.79  ? 274 TYR C OH  1 
ATOM   4682  N  N   . ARG C 3 188 ? 72.926  4.089   98.272  1.00 30.46  ? 275 ARG C N   1 
ATOM   4683  C  CA  . ARG C 3 188 ? 73.554  3.271   99.306  1.00 21.75  ? 275 ARG C CA  1 
ATOM   4684  C  C   . ARG C 3 188 ? 72.558  2.289   99.900  1.00 23.17  ? 275 ARG C C   1 
ATOM   4685  O  O   . ARG C 3 188 ? 71.352  2.568   99.959  1.00 11.26  ? 275 ARG C O   1 
ATOM   4686  C  CB  . ARG C 3 188 ? 74.141  4.146   100.412 1.00 17.71  ? 275 ARG C CB  1 
ATOM   4687  C  CG  . ARG C 3 188 ? 74.703  3.359   101.576 1.00 21.43  ? 275 ARG C CG  1 
ATOM   4688  C  CD  . ARG C 3 188 ? 75.343  4.278   102.603 1.00 22.70  ? 275 ARG C CD  1 
ATOM   4689  N  NE  . ARG C 3 188 ? 76.758  4.549   102.334 1.00 22.28  ? 275 ARG C NE  1 
ATOM   4690  C  CZ  . ARG C 3 188 ? 77.215  5.702   101.866 1.00 25.85  ? 275 ARG C CZ  1 
ATOM   4691  N  NH1 . ARG C 3 188 ? 76.359  6.677   101.620 1.00 26.22  ? 275 ARG C NH1 1 
ATOM   4692  N  NH2 . ARG C 3 188 ? 78.517  5.880   101.639 1.00 28.67  ? 275 ARG C NH2 1 
ATOM   4693  N  N   . LEU C 3 189 ? 73.084  1.134   100.311 1.00 25.23  ? 276 LEU C N   1 
ATOM   4694  C  CA  . LEU C 3 189 ? 72.309  0.061   100.916 1.00 17.21  ? 276 LEU C CA  1 
ATOM   4695  C  C   . LEU C 3 189 ? 72.580  -0.046  102.389 1.00 20.52  ? 276 LEU C C   1 
ATOM   4696  O  O   . LEU C 3 189 ? 73.740  -0.079  102.799 1.00 28.24  ? 276 LEU C O   1 
ATOM   4697  C  CB  . LEU C 3 189 ? 72.719  -1.283  100.318 1.00 18.49  ? 276 LEU C CB  1 
ATOM   4698  C  CG  . LEU C 3 189 ? 72.485  -2.540  101.192 1.00 15.09  ? 276 LEU C CG  1 
ATOM   4699  C  CD1 . LEU C 3 189 ? 71.020  -3.009  101.093 1.00 7.95   ? 276 LEU C CD1 1 
ATOM   4700  C  CD2 . LEU C 3 189 ? 73.431  -3.660  100.769 1.00 17.63  ? 276 LEU C CD2 1 
ATOM   4701  N  N   . THR C 3 190 ? 71.513  -0.169  103.174 1.00 21.92  ? 277 THR C N   1 
ATOM   4702  C  CA  . THR C 3 190 ? 71.639  -0.363  104.614 1.00 17.33  ? 277 THR C CA  1 
ATOM   4703  C  C   . THR C 3 190 ? 70.460  -1.155  105.164 1.00 22.49  ? 277 THR C C   1 
ATOM   4704  O  O   . THR C 3 190 ? 69.317  -1.056  104.668 1.00 19.63  ? 277 THR C O   1 
ATOM   4705  C  CB  . THR C 3 190 ? 71.737  0.941   105.397 1.00 17.61  ? 277 THR C CB  1 
ATOM   4706  O  OG1 . THR C 3 190 ? 70.545  1.709   105.204 1.00 17.81  ? 277 THR C OG1 1 
ATOM   4707  C  CG2 . THR C 3 190 ? 72.941  1.753   104.960 1.00 23.54  ? 277 THR C CG2 1 
ATOM   4708  N  N   . TYR C 3 191 ? 70.777  -1.949  106.182 1.00 20.09  ? 278 TYR C N   1 
ATOM   4709  C  CA  . TYR C 3 191 ? 69.826  -2.775  106.889 1.00 23.39  ? 278 TYR C CA  1 
ATOM   4710  C  C   . TYR C 3 191 ? 70.220  -2.796  108.379 1.00 29.84  ? 278 TYR C C   1 
ATOM   4711  O  O   . TYR C 3 191 ? 71.406  -2.635  108.722 1.00 29.16  ? 278 TYR C O   1 
ATOM   4712  C  CB  . TYR C 3 191 ? 69.795  -4.184  106.282 1.00 27.10  ? 278 TYR C CB  1 
ATOM   4713  C  CG  . TYR C 3 191 ? 71.064  -5.006  106.421 1.00 26.73  ? 278 TYR C CG  1 
ATOM   4714  C  CD1 . TYR C 3 191 ? 71.274  -5.819  107.537 1.00 26.09  ? 278 TYR C CD1 1 
ATOM   4715  C  CD2 . TYR C 3 191 ? 72.033  -4.996  105.428 1.00 25.70  ? 278 TYR C CD2 1 
ATOM   4716  C  CE1 . TYR C 3 191 ? 72.418  -6.599  107.659 1.00 32.37  ? 278 TYR C CE1 1 
ATOM   4717  C  CE2 . TYR C 3 191 ? 73.184  -5.771  105.538 1.00 31.86  ? 278 TYR C CE2 1 
ATOM   4718  C  CZ  . TYR C 3 191 ? 73.374  -6.572  106.657 1.00 36.20  ? 278 TYR C CZ  1 
ATOM   4719  O  OH  . TYR C 3 191 ? 74.516  -7.348  106.771 1.00 44.85  ? 278 TYR C OH  1 
ATOM   4720  N  N   . ALA C 3 192 ? 69.232  -2.967  109.260 1.00 29.27  ? 279 ALA C N   1 
ATOM   4721  C  CA  . ALA C 3 192 ? 69.480  -2.984  110.707 1.00 30.41  ? 279 ALA C CA  1 
ATOM   4722  C  C   . ALA C 3 192 ? 70.250  -4.211  111.149 1.00 33.22  ? 279 ALA C C   1 
ATOM   4723  O  O   . ALA C 3 192 ? 71.263  -4.103  111.846 1.00 31.78  ? 279 ALA C O   1 
ATOM   4724  C  CB  . ALA C 3 192 ? 68.178  -2.901  111.476 1.00 34.81  ? 279 ALA C CB  1 
ATOM   4725  N  N   . TYR C 3 193 ? 69.752  -5.378  110.753 1.00 34.74  ? 280 TYR C N   1 
ATOM   4726  C  CA  . TYR C 3 193 ? 70.383  -6.641  111.108 1.00 34.79  ? 280 TYR C CA  1 
ATOM   4727  C  C   . TYR C 3 193 ? 69.835  -7.775  110.275 1.00 35.58  ? 280 TYR C C   1 
ATOM   4728  O  O   . TYR C 3 193 ? 68.750  -7.678  109.692 1.00 35.81  ? 280 TYR C O   1 
ATOM   4729  C  CB  . TYR C 3 193 ? 70.119  -6.969  112.569 1.00 33.31  ? 280 TYR C CB  1 
ATOM   4730  C  CG  . TYR C 3 193 ? 68.654  -7.097  112.877 1.00 24.61  ? 280 TYR C CG  1 
ATOM   4731  C  CD1 . TYR C 3 193 ? 67.904  -5.984  113.183 1.00 21.62  ? 280 TYR C CD1 1 
ATOM   4732  C  CD2 . TYR C 3 193 ? 68.030  -8.338  112.884 1.00 25.74  ? 280 TYR C CD2 1 
ATOM   4733  C  CE1 . TYR C 3 193 ? 66.579  -6.091  113.495 1.00 24.15  ? 280 TYR C CE1 1 
ATOM   4734  C  CE2 . TYR C 3 193 ? 66.699  -8.460  113.196 1.00 26.83  ? 280 TYR C CE2 1 
ATOM   4735  C  CZ  . TYR C 3 193 ? 65.978  -7.329  113.505 1.00 25.06  ? 280 TYR C CZ  1 
ATOM   4736  O  OH  . TYR C 3 193 ? 64.654  -7.429  113.858 1.00 27.54  ? 280 TYR C OH  1 
ATOM   4737  N  N   . PHE C 3 194 ? 70.588  -8.864  110.259 1.00 35.69  ? 281 PHE C N   1 
ATOM   4738  C  CA  . PHE C 3 194 ? 70.197  -10.051 109.539 1.00 31.23  ? 281 PHE C CA  1 
ATOM   4739  C  C   . PHE C 3 194 ? 69.244  -10.825 110.428 1.00 33.44  ? 281 PHE C C   1 
ATOM   4740  O  O   . PHE C 3 194 ? 69.596  -11.205 111.553 1.00 35.30  ? 281 PHE C O   1 
ATOM   4741  C  CB  . PHE C 3 194 ? 71.423  -10.886 109.240 1.00 32.28  ? 281 PHE C CB  1 
ATOM   4742  C  CG  . PHE C 3 194 ? 71.115  -12.241 108.754 1.00 32.77  ? 281 PHE C CG  1 
ATOM   4743  C  CD1 . PHE C 3 194 ? 70.568  -12.427 107.503 1.00 35.74  ? 281 PHE C CD1 1 
ATOM   4744  C  CD2 . PHE C 3 194 ? 71.378  -13.346 109.544 1.00 34.65  ? 281 PHE C CD2 1 
ATOM   4745  C  CE1 . PHE C 3 194 ? 70.288  -13.701 107.039 1.00 36.83  ? 281 PHE C CE1 1 
ATOM   4746  C  CE2 . PHE C 3 194 ? 71.099  -14.629 109.092 1.00 32.09  ? 281 PHE C CE2 1 
ATOM   4747  C  CZ  . PHE C 3 194 ? 70.555  -14.805 107.837 1.00 34.22  ? 281 PHE C CZ  1 
ATOM   4748  N  N   . ALA C 3 195 ? 68.009  -10.968 109.956 1.00 37.25  ? 282 ALA C N   1 
ATOM   4749  C  CA  . ALA C 3 195 ? 66.981  -11.715 110.667 1.00 32.86  ? 282 ALA C CA  1 
ATOM   4750  C  C   . ALA C 3 195 ? 67.196  -13.191 110.298 1.00 36.42  ? 282 ALA C C   1 
ATOM   4751  O  O   . ALA C 3 195 ? 68.315  -13.588 109.977 1.00 42.55  ? 282 ALA C O   1 
ATOM   4752  C  CB  . ALA C 3 195 ? 65.620  -11.241 110.243 1.00 24.08  ? 282 ALA C CB  1 
ATOM   4753  N  N   . GLY C 3 196 ? 66.142  -13.995 110.297 1.00 37.02  ? 283 GLY C N   1 
ATOM   4754  C  CA  . GLY C 3 196 ? 66.299  -15.404 109.964 1.00 38.35  ? 283 GLY C CA  1 
ATOM   4755  C  C   . GLY C 3 196 ? 66.901  -15.774 108.613 1.00 33.70  ? 283 GLY C C   1 
ATOM   4756  O  O   . GLY C 3 196 ? 67.781  -15.104 108.090 1.00 26.76  ? 283 GLY C O   1 
ATOM   4757  N  N   . GLY C 3 197 ? 66.414  -16.867 108.048 1.00 38.25  ? 284 GLY C N   1 
ATOM   4758  C  CA  . GLY C 3 197 ? 66.914  -17.315 106.766 1.00 38.35  ? 284 GLY C CA  1 
ATOM   4759  C  C   . GLY C 3 197 ? 67.984  -18.378 106.933 1.00 39.20  ? 284 GLY C C   1 
ATOM   4760  O  O   . GLY C 3 197 ? 68.910  -18.217 107.725 1.00 36.90  ? 284 GLY C O   1 
ATOM   4761  N  N   . ASP C 3 198 ? 67.840  -19.479 106.199 1.00 44.44  ? 285 ASP C N   1 
ATOM   4762  C  CA  . ASP C 3 198 ? 68.806  -20.568 106.252 1.00 46.12  ? 285 ASP C CA  1 
ATOM   4763  C  C   . ASP C 3 198 ? 69.953  -20.434 105.223 1.00 42.83  ? 285 ASP C C   1 
ATOM   4764  O  O   . ASP C 3 198 ? 70.848  -21.285 105.190 1.00 42.87  ? 285 ASP C O   1 
ATOM   4765  C  CB  . ASP C 3 198 ? 68.096  -21.941 106.134 1.00 50.99  ? 285 ASP C CB  1 
ATOM   4766  C  CG  . ASP C 3 198 ? 67.580  -22.247 104.716 1.00 56.82  ? 285 ASP C CG  1 
ATOM   4767  O  OD1 . ASP C 3 198 ? 66.721  -21.496 104.198 1.00 59.22  ? 285 ASP C OD1 1 
ATOM   4768  O  OD2 . ASP C 3 198 ? 68.013  -23.270 104.135 1.00 58.49  ? 285 ASP C OD2 1 
ATOM   4769  N  N   . ALA C 3 199 ? 69.945  -19.374 104.403 1.00 39.15  ? 286 ALA C N   1 
ATOM   4770  C  CA  . ALA C 3 199 ? 70.996  -19.169 103.399 1.00 34.96  ? 286 ALA C CA  1 
ATOM   4771  C  C   . ALA C 3 199 ? 72.254  -18.513 103.971 1.00 39.66  ? 286 ALA C C   1 
ATOM   4772  O  O   . ALA C 3 199 ? 73.338  -18.630 103.390 1.00 42.34  ? 286 ALA C O   1 
ATOM   4773  C  CB  . ALA C 3 199 ? 70.484  -18.378 102.220 1.00 27.80  ? 286 ALA C CB  1 
ATOM   4774  N  N   . GLY C 3 200 ? 72.104  -17.790 105.080 1.00 32.77  ? 287 GLY C N   1 
ATOM   4775  C  CA  . GLY C 3 200 ? 73.256  -17.164 105.705 1.00 22.07  ? 287 GLY C CA  1 
ATOM   4776  C  C   . GLY C 3 200 ? 73.524  -15.724 105.345 1.00 21.95  ? 287 GLY C C   1 
ATOM   4777  O  O   . GLY C 3 200 ? 73.496  -15.359 104.180 1.00 29.23  ? 287 GLY C O   1 
ATOM   4778  N  N   . ASP C 3 201 ? 73.865  -14.921 106.346 1.00 23.17  ? 288 ASP C N   1 
ATOM   4779  C  CA  . ASP C 3 201 ? 74.143  -13.510 106.152 1.00 23.43  ? 288 ASP C CA  1 
ATOM   4780  C  C   . ASP C 3 201 ? 75.395  -13.282 105.335 1.00 29.01  ? 288 ASP C C   1 
ATOM   4781  O  O   . ASP C 3 201 ? 76.474  -13.023 105.881 1.00 32.91  ? 288 ASP C O   1 
ATOM   4782  C  CB  . ASP C 3 201 ? 74.283  -12.809 107.502 1.00 24.78  ? 288 ASP C CB  1 
ATOM   4783  C  CG  . ASP C 3 201 ? 74.389  -11.304 107.366 1.00 35.99  ? 288 ASP C CG  1 
ATOM   4784  O  OD1 . ASP C 3 201 ? 74.437  -10.785 106.220 1.00 35.10  ? 288 ASP C OD1 1 
ATOM   4785  O  OD2 . ASP C 3 201 ? 74.422  -10.633 108.417 1.00 42.52  ? 288 ASP C OD2 1 
ATOM   4786  N  N   . ALA C 3 202 ? 75.245  -13.354 104.023 1.00 27.42  ? 289 ALA C N   1 
ATOM   4787  C  CA  . ALA C 3 202 ? 76.372  -13.137 103.134 1.00 29.07  ? 289 ALA C CA  1 
ATOM   4788  C  C   . ALA C 3 202 ? 76.672  -11.633 103.096 1.00 29.29  ? 289 ALA C C   1 
ATOM   4789  O  O   . ALA C 3 202 ? 77.799  -11.208 102.786 1.00 26.21  ? 289 ALA C O   1 
ATOM   4790  C  CB  . ALA C 3 202 ? 76.071  -13.691 101.716 1.00 26.46  ? 289 ALA C CB  1 
ATOM   4791  N  N   . PHE C 3 203 ? 75.670  -10.838 103.467 1.00 26.37  ? 290 PHE C N   1 
ATOM   4792  C  CA  . PHE C 3 203 ? 75.827  -9.393  103.472 1.00 28.50  ? 290 PHE C CA  1 
ATOM   4793  C  C   . PHE C 3 203 ? 76.774  -8.949  104.553 1.00 31.35  ? 290 PHE C C   1 
ATOM   4794  O  O   . PHE C 3 203 ? 77.304  -7.838  104.520 1.00 33.02  ? 290 PHE C O   1 
ATOM   4795  C  CB  . PHE C 3 203 ? 74.487  -8.710  103.670 1.00 26.41  ? 290 PHE C CB  1 
ATOM   4796  C  CG  . PHE C 3 203 ? 73.735  -8.491  102.391 1.00 25.13  ? 290 PHE C CG  1 
ATOM   4797  C  CD1 . PHE C 3 203 ? 74.402  -8.516  101.169 1.00 18.14  ? 290 PHE C CD1 1 
ATOM   4798  C  CD2 . PHE C 3 203 ? 72.355  -8.287  102.402 1.00 24.36  ? 290 PHE C CD2 1 
ATOM   4799  C  CE1 . PHE C 3 203 ? 73.702  -8.350  99.983  1.00 22.12  ? 290 PHE C CE1 1 
ATOM   4800  C  CE2 . PHE C 3 203 ? 71.654  -8.118  101.214 1.00 20.54  ? 290 PHE C CE2 1 
ATOM   4801  C  CZ  . PHE C 3 203 ? 72.328  -8.152  100.002 1.00 20.15  ? 290 PHE C CZ  1 
ATOM   4802  N  N   . ASP C 3 204 ? 76.990  -9.840  105.509 1.00 34.46  ? 291 ASP C N   1 
ATOM   4803  C  CA  . ASP C 3 204 ? 77.859  -9.567  106.630 1.00 35.06  ? 291 ASP C CA  1 
ATOM   4804  C  C   . ASP C 3 204 ? 79.316  -9.755  106.261 1.00 34.75  ? 291 ASP C C   1 
ATOM   4805  O  O   . ASP C 3 204 ? 80.201  -9.478  107.055 1.00 36.47  ? 291 ASP C O   1 
ATOM   4806  C  CB  . ASP C 3 204 ? 77.511  -10.514 107.759 1.00 37.11  ? 291 ASP C CB  1 
ATOM   4807  C  CG  . ASP C 3 204 ? 78.160  -10.119 109.059 1.00 51.81  ? 291 ASP C CG  1 
ATOM   4808  O  OD1 . ASP C 3 204 ? 78.152  -8.912  109.372 1.00 57.23  ? 291 ASP C OD1 1 
ATOM   4809  O  OD2 . ASP C 3 204 ? 78.680  -11.008 109.772 1.00 57.69  ? 291 ASP C OD2 1 
ATOM   4810  N  N   . GLY C 3 205 ? 79.571  -10.177 105.035 1.00 30.39  ? 292 GLY C N   1 
ATOM   4811  C  CA  . GLY C 3 205 ? 80.937  -10.431 104.641 1.00 32.54  ? 292 GLY C CA  1 
ATOM   4812  C  C   . GLY C 3 205 ? 81.214  -11.890 104.939 1.00 38.41  ? 292 GLY C C   1 
ATOM   4813  O  O   . GLY C 3 205 ? 80.494  -12.541 105.724 1.00 37.97  ? 292 GLY C O   1 
ATOM   4814  N  N   . PHE C 3 206 ? 82.283  -12.402 104.352 1.00 40.15  ? 293 PHE C N   1 
ATOM   4815  C  CA  . PHE C 3 206 ? 82.617  -13.794 104.534 1.00 41.29  ? 293 PHE C CA  1 
ATOM   4816  C  C   . PHE C 3 206 ? 84.111  -13.940 104.452 1.00 41.16  ? 293 PHE C C   1 
ATOM   4817  O  O   . PHE C 3 206 ? 84.773  -13.130 103.811 1.00 36.23  ? 293 PHE C O   1 
ATOM   4818  C  CB  . PHE C 3 206 ? 81.958  -14.604 103.420 1.00 45.30  ? 293 PHE C CB  1 
ATOM   4819  C  CG  . PHE C 3 206 ? 82.168  -16.077 103.530 1.00 45.14  ? 293 PHE C CG  1 
ATOM   4820  C  CD1 . PHE C 3 206 ? 81.475  -16.819 104.482 1.00 44.10  ? 293 PHE C CD1 1 
ATOM   4821  C  CD2 . PHE C 3 206 ? 83.055  -16.728 102.682 1.00 44.78  ? 293 PHE C CD2 1 
ATOM   4822  C  CE1 . PHE C 3 206 ? 81.660  -18.192 104.595 1.00 46.65  ? 293 PHE C CE1 1 
ATOM   4823  C  CE2 . PHE C 3 206 ? 83.248  -18.102 102.786 1.00 49.71  ? 293 PHE C CE2 1 
ATOM   4824  C  CZ  . PHE C 3 206 ? 82.547  -18.834 103.747 1.00 50.33  ? 293 PHE C CZ  1 
ATOM   4825  N  N   . ASP C 3 207 ? 84.658  -14.940 105.133 1.00 49.43  ? 294 ASP C N   1 
ATOM   4826  C  CA  . ASP C 3 207 ? 86.086  -15.135 105.045 1.00 51.07  ? 294 ASP C CA  1 
ATOM   4827  C  C   . ASP C 3 207 ? 86.450  -16.168 103.997 1.00 48.23  ? 294 ASP C C   1 
ATOM   4828  O  O   . ASP C 3 207 ? 86.291  -17.366 104.194 1.00 46.93  ? 294 ASP C O   1 
ATOM   4829  C  CB  . ASP C 3 207 ? 86.709  -15.480 106.382 1.00 56.93  ? 294 ASP C CB  1 
ATOM   4830  C  CG  . ASP C 3 207 ? 88.105  -14.902 106.509 1.00 66.20  ? 294 ASP C CG  1 
ATOM   4831  O  OD1 . ASP C 3 207 ? 89.031  -15.380 105.802 1.00 65.80  ? 294 ASP C OD1 1 
ATOM   4832  O  OD2 . ASP C 3 207 ? 88.260  -13.919 107.266 1.00 70.27  ? 294 ASP C OD2 1 
ATOM   4833  N  N   . PHE C 3 208 ? 86.937  -15.673 102.872 1.00 53.17  ? 295 PHE C N   1 
ATOM   4834  C  CA  . PHE C 3 208 ? 87.321  -16.519 101.760 1.00 58.50  ? 295 PHE C CA  1 
ATOM   4835  C  C   . PHE C 3 208 ? 88.711  -17.124 101.936 1.00 60.80  ? 295 PHE C C   1 
ATOM   4836  O  O   . PHE C 3 208 ? 89.142  -17.955 101.127 1.00 64.89  ? 295 PHE C O   1 
ATOM   4837  C  CB  . PHE C 3 208 ? 87.208  -15.731 100.445 1.00 58.27  ? 295 PHE C CB  1 
ATOM   4838  C  CG  . PHE C 3 208 ? 85.787  -15.370 100.080 1.00 55.61  ? 295 PHE C CG  1 
ATOM   4839  C  CD1 . PHE C 3 208 ? 85.170  -14.273 100.660 1.00 50.13  ? 295 PHE C CD1 1 
ATOM   4840  C  CD2 . PHE C 3 208 ? 85.052  -16.169 99.205  1.00 52.59  ? 295 PHE C CD2 1 
ATOM   4841  C  CE1 . PHE C 3 208 ? 83.862  -13.983 100.386 1.00 47.89  ? 295 PHE C CE1 1 
ATOM   4842  C  CE2 . PHE C 3 208 ? 83.737  -15.881 98.927  1.00 49.70  ? 295 PHE C CE2 1 
ATOM   4843  C  CZ  . PHE C 3 208 ? 83.141  -14.788 99.520  1.00 50.04  ? 295 PHE C CZ  1 
ATOM   4844  N  N   . GLY C 3 209 ? 89.401  -16.724 103.003 1.00 57.66  ? 296 GLY C N   1 
ATOM   4845  C  CA  . GLY C 3 209 ? 90.726  -17.258 103.261 1.00 60.76  ? 296 GLY C CA  1 
ATOM   4846  C  C   . GLY C 3 209 ? 91.884  -16.564 102.566 1.00 62.42  ? 296 GLY C C   1 
ATOM   4847  O  O   . GLY C 3 209 ? 92.917  -16.340 103.196 1.00 65.87  ? 296 GLY C O   1 
ATOM   4848  N  N   . ASP C 3 210 ? 91.707  -16.223 101.286 1.00 62.35  ? 297 ASP C N   1 
ATOM   4849  C  CA  . ASP C 3 210 ? 92.723  -15.550 100.452 1.00 60.92  ? 297 ASP C CA  1 
ATOM   4850  C  C   . ASP C 3 210 ? 93.582  -14.597 101.265 1.00 58.19  ? 297 ASP C C   1 
ATOM   4851  O  O   . ASP C 3 210 ? 94.781  -14.435 101.030 1.00 60.07  ? 297 ASP C O   1 
ATOM   4852  C  CB  . ASP C 3 210 ? 92.046  -14.747 99.327  1.00 61.13  ? 297 ASP C CB  1 
ATOM   4853  C  CG  . ASP C 3 210 ? 91.254  -15.616 98.356  1.00 61.82  ? 297 ASP C CG  1 
ATOM   4854  O  OD1 . ASP C 3 210 ? 90.838  -16.741 98.724  1.00 62.03  ? 297 ASP C OD1 1 
ATOM   4855  O  OD2 . ASP C 3 210 ? 91.042  -15.154 97.211  1.00 64.35  ? 297 ASP C OD2 1 
ATOM   4856  N  N   . ASP C 3 211 ? 92.923  -13.954 102.212 1.00 55.20  ? 298 ASP C N   1 
ATOM   4857  C  CA  . ASP C 3 211 ? 93.548  -13.015 103.107 1.00 57.27  ? 298 ASP C CA  1 
ATOM   4858  C  C   . ASP C 3 211 ? 92.629  -12.906 104.328 1.00 59.75  ? 298 ASP C C   1 
ATOM   4859  O  O   . ASP C 3 211 ? 91.493  -13.391 104.315 1.00 62.12  ? 298 ASP C O   1 
ATOM   4860  C  CB  . ASP C 3 211 ? 93.698  -11.663 102.413 1.00 60.69  ? 298 ASP C CB  1 
ATOM   4861  C  CG  . ASP C 3 211 ? 94.727  -10.778 103.087 1.00 63.39  ? 298 ASP C CG  1 
ATOM   4862  O  OD1 . ASP C 3 211 ? 95.932  -10.942 102.778 1.00 69.62  ? 298 ASP C OD1 1 
ATOM   4863  O  OD2 . ASP C 3 211 ? 94.339  -9.947  103.944 1.00 57.53  ? 298 ASP C OD2 1 
ATOM   4864  N  N   . PRO C 3 212 ? 93.146  -12.373 105.437 1.00 61.36  ? 299 PRO C N   1 
ATOM   4865  C  CA  . PRO C 3 212 ? 92.321  -12.235 106.641 1.00 63.06  ? 299 PRO C CA  1 
ATOM   4866  C  C   . PRO C 3 212 ? 91.298  -11.095 106.569 1.00 62.31  ? 299 PRO C C   1 
ATOM   4867  O  O   . PRO C 3 212 ? 90.281  -11.109 107.276 1.00 60.06  ? 299 PRO C O   1 
ATOM   4868  C  CB  . PRO C 3 212 ? 93.364  -11.973 107.724 1.00 63.80  ? 299 PRO C CB  1 
ATOM   4869  C  CG  . PRO C 3 212 ? 94.561  -12.710 107.215 1.00 64.05  ? 299 PRO C CG  1 
ATOM   4870  C  CD  . PRO C 3 212 ? 94.573  -12.289 105.787 1.00 62.28  ? 299 PRO C CD  1 
ATOM   4871  N  N   . SER C 3 213 ? 91.582  -10.104 105.726 1.00 62.11  ? 300 SER C N   1 
ATOM   4872  C  CA  . SER C 3 213 ? 90.698  -8.947  105.554 1.00 57.69  ? 300 SER C CA  1 
ATOM   4873  C  C   . SER C 3 213 ? 89.444  -9.241  104.707 1.00 53.47  ? 300 SER C C   1 
ATOM   4874  O  O   . SER C 3 213 ? 88.454  -8.501  104.782 1.00 50.93  ? 300 SER C O   1 
ATOM   4875  C  CB  . SER C 3 213 ? 91.485  -7.776  104.951 1.00 56.41  ? 300 SER C CB  1 
ATOM   4876  O  OG  . SER C 3 213 ? 92.033  -8.109  103.685 1.00 59.58  ? 300 SER C OG  1 
ATOM   4877  N  N   . ASP C 3 214 ? 89.492  -10.329 103.926 1.00 48.12  ? 301 ASP C N   1 
ATOM   4878  C  CA  . ASP C 3 214 ? 88.394  -10.748 103.051 1.00 40.99  ? 301 ASP C CA  1 
ATOM   4879  C  C   . ASP C 3 214 ? 87.059  -10.544 103.745 1.00 37.76  ? 301 ASP C C   1 
ATOM   4880  O  O   . ASP C 3 214 ? 86.141  -9.908  103.220 1.00 31.39  ? 301 ASP C O   1 
ATOM   4881  C  CB  . ASP C 3 214 ? 88.525  -12.235 102.687 1.00 42.05  ? 301 ASP C CB  1 
ATOM   4882  C  CG  . ASP C 3 214 ? 89.731  -12.542 101.792 1.00 44.75  ? 301 ASP C CG  1 
ATOM   4883  O  OD1 . ASP C 3 214 ? 90.333  -11.616 101.184 1.00 45.71  ? 301 ASP C OD1 1 
ATOM   4884  O  OD2 . ASP C 3 214 ? 90.067  -13.748 101.692 1.00 40.96  ? 301 ASP C OD2 1 
ATOM   4885  N  N   . LYS C 3 215 ? 86.989  -11.046 104.967 1.00 38.94  ? 302 LYS C N   1 
ATOM   4886  C  CA  . LYS C 3 215 ? 85.783  -10.954 105.751 1.00 44.05  ? 302 LYS C CA  1 
ATOM   4887  C  C   . LYS C 3 215 ? 85.130  -9.568  105.767 1.00 50.64  ? 302 LYS C C   1 
ATOM   4888  O  O   . LYS C 3 215 ? 83.928  -9.458  105.501 1.00 54.72  ? 302 LYS C O   1 
ATOM   4889  C  CB  . LYS C 3 215 ? 86.046  -11.466 107.160 1.00 47.87  ? 302 LYS C CB  1 
ATOM   4890  C  CG  . LYS C 3 215 ? 84.849  -11.362 108.081 1.00 49.40  ? 302 LYS C CG  1 
ATOM   4891  C  CD  . LYS C 3 215 ? 83.602  -11.981 107.475 1.00 49.28  ? 302 LYS C CD  1 
ATOM   4892  C  CE  . LYS C 3 215 ? 82.421  -11.738 108.388 1.00 48.41  ? 302 LYS C CE  1 
ATOM   4893  N  NZ  . LYS C 3 215 ? 82.370  -10.309 108.772 1.00 48.74  ? 302 LYS C NZ  1 
ATOM   4894  N  N   . PHE C 3 216 ? 85.877  -8.509  106.077 1.00 50.93  ? 303 PHE C N   1 
ATOM   4895  C  CA  . PHE C 3 216 ? 85.223  -7.211  106.064 1.00 53.13  ? 303 PHE C CA  1 
ATOM   4896  C  C   . PHE C 3 216 ? 84.919  -6.859  104.641 1.00 54.52  ? 303 PHE C C   1 
ATOM   4897  O  O   . PHE C 3 216 ? 83.783  -6.539  104.297 1.00 61.66  ? 303 PHE C O   1 
ATOM   4898  C  CB  . PHE C 3 216 ? 86.074  -6.059  106.580 1.00 61.70  ? 303 PHE C CB  1 
ATOM   4899  C  CG  . PHE C 3 216 ? 85.619  -4.737  106.022 1.00 74.40  ? 303 PHE C CG  1 
ATOM   4900  C  CD1 . PHE C 3 216 ? 84.312  -4.300  106.248 1.00 79.90  ? 303 PHE C CD1 1 
ATOM   4901  C  CD2 . PHE C 3 216 ? 86.402  -4.032  105.115 1.00 81.20  ? 303 PHE C CD2 1 
ATOM   4902  C  CE1 . PHE C 3 216 ? 83.790  -3.190  105.566 1.00 83.42  ? 303 PHE C CE1 1 
ATOM   4903  C  CE2 . PHE C 3 216 ? 85.885  -2.916  104.425 1.00 83.21  ? 303 PHE C CE2 1 
ATOM   4904  C  CZ  . PHE C 3 216 ? 84.579  -2.501  104.651 1.00 82.63  ? 303 PHE C CZ  1 
ATOM   4905  N  N   . PHE C 3 217 ? 85.990  -6.787  103.858 1.00 46.50  ? 304 PHE C N   1 
ATOM   4906  C  CA  . PHE C 3 217 ? 85.916  -6.424  102.459 1.00 33.75  ? 304 PHE C CA  1 
ATOM   4907  C  C   . PHE C 3 217 ? 84.826  -7.107  101.659 1.00 28.47  ? 304 PHE C C   1 
ATOM   4908  O  O   . PHE C 3 217 ? 84.724  -6.881  100.474 1.00 36.37  ? 304 PHE C O   1 
ATOM   4909  C  CB  . PHE C 3 217 ? 87.258  -6.675  101.790 1.00 40.16  ? 304 PHE C CB  1 
ATOM   4910  C  CG  . PHE C 3 217 ? 88.309  -5.715  102.193 1.00 44.50  ? 304 PHE C CG  1 
ATOM   4911  C  CD1 . PHE C 3 217 ? 88.007  -4.364  102.323 1.00 46.00  ? 304 PHE C CD1 1 
ATOM   4912  C  CD2 . PHE C 3 217 ? 89.606  -6.149  102.453 1.00 48.11  ? 304 PHE C CD2 1 
ATOM   4913  C  CE1 . PHE C 3 217 ? 88.981  -3.447  102.710 1.00 44.27  ? 304 PHE C CE1 1 
ATOM   4914  C  CE2 . PHE C 3 217 ? 90.595  -5.243  102.843 1.00 50.30  ? 304 PHE C CE2 1 
ATOM   4915  C  CZ  . PHE C 3 217 ? 90.279  -3.887  102.972 1.00 46.49  ? 304 PHE C CZ  1 
ATOM   4916  N  N   . THR C 3 218 ? 84.061  -7.995  102.264 1.00 23.07  ? 305 THR C N   1 
ATOM   4917  C  CA  . THR C 3 218 ? 83.019  -8.631  101.499 1.00 31.24  ? 305 THR C CA  1 
ATOM   4918  C  C   . THR C 3 218 ? 81.659  -8.344  102.082 1.00 34.49  ? 305 THR C C   1 
ATOM   4919  O  O   . THR C 3 218 ? 80.672  -8.977  101.704 1.00 45.36  ? 305 THR C O   1 
ATOM   4920  C  CB  . THR C 3 218 ? 83.244  -10.140 101.358 1.00 31.80  ? 305 THR C CB  1 
ATOM   4921  O  OG1 . THR C 3 218 ? 83.308  -10.746 102.656 1.00 31.24  ? 305 THR C OG1 1 
ATOM   4922  C  CG2 . THR C 3 218 ? 84.526  -10.399 100.587 1.00 22.13  ? 305 THR C CG2 1 
ATOM   4923  N  N   . SER C 3 219 ? 81.608  -7.399  103.017 1.00 29.67  ? 306 SER C N   1 
ATOM   4924  C  CA  . SER C 3 219 ? 80.333  -7.024  103.629 1.00 32.15  ? 306 SER C CA  1 
ATOM   4925  C  C   . SER C 3 219 ? 79.708  -5.979  102.710 1.00 36.45  ? 306 SER C C   1 
ATOM   4926  O  O   . SER C 3 219 ? 80.427  -5.226  102.049 1.00 40.81  ? 306 SER C O   1 
ATOM   4927  C  CB  . SER C 3 219 ? 80.525  -6.458  105.040 1.00 25.12  ? 306 SER C CB  1 
ATOM   4928  O  OG  . SER C 3 219 ? 81.030  -5.140  104.989 1.00 26.93  ? 306 SER C OG  1 
ATOM   4929  N  N   . HIS C 3 220 ? 78.382  -5.923  102.668 1.00 32.10  ? 307 HIS C N   1 
ATOM   4930  C  CA  . HIS C 3 220 ? 77.731  -4.980  101.775 1.00 31.41  ? 307 HIS C CA  1 
ATOM   4931  C  C   . HIS C 3 220 ? 76.888  -3.936  102.451 1.00 30.11  ? 307 HIS C C   1 
ATOM   4932  O  O   . HIS C 3 220 ? 76.406  -2.997  101.812 1.00 30.37  ? 307 HIS C O   1 
ATOM   4933  C  CB  . HIS C 3 220 ? 76.901  -5.741  100.753 1.00 31.05  ? 307 HIS C CB  1 
ATOM   4934  C  CG  . HIS C 3 220 ? 77.676  -6.793  100.031 1.00 27.91  ? 307 HIS C CG  1 
ATOM   4935  N  ND1 . HIS C 3 220 ? 77.719  -8.104  100.456 1.00 22.19  ? 307 HIS C ND1 1 
ATOM   4936  C  CD2 . HIS C 3 220 ? 78.458  -6.724  98.926  1.00 27.75  ? 307 HIS C CD2 1 
ATOM   4937  C  CE1 . HIS C 3 220 ? 78.494  -8.796  99.639  1.00 26.94  ? 307 HIS C CE1 1 
ATOM   4938  N  NE2 . HIS C 3 220 ? 78.954  -7.983  98.705  1.00 28.20  ? 307 HIS C NE2 1 
ATOM   4939  N  N   . ASN C 3 221 ? 76.667  -4.120  103.742 1.00 28.31  ? 308 ASN C N   1 
ATOM   4940  C  CA  . ASN C 3 221 ? 75.878  -3.161  104.489 1.00 22.98  ? 308 ASN C CA  1 
ATOM   4941  C  C   . ASN C 3 221 ? 76.659  -1.849  104.464 1.00 19.40  ? 308 ASN C C   1 
ATOM   4942  O  O   . ASN C 3 221 ? 77.882  -1.831  104.683 1.00 17.87  ? 308 ASN C O   1 
ATOM   4943  C  CB  . ASN C 3 221 ? 75.663  -3.632  105.934 1.00 25.88  ? 308 ASN C CB  1 
ATOM   4944  C  CG  . ASN C 3 221 ? 74.599  -2.826  106.661 1.00 29.39  ? 308 ASN C CG  1 
ATOM   4945  O  OD1 . ASN C 3 221 ? 74.066  -1.842  106.134 1.00 32.25  ? 308 ASN C OD1 1 
ATOM   4946  N  ND2 . ASN C 3 221 ? 74.266  -3.253  107.870 1.00 30.01  ? 308 ASN C ND2 1 
ATOM   4947  N  N   . GLY C 3 222 ? 75.946  -0.774  104.131 1.00 19.96  ? 309 GLY C N   1 
ATOM   4948  C  CA  . GLY C 3 222 ? 76.541  0.550   104.075 1.00 19.01  ? 309 GLY C CA  1 
ATOM   4949  C  C   . GLY C 3 222 ? 77.235  0.842   102.766 1.00 24.50  ? 309 GLY C C   1 
ATOM   4950  O  O   . GLY C 3 222 ? 77.745  1.940   102.552 1.00 26.75  ? 309 GLY C O   1 
ATOM   4951  N  N   . MET C 3 223 ? 77.258  -0.137  101.875 1.00 25.56  ? 310 MET C N   1 
ATOM   4952  C  CA  . MET C 3 223 ? 77.909  0.069   100.603 1.00 28.60  ? 310 MET C CA  1 
ATOM   4953  C  C   . MET C 3 223 ? 77.018  0.832   99.627  1.00 32.50  ? 310 MET C C   1 
ATOM   4954  O  O   . MET C 3 223 ? 75.780  0.813   99.712  1.00 36.65  ? 310 MET C O   1 
ATOM   4955  C  CB  . MET C 3 223 ? 78.347  -1.266  100.008 1.00 35.42  ? 310 MET C CB  1 
ATOM   4956  C  CG  . MET C 3 223 ? 79.336  -2.033  100.868 1.00 42.67  ? 310 MET C CG  1 
ATOM   4957  S  SD  . MET C 3 223 ? 80.892  -1.134  101.090 1.00 44.43  ? 310 MET C SD  1 
ATOM   4958  C  CE  . MET C 3 223 ? 80.755  -0.655  102.768 1.00 38.49  ? 310 MET C CE  1 
ATOM   4959  N  N   . GLN C 3 224 ? 77.677  1.562   98.738  1.00 28.93  ? 311 GLN C N   1 
ATOM   4960  C  CA  . GLN C 3 224 ? 76.999  2.328   97.714  1.00 26.32  ? 311 GLN C CA  1 
ATOM   4961  C  C   . GLN C 3 224 ? 76.860  1.457   96.462  1.00 25.66  ? 311 GLN C C   1 
ATOM   4962  O  O   . GLN C 3 224 ? 77.620  0.490   96.257  1.00 18.23  ? 311 GLN C O   1 
ATOM   4963  C  CB  . GLN C 3 224 ? 77.806  3.582   97.366  1.00 29.60  ? 311 GLN C CB  1 
ATOM   4964  C  CG  . GLN C 3 224 ? 77.849  4.633   98.450  1.00 31.20  ? 311 GLN C CG  1 
ATOM   4965  C  CD  . GLN C 3 224 ? 78.450  5.931   97.974  1.00 28.01  ? 311 GLN C CD  1 
ATOM   4966  O  OE1 . GLN C 3 224 ? 79.547  5.958   97.418  1.00 36.69  ? 311 GLN C OE1 1 
ATOM   4967  N  NE2 . GLN C 3 224 ? 77.730  7.017   98.179  1.00 23.72  ? 311 GLN C NE2 1 
ATOM   4968  N  N   . PHE C 3 225 ? 75.931  1.842   95.591  1.00 20.92  ? 312 PHE C N   1 
ATOM   4969  C  CA  . PHE C 3 225 ? 75.723  1.086   94.382  1.00 16.64  ? 312 PHE C CA  1 
ATOM   4970  C  C   . PHE C 3 225 ? 76.838  1.372   93.382  1.00 16.62  ? 312 PHE C C   1 
ATOM   4971  O  O   . PHE C 3 225 ? 77.355  2.479   93.338  1.00 15.76  ? 312 PHE C O   1 
ATOM   4972  C  CB  . PHE C 3 225 ? 74.346  1.363   93.792  1.00 18.61  ? 312 PHE C CB  1 
ATOM   4973  C  CG  . PHE C 3 225 ? 73.858  0.255   92.937  1.00 16.32  ? 312 PHE C CG  1 
ATOM   4974  C  CD1 . PHE C 3 225 ? 73.311  -0.889  93.512  1.00 15.32  ? 312 PHE C CD1 1 
ATOM   4975  C  CD2 . PHE C 3 225 ? 74.045  0.289   91.573  1.00 15.39  ? 312 PHE C CD2 1 
ATOM   4976  C  CE1 . PHE C 3 225 ? 72.962  -1.998  92.730  1.00 16.98  ? 312 PHE C CE1 1 
ATOM   4977  C  CE2 . PHE C 3 225 ? 73.703  -0.806  90.789  1.00 22.30  ? 312 PHE C CE2 1 
ATOM   4978  C  CZ  . PHE C 3 225 ? 73.160  -1.956  91.374  1.00 20.18  ? 312 PHE C CZ  1 
ATOM   4979  N  N   . SER C 3 226 ? 77.207  0.373   92.582  1.00 25.08  ? 313 SER C N   1 
ATOM   4980  C  CA  . SER C 3 226 ? 78.297  0.525   91.617  1.00 28.40  ? 313 SER C CA  1 
ATOM   4981  C  C   . SER C 3 226 ? 78.053  -0.175  90.269  1.00 34.98  ? 313 SER C C   1 
ATOM   4982  O  O   . SER C 3 226 ? 77.585  -1.322  90.224  1.00 38.27  ? 313 SER C O   1 
ATOM   4983  C  CB  . SER C 3 226 ? 79.605  -0.011  92.227  1.00 21.42  ? 313 SER C CB  1 
ATOM   4984  O  OG  . SER C 3 226 ? 79.854  0.516   93.537  1.00 24.77  ? 313 SER C OG  1 
ATOM   4985  N  N   . THR C 3 227 ? 78.388  0.525   89.180  1.00 35.07  ? 314 THR C N   1 
ATOM   4986  C  CA  . THR C 3 227 ? 78.264  0.015   87.807  1.00 27.44  ? 314 THR C CA  1 
ATOM   4987  C  C   . THR C 3 227 ? 79.600  0.274   87.121  1.00 29.97  ? 314 THR C C   1 
ATOM   4988  O  O   . THR C 3 227 ? 80.388  1.088   87.603  1.00 33.20  ? 314 THR C O   1 
ATOM   4989  C  CB  . THR C 3 227 ? 77.166  0.760   87.000  1.00 26.58  ? 314 THR C CB  1 
ATOM   4990  O  OG1 . THR C 3 227 ? 77.424  2.176   86.990  1.00 16.21  ? 314 THR C OG1 1 
ATOM   4991  C  CG2 . THR C 3 227 ? 75.780  0.480   87.574  1.00 30.15  ? 314 THR C CG2 1 
ATOM   4992  N  N   . TRP C 3 228 ? 79.864  -0.396  86.002  1.00 30.70  ? 315 TRP C N   1 
ATOM   4993  C  CA  . TRP C 3 228 ? 81.128  -0.179  85.294  1.00 33.83  ? 315 TRP C CA  1 
ATOM   4994  C  C   . TRP C 3 228 ? 81.383  1.313   85.003  1.00 36.55  ? 315 TRP C C   1 
ATOM   4995  O  O   . TRP C 3 228 ? 82.527  1.761   84.978  1.00 36.07  ? 315 TRP C O   1 
ATOM   4996  C  CB  . TRP C 3 228 ? 81.162  -0.970  83.981  1.00 36.24  ? 315 TRP C CB  1 
ATOM   4997  C  CG  . TRP C 3 228 ? 80.193  -0.470  82.959  1.00 40.71  ? 315 TRP C CG  1 
ATOM   4998  C  CD1 . TRP C 3 228 ? 78.903  -0.886  82.775  1.00 46.97  ? 315 TRP C CD1 1 
ATOM   4999  C  CD2 . TRP C 3 228 ? 80.419  0.558   81.999  1.00 39.81  ? 315 TRP C CD2 1 
ATOM   5000  N  NE1 . TRP C 3 228 ? 78.315  -0.176  81.758  1.00 45.87  ? 315 TRP C NE1 1 
ATOM   5001  C  CE2 . TRP C 3 228 ? 79.226  0.718   81.265  1.00 42.91  ? 315 TRP C CE2 1 
ATOM   5002  C  CE3 . TRP C 3 228 ? 81.513  1.370   81.691  1.00 42.85  ? 315 TRP C CE3 1 
ATOM   5003  C  CZ2 . TRP C 3 228 ? 79.096  1.657   80.243  1.00 43.00  ? 315 TRP C CZ2 1 
ATOM   5004  C  CZ3 . TRP C 3 228 ? 81.385  2.310   80.673  1.00 41.36  ? 315 TRP C CZ3 1 
ATOM   5005  C  CH2 . TRP C 3 228 ? 80.186  2.444   79.963  1.00 41.09  ? 315 TRP C CH2 1 
ATOM   5006  N  N   . ASP C 3 229 ? 80.313  2.072   84.777  1.00 38.17  ? 316 ASP C N   1 
ATOM   5007  C  CA  . ASP C 3 229 ? 80.433  3.494   84.475  1.00 30.25  ? 316 ASP C CA  1 
ATOM   5008  C  C   . ASP C 3 229 ? 80.164  4.349   85.685  1.00 28.82  ? 316 ASP C C   1 
ATOM   5009  O  O   . ASP C 3 229 ? 79.786  5.506   85.559  1.00 33.50  ? 316 ASP C O   1 
ATOM   5010  C  CB  . ASP C 3 229 ? 79.495  3.903   83.325  1.00 29.69  ? 316 ASP C CB  1 
ATOM   5011  C  CG  . ASP C 3 229 ? 78.027  3.698   83.650  1.00 29.44  ? 316 ASP C CG  1 
ATOM   5012  O  OD1 . ASP C 3 229 ? 77.732  2.883   84.540  1.00 24.20  ? 316 ASP C OD1 1 
ATOM   5013  O  OD2 . ASP C 3 229 ? 77.167  4.353   83.008  1.00 34.71  ? 316 ASP C OD2 1 
ATOM   5014  N  N   . ASN C 3 230 ? 80.405  3.797   86.862  1.00 32.49  ? 317 ASN C N   1 
ATOM   5015  C  CA  . ASN C 3 230 ? 80.158  4.539   88.086  1.00 37.73  ? 317 ASN C CA  1 
ATOM   5016  C  C   . ASN C 3 230 ? 80.682  3.749   89.277  1.00 42.15  ? 317 ASN C C   1 
ATOM   5017  O  O   . ASN C 3 230 ? 79.949  2.949   89.859  1.00 42.34  ? 317 ASN C O   1 
ATOM   5018  C  CB  . ASN C 3 230 ? 78.656  4.761   88.228  1.00 36.08  ? 317 ASN C CB  1 
ATOM   5019  C  CG  . ASN C 3 230 ? 78.337  5.931   89.084  1.00 35.20  ? 317 ASN C CG  1 
ATOM   5020  O  OD1 . ASN C 3 230 ? 79.010  6.181   90.072  1.00 42.26  ? 317 ASN C OD1 1 
ATOM   5021  N  ND2 . ASN C 3 230 ? 77.323  6.679   88.705  1.00 26.97  ? 317 ASN C ND2 1 
ATOM   5022  N  N   . ASP C 3 231 ? 81.931  4.008   89.657  1.00 43.04  ? 318 ASP C N   1 
ATOM   5023  C  CA  . ASP C 3 231 ? 82.569  3.295   90.757  1.00 47.44  ? 318 ASP C CA  1 
ATOM   5024  C  C   . ASP C 3 231 ? 81.882  3.307   92.128  1.00 50.16  ? 318 ASP C C   1 
ATOM   5025  O  O   . ASP C 3 231 ? 80.921  2.577   92.341  1.00 57.04  ? 318 ASP C O   1 
ATOM   5026  C  CB  . ASP C 3 231 ? 84.030  3.707   90.887  1.00 54.10  ? 318 ASP C CB  1 
ATOM   5027  C  CG  . ASP C 3 231 ? 84.980  2.530   90.718  1.00 58.57  ? 318 ASP C CG  1 
ATOM   5028  O  OD1 . ASP C 3 231 ? 84.946  1.603   91.558  1.00 52.47  ? 318 ASP C OD1 1 
ATOM   5029  O  OD2 . ASP C 3 231 ? 85.753  2.528   89.732  1.00 64.85  ? 318 ASP C OD2 1 
ATOM   5030  N  N   . ASN C 3 232 ? 82.394  4.089   93.072  1.00 44.31  ? 319 ASN C N   1 
ATOM   5031  C  CA  . ASN C 3 232 ? 81.809  4.149   94.420  1.00 43.87  ? 319 ASN C CA  1 
ATOM   5032  C  C   . ASN C 3 232 ? 82.059  2.911   95.277  1.00 47.89  ? 319 ASN C C   1 
ATOM   5033  O  O   . ASN C 3 232 ? 81.429  2.750   96.334  1.00 49.50  ? 319 ASN C O   1 
ATOM   5034  C  CB  . ASN C 3 232 ? 80.305  4.424   94.370  1.00 36.25  ? 319 ASN C CB  1 
ATOM   5035  C  CG  . ASN C 3 232 ? 79.974  5.547   93.466  1.00 34.70  ? 319 ASN C CG  1 
ATOM   5036  O  OD1 . ASN C 3 232 ? 79.038  5.469   92.698  1.00 32.85  ? 319 ASN C OD1 1 
ATOM   5037  N  ND2 . ASN C 3 232 ? 80.791  6.590   93.500  1.00 41.10  ? 319 ASN C ND2 1 
ATOM   5038  N  N   . ASP C 3 233 ? 82.932  2.014   94.818  1.00 47.76  ? 320 ASP C N   1 
ATOM   5039  C  CA  . ASP C 3 233 ? 83.235  0.845   95.629  1.00 45.99  ? 320 ASP C CA  1 
ATOM   5040  C  C   . ASP C 3 233 ? 84.497  1.090   96.460  1.00 43.82  ? 320 ASP C C   1 
ATOM   5041  O  O   . ASP C 3 233 ? 85.240  2.047   96.229  1.00 44.68  ? 320 ASP C O   1 
ATOM   5042  C  CB  . ASP C 3 233 ? 83.309  -0.458  94.798  1.00 46.18  ? 320 ASP C CB  1 
ATOM   5043  C  CG  . ASP C 3 233 ? 84.569  -0.580  93.944  1.00 47.05  ? 320 ASP C CG  1 
ATOM   5044  O  OD1 . ASP C 3 233 ? 85.422  0.326   93.933  1.00 46.43  ? 320 ASP C OD1 1 
ATOM   5045  O  OD2 . ASP C 3 233 ? 84.706  -1.619  93.270  1.00 48.36  ? 320 ASP C OD2 1 
ATOM   5046  N  N   . LYS C 3 234 ? 84.700  0.238   97.453  1.00 40.62  ? 321 LYS C N   1 
ATOM   5047  C  CA  . LYS C 3 234 ? 85.847  0.326   98.334  1.00 41.10  ? 321 LYS C CA  1 
ATOM   5048  C  C   . LYS C 3 234 ? 87.121  -0.191  97.666  1.00 40.79  ? 321 LYS C C   1 
ATOM   5049  O  O   . LYS C 3 234 ? 88.225  0.103   98.110  1.00 39.28  ? 321 LYS C O   1 
ATOM   5050  C  CB  . LYS C 3 234 ? 85.558  -0.464  99.610  1.00 47.91  ? 321 LYS C CB  1 
ATOM   5051  C  CG  . LYS C 3 234 ? 84.423  0.110   100.447 1.00 51.65  ? 321 LYS C CG  1 
ATOM   5052  C  CD  . LYS C 3 234 ? 84.727  1.541   100.857 1.00 51.24  ? 321 LYS C CD  1 
ATOM   5053  C  CE  . LYS C 3 234 ? 83.622  2.143   101.706 1.00 52.50  ? 321 LYS C CE  1 
ATOM   5054  N  NZ  . LYS C 3 234 ? 83.894  3.584   102.048 1.00 55.72  ? 321 LYS C NZ  1 
ATOM   5055  N  N   . PHE C 3 235 ? 86.955  -0.992  96.621  1.00 41.20  ? 322 PHE C N   1 
ATOM   5056  C  CA  . PHE C 3 235 ? 88.077  -1.537  95.886  1.00 38.03  ? 322 PHE C CA  1 
ATOM   5057  C  C   . PHE C 3 235 ? 88.706  -0.403  95.109  1.00 41.72  ? 322 PHE C C   1 
ATOM   5058  O  O   . PHE C 3 235 ? 88.008  0.484   94.631  1.00 43.49  ? 322 PHE C O   1 
ATOM   5059  C  CB  . PHE C 3 235 ? 87.592  -2.613  94.925  1.00 38.26  ? 322 PHE C CB  1 
ATOM   5060  C  CG  . PHE C 3 235 ? 88.664  -3.168  94.058  1.00 39.29  ? 322 PHE C CG  1 
ATOM   5061  C  CD1 . PHE C 3 235 ? 89.987  -3.185  94.485  1.00 40.81  ? 322 PHE C CD1 1 
ATOM   5062  C  CD2 . PHE C 3 235 ? 88.358  -3.664  92.808  1.00 42.15  ? 322 PHE C CD2 1 
ATOM   5063  C  CE1 . PHE C 3 235 ? 90.989  -3.683  93.682  1.00 42.61  ? 322 PHE C CE1 1 
ATOM   5064  C  CE2 . PHE C 3 235 ? 89.355  -4.167  91.991  1.00 49.63  ? 322 PHE C CE2 1 
ATOM   5065  C  CZ  . PHE C 3 235 ? 90.678  -4.176  92.432  1.00 47.96  ? 322 PHE C CZ  1 
ATOM   5066  N  N   . GLU C 3 236 ? 90.032  -0.426  95.015  1.00 47.46  ? 323 GLU C N   1 
ATOM   5067  C  CA  . GLU C 3 236 ? 90.783  0.599   94.291  1.00 52.34  ? 323 GLU C CA  1 
ATOM   5068  C  C   . GLU C 3 236 ? 90.910  0.260   92.810  1.00 51.60  ? 323 GLU C C   1 
ATOM   5069  O  O   . GLU C 3 236 ? 91.901  0.627   92.179  1.00 50.51  ? 323 GLU C O   1 
ATOM   5070  C  CB  . GLU C 3 236 ? 92.187  0.778   94.901  1.00 60.11  ? 323 GLU C CB  1 
ATOM   5071  C  CG  . GLU C 3 236 ? 93.085  -0.483  94.941  1.00 67.78  ? 323 GLU C CG  1 
ATOM   5072  C  CD  . GLU C 3 236 ? 93.048  -1.246  96.279  1.00 73.24  ? 323 GLU C CD  1 
ATOM   5073  O  OE1 . GLU C 3 236 ? 92.584  -0.687  97.303  1.00 74.16  ? 323 GLU C OE1 1 
ATOM   5074  O  OE2 . GLU C 3 236 ? 93.501  -2.415  96.308  1.00 74.36  ? 323 GLU C OE2 1 
ATOM   5075  N  N   . GLY C 3 237 ? 89.905  -0.422  92.255  1.00 49.14  ? 324 GLY C N   1 
ATOM   5076  C  CA  . GLY C 3 237 ? 89.976  -0.803  90.855  1.00 46.65  ? 324 GLY C CA  1 
ATOM   5077  C  C   . GLY C 3 237 ? 88.691  -1.166  90.124  1.00 46.36  ? 324 GLY C C   1 
ATOM   5078  O  O   . GLY C 3 237 ? 88.735  -1.701  88.994  1.00 45.49  ? 324 GLY C O   1 
ATOM   5079  N  N   . ASN C 3 238 ? 87.552  -0.906  90.759  1.00 40.04  ? 325 ASN C N   1 
ATOM   5080  C  CA  . ASN C 3 238 ? 86.259  -1.178  90.137  1.00 41.14  ? 325 ASN C CA  1 
ATOM   5081  C  C   . ASN C 3 238 ? 85.863  -2.643  89.977  1.00 37.49  ? 325 ASN C C   1 
ATOM   5082  O  O   . ASN C 3 238 ? 86.123  -3.269  88.944  1.00 33.04  ? 325 ASN C O   1 
ATOM   5083  C  CB  . ASN C 3 238 ? 86.168  -0.492  88.771  1.00 36.79  ? 325 ASN C CB  1 
ATOM   5084  C  CG  . ASN C 3 238 ? 84.747  -0.316  88.308  1.00 39.66  ? 325 ASN C CG  1 
ATOM   5085  O  OD1 . ASN C 3 238 ? 84.491  0.428   87.368  1.00 38.10  ? 325 ASN C OD1 1 
ATOM   5086  N  ND2 . ASN C 3 238 ? 83.803  -0.979  88.987  1.00 43.60  ? 325 ASN C ND2 1 
ATOM   5087  N  N   . CYS C 3 239 ? 85.131  -3.139  90.964  1.00 32.78  ? 326 CYS C N   1 
ATOM   5088  C  CA  . CYS C 3 239 ? 84.655  -4.504  90.948  1.00 29.49  ? 326 CYS C CA  1 
ATOM   5089  C  C   . CYS C 3 239 ? 83.620  -4.629  89.824  1.00 28.47  ? 326 CYS C C   1 
ATOM   5090  O  O   . CYS C 3 239 ? 83.736  -5.484  88.948  1.00 30.24  ? 326 CYS C O   1 
ATOM   5091  C  CB  . CYS C 3 239 ? 84.007  -4.845  92.301  1.00 31.51  ? 326 CYS C CB  1 
ATOM   5092  S  SG  . CYS C 3 239 ? 85.040  -4.703  93.814  1.00 23.08  ? 326 CYS C SG  1 
ATOM   5093  N  N   . ALA C 3 240 ? 82.654  -3.715  89.815  1.00 29.03  ? 327 ALA C N   1 
ATOM   5094  C  CA  . ALA C 3 240 ? 81.573  -3.722  88.827  1.00 30.93  ? 327 ALA C CA  1 
ATOM   5095  C  C   . ALA C 3 240 ? 82.028  -3.973  87.396  1.00 33.12  ? 327 ALA C C   1 
ATOM   5096  O  O   . ALA C 3 240 ? 81.454  -4.807  86.691  1.00 34.35  ? 327 ALA C O   1 
ATOM   5097  C  CB  . ALA C 3 240 ? 80.807  -2.436  88.906  1.00 24.95  ? 327 ALA C CB  1 
ATOM   5098  N  N   . GLU C 3 241 ? 83.045  -3.228  86.975  1.00 32.80  ? 328 GLU C N   1 
ATOM   5099  C  CA  . GLU C 3 241 ? 83.607  -3.357  85.645  1.00 37.92  ? 328 GLU C CA  1 
ATOM   5100  C  C   . GLU C 3 241 ? 84.165  -4.758  85.479  1.00 38.96  ? 328 GLU C C   1 
ATOM   5101  O  O   . GLU C 3 241 ? 83.888  -5.442  84.498  1.00 38.72  ? 328 GLU C O   1 
ATOM   5102  C  CB  . GLU C 3 241 ? 84.731  -2.348  85.478  1.00 47.52  ? 328 GLU C CB  1 
ATOM   5103  C  CG  . GLU C 3 241 ? 85.701  -2.635  84.339  1.00 61.80  ? 328 GLU C CG  1 
ATOM   5104  C  CD  . GLU C 3 241 ? 85.169  -2.221  82.972  1.00 70.85  ? 328 GLU C CD  1 
ATOM   5105  O  OE1 . GLU C 3 241 ? 84.303  -2.935  82.417  1.00 74.89  ? 328 GLU C OE1 1 
ATOM   5106  O  OE2 . GLU C 3 241 ? 85.634  -1.186  82.445  1.00 76.13  ? 328 GLU C OE2 1 
ATOM   5107  N  N   . GLN C 3 242 ? 84.954  -5.183  86.454  1.00 39.41  ? 329 GLN C N   1 
ATOM   5108  C  CA  . GLN C 3 242 ? 85.557  -6.508  86.420  1.00 38.01  ? 329 GLN C CA  1 
ATOM   5109  C  C   . GLN C 3 242 ? 84.533  -7.617  86.494  1.00 38.30  ? 329 GLN C C   1 
ATOM   5110  O  O   . GLN C 3 242 ? 84.397  -8.411  85.562  1.00 42.11  ? 329 GLN C O   1 
ATOM   5111  C  CB  . GLN C 3 242 ? 86.556  -6.671  87.555  1.00 30.20  ? 329 GLN C CB  1 
ATOM   5112  C  CG  . GLN C 3 242 ? 87.672  -5.658  87.480  1.00 40.95  ? 329 GLN C CG  1 
ATOM   5113  C  CD  . GLN C 3 242 ? 88.815  -5.936  88.452  1.00 43.82  ? 329 GLN C CD  1 
ATOM   5114  O  OE1 . GLN C 3 242 ? 88.616  -6.539  89.505  1.00 47.72  ? 329 GLN C OE1 1 
ATOM   5115  N  NE2 . GLN C 3 242 ? 90.020  -5.486  88.100  1.00 43.04  ? 329 GLN C NE2 1 
ATOM   5116  N  N   . ASP C 3 243 ? 83.798  -7.661  87.596  1.00 32.65  ? 330 ASP C N   1 
ATOM   5117  C  CA  . ASP C 3 243 ? 82.809  -8.699  87.766  1.00 31.33  ? 330 ASP C CA  1 
ATOM   5118  C  C   . ASP C 3 243 ? 81.592  -8.557  86.874  1.00 25.69  ? 330 ASP C C   1 
ATOM   5119  O  O   . ASP C 3 243 ? 80.763  -9.449  86.813  1.00 22.01  ? 330 ASP C O   1 
ATOM   5120  C  CB  . ASP C 3 243 ? 82.473  -8.878  89.243  1.00 33.33  ? 330 ASP C CB  1 
ATOM   5121  C  CG  . ASP C 3 243 ? 83.601  -9.569  90.000  1.00 38.48  ? 330 ASP C CG  1 
ATOM   5122  O  OD1 . ASP C 3 243 ? 84.603  -9.932  89.346  1.00 44.27  ? 330 ASP C OD1 1 
ATOM   5123  O  OD2 . ASP C 3 243 ? 83.496  -9.770  91.232  1.00 40.82  ? 330 ASP C OD2 1 
ATOM   5124  N  N   . GLY C 3 244 ? 81.541  -7.456  86.132  1.00 26.75  ? 331 GLY C N   1 
ATOM   5125  C  CA  . GLY C 3 244 ? 80.461  -7.219  85.196  1.00 26.18  ? 331 GLY C CA  1 
ATOM   5126  C  C   . GLY C 3 244 ? 79.016  -7.304  85.664  1.00 29.66  ? 331 GLY C C   1 
ATOM   5127  O  O   . GLY C 3 244 ? 78.282  -8.229  85.319  1.00 28.30  ? 331 GLY C O   1 
ATOM   5128  N  N   . SER C 3 245 ? 78.577  -6.287  86.384  1.00 29.44  ? 332 SER C N   1 
ATOM   5129  C  CA  . SER C 3 245 ? 77.213  -6.253  86.848  1.00 19.11  ? 332 SER C CA  1 
ATOM   5130  C  C   . SER C 3 245 ? 76.943  -4.934  87.542  1.00 19.73  ? 332 SER C C   1 
ATOM   5131  O  O   . SER C 3 245 ? 77.667  -3.954  87.365  1.00 28.10  ? 332 SER C O   1 
ATOM   5132  C  CB  . SER C 3 245 ? 76.979  -7.381  87.830  1.00 23.10  ? 332 SER C CB  1 
ATOM   5133  O  OG  . SER C 3 245 ? 77.621  -7.097  89.055  1.00 24.11  ? 332 SER C OG  1 
ATOM   5134  N  N   . GLY C 3 246 ? 75.882  -4.924  88.334  1.00 20.07  ? 333 GLY C N   1 
ATOM   5135  C  CA  . GLY C 3 246 ? 75.517  -3.741  89.068  1.00 21.59  ? 333 GLY C CA  1 
ATOM   5136  C  C   . GLY C 3 246 ? 75.232  -4.283  90.434  1.00 23.71  ? 333 GLY C C   1 
ATOM   5137  O  O   . GLY C 3 246 ? 74.373  -5.158  90.580  1.00 26.20  ? 333 GLY C O   1 
ATOM   5138  N  N   . TRP C 3 247 ? 75.961  -3.784  91.426  1.00 21.61  ? 334 TRP C N   1 
ATOM   5139  C  CA  . TRP C 3 247 ? 75.799  -4.251  92.793  1.00 23.23  ? 334 TRP C CA  1 
ATOM   5140  C  C   . TRP C 3 247 ? 76.491  -3.269  93.720  1.00 25.38  ? 334 TRP C C   1 
ATOM   5141  O  O   . TRP C 3 247 ? 77.111  -2.316  93.261  1.00 26.43  ? 334 TRP C O   1 
ATOM   5142  C  CB  . TRP C 3 247 ? 76.453  -5.626  92.920  1.00 23.15  ? 334 TRP C CB  1 
ATOM   5143  C  CG  . TRP C 3 247 ? 75.929  -6.456  94.019  1.00 18.49  ? 334 TRP C CG  1 
ATOM   5144  C  CD1 . TRP C 3 247 ? 76.592  -6.832  95.142  1.00 20.32  ? 334 TRP C CD1 1 
ATOM   5145  C  CD2 . TRP C 3 247 ? 74.615  -7.010  94.119  1.00 17.44  ? 334 TRP C CD2 1 
ATOM   5146  N  NE1 . TRP C 3 247 ? 75.767  -7.580  95.949  1.00 23.29  ? 334 TRP C NE1 1 
ATOM   5147  C  CE2 . TRP C 3 247 ? 74.546  -7.703  95.345  1.00 16.01  ? 334 TRP C CE2 1 
ATOM   5148  C  CE3 . TRP C 3 247 ? 73.492  -6.988  93.292  1.00 19.00  ? 334 TRP C CE3 1 
ATOM   5149  C  CZ2 . TRP C 3 247 ? 73.409  -8.359  95.767  1.00 11.52  ? 334 TRP C CZ2 1 
ATOM   5150  C  CZ3 . TRP C 3 247 ? 72.356  -7.644  93.712  1.00 23.62  ? 334 TRP C CZ3 1 
ATOM   5151  C  CH2 . TRP C 3 247 ? 72.323  -8.319  94.942  1.00 21.13  ? 334 TRP C CH2 1 
ATOM   5152  N  N   . TRP C 3 248 ? 76.372  -3.501  95.023  1.00 26.45  ? 335 TRP C N   1 
ATOM   5153  C  CA  . TRP C 3 248 ? 77.000  -2.653  96.041  1.00 26.77  ? 335 TRP C CA  1 
ATOM   5154  C  C   . TRP C 3 248 ? 78.287  -3.347  96.444  1.00 25.78  ? 335 TRP C C   1 
ATOM   5155  O  O   . TRP C 3 248 ? 78.288  -4.205  97.321  1.00 29.13  ? 335 TRP C O   1 
ATOM   5156  C  CB  . TRP C 3 248 ? 76.093  -2.502  97.268  1.00 25.22  ? 335 TRP C CB  1 
ATOM   5157  C  CG  . TRP C 3 248 ? 74.744  -2.994  97.018  1.00 27.91  ? 335 TRP C CG  1 
ATOM   5158  C  CD1 . TRP C 3 248 ? 74.377  -4.292  96.788  1.00 37.56  ? 335 TRP C CD1 1 
ATOM   5159  C  CD2 . TRP C 3 248 ? 73.574  -2.214  96.854  1.00 24.99  ? 335 TRP C CD2 1 
ATOM   5160  N  NE1 . TRP C 3 248 ? 73.040  -4.368  96.468  1.00 36.78  ? 335 TRP C NE1 1 
ATOM   5161  C  CE2 . TRP C 3 248 ? 72.517  -3.106  96.506  1.00 28.69  ? 335 TRP C CE2 1 
ATOM   5162  C  CE3 . TRP C 3 248 ? 73.305  -0.852  96.960  1.00 23.71  ? 335 TRP C CE3 1 
ATOM   5163  C  CZ2 . TRP C 3 248 ? 71.215  -2.675  96.268  1.00 20.74  ? 335 TRP C CZ2 1 
ATOM   5164  C  CZ3 . TRP C 3 248 ? 72.009  -0.421  96.721  1.00 27.43  ? 335 TRP C CZ3 1 
ATOM   5165  C  CH2 . TRP C 3 248 ? 70.977  -1.334  96.379  1.00 26.76  ? 335 TRP C CH2 1 
ATOM   5166  N  N   . MET C 3 249 ? 79.374  -3.000  95.772  1.00 24.69  ? 336 MET C N   1 
ATOM   5167  C  CA  . MET C 3 249 ? 80.649  -3.613  96.057  1.00 25.78  ? 336 MET C CA  1 
ATOM   5168  C  C   . MET C 3 249 ? 81.271  -2.955  97.259  1.00 26.02  ? 336 MET C C   1 
ATOM   5169  O  O   . MET C 3 249 ? 80.866  -1.875  97.664  1.00 23.77  ? 336 MET C O   1 
ATOM   5170  C  CB  . MET C 3 249 ? 81.582  -3.484  94.856  1.00 32.44  ? 336 MET C CB  1 
ATOM   5171  C  CG  . MET C 3 249 ? 80.990  -3.987  93.547  1.00 35.77  ? 336 MET C CG  1 
ATOM   5172  S  SD  . MET C 3 249 ? 80.470  -5.693  93.623  1.00 39.51  ? 336 MET C SD  1 
ATOM   5173  C  CE  . MET C 3 249 ? 80.951  -6.289  91.984  1.00 43.13  ? 336 MET C CE  1 
ATOM   5174  N  N   . ASN C 3 250 ? 82.271  -3.617  97.816  1.00 31.26  ? 337 ASN C N   1 
ATOM   5175  C  CA  . ASN C 3 250 ? 82.997  -3.141  98.979  1.00 33.35  ? 337 ASN C CA  1 
ATOM   5176  C  C   . ASN C 3 250 ? 84.274  -3.879  98.759  1.00 32.87  ? 337 ASN C C   1 
ATOM   5177  O  O   . ASN C 3 250 ? 84.509  -4.879  99.402  1.00 37.95  ? 337 ASN C O   1 
ATOM   5178  C  CB  . ASN C 3 250 ? 82.315  -3.665  100.244 1.00 34.18  ? 337 ASN C CB  1 
ATOM   5179  C  CG  . ASN C 3 250 ? 83.229  -3.668  101.447 1.00 35.88  ? 337 ASN C CG  1 
ATOM   5180  O  OD1 . ASN C 3 250 ? 84.254  -2.980  101.461 1.00 35.06  ? 337 ASN C OD1 1 
ATOM   5181  N  ND2 . ASN C 3 250 ? 82.884  -4.473  102.456 1.00 37.48  ? 337 ASN C ND2 1 
ATOM   5182  N  N   . LYS C 3 251 ? 85.110  -3.407  97.848  1.00 32.40  ? 338 LYS C N   1 
ATOM   5183  C  CA  . LYS C 3 251 ? 86.323  -4.161  97.538  1.00 40.56  ? 338 LYS C CA  1 
ATOM   5184  C  C   . LYS C 3 251 ? 85.767  -5.542  97.107  1.00 43.32  ? 338 LYS C C   1 
ATOM   5185  O  O   . LYS C 3 251 ? 86.240  -6.620  97.520  1.00 25.35  ? 338 LYS C O   1 
ATOM   5186  C  CB  . LYS C 3 251 ? 87.242  -4.287  98.746  1.00 35.62  ? 338 LYS C CB  1 
ATOM   5187  C  CG  . LYS C 3 251 ? 88.655  -4.738  98.408  1.00 41.86  ? 338 LYS C CG  1 
ATOM   5188  C  CD  . LYS C 3 251 ? 89.564  -3.544  98.171  1.00 44.90  ? 338 LYS C CD  1 
ATOM   5189  C  CE  . LYS C 3 251 ? 91.024  -3.969  98.132  1.00 49.74  ? 338 LYS C CE  1 
ATOM   5190  N  NZ  . LYS C 3 251 ? 91.406  -4.766  99.331  1.00 54.62  ? 338 LYS C NZ  1 
ATOM   5191  N  N   . CYS C 3 252 ? 84.646  -5.430  96.390  1.00 45.25  ? 339 CYS C N   1 
ATOM   5192  C  CA  . CYS C 3 252 ? 83.879  -6.511  95.813  1.00 37.14  ? 339 CYS C CA  1 
ATOM   5193  C  C   . CYS C 3 252 ? 82.790  -7.174  96.663  1.00 33.85  ? 339 CYS C C   1 
ATOM   5194  O  O   . CYS C 3 252 ? 82.144  -6.492  97.466  1.00 28.09  ? 339 CYS C O   1 
ATOM   5195  C  CB  . CYS C 3 252 ? 84.793  -7.472  95.067  1.00 34.97  ? 339 CYS C CB  1 
ATOM   5196  S  SG  . CYS C 3 252 ? 85.869  -6.547  93.901  1.00 35.22  ? 339 CYS C SG  1 
ATOM   5197  N  N   . HIS C 3 253 ? 82.601  -8.484  96.531  1.00 34.59  ? 340 HIS C N   1 
ATOM   5198  C  CA  . HIS C 3 253 ? 81.479  -9.129  97.213  1.00 35.44  ? 340 HIS C CA  1 
ATOM   5199  C  C   . HIS C 3 253 ? 81.627  -10.524 97.824  1.00 38.74  ? 340 HIS C C   1 
ATOM   5200  O  O   . HIS C 3 253 ? 82.642  -11.206 97.657  1.00 39.96  ? 340 HIS C O   1 
ATOM   5201  C  CB  . HIS C 3 253 ? 80.329  -9.219  96.203  1.00 27.27  ? 340 HIS C CB  1 
ATOM   5202  C  CG  . HIS C 3 253 ? 80.689  -10.000 94.982  1.00 25.55  ? 340 HIS C CG  1 
ATOM   5203  N  ND1 . HIS C 3 253 ? 80.455  -11.352 94.869  1.00 30.08  ? 340 HIS C ND1 1 
ATOM   5204  C  CD2 . HIS C 3 253 ? 81.365  -9.641  93.861  1.00 27.14  ? 340 HIS C CD2 1 
ATOM   5205  C  CE1 . HIS C 3 253 ? 80.978  -11.794 93.736  1.00 32.23  ? 340 HIS C CE1 1 
ATOM   5206  N  NE2 . HIS C 3 253 ? 81.535  -10.776 93.105  1.00 27.22  ? 340 HIS C NE2 1 
ATOM   5207  N  N   . ALA C 3 254 ? 80.506  -10.953 98.421  1.00 37.06  ? 341 ALA C N   1 
ATOM   5208  C  CA  . ALA C 3 254 ? 80.314  -12.254 99.059  1.00 35.23  ? 341 ALA C CA  1 
ATOM   5209  C  C   . ALA C 3 254 ? 78.930  -12.724 98.617  1.00 42.07  ? 341 ALA C C   1 
ATOM   5210  O  O   . ALA C 3 254 ? 78.635  -13.920 98.630  1.00 50.32  ? 341 ALA C O   1 
ATOM   5211  C  CB  . ALA C 3 254 ? 80.362  -12.127 100.573 1.00 35.35  ? 341 ALA C CB  1 
ATOM   5212  N  N   . GLY C 3 255 ? 78.076  -11.755 98.277  1.00 42.14  ? 342 GLY C N   1 
ATOM   5213  C  CA  . GLY C 3 255 ? 76.718  -12.006 97.797  1.00 41.09  ? 342 GLY C CA  1 
ATOM   5214  C  C   . GLY C 3 255 ? 76.682  -11.266 96.471  1.00 44.01  ? 342 GLY C C   1 
ATOM   5215  O  O   . GLY C 3 255 ? 76.999  -10.080 96.423  1.00 49.14  ? 342 GLY C O   1 
ATOM   5216  N  N   . HIS C 3 256 ? 76.267  -11.921 95.397  1.00 38.26  ? 343 HIS C N   1 
ATOM   5217  C  CA  . HIS C 3 256 ? 76.315  -11.266 94.105  1.00 29.95  ? 343 HIS C CA  1 
ATOM   5218  C  C   . HIS C 3 256 ? 75.189  -11.723 93.206  1.00 29.97  ? 343 HIS C C   1 
ATOM   5219  O  O   . HIS C 3 256 ? 75.413  -12.446 92.245  1.00 32.16  ? 343 HIS C O   1 
ATOM   5220  C  CB  . HIS C 3 256 ? 77.637  -11.643 93.494  1.00 31.34  ? 343 HIS C CB  1 
ATOM   5221  C  CG  . HIS C 3 256 ? 78.047  -10.778 92.366  1.00 34.83  ? 343 HIS C CG  1 
ATOM   5222  N  ND1 . HIS C 3 256 ? 78.559  -11.289 91.197  1.00 40.89  ? 343 HIS C ND1 1 
ATOM   5223  C  CD2 . HIS C 3 256 ? 78.050  -9.434  92.229  1.00 36.20  ? 343 HIS C CD2 1 
ATOM   5224  C  CE1 . HIS C 3 256 ? 78.863  -10.293 90.385  1.00 44.37  ? 343 HIS C CE1 1 
ATOM   5225  N  NE2 . HIS C 3 256 ? 78.563  -9.157  90.989  1.00 41.12  ? 343 HIS C NE2 1 
ATOM   5226  N  N   . LEU C 3 257 ? 73.987  -11.240 93.487  1.00 30.12  ? 344 LEU C N   1 
ATOM   5227  C  CA  . LEU C 3 257 ? 72.789  -11.619 92.744  1.00 29.06  ? 344 LEU C CA  1 
ATOM   5228  C  C   . LEU C 3 257 ? 72.575  -11.000 91.368  1.00 29.13  ? 344 LEU C C   1 
ATOM   5229  O  O   . LEU C 3 257 ? 71.537  -11.213 90.730  1.00 27.78  ? 344 LEU C O   1 
ATOM   5230  C  CB  . LEU C 3 257 ? 71.561  -11.365 93.607  1.00 29.27  ? 344 LEU C CB  1 
ATOM   5231  C  CG  . LEU C 3 257 ? 71.686  -11.995 94.991  1.00 27.43  ? 344 LEU C CG  1 
ATOM   5232  C  CD1 . LEU C 3 257 ? 70.365  -11.829 95.708  1.00 23.02  ? 344 LEU C CD1 1 
ATOM   5233  C  CD2 . LEU C 3 257 ? 72.074  -13.469 94.866  1.00 33.95  ? 344 LEU C CD2 1 
ATOM   5234  N  N   . ASN C 3 258 ? 73.507  -10.169 90.934  1.00 28.20  ? 345 ASN C N   1 
ATOM   5235  C  CA  . ASN C 3 258 ? 73.357  -9.582  89.624  1.00 27.21  ? 345 ASN C CA  1 
ATOM   5236  C  C   . ASN C 3 258 ? 74.551  -10.002 88.814  1.00 25.26  ? 345 ASN C C   1 
ATOM   5237  O  O   . ASN C 3 258 ? 74.848  -9.451  87.770  1.00 24.70  ? 345 ASN C O   1 
ATOM   5238  C  CB  . ASN C 3 258 ? 73.185  -8.065  89.725  1.00 27.69  ? 345 ASN C CB  1 
ATOM   5239  C  CG  . ASN C 3 258 ? 71.816  -7.680  90.305  1.00 29.25  ? 345 ASN C CG  1 
ATOM   5240  O  OD1 . ASN C 3 258 ? 71.098  -8.528  90.836  1.00 27.42  ? 345 ASN C OD1 1 
ATOM   5241  N  ND2 . ASN C 3 258 ? 71.460  -6.407  90.208  1.00 30.70  ? 345 ASN C ND2 1 
ATOM   5242  N  N   . GLY C 3 259 ? 75.177  -11.075 89.275  1.00 29.50  ? 346 GLY C N   1 
ATOM   5243  C  CA  . GLY C 3 259 ? 76.349  -11.598 88.607  1.00 29.18  ? 346 GLY C CA  1 
ATOM   5244  C  C   . GLY C 3 259 ? 76.012  -12.356 87.346  1.00 24.50  ? 346 GLY C C   1 
ATOM   5245  O  O   . GLY C 3 259 ? 74.843  -12.486 86.956  1.00 13.96  ? 346 GLY C O   1 
ATOM   5246  N  N   . VAL C 3 260 ? 77.060  -12.871 86.716  1.00 21.99  ? 347 VAL C N   1 
ATOM   5247  C  CA  . VAL C 3 260 ? 76.922  -13.621 85.482  1.00 22.41  ? 347 VAL C CA  1 
ATOM   5248  C  C   . VAL C 3 260 ? 76.125  -14.866 85.710  1.00 25.10  ? 347 VAL C C   1 
ATOM   5249  O  O   . VAL C 3 260 ? 76.285  -15.517 86.737  1.00 33.60  ? 347 VAL C O   1 
ATOM   5250  C  CB  . VAL C 3 260 ? 78.282  -14.021 84.933  1.00 14.22  ? 347 VAL C CB  1 
ATOM   5251  C  CG1 . VAL C 3 260 ? 78.117  -14.881 83.722  1.00 12.63  ? 347 VAL C CG1 1 
ATOM   5252  C  CG2 . VAL C 3 260 ? 79.069  -12.776 84.575  1.00 15.96  ? 347 VAL C CG2 1 
ATOM   5253  N  N   . TYR C 3 261 ? 75.263  -15.198 84.757  1.00 25.11  ? 348 TYR C N   1 
ATOM   5254  C  CA  . TYR C 3 261 ? 74.465  -16.403 84.883  1.00 30.56  ? 348 TYR C CA  1 
ATOM   5255  C  C   . TYR C 3 261 ? 75.180  -17.596 84.290  1.00 29.01  ? 348 TYR C C   1 
ATOM   5256  O  O   . TYR C 3 261 ? 75.379  -17.685 83.078  1.00 31.68  ? 348 TYR C O   1 
ATOM   5257  C  CB  . TYR C 3 261 ? 73.109  -16.228 84.231  1.00 29.44  ? 348 TYR C CB  1 
ATOM   5258  C  CG  . TYR C 3 261 ? 72.112  -17.245 84.698  1.00 26.10  ? 348 TYR C CG  1 
ATOM   5259  C  CD1 . TYR C 3 261 ? 71.281  -16.980 85.775  1.00 24.40  ? 348 TYR C CD1 1 
ATOM   5260  C  CD2 . TYR C 3 261 ? 71.942  -18.434 84.011  1.00 29.70  ? 348 TYR C CD2 1 
ATOM   5261  C  CE1 . TYR C 3 261 ? 70.290  -17.865 86.151  1.00 28.64  ? 348 TYR C CE1 1 
ATOM   5262  C  CE2 . TYR C 3 261 ? 70.957  -19.336 84.378  1.00 35.14  ? 348 TYR C CE2 1 
ATOM   5263  C  CZ  . TYR C 3 261 ? 70.128  -19.045 85.447  1.00 31.61  ? 348 TYR C CZ  1 
ATOM   5264  O  OH  . TYR C 3 261 ? 69.124  -19.922 85.771  1.00 23.18  ? 348 TYR C OH  1 
ATOM   5265  N  N   . TYR C 3 262 ? 75.597  -18.499 85.162  1.00 32.68  ? 349 TYR C N   1 
ATOM   5266  C  CA  . TYR C 3 262 ? 76.290  -19.704 84.720  1.00 37.63  ? 349 TYR C CA  1 
ATOM   5267  C  C   . TYR C 3 262 ? 75.360  -20.901 84.744  1.00 40.41  ? 349 TYR C C   1 
ATOM   5268  O  O   . TYR C 3 262 ? 74.794  -21.244 85.789  1.00 44.24  ? 349 TYR C O   1 
ATOM   5269  C  CB  . TYR C 3 262 ? 77.504  -19.984 85.592  1.00 33.34  ? 349 TYR C CB  1 
ATOM   5270  C  CG  . TYR C 3 262 ? 78.602  -18.976 85.412  1.00 36.81  ? 349 TYR C CG  1 
ATOM   5271  C  CD1 . TYR C 3 262 ? 79.501  -19.085 84.350  1.00 39.66  ? 349 TYR C CD1 1 
ATOM   5272  C  CD2 . TYR C 3 262 ? 78.750  -17.908 86.299  1.00 36.77  ? 349 TYR C CD2 1 
ATOM   5273  C  CE1 . TYR C 3 262 ? 80.522  -18.160 84.173  1.00 41.36  ? 349 TYR C CE1 1 
ATOM   5274  C  CE2 . TYR C 3 262 ? 79.765  -16.979 86.134  1.00 39.81  ? 349 TYR C CE2 1 
ATOM   5275  C  CZ  . TYR C 3 262 ? 80.647  -17.113 85.069  1.00 43.14  ? 349 TYR C CZ  1 
ATOM   5276  O  OH  . TYR C 3 262 ? 81.659  -16.203 84.897  1.00 48.05  ? 349 TYR C OH  1 
ATOM   5277  N  N   . GLN C 3 263 ? 75.216  -21.531 83.582  1.00 44.64  ? 350 GLN C N   1 
ATOM   5278  C  CA  . GLN C 3 263 ? 74.350  -22.692 83.428  1.00 51.93  ? 350 GLN C CA  1 
ATOM   5279  C  C   . GLN C 3 263 ? 74.916  -23.904 84.177  1.00 57.65  ? 350 GLN C C   1 
ATOM   5280  O  O   . GLN C 3 263 ? 76.100  -24.244 84.040  1.00 57.85  ? 350 GLN C O   1 
ATOM   5281  C  CB  . GLN C 3 263 ? 74.156  -23.015 81.933  1.00 52.24  ? 350 GLN C CB  1 
ATOM   5282  C  CG  . GLN C 3 263 ? 72.690  -23.089 81.457  1.00 57.75  ? 350 GLN C CG  1 
ATOM   5283  C  CD  . GLN C 3 263 ? 72.002  -21.722 81.346  1.00 61.07  ? 350 GLN C CD  1 
ATOM   5284  O  OE1 . GLN C 3 263 ? 72.626  -20.724 80.958  1.00 59.84  ? 350 GLN C OE1 1 
ATOM   5285  N  NE2 . GLN C 3 263 ? 70.703  -21.682 81.662  1.00 63.22  ? 350 GLN C NE2 1 
ATOM   5286  N  N   . GLY C 3 264 ? 74.078  -24.515 85.013  1.00 59.82  ? 351 GLY C N   1 
ATOM   5287  C  CA  . GLY C 3 264 ? 74.501  -25.687 85.756  1.00 63.31  ? 351 GLY C CA  1 
ATOM   5288  C  C   . GLY C 3 264 ? 75.068  -25.404 87.132  1.00 67.74  ? 351 GLY C C   1 
ATOM   5289  O  O   . GLY C 3 264 ? 75.271  -26.333 87.923  1.00 66.05  ? 351 GLY C O   1 
ATOM   5290  N  N   . GLY C 3 265 ? 75.333  -24.128 87.412  1.00 71.82  ? 352 GLY C N   1 
ATOM   5291  C  CA  . GLY C 3 265 ? 75.867  -23.733 88.708  1.00 71.07  ? 352 GLY C CA  1 
ATOM   5292  C  C   . GLY C 3 265 ? 77.376  -23.641 88.840  1.00 70.23  ? 352 GLY C C   1 
ATOM   5293  O  O   . GLY C 3 265 ? 77.912  -22.558 89.072  1.00 69.34  ? 352 GLY C O   1 
ATOM   5294  N  N   . THR C 3 266 ? 78.059  -24.774 88.699  1.00 70.16  ? 353 THR C N   1 
ATOM   5295  C  CA  . THR C 3 266 ? 79.514  -24.829 88.823  1.00 70.43  ? 353 THR C CA  1 
ATOM   5296  C  C   . THR C 3 266 ? 80.286  -24.163 87.685  1.00 66.79  ? 353 THR C C   1 
ATOM   5297  O  O   . THR C 3 266 ? 80.142  -24.537 86.511  1.00 68.74  ? 353 THR C O   1 
ATOM   5298  C  CB  . THR C 3 266 ? 80.024  -26.288 88.931  1.00 72.93  ? 353 THR C CB  1 
ATOM   5299  O  OG1 . THR C 3 266 ? 79.274  -26.990 89.927  1.00 77.58  ? 353 THR C OG1 1 
ATOM   5300  C  CG2 . THR C 3 266 ? 81.508  -26.317 89.312  1.00 71.45  ? 353 THR C CG2 1 
ATOM   5301  N  N   . TYR C 3 267 ? 81.103  -23.175 88.042  1.00 58.00  ? 354 TYR C N   1 
ATOM   5302  C  CA  . TYR C 3 267 ? 81.941  -22.502 87.069  1.00 53.41  ? 354 TYR C CA  1 
ATOM   5303  C  C   . TYR C 3 267 ? 83.388  -22.493 87.547  1.00 50.73  ? 354 TYR C C   1 
ATOM   5304  O  O   . TYR C 3 267 ? 83.698  -23.004 88.625  1.00 43.07  ? 354 TYR C O   1 
ATOM   5305  C  CB  . TYR C 3 267 ? 81.433  -21.105 86.741  1.00 47.90  ? 354 TYR C CB  1 
ATOM   5306  C  CG  . TYR C 3 267 ? 81.518  -20.103 87.847  1.00 46.65  ? 354 TYR C CG  1 
ATOM   5307  C  CD1 . TYR C 3 267 ? 80.626  -20.135 88.919  1.00 46.75  ? 354 TYR C CD1 1 
ATOM   5308  C  CD2 . TYR C 3 267 ? 82.407  -19.038 87.761  1.00 49.17  ? 354 TYR C CD2 1 
ATOM   5309  C  CE1 . TYR C 3 267 ? 80.609  -19.121 89.864  1.00 43.41  ? 354 TYR C CE1 1 
ATOM   5310  C  CE2 . TYR C 3 267 ? 82.400  -18.019 88.696  1.00 49.78  ? 354 TYR C CE2 1 
ATOM   5311  C  CZ  . TYR C 3 267 ? 81.496  -18.063 89.739  1.00 46.28  ? 354 TYR C CZ  1 
ATOM   5312  O  OH  . TYR C 3 267 ? 81.463  -17.012 90.616  1.00 45.70  ? 354 TYR C OH  1 
ATOM   5313  N  N   . SER C 3 268 ? 84.274  -21.930 86.736  1.00 54.80  ? 355 SER C N   1 
ATOM   5314  C  CA  . SER C 3 268 ? 85.695  -21.914 87.067  1.00 58.64  ? 355 SER C CA  1 
ATOM   5315  C  C   . SER C 3 268 ? 86.424  -20.634 86.691  1.00 61.67  ? 355 SER C C   1 
ATOM   5316  O  O   . SER C 3 268 ? 86.003  -19.901 85.790  1.00 67.84  ? 355 SER C O   1 
ATOM   5317  C  CB  . SER C 3 268 ? 86.377  -23.090 86.372  1.00 63.86  ? 355 SER C CB  1 
ATOM   5318  O  OG  . SER C 3 268 ? 86.094  -23.084 84.977  1.00 68.55  ? 355 SER C OG  1 
ATOM   5319  N  N   . LYS C 3 269 ? 87.563  -20.419 87.338  1.00 59.50  ? 356 LYS C N   1 
ATOM   5320  C  CA  . LYS C 3 269 ? 88.384  -19.245 87.094  1.00 66.13  ? 356 LYS C CA  1 
ATOM   5321  C  C   . LYS C 3 269 ? 88.698  -18.982 85.601  1.00 66.35  ? 356 LYS C C   1 
ATOM   5322  O  O   . LYS C 3 269 ? 88.757  -17.826 85.161  1.00 63.88  ? 356 LYS C O   1 
ATOM   5323  C  CB  . LYS C 3 269 ? 89.672  -19.370 87.903  1.00 69.61  ? 356 LYS C CB  1 
ATOM   5324  C  CG  . LYS C 3 269 ? 90.690  -18.282 87.639  1.00 74.70  ? 356 LYS C CG  1 
ATOM   5325  C  CD  . LYS C 3 269 ? 91.882  -18.417 88.557  1.00 82.38  ? 356 LYS C CD  1 
ATOM   5326  C  CE  . LYS C 3 269 ? 91.480  -18.177 90.005  1.00 87.52  ? 356 LYS C CE  1 
ATOM   5327  N  NZ  . LYS C 3 269 ? 90.935  -16.804 90.224  1.00 88.48  ? 356 LYS C NZ  1 
ATOM   5328  N  N   . ALA C 3 270 ? 88.876  -20.048 84.825  1.00 67.99  ? 357 ALA C N   1 
ATOM   5329  C  CA  . ALA C 3 270 ? 89.185  -19.913 83.408  1.00 67.92  ? 357 ALA C CA  1 
ATOM   5330  C  C   . ALA C 3 270 ? 88.009  -19.356 82.646  1.00 68.16  ? 357 ALA C C   1 
ATOM   5331  O  O   . ALA C 3 270 ? 88.190  -18.569 81.721  1.00 73.78  ? 357 ALA C O   1 
ATOM   5332  C  CB  . ALA C 3 270 ? 89.588  -21.249 82.822  1.00 71.69  ? 357 ALA C CB  1 
ATOM   5333  N  N   . SER C 3 271 ? 86.807  -19.783 83.021  1.00 65.62  ? 358 SER C N   1 
ATOM   5334  C  CA  . SER C 3 271 ? 85.592  -19.323 82.362  1.00 64.84  ? 358 SER C CA  1 
ATOM   5335  C  C   . SER C 3 271 ? 85.459  -17.812 82.486  1.00 61.26  ? 358 SER C C   1 
ATOM   5336  O  O   . SER C 3 271 ? 85.093  -17.138 81.516  1.00 59.73  ? 358 SER C O   1 
ATOM   5337  C  CB  . SER C 3 271 ? 84.366  -19.991 82.981  1.00 67.64  ? 358 SER C CB  1 
ATOM   5338  O  OG  . SER C 3 271 ? 84.485  -21.399 82.957  1.00 68.86  ? 358 SER C OG  1 
ATOM   5339  N  N   . THR C 3 272 ? 85.774  -17.294 83.679  1.00 58.26  ? 359 THR C N   1 
ATOM   5340  C  CA  . THR C 3 272 ? 85.697  -15.856 83.971  1.00 57.10  ? 359 THR C CA  1 
ATOM   5341  C  C   . THR C 3 272 ? 86.784  -15.044 83.267  1.00 58.00  ? 359 THR C C   1 
ATOM   5342  O  O   . THR C 3 272 ? 87.940  -15.460 83.198  1.00 59.90  ? 359 THR C O   1 
ATOM   5343  C  CB  . THR C 3 272 ? 85.786  -15.545 85.502  1.00 51.81  ? 359 THR C CB  1 
ATOM   5344  O  OG1 . THR C 3 272 ? 87.096  -15.849 85.986  1.00 46.65  ? 359 THR C OG1 1 
ATOM   5345  C  CG2 . THR C 3 272 ? 84.765  -16.344 86.287  1.00 50.86  ? 359 THR C CG2 1 
ATOM   5346  N  N   . PRO C 3 273 ? 86.432  -13.843 82.789  1.00 60.35  ? 360 PRO C N   1 
ATOM   5347  C  CA  . PRO C 3 273 ? 87.374  -12.967 82.094  1.00 62.92  ? 360 PRO C CA  1 
ATOM   5348  C  C   . PRO C 3 273 ? 88.596  -12.559 82.925  1.00 64.09  ? 360 PRO C C   1 
ATOM   5349  O  O   . PRO C 3 273 ? 89.714  -13.011 82.674  1.00 60.50  ? 360 PRO C O   1 
ATOM   5350  C  CB  . PRO C 3 273 ? 86.498  -11.764 81.725  1.00 60.90  ? 360 PRO C CB  1 
ATOM   5351  C  CG  . PRO C 3 273 ? 85.462  -11.750 82.800  1.00 58.95  ? 360 PRO C CG  1 
ATOM   5352  C  CD  . PRO C 3 273 ? 85.110  -13.201 82.896  1.00 60.85  ? 360 PRO C CD  1 
ATOM   5353  N  N   . ASN C 3 274 ? 88.363  -11.729 83.933  1.00 68.77  ? 361 ASN C N   1 
ATOM   5354  C  CA  . ASN C 3 274 ? 89.430  -11.228 84.791  1.00 72.74  ? 361 ASN C CA  1 
ATOM   5355  C  C   . ASN C 3 274 ? 89.971  -12.269 85.763  1.00 69.95  ? 361 ASN C C   1 
ATOM   5356  O  O   . ASN C 3 274 ? 90.960  -12.032 86.481  1.00 63.37  ? 361 ASN C O   1 
ATOM   5357  C  CB  . ASN C 3 274 ? 88.944  -9.983  85.533  1.00 81.43  ? 361 ASN C CB  1 
ATOM   5358  C  CG  . ASN C 3 274 ? 88.615  -8.831  84.582  1.00 89.53  ? 361 ASN C CG  1 
ATOM   5359  O  OD1 . ASN C 3 274 ? 89.383  -7.866  84.466  1.00 92.77  ? 361 ASN C OD1 1 
ATOM   5360  N  ND2 . ASN C 3 274 ? 87.483  -8.940  83.880  1.00 89.93  ? 361 ASN C ND2 1 
ATOM   5361  N  N   . GLY C 3 275 ? 89.333  -13.436 85.750  1.00 69.21  ? 362 GLY C N   1 
ATOM   5362  C  CA  . GLY C 3 275 ? 89.755  -14.515 86.614  1.00 65.05  ? 362 GLY C CA  1 
ATOM   5363  C  C   . GLY C 3 275 ? 89.009  -14.600 87.931  1.00 63.14  ? 362 GLY C C   1 
ATOM   5364  O  O   . GLY C 3 275 ? 88.872  -15.695 88.470  1.00 70.87  ? 362 GLY C O   1 
ATOM   5365  N  N   . TYR C 3 276 ? 88.531  -13.473 88.461  1.00 56.74  ? 363 TYR C N   1 
ATOM   5366  C  CA  . TYR C 3 276 ? 87.798  -13.484 89.737  1.00 49.26  ? 363 TYR C CA  1 
ATOM   5367  C  C   . TYR C 3 276 ? 86.362  -13.969 89.547  1.00 41.24  ? 363 TYR C C   1 
ATOM   5368  O  O   . TYR C 3 276 ? 85.811  -13.922 88.441  1.00 44.55  ? 363 TYR C O   1 
ATOM   5369  C  CB  . TYR C 3 276 ? 87.806  -12.098 90.382  1.00 54.03  ? 363 TYR C CB  1 
ATOM   5370  C  CG  . TYR C 3 276 ? 89.175  -11.426 90.424  1.00 61.30  ? 363 TYR C CG  1 
ATOM   5371  C  CD1 . TYR C 3 276 ? 90.100  -11.724 91.430  1.00 62.15  ? 363 TYR C CD1 1 
ATOM   5372  C  CD2 . TYR C 3 276 ? 89.532  -10.455 89.476  1.00 64.42  ? 363 TYR C CD2 1 
ATOM   5373  C  CE1 . TYR C 3 276 ? 91.349  -11.064 91.498  1.00 65.42  ? 363 TYR C CE1 1 
ATOM   5374  C  CE2 . TYR C 3 276 ? 90.773  -9.792  89.534  1.00 64.96  ? 363 TYR C CE2 1 
ATOM   5375  C  CZ  . TYR C 3 276 ? 91.673  -10.099 90.548  1.00 66.51  ? 363 TYR C CZ  1 
ATOM   5376  O  OH  . TYR C 3 276 ? 92.878  -9.427  90.624  1.00 67.79  ? 363 TYR C OH  1 
ATOM   5377  N  N   . ASP C 3 277 ? 85.762  -14.464 90.620  1.00 30.82  ? 364 ASP C N   1 
ATOM   5378  C  CA  . ASP C 3 277 ? 84.398  -14.966 90.547  1.00 27.55  ? 364 ASP C CA  1 
ATOM   5379  C  C   . ASP C 3 277 ? 83.418  -13.838 90.316  1.00 28.89  ? 364 ASP C C   1 
ATOM   5380  O  O   . ASP C 3 277 ? 83.519  -12.788 90.935  1.00 29.98  ? 364 ASP C O   1 
ATOM   5381  C  CB  . ASP C 3 277 ? 84.037  -15.662 91.839  1.00 31.58  ? 364 ASP C CB  1 
ATOM   5382  C  CG  . ASP C 3 277 ? 84.095  -14.728 93.026  1.00 39.39  ? 364 ASP C CG  1 
ATOM   5383  O  OD1 . ASP C 3 277 ? 85.186  -14.172 93.283  1.00 39.28  ? 364 ASP C OD1 1 
ATOM   5384  O  OD2 . ASP C 3 277 ? 83.049  -14.526 93.684  1.00 43.07  ? 364 ASP C OD2 1 
ATOM   5385  N  N   . ASN C 3 278 ? 82.436  -14.076 89.463  1.00 31.33  ? 365 ASN C N   1 
ATOM   5386  C  CA  . ASN C 3 278 ? 81.438  -13.066 89.164  1.00 31.97  ? 365 ASN C CA  1 
ATOM   5387  C  C   . ASN C 3 278 ? 80.079  -13.704 88.956  1.00 31.89  ? 365 ASN C C   1 
ATOM   5388  O  O   . ASN C 3 278 ? 79.156  -13.071 88.427  1.00 38.39  ? 365 ASN C O   1 
ATOM   5389  C  CB  . ASN C 3 278 ? 81.845  -12.269 87.925  1.00 35.63  ? 365 ASN C CB  1 
ATOM   5390  C  CG  . ASN C 3 278 ? 81.956  -13.130 86.674  1.00 43.23  ? 365 ASN C CG  1 
ATOM   5391  O  OD1 . ASN C 3 278 ? 82.078  -12.610 85.562  1.00 47.33  ? 365 ASN C OD1 1 
ATOM   5392  N  ND2 . ASN C 3 278 ? 81.918  -14.447 86.847  1.00 41.89  ? 365 ASN C ND2 1 
ATOM   5393  N  N   . GLY C 3 279 ? 79.967  -14.971 89.335  1.00 24.44  ? 366 GLY C N   1 
ATOM   5394  C  CA  . GLY C 3 279 ? 78.703  -15.666 89.186  1.00 23.49  ? 366 GLY C CA  1 
ATOM   5395  C  C   . GLY C 3 279 ? 77.696  -15.142 90.191  1.00 18.99  ? 366 GLY C C   1 
ATOM   5396  O  O   . GLY C 3 279 ? 77.958  -14.215 90.960  1.00 13.51  ? 366 GLY C O   1 
ATOM   5397  N  N   . ILE C 3 280 ? 76.504  -15.696 90.146  1.00 20.45  ? 367 ILE C N   1 
ATOM   5398  C  CA  . ILE C 3 280 ? 75.491  -15.277 91.079  1.00 24.28  ? 367 ILE C CA  1 
ATOM   5399  C  C   . ILE C 3 280 ? 75.809  -16.109 92.298  1.00 31.57  ? 367 ILE C C   1 
ATOM   5400  O  O   . ILE C 3 280 ? 75.327  -17.239 92.461  1.00 37.95  ? 367 ILE C O   1 
ATOM   5401  C  CB  . ILE C 3 280 ? 74.103  -15.589 90.541  1.00 23.33  ? 367 ILE C CB  1 
ATOM   5402  C  CG1 . ILE C 3 280 ? 73.983  -14.992 89.133  1.00 25.01  ? 367 ILE C CG1 1 
ATOM   5403  C  CG2 . ILE C 3 280 ? 73.028  -15.087 91.529  1.00 22.06  ? 367 ILE C CG2 1 
ATOM   5404  C  CD1 . ILE C 3 280 ? 72.802  -15.492 88.332  1.00 33.90  ? 367 ILE C CD1 1 
ATOM   5405  N  N   . ILE C 3 281 ? 76.714  -15.588 93.107  1.00 26.30  ? 368 ILE C N   1 
ATOM   5406  C  CA  . ILE C 3 281 ? 77.123  -16.302 94.311  1.00 27.65  ? 368 ILE C CA  1 
ATOM   5407  C  C   . ILE C 3 281 ? 76.464  -15.759 95.565  1.00 26.99  ? 368 ILE C C   1 
ATOM   5408  O  O   . ILE C 3 281 ? 75.963  -14.634 95.608  1.00 27.19  ? 368 ILE C O   1 
ATOM   5409  C  CB  . ILE C 3 281 ? 78.671  -16.245 94.533  1.00 27.87  ? 368 ILE C CB  1 
ATOM   5410  C  CG1 . ILE C 3 281 ? 79.074  -14.894 95.135  1.00 22.50  ? 368 ILE C CG1 1 
ATOM   5411  C  CG2 . ILE C 3 281 ? 79.407  -16.454 93.208  1.00 30.45  ? 368 ILE C CG2 1 
ATOM   5412  C  CD1 . ILE C 3 281 ? 80.485  -14.843 95.624  1.00 24.92  ? 368 ILE C CD1 1 
ATOM   5413  N  N   . TRP C 3 282 ? 76.485  -16.583 96.596  1.00 30.70  ? 369 TRP C N   1 
ATOM   5414  C  CA  . TRP C 3 282 ? 75.947  -16.217 97.894  1.00 29.95  ? 369 TRP C CA  1 
ATOM   5415  C  C   . TRP C 3 282 ? 76.759  -17.056 98.872  1.00 33.38  ? 369 TRP C C   1 
ATOM   5416  O  O   . TRP C 3 282 ? 76.287  -18.070 99.395  1.00 34.85  ? 369 TRP C O   1 
ATOM   5417  C  CB  . TRP C 3 282 ? 74.469  -16.559 97.985  1.00 20.06  ? 369 TRP C CB  1 
ATOM   5418  C  CG  . TRP C 3 282 ? 73.902  -16.059 99.221  1.00 21.36  ? 369 TRP C CG  1 
ATOM   5419  C  CD1 . TRP C 3 282 ? 73.663  -16.767 100.361 1.00 25.69  ? 369 TRP C CD1 1 
ATOM   5420  C  CD2 . TRP C 3 282 ? 73.520  -14.718 99.489  1.00 22.27  ? 369 TRP C CD2 1 
ATOM   5421  N  NE1 . TRP C 3 282 ? 73.151  -15.939 101.331 1.00 24.56  ? 369 TRP C NE1 1 
ATOM   5422  C  CE2 . TRP C 3 282 ? 73.047  -14.677 100.818 1.00 19.89  ? 369 TRP C CE2 1 
ATOM   5423  C  CE3 . TRP C 3 282 ? 73.525  -13.542 98.734  1.00 29.28  ? 369 TRP C CE3 1 
ATOM   5424  C  CZ2 . TRP C 3 282 ? 72.580  -13.511 101.407 1.00 24.98  ? 369 TRP C CZ2 1 
ATOM   5425  C  CZ3 . TRP C 3 282 ? 73.057  -12.372 99.324  1.00 32.48  ? 369 TRP C CZ3 1 
ATOM   5426  C  CH2 . TRP C 3 282 ? 72.590  -12.366 100.647 1.00 31.37  ? 369 TRP C CH2 1 
ATOM   5427  N  N   . ALA C 3 283 ? 78.006  -16.628 99.059  1.00 31.38  ? 370 ALA C N   1 
ATOM   5428  C  CA  . ALA C 3 283 ? 78.998  -17.287 99.897  1.00 34.19  ? 370 ALA C CA  1 
ATOM   5429  C  C   . ALA C 3 283 ? 78.538  -18.093 101.123 1.00 36.13  ? 370 ALA C C   1 
ATOM   5430  O  O   . ALA C 3 283 ? 78.885  -19.272 101.259 1.00 41.52  ? 370 ALA C O   1 
ATOM   5431  C  CB  . ALA C 3 283 ? 80.090  -16.297 100.272 1.00 24.99  ? 370 ALA C CB  1 
ATOM   5432  N  N   . THR C 3 284 ? 77.733  -17.501 101.994 1.00 26.81  ? 371 THR C N   1 
ATOM   5433  C  CA  . THR C 3 284 ? 77.289  -18.230 103.177 1.00 27.71  ? 371 THR C CA  1 
ATOM   5434  C  C   . THR C 3 284 ? 76.408  -19.447 102.926 1.00 37.60  ? 371 THR C C   1 
ATOM   5435  O  O   . THR C 3 284 ? 75.964  -20.078 103.890 1.00 42.70  ? 371 THR C O   1 
ATOM   5436  C  CB  . THR C 3 284 ? 76.549  -17.331 104.138 1.00 25.55  ? 371 THR C CB  1 
ATOM   5437  O  OG1 . THR C 3 284 ? 75.309  -16.928 103.555 1.00 33.06  ? 371 THR C OG1 1 
ATOM   5438  C  CG2 . THR C 3 284 ? 77.385  -16.113 104.438 1.00 23.56  ? 371 THR C CG2 1 
ATOM   5439  N  N   . TRP C 3 285 ? 76.164  -19.785 101.654 1.00 42.86  ? 372 TRP C N   1 
ATOM   5440  C  CA  . TRP C 3 285 ? 75.318  -20.927 101.307 1.00 41.64  ? 372 TRP C CA  1 
ATOM   5441  C  C   . TRP C 3 285 ? 75.998  -21.920 100.395 1.00 38.83  ? 372 TRP C C   1 
ATOM   5442  O  O   . TRP C 3 285 ? 75.809  -23.128 100.525 1.00 39.61  ? 372 TRP C O   1 
ATOM   5443  C  CB  . TRP C 3 285 ? 74.041  -20.454 100.629 1.00 44.52  ? 372 TRP C CB  1 
ATOM   5444  C  CG  . TRP C 3 285 ? 72.986  -21.512 100.546 1.00 44.20  ? 372 TRP C CG  1 
ATOM   5445  C  CD1 . TRP C 3 285 ? 72.447  -22.208 101.584 1.00 42.53  ? 372 TRP C CD1 1 
ATOM   5446  C  CD2 . TRP C 3 285 ? 72.266  -21.914 99.380  1.00 45.46  ? 372 TRP C CD2 1 
ATOM   5447  N  NE1 . TRP C 3 285 ? 71.419  -23.004 101.146 1.00 44.46  ? 372 TRP C NE1 1 
ATOM   5448  C  CE2 . TRP C 3 285 ? 71.287  -22.844 99.794  1.00 45.92  ? 372 TRP C CE2 1 
ATOM   5449  C  CE3 . TRP C 3 285 ? 72.345  -21.572 98.029  1.00 46.04  ? 372 TRP C CE3 1 
ATOM   5450  C  CZ2 . TRP C 3 285 ? 70.394  -23.432 98.909  1.00 44.94  ? 372 TRP C CZ2 1 
ATOM   5451  C  CZ3 . TRP C 3 285 ? 71.456  -22.157 97.146  1.00 49.15  ? 372 TRP C CZ3 1 
ATOM   5452  C  CH2 . TRP C 3 285 ? 70.491  -23.078 97.592  1.00 48.26  ? 372 TRP C CH2 1 
ATOM   5453  N  N   . LYS C 3 286 ? 76.733  -21.388 99.433  1.00 34.28  ? 373 LYS C N   1 
ATOM   5454  C  CA  . LYS C 3 286 ? 77.452  -22.195 98.465  1.00 39.01  ? 373 LYS C CA  1 
ATOM   5455  C  C   . LYS C 3 286 ? 78.828  -21.571 98.246  1.00 39.30  ? 373 LYS C C   1 
ATOM   5456  O  O   . LYS C 3 286 ? 79.139  -20.528 98.807  1.00 35.77  ? 373 LYS C O   1 
ATOM   5457  C  CB  . LYS C 3 286 ? 76.680  -22.238 97.144  1.00 43.14  ? 373 LYS C CB  1 
ATOM   5458  C  CG  . LYS C 3 286 ? 75.329  -22.932 97.222  1.00 46.30  ? 373 LYS C CG  1 
ATOM   5459  C  CD  . LYS C 3 286 ? 75.483  -24.444 97.214  1.00 51.54  ? 373 LYS C CD  1 
ATOM   5460  C  CE  . LYS C 3 286 ? 74.135  -25.153 97.272  1.00 52.03  ? 373 LYS C CE  1 
ATOM   5461  N  NZ  . LYS C 3 286 ? 73.434  -24.850 98.545  1.00 51.87  ? 373 LYS C NZ  1 
ATOM   5462  N  N   . THR C 3 287 ? 79.639  -22.202 97.405  1.00 40.94  ? 374 THR C N   1 
ATOM   5463  C  CA  . THR C 3 287 ? 80.981  -21.711 97.122  1.00 41.45  ? 374 THR C CA  1 
ATOM   5464  C  C   . THR C 3 287 ? 80.949  -20.487 96.215  1.00 37.49  ? 374 THR C C   1 
ATOM   5465  O  O   . THR C 3 287 ? 79.956  -20.226 95.521  1.00 39.21  ? 374 THR C O   1 
ATOM   5466  C  CB  . THR C 3 287 ? 81.861  -22.829 96.484  1.00 46.23  ? 374 THR C CB  1 
ATOM   5467  O  OG1 . THR C 3 287 ? 83.209  -22.358 96.323  1.00 48.31  ? 374 THR C OG1 1 
ATOM   5468  C  CG2 . THR C 3 287 ? 81.294  -23.270 95.127  1.00 49.28  ? 374 THR C CG2 1 
ATOM   5469  N  N   . ARG C 3 288 ? 82.043  -19.733 96.233  1.00 29.97  ? 375 ARG C N   1 
ATOM   5470  C  CA  . ARG C 3 288 ? 82.153  -18.549 95.408  1.00 28.93  ? 375 ARG C CA  1 
ATOM   5471  C  C   . ARG C 3 288 ? 82.256  -18.975 93.962  1.00 35.02  ? 375 ARG C C   1 
ATOM   5472  O  O   . ARG C 3 288 ? 82.440  -18.139 93.074  1.00 38.49  ? 375 ARG C O   1 
ATOM   5473  C  CB  . ARG C 3 288 ? 83.388  -17.758 95.775  1.00 33.13  ? 375 ARG C CB  1 
ATOM   5474  C  CG  . ARG C 3 288 ? 84.661  -18.397 95.327  1.00 34.88  ? 375 ARG C CG  1 
ATOM   5475  C  CD  . ARG C 3 288 ? 85.782  -17.408 95.406  1.00 32.78  ? 375 ARG C CD  1 
ATOM   5476  N  NE  . ARG C 3 288 ? 86.767  -17.850 96.375  1.00 42.25  ? 375 ARG C NE  1 
ATOM   5477  C  CZ  . ARG C 3 288 ? 87.863  -17.175 96.694  1.00 44.01  ? 375 ARG C CZ  1 
ATOM   5478  N  NH1 . ARG C 3 288 ? 88.118  -16.001 96.122  1.00 40.19  ? 375 ARG C NH1 1 
ATOM   5479  N  NH2 . ARG C 3 288 ? 88.724  -17.705 97.557  1.00 43.00  ? 375 ARG C NH2 1 
ATOM   5480  N  N   . TRP C 3 289 ? 82.229  -20.287 93.738  1.00 36.54  ? 376 TRP C N   1 
ATOM   5481  C  CA  . TRP C 3 289 ? 82.283  -20.815 92.398  1.00 40.24  ? 376 TRP C CA  1 
ATOM   5482  C  C   . TRP C 3 289 ? 81.057  -21.615 92.018  1.00 41.97  ? 376 TRP C C   1 
ATOM   5483  O  O   . TRP C 3 289 ? 81.122  -22.540 91.215  1.00 44.53  ? 376 TRP C O   1 
ATOM   5484  C  CB  . TRP C 3 289 ? 83.589  -21.547 92.153  1.00 43.25  ? 376 TRP C CB  1 
ATOM   5485  C  CG  . TRP C 3 289 ? 84.598  -20.568 91.667  1.00 54.43  ? 376 TRP C CG  1 
ATOM   5486  C  CD1 . TRP C 3 289 ? 84.503  -19.769 90.545  1.00 60.08  ? 376 TRP C CD1 1 
ATOM   5487  C  CD2 . TRP C 3 289 ? 85.820  -20.212 92.305  1.00 58.05  ? 376 TRP C CD2 1 
ATOM   5488  N  NE1 . TRP C 3 289 ? 85.597  -18.932 90.459  1.00 60.98  ? 376 TRP C NE1 1 
ATOM   5489  C  CE2 . TRP C 3 289 ? 86.421  -19.186 91.524  1.00 62.04  ? 376 TRP C CE2 1 
ATOM   5490  C  CE3 . TRP C 3 289 ? 86.471  -20.653 93.460  1.00 60.04  ? 376 TRP C CE3 1 
ATOM   5491  C  CZ2 . TRP C 3 289 ? 87.639  -18.606 91.870  1.00 67.06  ? 376 TRP C CZ2 1 
ATOM   5492  C  CZ3 . TRP C 3 289 ? 87.680  -20.076 93.804  1.00 64.37  ? 376 TRP C CZ3 1 
ATOM   5493  C  CH2 . TRP C 3 289 ? 88.253  -19.064 93.013  1.00 67.42  ? 376 TRP C CH2 1 
ATOM   5494  N  N   . TYR C 3 290 ? 79.927  -21.206 92.588  1.00 39.52  ? 377 TYR C N   1 
ATOM   5495  C  CA  . TYR C 3 290 ? 78.655  -21.825 92.302  1.00 42.04  ? 377 TYR C CA  1 
ATOM   5496  C  C   . TYR C 3 290 ? 77.618  -20.720 92.137  1.00 41.90  ? 377 TYR C C   1 
ATOM   5497  O  O   . TYR C 3 290 ? 77.261  -20.030 93.099  1.00 42.66  ? 377 TYR C O   1 
ATOM   5498  C  CB  . TYR C 3 290 ? 78.240  -22.798 93.407  1.00 44.14  ? 377 TYR C CB  1 
ATOM   5499  C  CG  . TYR C 3 290 ? 76.975  -23.591 93.102  1.00 50.27  ? 377 TYR C CG  1 
ATOM   5500  C  CD1 . TYR C 3 290 ? 77.034  -24.804 92.413  1.00 50.35  ? 377 TYR C CD1 1 
ATOM   5501  C  CD2 . TYR C 3 290 ? 75.720  -23.134 93.512  1.00 53.88  ? 377 TYR C CD2 1 
ATOM   5502  C  CE1 . TYR C 3 290 ? 75.876  -25.547 92.141  1.00 52.70  ? 377 TYR C CE1 1 
ATOM   5503  C  CE2 . TYR C 3 290 ? 74.552  -23.872 93.244  1.00 55.71  ? 377 TYR C CE2 1 
ATOM   5504  C  CZ  . TYR C 3 290 ? 74.639  -25.079 92.559  1.00 55.35  ? 377 TYR C CZ  1 
ATOM   5505  O  OH  . TYR C 3 290 ? 73.498  -25.820 92.299  1.00 56.99  ? 377 TYR C OH  1 
ATOM   5506  N  N   . SER C 3 291 ? 77.204  -20.527 90.886  1.00 36.75  ? 378 SER C N   1 
ATOM   5507  C  CA  . SER C 3 291 ? 76.202  -19.548 90.513  1.00 31.63  ? 378 SER C CA  1 
ATOM   5508  C  C   . SER C 3 291 ? 74.836  -20.205 90.730  1.00 28.67  ? 378 SER C C   1 
ATOM   5509  O  O   . SER C 3 291 ? 74.612  -21.335 90.277  1.00 21.91  ? 378 SER C O   1 
ATOM   5510  C  CB  . SER C 3 291 ? 76.401  -19.184 89.041  1.00 33.17  ? 378 SER C CB  1 
ATOM   5511  O  OG  . SER C 3 291 ? 75.375  -18.354 88.536  1.00 37.00  ? 378 SER C OG  1 
ATOM   5512  N  N   . MET C 3 292 ? 73.942  -19.525 91.452  1.00 25.91  ? 379 MET C N   1 
ATOM   5513  C  CA  . MET C 3 292 ? 72.600  -20.058 91.708  1.00 27.41  ? 379 MET C CA  1 
ATOM   5514  C  C   . MET C 3 292 ? 71.816  -20.320 90.425  1.00 24.79  ? 379 MET C C   1 
ATOM   5515  O  O   . MET C 3 292 ? 72.208  -19.883 89.337  1.00 27.41  ? 379 MET C O   1 
ATOM   5516  C  CB  . MET C 3 292 ? 71.792  -19.111 92.598  1.00 29.76  ? 379 MET C CB  1 
ATOM   5517  C  CG  . MET C 3 292 ? 72.443  -18.798 93.930  1.00 34.48  ? 379 MET C CG  1 
ATOM   5518  S  SD  . MET C 3 292 ? 73.193  -20.236 94.740  1.00 40.08  ? 379 MET C SD  1 
ATOM   5519  C  CE  . MET C 3 292 ? 74.877  -19.588 95.092  1.00 41.72  ? 379 MET C CE  1 
ATOM   5520  N  N   . LYS C 3 293 ? 70.722  -21.063 90.545  1.00 24.21  ? 380 LYS C N   1 
ATOM   5521  C  CA  . LYS C 3 293 ? 69.893  -21.362 89.387  1.00 26.13  ? 380 LYS C CA  1 
ATOM   5522  C  C   . LYS C 3 293 ? 68.846  -20.268 89.255  1.00 23.68  ? 380 LYS C C   1 
ATOM   5523  O  O   . LYS C 3 293 ? 68.569  -19.795 88.160  1.00 24.40  ? 380 LYS C O   1 
ATOM   5524  C  CB  . LYS C 3 293 ? 69.226  -22.723 89.536  1.00 30.24  ? 380 LYS C CB  1 
ATOM   5525  C  CG  . LYS C 3 293 ? 68.505  -23.169 88.284  1.00 41.17  ? 380 LYS C CG  1 
ATOM   5526  C  CD  . LYS C 3 293 ? 67.563  -24.317 88.550  1.00 47.21  ? 380 LYS C CD  1 
ATOM   5527  C  CE  . LYS C 3 293 ? 66.694  -24.573 87.338  1.00 48.96  ? 380 LYS C CE  1 
ATOM   5528  N  NZ  . LYS C 3 293 ? 65.523  -25.419 87.695  1.00 52.53  ? 380 LYS C NZ  1 
ATOM   5529  N  N   . LYS C 3 294 ? 68.295  -19.855 90.392  1.00 28.11  ? 381 LYS C N   1 
ATOM   5530  C  CA  . LYS C 3 294 ? 67.284  -18.803 90.463  1.00 31.66  ? 381 LYS C CA  1 
ATOM   5531  C  C   . LYS C 3 294 ? 67.650  -17.888 91.629  1.00 34.53  ? 381 LYS C C   1 
ATOM   5532  O  O   . LYS C 3 294 ? 68.279  -18.318 92.600  1.00 39.28  ? 381 LYS C O   1 
ATOM   5533  C  CB  . LYS C 3 294 ? 65.880  -19.387 90.708  1.00 31.81  ? 381 LYS C CB  1 
ATOM   5534  C  CG  . LYS C 3 294 ? 65.385  -20.377 89.661  1.00 33.45  ? 381 LYS C CG  1 
ATOM   5535  C  CD  . LYS C 3 294 ? 63.963  -20.836 89.962  1.00 44.22  ? 381 LYS C CD  1 
ATOM   5536  C  CE  . LYS C 3 294 ? 63.501  -21.913 88.980  1.00 48.64  ? 381 LYS C CE  1 
ATOM   5537  N  NZ  . LYS C 3 294 ? 62.213  -22.562 89.386  1.00 56.19  ? 381 LYS C NZ  1 
ATOM   5538  N  N   . THR C 3 295 ? 67.234  -16.630 91.529  1.00 33.89  ? 382 THR C N   1 
ATOM   5539  C  CA  . THR C 3 295 ? 67.502  -15.635 92.554  1.00 23.97  ? 382 THR C CA  1 
ATOM   5540  C  C   . THR C 3 295 ? 66.329  -14.696 92.565  1.00 17.67  ? 382 THR C C   1 
ATOM   5541  O  O   . THR C 3 295 ? 65.814  -14.329 91.507  1.00 17.98  ? 382 THR C O   1 
ATOM   5542  C  CB  . THR C 3 295 ? 68.789  -14.825 92.222  1.00 26.18  ? 382 THR C CB  1 
ATOM   5543  O  OG1 . THR C 3 295 ? 69.931  -15.438 92.832  1.00 26.81  ? 382 THR C OG1 1 
ATOM   5544  C  CG2 . THR C 3 295 ? 68.689  -13.424 92.703  1.00 24.92  ? 382 THR C CG2 1 
ATOM   5545  N  N   . THR C 3 296 ? 65.896  -14.335 93.766  1.00 13.74  ? 383 THR C N   1 
ATOM   5546  C  CA  . THR C 3 296 ? 64.786  -13.401 93.930  1.00 27.15  ? 383 THR C CA  1 
ATOM   5547  C  C   . THR C 3 296 ? 64.914  -12.539 95.194  1.00 27.89  ? 383 THR C C   1 
ATOM   5548  O  O   . THR C 3 296 ? 65.255  -13.033 96.262  1.00 30.27  ? 383 THR C O   1 
ATOM   5549  C  CB  . THR C 3 296 ? 63.388  -14.109 93.819  1.00 29.57  ? 383 THR C CB  1 
ATOM   5550  O  OG1 . THR C 3 296 ? 62.432  -13.446 94.658  1.00 41.20  ? 383 THR C OG1 1 
ATOM   5551  C  CG2 . THR C 3 296 ? 63.459  -15.595 94.159  1.00 30.20  ? 383 THR C CG2 1 
ATOM   5552  N  N   . MET C 3 297 ? 64.716  -11.233 95.030  1.00 21.40  ? 384 MET C N   1 
ATOM   5553  C  CA  . MET C 3 297 ? 64.814  -10.273 96.122  1.00 17.45  ? 384 MET C CA  1 
ATOM   5554  C  C   . MET C 3 297 ? 63.512  -9.519  96.180  1.00 19.94  ? 384 MET C C   1 
ATOM   5555  O  O   . MET C 3 297 ? 63.195  -8.752  95.281  1.00 18.80  ? 384 MET C O   1 
ATOM   5556  C  CB  . MET C 3 297 ? 65.933  -9.265  95.864  1.00 11.83  ? 384 MET C CB  1 
ATOM   5557  C  CG  . MET C 3 297 ? 67.286  -9.866  95.625  1.00 14.03  ? 384 MET C CG  1 
ATOM   5558  S  SD  . MET C 3 297 ? 68.532  -8.609  95.139  1.00 24.09  ? 384 MET C SD  1 
ATOM   5559  C  CE  . MET C 3 297 ? 69.414  -8.405  96.623  1.00 12.07  ? 384 MET C CE  1 
ATOM   5560  N  N   . LYS C 3 298 ? 62.767  -9.724  97.249  1.00 23.01  ? 385 LYS C N   1 
ATOM   5561  C  CA  . LYS C 3 298 ? 61.491  -9.053  97.412  1.00 26.09  ? 385 LYS C CA  1 
ATOM   5562  C  C   . LYS C 3 298 ? 61.447  -8.374  98.777  1.00 29.76  ? 385 LYS C C   1 
ATOM   5563  O  O   . LYS C 3 298 ? 62.156  -8.778  99.706  1.00 26.10  ? 385 LYS C O   1 
ATOM   5564  C  CB  . LYS C 3 298 ? 60.370  -10.073 97.298  1.00 22.54  ? 385 LYS C CB  1 
ATOM   5565  C  CG  . LYS C 3 298 ? 60.559  -11.261 98.216  1.00 24.73  ? 385 LYS C CG  1 
ATOM   5566  C  CD  . LYS C 3 298 ? 59.584  -12.343 97.869  1.00 28.52  ? 385 LYS C CD  1 
ATOM   5567  C  CE  . LYS C 3 298 ? 59.742  -13.555 98.759  1.00 28.82  ? 385 LYS C CE  1 
ATOM   5568  N  NZ  . LYS C 3 298 ? 58.964  -14.685 98.168  1.00 29.03  ? 385 LYS C NZ  1 
ATOM   5569  N  N   . ILE C 3 299 ? 60.612  -7.345  98.895  1.00 29.34  ? 386 ILE C N   1 
ATOM   5570  C  CA  . ILE C 3 299 ? 60.479  -6.618  100.145 1.00 30.39  ? 386 ILE C CA  1 
ATOM   5571  C  C   . ILE C 3 299 ? 59.030  -6.492  100.605 1.00 28.34  ? 386 ILE C C   1 
ATOM   5572  O  O   . ILE C 3 299 ? 58.106  -6.503  99.797  1.00 30.20  ? 386 ILE C O   1 
ATOM   5573  C  CB  . ILE C 3 299 ? 61.093  -5.232  100.045 1.00 31.66  ? 386 ILE C CB  1 
ATOM   5574  C  CG1 . ILE C 3 299 ? 60.332  -4.403  99.018  1.00 28.66  ? 386 ILE C CG1 1 
ATOM   5575  C  CG2 . ILE C 3 299 ? 62.562  -5.342  99.659  1.00 29.56  ? 386 ILE C CG2 1 
ATOM   5576  C  CD1 . ILE C 3 299 ? 60.631  -2.940  99.106  1.00 28.91  ? 386 ILE C CD1 1 
ATOM   5577  N  N   . ILE C 3 300 ? 58.855  -6.316  101.911 1.00 31.05  ? 387 ILE C N   1 
ATOM   5578  C  CA  . ILE C 3 300 ? 57.536  -6.215  102.518 1.00 36.16  ? 387 ILE C CA  1 
ATOM   5579  C  C   . ILE C 3 300 ? 57.670  -5.485  103.854 1.00 36.22  ? 387 ILE C C   1 
ATOM   5580  O  O   . ILE C 3 300 ? 58.743  -5.491  104.469 1.00 37.50  ? 387 ILE C O   1 
ATOM   5581  C  CB  . ILE C 3 300 ? 56.978  -7.640  102.760 1.00 39.88  ? 387 ILE C CB  1 
ATOM   5582  C  CG1 . ILE C 3 300 ? 55.469  -7.621  102.967 1.00 39.37  ? 387 ILE C CG1 1 
ATOM   5583  C  CG2 . ILE C 3 300 ? 57.648  -8.270  103.958 1.00 41.72  ? 387 ILE C CG2 1 
ATOM   5584  C  CD1 . ILE C 3 300 ? 54.861  -8.997  102.972 1.00 42.37  ? 387 ILE C CD1 1 
ATOM   5585  N  N   . PRO C 3 301 ? 56.611  -4.784  104.286 1.00 34.38  ? 388 PRO C N   1 
ATOM   5586  C  CA  . PRO C 3 301 ? 56.700  -4.082  105.560 1.00 39.77  ? 388 PRO C CA  1 
ATOM   5587  C  C   . PRO C 3 301 ? 57.062  -5.062  106.672 1.00 44.05  ? 388 PRO C C   1 
ATOM   5588  O  O   . PRO C 3 301 ? 56.388  -6.062  106.876 1.00 50.45  ? 388 PRO C O   1 
ATOM   5589  C  CB  . PRO C 3 301 ? 55.295  -3.521  105.716 1.00 43.16  ? 388 PRO C CB  1 
ATOM   5590  C  CG  . PRO C 3 301 ? 54.932  -3.195  104.319 1.00 37.74  ? 388 PRO C CG  1 
ATOM   5591  C  CD  . PRO C 3 301 ? 55.359  -4.434  103.598 1.00 33.66  ? 388 PRO C CD  1 
ATOM   5592  N  N   . PHE C 3 302 ? 58.161  -4.772  107.354 1.00 43.92  ? 389 PHE C N   1 
ATOM   5593  C  CA  . PHE C 3 302 ? 58.689  -5.596  108.428 1.00 42.58  ? 389 PHE C CA  1 
ATOM   5594  C  C   . PHE C 3 302 ? 57.654  -6.195  109.362 1.00 38.74  ? 389 PHE C C   1 
ATOM   5595  O  O   . PHE C 3 302 ? 57.712  -7.375  109.705 1.00 28.97  ? 389 PHE C O   1 
ATOM   5596  C  CB  . PHE C 3 302 ? 59.677  -4.769  109.231 1.00 46.44  ? 389 PHE C CB  1 
ATOM   5597  C  CG  . PHE C 3 302 ? 60.487  -5.565  110.183 1.00 50.55  ? 389 PHE C CG  1 
ATOM   5598  C  CD1 . PHE C 3 302 ? 60.834  -6.876  109.888 1.00 51.86  ? 389 PHE C CD1 1 
ATOM   5599  C  CD2 . PHE C 3 302 ? 60.907  -5.011  111.375 1.00 54.45  ? 389 PHE C CD2 1 
ATOM   5600  C  CE1 . PHE C 3 302 ? 61.588  -7.626  110.767 1.00 55.91  ? 389 PHE C CE1 1 
ATOM   5601  C  CE2 . PHE C 3 302 ? 61.665  -5.755  112.267 1.00 58.62  ? 389 PHE C CE2 1 
ATOM   5602  C  CZ  . PHE C 3 302 ? 62.006  -7.068  111.960 1.00 58.01  ? 389 PHE C CZ  1 
ATOM   5603  N  N   . ASN C 3 303 ? 56.691  -5.378  109.755 1.00 41.47  ? 390 ASN C N   1 
ATOM   5604  C  CA  . ASN C 3 303 ? 55.656  -5.834  110.664 1.00 44.76  ? 390 ASN C CA  1 
ATOM   5605  C  C   . ASN C 3 303 ? 54.893  -7.039  110.145 1.00 41.42  ? 390 ASN C C   1 
ATOM   5606  O  O   . ASN C 3 303 ? 54.308  -7.791  110.912 1.00 46.77  ? 390 ASN C O   1 
ATOM   5607  C  CB  . ASN C 3 303 ? 54.674  -4.703  110.963 1.00 47.32  ? 390 ASN C CB  1 
ATOM   5608  C  CG  . ASN C 3 303 ? 53.814  -4.350  109.774 1.00 46.65  ? 390 ASN C CG  1 
ATOM   5609  O  OD1 . ASN C 3 303 ? 54.007  -3.312  109.149 1.00 51.61  ? 390 ASN C OD1 1 
ATOM   5610  N  ND2 . ASN C 3 303 ? 52.844  -5.206  109.464 1.00 45.23  ? 390 ASN C ND2 1 
ATOM   5611  N  N   . ARG C 3 304 ? 54.892  -7.213  108.838 1.00 33.07  ? 391 ARG C N   1 
ATOM   5612  C  CA  . ARG C 3 304 ? 54.176  -8.315  108.237 1.00 34.97  ? 391 ARG C CA  1 
ATOM   5613  C  C   . ARG C 3 304 ? 54.703  -9.675  108.607 1.00 34.65  ? 391 ARG C C   1 
ATOM   5614  O  O   . ARG C 3 304 ? 54.081  -10.691 108.293 1.00 35.73  ? 391 ARG C O   1 
ATOM   5615  C  CB  . ARG C 3 304 ? 54.169  -8.170  106.726 1.00 41.62  ? 391 ARG C CB  1 
ATOM   5616  C  CG  . ARG C 3 304 ? 53.263  -7.053  106.240 1.00 48.93  ? 391 ARG C CG  1 
ATOM   5617  C  CD  . ARG C 3 304 ? 51.815  -7.369  106.558 1.00 51.34  ? 391 ARG C CD  1 
ATOM   5618  N  NE  . ARG C 3 304 ? 51.493  -8.749  106.206 1.00 50.43  ? 391 ARG C NE  1 
ATOM   5619  C  CZ  . ARG C 3 304 ? 50.259  -9.225  106.106 1.00 52.48  ? 391 ARG C CZ  1 
ATOM   5620  N  NH1 . ARG C 3 304 ? 49.221  -8.427  106.320 1.00 52.57  ? 391 ARG C NH1 1 
ATOM   5621  N  NH2 . ARG C 3 304 ? 50.062  -10.512 105.848 1.00 54.71  ? 391 ARG C NH2 1 
ATOM   5622  N  N   . LEU C 3 305 ? 55.841  -9.705  109.281 1.00 34.96  ? 392 LEU C N   1 
ATOM   5623  C  CA  . LEU C 3 305 ? 56.426  -10.980 109.669 1.00 46.02  ? 392 LEU C CA  1 
ATOM   5624  C  C   . LEU C 3 305 ? 56.553  -11.033 111.181 1.00 54.80  ? 392 LEU C C   1 
ATOM   5625  O  O   . LEU C 3 305 ? 56.389  -12.081 111.824 1.00 54.51  ? 392 LEU C O   1 
ATOM   5626  C  CB  . LEU C 3 305 ? 57.787  -11.122 109.012 1.00 44.41  ? 392 LEU C CB  1 
ATOM   5627  C  CG  . LEU C 3 305 ? 57.694  -10.769 107.534 1.00 42.83  ? 392 LEU C CG  1 
ATOM   5628  C  CD1 . LEU C 3 305 ? 59.066  -10.830 106.884 1.00 45.49  ? 392 LEU C CD1 1 
ATOM   5629  C  CD2 . LEU C 3 305 ? 56.709  -11.716 106.864 1.00 43.33  ? 392 LEU C CD2 1 
ATOM   5630  N  N   . THR C 3 306 ? 56.899  -9.885  111.733 1.00 61.24  ? 393 THR C N   1 
ATOM   5631  C  CA  . THR C 3 306 ? 57.023  -9.733  113.158 1.00 69.53  ? 393 THR C CA  1 
ATOM   5632  C  C   . THR C 3 306 ? 55.598  -9.345  113.512 1.00 81.60  ? 393 THR C C   1 
ATOM   5633  O  O   . THR C 3 306 ? 55.308  -8.192  113.831 1.00 86.75  ? 393 THR C O   1 
ATOM   5634  C  CB  . THR C 3 306 ? 58.003  -8.604  113.473 1.00 66.67  ? 393 THR C CB  1 
ATOM   5635  O  OG1 . THR C 3 306 ? 57.779  -7.524  112.559 1.00 68.23  ? 393 THR C OG1 1 
ATOM   5636  C  CG2 . THR C 3 306 ? 59.439  -9.087  113.318 1.00 66.32  ? 393 THR C CG2 1 
ATOM   5637  N  N   . ILE C 3 307 ? 54.698  -10.310 113.335 1.00 90.73  ? 394 ILE C N   1 
ATOM   5638  C  CA  . ILE C 3 307 ? 53.269  -10.138 113.591 1.00 101.98 ? 394 ILE C CA  1 
ATOM   5639  C  C   . ILE C 3 307 ? 52.791  -10.710 114.936 1.00 113.50 ? 394 ILE C C   1 
ATOM   5640  O  O   . ILE C 3 307 ? 53.438  -11.595 115.508 1.00 117.29 ? 394 ILE C O   1 
ATOM   5641  C  CB  . ILE C 3 307 ? 52.446  -10.763 112.445 1.00 99.45  ? 394 ILE C CB  1 
ATOM   5642  C  CG1 . ILE C 3 307 ? 53.123  -12.049 111.953 1.00 96.96  ? 394 ILE C CG1 1 
ATOM   5643  C  CG2 . ILE C 3 307 ? 52.272  -9.766  111.318 1.00 101.43 ? 394 ILE C CG2 1 
ATOM   5644  C  CD1 . ILE C 3 307 ? 52.503  -12.652 110.700 1.00 96.46  ? 394 ILE C CD1 1 
ATOM   5645  N  N   . GLY C 3 308 ? 51.664  -10.190 115.434 1.00 122.07 ? 395 GLY C N   1 
ATOM   5646  C  CA  . GLY C 3 308 ? 51.103  -10.649 116.702 1.00 129.75 ? 395 GLY C CA  1 
ATOM   5647  C  C   . GLY C 3 308 ? 49.876  -9.885  117.202 1.00 135.89 ? 395 GLY C C   1 
ATOM   5648  O  O   . GLY C 3 308 ? 49.228  -9.162  116.435 1.00 135.38 ? 395 GLY C O   1 
ATOM   5649  N  N   . GLU C 3 309 ? 49.617  -10.079 118.483 1.00 123.76 ? 396 GLU C N   1 
ATOM   5650  C  CA  . GLU C 3 309 ? 48.533  -9.488  119.360 1.00 116.67 ? 396 GLU C CA  1 
ATOM   5651  C  C   . GLU C 3 309 ? 48.704  -9.761  121.100 1.00 120.33 ? 396 GLU C C   1 
ATOM   5652  O  O   . GLU C 3 309 ? 49.532  -10.115 120.745 1.00 121.12 ? 396 GLU C O   1 
ATOM   5653  C  CB  . GLU C 3 309 ? 47.143  -9.999  118.689 1.00 118.61 ? 396 GLU C CB  1 
ATOM   5654  C  CG  . GLU C 3 309 ? 46.914  -9.918  117.117 1.00 116.17 ? 396 GLU C CG  1 
ATOM   5655  C  CD  . GLU C 3 309 ? 45.599  -10.595 116.596 1.00 118.73 ? 396 GLU C CD  1 
ATOM   5656  O  OE1 . GLU C 3 309 ? 44.815  -11.127 117.496 1.00 123.10 ? 396 GLU C OE1 1 
ATOM   5657  O  OE2 . GLU C 3 309 ? 45.371  -10.583 115.308 1.00 120.16 ? 396 GLU C OE2 1 
ATOM   5658  N  N   . GLU D 1 3   ? 89.238  18.903  241.788 1.00 124.00 ? 113 GLU D N   1 
ATOM   5659  C  CA  . GLU D 1 3   ? 89.212  18.016  240.586 1.00 123.91 ? 113 GLU D CA  1 
ATOM   5660  C  C   . GLU D 1 3   ? 88.922  18.805  239.305 1.00 125.56 ? 113 GLU D C   1 
ATOM   5661  O  O   . GLU D 1 3   ? 88.579  18.222  238.275 1.00 126.37 ? 113 GLU D O   1 
ATOM   5662  C  CB  . GLU D 1 3   ? 88.174  16.892  240.766 1.00 123.44 ? 113 GLU D CB  1 
ATOM   5663  C  CG  . GLU D 1 3   ? 88.592  15.732  241.700 1.00 122.13 ? 113 GLU D CG  1 
ATOM   5664  C  CD  . GLU D 1 3   ? 88.642  16.111  243.180 1.00 120.29 ? 113 GLU D CD  1 
ATOM   5665  O  OE1 . GLU D 1 3   ? 87.565  16.335  243.780 1.00 119.16 ? 113 GLU D OE1 1 
ATOM   5666  O  OE2 . GLU D 1 3   ? 89.759  16.164  243.744 1.00 118.39 ? 113 GLU D OE2 1 
ATOM   5667  N  N   . ASP D 1 4   ? 89.073  20.127  239.368 1.00 127.52 ? 114 ASP D N   1 
ATOM   5668  C  CA  . ASP D 1 4   ? 88.825  20.984  238.207 1.00 130.82 ? 114 ASP D CA  1 
ATOM   5669  C  C   . ASP D 1 4   ? 90.054  21.836  237.849 1.00 132.78 ? 114 ASP D C   1 
ATOM   5670  O  O   . ASP D 1 4   ? 89.932  23.038  237.581 1.00 132.59 ? 114 ASP D O   1 
ATOM   5671  C  CB  . ASP D 1 4   ? 87.596  21.884  238.453 1.00 130.84 ? 114 ASP D CB  1 
ATOM   5672  C  CG  . ASP D 1 4   ? 86.826  22.221  237.162 1.00 130.02 ? 114 ASP D CG  1 
ATOM   5673  O  OD1 . ASP D 1 4   ? 85.918  21.444  236.795 1.00 127.48 ? 114 ASP D OD1 1 
ATOM   5674  O  OD2 . ASP D 1 4   ? 87.095  23.271  236.532 1.00 128.73 ? 114 ASP D OD2 1 
ATOM   5675  N  N   . LEU D 1 5   ? 91.238  21.218  237.884 1.00 133.62 ? 115 LEU D N   1 
ATOM   5676  C  CA  . LEU D 1 5   ? 92.488  21.904  237.529 1.00 132.59 ? 115 LEU D CA  1 
ATOM   5677  C  C   . LEU D 1 5   ? 92.918  21.441  236.134 1.00 132.56 ? 115 LEU D C   1 
ATOM   5678  O  O   . LEU D 1 5   ? 92.466  21.988  235.126 1.00 134.37 ? 115 LEU D O   1 
ATOM   5679  C  CB  . LEU D 1 5   ? 93.602  21.622  238.553 1.00 130.56 ? 115 LEU D CB  1 
ATOM   5680  C  CG  . LEU D 1 5   ? 93.590  22.398  239.875 1.00 127.31 ? 115 LEU D CG  1 
ATOM   5681  C  CD1 . LEU D 1 5   ? 92.631  21.744  240.860 1.00 125.85 ? 115 LEU D CD1 1 
ATOM   5682  C  CD2 . LEU D 1 5   ? 94.996  22.439  240.453 1.00 125.91 ? 115 LEU D CD2 1 
ATOM   5683  N  N   . ARG D 1 6   ? 93.807  20.450  236.087 1.00 130.75 ? 116 ARG D N   1 
ATOM   5684  C  CA  . ARG D 1 6   ? 94.279  19.875  234.826 1.00 126.75 ? 116 ARG D CA  1 
ATOM   5685  C  C   . ARG D 1 6   ? 93.656  18.481  234.679 1.00 123.62 ? 116 ARG D C   1 
ATOM   5686  O  O   . ARG D 1 6   ? 94.097  17.659  233.869 1.00 122.08 ? 116 ARG D O   1 
ATOM   5687  C  CB  . ARG D 1 6   ? 95.812  19.789  234.795 1.00 126.21 ? 116 ARG D CB  1 
ATOM   5688  C  CG  . ARG D 1 6   ? 96.533  21.113  234.510 1.00 123.59 ? 116 ARG D CG  1 
ATOM   5689  C  CD  . ARG D 1 6   ? 96.238  21.632  233.102 1.00 119.29 ? 116 ARG D CD  1 
ATOM   5690  N  NE  . ARG D 1 6   ? 97.058  22.794  232.758 1.00 115.18 ? 116 ARG D NE  1 
ATOM   5691  C  CZ  . ARG D 1 6   ? 96.863  23.562  231.690 1.00 113.71 ? 116 ARG D CZ  1 
ATOM   5692  N  NH1 . ARG D 1 6   ? 95.870  23.301  230.853 1.00 112.04 ? 116 ARG D NH1 1 
ATOM   5693  N  NH2 . ARG D 1 6   ? 97.660  24.598  231.460 1.00 114.80 ? 116 ARG D NH2 1 
ATOM   5694  N  N   . SER D 1 7   ? 92.634  18.232  235.497 1.00 120.03 ? 117 SER D N   1 
ATOM   5695  C  CA  . SER D 1 7   ? 91.899  16.973  235.501 1.00 117.14 ? 117 SER D CA  1 
ATOM   5696  C  C   . SER D 1 7   ? 90.964  16.956  234.286 1.00 117.11 ? 117 SER D C   1 
ATOM   5697  O  O   . SER D 1 7   ? 90.414  15.914  233.920 1.00 116.54 ? 117 SER D O   1 
ATOM   5698  C  CB  . SER D 1 7   ? 91.089  16.858  236.798 1.00 116.21 ? 117 SER D CB  1 
ATOM   5699  O  OG  . SER D 1 7   ? 91.887  17.150  237.940 1.00 114.66 ? 117 SER D OG  1 
ATOM   5700  N  N   . ARG D 1 8   ? 90.801  18.129  233.673 1.00 116.26 ? 118 ARG D N   1 
ATOM   5701  C  CA  . ARG D 1 8   ? 89.958  18.307  232.493 1.00 114.53 ? 118 ARG D CA  1 
ATOM   5702  C  C   . ARG D 1 8   ? 90.738  18.278  231.175 1.00 111.62 ? 118 ARG D C   1 
ATOM   5703  O  O   . ARG D 1 8   ? 90.239  18.735  230.141 1.00 110.28 ? 118 ARG D O   1 
ATOM   5704  C  CB  . ARG D 1 8   ? 89.152  19.612  232.588 1.00 116.63 ? 118 ARG D CB  1 
ATOM   5705  C  CG  . ARG D 1 8   ? 87.932  19.545  233.497 1.00 117.77 ? 118 ARG D CG  1 
ATOM   5706  C  CD  . ARG D 1 8   ? 87.068  20.798  233.363 1.00 119.12 ? 118 ARG D CD  1 
ATOM   5707  N  NE  . ARG D 1 8   ? 85.823  20.696  234.125 1.00 120.75 ? 118 ARG D NE  1 
ATOM   5708  C  CZ  . ARG D 1 8   ? 84.719  20.077  233.706 1.00 122.25 ? 118 ARG D CZ  1 
ATOM   5709  N  NH1 . ARG D 1 8   ? 84.679  19.492  232.512 1.00 122.24 ? 118 ARG D NH1 1 
ATOM   5710  N  NH2 . ARG D 1 8   ? 83.651  20.031  234.493 1.00 123.24 ? 118 ARG D NH2 1 
ATOM   5711  N  N   . ILE D 1 9   ? 91.971  17.778  231.209 1.00 107.48 ? 119 ILE D N   1 
ATOM   5712  C  CA  . ILE D 1 9   ? 92.762  17.684  229.987 1.00 104.05 ? 119 ILE D CA  1 
ATOM   5713  C  C   . ILE D 1 9   ? 92.083  16.629  229.119 1.00 104.96 ? 119 ILE D C   1 
ATOM   5714  O  O   . ILE D 1 9   ? 91.850  16.855  227.933 1.00 105.49 ? 119 ILE D O   1 
ATOM   5715  C  CB  . ILE D 1 9   ? 94.226  17.273  230.263 1.00 102.52 ? 119 ILE D CB  1 
ATOM   5716  C  CG1 . ILE D 1 9   ? 94.940  18.364  231.063 1.00 103.14 ? 119 ILE D CG1 1 
ATOM   5717  C  CG2 . ILE D 1 9   ? 94.967  17.049  228.953 1.00 99.51  ? 119 ILE D CG2 1 
ATOM   5718  C  CD1 . ILE D 1 9   ? 96.341  17.978  231.506 1.00 102.64 ? 119 ILE D CD1 1 
ATOM   5719  N  N   . GLU D 1 10  ? 91.727  15.498  229.731 1.00 106.74 ? 120 GLU D N   1 
ATOM   5720  C  CA  . GLU D 1 10  ? 91.047  14.409  229.023 1.00 110.77 ? 120 GLU D CA  1 
ATOM   5721  C  C   . GLU D 1 10  ? 89.578  14.743  228.761 1.00 110.34 ? 120 GLU D C   1 
ATOM   5722  O  O   . GLU D 1 10  ? 88.981  14.214  227.822 1.00 109.99 ? 120 GLU D O   1 
ATOM   5723  C  CB  . GLU D 1 10  ? 91.166  13.079  229.784 1.00 116.84 ? 120 GLU D CB  1 
ATOM   5724  C  CG  . GLU D 1 10  ? 92.559  12.431  229.723 1.00 123.37 ? 120 GLU D CG  1 
ATOM   5725  C  CD  . GLU D 1 10  ? 92.588  11.007  230.285 1.00 128.41 ? 120 GLU D CD  1 
ATOM   5726  O  OE1 . GLU D 1 10  ? 92.512  10.840  231.528 1.00 130.64 ? 120 GLU D OE1 1 
ATOM   5727  O  OE2 . GLU D 1 10  ? 92.696  10.057  229.474 1.00 130.59 ? 120 GLU D OE2 1 
ATOM   5728  N  N   . VAL D 1 11  ? 88.997  15.601  229.603 1.00 110.24 ? 121 VAL D N   1 
ATOM   5729  C  CA  . VAL D 1 11  ? 87.605  16.045  229.433 1.00 109.71 ? 121 VAL D CA  1 
ATOM   5730  C  C   . VAL D 1 11  ? 87.707  17.130  228.356 1.00 104.75 ? 121 VAL D C   1 
ATOM   5731  O  O   . VAL D 1 11  ? 87.246  18.266  228.513 1.00 105.67 ? 121 VAL D O   1 
ATOM   5732  C  CB  . VAL D 1 11  ? 87.007  16.641  230.753 1.00 113.48 ? 121 VAL D CB  1 
ATOM   5733  C  CG1 . VAL D 1 11  ? 85.508  16.937  230.584 1.00 114.48 ? 121 VAL D CG1 1 
ATOM   5734  C  CG2 . VAL D 1 11  ? 87.230  15.684  231.929 1.00 114.31 ? 121 VAL D CG2 1 
ATOM   5735  N  N   . LEU D 1 12  ? 88.358  16.740  227.267 1.00 98.40  ? 122 LEU D N   1 
ATOM   5736  C  CA  . LEU D 1 12  ? 88.620  17.589  226.126 1.00 95.01  ? 122 LEU D CA  1 
ATOM   5737  C  C   . LEU D 1 12  ? 89.208  16.700  225.026 1.00 94.61  ? 122 LEU D C   1 
ATOM   5738  O  O   . LEU D 1 12  ? 88.993  16.954  223.841 1.00 93.95  ? 122 LEU D O   1 
ATOM   5739  C  CB  . LEU D 1 12  ? 89.605  18.693  226.544 1.00 93.76  ? 122 LEU D CB  1 
ATOM   5740  C  CG  . LEU D 1 12  ? 90.283  19.666  225.573 1.00 91.38  ? 122 LEU D CG  1 
ATOM   5741  C  CD1 . LEU D 1 12  ? 91.552  19.056  225.012 1.00 91.75  ? 122 LEU D CD1 1 
ATOM   5742  C  CD2 . LEU D 1 12  ? 89.336  20.090  224.478 1.00 90.01  ? 122 LEU D CD2 1 
ATOM   5743  N  N   . LYS D 1 13  ? 89.902  15.630  225.423 1.00 94.24  ? 123 LYS D N   1 
ATOM   5744  C  CA  . LYS D 1 13  ? 90.520  14.713  224.462 1.00 94.10  ? 123 LYS D CA  1 
ATOM   5745  C  C   . LYS D 1 13  ? 89.549  13.840  223.669 1.00 93.33  ? 123 LYS D C   1 
ATOM   5746  O  O   . LYS D 1 13  ? 89.648  13.789  222.442 1.00 91.68  ? 123 LYS D O   1 
ATOM   5747  C  CB  . LYS D 1 13  ? 91.610  13.852  225.119 1.00 96.68  ? 123 LYS D CB  1 
ATOM   5748  C  CG  . LYS D 1 13  ? 92.884  14.621  225.466 1.00 98.74  ? 123 LYS D CG  1 
ATOM   5749  C  CD  . LYS D 1 13  ? 93.424  15.389  224.261 1.00 97.31  ? 123 LYS D CD  1 
ATOM   5750  C  CE  . LYS D 1 13  ? 94.537  16.348  224.672 1.00 95.66  ? 123 LYS D CE  1 
ATOM   5751  N  NZ  . LYS D 1 13  ? 95.010  17.223  223.560 1.00 94.49  ? 123 LYS D NZ  1 
ATOM   5752  N  N   . ARG D 1 14  ? 88.624  13.156  224.349 1.00 95.84  ? 124 ARG D N   1 
ATOM   5753  C  CA  . ARG D 1 14  ? 87.641  12.310  223.655 1.00 100.23 ? 124 ARG D CA  1 
ATOM   5754  C  C   . ARG D 1 14  ? 86.917  13.156  222.609 1.00 100.13 ? 124 ARG D C   1 
ATOM   5755  O  O   . ARG D 1 14  ? 86.494  12.648  221.570 1.00 102.25 ? 124 ARG D O   1 
ATOM   5756  C  CB  . ARG D 1 14  ? 86.634  11.690  224.641 1.00 105.14 ? 124 ARG D CB  1 
ATOM   5757  C  CG  . ARG D 1 14  ? 85.387  11.000  224.009 1.00 112.20 ? 124 ARG D CG  1 
ATOM   5758  C  CD  . ARG D 1 14  ? 85.689  9.726   223.167 1.00 117.45 ? 124 ARG D CD  1 
ATOM   5759  N  NE  . ARG D 1 14  ? 84.456  9.075   222.686 1.00 120.42 ? 124 ARG D NE  1 
ATOM   5760  C  CZ  . ARG D 1 14  ? 84.402  7.981   221.920 1.00 120.38 ? 124 ARG D CZ  1 
ATOM   5761  N  NH1 . ARG D 1 14  ? 85.514  7.372   221.515 1.00 119.94 ? 124 ARG D NH1 1 
ATOM   5762  N  NH2 . ARG D 1 14  ? 83.220  7.491   221.555 1.00 119.47 ? 124 ARG D NH2 1 
ATOM   5763  N  N   . LYS D 1 15  ? 86.819  14.456  222.881 1.00 98.07  ? 125 LYS D N   1 
ATOM   5764  C  CA  . LYS D 1 15  ? 86.180  15.402  221.971 1.00 95.91  ? 125 LYS D CA  1 
ATOM   5765  C  C   . LYS D 1 15  ? 87.008  15.514  220.675 1.00 93.19  ? 125 LYS D C   1 
ATOM   5766  O  O   . LYS D 1 15  ? 86.509  15.218  219.583 1.00 88.40  ? 125 LYS D O   1 
ATOM   5767  C  CB  . LYS D 1 15  ? 86.041  16.767  222.655 1.00 95.59  ? 125 LYS D CB  1 
ATOM   5768  C  CG  . LYS D 1 15  ? 85.259  16.738  223.974 1.00 98.94  ? 125 LYS D CG  1 
ATOM   5769  C  CD  . LYS D 1 15  ? 85.252  18.112  224.642 1.00 99.24  ? 125 LYS D CD  1 
ATOM   5770  C  CE  . LYS D 1 15  ? 84.436  18.127  225.924 1.00 99.38  ? 125 LYS D CE  1 
ATOM   5771  N  NZ  . LYS D 1 15  ? 84.978  17.176  226.932 1.00 96.68  ? 125 LYS D NZ  1 
ATOM   5772  N  N   . VAL D 1 16  ? 88.283  15.888  220.813 1.00 91.90  ? 126 VAL D N   1 
ATOM   5773  C  CA  . VAL D 1 16  ? 89.200  16.010  219.675 1.00 86.81  ? 126 VAL D CA  1 
ATOM   5774  C  C   . VAL D 1 16  ? 89.238  14.681  218.921 1.00 85.31  ? 126 VAL D C   1 
ATOM   5775  O  O   . VAL D 1 16  ? 89.393  14.654  217.706 1.00 85.64  ? 126 VAL D O   1 
ATOM   5776  C  CB  . VAL D 1 16  ? 90.631  16.388  220.142 1.00 86.41  ? 126 VAL D CB  1 
ATOM   5777  C  CG1 . VAL D 1 16  ? 91.604  16.372  218.982 1.00 87.33  ? 126 VAL D CG1 1 
ATOM   5778  C  CG2 . VAL D 1 16  ? 90.625  17.760  220.773 1.00 85.14  ? 126 VAL D CG2 1 
ATOM   5779  N  N   . ILE D 1 17  ? 89.071  13.584  219.651 1.00 86.22  ? 127 ILE D N   1 
ATOM   5780  C  CA  . ILE D 1 17  ? 89.056  12.261  219.053 1.00 89.30  ? 127 ILE D CA  1 
ATOM   5781  C  C   . ILE D 1 17  ? 87.752  12.060  218.272 1.00 91.88  ? 127 ILE D C   1 
ATOM   5782  O  O   . ILE D 1 17  ? 87.790  11.891  217.058 1.00 92.81  ? 127 ILE D O   1 
ATOM   5783  C  CB  . ILE D 1 17  ? 89.251  11.158  220.122 1.00 91.19  ? 127 ILE D CB  1 
ATOM   5784  C  CG1 . ILE D 1 17  ? 90.675  11.230  220.691 1.00 91.33  ? 127 ILE D CG1 1 
ATOM   5785  C  CG2 . ILE D 1 17  ? 88.960  9.781   219.541 1.00 92.85  ? 127 ILE D CG2 1 
ATOM   5786  C  CD1 . ILE D 1 17  ? 91.788  11.157  219.642 1.00 91.02  ? 127 ILE D CD1 1 
ATOM   5787  N  N   . GLU D 1 18  ? 86.605  12.137  218.952 1.00 92.70  ? 128 GLU D N   1 
ATOM   5788  C  CA  . GLU D 1 18  ? 85.298  11.976  218.297 1.00 91.45  ? 128 GLU D CA  1 
ATOM   5789  C  C   . GLU D 1 18  ? 85.222  12.825  217.032 1.00 86.41  ? 128 GLU D C   1 
ATOM   5790  O  O   . GLU D 1 18  ? 84.644  12.406  216.032 1.00 82.92  ? 128 GLU D O   1 
ATOM   5791  C  CB  . GLU D 1 18  ? 84.146  12.386  219.235 1.00 94.73  ? 128 GLU D CB  1 
ATOM   5792  C  CG  . GLU D 1 18  ? 83.738  11.361  220.299 1.00 98.11  ? 128 GLU D CG  1 
ATOM   5793  C  CD  . GLU D 1 18  ? 82.782  10.289  219.784 1.00 99.09  ? 128 GLU D CD  1 
ATOM   5794  O  OE1 . GLU D 1 18  ? 83.125  9.597   218.800 1.00 99.10  ? 128 GLU D OE1 1 
ATOM   5795  O  OE2 . GLU D 1 18  ? 81.691  10.122  220.378 1.00 99.84  ? 128 GLU D OE2 1 
ATOM   5796  N  N   . LYS D 1 19  ? 85.853  13.997  217.075 1.00 85.31  ? 129 LYS D N   1 
ATOM   5797  C  CA  . LYS D 1 19  ? 85.855  14.925  215.947 1.00 85.04  ? 129 LYS D CA  1 
ATOM   5798  C  C   . LYS D 1 19  ? 86.820  14.550  214.834 1.00 81.89  ? 129 LYS D C   1 
ATOM   5799  O  O   . LYS D 1 19  ? 86.426  14.516  213.667 1.00 79.27  ? 129 LYS D O   1 
ATOM   5800  C  CB  . LYS D 1 19  ? 86.147  16.353  216.415 1.00 88.03  ? 129 LYS D CB  1 
ATOM   5801  C  CG  . LYS D 1 19  ? 85.211  16.903  217.495 1.00 92.77  ? 129 LYS D CG  1 
ATOM   5802  C  CD  . LYS D 1 19  ? 83.729  16.854  217.117 1.00 95.70  ? 129 LYS D CD  1 
ATOM   5803  C  CE  . LYS D 1 19  ? 83.050  15.569  217.603 1.00 100.13 ? 129 LYS D CE  1 
ATOM   5804  N  NZ  . LYS D 1 19  ? 83.186  15.348  219.078 1.00 103.56 ? 129 LYS D NZ  1 
ATOM   5805  N  N   . VAL D 1 20  ? 88.082  14.292  215.181 1.00 81.63  ? 130 VAL D N   1 
ATOM   5806  C  CA  . VAL D 1 20  ? 89.071  13.918  214.169 1.00 83.88  ? 130 VAL D CA  1 
ATOM   5807  C  C   . VAL D 1 20  ? 88.605  12.668  213.426 1.00 86.98  ? 130 VAL D C   1 
ATOM   5808  O  O   . VAL D 1 20  ? 88.945  12.464  212.256 1.00 87.46  ? 130 VAL D O   1 
ATOM   5809  C  CB  . VAL D 1 20  ? 90.494  13.686  214.764 1.00 84.07  ? 130 VAL D CB  1 
ATOM   5810  C  CG1 . VAL D 1 20  ? 90.499  12.518  215.736 1.00 85.19  ? 130 VAL D CG1 1 
ATOM   5811  C  CG2 . VAL D 1 20  ? 91.498  13.434  213.640 1.00 85.15  ? 130 VAL D CG2 1 
ATOM   5812  N  N   . GLN D 1 21  ? 87.793  11.861  214.106 1.00 90.20  ? 131 GLN D N   1 
ATOM   5813  C  CA  . GLN D 1 21  ? 87.258  10.645  213.519 1.00 95.92  ? 131 GLN D CA  1 
ATOM   5814  C  C   . GLN D 1 21  ? 86.209  11.018  212.481 1.00 96.44  ? 131 GLN D C   1 
ATOM   5815  O  O   . GLN D 1 21  ? 86.112  10.373  211.433 1.00 100.51 ? 131 GLN D O   1 
ATOM   5816  C  CB  . GLN D 1 21  ? 86.650  9.740   214.594 1.00 100.91 ? 131 GLN D CB  1 
ATOM   5817  C  CG  . GLN D 1 21  ? 87.576  9.416   215.777 1.00 105.83 ? 131 GLN D CG  1 
ATOM   5818  C  CD  . GLN D 1 21  ? 88.976  8.934   215.373 1.00 109.17 ? 131 GLN D CD  1 
ATOM   5819  O  OE1 . GLN D 1 21  ? 89.833  9.729   214.967 1.00 109.69 ? 131 GLN D OE1 1 
ATOM   5820  N  NE2 . GLN D 1 21  ? 89.221  7.632   215.526 1.00 110.91 ? 131 GLN D NE2 1 
ATOM   5821  N  N   . HIS D 1 22  ? 85.430  12.059  212.775 1.00 92.15  ? 132 HIS D N   1 
ATOM   5822  C  CA  . HIS D 1 22  ? 84.409  12.536  211.843 1.00 89.62  ? 132 HIS D CA  1 
ATOM   5823  C  C   . HIS D 1 22  ? 85.082  13.045  210.586 1.00 85.75  ? 132 HIS D C   1 
ATOM   5824  O  O   . HIS D 1 22  ? 84.543  12.927  209.484 1.00 85.53  ? 132 HIS D O   1 
ATOM   5825  C  CB  . HIS D 1 22  ? 83.585  13.658  212.456 1.00 91.97  ? 132 HIS D CB  1 
ATOM   5826  C  CG  . HIS D 1 22  ? 82.495  13.171  213.346 1.00 96.24  ? 132 HIS D CG  1 
ATOM   5827  N  ND1 . HIS D 1 22  ? 82.258  13.710  214.591 1.00 99.73  ? 132 HIS D ND1 1 
ATOM   5828  C  CD2 . HIS D 1 22  ? 81.591  12.176  213.183 1.00 96.48  ? 132 HIS D CD2 1 
ATOM   5829  C  CE1 . HIS D 1 22  ? 81.253  13.066  215.159 1.00 100.20 ? 132 HIS D CE1 1 
ATOM   5830  N  NE2 . HIS D 1 22  ? 80.830  12.131  214.326 1.00 99.01  ? 132 HIS D NE2 1 
ATOM   5831  N  N   . ILE D 1 23  ? 86.261  13.625  210.771 1.00 79.56  ? 133 ILE D N   1 
ATOM   5832  C  CA  . ILE D 1 23  ? 87.044  14.139  209.663 1.00 73.82  ? 133 ILE D CA  1 
ATOM   5833  C  C   . ILE D 1 23  ? 87.545  12.943  208.860 1.00 73.51  ? 133 ILE D C   1 
ATOM   5834  O  O   . ILE D 1 23  ? 87.411  12.914  207.636 1.00 73.00  ? 133 ILE D O   1 
ATOM   5835  C  CB  . ILE D 1 23  ? 88.226  14.975  210.175 1.00 70.07  ? 133 ILE D CB  1 
ATOM   5836  C  CG1 . ILE D 1 23  ? 87.699  16.107  211.055 1.00 72.06  ? 133 ILE D CG1 1 
ATOM   5837  C  CG2 . ILE D 1 23  ? 89.034  15.525  209.017 1.00 65.68  ? 133 ILE D CG2 1 
ATOM   5838  C  CD1 . ILE D 1 23  ? 86.509  16.842  210.460 1.00 72.47  ? 133 ILE D CD1 1 
ATOM   5839  N  N   . GLN D 1 24  ? 88.069  11.938  209.561 1.00 73.91  ? 134 GLN D N   1 
ATOM   5840  C  CA  . GLN D 1 24  ? 88.569  10.731  208.917 1.00 74.10  ? 134 GLN D CA  1 
ATOM   5841  C  C   . GLN D 1 24  ? 87.467  10.054  208.096 1.00 74.60  ? 134 GLN D C   1 
ATOM   5842  O  O   . GLN D 1 24  ? 87.740  9.441   207.055 1.00 74.42  ? 134 GLN D O   1 
ATOM   5843  C  CB  . GLN D 1 24  ? 89.134  9.763   209.960 1.00 76.51  ? 134 GLN D CB  1 
ATOM   5844  C  CG  . GLN D 1 24  ? 90.412  10.255  210.641 1.00 78.09  ? 134 GLN D CG  1 
ATOM   5845  C  CD  . GLN D 1 24  ? 91.169  9.143   211.361 1.00 77.06  ? 134 GLN D CD  1 
ATOM   5846  O  OE1 . GLN D 1 24  ? 90.590  8.125   211.746 1.00 77.15  ? 134 GLN D OE1 1 
ATOM   5847  N  NE2 . GLN D 1 24  ? 92.476  9.332   211.533 1.00 74.82  ? 134 GLN D NE2 1 
ATOM   5848  N  N   . LEU D 1 25  ? 86.224  10.194  208.559 1.00 73.00  ? 135 LEU D N   1 
ATOM   5849  C  CA  . LEU D 1 25  ? 85.066  9.622   207.877 1.00 73.55  ? 135 LEU D CA  1 
ATOM   5850  C  C   . LEU D 1 25  ? 84.816  10.432  206.602 1.00 71.79  ? 135 LEU D C   1 
ATOM   5851  O  O   . LEU D 1 25  ? 84.577  9.868   205.539 1.00 74.63  ? 135 LEU D O   1 
ATOM   5852  C  CB  . LEU D 1 25  ? 83.826  9.681   208.786 1.00 79.29  ? 135 LEU D CB  1 
ATOM   5853  C  CG  . LEU D 1 25  ? 82.763  8.564   208.818 1.00 83.36  ? 135 LEU D CG  1 
ATOM   5854  C  CD1 . LEU D 1 25  ? 82.219  8.257   207.416 1.00 84.34  ? 135 LEU D CD1 1 
ATOM   5855  C  CD2 . LEU D 1 25  ? 83.338  7.305   209.480 1.00 82.92  ? 135 LEU D CD2 1 
ATOM   5856  N  N   . LEU D 1 26  ? 84.912  11.754  206.708 1.00 68.67  ? 136 LEU D N   1 
ATOM   5857  C  CA  . LEU D 1 26  ? 84.685  12.628  205.567 1.00 66.03  ? 136 LEU D CA  1 
ATOM   5858  C  C   . LEU D 1 26  ? 85.646  12.431  204.419 1.00 65.17  ? 136 LEU D C   1 
ATOM   5859  O  O   . LEU D 1 26  ? 85.226  12.229  203.284 1.00 67.55  ? 136 LEU D O   1 
ATOM   5860  C  CB  . LEU D 1 26  ? 84.701  14.091  205.980 1.00 67.24  ? 136 LEU D CB  1 
ATOM   5861  C  CG  . LEU D 1 26  ? 83.447  14.578  206.690 1.00 70.28  ? 136 LEU D CG  1 
ATOM   5862  C  CD1 . LEU D 1 26  ? 83.458  16.087  206.708 1.00 70.26  ? 136 LEU D CD1 1 
ATOM   5863  C  CD2 . LEU D 1 26  ? 82.201  14.065  205.978 1.00 71.20  ? 136 LEU D CD2 1 
ATOM   5864  N  N   . GLN D 1 27  ? 86.937  12.494  204.706 1.00 65.25  ? 137 GLN D N   1 
ATOM   5865  C  CA  . GLN D 1 27  ? 87.940  12.327  203.668 1.00 68.21  ? 137 GLN D CA  1 
ATOM   5866  C  C   . GLN D 1 27  ? 87.723  11.089  202.807 1.00 66.91  ? 137 GLN D C   1 
ATOM   5867  O  O   . GLN D 1 27  ? 88.054  11.092  201.626 1.00 63.64  ? 137 GLN D O   1 
ATOM   5868  C  CB  . GLN D 1 27  ? 89.338  12.333  204.274 1.00 72.26  ? 137 GLN D CB  1 
ATOM   5869  C  CG  . GLN D 1 27  ? 89.505  11.417  205.465 1.00 79.33  ? 137 GLN D CG  1 
ATOM   5870  C  CD  . GLN D 1 27  ? 90.634  11.866  206.386 1.00 84.40  ? 137 GLN D CD  1 
ATOM   5871  O  OE1 . GLN D 1 27  ? 91.444  11.051  206.848 1.00 86.71  ? 137 GLN D OE1 1 
ATOM   5872  N  NE2 . GLN D 1 27  ? 90.687  13.169  206.666 1.00 86.30  ? 137 GLN D NE2 1 
ATOM   5873  N  N   . LYS D 1 28  ? 87.133  10.048  203.385 1.00 68.56  ? 138 LYS D N   1 
ATOM   5874  C  CA  . LYS D 1 28  ? 86.870  8.839   202.626 1.00 72.92  ? 138 LYS D CA  1 
ATOM   5875  C  C   . LYS D 1 28  ? 85.527  8.929   201.908 1.00 71.47  ? 138 LYS D C   1 
ATOM   5876  O  O   . LYS D 1 28  ? 85.296  8.228   200.924 1.00 76.49  ? 138 LYS D O   1 
ATOM   5877  C  CB  . LYS D 1 28  ? 86.935  7.608   203.526 1.00 80.20  ? 138 LYS D CB  1 
ATOM   5878  C  CG  . LYS D 1 28  ? 85.811  7.482   204.531 1.00 87.02  ? 138 LYS D CG  1 
ATOM   5879  C  CD  . LYS D 1 28  ? 86.186  6.501   205.638 1.00 92.87  ? 138 LYS D CD  1 
ATOM   5880  C  CE  . LYS D 1 28  ? 85.071  6.338   206.668 1.00 98.70  ? 138 LYS D CE  1 
ATOM   5881  N  NZ  . LYS D 1 28  ? 85.492  5.558   207.878 1.00 101.69 ? 138 LYS D NZ  1 
ATOM   5882  N  N   . ASN D 1 29  ? 84.648  9.797   202.398 1.00 64.80  ? 139 ASN D N   1 
ATOM   5883  C  CA  . ASN D 1 29  ? 83.344  9.984   201.780 1.00 64.34  ? 139 ASN D CA  1 
ATOM   5884  C  C   . ASN D 1 29  ? 83.448  10.893  200.571 1.00 62.23  ? 139 ASN D C   1 
ATOM   5885  O  O   . ASN D 1 29  ? 82.648  10.784  199.644 1.00 67.18  ? 139 ASN D O   1 
ATOM   5886  C  CB  . ASN D 1 29  ? 82.323  10.541  202.777 1.00 70.15  ? 139 ASN D CB  1 
ATOM   5887  C  CG  . ASN D 1 29  ? 81.537  9.443   203.494 1.00 75.39  ? 139 ASN D CG  1 
ATOM   5888  O  OD1 . ASN D 1 29  ? 81.733  8.250   203.238 1.00 78.26  ? 139 ASN D OD1 1 
ATOM   5889  N  ND2 . ASN D 1 29  ? 80.636  9.845   204.391 1.00 73.95  ? 139 ASN D ND2 1 
ATOM   5890  N  N   . VAL D 1 30  ? 84.399  11.821  200.598 1.00 57.67  ? 140 VAL D N   1 
ATOM   5891  C  CA  . VAL D 1 30  ? 84.597  12.711  199.459 1.00 52.66  ? 140 VAL D CA  1 
ATOM   5892  C  C   . VAL D 1 30  ? 85.552  12.004  198.526 1.00 49.35  ? 140 VAL D C   1 
ATOM   5893  O  O   . VAL D 1 30  ? 85.525  12.227  197.324 1.00 53.32  ? 140 VAL D O   1 
ATOM   5894  C  CB  . VAL D 1 30  ? 85.202  14.079  199.834 1.00 54.00  ? 140 VAL D CB  1 
ATOM   5895  C  CG1 . VAL D 1 30  ? 84.236  14.879  200.672 1.00 51.43  ? 140 VAL D CG1 1 
ATOM   5896  C  CG2 . VAL D 1 30  ? 86.512  13.890  200.544 1.00 58.68  ? 140 VAL D CG2 1 
ATOM   5897  N  N   . ARG D 1 31  ? 86.410  11.166  199.095 1.00 48.57  ? 141 ARG D N   1 
ATOM   5898  C  CA  . ARG D 1 31  ? 87.359  10.385  198.311 1.00 49.83  ? 141 ARG D CA  1 
ATOM   5899  C  C   . ARG D 1 31  ? 86.490  9.661   197.276 1.00 47.63  ? 141 ARG D C   1 
ATOM   5900  O  O   . ARG D 1 31  ? 86.732  9.724   196.064 1.00 48.80  ? 141 ARG D O   1 
ATOM   5901  C  CB  . ARG D 1 31  ? 88.043  9.362   199.222 1.00 57.19  ? 141 ARG D CB  1 
ATOM   5902  C  CG  . ARG D 1 31  ? 89.523  9.188   198.997 1.00 66.29  ? 141 ARG D CG  1 
ATOM   5903  C  CD  . ARG D 1 31  ? 89.778  8.463   197.711 1.00 75.87  ? 141 ARG D CD  1 
ATOM   5904  N  NE  . ARG D 1 31  ? 90.909  9.031   196.980 1.00 84.67  ? 141 ARG D NE  1 
ATOM   5905  C  CZ  . ARG D 1 31  ? 90.920  10.236  196.408 1.00 90.11  ? 141 ARG D CZ  1 
ATOM   5906  N  NH1 . ARG D 1 31  ? 89.854  11.023  196.481 1.00 94.44  ? 141 ARG D NH1 1 
ATOM   5907  N  NH2 . ARG D 1 31  ? 91.990  10.642  195.731 1.00 91.10  ? 141 ARG D NH2 1 
ATOM   5908  N  N   . ALA D 1 32  ? 85.415  9.062   197.777 1.00 40.53  ? 142 ALA D N   1 
ATOM   5909  C  CA  . ALA D 1 32  ? 84.465  8.345   196.947 1.00 35.48  ? 142 ALA D CA  1 
ATOM   5910  C  C   . ALA D 1 32  ? 83.698  9.299   196.046 1.00 38.12  ? 142 ALA D C   1 
ATOM   5911  O  O   . ALA D 1 32  ? 83.531  9.030   194.858 1.00 47.11  ? 142 ALA D O   1 
ATOM   5912  C  CB  . ALA D 1 32  ? 83.515  7.570   197.813 1.00 32.69  ? 142 ALA D CB  1 
ATOM   5913  N  N   . GLN D 1 33  ? 83.238  10.411  196.607 1.00 37.80  ? 143 GLN D N   1 
ATOM   5914  C  CA  . GLN D 1 33  ? 82.493  11.393  195.823 1.00 40.37  ? 143 GLN D CA  1 
ATOM   5915  C  C   . GLN D 1 33  ? 83.308  11.845  194.624 1.00 40.13  ? 143 GLN D C   1 
ATOM   5916  O  O   . GLN D 1 33  ? 82.782  11.920  193.520 1.00 41.54  ? 143 GLN D O   1 
ATOM   5917  C  CB  . GLN D 1 33  ? 82.087  12.607  196.667 1.00 42.19  ? 143 GLN D CB  1 
ATOM   5918  C  CG  . GLN D 1 33  ? 81.220  13.610  195.908 1.00 36.33  ? 143 GLN D CG  1 
ATOM   5919  C  CD  . GLN D 1 33  ? 79.949  13.980  196.640 1.00 33.36  ? 143 GLN D CD  1 
ATOM   5920  O  OE1 . GLN D 1 33  ? 79.763  15.135  197.013 1.00 32.60  ? 143 GLN D OE1 1 
ATOM   5921  N  NE2 . GLN D 1 33  ? 79.054  13.003  196.834 1.00 32.32  ? 143 GLN D NE2 1 
ATOM   5922  N  N   . LEU D 1 34  ? 84.584  12.153  194.844 1.00 41.97  ? 144 LEU D N   1 
ATOM   5923  C  CA  . LEU D 1 34  ? 85.465  12.565  193.762 1.00 42.89  ? 144 LEU D CA  1 
ATOM   5924  C  C   . LEU D 1 34  ? 85.438  11.462  192.722 1.00 42.27  ? 144 LEU D C   1 
ATOM   5925  O  O   . LEU D 1 34  ? 85.136  11.700  191.550 1.00 39.74  ? 144 LEU D O   1 
ATOM   5926  C  CB  . LEU D 1 34  ? 86.895  12.714  194.263 1.00 43.43  ? 144 LEU D CB  1 
ATOM   5927  C  CG  . LEU D 1 34  ? 87.447  14.136  194.292 1.00 46.96  ? 144 LEU D CG  1 
ATOM   5928  C  CD1 . LEU D 1 34  ? 88.938  14.097  194.625 1.00 50.98  ? 144 LEU D CD1 1 
ATOM   5929  C  CD2 . LEU D 1 34  ? 87.226  14.817  192.954 1.00 44.85  ? 144 LEU D CD2 1 
ATOM   5930  N  N   . VAL D 1 35  ? 85.715  10.245  193.187 1.00 41.27  ? 145 VAL D N   1 
ATOM   5931  C  CA  . VAL D 1 35  ? 85.730  9.053   192.343 1.00 41.39  ? 145 VAL D CA  1 
ATOM   5932  C  C   . VAL D 1 35  ? 84.481  8.937   191.494 1.00 37.78  ? 145 VAL D C   1 
ATOM   5933  O  O   . VAL D 1 35  ? 84.561  8.648   190.302 1.00 39.81  ? 145 VAL D O   1 
ATOM   5934  C  CB  . VAL D 1 35  ? 85.867  7.786   193.194 1.00 43.18  ? 145 VAL D CB  1 
ATOM   5935  C  CG1 . VAL D 1 35  ? 85.455  6.565   192.403 1.00 42.47  ? 145 VAL D CG1 1 
ATOM   5936  C  CG2 . VAL D 1 35  ? 87.297  7.653   193.673 1.00 43.90  ? 145 VAL D CG2 1 
ATOM   5937  N  N   . ASP D 1 36  ? 83.332  9.147   192.117 1.00 31.70  ? 146 ASP D N   1 
ATOM   5938  C  CA  . ASP D 1 36  ? 82.073  9.080   191.411 1.00 35.22  ? 146 ASP D CA  1 
ATOM   5939  C  C   . ASP D 1 36  ? 81.948  10.119  190.303 1.00 39.26  ? 146 ASP D C   1 
ATOM   5940  O  O   . ASP D 1 36  ? 81.528  9.808   189.187 1.00 48.73  ? 146 ASP D O   1 
ATOM   5941  C  CB  . ASP D 1 36  ? 80.933  9.247   192.386 1.00 39.18  ? 146 ASP D CB  1 
ATOM   5942  C  CG  . ASP D 1 36  ? 80.059  8.043   192.430 1.00 46.66  ? 146 ASP D CG  1 
ATOM   5943  O  OD1 . ASP D 1 36  ? 80.503  7.042   193.038 1.00 51.79  ? 146 ASP D OD1 1 
ATOM   5944  O  OD2 . ASP D 1 36  ? 78.952  8.088   191.838 1.00 48.66  ? 146 ASP D OD2 1 
ATOM   5945  N  N   . MET D 1 37  ? 82.316  11.352  190.621 1.00 34.26  ? 147 MET D N   1 
ATOM   5946  C  CA  . MET D 1 37  ? 82.255  12.443  189.668 1.00 38.49  ? 147 MET D CA  1 
ATOM   5947  C  C   . MET D 1 37  ? 83.017  12.191  188.379 1.00 37.76  ? 147 MET D C   1 
ATOM   5948  O  O   . MET D 1 37  ? 82.411  12.161  187.305 1.00 36.62  ? 147 MET D O   1 
ATOM   5949  C  CB  . MET D 1 37  ? 82.734  13.726  190.330 1.00 45.20  ? 147 MET D CB  1 
ATOM   5950  C  CG  . MET D 1 37  ? 81.724  14.241  191.298 1.00 49.95  ? 147 MET D CG  1 
ATOM   5951  S  SD  . MET D 1 37  ? 80.145  14.147  190.459 1.00 53.63  ? 147 MET D SD  1 
ATOM   5952  C  CE  . MET D 1 37  ? 80.353  15.496  189.267 1.00 54.03  ? 147 MET D CE  1 
ATOM   5953  N  N   . LYS D 1 38  ? 84.334  12.008  188.494 1.00 36.27  ? 148 LYS D N   1 
ATOM   5954  C  CA  . LYS D 1 38  ? 85.196  11.751  187.341 1.00 41.20  ? 148 LYS D CA  1 
ATOM   5955  C  C   . LYS D 1 38  ? 84.536  10.686  186.468 1.00 42.96  ? 148 LYS D C   1 
ATOM   5956  O  O   . LYS D 1 38  ? 84.310  10.880  185.271 1.00 43.76  ? 148 LYS D O   1 
ATOM   5957  C  CB  . LYS D 1 38  ? 86.572  11.264  187.814 1.00 45.08  ? 148 LYS D CB  1 
ATOM   5958  C  CG  . LYS D 1 38  ? 87.630  11.123  186.719 1.00 47.60  ? 148 LYS D CG  1 
ATOM   5959  C  CD  . LYS D 1 38  ? 88.970  10.653  187.297 1.00 49.02  ? 148 LYS D CD  1 
ATOM   5960  C  CE  . LYS D 1 38  ? 90.058  10.624  186.232 1.00 50.95  ? 148 LYS D CE  1 
ATOM   5961  N  NZ  . LYS D 1 38  ? 91.396  10.263  186.773 1.00 53.60  ? 148 LYS D NZ  1 
ATOM   5962  N  N   . ARG D 1 39  ? 84.126  9.608   187.123 1.00 41.34  ? 149 ARG D N   1 
ATOM   5963  C  CA  . ARG D 1 39  ? 83.472  8.487   186.480 1.00 37.59  ? 149 ARG D CA  1 
ATOM   5964  C  C   . ARG D 1 39  ? 82.221  8.930   185.728 1.00 38.34  ? 149 ARG D C   1 
ATOM   5965  O  O   . ARG D 1 39  ? 81.998  8.538   184.583 1.00 48.11  ? 149 ARG D O   1 
ATOM   5966  C  CB  . ARG D 1 39  ? 83.117  7.464   187.554 1.00 37.15  ? 149 ARG D CB  1 
ATOM   5967  C  CG  . ARG D 1 39  ? 82.648  6.125   187.044 1.00 42.21  ? 149 ARG D CG  1 
ATOM   5968  C  CD  . ARG D 1 39  ? 82.921  5.039   188.076 1.00 43.25  ? 149 ARG D CD  1 
ATOM   5969  N  NE  . ARG D 1 39  ? 84.349  4.720   188.147 1.00 45.23  ? 149 ARG D NE  1 
ATOM   5970  C  CZ  . ARG D 1 39  ? 84.903  3.936   189.069 1.00 46.96  ? 149 ARG D CZ  1 
ATOM   5971  N  NH1 . ARG D 1 39  ? 84.159  3.384   190.025 1.00 50.01  ? 149 ARG D NH1 1 
ATOM   5972  N  NH2 . ARG D 1 39  ? 86.199  3.667   189.014 1.00 40.59  ? 149 ARG D NH2 1 
ATOM   5973  N  N   . LEU D 1 40  ? 81.440  9.795   186.355 1.00 30.35  ? 150 LEU D N   1 
ATOM   5974  C  CA  . LEU D 1 40  ? 80.201  10.282  185.773 1.00 23.70  ? 150 LEU D CA  1 
ATOM   5975  C  C   . LEU D 1 40  ? 80.404  11.361  184.713 1.00 25.56  ? 150 LEU D C   1 
ATOM   5976  O  O   . LEU D 1 40  ? 79.587  11.501  183.787 1.00 20.25  ? 150 LEU D O   1 
ATOM   5977  C  CB  . LEU D 1 40  ? 79.307  10.805  186.885 1.00 25.37  ? 150 LEU D CB  1 
ATOM   5978  C  CG  . LEU D 1 40  ? 78.033  11.512  186.473 1.00 26.43  ? 150 LEU D CG  1 
ATOM   5979  C  CD1 . LEU D 1 40  ? 77.136  10.514  185.816 1.00 27.16  ? 150 LEU D CD1 1 
ATOM   5980  C  CD2 . LEU D 1 40  ? 77.361  12.115  187.689 1.00 22.83  ? 150 LEU D CD2 1 
ATOM   5981  N  N   . GLU D 1 41  ? 81.471  12.142  184.871 1.00 24.84  ? 151 GLU D N   1 
ATOM   5982  C  CA  . GLU D 1 41  ? 81.780  13.193  183.917 1.00 25.21  ? 151 GLU D CA  1 
ATOM   5983  C  C   . GLU D 1 41  ? 81.971  12.455  182.611 1.00 24.90  ? 151 GLU D C   1 
ATOM   5984  O  O   . GLU D 1 41  ? 81.318  12.730  181.607 1.00 27.52  ? 151 GLU D O   1 
ATOM   5985  C  CB  . GLU D 1 41  ? 83.068  13.913  184.320 1.00 30.83  ? 151 GLU D CB  1 
ATOM   5986  C  CG  . GLU D 1 41  ? 83.493  15.051  183.371 1.00 45.64  ? 151 GLU D CG  1 
ATOM   5987  C  CD  . GLU D 1 41  ? 83.280  16.461  183.937 1.00 50.90  ? 151 GLU D CD  1 
ATOM   5988  O  OE1 . GLU D 1 41  ? 83.181  16.608  185.171 1.00 48.63  ? 151 GLU D OE1 1 
ATOM   5989  O  OE2 . GLU D 1 41  ? 83.229  17.427  183.138 1.00 51.48  ? 151 GLU D OE2 1 
ATOM   5990  N  N   . VAL D 1 42  ? 82.783  11.422  182.695 1.00 22.41  ? 152 VAL D N   1 
ATOM   5991  C  CA  . VAL D 1 42  ? 83.090  10.570  181.566 1.00 22.52  ? 152 VAL D CA  1 
ATOM   5992  C  C   . VAL D 1 42  ? 81.863  9.925   180.948 1.00 23.59  ? 152 VAL D C   1 
ATOM   5993  O  O   . VAL D 1 42  ? 81.637  9.989   179.724 1.00 24.59  ? 152 VAL D O   1 
ATOM   5994  C  CB  . VAL D 1 42  ? 83.989  9.446   182.008 1.00 23.89  ? 152 VAL D CB  1 
ATOM   5995  C  CG1 . VAL D 1 42  ? 83.952  8.324   181.010 1.00 20.69  ? 152 VAL D CG1 1 
ATOM   5996  C  CG2 . VAL D 1 42  ? 85.387  9.970   182.184 1.00 27.50  ? 152 VAL D CG2 1 
ATOM   5997  N  N   . ASP D 1 43  ? 81.113  9.238   181.796 1.00 17.96  ? 153 ASP D N   1 
ATOM   5998  C  CA  . ASP D 1 43  ? 79.922  8.554   181.336 1.00 19.11  ? 153 ASP D CA  1 
ATOM   5999  C  C   . ASP D 1 43  ? 79.068  9.505   180.512 1.00 18.44  ? 153 ASP D C   1 
ATOM   6000  O  O   . ASP D 1 43  ? 78.614  9.175   179.413 1.00 16.49  ? 153 ASP D O   1 
ATOM   6001  C  CB  . ASP D 1 43  ? 79.128  8.038   182.522 1.00 27.43  ? 153 ASP D CB  1 
ATOM   6002  C  CG  . ASP D 1 43  ? 78.068  7.053   182.108 1.00 35.35  ? 153 ASP D CG  1 
ATOM   6003  O  OD1 . ASP D 1 43  ? 78.389  5.857   181.966 1.00 42.33  ? 153 ASP D OD1 1 
ATOM   6004  O  OD2 . ASP D 1 43  ? 76.914  7.469   181.899 1.00 38.82  ? 153 ASP D OD2 1 
ATOM   6005  N  N   . ILE D 1 44  ? 78.924  10.714  181.029 1.00 14.42  ? 154 ILE D N   1 
ATOM   6006  C  CA  . ILE D 1 44  ? 78.135  11.714  180.360 1.00 15.20  ? 154 ILE D CA  1 
ATOM   6007  C  C   . ILE D 1 44  ? 78.745  12.114  179.026 1.00 16.41  ? 154 ILE D C   1 
ATOM   6008  O  O   . ILE D 1 44  ? 78.062  12.142  177.988 1.00 15.39  ? 154 ILE D O   1 
ATOM   6009  C  CB  . ILE D 1 44  ? 77.986  12.932  181.256 1.00 12.72  ? 154 ILE D CB  1 
ATOM   6010  C  CG1 . ILE D 1 44  ? 77.117  12.579  182.454 1.00 14.04  ? 154 ILE D CG1 1 
ATOM   6011  C  CG2 . ILE D 1 44  ? 77.356  14.060  180.509 1.00 9.90   ? 154 ILE D CG2 1 
ATOM   6012  C  CD1 . ILE D 1 44  ? 77.052  13.661  183.464 1.00 12.15  ? 154 ILE D CD1 1 
ATOM   6013  N  N   . ASP D 1 45  ? 80.032  12.429  179.059 1.00 14.33  ? 155 ASP D N   1 
ATOM   6014  C  CA  . ASP D 1 45  ? 80.742  12.846  177.875 1.00 15.39  ? 155 ASP D CA  1 
ATOM   6015  C  C   . ASP D 1 45  ? 80.508  11.824  176.770 1.00 20.04  ? 155 ASP D C   1 
ATOM   6016  O  O   . ASP D 1 45  ? 80.169  12.184  175.637 1.00 18.38  ? 155 ASP D O   1 
ATOM   6017  C  CB  . ASP D 1 45  ? 82.208  12.995  178.245 1.00 21.51  ? 155 ASP D CB  1 
ATOM   6018  C  CG  . ASP D 1 45  ? 83.115  12.880  177.073 1.00 24.99  ? 155 ASP D CG  1 
ATOM   6019  O  OD1 . ASP D 1 45  ? 83.203  13.848  176.289 1.00 23.52  ? 155 ASP D OD1 1 
ATOM   6020  O  OD2 . ASP D 1 45  ? 83.747  11.809  176.948 1.00 30.17  ? 155 ASP D OD2 1 
ATOM   6021  N  N   . ILE D 1 46  ? 80.580  10.553  177.156 1.00 19.17  ? 156 ILE D N   1 
ATOM   6022  C  CA  . ILE D 1 46  ? 80.367  9.417   176.260 1.00 17.97  ? 156 ILE D CA  1 
ATOM   6023  C  C   . ILE D 1 46  ? 78.910  9.265   175.779 1.00 17.60  ? 156 ILE D C   1 
ATOM   6024  O  O   . ILE D 1 46  ? 78.641  9.027   174.597 1.00 14.78  ? 156 ILE D O   1 
ATOM   6025  C  CB  . ILE D 1 46  ? 80.803  8.105   176.975 1.00 14.69  ? 156 ILE D CB  1 
ATOM   6026  C  CG1 . ILE D 1 46  ? 82.319  7.992   176.989 1.00 22.06  ? 156 ILE D CG1 1 
ATOM   6027  C  CG2 . ILE D 1 46  ? 80.242  6.888   176.307 1.00 6.20   ? 156 ILE D CG2 1 
ATOM   6028  C  CD1 . ILE D 1 46  ? 82.813  6.642   177.474 1.00 20.90  ? 156 ILE D CD1 1 
ATOM   6029  N  N   . LYS D 1 47  ? 77.974  9.347   176.711 1.00 20.04  ? 157 LYS D N   1 
ATOM   6030  C  CA  . LYS D 1 47  ? 76.576  9.193   176.352 1.00 25.46  ? 157 LYS D CA  1 
ATOM   6031  C  C   . LYS D 1 47  ? 76.061  10.335  175.520 1.00 21.17  ? 157 LYS D C   1 
ATOM   6032  O  O   . LYS D 1 47  ? 75.048  10.197  174.843 1.00 25.06  ? 157 LYS D O   1 
ATOM   6033  C  CB  . LYS D 1 47  ? 75.696  8.974   177.583 1.00 36.06  ? 157 LYS D CB  1 
ATOM   6034  C  CG  . LYS D 1 47  ? 75.829  7.569   178.145 1.00 45.08  ? 157 LYS D CG  1 
ATOM   6035  C  CD  . LYS D 1 47  ? 74.927  7.307   179.341 1.00 49.16  ? 157 LYS D CD  1 
ATOM   6036  C  CE  . LYS D 1 47  ? 74.987  5.837   179.754 1.00 51.19  ? 157 LYS D CE  1 
ATOM   6037  N  NZ  . LYS D 1 47  ? 76.397  5.401   179.990 1.00 54.37  ? 157 LYS D NZ  1 
ATOM   6038  N  N   . ILE D 1 48  ? 76.743  11.468  175.548 1.00 14.60  ? 158 ILE D N   1 
ATOM   6039  C  CA  . ILE D 1 48  ? 76.269  12.560  174.728 1.00 17.33  ? 158 ILE D CA  1 
ATOM   6040  C  C   . ILE D 1 48  ? 76.752  12.377  173.304 1.00 20.58  ? 158 ILE D C   1 
ATOM   6041  O  O   . ILE D 1 48  ? 76.008  12.607  172.356 1.00 18.40  ? 158 ILE D O   1 
ATOM   6042  C  CB  . ILE D 1 48  ? 76.716  13.895  175.266 1.00 19.57  ? 158 ILE D CB  1 
ATOM   6043  C  CG1 . ILE D 1 48  ? 75.946  14.188  176.556 1.00 18.73  ? 158 ILE D CG1 1 
ATOM   6044  C  CG2 . ILE D 1 48  ? 76.519  14.985  174.217 1.00 14.68  ? 158 ILE D CG2 1 
ATOM   6045  C  CD1 . ILE D 1 48  ? 76.244  15.539  177.150 1.00 10.62  ? 158 ILE D CD1 1 
ATOM   6046  N  N   . ARG D 1 49  ? 77.995  11.951  173.138 1.00 18.25  ? 159 ARG D N   1 
ATOM   6047  C  CA  . ARG D 1 49  ? 78.475  11.756  171.789 1.00 18.78  ? 159 ARG D CA  1 
ATOM   6048  C  C   . ARG D 1 49  ? 77.614  10.660  171.213 1.00 18.05  ? 159 ARG D C   1 
ATOM   6049  O  O   . ARG D 1 49  ? 77.212  10.727  170.067 1.00 22.64  ? 159 ARG D O   1 
ATOM   6050  C  CB  . ARG D 1 49  ? 79.957  11.375  171.754 1.00 26.81  ? 159 ARG D CB  1 
ATOM   6051  C  CG  . ARG D 1 49  ? 80.301  10.117  172.555 1.00 48.64  ? 159 ARG D CG  1 
ATOM   6052  C  CD  . ARG D 1 49  ? 81.791  9.738   172.523 1.00 54.68  ? 159 ARG D CD  1 
ATOM   6053  N  NE  . ARG D 1 49  ? 82.653  10.706  173.204 1.00 55.22  ? 159 ARG D NE  1 
ATOM   6054  C  CZ  . ARG D 1 49  ? 83.032  11.871  172.682 1.00 54.81  ? 159 ARG D CZ  1 
ATOM   6055  N  NH1 . ARG D 1 49  ? 82.627  12.232  171.463 1.00 47.91  ? 159 ARG D NH1 1 
ATOM   6056  N  NH2 . ARG D 1 49  ? 83.833  12.672  173.377 1.00 54.93  ? 159 ARG D NH2 1 
ATOM   6057  N  N   . SER D 1 50  ? 77.237  9.702   172.046 1.00 18.58  ? 160 SER D N   1 
ATOM   6058  C  CA  . SER D 1 50  ? 76.409  8.598   171.578 1.00 21.46  ? 160 SER D CA  1 
ATOM   6059  C  C   . SER D 1 50  ? 75.059  9.091   171.104 1.00 20.56  ? 160 SER D C   1 
ATOM   6060  O  O   . SER D 1 50  ? 74.399  8.447   170.307 1.00 28.13  ? 160 SER D O   1 
ATOM   6061  C  CB  . SER D 1 50  ? 76.192  7.594   172.701 1.00 23.07  ? 160 SER D CB  1 
ATOM   6062  O  OG  . SER D 1 50  ? 75.305  8.116   173.679 1.00 20.49  ? 160 SER D OG  1 
ATOM   6063  N  N   . CYS D 1 51  ? 74.643  10.236  171.613 1.00 21.06  ? 161 CYS D N   1 
ATOM   6064  C  CA  . CYS D 1 51  ? 73.355  10.785  171.248 1.00 17.50  ? 161 CYS D CA  1 
ATOM   6065  C  C   . CYS D 1 51  ? 73.468  11.550  169.936 1.00 13.58  ? 161 CYS D C   1 
ATOM   6066  O  O   . CYS D 1 51  ? 72.487  12.051  169.389 1.00 14.67  ? 161 CYS D O   1 
ATOM   6067  C  CB  . CYS D 1 51  ? 72.831  11.642  172.404 1.00 19.04  ? 161 CYS D CB  1 
ATOM   6068  S  SG  . CYS D 1 51  ? 71.054  11.427  172.814 1.00 27.24  ? 161 CYS D SG  1 
ATOM   6069  N  N   . ARG D 1 52  ? 74.672  11.563  169.385 1.00 18.82  ? 162 ARG D N   1 
ATOM   6070  C  CA  . ARG D 1 52  ? 74.916  12.243  168.117 1.00 15.99  ? 162 ARG D CA  1 
ATOM   6071  C  C   . ARG D 1 52  ? 74.290  11.452  166.970 1.00 19.02  ? 162 ARG D C   1 
ATOM   6072  O  O   . ARG D 1 52  ? 73.693  12.047  166.090 1.00 28.52  ? 162 ARG D O   1 
ATOM   6073  C  CB  . ARG D 1 52  ? 76.422  12.429  167.898 1.00 20.63  ? 162 ARG D CB  1 
ATOM   6074  C  CG  . ARG D 1 52  ? 76.807  13.025  166.548 1.00 37.36  ? 162 ARG D CG  1 
ATOM   6075  C  CD  . ARG D 1 52  ? 78.337  13.093  166.333 1.00 48.41  ? 162 ARG D CD  1 
ATOM   6076  N  NE  . ARG D 1 52  ? 78.991  14.041  167.237 1.00 59.44  ? 162 ARG D NE  1 
ATOM   6077  C  CZ  . ARG D 1 52  ? 80.213  13.886  167.746 1.00 66.78  ? 162 ARG D CZ  1 
ATOM   6078  N  NH1 . ARG D 1 52  ? 80.940  12.812  167.441 1.00 66.58  ? 162 ARG D NH1 1 
ATOM   6079  N  NH2 . ARG D 1 52  ? 80.699  14.798  168.588 1.00 70.46  ? 162 ARG D NH2 1 
ATOM   6080  N  N   . GLY D 1 53  ? 74.375  10.118  167.002 1.00 14.42  ? 163 GLY D N   1 
ATOM   6081  C  CA  . GLY D 1 53  ? 73.802  9.329   165.929 1.00 13.37  ? 163 GLY D CA  1 
ATOM   6082  C  C   . GLY D 1 53  ? 72.298  9.117   165.969 1.00 12.09  ? 163 GLY D C   1 
ATOM   6083  O  O   . GLY D 1 53  ? 71.762  8.269   165.263 1.00 12.94  ? 163 GLY D O   1 
ATOM   6084  N  N   . SER D 1 54  ? 71.598  9.923   166.744 1.00 10.53  ? 164 SER D N   1 
ATOM   6085  C  CA  . SER D 1 54  ? 70.181  9.745   166.868 1.00 14.63  ? 164 SER D CA  1 
ATOM   6086  C  C   . SER D 1 54  ? 69.501  11.075  166.885 1.00 22.31  ? 164 SER D C   1 
ATOM   6087  O  O   . SER D 1 54  ? 68.449  11.238  166.267 1.00 26.16  ? 164 SER D O   1 
ATOM   6088  C  CB  . SER D 1 54  ? 69.864  9.025   168.165 1.00 15.78  ? 164 SER D CB  1 
ATOM   6089  O  OG  . SER D 1 54  ? 70.598  7.819   168.280 1.00 22.68  ? 164 SER D OG  1 
ATOM   6090  N  N   . CYS D 1 55  ? 70.094  12.029  167.598 1.00 25.50  ? 165 CYS D N   1 
ATOM   6091  C  CA  . CYS D 1 55  ? 69.502  13.362  167.696 1.00 30.54  ? 165 CYS D CA  1 
ATOM   6092  C  C   . CYS D 1 55  ? 69.929  14.329  166.610 1.00 30.69  ? 165 CYS D C   1 
ATOM   6093  O  O   . CYS D 1 55  ? 70.984  14.181  165.990 1.00 32.05  ? 165 CYS D O   1 
ATOM   6094  C  CB  . CYS D 1 55  ? 69.776  13.982  169.059 1.00 28.39  ? 165 CYS D CB  1 
ATOM   6095  S  SG  . CYS D 1 55  ? 69.323  12.873  170.412 1.00 33.24  ? 165 CYS D SG  1 
ATOM   6096  N  N   . SER D 1 56  ? 69.105  15.347  166.418 1.00 29.30  ? 166 SER D N   1 
ATOM   6097  C  CA  . SER D 1 56  ? 69.368  16.361  165.426 1.00 31.50  ? 166 SER D CA  1 
ATOM   6098  C  C   . SER D 1 56  ? 70.697  17.071  165.687 1.00 36.90  ? 166 SER D C   1 
ATOM   6099  O  O   . SER D 1 56  ? 71.410  17.424  164.742 1.00 43.90  ? 166 SER D O   1 
ATOM   6100  C  CB  . SER D 1 56  ? 68.228  17.373  165.411 1.00 25.66  ? 166 SER D CB  1 
ATOM   6101  O  OG  . SER D 1 56  ? 68.231  18.155  166.587 1.00 18.25  ? 166 SER D OG  1 
ATOM   6102  N  N   . ARG D 1 57  ? 71.039  17.255  166.959 1.00 30.01  ? 167 ARG D N   1 
ATOM   6103  C  CA  . ARG D 1 57  ? 72.284  17.940  167.322 1.00 33.28  ? 167 ARG D CA  1 
ATOM   6104  C  C   . ARG D 1 57  ? 73.042  17.240  168.482 1.00 31.66  ? 167 ARG D C   1 
ATOM   6105  O  O   . ARG D 1 57  ? 72.514  16.352  169.154 1.00 27.71  ? 167 ARG D O   1 
ATOM   6106  C  CB  . ARG D 1 57  ? 71.958  19.396  167.716 1.00 37.12  ? 167 ARG D CB  1 
ATOM   6107  C  CG  . ARG D 1 57  ? 72.846  20.454  167.082 1.00 42.59  ? 167 ARG D CG  1 
ATOM   6108  C  CD  . ARG D 1 57  ? 73.278  21.513  168.087 1.00 44.46  ? 167 ARG D CD  1 
ATOM   6109  N  NE  . ARG D 1 57  ? 74.737  21.645  168.098 1.00 49.32  ? 167 ARG D NE  1 
ATOM   6110  C  CZ  . ARG D 1 57  ? 75.432  22.376  168.963 1.00 44.32  ? 167 ARG D CZ  1 
ATOM   6111  N  NH1 . ARG D 1 57  ? 74.812  23.059  169.909 1.00 40.04  ? 167 ARG D NH1 1 
ATOM   6112  N  NH2 . ARG D 1 57  ? 76.753  22.407  168.885 1.00 41.45  ? 167 ARG D NH2 1 
ATOM   6113  N  N   . ALA D 1 58  ? 74.288  17.632  168.714 1.00 28.58  ? 168 ALA D N   1 
ATOM   6114  C  CA  . ALA D 1 58  ? 75.047  17.050  169.816 1.00 30.69  ? 168 ALA D CA  1 
ATOM   6115  C  C   . ALA D 1 58  ? 76.001  18.094  170.431 1.00 34.70  ? 168 ALA D C   1 
ATOM   6116  O  O   . ALA D 1 58  ? 76.919  18.605  169.761 1.00 34.00  ? 168 ALA D O   1 
ATOM   6117  C  CB  . ALA D 1 58  ? 75.800  15.824  169.354 1.00 30.74  ? 168 ALA D CB  1 
ATOM   6118  N  N   . LEU D 1 59  ? 75.754  18.412  171.705 1.00 29.57  ? 169 LEU D N   1 
ATOM   6119  C  CA  . LEU D 1 59  ? 76.525  19.397  172.458 1.00 22.64  ? 169 LEU D CA  1 
ATOM   6120  C  C   . LEU D 1 59  ? 78.021  19.174  172.307 1.00 20.12  ? 169 LEU D C   1 
ATOM   6121  O  O   . LEU D 1 59  ? 78.540  18.103  172.646 1.00 14.19  ? 169 LEU D O   1 
ATOM   6122  C  CB  . LEU D 1 59  ? 76.118  19.350  173.938 1.00 24.65  ? 169 LEU D CB  1 
ATOM   6123  C  CG  . LEU D 1 59  ? 76.303  20.592  174.819 1.00 22.79  ? 169 LEU D CG  1 
ATOM   6124  C  CD1 . LEU D 1 59  ? 77.749  20.903  175.142 1.00 21.05  ? 169 LEU D CD1 1 
ATOM   6125  C  CD2 . LEU D 1 59  ? 75.701  21.751  174.099 1.00 30.77  ? 169 LEU D CD2 1 
ATOM   6126  N  N   . ALA D 1 60  ? 78.695  20.179  171.748 1.00 21.97  ? 170 ALA D N   1 
ATOM   6127  C  CA  . ALA D 1 60  ? 80.137  20.129  171.536 1.00 29.49  ? 170 ALA D CA  1 
ATOM   6128  C  C   . ALA D 1 60  ? 80.782  20.260  172.887 1.00 32.66  ? 170 ALA D C   1 
ATOM   6129  O  O   . ALA D 1 60  ? 80.662  21.302  173.530 1.00 37.32  ? 170 ALA D O   1 
ATOM   6130  C  CB  . ALA D 1 60  ? 80.585  21.264  170.639 1.00 30.81  ? 170 ALA D CB  1 
ATOM   6131  N  N   . ARG D 1 61  ? 81.413  19.180  173.342 1.00 40.94  ? 171 ARG D N   1 
ATOM   6132  C  CA  . ARG D 1 61  ? 82.075  19.177  174.646 1.00 46.74  ? 171 ARG D CA  1 
ATOM   6133  C  C   . ARG D 1 61  ? 83.513  18.703  174.606 1.00 60.50  ? 171 ARG D C   1 
ATOM   6134  O  O   . ARG D 1 61  ? 84.187  18.696  173.572 1.00 65.79  ? 171 ARG D O   1 
ATOM   6135  C  CB  . ARG D 1 61  ? 81.328  18.292  175.638 1.00 38.14  ? 171 ARG D CB  1 
ATOM   6136  C  CG  . ARG D 1 61  ? 79.968  18.760  175.960 1.00 41.09  ? 171 ARG D CG  1 
ATOM   6137  C  CD  . ARG D 1 61  ? 79.207  17.737  176.755 1.00 40.51  ? 171 ARG D CD  1 
ATOM   6138  N  NE  . ARG D 1 61  ? 79.664  17.676  178.131 1.00 36.72  ? 171 ARG D NE  1 
ATOM   6139  C  CZ  . ARG D 1 61  ? 80.554  16.805  178.567 1.00 39.20  ? 171 ARG D CZ  1 
ATOM   6140  N  NH1 . ARG D 1 61  ? 81.081  15.924  177.726 1.00 40.73  ? 171 ARG D NH1 1 
ATOM   6141  N  NH2 . ARG D 1 61  ? 80.906  16.809  179.840 1.00 44.89  ? 171 ARG D NH2 1 
ATOM   6142  N  N   . GLU D 1 62  ? 83.936  18.258  175.778 1.00 72.48  ? 172 GLU D N   1 
ATOM   6143  C  CA  . GLU D 1 62  ? 85.266  17.747  176.057 1.00 83.65  ? 172 GLU D CA  1 
ATOM   6144  C  C   . GLU D 1 62  ? 85.220  17.345  177.539 1.00 86.91  ? 172 GLU D C   1 
ATOM   6145  O  O   . GLU D 1 62  ? 84.153  17.367  178.165 1.00 89.63  ? 172 GLU D O   1 
ATOM   6146  C  CB  . GLU D 1 62  ? 86.315  18.852  175.833 1.00 89.08  ? 172 GLU D CB  1 
ATOM   6147  C  CG  . GLU D 1 62  ? 85.839  20.281  176.161 1.00 96.89  ? 172 GLU D CG  1 
ATOM   6148  C  CD  . GLU D 1 62  ? 84.983  20.363  177.430 1.00 104.71 ? 172 GLU D CD  1 
ATOM   6149  O  OE1 . GLU D 1 62  ? 85.535  20.198  178.544 1.00 109.70 ? 172 GLU D OE1 1 
ATOM   6150  O  OE2 . GLU D 1 62  ? 83.750  20.567  177.306 1.00 105.80 ? 172 GLU D OE2 1 
ATOM   6151  N  N   . VAL D 1 63  ? 86.375  17.013  178.103 1.00 87.35  ? 173 VAL D N   1 
ATOM   6152  C  CA  . VAL D 1 63  ? 86.464  16.640  179.510 1.00 90.07  ? 173 VAL D CA  1 
ATOM   6153  C  C   . VAL D 1 63  ? 87.831  17.010  180.062 1.00 90.38  ? 173 VAL D C   1 
ATOM   6154  O  O   . VAL D 1 63  ? 88.831  17.013  179.339 1.00 94.40  ? 173 VAL D O   1 
ATOM   6155  C  CB  . VAL D 1 63  ? 86.204  15.130  179.742 1.00 91.05  ? 173 VAL D CB  1 
ATOM   6156  C  CG1 . VAL D 1 63  ? 84.711  14.869  179.916 1.00 92.72  ? 173 VAL D CG1 1 
ATOM   6157  C  CG2 . VAL D 1 63  ? 86.752  14.314  178.579 1.00 94.59  ? 173 VAL D CG2 1 
ATOM   6158  N  N   . ASP D 1 64  ? 87.864  17.341  181.345 1.00 87.64  ? 174 ASP D N   1 
ATOM   6159  C  CA  . ASP D 1 64  ? 89.105  17.718  181.990 1.00 83.59  ? 174 ASP D CA  1 
ATOM   6160  C  C   . ASP D 1 64  ? 89.230  16.961  183.295 1.00 78.33  ? 174 ASP D C   1 
ATOM   6161  O  O   . ASP D 1 64  ? 88.766  17.420  184.345 1.00 75.27  ? 174 ASP D O   1 
ATOM   6162  C  CB  . ASP D 1 64  ? 89.119  19.222  182.252 1.00 89.70  ? 174 ASP D CB  1 
ATOM   6163  C  CG  . ASP D 1 64  ? 90.482  19.725  182.692 1.00 93.41  ? 174 ASP D CG  1 
ATOM   6164  O  OD1 . ASP D 1 64  ? 91.326  19.988  181.805 1.00 94.52  ? 174 ASP D OD1 1 
ATOM   6165  O  OD2 . ASP D 1 64  ? 90.706  19.863  183.920 1.00 95.04  ? 174 ASP D OD2 1 
ATOM   6166  N  N   . LEU D 1 65  ? 89.825  15.778  183.218 1.00 73.33  ? 175 LEU D N   1 
ATOM   6167  C  CA  . LEU D 1 65  ? 90.010  14.965  184.407 1.00 71.12  ? 175 LEU D CA  1 
ATOM   6168  C  C   . LEU D 1 65  ? 91.161  15.529  185.214 1.00 68.68  ? 175 LEU D C   1 
ATOM   6169  O  O   . LEU D 1 65  ? 91.466  15.044  186.297 1.00 68.63  ? 175 LEU D O   1 
ATOM   6170  C  CB  . LEU D 1 65  ? 90.297  13.508  184.042 1.00 67.07  ? 175 LEU D CB  1 
ATOM   6171  C  CG  . LEU D 1 65  ? 89.224  12.765  183.257 1.00 62.66  ? 175 LEU D CG  1 
ATOM   6172  C  CD1 . LEU D 1 65  ? 87.839  13.284  183.642 1.00 58.36  ? 175 LEU D CD1 1 
ATOM   6173  C  CD2 . LEU D 1 65  ? 89.475  12.953  181.779 1.00 65.57  ? 175 LEU D CD2 1 
ATOM   6174  N  N   . LYS D 1 66  ? 91.783  16.571  184.675 1.00 67.73  ? 176 LYS D N   1 
ATOM   6175  C  CA  . LYS D 1 66  ? 92.915  17.228  185.308 1.00 69.68  ? 176 LYS D CA  1 
ATOM   6176  C  C   . LYS D 1 66  ? 92.495  17.810  186.647 1.00 64.46  ? 176 LYS D C   1 
ATOM   6177  O  O   . LYS D 1 66  ? 93.031  17.424  187.689 1.00 64.30  ? 176 LYS D O   1 
ATOM   6178  C  CB  . LYS D 1 66  ? 93.488  18.311  184.383 1.00 74.98  ? 176 LYS D CB  1 
ATOM   6179  C  CG  . LYS D 1 66  ? 93.999  17.772  183.031 1.00 80.25  ? 176 LYS D CG  1 
ATOM   6180  C  CD  . LYS D 1 66  ? 92.864  17.183  182.173 1.00 81.78  ? 176 LYS D CD  1 
ATOM   6181  C  CE  . LYS D 1 66  ? 93.333  16.049  181.268 1.00 79.41  ? 176 LYS D CE  1 
ATOM   6182  N  NZ  . LYS D 1 66  ? 92.176  15.375  180.612 1.00 76.99  ? 176 LYS D NZ  1 
ATOM   6183  N  N   . ASP D 1 67  ? 91.496  18.689  186.627 1.00 58.41  ? 177 ASP D N   1 
ATOM   6184  C  CA  . ASP D 1 67  ? 91.014  19.289  187.862 1.00 56.01  ? 177 ASP D CA  1 
ATOM   6185  C  C   . ASP D 1 67  ? 90.703  18.146  188.816 1.00 53.11  ? 177 ASP D C   1 
ATOM   6186  O  O   . ASP D 1 67  ? 91.097  18.167  189.977 1.00 50.89  ? 177 ASP D O   1 
ATOM   6187  C  CB  . ASP D 1 67  ? 89.766  20.131  187.610 1.00 58.54  ? 177 ASP D CB  1 
ATOM   6188  C  CG  . ASP D 1 67  ? 89.450  21.071  188.772 1.00 62.21  ? 177 ASP D CG  1 
ATOM   6189  O  OD1 . ASP D 1 67  ? 90.399  21.605  189.399 1.00 61.11  ? 177 ASP D OD1 1 
ATOM   6190  O  OD2 . ASP D 1 67  ? 88.249  21.289  189.054 1.00 62.00  ? 177 ASP D OD2 1 
ATOM   6191  N  N   . TYR D 1 68  ? 90.095  17.101  188.265 1.00 51.62  ? 178 TYR D N   1 
ATOM   6192  C  CA  . TYR D 1 68  ? 89.745  15.910  189.019 1.00 50.32  ? 178 TYR D CA  1 
ATOM   6193  C  C   . TYR D 1 68  ? 90.985  15.255  189.581 1.00 51.65  ? 178 TYR D C   1 
ATOM   6194  O  O   . TYR D 1 68  ? 91.049  14.925  190.761 1.00 51.07  ? 178 TYR D O   1 
ATOM   6195  C  CB  . TYR D 1 68  ? 89.019  14.902  188.123 1.00 45.58  ? 178 TYR D CB  1 
ATOM   6196  C  CG  . TYR D 1 68  ? 87.538  15.146  188.025 1.00 45.61  ? 178 TYR D CG  1 
ATOM   6197  C  CD1 . TYR D 1 68  ? 86.718  14.998  189.151 1.00 42.86  ? 178 TYR D CD1 1 
ATOM   6198  C  CD2 . TYR D 1 68  ? 86.950  15.548  186.816 1.00 45.61  ? 178 TYR D CD2 1 
ATOM   6199  C  CE1 . TYR D 1 68  ? 85.347  15.245  189.085 1.00 42.88  ? 178 TYR D CE1 1 
ATOM   6200  C  CE2 . TYR D 1 68  ? 85.569  15.799  186.734 1.00 44.15  ? 178 TYR D CE2 1 
ATOM   6201  C  CZ  . TYR D 1 68  ? 84.776  15.642  187.878 1.00 44.72  ? 178 TYR D CZ  1 
ATOM   6202  O  OH  . TYR D 1 68  ? 83.419  15.870  187.822 1.00 47.17  ? 178 TYR D OH  1 
ATOM   6203  N  N   . GLU D 1 69  ? 91.976  15.078  188.722 1.00 54.67  ? 179 GLU D N   1 
ATOM   6204  C  CA  . GLU D 1 69  ? 93.215  14.443  189.122 1.00 53.77  ? 179 GLU D CA  1 
ATOM   6205  C  C   . GLU D 1 69  ? 93.953  15.209  190.197 1.00 50.94  ? 179 GLU D C   1 
ATOM   6206  O  O   . GLU D 1 69  ? 94.112  14.698  191.301 1.00 47.28  ? 179 GLU D O   1 
ATOM   6207  C  CB  . GLU D 1 69  ? 94.097  14.176  187.901 1.00 56.70  ? 179 GLU D CB  1 
ATOM   6208  C  CG  . GLU D 1 69  ? 93.739  12.860  187.185 1.00 63.11  ? 179 GLU D CG  1 
ATOM   6209  C  CD  . GLU D 1 69  ? 93.916  12.903  185.662 1.00 65.98  ? 179 GLU D CD  1 
ATOM   6210  O  OE1 . GLU D 1 69  ? 94.796  13.642  185.158 1.00 64.23  ? 179 GLU D OE1 1 
ATOM   6211  O  OE2 . GLU D 1 69  ? 93.165  12.181  184.966 1.00 66.25  ? 179 GLU D OE2 1 
ATOM   6212  N  N   . ASP D 1 70  ? 94.322  16.457  189.922 1.00 54.31  ? 180 ASP D N   1 
ATOM   6213  C  CA  . ASP D 1 70  ? 95.056  17.230  190.919 1.00 57.67  ? 180 ASP D CA  1 
ATOM   6214  C  C   . ASP D 1 70  ? 94.282  17.413  192.237 1.00 60.15  ? 180 ASP D C   1 
ATOM   6215  O  O   . ASP D 1 70  ? 94.883  17.695  193.273 1.00 62.69  ? 180 ASP D O   1 
ATOM   6216  C  CB  . ASP D 1 70  ? 95.577  18.562  190.348 1.00 59.79  ? 180 ASP D CB  1 
ATOM   6217  C  CG  . ASP D 1 70  ? 94.476  19.566  190.086 1.00 63.73  ? 180 ASP D CG  1 
ATOM   6218  O  OD1 . ASP D 1 70  ? 93.989  20.189  191.054 1.00 68.81  ? 180 ASP D OD1 1 
ATOM   6219  O  OD2 . ASP D 1 70  ? 94.112  19.753  188.912 1.00 63.52  ? 180 ASP D OD2 1 
ATOM   6220  N  N   . GLN D 1 71  ? 92.960  17.239  192.202 1.00 60.40  ? 181 GLN D N   1 
ATOM   6221  C  CA  . GLN D 1 71  ? 92.165  17.341  193.422 1.00 62.63  ? 181 GLN D CA  1 
ATOM   6222  C  C   . GLN D 1 71  ? 92.328  16.048  194.213 1.00 68.26  ? 181 GLN D C   1 
ATOM   6223  O  O   . GLN D 1 71  ? 92.501  16.076  195.432 1.00 67.45  ? 181 GLN D O   1 
ATOM   6224  C  CB  . GLN D 1 71  ? 90.693  17.552  193.109 1.00 59.46  ? 181 GLN D CB  1 
ATOM   6225  C  CG  . GLN D 1 71  ? 90.320  18.991  192.849 1.00 61.05  ? 181 GLN D CG  1 
ATOM   6226  C  CD  . GLN D 1 71  ? 88.830  19.158  192.647 1.00 64.44  ? 181 GLN D CD  1 
ATOM   6227  O  OE1 . GLN D 1 71  ? 88.266  18.669  191.664 1.00 69.81  ? 181 GLN D OE1 1 
ATOM   6228  N  NE2 . GLN D 1 71  ? 88.176  19.831  193.589 1.00 66.52  ? 181 GLN D NE2 1 
ATOM   6229  N  N   . GLN D 1 72  ? 92.260  14.919  193.503 1.00 74.15  ? 182 GLN D N   1 
ATOM   6230  C  CA  . GLN D 1 72  ? 92.417  13.597  194.106 1.00 74.43  ? 182 GLN D CA  1 
ATOM   6231  C  C   . GLN D 1 72  ? 93.720  13.631  194.874 1.00 75.21  ? 182 GLN D C   1 
ATOM   6232  O  O   . GLN D 1 72  ? 93.800  13.205  196.021 1.00 79.05  ? 182 GLN D O   1 
ATOM   6233  C  CB  . GLN D 1 72  ? 92.523  12.505  193.025 1.00 77.11  ? 182 GLN D CB  1 
ATOM   6234  C  CG  . GLN D 1 72  ? 91.275  12.275  192.149 1.00 79.42  ? 182 GLN D CG  1 
ATOM   6235  C  CD  . GLN D 1 72  ? 91.522  11.308  190.968 1.00 78.79  ? 182 GLN D CD  1 
ATOM   6236  O  OE1 . GLN D 1 72  ? 91.631  10.085  191.147 1.00 76.63  ? 182 GLN D OE1 1 
ATOM   6237  N  NE2 . GLN D 1 72  ? 91.590  11.861  189.759 1.00 75.67  ? 182 GLN D NE2 1 
ATOM   6238  N  N   . LYS D 1 73  ? 94.725  14.216  194.240 1.00 75.39  ? 183 LYS D N   1 
ATOM   6239  C  CA  . LYS D 1 73  ? 96.047  14.316  194.818 1.00 74.92  ? 183 LYS D CA  1 
ATOM   6240  C  C   . LYS D 1 73  ? 96.108  15.169  196.073 1.00 73.38  ? 183 LYS D C   1 
ATOM   6241  O  O   . LYS D 1 73  ? 96.807  14.815  197.020 1.00 75.04  ? 183 LYS D O   1 
ATOM   6242  C  CB  . LYS D 1 73  ? 97.031  14.783  193.749 1.00 74.83  ? 183 LYS D CB  1 
ATOM   6243  C  CG  . LYS D 1 73  ? 97.226  13.719  192.667 1.00 77.58  ? 183 LYS D CG  1 
ATOM   6244  C  CD  . LYS D 1 73  ? 97.202  14.276  191.247 1.00 81.75  ? 183 LYS D CD  1 
ATOM   6245  C  CE  . LYS D 1 73  ? 97.229  13.155  190.187 1.00 84.98  ? 183 LYS D CE  1 
ATOM   6246  N  NZ  . LYS D 1 73  ? 96.009  12.279  190.161 1.00 86.75  ? 183 LYS D NZ  1 
ATOM   6247  N  N   . GLN D 1 74  ? 95.341  16.255  196.111 1.00 71.55  ? 184 GLN D N   1 
ATOM   6248  C  CA  . GLN D 1 74  ? 95.335  17.117  197.292 1.00 72.59  ? 184 GLN D CA  1 
ATOM   6249  C  C   . GLN D 1 74  ? 94.667  16.375  198.453 1.00 71.38  ? 184 GLN D C   1 
ATOM   6250  O  O   . GLN D 1 74  ? 95.052  16.521  199.616 1.00 69.57  ? 184 GLN D O   1 
ATOM   6251  C  CB  . GLN D 1 74  ? 94.591  18.430  197.021 1.00 71.59  ? 184 GLN D CB  1 
ATOM   6252  C  CG  . GLN D 1 74  ? 94.927  19.121  195.706 1.00 76.61  ? 184 GLN D CG  1 
ATOM   6253  C  CD  . GLN D 1 74  ? 96.426  19.260  195.435 1.00 82.57  ? 184 GLN D CD  1 
ATOM   6254  O  OE1 . GLN D 1 74  ? 96.982  20.365  195.476 1.00 84.81  ? 184 GLN D OE1 1 
ATOM   6255  N  NE2 . GLN D 1 74  ? 97.075  18.145  195.104 1.00 84.40  ? 184 GLN D NE2 1 
ATOM   6256  N  N   . LEU D 1 75  ? 93.684  15.550  198.120 1.00 70.59  ? 185 LEU D N   1 
ATOM   6257  C  CA  . LEU D 1 75  ? 92.963  14.789  199.121 1.00 71.68  ? 185 LEU D CA  1 
ATOM   6258  C  C   . LEU D 1 75  ? 93.892  13.798  199.777 1.00 76.19  ? 185 LEU D C   1 
ATOM   6259  O  O   . LEU D 1 75  ? 93.988  13.750  200.995 1.00 80.44  ? 185 LEU D O   1 
ATOM   6260  C  CB  . LEU D 1 75  ? 91.801  14.034  198.484 1.00 72.06  ? 185 LEU D CB  1 
ATOM   6261  C  CG  . LEU D 1 75  ? 90.432  14.245  199.122 1.00 73.06  ? 185 LEU D CG  1 
ATOM   6262  C  CD1 . LEU D 1 75  ? 89.505  13.102  198.733 1.00 72.87  ? 185 LEU D CD1 1 
ATOM   6263  C  CD2 . LEU D 1 75  ? 90.568  14.310  200.626 1.00 74.00  ? 185 LEU D CD2 1 
ATOM   6264  N  N   . GLU D 1 76  ? 94.575  13.012  198.951 1.00 80.33  ? 186 GLU D N   1 
ATOM   6265  C  CA  . GLU D 1 76  ? 95.511  11.991  199.418 1.00 84.62  ? 186 GLU D CA  1 
ATOM   6266  C  C   . GLU D 1 76  ? 96.641  12.630  200.197 1.00 83.91  ? 186 GLU D C   1 
ATOM   6267  O  O   . GLU D 1 76  ? 97.063  12.111  201.232 1.00 86.09  ? 186 GLU D O   1 
ATOM   6268  C  CB  . GLU D 1 76  ? 96.072  11.215  198.227 1.00 88.91  ? 186 GLU D CB  1 
ATOM   6269  C  CG  . GLU D 1 76  ? 95.005  10.602  197.320 1.00 92.33  ? 186 GLU D CG  1 
ATOM   6270  C  CD  . GLU D 1 76  ? 94.183  9.506   197.999 1.00 94.26  ? 186 GLU D CD  1 
ATOM   6271  O  OE1 . GLU D 1 76  ? 93.511  9.779   199.026 1.00 93.06  ? 186 GLU D OE1 1 
ATOM   6272  O  OE2 . GLU D 1 76  ? 94.197  8.365   197.484 1.00 97.23  ? 186 GLU D OE2 1 
ATOM   6273  N  N   . GLN D 1 77  ? 97.100  13.772  199.693 1.00 81.97  ? 187 GLN D N   1 
ATOM   6274  C  CA  . GLN D 1 77  ? 98.163  14.562  200.306 1.00 83.90  ? 187 GLN D CA  1 
ATOM   6275  C  C   . GLN D 1 77  ? 97.801  14.908  201.757 1.00 82.80  ? 187 GLN D C   1 
ATOM   6276  O  O   . GLN D 1 77  ? 98.676  15.181  202.580 1.00 83.86  ? 187 GLN D O   1 
ATOM   6277  C  CB  . GLN D 1 77  ? 98.354  15.839  199.482 1.00 87.29  ? 187 GLN D CB  1 
ATOM   6278  C  CG  . GLN D 1 77  ? 99.239  16.913  200.083 1.00 90.27  ? 187 GLN D CG  1 
ATOM   6279  C  CD  . GLN D 1 77  ? 99.195  18.198  199.272 1.00 92.45  ? 187 GLN D CD  1 
ATOM   6280  O  OE1 . GLN D 1 77  ? 99.939  18.359  198.307 1.00 96.09  ? 187 GLN D OE1 1 
ATOM   6281  N  NE2 . GLN D 1 77  ? 98.302  19.109  199.647 1.00 92.93  ? 187 GLN D NE2 1 
ATOM   6282  N  N   . VAL D 1 78  ? 96.505  14.862  202.062 1.00 81.37  ? 188 VAL D N   1 
ATOM   6283  C  CA  . VAL D 1 78  ? 95.989  15.157  203.398 1.00 79.51  ? 188 VAL D CA  1 
ATOM   6284  C  C   . VAL D 1 78  ? 95.636  13.882  204.174 1.00 78.37  ? 188 VAL D C   1 
ATOM   6285  O  O   . VAL D 1 78  ? 96.005  13.729  205.339 1.00 79.06  ? 188 VAL D O   1 
ATOM   6286  C  CB  . VAL D 1 78  ? 94.728  16.060  203.312 1.00 78.65  ? 188 VAL D CB  1 
ATOM   6287  C  CG1 . VAL D 1 78  ? 94.134  16.287  204.697 1.00 77.09  ? 188 VAL D CG1 1 
ATOM   6288  C  CG2 . VAL D 1 78  ? 95.078  17.387  202.659 1.00 77.91  ? 188 VAL D CG2 1 
ATOM   6289  N  N   . ILE D 1 79  ? 94.890  12.991  203.527 1.00 79.01  ? 189 ILE D N   1 
ATOM   6290  C  CA  . ILE D 1 79  ? 94.469  11.733  204.126 1.00 80.05  ? 189 ILE D CA  1 
ATOM   6291  C  C   . ILE D 1 79  ? 95.654  10.988  204.732 1.00 85.43  ? 189 ILE D C   1 
ATOM   6292  O  O   . ILE D 1 79  ? 95.505  10.284  205.736 1.00 87.13  ? 189 ILE D O   1 
ATOM   6293  C  CB  . ILE D 1 79  ? 93.772  10.840  203.081 1.00 77.78  ? 189 ILE D CB  1 
ATOM   6294  C  CG1 . ILE D 1 79  ? 92.462  11.493  202.632 1.00 75.40  ? 189 ILE D CG1 1 
ATOM   6295  C  CG2 . ILE D 1 79  ? 93.512  9.455   203.650 1.00 79.57  ? 189 ILE D CG2 1 
ATOM   6296  C  CD1 . ILE D 1 79  ? 91.691  10.708  201.588 1.00 70.76  ? 189 ILE D CD1 1 
ATOM   6297  N  N   . ALA D 1 80  ? 96.832  11.175  204.134 1.00 90.01  ? 190 ALA D N   1 
ATOM   6298  C  CA  . ALA D 1 80  ? 98.068  10.542  204.602 1.00 94.83  ? 190 ALA D CA  1 
ATOM   6299  C  C   . ALA D 1 80  ? 98.658  11.267  205.826 1.00 97.67  ? 190 ALA D C   1 
ATOM   6300  O  O   . ALA D 1 80  ? 99.877  11.444  205.942 1.00 97.11  ? 190 ALA D O   1 
ATOM   6301  C  CB  . ALA D 1 80  ? 99.088  10.499  203.469 1.00 94.08  ? 190 ALA D CB  1 
ATOM   6302  N  N   . LYS D 1 81  ? 97.782  11.659  206.749 1.00 99.78  ? 191 LYS D N   1 
ATOM   6303  C  CA  . LYS D 1 81  ? 98.182  12.367  207.962 1.00 100.56 ? 191 LYS D CA  1 
ATOM   6304  C  C   . LYS D 1 81  ? 97.454  11.744  209.156 1.00 99.29  ? 191 LYS D C   1 
ATOM   6305  O  O   . LYS D 1 81  ? 96.219  11.790  209.237 1.00 99.38  ? 191 LYS D O   1 
ATOM   6306  C  CB  . LYS D 1 81  ? 97.822  13.850  207.821 1.00 102.80 ? 191 LYS D CB  1 
ATOM   6307  C  CG  . LYS D 1 81  ? 98.627  14.793  208.688 1.00 105.65 ? 191 LYS D CG  1 
ATOM   6308  C  CD  . LYS D 1 81  ? 98.594  16.210  208.121 1.00 108.73 ? 191 LYS D CD  1 
ATOM   6309  C  CE  . LYS D 1 81  ? 99.289  16.290  206.757 1.00 109.99 ? 191 LYS D CE  1 
ATOM   6310  N  NZ  . LYS D 1 81  ? 99.272  17.666  206.169 1.00 110.06 ? 191 LYS D NZ  1 
ATOM   6311  N  N   . ASP D 1 82  ? 98.220  11.140  210.064 1.00 96.72  ? 192 ASP D N   1 
ATOM   6312  C  CA  . ASP D 1 82  ? 97.645  10.495  211.243 1.00 97.63  ? 192 ASP D CA  1 
ATOM   6313  C  C   . ASP D 1 82  ? 96.996  11.504  212.183 1.00 94.75  ? 192 ASP D C   1 
ATOM   6314  O  O   . ASP D 1 82  ? 97.648  12.441  212.649 1.00 96.99  ? 192 ASP D O   1 
ATOM   6315  C  CB  . ASP D 1 82  ? 98.710  9.683   211.993 1.00 102.63 ? 192 ASP D CB  1 
ATOM   6316  C  CG  . ASP D 1 82  ? 98.124  8.860   213.144 1.00 106.49 ? 192 ASP D CG  1 
ATOM   6317  O  OD1 . ASP D 1 82  ? 97.076  8.200   212.948 1.00 106.98 ? 192 ASP D OD1 1 
ATOM   6318  O  OD2 . ASP D 1 82  ? 98.720  8.867   214.246 1.00 107.14 ? 192 ASP D OD2 1 
ATOM   6319  N  N   . LEU D 1 83  ? 95.706  11.298  212.446 1.00 92.82  ? 193 LEU D N   1 
ATOM   6320  C  CA  . LEU D 1 83  ? 94.924  12.169  213.323 1.00 91.45  ? 193 LEU D CA  1 
ATOM   6321  C  C   . LEU D 1 83  ? 95.032  13.635  212.905 1.00 92.80  ? 193 LEU D C   1 
ATOM   6322  O  O   . LEU D 1 83  ? 94.717  14.352  214.226 1.00 115.92 ? 193 LEU D O   1 
ATOM   6323  C  CB  . LEU D 1 83  ? 95.346  11.996  214.793 1.00 87.77  ? 193 LEU D CB  1 
ATOM   6324  C  CG  . LEU D 1 83  ? 94.710  10.884  215.638 1.00 85.14  ? 193 LEU D CG  1 
ATOM   6325  C  CD1 . LEU D 1 83  ? 94.810  9.530   214.955 1.00 84.43  ? 193 LEU D CD1 1 
ATOM   6326  C  CD2 . LEU D 1 83  ? 95.391  10.848  216.998 1.00 85.98  ? 193 LEU D CD2 1 
ATOM   6327  N  N   . LYS E 2 15  ? 106.150 16.840  230.149 1.00 123.57 ? 148 LYS E N   1 
ATOM   6328  C  CA  . LYS E 2 15  ? 105.687 16.043  231.328 1.00 123.82 ? 148 LYS E CA  1 
ATOM   6329  C  C   . LYS E 2 15  ? 104.852 14.818  230.918 1.00 126.40 ? 148 LYS E C   1 
ATOM   6330  O  O   . LYS E 2 15  ? 104.651 14.579  229.722 1.00 126.09 ? 148 LYS E O   1 
ATOM   6331  C  CB  . LYS E 2 15  ? 104.896 16.938  232.290 1.00 120.57 ? 148 LYS E CB  1 
ATOM   6332  C  CG  . LYS E 2 15  ? 105.712 18.066  232.922 1.00 116.44 ? 148 LYS E CG  1 
ATOM   6333  C  CD  . LYS E 2 15  ? 104.849 18.902  233.863 1.00 113.07 ? 148 LYS E CD  1 
ATOM   6334  C  CE  . LYS E 2 15  ? 105.643 20.009  234.545 1.00 109.88 ? 148 LYS E CE  1 
ATOM   6335  N  NZ  . LYS E 2 15  ? 104.774 20.867  235.412 1.00 105.97 ? 148 LYS E NZ  1 
ATOM   6336  N  N   . HIS E 2 16  ? 104.388 14.054  231.916 1.00 130.06 ? 149 HIS E N   1 
ATOM   6337  C  CA  . HIS E 2 16  ? 103.580 12.836  231.719 1.00 133.35 ? 149 HIS E CA  1 
ATOM   6338  C  C   . HIS E 2 16  ? 102.513 12.990  230.629 1.00 132.63 ? 149 HIS E C   1 
ATOM   6339  O  O   . HIS E 2 16  ? 101.357 13.325  230.918 1.00 129.74 ? 149 HIS E O   1 
ATOM   6340  C  CB  . HIS E 2 16  ? 102.896 12.407  233.033 1.00 136.23 ? 149 HIS E CB  1 
ATOM   6341  C  CG  . HIS E 2 16  ? 103.829 11.857  234.073 1.00 139.57 ? 149 HIS E CG  1 
ATOM   6342  N  ND1 . HIS E 2 16  ? 103.401 11.019  235.082 1.00 140.74 ? 149 HIS E ND1 1 
ATOM   6343  C  CD2 . HIS E 2 16  ? 105.156 12.041  234.279 1.00 140.81 ? 149 HIS E CD2 1 
ATOM   6344  C  CE1 . HIS E 2 16  ? 104.421 10.712  235.864 1.00 140.84 ? 149 HIS E CE1 1 
ATOM   6345  N  NE2 . HIS E 2 16  ? 105.498 11.320  235.399 1.00 141.73 ? 149 HIS E NE2 1 
ATOM   6346  N  N   . GLN E 2 17  ? 102.908 12.687  229.389 1.00 134.37 ? 150 GLN E N   1 
ATOM   6347  C  CA  . GLN E 2 17  ? 102.042 12.788  228.209 1.00 134.99 ? 150 GLN E CA  1 
ATOM   6348  C  C   . GLN E 2 17  ? 101.486 14.212  228.080 1.00 134.51 ? 150 GLN E C   1 
ATOM   6349  O  O   . GLN E 2 17  ? 100.344 14.480  228.473 1.00 135.54 ? 150 GLN E O   1 
ATOM   6350  C  CB  . GLN E 2 17  ? 100.887 11.772  228.271 1.00 136.29 ? 150 GLN E CB  1 
ATOM   6351  C  CG  . GLN E 2 17  ? 101.281 10.325  228.581 1.00 138.34 ? 150 GLN E CG  1 
ATOM   6352  C  CD  . GLN E 2 17  ? 101.318 10.023  230.079 1.00 140.55 ? 150 GLN E CD  1 
ATOM   6353  O  OE1 . GLN E 2 17  ? 102.270 9.421   230.579 1.00 141.10 ? 150 GLN E OE1 1 
ATOM   6354  N  NE2 . GLN E 2 17  ? 100.279 10.445  230.798 1.00 142.65 ? 150 GLN E NE2 1 
ATOM   6355  N  N   . LEU E 2 18  ? 102.300 15.122  227.545 1.00 132.75 ? 151 LEU E N   1 
ATOM   6356  C  CA  . LEU E 2 18  ? 101.893 16.517  227.379 1.00 130.76 ? 151 LEU E CA  1 
ATOM   6357  C  C   . LEU E 2 18  ? 100.651 16.703  226.509 1.00 127.57 ? 151 LEU E C   1 
ATOM   6358  O  O   . LEU E 2 18  ? 100.012 17.761  226.554 1.00 128.06 ? 151 LEU E O   1 
ATOM   6359  C  CB  . LEU E 2 18  ? 103.051 17.360  226.836 1.00 129.94 ? 151 LEU E CB  1 
ATOM   6360  C  CG  . LEU E 2 18  ? 104.128 17.786  227.840 1.00 129.36 ? 151 LEU E CG  1 
ATOM   6361  C  CD1 . LEU E 2 18  ? 105.227 18.563  227.124 1.00 128.90 ? 151 LEU E CD1 1 
ATOM   6362  C  CD2 . LEU E 2 18  ? 103.513 18.634  228.951 1.00 128.35 ? 151 LEU E CD2 1 
ATOM   6363  N  N   . TYR E 2 19  ? 100.312 15.670  225.735 1.00 122.65 ? 152 TYR E N   1 
ATOM   6364  C  CA  . TYR E 2 19  ? 99.145  15.682  224.850 1.00 118.21 ? 152 TYR E CA  1 
ATOM   6365  C  C   . TYR E 2 19  ? 99.000  17.000  224.085 1.00 114.22 ? 152 TYR E C   1 
ATOM   6366  O  O   . TYR E 2 19  ? 98.107  17.805  224.371 1.00 113.93 ? 152 TYR E O   1 
ATOM   6367  C  CB  . TYR E 2 19  ? 97.862  15.393  225.645 1.00 118.80 ? 152 TYR E CB  1 
ATOM   6368  C  CG  . TYR E 2 19  ? 97.664  13.949  226.061 1.00 117.84 ? 152 TYR E CG  1 
ATOM   6369  C  CD1 . TYR E 2 19  ? 98.550  12.953  225.654 1.00 117.36 ? 152 TYR E CD1 1 
ATOM   6370  C  CD2 . TYR E 2 19  ? 96.574  13.579  226.851 1.00 118.09 ? 152 TYR E CD2 1 
ATOM   6371  C  CE1 . TYR E 2 19  ? 98.356  11.622  226.022 1.00 118.50 ? 152 TYR E CE1 1 
ATOM   6372  C  CE2 . TYR E 2 19  ? 96.370  12.253  227.226 1.00 119.28 ? 152 TYR E CE2 1 
ATOM   6373  C  CZ  . TYR E 2 19  ? 97.264  11.279  226.808 1.00 119.90 ? 152 TYR E CZ  1 
ATOM   6374  O  OH  . TYR E 2 19  ? 97.070  9.966   227.179 1.00 120.02 ? 152 TYR E OH  1 
ATOM   6375  N  N   . ILE E 2 20  ? 99.890  17.225  223.124 1.00 109.05 ? 153 ILE E N   1 
ATOM   6376  C  CA  . ILE E 2 20  ? 99.855  18.449  222.333 1.00 102.16 ? 153 ILE E CA  1 
ATOM   6377  C  C   . ILE E 2 20  ? 98.926  18.325  221.117 1.00 95.90  ? 153 ILE E C   1 
ATOM   6378  O  O   . ILE E 2 20  ? 99.313  18.581  219.971 1.00 92.56  ? 153 ILE E O   1 
ATOM   6379  C  CB  . ILE E 2 20  ? 101.290 18.902  221.935 1.00 103.56 ? 153 ILE E CB  1 
ATOM   6380  C  CG1 . ILE E 2 20  ? 102.169 19.010  223.190 1.00 103.20 ? 153 ILE E CG1 1 
ATOM   6381  C  CG2 . ILE E 2 20  ? 101.259 20.264  221.246 1.00 104.20 ? 153 ILE E CG2 1 
ATOM   6382  C  CD1 . ILE E 2 20  ? 101.656 20.001  224.227 1.00 103.75 ? 153 ILE E CD1 1 
ATOM   6383  N  N   . ASP E 2 21  ? 97.695  17.891  221.381 1.00 93.10  ? 154 ASP E N   1 
ATOM   6384  C  CA  . ASP E 2 21  ? 96.689  17.775  220.333 1.00 91.94  ? 154 ASP E CA  1 
ATOM   6385  C  C   . ASP E 2 21  ? 96.107  19.176  220.143 1.00 92.06  ? 154 ASP E C   1 
ATOM   6386  O  O   . ASP E 2 21  ? 94.941  19.351  219.785 1.00 90.48  ? 154 ASP E O   1 
ATOM   6387  C  CB  . ASP E 2 21  ? 95.595  16.761  220.697 1.00 93.09  ? 154 ASP E CB  1 
ATOM   6388  C  CG  . ASP E 2 21  ? 96.076  15.314  220.610 1.00 91.96  ? 154 ASP E CG  1 
ATOM   6389  O  OD1 . ASP E 2 21  ? 97.010  14.950  221.361 1.00 93.66  ? 154 ASP E OD1 1 
ATOM   6390  O  OD2 . ASP E 2 21  ? 95.515  14.539  219.798 1.00 86.24  ? 154 ASP E OD2 1 
ATOM   6391  N  N   . GLU E 2 22  ? 96.927  20.165  220.491 1.00 94.61  ? 155 GLU E N   1 
ATOM   6392  C  CA  . GLU E 2 22  ? 96.599  21.572  220.329 1.00 98.71  ? 155 GLU E CA  1 
ATOM   6393  C  C   . GLU E 2 22  ? 97.175  21.916  218.959 1.00 99.46  ? 155 GLU E C   1 
ATOM   6394  O  O   . GLU E 2 22  ? 96.868  22.967  218.387 1.00 101.93 ? 155 GLU E O   1 
ATOM   6395  C  CB  . GLU E 2 22  ? 97.254  22.429  221.423 1.00 101.50 ? 155 GLU E CB  1 
ATOM   6396  C  CG  . GLU E 2 22  ? 98.781  22.570  221.329 1.00 103.64 ? 155 GLU E CG  1 
ATOM   6397  C  CD  . GLU E 2 22  ? 99.251  23.963  220.891 1.00 104.72 ? 155 GLU E CD  1 
ATOM   6398  O  OE1 . GLU E 2 22  ? 98.529  24.647  220.135 1.00 102.39 ? 155 GLU E OE1 1 
ATOM   6399  O  OE2 . GLU E 2 22  ? 100.356 24.376  221.302 1.00 107.02 ? 155 GLU E OE2 1 
ATOM   6400  N  N   . THR E 2 23  ? 98.057  21.034  218.476 1.00 97.44  ? 156 THR E N   1 
ATOM   6401  C  CA  . THR E 2 23  ? 98.677  21.162  217.156 1.00 93.64  ? 156 THR E CA  1 
ATOM   6402  C  C   . THR E 2 23  ? 97.559  20.768  216.200 1.00 89.40  ? 156 THR E C   1 
ATOM   6403  O  O   . THR E 2 23  ? 97.559  21.129  215.019 1.00 90.36  ? 156 THR E O   1 
ATOM   6404  C  CB  . THR E 2 23  ? 99.854  20.179  216.973 1.00 92.37  ? 156 THR E CB  1 
ATOM   6405  O  OG1 . THR E 2 23  ? 100.679 20.195  218.145 1.00 90.93  ? 156 THR E OG1 1 
ATOM   6406  C  CG2 . THR E 2 23  ? 100.699 20.579  215.754 1.00 91.54  ? 156 THR E CG2 1 
ATOM   6407  N  N   . VAL E 2 24  ? 96.614  20.008  216.751 1.00 82.33  ? 157 VAL E N   1 
ATOM   6408  C  CA  . VAL E 2 24  ? 95.433  19.553  216.046 1.00 77.52  ? 157 VAL E CA  1 
ATOM   6409  C  C   . VAL E 2 24  ? 94.588  20.793  215.708 1.00 77.57  ? 157 VAL E C   1 
ATOM   6410  O  O   . VAL E 2 24  ? 93.846  20.789  214.733 1.00 78.97  ? 157 VAL E O   1 
ATOM   6411  C  CB  . VAL E 2 24  ? 94.656  18.526  216.917 1.00 73.66  ? 157 VAL E CB  1 
ATOM   6412  C  CG1 . VAL E 2 24  ? 93.298  18.259  216.353 1.00 70.89  ? 157 VAL E CG1 1 
ATOM   6413  C  CG2 . VAL E 2 24  ? 95.440  17.208  217.008 1.00 71.00  ? 157 VAL E CG2 1 
ATOM   6414  N  N   . ASN E 2 25  ? 94.769  21.868  216.480 1.00 78.76  ? 158 ASN E N   1 
ATOM   6415  C  CA  . ASN E 2 25  ? 94.070  23.145  216.269 1.00 79.54  ? 158 ASN E CA  1 
ATOM   6416  C  C   . ASN E 2 25  ? 94.728  23.972  215.172 1.00 78.38  ? 158 ASN E C   1 
ATOM   6417  O  O   . ASN E 2 25  ? 94.512  25.178  215.064 1.00 75.93  ? 158 ASN E O   1 
ATOM   6418  C  CB  . ASN E 2 25  ? 94.050  23.972  217.548 1.00 83.86  ? 158 ASN E CB  1 
ATOM   6419  C  CG  . ASN E 2 25  ? 93.224  23.335  218.626 1.00 88.71  ? 158 ASN E CG  1 
ATOM   6420  O  OD1 . ASN E 2 25  ? 92.053  23.007  218.418 1.00 92.36  ? 158 ASN E OD1 1 
ATOM   6421  N  ND2 . ASN E 2 25  ? 93.829  23.144  219.791 1.00 88.70  ? 158 ASN E ND2 1 
ATOM   6422  N  N   . SER E 2 26  ? 95.575  23.311  214.399 1.00 81.23  ? 159 SER E N   1 
ATOM   6423  C  CA  . SER E 2 26  ? 96.288  23.906  213.279 1.00 83.27  ? 159 SER E CA  1 
ATOM   6424  C  C   . SER E 2 26  ? 96.278  22.795  212.244 1.00 83.71  ? 159 SER E C   1 
ATOM   6425  O  O   . SER E 2 26  ? 96.308  23.041  211.036 1.00 83.10  ? 159 SER E O   1 
ATOM   6426  C  CB  . SER E 2 26  ? 97.729  24.225  213.677 1.00 85.80  ? 159 SER E CB  1 
ATOM   6427  O  OG  . SER E 2 26  ? 97.761  25.028  214.847 1.00 87.84  ? 159 SER E OG  1 
ATOM   6428  N  N   . ASN E 2 27  ? 96.187  21.568  212.761 1.00 83.78  ? 160 ASN E N   1 
ATOM   6429  C  CA  . ASN E 2 27  ? 96.155  20.344  211.978 1.00 82.47  ? 160 ASN E CA  1 
ATOM   6430  C  C   . ASN E 2 27  ? 94.799  20.201  211.308 1.00 83.61  ? 160 ASN E C   1 
ATOM   6431  O  O   . ASN E 2 27  ? 94.714  20.198  210.082 1.00 88.04  ? 160 ASN E O   1 
ATOM   6432  C  CB  . ASN E 2 27  ? 96.419  19.148  212.886 1.00 81.72  ? 160 ASN E CB  1 
ATOM   6433  C  CG  . ASN E 2 27  ? 96.819  17.922  212.119 1.00 84.84  ? 160 ASN E CG  1 
ATOM   6434  O  OD1 . ASN E 2 27  ? 97.991  17.752  211.770 1.00 86.19  ? 160 ASN E OD1 1 
ATOM   6435  N  ND2 . ASN E 2 27  ? 95.849  17.058  211.834 1.00 86.70  ? 160 ASN E ND2 1 
ATOM   6436  N  N   . ILE E 2 28  ? 93.742  20.106  212.113 1.00 79.23  ? 161 ILE E N   1 
ATOM   6437  C  CA  . ILE E 2 28  ? 92.382  19.984  211.594 1.00 79.78  ? 161 ILE E CA  1 
ATOM   6438  C  C   . ILE E 2 28  ? 91.979  21.116  210.652 1.00 79.33  ? 161 ILE E C   1 
ATOM   6439  O  O   . ILE E 2 28  ? 91.394  20.869  209.592 1.00 76.91  ? 161 ILE E O   1 
ATOM   6440  C  CB  . ILE E 2 28  ? 91.349  19.884  212.721 1.00 81.57  ? 161 ILE E CB  1 
ATOM   6441  C  CG1 . ILE E 2 28  ? 91.549  18.581  213.487 1.00 83.38  ? 161 ILE E CG1 1 
ATOM   6442  C  CG2 . ILE E 2 28  ? 89.936  19.948  212.158 1.00 82.51  ? 161 ILE E CG2 1 
ATOM   6443  C  CD1 . ILE E 2 28  ? 91.504  17.342  212.615 1.00 84.44  ? 161 ILE E CD1 1 
ATOM   6444  N  N   . PRO E 2 29  ? 92.265  22.370  211.032 1.00 79.92  ? 162 PRO E N   1 
ATOM   6445  C  CA  . PRO E 2 29  ? 91.931  23.530  210.209 1.00 84.69  ? 162 PRO E CA  1 
ATOM   6446  C  C   . PRO E 2 29  ? 92.387  23.390  208.761 1.00 88.54  ? 162 PRO E C   1 
ATOM   6447  O  O   . PRO E 2 29  ? 91.585  23.553  207.841 1.00 91.25  ? 162 PRO E O   1 
ATOM   6448  C  CB  . PRO E 2 29  ? 92.666  24.655  210.923 1.00 81.51  ? 162 PRO E CB  1 
ATOM   6449  C  CG  . PRO E 2 29  ? 92.490  24.283  212.321 1.00 82.56  ? 162 PRO E CG  1 
ATOM   6450  C  CD  . PRO E 2 29  ? 92.841  22.818  212.307 1.00 80.84  ? 162 PRO E CD  1 
ATOM   6451  N  N   . THR E 2 30  ? 93.665  23.079  208.561 1.00 89.95  ? 163 THR E N   1 
ATOM   6452  C  CA  . THR E 2 30  ? 94.192  22.912  207.212 1.00 89.30  ? 163 THR E CA  1 
ATOM   6453  C  C   . THR E 2 30  ? 93.576  21.688  206.561 1.00 87.12  ? 163 THR E C   1 
ATOM   6454  O  O   . THR E 2 30  ? 93.107  21.761  205.424 1.00 85.44  ? 163 THR E O   1 
ATOM   6455  C  CB  . THR E 2 30  ? 95.712  22.750  207.201 1.00 90.00  ? 163 THR E CB  1 
ATOM   6456  O  OG1 . THR E 2 30  ? 96.079  21.597  207.972 1.00 85.97  ? 163 THR E OG1 1 
ATOM   6457  C  CG2 . THR E 2 30  ? 96.371  23.991  207.766 1.00 93.13  ? 163 THR E CG2 1 
ATOM   6458  N  N   . ASN E 2 31  ? 93.544  20.573  207.289 1.00 81.82  ? 164 ASN E N   1 
ATOM   6459  C  CA  . ASN E 2 31  ? 92.973  19.361  206.733 1.00 81.70  ? 164 ASN E CA  1 
ATOM   6460  C  C   . ASN E 2 31  ? 91.463  19.465  206.585 1.00 84.69  ? 164 ASN E C   1 
ATOM   6461  O  O   . ASN E 2 31  ? 90.778  18.463  206.391 1.00 91.53  ? 164 ASN E O   1 
ATOM   6462  C  CB  . ASN E 2 31  ? 93.385  18.111  207.525 1.00 80.71  ? 164 ASN E CB  1 
ATOM   6463  C  CG  . ASN E 2 31  ? 92.762  18.039  208.910 1.00 83.48  ? 164 ASN E CG  1 
ATOM   6464  O  OD1 . ASN E 2 31  ? 93.461  17.772  209.895 1.00 85.99  ? 164 ASN E OD1 1 
ATOM   6465  N  ND2 . ASN E 2 31  ? 91.443  18.231  208.994 1.00 82.77  ? 164 ASN E ND2 1 
ATOM   6466  N  N   . LEU E 2 32  ? 90.943  20.676  206.744 1.00 79.95  ? 165 LEU E N   1 
ATOM   6467  C  CA  . LEU E 2 32  ? 89.521  20.919  206.577 1.00 78.37  ? 165 LEU E CA  1 
ATOM   6468  C  C   . LEU E 2 32  ? 89.317  21.986  205.509 1.00 80.08  ? 165 LEU E C   1 
ATOM   6469  O  O   . LEU E 2 32  ? 88.220  22.143  204.977 1.00 83.21  ? 165 LEU E O   1 
ATOM   6470  C  CB  . LEU E 2 32  ? 88.865  21.330  207.887 1.00 74.23  ? 165 LEU E CB  1 
ATOM   6471  C  CG  . LEU E 2 32  ? 87.732  20.365  208.225 1.00 74.35  ? 165 LEU E CG  1 
ATOM   6472  C  CD1 . LEU E 2 32  ? 88.303  18.965  208.405 1.00 72.74  ? 165 LEU E CD1 1 
ATOM   6473  C  CD2 . LEU E 2 32  ? 86.999  20.817  209.474 1.00 73.27  ? 165 LEU E CD2 1 
ATOM   6474  N  N   . ARG E 2 33  ? 90.388  22.715  205.202 1.00 80.30  ? 166 ARG E N   1 
ATOM   6475  C  CA  . ARG E 2 33  ? 90.366  23.752  204.170 1.00 84.22  ? 166 ARG E CA  1 
ATOM   6476  C  C   . ARG E 2 33  ? 90.268  23.033  202.821 1.00 79.90  ? 166 ARG E C   1 
ATOM   6477  O  O   . ARG E 2 33  ? 89.650  23.525  201.871 1.00 78.57  ? 166 ARG E O   1 
ATOM   6478  C  CB  . ARG E 2 33  ? 91.661  24.571  204.219 1.00 91.24  ? 166 ARG E CB  1 
ATOM   6479  C  CG  . ARG E 2 33  ? 91.745  25.687  203.182 1.00 99.60  ? 166 ARG E CG  1 
ATOM   6480  C  CD  . ARG E 2 33  ? 93.096  26.396  203.223 1.00 105.54 ? 166 ARG E CD  1 
ATOM   6481  N  NE  . ARG E 2 33  ? 93.075  27.653  202.474 1.00 111.75 ? 166 ARG E NE  1 
ATOM   6482  C  CZ  . ARG E 2 33  ? 92.947  28.861  203.025 1.00 116.09 ? 166 ARG E CZ  1 
ATOM   6483  N  NH1 . ARG E 2 33  ? 92.832  28.991  204.344 1.00 116.90 ? 166 ARG E NH1 1 
ATOM   6484  N  NH2 . ARG E 2 33  ? 92.911  29.944  202.254 1.00 117.25 ? 166 ARG E NH2 1 
ATOM   6485  N  N   . VAL E 2 34  ? 90.836  21.800  202.639 1.00 75.36  ? 167 VAL E N   1 
ATOM   6486  C  CA  . VAL E 2 34  ? 90.723  21.039  201.408 1.00 71.23  ? 167 VAL E CA  1 
ATOM   6487  C  C   . VAL E 2 34  ? 89.369  20.363  201.342 1.00 70.75  ? 167 VAL E C   1 
ATOM   6488  O  O   . VAL E 2 34  ? 88.616  20.592  200.396 1.00 71.64  ? 167 VAL E O   1 
ATOM   6489  C  CB  . VAL E 2 34  ? 91.833  19.959  201.255 1.00 69.20  ? 167 VAL E CB  1 
ATOM   6490  C  CG1 . VAL E 2 34  ? 93.157  20.619  200.886 1.00 66.91  ? 167 VAL E CG1 1 
ATOM   6491  C  CG2 . VAL E 2 34  ? 91.976  19.124  202.527 1.00 63.50  ? 167 VAL E CG2 1 
ATOM   6492  N  N   . LEU E 2 35  ? 89.161  19.602  202.462 1.00 69.32  ? 168 LEU E N   1 
ATOM   6493  C  CA  . LEU E 2 35  ? 87.892  18.865  202.461 1.00 72.45  ? 168 LEU E CA  1 
ATOM   6494  C  C   . LEU E 2 35  ? 86.669  19.716  202.089 1.00 71.05  ? 168 LEU E C   1 
ATOM   6495  O  O   . LEU E 2 35  ? 85.634  19.193  201.673 1.00 70.32  ? 168 LEU E O   1 
ATOM   6496  C  CB  . LEU E 2 35  ? 87.688  18.151  203.808 1.00 78.17  ? 168 LEU E CB  1 
ATOM   6497  C  CG  . LEU E 2 35  ? 86.763  16.920  203.851 1.00 81.87  ? 168 LEU E CG  1 
ATOM   6498  C  CD1 . LEU E 2 35  ? 87.326  15.842  204.783 1.00 79.89  ? 168 LEU E CD1 1 
ATOM   6499  C  CD2 . LEU E 2 35  ? 85.351  17.326  204.262 1.00 82.20  ? 168 LEU E CD2 1 
ATOM   6500  N  N   . ARG E 2 36  ? 86.785  21.028  202.228 1.00 73.80  ? 169 ARG E N   1 
ATOM   6501  C  CA  . ARG E 2 36  ? 85.679  21.888  201.866 1.00 78.51  ? 169 ARG E CA  1 
ATOM   6502  C  C   . ARG E 2 36  ? 85.806  22.196  200.379 1.00 78.67  ? 169 ARG E C   1 
ATOM   6503  O  O   . ARG E 2 36  ? 84.945  21.807  199.591 1.00 83.27  ? 169 ARG E O   1 
ATOM   6504  C  CB  . ARG E 2 36  ? 85.690  23.176  202.686 1.00 84.32  ? 169 ARG E CB  1 
ATOM   6505  C  CG  . ARG E 2 36  ? 84.451  24.039  202.469 1.00 93.33  ? 169 ARG E CG  1 
ATOM   6506  C  CD  . ARG E 2 36  ? 84.531  25.354  203.230 1.00 99.35  ? 169 ARG E CD  1 
ATOM   6507  N  NE  . ARG E 2 36  ? 83.354  26.200  203.024 1.00 104.98 ? 169 ARG E NE  1 
ATOM   6508  C  CZ  . ARG E 2 36  ? 83.305  27.235  202.187 1.00 109.38 ? 169 ARG E CZ  1 
ATOM   6509  N  NH1 . ARG E 2 36  ? 84.372  27.563  201.463 1.00 113.04 ? 169 ARG E NH1 1 
ATOM   6510  N  NH2 . ARG E 2 36  ? 82.192  27.956  202.084 1.00 110.25 ? 169 ARG E NH2 1 
ATOM   6511  N  N   . SER E 2 37  ? 86.925  22.818  200.000 1.00 74.39  ? 170 SER E N   1 
ATOM   6512  C  CA  . SER E 2 37  ? 87.219  23.207  198.611 1.00 73.81  ? 170 SER E CA  1 
ATOM   6513  C  C   . SER E 2 37  ? 86.835  22.177  197.542 1.00 70.14  ? 170 SER E C   1 
ATOM   6514  O  O   . SER E 2 37  ? 86.416  22.531  196.437 1.00 68.06  ? 170 SER E O   1 
ATOM   6515  C  CB  . SER E 2 37  ? 88.710  23.531  198.460 1.00 81.02  ? 170 SER E CB  1 
ATOM   6516  O  OG  . SER E 2 37  ? 89.506  22.350  198.490 1.00 83.26  ? 170 SER E OG  1 
ATOM   6517  N  N   . ILE E 2 38  ? 87.029  20.904  197.853 1.00 66.68  ? 171 ILE E N   1 
ATOM   6518  C  CA  . ILE E 2 38  ? 86.691  19.864  196.905 1.00 62.40  ? 171 ILE E CA  1 
ATOM   6519  C  C   . ILE E 2 38  ? 85.203  19.544  196.991 1.00 58.79  ? 171 ILE E C   1 
ATOM   6520  O  O   . ILE E 2 38  ? 84.517  19.572  195.983 1.00 58.39  ? 171 ILE E O   1 
ATOM   6521  C  CB  . ILE E 2 38  ? 87.542  18.569  197.120 1.00 65.31  ? 171 ILE E CB  1 
ATOM   6522  C  CG1 . ILE E 2 38  ? 87.173  17.887  198.441 1.00 68.22  ? 171 ILE E CG1 1 
ATOM   6523  C  CG2 . ILE E 2 38  ? 89.033  18.903  197.113 1.00 63.60  ? 171 ILE E CG2 1 
ATOM   6524  C  CD1 . ILE E 2 38  ? 87.745  16.502  198.594 1.00 70.24  ? 171 ILE E CD1 1 
ATOM   6525  N  N   . LEU E 2 39  ? 84.701  19.312  198.203 1.00 59.41  ? 172 LEU E N   1 
ATOM   6526  C  CA  . LEU E 2 39  ? 83.302  18.964  198.401 1.00 62.96  ? 172 LEU E CA  1 
ATOM   6527  C  C   . LEU E 2 39  ? 82.375  20.037  197.854 1.00 66.08  ? 172 LEU E C   1 
ATOM   6528  O  O   . LEU E 2 39  ? 81.172  19.819  197.719 1.00 68.13  ? 172 LEU E O   1 
ATOM   6529  C  CB  . LEU E 2 39  ? 83.017  18.704  199.879 1.00 62.86  ? 172 LEU E CB  1 
ATOM   6530  C  CG  . LEU E 2 39  ? 81.674  18.044  200.213 1.00 66.85  ? 172 LEU E CG  1 
ATOM   6531  C  CD1 . LEU E 2 39  ? 81.521  16.712  199.493 1.00 67.98  ? 172 LEU E CD1 1 
ATOM   6532  C  CD2 . LEU E 2 39  ? 81.578  17.830  201.710 1.00 70.80  ? 172 LEU E CD2 1 
ATOM   6533  N  N   . GLU E 2 40  ? 82.950  21.187  197.519 1.00 67.97  ? 173 GLU E N   1 
ATOM   6534  C  CA  . GLU E 2 40  ? 82.187  22.299  196.966 1.00 70.31  ? 173 GLU E CA  1 
ATOM   6535  C  C   . GLU E 2 40  ? 82.408  22.391  195.468 1.00 65.78  ? 173 GLU E C   1 
ATOM   6536  O  O   . GLU E 2 40  ? 81.516  22.791  194.723 1.00 65.85  ? 173 GLU E O   1 
ATOM   6537  C  CB  . GLU E 2 40  ? 82.570  23.622  197.636 1.00 78.70  ? 173 GLU E CB  1 
ATOM   6538  C  CG  . GLU E 2 40  ? 82.223  23.690  199.130 1.00 84.13  ? 173 GLU E CG  1 
ATOM   6539  C  CD  . GLU E 2 40  ? 81.836  25.092  199.610 1.00 84.90  ? 173 GLU E CD  1 
ATOM   6540  O  OE1 . GLU E 2 40  ? 82.324  26.096  199.029 1.00 83.45  ? 173 GLU E OE1 1 
ATOM   6541  O  OE2 . GLU E 2 40  ? 81.037  25.180  200.579 1.00 85.25  ? 173 GLU E OE2 1 
ATOM   6542  N  N   . ASN E 2 41  ? 83.613  22.043  195.031 1.00 61.35  ? 174 ASN E N   1 
ATOM   6543  C  CA  . ASN E 2 41  ? 83.938  22.056  193.605 1.00 57.91  ? 174 ASN E CA  1 
ATOM   6544  C  C   . ASN E 2 41  ? 83.064  21.003  192.891 1.00 53.55  ? 174 ASN E C   1 
ATOM   6545  O  O   . ASN E 2 41  ? 82.770  21.122  191.703 1.00 42.44  ? 174 ASN E O   1 
ATOM   6546  C  CB  . ASN E 2 41  ? 85.420  21.737  193.412 1.00 60.08  ? 174 ASN E CB  1 
ATOM   6547  C  CG  . ASN E 2 41  ? 85.937  22.161  192.058 1.00 61.23  ? 174 ASN E CG  1 
ATOM   6548  O  OD1 . ASN E 2 41  ? 87.137  22.380  191.888 1.00 61.73  ? 174 ASN E OD1 1 
ATOM   6549  N  ND2 . ASN E 2 41  ? 85.037  22.287  191.084 1.00 60.81  ? 174 ASN E ND2 1 
ATOM   6550  N  N   . LEU E 2 42  ? 82.661  19.971  193.630 1.00 53.43  ? 175 LEU E N   1 
ATOM   6551  C  CA  . LEU E 2 42  ? 81.815  18.928  193.084 1.00 51.38  ? 175 LEU E CA  1 
ATOM   6552  C  C   . LEU E 2 42  ? 80.369  19.444  193.045 1.00 53.44  ? 175 LEU E C   1 
ATOM   6553  O  O   . LEU E 2 42  ? 79.609  19.088  192.142 1.00 50.10  ? 175 LEU E O   1 
ATOM   6554  C  CB  . LEU E 2 42  ? 81.941  17.638  193.910 1.00 51.57  ? 175 LEU E CB  1 
ATOM   6555  C  CG  . LEU E 2 42  ? 83.363  17.069  194.075 1.00 49.66  ? 175 LEU E CG  1 
ATOM   6556  C  CD1 . LEU E 2 42  ? 83.327  15.724  194.800 1.00 47.09  ? 175 LEU E CD1 1 
ATOM   6557  C  CD2 . LEU E 2 42  ? 84.055  16.930  192.718 1.00 49.43  ? 175 LEU E CD2 1 
ATOM   6558  N  N   . ARG E 2 43  ? 80.226  20.146  193.914 1.00 50.63  ? 176 ARG E N   1 
ATOM   6559  C  CA  . ARG E 2 43  ? 78.908  20.738  194.040 1.00 49.03  ? 176 ARG E CA  1 
ATOM   6560  C  C   . ARG E 2 43  ? 78.648  21.679  192.865 1.00 49.61  ? 176 ARG E C   1 
ATOM   6561  O  O   . ARG E 2 43  ? 77.501  21.974  192.514 1.00 50.13  ? 176 ARG E O   1 
ATOM   6562  C  CB  . ARG E 2 43  ? 78.837  21.479  195.369 1.00 45.58  ? 176 ARG E CB  1 
ATOM   6563  C  CG  . ARG E 2 43  ? 77.468  21.941  195.754 1.00 42.56  ? 176 ARG E CG  1 
ATOM   6564  C  CD  . ARG E 2 43  ? 77.268  23.350  195.319 1.00 33.97  ? 176 ARG E CD  1 
ATOM   6565  N  NE  . ARG E 2 43  ? 76.381  24.081  196.232 1.00 60.76  ? 176 ARG E NE  1 
ATOM   6566  C  CZ  . ARG E 2 43  ? 76.479  24.102  197.581 1.00 71.22  ? 176 ARG E CZ  1 
ATOM   6567  N  NH1 . ARG E 2 43  ? 77.436  23.396  198.237 1.00 73.39  ? 176 ARG E NH1 1 
ATOM   6568  N  NH2 . ARG E 2 43  ? 75.671  24.926  198.299 1.00 79.58  ? 176 ARG E NH2 1 
ATOM   6569  N  N   . SER E 2 44  ? 79.611  22.238  192.288 1.00 48.83  ? 177 SER E N   1 
ATOM   6570  C  CA  . SER E 2 44  ? 79.625  23.070  191.095 1.00 56.47  ? 177 SER E CA  1 
ATOM   6571  C  C   . SER E 2 44  ? 79.605  22.251  189.801 1.00 55.13  ? 177 SER E C   1 
ATOM   6572  O  O   . SER E 2 44  ? 78.850  22.555  188.865 1.00 53.49  ? 177 SER E O   1 
ATOM   6573  C  CB  . SER E 2 44  ? 80.839  24.007  191.111 1.00 63.48  ? 177 SER E CB  1 
ATOM   6574  O  OG  . SER E 2 44  ? 82.066  23.298  191.055 1.00 69.44  ? 177 SER E OG  1 
ATOM   6575  N  N   . LYS E 2 45  ? 80.428  21.204  189.762 1.00 53.40  ? 178 LYS E N   1 
ATOM   6576  C  CA  . LYS E 2 45  ? 80.511  20.341  188.591 1.00 42.29  ? 178 LYS E CA  1 
ATOM   6577  C  C   . LYS E 2 45  ? 79.174  19.728  188.249 1.00 31.84  ? 178 LYS E C   1 
ATOM   6578  O  O   . LYS E 2 45  ? 78.840  19.603  187.077 1.00 36.55  ? 178 LYS E O   1 
ATOM   6579  C  CB  . LYS E 2 45  ? 81.582  19.277  188.786 1.00 43.05  ? 178 LYS E CB  1 
ATOM   6580  C  CG  . LYS E 2 45  ? 82.957  19.888  188.742 1.00 45.30  ? 178 LYS E CG  1 
ATOM   6581  C  CD  . LYS E 2 45  ? 84.035  18.895  189.070 1.00 48.39  ? 178 LYS E CD  1 
ATOM   6582  C  CE  . LYS E 2 45  ? 85.396  19.549  188.966 1.00 48.09  ? 178 LYS E CE  1 
ATOM   6583  N  NZ  . LYS E 2 45  ? 85.606  20.161  187.622 1.00 50.54  ? 178 LYS E NZ  1 
ATOM   6584  N  N   . ILE E 2 46  ? 78.383  19.403  189.262 1.00 26.80  ? 179 ILE E N   1 
ATOM   6585  C  CA  . ILE E 2 46  ? 77.068  18.835  189.017 1.00 32.71  ? 179 ILE E CA  1 
ATOM   6586  C  C   . ILE E 2 46  ? 76.188  19.775  188.206 1.00 34.20  ? 179 ILE E C   1 
ATOM   6587  O  O   . ILE E 2 46  ? 75.594  19.365  187.208 1.00 34.26  ? 179 ILE E O   1 
ATOM   6588  C  CB  . ILE E 2 46  ? 76.310  18.518  190.319 1.00 33.72  ? 179 ILE E CB  1 
ATOM   6589  C  CG1 . ILE E 2 46  ? 77.124  17.558  191.179 1.00 35.75  ? 179 ILE E CG1 1 
ATOM   6590  C  CG2 . ILE E 2 46  ? 74.932  17.915  190.002 1.00 30.53  ? 179 ILE E CG2 1 
ATOM   6591  C  CD1 . ILE E 2 46  ? 76.417  17.167  192.458 1.00 43.15  ? 179 ILE E CD1 1 
ATOM   6592  N  N   . GLN E 2 47  ? 76.130  21.039  188.609 1.00 34.84  ? 180 GLN E N   1 
ATOM   6593  C  CA  . GLN E 2 47  ? 75.278  21.966  187.900 1.00 40.49  ? 180 GLN E CA  1 
ATOM   6594  C  C   . GLN E 2 47  ? 75.587  22.061  186.420 1.00 39.03  ? 180 GLN E C   1 
ATOM   6595  O  O   . GLN E 2 47  ? 74.663  22.119  185.602 1.00 42.11  ? 180 GLN E O   1 
ATOM   6596  C  CB  . GLN E 2 47  ? 75.272  23.348  188.540 1.00 49.19  ? 180 GLN E CB  1 
ATOM   6597  C  CG  . GLN E 2 47  ? 74.063  24.195  188.113 1.00 58.93  ? 180 GLN E CG  1 
ATOM   6598  C  CD  . GLN E 2 47  ? 72.721  23.497  188.354 1.00 67.30  ? 180 GLN E CD  1 
ATOM   6599  O  OE1 . GLN E 2 47  ? 72.455  22.994  189.454 1.00 69.34  ? 180 GLN E OE1 1 
ATOM   6600  N  NE2 . GLN E 2 47  ? 71.872  23.464  187.319 1.00 67.38  ? 180 GLN E NE2 1 
ATOM   6601  N  N   . LYS E 2 48  ? 76.869  22.035  186.062 1.00 35.94  ? 181 LYS E N   1 
ATOM   6602  C  CA  . LYS E 2 48  ? 77.252  22.123  184.647 1.00 37.74  ? 181 LYS E CA  1 
ATOM   6603  C  C   . LYS E 2 48  ? 76.683  20.942  183.883 1.00 35.83  ? 181 LYS E C   1 
ATOM   6604  O  O   . LYS E 2 48  ? 75.980  21.108  182.883 1.00 32.46  ? 181 LYS E O   1 
ATOM   6605  C  CB  . LYS E 2 48  ? 78.773  22.144  184.476 1.00 36.85  ? 181 LYS E CB  1 
ATOM   6606  C  CG  . LYS E 2 48  ? 79.239  21.999  183.022 1.00 42.77  ? 181 LYS E CG  1 
ATOM   6607  C  CD  . LYS E 2 48  ? 79.040  23.281  182.143 1.00 48.81  ? 181 LYS E CD  1 
ATOM   6608  C  CE  . LYS E 2 48  ? 77.560  23.668  181.862 1.00 43.91  ? 181 LYS E CE  1 
ATOM   6609  N  NZ  . LYS E 2 48  ? 77.340  24.205  180.469 1.00 38.21  ? 181 LYS E NZ  1 
ATOM   6610  N  N   . LEU E 2 49  ? 76.991  19.752  184.384 1.00 36.58  ? 182 LEU E N   1 
ATOM   6611  C  CA  . LEU E 2 49  ? 76.523  18.514  183.794 1.00 35.53  ? 182 LEU E CA  1 
ATOM   6612  C  C   . LEU E 2 49  ? 74.995  18.499  183.740 1.00 34.11  ? 182 LEU E C   1 
ATOM   6613  O  O   . LEU E 2 49  ? 74.405  18.051  182.750 1.00 30.28  ? 182 LEU E O   1 
ATOM   6614  C  CB  . LEU E 2 49  ? 77.076  17.328  184.594 1.00 38.37  ? 182 LEU E CB  1 
ATOM   6615  C  CG  . LEU E 2 49  ? 78.619  17.248  184.694 1.00 38.34  ? 182 LEU E CG  1 
ATOM   6616  C  CD1 . LEU E 2 49  ? 79.052  16.038  185.498 1.00 38.54  ? 182 LEU E CD1 1 
ATOM   6617  C  CD2 . LEU E 2 49  ? 79.262  17.172  183.310 1.00 39.43  ? 182 LEU E CD2 1 
ATOM   6618  N  N   . GLU E 2 50  ? 74.364  19.040  184.784 1.00 30.80  ? 183 GLU E N   1 
ATOM   6619  C  CA  . GLU E 2 50  ? 72.906  19.116  184.854 1.00 31.62  ? 183 GLU E CA  1 
ATOM   6620  C  C   . GLU E 2 50  ? 72.486  19.881  183.614 1.00 29.98  ? 183 GLU E C   1 
ATOM   6621  O  O   . GLU E 2 50  ? 71.644  19.430  182.831 1.00 33.37  ? 183 GLU E O   1 
ATOM   6622  C  CB  . GLU E 2 50  ? 72.487  19.885  186.107 1.00 33.28  ? 183 GLU E CB  1 
ATOM   6623  C  CG  . GLU E 2 50  ? 71.198  19.424  186.769 1.00 43.26  ? 183 GLU E CG  1 
ATOM   6624  C  CD  . GLU E 2 50  ? 71.186  19.773  188.259 1.00 54.86  ? 183 GLU E CD  1 
ATOM   6625  O  OE1 . GLU E 2 50  ? 71.868  19.058  189.037 1.00 57.79  ? 183 GLU E OE1 1 
ATOM   6626  O  OE2 . GLU E 2 50  ? 70.523  20.770  188.655 1.00 56.20  ? 183 GLU E OE2 1 
ATOM   6627  N  N   . SER E 2 51  ? 73.170  20.996  183.398 1.00 24.80  ? 184 SER E N   1 
ATOM   6628  C  CA  . SER E 2 51  ? 72.906  21.846  182.255 1.00 29.59  ? 184 SER E CA  1 
ATOM   6629  C  C   . SER E 2 51  ? 73.209  21.132  180.938 1.00 35.94  ? 184 SER E C   1 
ATOM   6630  O  O   . SER E 2 51  ? 72.373  21.108  180.021 1.00 44.34  ? 184 SER E O   1 
ATOM   6631  C  CB  . SER E 2 51  ? 73.728  23.125  182.347 1.00 29.91  ? 184 SER E CB  1 
ATOM   6632  O  OG  . SER E 2 51  ? 73.438  23.954  181.233 1.00 34.36  ? 184 SER E OG  1 
ATOM   6633  N  N   . ASP E 2 52  ? 74.398  20.541  180.847 1.00 35.74  ? 185 ASP E N   1 
ATOM   6634  C  CA  . ASP E 2 52  ? 74.785  19.823  179.642 1.00 28.31  ? 185 ASP E CA  1 
ATOM   6635  C  C   . ASP E 2 52  ? 73.742  18.810  179.220 1.00 22.68  ? 185 ASP E C   1 
ATOM   6636  O  O   . ASP E 2 52  ? 73.349  18.786  178.057 1.00 24.74  ? 185 ASP E O   1 
ATOM   6637  C  CB  . ASP E 2 52  ? 76.142  19.160  179.824 1.00 31.30  ? 185 ASP E CB  1 
ATOM   6638  C  CG  . ASP E 2 52  ? 77.275  20.160  179.786 1.00 37.66  ? 185 ASP E CG  1 
ATOM   6639  O  OD1 . ASP E 2 52  ? 76.992  21.370  179.943 1.00 42.95  ? 185 ASP E OD1 1 
ATOM   6640  O  OD2 . ASP E 2 52  ? 78.441  19.743  179.589 1.00 37.36  ? 185 ASP E OD2 1 
ATOM   6641  N  N   . VAL E 2 53  ? 73.245  18.025  180.172 1.00 17.22  ? 186 VAL E N   1 
ATOM   6642  C  CA  . VAL E 2 53  ? 72.227  17.036  179.865 1.00 20.71  ? 186 VAL E CA  1 
ATOM   6643  C  C   . VAL E 2 53  ? 70.960  17.721  179.377 1.00 22.95  ? 186 VAL E C   1 
ATOM   6644  O  O   . VAL E 2 53  ? 70.417  17.360  178.331 1.00 24.42  ? 186 VAL E O   1 
ATOM   6645  C  CB  . VAL E 2 53  ? 71.899  16.161  181.091 1.00 27.42  ? 186 VAL E CB  1 
ATOM   6646  C  CG1 . VAL E 2 53  ? 70.733  15.198  180.777 1.00 27.66  ? 186 VAL E CG1 1 
ATOM   6647  C  CG2 . VAL E 2 53  ? 73.128  15.383  181.510 1.00 25.50  ? 186 VAL E CG2 1 
ATOM   6648  N  N   . SER E 2 54  ? 70.515  18.731  180.117 1.00 22.53  ? 187 SER E N   1 
ATOM   6649  C  CA  . SER E 2 54  ? 69.308  19.456  179.755 1.00 23.61  ? 187 SER E CA  1 
ATOM   6650  C  C   . SER E 2 54  ? 69.369  19.848  178.308 1.00 19.12  ? 187 SER E C   1 
ATOM   6651  O  O   . SER E 2 54  ? 68.507  19.457  177.516 1.00 18.46  ? 187 SER E O   1 
ATOM   6652  C  CB  . SER E 2 54  ? 69.143  20.695  180.617 1.00 31.12  ? 187 SER E CB  1 
ATOM   6653  O  OG  . SER E 2 54  ? 68.737  20.335  181.924 1.00 41.68  ? 187 SER E OG  1 
ATOM   6654  N  N   . ALA E 2 55  ? 70.441  20.540  177.951 1.00 15.39  ? 188 ALA E N   1 
ATOM   6655  C  CA  . ALA E 2 55  ? 70.637  20.987  176.576 1.00 23.54  ? 188 ALA E CA  1 
ATOM   6656  C  C   . ALA E 2 55  ? 70.481  19.839  175.563 1.00 27.90  ? 188 ALA E C   1 
ATOM   6657  O  O   . ALA E 2 55  ? 69.712  19.937  174.598 1.00 31.46  ? 188 ALA E O   1 
ATOM   6658  C  CB  . ALA E 2 55  ? 72.020  21.635  176.429 1.00 23.82  ? 188 ALA E CB  1 
ATOM   6659  N  N   . GLN E 2 56  ? 71.181  18.737  175.804 1.00 24.43  ? 189 GLN E N   1 
ATOM   6660  C  CA  . GLN E 2 56  ? 71.108  17.618  174.891 1.00 21.83  ? 189 GLN E CA  1 
ATOM   6661  C  C   . GLN E 2 56  ? 69.678  17.115  174.747 1.00 28.53  ? 189 GLN E C   1 
ATOM   6662  O  O   . GLN E 2 56  ? 69.233  16.796  173.638 1.00 31.37  ? 189 GLN E O   1 
ATOM   6663  C  CB  . GLN E 2 56  ? 72.029  16.496  175.343 1.00 18.05  ? 189 GLN E CB  1 
ATOM   6664  C  CG  . GLN E 2 56  ? 72.292  15.480  174.262 1.00 12.05  ? 189 GLN E CG  1 
ATOM   6665  C  CD  . GLN E 2 56  ? 72.763  16.113  172.971 1.00 17.81  ? 189 GLN E CD  1 
ATOM   6666  O  OE1 . GLN E 2 56  ? 72.140  15.941  171.927 1.00 20.59  ? 189 GLN E OE1 1 
ATOM   6667  N  NE2 . GLN E 2 56  ? 73.872  16.853  173.034 1.00 19.25  ? 189 GLN E NE2 1 
ATOM   6668  N  N   . MET E 2 57  ? 68.952  17.062  175.860 1.00 26.81  ? 190 MET E N   1 
ATOM   6669  C  CA  . MET E 2 57  ? 67.569  16.619  175.816 1.00 27.20  ? 190 MET E CA  1 
ATOM   6670  C  C   . MET E 2 57  ? 66.775  17.549  174.891 1.00 24.57  ? 190 MET E C   1 
ATOM   6671  O  O   . MET E 2 57  ? 65.853  17.111  174.200 1.00 31.06  ? 190 MET E O   1 
ATOM   6672  C  CB  . MET E 2 57  ? 66.965  16.608  177.219 1.00 34.65  ? 190 MET E CB  1 
ATOM   6673  C  CG  . MET E 2 57  ? 67.679  15.670  178.162 1.00 43.60  ? 190 MET E CG  1 
ATOM   6674  S  SD  . MET E 2 57  ? 66.539  14.722  179.174 1.00 51.01  ? 190 MET E SD  1 
ATOM   6675  C  CE  . MET E 2 57  ? 65.946  13.484  177.960 1.00 48.60  ? 190 MET E CE  1 
ATOM   6676  N  N   . GLU E 2 58  ? 67.135  18.830  174.880 1.00 17.85  ? 191 GLU E N   1 
ATOM   6677  C  CA  . GLU E 2 58  ? 66.456  19.778  174.024 1.00 23.96  ? 191 GLU E CA  1 
ATOM   6678  C  C   . GLU E 2 58  ? 66.843  19.459  172.600 1.00 27.18  ? 191 GLU E C   1 
ATOM   6679  O  O   . GLU E 2 58  ? 66.005  19.504  171.694 1.00 31.40  ? 191 GLU E O   1 
ATOM   6680  C  CB  . GLU E 2 58  ? 66.874  21.208  174.341 1.00 32.39  ? 191 GLU E CB  1 
ATOM   6681  C  CG  . GLU E 2 58  ? 65.730  22.094  174.795 1.00 46.64  ? 191 GLU E CG  1 
ATOM   6682  C  CD  . GLU E 2 58  ? 65.082  21.596  176.084 1.00 57.77  ? 191 GLU E CD  1 
ATOM   6683  O  OE1 . GLU E 2 58  ? 65.805  21.089  176.978 1.00 61.03  ? 191 GLU E OE1 1 
ATOM   6684  O  OE2 . GLU E 2 58  ? 63.843  21.711  176.204 1.00 61.75  ? 191 GLU E OE2 1 
ATOM   6685  N  N   . TYR E 2 59  ? 68.114  19.127  172.395 1.00 23.07  ? 192 TYR E N   1 
ATOM   6686  C  CA  . TYR E 2 59  ? 68.577  18.810  171.053 1.00 21.47  ? 192 TYR E CA  1 
ATOM   6687  C  C   . TYR E 2 59  ? 67.858  17.592  170.508 1.00 21.26  ? 192 TYR E C   1 
ATOM   6688  O  O   . TYR E 2 59  ? 67.576  17.495  169.313 1.00 23.44  ? 192 TYR E O   1 
ATOM   6689  C  CB  . TYR E 2 59  ? 70.067  18.538  171.062 1.00 24.06  ? 192 TYR E CB  1 
ATOM   6690  C  CG  . TYR E 2 59  ? 70.887  19.718  171.464 1.00 25.58  ? 192 TYR E CG  1 
ATOM   6691  C  CD1 . TYR E 2 59  ? 70.402  21.013  171.305 1.00 25.93  ? 192 TYR E CD1 1 
ATOM   6692  C  CD2 . TYR E 2 59  ? 72.163  19.545  171.989 1.00 28.02  ? 192 TYR E CD2 1 
ATOM   6693  C  CE1 . TYR E 2 59  ? 71.176  22.118  171.659 1.00 32.01  ? 192 TYR E CE1 1 
ATOM   6694  C  CE2 . TYR E 2 59  ? 72.948  20.631  172.348 1.00 34.66  ? 192 TYR E CE2 1 
ATOM   6695  C  CZ  . TYR E 2 59  ? 72.456  21.920  172.182 1.00 37.32  ? 192 TYR E CZ  1 
ATOM   6696  O  OH  . TYR E 2 59  ? 73.250  23.001  172.537 1.00 40.45  ? 192 TYR E OH  1 
ATOM   6697  N  N   . CYS E 2 60  ? 67.490  16.697  171.409 1.00 21.20  ? 193 CYS E N   1 
ATOM   6698  C  CA  . CYS E 2 60  ? 66.839  15.463  171.007 1.00 28.99  ? 193 CYS E CA  1 
ATOM   6699  C  C   . CYS E 2 60  ? 65.344  15.503  170.742 1.00 34.90  ? 193 CYS E C   1 
ATOM   6700  O  O   . CYS E 2 60  ? 64.764  14.511  170.313 1.00 41.26  ? 193 CYS E O   1 
ATOM   6701  C  CB  . CYS E 2 60  ? 67.203  14.355  171.990 1.00 28.13  ? 193 CYS E CB  1 
ATOM   6702  S  SG  . CYS E 2 60  ? 69.011  14.077  172.028 1.00 34.91  ? 193 CYS E SG  1 
ATOM   6703  N  N   . ARG E 2 61  ? 64.714  16.643  170.984 1.00 40.99  ? 194 ARG E N   1 
ATOM   6704  C  CA  . ARG E 2 61  ? 63.285  16.763  170.723 1.00 45.47  ? 194 ARG E CA  1 
ATOM   6705  C  C   . ARG E 2 61  ? 63.127  16.514  169.241 1.00 43.22  ? 194 ARG E C   1 
ATOM   6706  O  O   . ARG E 2 61  ? 62.155  15.912  168.800 1.00 43.50  ? 194 ARG E O   1 
ATOM   6707  C  CB  . ARG E 2 61  ? 62.794  18.174  171.052 1.00 53.38  ? 194 ARG E CB  1 
ATOM   6708  C  CG  . ARG E 2 61  ? 62.804  18.507  172.532 1.00 56.30  ? 194 ARG E CG  1 
ATOM   6709  C  CD  . ARG E 2 61  ? 62.420  19.965  172.773 1.00 62.28  ? 194 ARG E CD  1 
ATOM   6710  N  NE  . ARG E 2 61  ? 62.361  20.255  174.201 1.00 65.23  ? 194 ARG E NE  1 
ATOM   6711  C  CZ  . ARG E 2 61  ? 61.363  19.878  174.997 1.00 71.02  ? 194 ARG E CZ  1 
ATOM   6712  N  NH1 . ARG E 2 61  ? 60.324  19.202  174.502 1.00 74.49  ? 194 ARG E NH1 1 
ATOM   6713  N  NH2 . ARG E 2 61  ? 61.427  20.130  176.302 1.00 73.45  ? 194 ARG E NH2 1 
ATOM   6714  N  N   . THR E 2 62  ? 64.117  16.991  168.496 1.00 42.64  ? 195 THR E N   1 
ATOM   6715  C  CA  . THR E 2 62  ? 64.186  16.864  167.052 1.00 41.38  ? 195 THR E CA  1 
ATOM   6716  C  C   . THR E 2 62  ? 65.370  15.930  166.729 1.00 38.85  ? 195 THR E C   1 
ATOM   6717  O  O   . THR E 2 62  ? 66.480  16.112  167.240 1.00 37.16  ? 195 THR E O   1 
ATOM   6718  C  CB  . THR E 2 62  ? 64.315  18.275  166.393 1.00 46.66  ? 195 THR E CB  1 
ATOM   6719  O  OG1 . THR E 2 62  ? 64.924  18.166  165.103 1.00 49.36  ? 195 THR E OG1 1 
ATOM   6720  C  CG2 . THR E 2 62  ? 65.126  19.236  167.282 1.00 49.68  ? 195 THR E CG2 1 
ATOM   6721  N  N   . PRO E 2 63  ? 65.118  14.871  165.932 1.00 37.65  ? 196 PRO E N   1 
ATOM   6722  C  CA  . PRO E 2 63  ? 66.084  13.846  165.500 1.00 32.81  ? 196 PRO E CA  1 
ATOM   6723  C  C   . PRO E 2 63  ? 67.018  14.181  164.342 1.00 32.41  ? 196 PRO E C   1 
ATOM   6724  O  O   . PRO E 2 63  ? 66.865  15.205  163.671 1.00 37.33  ? 196 PRO E O   1 
ATOM   6725  C  CB  . PRO E 2 63  ? 65.172  12.689  165.095 1.00 26.46  ? 196 PRO E CB  1 
ATOM   6726  C  CG  . PRO E 2 63  ? 64.041  13.390  164.456 1.00 26.54  ? 196 PRO E CG  1 
ATOM   6727  C  CD  . PRO E 2 63  ? 63.769  14.541  165.430 1.00 33.95  ? 196 PRO E CD  1 
ATOM   6728  N  N   . CYS E 2 64  ? 67.982  13.294  164.116 1.00 25.51  ? 197 CYS E N   1 
ATOM   6729  C  CA  . CYS E 2 64  ? 68.911  13.461  163.018 1.00 26.84  ? 197 CYS E CA  1 
ATOM   6730  C  C   . CYS E 2 64  ? 68.284  12.728  161.853 1.00 25.95  ? 197 CYS E C   1 
ATOM   6731  O  O   . CYS E 2 64  ? 67.524  11.797  162.060 1.00 25.01  ? 197 CYS E O   1 
ATOM   6732  C  CB  . CYS E 2 64  ? 70.300  12.893  163.356 1.00 26.90  ? 197 CYS E CB  1 
ATOM   6733  S  SG  . CYS E 2 64  ? 70.383  11.149  163.855 1.00 30.27  ? 197 CYS E SG  1 
ATOM   6734  N  N   . THR E 2 65  ? 68.578  13.170  160.636 1.00 28.70  ? 198 THR E N   1 
ATOM   6735  C  CA  . THR E 2 65  ? 68.021  12.553  159.441 1.00 32.06  ? 198 THR E CA  1 
ATOM   6736  C  C   . THR E 2 65  ? 69.025  12.398  158.324 1.00 33.08  ? 198 THR E C   1 
ATOM   6737  O  O   . THR E 2 65  ? 70.019  13.115  158.246 1.00 40.36  ? 198 THR E O   1 
ATOM   6738  C  CB  . THR E 2 65  ? 66.883  13.390  158.854 1.00 39.07  ? 198 THR E CB  1 
ATOM   6739  O  OG1 . THR E 2 65  ? 67.322  14.749  158.717 1.00 43.62  ? 198 THR E OG1 1 
ATOM   6740  C  CG2 . THR E 2 65  ? 65.635  13.314  159.726 1.00 45.32  ? 198 THR E CG2 1 
ATOM   6741  N  N   . VAL E 2 66  ? 68.691  11.515  157.399 1.00 25.95  ? 199 VAL E N   1 
ATOM   6742  C  CA  . VAL E 2 66  ? 69.536  11.241  156.267 1.00 24.43  ? 199 VAL E CA  1 
ATOM   6743  C  C   . VAL E 2 66  ? 68.643  10.915  155.101 1.00 23.18  ? 199 VAL E C   1 
ATOM   6744  O  O   . VAL E 2 66  ? 67.519  10.460  155.296 1.00 15.78  ? 199 VAL E O   1 
ATOM   6745  C  CB  . VAL E 2 66  ? 70.406  10.007  156.510 1.00 21.06  ? 199 VAL E CB  1 
ATOM   6746  C  CG1 . VAL E 2 66  ? 71.401  10.267  157.612 1.00 18.74  ? 199 VAL E CG1 1 
ATOM   6747  C  CG2 . VAL E 2 66  ? 69.540  8.806   156.826 1.00 17.23  ? 199 VAL E CG2 1 
ATOM   6748  N  N   . SER E 2 67  ? 69.159  11.118  153.893 1.00 23.78  ? 200 SER E N   1 
ATOM   6749  C  CA  . SER E 2 67  ? 68.414  10.816  152.692 1.00 26.40  ? 200 SER E CA  1 
ATOM   6750  C  C   . SER E 2 67  ? 69.294  9.927   151.846 1.00 28.69  ? 200 SER E C   1 
ATOM   6751  O  O   . SER E 2 67  ? 69.996  10.387  150.946 1.00 33.59  ? 200 SER E O   1 
ATOM   6752  C  CB  . SER E 2 67  ? 68.041  12.097  151.974 1.00 32.27  ? 200 SER E CB  1 
ATOM   6753  O  OG  . SER E 2 67  ? 67.174  12.865  152.800 1.00 39.05  ? 200 SER E OG  1 
ATOM   6754  N  N   . CYS E 2 68  ? 69.247  8.638   152.168 1.00 22.32  ? 201 CYS E N   1 
ATOM   6755  C  CA  . CYS E 2 68  ? 70.051  7.634   151.505 1.00 21.16  ? 201 CYS E CA  1 
ATOM   6756  C  C   . CYS E 2 68  ? 69.457  7.025   150.264 1.00 25.01  ? 201 CYS E C   1 
ATOM   6757  O  O   . CYS E 2 68  ? 68.890  5.930   150.309 1.00 28.93  ? 201 CYS E O   1 
ATOM   6758  C  CB  . CYS E 2 68  ? 70.405  6.551   152.502 1.00 19.90  ? 201 CYS E CB  1 
ATOM   6759  S  SG  . CYS E 2 68  ? 71.330  7.270   153.887 1.00 25.18  ? 201 CYS E SG  1 
ATOM   6760  N  N   . ASN E 2 69  ? 69.610  7.735   149.151 1.00 21.84  ? 202 ASN E N   1 
ATOM   6761  C  CA  . ASN E 2 69  ? 69.113  7.275   147.868 1.00 21.77  ? 202 ASN E CA  1 
ATOM   6762  C  C   . ASN E 2 69  ? 69.737  5.945   147.535 1.00 22.61  ? 202 ASN E C   1 
ATOM   6763  O  O   . ASN E 2 69  ? 70.879  5.654   147.927 1.00 25.69  ? 202 ASN E O   1 
ATOM   6764  C  CB  . ASN E 2 69  ? 69.373  8.309   146.797 1.00 27.29  ? 202 ASN E CB  1 
ATOM   6765  C  CG  . ASN E 2 69  ? 68.446  9.505   146.932 1.00 30.74  ? 202 ASN E CG  1 
ATOM   6766  O  OD1 . ASN E 2 69  ? 67.272  9.349   147.281 1.00 21.68  ? 202 ASN E OD1 1 
ATOM   6767  N  ND2 . ASN E 2 69  ? 68.965  10.703  146.658 1.00 35.87  ? 202 ASN E ND2 1 
ATOM   6768  N  N   . ILE E 2 70  ? 68.978  5.133   146.816 1.00 23.83  ? 203 ILE E N   1 
ATOM   6769  C  CA  . ILE E 2 70  ? 69.421  3.786   146.530 1.00 24.27  ? 203 ILE E CA  1 
ATOM   6770  C  C   . ILE E 2 70  ? 70.030  3.488   145.182 1.00 27.97  ? 203 ILE E C   1 
ATOM   6771  O  O   . ILE E 2 70  ? 69.427  3.749   144.144 1.00 37.25  ? 203 ILE E O   1 
ATOM   6772  C  CB  . ILE E 2 70  ? 68.294  2.812   146.827 1.00 20.97  ? 203 ILE E CB  1 
ATOM   6773  C  CG1 . ILE E 2 70  ? 67.747  3.110   148.229 1.00 11.42  ? 203 ILE E CG1 1 
ATOM   6774  C  CG2 . ILE E 2 70  ? 68.808  1.388   146.739 1.00 19.78  ? 203 ILE E CG2 1 
ATOM   6775  C  CD1 . ILE E 2 70  ? 66.585  2.295   148.617 1.00 5.91   ? 203 ILE E CD1 1 
ATOM   6776  N  N   . PRO E 2 71  ? 71.246  2.928   145.189 1.00 19.75  ? 204 PRO E N   1 
ATOM   6777  C  CA  . PRO E 2 71  ? 72.010  2.559   144.004 1.00 20.99  ? 204 PRO E CA  1 
ATOM   6778  C  C   . PRO E 2 71  ? 71.206  1.584   143.178 1.00 25.16  ? 204 PRO E C   1 
ATOM   6779  O  O   . PRO E 2 71  ? 70.446  0.783   143.718 1.00 28.66  ? 204 PRO E O   1 
ATOM   6780  C  CB  . PRO E 2 71  ? 73.236  1.881   144.598 1.00 20.88  ? 204 PRO E CB  1 
ATOM   6781  C  CG  . PRO E 2 71  ? 73.438  2.612   145.852 1.00 20.96  ? 204 PRO E CG  1 
ATOM   6782  C  CD  . PRO E 2 71  ? 72.035  2.679   146.400 1.00 21.07  ? 204 PRO E CD  1 
ATOM   6783  N  N   . VAL E 2 72  ? 71.371  1.643   141.868 1.00 27.02  ? 205 VAL E N   1 
ATOM   6784  C  CA  . VAL E 2 72  ? 70.635  0.750   141.021 1.00 18.91  ? 205 VAL E CA  1 
ATOM   6785  C  C   . VAL E 2 72  ? 71.141  -0.663  141.169 1.00 19.55  ? 205 VAL E C   1 
ATOM   6786  O  O   . VAL E 2 72  ? 70.342  -1.569  141.339 1.00 23.00  ? 205 VAL E O   1 
ATOM   6787  C  CB  . VAL E 2 72  ? 70.673  1.210   139.576 1.00 20.09  ? 205 VAL E CB  1 
ATOM   6788  C  CG1 . VAL E 2 72  ? 69.954  0.216   138.679 1.00 17.71  ? 205 VAL E CG1 1 
ATOM   6789  C  CG2 . VAL E 2 72  ? 70.021  2.571   139.489 1.00 17.62  ? 205 VAL E CG2 1 
ATOM   6790  N  N   . VAL E 2 73  ? 72.454  -0.846  141.207 1.00 24.04  ? 206 VAL E N   1 
ATOM   6791  C  CA  . VAL E 2 73  ? 73.012  -2.184  141.322 1.00 22.06  ? 206 VAL E CA  1 
ATOM   6792  C  C   . VAL E 2 73  ? 72.713  -2.815  142.656 1.00 23.51  ? 206 VAL E C   1 
ATOM   6793  O  O   . VAL E 2 73  ? 72.670  -2.134  143.681 1.00 24.23  ? 206 VAL E O   1 
ATOM   6794  C  CB  . VAL E 2 73  ? 74.535  -2.193  141.185 1.00 25.62  ? 206 VAL E CB  1 
ATOM   6795  C  CG1 . VAL E 2 73  ? 75.008  -3.578  140.785 1.00 28.86  ? 206 VAL E CG1 1 
ATOM   6796  C  CG2 . VAL E 2 73  ? 74.993  -1.170  140.181 1.00 34.57  ? 206 VAL E CG2 1 
ATOM   6797  N  N   . SER E 2 74  ? 72.561  -4.134  142.634 1.00 26.83  ? 207 SER E N   1 
ATOM   6798  C  CA  . SER E 2 74  ? 72.293  -4.922  143.824 1.00 25.13  ? 207 SER E CA  1 
ATOM   6799  C  C   . SER E 2 74  ? 72.723  -6.368  143.606 1.00 25.84  ? 207 SER E C   1 
ATOM   6800  O  O   . SER E 2 74  ? 72.996  -6.785  142.486 1.00 29.42  ? 207 SER E O   1 
ATOM   6801  C  CB  . SER E 2 74  ? 70.809  -4.878  144.162 1.00 20.90  ? 207 SER E CB  1 
ATOM   6802  O  OG  . SER E 2 74  ? 70.542  -5.609  145.347 1.00 11.72  ? 207 SER E OG  1 
ATOM   6803  N  N   . GLY E 2 75  ? 72.760  -7.134  144.684 1.00 23.04  ? 208 GLY E N   1 
ATOM   6804  C  CA  . GLY E 2 75  ? 73.151  -8.521  144.589 1.00 25.65  ? 208 GLY E CA  1 
ATOM   6805  C  C   . GLY E 2 75  ? 73.070  -9.181  145.943 1.00 26.81  ? 208 GLY E C   1 
ATOM   6806  O  O   . GLY E 2 75  ? 72.629  -8.558  146.910 1.00 30.07  ? 208 GLY E O   1 
ATOM   6807  N  N   . LYS E 2 76  ? 73.481  -10.446 146.015 1.00 26.51  ? 209 LYS E N   1 
ATOM   6808  C  CA  . LYS E 2 76  ? 73.472  -11.210 147.267 1.00 28.20  ? 209 LYS E CA  1 
ATOM   6809  C  C   . LYS E 2 76  ? 74.279  -10.489 148.332 1.00 23.80  ? 209 LYS E C   1 
ATOM   6810  O  O   . LYS E 2 76  ? 73.956  -10.531 149.519 1.00 17.39  ? 209 LYS E O   1 
ATOM   6811  C  CB  . LYS E 2 76  ? 74.056  -12.613 147.061 1.00 32.44  ? 209 LYS E CB  1 
ATOM   6812  C  CG  . LYS E 2 76  ? 73.141  -13.585 146.352 1.00 39.17  ? 209 LYS E CG  1 
ATOM   6813  C  CD  . LYS E 2 76  ? 73.759  -14.965 146.339 1.00 49.67  ? 209 LYS E CD  1 
ATOM   6814  C  CE  . LYS E 2 76  ? 75.000  -15.010 145.461 1.00 59.53  ? 209 LYS E CE  1 
ATOM   6815  N  NZ  . LYS E 2 76  ? 74.675  -14.971 143.994 1.00 60.84  ? 209 LYS E NZ  1 
ATOM   6816  N  N   . GLU E 2 77  ? 75.340  -9.825  147.894 1.00 28.90  ? 210 GLU E N   1 
ATOM   6817  C  CA  . GLU E 2 77  ? 76.187  -9.092  148.808 1.00 28.59  ? 210 GLU E CA  1 
ATOM   6818  C  C   . GLU E 2 77  ? 77.173  -8.199  148.081 1.00 21.61  ? 210 GLU E C   1 
ATOM   6819  O  O   . GLU E 2 77  ? 77.183  -8.160  146.854 1.00 17.74  ? 210 GLU E O   1 
ATOM   6820  C  CB  . GLU E 2 77  ? 76.886  -10.076 149.744 1.00 31.56  ? 210 GLU E CB  1 
ATOM   6821  C  CG  . GLU E 2 77  ? 77.329  -11.337 149.050 1.00 31.61  ? 210 GLU E CG  1 
ATOM   6822  C  CD  . GLU E 2 77  ? 78.487  -11.082 148.159 1.00 39.05  ? 210 GLU E CD  1 
ATOM   6823  O  OE1 . GLU E 2 77  ? 79.458  -10.485 148.669 1.00 40.77  ? 210 GLU E OE1 1 
ATOM   6824  O  OE2 . GLU E 2 77  ? 78.417  -11.457 146.970 1.00 40.98  ? 210 GLU E OE2 1 
ATOM   6825  N  N   . CYS E 2 78  ? 77.997  -7.498  148.860 1.00 26.90  ? 211 CYS E N   1 
ATOM   6826  C  CA  . CYS E 2 78  ? 78.995  -6.571  148.340 1.00 27.17  ? 211 CYS E CA  1 
ATOM   6827  C  C   . CYS E 2 78  ? 79.805  -7.145  147.205 1.00 24.89  ? 211 CYS E C   1 
ATOM   6828  O  O   . CYS E 2 78  ? 79.828  -6.576  146.109 1.00 28.17  ? 211 CYS E O   1 
ATOM   6829  C  CB  . CYS E 2 78  ? 79.918  -6.068  149.450 1.00 27.48  ? 211 CYS E CB  1 
ATOM   6830  S  SG  . CYS E 2 78  ? 79.095  -5.041  150.722 1.00 24.83  ? 211 CYS E SG  1 
ATOM   6831  N  N   . GLU E 2 79  ? 80.429  -8.287  147.441 1.00 21.25  ? 212 GLU E N   1 
ATOM   6832  C  CA  . GLU E 2 79  ? 81.222  -8.939  146.401 1.00 27.65  ? 212 GLU E CA  1 
ATOM   6833  C  C   . GLU E 2 79  ? 80.445  -9.005  145.081 1.00 22.90  ? 212 GLU E C   1 
ATOM   6834  O  O   . GLU E 2 79  ? 80.843  -8.389  144.093 1.00 17.51  ? 212 GLU E O   1 
ATOM   6835  C  CB  . GLU E 2 79  ? 81.645  -10.343 146.865 1.00 31.80  ? 212 GLU E CB  1 
ATOM   6836  C  CG  . GLU E 2 79  ? 81.757  -11.422 145.783 1.00 36.16  ? 212 GLU E CG  1 
ATOM   6837  C  CD  . GLU E 2 79  ? 83.025  -11.304 144.962 1.00 42.15  ? 212 GLU E CD  1 
ATOM   6838  O  OE1 . GLU E 2 79  ? 83.938  -10.564 145.385 1.00 46.54  ? 212 GLU E OE1 1 
ATOM   6839  O  OE2 . GLU E 2 79  ? 83.117  -11.955 143.896 1.00 42.70  ? 212 GLU E OE2 1 
ATOM   6840  N  N   . GLU E 2 80  ? 79.299  -9.687  145.092 1.00 17.91  ? 213 GLU E N   1 
ATOM   6841  C  CA  . GLU E 2 80  ? 78.493  -9.806  143.887 1.00 14.01  ? 213 GLU E CA  1 
ATOM   6842  C  C   . GLU E 2 80  ? 78.263  -8.431  143.288 1.00 13.60  ? 213 GLU E C   1 
ATOM   6843  O  O   . GLU E 2 80  ? 78.462  -8.214  142.102 1.00 13.18  ? 213 GLU E O   1 
ATOM   6844  C  CB  . GLU E 2 80  ? 77.164  -10.485 144.165 1.00 7.30   ? 213 GLU E CB  1 
ATOM   6845  C  CG  . GLU E 2 80  ? 76.419  -10.720 142.903 1.00 15.61  ? 213 GLU E CG  1 
ATOM   6846  C  CD  . GLU E 2 80  ? 75.283  -11.686 143.052 1.00 30.45  ? 213 GLU E CD  1 
ATOM   6847  O  OE1 . GLU E 2 80  ? 74.362  -11.393 143.829 1.00 31.67  ? 213 GLU E OE1 1 
ATOM   6848  O  OE2 . GLU E 2 80  ? 75.294  -12.734 142.368 1.00 38.64  ? 213 GLU E OE2 1 
ATOM   6849  N  N   . ILE E 2 81  ? 77.923  -7.479  144.132 1.00 8.52   ? 214 ILE E N   1 
ATOM   6850  C  CA  . ILE E 2 81  ? 77.703  -6.143  143.658 1.00 13.46  ? 214 ILE E CA  1 
ATOM   6851  C  C   . ILE E 2 81  ? 78.894  -5.567  142.888 1.00 17.59  ? 214 ILE E C   1 
ATOM   6852  O  O   . ILE E 2 81  ? 78.730  -5.033  141.788 1.00 18.44  ? 214 ILE E O   1 
ATOM   6853  C  CB  . ILE E 2 81  ? 77.388  -5.237  144.798 1.00 10.19  ? 214 ILE E CB  1 
ATOM   6854  C  CG1 . ILE E 2 81  ? 76.065  -5.670  145.408 1.00 10.92  ? 214 ILE E CG1 1 
ATOM   6855  C  CG2 . ILE E 2 81  ? 77.349  -3.815  144.309 1.00 10.34  ? 214 ILE E CG2 1 
ATOM   6856  C  CD1 . ILE E 2 81  ? 75.626  -4.876  146.605 1.00 5.87   ? 214 ILE E CD1 1 
ATOM   6857  N  N   . ILE E 2 82  ? 80.088  -5.648  143.457 1.00 16.29  ? 215 ILE E N   1 
ATOM   6858  C  CA  . ILE E 2 82  ? 81.243  -5.109  142.760 1.00 16.46  ? 215 ILE E CA  1 
ATOM   6859  C  C   . ILE E 2 82  ? 81.443  -5.789  141.406 1.00 28.76  ? 215 ILE E C   1 
ATOM   6860  O  O   . ILE E 2 82  ? 81.867  -5.150  140.424 1.00 31.84  ? 215 ILE E O   1 
ATOM   6861  C  CB  . ILE E 2 82  ? 82.512  -5.223  143.598 1.00 13.06  ? 215 ILE E CB  1 
ATOM   6862  C  CG1 . ILE E 2 82  ? 83.569  -4.313  143.012 1.00 14.72  ? 215 ILE E CG1 1 
ATOM   6863  C  CG2 . ILE E 2 82  ? 83.047  -6.645  143.606 1.00 9.96   ? 215 ILE E CG2 1 
ATOM   6864  C  CD1 . ILE E 2 82  ? 84.694  -4.056  143.921 1.00 20.86  ? 215 ILE E CD1 1 
ATOM   6865  N  N   . ARG E 2 83  ? 81.129  -7.084  141.357 1.00 33.13  ? 216 ARG E N   1 
ATOM   6866  C  CA  . ARG E 2 83  ? 81.245  -7.836  140.119 1.00 34.30  ? 216 ARG E CA  1 
ATOM   6867  C  C   . ARG E 2 83  ? 80.191  -7.308  139.143 1.00 32.07  ? 216 ARG E C   1 
ATOM   6868  O  O   . ARG E 2 83  ? 80.419  -7.256  137.940 1.00 34.51  ? 216 ARG E O   1 
ATOM   6869  C  CB  . ARG E 2 83  ? 81.015  -9.329  140.357 1.00 38.94  ? 216 ARG E CB  1 
ATOM   6870  C  CG  . ARG E 2 83  ? 82.180  -10.087 140.961 1.00 49.66  ? 216 ARG E CG  1 
ATOM   6871  C  CD  . ARG E 2 83  ? 81.891  -11.611 140.992 1.00 63.61  ? 216 ARG E CD  1 
ATOM   6872  N  NE  . ARG E 2 83  ? 80.825  -11.990 141.934 1.00 72.46  ? 216 ARG E NE  1 
ATOM   6873  C  CZ  . ARG E 2 83  ? 80.235  -13.187 141.984 1.00 74.17  ? 216 ARG E CZ  1 
ATOM   6874  N  NH1 . ARG E 2 83  ? 80.595  -14.150 141.139 1.00 75.62  ? 216 ARG E NH1 1 
ATOM   6875  N  NH2 . ARG E 2 83  ? 79.294  -13.432 142.897 1.00 75.06  ? 216 ARG E NH2 1 
ATOM   6876  N  N   . LYS E 2 84  ? 79.038  -6.914  139.672 1.00 26.43  ? 217 LYS E N   1 
ATOM   6877  C  CA  . LYS E 2 84  ? 77.966  -6.407  138.837 1.00 24.23  ? 217 LYS E CA  1 
ATOM   6878  C  C   . LYS E 2 84  ? 78.170  -4.933  138.460 1.00 26.45  ? 217 LYS E C   1 
ATOM   6879  O  O   . LYS E 2 84  ? 77.212  -4.188  138.224 1.00 28.15  ? 217 LYS E O   1 
ATOM   6880  C  CB  . LYS E 2 84  ? 76.601  -6.653  139.495 1.00 24.59  ? 217 LYS E CB  1 
ATOM   6881  C  CG  . LYS E 2 84  ? 76.305  -8.126  139.743 1.00 26.84  ? 217 LYS E CG  1 
ATOM   6882  C  CD  . LYS E 2 84  ? 75.025  -8.341  140.561 1.00 33.00  ? 217 LYS E CD  1 
ATOM   6883  C  CE  . LYS E 2 84  ? 73.758  -8.133  139.717 1.00 36.88  ? 217 LYS E CE  1 
ATOM   6884  N  NZ  . LYS E 2 84  ? 72.495  -8.588  140.389 1.00 41.81  ? 217 LYS E NZ  1 
ATOM   6885  N  N   . GLY E 2 85  ? 79.428  -4.518  138.396 1.00 27.29  ? 218 GLY E N   1 
ATOM   6886  C  CA  . GLY E 2 85  ? 79.733  -3.155  138.010 1.00 28.90  ? 218 GLY E CA  1 
ATOM   6887  C  C   . GLY E 2 85  ? 79.749  -2.082  139.081 1.00 34.80  ? 218 GLY E C   1 
ATOM   6888  O  O   . GLY E 2 85  ? 80.326  -1.022  138.861 1.00 40.72  ? 218 GLY E O   1 
ATOM   6889  N  N   . GLY E 2 86  ? 79.128  -2.334  140.230 1.00 37.10  ? 219 GLY E N   1 
ATOM   6890  C  CA  . GLY E 2 86  ? 79.087  -1.330  141.295 1.00 35.02  ? 219 GLY E CA  1 
ATOM   6891  C  C   . GLY E 2 86  ? 80.452  -1.122  141.904 1.00 32.41  ? 219 GLY E C   1 
ATOM   6892  O  O   . GLY E 2 86  ? 80.953  -2.013  142.579 1.00 40.86  ? 219 GLY E O   1 
ATOM   6893  N  N   . GLU E 2 87  ? 81.036  0.056   141.737 1.00 30.85  ? 220 GLU E N   1 
ATOM   6894  C  CA  . GLU E 2 87  ? 82.378  0.246   142.246 1.00 34.01  ? 220 GLU E CA  1 
ATOM   6895  C  C   . GLU E 2 87  ? 82.663  1.352   143.228 1.00 32.40  ? 220 GLU E C   1 
ATOM   6896  O  O   . GLU E 2 87  ? 83.817  1.558   143.592 1.00 42.08  ? 220 GLU E O   1 
ATOM   6897  C  CB  . GLU E 2 87  ? 83.360  0.298   141.080 1.00 43.88  ? 220 GLU E CB  1 
ATOM   6898  C  CG  . GLU E 2 87  ? 82.922  1.203   139.940 1.00 53.74  ? 220 GLU E CG  1 
ATOM   6899  C  CD  . GLU E 2 87  ? 83.531  0.811   138.598 1.00 63.84  ? 220 GLU E CD  1 
ATOM   6900  O  OE1 . GLU E 2 87  ? 83.883  -0.376  138.395 1.00 66.19  ? 220 GLU E OE1 1 
ATOM   6901  O  OE2 . GLU E 2 87  ? 83.630  1.696   137.726 1.00 71.01  ? 220 GLU E OE2 1 
ATOM   6902  N  N   . THR E 2 88  ? 81.637  2.059   143.677 1.00 29.26  ? 221 THR E N   1 
ATOM   6903  C  CA  . THR E 2 88  ? 81.847  3.115   144.661 1.00 26.63  ? 221 THR E CA  1 
ATOM   6904  C  C   . THR E 2 88  ? 81.516  2.622   146.061 1.00 21.27  ? 221 THR E C   1 
ATOM   6905  O  O   . THR E 2 88  ? 80.598  1.842   146.243 1.00 18.42  ? 221 THR E O   1 
ATOM   6906  C  CB  . THR E 2 88  ? 81.011  4.359   144.361 1.00 28.49  ? 221 THR E CB  1 
ATOM   6907  O  OG1 . THR E 2 88  ? 79.751  3.980   143.788 1.00 29.61  ? 221 THR E OG1 1 
ATOM   6908  C  CG2 . THR E 2 88  ? 81.768  5.271   143.424 1.00 30.01  ? 221 THR E CG2 1 
ATOM   6909  N  N   . SER E 2 89  ? 82.322  3.008   147.039 1.00 22.90  ? 222 SER E N   1 
ATOM   6910  C  CA  . SER E 2 89  ? 82.075  2.602   148.417 1.00 17.21  ? 222 SER E CA  1 
ATOM   6911  C  C   . SER E 2 89  ? 80.913  3.440   148.883 1.00 14.34  ? 222 SER E C   1 
ATOM   6912  O  O   . SER E 2 89  ? 80.978  4.658   148.845 1.00 26.21  ? 222 SER E O   1 
ATOM   6913  C  CB  . SER E 2 89  ? 83.298  2.891   149.302 1.00 12.75  ? 222 SER E CB  1 
ATOM   6914  O  OG  . SER E 2 89  ? 84.402  2.085   148.960 1.00 14.91  ? 222 SER E OG  1 
ATOM   6915  N  N   . GLU E 2 90  ? 79.839  2.802   149.307 1.00 12.85  ? 223 GLU E N   1 
ATOM   6916  C  CA  . GLU E 2 90  ? 78.651  3.520   149.769 1.00 16.02  ? 223 GLU E CA  1 
ATOM   6917  C  C   . GLU E 2 90  ? 77.600  2.552   150.283 1.00 17.96  ? 223 GLU E C   1 
ATOM   6918  O  O   . GLU E 2 90  ? 77.853  1.357   150.388 1.00 23.59  ? 223 GLU E O   1 
ATOM   6919  C  CB  . GLU E 2 90  ? 78.061  4.388   148.651 1.00 12.10  ? 223 GLU E CB  1 
ATOM   6920  C  CG  . GLU E 2 90  ? 77.927  3.684   147.306 1.00 23.69  ? 223 GLU E CG  1 
ATOM   6921  C  CD  . GLU E 2 90  ? 77.052  4.433   146.307 1.00 27.57  ? 223 GLU E CD  1 
ATOM   6922  O  OE1 . GLU E 2 90  ? 75.986  4.947   146.717 1.00 25.59  ? 223 GLU E OE1 1 
ATOM   6923  O  OE2 . GLU E 2 90  ? 77.414  4.475   145.107 1.00 29.16  ? 223 GLU E OE2 1 
ATOM   6924  N  N   . MET E 2 91  ? 76.429  3.067   150.638 1.00 19.54  ? 224 MET E N   1 
ATOM   6925  C  CA  . MET E 2 91  ? 75.359  2.207   151.131 1.00 19.50  ? 224 MET E CA  1 
ATOM   6926  C  C   . MET E 2 91  ? 74.685  1.526   149.954 1.00 22.31  ? 224 MET E C   1 
ATOM   6927  O  O   . MET E 2 91  ? 74.291  2.193   149.006 1.00 29.48  ? 224 MET E O   1 
ATOM   6928  C  CB  . MET E 2 91  ? 74.326  3.015   151.897 1.00 19.26  ? 224 MET E CB  1 
ATOM   6929  C  CG  . MET E 2 91  ? 73.206  2.178   152.484 1.00 26.39  ? 224 MET E CG  1 
ATOM   6930  S  SD  . MET E 2 91  ? 71.577  2.877   152.180 1.00 28.45  ? 224 MET E SD  1 
ATOM   6931  C  CE  . MET E 2 91  ? 71.014  1.802   150.874 1.00 26.28  ? 224 MET E CE  1 
ATOM   6932  N  N   . TYR E 2 92  ? 74.607  0.198   149.991 1.00 20.66  ? 225 TYR E N   1 
ATOM   6933  C  CA  . TYR E 2 92  ? 73.975  -0.582  148.928 1.00 14.68  ? 225 TYR E CA  1 
ATOM   6934  C  C   . TYR E 2 92  ? 72.872  -1.425  149.517 1.00 13.63  ? 225 TYR E C   1 
ATOM   6935  O  O   . TYR E 2 92  ? 72.852  -1.708  150.711 1.00 17.71  ? 225 TYR E O   1 
ATOM   6936  C  CB  . TYR E 2 92  ? 74.966  -1.529  148.257 1.00 13.91  ? 225 TYR E CB  1 
ATOM   6937  C  CG  . TYR E 2 92  ? 75.937  -0.868  147.339 1.00 19.84  ? 225 TYR E CG  1 
ATOM   6938  C  CD1 . TYR E 2 92  ? 77.152  -0.378  147.820 1.00 25.48  ? 225 TYR E CD1 1 
ATOM   6939  C  CD2 . TYR E 2 92  ? 75.663  -0.741  145.982 1.00 16.76  ? 225 TYR E CD2 1 
ATOM   6940  C  CE1 . TYR E 2 92  ? 78.074  0.221   146.975 1.00 24.30  ? 225 TYR E CE1 1 
ATOM   6941  C  CE2 . TYR E 2 92  ? 76.584  -0.137  145.124 1.00 15.53  ? 225 TYR E CE2 1 
ATOM   6942  C  CZ  . TYR E 2 92  ? 77.784  0.339   145.633 1.00 18.09  ? 225 TYR E CZ  1 
ATOM   6943  O  OH  . TYR E 2 92  ? 78.693  0.948   144.815 1.00 23.46  ? 225 TYR E OH  1 
ATOM   6944  N  N   . LEU E 2 93  ? 71.969  -1.856  148.661 1.00 13.09  ? 226 LEU E N   1 
ATOM   6945  C  CA  . LEU E 2 93  ? 70.874  -2.679  149.101 1.00 17.65  ? 226 LEU E CA  1 
ATOM   6946  C  C   . LEU E 2 93  ? 71.196  -4.107  148.678 1.00 27.05  ? 226 LEU E C   1 
ATOM   6947  O  O   . LEU E 2 93  ? 71.470  -4.372  147.505 1.00 26.00  ? 226 LEU E O   1 
ATOM   6948  C  CB  . LEU E 2 93  ? 69.577  -2.190  148.455 1.00 12.26  ? 226 LEU E CB  1 
ATOM   6949  C  CG  . LEU E 2 93  ? 68.311  -2.875  148.937 1.00 18.89  ? 226 LEU E CG  1 
ATOM   6950  C  CD1 . LEU E 2 93  ? 68.297  -2.847  150.432 1.00 23.17  ? 226 LEU E CD1 1 
ATOM   6951  C  CD2 . LEU E 2 93  ? 67.112  -2.163  148.413 1.00 17.44  ? 226 LEU E CD2 1 
ATOM   6952  N  N   . ILE E 2 94  ? 71.249  -5.019  149.637 1.00 26.78  ? 227 ILE E N   1 
ATOM   6953  C  CA  . ILE E 2 94  ? 71.539  -6.390  149.273 1.00 24.19  ? 227 ILE E CA  1 
ATOM   6954  C  C   . ILE E 2 94  ? 70.438  -7.327  149.754 1.00 33.48  ? 227 ILE E C   1 
ATOM   6955  O  O   . ILE E 2 94  ? 69.605  -6.956  150.584 1.00 36.53  ? 227 ILE E O   1 
ATOM   6956  C  CB  . ILE E 2 94  ? 72.886  -6.870  149.827 1.00 8.25   ? 227 ILE E CB  1 
ATOM   6957  C  CG1 . ILE E 2 94  ? 72.832  -6.882  151.340 1.00 10.92  ? 227 ILE E CG1 1 
ATOM   6958  C  CG2 . ILE E 2 94  ? 73.997  -6.030  149.315 1.00 2.70   ? 227 ILE E CG2 1 
ATOM   6959  C  CD1 . ILE E 2 94  ? 73.920  -7.681  151.954 1.00 18.76  ? 227 ILE E CD1 1 
ATOM   6960  N  N   . GLN E 2 95  ? 70.433  -8.529  149.186 1.00 36.33  ? 228 GLN E N   1 
ATOM   6961  C  CA  . GLN E 2 95  ? 69.488  -9.585  149.523 1.00 38.48  ? 228 GLN E CA  1 
ATOM   6962  C  C   . GLN E 2 95  ? 70.239  -10.898 149.309 1.00 39.05  ? 228 GLN E C   1 
ATOM   6963  O  O   . GLN E 2 95  ? 70.401  -11.354 148.180 1.00 37.01  ? 228 GLN E O   1 
ATOM   6964  C  CB  . GLN E 2 95  ? 68.252  -9.525  148.627 1.00 38.70  ? 228 GLN E CB  1 
ATOM   6965  C  CG  . GLN E 2 95  ? 67.303  -10.686 148.837 1.00 40.59  ? 228 GLN E CG  1 
ATOM   6966  C  CD  . GLN E 2 95  ? 66.031  -10.552 148.039 1.00 42.73  ? 228 GLN E CD  1 
ATOM   6967  O  OE1 . GLN E 2 95  ? 64.952  -10.853 148.531 1.00 44.10  ? 228 GLN E OE1 1 
ATOM   6968  N  NE2 . GLN E 2 95  ? 66.149  -10.093 146.804 1.00 45.09  ? 228 GLN E NE2 1 
ATOM   6969  N  N   . PRO E 2 96  ? 70.756  -11.489 150.394 1.00 38.45  ? 229 PRO E N   1 
ATOM   6970  C  CA  . PRO E 2 96  ? 71.513  -12.742 150.390 1.00 39.26  ? 229 PRO E CA  1 
ATOM   6971  C  C   . PRO E 2 96  ? 70.683  -13.957 150.016 1.00 43.04  ? 229 PRO E C   1 
ATOM   6972  O  O   . PRO E 2 96  ? 70.942  -14.623 149.016 1.00 45.58  ? 229 PRO E O   1 
ATOM   6973  C  CB  . PRO E 2 96  ? 72.014  -12.829 151.829 1.00 36.51  ? 229 PRO E CB  1 
ATOM   6974  C  CG  . PRO E 2 96  ? 72.056  -11.383 152.274 1.00 35.43  ? 229 PRO E CG  1 
ATOM   6975  C  CD  . PRO E 2 96  ? 70.765  -10.886 151.735 1.00 36.47  ? 229 PRO E CD  1 
ATOM   6976  N  N   . ASP E 2 97  ? 69.720  -14.277 150.861 1.00 51.35  ? 230 ASP E N   1 
ATOM   6977  C  CA  . ASP E 2 97  ? 68.853  -15.406 150.608 1.00 59.96  ? 230 ASP E CA  1 
ATOM   6978  C  C   . ASP E 2 97  ? 67.626  -14.847 149.939 1.00 61.28  ? 230 ASP E C   1 
ATOM   6979  O  O   . ASP E 2 97  ? 67.054  -13.859 150.389 1.00 62.75  ? 230 ASP E O   1 
ATOM   6980  C  CB  . ASP E 2 97  ? 68.486  -16.102 151.915 1.00 67.60  ? 230 ASP E CB  1 
ATOM   6981  C  CG  . ASP E 2 97  ? 67.440  -17.187 151.736 1.00 69.16  ? 230 ASP E CG  1 
ATOM   6982  O  OD1 . ASP E 2 97  ? 67.180  -17.617 150.590 1.00 69.64  ? 230 ASP E OD1 1 
ATOM   6983  O  OD2 . ASP E 2 97  ? 66.877  -17.614 152.766 1.00 74.09  ? 230 ASP E OD2 1 
ATOM   6984  N  N   . SER E 2 98  ? 67.224  -15.505 148.862 1.00 64.31  ? 231 SER E N   1 
ATOM   6985  C  CA  . SER E 2 98  ? 66.071  -15.095 148.072 1.00 66.36  ? 231 SER E CA  1 
ATOM   6986  C  C   . SER E 2 98  ? 64.750  -15.104 148.853 1.00 64.36  ? 231 SER E C   1 
ATOM   6987  O  O   . SER E 2 98  ? 63.681  -14.988 148.264 1.00 66.01  ? 231 SER E O   1 
ATOM   6988  C  CB  . SER E 2 98  ? 65.963  -15.981 146.817 1.00 70.44  ? 231 SER E CB  1 
ATOM   6989  O  OG  . SER E 2 98  ? 67.171  -15.993 146.063 1.00 72.13  ? 231 SER E OG  1 
ATOM   6990  N  N   . SER E 2 99  ? 64.827  -15.232 150.173 1.00 62.45  ? 232 SER E N   1 
ATOM   6991  C  CA  . SER E 2 99  ? 63.632  -15.246 151.005 1.00 64.37  ? 232 SER E CA  1 
ATOM   6992  C  C   . SER E 2 99  ? 63.616  -14.033 151.933 1.00 67.06  ? 232 SER E C   1 
ATOM   6993  O  O   . SER E 2 99  ? 62.552  -13.545 152.337 1.00 70.38  ? 232 SER E O   1 
ATOM   6994  C  CB  . SER E 2 99  ? 63.578  -16.530 151.837 1.00 66.61  ? 232 SER E CB  1 
ATOM   6995  O  OG  . SER E 2 99  ? 64.462  -16.468 152.942 1.00 68.38  ? 232 SER E OG  1 
ATOM   6996  N  N   . VAL E 2 100 ? 64.810  -13.544 152.250 1.00 67.27  ? 233 VAL E N   1 
ATOM   6997  C  CA  . VAL E 2 100 ? 64.982  -12.406 153.140 1.00 64.59  ? 233 VAL E CA  1 
ATOM   6998  C  C   . VAL E 2 100 ? 64.544  -11.092 152.517 1.00 58.40  ? 233 VAL E C   1 
ATOM   6999  O  O   . VAL E 2 100 ? 64.677  -10.883 151.309 1.00 52.49  ? 233 VAL E O   1 
ATOM   7000  C  CB  . VAL E 2 100 ? 66.457  -12.263 153.571 1.00 68.78  ? 233 VAL E CB  1 
ATOM   7001  C  CG1 . VAL E 2 100 ? 66.994  -13.605 154.073 1.00 71.15  ? 233 VAL E CG1 1 
ATOM   7002  C  CG2 . VAL E 2 100 ? 67.309  -11.731 152.414 1.00 70.03  ? 233 VAL E CG2 1 
ATOM   7003  N  N   . LYS E 2 101 ? 63.967  -10.230 153.345 1.00 55.04  ? 234 LYS E N   1 
ATOM   7004  C  CA  . LYS E 2 101 ? 63.558  -8.917  152.888 1.00 52.18  ? 234 LYS E CA  1 
ATOM   7005  C  C   . LYS E 2 101 ? 64.904  -8.232  152.729 1.00 49.59  ? 234 LYS E C   1 
ATOM   7006  O  O   . LYS E 2 101 ? 65.709  -8.208  153.664 1.00 56.34  ? 234 LYS E O   1 
ATOM   7007  C  CB  . LYS E 2 101 ? 62.716  -8.218  153.959 1.00 53.69  ? 234 LYS E CB  1 
ATOM   7008  C  CG  . LYS E 2 101 ? 62.316  -6.795  153.627 1.00 59.23  ? 234 LYS E CG  1 
ATOM   7009  C  CD  . LYS E 2 101 ? 61.772  -6.677  152.209 1.00 68.45  ? 234 LYS E CD  1 
ATOM   7010  C  CE  . LYS E 2 101 ? 60.596  -7.613  151.937 1.00 73.23  ? 234 LYS E CE  1 
ATOM   7011  N  NZ  . LYS E 2 101 ? 60.259  -7.694  150.475 1.00 75.89  ? 234 LYS E NZ  1 
ATOM   7012  N  N   . PRO E 2 102 ? 65.210  -7.753  151.519 1.00 38.78  ? 235 PRO E N   1 
ATOM   7013  C  CA  . PRO E 2 102 ? 66.486  -7.081  151.267 1.00 30.18  ? 235 PRO E CA  1 
ATOM   7014  C  C   . PRO E 2 102 ? 66.701  -5.952  152.254 1.00 31.24  ? 235 PRO E C   1 
ATOM   7015  O  O   . PRO E 2 102 ? 65.741  -5.317  152.710 1.00 30.91  ? 235 PRO E O   1 
ATOM   7016  C  CB  . PRO E 2 102 ? 66.331  -6.572  149.840 1.00 32.54  ? 235 PRO E CB  1 
ATOM   7017  C  CG  . PRO E 2 102 ? 64.841  -6.391  149.701 1.00 38.39  ? 235 PRO E CG  1 
ATOM   7018  C  CD  . PRO E 2 102 ? 64.309  -7.632  150.363 1.00 37.08  ? 235 PRO E CD  1 
ATOM   7019  N  N   . TYR E 2 103 ? 67.964  -5.715  152.590 1.00 32.70  ? 236 TYR E N   1 
ATOM   7020  C  CA  . TYR E 2 103 ? 68.318  -4.689  153.556 1.00 23.23  ? 236 TYR E CA  1 
ATOM   7021  C  C   . TYR E 2 103 ? 69.537  -3.867  153.176 1.00 27.08  ? 236 TYR E C   1 
ATOM   7022  O  O   . TYR E 2 103 ? 70.398  -4.313  152.386 1.00 25.17  ? 236 TYR E O   1 
ATOM   7023  C  CB  . TYR E 2 103 ? 68.572  -5.346  154.889 1.00 20.17  ? 236 TYR E CB  1 
ATOM   7024  C  CG  . TYR E 2 103 ? 69.639  -6.418  154.841 1.00 19.78  ? 236 TYR E CG  1 
ATOM   7025  C  CD1 . TYR E 2 103 ? 70.981  -6.101  155.068 1.00 20.02  ? 236 TYR E CD1 1 
ATOM   7026  C  CD2 . TYR E 2 103 ? 69.301  -7.757  154.651 1.00 17.38  ? 236 TYR E CD2 1 
ATOM   7027  C  CE1 . TYR E 2 103 ? 71.951  -7.084  155.123 1.00 21.84  ? 236 TYR E CE1 1 
ATOM   7028  C  CE2 . TYR E 2 103 ? 70.275  -8.756  154.703 1.00 19.03  ? 236 TYR E CE2 1 
ATOM   7029  C  CZ  . TYR E 2 103 ? 71.599  -8.407  154.946 1.00 19.90  ? 236 TYR E CZ  1 
ATOM   7030  O  OH  . TYR E 2 103 ? 72.570  -9.374  155.048 1.00 20.74  ? 236 TYR E OH  1 
ATOM   7031  N  N   . ARG E 2 104 ? 69.615  -2.680  153.781 1.00 26.04  ? 237 ARG E N   1 
ATOM   7032  C  CA  . ARG E 2 104 ? 70.712  -1.744  153.541 1.00 20.31  ? 237 ARG E CA  1 
ATOM   7033  C  C   . ARG E 2 104 ? 71.969  -2.202  154.222 1.00 14.30  ? 237 ARG E C   1 
ATOM   7034  O  O   . ARG E 2 104 ? 71.919  -2.824  155.283 1.00 21.55  ? 237 ARG E O   1 
ATOM   7035  C  CB  . ARG E 2 104 ? 70.325  -0.359  154.025 1.00 21.72  ? 237 ARG E CB  1 
ATOM   7036  C  CG  . ARG E 2 104 ? 69.036  0.117   153.400 1.00 25.78  ? 237 ARG E CG  1 
ATOM   7037  C  CD  . ARG E 2 104 ? 68.603  1.452   153.949 1.00 30.06  ? 237 ARG E CD  1 
ATOM   7038  N  NE  . ARG E 2 104 ? 67.388  1.947   153.306 1.00 34.20  ? 237 ARG E NE  1 
ATOM   7039  C  CZ  . ARG E 2 104 ? 66.217  1.307   153.298 1.00 35.26  ? 237 ARG E CZ  1 
ATOM   7040  N  NH1 . ARG E 2 104 ? 66.076  0.117   153.883 1.00 30.66  ? 237 ARG E NH1 1 
ATOM   7041  N  NH2 . ARG E 2 104 ? 65.152  1.903   152.776 1.00 40.34  ? 237 ARG E NH2 1 
ATOM   7042  N  N   . VAL E 2 105 ? 73.099  -1.876  153.617 1.00 16.17  ? 238 VAL E N   1 
ATOM   7043  C  CA  . VAL E 2 105 ? 74.395  -2.270  154.150 1.00 12.37  ? 238 VAL E CA  1 
ATOM   7044  C  C   . VAL E 2 105 ? 75.471  -1.392  153.512 1.00 16.07  ? 238 VAL E C   1 
ATOM   7045  O  O   . VAL E 2 105 ? 75.314  -0.931  152.382 1.00 22.00  ? 238 VAL E O   1 
ATOM   7046  C  CB  . VAL E 2 105 ? 74.661  -3.744  153.809 1.00 2.70   ? 238 VAL E CB  1 
ATOM   7047  C  CG1 . VAL E 2 105 ? 75.478  -3.889  152.516 1.00 2.70   ? 238 VAL E CG1 1 
ATOM   7048  C  CG2 . VAL E 2 105 ? 75.269  -4.425  154.979 1.00 16.89  ? 238 VAL E CG2 1 
ATOM   7049  N  N   . TYR E 2 106 ? 76.557  -1.134  154.216 1.00 8.53   ? 239 TYR E N   1 
ATOM   7050  C  CA  . TYR E 2 106 ? 77.586  -0.316  153.608 1.00 7.47   ? 239 TYR E CA  1 
ATOM   7051  C  C   . TYR E 2 106 ? 78.586  -1.258  152.951 1.00 12.17  ? 239 TYR E C   1 
ATOM   7052  O  O   . TYR E 2 106 ? 78.922  -2.295  153.521 1.00 19.51  ? 239 TYR E O   1 
ATOM   7053  C  CB  . TYR E 2 106 ? 78.271  0.568   154.663 1.00 8.29   ? 239 TYR E CB  1 
ATOM   7054  C  CG  . TYR E 2 106 ? 79.211  1.577   154.055 1.00 17.61  ? 239 TYR E CG  1 
ATOM   7055  C  CD1 . TYR E 2 106 ? 78.729  2.760   153.492 1.00 20.70  ? 239 TYR E CD1 1 
ATOM   7056  C  CD2 . TYR E 2 106 ? 80.573  1.325   153.972 1.00 17.58  ? 239 TYR E CD2 1 
ATOM   7057  C  CE1 . TYR E 2 106 ? 79.585  3.658   152.860 1.00 20.87  ? 239 TYR E CE1 1 
ATOM   7058  C  CE2 . TYR E 2 106 ? 81.429  2.210   153.343 1.00 19.81  ? 239 TYR E CE2 1 
ATOM   7059  C  CZ  . TYR E 2 106 ? 80.936  3.373   152.786 1.00 19.58  ? 239 TYR E CZ  1 
ATOM   7060  O  OH  . TYR E 2 106 ? 81.803  4.228   152.135 1.00 22.56  ? 239 TYR E OH  1 
ATOM   7061  N  N   . CYS E 2 107 ? 79.008  -0.945  151.730 1.00 14.07  ? 240 CYS E N   1 
ATOM   7062  C  CA  . CYS E 2 107 ? 80.003  -1.781  151.032 1.00 15.52  ? 240 CYS E CA  1 
ATOM   7063  C  C   . CYS E 2 107 ? 81.291  -1.020  150.815 1.00 13.51  ? 240 CYS E C   1 
ATOM   7064  O  O   . CYS E 2 107 ? 81.278  0.065   150.247 1.00 15.07  ? 240 CYS E O   1 
ATOM   7065  C  CB  . CYS E 2 107 ? 79.525  -2.250  149.650 1.00 13.74  ? 240 CYS E CB  1 
ATOM   7066  S  SG  . CYS E 2 107 ? 78.267  -3.535  149.651 1.00 23.54  ? 240 CYS E SG  1 
ATOM   7067  N  N   . ASP E 2 108 ? 82.400  -1.604  151.248 1.00 18.14  ? 241 ASP E N   1 
ATOM   7068  C  CA  . ASP E 2 108 ? 83.705  -0.998  151.046 1.00 20.49  ? 241 ASP E CA  1 
ATOM   7069  C  C   . ASP E 2 108 ? 84.204  -1.526  149.720 1.00 27.40  ? 241 ASP E C   1 
ATOM   7070  O  O   . ASP E 2 108 ? 84.737  -2.627  149.622 1.00 25.88  ? 241 ASP E O   1 
ATOM   7071  C  CB  . ASP E 2 108 ? 84.670  -1.404  152.136 1.00 23.24  ? 241 ASP E CB  1 
ATOM   7072  C  CG  . ASP E 2 108 ? 86.034  -0.780  151.959 1.00 26.63  ? 241 ASP E CG  1 
ATOM   7073  O  OD1 . ASP E 2 108 ? 86.417  -0.419  150.825 1.00 33.66  ? 241 ASP E OD1 1 
ATOM   7074  O  OD2 . ASP E 2 108 ? 86.747  -0.654  152.966 1.00 25.46  ? 241 ASP E OD2 1 
ATOM   7075  N  N   . MET E 2 109 ? 84.106  -0.689  148.710 1.00 34.39  ? 242 MET E N   1 
ATOM   7076  C  CA  . MET E 2 109 ? 84.503  -1.093  147.387 1.00 32.03  ? 242 MET E CA  1 
ATOM   7077  C  C   . MET E 2 109 ? 85.957  -0.880  147.047 1.00 29.22  ? 242 MET E C   1 
ATOM   7078  O  O   . MET E 2 109 ? 86.339  -0.980  145.884 1.00 30.89  ? 242 MET E O   1 
ATOM   7079  C  CB  . MET E 2 109 ? 83.594  -0.420  146.372 1.00 31.76  ? 242 MET E CB  1 
ATOM   7080  C  CG  . MET E 2 109 ? 82.157  -0.845  146.566 1.00 29.31  ? 242 MET E CG  1 
ATOM   7081  S  SD  . MET E 2 109 ? 82.125  -2.643  146.760 1.00 26.60  ? 242 MET E SD  1 
ATOM   7082  C  CE  . MET E 2 109 ? 80.487  -3.117  145.934 1.00 21.53  ? 242 MET E CE  1 
ATOM   7083  N  N   . ASN E 2 110 ? 86.785  -0.625  148.053 1.00 35.50  ? 243 ASN E N   1 
ATOM   7084  C  CA  . ASN E 2 110 ? 88.199  -0.422  147.786 1.00 45.48  ? 243 ASN E CA  1 
ATOM   7085  C  C   . ASN E 2 110 ? 89.095  -0.459  149.001 1.00 50.45  ? 243 ASN E C   1 
ATOM   7086  O  O   . ASN E 2 110 ? 89.341  0.561   149.630 1.00 62.14  ? 243 ASN E O   1 
ATOM   7087  C  CB  . ASN E 2 110 ? 88.425  0.876   146.997 1.00 53.45  ? 243 ASN E CB  1 
ATOM   7088  C  CG  . ASN E 2 110 ? 87.552  2.025   147.479 1.00 58.95  ? 243 ASN E CG  1 
ATOM   7089  O  OD1 . ASN E 2 110 ? 87.322  2.197   148.678 1.00 59.92  ? 243 ASN E OD1 1 
ATOM   7090  N  ND2 . ASN E 2 110 ? 87.060  2.817   146.537 1.00 62.67  ? 243 ASN E ND2 1 
ATOM   7091  N  N   . THR E 2 111 ? 89.569  -1.649  149.345 1.00 45.61  ? 244 THR E N   1 
ATOM   7092  C  CA  . THR E 2 111 ? 90.474  -1.799  150.480 1.00 44.91  ? 244 THR E CA  1 
ATOM   7093  C  C   . THR E 2 111 ? 91.425  -2.902  150.131 1.00 50.38  ? 244 THR E C   1 
ATOM   7094  O  O   . THR E 2 111 ? 92.637  -2.708  150.084 1.00 59.22  ? 244 THR E O   1 
ATOM   7095  C  CB  . THR E 2 111 ? 89.754  -2.191  151.766 1.00 31.10  ? 244 THR E CB  1 
ATOM   7096  O  OG1 . THR E 2 111 ? 88.376  -2.409  151.483 1.00 38.55  ? 244 THR E OG1 1 
ATOM   7097  C  CG2 . THR E 2 111 ? 89.884  -1.111  152.782 1.00 22.38  ? 244 THR E CG2 1 
ATOM   7098  N  N   . GLU E 2 112 ? 90.861  -4.069  149.879 1.00 42.77  ? 245 GLU E N   1 
ATOM   7099  C  CA  . GLU E 2 112 ? 91.658  -5.214  149.511 1.00 49.67  ? 245 GLU E CA  1 
ATOM   7100  C  C   . GLU E 2 112 ? 90.917  -5.770  148.325 1.00 55.96  ? 245 GLU E C   1 
ATOM   7101  O  O   . GLU E 2 112 ? 90.413  -6.893  148.351 1.00 65.73  ? 245 GLU E O   1 
ATOM   7102  C  CB  . GLU E 2 112 ? 91.685  -6.229  150.649 1.00 52.44  ? 245 GLU E CB  1 
ATOM   7103  C  CG  . GLU E 2 112 ? 92.218  -5.694  151.971 1.00 58.42  ? 245 GLU E CG  1 
ATOM   7104  C  CD  . GLU E 2 112 ? 93.723  -5.576  152.001 1.00 58.15  ? 245 GLU E CD  1 
ATOM   7105  O  OE1 . GLU E 2 112 ? 94.400  -6.623  151.888 1.00 60.06  ? 245 GLU E OE1 1 
ATOM   7106  O  OE2 . GLU E 2 112 ? 94.218  -4.441  152.158 1.00 57.05  ? 245 GLU E OE2 1 
ATOM   7107  N  N   . ASN E 2 113 ? 90.826  -4.934  147.297 1.00 51.96  ? 246 ASN E N   1 
ATOM   7108  C  CA  . ASN E 2 113 ? 90.136  -5.263  146.060 1.00 50.38  ? 246 ASN E CA  1 
ATOM   7109  C  C   . ASN E 2 113 ? 88.625  -5.049  146.185 1.00 44.12  ? 246 ASN E C   1 
ATOM   7110  O  O   . ASN E 2 113 ? 87.883  -5.370  145.265 1.00 45.48  ? 246 ASN E O   1 
ATOM   7111  C  CB  . ASN E 2 113 ? 90.438  -6.705  145.606 1.00 61.16  ? 246 ASN E CB  1 
ATOM   7112  C  CG  . ASN E 2 113 ? 91.914  -6.939  145.291 1.00 67.70  ? 246 ASN E CG  1 
ATOM   7113  O  OD1 . ASN E 2 113 ? 92.252  -7.427  144.211 1.00 68.62  ? 246 ASN E OD1 1 
ATOM   7114  N  ND2 . ASN E 2 113 ? 92.795  -6.624  146.247 1.00 68.15  ? 246 ASN E ND2 1 
ATOM   7115  N  N   . GLY E 2 114 ? 88.169  -4.536  147.327 1.00 43.59  ? 247 GLY E N   1 
ATOM   7116  C  CA  . GLY E 2 114 ? 86.747  -4.266  147.517 1.00 34.05  ? 247 GLY E CA  1 
ATOM   7117  C  C   . GLY E 2 114 ? 85.846  -5.473  147.656 1.00 27.97  ? 247 GLY E C   1 
ATOM   7118  O  O   . GLY E 2 114 ? 86.353  -6.586  147.641 1.00 29.76  ? 247 GLY E O   1 
ATOM   7119  N  N   . GLY E 2 115 ? 84.527  -5.248  147.797 1.00 28.10  ? 248 GLY E N   1 
ATOM   7120  C  CA  . GLY E 2 115 ? 83.532  -6.320  147.941 1.00 22.82  ? 248 GLY E CA  1 
ATOM   7121  C  C   . GLY E 2 115 ? 83.249  -6.712  149.386 1.00 23.41  ? 248 GLY E C   1 
ATOM   7122  O  O   . GLY E 2 115 ? 82.628  -7.743  149.670 1.00 23.72  ? 248 GLY E O   1 
ATOM   7123  N  N   . TRP E 2 116 ? 83.699  -5.853  150.297 1.00 18.76  ? 249 TRP E N   1 
ATOM   7124  C  CA  . TRP E 2 116 ? 83.572  -6.052  151.724 1.00 10.46  ? 249 TRP E CA  1 
ATOM   7125  C  C   . TRP E 2 116 ? 82.284  -5.559  152.284 1.00 9.74   ? 249 TRP E C   1 
ATOM   7126  O  O   . TRP E 2 116 ? 81.992  -4.364  152.271 1.00 9.39   ? 249 TRP E O   1 
ATOM   7127  C  CB  . TRP E 2 116 ? 84.701  -5.352  152.456 1.00 12.58  ? 249 TRP E CB  1 
ATOM   7128  C  CG  . TRP E 2 116 ? 86.041  -5.897  152.123 1.00 22.22  ? 249 TRP E CG  1 
ATOM   7129  C  CD1 . TRP E 2 116 ? 86.973  -5.341  151.297 1.00 25.72  ? 249 TRP E CD1 1 
ATOM   7130  C  CD2 . TRP E 2 116 ? 86.633  -7.089  152.653 1.00 26.91  ? 249 TRP E CD2 1 
ATOM   7131  N  NE1 . TRP E 2 116 ? 88.113  -6.106  151.286 1.00 28.39  ? 249 TRP E NE1 1 
ATOM   7132  C  CE2 . TRP E 2 116 ? 87.933  -7.185  152.114 1.00 29.14  ? 249 TRP E CE2 1 
ATOM   7133  C  CE3 . TRP E 2 116 ? 86.192  -8.086  153.539 1.00 22.62  ? 249 TRP E CE3 1 
ATOM   7134  C  CZ2 . TRP E 2 116 ? 88.798  -8.235  152.434 1.00 26.56  ? 249 TRP E CZ2 1 
ATOM   7135  C  CZ3 . TRP E 2 116 ? 87.052  -9.128  153.854 1.00 16.41  ? 249 TRP E CZ3 1 
ATOM   7136  C  CH2 . TRP E 2 116 ? 88.341  -9.192  153.303 1.00 24.61  ? 249 TRP E CH2 1 
ATOM   7137  N  N   . THR E 2 117 ? 81.497  -6.497  152.771 1.00 6.99   ? 250 THR E N   1 
ATOM   7138  C  CA  . THR E 2 117 ? 80.258  -6.123  153.378 1.00 10.07  ? 250 THR E CA  1 
ATOM   7139  C  C   . THR E 2 117 ? 80.600  -5.715  154.787 1.00 8.01   ? 250 THR E C   1 
ATOM   7140  O  O   . THR E 2 117 ? 80.995  -6.544  155.598 1.00 6.62   ? 250 THR E O   1 
ATOM   7141  C  CB  . THR E 2 117 ? 79.283  -7.274  153.416 1.00 11.23  ? 250 THR E CB  1 
ATOM   7142  O  OG1 . THR E 2 117 ? 79.023  -7.720  152.074 1.00 13.02  ? 250 THR E OG1 1 
ATOM   7143  C  CG2 . THR E 2 117 ? 78.000  -6.818  154.105 1.00 2.70   ? 250 THR E CG2 1 
ATOM   7144  N  N   . VAL E 2 118 ? 80.528  -4.420  155.049 1.00 8.66   ? 251 VAL E N   1 
ATOM   7145  C  CA  . VAL E 2 118 ? 80.803  -3.896  156.382 1.00 14.32  ? 251 VAL E CA  1 
ATOM   7146  C  C   . VAL E 2 118 ? 79.776  -4.483  157.353 1.00 17.48  ? 251 VAL E C   1 
ATOM   7147  O  O   . VAL E 2 118 ? 78.554  -4.376  157.128 1.00 13.51  ? 251 VAL E O   1 
ATOM   7148  C  CB  . VAL E 2 118 ? 80.681  -2.378  156.392 1.00 16.53  ? 251 VAL E CB  1 
ATOM   7149  C  CG1 . VAL E 2 118 ? 81.089  -1.817  157.724 1.00 13.10  ? 251 VAL E CG1 1 
ATOM   7150  C  CG2 . VAL E 2 118 ? 81.511  -1.802  155.272 1.00 26.96  ? 251 VAL E CG2 1 
ATOM   7151  N  N   . ILE E 2 119 ? 80.281  -5.090  158.426 1.00 9.47   ? 252 ILE E N   1 
ATOM   7152  C  CA  . ILE E 2 119 ? 79.446  -5.743  159.426 1.00 10.26  ? 252 ILE E CA  1 
ATOM   7153  C  C   . ILE E 2 119 ? 79.350  -5.041  160.794 1.00 16.88  ? 252 ILE E C   1 
ATOM   7154  O  O   . ILE E 2 119 ? 78.454  -5.300  161.600 1.00 17.76  ? 252 ILE E O   1 
ATOM   7155  C  CB  . ILE E 2 119 ? 79.875  -7.225  159.525 1.00 16.95  ? 252 ILE E CB  1 
ATOM   7156  C  CG1 . ILE E 2 119 ? 78.685  -8.088  159.206 1.00 22.82  ? 252 ILE E CG1 1 
ATOM   7157  C  CG2 . ILE E 2 119 ? 80.486  -7.593  160.866 1.00 22.85  ? 252 ILE E CG2 1 
ATOM   7158  C  CD1 . ILE E 2 119 ? 78.236  -7.945  157.792 1.00 28.49  ? 252 ILE E CD1 1 
ATOM   7159  N  N   . GLN E 2 120 ? 80.238  -4.093  161.016 1.00 17.01  ? 253 GLN E N   1 
ATOM   7160  C  CA  . GLN E 2 120 ? 80.266  -3.349  162.255 1.00 20.16  ? 253 GLN E CA  1 
ATOM   7161  C  C   . GLN E 2 120 ? 81.238  -2.214  162.000 1.00 23.81  ? 253 GLN E C   1 
ATOM   7162  O  O   . GLN E 2 120 ? 82.245  -2.390  161.304 1.00 23.90  ? 253 GLN E O   1 
ATOM   7163  C  CB  . GLN E 2 120 ? 80.752  -4.247  163.398 1.00 21.25  ? 253 GLN E CB  1 
ATOM   7164  C  CG  . GLN E 2 120 ? 80.918  -3.545  164.757 1.00 21.64  ? 253 GLN E CG  1 
ATOM   7165  C  CD  . GLN E 2 120 ? 82.323  -2.983  165.001 1.00 24.46  ? 253 GLN E CD  1 
ATOM   7166  O  OE1 . GLN E 2 120 ? 82.613  -2.480  166.088 1.00 30.13  ? 253 GLN E OE1 1 
ATOM   7167  N  NE2 . GLN E 2 120 ? 83.195  -3.070  164.002 1.00 20.90  ? 253 GLN E NE2 1 
ATOM   7168  N  N   . ASN E 2 121 ? 80.981  -1.060  162.597 1.00 20.16  ? 254 ASN E N   1 
ATOM   7169  C  CA  . ASN E 2 121 ? 81.861  0.070   162.363 1.00 18.23  ? 254 ASN E CA  1 
ATOM   7170  C  C   . ASN E 2 121 ? 81.877  1.096   163.503 1.00 20.67  ? 254 ASN E C   1 
ATOM   7171  O  O   . ASN E 2 121 ? 80.848  1.507   164.014 1.00 17.81  ? 254 ASN E O   1 
ATOM   7172  C  CB  . ASN E 2 121 ? 81.488  0.717   161.024 1.00 11.87  ? 254 ASN E CB  1 
ATOM   7173  C  CG  . ASN E 2 121 ? 82.274  1.948   160.742 1.00 16.82  ? 254 ASN E CG  1 
ATOM   7174  O  OD1 . ASN E 2 121 ? 83.511  1.926   160.731 1.00 20.43  ? 254 ASN E OD1 1 
ATOM   7175  N  ND2 . ASN E 2 121 ? 81.571  3.057   160.535 1.00 19.70  ? 254 ASN E ND2 1 
ATOM   7176  N  N   . ARG E 2 122 ? 83.075  1.444   163.939 1.00 23.68  ? 255 ARG E N   1 
ATOM   7177  C  CA  . ARG E 2 122 ? 83.264  2.416   164.994 1.00 22.02  ? 255 ARG E CA  1 
ATOM   7178  C  C   . ARG E 2 122 ? 84.172  3.469   164.396 1.00 21.02  ? 255 ARG E C   1 
ATOM   7179  O  O   . ARG E 2 122 ? 85.092  3.139   163.659 1.00 19.77  ? 255 ARG E O   1 
ATOM   7180  C  CB  . ARG E 2 122 ? 83.962  1.776   166.191 1.00 23.31  ? 255 ARG E CB  1 
ATOM   7181  C  CG  . ARG E 2 122 ? 83.303  0.509   166.728 1.00 17.89  ? 255 ARG E CG  1 
ATOM   7182  C  CD  . ARG E 2 122 ? 81.870  0.723   167.125 1.00 12.05  ? 255 ARG E CD  1 
ATOM   7183  N  NE  . ARG E 2 122 ? 81.698  1.632   168.255 1.00 15.25  ? 255 ARG E NE  1 
ATOM   7184  C  CZ  . ARG E 2 122 ? 81.960  1.340   169.533 1.00 15.53  ? 255 ARG E CZ  1 
ATOM   7185  N  NH1 . ARG E 2 122 ? 82.430  0.156   169.873 1.00 18.92  ? 255 ARG E NH1 1 
ATOM   7186  N  NH2 . ARG E 2 122 ? 81.675  2.211   170.492 1.00 17.93  ? 255 ARG E NH2 1 
ATOM   7187  N  N   . GLN E 2 123 ? 83.921  4.733   164.712 1.00 24.55  ? 256 GLN E N   1 
ATOM   7188  C  CA  . GLN E 2 123 ? 84.746  5.805   164.168 1.00 27.08  ? 256 GLN E CA  1 
ATOM   7189  C  C   . GLN E 2 123 ? 84.602  7.171   164.841 1.00 35.65  ? 256 GLN E C   1 
ATOM   7190  O  O   . GLN E 2 123 ? 85.474  8.028   164.653 1.00 38.67  ? 256 GLN E O   1 
ATOM   7191  C  CB  . GLN E 2 123 ? 84.457  5.961   162.685 1.00 20.53  ? 256 GLN E CB  1 
ATOM   7192  C  CG  . GLN E 2 123 ? 83.092  6.540   162.408 1.00 11.83  ? 256 GLN E CG  1 
ATOM   7193  C  CD  . GLN E 2 123 ? 82.677  6.339   160.981 1.00 14.32  ? 256 GLN E CD  1 
ATOM   7194  O  OE1 . GLN E 2 123 ? 81.535  6.611   160.614 1.00 18.38  ? 256 GLN E OE1 1 
ATOM   7195  N  NE2 . GLN E 2 123 ? 83.604  5.855   160.156 1.00 11.84  ? 256 GLN E NE2 1 
ATOM   7196  N  N   . ASP E 2 124 ? 83.536  7.377   165.622 1.00 36.43  ? 257 ASP E N   1 
ATOM   7197  C  CA  . ASP E 2 124 ? 83.321  8.671   166.275 1.00 35.65  ? 257 ASP E CA  1 
ATOM   7198  C  C   . ASP E 2 124 ? 82.468  8.688   167.557 1.00 35.68  ? 257 ASP E C   1 
ATOM   7199  O  O   . ASP E 2 124 ? 82.165  9.751   168.096 1.00 38.76  ? 257 ASP E O   1 
ATOM   7200  C  CB  . ASP E 2 124 ? 82.751  9.659   165.253 1.00 33.21  ? 257 ASP E CB  1 
ATOM   7201  C  CG  . ASP E 2 124 ? 81.410  9.225   164.697 1.00 35.11  ? 257 ASP E CG  1 
ATOM   7202  O  OD1 . ASP E 2 124 ? 80.816  8.246   165.214 1.00 34.68  ? 257 ASP E OD1 1 
ATOM   7203  O  OD2 . ASP E 2 124 ? 80.947  9.887   163.739 1.00 37.44  ? 257 ASP E OD2 1 
ATOM   7204  N  N   . GLY E 2 125 ? 82.048  7.518   168.016 1.00 34.93  ? 258 GLY E N   1 
ATOM   7205  C  CA  . GLY E 2 125 ? 81.251  7.435   169.229 1.00 28.46  ? 258 GLY E CA  1 
ATOM   7206  C  C   . GLY E 2 125 ? 79.838  7.971   169.172 1.00 25.01  ? 258 GLY E C   1 
ATOM   7207  O  O   . GLY E 2 125 ? 79.257  8.311   170.195 1.00 19.85  ? 258 GLY E O   1 
ATOM   7208  N  N   . SER E 2 126 ? 79.246  7.968   167.989 1.00 28.21  ? 259 SER E N   1 
ATOM   7209  C  CA  . SER E 2 126 ? 77.892  8.484   167.820 1.00 29.04  ? 259 SER E CA  1 
ATOM   7210  C  C   . SER E 2 126 ? 76.740  7.513   168.084 1.00 22.95  ? 259 SER E C   1 
ATOM   7211  O  O   . SER E 2 126 ? 75.576  7.917   167.996 1.00 24.17  ? 259 SER E O   1 
ATOM   7212  C  CB  . SER E 2 126 ? 77.740  9.054   166.416 1.00 27.57  ? 259 SER E CB  1 
ATOM   7213  O  OG  . SER E 2 126 ? 77.911  8.015   165.477 1.00 27.70  ? 259 SER E OG  1 
ATOM   7214  N  N   . VAL E 2 127 ? 77.050  6.246   168.358 1.00 18.66  ? 260 VAL E N   1 
ATOM   7215  C  CA  . VAL E 2 127 ? 76.021  5.221   168.629 1.00 20.11  ? 260 VAL E CA  1 
ATOM   7216  C  C   . VAL E 2 127 ? 76.234  4.398   169.910 1.00 22.11  ? 260 VAL E C   1 
ATOM   7217  O  O   . VAL E 2 127 ? 77.340  3.884   170.162 1.00 17.49  ? 260 VAL E O   1 
ATOM   7218  C  CB  . VAL E 2 127 ? 75.930  4.212   167.486 1.00 21.42  ? 260 VAL E CB  1 
ATOM   7219  C  CG1 . VAL E 2 127 ? 74.964  3.095   167.829 1.00 19.42  ? 260 VAL E CG1 1 
ATOM   7220  C  CG2 . VAL E 2 127 ? 75.509  4.898   166.235 1.00 26.18  ? 260 VAL E CG2 1 
ATOM   7221  N  N   . ASP E 2 128 ? 75.173  4.250   170.702 1.00 21.66  ? 261 ASP E N   1 
ATOM   7222  C  CA  . ASP E 2 128 ? 75.262  3.466   171.930 1.00 19.97  ? 261 ASP E CA  1 
ATOM   7223  C  C   . ASP E 2 128 ? 75.421  2.027   171.494 1.00 22.87  ? 261 ASP E C   1 
ATOM   7224  O  O   . ASP E 2 128 ? 74.674  1.554   170.648 1.00 24.43  ? 261 ASP E O   1 
ATOM   7225  C  CB  . ASP E 2 128 ? 73.992  3.597   172.786 1.00 20.13  ? 261 ASP E CB  1 
ATOM   7226  C  CG  . ASP E 2 128 ? 74.068  2.789   174.072 1.00 27.27  ? 261 ASP E CG  1 
ATOM   7227  O  OD1 . ASP E 2 128 ? 75.186  2.340   174.429 1.00 30.17  ? 261 ASP E OD1 1 
ATOM   7228  O  OD2 . ASP E 2 128 ? 73.013  2.597   174.729 1.00 31.18  ? 261 ASP E OD2 1 
ATOM   7229  N  N   . PHE E 2 129 ? 76.445  1.351   171.997 1.00 23.30  ? 262 PHE E N   1 
ATOM   7230  C  CA  . PHE E 2 129 ? 76.631  -0.038  171.622 1.00 21.25  ? 262 PHE E CA  1 
ATOM   7231  C  C   . PHE E 2 129 ? 76.302  -0.925  172.764 1.00 23.14  ? 262 PHE E C   1 
ATOM   7232  O  O   . PHE E 2 129 ? 76.301  -2.138  172.636 1.00 20.17  ? 262 PHE E O   1 
ATOM   7233  C  CB  . PHE E 2 129 ? 78.040  -0.301  171.176 1.00 12.21  ? 262 PHE E CB  1 
ATOM   7234  C  CG  . PHE E 2 129 ? 78.226  -0.147  169.715 1.00 8.70   ? 262 PHE E CG  1 
ATOM   7235  C  CD1 . PHE E 2 129 ? 78.315  1.104   169.152 1.00 9.61   ? 262 PHE E CD1 1 
ATOM   7236  C  CD2 . PHE E 2 129 ? 78.356  -1.256  168.905 1.00 7.88   ? 262 PHE E CD2 1 
ATOM   7237  C  CE1 . PHE E 2 129 ? 78.539  1.257   167.800 1.00 6.66   ? 262 PHE E CE1 1 
ATOM   7238  C  CE2 . PHE E 2 129 ? 78.578  -1.108  167.562 1.00 9.16   ? 262 PHE E CE2 1 
ATOM   7239  C  CZ  . PHE E 2 129 ? 78.672  0.164   167.004 1.00 2.70   ? 262 PHE E CZ  1 
ATOM   7240  N  N   . GLY E 2 130 ? 76.064  -0.303  173.904 1.00 26.37  ? 263 GLY E N   1 
ATOM   7241  C  CA  . GLY E 2 130 ? 75.706  -1.057  175.079 1.00 22.44  ? 263 GLY E CA  1 
ATOM   7242  C  C   . GLY E 2 130 ? 74.239  -1.315  174.935 1.00 19.43  ? 263 GLY E C   1 
ATOM   7243  O  O   . GLY E 2 130 ? 73.414  -0.534  175.406 1.00 33.12  ? 263 GLY E O   1 
ATOM   7244  N  N   . ARG E 2 131 ? 73.915  -2.372  174.210 1.00 13.89  ? 264 ARG E N   1 
ATOM   7245  C  CA  . ARG E 2 131 ? 72.525  -2.726  173.982 1.00 18.30  ? 264 ARG E CA  1 
ATOM   7246  C  C   . ARG E 2 131 ? 72.239  -4.153  174.407 1.00 21.97  ? 264 ARG E C   1 
ATOM   7247  O  O   . ARG E 2 131 ? 73.147  -4.978  174.506 1.00 23.67  ? 264 ARG E O   1 
ATOM   7248  C  CB  . ARG E 2 131 ? 72.168  -2.518  172.510 1.00 18.62  ? 264 ARG E CB  1 
ATOM   7249  C  CG  . ARG E 2 131 ? 72.605  -1.165  171.999 1.00 22.62  ? 264 ARG E CG  1 
ATOM   7250  C  CD  . ARG E 2 131 ? 71.827  -0.722  170.783 1.00 23.38  ? 264 ARG E CD  1 
ATOM   7251  N  NE  . ARG E 2 131 ? 72.141  0.669   170.472 1.00 21.69  ? 264 ARG E NE  1 
ATOM   7252  C  CZ  . ARG E 2 131 ? 71.355  1.481   169.785 1.00 21.86  ? 264 ARG E CZ  1 
ATOM   7253  N  NH1 . ARG E 2 131 ? 70.193  1.046   169.320 1.00 27.65  ? 264 ARG E NH1 1 
ATOM   7254  N  NH2 . ARG E 2 131 ? 71.722  2.734   169.590 1.00 23.73  ? 264 ARG E NH2 1 
ATOM   7255  N  N   . LYS E 2 132 ? 70.975  -4.436  174.683 1.00 25.72  ? 265 LYS E N   1 
ATOM   7256  C  CA  . LYS E 2 132 ? 70.573  -5.767  175.115 1.00 25.36  ? 265 LYS E CA  1 
ATOM   7257  C  C   . LYS E 2 132 ? 70.656  -6.784  173.973 1.00 25.12  ? 265 LYS E C   1 
ATOM   7258  O  O   . LYS E 2 132 ? 71.107  -6.466  172.881 1.00 26.29  ? 265 LYS E O   1 
ATOM   7259  C  CB  . LYS E 2 132 ? 69.148  -5.725  175.672 1.00 32.02  ? 265 LYS E CB  1 
ATOM   7260  C  CG  . LYS E 2 132 ? 68.949  -4.804  176.854 1.00 32.52  ? 265 LYS E CG  1 
ATOM   7261  C  CD  . LYS E 2 132 ? 67.496  -4.798  177.244 1.00 35.60  ? 265 LYS E CD  1 
ATOM   7262  C  CE  . LYS E 2 132 ? 67.202  -3.701  178.224 1.00 39.58  ? 265 LYS E CE  1 
ATOM   7263  N  NZ  . LYS E 2 132 ? 67.969  -3.919  179.471 1.00 43.91  ? 265 LYS E NZ  1 
ATOM   7264  N  N   . TRP E 2 133 ? 70.172  -7.997  174.229 1.00 27.48  ? 266 TRP E N   1 
ATOM   7265  C  CA  . TRP E 2 133 ? 70.187  -9.078  173.267 1.00 19.57  ? 266 TRP E CA  1 
ATOM   7266  C  C   . TRP E 2 133 ? 69.536  -8.791  171.933 1.00 19.51  ? 266 TRP E C   1 
ATOM   7267  O  O   . TRP E 2 133 ? 70.191  -8.905  170.911 1.00 30.78  ? 266 TRP E O   1 
ATOM   7268  C  CB  . TRP E 2 133 ? 69.569  -10.308 173.882 1.00 21.78  ? 266 TRP E CB  1 
ATOM   7269  C  CG  . TRP E 2 133 ? 69.669  -11.488 173.006 1.00 25.45  ? 266 TRP E CG  1 
ATOM   7270  C  CD1 . TRP E 2 133 ? 68.716  -11.951 172.148 1.00 23.90  ? 266 TRP E CD1 1 
ATOM   7271  C  CD2 . TRP E 2 133 ? 70.786  -12.376 172.887 1.00 25.86  ? 266 TRP E CD2 1 
ATOM   7272  N  NE1 . TRP E 2 133 ? 69.166  -13.075 171.502 1.00 21.16  ? 266 TRP E NE1 1 
ATOM   7273  C  CE2 . TRP E 2 133 ? 70.436  -13.359 171.934 1.00 23.17  ? 266 TRP E CE2 1 
ATOM   7274  C  CE3 . TRP E 2 133 ? 72.052  -12.435 173.486 1.00 24.47  ? 266 TRP E CE3 1 
ATOM   7275  C  CZ2 . TRP E 2 133 ? 71.312  -14.396 171.561 1.00 18.24  ? 266 TRP E CZ2 1 
ATOM   7276  C  CZ3 . TRP E 2 133 ? 72.926  -13.465 173.114 1.00 20.19  ? 266 TRP E CZ3 1 
ATOM   7277  C  CH2 . TRP E 2 133 ? 72.548  -14.429 172.160 1.00 18.76  ? 266 TRP E CH2 1 
ATOM   7278  N  N   . ASP E 2 134 ? 68.264  -8.404  171.927 1.00 21.47  ? 267 ASP E N   1 
ATOM   7279  C  CA  . ASP E 2 134 ? 67.531  -8.104  170.670 1.00 29.12  ? 267 ASP E CA  1 
ATOM   7280  C  C   . ASP E 2 134 ? 68.138  -7.142  169.630 1.00 31.82  ? 267 ASP E C   1 
ATOM   7281  O  O   . ASP E 2 134 ? 68.119  -7.438  168.429 1.00 34.44  ? 267 ASP E O   1 
ATOM   7282  C  CB  . ASP E 2 134 ? 66.091  -7.690  170.954 1.00 39.98  ? 267 ASP E CB  1 
ATOM   7283  C  CG  . ASP E 2 134 ? 65.158  -8.879  171.054 1.00 50.79  ? 267 ASP E CG  1 
ATOM   7284  O  OD1 . ASP E 2 134 ? 65.159  -9.553  172.119 1.00 56.67  ? 267 ASP E OD1 1 
ATOM   7285  O  OD2 . ASP E 2 134 ? 64.434  -9.135  170.058 1.00 52.17  ? 267 ASP E OD2 1 
ATOM   7286  N  N   . PRO E 2 135 ? 68.605  -5.951  170.055 1.00 29.09  ? 268 PRO E N   1 
ATOM   7287  C  CA  . PRO E 2 135 ? 69.201  -5.003  169.109 1.00 29.62  ? 268 PRO E CA  1 
ATOM   7288  C  C   . PRO E 2 135 ? 70.415  -5.611  168.400 1.00 30.94  ? 268 PRO E C   1 
ATOM   7289  O  O   . PRO E 2 135 ? 70.696  -5.305  167.231 1.00 28.30  ? 268 PRO E O   1 
ATOM   7290  C  CB  . PRO E 2 135 ? 69.613  -3.851  170.016 1.00 27.95  ? 268 PRO E CB  1 
ATOM   7291  C  CG  . PRO E 2 135 ? 68.542  -3.857  171.026 1.00 23.77  ? 268 PRO E CG  1 
ATOM   7292  C  CD  . PRO E 2 135 ? 68.443  -5.318  171.372 1.00 24.66  ? 268 PRO E CD  1 
ATOM   7293  N  N   . TYR E 2 136 ? 71.150  -6.453  169.123 1.00 24.74  ? 269 TYR E N   1 
ATOM   7294  C  CA  . TYR E 2 136 ? 72.299  -7.089  168.519 1.00 24.29  ? 269 TYR E CA  1 
ATOM   7295  C  C   . TYR E 2 136 ? 71.842  -8.100  167.490 1.00 23.90  ? 269 TYR E C   1 
ATOM   7296  O  O   . TYR E 2 136 ? 72.518  -8.331  166.507 1.00 32.99  ? 269 TYR E O   1 
ATOM   7297  C  CB  . TYR E 2 136 ? 73.200  -7.714  169.577 1.00 19.93  ? 269 TYR E CB  1 
ATOM   7298  C  CG  . TYR E 2 136 ? 74.250  -6.747  170.049 1.00 22.66  ? 269 TYR E CG  1 
ATOM   7299  C  CD1 . TYR E 2 136 ? 75.316  -6.390  169.223 1.00 29.62  ? 269 TYR E CD1 1 
ATOM   7300  C  CD2 . TYR E 2 136 ? 74.158  -6.146  171.289 1.00 20.85  ? 269 TYR E CD2 1 
ATOM   7301  C  CE1 . TYR E 2 136 ? 76.267  -5.448  169.635 1.00 34.09  ? 269 TYR E CE1 1 
ATOM   7302  C  CE2 . TYR E 2 136 ? 75.100  -5.203  171.712 1.00 30.37  ? 269 TYR E CE2 1 
ATOM   7303  C  CZ  . TYR E 2 136 ? 76.152  -4.861  170.886 1.00 36.09  ? 269 TYR E CZ  1 
ATOM   7304  O  OH  . TYR E 2 136 ? 77.102  -3.964  171.332 1.00 38.88  ? 269 TYR E OH  1 
ATOM   7305  N  N   . LYS E 2 137 ? 70.651  -8.642  167.687 1.00 23.43  ? 270 LYS E N   1 
ATOM   7306  C  CA  . LYS E 2 137 ? 70.104  -9.621  166.770 1.00 27.11  ? 270 LYS E CA  1 
ATOM   7307  C  C   . LYS E 2 137 ? 69.602  -8.940  165.506 1.00 30.57  ? 270 LYS E C   1 
ATOM   7308  O  O   . LYS E 2 137 ? 70.004  -9.311  164.394 1.00 37.66  ? 270 LYS E O   1 
ATOM   7309  C  CB  . LYS E 2 137 ? 68.971  -10.389 167.443 1.00 32.10  ? 270 LYS E CB  1 
ATOM   7310  C  CG  . LYS E 2 137 ? 68.378  -11.474 166.585 1.00 37.05  ? 270 LYS E CG  1 
ATOM   7311  C  CD  . LYS E 2 137 ? 67.485  -12.406 167.374 1.00 39.59  ? 270 LYS E CD  1 
ATOM   7312  C  CE  . LYS E 2 137 ? 66.178  -11.757 167.767 1.00 45.75  ? 270 LYS E CE  1 
ATOM   7313  N  NZ  . LYS E 2 137 ? 65.320  -12.683 168.574 1.00 50.29  ? 270 LYS E NZ  1 
ATOM   7314  N  N   . GLN E 2 138 ? 68.749  -7.927  165.676 1.00 30.82  ? 271 GLN E N   1 
ATOM   7315  C  CA  . GLN E 2 138 ? 68.186  -7.180  164.543 1.00 32.68  ? 271 GLN E CA  1 
ATOM   7316  C  C   . GLN E 2 138 ? 69.248  -6.327  163.849 1.00 31.23  ? 271 GLN E C   1 
ATOM   7317  O  O   . GLN E 2 138 ? 69.391  -6.349  162.643 1.00 41.32  ? 271 GLN E O   1 
ATOM   7318  C  CB  . GLN E 2 138 ? 67.082  -6.226  165.017 1.00 45.07  ? 271 GLN E CB  1 
ATOM   7319  C  CG  . GLN E 2 138 ? 66.245  -6.710  166.193 1.00 58.68  ? 271 GLN E CG  1 
ATOM   7320  C  CD  . GLN E 2 138 ? 65.167  -7.717  165.813 1.00 65.70  ? 271 GLN E CD  1 
ATOM   7321  O  OE1 . GLN E 2 138 ? 65.213  -8.331  164.740 1.00 65.54  ? 271 GLN E OE1 1 
ATOM   7322  N  NE2 . GLN E 2 138 ? 64.182  -7.887  166.699 1.00 69.12  ? 271 GLN E NE2 1 
ATOM   7323  N  N   . GLY E 2 139 ? 70.016  -5.604  164.647 1.00 27.86  ? 272 GLY E N   1 
ATOM   7324  C  CA  . GLY E 2 139 ? 71.017  -4.700  164.133 1.00 15.56  ? 272 GLY E CA  1 
ATOM   7325  C  C   . GLY E 2 139 ? 70.591  -3.347  164.676 1.00 17.47  ? 272 GLY E C   1 
ATOM   7326  O  O   . GLY E 2 139 ? 69.441  -3.160  165.087 1.00 11.34  ? 272 GLY E O   1 
ATOM   7327  N  N   . PHE E 2 140 ? 71.531  -2.424  164.774 1.00 16.45  ? 273 PHE E N   1 
ATOM   7328  C  CA  . PHE E 2 140 ? 71.205  -1.098  165.256 1.00 14.80  ? 273 PHE E CA  1 
ATOM   7329  C  C   . PHE E 2 140 ? 72.268  -0.169  164.748 1.00 21.47  ? 273 PHE E C   1 
ATOM   7330  O  O   . PHE E 2 140 ? 73.331  -0.607  164.299 1.00 23.40  ? 273 PHE E O   1 
ATOM   7331  C  CB  . PHE E 2 140 ? 71.157  -1.056  166.778 1.00 9.83   ? 273 PHE E CB  1 
ATOM   7332  C  CG  . PHE E 2 140 ? 72.445  -1.429  167.430 1.00 8.75   ? 273 PHE E CG  1 
ATOM   7333  C  CD1 . PHE E 2 140 ? 73.477  -0.496  167.556 1.00 13.84  ? 273 PHE E CD1 1 
ATOM   7334  C  CD2 . PHE E 2 140 ? 72.645  -2.723  167.909 1.00 10.35  ? 273 PHE E CD2 1 
ATOM   7335  C  CE1 . PHE E 2 140 ? 74.719  -0.841  168.156 1.00 13.94  ? 273 PHE E CE1 1 
ATOM   7336  C  CE2 . PHE E 2 140 ? 73.871  -3.095  168.514 1.00 13.47  ? 273 PHE E CE2 1 
ATOM   7337  C  CZ  . PHE E 2 140 ? 74.918  -2.143  168.637 1.00 16.24  ? 273 PHE E CZ  1 
ATOM   7338  N  N   . GLY E 2 141 ? 71.983  1.121   164.827 1.00 26.98  ? 274 GLY E N   1 
ATOM   7339  C  CA  . GLY E 2 141 ? 72.951  2.094   164.370 1.00 24.78  ? 274 GLY E CA  1 
ATOM   7340  C  C   . GLY E 2 141 ? 72.591  2.692   163.037 1.00 22.64  ? 274 GLY E C   1 
ATOM   7341  O  O   . GLY E 2 141 ? 71.499  2.453   162.514 1.00 21.80  ? 274 GLY E O   1 
ATOM   7342  N  N   . ASN E 2 142 ? 73.517  3.489   162.510 1.00 29.51  ? 275 ASN E N   1 
ATOM   7343  C  CA  . ASN E 2 142 ? 73.354  4.179   161.234 1.00 28.57  ? 275 ASN E CA  1 
ATOM   7344  C  C   . ASN E 2 142 ? 74.317  3.593   160.193 1.00 23.32  ? 275 ASN E C   1 
ATOM   7345  O  O   . ASN E 2 142 ? 75.520  3.804   160.260 1.00 21.04  ? 275 ASN E O   1 
ATOM   7346  C  CB  . ASN E 2 142 ? 73.622  5.691   161.399 1.00 28.37  ? 275 ASN E CB  1 
ATOM   7347  C  CG  . ASN E 2 142 ? 72.598  6.401   162.309 1.00 27.02  ? 275 ASN E CG  1 
ATOM   7348  O  OD1 . ASN E 2 142 ? 71.401  6.480   161.991 1.00 26.61  ? 275 ASN E OD1 1 
ATOM   7349  N  ND2 . ASN E 2 142 ? 73.084  6.962   163.420 1.00 15.45  ? 275 ASN E ND2 1 
ATOM   7350  N  N   . VAL E 2 143 ? 73.778  2.836   159.247 1.00 16.25  ? 276 VAL E N   1 
ATOM   7351  C  CA  . VAL E 2 143 ? 74.565  2.226   158.186 1.00 11.56  ? 276 VAL E CA  1 
ATOM   7352  C  C   . VAL E 2 143 ? 75.370  3.251   157.416 1.00 16.32  ? 276 VAL E C   1 
ATOM   7353  O  O   . VAL E 2 143 ? 76.582  3.103   157.254 1.00 24.21  ? 276 VAL E O   1 
ATOM   7354  C  CB  . VAL E 2 143 ? 73.633  1.493   157.186 1.00 15.20  ? 276 VAL E CB  1 
ATOM   7355  C  CG1 . VAL E 2 143 ? 74.361  1.083   155.908 1.00 9.98   ? 276 VAL E CG1 1 
ATOM   7356  C  CG2 . VAL E 2 143 ? 73.032  0.298   157.846 1.00 19.36  ? 276 VAL E CG2 1 
ATOM   7357  N  N   . ALA E 2 144 ? 74.693  4.298   156.957 1.00 16.76  ? 277 ALA E N   1 
ATOM   7358  C  CA  . ALA E 2 144 ? 75.350  5.311   156.157 1.00 19.39  ? 277 ALA E CA  1 
ATOM   7359  C  C   . ALA E 2 144 ? 74.716  6.672   156.278 1.00 18.19  ? 277 ALA E C   1 
ATOM   7360  O  O   . ALA E 2 144 ? 73.524  6.779   156.583 1.00 14.16  ? 277 ALA E O   1 
ATOM   7361  C  CB  . ALA E 2 144 ? 75.342  4.884   154.710 1.00 21.58  ? 277 ALA E CB  1 
ATOM   7362  N  N   . THR E 2 145 ? 75.529  7.697   156.005 1.00 20.99  ? 278 THR E N   1 
ATOM   7363  C  CA  . THR E 2 145 ? 75.119  9.100   156.046 1.00 22.26  ? 278 THR E CA  1 
ATOM   7364  C  C   . THR E 2 145 ? 75.502  9.822   154.754 1.00 27.03  ? 278 THR E C   1 
ATOM   7365  O  O   . THR E 2 145 ? 76.396  9.385   154.018 1.00 22.70  ? 278 THR E O   1 
ATOM   7366  C  CB  . THR E 2 145 ? 75.780  9.841   157.195 1.00 23.73  ? 278 THR E CB  1 
ATOM   7367  O  OG1 . THR E 2 145 ? 77.193  9.898   156.974 1.00 31.39  ? 278 THR E OG1 1 
ATOM   7368  C  CG2 . THR E 2 145 ? 75.515  9.128   158.491 1.00 24.90  ? 278 THR E CG2 1 
ATOM   7369  N  N   . ASN E 2 146 ? 74.840  10.949  154.506 1.00 33.70  ? 279 ASN E N   1 
ATOM   7370  C  CA  . ASN E 2 146 ? 75.082  11.740  153.310 1.00 35.87  ? 279 ASN E CA  1 
ATOM   7371  C  C   . ASN E 2 146 ? 76.425  12.402  153.421 1.00 43.21  ? 279 ASN E C   1 
ATOM   7372  O  O   . ASN E 2 146 ? 76.876  12.740  154.523 1.00 42.51  ? 279 ASN E O   1 
ATOM   7373  C  CB  . ASN E 2 146 ? 73.992  12.788  153.150 1.00 32.22  ? 279 ASN E CB  1 
ATOM   7374  C  CG  . ASN E 2 146 ? 72.609  12.176  153.152 1.00 29.40  ? 279 ASN E CG  1 
ATOM   7375  O  OD1 . ASN E 2 146 ? 71.881  12.255  154.138 1.00 32.44  ? 279 ASN E OD1 1 
ATOM   7376  N  ND2 . ASN E 2 146 ? 72.257  11.524  152.061 1.00 23.06  ? 279 ASN E ND2 1 
ATOM   7377  N  N   . THR E 2 147 ? 77.071  12.567  152.276 1.00 55.70  ? 280 THR E N   1 
ATOM   7378  C  CA  . THR E 2 147 ? 78.387  13.187  152.228 1.00 70.26  ? 280 THR E CA  1 
ATOM   7379  C  C   . THR E 2 147 ? 78.310  14.678  152.569 1.00 74.49  ? 280 THR E C   1 
ATOM   7380  O  O   . THR E 2 147 ? 77.891  15.054  153.664 1.00 76.79  ? 280 THR E O   1 
ATOM   7381  C  CB  . THR E 2 147 ? 79.014  12.991  150.842 1.00 77.04  ? 280 THR E CB  1 
ATOM   7382  O  OG1 . THR E 2 147 ? 78.322  13.809  149.886 1.00 77.09  ? 280 THR E OG1 1 
ATOM   7383  C  CG2 . THR E 2 147 ? 78.902  11.520  150.424 1.00 81.83  ? 280 THR E CG2 1 
ATOM   7384  N  N   . ASP E 2 148 ? 78.761  15.520  151.648 1.00 76.94  ? 281 ASP E N   1 
ATOM   7385  C  CA  . ASP E 2 148 ? 78.719  16.961  151.832 1.00 82.65  ? 281 ASP E CA  1 
ATOM   7386  C  C   . ASP E 2 148 ? 77.273  17.392  151.652 1.00 86.78  ? 281 ASP E C   1 
ATOM   7387  O  O   . ASP E 2 148 ? 76.701  18.079  152.498 1.00 91.82  ? 281 ASP E O   1 
ATOM   7388  C  CB  . ASP E 2 148 ? 79.586  17.645  150.772 1.00 82.61  ? 281 ASP E CB  1 
ATOM   7389  C  CG  . ASP E 2 148 ? 79.245  17.194  149.351 1.00 79.20  ? 281 ASP E CG  1 
ATOM   7390  O  OD1 . ASP E 2 148 ? 79.810  16.173  148.901 1.00 80.75  ? 281 ASP E OD1 1 
ATOM   7391  O  OD2 . ASP E 2 148 ? 78.409  17.854  148.693 1.00 73.56  ? 281 ASP E OD2 1 
ATOM   7392  N  N   . GLY E 2 149 ? 76.693  16.939  150.545 1.00 85.10  ? 282 GLY E N   1 
ATOM   7393  C  CA  . GLY E 2 149 ? 75.326  17.255  150.192 1.00 84.10  ? 282 GLY E CA  1 
ATOM   7394  C  C   . GLY E 2 149 ? 75.009  16.568  148.878 1.00 82.92  ? 282 GLY E C   1 
ATOM   7395  O  O   . GLY E 2 149 ? 74.249  17.087  148.058 1.00 87.35  ? 282 GLY E O   1 
ATOM   7396  N  N   . LYS E 2 150 ? 75.642  15.417  148.661 1.00 76.00  ? 283 LYS E N   1 
ATOM   7397  C  CA  . LYS E 2 150 ? 75.432  14.627  147.456 1.00 67.03  ? 283 LYS E CA  1 
ATOM   7398  C  C   . LYS E 2 150 ? 74.078  13.941  147.558 1.00 61.06  ? 283 LYS E C   1 
ATOM   7399  O  O   . LYS E 2 150 ? 73.475  13.920  148.630 1.00 62.36  ? 283 LYS E O   1 
ATOM   7400  C  CB  . LYS E 2 150 ? 76.532  13.573  147.316 1.00 66.47  ? 283 LYS E CB  1 
ATOM   7401  C  CG  . LYS E 2 150 ? 77.508  13.823  146.177 1.00 68.49  ? 283 LYS E CG  1 
ATOM   7402  C  CD  . LYS E 2 150 ? 78.293  15.117  146.360 1.00 75.03  ? 283 LYS E CD  1 
ATOM   7403  C  CE  . LYS E 2 150 ? 78.021  16.146  145.247 1.00 78.05  ? 283 LYS E CE  1 
ATOM   7404  N  NZ  . LYS E 2 150 ? 76.634  16.720  145.271 1.00 80.56  ? 283 LYS E NZ  1 
ATOM   7405  N  N   . ASN E 2 151 ? 73.594  13.401  146.441 1.00 58.27  ? 284 ASN E N   1 
ATOM   7406  C  CA  . ASN E 2 151 ? 72.308  12.695  146.417 1.00 56.40  ? 284 ASN E CA  1 
ATOM   7407  C  C   . ASN E 2 151 ? 72.369  11.353  147.177 1.00 48.98  ? 284 ASN E C   1 
ATOM   7408  O  O   . ASN E 2 151 ? 71.326  10.797  147.543 1.00 45.04  ? 284 ASN E O   1 
ATOM   7409  C  CB  . ASN E 2 151 ? 71.860  12.432  144.965 1.00 66.75  ? 284 ASN E CB  1 
ATOM   7410  C  CG  . ASN E 2 151 ? 71.271  13.664  144.285 1.00 76.28  ? 284 ASN E CG  1 
ATOM   7411  O  OD1 . ASN E 2 151 ? 71.936  14.322  143.478 1.00 83.06  ? 284 ASN E OD1 1 
ATOM   7412  N  ND2 . ASN E 2 151 ? 70.005  13.958  144.581 1.00 76.44  ? 284 ASN E ND2 1 
ATOM   7413  N  N   . TYR E 2 152 ? 73.586  10.877  147.473 1.00 45.57  ? 285 TYR E N   1 
ATOM   7414  C  CA  . TYR E 2 152 ? 73.774  9.581   148.142 1.00 39.39  ? 285 TYR E CA  1 
ATOM   7415  C  C   . TYR E 2 152 ? 74.508  9.500   149.496 1.00 32.24  ? 285 TYR E C   1 
ATOM   7416  O  O   . TYR E 2 152 ? 75.235  10.419  149.898 1.00 37.35  ? 285 TYR E O   1 
ATOM   7417  C  CB  . TYR E 2 152 ? 74.445  8.621   147.164 1.00 41.05  ? 285 TYR E CB  1 
ATOM   7418  C  CG  . TYR E 2 152 ? 75.871  8.987   146.805 1.00 42.51  ? 285 TYR E CG  1 
ATOM   7419  C  CD1 . TYR E 2 152 ? 76.145  10.021  145.923 1.00 43.50  ? 285 TYR E CD1 1 
ATOM   7420  C  CD2 . TYR E 2 152 ? 76.941  8.246   147.302 1.00 45.54  ? 285 TYR E CD2 1 
ATOM   7421  C  CE1 . TYR E 2 152 ? 77.446  10.304  145.535 1.00 48.25  ? 285 TYR E CE1 1 
ATOM   7422  C  CE2 . TYR E 2 152 ? 78.242  8.518   146.922 1.00 50.35  ? 285 TYR E CE2 1 
ATOM   7423  C  CZ  . TYR E 2 152 ? 78.490  9.549   146.034 1.00 52.23  ? 285 TYR E CZ  1 
ATOM   7424  O  OH  . TYR E 2 152 ? 79.777  9.815   145.632 1.00 56.49  ? 285 TYR E OH  1 
ATOM   7425  N  N   . CYS E 2 153 ? 74.325  8.361   150.172 1.00 25.00  ? 286 CYS E N   1 
ATOM   7426  C  CA  . CYS E 2 153 ? 74.963  8.097   151.460 1.00 19.46  ? 286 CYS E CA  1 
ATOM   7427  C  C   . CYS E 2 153 ? 76.275  7.344   151.291 1.00 20.87  ? 286 CYS E C   1 
ATOM   7428  O  O   . CYS E 2 153 ? 76.309  6.131   151.365 1.00 15.64  ? 286 CYS E O   1 
ATOM   7429  C  CB  . CYS E 2 153 ? 74.005  7.334   152.357 1.00 13.96  ? 286 CYS E CB  1 
ATOM   7430  S  SG  . CYS E 2 153 ? 72.683  8.435   152.924 1.00 24.43  ? 286 CYS E SG  1 
ATOM   7431  N  N   . GLY E 2 154 ? 77.351  8.085   151.034 1.00 26.55  ? 287 GLY E N   1 
ATOM   7432  C  CA  . GLY E 2 154 ? 78.643  7.469   150.814 1.00 24.96  ? 287 GLY E CA  1 
ATOM   7433  C  C   . GLY E 2 154 ? 79.473  7.275   152.055 1.00 21.57  ? 287 GLY E C   1 
ATOM   7434  O  O   . GLY E 2 154 ? 80.583  6.751   151.996 1.00 28.27  ? 287 GLY E O   1 
ATOM   7435  N  N   . LEU E 2 155 ? 78.925  7.674   153.191 1.00 19.91  ? 288 LEU E N   1 
ATOM   7436  C  CA  . LEU E 2 155 ? 79.635  7.556   154.464 1.00 26.63  ? 288 LEU E CA  1 
ATOM   7437  C  C   . LEU E 2 155 ? 79.047  6.507   155.405 1.00 28.96  ? 288 LEU E C   1 
ATOM   7438  O  O   . LEU E 2 155 ? 77.850  6.517   155.668 1.00 28.31  ? 288 LEU E O   1 
ATOM   7439  C  CB  . LEU E 2 155 ? 79.651  8.903   155.171 1.00 26.45  ? 288 LEU E CB  1 
ATOM   7440  C  CG  . LEU E 2 155 ? 80.611  9.939   154.598 1.00 33.84  ? 288 LEU E CG  1 
ATOM   7441  C  CD1 . LEU E 2 155 ? 80.320  11.293  155.234 1.00 32.91  ? 288 LEU E CD1 1 
ATOM   7442  C  CD2 . LEU E 2 155 ? 82.065  9.490   154.841 1.00 32.75  ? 288 LEU E CD2 1 
ATOM   7443  N  N   . PRO E 2 156 ? 79.892  5.610   155.958 1.00 27.51  ? 289 PRO E N   1 
ATOM   7444  C  CA  . PRO E 2 156 ? 79.366  4.594   156.860 1.00 22.41  ? 289 PRO E CA  1 
ATOM   7445  C  C   . PRO E 2 156 ? 79.218  5.202   158.229 1.00 24.49  ? 289 PRO E C   1 
ATOM   7446  O  O   . PRO E 2 156 ? 80.060  5.956   158.682 1.00 27.45  ? 289 PRO E O   1 
ATOM   7447  C  CB  . PRO E 2 156 ? 80.464  3.542   156.850 1.00 17.43  ? 289 PRO E CB  1 
ATOM   7448  C  CG  . PRO E 2 156 ? 81.690  4.371   156.827 1.00 20.17  ? 289 PRO E CG  1 
ATOM   7449  C  CD  . PRO E 2 156 ? 81.357  5.469   155.823 1.00 26.88  ? 289 PRO E CD  1 
ATOM   7450  N  N   . GLY E 2 157 ? 78.084  4.973   158.851 1.00 27.18  ? 290 GLY E N   1 
ATOM   7451  C  CA  . GLY E 2 157 ? 77.921  5.486   160.186 1.00 25.71  ? 290 GLY E CA  1 
ATOM   7452  C  C   . GLY E 2 157 ? 78.316  4.337   161.085 1.00 24.52  ? 290 GLY E C   1 
ATOM   7453  O  O   . GLY E 2 157 ? 78.729  3.262   160.634 1.00 19.21  ? 290 GLY E O   1 
ATOM   7454  N  N   . GLU E 2 158 ? 78.219  4.549   162.375 1.00 21.17  ? 291 GLU E N   1 
ATOM   7455  C  CA  . GLU E 2 158 ? 78.556  3.469   163.258 1.00 18.88  ? 291 GLU E CA  1 
ATOM   7456  C  C   . GLU E 2 158 ? 77.352  2.535   163.297 1.00 18.43  ? 291 GLU E C   1 
ATOM   7457  O  O   . GLU E 2 158 ? 76.203  2.975   163.370 1.00 13.77  ? 291 GLU E O   1 
ATOM   7458  C  CB  . GLU E 2 158 ? 78.882  3.998   164.650 1.00 16.99  ? 291 GLU E CB  1 
ATOM   7459  C  CG  . GLU E 2 158 ? 80.119  4.839   164.698 1.00 19.47  ? 291 GLU E CG  1 
ATOM   7460  C  CD  . GLU E 2 158 ? 80.572  5.115   166.109 1.00 26.40  ? 291 GLU E CD  1 
ATOM   7461  O  OE1 . GLU E 2 158 ? 79.736  5.026   167.047 1.00 28.39  ? 291 GLU E OE1 1 
ATOM   7462  O  OE2 . GLU E 2 158 ? 81.780  5.411   166.277 1.00 26.00  ? 291 GLU E OE2 1 
ATOM   7463  N  N   . TYR E 2 159 ? 77.605  1.242   163.182 1.00 17.70  ? 292 TYR E N   1 
ATOM   7464  C  CA  . TYR E 2 159 ? 76.504  0.301   163.240 1.00 16.95  ? 292 TYR E CA  1 
ATOM   7465  C  C   . TYR E 2 159 ? 76.916  -1.109  163.505 1.00 16.62  ? 292 TYR E C   1 
ATOM   7466  O  O   . TYR E 2 159 ? 78.097  -1.437  163.562 1.00 22.01  ? 292 TYR E O   1 
ATOM   7467  C  CB  . TYR E 2 159 ? 75.691  0.330   161.959 1.00 16.30  ? 292 TYR E CB  1 
ATOM   7468  C  CG  . TYR E 2 159 ? 76.333  -0.321  160.732 1.00 15.49  ? 292 TYR E CG  1 
ATOM   7469  C  CD1 . TYR E 2 159 ? 77.229  0.385   159.918 1.00 16.92  ? 292 TYR E CD1 1 
ATOM   7470  C  CD2 . TYR E 2 159 ? 75.894  -1.564  160.284 1.00 11.04  ? 292 TYR E CD2 1 
ATOM   7471  C  CE1 . TYR E 2 159 ? 77.644  -0.129  158.678 1.00 16.80  ? 292 TYR E CE1 1 
ATOM   7472  C  CE2 . TYR E 2 159 ? 76.303  -2.086  159.063 1.00 13.30  ? 292 TYR E CE2 1 
ATOM   7473  C  CZ  . TYR E 2 159 ? 77.171  -1.369  158.258 1.00 18.04  ? 292 TYR E CZ  1 
ATOM   7474  O  OH  . TYR E 2 159 ? 77.540  -1.897  157.031 1.00 15.60  ? 292 TYR E OH  1 
ATOM   7475  N  N   . TRP E 2 160 ? 75.895  -1.921  163.707 1.00 16.16  ? 293 TRP E N   1 
ATOM   7476  C  CA  . TRP E 2 160 ? 76.019  -3.340  163.950 1.00 16.94  ? 293 TRP E CA  1 
ATOM   7477  C  C   . TRP E 2 160 ? 74.951  -3.967  163.059 1.00 17.46  ? 293 TRP E C   1 
ATOM   7478  O  O   . TRP E 2 160 ? 73.746  -3.729  163.259 1.00 22.34  ? 293 TRP E O   1 
ATOM   7479  C  CB  . TRP E 2 160 ? 75.710  -3.651  165.404 1.00 17.23  ? 293 TRP E CB  1 
ATOM   7480  C  CG  . TRP E 2 160 ? 75.734  -5.112  165.668 1.00 19.66  ? 293 TRP E CG  1 
ATOM   7481  C  CD1 . TRP E 2 160 ? 74.666  -5.935  165.801 1.00 16.90  ? 293 TRP E CD1 1 
ATOM   7482  C  CD2 . TRP E 2 160 ? 76.897  -5.938  165.763 1.00 22.18  ? 293 TRP E CD2 1 
ATOM   7483  N  NE1 . TRP E 2 160 ? 75.085  -7.230  165.964 1.00 17.55  ? 293 TRP E NE1 1 
ATOM   7484  C  CE2 . TRP E 2 160 ? 76.452  -7.260  165.946 1.00 19.91  ? 293 TRP E CE2 1 
ATOM   7485  C  CE3 . TRP E 2 160 ? 78.281  -5.686  165.707 1.00 19.08  ? 293 TRP E CE3 1 
ATOM   7486  C  CZ2 . TRP E 2 160 ? 77.337  -8.335  166.075 1.00 16.03  ? 293 TRP E CZ2 1 
ATOM   7487  C  CZ3 . TRP E 2 160 ? 79.157  -6.749  165.833 1.00 12.85  ? 293 TRP E CZ3 1 
ATOM   7488  C  CH2 . TRP E 2 160 ? 78.684  -8.058  166.016 1.00 11.90  ? 293 TRP E CH2 1 
ATOM   7489  N  N   . LEU E 2 161 ? 75.379  -4.780  162.096 1.00 12.13  ? 294 LEU E N   1 
ATOM   7490  C  CA  . LEU E 2 161 ? 74.434  -5.374  161.160 1.00 13.13  ? 294 LEU E CA  1 
ATOM   7491  C  C   . LEU E 2 161 ? 73.356  -6.215  161.778 1.00 20.29  ? 294 LEU E C   1 
ATOM   7492  O  O   . LEU E 2 161 ? 72.285  -6.344  161.184 1.00 20.37  ? 294 LEU E O   1 
ATOM   7493  C  CB  . LEU E 2 161 ? 75.138  -6.195  160.091 1.00 10.24  ? 294 LEU E CB  1 
ATOM   7494  C  CG  . LEU E 2 161 ? 74.263  -6.300  158.839 1.00 5.12   ? 294 LEU E CG  1 
ATOM   7495  C  CD1 . LEU E 2 161 ? 74.262  -4.971  158.184 1.00 2.70   ? 294 LEU E CD1 1 
ATOM   7496  C  CD2 . LEU E 2 161 ? 74.779  -7.334  157.860 1.00 8.89   ? 294 LEU E CD2 1 
ATOM   7497  N  N   . GLY E 2 162 ? 73.621  -6.742  162.976 1.00 24.37  ? 295 GLY E N   1 
ATOM   7498  C  CA  . GLY E 2 162 ? 72.660  -7.589  163.652 1.00 17.92  ? 295 GLY E CA  1 
ATOM   7499  C  C   . GLY E 2 162 ? 73.108  -9.017  163.455 1.00 20.53  ? 295 GLY E C   1 
ATOM   7500  O  O   . GLY E 2 162 ? 73.461  -9.394  162.337 1.00 19.79  ? 295 GLY E O   1 
ATOM   7501  N  N   . ASN E 2 163 ? 73.079  -9.801  164.534 1.00 20.06  ? 296 ASN E N   1 
ATOM   7502  C  CA  . ASN E 2 163 ? 73.509  -11.206 164.550 1.00 22.49  ? 296 ASN E CA  1 
ATOM   7503  C  C   . ASN E 2 163 ? 72.889  -12.198 163.567 1.00 24.73  ? 296 ASN E C   1 
ATOM   7504  O  O   . ASN E 2 163 ? 73.580  -13.110 163.091 1.00 27.38  ? 296 ASN E O   1 
ATOM   7505  C  CB  . ASN E 2 163 ? 73.398  -11.771 165.957 1.00 22.52  ? 296 ASN E CB  1 
ATOM   7506  C  CG  . ASN E 2 163 ? 74.443  -11.208 166.893 1.00 25.41  ? 296 ASN E CG  1 
ATOM   7507  O  OD1 . ASN E 2 163 ? 74.239  -11.183 168.091 1.00 32.52  ? 296 ASN E OD1 1 
ATOM   7508  N  ND2 . ASN E 2 163 ? 75.567  -10.762 166.352 1.00 22.04  ? 296 ASN E ND2 1 
ATOM   7509  N  N   . ASP E 2 164 ? 71.592  -12.064 163.300 1.00 19.74  ? 297 ASP E N   1 
ATOM   7510  C  CA  . ASP E 2 164 ? 70.945  -12.966 162.359 1.00 17.19  ? 297 ASP E CA  1 
ATOM   7511  C  C   . ASP E 2 164 ? 71.496  -12.807 160.974 1.00 22.46  ? 297 ASP E C   1 
ATOM   7512  O  O   . ASP E 2 164 ? 71.852  -13.794 160.348 1.00 27.89  ? 297 ASP E O   1 
ATOM   7513  C  CB  . ASP E 2 164 ? 69.444  -12.763 162.332 1.00 20.84  ? 297 ASP E CB  1 
ATOM   7514  C  CG  . ASP E 2 164 ? 68.766  -13.345 163.549 1.00 25.84  ? 297 ASP E CG  1 
ATOM   7515  O  OD1 . ASP E 2 164 ? 69.430  -14.067 164.323 1.00 31.75  ? 297 ASP E OD1 1 
ATOM   7516  O  OD2 . ASP E 2 164 ? 67.567  -13.083 163.739 1.00 26.32  ? 297 ASP E OD2 1 
ATOM   7517  N  N   . LYS E 2 165 ? 71.596  -11.563 160.510 1.00 23.30  ? 298 LYS E N   1 
ATOM   7518  C  CA  . LYS E 2 165 ? 72.129  -11.275 159.181 1.00 18.88  ? 298 LYS E CA  1 
ATOM   7519  C  C   . LYS E 2 165 ? 73.542  -11.805 159.027 1.00 19.23  ? 298 LYS E C   1 
ATOM   7520  O  O   . LYS E 2 165 ? 73.847  -12.501 158.069 1.00 21.45  ? 298 LYS E O   1 
ATOM   7521  C  CB  . LYS E 2 165 ? 72.121  -9.777  158.919 1.00 19.95  ? 298 LYS E CB  1 
ATOM   7522  C  CG  . LYS E 2 165 ? 70.760  -9.125  159.073 1.00 20.63  ? 298 LYS E CG  1 
ATOM   7523  C  CD  . LYS E 2 165 ? 70.854  -7.626  158.880 1.00 22.67  ? 298 LYS E CD  1 
ATOM   7524  C  CE  . LYS E 2 165 ? 69.515  -6.943  159.129 1.00 28.18  ? 298 LYS E CE  1 
ATOM   7525  N  NZ  . LYS E 2 165 ? 68.504  -7.272  158.077 1.00 39.59  ? 298 LYS E NZ  1 
ATOM   7526  N  N   . ILE E 2 166 ? 74.397  -11.486 159.991 1.00 20.83  ? 299 ILE E N   1 
ATOM   7527  C  CA  . ILE E 2 166 ? 75.793  -11.922 159.976 1.00 14.69  ? 299 ILE E CA  1 
ATOM   7528  C  C   . ILE E 2 166 ? 75.834  -13.420 159.848 1.00 17.19  ? 299 ILE E C   1 
ATOM   7529  O  O   . ILE E 2 166 ? 76.413  -13.951 158.914 1.00 23.17  ? 299 ILE E O   1 
ATOM   7530  C  CB  . ILE E 2 166 ? 76.498  -11.488 161.255 1.00 13.71  ? 299 ILE E CB  1 
ATOM   7531  C  CG1 . ILE E 2 166 ? 76.581  -9.955  161.284 1.00 15.15  ? 299 ILE E CG1 1 
ATOM   7532  C  CG2 . ILE E 2 166 ? 77.876  -12.141 161.349 1.00 19.04  ? 299 ILE E CG2 1 
ATOM   7533  C  CD1 . ILE E 2 166 ? 76.680  -9.333  162.631 1.00 15.19  ? 299 ILE E CD1 1 
ATOM   7534  N  N   . SER E 2 167 ? 75.143  -14.091 160.760 1.00 19.95  ? 300 SER E N   1 
ATOM   7535  C  CA  . SER E 2 167 ? 75.052  -15.553 160.761 1.00 24.94  ? 300 SER E CA  1 
ATOM   7536  C  C   . SER E 2 167 ? 74.768  -16.112 159.347 1.00 21.07  ? 300 SER E C   1 
ATOM   7537  O  O   . SER E 2 167 ? 75.626  -16.748 158.731 1.00 18.64  ? 300 SER E O   1 
ATOM   7538  C  CB  . SER E 2 167 ? 73.954  -15.990 161.737 1.00 20.93  ? 300 SER E CB  1 
ATOM   7539  O  OG  . SER E 2 167 ? 73.770  -17.382 161.684 1.00 17.87  ? 300 SER E OG  1 
ATOM   7540  N  N   . GLN E 2 168 ? 73.586  -15.788 158.827 1.00 19.53  ? 301 GLN E N   1 
ATOM   7541  C  CA  . GLN E 2 168 ? 73.122  -16.208 157.508 1.00 17.84  ? 301 GLN E CA  1 
ATOM   7542  C  C   . GLN E 2 168 ? 74.200  -16.032 156.462 1.00 15.05  ? 301 GLN E C   1 
ATOM   7543  O  O   . GLN E 2 168 ? 74.437  -16.919 155.663 1.00 10.91  ? 301 GLN E O   1 
ATOM   7544  C  CB  . GLN E 2 168 ? 71.904  -15.362 157.120 1.00 19.36  ? 301 GLN E CB  1 
ATOM   7545  C  CG  . GLN E 2 168 ? 71.085  -15.853 155.937 1.00 34.94  ? 301 GLN E CG  1 
ATOM   7546  C  CD  . GLN E 2 168 ? 71.806  -15.731 154.600 1.00 44.53  ? 301 GLN E CD  1 
ATOM   7547  O  OE1 . GLN E 2 168 ? 71.538  -16.503 153.664 1.00 48.83  ? 301 GLN E OE1 1 
ATOM   7548  N  NE2 . GLN E 2 168 ? 72.733  -14.771 154.501 1.00 49.51  ? 301 GLN E NE2 1 
ATOM   7549  N  N   . LEU E 2 169 ? 74.822  -14.860 156.477 1.00 18.80  ? 302 LEU E N   1 
ATOM   7550  C  CA  . LEU E 2 169 ? 75.860  -14.477 155.540 1.00 20.30  ? 302 LEU E CA  1 
ATOM   7551  C  C   . LEU E 2 169 ? 77.073  -15.380 155.570 1.00 25.61  ? 302 LEU E C   1 
ATOM   7552  O  O   . LEU E 2 169 ? 77.492  -15.925 154.542 1.00 30.09  ? 302 LEU E O   1 
ATOM   7553  C  CB  . LEU E 2 169 ? 76.314  -13.041 155.824 1.00 21.33  ? 302 LEU E CB  1 
ATOM   7554  C  CG  . LEU E 2 169 ? 75.492  -11.865 155.298 1.00 13.97  ? 302 LEU E CG  1 
ATOM   7555  C  CD1 . LEU E 2 169 ? 76.193  -10.566 155.619 1.00 7.25   ? 302 LEU E CD1 1 
ATOM   7556  C  CD2 . LEU E 2 169 ? 75.336  -12.014 153.797 1.00 12.55  ? 302 LEU E CD2 1 
ATOM   7557  N  N   . THR E 2 170 ? 77.658  -15.511 156.754 1.00 24.33  ? 303 THR E N   1 
ATOM   7558  C  CA  . THR E 2 170 ? 78.846  -16.334 156.925 1.00 24.53  ? 303 THR E CA  1 
ATOM   7559  C  C   . THR E 2 170 ? 78.508  -17.793 156.607 1.00 22.60  ? 303 THR E C   1 
ATOM   7560  O  O   . THR E 2 170 ? 79.398  -18.605 156.334 1.00 27.37  ? 303 THR E O   1 
ATOM   7561  C  CB  . THR E 2 170 ? 79.452  -16.201 158.380 1.00 24.18  ? 303 THR E CB  1 
ATOM   7562  O  OG1 . THR E 2 170 ? 78.598  -16.832 159.340 1.00 24.60  ? 303 THR E OG1 1 
ATOM   7563  C  CG2 . THR E 2 170 ? 79.612  -14.752 158.771 1.00 17.04  ? 303 THR E CG2 1 
ATOM   7564  N  N   . ARG E 2 171 ? 77.216  -18.108 156.590 1.00 15.29  ? 304 ARG E N   1 
ATOM   7565  C  CA  . ARG E 2 171 ? 76.794  -19.465 156.322 1.00 21.07  ? 304 ARG E CA  1 
ATOM   7566  C  C   . ARG E 2 171 ? 76.372  -19.760 154.903 1.00 27.92  ? 304 ARG E C   1 
ATOM   7567  O  O   . ARG E 2 171 ? 75.861  -20.837 154.608 1.00 33.45  ? 304 ARG E O   1 
ATOM   7568  C  CB  . ARG E 2 171 ? 75.730  -19.899 157.313 1.00 24.64  ? 304 ARG E CB  1 
ATOM   7569  C  CG  . ARG E 2 171 ? 76.295  -20.116 158.713 1.00 30.24  ? 304 ARG E CG  1 
ATOM   7570  C  CD  . ARG E 2 171 ? 75.277  -20.771 159.630 1.00 39.29  ? 304 ARG E CD  1 
ATOM   7571  N  NE  . ARG E 2 171 ? 74.131  -19.897 159.891 1.00 51.81  ? 304 ARG E NE  1 
ATOM   7572  C  CZ  . ARG E 2 171 ? 72.857  -20.281 159.865 1.00 56.25  ? 304 ARG E CZ  1 
ATOM   7573  N  NH1 . ARG E 2 171 ? 72.539  -21.540 159.585 1.00 58.25  ? 304 ARG E NH1 1 
ATOM   7574  N  NH2 . ARG E 2 171 ? 71.898  -19.397 160.125 1.00 57.87  ? 304 ARG E NH2 1 
ATOM   7575  N  N   . MET E 2 172 ? 76.596  -18.802 154.016 1.00 35.45  ? 305 MET E N   1 
ATOM   7576  C  CA  . MET E 2 172 ? 76.269  -18.986 152.606 1.00 33.35  ? 305 MET E CA  1 
ATOM   7577  C  C   . MET E 2 172 ? 77.453  -19.644 151.931 1.00 34.90  ? 305 MET E C   1 
ATOM   7578  O  O   . MET E 2 172 ? 77.358  -20.090 150.804 1.00 42.27  ? 305 MET E O   1 
ATOM   7579  C  CB  . MET E 2 172 ? 76.017  -17.646 151.930 1.00 27.79  ? 305 MET E CB  1 
ATOM   7580  C  CG  . MET E 2 172 ? 74.729  -16.967 152.308 1.00 25.14  ? 305 MET E CG  1 
ATOM   7581  S  SD  . MET E 2 172 ? 74.680  -15.365 151.480 1.00 34.02  ? 305 MET E SD  1 
ATOM   7582  C  CE  . MET E 2 172 ? 73.822  -15.768 150.033 1.00 28.66  ? 305 MET E CE  1 
ATOM   7583  N  N   . GLY E 2 173 ? 78.587  -19.646 152.618 1.00 37.43  ? 306 GLY E N   1 
ATOM   7584  C  CA  . GLY E 2 173 ? 79.797  -20.232 152.082 1.00 32.21  ? 306 GLY E CA  1 
ATOM   7585  C  C   . GLY E 2 173 ? 80.991  -19.669 152.809 1.00 28.35  ? 306 GLY E C   1 
ATOM   7586  O  O   . GLY E 2 173 ? 80.820  -18.869 153.726 1.00 28.58  ? 306 GLY E O   1 
ATOM   7587  N  N   . PRO E 2 174 ? 82.214  -20.031 152.397 1.00 28.36  ? 307 PRO E N   1 
ATOM   7588  C  CA  . PRO E 2 174 ? 83.467  -19.573 153.001 1.00 26.56  ? 307 PRO E CA  1 
ATOM   7589  C  C   . PRO E 2 174 ? 83.507  -18.075 152.953 1.00 21.60  ? 307 PRO E C   1 
ATOM   7590  O  O   . PRO E 2 174 ? 83.521  -17.496 151.869 1.00 24.22  ? 307 PRO E O   1 
ATOM   7591  C  CB  . PRO E 2 174 ? 84.529  -20.157 152.081 1.00 28.73  ? 307 PRO E CB  1 
ATOM   7592  C  CG  . PRO E 2 174 ? 83.880  -21.361 151.537 1.00 30.61  ? 307 PRO E CG  1 
ATOM   7593  C  CD  . PRO E 2 174 ? 82.495  -20.860 151.221 1.00 30.27  ? 307 PRO E CD  1 
ATOM   7594  N  N   . THR E 2 175 ? 83.441  -17.452 154.123 1.00 8.83   ? 308 THR E N   1 
ATOM   7595  C  CA  . THR E 2 175 ? 83.457  -16.012 154.196 1.00 12.37  ? 308 THR E CA  1 
ATOM   7596  C  C   . THR E 2 175 ? 84.642  -15.646 155.049 1.00 18.95  ? 308 THR E C   1 
ATOM   7597  O  O   . THR E 2 175 ? 84.948  -16.316 156.029 1.00 19.85  ? 308 THR E O   1 
ATOM   7598  C  CB  . THR E 2 175 ? 82.121  -15.434 154.782 1.00 16.88  ? 308 THR E CB  1 
ATOM   7599  O  OG1 . THR E 2 175 ? 81.884  -15.985 156.079 1.00 24.31  ? 308 THR E OG1 1 
ATOM   7600  C  CG2 . THR E 2 175 ? 80.914  -15.776 153.873 1.00 11.45  ? 308 THR E CG2 1 
ATOM   7601  N  N   . GLU E 2 176 ? 85.349  -14.611 154.637 1.00 22.55  ? 309 GLU E N   1 
ATOM   7602  C  CA  . GLU E 2 176 ? 86.524  -14.178 155.359 1.00 23.46  ? 309 GLU E CA  1 
ATOM   7603  C  C   . GLU E 2 176 ? 86.298  -12.849 156.051 1.00 24.66  ? 309 GLU E C   1 
ATOM   7604  O  O   . GLU E 2 176 ? 85.759  -11.917 155.470 1.00 34.00  ? 309 GLU E O   1 
ATOM   7605  C  CB  . GLU E 2 176 ? 87.689  -14.070 154.392 1.00 27.75  ? 309 GLU E CB  1 
ATOM   7606  C  CG  . GLU E 2 176 ? 87.289  -13.449 153.058 1.00 31.67  ? 309 GLU E CG  1 
ATOM   7607  C  CD  . GLU E 2 176 ? 88.470  -13.245 152.134 1.00 41.75  ? 309 GLU E CD  1 
ATOM   7608  O  OE1 . GLU E 2 176 ? 89.601  -13.118 152.648 1.00 43.63  ? 309 GLU E OE1 1 
ATOM   7609  O  OE2 . GLU E 2 176 ? 88.273  -13.208 150.897 1.00 47.90  ? 309 GLU E OE2 1 
ATOM   7610  N  N   . LEU E 2 177 ? 86.725  -12.768 157.299 1.00 19.67  ? 310 LEU E N   1 
ATOM   7611  C  CA  . LEU E 2 177 ? 86.583  -11.558 158.077 1.00 12.81  ? 310 LEU E CA  1 
ATOM   7612  C  C   . LEU E 2 177 ? 87.850  -10.703 158.045 1.00 17.23  ? 310 LEU E C   1 
ATOM   7613  O  O   . LEU E 2 177 ? 88.969  -11.226 158.075 1.00 16.93  ? 310 LEU E O   1 
ATOM   7614  C  CB  . LEU E 2 177 ? 86.263  -11.928 159.514 1.00 11.65  ? 310 LEU E CB  1 
ATOM   7615  C  CG  . LEU E 2 177 ? 86.353  -10.833 160.572 1.00 14.24  ? 310 LEU E CG  1 
ATOM   7616  C  CD1 . LEU E 2 177 ? 85.429  -9.667  160.246 1.00 17.47  ? 310 LEU E CD1 1 
ATOM   7617  C  CD2 . LEU E 2 177 ? 85.998  -11.441 161.896 1.00 8.81   ? 310 LEU E CD2 1 
ATOM   7618  N  N   . LEU E 2 178 ? 87.648  -9.389  157.963 1.00 17.78  ? 311 LEU E N   1 
ATOM   7619  C  CA  . LEU E 2 178 ? 88.721  -8.412  157.961 1.00 12.05  ? 311 LEU E CA  1 
ATOM   7620  C  C   . LEU E 2 178 ? 88.366  -7.371  158.982 1.00 14.14  ? 311 LEU E C   1 
ATOM   7621  O  O   . LEU E 2 178 ? 87.365  -6.651  158.843 1.00 13.13  ? 311 LEU E O   1 
ATOM   7622  C  CB  . LEU E 2 178 ? 88.863  -7.712  156.617 1.00 16.98  ? 311 LEU E CB  1 
ATOM   7623  C  CG  . LEU E 2 178 ? 89.747  -6.448  156.631 1.00 14.98  ? 311 LEU E CG  1 
ATOM   7624  C  CD1 . LEU E 2 178 ? 91.054  -6.689  157.357 1.00 17.59  ? 311 LEU E CD1 1 
ATOM   7625  C  CD2 . LEU E 2 178 ? 90.026  -6.008  155.213 1.00 15.69  ? 311 LEU E CD2 1 
ATOM   7626  N  N   . ILE E 2 179 ? 89.245  -7.244  159.962 1.00 9.00   ? 312 ILE E N   1 
ATOM   7627  C  CA  . ILE E 2 179 ? 89.069  -6.288  161.026 1.00 15.91  ? 312 ILE E CA  1 
ATOM   7628  C  C   . ILE E 2 179 ? 90.175  -5.249  161.024 1.00 23.82  ? 312 ILE E C   1 
ATOM   7629  O  O   . ILE E 2 179 ? 91.343  -5.597  161.210 1.00 24.95  ? 312 ILE E O   1 
ATOM   7630  C  CB  . ILE E 2 179 ? 89.144  -6.987  162.333 1.00 17.17  ? 312 ILE E CB  1 
ATOM   7631  C  CG1 . ILE E 2 179 ? 88.180  -8.159  162.334 1.00 15.99  ? 312 ILE E CG1 1 
ATOM   7632  C  CG2 . ILE E 2 179 ? 88.841  -6.037  163.444 1.00 20.00  ? 312 ILE E CG2 1 
ATOM   7633  C  CD1 . ILE E 2 179 ? 88.273  -9.018  163.581 1.00 10.32  ? 312 ILE E CD1 1 
ATOM   7634  N  N   . GLU E 2 180 ? 89.808  -3.979  160.842 1.00 19.40  ? 313 GLU E N   1 
ATOM   7635  C  CA  . GLU E 2 180 ? 90.787  -2.895  160.858 1.00 22.32  ? 313 GLU E CA  1 
ATOM   7636  C  C   . GLU E 2 180 ? 90.540  -1.956  162.006 1.00 26.09  ? 313 GLU E C   1 
ATOM   7637  O  O   . GLU E 2 180 ? 89.399  -1.695  162.376 1.00 27.60  ? 313 GLU E O   1 
ATOM   7638  C  CB  . GLU E 2 180 ? 90.736  -2.069  159.596 1.00 29.03  ? 313 GLU E CB  1 
ATOM   7639  C  CG  . GLU E 2 180 ? 90.952  -2.834  158.348 1.00 37.22  ? 313 GLU E CG  1 
ATOM   7640  C  CD  . GLU E 2 180 ? 89.815  -2.603  157.415 1.00 39.99  ? 313 GLU E CD  1 
ATOM   7641  O  OE1 . GLU E 2 180 ? 88.742  -3.212  157.660 1.00 47.18  ? 313 GLU E OE1 1 
ATOM   7642  O  OE2 . GLU E 2 180 ? 89.978  -1.779  156.483 1.00 33.31  ? 313 GLU E OE2 1 
ATOM   7643  N  N   . MET E 2 181 ? 91.619  -1.385  162.520 1.00 26.68  ? 314 MET E N   1 
ATOM   7644  C  CA  . MET E 2 181 ? 91.518  -0.459  163.633 1.00 22.96  ? 314 MET E CA  1 
ATOM   7645  C  C   . MET E 2 181 ? 92.591  0.588   163.469 1.00 27.05  ? 314 MET E C   1 
ATOM   7646  O  O   . MET E 2 181 ? 93.546  0.387   162.731 1.00 28.85  ? 314 MET E O   1 
ATOM   7647  C  CB  . MET E 2 181 ? 91.687  -1.196  164.959 1.00 17.10  ? 314 MET E CB  1 
ATOM   7648  C  CG  . MET E 2 181 ? 92.997  -1.907  165.085 1.00 16.76  ? 314 MET E CG  1 
ATOM   7649  S  SD  . MET E 2 181 ? 92.939  -3.290  166.225 1.00 22.55  ? 314 MET E SD  1 
ATOM   7650  C  CE  . MET E 2 181 ? 91.914  -4.371  165.365 1.00 24.24  ? 314 MET E CE  1 
ATOM   7651  N  N   . GLU E 2 182 ? 92.439  1.692   164.182 1.00 26.06  ? 315 GLU E N   1 
ATOM   7652  C  CA  . GLU E 2 182 ? 93.377  2.783   164.099 1.00 27.19  ? 315 GLU E CA  1 
ATOM   7653  C  C   . GLU E 2 182 ? 93.391  3.553   165.413 1.00 30.27  ? 315 GLU E C   1 
ATOM   7654  O  O   . GLU E 2 182 ? 92.330  3.881   165.939 1.00 32.84  ? 315 GLU E O   1 
ATOM   7655  C  CB  . GLU E 2 182 ? 92.940  3.690   162.961 1.00 34.85  ? 315 GLU E CB  1 
ATOM   7656  C  CG  . GLU E 2 182 ? 93.692  4.997   162.875 1.00 46.18  ? 315 GLU E CG  1 
ATOM   7657  C  CD  . GLU E 2 182 ? 93.117  5.951   161.830 1.00 50.92  ? 315 GLU E CD  1 
ATOM   7658  O  OE1 . GLU E 2 182 ? 93.058  5.583   160.628 1.00 49.57  ? 315 GLU E OE1 1 
ATOM   7659  O  OE2 . GLU E 2 182 ? 92.744  7.081   162.220 1.00 52.94  ? 315 GLU E OE2 1 
ATOM   7660  N  N   . ASP E 2 183 ? 94.584  3.809   165.954 1.00 30.69  ? 316 ASP E N   1 
ATOM   7661  C  CA  . ASP E 2 183 ? 94.731  4.558   167.206 1.00 37.13  ? 316 ASP E CA  1 
ATOM   7662  C  C   . ASP E 2 183 ? 94.489  6.046   166.970 1.00 38.59  ? 316 ASP E C   1 
ATOM   7663  O  O   . ASP E 2 183 ? 94.290  6.485   165.840 1.00 39.62  ? 316 ASP E O   1 
ATOM   7664  C  CB  . ASP E 2 183 ? 96.125  4.353   167.817 1.00 44.25  ? 316 ASP E CB  1 
ATOM   7665  C  CG  . ASP E 2 183 ? 97.256  5.024   167.012 1.00 47.09  ? 316 ASP E CG  1 
ATOM   7666  O  OD1 . ASP E 2 183 ? 97.106  5.296   165.803 1.00 42.84  ? 316 ASP E OD1 1 
ATOM   7667  O  OD2 . ASP E 2 183 ? 98.326  5.263   167.606 1.00 50.14  ? 316 ASP E OD2 1 
ATOM   7668  N  N   . TRP E 2 184 ? 94.557  6.838   168.025 1.00 39.04  ? 317 TRP E N   1 
ATOM   7669  C  CA  . TRP E 2 184 ? 94.320  8.261   167.880 1.00 41.52  ? 317 TRP E CA  1 
ATOM   7670  C  C   . TRP E 2 184 ? 95.464  9.051   167.245 1.00 45.21  ? 317 TRP E C   1 
ATOM   7671  O  O   . TRP E 2 184 ? 95.359  10.269  167.069 1.00 45.82  ? 317 TRP E O   1 
ATOM   7672  C  CB  . TRP E 2 184 ? 93.911  8.844   169.224 1.00 42.69  ? 317 TRP E CB  1 
ATOM   7673  C  CG  . TRP E 2 184 ? 92.619  8.268   169.697 1.00 40.01  ? 317 TRP E CG  1 
ATOM   7674  C  CD1 . TRP E 2 184 ? 92.398  6.994   170.156 1.00 38.53  ? 317 TRP E CD1 1 
ATOM   7675  C  CD2 . TRP E 2 184 ? 91.353  8.931   169.725 1.00 40.06  ? 317 TRP E CD2 1 
ATOM   7676  N  NE1 . TRP E 2 184 ? 91.070  6.828   170.463 1.00 35.65  ? 317 TRP E NE1 1 
ATOM   7677  C  CE2 . TRP E 2 184 ? 90.404  8.001   170.208 1.00 39.08  ? 317 TRP E CE2 1 
ATOM   7678  C  CE3 . TRP E 2 184 ? 90.924  10.226  169.387 1.00 37.26  ? 317 TRP E CE3 1 
ATOM   7679  C  CZ2 . TRP E 2 184 ? 89.048  8.326   170.362 1.00 38.57  ? 317 TRP E CZ2 1 
ATOM   7680  C  CZ3 . TRP E 2 184 ? 89.574  10.548  169.540 1.00 35.15  ? 317 TRP E CZ3 1 
ATOM   7681  C  CH2 . TRP E 2 184 ? 88.656  9.601   170.022 1.00 35.85  ? 317 TRP E CH2 1 
ATOM   7682  N  N   . LYS E 2 185 ? 96.551  8.364   166.897 1.00 45.57  ? 318 LYS E N   1 
ATOM   7683  C  CA  . LYS E 2 185 ? 97.681  9.026   166.258 1.00 50.62  ? 318 LYS E CA  1 
ATOM   7684  C  C   . LYS E 2 185 ? 97.758  8.642   164.794 1.00 53.28  ? 318 LYS E C   1 
ATOM   7685  O  O   . LYS E 2 185 ? 98.812  8.760   164.166 1.00 58.29  ? 318 LYS E O   1 
ATOM   7686  C  CB  . LYS E 2 185 ? 98.999  8.712   166.965 1.00 54.25  ? 318 LYS E CB  1 
ATOM   7687  C  CG  . LYS E 2 185 ? 99.158  9.425   168.299 1.00 62.99  ? 318 LYS E CG  1 
ATOM   7688  C  CD  . LYS E 2 185 ? 100.489 9.087   168.954 1.00 70.30  ? 318 LYS E CD  1 
ATOM   7689  C  CE  . LYS E 2 185 ? 100.616 9.744   170.327 1.00 74.40  ? 318 LYS E CE  1 
ATOM   7690  N  NZ  . LYS E 2 185 ? 101.915 9.421   170.998 1.00 75.16  ? 318 LYS E NZ  1 
ATOM   7691  N  N   . GLY E 2 186 ? 96.639  8.161   164.258 1.00 53.08  ? 319 GLY E N   1 
ATOM   7692  C  CA  . GLY E 2 186 ? 96.580  7.791   162.853 1.00 53.68  ? 319 GLY E CA  1 
ATOM   7693  C  C   . GLY E 2 186 ? 97.247  6.504   162.376 1.00 57.87  ? 319 GLY E C   1 
ATOM   7694  O  O   . GLY E 2 186 ? 97.227  6.220   161.170 1.00 62.21  ? 319 GLY E O   1 
ATOM   7695  N  N   . ASP E 2 187 ? 97.872  5.740   163.270 1.00 55.90  ? 320 ASP E N   1 
ATOM   7696  C  CA  . ASP E 2 187 ? 98.490  4.488   162.840 1.00 55.21  ? 320 ASP E CA  1 
ATOM   7697  C  C   . ASP E 2 187 ? 97.371  3.479   162.657 1.00 50.37  ? 320 ASP E C   1 
ATOM   7698  O  O   . ASP E 2 187 ? 96.414  3.480   163.433 1.00 49.74  ? 320 ASP E O   1 
ATOM   7699  C  CB  . ASP E 2 187 ? 99.512  3.981   163.861 1.00 58.53  ? 320 ASP E CB  1 
ATOM   7700  C  CG  . ASP E 2 187 ? 100.806 4.763   163.822 1.00 64.29  ? 320 ASP E CG  1 
ATOM   7701  O  OD1 . ASP E 2 187 ? 101.317 5.012   162.706 1.00 65.62  ? 320 ASP E OD1 1 
ATOM   7702  O  OD2 . ASP E 2 187 ? 101.309 5.133   164.906 1.00 68.42  ? 320 ASP E OD2 1 
ATOM   7703  N  N   . LYS E 2 188 ? 97.480  2.635   161.631 1.00 49.52  ? 321 LYS E N   1 
ATOM   7704  C  CA  . LYS E 2 188 ? 96.437  1.648   161.360 1.00 55.70  ? 321 LYS E CA  1 
ATOM   7705  C  C   . LYS E 2 188 ? 96.953  0.245   161.098 1.00 52.14  ? 321 LYS E C   1 
ATOM   7706  O  O   . LYS E 2 188 ? 97.927  0.061   160.373 1.00 59.23  ? 321 LYS E O   1 
ATOM   7707  C  CB  . LYS E 2 188 ? 95.567  2.105   160.175 1.00 64.66  ? 321 LYS E CB  1 
ATOM   7708  C  CG  . LYS E 2 188 ? 94.320  1.245   159.922 1.00 72.83  ? 321 LYS E CG  1 
ATOM   7709  C  CD  . LYS E 2 188 ? 93.146  2.109   159.447 1.00 81.29  ? 321 LYS E CD  1 
ATOM   7710  C  CE  . LYS E 2 188 ? 91.815  1.351   159.504 1.00 86.76  ? 321 LYS E CE  1 
ATOM   7711  N  NZ  . LYS E 2 188 ? 90.620  2.216   159.227 1.00 88.44  ? 321 LYS E NZ  1 
ATOM   7712  N  N   . VAL E 2 189 ? 96.297  -0.740  161.706 1.00 44.12  ? 322 VAL E N   1 
ATOM   7713  C  CA  . VAL E 2 189 ? 96.666  -2.137  161.525 1.00 36.55  ? 322 VAL E CA  1 
ATOM   7714  C  C   . VAL E 2 189 ? 95.446  -2.910  161.109 1.00 32.36  ? 322 VAL E C   1 
ATOM   7715  O  O   . VAL E 2 189 ? 94.335  -2.375  161.037 1.00 31.29  ? 322 VAL E O   1 
ATOM   7716  C  CB  . VAL E 2 189 ? 97.218  -2.809  162.812 1.00 34.86  ? 322 VAL E CB  1 
ATOM   7717  C  CG1 . VAL E 2 189 ? 98.534  -2.207  163.205 1.00 37.81  ? 322 VAL E CG1 1 
ATOM   7718  C  CG2 . VAL E 2 189 ? 96.234  -2.682  163.946 1.00 40.45  ? 322 VAL E CG2 1 
ATOM   7719  N  N   . LYS E 2 190 ? 95.656  -4.193  160.875 1.00 30.23  ? 323 LYS E N   1 
ATOM   7720  C  CA  . LYS E 2 190 ? 94.572  -5.042  160.475 1.00 32.88  ? 323 LYS E CA  1 
ATOM   7721  C  C   . LYS E 2 190 ? 94.756  -6.463  161.013 1.00 34.07  ? 323 LYS E C   1 
ATOM   7722  O  O   . LYS E 2 190 ? 95.830  -6.846  161.477 1.00 34.65  ? 323 LYS E O   1 
ATOM   7723  C  CB  . LYS E 2 190 ? 94.445  -5.025  158.948 1.00 36.17  ? 323 LYS E CB  1 
ATOM   7724  C  CG  . LYS E 2 190 ? 95.746  -5.313  158.206 1.00 42.18  ? 323 LYS E CG  1 
ATOM   7725  C  CD  . LYS E 2 190 ? 95.532  -5.392  156.695 1.00 50.62  ? 323 LYS E CD  1 
ATOM   7726  C  CE  . LYS E 2 190 ? 96.789  -5.888  155.957 1.00 59.55  ? 323 LYS E CE  1 
ATOM   7727  N  NZ  . LYS E 2 190 ? 96.631  -5.898  154.464 1.00 60.97  ? 323 LYS E NZ  1 
ATOM   7728  N  N   . ALA E 2 191 ? 93.649  -7.187  161.064 1.00 33.68  ? 324 ALA E N   1 
ATOM   7729  C  CA  . ALA E 2 191 ? 93.625  -8.575  161.491 1.00 33.28  ? 324 ALA E CA  1 
ATOM   7730  C  C   . ALA E 2 191 ? 92.653  -9.212  160.498 1.00 38.79  ? 324 ALA E C   1 
ATOM   7731  O  O   . ALA E 2 191 ? 91.509  -8.772  160.352 1.00 43.38  ? 324 ALA E O   1 
ATOM   7732  C  CB  . ALA E 2 191 ? 93.124  -8.691  162.888 1.00 31.37  ? 324 ALA E CB  1 
ATOM   7733  N  N   . HIS E 2 192 ? 93.150  -10.202 159.769 1.00 36.24  ? 325 HIS E N   1 
ATOM   7734  C  CA  . HIS E 2 192 ? 92.398  -10.889 158.739 1.00 28.73  ? 325 HIS E CA  1 
ATOM   7735  C  C   . HIS E 2 192 ? 92.276  -12.358 159.091 1.00 34.00  ? 325 HIS E C   1 
ATOM   7736  O  O   . HIS E 2 192 ? 93.209  -12.964 159.622 1.00 32.10  ? 325 HIS E O   1 
ATOM   7737  C  CB  . HIS E 2 192 ? 93.155  -10.706 157.434 1.00 33.74  ? 325 HIS E CB  1 
ATOM   7738  C  CG  . HIS E 2 192 ? 92.498  -11.318 156.244 1.00 40.55  ? 325 HIS E CG  1 
ATOM   7739  N  ND1 . HIS E 2 192 ? 92.293  -10.615 155.075 1.00 45.21  ? 325 HIS E ND1 1 
ATOM   7740  C  CD2 . HIS E 2 192 ? 92.063  -12.577 156.009 1.00 42.96  ? 325 HIS E CD2 1 
ATOM   7741  C  CE1 . HIS E 2 192 ? 91.763  -11.418 154.171 1.00 45.79  ? 325 HIS E CE1 1 
ATOM   7742  N  NE2 . HIS E 2 192 ? 91.613  -12.614 154.712 1.00 47.70  ? 325 HIS E NE2 1 
ATOM   7743  N  N   . TYR E 2 193 ? 91.111  -12.927 158.813 1.00 37.15  ? 326 TYR E N   1 
ATOM   7744  C  CA  . TYR E 2 193 ? 90.863  -14.330 159.107 1.00 34.04  ? 326 TYR E CA  1 
ATOM   7745  C  C   . TYR E 2 193 ? 90.254  -14.976 157.891 1.00 31.25  ? 326 TYR E C   1 
ATOM   7746  O  O   . TYR E 2 193 ? 89.184  -14.574 157.441 1.00 34.22  ? 326 TYR E O   1 
ATOM   7747  C  CB  . TYR E 2 193 ? 89.915  -14.467 160.305 1.00 35.22  ? 326 TYR E CB  1 
ATOM   7748  C  CG  . TYR E 2 193 ? 90.530  -14.027 161.613 1.00 32.40  ? 326 TYR E CG  1 
ATOM   7749  C  CD1 . TYR E 2 193 ? 90.577  -12.678 161.966 1.00 34.09  ? 326 TYR E CD1 1 
ATOM   7750  C  CD2 . TYR E 2 193 ? 91.111  -14.945 162.465 1.00 28.08  ? 326 TYR E CD2 1 
ATOM   7751  C  CE1 . TYR E 2 193 ? 91.203  -12.250 163.133 1.00 28.61  ? 326 TYR E CE1 1 
ATOM   7752  C  CE2 . TYR E 2 193 ? 91.734  -14.532 163.632 1.00 30.97  ? 326 TYR E CE2 1 
ATOM   7753  C  CZ  . TYR E 2 193 ? 91.784  -13.179 163.959 1.00 24.96  ? 326 TYR E CZ  1 
ATOM   7754  O  OH  . TYR E 2 193 ? 92.458  -12.759 165.086 1.00 24.16  ? 326 TYR E OH  1 
ATOM   7755  N  N   . GLY E 2 194 ? 90.950  -15.963 157.342 1.00 30.11  ? 327 GLY E N   1 
ATOM   7756  C  CA  . GLY E 2 194 ? 90.449  -16.644 156.164 1.00 28.26  ? 327 GLY E CA  1 
ATOM   7757  C  C   . GLY E 2 194 ? 89.109  -17.307 156.404 1.00 28.57  ? 327 GLY E C   1 
ATOM   7758  O  O   . GLY E 2 194 ? 88.286  -17.394 155.509 1.00 29.25  ? 327 GLY E O   1 
ATOM   7759  N  N   . GLY E 2 195 ? 88.876  -17.757 157.627 1.00 33.95  ? 328 GLY E N   1 
ATOM   7760  C  CA  . GLY E 2 195 ? 87.620  -18.414 157.925 1.00 32.47  ? 328 GLY E CA  1 
ATOM   7761  C  C   . GLY E 2 195 ? 86.864  -17.687 159.005 1.00 31.36  ? 328 GLY E C   1 
ATOM   7762  O  O   . GLY E 2 195 ? 87.449  -17.300 160.023 1.00 37.87  ? 328 GLY E O   1 
ATOM   7763  N  N   . PHE E 2 196 ? 85.563  -17.514 158.799 1.00 16.95  ? 329 PHE E N   1 
ATOM   7764  C  CA  . PHE E 2 196 ? 84.747  -16.823 159.775 1.00 13.82  ? 329 PHE E CA  1 
ATOM   7765  C  C   . PHE E 2 196 ? 83.319  -17.287 159.718 1.00 15.79  ? 329 PHE E C   1 
ATOM   7766  O  O   . PHE E 2 196 ? 82.640  -17.179 158.695 1.00 11.91  ? 329 PHE E O   1 
ATOM   7767  C  CB  . PHE E 2 196 ? 84.773  -15.325 159.530 1.00 16.79  ? 329 PHE E CB  1 
ATOM   7768  C  CG  . PHE E 2 196 ? 83.825  -14.575 160.391 1.00 21.74  ? 329 PHE E CG  1 
ATOM   7769  C  CD1 . PHE E 2 196 ? 83.938  -14.632 161.770 1.00 24.76  ? 329 PHE E CD1 1 
ATOM   7770  C  CD2 . PHE E 2 196 ? 82.807  -13.825 159.833 1.00 25.57  ? 329 PHE E CD2 1 
ATOM   7771  C  CE1 . PHE E 2 196 ? 83.041  -13.946 162.593 1.00 21.33  ? 329 PHE E CE1 1 
ATOM   7772  C  CE2 . PHE E 2 196 ? 81.906  -13.132 160.647 1.00 26.10  ? 329 PHE E CE2 1 
ATOM   7773  C  CZ  . PHE E 2 196 ? 82.023  -13.193 162.026 1.00 20.20  ? 329 PHE E CZ  1 
ATOM   7774  N  N   . THR E 2 197 ? 82.816  -17.705 160.859 1.00 20.01  ? 330 THR E N   1 
ATOM   7775  C  CA  . THR E 2 197 ? 81.469  -18.183 160.866 1.00 19.48  ? 330 THR E CA  1 
ATOM   7776  C  C   . THR E 2 197 ? 80.776  -17.823 162.138 1.00 19.26  ? 330 THR E C   1 
ATOM   7777  O  O   . THR E 2 197 ? 81.414  -17.676 163.180 1.00 20.08  ? 330 THR E O   1 
ATOM   7778  C  CB  . THR E 2 197 ? 81.454  -19.690 160.702 1.00 26.67  ? 330 THR E CB  1 
ATOM   7779  O  OG1 . THR E 2 197 ? 82.227  -20.044 159.551 1.00 31.40  ? 330 THR E OG1 1 
ATOM   7780  C  CG2 . THR E 2 197 ? 80.027  -20.185 160.512 1.00 33.81  ? 330 THR E CG2 1 
ATOM   7781  N  N   . VAL E 2 198 ? 79.466  -17.618 162.019 1.00 14.38  ? 331 VAL E N   1 
ATOM   7782  C  CA  . VAL E 2 198 ? 78.635  -17.311 163.158 1.00 13.82  ? 331 VAL E CA  1 
ATOM   7783  C  C   . VAL E 2 198 ? 77.350  -18.117 163.080 1.00 15.16  ? 331 VAL E C   1 
ATOM   7784  O  O   . VAL E 2 198 ? 76.564  -17.969 162.148 1.00 10.78  ? 331 VAL E O   1 
ATOM   7785  C  CB  . VAL E 2 198 ? 78.341  -15.847 163.239 1.00 11.43  ? 331 VAL E CB  1 
ATOM   7786  C  CG1 . VAL E 2 198 ? 77.346  -15.594 164.377 1.00 13.93  ? 331 VAL E CG1 1 
ATOM   7787  C  CG2 . VAL E 2 198 ? 79.647  -15.091 163.476 1.00 7.34   ? 331 VAL E CG2 1 
ATOM   7788  N  N   . GLN E 2 199 ? 77.144  -18.965 164.082 1.00 18.97  ? 332 GLN E N   1 
ATOM   7789  C  CA  . GLN E 2 199 ? 75.978  -19.829 164.131 1.00 25.94  ? 332 GLN E CA  1 
ATOM   7790  C  C   . GLN E 2 199 ? 74.658  -19.118 164.340 1.00 30.18  ? 332 GLN E C   1 
ATOM   7791  O  O   . GLN E 2 199 ? 74.621  -17.918 164.595 1.00 28.61  ? 332 GLN E O   1 
ATOM   7792  C  CB  . GLN E 2 199 ? 76.184  -20.885 165.202 1.00 25.76  ? 332 GLN E CB  1 
ATOM   7793  C  CG  . GLN E 2 199 ? 77.357  -21.807 164.882 1.00 28.70  ? 332 GLN E CG  1 
ATOM   7794  C  CD  . GLN E 2 199 ? 77.274  -22.405 163.469 1.00 30.56  ? 332 GLN E CD  1 
ATOM   7795  O  OE1 . GLN E 2 199 ? 78.297  -22.605 162.809 1.00 23.77  ? 332 GLN E OE1 1 
ATOM   7796  N  NE2 . GLN E 2 199 ? 76.050  -22.688 163.006 1.00 30.88  ? 332 GLN E NE2 1 
ATOM   7797  N  N   . ASN E 2 200 ? 73.563  -19.856 164.180 1.00 29.47  ? 333 ASN E N   1 
ATOM   7798  C  CA  . ASN E 2 200 ? 72.244  -19.277 164.377 1.00 24.38  ? 333 ASN E CA  1 
ATOM   7799  C  C   . ASN E 2 200 ? 72.079  -18.920 165.836 1.00 22.82  ? 333 ASN E C   1 
ATOM   7800  O  O   . ASN E 2 200 ? 72.969  -19.177 166.671 1.00 17.51  ? 333 ASN E O   1 
ATOM   7801  C  CB  . ASN E 2 200 ? 71.151  -20.250 163.966 1.00 23.59  ? 333 ASN E CB  1 
ATOM   7802  C  CG  . ASN E 2 200 ? 71.260  -21.567 164.676 1.00 27.22  ? 333 ASN E CG  1 
ATOM   7803  O  OD1 . ASN E 2 200 ? 72.151  -21.770 165.508 1.00 27.37  ? 333 ASN E OD1 1 
ATOM   7804  N  ND2 . ASN E 2 200 ? 70.354  -22.484 164.355 1.00 33.38  ? 333 ASN E ND2 1 
ATOM   7805  N  N   . GLU E 2 201 ? 70.931  -18.329 166.138 1.00 23.12  ? 334 GLU E N   1 
ATOM   7806  C  CA  . GLU E 2 201 ? 70.647  -17.911 167.493 1.00 21.79  ? 334 GLU E CA  1 
ATOM   7807  C  C   . GLU E 2 201 ? 70.574  -19.150 168.352 1.00 23.31  ? 334 GLU E C   1 
ATOM   7808  O  O   . GLU E 2 201 ? 70.986  -19.131 169.503 1.00 27.76  ? 334 GLU E O   1 
ATOM   7809  C  CB  . GLU E 2 201 ? 69.343  -17.146 167.537 1.00 27.43  ? 334 GLU E CB  1 
ATOM   7810  C  CG  . GLU E 2 201 ? 69.051  -16.498 168.868 1.00 31.99  ? 334 GLU E CG  1 
ATOM   7811  C  CD  . GLU E 2 201 ? 67.716  -15.772 168.879 1.00 35.24  ? 334 GLU E CD  1 
ATOM   7812  O  OE1 . GLU E 2 201 ? 66.902  -15.987 167.945 1.00 35.13  ? 334 GLU E OE1 1 
ATOM   7813  O  OE2 . GLU E 2 201 ? 67.490  -14.987 169.829 1.00 36.96  ? 334 GLU E OE2 1 
ATOM   7814  N  N   . ALA E 2 202 ? 70.110  -20.250 167.770 1.00 25.79  ? 335 ALA E N   1 
ATOM   7815  C  CA  . ALA E 2 202 ? 70.012  -21.505 168.501 1.00 20.58  ? 335 ALA E CA  1 
ATOM   7816  C  C   . ALA E 2 202 ? 71.359  -21.920 169.088 1.00 21.06  ? 335 ALA E C   1 
ATOM   7817  O  O   . ALA E 2 202 ? 71.424  -22.512 170.156 1.00 21.92  ? 335 ALA E O   1 
ATOM   7818  C  CB  . ALA E 2 202 ? 69.509  -22.582 167.602 1.00 18.80  ? 335 ALA E CB  1 
ATOM   7819  N  N   . ASN E 2 203 ? 72.441  -21.642 168.382 1.00 23.74  ? 336 ASN E N   1 
ATOM   7820  C  CA  . ASN E 2 203 ? 73.744  -22.017 168.890 1.00 24.44  ? 336 ASN E CA  1 
ATOM   7821  C  C   . ASN E 2 203 ? 74.429  -20.824 169.491 1.00 25.78  ? 336 ASN E C   1 
ATOM   7822  O  O   . ASN E 2 203 ? 75.664  -20.763 169.582 1.00 26.14  ? 336 ASN E O   1 
ATOM   7823  C  CB  . ASN E 2 203 ? 74.557  -22.663 167.793 1.00 24.39  ? 336 ASN E CB  1 
ATOM   7824  C  CG  . ASN E 2 203 ? 73.954  -23.972 167.352 1.00 30.44  ? 336 ASN E CG  1 
ATOM   7825  O  OD1 . ASN E 2 203 ? 74.444  -25.030 167.717 1.00 39.58  ? 336 ASN E OD1 1 
ATOM   7826  N  ND2 . ASN E 2 203 ? 72.844  -23.911 166.628 1.00 25.05  ? 336 ASN E ND2 1 
ATOM   7827  N  N   . LYS E 2 204 ? 73.576  -19.896 169.927 1.00 25.87  ? 337 LYS E N   1 
ATOM   7828  C  CA  . LYS E 2 204 ? 73.959  -18.646 170.563 1.00 29.32  ? 337 LYS E CA  1 
ATOM   7829  C  C   . LYS E 2 204 ? 74.982  -17.876 169.741 1.00 27.90  ? 337 LYS E C   1 
ATOM   7830  O  O   . LYS E 2 204 ? 75.950  -17.347 170.284 1.00 31.42  ? 337 LYS E O   1 
ATOM   7831  C  CB  . LYS E 2 204 ? 74.476  -18.916 171.974 1.00 36.64  ? 337 LYS E CB  1 
ATOM   7832  C  CG  . LYS E 2 204 ? 73.515  -19.744 172.824 1.00 45.28  ? 337 LYS E CG  1 
ATOM   7833  C  CD  . LYS E 2 204 ? 74.127  -20.070 174.194 1.00 52.98  ? 337 LYS E CD  1 
ATOM   7834  C  CE  . LYS E 2 204 ? 73.328  -21.119 174.995 1.00 56.49  ? 337 LYS E CE  1 
ATOM   7835  N  NZ  . LYS E 2 204 ? 73.511  -22.533 174.522 1.00 61.51  ? 337 LYS E NZ  1 
ATOM   7836  N  N   . TYR E 2 205 ? 74.750  -17.806 168.430 1.00 23.15  ? 338 TYR E N   1 
ATOM   7837  C  CA  . TYR E 2 205 ? 75.646  -17.101 167.522 1.00 22.85  ? 338 TYR E CA  1 
ATOM   7838  C  C   . TYR E 2 205 ? 77.103  -17.471 167.801 1.00 22.62  ? 338 TYR E C   1 
ATOM   7839  O  O   . TYR E 2 205 ? 77.970  -16.612 167.867 1.00 29.98  ? 338 TYR E O   1 
ATOM   7840  C  CB  . TYR E 2 205 ? 75.448  -15.586 167.647 1.00 19.14  ? 338 TYR E CB  1 
ATOM   7841  C  CG  . TYR E 2 205 ? 74.036  -15.135 167.384 1.00 18.53  ? 338 TYR E CG  1 
ATOM   7842  C  CD1 . TYR E 2 205 ? 73.398  -15.418 166.188 1.00 23.66  ? 338 TYR E CD1 1 
ATOM   7843  C  CD2 . TYR E 2 205 ? 73.324  -14.448 168.349 1.00 23.45  ? 338 TYR E CD2 1 
ATOM   7844  C  CE1 . TYR E 2 205 ? 72.077  -15.033 165.966 1.00 27.51  ? 338 TYR E CE1 1 
ATOM   7845  C  CE2 . TYR E 2 205 ? 72.008  -14.058 168.138 1.00 22.77  ? 338 TYR E CE2 1 
ATOM   7846  C  CZ  . TYR E 2 205 ? 71.391  -14.359 166.954 1.00 25.03  ? 338 TYR E CZ  1 
ATOM   7847  O  OH  . TYR E 2 205 ? 70.076  -14.022 166.800 1.00 25.14  ? 338 TYR E OH  1 
ATOM   7848  N  N   . GLN E 2 206 ? 77.363  -18.757 167.975 1.00 18.90  ? 339 GLN E N   1 
ATOM   7849  C  CA  . GLN E 2 206 ? 78.710  -19.228 168.273 1.00 21.79  ? 339 GLN E CA  1 
ATOM   7850  C  C   . GLN E 2 206 ? 79.727  -18.886 167.175 1.00 21.55  ? 339 GLN E C   1 
ATOM   7851  O  O   . GLN E 2 206 ? 79.567  -19.285 166.012 1.00 24.05  ? 339 GLN E O   1 
ATOM   7852  C  CB  . GLN E 2 206 ? 78.678  -20.740 168.561 1.00 24.13  ? 339 GLN E CB  1 
ATOM   7853  C  CG  . GLN E 2 206 ? 79.936  -21.278 169.221 1.00 27.63  ? 339 GLN E CG  1 
ATOM   7854  C  CD  . GLN E 2 206 ? 79.758  -22.670 169.792 1.00 30.84  ? 339 GLN E CD  1 
ATOM   7855  O  OE1 . GLN E 2 206 ? 80.372  -23.013 170.804 1.00 38.97  ? 339 GLN E OE1 1 
ATOM   7856  N  NE2 . GLN E 2 206 ? 78.902  -23.469 169.170 1.00 25.99  ? 339 GLN E NE2 1 
ATOM   7857  N  N   . ILE E 2 207 ? 80.770  -18.151 167.570 1.00 19.44  ? 340 ILE E N   1 
ATOM   7858  C  CA  . ILE E 2 207 ? 81.837  -17.715 166.659 1.00 23.62  ? 340 ILE E CA  1 
ATOM   7859  C  C   . ILE E 2 207 ? 82.971  -18.729 166.401 1.00 26.80  ? 340 ILE E C   1 
ATOM   7860  O  O   . ILE E 2 207 ? 83.324  -19.527 167.266 1.00 32.64  ? 340 ILE E O   1 
ATOM   7861  C  CB  . ILE E 2 207 ? 82.457  -16.394 167.149 1.00 25.65  ? 340 ILE E CB  1 
ATOM   7862  C  CG1 . ILE E 2 207 ? 83.448  -15.852 166.117 1.00 25.82  ? 340 ILE E CG1 1 
ATOM   7863  C  CG2 . ILE E 2 207 ? 83.146  -16.598 168.500 1.00 29.84  ? 340 ILE E CG2 1 
ATOM   7864  C  CD1 . ILE E 2 207 ? 84.080  -14.521 166.497 1.00 24.16  ? 340 ILE E CD1 1 
ATOM   7865  N  N   . SER E 2 208 ? 83.547  -18.667 165.202 1.00 32.39  ? 341 SER E N   1 
ATOM   7866  C  CA  . SER E 2 208 ? 84.641  -19.553 164.788 1.00 27.00  ? 341 SER E CA  1 
ATOM   7867  C  C   . SER E 2 208 ? 85.529  -18.894 163.729 1.00 26.04  ? 341 SER E C   1 
ATOM   7868  O  O   . SER E 2 208 ? 85.051  -18.427 162.679 1.00 25.45  ? 341 SER E O   1 
ATOM   7869  C  CB  . SER E 2 208 ? 84.085  -20.864 164.239 1.00 27.55  ? 341 SER E CB  1 
ATOM   7870  O  OG  . SER E 2 208 ? 85.130  -21.688 163.756 1.00 38.55  ? 341 SER E OG  1 
ATOM   7871  N  N   . VAL E 2 209 ? 86.828  -18.874 164.000 1.00 24.11  ? 342 VAL E N   1 
ATOM   7872  C  CA  . VAL E 2 209 ? 87.763  -18.261 163.068 1.00 32.37  ? 342 VAL E CA  1 
ATOM   7873  C  C   . VAL E 2 209 ? 89.012  -19.103 162.828 1.00 33.46  ? 342 VAL E C   1 
ATOM   7874  O  O   . VAL E 2 209 ? 89.410  -19.884 163.697 1.00 31.36  ? 342 VAL E O   1 
ATOM   7875  C  CB  . VAL E 2 209 ? 88.177  -16.830 163.543 1.00 33.15  ? 342 VAL E CB  1 
ATOM   7876  C  CG1 . VAL E 2 209 ? 87.003  -15.868 163.456 1.00 30.67  ? 342 VAL E CG1 1 
ATOM   7877  C  CG2 . VAL E 2 209 ? 88.673  -16.868 164.956 1.00 34.32  ? 342 VAL E CG2 1 
ATOM   7878  N  N   . ASN E 2 210 ? 89.609  -18.951 161.641 1.00 35.18  ? 343 ASN E N   1 
ATOM   7879  C  CA  . ASN E 2 210 ? 90.834  -19.673 161.249 1.00 37.84  ? 343 ASN E CA  1 
ATOM   7880  C  C   . ASN E 2 210 ? 91.727  -18.750 160.443 1.00 36.33  ? 343 ASN E C   1 
ATOM   7881  O  O   . ASN E 2 210 ? 91.384  -17.601 160.184 1.00 44.23  ? 343 ASN E O   1 
ATOM   7882  C  CB  . ASN E 2 210 ? 90.512  -20.848 160.321 1.00 46.23  ? 343 ASN E CB  1 
ATOM   7883  C  CG  . ASN E 2 210 ? 89.276  -21.597 160.732 1.00 59.76  ? 343 ASN E CG  1 
ATOM   7884  O  OD1 . ASN E 2 210 ? 88.171  -21.309 160.255 1.00 64.02  ? 343 ASN E OD1 1 
ATOM   7885  N  ND2 . ASN E 2 210 ? 89.444  -22.560 161.635 1.00 68.13  ? 343 ASN E ND2 1 
ATOM   7886  N  N   . LYS E 2 211 ? 92.852  -19.290 160.003 1.00 28.62  ? 344 LYS E N   1 
ATOM   7887  C  CA  . LYS E 2 211 ? 93.785  -18.568 159.161 1.00 26.04  ? 344 LYS E CA  1 
ATOM   7888  C  C   . LYS E 2 211 ? 93.932  -17.077 159.398 1.00 24.98  ? 344 LYS E C   1 
ATOM   7889  O  O   . LYS E 2 211 ? 93.573  -16.256 158.543 1.00 34.68  ? 344 LYS E O   1 
ATOM   7890  C  CB  . LYS E 2 211 ? 93.429  -18.796 157.691 1.00 38.03  ? 344 LYS E CB  1 
ATOM   7891  C  CG  . LYS E 2 211 ? 93.719  -20.204 157.178 1.00 44.63  ? 344 LYS E CG  1 
ATOM   7892  C  CD  . LYS E 2 211 ? 92.454  -21.012 156.909 1.00 42.30  ? 344 LYS E CD  1 
ATOM   7893  C  CE  . LYS E 2 211 ? 91.735  -20.524 155.662 1.00 43.77  ? 344 LYS E CE  1 
ATOM   7894  N  NZ  . LYS E 2 211 ? 90.517  -21.335 155.365 1.00 43.93  ? 344 LYS E NZ  1 
ATOM   7895  N  N   . TYR E 2 212 ? 94.432  -16.711 160.564 1.00 21.22  ? 345 TYR E N   1 
ATOM   7896  C  CA  . TYR E 2 212 ? 94.634  -15.294 160.835 1.00 27.19  ? 345 TYR E CA  1 
ATOM   7897  C  C   . TYR E 2 212 ? 95.892  -14.871 160.101 1.00 33.69  ? 345 TYR E C   1 
ATOM   7898  O  O   . TYR E 2 212 ? 96.854  -15.638 159.993 1.00 36.71  ? 345 TYR E O   1 
ATOM   7899  C  CB  . TYR E 2 212 ? 94.774  -15.008 162.345 1.00 23.38  ? 345 TYR E CB  1 
ATOM   7900  C  CG  . TYR E 2 212 ? 95.554  -13.753 162.695 1.00 26.59  ? 345 TYR E CG  1 
ATOM   7901  C  CD1 . TYR E 2 212 ? 96.939  -13.798 162.834 1.00 30.18  ? 345 TYR E CD1 1 
ATOM   7902  C  CD2 . TYR E 2 212 ? 94.918  -12.531 162.904 1.00 28.12  ? 345 TYR E CD2 1 
ATOM   7903  C  CE1 . TYR E 2 212 ? 97.676  -12.672 163.173 1.00 31.28  ? 345 TYR E CE1 1 
ATOM   7904  C  CE2 . TYR E 2 212 ? 95.658  -11.390 163.249 1.00 31.36  ? 345 TYR E CE2 1 
ATOM   7905  C  CZ  . TYR E 2 212 ? 97.044  -11.482 163.385 1.00 29.29  ? 345 TYR E CZ  1 
ATOM   7906  O  OH  . TYR E 2 212 ? 97.826  -10.430 163.779 1.00 29.17  ? 345 TYR E OH  1 
ATOM   7907  N  N   . ARG E 2 213 ? 95.873  -13.645 159.601 1.00 38.31  ? 346 ARG E N   1 
ATOM   7908  C  CA  . ARG E 2 213 ? 97.006  -13.076 158.890 1.00 37.53  ? 346 ARG E CA  1 
ATOM   7909  C  C   . ARG E 2 213 ? 96.888  -11.582 159.115 1.00 34.44  ? 346 ARG E C   1 
ATOM   7910  O  O   . ARG E 2 213 ? 95.849  -10.996 158.801 1.00 32.50  ? 346 ARG E O   1 
ATOM   7911  C  CB  . ARG E 2 213 ? 96.938  -13.432 157.400 1.00 39.27  ? 346 ARG E CB  1 
ATOM   7912  C  CG  . ARG E 2 213 ? 95.577  -13.214 156.771 1.00 50.06  ? 346 ARG E CG  1 
ATOM   7913  C  CD  . ARG E 2 213 ? 95.374  -14.040 155.506 1.00 58.21  ? 346 ARG E CD  1 
ATOM   7914  N  NE  . ARG E 2 213 ? 96.340  -13.719 154.461 1.00 65.38  ? 346 ARG E NE  1 
ATOM   7915  C  CZ  . ARG E 2 213 ? 96.594  -12.492 154.015 1.00 71.35  ? 346 ARG E CZ  1 
ATOM   7916  N  NH1 . ARG E 2 213 ? 95.959  -11.443 154.519 1.00 70.28  ? 346 ARG E NH1 1 
ATOM   7917  N  NH2 . ARG E 2 213 ? 97.486  -12.314 153.051 1.00 76.57  ? 346 ARG E NH2 1 
ATOM   7918  N  N   . GLY E 2 214 ? 97.897  -10.985 159.750 1.00 31.47  ? 347 GLY E N   1 
ATOM   7919  C  CA  . GLY E 2 214 ? 97.824  -9.559  159.998 1.00 32.32  ? 347 GLY E CA  1 
ATOM   7920  C  C   . GLY E 2 214 ? 98.829  -8.954  160.945 1.00 35.50  ? 347 GLY E C   1 
ATOM   7921  O  O   . GLY E 2 214 ? 99.616  -9.641  161.604 1.00 37.91  ? 347 GLY E O   1 
ATOM   7922  N  N   . THR E 2 215 ? 98.740  -7.639  161.059 1.00 33.26  ? 348 THR E N   1 
ATOM   7923  C  CA  . THR E 2 215 ? 99.638  -6.880  161.897 1.00 33.47  ? 348 THR E CA  1 
ATOM   7924  C  C   . THR E 2 215 ? 99.098  -6.536  163.272 1.00 30.23  ? 348 THR E C   1 
ATOM   7925  O  O   . THR E 2 215 ? 99.865  -6.175  164.153 1.00 38.87  ? 348 THR E O   1 
ATOM   7926  C  CB  . THR E 2 215 ? 100.040 -5.580  161.185 1.00 38.38  ? 348 THR E CB  1 
ATOM   7927  O  OG1 . THR E 2 215 ? 98.865  -4.841  160.809 1.00 38.66  ? 348 THR E OG1 1 
ATOM   7928  C  CG2 . THR E 2 215 ? 100.839 -5.906  159.937 1.00 38.21  ? 348 THR E CG2 1 
ATOM   7929  N  N   . ALA E 2 216 ? 97.795  -6.696  163.474 1.00 25.57  ? 349 ALA E N   1 
ATOM   7930  C  CA  . ALA E 2 216 ? 97.153  -6.346  164.751 1.00 29.73  ? 349 ALA E CA  1 
ATOM   7931  C  C   . ALA E 2 216 ? 97.390  -7.258  165.950 1.00 27.11  ? 349 ALA E C   1 
ATOM   7932  O  O   . ALA E 2 216 ? 97.317  -6.825  167.101 1.00 28.84  ? 349 ALA E O   1 
ATOM   7933  C  CB  . ALA E 2 216 ? 95.651  -6.167  164.535 1.00 39.18  ? 349 ALA E CB  1 
ATOM   7934  N  N   . GLY E 2 217 ? 97.675  -8.521  165.676 1.00 29.63  ? 350 GLY E N   1 
ATOM   7935  C  CA  . GLY E 2 217 ? 97.884  -9.479  166.740 1.00 30.44  ? 350 GLY E CA  1 
ATOM   7936  C  C   . GLY E 2 217 ? 96.622  -10.296 166.767 1.00 33.58  ? 350 GLY E C   1 
ATOM   7937  O  O   . GLY E 2 217 ? 95.528  -9.748  166.604 1.00 36.84  ? 350 GLY E O   1 
ATOM   7938  N  N   . ASN E 2 218 ? 96.768  -11.603 166.939 1.00 32.90  ? 351 ASN E N   1 
ATOM   7939  C  CA  . ASN E 2 218 ? 95.620  -12.491 166.960 1.00 35.42  ? 351 ASN E CA  1 
ATOM   7940  C  C   . ASN E 2 218 ? 94.965  -12.588 168.320 1.00 41.27  ? 351 ASN E C   1 
ATOM   7941  O  O   . ASN E 2 218 ? 95.121  -13.584 169.024 1.00 48.19  ? 351 ASN E O   1 
ATOM   7942  C  CB  . ASN E 2 218 ? 96.003  -13.886 166.484 1.00 33.49  ? 351 ASN E CB  1 
ATOM   7943  C  CG  . ASN E 2 218 ? 94.790  -14.749 166.221 1.00 34.45  ? 351 ASN E CG  1 
ATOM   7944  O  OD1 . ASN E 2 218 ? 94.759  -15.547 165.282 1.00 34.30  ? 351 ASN E OD1 1 
ATOM   7945  N  ND2 . ASN E 2 218 ? 93.764  -14.568 167.034 1.00 32.64  ? 351 ASN E ND2 1 
ATOM   7946  N  N   . ALA E 2 219 ? 94.153  -11.596 168.647 1.00 39.97  ? 352 ALA E N   1 
ATOM   7947  C  CA  . ALA E 2 219 ? 93.475  -11.591 169.927 1.00 36.59  ? 352 ALA E CA  1 
ATOM   7948  C  C   . ALA E 2 219 ? 92.359  -12.623 169.946 1.00 32.78  ? 352 ALA E C   1 
ATOM   7949  O  O   . ALA E 2 219 ? 92.091  -13.236 170.972 1.00 36.52  ? 352 ALA E O   1 
ATOM   7950  C  CB  . ALA E 2 219 ? 92.927  -10.217 170.214 1.00 37.00  ? 352 ALA E CB  1 
ATOM   7951  N  N   . LEU E 2 220 ? 91.778  -12.889 168.787 1.00 28.30  ? 353 LEU E N   1 
ATOM   7952  C  CA  . LEU E 2 220 ? 90.671  -13.828 168.712 1.00 32.28  ? 353 LEU E CA  1 
ATOM   7953  C  C   . LEU E 2 220 ? 90.953  -15.316 168.937 1.00 35.66  ? 353 LEU E C   1 
ATOM   7954  O  O   . LEU E 2 220 ? 90.208  -15.991 169.653 1.00 35.18  ? 353 LEU E O   1 
ATOM   7955  C  CB  . LEU E 2 220 ? 89.925  -13.632 167.402 1.00 30.40  ? 353 LEU E CB  1 
ATOM   7956  C  CG  . LEU E 2 220 ? 89.345  -12.231 167.234 1.00 32.06  ? 353 LEU E CG  1 
ATOM   7957  C  CD1 . LEU E 2 220 ? 88.475  -12.182 165.988 1.00 34.99  ? 353 LEU E CD1 1 
ATOM   7958  C  CD2 . LEU E 2 220 ? 88.546  -11.872 168.461 1.00 33.17  ? 353 LEU E CD2 1 
ATOM   7959  N  N   . MET E 2 221 ? 92.011  -15.828 168.320 1.00 35.71  ? 354 MET E N   1 
ATOM   7960  C  CA  . MET E 2 221 ? 92.357  -17.234 168.441 1.00 32.96  ? 354 MET E CA  1 
ATOM   7961  C  C   . MET E 2 221 ? 93.395  -17.471 169.534 1.00 35.99  ? 354 MET E C   1 
ATOM   7962  O  O   . MET E 2 221 ? 93.312  -18.440 170.310 1.00 36.28  ? 354 MET E O   1 
ATOM   7963  C  CB  . MET E 2 221 ? 92.933  -17.749 167.118 1.00 31.65  ? 354 MET E CB  1 
ATOM   7964  C  CG  . MET E 2 221 ? 92.075  -17.564 165.876 1.00 31.53  ? 354 MET E CG  1 
ATOM   7965  S  SD  . MET E 2 221 ? 92.571  -18.712 164.541 1.00 29.19  ? 354 MET E SD  1 
ATOM   7966  C  CE  . MET E 2 221 ? 93.579  -17.727 163.530 1.00 30.22  ? 354 MET E CE  1 
ATOM   7967  N  N   . ASP E 2 222 ? 94.389  -16.592 169.570 1.00 35.46  ? 355 ASP E N   1 
ATOM   7968  C  CA  . ASP E 2 222 ? 95.474  -16.722 170.526 1.00 36.15  ? 355 ASP E CA  1 
ATOM   7969  C  C   . ASP E 2 222 ? 95.295  -16.000 171.852 1.00 34.67  ? 355 ASP E C   1 
ATOM   7970  O  O   . ASP E 2 222 ? 96.118  -16.147 172.750 1.00 38.78  ? 355 ASP E O   1 
ATOM   7971  C  CB  . ASP E 2 222 ? 96.790  -16.271 169.875 1.00 36.03  ? 355 ASP E CB  1 
ATOM   7972  C  CG  . ASP E 2 222 ? 97.206  -17.156 168.713 1.00 40.45  ? 355 ASP E CG  1 
ATOM   7973  O  OD1 . ASP E 2 222 ? 96.699  -18.302 168.611 1.00 38.10  ? 355 ASP E OD1 1 
ATOM   7974  O  OD2 . ASP E 2 222 ? 98.060  -16.706 167.912 1.00 48.01  ? 355 ASP E OD2 1 
ATOM   7975  N  N   . GLY E 2 223 ? 94.235  -15.219 171.996 1.00 29.39  ? 356 GLY E N   1 
ATOM   7976  C  CA  . GLY E 2 223 ? 94.077  -14.491 173.240 1.00 26.15  ? 356 GLY E CA  1 
ATOM   7977  C  C   . GLY E 2 223 ? 95.169  -13.432 173.365 1.00 32.18  ? 356 GLY E C   1 
ATOM   7978  O  O   . GLY E 2 223 ? 95.926  -13.181 172.416 1.00 36.75  ? 356 GLY E O   1 
ATOM   7979  N  N   . ALA E 2 224 ? 95.296  -12.850 174.555 1.00 30.14  ? 357 ALA E N   1 
ATOM   7980  C  CA  . ALA E 2 224 ? 96.273  -11.786 174.795 1.00 34.11  ? 357 ALA E CA  1 
ATOM   7981  C  C   . ALA E 2 224 ? 97.716  -12.202 174.855 1.00 39.65  ? 357 ALA E C   1 
ATOM   7982  O  O   . ALA E 2 224 ? 98.135  -12.913 175.772 1.00 36.64  ? 357 ALA E O   1 
ATOM   7983  C  CB  . ALA E 2 224 ? 95.927  -11.017 176.041 1.00 36.03  ? 357 ALA E CB  1 
ATOM   7984  N  N   . SER E 2 225 ? 98.489  -11.662 173.921 1.00 43.84  ? 358 SER E N   1 
ATOM   7985  C  CA  . SER E 2 225 ? 99.913  -11.940 173.840 1.00 47.58  ? 358 SER E CA  1 
ATOM   7986  C  C   . SER E 2 225 ? 100.624 -11.590 175.152 1.00 50.64  ? 358 SER E C   1 
ATOM   7987  O  O   . SER E 2 225 ? 101.571 -12.273 175.564 1.00 50.59  ? 358 SER E O   1 
ATOM   7988  C  CB  . SER E 2 225 ? 100.542 -11.179 172.655 1.00 48.44  ? 358 SER E CB  1 
ATOM   7989  O  OG  . SER E 2 225 ? 100.468 -9.764  172.799 1.00 44.19  ? 358 SER E OG  1 
ATOM   7990  N  N   . GLN E 2 226 ? 100.135 -10.552 175.824 1.00 52.88  ? 359 GLN E N   1 
ATOM   7991  C  CA  . GLN E 2 226 ? 100.731 -10.118 177.080 1.00 58.91  ? 359 GLN E CA  1 
ATOM   7992  C  C   . GLN E 2 226 ? 100.459 -11.045 178.271 1.00 56.12  ? 359 GLN E C   1 
ATOM   7993  O  O   . GLN E 2 226 ? 101.334 -11.251 179.114 1.00 58.73  ? 359 GLN E O   1 
ATOM   7994  C  CB  . GLN E 2 226 ? 100.347 -8.657  177.408 1.00 63.52  ? 359 GLN E CB  1 
ATOM   7995  C  CG  . GLN E 2 226 ? 98.965  -8.189  176.927 1.00 69.25  ? 359 GLN E CG  1 
ATOM   7996  C  CD  . GLN E 2 226 ? 98.939  -7.764  175.459 1.00 71.80  ? 359 GLN E CD  1 
ATOM   7997  O  OE1 . GLN E 2 226 ? 99.103  -6.580  175.131 1.00 72.23  ? 359 GLN E OE1 1 
ATOM   7998  N  NE2 . GLN E 2 226 ? 98.705  -8.726  174.574 1.00 73.17  ? 359 GLN E NE2 1 
ATOM   7999  N  N   . LEU E 2 227 ? 99.270  -11.635 178.315 1.00 51.89  ? 360 LEU E N   1 
ATOM   8000  C  CA  . LEU E 2 227 ? 98.907  -12.524 179.411 1.00 51.34  ? 360 LEU E CA  1 
ATOM   8001  C  C   . LEU E 2 227 ? 99.559  -13.882 179.352 1.00 54.58  ? 360 LEU E C   1 
ATOM   8002  O  O   . LEU E 2 227 ? 99.980  -14.336 178.290 1.00 54.42  ? 360 LEU E O   1 
ATOM   8003  C  CB  . LEU E 2 227 ? 97.400  -12.686 179.502 1.00 50.66  ? 360 LEU E CB  1 
ATOM   8004  C  CG  . LEU E 2 227 ? 96.702  -11.462 180.098 1.00 50.32  ? 360 LEU E CG  1 
ATOM   8005  C  CD1 . LEU E 2 227 ? 95.199  -11.690 180.103 1.00 51.19  ? 360 LEU E CD1 1 
ATOM   8006  C  CD2 . LEU E 2 227 ? 97.220  -11.199 181.511 1.00 48.13  ? 360 LEU E CD2 1 
ATOM   8007  N  N   . MET E 2 228 ? 99.601  -14.544 180.506 1.00 62.62  ? 361 MET E N   1 
ATOM   8008  C  CA  . MET E 2 228 ? 100.230 -15.860 180.621 1.00 70.80  ? 361 MET E CA  1 
ATOM   8009  C  C   . MET E 2 228 ? 99.259  -16.987 180.973 1.00 67.27  ? 361 MET E C   1 
ATOM   8010  O  O   . MET E 2 228 ? 98.357  -16.820 181.805 1.00 65.77  ? 361 MET E O   1 
ATOM   8011  C  CB  . MET E 2 228 ? 101.372 -15.823 181.659 1.00 78.53  ? 361 MET E CB  1 
ATOM   8012  C  CG  . MET E 2 228 ? 102.532 -14.847 181.357 1.00 85.21  ? 361 MET E CG  1 
ATOM   8013  S  SD  . MET E 2 228 ? 103.642 -15.326 180.002 1.00 90.45  ? 361 MET E SD  1 
ATOM   8014  C  CE  . MET E 2 228 ? 103.425 -13.963 178.832 1.00 92.09  ? 361 MET E CE  1 
ATOM   8015  N  N   . GLY E 2 229 ? 99.467  -18.124 180.311 1.00 60.87  ? 362 GLY E N   1 
ATOM   8016  C  CA  . GLY E 2 229 ? 98.671  -19.321 180.514 1.00 59.30  ? 362 GLY E CA  1 
ATOM   8017  C  C   . GLY E 2 229 ? 97.218  -19.166 180.909 1.00 61.17  ? 362 GLY E C   1 
ATOM   8018  O  O   . GLY E 2 229 ? 96.372  -18.858 180.078 1.00 62.30  ? 362 GLY E O   1 
ATOM   8019  N  N   . GLU E 2 230 ? 96.944  -19.400 182.189 1.00 68.53  ? 363 GLU E N   1 
ATOM   8020  C  CA  . GLU E 2 230 ? 95.602  -19.315 182.767 1.00 74.29  ? 363 GLU E CA  1 
ATOM   8021  C  C   . GLU E 2 230 ? 94.846  -18.111 182.250 1.00 71.03  ? 363 GLU E C   1 
ATOM   8022  O  O   . GLU E 2 230 ? 93.785  -18.237 181.640 1.00 71.39  ? 363 GLU E O   1 
ATOM   8023  C  CB  . GLU E 2 230 ? 95.690  -19.206 184.301 1.00 80.24  ? 363 GLU E CB  1 
ATOM   8024  C  CG  . GLU E 2 230 ? 94.352  -18.865 185.005 1.00 85.75  ? 363 GLU E CG  1 
ATOM   8025  C  CD  . GLU E 2 230 ? 94.532  -18.201 186.377 1.00 87.30  ? 363 GLU E CD  1 
ATOM   8026  O  OE1 . GLU E 2 230 ? 95.570  -18.433 187.029 1.00 88.21  ? 363 GLU E OE1 1 
ATOM   8027  O  OE2 . GLU E 2 230 ? 93.629  -17.445 186.806 1.00 87.96  ? 363 GLU E OE2 1 
ATOM   8028  N  N   . ASN E 2 231 ? 95.422  -16.945 182.503 1.00 64.02  ? 364 ASN E N   1 
ATOM   8029  C  CA  . ASN E 2 231 ? 94.833  -15.689 182.113 1.00 59.90  ? 364 ASN E CA  1 
ATOM   8030  C  C   . ASN E 2 231 ? 94.816  -15.486 180.610 1.00 57.66  ? 364 ASN E C   1 
ATOM   8031  O  O   . ASN E 2 231 ? 93.873  -14.909 180.083 1.00 64.51  ? 364 ASN E O   1 
ATOM   8032  C  CB  . ASN E 2 231 ? 95.583  -14.558 182.789 1.00 65.23  ? 364 ASN E CB  1 
ATOM   8033  C  CG  . ASN E 2 231 ? 95.937  -14.884 184.228 1.00 71.99  ? 364 ASN E CG  1 
ATOM   8034  O  OD1 . ASN E 2 231 ? 95.056  -15.014 185.089 1.00 74.50  ? 364 ASN E OD1 1 
ATOM   8035  N  ND2 . ASN E 2 231 ? 97.234  -15.050 184.493 1.00 74.65  ? 364 ASN E ND2 1 
ATOM   8036  N  N   . ARG E 2 232 ? 95.830  -15.973 179.905 1.00 50.68  ? 365 ARG E N   1 
ATOM   8037  C  CA  . ARG E 2 232 ? 95.844  -15.788 178.465 1.00 45.55  ? 365 ARG E CA  1 
ATOM   8038  C  C   . ARG E 2 232 ? 94.746  -16.529 177.715 1.00 39.13  ? 365 ARG E C   1 
ATOM   8039  O  O   . ARG E 2 232 ? 94.107  -15.962 176.837 1.00 38.52  ? 365 ARG E O   1 
ATOM   8040  C  CB  . ARG E 2 232 ? 97.198  -16.140 177.865 1.00 48.95  ? 365 ARG E CB  1 
ATOM   8041  C  CG  . ARG E 2 232 ? 97.194  -15.952 176.372 1.00 52.36  ? 365 ARG E CG  1 
ATOM   8042  C  CD  . ARG E 2 232 ? 98.569  -15.922 175.787 1.00 59.36  ? 365 ARG E CD  1 
ATOM   8043  N  NE  . ARG E 2 232 ? 98.513  -15.385 174.431 1.00 67.75  ? 365 ARG E NE  1 
ATOM   8044  C  CZ  . ARG E 2 232 ? 99.560  -15.274 173.621 1.00 72.08  ? 365 ARG E CZ  1 
ATOM   8045  N  NH1 . ARG E 2 232 ? 100.765 -15.667 174.023 1.00 76.35  ? 365 ARG E NH1 1 
ATOM   8046  N  NH2 . ARG E 2 232 ? 99.403  -14.749 172.413 1.00 71.72  ? 365 ARG E NH2 1 
ATOM   8047  N  N   . THR E 2 233 ? 94.516  -17.790 178.058 1.00 38.43  ? 366 THR E N   1 
ATOM   8048  C  CA  . THR E 2 233 ? 93.495  -18.570 177.355 1.00 41.32  ? 366 THR E CA  1 
ATOM   8049  C  C   . THR E 2 233 ? 92.068  -18.203 177.721 1.00 35.96  ? 366 THR E C   1 
ATOM   8050  O  O   . THR E 2 233 ? 91.129  -18.535 177.004 1.00 36.15  ? 366 THR E O   1 
ATOM   8051  C  CB  . THR E 2 233 ? 93.673  -20.087 177.560 1.00 43.88  ? 366 THR E CB  1 
ATOM   8052  O  OG1 . THR E 2 233 ? 93.062  -20.479 178.793 1.00 43.44  ? 366 THR E OG1 1 
ATOM   8053  C  CG2 . THR E 2 233 ? 95.161  -20.454 177.590 1.00 45.62  ? 366 THR E CG2 1 
ATOM   8054  N  N   . MET E 2 234 ? 91.896  -17.558 178.860 1.00 36.63  ? 367 MET E N   1 
ATOM   8055  C  CA  . MET E 2 234 ? 90.565  -17.164 179.266 1.00 43.68  ? 367 MET E CA  1 
ATOM   8056  C  C   . MET E 2 234 ? 90.115  -15.917 178.524 1.00 43.90  ? 367 MET E C   1 
ATOM   8057  O  O   . MET E 2 234 ? 89.006  -15.414 178.740 1.00 44.38  ? 367 MET E O   1 
ATOM   8058  C  CB  . MET E 2 234 ? 90.499  -16.978 180.775 1.00 56.06  ? 367 MET E CB  1 
ATOM   8059  C  CG  . MET E 2 234 ? 90.283  -18.303 181.494 1.00 74.89  ? 367 MET E CG  1 
ATOM   8060  S  SD  . MET E 2 234 ? 88.759  -19.184 180.923 1.00 86.09  ? 367 MET E SD  1 
ATOM   8061  C  CE  . MET E 2 234 ? 89.424  -20.340 179.666 1.00 83.04  ? 367 MET E CE  1 
ATOM   8062  N  N   . THR E 2 235 ? 90.964  -15.455 177.608 1.00 37.65  ? 368 THR E N   1 
ATOM   8063  C  CA  . THR E 2 235 ? 90.671  -14.269 176.819 1.00 33.33  ? 368 THR E CA  1 
ATOM   8064  C  C   . THR E 2 235 ? 90.517  -14.643 175.352 1.00 31.64  ? 368 THR E C   1 
ATOM   8065  O  O   . THR E 2 235 ? 90.291  -13.778 174.507 1.00 33.00  ? 368 THR E O   1 
ATOM   8066  C  CB  . THR E 2 235 ? 91.780  -13.169 176.956 1.00 28.37  ? 368 THR E CB  1 
ATOM   8067  O  OG1 . THR E 2 235 ? 93.009  -13.624 176.374 1.00 31.05  ? 368 THR E OG1 1 
ATOM   8068  C  CG2 . THR E 2 235 ? 92.020  -12.813 178.400 1.00 20.27  ? 368 THR E CG2 1 
ATOM   8069  N  N   . ILE E 2 236 ? 90.678  -15.928 175.047 1.00 34.07  ? 369 ILE E N   1 
ATOM   8070  C  CA  . ILE E 2 236 ? 90.539  -16.420 173.670 1.00 34.31  ? 369 ILE E CA  1 
ATOM   8071  C  C   . ILE E 2 236 ? 89.053  -16.403 173.309 1.00 29.70  ? 369 ILE E C   1 
ATOM   8072  O  O   . ILE E 2 236 ? 88.204  -16.833 174.098 1.00 28.47  ? 369 ILE E O   1 
ATOM   8073  C  CB  . ILE E 2 236 ? 91.133  -17.855 173.514 1.00 33.35  ? 369 ILE E CB  1 
ATOM   8074  C  CG1 . ILE E 2 236 ? 92.641  -17.821 173.800 1.00 33.85  ? 369 ILE E CG1 1 
ATOM   8075  C  CG2 . ILE E 2 236 ? 90.859  -18.408 172.113 1.00 26.65  ? 369 ILE E CG2 1 
ATOM   8076  C  CD1 . ILE E 2 236 ? 93.296  -19.186 173.860 1.00 34.18  ? 369 ILE E CD1 1 
ATOM   8077  N  N   . HIS E 2 237 ? 88.738  -15.893 172.121 1.00 28.23  ? 370 HIS E N   1 
ATOM   8078  C  CA  . HIS E 2 237 ? 87.342  -15.785 171.699 1.00 24.00  ? 370 HIS E CA  1 
ATOM   8079  C  C   . HIS E 2 237 ? 86.802  -16.926 170.852 1.00 21.68  ? 370 HIS E C   1 
ATOM   8080  O  O   . HIS E 2 237 ? 85.578  -17.191 170.847 1.00 16.26  ? 370 HIS E O   1 
ATOM   8081  C  CB  . HIS E 2 237 ? 87.131  -14.459 170.983 1.00 17.28  ? 370 HIS E CB  1 
ATOM   8082  C  CG  . HIS E 2 237 ? 87.443  -13.276 171.831 1.00 17.34  ? 370 HIS E CG  1 
ATOM   8083  N  ND1 . HIS E 2 237 ? 86.545  -12.760 172.741 1.00 21.91  ? 370 HIS E ND1 1 
ATOM   8084  C  CD2 . HIS E 2 237 ? 88.562  -12.525 171.934 1.00 16.58  ? 370 HIS E CD2 1 
ATOM   8085  C  CE1 . HIS E 2 237 ? 87.099  -11.739 173.370 1.00 25.90  ? 370 HIS E CE1 1 
ATOM   8086  N  NE2 . HIS E 2 237 ? 88.322  -11.576 172.900 1.00 22.59  ? 370 HIS E NE2 1 
ATOM   8087  N  N   . ASN E 2 238 ? 87.704  -17.592 170.133 1.00 18.93  ? 371 ASN E N   1 
ATOM   8088  C  CA  . ASN E 2 238 ? 87.301  -18.686 169.277 1.00 17.16  ? 371 ASN E CA  1 
ATOM   8089  C  C   . ASN E 2 238 ? 86.426  -19.650 170.077 1.00 20.79  ? 371 ASN E C   1 
ATOM   8090  O  O   . ASN E 2 238 ? 86.715  -19.959 171.238 1.00 27.64  ? 371 ASN E O   1 
ATOM   8091  C  CB  . ASN E 2 238 ? 88.527  -19.397 168.733 1.00 20.98  ? 371 ASN E CB  1 
ATOM   8092  C  CG  . ASN E 2 238 ? 88.267  -20.067 167.405 1.00 28.52  ? 371 ASN E CG  1 
ATOM   8093  O  OD1 . ASN E 2 238 ? 87.120  -20.304 167.015 1.00 30.46  ? 371 ASN E OD1 1 
ATOM   8094  N  ND2 . ASN E 2 238 ? 89.343  -20.365 166.684 1.00 31.40  ? 371 ASN E ND2 1 
ATOM   8095  N  N   . GLY E 2 239 ? 85.284  -20.007 169.504 1.00 18.71  ? 372 GLY E N   1 
ATOM   8096  C  CA  . GLY E 2 239 ? 84.388  -20.941 170.167 1.00 25.69  ? 372 GLY E CA  1 
ATOM   8097  C  C   . GLY E 2 239 ? 83.460  -20.348 171.200 1.00 29.96  ? 372 GLY E C   1 
ATOM   8098  O  O   . GLY E 2 239 ? 82.553  -21.034 171.689 1.00 36.32  ? 372 GLY E O   1 
ATOM   8099  N  N   . MET E 2 240 ? 83.672  -19.078 171.533 1.00 25.78  ? 373 MET E N   1 
ATOM   8100  C  CA  . MET E 2 240 ? 82.812  -18.422 172.509 1.00 26.64  ? 373 MET E CA  1 
ATOM   8101  C  C   . MET E 2 240 ? 81.383  -18.193 171.988 1.00 29.75  ? 373 MET E C   1 
ATOM   8102  O  O   . MET E 2 240 ? 81.100  -18.375 170.809 1.00 31.19  ? 373 MET E O   1 
ATOM   8103  C  CB  . MET E 2 240 ? 83.429  -17.089 172.957 1.00 26.30  ? 373 MET E CB  1 
ATOM   8104  C  CG  . MET E 2 240 ? 84.742  -17.221 173.713 1.00 33.52  ? 373 MET E CG  1 
ATOM   8105  S  SD  . MET E 2 240 ? 84.766  -18.542 174.962 1.00 38.46  ? 373 MET E SD  1 
ATOM   8106  C  CE  . MET E 2 240 ? 83.224  -18.264 175.815 1.00 35.71  ? 373 MET E CE  1 
ATOM   8107  N  N   . PHE E 2 241 ? 80.472  -17.879 172.896 1.00 29.32  ? 374 PHE E N   1 
ATOM   8108  C  CA  . PHE E 2 241 ? 79.092  -17.592 172.528 1.00 26.48  ? 374 PHE E CA  1 
ATOM   8109  C  C   . PHE E 2 241 ? 78.895  -16.082 172.650 1.00 29.60  ? 374 PHE E C   1 
ATOM   8110  O  O   . PHE E 2 241 ? 79.698  -15.366 173.275 1.00 33.02  ? 374 PHE E O   1 
ATOM   8111  C  CB  . PHE E 2 241 ? 78.103  -18.261 173.488 1.00 27.04  ? 374 PHE E CB  1 
ATOM   8112  C  CG  . PHE E 2 241 ? 78.142  -19.749 173.473 1.00 31.25  ? 374 PHE E CG  1 
ATOM   8113  C  CD1 . PHE E 2 241 ? 77.981  -20.457 172.292 1.00 34.26  ? 374 PHE E CD1 1 
ATOM   8114  C  CD2 . PHE E 2 241 ? 78.274  -20.457 174.660 1.00 35.38  ? 374 PHE E CD2 1 
ATOM   8115  C  CE1 . PHE E 2 241 ? 77.941  -21.856 172.295 1.00 35.43  ? 374 PHE E CE1 1 
ATOM   8116  C  CE2 . PHE E 2 241 ? 78.236  -21.858 174.670 1.00 37.44  ? 374 PHE E CE2 1 
ATOM   8117  C  CZ  . PHE E 2 241 ? 78.067  -22.553 173.481 1.00 35.51  ? 374 PHE E CZ  1 
ATOM   8118  N  N   . PHE E 2 242 ? 77.798  -15.596 172.093 1.00 26.98  ? 375 PHE E N   1 
ATOM   8119  C  CA  . PHE E 2 242 ? 77.528  -14.185 172.182 1.00 27.78  ? 375 PHE E CA  1 
ATOM   8120  C  C   . PHE E 2 242 ? 76.841  -13.848 173.509 1.00 27.30  ? 375 PHE E C   1 
ATOM   8121  O  O   . PHE E 2 242 ? 75.954  -14.587 173.955 1.00 28.25  ? 375 PHE E O   1 
ATOM   8122  C  CB  . PHE E 2 242 ? 76.666  -13.740 171.016 1.00 25.86  ? 375 PHE E CB  1 
ATOM   8123  C  CG  . PHE E 2 242 ? 76.860  -12.309 170.668 1.00 27.56  ? 375 PHE E CG  1 
ATOM   8124  C  CD1 . PHE E 2 242 ? 77.997  -11.909 169.982 1.00 29.96  ? 375 PHE E CD1 1 
ATOM   8125  C  CD2 . PHE E 2 242 ? 75.937  -11.353 171.056 1.00 27.20  ? 375 PHE E CD2 1 
ATOM   8126  C  CE1 . PHE E 2 242 ? 78.218  -10.568 169.684 1.00 34.37  ? 375 PHE E CE1 1 
ATOM   8127  C  CE2 . PHE E 2 242 ? 76.144  -10.006 170.764 1.00 34.36  ? 375 PHE E CE2 1 
ATOM   8128  C  CZ  . PHE E 2 242 ? 77.287  -9.613  170.077 1.00 36.44  ? 375 PHE E CZ  1 
ATOM   8129  N  N   . SER E 2 243 ? 77.254  -12.743 174.139 1.00 23.57  ? 376 SER E N   1 
ATOM   8130  C  CA  . SER E 2 243 ? 76.654  -12.313 175.400 1.00 23.17  ? 376 SER E CA  1 
ATOM   8131  C  C   . SER E 2 243 ? 76.357  -10.822 175.424 1.00 24.56  ? 376 SER E C   1 
ATOM   8132  O  O   . SER E 2 243 ? 77.220  -9.996  175.128 1.00 28.08  ? 376 SER E O   1 
ATOM   8133  C  CB  . SER E 2 243 ? 77.560  -12.653 176.585 1.00 18.75  ? 376 SER E CB  1 
ATOM   8134  O  OG  . SER E 2 243 ? 78.224  -13.895 176.392 1.00 28.31  ? 376 SER E OG  1 
ATOM   8135  N  N   . THR E 2 244 ? 75.109  -10.495 175.719 1.00 20.65  ? 377 THR E N   1 
ATOM   8136  C  CA  . THR E 2 244 ? 74.675  -9.116  175.844 1.00 23.73  ? 377 THR E CA  1 
ATOM   8137  C  C   . THR E 2 244 ? 74.516  -8.912  177.348 1.00 26.08  ? 377 THR E C   1 
ATOM   8138  O  O   . THR E 2 244 ? 74.432  -9.896  178.081 1.00 24.66  ? 377 THR E O   1 
ATOM   8139  C  CB  . THR E 2 244 ? 73.356  -8.882  175.118 1.00 20.01  ? 377 THR E CB  1 
ATOM   8140  O  OG1 . THR E 2 244 ? 72.432  -9.941  175.405 1.00 15.51  ? 377 THR E OG1 1 
ATOM   8141  C  CG2 . THR E 2 244 ? 73.603  -8.842  173.666 1.00 21.41  ? 377 THR E CG2 1 
ATOM   8142  N  N   . TYR E 2 245 ? 74.484  -7.670  177.830 1.00 28.62  ? 378 TYR E N   1 
ATOM   8143  C  CA  . TYR E 2 245 ? 74.368  -7.488  179.275 1.00 33.66  ? 378 TYR E CA  1 
ATOM   8144  C  C   . TYR E 2 245 ? 73.142  -8.156  179.879 1.00 36.12  ? 378 TYR E C   1 
ATOM   8145  O  O   . TYR E 2 245 ? 73.189  -8.627  181.018 1.00 41.68  ? 378 TYR E O   1 
ATOM   8146  C  CB  . TYR E 2 245 ? 74.496  -6.016  179.709 1.00 40.56  ? 378 TYR E CB  1 
ATOM   8147  C  CG  . TYR E 2 245 ? 73.335  -5.089  179.386 1.00 45.85  ? 378 TYR E CG  1 
ATOM   8148  C  CD1 . TYR E 2 245 ? 72.187  -5.068  180.176 1.00 45.68  ? 378 TYR E CD1 1 
ATOM   8149  C  CD2 . TYR E 2 245 ? 73.405  -4.202  178.309 1.00 51.15  ? 378 TYR E CD2 1 
ATOM   8150  C  CE1 . TYR E 2 245 ? 71.140  -4.193  179.900 1.00 48.67  ? 378 TYR E CE1 1 
ATOM   8151  C  CE2 . TYR E 2 245 ? 72.367  -3.321  178.027 1.00 50.20  ? 378 TYR E CE2 1 
ATOM   8152  C  CZ  . TYR E 2 245 ? 71.235  -3.325  178.825 1.00 52.50  ? 378 TYR E CZ  1 
ATOM   8153  O  OH  . TYR E 2 245 ? 70.186  -2.481  178.528 1.00 58.19  ? 378 TYR E OH  1 
ATOM   8154  N  N   . ASP E 2 246 ? 72.066  -8.252  179.103 1.00 34.67  ? 379 ASP E N   1 
ATOM   8155  C  CA  . ASP E 2 246 ? 70.849  -8.888  179.592 1.00 31.21  ? 379 ASP E CA  1 
ATOM   8156  C  C   . ASP E 2 246 ? 70.922  -10.406 179.447 1.00 33.92  ? 379 ASP E C   1 
ATOM   8157  O  O   . ASP E 2 246 ? 70.393  -11.134 180.287 1.00 38.00  ? 379 ASP E O   1 
ATOM   8158  C  CB  . ASP E 2 246 ? 69.611  -8.320  178.894 1.00 27.24  ? 379 ASP E CB  1 
ATOM   8159  C  CG  . ASP E 2 246 ? 69.645  -8.502  177.392 1.00 28.00  ? 379 ASP E CG  1 
ATOM   8160  O  OD1 . ASP E 2 246 ? 70.746  -8.503  176.792 1.00 21.10  ? 379 ASP E OD1 1 
ATOM   8161  O  OD2 . ASP E 2 246 ? 68.551  -8.633  176.808 1.00 31.96  ? 379 ASP E OD2 1 
ATOM   8162  N  N   . ARG E 2 247 ? 71.590  -10.885 178.399 1.00 33.54  ? 380 ARG E N   1 
ATOM   8163  C  CA  . ARG E 2 247 ? 71.739  -12.322 178.198 1.00 29.27  ? 380 ARG E CA  1 
ATOM   8164  C  C   . ARG E 2 247 ? 73.216  -12.702 178.169 1.00 30.56  ? 380 ARG E C   1 
ATOM   8165  O  O   . ARG E 2 247 ? 73.950  -12.359 177.233 1.00 29.16  ? 380 ARG E O   1 
ATOM   8166  C  CB  . ARG E 2 247 ? 71.077  -12.773 176.913 1.00 26.92  ? 380 ARG E CB  1 
ATOM   8167  C  CG  . ARG E 2 247 ? 70.775  -14.257 176.930 1.00 33.12  ? 380 ARG E CG  1 
ATOM   8168  C  CD  . ARG E 2 247 ? 70.506  -14.834 175.538 1.00 41.99  ? 380 ARG E CD  1 
ATOM   8169  N  NE  . ARG E 2 247 ? 69.091  -14.959 175.174 1.00 45.18  ? 380 ARG E NE  1 
ATOM   8170  C  CZ  . ARG E 2 247 ? 68.171  -14.004 175.293 1.00 45.21  ? 380 ARG E CZ  1 
ATOM   8171  N  NH1 . ARG E 2 247 ? 68.471  -12.815 175.791 1.00 47.07  ? 380 ARG E NH1 1 
ATOM   8172  N  NH2 . ARG E 2 247 ? 66.952  -14.215 174.827 1.00 46.63  ? 380 ARG E NH2 1 
ATOM   8173  N  N   . ASP E 2 248 ? 73.650  -13.447 179.178 1.00 37.18  ? 381 ASP E N   1 
ATOM   8174  C  CA  . ASP E 2 248 ? 75.054  -13.825 179.244 1.00 49.92  ? 381 ASP E CA  1 
ATOM   8175  C  C   . ASP E 2 248 ? 75.403  -15.307 179.044 1.00 44.22  ? 381 ASP E C   1 
ATOM   8176  O  O   . ASP E 2 248 ? 74.847  -16.203 179.692 1.00 38.47  ? 381 ASP E O   1 
ATOM   8177  C  CB  . ASP E 2 248 ? 75.703  -13.236 180.516 1.00 58.99  ? 381 ASP E CB  1 
ATOM   8178  C  CG  . ASP E 2 248 ? 76.347  -14.288 181.402 1.00 62.68  ? 381 ASP E CG  1 
ATOM   8179  O  OD1 . ASP E 2 248 ? 77.471  -14.728 181.088 1.00 63.62  ? 381 ASP E OD1 1 
ATOM   8180  O  OD2 . ASP E 2 248 ? 75.725  -14.665 182.416 1.00 66.41  ? 381 ASP E OD2 1 
ATOM   8181  N  N   . ASN E 2 249 ? 76.387  -15.526 178.174 1.00 36.09  ? 382 ASN E N   1 
ATOM   8182  C  CA  . ASN E 2 249 ? 76.858  -16.849 177.844 1.00 26.82  ? 382 ASN E CA  1 
ATOM   8183  C  C   . ASN E 2 249 ? 78.370  -16.839 177.733 1.00 29.61  ? 382 ASN E C   1 
ATOM   8184  O  O   . ASN E 2 249 ? 78.944  -17.447 176.822 1.00 34.72  ? 382 ASN E O   1 
ATOM   8185  C  CB  . ASN E 2 249 ? 76.229  -17.292 176.534 1.00 25.88  ? 382 ASN E CB  1 
ATOM   8186  C  CG  . ASN E 2 249 ? 74.720  -17.204 176.561 1.00 33.16  ? 382 ASN E CG  1 
ATOM   8187  O  OD1 . ASN E 2 249 ? 74.047  -18.032 177.176 1.00 42.14  ? 382 ASN E OD1 1 
ATOM   8188  N  ND2 . ASN E 2 249 ? 74.178  -16.195 175.903 1.00 31.15  ? 382 ASN E ND2 1 
ATOM   8189  N  N   . ASP E 2 250 ? 79.018  -16.115 178.642 1.00 30.53  ? 383 ASP E N   1 
ATOM   8190  C  CA  . ASP E 2 250 ? 80.478  -16.053 178.653 1.00 37.75  ? 383 ASP E CA  1 
ATOM   8191  C  C   . ASP E 2 250 ? 81.071  -17.175 179.498 1.00 39.16  ? 383 ASP E C   1 
ATOM   8192  O  O   . ASP E 2 250 ? 80.379  -18.136 179.836 1.00 39.72  ? 383 ASP E O   1 
ATOM   8193  C  CB  . ASP E 2 250 ? 80.990  -14.683 179.136 1.00 40.15  ? 383 ASP E CB  1 
ATOM   8194  C  CG  . ASP E 2 250 ? 80.630  -14.365 180.598 1.00 41.96  ? 383 ASP E CG  1 
ATOM   8195  O  OD1 . ASP E 2 250 ? 80.026  -15.209 181.295 1.00 37.23  ? 383 ASP E OD1 1 
ATOM   8196  O  OD2 . ASP E 2 250 ? 80.960  -13.240 181.052 1.00 40.27  ? 383 ASP E OD2 1 
ATOM   8197  N  N   . GLY E 2 251 ? 82.366  -17.076 179.787 1.00 37.61  ? 384 GLY E N   1 
ATOM   8198  C  CA  . GLY E 2 251 ? 83.024  -18.079 180.608 1.00 39.61  ? 384 GLY E CA  1 
ATOM   8199  C  C   . GLY E 2 251 ? 83.044  -17.538 182.018 1.00 46.74  ? 384 GLY E C   1 
ATOM   8200  O  O   . GLY E 2 251 ? 83.787  -16.601 182.311 1.00 53.32  ? 384 GLY E O   1 
ATOM   8201  N  N   . TRP E 2 252 ? 82.228  -18.107 182.897 1.00 56.25  ? 385 TRP E N   1 
ATOM   8202  C  CA  . TRP E 2 252 ? 82.162  -17.622 184.274 1.00 58.29  ? 385 TRP E CA  1 
ATOM   8203  C  C   . TRP E 2 252 ? 81.458  -18.516 185.304 1.00 64.53  ? 385 TRP E C   1 
ATOM   8204  O  O   . TRP E 2 252 ? 80.839  -19.539 184.980 1.00 62.64  ? 385 TRP E O   1 
ATOM   8205  C  CB  . TRP E 2 252 ? 81.517  -16.234 184.286 1.00 55.18  ? 385 TRP E CB  1 
ATOM   8206  C  CG  . TRP E 2 252 ? 80.041  -16.173 183.955 1.00 57.50  ? 385 TRP E CG  1 
ATOM   8207  C  CD1 . TRP E 2 252 ? 79.193  -15.186 184.315 1.00 60.53  ? 385 TRP E CD1 1 
ATOM   8208  C  CD2 . TRP E 2 252 ? 79.250  -17.122 183.211 1.00 61.18  ? 385 TRP E CD2 1 
ATOM   8209  N  NE1 . TRP E 2 252 ? 77.930  -15.445 183.858 1.00 59.61  ? 385 TRP E NE1 1 
ATOM   8210  C  CE2 . TRP E 2 252 ? 77.936  -16.629 183.179 1.00 62.25  ? 385 TRP E CE2 1 
ATOM   8211  C  CE3 . TRP E 2 252 ? 79.525  -18.334 182.567 1.00 70.33  ? 385 TRP E CE3 1 
ATOM   8212  C  CZ2 . TRP E 2 252 ? 76.893  -17.302 182.533 1.00 70.60  ? 385 TRP E CZ2 1 
ATOM   8213  C  CZ3 . TRP E 2 252 ? 78.485  -19.007 181.919 1.00 76.09  ? 385 TRP E CZ3 1 
ATOM   8214  C  CH2 . TRP E 2 252 ? 77.186  -18.485 181.910 1.00 75.23  ? 385 TRP E CH2 1 
ATOM   8215  N  N   . LEU E 2 253 ? 81.595  -18.118 186.562 1.00 71.49  ? 386 LEU E N   1 
ATOM   8216  C  CA  . LEU E 2 253 ? 80.966  -18.811 187.673 1.00 77.64  ? 386 LEU E CA  1 
ATOM   8217  C  C   . LEU E 2 253 ? 79.694  -18.023 187.947 1.00 75.53  ? 386 LEU E C   1 
ATOM   8218  O  O   . LEU E 2 253 ? 79.759  -16.842 188.291 1.00 71.93  ? 386 LEU E O   1 
ATOM   8219  C  CB  . LEU E 2 253 ? 81.882  -18.802 188.907 1.00 85.94  ? 386 LEU E CB  1 
ATOM   8220  C  CG  . LEU E 2 253 ? 82.294  -17.483 189.584 1.00 89.92  ? 386 LEU E CG  1 
ATOM   8221  C  CD1 . LEU E 2 253 ? 83.002  -17.773 190.911 1.00 90.36  ? 386 LEU E CD1 1 
ATOM   8222  C  CD2 . LEU E 2 253 ? 83.179  -16.641 188.660 1.00 89.88  ? 386 LEU E CD2 1 
ATOM   8223  N  N   . THR E 2 254 ? 78.541  -18.657 187.745 1.00 83.26  ? 387 THR E N   1 
ATOM   8224  C  CA  . THR E 2 254 ? 77.254  -17.994 187.956 1.00 91.98  ? 387 THR E CA  1 
ATOM   8225  C  C   . THR E 2 254 ? 77.038  -17.588 189.420 1.00 95.12  ? 387 THR E C   1 
ATOM   8226  O  O   . THR E 2 254 ? 76.137  -18.092 190.100 1.00 96.37  ? 387 THR E O   1 
ATOM   8227  C  CB  . THR E 2 254 ? 76.078  -18.874 187.462 1.00 94.52  ? 387 THR E CB  1 
ATOM   8228  O  OG1 . THR E 2 254 ? 76.423  -19.463 186.204 1.00 98.76  ? 387 THR E OG1 1 
ATOM   8229  C  CG2 . THR E 2 254 ? 74.819  -18.031 187.268 1.00 94.19  ? 387 THR E CG2 1 
ATOM   8230  N  N   . SER E 2 255 ? 77.891  -16.681 189.894 1.00 97.68  ? 388 SER E N   1 
ATOM   8231  C  CA  . SER E 2 255 ? 77.832  -16.160 191.257 1.00 99.87  ? 388 SER E CA  1 
ATOM   8232  C  C   . SER E 2 255 ? 76.798  -15.039 191.270 1.00 101.55 ? 388 SER E C   1 
ATOM   8233  O  O   . SER E 2 255 ? 77.047  -13.928 191.756 1.00 94.41  ? 388 SER E O   1 
ATOM   8234  C  CB  . SER E 2 255 ? 79.208  -15.632 191.673 1.00 101.57 ? 388 SER E CB  1 
ATOM   8235  O  OG  . SER E 2 255 ? 79.696  -14.698 190.726 1.00 103.75 ? 388 SER E OG  1 
ATOM   8236  N  N   . ASP E 2 256 ? 75.639  -15.349 190.698 1.00 109.87 ? 389 ASP E N   1 
ATOM   8237  C  CA  . ASP E 2 256 ? 74.536  -14.407 190.584 1.00 116.04 ? 389 ASP E CA  1 
ATOM   8238  C  C   . ASP E 2 256 ? 74.946  -13.195 189.713 1.00 119.28 ? 389 ASP E C   1 
ATOM   8239  O  O   . ASP E 2 256 ? 75.957  -13.268 189.005 1.00 121.90 ? 389 ASP E O   1 
ATOM   8240  C  CB  . ASP E 2 256 ? 74.007  -14.069 191.981 1.00 114.80 ? 389 ASP E CB  1 
ATOM   8241  C  CG  . ASP E 2 256 ? 73.043  -15.130 192.503 1.00 114.91 ? 389 ASP E CG  1 
ATOM   8242  O  OD1 . ASP E 2 256 ? 73.191  -16.322 192.140 1.00 114.86 ? 389 ASP E OD1 1 
ATOM   8243  O  OD2 . ASP E 2 256 ? 72.121  -14.768 193.262 1.00 114.50 ? 389 ASP E OD2 1 
ATOM   8244  N  N   . PRO E 2 257 ? 74.168  -12.094 189.707 1.00 118.36 ? 390 PRO E N   1 
ATOM   8245  C  CA  . PRO E 2 257 ? 74.561  -10.951 188.864 1.00 115.44 ? 390 PRO E CA  1 
ATOM   8246  C  C   . PRO E 2 257 ? 75.948  -10.333 189.060 1.00 110.01 ? 390 PRO E C   1 
ATOM   8247  O  O   . PRO E 2 257 ? 76.275  -9.333  188.410 1.00 105.56 ? 390 PRO E O   1 
ATOM   8248  C  CB  . PRO E 2 257 ? 73.455  -9.932  189.143 1.00 120.61 ? 390 PRO E CB  1 
ATOM   8249  C  CG  . PRO E 2 257 ? 72.993  -10.296 190.543 1.00 120.78 ? 390 PRO E CG  1 
ATOM   8250  C  CD  . PRO E 2 257 ? 72.914  -11.787 190.419 1.00 119.79 ? 390 PRO E CD  1 
ATOM   8251  N  N   . ARG E 2 258 ? 76.762  -10.943 189.921 1.00 106.61 ? 391 ARG E N   1 
ATOM   8252  C  CA  . ARG E 2 258 ? 78.111  -10.451 190.213 1.00 104.93 ? 391 ARG E CA  1 
ATOM   8253  C  C   . ARG E 2 258 ? 78.992  -10.295 188.950 1.00 94.00  ? 391 ARG E C   1 
ATOM   8254  O  O   . ARG E 2 258 ? 78.812  -9.344  188.180 1.00 89.01  ? 391 ARG E O   1 
ATOM   8255  C  CB  . ARG E 2 258 ? 78.775  -11.343 191.283 1.00 111.23 ? 391 ARG E CB  1 
ATOM   8256  C  CG  . ARG E 2 258 ? 79.981  -10.712 191.993 1.00 119.11 ? 391 ARG E CG  1 
ATOM   8257  C  CD  . ARG E 2 258 ? 80.302  -11.418 193.321 1.00 124.48 ? 391 ARG E CD  1 
ATOM   8258  N  NE  . ARG E 2 258 ? 81.506  -10.885 193.971 1.00 128.43 ? 391 ARG E NE  1 
ATOM   8259  C  CZ  . ARG E 2 258 ? 81.876  -11.138 195.229 1.00 129.04 ? 391 ARG E CZ  1 
ATOM   8260  N  NH1 . ARG E 2 258 ? 81.138  -11.920 196.011 1.00 128.04 ? 391 ARG E NH1 1 
ATOM   8261  N  NH2 . ARG E 2 258 ? 83.005  -10.622 195.703 1.00 129.99 ? 391 ARG E NH2 1 
ATOM   8262  N  N   . LYS E 2 259 ? 79.934  -11.213 188.738 1.00 84.34  ? 392 LYS E N   1 
ATOM   8263  C  CA  . LYS E 2 259 ? 80.816  -11.148 187.572 1.00 74.68  ? 392 LYS E CA  1 
ATOM   8264  C  C   . LYS E 2 259 ? 80.150  -11.565 186.258 1.00 70.89  ? 392 LYS E C   1 
ATOM   8265  O  O   . LYS E 2 259 ? 79.637  -12.680 186.120 1.00 74.90  ? 392 LYS E O   1 
ATOM   8266  C  CB  . LYS E 2 259 ? 82.089  -11.990 187.788 1.00 70.61  ? 392 LYS E CB  1 
ATOM   8267  C  CG  . LYS E 2 259 ? 82.966  -12.165 186.534 1.00 60.04  ? 392 LYS E CG  1 
ATOM   8268  C  CD  . LYS E 2 259 ? 83.516  -13.585 186.454 1.00 51.42  ? 392 LYS E CD  1 
ATOM   8269  C  CE  . LYS E 2 259 ? 83.864  -13.941 185.027 1.00 42.44  ? 392 LYS E CE  1 
ATOM   8270  N  NZ  . LYS E 2 259 ? 84.188  -15.379 184.882 1.00 32.70  ? 392 LYS E NZ  1 
ATOM   8271  N  N   . GLN E 2 260 ? 80.161  -10.637 185.310 1.00 62.27  ? 393 GLN E N   1 
ATOM   8272  C  CA  . GLN E 2 260 ? 79.631  -10.829 183.968 1.00 56.87  ? 393 GLN E CA  1 
ATOM   8273  C  C   . GLN E 2 260 ? 80.568  -9.977  183.146 1.00 59.67  ? 393 GLN E C   1 
ATOM   8274  O  O   . GLN E 2 260 ? 80.876  -8.851  183.539 1.00 68.33  ? 393 GLN E O   1 
ATOM   8275  C  CB  . GLN E 2 260 ? 78.214  -10.284 183.835 1.00 51.24  ? 393 GLN E CB  1 
ATOM   8276  C  CG  . GLN E 2 260 ? 77.177  -11.095 184.560 1.00 54.99  ? 393 GLN E CG  1 
ATOM   8277  C  CD  . GLN E 2 260 ? 75.783  -10.897 184.005 1.00 58.37  ? 393 GLN E CD  1 
ATOM   8278  O  OE1 . GLN E 2 260 ? 74.793  -11.047 184.722 1.00 65.46  ? 393 GLN E OE1 1 
ATOM   8279  N  NE2 . GLN E 2 260 ? 75.694  -10.579 182.715 1.00 59.87  ? 393 GLN E NE2 1 
ATOM   8280  N  N   . CYS E 2 261 ? 81.085  -10.520 182.052 1.00 50.41  ? 394 CYS E N   1 
ATOM   8281  C  CA  . CYS E 2 261 ? 81.992  -9.745  181.230 1.00 42.62  ? 394 CYS E CA  1 
ATOM   8282  C  C   . CYS E 2 261 ? 81.255  -8.610  180.573 1.00 46.63  ? 394 CYS E C   1 
ATOM   8283  O  O   . CYS E 2 261 ? 81.753  -7.489  180.514 1.00 55.78  ? 394 CYS E O   1 
ATOM   8284  C  CB  . CYS E 2 261 ? 82.634  -10.629 180.198 1.00 37.35  ? 394 CYS E CB  1 
ATOM   8285  S  SG  . CYS E 2 261 ? 83.663  -11.875 180.997 1.00 26.35  ? 394 CYS E SG  1 
ATOM   8286  N  N   . SER E 2 262 ? 80.059  -8.910  180.083 1.00 47.87  ? 395 SER E N   1 
ATOM   8287  C  CA  . SER E 2 262 ? 79.219  -7.908  179.443 1.00 51.90  ? 395 SER E CA  1 
ATOM   8288  C  C   . SER E 2 262 ? 78.385  -7.253  180.533 1.00 57.02  ? 395 SER E C   1 
ATOM   8289  O  O   . SER E 2 262 ? 77.770  -7.955  181.331 1.00 62.11  ? 395 SER E O   1 
ATOM   8290  C  CB  . SER E 2 262 ? 78.288  -8.582  178.432 1.00 48.88  ? 395 SER E CB  1 
ATOM   8291  O  OG  . SER E 2 262 ? 77.488  -7.640  177.744 1.00 47.06  ? 395 SER E OG  1 
ATOM   8292  N  N   . LYS E 2 263 ? 78.376  -5.927  180.599 1.00 61.16  ? 396 LYS E N   1 
ATOM   8293  C  CA  . LYS E 2 263 ? 77.573  -5.275  181.617 1.00 69.31  ? 396 LYS E CA  1 
ATOM   8294  C  C   . LYS E 2 263 ? 76.844  -4.010  181.177 1.00 79.77  ? 396 LYS E C   1 
ATOM   8295  O  O   . LYS E 2 263 ? 76.623  -3.813  179.979 1.00 82.72  ? 396 LYS E O   1 
ATOM   8296  C  CB  . LYS E 2 263 ? 78.388  -5.037  182.875 1.00 69.82  ? 396 LYS E CB  1 
ATOM   8297  C  CG  . LYS E 2 263 ? 77.950  -5.928  184.042 1.00 76.18  ? 396 LYS E CG  1 
ATOM   8298  C  CD  . LYS E 2 263 ? 76.534  -5.603  184.573 1.00 77.81  ? 396 LYS E CD  1 
ATOM   8299  C  CE  . LYS E 2 263 ? 75.408  -6.253  183.770 1.00 76.48  ? 396 LYS E CE  1 
ATOM   8300  N  NZ  . LYS E 2 263 ? 75.449  -7.731  183.845 1.00 75.35  ? 396 LYS E NZ  1 
ATOM   8301  N  N   . GLU E 2 264 ? 76.416  -3.197  182.150 1.00 84.86  ? 397 GLU E N   1 
ATOM   8302  C  CA  . GLU E 2 264 ? 75.686  -1.948  181.890 1.00 87.47  ? 397 GLU E CA  1 
ATOM   8303  C  C   . GLU E 2 264 ? 76.402  -1.075  180.849 1.00 86.03  ? 397 GLU E C   1 
ATOM   8304  O  O   . GLU E 2 264 ? 77.570  -0.703  181.024 1.00 85.60  ? 397 GLU E O   1 
ATOM   8305  C  CB  . GLU E 2 264 ? 75.457  -1.167  183.197 1.00 92.10  ? 397 GLU E CB  1 
ATOM   8306  C  CG  . GLU E 2 264 ? 74.611  -1.912  184.238 1.00 97.90  ? 397 GLU E CG  1 
ATOM   8307  C  CD  . GLU E 2 264 ? 74.393  -1.117  185.530 1.00 102.38 ? 397 GLU E CD  1 
ATOM   8308  O  OE1 . GLU E 2 264 ? 73.554  -0.187  185.530 1.00 104.64 ? 397 GLU E OE1 1 
ATOM   8309  O  OE2 . GLU E 2 264 ? 75.044  -1.432  186.552 1.00 101.46 ? 397 GLU E OE2 1 
ATOM   8310  N  N   . ASP E 2 265 ? 75.695  -0.799  179.749 1.00 84.60  ? 398 ASP E N   1 
ATOM   8311  C  CA  . ASP E 2 265 ? 76.197  -0.010  178.616 1.00 81.00  ? 398 ASP E CA  1 
ATOM   8312  C  C   . ASP E 2 265 ? 77.481  -0.583  178.007 1.00 76.08  ? 398 ASP E C   1 
ATOM   8313  O  O   . ASP E 2 265 ? 78.104  0.030   177.129 1.00 75.82  ? 398 ASP E O   1 
ATOM   8314  C  CB  . ASP E 2 265 ? 76.367  1.473   178.973 1.00 82.58  ? 398 ASP E CB  1 
ATOM   8315  C  CG  . ASP E 2 265 ? 76.055  2.387   177.792 1.00 83.78  ? 398 ASP E CG  1 
ATOM   8316  O  OD1 . ASP E 2 265 ? 74.950  2.246   177.211 1.00 81.22  ? 398 ASP E OD1 1 
ATOM   8317  O  OD2 . ASP E 2 265 ? 76.916  3.226   177.434 1.00 86.25  ? 398 ASP E OD2 1 
ATOM   8318  N  N   . GLY E 2 266 ? 77.862  -1.763  178.495 1.00 72.77  ? 399 GLY E N   1 
ATOM   8319  C  CA  . GLY E 2 266 ? 79.029  -2.469  177.998 1.00 67.41  ? 399 GLY E CA  1 
ATOM   8320  C  C   . GLY E 2 266 ? 78.540  -3.246  176.794 1.00 60.03  ? 399 GLY E C   1 
ATOM   8321  O  O   . GLY E 2 266 ? 77.389  -3.705  176.760 1.00 62.65  ? 399 GLY E O   1 
ATOM   8322  N  N   . GLY E 2 267 ? 79.410  -3.430  175.817 1.00 50.08  ? 400 GLY E N   1 
ATOM   8323  C  CA  . GLY E 2 267 ? 78.993  -4.124  174.614 1.00 42.94  ? 400 GLY E CA  1 
ATOM   8324  C  C   . GLY E 2 267 ? 78.656  -5.603  174.641 1.00 35.24  ? 400 GLY E C   1 
ATOM   8325  O  O   . GLY E 2 267 ? 78.991  -6.344  175.572 1.00 30.95  ? 400 GLY E O   1 
ATOM   8326  N  N   . GLY E 2 268 ? 77.924  -6.010  173.610 1.00 29.31  ? 401 GLY E N   1 
ATOM   8327  C  CA  . GLY E 2 268 ? 77.582  -7.406  173.441 1.00 26.79  ? 401 GLY E CA  1 
ATOM   8328  C  C   . GLY E 2 268 ? 78.762  -7.894  172.635 1.00 26.98  ? 401 GLY E C   1 
ATOM   8329  O  O   . GLY E 2 268 ? 79.224  -7.191  171.729 1.00 19.41  ? 401 GLY E O   1 
ATOM   8330  N  N   . TRP E 2 269 ? 79.242  -9.095  172.933 1.00 30.36  ? 402 TRP E N   1 
ATOM   8331  C  CA  . TRP E 2 269 ? 80.416  -9.615  172.248 1.00 26.42  ? 402 TRP E CA  1 
ATOM   8332  C  C   . TRP E 2 269 ? 80.571  -11.109 172.550 1.00 23.01  ? 402 TRP E C   1 
ATOM   8333  O  O   . TRP E 2 269 ? 79.736  -11.696 173.233 1.00 22.57  ? 402 TRP E O   1 
ATOM   8334  C  CB  . TRP E 2 269 ? 81.618  -8.817  172.779 1.00 23.79  ? 402 TRP E CB  1 
ATOM   8335  C  CG  . TRP E 2 269 ? 82.876  -9.195  172.199 1.00 20.43  ? 402 TRP E CG  1 
ATOM   8336  C  CD1 . TRP E 2 269 ? 83.928  -9.770  172.832 1.00 20.84  ? 402 TRP E CD1 1 
ATOM   8337  C  CD2 . TRP E 2 269 ? 83.222  -9.102  170.829 1.00 22.24  ? 402 TRP E CD2 1 
ATOM   8338  N  NE1 . TRP E 2 269 ? 84.915  -10.057 171.930 1.00 18.79  ? 402 TRP E NE1 1 
ATOM   8339  C  CE2 . TRP E 2 269 ? 84.504  -9.657  170.689 1.00 21.90  ? 402 TRP E CE2 1 
ATOM   8340  C  CE3 . TRP E 2 269 ? 82.567  -8.605  169.694 1.00 23.30  ? 402 TRP E CE3 1 
ATOM   8341  C  CZ2 . TRP E 2 269 ? 85.147  -9.733  169.463 1.00 25.08  ? 402 TRP E CZ2 1 
ATOM   8342  C  CZ3 . TRP E 2 269 ? 83.207  -8.679  168.469 1.00 18.49  ? 402 TRP E CZ3 1 
ATOM   8343  C  CH2 . TRP E 2 269 ? 84.482  -9.239  168.365 1.00 22.38  ? 402 TRP E CH2 1 
ATOM   8344  N  N   . TRP E 2 270 ? 81.583  -11.747 171.975 1.00 23.02  ? 403 TRP E N   1 
ATOM   8345  C  CA  . TRP E 2 270 ? 81.842  -13.161 172.266 1.00 21.90  ? 403 TRP E CA  1 
ATOM   8346  C  C   . TRP E 2 270 ? 82.919  -13.214 173.359 1.00 21.21  ? 403 TRP E C   1 
ATOM   8347  O  O   . TRP E 2 270 ? 84.117  -13.359 173.084 1.00 17.84  ? 403 TRP E O   1 
ATOM   8348  C  CB  . TRP E 2 270 ? 82.344  -13.894 171.037 1.00 22.18  ? 403 TRP E CB  1 
ATOM   8349  C  CG  . TRP E 2 270 ? 81.350  -13.989 169.959 1.00 21.62  ? 403 TRP E CG  1 
ATOM   8350  C  CD1 . TRP E 2 270 ? 80.375  -14.933 169.825 1.00 25.06  ? 403 TRP E CD1 1 
ATOM   8351  C  CD2 . TRP E 2 270 ? 81.244  -13.140 168.822 1.00 17.16  ? 403 TRP E CD2 1 
ATOM   8352  N  NE1 . TRP E 2 270 ? 79.669  -14.728 168.671 1.00 16.73  ? 403 TRP E NE1 1 
ATOM   8353  C  CE2 . TRP E 2 270 ? 80.182  -13.633 168.033 1.00 17.50  ? 403 TRP E CE2 1 
ATOM   8354  C  CE3 . TRP E 2 270 ? 81.942  -12.004 168.388 1.00 14.28  ? 403 TRP E CE3 1 
ATOM   8355  C  CZ2 . TRP E 2 270 ? 79.803  -13.033 166.831 1.00 18.60  ? 403 TRP E CZ2 1 
ATOM   8356  C  CZ3 . TRP E 2 270 ? 81.566  -11.405 167.197 1.00 18.02  ? 403 TRP E CZ3 1 
ATOM   8357  C  CH2 . TRP E 2 270 ? 80.505  -11.921 166.430 1.00 16.61  ? 403 TRP E CH2 1 
ATOM   8358  N  N   . TYR E 2 271 ? 82.464  -13.043 174.597 1.00 22.78  ? 404 TYR E N   1 
ATOM   8359  C  CA  . TYR E 2 271 ? 83.325  -13.043 175.771 1.00 25.64  ? 404 TYR E CA  1 
ATOM   8360  C  C   . TYR E 2 271 ? 83.642  -14.438 176.293 1.00 27.46  ? 404 TYR E C   1 
ATOM   8361  O  O   . TYR E 2 271 ? 82.764  -15.297 176.386 1.00 28.54  ? 404 TYR E O   1 
ATOM   8362  C  CB  . TYR E 2 271 ? 82.678  -12.245 176.908 1.00 22.83  ? 404 TYR E CB  1 
ATOM   8363  C  CG  . TYR E 2 271 ? 82.386  -10.777 176.615 1.00 22.69  ? 404 TYR E CG  1 
ATOM   8364  C  CD1 . TYR E 2 271 ? 83.403  -9.800  176.696 1.00 12.35  ? 404 TYR E CD1 1 
ATOM   8365  C  CD2 . TYR E 2 271 ? 81.079  -10.352 176.311 1.00 17.83  ? 404 TYR E CD2 1 
ATOM   8366  C  CE1 . TYR E 2 271 ? 83.123  -8.448  176.488 1.00 8.23   ? 404 TYR E CE1 1 
ATOM   8367  C  CE2 . TYR E 2 271 ? 80.798  -9.006  176.099 1.00 11.51  ? 404 TYR E CE2 1 
ATOM   8368  C  CZ  . TYR E 2 271 ? 81.825  -8.067  176.191 1.00 12.47  ? 404 TYR E CZ  1 
ATOM   8369  O  OH  . TYR E 2 271 ? 81.557  -6.750  175.962 1.00 12.52  ? 404 TYR E OH  1 
ATOM   8370  N  N   . ASN E 2 272 ? 84.908  -14.638 176.639 1.00 27.00  ? 405 ASN E N   1 
ATOM   8371  C  CA  . ASN E 2 272 ? 85.392  -15.889 177.194 1.00 29.03  ? 405 ASN E CA  1 
ATOM   8372  C  C   . ASN E 2 272 ? 85.351  -15.591 178.689 1.00 32.11  ? 405 ASN E C   1 
ATOM   8373  O  O   . ASN E 2 272 ? 84.312  -15.160 179.199 1.00 33.56  ? 405 ASN E O   1 
ATOM   8374  C  CB  . ASN E 2 272 ? 86.823  -16.113 176.726 1.00 28.09  ? 405 ASN E CB  1 
ATOM   8375  C  CG  . ASN E 2 272 ? 87.298  -17.503 176.994 1.00 31.09  ? 405 ASN E CG  1 
ATOM   8376  O  OD1 . ASN E 2 272 ? 86.639  -18.254 177.692 1.00 33.62  ? 405 ASN E OD1 1 
ATOM   8377  N  ND2 . ASN E 2 272 ? 88.447  -17.863 176.445 1.00 33.98  ? 405 ASN E ND2 1 
ATOM   8378  N  N   . ARG E 2 273 ? 86.433  -15.844 179.421 1.00 32.22  ? 406 ARG E N   1 
ATOM   8379  C  CA  . ARG E 2 273 ? 86.420  -15.438 180.829 1.00 40.50  ? 406 ARG E CA  1 
ATOM   8380  C  C   . ARG E 2 273 ? 86.883  -13.995 180.663 1.00 37.71  ? 406 ARG E C   1 
ATOM   8381  O  O   . ARG E 2 273 ? 87.949  -13.567 181.133 1.00 33.90  ? 406 ARG E O   1 
ATOM   8382  C  CB  . ARG E 2 273 ? 87.372  -16.250 181.715 1.00 49.19  ? 406 ARG E CB  1 
ATOM   8383  C  CG  . ARG E 2 273 ? 87.462  -15.728 183.170 1.00 55.51  ? 406 ARG E CG  1 
ATOM   8384  C  CD  . ARG E 2 273 ? 88.210  -16.686 184.112 1.00 62.35  ? 406 ARG E CD  1 
ATOM   8385  N  NE  . ARG E 2 273 ? 87.332  -17.727 184.646 1.00 68.36  ? 406 ARG E NE  1 
ATOM   8386  C  CZ  . ARG E 2 273 ? 86.528  -17.557 185.690 1.00 70.34  ? 406 ARG E CZ  1 
ATOM   8387  N  NH1 . ARG E 2 273 ? 86.499  -16.389 186.318 1.00 74.94  ? 406 ARG E NH1 1 
ATOM   8388  N  NH2 . ARG E 2 273 ? 85.721  -18.533 186.081 1.00 70.60  ? 406 ARG E NH2 1 
ATOM   8389  N  N   . CYS E 2 274 ? 86.095  -13.347 179.810 1.00 35.70  ? 407 CYS E N   1 
ATOM   8390  C  CA  . CYS E 2 274 ? 86.175  -11.972 179.337 1.00 32.76  ? 407 CYS E CA  1 
ATOM   8391  C  C   . CYS E 2 274 ? 86.821  -11.746 177.966 1.00 31.80  ? 407 CYS E C   1 
ATOM   8392  O  O   . CYS E 2 274 ? 86.625  -12.566 177.059 1.00 37.32  ? 407 CYS E O   1 
ATOM   8393  C  CB  . CYS E 2 274 ? 86.603  -11.010 180.420 1.00 27.13  ? 407 CYS E CB  1 
ATOM   8394  S  SG  . CYS E 2 274 ? 85.258  -10.784 181.645 1.00 41.41  ? 407 CYS E SG  1 
ATOM   8395  N  N   . HIS E 2 275 ? 87.579  -10.678 177.776 1.00 22.90  ? 408 HIS E N   1 
ATOM   8396  C  CA  . HIS E 2 275 ? 88.107  -10.456 176.443 1.00 21.78  ? 408 HIS E CA  1 
ATOM   8397  C  C   . HIS E 2 275 ? 89.595  -10.209 176.262 1.00 18.90  ? 408 HIS E C   1 
ATOM   8398  O  O   . HIS E 2 275 ? 90.326  -9.996  177.211 1.00 16.68  ? 408 HIS E O   1 
ATOM   8399  C  CB  . HIS E 2 275 ? 87.383  -9.269  175.843 1.00 27.99  ? 408 HIS E CB  1 
ATOM   8400  C  CG  . HIS E 2 275 ? 87.828  -7.967  176.425 1.00 33.38  ? 408 HIS E CG  1 
ATOM   8401  N  ND1 . HIS E 2 275 ? 87.452  -7.554  177.683 1.00 38.71  ? 408 HIS E ND1 1 
ATOM   8402  C  CD2 . HIS E 2 275 ? 88.669  -7.017  175.952 1.00 35.32  ? 408 HIS E CD2 1 
ATOM   8403  C  CE1 . HIS E 2 275 ? 88.040  -6.405  177.963 1.00 41.68  ? 408 HIS E CE1 1 
ATOM   8404  N  NE2 . HIS E 2 275 ? 88.784  -6.057  176.929 1.00 37.04  ? 408 HIS E NE2 1 
ATOM   8405  N  N   . ALA E 2 276 ? 89.964  -10.128 174.986 1.00 22.31  ? 409 ALA E N   1 
ATOM   8406  C  CA  . ALA E 2 276 ? 91.307  -9.836  174.496 1.00 28.98  ? 409 ALA E CA  1 
ATOM   8407  C  C   . ALA E 2 276 ? 91.115  -8.701  173.491 1.00 32.55  ? 409 ALA E C   1 
ATOM   8408  O  O   . ALA E 2 276 ? 92.042  -7.962  173.145 1.00 38.63  ? 409 ALA E O   1 
ATOM   8409  C  CB  . ALA E 2 276 ? 91.886  -11.038 173.801 1.00 29.95  ? 409 ALA E CB  1 
ATOM   8410  N  N   . ALA E 2 277 ? 89.876  -8.571  173.042 1.00 29.72  ? 410 ALA E N   1 
ATOM   8411  C  CA  . ALA E 2 277 ? 89.491  -7.549  172.099 1.00 25.42  ? 410 ALA E CA  1 
ATOM   8412  C  C   . ALA E 2 277 ? 88.045  -7.247  172.380 1.00 26.64  ? 410 ALA E C   1 
ATOM   8413  O  O   . ALA E 2 277 ? 87.252  -8.151  172.687 1.00 30.41  ? 410 ALA E O   1 
ATOM   8414  C  CB  . ALA E 2 277 ? 89.639  -8.053  170.703 1.00 21.92  ? 410 ALA E CB  1 
ATOM   8415  N  N   . ASN E 2 278 ? 87.718  -5.963  172.319 1.00 22.93  ? 411 ASN E N   1 
ATOM   8416  C  CA  . ASN E 2 278 ? 86.355  -5.518  172.526 1.00 24.52  ? 411 ASN E CA  1 
ATOM   8417  C  C   . ASN E 2 278 ? 85.996  -4.382  171.573 1.00 24.71  ? 411 ASN E C   1 
ATOM   8418  O  O   . ASN E 2 278 ? 86.078  -3.194  171.916 1.00 24.42  ? 411 ASN E O   1 
ATOM   8419  C  CB  . ASN E 2 278 ? 86.158  -5.062  173.950 1.00 32.06  ? 411 ASN E CB  1 
ATOM   8420  C  CG  . ASN E 2 278 ? 84.720  -5.078  174.336 1.00 38.20  ? 411 ASN E CG  1 
ATOM   8421  O  OD1 . ASN E 2 278 ? 83.874  -5.620  173.595 1.00 44.75  ? 411 ASN E OD1 1 
ATOM   8422  N  ND2 . ASN E 2 278 ? 84.411  -4.502  175.495 1.00 32.01  ? 411 ASN E ND2 1 
ATOM   8423  N  N   . PRO E 2 279 ? 85.588  -4.738  170.353 1.00 23.47  ? 412 PRO E N   1 
ATOM   8424  C  CA  . PRO E 2 279 ? 85.211  -3.786  169.310 1.00 24.02  ? 412 PRO E CA  1 
ATOM   8425  C  C   . PRO E 2 279 ? 83.941  -3.051  169.660 1.00 28.70  ? 412 PRO E C   1 
ATOM   8426  O  O   . PRO E 2 279 ? 83.713  -1.936  169.191 1.00 33.59  ? 412 PRO E O   1 
ATOM   8427  C  CB  . PRO E 2 279 ? 84.997  -4.684  168.088 1.00 14.09  ? 412 PRO E CB  1 
ATOM   8428  C  CG  . PRO E 2 279 ? 85.818  -5.871  168.379 1.00 17.53  ? 412 PRO E CG  1 
ATOM   8429  C  CD  . PRO E 2 279 ? 85.551  -6.109  169.832 1.00 21.42  ? 412 PRO E CD  1 
ATOM   8430  N  N   . ASN E 2 280 ? 83.106  -3.690  170.474 1.00 28.85  ? 413 ASN E N   1 
ATOM   8431  C  CA  . ASN E 2 280 ? 81.837  -3.095  170.868 1.00 26.74  ? 413 ASN E CA  1 
ATOM   8432  C  C   . ASN E 2 280 ? 81.852  -2.462  172.225 1.00 23.87  ? 413 ASN E C   1 
ATOM   8433  O  O   . ASN E 2 280 ? 80.800  -2.131  172.766 1.00 17.45  ? 413 ASN E O   1 
ATOM   8434  C  CB  . ASN E 2 280 ? 80.736  -4.123  170.779 1.00 23.47  ? 413 ASN E CB  1 
ATOM   8435  C  CG  . ASN E 2 280 ? 80.512  -4.566  169.372 1.00 24.94  ? 413 ASN E CG  1 
ATOM   8436  O  OD1 . ASN E 2 280 ? 80.967  -3.908  168.425 1.00 28.51  ? 413 ASN E OD1 1 
ATOM   8437  N  ND2 . ASN E 2 280 ? 79.817  -5.685  169.204 1.00 24.51  ? 413 ASN E ND2 1 
ATOM   8438  N  N   . GLY E 2 281 ? 83.055  -2.232  172.738 1.00 21.23  ? 414 GLY E N   1 
ATOM   8439  C  CA  . GLY E 2 281 ? 83.178  -1.633  174.037 1.00 19.97  ? 414 GLY E CA  1 
ATOM   8440  C  C   . GLY E 2 281 ? 82.685  -0.212  174.031 1.00 23.44  ? 414 GLY E C   1 
ATOM   8441  O  O   . GLY E 2 281 ? 81.893  0.197   173.190 1.00 24.49  ? 414 GLY E O   1 
ATOM   8442  N  N   . ARG E 2 282 ? 83.170  0.547   174.995 1.00 21.93  ? 415 ARG E N   1 
ATOM   8443  C  CA  . ARG E 2 282 ? 82.798  1.933   175.130 1.00 21.32  ? 415 ARG E CA  1 
ATOM   8444  C  C   . ARG E 2 282 ? 83.808  2.835   174.461 1.00 24.53  ? 415 ARG E C   1 
ATOM   8445  O  O   . ARG E 2 282 ? 85.017  2.667   174.603 1.00 28.35  ? 415 ARG E O   1 
ATOM   8446  C  CB  . ARG E 2 282 ? 82.642  2.279   176.595 1.00 26.58  ? 415 ARG E CB  1 
ATOM   8447  C  CG  . ARG E 2 282 ? 81.521  1.500   177.246 1.00 26.36  ? 415 ARG E CG  1 
ATOM   8448  C  CD  . ARG E 2 282 ? 80.564  2.440   177.916 1.00 26.66  ? 415 ARG E CD  1 
ATOM   8449  N  NE  . ARG E 2 282 ? 81.217  3.089   179.040 1.00 31.27  ? 415 ARG E NE  1 
ATOM   8450  C  CZ  . ARG E 2 282 ? 80.623  3.953   179.845 1.00 35.45  ? 415 ARG E CZ  1 
ATOM   8451  N  NH1 . ARG E 2 282 ? 79.352  4.290   179.644 1.00 37.65  ? 415 ARG E NH1 1 
ATOM   8452  N  NH2 . ARG E 2 282 ? 81.284  4.423   180.888 1.00 33.45  ? 415 ARG E NH2 1 
ATOM   8453  N  N   . TYR E 2 283 ? 83.283  3.804   173.725 1.00 28.54  ? 416 TYR E N   1 
ATOM   8454  C  CA  . TYR E 2 283 ? 84.094  4.748   172.981 1.00 26.36  ? 416 TYR E CA  1 
ATOM   8455  C  C   . TYR E 2 283 ? 84.642  5.931   173.795 1.00 27.63  ? 416 TYR E C   1 
ATOM   8456  O  O   . TYR E 2 283 ? 84.049  7.028   173.830 1.00 29.37  ? 416 TYR E O   1 
ATOM   8457  C  CB  . TYR E 2 283 ? 83.279  5.249   171.793 1.00 28.13  ? 416 TYR E CB  1 
ATOM   8458  C  CG  . TYR E 2 283 ? 84.114  5.866   170.705 1.00 28.34  ? 416 TYR E CG  1 
ATOM   8459  C  CD1 . TYR E 2 283 ? 84.492  7.214   170.765 1.00 29.13  ? 416 TYR E CD1 1 
ATOM   8460  C  CD2 . TYR E 2 283 ? 84.543  5.104   169.625 1.00 24.11  ? 416 TYR E CD2 1 
ATOM   8461  C  CE1 . TYR E 2 283 ? 85.276  7.784   169.775 1.00 26.92  ? 416 TYR E CE1 1 
ATOM   8462  C  CE2 . TYR E 2 283 ? 85.328  5.659   168.635 1.00 25.28  ? 416 TYR E CE2 1 
ATOM   8463  C  CZ  . TYR E 2 283 ? 85.693  6.997   168.713 1.00 25.80  ? 416 TYR E CZ  1 
ATOM   8464  O  OH  . TYR E 2 283 ? 86.491  7.535   167.734 1.00 30.72  ? 416 TYR E OH  1 
ATOM   8465  N  N   . TYR E 2 284 ? 85.776  5.706   174.453 1.00 26.76  ? 417 TYR E N   1 
ATOM   8466  C  CA  . TYR E 2 284 ? 86.412  6.761   175.227 1.00 27.14  ? 417 TYR E CA  1 
ATOM   8467  C  C   . TYR E 2 284 ? 87.127  7.668   174.231 1.00 35.70  ? 417 TYR E C   1 
ATOM   8468  O  O   . TYR E 2 284 ? 87.661  7.196   173.207 1.00 35.05  ? 417 TYR E O   1 
ATOM   8469  C  CB  . TYR E 2 284 ? 87.404  6.177   176.229 1.00 20.23  ? 417 TYR E CB  1 
ATOM   8470  C  CG  . TYR E 2 284 ? 86.745  5.378   177.325 1.00 17.22  ? 417 TYR E CG  1 
ATOM   8471  C  CD1 . TYR E 2 284 ? 86.475  4.020   177.158 1.00 19.45  ? 417 TYR E CD1 1 
ATOM   8472  C  CD2 . TYR E 2 284 ? 86.352  5.984   178.526 1.00 14.50  ? 417 TYR E CD2 1 
ATOM   8473  C  CE1 . TYR E 2 284 ? 85.811  3.274   178.179 1.00 23.22  ? 417 TYR E CE1 1 
ATOM   8474  C  CE2 . TYR E 2 284 ? 85.694  5.250   179.550 1.00 19.69  ? 417 TYR E CE2 1 
ATOM   8475  C  CZ  . TYR E 2 284 ? 85.424  3.898   179.368 1.00 24.75  ? 417 TYR E CZ  1 
ATOM   8476  O  OH  . TYR E 2 284 ? 84.758  3.183   180.349 1.00 26.86  ? 417 TYR E OH  1 
ATOM   8477  N  N   . TRP E 2 285 ? 87.079  8.971   174.499 1.00 35.62  ? 418 TRP E N   1 
ATOM   8478  C  CA  . TRP E 2 285 ? 87.720  9.943   173.629 1.00 33.42  ? 418 TRP E CA  1 
ATOM   8479  C  C   . TRP E 2 285 ? 89.213  10.068  173.933 1.00 35.47  ? 418 TRP E C   1 
ATOM   8480  O  O   . TRP E 2 285 ? 89.641  10.002  175.103 1.00 34.01  ? 418 TRP E O   1 
ATOM   8481  C  CB  . TRP E 2 285 ? 87.044  11.300  173.775 1.00 35.36  ? 418 TRP E CB  1 
ATOM   8482  C  CG  . TRP E 2 285 ? 87.375  12.184  172.662 1.00 37.03  ? 418 TRP E CG  1 
ATOM   8483  C  CD1 . TRP E 2 285 ? 88.423  13.042  172.588 1.00 37.11  ? 418 TRP E CD1 1 
ATOM   8484  C  CD2 . TRP E 2 285 ? 86.727  12.219  171.390 1.00 37.43  ? 418 TRP E CD2 1 
ATOM   8485  N  NE1 . TRP E 2 285 ? 88.485  13.599  171.336 1.00 39.54  ? 418 TRP E NE1 1 
ATOM   8486  C  CE2 . TRP E 2 285 ? 87.451  13.111  170.582 1.00 35.65  ? 418 TRP E CE2 1 
ATOM   8487  C  CE3 . TRP E 2 285 ? 85.607  11.575  170.854 1.00 38.14  ? 418 TRP E CE3 1 
ATOM   8488  C  CZ2 . TRP E 2 285 ? 87.099  13.378  169.267 1.00 34.54  ? 418 TRP E CZ2 1 
ATOM   8489  C  CZ3 . TRP E 2 285 ? 85.255  11.839  169.551 1.00 41.07  ? 418 TRP E CZ3 1 
ATOM   8490  C  CH2 . TRP E 2 285 ? 86.001  12.736  168.768 1.00 40.36  ? 418 TRP E CH2 1 
ATOM   8491  N  N   . GLY E 2 286 ? 90.004  10.249  172.880 1.00 37.05  ? 419 GLY E N   1 
ATOM   8492  C  CA  . GLY E 2 286 ? 91.440  10.380  173.056 1.00 45.90  ? 419 GLY E CA  1 
ATOM   8493  C  C   . GLY E 2 286 ? 92.121  9.029   173.153 1.00 52.23  ? 419 GLY E C   1 
ATOM   8494  O  O   . GLY E 2 286 ? 93.358  8.934   173.124 1.00 53.90  ? 419 GLY E O   1 
ATOM   8495  N  N   . GLY E 2 287 ? 91.300  7.988   173.291 1.00 55.78  ? 420 GLY E N   1 
ATOM   8496  C  CA  . GLY E 2 287 ? 91.794  6.624   173.375 1.00 56.17  ? 420 GLY E CA  1 
ATOM   8497  C  C   . GLY E 2 287 ? 92.591  6.270   174.606 1.00 53.14  ? 420 GLY E C   1 
ATOM   8498  O  O   . GLY E 2 287 ? 93.314  5.284   174.612 1.00 53.54  ? 420 GLY E O   1 
ATOM   8499  N  N   . GLN E 2 288 ? 92.451  7.057   175.658 1.00 50.08  ? 421 GLN E N   1 
ATOM   8500  C  CA  . GLN E 2 288 ? 93.185  6.787   176.872 1.00 48.60  ? 421 GLN E CA  1 
ATOM   8501  C  C   . GLN E 2 288 ? 92.224  6.832   178.031 1.00 49.11  ? 421 GLN E C   1 
ATOM   8502  O  O   . GLN E 2 288 ? 91.479  7.798   178.166 1.00 57.91  ? 421 GLN E O   1 
ATOM   8503  C  CB  . GLN E 2 288 ? 94.260  7.851   177.052 1.00 54.16  ? 421 GLN E CB  1 
ATOM   8504  C  CG  . GLN E 2 288 ? 95.321  7.866   175.955 1.00 57.48  ? 421 GLN E CG  1 
ATOM   8505  C  CD  . GLN E 2 288 ? 96.499  6.977   176.274 1.00 62.41  ? 421 GLN E CD  1 
ATOM   8506  O  OE1 . GLN E 2 288 ? 96.515  6.281   177.297 1.00 66.24  ? 421 GLN E OE1 1 
ATOM   8507  N  NE2 . GLN E 2 288 ? 97.507  7.008   175.411 1.00 64.04  ? 421 GLN E NE2 1 
ATOM   8508  N  N   . TYR E 2 289 ? 92.187  5.772   178.830 1.00 44.34  ? 422 TYR E N   1 
ATOM   8509  C  CA  . TYR E 2 289 ? 91.303  5.761   179.991 1.00 43.92  ? 422 TYR E CA  1 
ATOM   8510  C  C   . TYR E 2 289 ? 91.860  4.978   181.173 1.00 48.96  ? 422 TYR E C   1 
ATOM   8511  O  O   . TYR E 2 289 ? 92.866  4.267   181.060 1.00 49.20  ? 422 TYR E O   1 
ATOM   8512  C  CB  . TYR E 2 289 ? 89.878  5.302   179.635 1.00 35.93  ? 422 TYR E CB  1 
ATOM   8513  C  CG  . TYR E 2 289 ? 89.745  3.856   179.225 1.00 32.28  ? 422 TYR E CG  1 
ATOM   8514  C  CD1 . TYR E 2 289 ? 90.303  3.400   178.030 1.00 27.85  ? 422 TYR E CD1 1 
ATOM   8515  C  CD2 . TYR E 2 289 ? 89.048  2.940   180.023 1.00 34.06  ? 422 TYR E CD2 1 
ATOM   8516  C  CE1 . TYR E 2 289 ? 90.177  2.072   177.630 1.00 24.85  ? 422 TYR E CE1 1 
ATOM   8517  C  CE2 . TYR E 2 289 ? 88.915  1.603   179.633 1.00 33.56  ? 422 TYR E CE2 1 
ATOM   8518  C  CZ  . TYR E 2 289 ? 89.490  1.181   178.431 1.00 32.07  ? 422 TYR E CZ  1 
ATOM   8519  O  OH  . TYR E 2 289 ? 89.406  -0.131  178.027 1.00 35.70  ? 422 TYR E OH  1 
ATOM   8520  N  N   . THR E 2 290 ? 91.202  5.138   182.318 1.00 53.15  ? 423 THR E N   1 
ATOM   8521  C  CA  . THR E 2 290 ? 91.614  4.491   183.553 1.00 47.29  ? 423 THR E CA  1 
ATOM   8522  C  C   . THR E 2 290 ? 90.424  3.885   184.258 1.00 44.02  ? 423 THR E C   1 
ATOM   8523  O  O   . THR E 2 290 ? 89.277  4.280   184.031 1.00 42.06  ? 423 THR E O   1 
ATOM   8524  C  CB  . THR E 2 290 ? 92.255  5.505   184.504 1.00 51.55  ? 423 THR E CB  1 
ATOM   8525  O  OG1 . THR E 2 290 ? 91.323  6.566   184.778 1.00 53.63  ? 423 THR E OG1 1 
ATOM   8526  C  CG2 . THR E 2 290 ? 93.526  6.090   183.878 1.00 51.83  ? 423 THR E CG2 1 
ATOM   8527  N  N   . TRP E 2 291 ? 90.715  2.943   185.144 1.00 42.62  ? 424 TRP E N   1 
ATOM   8528  C  CA  . TRP E 2 291 ? 89.688  2.252   185.899 1.00 41.59  ? 424 TRP E CA  1 
ATOM   8529  C  C   . TRP E 2 291 ? 88.733  3.223   186.583 1.00 38.11  ? 424 TRP E C   1 
ATOM   8530  O  O   . TRP E 2 291 ? 87.557  2.927   186.703 1.00 38.39  ? 424 TRP E O   1 
ATOM   8531  C  CB  . TRP E 2 291 ? 90.347  1.345   186.929 1.00 48.69  ? 424 TRP E CB  1 
ATOM   8532  C  CG  . TRP E 2 291 ? 91.293  2.102   187.790 1.00 55.86  ? 424 TRP E CG  1 
ATOM   8533  C  CD1 . TRP E 2 291 ? 92.565  2.482   187.471 1.00 59.85  ? 424 TRP E CD1 1 
ATOM   8534  C  CD2 . TRP E 2 291 ? 91.004  2.693   189.062 1.00 57.42  ? 424 TRP E CD2 1 
ATOM   8535  N  NE1 . TRP E 2 291 ? 93.079  3.290   188.457 1.00 61.64  ? 424 TRP E NE1 1 
ATOM   8536  C  CE2 . TRP E 2 291 ? 92.140  3.436   189.446 1.00 58.22  ? 424 TRP E CE2 1 
ATOM   8537  C  CE3 . TRP E 2 291 ? 89.889  2.675   189.910 1.00 59.92  ? 424 TRP E CE3 1 
ATOM   8538  C  CZ2 . TRP E 2 291 ? 92.195  4.160   190.645 1.00 59.32  ? 424 TRP E CZ2 1 
ATOM   8539  C  CZ3 . TRP E 2 291 ? 89.942  3.393   191.100 1.00 62.12  ? 424 TRP E CZ3 1 
ATOM   8540  C  CH2 . TRP E 2 291 ? 91.091  4.127   191.456 1.00 60.34  ? 424 TRP E CH2 1 
ATOM   8541  N  N   . ASP E 2 292 ? 89.226  4.378   187.028 1.00 39.41  ? 425 ASP E N   1 
ATOM   8542  C  CA  . ASP E 2 292 ? 88.344  5.337   187.689 1.00 44.53  ? 425 ASP E CA  1 
ATOM   8543  C  C   . ASP E 2 292 ? 87.458  6.076   186.701 1.00 44.38  ? 425 ASP E C   1 
ATOM   8544  O  O   . ASP E 2 292 ? 86.428  6.664   187.067 1.00 46.61  ? 425 ASP E O   1 
ATOM   8545  C  CB  . ASP E 2 292 ? 89.075  6.284   188.665 1.00 48.71  ? 425 ASP E CB  1 
ATOM   8546  C  CG  . ASP E 2 292 ? 90.388  6.811   188.135 1.00 52.42  ? 425 ASP E CG  1 
ATOM   8547  O  OD1 . ASP E 2 292 ? 91.012  6.157   187.275 1.00 50.39  ? 425 ASP E OD1 1 
ATOM   8548  O  OD2 . ASP E 2 292 ? 90.814  7.879   188.631 1.00 57.06  ? 425 ASP E OD2 1 
ATOM   8549  N  N   . MET E 2 293 ? 87.837  5.982   185.436 1.00 35.78  ? 426 MET E N   1 
ATOM   8550  C  CA  . MET E 2 293 ? 87.051  6.584   184.376 1.00 35.72  ? 426 MET E CA  1 
ATOM   8551  C  C   . MET E 2 293 ? 86.010  5.545   183.960 1.00 35.89  ? 426 MET E C   1 
ATOM   8552  O  O   . MET E 2 293 ? 84.848  5.873   183.675 1.00 38.77  ? 426 MET E O   1 
ATOM   8553  C  CB  . MET E 2 293 ? 87.954  6.939   183.198 1.00 35.32  ? 426 MET E CB  1 
ATOM   8554  C  CG  . MET E 2 293 ? 88.979  8.009   183.531 1.00 36.66  ? 426 MET E CG  1 
ATOM   8555  S  SD  . MET E 2 293 ? 90.146  8.253   182.196 1.00 37.43  ? 426 MET E SD  1 
ATOM   8556  C  CE  . MET E 2 293 ? 88.991  8.578   180.778 1.00 35.45  ? 426 MET E CE  1 
ATOM   8557  N  N   . ALA E 2 294 ? 86.434  4.281   183.983 1.00 28.28  ? 427 ALA E N   1 
ATOM   8558  C  CA  . ALA E 2 294 ? 85.580  3.171   183.600 1.00 26.20  ? 427 ALA E CA  1 
ATOM   8559  C  C   . ALA E 2 294 ? 84.415  3.035   184.556 1.00 25.40  ? 427 ALA E C   1 
ATOM   8560  O  O   . ALA E 2 294 ? 84.591  3.017   185.767 1.00 26.73  ? 427 ALA E O   1 
ATOM   8561  C  CB  . ALA E 2 294 ? 86.377  1.899   183.547 1.00 26.03  ? 427 ALA E CB  1 
ATOM   8562  N  N   . LYS E 2 295 ? 83.222  2.928   183.990 1.00 28.34  ? 428 LYS E N   1 
ATOM   8563  C  CA  . LYS E 2 295 ? 81.990  2.822   184.760 1.00 31.68  ? 428 LYS E CA  1 
ATOM   8564  C  C   . LYS E 2 295 ? 82.100  1.771   185.822 1.00 32.75  ? 428 LYS E C   1 
ATOM   8565  O  O   . LYS E 2 295 ? 81.720  1.989   186.965 1.00 43.43  ? 428 LYS E O   1 
ATOM   8566  C  CB  . LYS E 2 295 ? 80.824  2.482   183.842 1.00 33.27  ? 428 LYS E CB  1 
ATOM   8567  C  CG  . LYS E 2 295 ? 79.449  2.760   184.406 1.00 31.23  ? 428 LYS E CG  1 
ATOM   8568  C  CD  . LYS E 2 295 ? 78.409  2.516   183.314 1.00 37.66  ? 428 LYS E CD  1 
ATOM   8569  C  CE  . LYS E 2 295 ? 77.030  3.094   183.630 1.00 37.12  ? 428 LYS E CE  1 
ATOM   8570  N  NZ  . LYS E 2 295 ? 76.117  2.903   182.458 1.00 42.00  ? 428 LYS E NZ  1 
ATOM   8571  N  N   . HIS E 2 296 ? 82.667  0.640   185.458 1.00 32.05  ? 429 HIS E N   1 
ATOM   8572  C  CA  . HIS E 2 296 ? 82.800  -0.438  186.410 1.00 32.78  ? 429 HIS E CA  1 
ATOM   8573  C  C   . HIS E 2 296 ? 84.236  -0.710  186.797 1.00 33.68  ? 429 HIS E C   1 
ATOM   8574  O  O   . HIS E 2 296 ? 84.526  -1.724  187.416 1.00 24.57  ? 429 HIS E O   1 
ATOM   8575  C  CB  . HIS E 2 296 ? 82.168  -1.693  185.835 1.00 37.96  ? 429 HIS E CB  1 
ATOM   8576  C  CG  . HIS E 2 296 ? 80.714  -1.540  185.530 1.00 43.68  ? 429 HIS E CG  1 
ATOM   8577  N  ND1 . HIS E 2 296 ? 79.845  -0.873  186.367 1.00 47.55  ? 429 HIS E ND1 1 
ATOM   8578  C  CD2 . HIS E 2 296 ? 79.972  -1.968  184.483 1.00 50.57  ? 429 HIS E CD2 1 
ATOM   8579  C  CE1 . HIS E 2 296 ? 78.629  -0.900  185.852 1.00 51.37  ? 429 HIS E CE1 1 
ATOM   8580  N  NE2 . HIS E 2 296 ? 78.679  -1.559  184.708 1.00 52.88  ? 429 HIS E NE2 1 
ATOM   8581  N  N   . GLY E 2 297 ? 85.131  0.206   186.447 1.00 37.53  ? 430 GLY E N   1 
ATOM   8582  C  CA  . GLY E 2 297 ? 86.542  0.019   186.767 1.00 43.16  ? 430 GLY E CA  1 
ATOM   8583  C  C   . GLY E 2 297 ? 87.205  -1.048  185.907 1.00 42.09  ? 430 GLY E C   1 
ATOM   8584  O  O   . GLY E 2 297 ? 88.312  -1.500  186.180 1.00 33.56  ? 430 GLY E O   1 
ATOM   8585  N  N   . THR E 2 298 ? 86.525  -1.428  184.835 1.00 43.58  ? 431 THR E N   1 
ATOM   8586  C  CA  . THR E 2 298 ? 87.029  -2.450  183.937 1.00 42.09  ? 431 THR E CA  1 
ATOM   8587  C  C   . THR E 2 298 ? 87.569  -1.911  182.632 1.00 40.05  ? 431 THR E C   1 
ATOM   8588  O  O   . THR E 2 298 ? 87.721  -0.705  182.431 1.00 40.06  ? 431 THR E O   1 
ATOM   8589  C  CB  . THR E 2 298 ? 85.925  -3.444  183.591 1.00 47.32  ? 431 THR E CB  1 
ATOM   8590  O  OG1 . THR E 2 298 ? 84.694  -2.733  183.370 1.00 55.41  ? 431 THR E OG1 1 
ATOM   8591  C  CG2 . THR E 2 298 ? 85.752  -4.443  184.705 1.00 47.87  ? 431 THR E CG2 1 
ATOM   8592  N  N   . ASP E 2 299 ? 87.810  -2.850  181.731 1.00 38.80  ? 432 ASP E N   1 
ATOM   8593  C  CA  . ASP E 2 299 ? 88.307  -2.585  180.399 1.00 31.31  ? 432 ASP E CA  1 
ATOM   8594  C  C   . ASP E 2 299 ? 87.193  -2.199  179.433 1.00 29.40  ? 432 ASP E C   1 
ATOM   8595  O  O   . ASP E 2 299 ? 87.214  -2.640  178.283 1.00 28.18  ? 432 ASP E O   1 
ATOM   8596  C  CB  . ASP E 2 299 ? 88.935  -3.859  179.895 1.00 30.16  ? 432 ASP E CB  1 
ATOM   8597  C  CG  . ASP E 2 299 ? 90.377  -3.713  179.665 1.00 35.24  ? 432 ASP E CG  1 
ATOM   8598  O  OD1 . ASP E 2 299 ? 90.793  -2.620  179.202 1.00 40.21  ? 432 ASP E OD1 1 
ATOM   8599  O  OD2 . ASP E 2 299 ? 91.091  -4.697  179.940 1.00 37.77  ? 432 ASP E OD2 1 
ATOM   8600  N  N   . ASP E 2 300 ? 86.243  -1.383  179.892 1.00 29.16  ? 433 ASP E N   1 
ATOM   8601  C  CA  . ASP E 2 300 ? 85.088  -0.944  179.102 1.00 31.27  ? 433 ASP E CA  1 
ATOM   8602  C  C   . ASP E 2 300 ? 85.310  -0.676  177.588 1.00 35.27  ? 433 ASP E C   1 
ATOM   8603  O  O   . ASP E 2 300 ? 84.470  -1.042  176.759 1.00 38.60  ? 433 ASP E O   1 
ATOM   8604  C  CB  . ASP E 2 300 ? 84.497  0.339   179.721 1.00 27.54  ? 433 ASP E CB  1 
ATOM   8605  C  CG  . ASP E 2 300 ? 83.372  0.078   180.718 1.00 38.36  ? 433 ASP E CG  1 
ATOM   8606  O  OD1 . ASP E 2 300 ? 82.356  -0.571  180.366 1.00 40.36  ? 433 ASP E OD1 1 
ATOM   8607  O  OD2 . ASP E 2 300 ? 83.482  0.580   181.858 1.00 47.53  ? 433 ASP E OD2 1 
ATOM   8608  N  N   . GLY E 2 301 ? 86.451  -0.074  177.246 1.00 29.27  ? 434 GLY E N   1 
ATOM   8609  C  CA  . GLY E 2 301 ? 86.760  0.336   175.882 1.00 27.31  ? 434 GLY E CA  1 
ATOM   8610  C  C   . GLY E 2 301 ? 86.729  -0.514  174.624 1.00 31.70  ? 434 GLY E C   1 
ATOM   8611  O  O   . GLY E 2 301 ? 86.491  -1.736  174.642 1.00 29.78  ? 434 GLY E O   1 
ATOM   8612  N  N   . VAL E 2 302 ? 86.945  0.188   173.506 1.00 27.31  ? 435 VAL E N   1 
ATOM   8613  C  CA  . VAL E 2 302 ? 87.007  -0.405  172.180 1.00 23.12  ? 435 VAL E CA  1 
ATOM   8614  C  C   . VAL E 2 302 ? 88.459  -0.796  172.083 1.00 27.31  ? 435 VAL E C   1 
ATOM   8615  O  O   . VAL E 2 302 ? 89.276  -0.111  171.454 1.00 29.66  ? 435 VAL E O   1 
ATOM   8616  C  CB  . VAL E 2 302 ? 86.652  0.616   171.112 1.00 20.87  ? 435 VAL E CB  1 
ATOM   8617  C  CG1 . VAL E 2 302 ? 86.747  -0.010  169.751 1.00 21.57  ? 435 VAL E CG1 1 
ATOM   8618  C  CG2 . VAL E 2 302 ? 85.224  1.116   171.340 1.00 22.63  ? 435 VAL E CG2 1 
ATOM   8619  N  N   . VAL E 2 303 ? 88.734  -1.920  172.745 1.00 28.65  ? 436 VAL E N   1 
ATOM   8620  C  CA  . VAL E 2 303 ? 90.038  -2.541  172.942 1.00 21.97  ? 436 VAL E CA  1 
ATOM   8621  C  C   . VAL E 2 303 ? 90.528  -3.622  171.999 1.00 23.17  ? 436 VAL E C   1 
ATOM   8622  O  O   . VAL E 2 303 ? 89.747  -4.377  171.415 1.00 25.67  ? 436 VAL E O   1 
ATOM   8623  C  CB  . VAL E 2 303 ? 90.006  -3.148  174.348 1.00 22.33  ? 436 VAL E CB  1 
ATOM   8624  C  CG1 . VAL E 2 303 ? 91.063  -4.219  174.555 1.00 23.04  ? 436 VAL E CG1 1 
ATOM   8625  C  CG2 . VAL E 2 303 ? 90.133  -2.047  175.358 1.00 27.51  ? 436 VAL E CG2 1 
ATOM   8626  N  N   . TRP E 2 304 ? 91.850  -3.728  171.927 1.00 24.12  ? 437 TRP E N   1 
ATOM   8627  C  CA  . TRP E 2 304 ? 92.531  -4.773  171.161 1.00 27.99  ? 437 TRP E CA  1 
ATOM   8628  C  C   . TRP E 2 304 ? 93.857  -4.913  171.875 1.00 31.71  ? 437 TRP E C   1 
ATOM   8629  O  O   . TRP E 2 304 ? 94.847  -4.293  171.501 1.00 34.40  ? 437 TRP E O   1 
ATOM   8630  C  CB  . TRP E 2 304 ? 92.761  -4.384  169.708 1.00 25.04  ? 437 TRP E CB  1 
ATOM   8631  C  CG  . TRP E 2 304 ? 93.218  -5.534  168.901 1.00 26.90  ? 437 TRP E CG  1 
ATOM   8632  C  CD1 . TRP E 2 304 ? 94.500  -5.950  168.717 1.00 30.07  ? 437 TRP E CD1 1 
ATOM   8633  C  CD2 . TRP E 2 304 ? 92.388  -6.461  168.201 1.00 30.19  ? 437 TRP E CD2 1 
ATOM   8634  N  NE1 . TRP E 2 304 ? 94.526  -7.092  167.946 1.00 30.81  ? 437 TRP E NE1 1 
ATOM   8635  C  CE2 . TRP E 2 304 ? 93.239  -7.427  167.618 1.00 31.02  ? 437 TRP E CE2 1 
ATOM   8636  C  CE3 . TRP E 2 304 ? 91.001  -6.576  168.012 1.00 27.53  ? 437 TRP E CE3 1 
ATOM   8637  C  CZ2 . TRP E 2 304 ? 92.746  -8.498  166.857 1.00 30.49  ? 437 TRP E CZ2 1 
ATOM   8638  C  CZ3 . TRP E 2 304 ? 90.510  -7.643  167.254 1.00 22.59  ? 437 TRP E CZ3 1 
ATOM   8639  C  CH2 . TRP E 2 304 ? 91.379  -8.586  166.689 1.00 25.81  ? 437 TRP E CH2 1 
ATOM   8640  N  N   . MET E 2 305 ? 93.855  -5.707  172.935 1.00 34.71  ? 438 MET E N   1 
ATOM   8641  C  CA  . MET E 2 305 ? 95.041  -5.898  173.751 1.00 36.36  ? 438 MET E CA  1 
ATOM   8642  C  C   . MET E 2 305 ? 96.304  -6.247  173.018 1.00 38.60  ? 438 MET E C   1 
ATOM   8643  O  O   . MET E 2 305 ? 97.362  -5.683  173.312 1.00 40.51  ? 438 MET E O   1 
ATOM   8644  C  CB  . MET E 2 305 ? 94.773  -6.923  174.833 1.00 38.47  ? 438 MET E CB  1 
ATOM   8645  C  CG  . MET E 2 305 ? 93.776  -6.434  175.863 1.00 42.54  ? 438 MET E CG  1 
ATOM   8646  S  SD  . MET E 2 305 ? 93.623  -7.571  177.250 1.00 43.43  ? 438 MET E SD  1 
ATOM   8647  C  CE  . MET E 2 305 ? 95.398  -7.785  177.686 1.00 44.54  ? 438 MET E CE  1 
ATOM   8648  N  N   . ASN E 2 306 ? 96.197  -7.164  172.060 1.00 35.90  ? 439 ASN E N   1 
ATOM   8649  C  CA  . ASN E 2 306 ? 97.358  -7.584  171.281 1.00 35.33  ? 439 ASN E CA  1 
ATOM   8650  C  C   . ASN E 2 306 ? 98.079  -6.427  170.603 1.00 35.02  ? 439 ASN E C   1 
ATOM   8651  O  O   . ASN E 2 306 ? 99.257  -6.544  170.266 1.00 40.71  ? 439 ASN E O   1 
ATOM   8652  C  CB  . ASN E 2 306 ? 96.972  -8.645  170.255 1.00 36.52  ? 439 ASN E CB  1 
ATOM   8653  C  CG  . ASN E 2 306 ? 96.608  -9.962  170.900 1.00 35.53  ? 439 ASN E CG  1 
ATOM   8654  O  OD1 . ASN E 2 306 ? 97.161  -11.012 170.567 1.00 32.56  ? 439 ASN E OD1 1 
ATOM   8655  N  ND2 . ASN E 2 306 ? 95.671  -9.913  171.837 1.00 33.49  ? 439 ASN E ND2 1 
ATOM   8656  N  N   . TRP E 2 307 ? 97.384  -5.305  170.435 1.00 34.33  ? 440 TRP E N   1 
ATOM   8657  C  CA  . TRP E 2 307 ? 97.986  -4.133  169.818 1.00 37.73  ? 440 TRP E CA  1 
ATOM   8658  C  C   . TRP E 2 307 ? 98.357  -3.013  170.809 1.00 38.58  ? 440 TRP E C   1 
ATOM   8659  O  O   . TRP E 2 307 ? 99.545  -2.729  171.026 1.00 41.59  ? 440 TRP E O   1 
ATOM   8660  C  CB  . TRP E 2 307 ? 97.092  -3.587  168.717 1.00 40.17  ? 440 TRP E CB  1 
ATOM   8661  C  CG  . TRP E 2 307 ? 97.795  -2.575  167.894 1.00 47.83  ? 440 TRP E CG  1 
ATOM   8662  C  CD1 . TRP E 2 307 ? 99.125  -2.551  167.582 1.00 46.72  ? 440 TRP E CD1 1 
ATOM   8663  C  CD2 . TRP E 2 307 ? 97.216  -1.430  167.270 1.00 52.37  ? 440 TRP E CD2 1 
ATOM   8664  N  NE1 . TRP E 2 307 ? 99.407  -1.461  166.800 1.00 50.65  ? 440 TRP E NE1 1 
ATOM   8665  C  CE2 . TRP E 2 307 ? 98.251  -0.757  166.592 1.00 51.63  ? 440 TRP E CE2 1 
ATOM   8666  C  CE3 . TRP E 2 307 ? 95.919  -0.907  167.214 1.00 55.59  ? 440 TRP E CE3 1 
ATOM   8667  C  CZ2 . TRP E 2 307 ? 98.028  0.413   165.864 1.00 53.25  ? 440 TRP E CZ2 1 
ATOM   8668  C  CZ3 . TRP E 2 307 ? 95.697  0.259   166.487 1.00 55.49  ? 440 TRP E CZ3 1 
ATOM   8669  C  CH2 . TRP E 2 307 ? 96.746  0.903   165.823 1.00 54.00  ? 440 TRP E CH2 1 
ATOM   8670  N  N   . LYS E 2 308 ? 97.344  -2.355  171.369 1.00 35.03  ? 441 LYS E N   1 
ATOM   8671  C  CA  . LYS E 2 308 ? 97.547  -1.270  172.333 1.00 31.29  ? 441 LYS E CA  1 
ATOM   8672  C  C   . LYS E 2 308 ? 97.173  -1.711  173.744 1.00 27.04  ? 441 LYS E C   1 
ATOM   8673  O  O   . LYS E 2 308 ? 96.915  -0.872  174.622 1.00 24.69  ? 441 LYS E O   1 
ATOM   8674  C  CB  . LYS E 2 308 ? 96.695  -0.066  171.961 1.00 32.32  ? 441 LYS E CB  1 
ATOM   8675  C  CG  . LYS E 2 308 ? 97.017  0.521   170.607 1.00 35.14  ? 441 LYS E CG  1 
ATOM   8676  C  CD  . LYS E 2 308 ? 98.182  1.476   170.708 1.00 42.90  ? 441 LYS E CD  1 
ATOM   8677  C  CE  . LYS E 2 308 ? 98.465  2.176   169.380 1.00 44.47  ? 441 LYS E CE  1 
ATOM   8678  N  NZ  . LYS E 2 308 ? 99.598  3.155   169.471 1.00 47.98  ? 441 LYS E NZ  1 
ATOM   8679  N  N   . GLY E 2 309 ? 97.102  -3.028  173.934 1.00 24.42  ? 442 GLY E N   1 
ATOM   8680  C  CA  . GLY E 2 309 ? 96.763  -3.574  175.229 1.00 27.97  ? 442 GLY E CA  1 
ATOM   8681  C  C   . GLY E 2 309 ? 95.480  -2.992  175.764 1.00 32.67  ? 442 GLY E C   1 
ATOM   8682  O  O   . GLY E 2 309 ? 94.702  -2.378  175.020 1.00 39.51  ? 442 GLY E O   1 
ATOM   8683  N  N   . SER E 2 310 ? 95.259  -3.202  177.059 1.00 33.73  ? 443 SER E N   1 
ATOM   8684  C  CA  . SER E 2 310 ? 94.078  -2.703  177.766 1.00 31.80  ? 443 SER E CA  1 
ATOM   8685  C  C   . SER E 2 310 ? 94.208  -1.205  177.968 1.00 36.40  ? 443 SER E C   1 
ATOM   8686  O  O   . SER E 2 310 ? 95.297  -0.630  177.802 1.00 48.47  ? 443 SER E O   1 
ATOM   8687  C  CB  . SER E 2 310 ? 93.971  -3.346  179.152 1.00 30.48  ? 443 SER E CB  1 
ATOM   8688  O  OG  . SER E 2 310 ? 93.856  -4.753  179.089 1.00 32.70  ? 443 SER E OG  1 
ATOM   8689  N  N   . TRP E 2 311 ? 93.106  -0.575  178.351 1.00 33.26  ? 444 TRP E N   1 
ATOM   8690  C  CA  . TRP E 2 311 ? 93.097  0.862   178.623 1.00 38.08  ? 444 TRP E CA  1 
ATOM   8691  C  C   . TRP E 2 311 ? 93.416  1.731   177.423 1.00 37.97  ? 444 TRP E C   1 
ATOM   8692  O  O   . TRP E 2 311 ? 94.075  2.758   177.559 1.00 40.52  ? 444 TRP E O   1 
ATOM   8693  C  CB  . TRP E 2 311 ? 94.027  1.218   179.811 1.00 34.71  ? 444 TRP E CB  1 
ATOM   8694  C  CG  . TRP E 2 311 ? 93.879  0.262   180.949 1.00 29.75  ? 444 TRP E CG  1 
ATOM   8695  C  CD1 . TRP E 2 311 ? 94.761  -0.710  181.307 1.00 27.09  ? 444 TRP E CD1 1 
ATOM   8696  C  CD2 . TRP E 2 311 ? 92.692  0.037   181.727 1.00 29.67  ? 444 TRP E CD2 1 
ATOM   8697  N  NE1 . TRP E 2 311 ? 94.186  -1.549  182.227 1.00 31.16  ? 444 TRP E NE1 1 
ATOM   8698  C  CE2 . TRP E 2 311 ? 92.916  -1.114  182.503 1.00 29.74  ? 444 TRP E CE2 1 
ATOM   8699  C  CE3 . TRP E 2 311 ? 91.454  0.686   181.825 1.00 31.86  ? 444 TRP E CE3 1 
ATOM   8700  C  CZ2 . TRP E 2 311 ? 91.947  -1.636  183.366 1.00 30.79  ? 444 TRP E CZ2 1 
ATOM   8701  C  CZ3 . TRP E 2 311 ? 90.491  0.166   182.683 1.00 32.79  ? 444 TRP E CZ3 1 
ATOM   8702  C  CH2 . TRP E 2 311 ? 90.744  -0.983  183.439 1.00 31.63  ? 444 TRP E CH2 1 
ATOM   8703  N  N   . TYR E 2 312 ? 92.985  1.295   176.243 1.00 38.73  ? 445 TYR E N   1 
ATOM   8704  C  CA  . TYR E 2 312 ? 93.168  2.086   175.035 1.00 38.33  ? 445 TYR E CA  1 
ATOM   8705  C  C   . TYR E 2 312 ? 92.030  1.870   174.040 1.00 40.89  ? 445 TYR E C   1 
ATOM   8706  O  O   . TYR E 2 312 ? 91.982  0.827   173.397 1.00 44.77  ? 445 TYR E O   1 
ATOM   8707  C  CB  . TYR E 2 312 ? 94.506  1.808   174.360 1.00 32.09  ? 445 TYR E CB  1 
ATOM   8708  C  CG  . TYR E 2 312 ? 94.817  2.855   173.312 1.00 28.93  ? 445 TYR E CG  1 
ATOM   8709  C  CD1 . TYR E 2 312 ? 94.134  2.886   172.093 1.00 24.68  ? 445 TYR E CD1 1 
ATOM   8710  C  CD2 . TYR E 2 312 ? 95.744  3.862   173.568 1.00 33.20  ? 445 TYR E CD2 1 
ATOM   8711  C  CE1 . TYR E 2 312 ? 94.364  3.894   171.163 1.00 28.36  ? 445 TYR E CE1 1 
ATOM   8712  C  CE2 . TYR E 2 312 ? 95.985  4.875   172.645 1.00 36.06  ? 445 TYR E CE2 1 
ATOM   8713  C  CZ  . TYR E 2 312 ? 95.293  4.885   171.447 1.00 35.09  ? 445 TYR E CZ  1 
ATOM   8714  O  OH  . TYR E 2 312 ? 95.547  5.892   170.539 1.00 39.46  ? 445 TYR E OH  1 
ATOM   8715  N  N   . SER E 2 313 ? 91.111  2.840   173.942 1.00 34.20  ? 446 SER E N   1 
ATOM   8716  C  CA  . SER E 2 313 ? 89.986  2.761   173.008 1.00 30.84  ? 446 SER E CA  1 
ATOM   8717  C  C   . SER E 2 313 ? 90.411  3.377   171.692 1.00 28.39  ? 446 SER E C   1 
ATOM   8718  O  O   . SER E 2 313 ? 90.545  4.591   171.568 1.00 28.08  ? 446 SER E O   1 
ATOM   8719  C  CB  . SER E 2 313 ? 88.743  3.485   173.549 1.00 34.35  ? 446 SER E CB  1 
ATOM   8720  O  OG  . SER E 2 313 ? 87.888  3.946   172.502 1.00 34.13  ? 446 SER E OG  1 
ATOM   8721  N  N   . MET E 2 314 ? 90.605  2.523   170.699 1.00 29.79  ? 447 MET E N   1 
ATOM   8722  C  CA  . MET E 2 314 ? 91.025  2.959   169.370 1.00 32.12  ? 447 MET E CA  1 
ATOM   8723  C  C   . MET E 2 314 ? 90.142  4.098   168.851 1.00 38.05  ? 447 MET E C   1 
ATOM   8724  O  O   . MET E 2 314 ? 89.058  4.368   169.409 1.00 40.27  ? 447 MET E O   1 
ATOM   8725  C  CB  . MET E 2 314 ? 90.926  1.782   168.398 1.00 27.60  ? 447 MET E CB  1 
ATOM   8726  C  CG  . MET E 2 314 ? 91.484  0.484   168.931 1.00 27.04  ? 447 MET E CG  1 
ATOM   8727  S  SD  . MET E 2 314 ? 93.257  0.561   169.072 1.00 35.03  ? 447 MET E SD  1 
ATOM   8728  C  CE  . MET E 2 314 ? 93.529  -0.327  170.634 1.00 35.45  ? 447 MET E CE  1 
ATOM   8729  N  N   . ARG E 2 315 ? 90.624  4.800   167.822 1.00 36.40  ? 448 ARG E N   1 
ATOM   8730  C  CA  . ARG E 2 315 ? 89.828  5.871   167.226 1.00 33.61  ? 448 ARG E CA  1 
ATOM   8731  C  C   . ARG E 2 315 ? 88.839  5.249   166.229 1.00 29.09  ? 448 ARG E C   1 
ATOM   8732  O  O   . ARG E 2 315 ? 87.688  5.706   166.115 1.00 20.58  ? 448 ARG E O   1 
ATOM   8733  C  CB  . ARG E 2 315 ? 90.688  6.913   166.503 1.00 38.11  ? 448 ARG E CB  1 
ATOM   8734  C  CG  . ARG E 2 315 ? 89.841  8.058   165.926 1.00 44.10  ? 448 ARG E CG  1 
ATOM   8735  C  CD  . ARG E 2 315 ? 90.433  8.679   164.661 1.00 51.15  ? 448 ARG E CD  1 
ATOM   8736  N  NE  . ARG E 2 315 ? 91.273  9.846   164.927 1.00 61.05  ? 448 ARG E NE  1 
ATOM   8737  C  CZ  . ARG E 2 315 ? 92.600  9.817   165.055 1.00 70.06  ? 448 ARG E CZ  1 
ATOM   8738  N  NH1 . ARG E 2 315 ? 93.267  8.671   164.942 1.00 68.88  ? 448 ARG E NH1 1 
ATOM   8739  N  NH2 . ARG E 2 315 ? 93.266  10.943  165.299 1.00 75.59  ? 448 ARG E NH2 1 
ATOM   8740  N  N   . LYS E 2 316 ? 89.304  4.220   165.507 1.00 26.10  ? 449 LYS E N   1 
ATOM   8741  C  CA  . LYS E 2 316 ? 88.495  3.533   164.515 1.00 18.76  ? 449 LYS E CA  1 
ATOM   8742  C  C   . LYS E 2 316 ? 88.668  2.054   164.584 1.00 19.39  ? 449 LYS E C   1 
ATOM   8743  O  O   . LYS E 2 316 ? 89.777  1.565   164.716 1.00 22.28  ? 449 LYS E O   1 
ATOM   8744  C  CB  . LYS E 2 316 ? 88.827  4.015   163.108 1.00 23.24  ? 449 LYS E CB  1 
ATOM   8745  C  CG  . LYS E 2 316 ? 88.128  5.316   162.786 1.00 29.40  ? 449 LYS E CG  1 
ATOM   8746  C  CD  . LYS E 2 316 ? 88.198  5.676   161.330 1.00 35.90  ? 449 LYS E CD  1 
ATOM   8747  C  CE  . LYS E 2 316 ? 89.608  6.010   160.919 1.00 37.99  ? 449 LYS E CE  1 
ATOM   8748  N  NZ  . LYS E 2 316 ? 89.613  6.494   159.512 1.00 41.05  ? 449 LYS E NZ  1 
ATOM   8749  N  N   . MET E 2 317 ? 87.553  1.343   164.457 1.00 23.38  ? 450 MET E N   1 
ATOM   8750  C  CA  . MET E 2 317 ? 87.526  -0.115  164.494 1.00 20.77  ? 450 MET E CA  1 
ATOM   8751  C  C   . MET E 2 317 ? 86.402  -0.577  163.572 1.00 20.86  ? 450 MET E C   1 
ATOM   8752  O  O   . MET E 2 317 ? 85.279  -0.081  163.666 1.00 22.16  ? 450 MET E O   1 
ATOM   8753  C  CB  . MET E 2 317 ? 87.245  -0.580  165.916 1.00 20.36  ? 450 MET E CB  1 
ATOM   8754  C  CG  . MET E 2 317 ? 86.913  -2.059  166.055 1.00 24.61  ? 450 MET E CG  1 
ATOM   8755  S  SD  . MET E 2 317 ? 88.343  -3.165  166.057 1.00 28.69  ? 450 MET E SD  1 
ATOM   8756  C  CE  . MET E 2 317 ? 89.068  -2.702  167.629 1.00 22.04  ? 450 MET E CE  1 
ATOM   8757  N  N   . SER E 2 318 ? 86.691  -1.550  162.712 1.00 12.91  ? 451 SER E N   1 
ATOM   8758  C  CA  . SER E 2 318 ? 85.701  -2.052  161.771 1.00 10.61  ? 451 SER E CA  1 
ATOM   8759  C  C   . SER E 2 318 ? 85.776  -3.557  161.497 1.00 16.53  ? 451 SER E C   1 
ATOM   8760  O  O   . SER E 2 318 ? 86.829  -4.173  161.597 1.00 24.38  ? 451 SER E O   1 
ATOM   8761  C  CB  . SER E 2 318 ? 85.844  -1.295  160.462 1.00 15.43  ? 451 SER E CB  1 
ATOM   8762  O  OG  . SER E 2 318 ? 87.179  -1.369  159.987 1.00 19.43  ? 451 SER E OG  1 
ATOM   8763  N  N   . MET E 2 319 ? 84.635  -4.148  161.161 1.00 17.34  ? 452 MET E N   1 
ATOM   8764  C  CA  . MET E 2 319 ? 84.557  -5.564  160.841 1.00 11.49  ? 452 MET E CA  1 
ATOM   8765  C  C   . MET E 2 319 ? 83.803  -5.681  159.564 1.00 12.06  ? 452 MET E C   1 
ATOM   8766  O  O   . MET E 2 319 ? 82.715  -5.161  159.449 1.00 13.98  ? 452 MET E O   1 
ATOM   8767  C  CB  . MET E 2 319 ? 83.786  -6.321  161.888 1.00 16.35  ? 452 MET E CB  1 
ATOM   8768  C  CG  . MET E 2 319 ? 84.487  -6.413  163.224 1.00 20.77  ? 452 MET E CG  1 
ATOM   8769  S  SD  . MET E 2 319 ? 83.774  -7.787  164.142 1.00 18.78  ? 452 MET E SD  1 
ATOM   8770  C  CE  . MET E 2 319 ? 82.378  -6.990  164.858 1.00 20.32  ? 452 MET E CE  1 
ATOM   8771  N  N   . LYS E 2 320 ? 84.379  -6.374  158.601 1.00 19.74  ? 453 LYS E N   1 
ATOM   8772  C  CA  . LYS E 2 320 ? 83.746  -6.553  157.310 1.00 15.64  ? 453 LYS E CA  1 
ATOM   8773  C  C   . LYS E 2 320 ? 84.074  -7.941  156.792 1.00 11.76  ? 453 LYS E C   1 
ATOM   8774  O  O   . LYS E 2 320 ? 85.094  -8.527  157.147 1.00 17.19  ? 453 LYS E O   1 
ATOM   8775  C  CB  . LYS E 2 320 ? 84.243  -5.485  156.364 1.00 22.31  ? 453 LYS E CB  1 
ATOM   8776  C  CG  . LYS E 2 320 ? 85.736  -5.276  156.493 1.00 27.92  ? 453 LYS E CG  1 
ATOM   8777  C  CD  . LYS E 2 320 ? 86.189  -4.072  155.730 1.00 30.58  ? 453 LYS E CD  1 
ATOM   8778  C  CE  . LYS E 2 320 ? 85.671  -2.813  156.358 1.00 29.66  ? 453 LYS E CE  1 
ATOM   8779  N  NZ  . LYS E 2 320 ? 86.392  -1.642  155.799 1.00 33.90  ? 453 LYS E NZ  1 
ATOM   8780  N  N   . ILE E 2 321 ? 83.185  -8.477  155.970 1.00 8.56   ? 454 ILE E N   1 
ATOM   8781  C  CA  . ILE E 2 321 ? 83.341  -9.822  155.433 1.00 10.26  ? 454 ILE E CA  1 
ATOM   8782  C  C   . ILE E 2 321 ? 83.327  -9.839  153.925 1.00 10.15  ? 454 ILE E C   1 
ATOM   8783  O  O   . ILE E 2 321 ? 83.223  -8.807  153.298 1.00 21.95  ? 454 ILE E O   1 
ATOM   8784  C  CB  . ILE E 2 321 ? 82.232  -10.777 155.974 1.00 8.77   ? 454 ILE E CB  1 
ATOM   8785  C  CG1 . ILE E 2 321 ? 80.840  -10.321 155.498 1.00 8.08   ? 454 ILE E CG1 1 
ATOM   8786  C  CG2 . ILE E 2 321 ? 82.273  -10.804 157.498 1.00 6.00   ? 454 ILE E CG2 1 
ATOM   8787  C  CD1 . ILE E 2 321 ? 79.666  -11.069 156.165 1.00 2.70   ? 454 ILE E CD1 1 
ATOM   8788  N  N   . ARG E 2 322 ? 83.419  -11.029 153.356 1.00 14.30  ? 455 ARG E N   1 
ATOM   8789  C  CA  . ARG E 2 322 ? 83.439  -11.213 151.920 1.00 21.96  ? 455 ARG E CA  1 
ATOM   8790  C  C   . ARG E 2 322 ? 83.566  -12.696 151.691 1.00 25.57  ? 455 ARG E C   1 
ATOM   8791  O  O   . ARG E 2 322 ? 84.271  -13.385 152.424 1.00 26.45  ? 455 ARG E O   1 
ATOM   8792  C  CB  . ARG E 2 322 ? 84.665  -10.513 151.330 1.00 31.70  ? 455 ARG E CB  1 
ATOM   8793  C  CG  . ARG E 2 322 ? 84.817  -10.594 149.802 1.00 31.77  ? 455 ARG E CG  1 
ATOM   8794  C  CD  . ARG E 2 322 ? 85.998  -9.726  149.290 1.00 31.70  ? 455 ARG E CD  1 
ATOM   8795  N  NE  . ARG E 2 322 ? 87.335  -10.309 149.501 1.00 31.30  ? 455 ARG E NE  1 
ATOM   8796  C  CZ  . ARG E 2 322 ? 88.491  -9.658  149.334 1.00 37.82  ? 455 ARG E CZ  1 
ATOM   8797  N  NH1 . ARG E 2 322 ? 88.505  -8.388  148.958 1.00 36.72  ? 455 ARG E NH1 1 
ATOM   8798  N  NH2 . ARG E 2 322 ? 89.646  -10.286 149.525 1.00 43.61  ? 455 ARG E NH2 1 
ATOM   8799  N  N   . PRO E 2 323 ? 82.868  -13.219 150.682 1.00 30.50  ? 456 PRO E N   1 
ATOM   8800  C  CA  . PRO E 2 323 ? 82.966  -14.658 150.419 1.00 34.34  ? 456 PRO E CA  1 
ATOM   8801  C  C   . PRO E 2 323 ? 84.380  -14.931 149.978 1.00 43.31  ? 456 PRO E C   1 
ATOM   8802  O  O   . PRO E 2 323 ? 84.967  -14.148 149.232 1.00 42.31  ? 456 PRO E O   1 
ATOM   8803  C  CB  . PRO E 2 323 ? 81.969  -14.875 149.289 1.00 29.62  ? 456 PRO E CB  1 
ATOM   8804  C  CG  . PRO E 2 323 ? 80.978  -13.754 149.490 1.00 29.57  ? 456 PRO E CG  1 
ATOM   8805  C  CD  . PRO E 2 323 ? 81.860  -12.585 149.820 1.00 29.51  ? 456 PRO E CD  1 
ATOM   8806  N  N   . PHE E 2 324 ? 84.927  -16.037 150.457 1.00 58.48  ? 457 PHE E N   1 
ATOM   8807  C  CA  . PHE E 2 324 ? 86.300  -16.386 150.157 1.00 72.87  ? 457 PHE E CA  1 
ATOM   8808  C  C   . PHE E 2 324 ? 86.607  -16.565 148.685 1.00 80.11  ? 457 PHE E C   1 
ATOM   8809  O  O   . PHE E 2 324 ? 87.423  -15.822 148.135 1.00 84.11  ? 457 PHE E O   1 
ATOM   8810  C  CB  . PHE E 2 324 ? 86.740  -17.615 150.953 1.00 75.70  ? 457 PHE E CB  1 
ATOM   8811  C  CG  . PHE E 2 324 ? 88.214  -17.627 151.286 1.00 81.85  ? 457 PHE E CG  1 
ATOM   8812  C  CD1 . PHE E 2 324 ? 89.122  -16.848 150.558 1.00 85.56  ? 457 PHE E CD1 1 
ATOM   8813  C  CD2 . PHE E 2 324 ? 88.699  -18.414 152.329 1.00 82.27  ? 457 PHE E CD2 1 
ATOM   8814  C  CE1 . PHE E 2 324 ? 90.487  -16.851 150.859 1.00 87.34  ? 457 PHE E CE1 1 
ATOM   8815  C  CE2 . PHE E 2 324 ? 90.070  -18.426 152.642 1.00 83.73  ? 457 PHE E CE2 1 
ATOM   8816  C  CZ  . PHE E 2 324 ? 90.964  -17.640 151.901 1.00 86.56  ? 457 PHE E CZ  1 
ATOM   8817  N  N   . PHE E 2 325 ? 85.954  -17.530 148.043 1.00 86.26  ? 458 PHE E N   1 
ATOM   8818  C  CA  . PHE E 2 325 ? 86.187  -17.804 146.616 1.00 92.66  ? 458 PHE E CA  1 
ATOM   8819  C  C   . PHE E 2 325 ? 87.678  -18.076 146.346 1.00 97.17  ? 458 PHE E C   1 
ATOM   8820  O  O   . PHE E 2 325 ? 88.340  -17.306 145.640 1.00 97.84  ? 458 PHE E O   1 
ATOM   8821  C  CB  . PHE E 2 325 ? 85.712  -16.621 145.744 1.00 93.05  ? 458 PHE E CB  1 
ATOM   8822  C  CG  . PHE E 2 325 ? 84.215  -16.413 145.732 1.00 93.07  ? 458 PHE E CG  1 
ATOM   8823  C  CD1 . PHE E 2 325 ? 83.365  -17.223 146.482 1.00 93.77  ? 458 PHE E CD1 1 
ATOM   8824  C  CD2 . PHE E 2 325 ? 83.658  -15.403 144.958 1.00 92.41  ? 458 PHE E CD2 1 
ATOM   8825  C  CE1 . PHE E 2 325 ? 81.984  -17.027 146.457 1.00 92.53  ? 458 PHE E CE1 1 
ATOM   8826  C  CE2 . PHE E 2 325 ? 82.280  -15.200 144.928 1.00 91.71  ? 458 PHE E CE2 1 
ATOM   8827  C  CZ  . PHE E 2 325 ? 81.442  -16.011 145.677 1.00 90.45  ? 458 PHE E CZ  1 
ATOM   8828  N  N   . PRO E 2 326 ? 88.228  -19.168 146.917 1.00 101.01 ? 459 PRO E N   1 
ATOM   8829  C  CA  . PRO E 2 326 ? 89.642  -19.516 146.728 1.00 102.68 ? 459 PRO E CA  1 
ATOM   8830  C  C   . PRO E 2 326 ? 89.946  -20.053 145.331 1.00 103.01 ? 459 PRO E C   1 
ATOM   8831  O  O   . PRO E 2 326 ? 89.793  -21.553 145.810 1.00 115.37 ? 459 PRO E O   1 
ATOM   8832  C  CB  . PRO E 2 326 ? 89.873  -20.578 147.803 1.00 102.73 ? 459 PRO E CB  1 
ATOM   8833  C  CG  . PRO E 2 326 ? 88.563  -21.297 147.831 1.00 102.33 ? 459 PRO E CG  1 
ATOM   8834  C  CD  . PRO E 2 326 ? 87.559  -20.158 147.785 1.00 101.68 ? 459 PRO E CD  1 
ATOM   8835  N  N   . LYS F 3 1   ? 98.299  28.809  231.849 1.00 153.65 ? 88  LYS F N   1 
ATOM   8836  C  CA  . LYS F 3 1   ? 96.996  28.763  231.125 1.00 153.42 ? 88  LYS F CA  1 
ATOM   8837  C  C   . LYS F 3 1   ? 96.250  27.457  231.361 1.00 150.00 ? 88  LYS F C   1 
ATOM   8838  O  O   . LYS F 3 1   ? 96.018  26.679  230.436 1.00 147.32 ? 88  LYS F O   1 
ATOM   8839  C  CB  . LYS F 3 1   ? 97.210  28.992  229.627 1.00 157.68 ? 88  LYS F CB  1 
ATOM   8840  C  CG  . LYS F 3 1   ? 97.411  30.456  229.233 1.00 162.11 ? 88  LYS F CG  1 
ATOM   8841  C  CD  . LYS F 3 1   ? 96.128  31.269  229.419 1.00 164.33 ? 88  LYS F CD  1 
ATOM   8842  C  CE  . LYS F 3 1   ? 96.267  32.703  228.917 1.00 165.48 ? 88  LYS F CE  1 
ATOM   8843  N  NZ  . LYS F 3 1   ? 94.992  33.463  229.058 1.00 166.59 ? 88  LYS F NZ  1 
ATOM   8844  N  N   . MET F 3 2   ? 95.867  27.237  232.614 1.00 150.18 ? 89  MET F N   1 
ATOM   8845  C  CA  . MET F 3 2   ? 95.144  26.037  233.017 1.00 151.93 ? 89  MET F CA  1 
ATOM   8846  C  C   . MET F 3 2   ? 93.736  26.064  232.411 1.00 150.43 ? 89  MET F C   1 
ATOM   8847  O  O   . MET F 3 2   ? 93.580  25.863  231.202 1.00 151.77 ? 89  MET F O   1 
ATOM   8848  C  CB  . MET F 3 2   ? 95.103  25.945  234.552 1.00 155.33 ? 89  MET F CB  1 
ATOM   8849  C  CG  . MET F 3 2   ? 96.487  26.017  235.224 1.00 158.24 ? 89  MET F CG  1 
ATOM   8850  S  SD  . MET F 3 2   ? 96.471  26.085  237.055 1.00 160.97 ? 89  MET F SD  1 
ATOM   8851  C  CE  . MET F 3 2   ? 97.394  24.574  237.489 1.00 161.08 ? 89  MET F CE  1 
ATOM   8852  N  N   . LEU F 3 3   ? 92.719  26.309  233.242 1.00 147.90 ? 90  LEU F N   1 
ATOM   8853  C  CA  . LEU F 3 3   ? 91.329  26.398  232.778 1.00 144.20 ? 90  LEU F CA  1 
ATOM   8854  C  C   . LEU F 3 3   ? 91.232  27.729  232.043 1.00 138.35 ? 90  LEU F C   1 
ATOM   8855  O  O   . LEU F 3 3   ? 90.330  28.532  232.289 1.00 138.49 ? 90  LEU F O   1 
ATOM   8856  C  CB  . LEU F 3 3   ? 90.349  26.405  233.965 1.00 146.90 ? 90  LEU F CB  1 
ATOM   8857  C  CG  . LEU F 3 3   ? 90.001  25.135  234.751 1.00 149.06 ? 90  LEU F CG  1 
ATOM   8858  C  CD1 . LEU F 3 3   ? 89.160  25.516  235.964 1.00 149.25 ? 90  LEU F CD1 1 
ATOM   8859  C  CD2 . LEU F 3 3   ? 89.247  24.144  233.868 1.00 148.94 ? 90  LEU F CD2 1 
ATOM   8860  N  N   . GLU F 3 4   ? 92.193  27.959  231.155 1.00 131.97 ? 91  GLU F N   1 
ATOM   8861  C  CA  . GLU F 3 4   ? 92.287  29.192  230.397 1.00 128.04 ? 91  GLU F CA  1 
ATOM   8862  C  C   . GLU F 3 4   ? 92.575  28.812  228.953 1.00 125.40 ? 91  GLU F C   1 
ATOM   8863  O  O   . GLU F 3 4   ? 91.908  29.286  228.031 1.00 123.75 ? 91  GLU F O   1 
ATOM   8864  C  CB  . GLU F 3 4   ? 93.410  30.043  230.995 1.00 127.44 ? 91  GLU F CB  1 
ATOM   8865  C  CG  . GLU F 3 4   ? 93.548  29.843  232.513 1.00 126.22 ? 91  GLU F CG  1 
ATOM   8866  C  CD  . GLU F 3 4   ? 94.413  30.873  233.203 1.00 126.16 ? 91  GLU F CD  1 
ATOM   8867  O  OE1 . GLU F 3 4   ? 95.615  30.960  232.889 1.00 127.51 ? 91  GLU F OE1 1 
ATOM   8868  O  OE2 . GLU F 3 4   ? 93.891  31.584  234.087 1.00 125.27 ? 91  GLU F OE2 1 
ATOM   8869  N  N   . GLU F 3 5   ? 93.570  27.948  228.768 1.00 125.03 ? 92  GLU F N   1 
ATOM   8870  C  CA  . GLU F 3 5   ? 93.918  27.458  227.442 1.00 125.10 ? 92  GLU F CA  1 
ATOM   8871  C  C   . GLU F 3 5   ? 92.886  26.375  227.177 1.00 124.74 ? 92  GLU F C   1 
ATOM   8872  O  O   . GLU F 3 5   ? 92.313  26.291  226.093 1.00 126.62 ? 92  GLU F O   1 
ATOM   8873  C  CB  . GLU F 3 5   ? 95.317  26.845  227.441 1.00 127.85 ? 92  GLU F CB  1 
ATOM   8874  C  CG  . GLU F 3 5   ? 95.785  26.368  226.077 1.00 132.78 ? 92  GLU F CG  1 
ATOM   8875  C  CD  . GLU F 3 5   ? 97.100  25.613  226.140 1.00 136.33 ? 92  GLU F CD  1 
ATOM   8876  O  OE1 . GLU F 3 5   ? 98.164  26.265  226.226 1.00 138.96 ? 92  GLU F OE1 1 
ATOM   8877  O  OE2 . GLU F 3 5   ? 97.068  24.365  226.100 1.00 135.49 ? 92  GLU F OE2 1 
ATOM   8878  N  N   . ILE F 3 6   ? 92.634  25.575  228.209 1.00 122.56 ? 93  ILE F N   1 
ATOM   8879  C  CA  . ILE F 3 6   ? 91.663  24.496  228.143 1.00 122.79 ? 93  ILE F CA  1 
ATOM   8880  C  C   . ILE F 3 6   ? 90.230  25.040  228.148 1.00 125.39 ? 93  ILE F C   1 
ATOM   8881  O  O   . ILE F 3 6   ? 89.310  24.373  227.680 1.00 129.16 ? 93  ILE F O   1 
ATOM   8882  C  CB  . ILE F 3 6   ? 91.882  23.472  229.292 1.00 121.16 ? 93  ILE F CB  1 
ATOM   8883  C  CG1 . ILE F 3 6   ? 93.177  22.693  229.044 1.00 120.96 ? 93  ILE F CG1 1 
ATOM   8884  C  CG2 . ILE F 3 6   ? 90.708  22.502  229.401 1.00 120.01 ? 93  ILE F CG2 1 
ATOM   8885  C  CD1 . ILE F 3 6   ? 93.395  21.518  229.985 1.00 121.52 ? 93  ILE F CD1 1 
ATOM   8886  N  N   . MET F 3 7   ? 90.038  26.251  228.663 1.00 125.85 ? 94  MET F N   1 
ATOM   8887  C  CA  . MET F 3 7   ? 88.705  26.852  228.676 1.00 126.45 ? 94  MET F CA  1 
ATOM   8888  C  C   . MET F 3 7   ? 88.362  27.210  227.233 1.00 123.79 ? 94  MET F C   1 
ATOM   8889  O  O   . MET F 3 7   ? 87.206  27.133  226.818 1.00 125.26 ? 94  MET F O   1 
ATOM   8890  C  CB  . MET F 3 7   ? 88.684  28.110  229.548 1.00 128.81 ? 94  MET F CB  1 
ATOM   8891  C  CG  . MET F 3 7   ? 87.293  28.635  229.856 1.00 130.97 ? 94  MET F CG  1 
ATOM   8892  S  SD  . MET F 3 7   ? 86.232  27.340  230.516 1.00 135.09 ? 94  MET F SD  1 
ATOM   8893  C  CE  . MET F 3 7   ? 86.888  27.168  232.190 1.00 132.08 ? 94  MET F CE  1 
ATOM   8894  N  N   . LYS F 3 8   ? 89.400  27.559  226.476 1.00 118.53 ? 95  LYS F N   1 
ATOM   8895  C  CA  . LYS F 3 8   ? 89.301  27.927  225.065 1.00 115.59 ? 95  LYS F CA  1 
ATOM   8896  C  C   . LYS F 3 8   ? 89.112  26.692  224.171 1.00 115.43 ? 95  LYS F C   1 
ATOM   8897  O  O   . LYS F 3 8   ? 88.809  26.802  222.980 1.00 109.79 ? 95  LYS F O   1 
ATOM   8898  C  CB  . LYS F 3 8   ? 90.582  28.664  224.661 1.00 113.29 ? 95  LYS F CB  1 
ATOM   8899  C  CG  . LYS F 3 8   ? 90.692  29.013  223.191 1.00 113.53 ? 95  LYS F CG  1 
ATOM   8900  C  CD  . LYS F 3 8   ? 92.083  29.522  222.860 1.00 116.19 ? 95  LYS F CD  1 
ATOM   8901  C  CE  . LYS F 3 8   ? 92.227  29.825  221.373 1.00 118.59 ? 95  LYS F CE  1 
ATOM   8902  N  NZ  . LYS F 3 8   ? 92.019  28.628  220.501 1.00 120.51 ? 95  LYS F NZ  1 
ATOM   8903  N  N   . TYR F 3 9   ? 89.276  25.514  224.764 1.00 119.93 ? 96  TYR F N   1 
ATOM   8904  C  CA  . TYR F 3 9   ? 89.158  24.262  224.030 1.00 124.36 ? 96  TYR F CA  1 
ATOM   8905  C  C   . TYR F 3 9   ? 88.035  23.309  224.469 1.00 130.83 ? 96  TYR F C   1 
ATOM   8906  O  O   . TYR F 3 9   ? 87.622  22.465  223.673 1.00 134.77 ? 96  TYR F O   1 
ATOM   8907  C  CB  . TYR F 3 9   ? 90.501  23.516  224.058 1.00 123.66 ? 96  TYR F CB  1 
ATOM   8908  C  CG  . TYR F 3 9   ? 91.656  24.270  223.433 1.00 123.01 ? 96  TYR F CG  1 
ATOM   8909  C  CD1 . TYR F 3 9   ? 91.438  25.197  222.415 1.00 120.94 ? 96  TYR F CD1 1 
ATOM   8910  C  CD2 . TYR F 3 9   ? 92.969  24.043  223.849 1.00 123.89 ? 96  TYR F CD2 1 
ATOM   8911  C  CE1 . TYR F 3 9   ? 92.497  25.878  221.823 1.00 121.43 ? 96  TYR F CE1 1 
ATOM   8912  C  CE2 . TYR F 3 9   ? 94.039  24.719  223.263 1.00 123.95 ? 96  TYR F CE2 1 
ATOM   8913  C  CZ  . TYR F 3 9   ? 93.797  25.635  222.248 1.00 123.62 ? 96  TYR F CZ  1 
ATOM   8914  O  OH  . TYR F 3 9   ? 94.847  26.300  221.649 1.00 125.64 ? 96  TYR F OH  1 
ATOM   8915  N  N   . GLU F 3 10  ? 87.549  23.419  225.710 1.00 133.55 ? 97  GLU F N   1 
ATOM   8916  C  CA  . GLU F 3 10  ? 86.482  22.523  226.195 1.00 135.87 ? 97  GLU F CA  1 
ATOM   8917  C  C   . GLU F 3 10  ? 85.107  22.821  225.593 1.00 137.03 ? 97  GLU F C   1 
ATOM   8918  O  O   . GLU F 3 10  ? 84.137  22.088  225.819 1.00 135.44 ? 97  GLU F O   1 
ATOM   8919  C  CB  . GLU F 3 10  ? 86.406  22.504  227.730 1.00 135.00 ? 97  GLU F CB  1 
ATOM   8920  C  CG  . GLU F 3 10  ? 85.952  23.797  228.383 1.00 133.88 ? 97  GLU F CG  1 
ATOM   8921  C  CD  . GLU F 3 10  ? 85.688  23.626  229.866 1.00 134.14 ? 97  GLU F CD  1 
ATOM   8922  O  OE1 . GLU F 3 10  ? 86.575  23.102  230.576 1.00 134.13 ? 97  GLU F OE1 1 
ATOM   8923  O  OE2 . GLU F 3 10  ? 84.589  24.009  230.322 1.00 134.60 ? 97  GLU F OE2 1 
ATOM   8924  N  N   . ALA F 3 11  ? 85.046  23.901  224.819 1.00 139.43 ? 98  ALA F N   1 
ATOM   8925  C  CA  . ALA F 3 11  ? 83.827  24.320  224.141 1.00 141.24 ? 98  ALA F CA  1 
ATOM   8926  C  C   . ALA F 3 11  ? 84.115  24.578  222.650 1.00 142.50 ? 98  ALA F C   1 
ATOM   8927  O  O   . ALA F 3 11  ? 83.186  24.781  221.858 1.00 143.09 ? 98  ALA F O   1 
ATOM   8928  C  CB  . ALA F 3 11  ? 83.254  25.568  224.807 1.00 141.66 ? 98  ALA F CB  1 
ATOM   8929  N  N   . SER F 3 12  ? 85.402  24.550  222.277 1.00 141.78 ? 99  SER F N   1 
ATOM   8930  C  CA  . SER F 3 12  ? 85.851  24.763  220.888 1.00 138.01 ? 99  SER F CA  1 
ATOM   8931  C  C   . SER F 3 12  ? 85.671  23.506  220.022 1.00 135.18 ? 99  SER F C   1 
ATOM   8932  O  O   . SER F 3 12  ? 86.068  23.468  218.853 1.00 133.90 ? 99  SER F O   1 
ATOM   8933  C  CB  . SER F 3 12  ? 87.320  25.214  220.856 1.00 137.25 ? 99  SER F CB  1 
ATOM   8934  O  OG  . SER F 3 12  ? 87.731  25.566  219.541 1.00 135.45 ? 99  SER F OG  1 
ATOM   8935  N  N   . ILE F 3 13  ? 85.106  22.468  220.631 1.00 133.24 ? 100 ILE F N   1 
ATOM   8936  C  CA  . ILE F 3 13  ? 84.835  21.215  219.946 1.00 132.47 ? 100 ILE F CA  1 
ATOM   8937  C  C   . ILE F 3 13  ? 83.403  21.289  219.421 1.00 133.36 ? 100 ILE F C   1 
ATOM   8938  O  O   . ILE F 3 13  ? 82.973  20.447  218.633 1.00 135.24 ? 100 ILE F O   1 
ATOM   8939  C  CB  . ILE F 3 13  ? 85.034  19.991  220.888 1.00 132.03 ? 100 ILE F CB  1 
ATOM   8940  C  CG1 . ILE F 3 13  ? 83.961  19.944  221.984 1.00 131.59 ? 100 ILE F CG1 1 
ATOM   8941  C  CG2 . ILE F 3 13  ? 86.427  20.043  221.512 1.00 130.87 ? 100 ILE F CG2 1 
ATOM   8942  C  CD1 . ILE F 3 13  ? 82.894  18.867  221.771 1.00 130.26 ? 100 ILE F CD1 1 
ATOM   8943  N  N   . LEU F 3 14  ? 82.667  22.295  219.897 1.00 133.04 ? 101 LEU F N   1 
ATOM   8944  C  CA  . LEU F 3 14  ? 81.294  22.540  219.470 1.00 133.03 ? 101 LEU F CA  1 
ATOM   8945  C  C   . LEU F 3 14  ? 81.325  23.655  218.429 1.00 134.93 ? 101 LEU F C   1 
ATOM   8946  O  O   . LEU F 3 14  ? 80.316  23.953  217.787 1.00 136.23 ? 101 LEU F O   1 
ATOM   8947  C  CB  . LEU F 3 14  ? 80.402  22.952  220.646 1.00 130.82 ? 101 LEU F CB  1 
ATOM   8948  C  CG  . LEU F 3 14  ? 80.104  21.940  221.754 1.00 130.25 ? 101 LEU F CG  1 
ATOM   8949  C  CD1 . LEU F 3 14  ? 79.816  20.555  221.161 1.00 130.20 ? 101 LEU F CD1 1 
ATOM   8950  C  CD2 . LEU F 3 14  ? 81.271  21.887  222.719 1.00 130.69 ? 101 LEU F CD2 1 
ATOM   8951  N  N   . THR F 3 15  ? 82.491  24.283  218.294 1.00 135.51 ? 102 THR F N   1 
ATOM   8952  C  CA  . THR F 3 15  ? 82.705  25.357  217.329 1.00 137.82 ? 102 THR F CA  1 
ATOM   8953  C  C   . THR F 3 15  ? 82.887  24.737  215.936 1.00 139.37 ? 102 THR F C   1 
ATOM   8954  O  O   . THR F 3 15  ? 82.234  25.133  214.963 1.00 137.49 ? 102 THR F O   1 
ATOM   8955  C  CB  . THR F 3 15  ? 83.972  26.172  217.694 1.00 137.74 ? 102 THR F CB  1 
ATOM   8956  O  OG1 . THR F 3 15  ? 83.815  26.735  219.003 1.00 138.46 ? 102 THR F OG1 1 
ATOM   8957  C  CG2 . THR F 3 15  ? 84.217  27.292  216.678 1.00 136.77 ? 102 THR F CG2 1 
ATOM   8958  N  N   . HIS F 3 16  ? 83.775  23.750  215.862 1.00 141.92 ? 103 HIS F N   1 
ATOM   8959  C  CA  . HIS F 3 16  ? 84.063  23.056  214.618 1.00 141.22 ? 103 HIS F CA  1 
ATOM   8960  C  C   . HIS F 3 16  ? 83.050  21.945  214.341 1.00 139.27 ? 103 HIS F C   1 
ATOM   8961  O  O   . HIS F 3 16  ? 82.986  21.432  213.226 1.00 138.89 ? 103 HIS F O   1 
ATOM   8962  C  CB  . HIS F 3 16  ? 85.487  22.490  214.653 1.00 143.36 ? 103 HIS F CB  1 
ATOM   8963  C  CG  . HIS F 3 16  ? 86.553  23.537  214.774 1.00 145.47 ? 103 HIS F CG  1 
ATOM   8964  N  ND1 . HIS F 3 16  ? 87.045  23.962  215.988 1.00 146.72 ? 103 HIS F ND1 1 
ATOM   8965  C  CD2 . HIS F 3 16  ? 87.226  24.237  213.830 1.00 144.79 ? 103 HIS F CD2 1 
ATOM   8966  C  CE1 . HIS F 3 16  ? 87.975  24.879  215.787 1.00 146.24 ? 103 HIS F CE1 1 
ATOM   8967  N  NE2 . HIS F 3 16  ? 88.104  25.064  214.487 1.00 143.63 ? 103 HIS F NE2 1 
ATOM   8968  N  N   . ASP F 3 17  ? 82.248  21.592  215.349 1.00 137.56 ? 104 ASP F N   1 
ATOM   8969  C  CA  . ASP F 3 17  ? 81.232  20.542  215.207 1.00 136.03 ? 104 ASP F CA  1 
ATOM   8970  C  C   . ASP F 3 17  ? 80.174  20.953  214.186 1.00 134.30 ? 104 ASP F C   1 
ATOM   8971  O  O   . ASP F 3 17  ? 79.393  20.121  213.718 1.00 131.96 ? 104 ASP F O   1 
ATOM   8972  C  CB  . ASP F 3 17  ? 80.570  20.227  216.559 1.00 136.90 ? 104 ASP F CB  1 
ATOM   8973  C  CG  . ASP F 3 17  ? 79.707  18.958  216.523 1.00 138.20 ? 104 ASP F CG  1 
ATOM   8974  O  OD1 . ASP F 3 17  ? 80.177  17.917  216.008 1.00 137.67 ? 104 ASP F OD1 1 
ATOM   8975  O  OD2 . ASP F 3 17  ? 78.561  19.000  217.025 1.00 138.37 ? 104 ASP F OD2 1 
ATOM   8976  N  N   . SER F 3 18  ? 80.160  22.239  213.843 1.00 134.74 ? 105 SER F N   1 
ATOM   8977  C  CA  . SER F 3 18  ? 79.226  22.767  212.854 1.00 136.19 ? 105 SER F CA  1 
ATOM   8978  C  C   . SER F 3 18  ? 79.770  22.511  211.441 1.00 135.68 ? 105 SER F C   1 
ATOM   8979  O  O   . SER F 3 18  ? 79.540  23.293  210.514 1.00 138.08 ? 105 SER F O   1 
ATOM   8980  C  CB  . SER F 3 18  ? 79.001  24.261  213.085 1.00 137.88 ? 105 SER F CB  1 
ATOM   8981  O  OG  . SER F 3 18  ? 78.368  24.482  214.332 1.00 139.51 ? 105 SER F OG  1 
ATOM   8982  N  N   . SER F 3 19  ? 80.504  21.406  211.308 1.00 132.04 ? 106 SER F N   1 
ATOM   8983  C  CA  . SER F 3 19  ? 81.110  20.969  210.054 1.00 127.03 ? 106 SER F CA  1 
ATOM   8984  C  C   . SER F 3 19  ? 81.153  19.436  210.033 1.00 123.12 ? 106 SER F C   1 
ATOM   8985  O  O   . SER F 3 19  ? 82.022  18.838  209.400 1.00 119.09 ? 106 SER F O   1 
ATOM   8986  C  CB  . SER F 3 19  ? 82.529  21.537  209.910 1.00 126.04 ? 106 SER F CB  1 
ATOM   8987  O  OG  . SER F 3 19  ? 82.519  22.951  209.815 1.00 126.74 ? 106 SER F OG  1 
ATOM   8988  N  N   . ILE F 3 20  ? 80.244  18.814  210.785 1.00 122.21 ? 107 ILE F N   1 
ATOM   8989  C  CA  . ILE F 3 20  ? 80.127  17.353  210.867 1.00 120.68 ? 107 ILE F CA  1 
ATOM   8990  C  C   . ILE F 3 20  ? 78.683  17.006  210.528 1.00 119.72 ? 107 ILE F C   1 
ATOM   8991  O  O   . ILE F 3 20  ? 78.414  16.159  209.671 1.00 115.61 ? 107 ILE F O   1 
ATOM   8992  C  CB  . ILE F 3 20  ? 80.460  16.802  212.291 1.00 121.92 ? 107 ILE F CB  1 
ATOM   8993  C  CG1 . ILE F 3 20  ? 81.977  16.766  212.527 1.00 122.06 ? 107 ILE F CG1 1 
ATOM   8994  C  CG2 . ILE F 3 20  ? 79.888  15.392  212.467 1.00 120.84 ? 107 ILE F CG2 1 
ATOM   8995  C  CD1 . ILE F 3 20  ? 82.638  18.121  212.698 1.00 119.41 ? 107 ILE F CD1 1 
ATOM   8996  N  N   . ARG F 3 21  ? 77.759  17.637  211.247 1.00 122.10 ? 108 ARG F N   1 
ATOM   8997  C  CA  . ARG F 3 21  ? 76.340  17.437  211.005 1.00 124.30 ? 108 ARG F CA  1 
ATOM   8998  C  C   . ARG F 3 21  ? 76.075  18.183  209.704 1.00 122.38 ? 108 ARG F C   1 
ATOM   8999  O  O   . ARG F 3 21  ? 75.285  17.737  208.874 1.00 120.99 ? 108 ARG F O   1 
ATOM   9000  C  CB  . ARG F 3 21  ? 75.497  18.042  212.133 1.00 130.29 ? 108 ARG F CB  1 
ATOM   9001  C  CG  . ARG F 3 21  ? 75.808  17.513  213.533 1.00 137.43 ? 108 ARG F CG  1 
ATOM   9002  C  CD  . ARG F 3 21  ? 76.953  18.273  214.196 1.00 144.60 ? 108 ARG F CD  1 
ATOM   9003  N  NE  . ARG F 3 21  ? 76.657  19.698  214.362 1.00 151.93 ? 108 ARG F NE  1 
ATOM   9004  C  CZ  . ARG F 3 21  ? 76.011  20.226  215.400 1.00 154.37 ? 108 ARG F CZ  1 
ATOM   9005  N  NH1 . ARG F 3 21  ? 75.580  19.455  216.393 1.00 154.34 ? 108 ARG F NH1 1 
ATOM   9006  N  NH2 . ARG F 3 21  ? 75.780  21.532  215.439 1.00 155.92 ? 108 ARG F NH2 1 
ATOM   9007  N  N   . TYR F 3 22  ? 76.787  19.298  209.529 1.00 122.30 ? 109 TYR F N   1 
ATOM   9008  C  CA  . TYR F 3 22  ? 76.691  20.147  208.341 1.00 124.06 ? 109 TYR F CA  1 
ATOM   9009  C  C   . TYR F 3 22  ? 77.283  19.449  207.109 1.00 122.90 ? 109 TYR F C   1 
ATOM   9010  O  O   . TYR F 3 22  ? 76.759  19.573  205.995 1.00 122.96 ? 109 TYR F O   1 
ATOM   9011  C  CB  . TYR F 3 22  ? 77.402  21.486  208.608 1.00 127.70 ? 109 TYR F CB  1 
ATOM   9012  C  CG  . TYR F 3 22  ? 77.600  22.388  207.397 1.00 131.63 ? 109 TYR F CG  1 
ATOM   9013  C  CD1 . TYR F 3 22  ? 76.521  23.046  206.795 1.00 133.67 ? 109 TYR F CD1 1 
ATOM   9014  C  CD2 . TYR F 3 22  ? 78.878  22.603  206.870 1.00 132.16 ? 109 TYR F CD2 1 
ATOM   9015  C  CE1 . TYR F 3 22  ? 76.717  23.902  205.691 1.00 134.96 ? 109 TYR F CE1 1 
ATOM   9016  C  CE2 . TYR F 3 22  ? 79.085  23.451  205.772 1.00 132.99 ? 109 TYR F CE2 1 
ATOM   9017  C  CZ  . TYR F 3 22  ? 78.006  24.098  205.187 1.00 134.58 ? 109 TYR F CZ  1 
ATOM   9018  O  OH  . TYR F 3 22  ? 78.225  24.932  204.105 1.00 135.36 ? 109 TYR F OH  1 
ATOM   9019  N  N   . LEU F 3 23  ? 78.375  18.716  207.311 1.00 121.06 ? 110 LEU F N   1 
ATOM   9020  C  CA  . LEU F 3 23  ? 79.008  18.001  206.209 1.00 117.88 ? 110 LEU F CA  1 
ATOM   9021  C  C   . LEU F 3 23  ? 78.495  16.566  206.058 1.00 117.44 ? 110 LEU F C   1 
ATOM   9022  O  O   . LEU F 3 23  ? 79.245  15.646  205.719 1.00 118.09 ? 110 LEU F O   1 
ATOM   9023  C  CB  . LEU F 3 23  ? 80.541  18.057  206.308 1.00 116.47 ? 110 LEU F CB  1 
ATOM   9024  C  CG  . LEU F 3 23  ? 81.208  19.396  205.947 1.00 114.22 ? 110 LEU F CG  1 
ATOM   9025  C  CD1 . LEU F 3 23  ? 82.724  19.265  205.942 1.00 114.33 ? 110 LEU F CD1 1 
ATOM   9026  C  CD2 . LEU F 3 23  ? 80.735  19.866  204.590 1.00 109.80 ? 110 LEU F CD2 1 
ATOM   9027  N  N   . GLN F 3 24  ? 77.214  16.386  206.375 1.00 118.65 ? 111 GLN F N   1 
ATOM   9028  C  CA  . GLN F 3 24  ? 76.514  15.107  206.229 1.00 120.86 ? 111 GLN F CA  1 
ATOM   9029  C  C   . GLN F 3 24  ? 75.155  15.467  205.610 1.00 118.59 ? 111 GLN F C   1 
ATOM   9030  O  O   . GLN F 3 24  ? 74.358  14.596  205.243 1.00 119.19 ? 111 GLN F O   1 
ATOM   9031  C  CB  . GLN F 3 24  ? 76.353  14.363  207.565 1.00 124.27 ? 111 GLN F CB  1 
ATOM   9032  C  CG  . GLN F 3 24  ? 75.891  12.906  207.382 1.00 128.07 ? 111 GLN F CG  1 
ATOM   9033  C  CD  . GLN F 3 24  ? 76.071  12.045  208.622 1.00 130.72 ? 111 GLN F CD  1 
ATOM   9034  O  OE1 . GLN F 3 24  ? 77.191  11.859  209.107 1.00 130.99 ? 111 GLN F OE1 1 
ATOM   9035  N  NE2 . GLN F 3 24  ? 74.970  11.489  209.124 1.00 131.50 ? 111 GLN F NE2 1 
ATOM   9036  N  N   . GLU F 3 25  ? 74.915  16.777  205.512 1.00 113.89 ? 112 GLU F N   1 
ATOM   9037  C  CA  . GLU F 3 25  ? 73.714  17.339  204.904 1.00 108.37 ? 112 GLU F CA  1 
ATOM   9038  C  C   . GLU F 3 25  ? 74.006  17.266  203.409 1.00 102.41 ? 112 GLU F C   1 
ATOM   9039  O  O   . GLU F 3 25  ? 73.156  16.857  202.615 1.00 100.32 ? 112 GLU F O   1 
ATOM   9040  C  CB  . GLU F 3 25  ? 73.544  18.811  205.314 1.00 111.83 ? 112 GLU F CB  1 
ATOM   9041  C  CG  . GLU F 3 25  ? 73.336  19.052  206.820 1.00 114.41 ? 112 GLU F CG  1 
ATOM   9042  C  CD  . GLU F 3 25  ? 73.395  20.532  207.230 1.00 116.47 ? 112 GLU F CD  1 
ATOM   9043  O  OE1 . GLU F 3 25  ? 73.595  21.406  206.355 1.00 118.46 ? 112 GLU F OE1 1 
ATOM   9044  O  OE2 . GLU F 3 25  ? 73.251  20.820  208.441 1.00 116.45 ? 112 GLU F OE2 1 
ATOM   9045  N  N   . ILE F 3 26  ? 75.239  17.643  203.053 1.00 97.96  ? 113 ILE F N   1 
ATOM   9046  C  CA  . ILE F 3 26  ? 75.717  17.627  201.669 1.00 92.75  ? 113 ILE F CA  1 
ATOM   9047  C  C   . ILE F 3 26  ? 75.845  16.204  201.152 1.00 88.04  ? 113 ILE F C   1 
ATOM   9048  O  O   . ILE F 3 26  ? 75.312  15.886  200.103 1.00 83.45  ? 113 ILE F O   1 
ATOM   9049  C  CB  . ILE F 3 26  ? 77.090  18.336  201.513 1.00 90.94  ? 113 ILE F CB  1 
ATOM   9050  C  CG1 . ILE F 3 26  ? 76.949  19.833  201.798 1.00 89.46  ? 113 ILE F CG1 1 
ATOM   9051  C  CG2 . ILE F 3 26  ? 77.643  18.124  200.113 1.00 88.86  ? 113 ILE F CG2 1 
ATOM   9052  C  CD1 . ILE F 3 26  ? 78.179  20.661  201.430 1.00 86.28  ? 113 ILE F CD1 1 
ATOM   9053  N  N   . TYR F 3 27  ? 76.560  15.356  201.880 1.00 86.40  ? 114 TYR F N   1 
ATOM   9054  C  CA  . TYR F 3 27  ? 76.720  13.970  201.465 1.00 88.49  ? 114 TYR F CA  1 
ATOM   9055  C  C   . TYR F 3 27  ? 75.360  13.275  201.303 1.00 93.17  ? 114 TYR F C   1 
ATOM   9056  O  O   . TYR F 3 27  ? 75.212  12.424  200.424 1.00 96.08  ? 114 TYR F O   1 
ATOM   9057  C  CB  . TYR F 3 27  ? 77.604  13.195  202.451 1.00 88.74  ? 114 TYR F CB  1 
ATOM   9058  C  CG  . TYR F 3 27  ? 77.732  11.712  202.144 1.00 86.59  ? 114 TYR F CG  1 
ATOM   9059  C  CD1 . TYR F 3 27  ? 76.808  10.786  202.660 1.00 88.64  ? 114 TYR F CD1 1 
ATOM   9060  C  CD2 . TYR F 3 27  ? 78.767  11.233  201.341 1.00 82.99  ? 114 TYR F CD2 1 
ATOM   9061  C  CE1 . TYR F 3 27  ? 76.911  9.421   202.381 1.00 87.19  ? 114 TYR F CE1 1 
ATOM   9062  C  CE2 . TYR F 3 27  ? 78.882  9.868   201.056 1.00 84.98  ? 114 TYR F CE2 1 
ATOM   9063  C  CZ  . TYR F 3 27  ? 77.949  8.967   201.580 1.00 86.45  ? 114 TYR F CZ  1 
ATOM   9064  O  OH  . TYR F 3 27  ? 78.049  7.617   201.308 1.00 85.41  ? 114 TYR F OH  1 
ATOM   9065  N  N   . ASN F 3 28  ? 74.383  13.611  202.151 1.00 95.13  ? 115 ASN F N   1 
ATOM   9066  C  CA  . ASN F 3 28  ? 73.050  13.003  202.051 1.00 97.56  ? 115 ASN F CA  1 
ATOM   9067  C  C   . ASN F 3 28  ? 72.220  13.637  200.936 1.00 95.44  ? 115 ASN F C   1 
ATOM   9068  O  O   . ASN F 3 28  ? 71.286  13.010  200.417 1.00 94.69  ? 115 ASN F O   1 
ATOM   9069  C  CB  . ASN F 3 28  ? 72.293  13.075  203.382 1.00 103.95 ? 115 ASN F CB  1 
ATOM   9070  C  CG  . ASN F 3 28  ? 72.701  11.971  204.347 1.00 107.78 ? 115 ASN F CG  1 
ATOM   9071  O  OD1 . ASN F 3 28  ? 73.886  11.650  204.481 1.00 107.81 ? 115 ASN F OD1 1 
ATOM   9072  N  ND2 . ASN F 3 28  ? 71.716  11.378  205.021 1.00 110.49 ? 115 ASN F ND2 1 
ATOM   9073  N  N   . SER F 3 29  ? 72.571  14.873  200.572 1.00 91.88  ? 116 SER F N   1 
ATOM   9074  C  CA  . SER F 3 29  ? 71.882  15.599  199.498 1.00 90.76  ? 116 SER F CA  1 
ATOM   9075  C  C   . SER F 3 29  ? 72.505  15.299  198.117 1.00 87.48  ? 116 SER F C   1 
ATOM   9076  O  O   . SER F 3 29  ? 71.795  14.911  197.177 1.00 85.52  ? 116 SER F O   1 
ATOM   9077  C  CB  . SER F 3 29  ? 71.890  17.111  199.769 1.00 91.41  ? 116 SER F CB  1 
ATOM   9078  O  OG  . SER F 3 29  ? 73.194  17.658  199.651 1.00 94.05  ? 116 SER F OG  1 
ATOM   9079  N  N   . ASN F 3 30  ? 73.823  15.496  198.001 1.00 81.37  ? 117 ASN F N   1 
ATOM   9080  C  CA  . ASN F 3 30  ? 74.556  15.229  196.757 1.00 72.73  ? 117 ASN F CA  1 
ATOM   9081  C  C   . ASN F 3 30  ? 74.296  13.791  196.329 1.00 72.30  ? 117 ASN F C   1 
ATOM   9082  O  O   . ASN F 3 30  ? 73.914  13.543  195.196 1.00 74.18  ? 117 ASN F O   1 
ATOM   9083  C  CB  . ASN F 3 30  ? 76.072  15.461  196.936 1.00 65.25  ? 117 ASN F CB  1 
ATOM   9084  C  CG  . ASN F 3 30  ? 76.465  16.944  196.847 1.00 58.77  ? 117 ASN F CG  1 
ATOM   9085  O  OD1 . ASN F 3 30  ? 77.633  17.288  196.591 1.00 48.86  ? 117 ASN F OD1 1 
ATOM   9086  N  ND2 . ASN F 3 30  ? 75.488  17.827  197.055 1.00 59.46  ? 117 ASN F ND2 1 
ATOM   9087  N  N   . ASN F 3 31  ? 74.466  12.858  197.259 1.00 70.83  ? 118 ASN F N   1 
ATOM   9088  C  CA  . ASN F 3 31  ? 74.228  11.448  196.999 1.00 77.36  ? 118 ASN F CA  1 
ATOM   9089  C  C   . ASN F 3 31  ? 72.855  11.276  196.331 1.00 82.69  ? 118 ASN F C   1 
ATOM   9090  O  O   . ASN F 3 31  ? 72.748  10.628  195.276 1.00 82.57  ? 118 ASN F O   1 
ATOM   9091  C  CB  . ASN F 3 31  ? 74.257  10.668  198.319 1.00 79.79  ? 118 ASN F CB  1 
ATOM   9092  C  CG  . ASN F 3 31  ? 74.379  9.166   198.119 1.00 83.04  ? 118 ASN F CG  1 
ATOM   9093  O  OD1 . ASN F 3 31  ? 75.378  8.565   198.517 1.00 86.32  ? 118 ASN F OD1 1 
ATOM   9094  N  ND2 . ASN F 3 31  ? 73.362  8.549   197.512 1.00 83.05  ? 118 ASN F ND2 1 
ATOM   9095  N  N   . GLN F 3 32  ? 71.825  11.887  196.933 1.00 86.96  ? 119 GLN F N   1 
ATOM   9096  C  CA  . GLN F 3 32  ? 70.439  11.819  196.433 1.00 89.35  ? 119 GLN F CA  1 
ATOM   9097  C  C   . GLN F 3 32  ? 70.315  12.374  195.000 1.00 85.80  ? 119 GLN F C   1 
ATOM   9098  O  O   . GLN F 3 32  ? 69.682  11.749  194.135 1.00 84.57  ? 119 GLN F O   1 
ATOM   9099  C  CB  . GLN F 3 32  ? 69.471  12.544  197.401 1.00 90.88  ? 119 GLN F CB  1 
ATOM   9100  C  CG  . GLN F 3 32  ? 67.969  12.210  197.214 1.00 93.66  ? 119 GLN F CG  1 
ATOM   9101  C  CD  . GLN F 3 32  ? 67.619  10.732  197.504 1.00 97.71  ? 119 GLN F CD  1 
ATOM   9102  O  OE1 . GLN F 3 32  ? 67.383  9.935   196.582 1.00 99.16  ? 119 GLN F OE1 1 
ATOM   9103  N  NE2 . GLN F 3 32  ? 67.569  10.374  198.789 1.00 98.85  ? 119 GLN F NE2 1 
ATOM   9104  N  N   . LYS F 3 33  ? 70.949  13.523  194.753 1.00 82.00  ? 120 LYS F N   1 
ATOM   9105  C  CA  . LYS F 3 33  ? 70.945  14.174  193.437 1.00 81.19  ? 120 LYS F CA  1 
ATOM   9106  C  C   . LYS F 3 33  ? 71.326  13.170  192.341 1.00 76.71  ? 120 LYS F C   1 
ATOM   9107  O  O   . LYS F 3 33  ? 70.628  13.000  191.335 1.00 70.53  ? 120 LYS F O   1 
ATOM   9108  C  CB  . LYS F 3 33  ? 71.974  15.305  193.436 1.00 84.61  ? 120 LYS F CB  1 
ATOM   9109  C  CG  . LYS F 3 33  ? 71.760  16.344  194.510 1.00 91.80  ? 120 LYS F CG  1 
ATOM   9110  C  CD  . LYS F 3 33  ? 70.622  17.289  194.149 1.00 95.35  ? 120 LYS F CD  1 
ATOM   9111  C  CE  . LYS F 3 33  ? 70.992  18.192  192.968 1.00 96.46  ? 120 LYS F CE  1 
ATOM   9112  N  NZ  . LYS F 3 33  ? 72.150  19.096  193.252 1.00 97.17  ? 120 LYS F NZ  1 
ATOM   9113  N  N   . ILE F 3 34  ? 72.470  12.534  192.557 1.00 72.39  ? 121 ILE F N   1 
ATOM   9114  C  CA  . ILE F 3 34  ? 73.003  11.536  191.662 1.00 61.98  ? 121 ILE F CA  1 
ATOM   9115  C  C   . ILE F 3 34  ? 71.991  10.414  191.480 1.00 58.23  ? 121 ILE F C   1 
ATOM   9116  O  O   . ILE F 3 34  ? 71.677  10.073  190.353 1.00 56.22  ? 121 ILE F O   1 
ATOM   9117  C  CB  . ILE F 3 34  ? 74.357  11.007  192.208 1.00 61.23  ? 121 ILE F CB  1 
ATOM   9118  C  CG1 . ILE F 3 34  ? 75.503  11.847  191.650 1.00 53.49  ? 121 ILE F CG1 1 
ATOM   9119  C  CG2 . ILE F 3 34  ? 74.545  9.503   191.934 1.00 66.63  ? 121 ILE F CG2 1 
ATOM   9120  C  CD1 . ILE F 3 34  ? 75.541  13.263  192.153 1.00 49.97  ? 121 ILE F CD1 1 
ATOM   9121  N  N   . VAL F 3 35  ? 71.462  9.866   192.575 1.00 60.87  ? 122 VAL F N   1 
ATOM   9122  C  CA  . VAL F 3 35  ? 70.481  8.775   192.495 1.00 66.30  ? 122 VAL F CA  1 
ATOM   9123  C  C   . VAL F 3 35  ? 69.459  9.061   191.397 1.00 64.57  ? 122 VAL F C   1 
ATOM   9124  O  O   . VAL F 3 35  ? 69.156  8.192   190.568 1.00 60.04  ? 122 VAL F O   1 
ATOM   9125  C  CB  . VAL F 3 35  ? 69.717  8.587   193.839 1.00 67.11  ? 122 VAL F CB  1 
ATOM   9126  C  CG1 . VAL F 3 35  ? 68.589  7.540   193.687 1.00 69.38  ? 122 VAL F CG1 1 
ATOM   9127  C  CG2 . VAL F 3 35  ? 70.683  8.169   194.933 1.00 67.35  ? 122 VAL F CG2 1 
ATOM   9128  N  N   . ASN F 3 36  ? 68.965  10.301  191.396 1.00 65.00  ? 123 ASN F N   1 
ATOM   9129  C  CA  . ASN F 3 36  ? 67.980  10.757  190.420 1.00 68.21  ? 123 ASN F CA  1 
ATOM   9130  C  C   . ASN F 3 36  ? 68.705  11.130  189.122 1.00 63.11  ? 123 ASN F C   1 
ATOM   9131  O  O   . ASN F 3 36  ? 68.188  10.879  188.024 1.00 61.91  ? 123 ASN F O   1 
ATOM   9132  C  CB  . ASN F 3 36  ? 67.174  11.955  190.973 1.00 75.33  ? 123 ASN F CB  1 
ATOM   9133  C  CG  . ASN F 3 36  ? 65.803  12.137  190.279 1.00 78.72  ? 123 ASN F CG  1 
ATOM   9134  O  OD1 . ASN F 3 36  ? 65.597  11.709  189.130 1.00 79.00  ? 123 ASN F OD1 1 
ATOM   9135  N  ND2 . ASN F 3 36  ? 64.863  12.780  190.986 1.00 79.39  ? 123 ASN F ND2 1 
ATOM   9136  N  N   . LEU F 3 37  ? 69.897  11.722  189.249 1.00 56.55  ? 124 LEU F N   1 
ATOM   9137  C  CA  . LEU F 3 37  ? 70.694  12.097  188.074 1.00 51.87  ? 124 LEU F CA  1 
ATOM   9138  C  C   . LEU F 3 37  ? 70.891  10.848  187.205 1.00 48.94  ? 124 LEU F C   1 
ATOM   9139  O  O   . LEU F 3 37  ? 70.697  10.872  186.001 1.00 39.27  ? 124 LEU F O   1 
ATOM   9140  C  CB  . LEU F 3 37  ? 72.048  12.661  188.501 1.00 45.94  ? 124 LEU F CB  1 
ATOM   9141  C  CG  . LEU F 3 37  ? 72.822  13.287  187.339 1.00 40.55  ? 124 LEU F CG  1 
ATOM   9142  C  CD1 . LEU F 3 37  ? 71.915  14.246  186.599 1.00 35.03  ? 124 LEU F CD1 1 
ATOM   9143  C  CD2 . LEU F 3 37  ? 74.047  14.031  187.842 1.00 41.36  ? 124 LEU F CD2 1 
ATOM   9144  N  N   . LYS F 3 38  ? 71.251  9.754   187.858 1.00 51.10  ? 125 LYS F N   1 
ATOM   9145  C  CA  . LYS F 3 38  ? 71.413  8.487   187.191 1.00 56.67  ? 125 LYS F CA  1 
ATOM   9146  C  C   . LYS F 3 38  ? 70.082  8.269   186.467 1.00 60.17  ? 125 LYS F C   1 
ATOM   9147  O  O   . LYS F 3 38  ? 70.072  7.977   185.276 1.00 67.43  ? 125 LYS F O   1 
ATOM   9148  C  CB  . LYS F 3 38  ? 71.615  7.355   188.220 1.00 63.02  ? 125 LYS F CB  1 
ATOM   9149  C  CG  . LYS F 3 38  ? 72.825  7.491   189.172 1.00 60.93  ? 125 LYS F CG  1 
ATOM   9150  C  CD  . LYS F 3 38  ? 72.606  6.686   190.481 1.00 60.33  ? 125 LYS F CD  1 
ATOM   9151  C  CE  . LYS F 3 38  ? 73.284  5.311   190.478 1.00 61.15  ? 125 LYS F CE  1 
ATOM   9152  N  NZ  . LYS F 3 38  ? 74.771  5.426   190.618 1.00 62.89  ? 125 LYS F NZ  1 
ATOM   9153  N  N   . GLU F 3 39  ? 68.965  8.486   187.172 1.00 62.98  ? 126 GLU F N   1 
ATOM   9154  C  CA  . GLU F 3 39  ? 67.623  8.289   186.596 1.00 65.44  ? 126 GLU F CA  1 
ATOM   9155  C  C   . GLU F 3 39  ? 67.395  9.165   185.387 1.00 62.76  ? 126 GLU F C   1 
ATOM   9156  O  O   . GLU F 3 39  ? 66.795  8.731   184.408 1.00 62.77  ? 126 GLU F O   1 
ATOM   9157  C  CB  . GLU F 3 39  ? 66.513  8.570   187.620 1.00 70.37  ? 126 GLU F CB  1 
ATOM   9158  C  CG  . GLU F 3 39  ? 66.372  7.528   188.734 1.00 78.66  ? 126 GLU F CG  1 
ATOM   9159  C  CD  . GLU F 3 39  ? 65.260  7.874   189.727 1.00 82.76  ? 126 GLU F CD  1 
ATOM   9160  O  OE1 . GLU F 3 39  ? 64.064  7.694   189.380 1.00 84.73  ? 126 GLU F OE1 1 
ATOM   9161  O  OE2 . GLU F 3 39  ? 65.589  8.320   190.855 1.00 79.18  ? 126 GLU F OE2 1 
ATOM   9162  N  N   . LYS F 3 40  ? 67.890  10.395  185.460 1.00 62.32  ? 127 LYS F N   1 
ATOM   9163  C  CA  . LYS F 3 40  ? 67.737  11.354  184.371 1.00 64.09  ? 127 LYS F CA  1 
ATOM   9164  C  C   . LYS F 3 40  ? 68.451  10.910  183.091 1.00 61.12  ? 127 LYS F C   1 
ATOM   9165  O  O   . LYS F 3 40  ? 67.820  10.748  182.037 1.00 59.58  ? 127 LYS F O   1 
ATOM   9166  C  CB  . LYS F 3 40  ? 68.249  12.725  184.811 1.00 70.87  ? 127 LYS F CB  1 
ATOM   9167  C  CG  . LYS F 3 40  ? 67.846  13.872  183.892 1.00 80.59  ? 127 LYS F CG  1 
ATOM   9168  C  CD  . LYS F 3 40  ? 68.187  15.219  184.525 1.00 86.59  ? 127 LYS F CD  1 
ATOM   9169  C  CE  . LYS F 3 40  ? 67.793  16.392  183.630 1.00 89.96  ? 127 LYS F CE  1 
ATOM   9170  N  NZ  . LYS F 3 40  ? 68.163  17.704  184.244 1.00 91.56  ? 127 LYS F NZ  1 
ATOM   9171  N  N   . VAL F 3 41  ? 69.763  10.699  183.190 1.00 56.48  ? 128 VAL F N   1 
ATOM   9172  C  CA  . VAL F 3 41  ? 70.555  10.259  182.046 1.00 51.39  ? 128 VAL F CA  1 
ATOM   9173  C  C   . VAL F 3 41  ? 70.031  8.926   181.529 1.00 49.98  ? 128 VAL F C   1 
ATOM   9174  O  O   . VAL F 3 41  ? 70.334  8.529   180.410 1.00 53.12  ? 128 VAL F O   1 
ATOM   9175  C  CB  . VAL F 3 41  ? 72.030  10.090  182.402 1.00 49.57  ? 128 VAL F CB  1 
ATOM   9176  C  CG1 . VAL F 3 41  ? 72.480  11.226  183.300 1.00 50.57  ? 128 VAL F CG1 1 
ATOM   9177  C  CG2 . VAL F 3 41  ? 72.277  8.730   183.040 1.00 54.91  ? 128 VAL F CG2 1 
ATOM   9178  N  N   . ALA F 3 42  ? 69.286  8.225   182.375 1.00 44.76  ? 129 ALA F N   1 
ATOM   9179  C  CA  . ALA F 3 42  ? 68.703  6.959   182.005 1.00 43.40  ? 129 ALA F CA  1 
ATOM   9180  C  C   . ALA F 3 42  ? 67.609  7.241   180.983 1.00 45.54  ? 129 ALA F C   1 
ATOM   9181  O  O   . ALA F 3 42  ? 67.438  6.482   180.011 1.00 50.23  ? 129 ALA F O   1 
ATOM   9182  C  CB  . ALA F 3 42  ? 68.123  6.274   183.222 1.00 46.70  ? 129 ALA F CB  1 
ATOM   9183  N  N   . GLN F 3 43  ? 66.879  8.338   181.203 1.00 42.20  ? 130 GLN F N   1 
ATOM   9184  C  CA  . GLN F 3 43  ? 65.799  8.745   180.301 1.00 46.91  ? 130 GLN F CA  1 
ATOM   9185  C  C   . GLN F 3 43  ? 66.431  9.197   178.990 1.00 40.28  ? 130 GLN F C   1 
ATOM   9186  O  O   . GLN F 3 43  ? 65.877  8.992   177.894 1.00 37.19  ? 130 GLN F O   1 
ATOM   9187  C  CB  . GLN F 3 43  ? 65.006  9.904   180.896 1.00 52.81  ? 130 GLN F CB  1 
ATOM   9188  C  CG  . GLN F 3 43  ? 64.309  9.576   182.190 1.00 63.26  ? 130 GLN F CG  1 
ATOM   9189  C  CD  . GLN F 3 43  ? 63.594  10.775  182.791 1.00 71.04  ? 130 GLN F CD  1 
ATOM   9190  O  OE1 . GLN F 3 43  ? 62.780  10.628  183.712 1.00 78.53  ? 130 GLN F OE1 1 
ATOM   9191  N  NE2 . GLN F 3 43  ? 63.896  11.970  182.280 1.00 70.52  ? 130 GLN F NE2 1 
ATOM   9192  N  N   . LEU F 3 44  ? 67.609  9.801   179.129 1.00 31.31  ? 131 LEU F N   1 
ATOM   9193  C  CA  . LEU F 3 44  ? 68.368  10.288  177.997 1.00 25.39  ? 131 LEU F CA  1 
ATOM   9194  C  C   . LEU F 3 44  ? 68.865  9.128   177.143 1.00 24.19  ? 131 LEU F C   1 
ATOM   9195  O  O   . LEU F 3 44  ? 68.705  9.147   175.927 1.00 24.09  ? 131 LEU F O   1 
ATOM   9196  C  CB  . LEU F 3 44  ? 69.549  11.102  178.493 1.00 26.74  ? 131 LEU F CB  1 
ATOM   9197  C  CG  . LEU F 3 44  ? 70.464  11.653  177.397 1.00 26.68  ? 131 LEU F CG  1 
ATOM   9198  C  CD1 . LEU F 3 44  ? 69.719  12.733  176.613 1.00 22.87  ? 131 LEU F CD1 1 
ATOM   9199  C  CD2 . LEU F 3 44  ? 71.761  12.204  177.991 1.00 19.84  ? 131 LEU F CD2 1 
ATOM   9200  N  N   . GLU F 3 45  ? 69.465  8.123   177.784 1.00 25.67  ? 132 GLU F N   1 
ATOM   9201  C  CA  . GLU F 3 45  ? 69.970  6.959   177.075 1.00 26.09  ? 132 GLU F CA  1 
ATOM   9202  C  C   . GLU F 3 45  ? 68.821  6.412   176.274 1.00 26.91  ? 132 GLU F C   1 
ATOM   9203  O  O   . GLU F 3 45  ? 68.991  6.040   175.126 1.00 30.86  ? 132 GLU F O   1 
ATOM   9204  C  CB  . GLU F 3 45  ? 70.446  5.884   178.045 1.00 32.10  ? 132 GLU F CB  1 
ATOM   9205  C  CG  . GLU F 3 45  ? 71.504  4.957   177.438 1.00 37.63  ? 132 GLU F CG  1 
ATOM   9206  C  CD  . GLU F 3 45  ? 71.657  3.641   178.181 1.00 41.02  ? 132 GLU F CD  1 
ATOM   9207  O  OE1 . GLU F 3 45  ? 71.315  3.606   179.388 1.00 39.41  ? 132 GLU F OE1 1 
ATOM   9208  O  OE2 . GLU F 3 45  ? 72.102  2.639   177.543 1.00 39.42  ? 132 GLU F OE2 1 
ATOM   9209  N  N   . ALA F 3 46  ? 67.640  6.411   176.886 1.00 26.39  ? 133 ALA F N   1 
ATOM   9210  C  CA  . ALA F 3 46  ? 66.431  5.934   176.242 1.00 23.47  ? 133 ALA F CA  1 
ATOM   9211  C  C   . ALA F 3 46  ? 66.146  6.737   174.998 1.00 24.70  ? 133 ALA F C   1 
ATOM   9212  O  O   . ALA F 3 46  ? 65.914  6.176   173.935 1.00 33.93  ? 133 ALA F O   1 
ATOM   9213  C  CB  . ALA F 3 46  ? 65.277  6.038   177.177 1.00 23.85  ? 133 ALA F CB  1 
ATOM   9214  N  N   . GLN F 3 47  ? 66.196  8.055   175.119 1.00 21.12  ? 134 GLN F N   1 
ATOM   9215  C  CA  . GLN F 3 47  ? 65.930  8.910   173.979 1.00 34.19  ? 134 GLN F CA  1 
ATOM   9216  C  C   . GLN F 3 47  ? 66.767  8.560   172.753 1.00 35.34  ? 134 GLN F C   1 
ATOM   9217  O  O   . GLN F 3 47  ? 66.236  8.493   171.647 1.00 35.76  ? 134 GLN F O   1 
ATOM   9218  C  CB  . GLN F 3 47  ? 66.126  10.364  174.361 1.00 46.27  ? 134 GLN F CB  1 
ATOM   9219  C  CG  . GLN F 3 47  ? 64.873  11.195  174.223 1.00 56.84  ? 134 GLN F CG  1 
ATOM   9220  C  CD  . GLN F 3 47  ? 63.691  10.583  174.936 1.00 65.29  ? 134 GLN F CD  1 
ATOM   9221  O  OE1 . GLN F 3 47  ? 63.715  10.379  176.156 1.00 70.82  ? 134 GLN F OE1 1 
ATOM   9222  N  NE2 . GLN F 3 47  ? 62.647  10.271  174.177 1.00 68.51  ? 134 GLN F NE2 1 
ATOM   9223  N  N   . CYS F 3 48  ? 68.059  8.293   172.947 1.00 31.07  ? 135 CYS F N   1 
ATOM   9224  C  CA  . CYS F 3 48  ? 68.923  7.931   171.828 1.00 27.66  ? 135 CYS F CA  1 
ATOM   9225  C  C   . CYS F 3 48  ? 69.344  6.491   171.727 1.00 23.95  ? 135 CYS F C   1 
ATOM   9226  O  O   . CYS F 3 48  ? 70.357  6.091   172.270 1.00 28.75  ? 135 CYS F O   1 
ATOM   9227  C  CB  . CYS F 3 48  ? 70.169  8.797   171.767 1.00 28.39  ? 135 CYS F CB  1 
ATOM   9228  S  SG  . CYS F 3 48  ? 70.768  9.482   173.327 1.00 35.50  ? 135 CYS F SG  1 
ATOM   9229  N  N   . GLN F 3 49  ? 68.563  5.721   171.000 1.00 25.11  ? 136 GLN F N   1 
ATOM   9230  C  CA  . GLN F 3 49  ? 68.849  4.316   170.780 1.00 28.52  ? 136 GLN F CA  1 
ATOM   9231  C  C   . GLN F 3 49  ? 68.500  4.162   169.311 1.00 33.74  ? 136 GLN F C   1 
ATOM   9232  O  O   . GLN F 3 49  ? 69.140  3.420   168.557 1.00 35.81  ? 136 GLN F O   1 
ATOM   9233  C  CB  . GLN F 3 49  ? 67.934  3.453   171.641 1.00 29.03  ? 136 GLN F CB  1 
ATOM   9234  C  CG  . GLN F 3 49  ? 68.221  3.509   173.135 1.00 37.25  ? 136 GLN F CG  1 
ATOM   9235  C  CD  . GLN F 3 49  ? 69.546  2.862   173.499 1.00 43.78  ? 136 GLN F CD  1 
ATOM   9236  O  OE1 . GLN F 3 49  ? 70.483  3.538   173.923 1.00 44.03  ? 136 GLN F OE1 1 
ATOM   9237  N  NE2 . GLN F 3 49  ? 69.633  1.542   173.328 1.00 47.61  ? 136 GLN F NE2 1 
ATOM   9238  N  N   . GLU F 3 50  ? 67.518  4.958   168.906 1.00 34.18  ? 137 GLU F N   1 
ATOM   9239  C  CA  . GLU F 3 50  ? 67.037  4.993   167.544 1.00 40.20  ? 137 GLU F CA  1 
ATOM   9240  C  C   . GLU F 3 50  ? 68.102  5.639   166.648 1.00 39.10  ? 137 GLU F C   1 
ATOM   9241  O  O   . GLU F 3 50  ? 68.902  6.451   167.104 1.00 37.83  ? 137 GLU F O   1 
ATOM   9242  C  CB  . GLU F 3 50  ? 65.762  5.843   167.479 1.00 47.46  ? 137 GLU F CB  1 
ATOM   9243  C  CG  . GLU F 3 50  ? 64.610  5.382   168.358 1.00 55.38  ? 137 GLU F CG  1 
ATOM   9244  C  CD  . GLU F 3 50  ? 63.713  4.388   167.661 1.00 62.61  ? 137 GLU F CD  1 
ATOM   9245  O  OE1 . GLU F 3 50  ? 64.113  3.207   167.543 1.00 69.47  ? 137 GLU F OE1 1 
ATOM   9246  O  OE2 . GLU F 3 50  ? 62.606  4.792   167.233 1.00 67.49  ? 137 GLU F OE2 1 
ATOM   9247  N  N   . PRO F 3 51  ? 68.187  5.201   165.383 1.00 34.66  ? 138 PRO F N   1 
ATOM   9248  C  CA  . PRO F 3 51  ? 69.152  5.757   164.431 1.00 30.31  ? 138 PRO F CA  1 
ATOM   9249  C  C   . PRO F 3 51  ? 68.473  6.932   163.693 1.00 26.57  ? 138 PRO F C   1 
ATOM   9250  O  O   . PRO F 3 51  ? 67.257  7.108   163.793 1.00 26.20  ? 138 PRO F O   1 
ATOM   9251  C  CB  . PRO F 3 51  ? 69.394  4.579   163.498 1.00 29.89  ? 138 PRO F CB  1 
ATOM   9252  C  CG  . PRO F 3 51  ? 68.034  3.966   163.409 1.00 31.61  ? 138 PRO F CG  1 
ATOM   9253  C  CD  . PRO F 3 51  ? 67.577  3.964   164.850 1.00 32.72  ? 138 PRO F CD  1 
ATOM   9254  N  N   . CYS F 3 52  ? 69.230  7.737   162.957 1.00 23.26  ? 139 CYS F N   1 
ATOM   9255  C  CA  . CYS F 3 52  ? 68.600  8.847   162.251 1.00 20.85  ? 139 CYS F CA  1 
ATOM   9256  C  C   . CYS F 3 52  ? 67.490  8.350   161.363 1.00 21.13  ? 139 CYS F C   1 
ATOM   9257  O  O   . CYS F 3 52  ? 67.464  7.184   160.983 1.00 20.82  ? 139 CYS F O   1 
ATOM   9258  C  CB  . CYS F 3 52  ? 69.576  9.585   161.352 1.00 14.25  ? 139 CYS F CB  1 
ATOM   9259  S  SG  . CYS F 3 52  ? 71.039  10.199  162.184 1.00 18.33  ? 139 CYS F SG  1 
ATOM   9260  N  N   . LYS F 3 53  ? 66.607  9.264   160.992 1.00 24.58  ? 140 LYS F N   1 
ATOM   9261  C  CA  . LYS F 3 53  ? 65.506  8.933   160.116 1.00 31.75  ? 140 LYS F CA  1 
ATOM   9262  C  C   . LYS F 3 53  ? 65.936  9.030   158.664 1.00 31.63  ? 140 LYS F C   1 
ATOM   9263  O  O   . LYS F 3 53  ? 66.458  10.060  158.226 1.00 31.08  ? 140 LYS F O   1 
ATOM   9264  C  CB  . LYS F 3 53  ? 64.336  9.870   160.356 1.00 38.95  ? 140 LYS F CB  1 
ATOM   9265  C  CG  . LYS F 3 53  ? 63.402  9.396   161.434 1.00 49.93  ? 140 LYS F CG  1 
ATOM   9266  C  CD  . LYS F 3 53  ? 61.984  9.913   161.175 1.00 59.45  ? 140 LYS F CD  1 
ATOM   9267  C  CE  . LYS F 3 53  ? 61.490  9.500   159.784 1.00 62.01  ? 140 LYS F CE  1 
ATOM   9268  N  NZ  . LYS F 3 53  ? 60.060  9.848   159.569 1.00 64.78  ? 140 LYS F NZ  1 
ATOM   9269  N  N   . ASP F 3 54  ? 65.781  7.933   157.932 1.00 26.74  ? 141 ASP F N   1 
ATOM   9270  C  CA  . ASP F 3 54  ? 66.131  7.943   156.527 1.00 26.06  ? 141 ASP F CA  1 
ATOM   9271  C  C   . ASP F 3 54  ? 64.859  8.295   155.788 1.00 30.49  ? 141 ASP F C   1 
ATOM   9272  O  O   . ASP F 3 54  ? 63.895  7.531   155.749 1.00 29.76  ? 141 ASP F O   1 
ATOM   9273  C  CB  . ASP F 3 54  ? 66.669  6.592   156.057 1.00 22.91  ? 141 ASP F CB  1 
ATOM   9274  C  CG  . ASP F 3 54  ? 67.203  6.633   154.641 1.00 25.07  ? 141 ASP F CG  1 
ATOM   9275  O  OD1 . ASP F 3 54  ? 67.053  7.669   153.964 1.00 29.99  ? 141 ASP F OD1 1 
ATOM   9276  O  OD2 . ASP F 3 54  ? 67.780  5.625   154.191 1.00 26.03  ? 141 ASP F OD2 1 
ATOM   9277  N  N   . THR F 3 55  ? 64.866  9.486   155.217 1.00 36.16  ? 142 THR F N   1 
ATOM   9278  C  CA  . THR F 3 55  ? 63.731  9.987   154.474 1.00 33.56  ? 142 THR F CA  1 
ATOM   9279  C  C   . THR F 3 55  ? 63.356  9.053   153.331 1.00 38.18  ? 142 THR F C   1 
ATOM   9280  O  O   . THR F 3 55  ? 62.246  9.136   152.813 1.00 39.92  ? 142 THR F O   1 
ATOM   9281  C  CB  . THR F 3 55  ? 64.035  11.379  153.920 1.00 31.42  ? 142 THR F CB  1 
ATOM   9282  O  OG1 . THR F 3 55  ? 65.083  11.277  152.956 1.00 32.49  ? 142 THR F OG1 1 
ATOM   9283  C  CG2 . THR F 3 55  ? 64.504  12.308  155.039 1.00 31.14  ? 142 THR F CG2 1 
ATOM   9284  N  N   . VAL F 3 56  ? 64.271  8.172   152.922 1.00 40.45  ? 143 VAL F N   1 
ATOM   9285  C  CA  . VAL F 3 56  ? 63.946  7.252   151.834 1.00 39.38  ? 143 VAL F CA  1 
ATOM   9286  C  C   . VAL F 3 56  ? 63.228  6.020   152.362 1.00 39.77  ? 143 VAL F C   1 
ATOM   9287  O  O   . VAL F 3 56  ? 63.732  5.294   153.218 1.00 34.88  ? 143 VAL F O   1 
ATOM   9288  C  CB  . VAL F 3 56  ? 65.173  6.870   150.913 1.00 35.65  ? 143 VAL F CB  1 
ATOM   9289  C  CG1 . VAL F 3 56  ? 66.010  8.101   150.614 1.00 32.38  ? 143 VAL F CG1 1 
ATOM   9290  C  CG2 . VAL F 3 56  ? 66.014  5.753   151.503 1.00 37.53  ? 143 VAL F CG2 1 
ATOM   9291  N  N   . GLN F 3 57  ? 61.982  5.881   151.931 1.00 46.08  ? 144 GLN F N   1 
ATOM   9292  C  CA  . GLN F 3 57  ? 61.139  4.761   152.310 1.00 50.37  ? 144 GLN F CA  1 
ATOM   9293  C  C   . GLN F 3 57  ? 60.846  3.976   151.040 1.00 51.87  ? 144 GLN F C   1 
ATOM   9294  O  O   . GLN F 3 57  ? 60.904  4.523   149.940 1.00 58.34  ? 144 GLN F O   1 
ATOM   9295  C  CB  . GLN F 3 57  ? 59.819  5.269   152.883 1.00 55.96  ? 144 GLN F CB  1 
ATOM   9296  C  CG  . GLN F 3 57  ? 59.559  4.862   154.317 1.00 67.17  ? 144 GLN F CG  1 
ATOM   9297  C  CD  . GLN F 3 57  ? 60.153  5.838   155.317 1.00 74.21  ? 144 GLN F CD  1 
ATOM   9298  O  OE1 . GLN F 3 57  ? 59.527  6.848   155.660 1.00 78.53  ? 144 GLN F OE1 1 
ATOM   9299  N  NE2 . GLN F 3 57  ? 61.361  5.541   155.795 1.00 74.90  ? 144 GLN F NE2 1 
ATOM   9300  N  N   . ILE F 3 58  ? 60.548  2.690   151.190 1.00 49.04  ? 145 ILE F N   1 
ATOM   9301  C  CA  . ILE F 3 58  ? 60.212  1.839   150.048 1.00 40.53  ? 145 ILE F CA  1 
ATOM   9302  C  C   . ILE F 3 58  ? 58.803  1.307   150.240 1.00 42.85  ? 145 ILE F C   1 
ATOM   9303  O  O   . ILE F 3 58  ? 58.321  1.165   151.371 1.00 52.08  ? 145 ILE F O   1 
ATOM   9304  C  CB  . ILE F 3 58  ? 61.176  0.669   149.911 1.00 36.32  ? 145 ILE F CB  1 
ATOM   9305  C  CG1 . ILE F 3 58  ? 62.567  1.196   149.576 1.00 35.68  ? 145 ILE F CG1 1 
ATOM   9306  C  CG2 . ILE F 3 58  ? 60.702  -0.281  148.847 1.00 34.15  ? 145 ILE F CG2 1 
ATOM   9307  C  CD1 . ILE F 3 58  ? 63.621  0.131   149.560 1.00 34.81  ? 145 ILE F CD1 1 
ATOM   9308  N  N   . HIS F 3 59  ? 58.123  1.032   149.141 1.00 40.12  ? 146 HIS F N   1 
ATOM   9309  C  CA  . HIS F 3 59  ? 56.772  0.535   149.258 1.00 43.06  ? 146 HIS F CA  1 
ATOM   9310  C  C   . HIS F 3 59  ? 56.646  -0.976  149.205 1.00 46.41  ? 146 HIS F C   1 
ATOM   9311  O  O   . HIS F 3 59  ? 57.327  -1.658  148.432 1.00 50.29  ? 146 HIS F O   1 
ATOM   9312  C  CB  . HIS F 3 59  ? 55.870  1.225   148.246 1.00 46.88  ? 146 HIS F CB  1 
ATOM   9313  C  CG  . HIS F 3 59  ? 55.699  2.687   148.509 1.00 48.54  ? 146 HIS F CG  1 
ATOM   9314  N  ND1 . HIS F 3 59  ? 55.839  3.639   147.526 1.00 49.16  ? 146 HIS F ND1 1 
ATOM   9315  C  CD2 . HIS F 3 59  ? 55.420  3.361   149.649 1.00 51.53  ? 146 HIS F CD2 1 
ATOM   9316  C  CE1 . HIS F 3 59  ? 55.653  4.838   148.048 1.00 51.72  ? 146 HIS F CE1 1 
ATOM   9317  N  NE2 . HIS F 3 59  ? 55.397  4.696   149.335 1.00 54.34  ? 146 HIS F NE2 1 
ATOM   9318  N  N   . ASP F 3 60  ? 55.778  -1.486  150.070 1.00 52.07  ? 147 ASP F N   1 
ATOM   9319  C  CA  . ASP F 3 60  ? 55.510  -2.914  150.209 1.00 54.02  ? 147 ASP F CA  1 
ATOM   9320  C  C   . ASP F 3 60  ? 54.774  -3.578  149.037 1.00 47.42  ? 147 ASP F C   1 
ATOM   9321  O  O   . ASP F 3 60  ? 54.606  -4.795  149.029 1.00 45.59  ? 147 ASP F O   1 
ATOM   9322  C  CB  . ASP F 3 60  ? 54.739  -3.138  151.509 1.00 57.43  ? 147 ASP F CB  1 
ATOM   9323  C  CG  . ASP F 3 60  ? 53.728  -2.029  151.780 1.00 62.77  ? 147 ASP F CG  1 
ATOM   9324  O  OD1 . ASP F 3 60  ? 53.034  -1.606  150.828 1.00 63.42  ? 147 ASP F OD1 1 
ATOM   9325  O  OD2 . ASP F 3 60  ? 53.647  -1.563  152.938 1.00 67.07  ? 147 ASP F OD2 1 
ATOM   9326  N  N   . ILE F 3 61  ? 54.340  -2.787  148.057 1.00 41.93  ? 148 ILE F N   1 
ATOM   9327  C  CA  . ILE F 3 61  ? 53.622  -3.321  146.880 1.00 42.43  ? 148 ILE F CA  1 
ATOM   9328  C  C   . ILE F 3 61  ? 54.535  -3.722  145.707 1.00 41.00  ? 148 ILE F C   1 
ATOM   9329  O  O   . ILE F 3 61  ? 55.206  -2.873  145.114 1.00 38.98  ? 148 ILE F O   1 
ATOM   9330  C  CB  . ILE F 3 61  ? 52.552  -2.333  146.311 1.00 39.84  ? 148 ILE F CB  1 
ATOM   9331  C  CG1 . ILE F 3 61  ? 52.367  -1.117  147.223 1.00 41.76  ? 148 ILE F CG1 1 
ATOM   9332  C  CG2 . ILE F 3 61  ? 51.233  -3.048  146.146 1.00 36.05  ? 148 ILE F CG2 1 
ATOM   9333  C  CD1 . ILE F 3 61  ? 51.525  -0.015  146.602 1.00 39.47  ? 148 ILE F CD1 1 
ATOM   9334  N  N   . THR F 3 62  ? 54.502  -5.008  145.357 1.00 39.13  ? 149 THR F N   1 
ATOM   9335  C  CA  . THR F 3 62  ? 55.307  -5.574  144.272 1.00 41.61  ? 149 THR F CA  1 
ATOM   9336  C  C   . THR F 3 62  ? 54.417  -5.782  143.070 1.00 48.67  ? 149 THR F C   1 
ATOM   9337  O  O   . THR F 3 62  ? 53.193  -5.735  143.186 1.00 53.22  ? 149 THR F O   1 
ATOM   9338  C  CB  . THR F 3 62  ? 55.901  -6.957  144.673 1.00 38.07  ? 149 THR F CB  1 
ATOM   9339  O  OG1 . THR F 3 62  ? 56.758  -6.788  145.806 1.00 30.99  ? 149 THR F OG1 1 
ATOM   9340  C  CG2 . THR F 3 62  ? 56.715  -7.590  143.542 1.00 43.59  ? 149 THR F CG2 1 
ATOM   9341  N  N   . GLY F 3 63  ? 55.042  -6.004  141.917 1.00 48.22  ? 150 GLY F N   1 
ATOM   9342  C  CA  . GLY F 3 63  ? 54.312  -6.243  140.689 1.00 40.91  ? 150 GLY F CA  1 
ATOM   9343  C  C   . GLY F 3 63  ? 55.281  -6.590  139.576 1.00 41.35  ? 150 GLY F C   1 
ATOM   9344  O  O   . GLY F 3 63  ? 56.504  -6.551  139.755 1.00 43.13  ? 150 GLY F O   1 
ATOM   9345  N  N   . LYS F 3 64  ? 54.733  -6.940  138.420 1.00 43.30  ? 151 LYS F N   1 
ATOM   9346  C  CA  . LYS F 3 64  ? 55.542  -7.279  137.253 1.00 43.47  ? 151 LYS F CA  1 
ATOM   9347  C  C   . LYS F 3 64  ? 56.156  -5.989  136.696 1.00 40.77  ? 151 LYS F C   1 
ATOM   9348  O  O   . LYS F 3 64  ? 57.164  -6.022  135.999 1.00 35.72  ? 151 LYS F O   1 
ATOM   9349  C  CB  . LYS F 3 64  ? 54.663  -7.919  136.175 1.00 48.63  ? 151 LYS F CB  1 
ATOM   9350  C  CG  . LYS F 3 64  ? 53.452  -8.701  136.691 1.00 55.37  ? 151 LYS F CG  1 
ATOM   9351  C  CD  . LYS F 3 64  ? 53.865  -9.916  137.516 1.00 63.62  ? 151 LYS F CD  1 
ATOM   9352  C  CE  . LYS F 3 64  ? 52.687  -10.499 138.306 1.00 66.45  ? 151 LYS F CE  1 
ATOM   9353  N  NZ  . LYS F 3 64  ? 52.204  -9.578  139.388 1.00 66.49  ? 151 LYS F NZ  1 
ATOM   9354  N  N   . ASP F 3 65  ? 55.530  -4.856  137.015 1.00 42.40  ? 152 ASP F N   1 
ATOM   9355  C  CA  . ASP F 3 65  ? 55.978  -3.548  136.557 1.00 42.17  ? 152 ASP F CA  1 
ATOM   9356  C  C   . ASP F 3 65  ? 55.099  -2.484  137.203 1.00 39.87  ? 152 ASP F C   1 
ATOM   9357  O  O   . ASP F 3 65  ? 54.036  -2.799  137.736 1.00 38.59  ? 152 ASP F O   1 
ATOM   9358  C  CB  . ASP F 3 65  ? 55.841  -3.467  135.046 1.00 44.33  ? 152 ASP F CB  1 
ATOM   9359  C  CG  . ASP F 3 65  ? 54.408  -3.537  134.602 1.00 47.86  ? 152 ASP F CG  1 
ATOM   9360  O  OD1 . ASP F 3 65  ? 53.651  -4.352  135.149 1.00 53.35  ? 152 ASP F OD1 1 
ATOM   9361  O  OD2 . ASP F 3 65  ? 54.027  -2.758  133.721 1.00 53.85  ? 152 ASP F OD2 1 
ATOM   9362  N  N   . CYS F 3 66  ? 55.508  -1.224  137.089 1.00 41.40  ? 153 CYS F N   1 
ATOM   9363  C  CA  . CYS F 3 66  ? 54.767  -0.116  137.687 1.00 42.64  ? 153 CYS F CA  1 
ATOM   9364  C  C   . CYS F 3 66  ? 53.278  -0.032  137.376 1.00 45.37  ? 153 CYS F C   1 
ATOM   9365  O  O   . CYS F 3 66  ? 52.496  0.402   138.229 1.00 48.53  ? 153 CYS F O   1 
ATOM   9366  C  CB  . CYS F 3 66  ? 55.426  1.195   137.332 1.00 38.53  ? 153 CYS F CB  1 
ATOM   9367  S  SG  . CYS F 3 66  ? 57.138  1.206   137.869 1.00 36.26  ? 153 CYS F SG  1 
ATOM   9368  N  N   . GLN F 3 67  ? 52.888  -0.392  136.154 1.00 45.14  ? 154 GLN F N   1 
ATOM   9369  C  CA  . GLN F 3 67  ? 51.478  -0.352  135.801 1.00 44.55  ? 154 GLN F CA  1 
ATOM   9370  C  C   . GLN F 3 67  ? 50.767  -1.423  136.597 1.00 43.69  ? 154 GLN F C   1 
ATOM   9371  O  O   . GLN F 3 67  ? 49.731  -1.160  137.198 1.00 45.29  ? 154 GLN F O   1 
ATOM   9372  C  CB  . GLN F 3 67  ? 51.257  -0.570  134.312 1.00 47.06  ? 154 GLN F CB  1 
ATOM   9373  C  CG  . GLN F 3 67  ? 49.802  -0.361  133.884 1.00 46.96  ? 154 GLN F CG  1 
ATOM   9374  C  CD  . GLN F 3 67  ? 49.239  0.971   134.355 1.00 51.41  ? 154 GLN F CD  1 
ATOM   9375  O  OE1 . GLN F 3 67  ? 49.622  2.034   133.865 1.00 55.15  ? 154 GLN F OE1 1 
ATOM   9376  N  NE2 . GLN F 3 67  ? 48.326  0.916   135.316 1.00 53.70  ? 154 GLN F NE2 1 
ATOM   9377  N  N   . ASP F 3 68  ? 51.343  -2.619  136.626 1.00 42.40  ? 155 ASP F N   1 
ATOM   9378  C  CA  . ASP F 3 68  ? 50.765  -3.710  137.391 1.00 46.22  ? 155 ASP F CA  1 
ATOM   9379  C  C   . ASP F 3 68  ? 50.598  -3.234  138.826 1.00 44.75  ? 155 ASP F C   1 
ATOM   9380  O  O   . ASP F 3 68  ? 49.571  -3.485  139.454 1.00 47.52  ? 155 ASP F O   1 
ATOM   9381  C  CB  . ASP F 3 68  ? 51.686  -4.928  137.367 1.00 51.27  ? 155 ASP F CB  1 
ATOM   9382  C  CG  . ASP F 3 68  ? 51.087  -6.128  138.067 1.00 58.52  ? 155 ASP F CG  1 
ATOM   9383  O  OD1 . ASP F 3 68  ? 49.860  -6.342  137.939 1.00 62.93  ? 155 ASP F OD1 1 
ATOM   9384  O  OD2 . ASP F 3 68  ? 51.842  -6.859  138.745 1.00 62.10  ? 155 ASP F OD2 1 
ATOM   9385  N  N   . ILE F 3 69  ? 51.606  -2.525  139.328 1.00 44.08  ? 156 ILE F N   1 
ATOM   9386  C  CA  . ILE F 3 69  ? 51.575  -2.000  140.686 1.00 44.00  ? 156 ILE F CA  1 
ATOM   9387  C  C   . ILE F 3 69  ? 50.471  -0.956  140.802 1.00 42.46  ? 156 ILE F C   1 
ATOM   9388  O  O   . ILE F 3 69  ? 49.733  -0.931  141.782 1.00 41.11  ? 156 ILE F O   1 
ATOM   9389  C  CB  . ILE F 3 69  ? 52.938  -1.380  141.081 1.00 43.10  ? 156 ILE F CB  1 
ATOM   9390  C  CG1 . ILE F 3 69  ? 53.978  -2.484  141.271 1.00 43.89  ? 156 ILE F CG1 1 
ATOM   9391  C  CG2 . ILE F 3 69  ? 52.803  -0.554  142.355 1.00 44.93  ? 156 ILE F CG2 1 
ATOM   9392  C  CD1 . ILE F 3 69  ? 55.285  -2.004  141.863 1.00 46.66  ? 156 ILE F CD1 1 
ATOM   9393  N  N   . ALA F 3 70  ? 50.350  -0.122  139.773 1.00 42.94  ? 157 ALA F N   1 
ATOM   9394  C  CA  . ALA F 3 70  ? 49.339  0.925   139.729 1.00 44.85  ? 157 ALA F CA  1 
ATOM   9395  C  C   . ALA F 3 70  ? 47.957  0.310   139.857 1.00 49.24  ? 157 ALA F C   1 
ATOM   9396  O  O   . ALA F 3 70  ? 47.050  0.906   140.434 1.00 53.94  ? 157 ALA F O   1 
ATOM   9397  C  CB  . ALA F 3 70  ? 49.446  1.704   138.435 1.00 40.13  ? 157 ALA F CB  1 
ATOM   9398  N  N   . ASN F 3 71  ? 47.813  -0.902  139.338 1.00 51.33  ? 158 ASN F N   1 
ATOM   9399  C  CA  . ASN F 3 71  ? 46.546  -1.612  139.402 1.00 57.11  ? 158 ASN F CA  1 
ATOM   9400  C  C   . ASN F 3 71  ? 46.261  -2.088  140.815 1.00 61.37  ? 158 ASN F C   1 
ATOM   9401  O  O   . ASN F 3 71  ? 45.171  -1.860  141.353 1.00 65.89  ? 158 ASN F O   1 
ATOM   9402  C  CB  . ASN F 3 71  ? 46.557  -2.796  138.444 1.00 60.56  ? 158 ASN F CB  1 
ATOM   9403  C  CG  . ASN F 3 71  ? 46.753  -2.365  137.006 1.00 64.88  ? 158 ASN F CG  1 
ATOM   9404  O  OD1 . ASN F 3 71  ? 46.398  -1.237  136.625 1.00 64.05  ? 158 ASN F OD1 1 
ATOM   9405  N  ND2 . ASN F 3 71  ? 47.342  -3.248  136.199 1.00 64.68  ? 158 ASN F ND2 1 
ATOM   9406  N  N   . LYS F 3 72  ? 47.260  -2.717  141.424 1.00 60.92  ? 159 LYS F N   1 
ATOM   9407  C  CA  . LYS F 3 72  ? 47.142  -3.226  142.784 1.00 59.94  ? 159 LYS F CA  1 
ATOM   9408  C  C   . LYS F 3 72  ? 46.548  -2.177  143.728 1.00 60.10  ? 159 LYS F C   1 
ATOM   9409  O  O   . LYS F 3 72  ? 45.863  -2.524  144.692 1.00 61.76  ? 159 LYS F O   1 
ATOM   9410  C  CB  . LYS F 3 72  ? 48.514  -3.665  143.297 1.00 59.76  ? 159 LYS F CB  1 
ATOM   9411  C  CG  . LYS F 3 72  ? 49.225  -4.679  142.416 1.00 61.68  ? 159 LYS F CG  1 
ATOM   9412  C  CD  . LYS F 3 72  ? 48.429  -5.956  142.280 1.00 66.81  ? 159 LYS F CD  1 
ATOM   9413  C  CE  . LYS F 3 72  ? 49.171  -6.990  141.445 1.00 69.41  ? 159 LYS F CE  1 
ATOM   9414  N  NZ  . LYS F 3 72  ? 50.419  -7.490  142.096 1.00 71.69  ? 159 LYS F NZ  1 
ATOM   9415  N  N   . GLY F 3 73  ? 46.804  -0.901  143.436 1.00 59.46  ? 160 GLY F N   1 
ATOM   9416  C  CA  . GLY F 3 73  ? 46.277  0.176   144.259 1.00 59.97  ? 160 GLY F CA  1 
ATOM   9417  C  C   . GLY F 3 73  ? 47.279  1.240   144.681 1.00 61.75  ? 160 GLY F C   1 
ATOM   9418  O  O   . GLY F 3 73  ? 47.032  1.990   145.636 1.00 65.97  ? 160 GLY F O   1 
ATOM   9419  N  N   . ALA F 3 74  ? 48.408  1.311   143.980 1.00 60.03  ? 161 ALA F N   1 
ATOM   9420  C  CA  . ALA F 3 74  ? 49.436  2.291   144.294 1.00 58.14  ? 161 ALA F CA  1 
ATOM   9421  C  C   . ALA F 3 74  ? 48.984  3.673   143.829 1.00 58.53  ? 161 ALA F C   1 
ATOM   9422  O  O   . ALA F 3 74  ? 48.473  3.831   142.718 1.00 59.81  ? 161 ALA F O   1 
ATOM   9423  C  CB  . ALA F 3 74  ? 50.729  1.903   143.633 1.00 60.13  ? 161 ALA F CB  1 
ATOM   9424  N  N   . LYS F 3 75  ? 49.190  4.675   144.673 1.00 55.54  ? 162 LYS F N   1 
ATOM   9425  C  CA  . LYS F 3 75  ? 48.767  6.024   144.349 1.00 52.05  ? 162 LYS F CA  1 
ATOM   9426  C  C   . LYS F 3 75  ? 49.905  7.006   144.168 1.00 47.92  ? 162 LYS F C   1 
ATOM   9427  O  O   . LYS F 3 75  ? 49.723  8.029   143.517 1.00 50.24  ? 162 LYS F O   1 
ATOM   9428  C  CB  . LYS F 3 75  ? 47.834  6.552   145.452 1.00 60.42  ? 162 LYS F CB  1 
ATOM   9429  C  CG  . LYS F 3 75  ? 48.539  6.944   146.783 1.00 68.27  ? 162 LYS F CG  1 
ATOM   9430  C  CD  . LYS F 3 75  ? 49.238  5.752   147.469 1.00 72.49  ? 162 LYS F CD  1 
ATOM   9431  C  CE  . LYS F 3 75  ? 49.984  6.148   148.757 1.00 72.62  ? 162 LYS F CE  1 
ATOM   9432  N  NZ  . LYS F 3 75  ? 51.241  6.926   148.536 1.00 71.47  ? 162 LYS F NZ  1 
ATOM   9433  N  N   . GLN F 3 76  ? 51.080  6.699   144.714 1.00 47.17  ? 163 GLN F N   1 
ATOM   9434  C  CA  . GLN F 3 76  ? 52.194  7.640   144.644 1.00 50.26  ? 163 GLN F CA  1 
ATOM   9435  C  C   . GLN F 3 76  ? 53.456  7.203   143.924 1.00 44.60  ? 163 GLN F C   1 
ATOM   9436  O  O   . GLN F 3 76  ? 53.847  6.044   143.959 1.00 44.41  ? 163 GLN F O   1 
ATOM   9437  C  CB  . GLN F 3 76  ? 52.551  8.095   146.061 1.00 58.75  ? 163 GLN F CB  1 
ATOM   9438  C  CG  . GLN F 3 76  ? 53.223  9.457   146.153 1.00 65.75  ? 163 GLN F CG  1 
ATOM   9439  C  CD  . GLN F 3 76  ? 52.505  10.382  147.134 1.00 69.93  ? 163 GLN F CD  1 
ATOM   9440  O  OE1 . GLN F 3 76  ? 51.891  11.385  146.738 1.00 71.19  ? 163 GLN F OE1 1 
ATOM   9441  N  NE2 . GLN F 3 76  ? 52.565  10.039  148.419 1.00 70.48  ? 163 GLN F NE2 1 
ATOM   9442  N  N   . SER F 3 77  ? 54.102  8.164   143.283 1.00 43.06  ? 164 SER F N   1 
ATOM   9443  C  CA  . SER F 3 77  ? 55.338  7.902   142.570 1.00 45.58  ? 164 SER F CA  1 
ATOM   9444  C  C   . SER F 3 77  ? 56.432  7.647   143.587 1.00 47.08  ? 164 SER F C   1 
ATOM   9445  O  O   . SER F 3 77  ? 56.779  8.529   144.383 1.00 51.67  ? 164 SER F O   1 
ATOM   9446  C  CB  . SER F 3 77  ? 55.728  9.105   141.716 1.00 48.46  ? 164 SER F CB  1 
ATOM   9447  O  OG  . SER F 3 77  ? 54.738  9.372   140.750 1.00 50.28  ? 164 SER F OG  1 
ATOM   9448  N  N   . GLY F 3 78  ? 56.979  6.442   143.558 1.00 45.05  ? 165 GLY F N   1 
ATOM   9449  C  CA  . GLY F 3 78  ? 58.039  6.112   144.483 1.00 45.34  ? 165 GLY F CA  1 
ATOM   9450  C  C   . GLY F 3 78  ? 58.787  4.881   144.033 1.00 43.47  ? 165 GLY F C   1 
ATOM   9451  O  O   . GLY F 3 78  ? 58.551  4.346   142.947 1.00 40.45  ? 165 GLY F O   1 
ATOM   9452  N  N   . LEU F 3 79  ? 59.715  4.449   144.878 1.00 40.38  ? 166 LEU F N   1 
ATOM   9453  C  CA  . LEU F 3 79  ? 60.519  3.272   144.605 1.00 36.48  ? 166 LEU F CA  1 
ATOM   9454  C  C   . LEU F 3 79  ? 59.679  2.050   144.933 1.00 39.56  ? 166 LEU F C   1 
ATOM   9455  O  O   . LEU F 3 79  ? 58.851  2.091   145.848 1.00 44.14  ? 166 LEU F O   1 
ATOM   9456  C  CB  . LEU F 3 79  ? 61.787  3.295   145.451 1.00 29.62  ? 166 LEU F CB  1 
ATOM   9457  C  CG  . LEU F 3 79  ? 62.578  4.589   145.277 1.00 28.69  ? 166 LEU F CG  1 
ATOM   9458  C  CD1 . LEU F 3 79  ? 63.911  4.467   146.004 1.00 29.75  ? 166 LEU F CD1 1 
ATOM   9459  C  CD2 . LEU F 3 79  ? 62.782  4.894   143.791 1.00 28.70  ? 166 LEU F CD2 1 
ATOM   9460  N  N   . TYR F 3 80  ? 59.824  1.004   144.123 1.00 38.54  ? 167 TYR F N   1 
ATOM   9461  C  CA  . TYR F 3 80  ? 59.084  -0.250  144.312 1.00 37.49  ? 167 TYR F CA  1 
ATOM   9462  C  C   . TYR F 3 80  ? 59.905  -1.442  143.836 1.00 41.21  ? 167 TYR F C   1 
ATOM   9463  O  O   . TYR F 3 80  ? 60.824  -1.305  143.022 1.00 45.01  ? 167 TYR F O   1 
ATOM   9464  C  CB  . TYR F 3 80  ? 57.782  -0.260  143.509 1.00 29.38  ? 167 TYR F CB  1 
ATOM   9465  C  CG  . TYR F 3 80  ? 56.744  0.737   143.927 1.00 28.64  ? 167 TYR F CG  1 
ATOM   9466  C  CD1 . TYR F 3 80  ? 56.736  2.025   143.394 1.00 31.01  ? 167 TYR F CD1 1 
ATOM   9467  C  CD2 . TYR F 3 80  ? 55.722  0.379   144.799 1.00 32.47  ? 167 TYR F CD2 1 
ATOM   9468  C  CE1 . TYR F 3 80  ? 55.732  2.933   143.707 1.00 33.57  ? 167 TYR F CE1 1 
ATOM   9469  C  CE2 . TYR F 3 80  ? 54.707  1.281   145.124 1.00 35.82  ? 167 TYR F CE2 1 
ATOM   9470  C  CZ  . TYR F 3 80  ? 54.719  2.551   144.569 1.00 39.29  ? 167 TYR F CZ  1 
ATOM   9471  O  OH  . TYR F 3 80  ? 53.699  3.423   144.846 1.00 43.00  ? 167 TYR F OH  1 
ATOM   9472  N  N   . PHE F 3 81  ? 59.574  -2.614  144.357 1.00 40.16  ? 168 PHE F N   1 
ATOM   9473  C  CA  . PHE F 3 81  ? 60.254  -3.831  143.955 1.00 38.16  ? 168 PHE F CA  1 
ATOM   9474  C  C   . PHE F 3 81  ? 59.383  -4.503  142.939 1.00 37.81  ? 168 PHE F C   1 
ATOM   9475  O  O   . PHE F 3 81  ? 58.188  -4.694  143.153 1.00 33.55  ? 168 PHE F O   1 
ATOM   9476  C  CB  . PHE F 3 81  ? 60.448  -4.783  145.127 1.00 30.87  ? 168 PHE F CB  1 
ATOM   9477  C  CG  . PHE F 3 81  ? 61.752  -4.627  145.807 1.00 28.88  ? 168 PHE F CG  1 
ATOM   9478  C  CD1 . PHE F 3 81  ? 62.918  -4.993  145.174 1.00 28.17  ? 168 PHE F CD1 1 
ATOM   9479  C  CD2 . PHE F 3 81  ? 61.824  -4.086  147.068 1.00 25.25  ? 168 PHE F CD2 1 
ATOM   9480  C  CE1 . PHE F 3 81  ? 64.130  -4.817  145.790 1.00 27.92  ? 168 PHE F CE1 1 
ATOM   9481  C  CE2 . PHE F 3 81  ? 63.035  -3.912  147.684 1.00 24.88  ? 168 PHE F CE2 1 
ATOM   9482  C  CZ  . PHE F 3 81  ? 64.187  -4.276  147.046 1.00 24.91  ? 168 PHE F CZ  1 
ATOM   9483  N  N   . ILE F 3 82  ? 59.959  -4.798  141.792 1.00 39.32  ? 169 ILE F N   1 
ATOM   9484  C  CA  . ILE F 3 82  ? 59.201  -5.478  140.771 1.00 35.76  ? 169 ILE F CA  1 
ATOM   9485  C  C   . ILE F 3 82  ? 60.005  -6.669  140.372 1.00 43.13  ? 169 ILE F C   1 
ATOM   9486  O  O   . ILE F 3 82  ? 61.226  -6.698  140.535 1.00 46.67  ? 169 ILE F O   1 
ATOM   9487  C  CB  . ILE F 3 82  ? 58.925  -4.617  139.534 1.00 32.91  ? 169 ILE F CB  1 
ATOM   9488  C  CG1 . ILE F 3 82  ? 60.213  -4.329  138.775 1.00 29.79  ? 169 ILE F CG1 1 
ATOM   9489  C  CG2 . ILE F 3 82  ? 58.224  -3.333  139.936 1.00 36.56  ? 169 ILE F CG2 1 
ATOM   9490  C  CD1 . ILE F 3 82  ? 59.985  -3.573  137.498 1.00 23.98  ? 169 ILE F CD1 1 
ATOM   9491  N  N   . LYS F 3 83  ? 59.296  -7.683  139.915 1.00 47.90  ? 170 LYS F N   1 
ATOM   9492  C  CA  . LYS F 3 83  ? 59.915  -8.914  139.484 1.00 53.34  ? 170 LYS F CA  1 
ATOM   9493  C  C   . LYS F 3 83  ? 59.155  -9.345  138.241 1.00 54.15  ? 170 LYS F C   1 
ATOM   9494  O  O   . LYS F 3 83  ? 58.013  -9.802  138.330 1.00 52.30  ? 170 LYS F O   1 
ATOM   9495  C  CB  . LYS F 3 83  ? 59.806  -9.995  140.575 1.00 55.95  ? 170 LYS F CB  1 
ATOM   9496  C  CG  . LYS F 3 83  ? 60.520  -11.309 140.233 1.00 57.97  ? 170 LYS F CG  1 
ATOM   9497  C  CD  . LYS F 3 83  ? 60.153  -12.435 141.198 1.00 59.34  ? 170 LYS F CD  1 
ATOM   9498  C  CE  . LYS F 3 83  ? 60.497  -13.803 140.611 1.00 60.81  ? 170 LYS F CE  1 
ATOM   9499  N  NZ  . LYS F 3 83  ? 59.750  -14.076 139.331 1.00 61.02  ? 170 LYS F NZ  1 
ATOM   9500  N  N   . PRO F 3 84  ? 59.729  -9.083  137.057 1.00 53.11  ? 171 PRO F N   1 
ATOM   9501  C  CA  . PRO F 3 84  ? 59.130  -9.443  135.771 1.00 51.28  ? 171 PRO F CA  1 
ATOM   9502  C  C   . PRO F 3 84  ? 58.976  -10.958 135.689 1.00 53.40  ? 171 PRO F C   1 
ATOM   9503  O  O   . PRO F 3 84  ? 59.729  -11.704 136.318 1.00 55.01  ? 171 PRO F O   1 
ATOM   9504  C  CB  . PRO F 3 84  ? 60.161  -8.934  134.771 1.00 52.86  ? 171 PRO F CB  1 
ATOM   9505  C  CG  . PRO F 3 84  ? 60.702  -7.735  135.449 1.00 52.48  ? 171 PRO F CG  1 
ATOM   9506  C  CD  . PRO F 3 84  ? 60.914  -8.230  136.857 1.00 52.58  ? 171 PRO F CD  1 
ATOM   9507  N  N   . LEU F 3 85  ? 58.019  -11.407 134.889 1.00 55.44  ? 172 LEU F N   1 
ATOM   9508  C  CA  . LEU F 3 85  ? 57.737  -12.825 134.747 1.00 57.68  ? 172 LEU F CA  1 
ATOM   9509  C  C   . LEU F 3 85  ? 58.932  -13.760 134.620 1.00 59.78  ? 172 LEU F C   1 
ATOM   9510  O  O   . LEU F 3 85  ? 59.131  -14.645 135.455 1.00 66.97  ? 172 LEU F O   1 
ATOM   9511  C  CB  . LEU F 3 85  ? 56.755  -13.030 133.609 1.00 56.41  ? 172 LEU F CB  1 
ATOM   9512  C  CG  . LEU F 3 85  ? 55.432  -12.337 133.952 1.00 62.96  ? 172 LEU F CG  1 
ATOM   9513  C  CD1 . LEU F 3 85  ? 54.452  -12.447 132.810 1.00 63.39  ? 172 LEU F CD1 1 
ATOM   9514  C  CD2 . LEU F 3 85  ? 54.831  -12.940 135.219 1.00 69.38  ? 172 LEU F CD2 1 
ATOM   9515  N  N   . LYS F 3 86  ? 59.770  -13.518 133.628 1.00 60.31  ? 173 LYS F N   1 
ATOM   9516  C  CA  . LYS F 3 86  ? 60.938  -14.361 133.397 1.00 65.09  ? 173 LYS F CA  1 
ATOM   9517  C  C   . LYS F 3 86  ? 62.092  -14.105 134.376 1.00 63.98  ? 173 LYS F C   1 
ATOM   9518  O  O   . LYS F 3 86  ? 63.054  -14.871 134.430 1.00 69.61  ? 173 LYS F O   1 
ATOM   9519  C  CB  . LYS F 3 86  ? 61.404  -14.161 131.951 1.00 70.57  ? 173 LYS F CB  1 
ATOM   9520  C  CG  . LYS F 3 86  ? 62.401  -15.174 131.412 1.00 72.38  ? 173 LYS F CG  1 
ATOM   9521  C  CD  . LYS F 3 86  ? 62.643  -14.933 129.914 1.00 76.04  ? 173 LYS F CD  1 
ATOM   9522  C  CE  . LYS F 3 86  ? 63.047  -13.474 129.632 1.00 75.86  ? 173 LYS F CE  1 
ATOM   9523  N  NZ  . LYS F 3 86  ? 63.378  -13.208 128.200 1.00 72.84  ? 173 LYS F NZ  1 
ATOM   9524  N  N   . ALA F 3 87  ? 61.988  -13.041 135.163 1.00 60.19  ? 174 ALA F N   1 
ATOM   9525  C  CA  . ALA F 3 87  ? 63.035  -12.701 136.120 1.00 57.85  ? 174 ALA F CA  1 
ATOM   9526  C  C   . ALA F 3 87  ? 63.158  -13.696 137.280 1.00 57.02  ? 174 ALA F C   1 
ATOM   9527  O  O   . ALA F 3 87  ? 62.173  -14.322 137.679 1.00 58.86  ? 174 ALA F O   1 
ATOM   9528  C  CB  . ALA F 3 87  ? 62.803  -11.296 136.657 1.00 56.59  ? 174 ALA F CB  1 
ATOM   9529  N  N   . ASN F 3 88  ? 64.377  -13.857 137.793 1.00 55.64  ? 175 ASN F N   1 
ATOM   9530  C  CA  . ASN F 3 88  ? 64.636  -14.745 138.925 1.00 57.23  ? 175 ASN F CA  1 
ATOM   9531  C  C   . ASN F 3 88  ? 64.710  -13.971 140.236 1.00 53.99  ? 175 ASN F C   1 
ATOM   9532  O  O   . ASN F 3 88  ? 64.170  -14.422 141.241 1.00 60.80  ? 175 ASN F O   1 
ATOM   9533  C  CB  . ASN F 3 88  ? 65.910  -15.573 138.712 1.00 64.27  ? 175 ASN F CB  1 
ATOM   9534  C  CG  . ASN F 3 88  ? 67.056  -14.755 138.148 1.00 73.17  ? 175 ASN F CG  1 
ATOM   9535  O  OD1 . ASN F 3 88  ? 67.107  -14.478 136.943 1.00 78.40  ? 175 ASN F OD1 1 
ATOM   9536  N  ND2 . ASN F 3 88  ? 67.993  -14.373 139.014 1.00 75.36  ? 175 ASN F ND2 1 
ATOM   9537  N  N   . GLN F 3 89  ? 65.369  -12.812 140.213 1.00 48.85  ? 176 GLN F N   1 
ATOM   9538  C  CA  . GLN F 3 89  ? 65.488  -11.959 141.387 1.00 47.76  ? 176 GLN F CA  1 
ATOM   9539  C  C   . GLN F 3 89  ? 64.862  -10.583 141.130 1.00 43.27  ? 176 GLN F C   1 
ATOM   9540  O  O   . GLN F 3 89  ? 65.114  -9.960  140.095 1.00 37.14  ? 176 GLN F O   1 
ATOM   9541  C  CB  . GLN F 3 89  ? 66.955  -11.821 141.837 1.00 55.52  ? 176 GLN F CB  1 
ATOM   9542  C  CG  . GLN F 3 89  ? 67.787  -10.718 141.161 1.00 64.70  ? 176 GLN F CG  1 
ATOM   9543  C  CD  . GLN F 3 89  ? 68.667  -11.222 140.011 1.00 70.62  ? 176 GLN F CD  1 
ATOM   9544  O  OE1 . GLN F 3 89  ? 69.689  -11.886 140.227 1.00 75.69  ? 176 GLN F OE1 1 
ATOM   9545  N  NE2 . GLN F 3 89  ? 68.284  -10.882 138.787 1.00 71.99  ? 176 GLN F NE2 1 
ATOM   9546  N  N   . GLN F 3 90  ? 64.039  -10.134 142.079 1.00 43.23  ? 177 GLN F N   1 
ATOM   9547  C  CA  . GLN F 3 90  ? 63.351  -8.843  142.007 1.00 40.53  ? 177 GLN F CA  1 
ATOM   9548  C  C   . GLN F 3 90  ? 64.328  -7.670  142.051 1.00 35.07  ? 177 GLN F C   1 
ATOM   9549  O  O   . GLN F 3 90  ? 65.534  -7.854  142.274 1.00 33.05  ? 177 GLN F O   1 
ATOM   9550  C  CB  . GLN F 3 90  ? 62.354  -8.697  143.166 1.00 41.24  ? 177 GLN F CB  1 
ATOM   9551  C  CG  . GLN F 3 90  ? 63.006  -8.574  144.546 1.00 45.03  ? 177 GLN F CG  1 
ATOM   9552  C  CD  . GLN F 3 90  ? 61.989  -8.417  145.665 1.00 50.08  ? 177 GLN F CD  1 
ATOM   9553  O  OE1 . GLN F 3 90  ? 62.287  -8.693  146.826 1.00 51.34  ? 177 GLN F OE1 1 
ATOM   9554  N  NE2 . GLN F 3 90  ? 60.780  -7.976  145.318 1.00 55.10  ? 177 GLN F NE2 1 
ATOM   9555  N  N   . PHE F 3 91  ? 63.804  -6.468  141.813 1.00 27.89  ? 178 PHE F N   1 
ATOM   9556  C  CA  . PHE F 3 91  ? 64.629  -5.275  141.861 1.00 27.91  ? 178 PHE F CA  1 
ATOM   9557  C  C   . PHE F 3 91  ? 63.834  -4.001  142.016 1.00 24.71  ? 178 PHE F C   1 
ATOM   9558  O  O   . PHE F 3 91  ? 62.647  -3.924  141.703 1.00 19.58  ? 178 PHE F O   1 
ATOM   9559  C  CB  . PHE F 3 91  ? 65.548  -5.185  140.657 1.00 26.94  ? 178 PHE F CB  1 
ATOM   9560  C  CG  . PHE F 3 91  ? 64.852  -5.428  139.371 1.00 25.90  ? 178 PHE F CG  1 
ATOM   9561  C  CD1 . PHE F 3 91  ? 64.075  -4.436  138.787 1.00 27.91  ? 178 PHE F CD1 1 
ATOM   9562  C  CD2 . PHE F 3 91  ? 64.946  -6.663  138.744 1.00 24.08  ? 178 PHE F CD2 1 
ATOM   9563  C  CE1 . PHE F 3 91  ? 63.396  -4.673  137.587 1.00 25.94  ? 178 PHE F CE1 1 
ATOM   9564  C  CE2 . PHE F 3 91  ? 64.272  -6.913  137.544 1.00 21.71  ? 178 PHE F CE2 1 
ATOM   9565  C  CZ  . PHE F 3 91  ? 63.496  -5.916  136.966 1.00 24.38  ? 178 PHE F CZ  1 
ATOM   9566  N  N   . LEU F 3 92  ? 64.526  -3.002  142.528 1.00 22.84  ? 179 LEU F N   1 
ATOM   9567  C  CA  . LEU F 3 92  ? 63.935  -1.718  142.780 1.00 26.70  ? 179 LEU F CA  1 
ATOM   9568  C  C   . LEU F 3 92  ? 63.924  -0.902  141.503 1.00 29.70  ? 179 LEU F C   1 
ATOM   9569  O  O   . LEU F 3 92  ? 64.867  -0.972  140.688 1.00 25.12  ? 179 LEU F O   1 
ATOM   9570  C  CB  . LEU F 3 92  ? 64.737  -0.999  143.864 1.00 22.98  ? 179 LEU F CB  1 
ATOM   9571  C  CG  . LEU F 3 92  ? 64.123  0.216   144.532 1.00 23.36  ? 179 LEU F CG  1 
ATOM   9572  C  CD1 . LEU F 3 92  ? 62.903  -0.205  145.339 1.00 17.05  ? 179 LEU F CD1 1 
ATOM   9573  C  CD2 . LEU F 3 92  ? 65.176  0.847   145.442 1.00 28.86  ? 179 LEU F CD2 1 
ATOM   9574  N  N   . VAL F 3 93  ? 62.830  -0.159  141.340 1.00 27.54  ? 180 VAL F N   1 
ATOM   9575  C  CA  . VAL F 3 93  ? 62.610  0.723   140.212 1.00 27.16  ? 180 VAL F CA  1 
ATOM   9576  C  C   . VAL F 3 93  ? 61.842  1.922   140.705 1.00 25.45  ? 180 VAL F C   1 
ATOM   9577  O  O   . VAL F 3 93  ? 61.289  1.903   141.800 1.00 21.12  ? 180 VAL F O   1 
ATOM   9578  C  CB  . VAL F 3 93  ? 61.740  0.066   139.130 1.00 30.88  ? 180 VAL F CB  1 
ATOM   9579  C  CG1 . VAL F 3 93  ? 62.353  -1.238  138.693 1.00 29.46  ? 180 VAL F CG1 1 
ATOM   9580  C  CG2 . VAL F 3 93  ? 60.326  -0.144  139.628 1.00 28.58  ? 180 VAL F CG2 1 
ATOM   9581  N  N   . TYR F 3 94  ? 61.803  2.966   139.889 1.00 28.07  ? 181 TYR F N   1 
ATOM   9582  C  CA  . TYR F 3 94  ? 61.054  4.149   140.255 1.00 30.47  ? 181 TYR F CA  1 
ATOM   9583  C  C   . TYR F 3 94  ? 59.772  4.131   139.434 1.00 29.23  ? 181 TYR F C   1 
ATOM   9584  O  O   . TYR F 3 94  ? 59.798  4.040   138.215 1.00 27.16  ? 181 TYR F O   1 
ATOM   9585  C  CB  . TYR F 3 94  ? 61.852  5.435   139.995 1.00 38.05  ? 181 TYR F CB  1 
ATOM   9586  C  CG  . TYR F 3 94  ? 61.108  6.701   140.378 1.00 47.02  ? 181 TYR F CG  1 
ATOM   9587  C  CD1 . TYR F 3 94  ? 60.845  6.999   141.716 1.00 51.55  ? 181 TYR F CD1 1 
ATOM   9588  C  CD2 . TYR F 3 94  ? 60.629  7.581   139.403 1.00 49.81  ? 181 TYR F CD2 1 
ATOM   9589  C  CE1 . TYR F 3 94  ? 60.118  8.142   142.077 1.00 56.50  ? 181 TYR F CE1 1 
ATOM   9590  C  CE2 . TYR F 3 94  ? 59.900  8.725   139.752 1.00 55.14  ? 181 TYR F CE2 1 
ATOM   9591  C  CZ  . TYR F 3 94  ? 59.648  9.000   141.092 1.00 59.29  ? 181 TYR F CZ  1 
ATOM   9592  O  OH  . TYR F 3 94  ? 58.928  10.121  141.455 1.00 64.00  ? 181 TYR F OH  1 
ATOM   9593  N  N   . CYS F 3 95  ? 58.643  4.103   140.120 1.00 30.39  ? 182 CYS F N   1 
ATOM   9594  C  CA  . CYS F 3 95  ? 57.367  4.122   139.433 1.00 28.74  ? 182 CYS F CA  1 
ATOM   9595  C  C   . CYS F 3 95  ? 56.756  5.517   139.485 1.00 37.42  ? 182 CYS F C   1 
ATOM   9596  O  O   . CYS F 3 95  ? 56.802  6.205   140.520 1.00 39.27  ? 182 CYS F O   1 
ATOM   9597  C  CB  . CYS F 3 95  ? 56.406  3.119   140.042 1.00 25.43  ? 182 CYS F CB  1 
ATOM   9598  S  SG  . CYS F 3 95  ? 56.965  1.404   139.868 1.00 31.14  ? 182 CYS F SG  1 
ATOM   9599  N  N   . GLU F 3 96  ? 56.221  5.934   138.342 1.00 41.67  ? 183 GLU F N   1 
ATOM   9600  C  CA  . GLU F 3 96  ? 55.573  7.233   138.193 1.00 45.52  ? 183 GLU F CA  1 
ATOM   9601  C  C   . GLU F 3 96  ? 54.070  6.971   138.061 1.00 43.47  ? 183 GLU F C   1 
ATOM   9602  O  O   . GLU F 3 96  ? 53.615  6.434   137.053 1.00 41.47  ? 183 GLU F O   1 
ATOM   9603  C  CB  . GLU F 3 96  ? 56.102  7.963   136.948 1.00 44.11  ? 183 GLU F CB  1 
ATOM   9604  C  CG  . GLU F 3 96  ? 55.533  9.350   136.782 1.00 47.73  ? 183 GLU F CG  1 
ATOM   9605  C  CD  . GLU F 3 96  ? 56.056  10.056  135.560 1.00 55.31  ? 183 GLU F CD  1 
ATOM   9606  O  OE1 . GLU F 3 96  ? 57.289  10.258  135.454 1.00 61.13  ? 183 GLU F OE1 1 
ATOM   9607  O  OE2 . GLU F 3 96  ? 55.224  10.424  134.709 1.00 57.13  ? 183 GLU F OE2 1 
ATOM   9608  N  N   . ILE F 3 97  ? 53.308  7.330   139.089 1.00 41.97  ? 184 ILE F N   1 
ATOM   9609  C  CA  . ILE F 3 97  ? 51.871  7.094   139.075 1.00 41.58  ? 184 ILE F CA  1 
ATOM   9610  C  C   . ILE F 3 97  ? 51.071  8.362   139.029 1.00 43.61  ? 184 ILE F C   1 
ATOM   9611  O  O   . ILE F 3 97  ? 51.178  9.200   139.923 1.00 48.15  ? 184 ILE F O   1 
ATOM   9612  C  CB  . ILE F 3 97  ? 51.410  6.330   140.331 1.00 39.06  ? 184 ILE F CB  1 
ATOM   9613  C  CG1 . ILE F 3 97  ? 52.223  5.041   140.496 1.00 35.54  ? 184 ILE F CG1 1 
ATOM   9614  C  CG2 . ILE F 3 97  ? 49.901  6.035   140.246 1.00 35.75  ? 184 ILE F CG2 1 
ATOM   9615  C  CD1 . ILE F 3 97  ? 52.120  4.444   141.879 1.00 35.76  ? 184 ILE F CD1 1 
ATOM   9616  N  N   . ASP F 3 98  ? 50.249  8.496   138.003 1.00 46.58  ? 185 ASP F N   1 
ATOM   9617  C  CA  . ASP F 3 98  ? 49.419  9.676   137.907 1.00 55.78  ? 185 ASP F CA  1 
ATOM   9618  C  C   . ASP F 3 98  ? 48.069  9.381   138.538 1.00 61.18  ? 185 ASP F C   1 
ATOM   9619  O  O   . ASP F 3 98  ? 47.816  8.263   139.007 1.00 60.29  ? 185 ASP F O   1 
ATOM   9620  C  CB  . ASP F 3 98  ? 49.258  10.130  136.454 1.00 60.09  ? 185 ASP F CB  1 
ATOM   9621  C  CG  . ASP F 3 98  ? 48.785  9.019   135.537 1.00 63.75  ? 185 ASP F CG  1 
ATOM   9622  O  OD1 . ASP F 3 98  ? 48.082  8.091   136.001 1.00 61.44  ? 185 ASP F OD1 1 
ATOM   9623  O  OD2 . ASP F 3 98  ? 49.113  9.090   134.333 1.00 65.85  ? 185 ASP F OD2 1 
ATOM   9624  N  N   . GLY F 3 99  ? 47.212  10.397  138.550 1.00 66.00  ? 186 GLY F N   1 
ATOM   9625  C  CA  . GLY F 3 99  ? 45.888  10.249  139.118 1.00 67.05  ? 186 GLY F CA  1 
ATOM   9626  C  C   . GLY F 3 99  ? 44.986  9.412   138.236 1.00 66.50  ? 186 GLY F C   1 
ATOM   9627  O  O   . GLY F 3 99  ? 44.079  8.733   138.730 1.00 70.81  ? 186 GLY F O   1 
ATOM   9628  N  N   . SER F 3 100 ? 45.244  9.451   136.932 1.00 63.46  ? 187 SER F N   1 
ATOM   9629  C  CA  . SER F 3 100 ? 44.458  8.692   135.968 1.00 63.63  ? 187 SER F CA  1 
ATOM   9630  C  C   . SER F 3 100 ? 44.636  7.181   136.118 1.00 63.22  ? 187 SER F C   1 
ATOM   9631  O  O   . SER F 3 100 ? 43.861  6.399   135.558 1.00 66.01  ? 187 SER F O   1 
ATOM   9632  C  CB  . SER F 3 100 ? 44.820  9.132   134.561 1.00 65.04  ? 187 SER F CB  1 
ATOM   9633  O  OG  . SER F 3 100 ? 46.221  9.264   134.443 1.00 64.63  ? 187 SER F OG  1 
ATOM   9634  N  N   . GLY F 3 101 ? 45.665  6.778   136.860 1.00 60.36  ? 188 GLY F N   1 
ATOM   9635  C  CA  . GLY F 3 101 ? 45.902  5.364   137.095 1.00 58.18  ? 188 GLY F CA  1 
ATOM   9636  C  C   . GLY F 3 101 ? 47.012  4.735   136.283 1.00 57.22  ? 188 GLY F C   1 
ATOM   9637  O  O   . GLY F 3 101 ? 47.170  3.513   136.280 1.00 58.25  ? 188 GLY F O   1 
ATOM   9638  N  N   . ASN F 3 102 ? 47.765  5.558   135.568 1.00 53.95  ? 189 ASN F N   1 
ATOM   9639  C  CA  . ASN F 3 102 ? 48.855  5.055   134.758 1.00 49.27  ? 189 ASN F CA  1 
ATOM   9640  C  C   . ASN F 3 102 ? 50.102  4.894   135.577 1.00 49.69  ? 189 ASN F C   1 
ATOM   9641  O  O   . ASN F 3 102 ? 50.499  5.811   136.307 1.00 49.38  ? 189 ASN F O   1 
ATOM   9642  C  CB  . ASN F 3 102 ? 49.117  5.991   133.603 1.00 53.05  ? 189 ASN F CB  1 
ATOM   9643  C  CG  . ASN F 3 102 ? 47.931  6.108   132.702 1.00 55.72  ? 189 ASN F CG  1 
ATOM   9644  O  OD1 . ASN F 3 102 ? 47.882  5.483   131.645 1.00 55.37  ? 189 ASN F OD1 1 
ATOM   9645  N  ND2 . ASN F 3 102 ? 46.929  6.866   133.138 1.00 57.40  ? 189 ASN F ND2 1 
ATOM   9646  N  N   . GLY F 3 103 ? 50.712  3.718   135.433 1.00 49.91  ? 190 GLY F N   1 
ATOM   9647  C  CA  . GLY F 3 103 ? 51.923  3.379   136.154 1.00 47.50  ? 190 GLY F CA  1 
ATOM   9648  C  C   . GLY F 3 103 ? 53.125  3.262   135.246 1.00 43.61  ? 190 GLY F C   1 
ATOM   9649  O  O   . GLY F 3 103 ? 53.403  2.205   134.666 1.00 42.51  ? 190 GLY F O   1 
ATOM   9650  N  N   . TRP F 3 104 ? 53.830  4.379   135.128 1.00 41.03  ? 191 TRP F N   1 
ATOM   9651  C  CA  . TRP F 3 104 ? 55.024  4.475   134.312 1.00 42.51  ? 191 TRP F CA  1 
ATOM   9652  C  C   . TRP F 3 104 ? 56.213  3.900   135.040 1.00 38.36  ? 191 TRP F C   1 
ATOM   9653  O  O   . TRP F 3 104 ? 56.483  4.278   136.174 1.00 40.87  ? 191 TRP F O   1 
ATOM   9654  C  CB  . TRP F 3 104 ? 55.327  5.933   134.023 1.00 45.42  ? 191 TRP F CB  1 
ATOM   9655  C  CG  . TRP F 3 104 ? 54.374  6.564   133.103 1.00 46.09  ? 191 TRP F CG  1 
ATOM   9656  C  CD1 . TRP F 3 104 ? 53.316  7.346   133.434 1.00 43.92  ? 191 TRP F CD1 1 
ATOM   9657  C  CD2 . TRP F 3 104 ? 54.438  6.545   131.682 1.00 46.97  ? 191 TRP F CD2 1 
ATOM   9658  N  NE1 . TRP F 3 104 ? 52.719  7.833   132.302 1.00 43.50  ? 191 TRP F NE1 1 
ATOM   9659  C  CE2 . TRP F 3 104 ? 53.392  7.356   131.210 1.00 45.58  ? 191 TRP F CE2 1 
ATOM   9660  C  CE3 . TRP F 3 104 ? 55.288  5.923   130.757 1.00 47.06  ? 191 TRP F CE3 1 
ATOM   9661  C  CZ2 . TRP F 3 104 ? 53.168  7.569   129.848 1.00 50.75  ? 191 TRP F CZ2 1 
ATOM   9662  C  CZ3 . TRP F 3 104 ? 55.069  6.131   129.402 1.00 49.32  ? 191 TRP F CZ3 1 
ATOM   9663  C  CH2 . TRP F 3 104 ? 54.016  6.950   128.958 1.00 50.33  ? 191 TRP F CH2 1 
ATOM   9664  N  N   . THR F 3 105 ? 56.929  2.997   134.389 1.00 31.09  ? 192 THR F N   1 
ATOM   9665  C  CA  . THR F 3 105 ? 58.106  2.418   135.013 1.00 28.12  ? 192 THR F CA  1 
ATOM   9666  C  C   . THR F 3 105 ? 59.348  2.944   134.293 1.00 26.18  ? 192 THR F C   1 
ATOM   9667  O  O   . THR F 3 105 ? 59.735  2.462   133.241 1.00 30.48  ? 192 THR F O   1 
ATOM   9668  C  CB  . THR F 3 105 ? 58.020  0.872   135.086 1.00 24.41  ? 192 THR F CB  1 
ATOM   9669  O  OG1 . THR F 3 105 ? 59.316  0.302   134.900 1.00 23.74  ? 192 THR F OG1 1 
ATOM   9670  C  CG2 . THR F 3 105 ? 57.021  0.324   134.076 1.00 17.98  ? 192 THR F CG2 1 
ATOM   9671  N  N   . VAL F 3 106 ? 59.900  4.005   134.863 1.00 21.68  ? 193 VAL F N   1 
ATOM   9672  C  CA  . VAL F 3 106 ? 61.067  4.729   134.363 1.00 22.59  ? 193 VAL F CA  1 
ATOM   9673  C  C   . VAL F 3 106 ? 62.412  3.985   134.337 1.00 17.23  ? 193 VAL F C   1 
ATOM   9674  O  O   . VAL F 3 106 ? 62.830  3.407   135.345 1.00 14.78  ? 193 VAL F O   1 
ATOM   9675  C  CB  . VAL F 3 106 ? 61.245  5.997   135.215 1.00 26.18  ? 193 VAL F CB  1 
ATOM   9676  C  CG1 . VAL F 3 106 ? 62.328  6.890   134.638 1.00 28.60  ? 193 VAL F CG1 1 
ATOM   9677  C  CG2 . VAL F 3 106 ? 59.908  6.718   135.349 1.00 21.01  ? 193 VAL F CG2 1 
ATOM   9678  N  N   . PHE F 3 107 ? 63.135  4.086   133.221 1.00 16.26  ? 194 PHE F N   1 
ATOM   9679  C  CA  . PHE F 3 107 ? 64.422  3.414   133.143 1.00 18.36  ? 194 PHE F CA  1 
ATOM   9680  C  C   . PHE F 3 107 ? 65.637  4.280   132.826 1.00 15.38  ? 194 PHE F C   1 
ATOM   9681  O  O   . PHE F 3 107 ? 66.730  3.755   132.605 1.00 17.54  ? 194 PHE F O   1 
ATOM   9682  C  CB  . PHE F 3 107 ? 64.350  2.229   132.192 1.00 13.74  ? 194 PHE F CB  1 
ATOM   9683  C  CG  . PHE F 3 107 ? 64.321  2.597   130.757 1.00 18.25  ? 194 PHE F CG  1 
ATOM   9684  C  CD1 . PHE F 3 107 ? 65.512  2.792   130.042 1.00 23.40  ? 194 PHE F CD1 1 
ATOM   9685  C  CD2 . PHE F 3 107 ? 63.115  2.695   130.088 1.00 17.10  ? 194 PHE F CD2 1 
ATOM   9686  C  CE1 . PHE F 3 107 ? 65.496  3.079   128.666 1.00 11.92  ? 194 PHE F CE1 1 
ATOM   9687  C  CE2 . PHE F 3 107 ? 63.085  2.980   128.720 1.00 16.94  ? 194 PHE F CE2 1 
ATOM   9688  C  CZ  . PHE F 3 107 ? 64.282  3.172   128.010 1.00 11.38  ? 194 PHE F CZ  1 
ATOM   9689  N  N   . GLN F 3 108 ? 65.463  5.597   132.876 1.00 9.30   ? 195 GLN F N   1 
ATOM   9690  C  CA  . GLN F 3 108 ? 66.536  6.520   132.574 1.00 13.16  ? 195 GLN F CA  1 
ATOM   9691  C  C   . GLN F 3 108 ? 66.098  7.932   132.937 1.00 18.31  ? 195 GLN F C   1 
ATOM   9692  O  O   . GLN F 3 108 ? 64.954  8.317   132.666 1.00 25.53  ? 195 GLN F O   1 
ATOM   9693  C  CB  . GLN F 3 108 ? 66.847  6.419   131.076 1.00 16.38  ? 195 GLN F CB  1 
ATOM   9694  C  CG  . GLN F 3 108 ? 66.857  7.734   130.291 1.00 21.52  ? 195 GLN F CG  1 
ATOM   9695  C  CD  . GLN F 3 108 ? 68.219  8.378   130.238 1.00 22.73  ? 195 GLN F CD  1 
ATOM   9696  O  OE1 . GLN F 3 108 ? 68.345  9.561   129.941 1.00 19.01  ? 195 GLN F OE1 1 
ATOM   9697  N  NE2 . GLN F 3 108 ? 69.255  7.596   130.528 1.00 25.66  ? 195 GLN F NE2 1 
ATOM   9698  N  N   . LYS F 3 109 ? 66.995  8.707   133.542 1.00 18.02  ? 196 LYS F N   1 
ATOM   9699  C  CA  . LYS F 3 109 ? 66.676  10.083  133.910 1.00 13.90  ? 196 LYS F CA  1 
ATOM   9700  C  C   . LYS F 3 109 ? 67.935  10.898  134.043 1.00 13.11  ? 196 LYS F C   1 
ATOM   9701  O  O   . LYS F 3 109 ? 68.907  10.423  134.579 1.00 15.61  ? 196 LYS F O   1 
ATOM   9702  C  CB  . LYS F 3 109 ? 65.872  10.133  135.212 1.00 16.89  ? 196 LYS F CB  1 
ATOM   9703  C  CG  . LYS F 3 109 ? 65.759  11.512  135.882 1.00 22.65  ? 196 LYS F CG  1 
ATOM   9704  C  CD  . LYS F 3 109 ? 64.876  12.501  135.113 1.00 36.29  ? 196 LYS F CD  1 
ATOM   9705  C  CE  . LYS F 3 109 ? 63.404  12.081  135.105 1.00 39.77  ? 196 LYS F CE  1 
ATOM   9706  N  NZ  . LYS F 3 109 ? 62.782  12.052  136.458 1.00 40.12  ? 196 LYS F NZ  1 
ATOM   9707  N  N   . ARG F 3 110 ? 67.926  12.099  133.473 1.00 19.02  ? 197 ARG F N   1 
ATOM   9708  C  CA  . ARG F 3 110 ? 69.049  13.032  133.544 1.00 17.69  ? 197 ARG F CA  1 
ATOM   9709  C  C   . ARG F 3 110 ? 68.422  14.295  134.094 1.00 22.86  ? 197 ARG F C   1 
ATOM   9710  O  O   . ARG F 3 110 ? 67.245  14.569  133.832 1.00 27.03  ? 197 ARG F O   1 
ATOM   9711  C  CB  . ARG F 3 110 ? 69.601  13.346  132.148 1.00 14.02  ? 197 ARG F CB  1 
ATOM   9712  C  CG  . ARG F 3 110 ? 69.907  12.145  131.267 1.00 9.78   ? 197 ARG F CG  1 
ATOM   9713  C  CD  . ARG F 3 110 ? 70.986  11.306  131.872 1.00 12.98  ? 197 ARG F CD  1 
ATOM   9714  N  NE  . ARG F 3 110 ? 72.282  11.978  131.943 1.00 21.63  ? 197 ARG F NE  1 
ATOM   9715  C  CZ  . ARG F 3 110 ? 73.142  12.070  130.928 1.00 19.00  ? 197 ARG F CZ  1 
ATOM   9716  N  NH1 . ARG F 3 110 ? 72.839  11.558  129.736 1.00 14.65  ? 197 ARG F NH1 1 
ATOM   9717  N  NH2 . ARG F 3 110 ? 74.367  12.541  131.144 1.00 11.65  ? 197 ARG F NH2 1 
ATOM   9718  N  N   . LEU F 3 111 ? 69.160  15.029  134.916 1.00 22.08  ? 198 LEU F N   1 
ATOM   9719  C  CA  . LEU F 3 111 ? 68.612  16.279  135.430 1.00 21.14  ? 198 LEU F CA  1 
ATOM   9720  C  C   . LEU F 3 111 ? 69.579  17.250  136.075 1.00 22.90  ? 198 LEU F C   1 
ATOM   9721  O  O   . LEU F 3 111 ? 69.200  18.389  136.361 1.00 26.47  ? 198 LEU F O   1 
ATOM   9722  C  CB  . LEU F 3 111 ? 67.400  16.033  136.319 1.00 18.36  ? 198 LEU F CB  1 
ATOM   9723  C  CG  . LEU F 3 111 ? 67.499  14.941  137.360 1.00 21.08  ? 198 LEU F CG  1 
ATOM   9724  C  CD1 . LEU F 3 111 ? 68.552  15.297  138.382 1.00 24.44  ? 198 LEU F CD1 1 
ATOM   9725  C  CD2 . LEU F 3 111 ? 66.136  14.799  138.012 1.00 18.44  ? 198 LEU F CD2 1 
ATOM   9726  N  N   . ASP F 3 112 ? 70.832  16.833  136.240 1.00 19.92  ? 199 ASP F N   1 
ATOM   9727  C  CA  . ASP F 3 112 ? 71.831  17.700  136.841 1.00 22.93  ? 199 ASP F CA  1 
ATOM   9728  C  C   . ASP F 3 112 ? 73.252  17.352  136.460 1.00 26.68  ? 199 ASP F C   1 
ATOM   9729  O  O   . ASP F 3 112 ? 74.193  17.989  136.918 1.00 25.89  ? 199 ASP F O   1 
ATOM   9730  C  CB  . ASP F 3 112 ? 71.696  17.717  138.371 1.00 29.03  ? 199 ASP F CB  1 
ATOM   9731  C  CG  . ASP F 3 112 ? 71.598  16.330  138.976 1.00 32.66  ? 199 ASP F CG  1 
ATOM   9732  O  OD1 . ASP F 3 112 ? 71.907  15.353  138.268 1.00 36.87  ? 199 ASP F OD1 1 
ATOM   9733  O  OD2 . ASP F 3 112 ? 71.194  16.215  140.162 1.00 32.25  ? 199 ASP F OD2 1 
ATOM   9734  N  N   . GLY F 3 113 ? 73.417  16.338  135.620 1.00 34.77  ? 200 GLY F N   1 
ATOM   9735  C  CA  . GLY F 3 113 ? 74.758  15.940  135.219 1.00 32.24  ? 200 GLY F CA  1 
ATOM   9736  C  C   . GLY F 3 113 ? 75.562  15.440  136.397 1.00 30.58  ? 200 GLY F C   1 
ATOM   9737  O  O   . GLY F 3 113 ? 76.778  15.309  136.313 1.00 33.87  ? 200 GLY F O   1 
ATOM   9738  N  N   . SER F 3 114 ? 74.861  15.133  137.486 1.00 29.24  ? 201 SER F N   1 
ATOM   9739  C  CA  . SER F 3 114 ? 75.483  14.640  138.705 1.00 33.05  ? 201 SER F CA  1 
ATOM   9740  C  C   . SER F 3 114 ? 76.118  13.258  138.554 1.00 35.93  ? 201 SER F C   1 
ATOM   9741  O  O   . SER F 3 114 ? 77.016  12.896  139.314 1.00 40.49  ? 201 SER F O   1 
ATOM   9742  C  CB  . SER F 3 114 ? 74.479  14.631  139.869 1.00 30.27  ? 201 SER F CB  1 
ATOM   9743  O  OG  . SER F 3 114 ? 73.481  13.639  139.713 1.00 29.82  ? 201 SER F OG  1 
ATOM   9744  N  N   . VAL F 3 115 ? 75.650  12.479  137.590 1.00 30.68  ? 202 VAL F N   1 
ATOM   9745  C  CA  . VAL F 3 115 ? 76.199  11.153  137.383 1.00 27.92  ? 202 VAL F CA  1 
ATOM   9746  C  C   . VAL F 3 115 ? 76.847  11.027  136.012 1.00 33.43  ? 202 VAL F C   1 
ATOM   9747  O  O   . VAL F 3 115 ? 76.367  11.602  135.033 1.00 40.32  ? 202 VAL F O   1 
ATOM   9748  C  CB  . VAL F 3 115 ? 75.106  10.089  137.525 1.00 27.22  ? 202 VAL F CB  1 
ATOM   9749  C  CG1 . VAL F 3 115 ? 75.643  8.713   137.131 1.00 26.53  ? 202 VAL F CG1 1 
ATOM   9750  C  CG2 . VAL F 3 115 ? 74.584  10.070  138.944 1.00 23.71  ? 202 VAL F CG2 1 
ATOM   9751  N  N   . ASP F 3 116 ? 77.947  10.283  135.957 1.00 32.30  ? 203 ASP F N   1 
ATOM   9752  C  CA  . ASP F 3 116 ? 78.664  10.066  134.711 1.00 35.93  ? 203 ASP F CA  1 
ATOM   9753  C  C   . ASP F 3 116 ? 78.123  8.829   133.999 1.00 36.45  ? 203 ASP F C   1 
ATOM   9754  O  O   . ASP F 3 116 ? 78.058  7.748   134.586 1.00 38.16  ? 203 ASP F O   1 
ATOM   9755  C  CB  . ASP F 3 116 ? 80.169  9.922   134.967 1.00 37.27  ? 203 ASP F CB  1 
ATOM   9756  C  CG  . ASP F 3 116 ? 80.975  9.744   133.679 1.00 47.40  ? 203 ASP F CG  1 
ATOM   9757  O  OD1 . ASP F 3 116 ? 80.735  10.462  132.677 1.00 53.04  ? 203 ASP F OD1 1 
ATOM   9758  O  OD2 . ASP F 3 116 ? 81.862  8.871   133.668 1.00 52.47  ? 203 ASP F OD2 1 
ATOM   9759  N  N   . PHE F 3 117 ? 77.727  9.002   132.738 1.00 28.56  ? 204 PHE F N   1 
ATOM   9760  C  CA  . PHE F 3 117 ? 77.189  7.915   131.935 1.00 23.14  ? 204 PHE F CA  1 
ATOM   9761  C  C   . PHE F 3 117 ? 78.237  7.280   131.035 1.00 21.06  ? 204 PHE F C   1 
ATOM   9762  O  O   . PHE F 3 117 ? 77.922  6.486   130.150 1.00 22.48  ? 204 PHE F O   1 
ATOM   9763  C  CB  . PHE F 3 117 ? 75.994  8.405   131.119 1.00 28.17  ? 204 PHE F CB  1 
ATOM   9764  C  CG  . PHE F 3 117 ? 74.698  8.340   131.860 1.00 26.81  ? 204 PHE F CG  1 
ATOM   9765  C  CD1 . PHE F 3 117 ? 74.475  9.148   132.976 1.00 23.99  ? 204 PHE F CD1 1 
ATOM   9766  C  CD2 . PHE F 3 117 ? 73.714  7.431   131.474 1.00 29.33  ? 204 PHE F CD2 1 
ATOM   9767  C  CE1 . PHE F 3 117 ? 73.282  9.049   133.714 1.00 22.15  ? 204 PHE F CE1 1 
ATOM   9768  C  CE2 . PHE F 3 117 ? 72.527  7.322   132.193 1.00 31.56  ? 204 PHE F CE2 1 
ATOM   9769  C  CZ  . PHE F 3 117 ? 72.311  8.139   133.327 1.00 27.86  ? 204 PHE F CZ  1 
ATOM   9770  N  N   . LYS F 3 118 ? 79.490  7.652   131.254 1.00 20.10  ? 205 LYS F N   1 
ATOM   9771  C  CA  . LYS F 3 118 ? 80.595  7.101   130.488 1.00 19.52  ? 205 LYS F CA  1 
ATOM   9772  C  C   . LYS F 3 118 ? 80.902  5.802   131.190 1.00 20.89  ? 205 LYS F C   1 
ATOM   9773  O  O   . LYS F 3 118 ? 81.967  5.653   131.789 1.00 20.48  ? 205 LYS F O   1 
ATOM   9774  C  CB  . LYS F 3 118 ? 81.797  8.027   130.595 1.00 26.87  ? 205 LYS F CB  1 
ATOM   9775  C  CG  . LYS F 3 118 ? 83.058  7.523   129.929 1.00 38.79  ? 205 LYS F CG  1 
ATOM   9776  C  CD  . LYS F 3 118 ? 82.863  7.366   128.449 1.00 50.30  ? 205 LYS F CD  1 
ATOM   9777  C  CE  . LYS F 3 118 ? 84.192  7.144   127.743 1.00 61.05  ? 205 LYS F CE  1 
ATOM   9778  N  NZ  . LYS F 3 118 ? 85.096  8.328   127.868 1.00 65.18  ? 205 LYS F NZ  1 
ATOM   9779  N  N   . LYS F 3 119 ? 79.933  4.885   131.177 1.00 24.24  ? 206 LYS F N   1 
ATOM   9780  C  CA  . LYS F 3 119 ? 80.086  3.592   131.851 1.00 22.13  ? 206 LYS F CA  1 
ATOM   9781  C  C   . LYS F 3 119 ? 80.286  2.428   130.903 1.00 21.96  ? 206 LYS F C   1 
ATOM   9782  O  O   . LYS F 3 119 ? 79.837  2.463   129.767 1.00 24.97  ? 206 LYS F O   1 
ATOM   9783  C  CB  . LYS F 3 119 ? 78.896  3.326   132.779 1.00 18.39  ? 206 LYS F CB  1 
ATOM   9784  C  CG  . LYS F 3 119 ? 78.744  4.352   133.921 1.00 24.95  ? 206 LYS F CG  1 
ATOM   9785  C  CD  . LYS F 3 119 ? 80.005  4.388   134.797 1.00 34.07  ? 206 LYS F CD  1 
ATOM   9786  C  CE  . LYS F 3 119 ? 80.089  5.626   135.687 1.00 33.43  ? 206 LYS F CE  1 
ATOM   9787  N  NZ  . LYS F 3 119 ? 79.043  5.626   136.744 1.00 35.52  ? 206 LYS F NZ  1 
ATOM   9788  N  N   . ASN F 3 120 ? 80.975  1.395   131.371 1.00 27.12  ? 207 ASN F N   1 
ATOM   9789  C  CA  . ASN F 3 120 ? 81.225  0.224   130.539 1.00 27.59  ? 207 ASN F CA  1 
ATOM   9790  C  C   . ASN F 3 120 ? 79.996  -0.665  130.333 1.00 27.72  ? 207 ASN F C   1 
ATOM   9791  O  O   . ASN F 3 120 ? 78.877  -0.341  130.764 1.00 29.06  ? 207 ASN F O   1 
ATOM   9792  C  CB  . ASN F 3 120 ? 82.417  -0.597  131.057 1.00 25.89  ? 207 ASN F CB  1 
ATOM   9793  C  CG  . ASN F 3 120 ? 82.138  -1.278  132.380 1.00 28.07  ? 207 ASN F CG  1 
ATOM   9794  O  OD1 . ASN F 3 120 ? 81.016  -1.683  132.669 1.00 30.75  ? 207 ASN F OD1 1 
ATOM   9795  N  ND2 . ASN F 3 120 ? 83.171  -1.421  133.187 1.00 31.02  ? 207 ASN F ND2 1 
ATOM   9796  N  N   . TRP F 3 121 ? 80.247  -1.818  129.722 1.00 26.46  ? 208 TRP F N   1 
ATOM   9797  C  CA  . TRP F 3 121 ? 79.220  -2.790  129.382 1.00 26.74  ? 208 TRP F CA  1 
ATOM   9798  C  C   . TRP F 3 121 ? 78.421  -3.289  130.557 1.00 26.37  ? 208 TRP F C   1 
ATOM   9799  O  O   . TRP F 3 121 ? 77.190  -3.202  130.597 1.00 24.42  ? 208 TRP F O   1 
ATOM   9800  C  CB  . TRP F 3 121 ? 79.868  -3.997  128.696 1.00 29.56  ? 208 TRP F CB  1 
ATOM   9801  C  CG  . TRP F 3 121 ? 78.853  -4.974  128.181 1.00 26.78  ? 208 TRP F CG  1 
ATOM   9802  C  CD1 . TRP F 3 121 ? 78.545  -6.200  128.699 1.00 21.23  ? 208 TRP F CD1 1 
ATOM   9803  C  CD2 . TRP F 3 121 ? 77.938  -4.754  127.106 1.00 29.30  ? 208 TRP F CD2 1 
ATOM   9804  N  NE1 . TRP F 3 121 ? 77.477  -6.750  128.025 1.00 17.73  ? 208 TRP F NE1 1 
ATOM   9805  C  CE2 . TRP F 3 121 ? 77.088  -5.881  127.041 1.00 27.41  ? 208 TRP F CE2 1 
ATOM   9806  C  CE3 . TRP F 3 121 ? 77.751  -3.709  126.187 1.00 31.97  ? 208 TRP F CE3 1 
ATOM   9807  C  CZ2 . TRP F 3 121 ? 76.065  -5.990  126.092 1.00 36.09  ? 208 TRP F CZ2 1 
ATOM   9808  C  CZ3 . TRP F 3 121 ? 76.730  -3.821  125.238 1.00 32.69  ? 208 TRP F CZ3 1 
ATOM   9809  C  CH2 . TRP F 3 121 ? 75.904  -4.951  125.200 1.00 35.65  ? 208 TRP F CH2 1 
ATOM   9810  N  N   . ILE F 3 122 ? 79.151  -3.933  131.447 1.00 24.93  ? 209 ILE F N   1 
ATOM   9811  C  CA  . ILE F 3 122 ? 78.609  -4.514  132.655 1.00 27.91  ? 209 ILE F CA  1 
ATOM   9812  C  C   . ILE F 3 122 ? 77.777  -3.467  133.367 1.00 24.39  ? 209 ILE F C   1 
ATOM   9813  O  O   . ILE F 3 122 ? 76.606  -3.695  133.715 1.00 22.44  ? 209 ILE F O   1 
ATOM   9814  C  CB  . ILE F 3 122 ? 79.760  -4.931  133.604 1.00 34.76  ? 209 ILE F CB  1 
ATOM   9815  C  CG1 . ILE F 3 122 ? 80.822  -5.754  132.850 1.00 41.50  ? 209 ILE F CG1 1 
ATOM   9816  C  CG2 . ILE F 3 122 ? 79.207  -5.665  134.804 1.00 29.75  ? 209 ILE F CG2 1 
ATOM   9817  C  CD1 . ILE F 3 122 ? 81.747  -4.924  131.855 1.00 44.76  ? 209 ILE F CD1 1 
ATOM   9818  N  N   . GLN F 3 123 ? 78.388  -2.300  133.537 1.00 20.63  ? 210 GLN F N   1 
ATOM   9819  C  CA  . GLN F 3 123 ? 77.736  -1.209  134.230 1.00 25.10  ? 210 GLN F CA  1 
ATOM   9820  C  C   . GLN F 3 123 ? 76.422  -0.816  133.567 1.00 25.04  ? 210 GLN F C   1 
ATOM   9821  O  O   . GLN F 3 123 ? 75.426  -0.589  134.254 1.00 18.73  ? 210 GLN F O   1 
ATOM   9822  C  CB  . GLN F 3 123 ? 78.702  -0.039  134.382 1.00 26.53  ? 210 GLN F CB  1 
ATOM   9823  C  CG  . GLN F 3 123 ? 79.934  -0.416  135.197 1.00 28.85  ? 210 GLN F CG  1 
ATOM   9824  C  CD  . GLN F 3 123 ? 80.881  0.741   135.443 1.00 33.94  ? 210 GLN F CD  1 
ATOM   9825  O  OE1 . GLN F 3 123 ? 81.317  1.436   134.513 1.00 38.09  ? 210 GLN F OE1 1 
ATOM   9826  N  NE2 . GLN F 3 123 ? 81.220  0.945   136.705 1.00 36.43  ? 210 GLN F NE2 1 
ATOM   9827  N  N   . TYR F 3 124 ? 76.411  -0.802  132.234 1.00 27.25  ? 211 TYR F N   1 
ATOM   9828  C  CA  . TYR F 3 124 ? 75.200  -0.477  131.486 1.00 25.93  ? 211 TYR F CA  1 
ATOM   9829  C  C   . TYR F 3 124 ? 74.219  -1.692  131.449 1.00 26.47  ? 211 TYR F C   1 
ATOM   9830  O  O   . TYR F 3 124 ? 73.011  -1.560  131.158 1.00 16.91  ? 211 TYR F O   1 
ATOM   9831  C  CB  . TYR F 3 124 ? 75.563  0.024   130.079 1.00 21.08  ? 211 TYR F CB  1 
ATOM   9832  C  CG  . TYR F 3 124 ? 75.580  1.535   129.939 1.00 18.38  ? 211 TYR F CG  1 
ATOM   9833  C  CD1 . TYR F 3 124 ? 74.404  2.248   129.696 1.00 21.34  ? 211 TYR F CD1 1 
ATOM   9834  C  CD2 . TYR F 3 124 ? 76.763  2.260   130.078 1.00 20.12  ? 211 TYR F CD2 1 
ATOM   9835  C  CE1 . TYR F 3 124 ? 74.404  3.647   129.600 1.00 23.03  ? 211 TYR F CE1 1 
ATOM   9836  C  CE2 . TYR F 3 124 ? 76.767  3.665   129.985 1.00 23.93  ? 211 TYR F CE2 1 
ATOM   9837  C  CZ  . TYR F 3 124 ? 75.582  4.340   129.748 1.00 24.02  ? 211 TYR F CZ  1 
ATOM   9838  O  OH  . TYR F 3 124 ? 75.572  5.701   129.674 1.00 25.92  ? 211 TYR F OH  1 
ATOM   9839  N  N   . LYS F 3 125 ? 74.732  -2.872  131.787 1.00 26.33  ? 212 LYS F N   1 
ATOM   9840  C  CA  . LYS F 3 125 ? 73.894  -4.060  131.830 1.00 25.34  ? 212 LYS F CA  1 
ATOM   9841  C  C   . LYS F 3 125 ? 73.187  -4.211  133.189 1.00 26.64  ? 212 LYS F C   1 
ATOM   9842  O  O   . LYS F 3 125 ? 72.018  -4.619  133.260 1.00 25.27  ? 212 LYS F O   1 
ATOM   9843  C  CB  . LYS F 3 125 ? 74.736  -5.305  131.591 1.00 20.19  ? 212 LYS F CB  1 
ATOM   9844  C  CG  . LYS F 3 125 ? 73.979  -6.580  131.939 1.00 15.20  ? 212 LYS F CG  1 
ATOM   9845  C  CD  . LYS F 3 125 ? 74.892  -7.778  131.916 1.00 16.92  ? 212 LYS F CD  1 
ATOM   9846  C  CE  . LYS F 3 125 ? 74.122  -9.046  132.216 1.00 24.08  ? 212 LYS F CE  1 
ATOM   9847  N  NZ  . LYS F 3 125 ? 75.066  -10.194 132.255 1.00 30.85  ? 212 LYS F NZ  1 
ATOM   9848  N  N   . GLU F 3 126 ? 73.914  -3.904  134.259 1.00 21.58  ? 213 GLU F N   1 
ATOM   9849  C  CA  . GLU F 3 126 ? 73.380  -4.050  135.606 1.00 24.11  ? 213 GLU F CA  1 
ATOM   9850  C  C   . GLU F 3 126 ? 72.729  -2.822  136.190 1.00 26.33  ? 213 GLU F C   1 
ATOM   9851  O  O   . GLU F 3 126 ? 72.058  -2.921  137.210 1.00 29.90  ? 213 GLU F O   1 
ATOM   9852  C  CB  . GLU F 3 126 ? 74.480  -4.516  136.562 1.00 27.93  ? 213 GLU F CB  1 
ATOM   9853  C  CG  . GLU F 3 126 ? 74.993  -5.914  136.298 1.00 32.86  ? 213 GLU F CG  1 
ATOM   9854  C  CD  . GLU F 3 126 ? 73.896  -6.980  136.360 1.00 37.78  ? 213 GLU F CD  1 
ATOM   9855  O  OE1 . GLU F 3 126 ? 72.791  -6.729  136.895 1.00 39.82  ? 213 GLU F OE1 1 
ATOM   9856  O  OE2 . GLU F 3 126 ? 74.145  -8.093  135.865 1.00 42.29  ? 213 GLU F OE2 1 
ATOM   9857  N  N   . GLY F 3 127 ? 72.959  -1.668  135.573 1.00 22.54  ? 214 GLY F N   1 
ATOM   9858  C  CA  . GLY F 3 127 ? 72.391  -0.431  136.083 1.00 21.84  ? 214 GLY F CA  1 
ATOM   9859  C  C   . GLY F 3 127 ? 73.347  0.390   136.942 1.00 23.49  ? 214 GLY F C   1 
ATOM   9860  O  O   . GLY F 3 127 ? 74.248  -0.153  137.582 1.00 25.78  ? 214 GLY F O   1 
ATOM   9861  N  N   . PHE F 3 128 ? 73.194  1.710   136.892 1.00 22.09  ? 215 PHE F N   1 
ATOM   9862  C  CA  . PHE F 3 128 ? 74.015  2.626   137.682 1.00 20.97  ? 215 PHE F CA  1 
ATOM   9863  C  C   . PHE F 3 128 ? 73.234  3.907   137.992 1.00 20.57  ? 215 PHE F C   1 
ATOM   9864  O  O   . PHE F 3 128 ? 72.131  4.121   137.472 1.00 14.12  ? 215 PHE F O   1 
ATOM   9865  C  CB  . PHE F 3 128 ? 75.367  2.920   137.009 1.00 18.15  ? 215 PHE F CB  1 
ATOM   9866  C  CG  . PHE F 3 128 ? 75.261  3.547   135.650 1.00 16.24  ? 215 PHE F CG  1 
ATOM   9867  C  CD1 . PHE F 3 128 ? 75.119  2.755   134.510 1.00 18.40  ? 215 PHE F CD1 1 
ATOM   9868  C  CD2 . PHE F 3 128 ? 75.339  4.919   135.504 1.00 10.61  ? 215 PHE F CD2 1 
ATOM   9869  C  CE1 . PHE F 3 128 ? 75.056  3.325   133.249 1.00 15.40  ? 215 PHE F CE1 1 
ATOM   9870  C  CE2 . PHE F 3 128 ? 75.279  5.495   134.257 1.00 13.00  ? 215 PHE F CE2 1 
ATOM   9871  C  CZ  . PHE F 3 128 ? 75.136  4.696   133.119 1.00 16.53  ? 215 PHE F CZ  1 
ATOM   9872  N  N   . GLY F 3 129 ? 73.799  4.750   138.847 1.00 18.07  ? 216 GLY F N   1 
ATOM   9873  C  CA  . GLY F 3 129 ? 73.099  5.960   139.231 1.00 22.18  ? 216 GLY F CA  1 
ATOM   9874  C  C   . GLY F 3 129 ? 72.319  5.673   140.512 1.00 26.81  ? 216 GLY F C   1 
ATOM   9875  O  O   . GLY F 3 129 ? 72.499  4.617   141.141 1.00 23.02  ? 216 GLY F O   1 
ATOM   9876  N  N   . HIS F 3 130 ? 71.442  6.596   140.900 1.00 26.32  ? 217 HIS F N   1 
ATOM   9877  C  CA  . HIS F 3 130 ? 70.667  6.417   142.117 1.00 22.81  ? 217 HIS F CA  1 
ATOM   9878  C  C   . HIS F 3 130 ? 69.181  6.597   141.989 1.00 21.15  ? 217 HIS F C   1 
ATOM   9879  O  O   . HIS F 3 130 ? 68.692  7.463   141.259 1.00 27.32  ? 217 HIS F O   1 
ATOM   9880  C  CB  . HIS F 3 130 ? 71.159  7.355   143.192 1.00 23.29  ? 217 HIS F CB  1 
ATOM   9881  C  CG  . HIS F 3 130 ? 72.546  7.058   143.645 1.00 28.15  ? 217 HIS F CG  1 
ATOM   9882  N  ND1 . HIS F 3 130 ? 73.660  7.559   143.007 1.00 27.10  ? 217 HIS F ND1 1 
ATOM   9883  C  CD2 . HIS F 3 130 ? 73.000  6.341   144.698 1.00 25.03  ? 217 HIS F CD2 1 
ATOM   9884  C  CE1 . HIS F 3 130 ? 74.742  7.169   143.657 1.00 27.35  ? 217 HIS F CE1 1 
ATOM   9885  N  NE2 . HIS F 3 130 ? 74.368  6.430   144.688 1.00 27.17  ? 217 HIS F NE2 1 
ATOM   9886  N  N   . LEU F 3 131 ? 68.471  5.799   142.768 1.00 14.75  ? 218 LEU F N   1 
ATOM   9887  C  CA  . LEU F 3 131 ? 67.024  5.838   142.815 1.00 14.72  ? 218 LEU F CA  1 
ATOM   9888  C  C   . LEU F 3 131 ? 66.572  6.651   144.013 1.00 25.30  ? 218 LEU F C   1 
ATOM   9889  O  O   . LEU F 3 131 ? 67.060  6.449   145.139 1.00 25.62  ? 218 LEU F O   1 
ATOM   9890  C  CB  . LEU F 3 131 ? 66.476  4.430   142.950 1.00 10.53  ? 218 LEU F CB  1 
ATOM   9891  C  CG  . LEU F 3 131 ? 66.725  3.605   141.695 1.00 13.08  ? 218 LEU F CG  1 
ATOM   9892  C  CD1 . LEU F 3 131 ? 66.501  2.113   141.936 1.00 11.08  ? 218 LEU F CD1 1 
ATOM   9893  C  CD2 . LEU F 3 131 ? 65.809  4.161   140.584 1.00 11.90  ? 218 LEU F CD2 1 
ATOM   9894  N  N   . SER F 3 132 ? 65.668  7.594   143.755 1.00 32.14  ? 219 SER F N   1 
ATOM   9895  C  CA  . SER F 3 132 ? 65.101  8.447   144.795 1.00 32.38  ? 219 SER F CA  1 
ATOM   9896  C  C   . SER F 3 132 ? 63.606  8.338   144.631 1.00 29.18  ? 219 SER F C   1 
ATOM   9897  O  O   . SER F 3 132 ? 63.114  8.117   143.530 1.00 32.76  ? 219 SER F O   1 
ATOM   9898  C  CB  . SER F 3 132 ? 65.522  9.918   144.626 1.00 35.74  ? 219 SER F CB  1 
ATOM   9899  O  OG  . SER F 3 132 ? 64.910  10.533  143.500 1.00 40.22  ? 219 SER F OG  1 
ATOM   9900  N  N   . PRO F 3 133 ? 62.862  8.465   145.725 1.00 30.70  ? 220 PRO F N   1 
ATOM   9901  C  CA  . PRO F 3 133 ? 61.399  8.383   145.697 1.00 32.47  ? 220 PRO F CA  1 
ATOM   9902  C  C   . PRO F 3 133 ? 60.773  9.656   145.126 1.00 33.66  ? 220 PRO F C   1 
ATOM   9903  O  O   . PRO F 3 133 ? 59.562  9.725   144.897 1.00 39.20  ? 220 PRO F O   1 
ATOM   9904  C  CB  . PRO F 3 133 ? 61.056  8.183   147.162 1.00 34.05  ? 220 PRO F CB  1 
ATOM   9905  C  CG  . PRO F 3 133 ? 62.116  8.984   147.853 1.00 36.49  ? 220 PRO F CG  1 
ATOM   9906  C  CD  . PRO F 3 133 ? 63.364  8.607   147.098 1.00 31.31  ? 220 PRO F CD  1 
ATOM   9907  N  N   . THR F 3 134 ? 61.619  10.642  144.853 1.00 35.15  ? 221 THR F N   1 
ATOM   9908  C  CA  . THR F 3 134 ? 61.175  11.915  144.301 1.00 36.20  ? 221 THR F CA  1 
ATOM   9909  C  C   . THR F 3 134 ? 61.720  12.169  142.901 1.00 32.61  ? 221 THR F C   1 
ATOM   9910  O  O   . THR F 3 134 ? 61.640  13.289  142.400 1.00 34.80  ? 221 THR F O   1 
ATOM   9911  C  CB  . THR F 3 134 ? 61.631  13.067  145.190 1.00 37.79  ? 221 THR F CB  1 
ATOM   9912  O  OG1 . THR F 3 134 ? 63.059  13.023  145.315 1.00 40.53  ? 221 THR F OG1 1 
ATOM   9913  C  CG2 . THR F 3 134 ? 60.998  12.960  146.564 1.00 37.83  ? 221 THR F CG2 1 
ATOM   9914  N  N   . GLY F 3 135 ? 62.289  11.131  142.295 1.00 33.43  ? 222 GLY F N   1 
ATOM   9915  C  CA  . GLY F 3 135 ? 62.856  11.231  140.962 1.00 34.30  ? 222 GLY F CA  1 
ATOM   9916  C  C   . GLY F 3 135 ? 63.677  12.486  140.766 1.00 35.84  ? 222 GLY F C   1 
ATOM   9917  O  O   . GLY F 3 135 ? 63.563  13.148  139.741 1.00 45.45  ? 222 GLY F O   1 
ATOM   9918  N  N   . THR F 3 136 ? 64.460  12.846  141.773 1.00 28.10  ? 223 THR F N   1 
ATOM   9919  C  CA  . THR F 3 136 ? 65.284  14.046  141.706 1.00 28.44  ? 223 THR F CA  1 
ATOM   9920  C  C   . THR F 3 136 ? 66.747  13.664  141.666 1.00 26.84  ? 223 THR F C   1 
ATOM   9921  O  O   . THR F 3 136 ? 67.627  14.422  142.088 1.00 22.14  ? 223 THR F O   1 
ATOM   9922  C  CB  . THR F 3 136 ? 65.081  14.878  142.930 1.00 35.45  ? 223 THR F CB  1 
ATOM   9923  O  OG1 . THR F 3 136 ? 65.312  14.052  144.076 1.00 39.02  ? 223 THR F OG1 1 
ATOM   9924  C  CG2 . THR F 3 136 ? 63.676  15.445  142.950 1.00 40.33  ? 223 THR F CG2 1 
ATOM   9925  N  N   . THR F 3 137 ? 66.984  12.474  141.141 1.00 27.21  ? 224 THR F N   1 
ATOM   9926  C  CA  . THR F 3 137 ? 68.310  11.931  141.037 1.00 25.87  ? 224 THR F CA  1 
ATOM   9927  C  C   . THR F 3 137 ? 68.442  11.176  139.722 1.00 22.64  ? 224 THR F C   1 
ATOM   9928  O  O   . THR F 3 137 ? 67.604  10.340  139.394 1.00 16.55  ? 224 THR F O   1 
ATOM   9929  C  CB  . THR F 3 137 ? 68.574  10.982  142.212 1.00 30.06  ? 224 THR F CB  1 
ATOM   9930  O  OG1 . THR F 3 137 ? 69.865  10.385  142.062 1.00 46.82  ? 224 THR F OG1 1 
ATOM   9931  C  CG2 . THR F 3 137 ? 67.541  9.898   142.248 1.00 20.53  ? 224 THR F CG2 1 
ATOM   9932  N  N   . GLU F 3 138 ? 69.500  11.474  138.974 1.00 26.71  ? 225 GLU F N   1 
ATOM   9933  C  CA  . GLU F 3 138 ? 69.709  10.815  137.698 1.00 23.29  ? 225 GLU F CA  1 
ATOM   9934  C  C   . GLU F 3 138 ? 70.362  9.432   137.812 1.00 25.70  ? 225 GLU F C   1 
ATOM   9935  O  O   . GLU F 3 138 ? 71.179  9.189   138.696 1.00 24.93  ? 225 GLU F O   1 
ATOM   9936  C  CB  . GLU F 3 138 ? 70.435  11.742  136.708 1.00 19.54  ? 225 GLU F CB  1 
ATOM   9937  C  CG  . GLU F 3 138 ? 71.853  12.190  137.028 1.00 18.28  ? 225 GLU F CG  1 
ATOM   9938  C  CD  . GLU F 3 138 ? 72.337  13.218  136.007 1.00 26.98  ? 225 GLU F CD  1 
ATOM   9939  O  OE1 . GLU F 3 138 ? 71.594  14.199  135.732 1.00 21.38  ? 225 GLU F OE1 1 
ATOM   9940  O  OE2 . GLU F 3 138 ? 73.435  13.022  135.441 1.00 35.59  ? 225 GLU F OE2 1 
ATOM   9941  N  N   . PHE F 3 139 ? 69.957  8.525   136.923 1.00 29.73  ? 226 PHE F N   1 
ATOM   9942  C  CA  . PHE F 3 139 ? 70.450  7.152   136.909 1.00 24.87  ? 226 PHE F CA  1 
ATOM   9943  C  C   . PHE F 3 139 ? 70.117  6.410   135.616 1.00 22.78  ? 226 PHE F C   1 
ATOM   9944  O  O   . PHE F 3 139 ? 69.317  6.862   134.808 1.00 24.79  ? 226 PHE F O   1 
ATOM   9945  C  CB  . PHE F 3 139 ? 69.741  6.390   137.993 1.00 24.52  ? 226 PHE F CB  1 
ATOM   9946  C  CG  . PHE F 3 139 ? 68.309  6.081   137.652 1.00 18.23  ? 226 PHE F CG  1 
ATOM   9947  C  CD1 . PHE F 3 139 ? 67.302  6.995   137.924 1.00 12.03  ? 226 PHE F CD1 1 
ATOM   9948  C  CD2 . PHE F 3 139 ? 67.976  4.884   137.027 1.00 19.22  ? 226 PHE F CD2 1 
ATOM   9949  C  CE1 . PHE F 3 139 ? 65.984  6.727   137.578 1.00 4.10   ? 226 PHE F CE1 1 
ATOM   9950  C  CE2 . PHE F 3 139 ? 66.652  4.606   136.674 1.00 19.62  ? 226 PHE F CE2 1 
ATOM   9951  C  CZ  . PHE F 3 139 ? 65.655  5.535   136.952 1.00 13.46  ? 226 PHE F CZ  1 
ATOM   9952  N  N   . TRP F 3 140 ? 70.627  5.190   135.517 1.00 20.49  ? 227 TRP F N   1 
ATOM   9953  C  CA  . TRP F 3 140 ? 70.375  4.309   134.373 1.00 22.20  ? 227 TRP F CA  1 
ATOM   9954  C  C   . TRP F 3 140 ? 69.968  2.982   135.001 1.00 20.61  ? 227 TRP F C   1 
ATOM   9955  O  O   . TRP F 3 140 ? 70.707  2.444   135.830 1.00 25.44  ? 227 TRP F O   1 
ATOM   9956  C  CB  . TRP F 3 140 ? 71.635  4.103   133.526 1.00 17.28  ? 227 TRP F CB  1 
ATOM   9957  C  CG  . TRP F 3 140 ? 71.373  3.156   132.430 1.00 20.95  ? 227 TRP F CG  1 
ATOM   9958  C  CD1 . TRP F 3 140 ? 71.735  1.857   132.382 1.00 25.00  ? 227 TRP F CD1 1 
ATOM   9959  C  CD2 . TRP F 3 140 ? 70.625  3.412   131.227 1.00 30.15  ? 227 TRP F CD2 1 
ATOM   9960  N  NE1 . TRP F 3 140 ? 71.260  1.269   131.226 1.00 28.96  ? 227 TRP F NE1 1 
ATOM   9961  C  CE2 . TRP F 3 140 ? 70.576  2.207   130.501 1.00 31.23  ? 227 TRP F CE2 1 
ATOM   9962  C  CE3 . TRP F 3 140 ? 69.993  4.545   130.693 1.00 35.32  ? 227 TRP F CE3 1 
ATOM   9963  C  CZ2 . TRP F 3 140 ? 69.921  2.100   129.267 1.00 34.49  ? 227 TRP F CZ2 1 
ATOM   9964  C  CZ3 . TRP F 3 140 ? 69.341  4.435   129.460 1.00 32.77  ? 227 TRP F CZ3 1 
ATOM   9965  C  CH2 . TRP F 3 140 ? 69.312  3.221   128.767 1.00 33.07  ? 227 TRP F CH2 1 
ATOM   9966  N  N   . LEU F 3 141 ? 68.826  2.435   134.598 1.00 11.79  ? 228 LEU F N   1 
ATOM   9967  C  CA  . LEU F 3 141 ? 68.329  1.186   135.195 1.00 13.92  ? 228 LEU F CA  1 
ATOM   9968  C  C   . LEU F 3 141 ? 69.058  -0.133  134.927 1.00 19.78  ? 228 LEU F C   1 
ATOM   9969  O  O   . LEU F 3 141 ? 69.171  -0.975  135.816 1.00 24.55  ? 228 LEU F O   1 
ATOM   9970  C  CB  . LEU F 3 141 ? 66.849  1.012   134.896 1.00 18.11  ? 228 LEU F CB  1 
ATOM   9971  C  CG  . LEU F 3 141 ? 66.213  -0.188  135.584 1.00 17.65  ? 228 LEU F CG  1 
ATOM   9972  C  CD1 . LEU F 3 141 ? 66.317  -0.031  137.078 1.00 18.88  ? 228 LEU F CD1 1 
ATOM   9973  C  CD2 . LEU F 3 141 ? 64.756  -0.301  135.174 1.00 21.60  ? 228 LEU F CD2 1 
ATOM   9974  N  N   . GLY F 3 142 ? 69.508  -0.351  133.702 1.00 24.52  ? 229 GLY F N   1 
ATOM   9975  C  CA  . GLY F 3 142 ? 70.218  -1.586  133.424 1.00 28.97  ? 229 GLY F CA  1 
ATOM   9976  C  C   . GLY F 3 142 ? 69.594  -2.392  132.311 1.00 26.62  ? 229 GLY F C   1 
ATOM   9977  O  O   . GLY F 3 142 ? 68.515  -2.944  132.475 1.00 23.54  ? 229 GLY F O   1 
ATOM   9978  N  N   . ASN F 3 143 ? 70.312  -2.496  131.198 1.00 23.09  ? 230 ASN F N   1 
ATOM   9979  C  CA  . ASN F 3 143 ? 69.842  -3.211  130.020 1.00 17.69  ? 230 ASN F CA  1 
ATOM   9980  C  C   . ASN F 3 143 ? 69.085  -4.454  130.399 1.00 18.16  ? 230 ASN F C   1 
ATOM   9981  O  O   . ASN F 3 143 ? 67.946  -4.656  129.989 1.00 11.37  ? 230 ASN F O   1 
ATOM   9982  C  CB  . ASN F 3 143 ? 71.024  -3.632  129.147 1.00 22.00  ? 230 ASN F CB  1 
ATOM   9983  C  CG  . ASN F 3 143 ? 71.719  -2.472  128.489 1.00 23.89  ? 230 ASN F CG  1 
ATOM   9984  O  OD1 . ASN F 3 143 ? 72.936  -2.503  128.281 1.00 27.02  ? 230 ASN F OD1 1 
ATOM   9985  N  ND2 . ASN F 3 143 ? 70.956  -1.451  128.132 1.00 17.67  ? 230 ASN F ND2 1 
ATOM   9986  N  N   . GLU F 3 144 ? 69.725  -5.276  131.221 1.00 27.15  ? 231 GLU F N   1 
ATOM   9987  C  CA  . GLU F 3 144 ? 69.122  -6.517  131.635 1.00 25.41  ? 231 GLU F CA  1 
ATOM   9988  C  C   . GLU F 3 144 ? 67.717  -6.314  132.151 1.00 19.39  ? 231 GLU F C   1 
ATOM   9989  O  O   . GLU F 3 144 ? 66.779  -6.836  131.593 1.00 16.38  ? 231 GLU F O   1 
ATOM   9990  C  CB  . GLU F 3 144 ? 69.977  -7.207  132.681 1.00 28.08  ? 231 GLU F CB  1 
ATOM   9991  C  CG  . GLU F 3 144 ? 69.415  -8.547  133.110 1.00 31.87  ? 231 GLU F CG  1 
ATOM   9992  C  CD  . GLU F 3 144 ? 69.428  -9.592  132.008 1.00 40.78  ? 231 GLU F CD  1 
ATOM   9993  O  OE1 . GLU F 3 144 ? 69.965  -9.314  130.911 1.00 44.99  ? 231 GLU F OE1 1 
ATOM   9994  O  OE2 . GLU F 3 144 ? 68.909  -10.709 132.248 1.00 46.61  ? 231 GLU F OE2 1 
ATOM   9995  N  N   . LYS F 3 145 ? 67.567  -5.482  133.163 1.00 23.31  ? 232 LYS F N   1 
ATOM   9996  C  CA  . LYS F 3 145 ? 66.250  -5.245  133.740 1.00 25.64  ? 232 LYS F CA  1 
ATOM   9997  C  C   . LYS F 3 145 ? 65.283  -4.688  132.689 1.00 24.87  ? 232 LYS F C   1 
ATOM   9998  O  O   . LYS F 3 145 ? 64.119  -5.105  132.608 1.00 23.10  ? 232 LYS F O   1 
ATOM   9999  C  CB  . LYS F 3 145 ? 66.368  -4.308  134.945 1.00 21.51  ? 232 LYS F CB  1 
ATOM   10000 C  CG  . LYS F 3 145 ? 67.342  -4.789  136.014 1.00 26.65  ? 232 LYS F CG  1 
ATOM   10001 C  CD  . LYS F 3 145 ? 67.740  -3.641  136.921 1.00 34.00  ? 232 LYS F CD  1 
ATOM   10002 C  CE  . LYS F 3 145 ? 68.820  -4.013  137.909 1.00 33.77  ? 232 LYS F CE  1 
ATOM   10003 N  NZ  . LYS F 3 145 ? 69.020  -2.899  138.871 1.00 32.88  ? 232 LYS F NZ  1 
ATOM   10004 N  N   . ILE F 3 146 ? 65.787  -3.791  131.847 1.00 24.99  ? 233 ILE F N   1 
ATOM   10005 C  CA  . ILE F 3 146 ? 64.962  -3.199  130.806 1.00 22.86  ? 233 ILE F CA  1 
ATOM   10006 C  C   . ILE F 3 146 ? 64.463  -4.311  129.902 1.00 21.23  ? 233 ILE F C   1 
ATOM   10007 O  O   . ILE F 3 146 ? 63.290  -4.349  129.516 1.00 16.58  ? 233 ILE F O   1 
ATOM   10008 C  CB  . ILE F 3 146 ? 65.750  -2.223  129.935 1.00 18.29  ? 233 ILE F CB  1 
ATOM   10009 C  CG1 . ILE F 3 146 ? 66.247  -1.047  130.761 1.00 19.12  ? 233 ILE F CG1 1 
ATOM   10010 C  CG2 . ILE F 3 146 ? 64.865  -1.719  128.812 1.00 18.24  ? 233 ILE F CG2 1 
ATOM   10011 C  CD1 . ILE F 3 146 ? 67.140  -0.130  129.975 1.00 23.85  ? 233 ILE F CD1 1 
ATOM   10012 N  N   . HIS F 3 147 ? 65.377  -5.205  129.554 1.00 18.47  ? 234 HIS F N   1 
ATOM   10013 C  CA  . HIS F 3 147 ? 65.044  -6.322  128.702 1.00 18.69  ? 234 HIS F CA  1 
ATOM   10014 C  C   . HIS F 3 147 ? 63.940  -7.132  129.341 1.00 23.70  ? 234 HIS F C   1 
ATOM   10015 O  O   . HIS F 3 147 ? 62.889  -7.329  128.738 1.00 24.59  ? 234 HIS F O   1 
ATOM   10016 C  CB  . HIS F 3 147 ? 66.267  -7.207  128.495 1.00 17.15  ? 234 HIS F CB  1 
ATOM   10017 C  CG  . HIS F 3 147 ? 65.955  -8.512  127.839 1.00 20.45  ? 234 HIS F CG  1 
ATOM   10018 N  ND1 . HIS F 3 147 ? 64.878  -8.680  126.997 1.00 24.95  ? 234 HIS F ND1 1 
ATOM   10019 C  CD2 . HIS F 3 147 ? 66.541  -9.729  127.946 1.00 27.56  ? 234 HIS F CD2 1 
ATOM   10020 C  CE1 . HIS F 3 147 ? 64.806  -9.945  126.620 1.00 25.31  ? 234 HIS F CE1 1 
ATOM   10021 N  NE2 . HIS F 3 147 ? 65.804  -10.604 127.181 1.00 28.77  ? 234 HIS F NE2 1 
ATOM   10022 N  N   . LEU F 3 148 ? 64.157  -7.535  130.591 1.00 27.52  ? 235 LEU F N   1 
ATOM   10023 C  CA  . LEU F 3 148 ? 63.193  -8.356  131.317 1.00 32.05  ? 235 LEU F CA  1 
ATOM   10024 C  C   . LEU F 3 148 ? 61.755  -7.859  131.320 1.00 34.40  ? 235 LEU F C   1 
ATOM   10025 O  O   . LEU F 3 148 ? 60.830  -8.634  131.070 1.00 35.40  ? 235 LEU F O   1 
ATOM   10026 C  CB  . LEU F 3 148 ? 63.653  -8.596  132.754 1.00 31.14  ? 235 LEU F CB  1 
ATOM   10027 C  CG  . LEU F 3 148 ? 64.894  -9.472  132.892 1.00 28.52  ? 235 LEU F CG  1 
ATOM   10028 C  CD1 . LEU F 3 148 ? 65.158  -9.750  134.345 1.00 25.89  ? 235 LEU F CD1 1 
ATOM   10029 C  CD2 . LEU F 3 148 ? 64.697  -10.763 132.141 1.00 28.68  ? 235 LEU F CD2 1 
ATOM   10030 N  N   . ILE F 3 149 ? 61.579  -6.563  131.561 1.00 35.83  ? 236 ILE F N   1 
ATOM   10031 C  CA  . ILE F 3 149 ? 60.250  -5.971  131.627 1.00 35.91  ? 236 ILE F CA  1 
ATOM   10032 C  C   . ILE F 3 149 ? 59.602  -5.834  130.269 1.00 35.33  ? 236 ILE F C   1 
ATOM   10033 O  O   . ILE F 3 149 ? 58.442  -6.190  130.077 1.00 36.38  ? 236 ILE F O   1 
ATOM   10034 C  CB  . ILE F 3 149 ? 60.284  -4.560  132.248 1.00 36.37  ? 236 ILE F CB  1 
ATOM   10035 C  CG1 . ILE F 3 149 ? 61.065  -4.581  133.562 1.00 37.68  ? 236 ILE F CG1 1 
ATOM   10036 C  CG2 . ILE F 3 149 ? 58.850  -4.058  132.458 1.00 35.68  ? 236 ILE F CG2 1 
ATOM   10037 C  CD1 . ILE F 3 149 ? 61.294  -3.231  134.164 1.00 41.40  ? 236 ILE F CD1 1 
ATOM   10038 N  N   . SER F 3 150 ? 60.352  -5.277  129.334 1.00 34.67  ? 237 SER F N   1 
ATOM   10039 C  CA  . SER F 3 150 ? 59.838  -5.044  128.003 1.00 38.00  ? 237 SER F CA  1 
ATOM   10040 C  C   . SER F 3 150 ? 59.611  -6.336  127.259 1.00 46.63  ? 237 SER F C   1 
ATOM   10041 O  O   . SER F 3 150 ? 59.124  -6.330  126.128 1.00 56.24  ? 237 SER F O   1 
ATOM   10042 C  CB  . SER F 3 150 ? 60.820  -4.182  127.229 1.00 41.28  ? 237 SER F CB  1 
ATOM   10043 O  OG  . SER F 3 150 ? 62.092  -4.802  127.217 1.00 47.33  ? 237 SER F OG  1 
ATOM   10044 N  N   . THR F 3 151 ? 59.911  -7.450  127.912 1.00 48.98  ? 238 THR F N   1 
ATOM   10045 C  CA  . THR F 3 151 ? 59.769  -8.736  127.259 1.00 46.75  ? 238 THR F CA  1 
ATOM   10046 C  C   . THR F 3 151 ? 58.836  -9.731  127.933 1.00 51.57  ? 238 THR F C   1 
ATOM   10047 O  O   . THR F 3 151 ? 58.291  -10.618 127.276 1.00 51.34  ? 238 THR F O   1 
ATOM   10048 C  CB  . THR F 3 151 ? 61.155  -9.321  127.025 1.00 41.91  ? 238 THR F CB  1 
ATOM   10049 O  OG1 . THR F 3 151 ? 61.712  -8.715  125.851 1.00 36.36  ? 238 THR F OG1 1 
ATOM   10050 C  CG2 . THR F 3 151 ? 61.110  -10.815 126.876 1.00 49.00  ? 238 THR F CG2 1 
ATOM   10051 N  N   . GLN F 3 152 ? 58.642  -9.571  129.238 1.00 61.10  ? 239 GLN F N   1 
ATOM   10052 C  CA  . GLN F 3 152 ? 57.760  -10.452 129.990 1.00 72.83  ? 239 GLN F CA  1 
ATOM   10053 C  C   . GLN F 3 152 ? 56.390  -10.396 129.343 1.00 79.74  ? 239 GLN F C   1 
ATOM   10054 O  O   . GLN F 3 152 ? 55.971  -9.339  128.876 1.00 74.60  ? 239 GLN F O   1 
ATOM   10055 C  CB  . GLN F 3 152 ? 57.644  -9.982  131.439 1.00 80.04  ? 239 GLN F CB  1 
ATOM   10056 C  CG  . GLN F 3 152 ? 56.972  -8.629  131.598 1.00 87.06  ? 239 GLN F CG  1 
ATOM   10057 C  CD  . GLN F 3 152 ? 56.829  -8.221  133.037 1.00 90.55  ? 239 GLN F CD  1 
ATOM   10058 O  OE1 . GLN F 3 152 ? 57.152  -7.094  133.409 1.00 94.97  ? 239 GLN F OE1 1 
ATOM   10059 N  NE2 . GLN F 3 152 ? 56.345  -9.137  133.863 1.00 91.06  ? 239 GLN F NE2 1 
ATOM   10060 N  N   . SER F 3 153 ? 55.717  -11.542 129.282 1.00 90.64  ? 240 SER F N   1 
ATOM   10061 C  CA  . SER F 3 153 ? 54.376  -11.663 128.692 1.00 102.15 ? 240 SER F CA  1 
ATOM   10062 C  C   . SER F 3 153 ? 54.287  -11.357 127.193 1.00 104.99 ? 240 SER F C   1 
ATOM   10063 O  O   . SER F 3 153 ? 53.394  -11.862 126.500 1.00 106.51 ? 240 SER F O   1 
ATOM   10064 C  CB  . SER F 3 153 ? 53.356  -10.797 129.451 1.00 105.60 ? 240 SER F CB  1 
ATOM   10065 O  OG  . SER F 3 153 ? 53.475  -9.419  129.128 1.00 106.44 ? 240 SER F OG  1 
ATOM   10066 N  N   . ALA F 3 154 ? 55.212  -10.535 126.700 1.00 106.08 ? 241 ALA F N   1 
ATOM   10067 C  CA  . ALA F 3 154 ? 55.239  -10.140 125.299 1.00 109.04 ? 241 ALA F CA  1 
ATOM   10068 C  C   . ALA F 3 154 ? 53.918  -9.458  124.923 1.00 109.04 ? 241 ALA F C   1 
ATOM   10069 O  O   . ALA F 3 154 ? 53.222  -9.872  123.988 1.00 110.22 ? 241 ALA F O   1 
ATOM   10070 C  CB  . ALA F 3 154 ? 55.510  -11.351 124.406 1.00 110.76 ? 241 ALA F CB  1 
ATOM   10071 N  N   . ILE F 3 155 ? 53.549  -8.456  125.719 1.00 105.73 ? 242 ILE F N   1 
ATOM   10072 C  CA  . ILE F 3 155 ? 52.337  -7.671  125.502 1.00 100.59 ? 242 ILE F CA  1 
ATOM   10073 C  C   . ILE F 3 155 ? 52.781  -6.210  125.386 1.00 90.47  ? 242 ILE F C   1 
ATOM   10074 O  O   . ILE F 3 155 ? 53.423  -5.674  126.291 1.00 90.80  ? 242 ILE F O   1 
ATOM   10075 C  CB  . ILE F 3 155 ? 51.310  -7.852  126.657 1.00 107.07 ? 242 ILE F CB  1 
ATOM   10076 C  CG1 . ILE F 3 155 ? 50.857  -9.316  126.725 1.00 110.74 ? 242 ILE F CG1 1 
ATOM   10077 C  CG2 . ILE F 3 155 ? 50.097  -6.929  126.466 1.00 109.50 ? 242 ILE F CG2 1 
ATOM   10078 C  CD1 . ILE F 3 155 ? 50.315  -9.867  125.411 1.00 111.94 ? 242 ILE F CD1 1 
ATOM   10079 N  N   . PRO F 3 156 ? 52.409  -5.547  124.277 1.00 82.82  ? 243 PRO F N   1 
ATOM   10080 C  CA  . PRO F 3 156 ? 52.695  -4.163  123.891 1.00 74.99  ? 243 PRO F CA  1 
ATOM   10081 C  C   . PRO F 3 156 ? 53.124  -3.194  124.979 1.00 62.87  ? 243 PRO F C   1 
ATOM   10082 O  O   . PRO F 3 156 ? 52.350  -2.866  125.876 1.00 62.85  ? 243 PRO F O   1 
ATOM   10083 C  CB  . PRO F 3 156 ? 51.383  -3.729  123.257 1.00 79.65  ? 243 PRO F CB  1 
ATOM   10084 C  CG  . PRO F 3 156 ? 51.010  -4.924  122.499 1.00 83.50  ? 243 PRO F CG  1 
ATOM   10085 C  CD  . PRO F 3 156 ? 51.295  -6.068  123.464 1.00 84.53  ? 243 PRO F CD  1 
ATOM   10086 N  N   . TYR F 3 157 ? 54.382  -2.777  124.905 1.00 50.40  ? 244 TYR F N   1 
ATOM   10087 C  CA  . TYR F 3 157 ? 54.928  -1.809  125.839 1.00 42.95  ? 244 TYR F CA  1 
ATOM   10088 C  C   . TYR F 3 157 ? 55.243  -0.603  124.993 1.00 44.77  ? 244 TYR F C   1 
ATOM   10089 O  O   . TYR F 3 157 ? 55.676  -0.729  123.846 1.00 49.89  ? 244 TYR F O   1 
ATOM   10090 C  CB  . TYR F 3 157 ? 56.195  -2.325  126.515 1.00 37.67  ? 244 TYR F CB  1 
ATOM   10091 C  CG  . TYR F 3 157 ? 55.959  -2.845  127.914 1.00 32.03  ? 244 TYR F CG  1 
ATOM   10092 C  CD1 . TYR F 3 157 ? 55.624  -1.975  128.941 1.00 29.71  ? 244 TYR F CD1 1 
ATOM   10093 C  CD2 . TYR F 3 157 ? 56.055  -4.209  128.204 1.00 33.81  ? 244 TYR F CD2 1 
ATOM   10094 C  CE1 . TYR F 3 157 ? 55.390  -2.437  130.220 1.00 29.36  ? 244 TYR F CE1 1 
ATOM   10095 C  CE2 . TYR F 3 157 ? 55.818  -4.688  129.482 1.00 30.91  ? 244 TYR F CE2 1 
ATOM   10096 C  CZ  . TYR F 3 157 ? 55.484  -3.794  130.493 1.00 32.72  ? 244 TYR F CZ  1 
ATOM   10097 O  OH  . TYR F 3 157 ? 55.233  -4.240  131.781 1.00 35.23  ? 244 TYR F OH  1 
ATOM   10098 N  N   . ALA F 3 158 ? 54.993  0.570   125.545 1.00 39.53  ? 245 ALA F N   1 
ATOM   10099 C  CA  . ALA F 3 158 ? 55.235  1.796   124.809 1.00 36.72  ? 245 ALA F CA  1 
ATOM   10100 C  C   . ALA F 3 158 ? 56.269  2.646   125.515 1.00 37.01  ? 245 ALA F C   1 
ATOM   10101 O  O   . ALA F 3 158 ? 56.227  2.814   126.735 1.00 36.11  ? 245 ALA F O   1 
ATOM   10102 C  CB  . ALA F 3 158 ? 53.932  2.574   124.636 1.00 37.73  ? 245 ALA F CB  1 
ATOM   10103 N  N   . LEU F 3 159 ? 57.202  3.176   124.735 1.00 35.63  ? 246 LEU F N   1 
ATOM   10104 C  CA  . LEU F 3 159 ? 58.258  4.007   125.270 1.00 29.59  ? 246 LEU F CA  1 
ATOM   10105 C  C   . LEU F 3 159 ? 57.910  5.473   125.176 1.00 28.96  ? 246 LEU F C   1 
ATOM   10106 O  O   . LEU F 3 159 ? 57.347  5.907   124.181 1.00 31.23  ? 246 LEU F O   1 
ATOM   10107 C  CB  . LEU F 3 159 ? 59.544  3.773   124.489 1.00 22.86  ? 246 LEU F CB  1 
ATOM   10108 C  CG  . LEU F 3 159 ? 60.623  4.823   124.758 1.00 25.44  ? 246 LEU F CG  1 
ATOM   10109 C  CD1 . LEU F 3 159 ? 61.102  4.735   126.206 1.00 27.72  ? 246 LEU F CD1 1 
ATOM   10110 C  CD2 . LEU F 3 159 ? 61.773  4.635   123.791 1.00 25.65  ? 246 LEU F CD2 1 
ATOM   10111 N  N   . ARG F 3 160 ? 58.236  6.230   126.218 1.00 28.67  ? 247 ARG F N   1 
ATOM   10112 C  CA  . ARG F 3 160 ? 58.023  7.665   126.196 1.00 31.29  ? 247 ARG F CA  1 
ATOM   10113 C  C   . ARG F 3 160 ? 59.248  8.436   126.624 1.00 31.10  ? 247 ARG F C   1 
ATOM   10114 O  O   . ARG F 3 160 ? 59.755  8.295   127.735 1.00 33.78  ? 247 ARG F O   1 
ATOM   10115 C  CB  . ARG F 3 160 ? 56.849  8.130   127.034 1.00 33.82  ? 247 ARG F CB  1 
ATOM   10116 C  CG  . ARG F 3 160 ? 56.871  9.648   127.165 1.00 38.14  ? 247 ARG F CG  1 
ATOM   10117 C  CD  . ARG F 3 160 ? 55.611  10.197  127.780 1.00 47.03  ? 247 ARG F CD  1 
ATOM   10118 N  NE  . ARG F 3 160 ? 54.446  10.027  126.914 1.00 50.84  ? 247 ARG F NE  1 
ATOM   10119 C  CZ  . ARG F 3 160 ? 53.200  10.355  127.259 1.00 57.47  ? 247 ARG F CZ  1 
ATOM   10120 N  NH1 . ARG F 3 160 ? 52.940  10.871  128.460 1.00 58.23  ? 247 ARG F NH1 1 
ATOM   10121 N  NH2 . ARG F 3 160 ? 52.206  10.178  126.399 1.00 57.69  ? 247 ARG F NH2 1 
ATOM   10122 N  N   . VAL F 3 161 ? 59.713  9.261   125.707 1.00 31.42  ? 248 VAL F N   1 
ATOM   10123 C  CA  . VAL F 3 161 ? 60.846  10.105  125.946 1.00 26.53  ? 248 VAL F CA  1 
ATOM   10124 C  C   . VAL F 3 161 ? 60.233  11.439  126.334 1.00 27.94  ? 248 VAL F C   1 
ATOM   10125 O  O   . VAL F 3 161 ? 59.173  11.798  125.848 1.00 33.39  ? 248 VAL F O   1 
ATOM   10126 C  CB  . VAL F 3 161 ? 61.668  10.285  124.664 1.00 19.97  ? 248 VAL F CB  1 
ATOM   10127 C  CG1 . VAL F 3 161 ? 62.872  11.162  124.942 1.00 21.10  ? 248 VAL F CG1 1 
ATOM   10128 C  CG2 . VAL F 3 161 ? 62.107  8.940   124.129 1.00 12.74  ? 248 VAL F CG2 1 
ATOM   10129 N  N   . GLU F 3 162 ? 60.863  12.123  127.276 1.00 32.33  ? 249 GLU F N   1 
ATOM   10130 C  CA  . GLU F 3 162 ? 60.430  13.435  127.725 1.00 31.65  ? 249 GLU F CA  1 
ATOM   10131 C  C   . GLU F 3 162 ? 61.707  14.218  127.840 1.00 34.12  ? 249 GLU F C   1 
ATOM   10132 O  O   . GLU F 3 162 ? 62.660  13.789  128.504 1.00 39.44  ? 249 GLU F O   1 
ATOM   10133 C  CB  . GLU F 3 162 ? 59.778  13.393  129.107 1.00 37.78  ? 249 GLU F CB  1 
ATOM   10134 C  CG  . GLU F 3 162 ? 58.483  12.585  129.202 1.00 46.66  ? 249 GLU F CG  1 
ATOM   10135 C  CD  . GLU F 3 162 ? 57.713  12.832  130.504 1.00 49.47  ? 249 GLU F CD  1 
ATOM   10136 O  OE1 . GLU F 3 162 ? 58.339  13.062  131.563 1.00 51.38  ? 249 GLU F OE1 1 
ATOM   10137 O  OE2 . GLU F 3 162 ? 56.466  12.792  130.467 1.00 52.01  ? 249 GLU F OE2 1 
ATOM   10138 N  N   . LEU F 3 163 ? 61.771  15.329  127.130 1.00 37.77  ? 250 LEU F N   1 
ATOM   10139 C  CA  . LEU F 3 163 ? 62.959  16.166  127.201 1.00 39.19  ? 250 LEU F CA  1 
ATOM   10140 C  C   . LEU F 3 163 ? 62.539  17.496  127.787 1.00 38.30  ? 250 LEU F C   1 
ATOM   10141 O  O   . LEU F 3 163 ? 61.341  17.760  127.988 1.00 40.03  ? 250 LEU F O   1 
ATOM   10142 C  CB  . LEU F 3 163 ? 63.582  16.404  125.814 1.00 38.59  ? 250 LEU F CB  1 
ATOM   10143 C  CG  . LEU F 3 163 ? 64.136  15.239  124.985 1.00 40.70  ? 250 LEU F CG  1 
ATOM   10144 C  CD1 . LEU F 3 163 ? 64.974  14.315  125.884 1.00 37.62  ? 250 LEU F CD1 1 
ATOM   10145 C  CD2 . LEU F 3 163 ? 62.998  14.475  124.323 1.00 41.26  ? 250 LEU F CD2 1 
ATOM   10146 N  N   . GLU F 3 164 ? 63.539  18.296  128.128 1.00 31.24  ? 251 GLU F N   1 
ATOM   10147 C  CA  . GLU F 3 164 ? 63.295  19.626  128.637 1.00 29.36  ? 251 GLU F CA  1 
ATOM   10148 C  C   . GLU F 3 164 ? 64.553  20.410  128.406 1.00 29.22  ? 251 GLU F C   1 
ATOM   10149 O  O   . GLU F 3 164 ? 65.635  19.997  128.821 1.00 18.63  ? 251 GLU F O   1 
ATOM   10150 C  CB  . GLU F 3 164 ? 62.951  19.649  130.120 1.00 28.93  ? 251 GLU F CB  1 
ATOM   10151 C  CG  . GLU F 3 164 ? 62.579  21.061  130.577 1.00 34.47  ? 251 GLU F CG  1 
ATOM   10152 C  CD  . GLU F 3 164 ? 62.606  21.259  132.088 1.00 42.21  ? 251 GLU F CD  1 
ATOM   10153 O  OE1 . GLU F 3 164 ? 61.920  20.505  132.815 1.00 44.88  ? 251 GLU F OE1 1 
ATOM   10154 O  OE2 . GLU F 3 164 ? 63.303  22.192  132.551 1.00 45.43  ? 251 GLU F OE2 1 
ATOM   10155 N  N   . ASP F 3 165 ? 64.413  21.511  127.677 1.00 33.27  ? 252 ASP F N   1 
ATOM   10156 C  CA  . ASP F 3 165 ? 65.552  22.365  127.402 1.00 35.13  ? 252 ASP F CA  1 
ATOM   10157 C  C   . ASP F 3 165 ? 65.855  23.195  128.640 1.00 32.28  ? 252 ASP F C   1 
ATOM   10158 O  O   . ASP F 3 165 ? 65.188  23.091  129.678 1.00 30.41  ? 252 ASP F O   1 
ATOM   10159 C  CB  . ASP F 3 165 ? 65.277  23.274  126.196 1.00 38.09  ? 252 ASP F CB  1 
ATOM   10160 C  CG  . ASP F 3 165 ? 63.996  24.090  126.341 1.00 41.74  ? 252 ASP F CG  1 
ATOM   10161 O  OD1 . ASP F 3 165 ? 63.595  24.414  127.485 1.00 40.02  ? 252 ASP F OD1 1 
ATOM   10162 O  OD2 . ASP F 3 165 ? 63.386  24.407  125.291 1.00 42.53  ? 252 ASP F OD2 1 
ATOM   10163 N  N   . TRP F 3 166 ? 66.844  24.055  128.507 1.00 32.70  ? 253 TRP F N   1 
ATOM   10164 C  CA  . TRP F 3 166 ? 67.240  24.917  129.597 1.00 35.60  ? 253 TRP F CA  1 
ATOM   10165 C  C   . TRP F 3 166 ? 66.322  26.115  129.671 1.00 40.08  ? 253 TRP F C   1 
ATOM   10166 O  O   . TRP F 3 166 ? 66.706  27.173  130.148 1.00 42.72  ? 253 TRP F O   1 
ATOM   10167 C  CB  . TRP F 3 166 ? 68.680  25.341  129.387 1.00 36.06  ? 253 TRP F CB  1 
ATOM   10168 C  CG  . TRP F 3 166 ? 69.534  24.160  129.344 1.00 38.91  ? 253 TRP F CG  1 
ATOM   10169 C  CD1 . TRP F 3 166 ? 69.664  23.275  128.317 1.00 42.90  ? 253 TRP F CD1 1 
ATOM   10170 C  CD2 . TRP F 3 166 ? 70.322  23.661  130.409 1.00 38.78  ? 253 TRP F CD2 1 
ATOM   10171 N  NE1 . TRP F 3 166 ? 70.488  22.246  128.683 1.00 43.50  ? 253 TRP F NE1 1 
ATOM   10172 C  CE2 . TRP F 3 166 ? 70.910  22.461  129.966 1.00 40.30  ? 253 TRP F CE2 1 
ATOM   10173 C  CE3 . TRP F 3 166 ? 70.590  24.110  131.705 1.00 40.41  ? 253 TRP F CE3 1 
ATOM   10174 C  CZ2 . TRP F 3 166 ? 71.753  21.704  130.771 1.00 43.77  ? 253 TRP F CZ2 1 
ATOM   10175 C  CZ3 . TRP F 3 166 ? 71.429  23.361  132.508 1.00 41.41  ? 253 TRP F CZ3 1 
ATOM   10176 C  CH2 . TRP F 3 166 ? 72.002  22.170  132.039 1.00 44.25  ? 253 TRP F CH2 1 
ATOM   10177 N  N   . ASN F 3 167 ? 65.114  25.952  129.155 1.00 43.38  ? 254 ASN F N   1 
ATOM   10178 C  CA  . ASN F 3 167 ? 64.151  27.023  129.186 1.00 46.94  ? 254 ASN F CA  1 
ATOM   10179 C  C   . ASN F 3 167 ? 62.819  26.547  129.678 1.00 46.99  ? 254 ASN F C   1 
ATOM   10180 O  O   . ASN F 3 167 ? 61.805  27.224  129.494 1.00 47.02  ? 254 ASN F O   1 
ATOM   10181 C  CB  . ASN F 3 167 ? 64.018  27.672  127.829 1.00 56.30  ? 254 ASN F CB  1 
ATOM   10182 C  CG  . ASN F 3 167 ? 64.633  29.023  127.810 1.00 61.47  ? 254 ASN F CG  1 
ATOM   10183 O  OD1 . ASN F 3 167 ? 64.101  29.953  128.414 1.00 66.80  ? 254 ASN F OD1 1 
ATOM   10184 N  ND2 . ASN F 3 167 ? 65.805  29.136  127.189 1.00 61.77  ? 254 ASN F ND2 1 
ATOM   10185 N  N   . GLY F 3 168 ? 62.835  25.370  130.300 1.00 48.80  ? 255 GLY F N   1 
ATOM   10186 C  CA  . GLY F 3 168 ? 61.634  24.796  130.870 1.00 52.78  ? 255 GLY F CA  1 
ATOM   10187 C  C   . GLY F 3 168 ? 60.589  24.408  129.860 1.00 57.71  ? 255 GLY F C   1 
ATOM   10188 O  O   . GLY F 3 168 ? 59.418  24.277  130.205 1.00 57.34  ? 255 GLY F O   1 
ATOM   10189 N  N   . ARG F 3 169 ? 60.996  24.295  128.602 1.00 62.51  ? 256 ARG F N   1 
ATOM   10190 C  CA  . ARG F 3 169 ? 60.082  23.892  127.553 1.00 63.61  ? 256 ARG F CA  1 
ATOM   10191 C  C   . ARG F 3 169 ? 60.299  22.399  127.430 1.00 58.81  ? 256 ARG F C   1 
ATOM   10192 O  O   . ARG F 3 169 ? 61.442  21.937  127.382 1.00 57.56  ? 256 ARG F O   1 
ATOM   10193 C  CB  . ARG F 3 169 ? 60.416  24.611  126.248 1.00 74.51  ? 256 ARG F CB  1 
ATOM   10194 C  CG  . ARG F 3 169 ? 60.114  26.109  126.277 1.00 86.22  ? 256 ARG F CG  1 
ATOM   10195 C  CD  . ARG F 3 169 ? 60.791  26.860  125.129 1.00 93.40  ? 256 ARG F CD  1 
ATOM   10196 N  NE  . ARG F 3 169 ? 60.498  26.278  123.820 1.00 101.12 ? 256 ARG F NE  1 
ATOM   10197 C  CZ  . ARG F 3 169 ? 59.307  26.306  123.222 1.00 106.91 ? 256 ARG F CZ  1 
ATOM   10198 N  NH1 . ARG F 3 169 ? 58.270  26.895  123.811 1.00 108.43 ? 256 ARG F NH1 1 
ATOM   10199 N  NH2 . ARG F 3 169 ? 59.150  25.732  122.032 1.00 108.85 ? 256 ARG F NH2 1 
ATOM   10200 N  N   . THR F 3 170 ? 59.207  21.645  127.469 1.00 55.32  ? 257 THR F N   1 
ATOM   10201 C  CA  . THR F 3 170 ? 59.282  20.196  127.378 1.00 55.59  ? 257 THR F CA  1 
ATOM   10202 C  C   . THR F 3 170 ? 58.753  19.674  126.045 1.00 56.99  ? 257 THR F C   1 
ATOM   10203 O  O   . THR F 3 170 ? 58.327  20.452  125.191 1.00 61.68  ? 257 THR F O   1 
ATOM   10204 C  CB  . THR F 3 170 ? 58.498  19.549  128.516 1.00 54.96  ? 257 THR F CB  1 
ATOM   10205 O  OG1 . THR F 3 170 ? 57.114  19.905  128.400 1.00 61.19  ? 257 THR F OG1 1 
ATOM   10206 C  CG2 . THR F 3 170 ? 59.014  20.036  129.852 1.00 49.20  ? 257 THR F CG2 1 
ATOM   10207 N  N   . SER F 3 171 ? 58.808  18.356  125.868 1.00 53.17  ? 258 SER F N   1 
ATOM   10208 C  CA  . SER F 3 171 ? 58.337  17.701  124.652 1.00 45.82  ? 258 SER F CA  1 
ATOM   10209 C  C   . SER F 3 171 ? 58.508  16.199  124.794 1.00 45.12  ? 258 SER F C   1 
ATOM   10210 O  O   . SER F 3 171 ? 59.490  15.713  125.341 1.00 44.44  ? 258 SER F O   1 
ATOM   10211 C  CB  . SER F 3 171 ? 59.100  18.195  123.424 1.00 42.70  ? 258 SER F CB  1 
ATOM   10212 O  OG  . SER F 3 171 ? 60.448  17.767  123.452 1.00 37.29  ? 258 SER F OG  1 
ATOM   10213 N  N   . THR F 3 172 ? 57.531  15.464  124.302 1.00 44.52  ? 259 THR F N   1 
ATOM   10214 C  CA  . THR F 3 172 ? 57.575  14.025  124.390 1.00 37.68  ? 259 THR F CA  1 
ATOM   10215 C  C   . THR F 3 172 ? 57.956  13.457  123.041 1.00 38.34  ? 259 THR F C   1 
ATOM   10216 O  O   . THR F 3 172 ? 58.300  14.186  122.128 1.00 36.24  ? 259 THR F O   1 
ATOM   10217 C  CB  . THR F 3 172 ? 56.207  13.477  124.761 1.00 37.40  ? 259 THR F CB  1 
ATOM   10218 O  OG1 . THR F 3 172 ? 55.312  13.659  123.655 1.00 41.98  ? 259 THR F OG1 1 
ATOM   10219 C  CG2 . THR F 3 172 ? 55.667  14.208  125.963 1.00 32.05  ? 259 THR F CG2 1 
ATOM   10220 N  N   . ALA F 3 173 ? 57.849  12.143  122.932 1.00 39.09  ? 260 ALA F N   1 
ATOM   10221 C  CA  . ALA F 3 173 ? 58.145  11.399  121.721 1.00 39.29  ? 260 ALA F CA  1 
ATOM   10222 C  C   . ALA F 3 173 ? 57.866  9.989   122.184 1.00 40.04  ? 260 ALA F C   1 
ATOM   10223 O  O   . ALA F 3 173 ? 58.460  9.507   123.148 1.00 42.11  ? 260 ALA F O   1 
ATOM   10224 C  CB  . ALA F 3 173 ? 59.602  11.560  121.320 1.00 39.01  ? 260 ALA F CB  1 
ATOM   10225 N  N   . ASP F 3 174 ? 56.904  9.351   121.544 1.00 37.79  ? 261 ASP F N   1 
ATOM   10226 C  CA  . ASP F 3 174 ? 56.529  8.013   121.942 1.00 33.57  ? 261 ASP F CA  1 
ATOM   10227 C  C   . ASP F 3 174 ? 56.883  6.995   120.874 1.00 31.48  ? 261 ASP F C   1 
ATOM   10228 O  O   . ASP F 3 174 ? 57.250  7.346   119.762 1.00 34.42  ? 261 ASP F O   1 
ATOM   10229 C  CB  . ASP F 3 174 ? 55.045  8.007   122.279 1.00 38.01  ? 261 ASP F CB  1 
ATOM   10230 C  CG  . ASP F 3 174 ? 54.674  9.124   123.247 1.00 45.65  ? 261 ASP F CG  1 
ATOM   10231 O  OD1 . ASP F 3 174 ? 54.499  10.283  122.810 1.00 51.02  ? 261 ASP F OD1 1 
ATOM   10232 O  OD2 . ASP F 3 174 ? 54.596  8.853   124.458 1.00 48.84  ? 261 ASP F OD2 1 
ATOM   10233 N  N   . TYR F 3 175 ? 56.842  5.727   121.234 1.00 29.35  ? 262 TYR F N   1 
ATOM   10234 C  CA  . TYR F 3 175 ? 57.177  4.674   120.304 1.00 28.59  ? 262 TYR F CA  1 
ATOM   10235 C  C   . TYR F 3 175 ? 56.391  3.456   120.745 1.00 30.01  ? 262 TYR F C   1 
ATOM   10236 O  O   . TYR F 3 175 ? 56.491  3.028   121.892 1.00 35.12  ? 262 TYR F O   1 
ATOM   10237 C  CB  . TYR F 3 175 ? 58.691  4.401   120.350 1.00 26.26  ? 262 TYR F CB  1 
ATOM   10238 C  CG  . TYR F 3 175 ? 59.532  5.516   119.734 1.00 26.87  ? 262 TYR F CG  1 
ATOM   10239 C  CD1 . TYR F 3 175 ? 59.781  5.536   118.358 1.00 30.97  ? 262 TYR F CD1 1 
ATOM   10240 C  CD2 . TYR F 3 175 ? 60.050  6.568   120.509 1.00 19.00  ? 262 TYR F CD2 1 
ATOM   10241 C  CE1 . TYR F 3 175 ? 60.509  6.554   117.761 1.00 21.27  ? 262 TYR F CE1 1 
ATOM   10242 C  CE2 . TYR F 3 175 ? 60.786  7.596   119.912 1.00 20.94  ? 262 TYR F CE2 1 
ATOM   10243 C  CZ  . TYR F 3 175 ? 61.006  7.575   118.527 1.00 21.77  ? 262 TYR F CZ  1 
ATOM   10244 O  OH  . TYR F 3 175 ? 61.715  8.576   117.900 1.00 23.28  ? 262 TYR F OH  1 
ATOM   10245 N  N   . ALA F 3 176 ? 55.562  2.933   119.856 1.00 23.96  ? 263 ALA F N   1 
ATOM   10246 C  CA  . ALA F 3 176 ? 54.763  1.759   120.170 1.00 28.48  ? 263 ALA F CA  1 
ATOM   10247 C  C   . ALA F 3 176 ? 55.508  0.447   119.930 1.00 32.27  ? 263 ALA F C   1 
ATOM   10248 O  O   . ALA F 3 176 ? 56.306  0.326   118.986 1.00 31.47  ? 263 ALA F O   1 
ATOM   10249 C  CB  . ALA F 3 176 ? 53.470  1.775   119.371 1.00 30.47  ? 263 ALA F CB  1 
ATOM   10250 N  N   . MET F 3 177 ? 55.182  -0.549  120.751 1.00 30.89  ? 264 MET F N   1 
ATOM   10251 C  CA  . MET F 3 177 ? 55.798  -1.860  120.658 1.00 38.12  ? 264 MET F CA  1 
ATOM   10252 C  C   . MET F 3 177 ? 57.280  -1.735  120.850 1.00 36.53  ? 264 MET F C   1 
ATOM   10253 O  O   . MET F 3 177 ? 58.069  -2.152  120.005 1.00 34.36  ? 264 MET F O   1 
ATOM   10254 C  CB  . MET F 3 177 ? 55.503  -2.533  119.315 1.00 43.46  ? 264 MET F CB  1 
ATOM   10255 C  CG  . MET F 3 177 ? 54.166  -3.234  119.268 1.00 52.67  ? 264 MET F CG  1 
ATOM   10256 S  SD  . MET F 3 177 ? 52.818  -2.059  119.500 1.00 60.51  ? 264 MET F SD  1 
ATOM   10257 C  CE  . MET F 3 177 ? 52.216  -2.007  117.814 1.00 60.55  ? 264 MET F CE  1 
ATOM   10258 N  N   . PHE F 3 178 ? 57.646  -1.097  121.946 1.00 32.73  ? 265 PHE F N   1 
ATOM   10259 C  CA  . PHE F 3 178 ? 59.037  -0.920  122.268 1.00 32.78  ? 265 PHE F CA  1 
ATOM   10260 C  C   . PHE F 3 178 ? 59.526  -2.205  122.891 1.00 32.42  ? 265 PHE F C   1 
ATOM   10261 O  O   . PHE F 3 178 ? 58.744  -2.907  123.530 1.00 37.33  ? 265 PHE F O   1 
ATOM   10262 C  CB  . PHE F 3 178 ? 59.182  0.206   123.276 1.00 32.08  ? 265 PHE F CB  1 
ATOM   10263 C  CG  . PHE F 3 178 ? 60.532  0.274   123.901 1.00 32.14  ? 265 PHE F CG  1 
ATOM   10264 C  CD1 . PHE F 3 178 ? 61.556  0.992   123.295 1.00 30.94  ? 265 PHE F CD1 1 
ATOM   10265 C  CD2 . PHE F 3 178 ? 60.778  -0.362  125.112 1.00 28.32  ? 265 PHE F CD2 1 
ATOM   10266 C  CE1 . PHE F 3 178 ? 62.799  1.079   123.887 1.00 30.33  ? 265 PHE F CE1 1 
ATOM   10267 C  CE2 . PHE F 3 178 ? 62.022  -0.283  125.713 1.00 27.02  ? 265 PHE F CE2 1 
ATOM   10268 C  CZ  . PHE F 3 178 ? 63.037  0.442   125.102 1.00 31.18  ? 265 PHE F CZ  1 
ATOM   10269 N  N   . LYS F 3 179 ? 60.807  -2.509  122.694 1.00 24.94  ? 266 LYS F N   1 
ATOM   10270 C  CA  . LYS F 3 179 ? 61.398  -3.695  123.288 1.00 33.81  ? 266 LYS F CA  1 
ATOM   10271 C  C   . LYS F 3 179 ? 62.903  -3.745  123.124 1.00 31.65  ? 266 LYS F C   1 
ATOM   10272 O  O   . LYS F 3 179 ? 63.460  -3.162  122.198 1.00 28.84  ? 266 LYS F O   1 
ATOM   10273 C  CB  . LYS F 3 179 ? 60.772  -4.969  122.726 1.00 38.73  ? 266 LYS F CB  1 
ATOM   10274 C  CG  . LYS F 3 179 ? 61.306  -5.395  121.390 1.00 43.74  ? 266 LYS F CG  1 
ATOM   10275 C  CD  . LYS F 3 179 ? 60.247  -6.193  120.646 1.00 52.94  ? 266 LYS F CD  1 
ATOM   10276 C  CE  . LYS F 3 179 ? 59.097  -5.293  120.124 1.00 53.03  ? 266 LYS F CE  1 
ATOM   10277 N  NZ  . LYS F 3 179 ? 59.505  -4.303  119.052 1.00 43.14  ? 266 LYS F NZ  1 
ATOM   10278 N  N   . VAL F 3 180 ? 63.552  -4.447  124.044 1.00 27.35  ? 267 VAL F N   1 
ATOM   10279 C  CA  . VAL F 3 180 ? 64.997  -4.613  124.025 1.00 27.05  ? 267 VAL F CA  1 
ATOM   10280 C  C   . VAL F 3 180 ? 65.335  -6.090  124.201 1.00 27.99  ? 267 VAL F C   1 
ATOM   10281 O  O   . VAL F 3 180 ? 64.828  -6.757  125.108 1.00 30.21  ? 267 VAL F O   1 
ATOM   10282 C  CB  . VAL F 3 180 ? 65.660  -3.809  125.148 1.00 22.06  ? 267 VAL F CB  1 
ATOM   10283 C  CG1 . VAL F 3 180 ? 67.168  -4.069  125.178 1.00 13.92  ? 267 VAL F CG1 1 
ATOM   10284 C  CG2 . VAL F 3 180 ? 65.353  -2.335  124.963 1.00 21.42  ? 267 VAL F CG2 1 
ATOM   10285 N  N   . GLY F 3 181 ? 66.199  -6.593  123.330 1.00 25.61  ? 268 GLY F N   1 
ATOM   10286 C  CA  . GLY F 3 181 ? 66.576  -7.989  123.385 1.00 23.75  ? 268 GLY F CA  1 
ATOM   10287 C  C   . GLY F 3 181 ? 67.498  -8.356  124.523 1.00 22.98  ? 268 GLY F C   1 
ATOM   10288 O  O   . GLY F 3 181 ? 67.842  -7.507  125.342 1.00 25.72  ? 268 GLY F O   1 
ATOM   10289 N  N   . PRO F 3 182 ? 67.896  -9.638  124.602 1.00 21.12  ? 269 PRO F N   1 
ATOM   10290 C  CA  . PRO F 3 182 ? 68.782  -10.223 125.610 1.00 21.30  ? 269 PRO F CA  1 
ATOM   10291 C  C   . PRO F 3 182 ? 70.219  -9.876  125.301 1.00 19.38  ? 269 PRO F C   1 
ATOM   10292 O  O   . PRO F 3 182 ? 70.529  -9.439  124.188 1.00 8.56   ? 269 PRO F O   1 
ATOM   10293 C  CB  . PRO F 3 182 ? 68.555  -11.710 125.415 1.00 22.17  ? 269 PRO F CB  1 
ATOM   10294 C  CG  . PRO F 3 182 ? 68.433  -11.792 123.951 1.00 13.66  ? 269 PRO F CG  1 
ATOM   10295 C  CD  . PRO F 3 182 ? 67.460  -10.681 123.660 1.00 11.77  ? 269 PRO F CD  1 
ATOM   10296 N  N   . GLU F 3 183 ? 71.096  -10.148 126.262 1.00 20.12  ? 270 GLU F N   1 
ATOM   10297 C  CA  . GLU F 3 183 ? 72.493  -9.826  126.099 1.00 19.05  ? 270 GLU F CA  1 
ATOM   10298 C  C   . GLU F 3 183 ? 73.045  -10.564 124.922 1.00 21.20  ? 270 GLU F C   1 
ATOM   10299 O  O   . GLU F 3 183 ? 73.930  -10.079 124.227 1.00 21.95  ? 270 GLU F O   1 
ATOM   10300 C  CB  . GLU F 3 183 ? 73.278  -10.193 127.338 1.00 22.30  ? 270 GLU F CB  1 
ATOM   10301 C  CG  . GLU F 3 183 ? 74.739  -9.812  127.232 1.00 30.23  ? 270 GLU F CG  1 
ATOM   10302 C  CD  . GLU F 3 183 ? 75.485  -9.972  128.540 1.00 36.95  ? 270 GLU F CD  1 
ATOM   10303 O  OE1 . GLU F 3 183 ? 75.028  -10.746 129.418 1.00 37.62  ? 270 GLU F OE1 1 
ATOM   10304 O  OE2 . GLU F 3 183 ? 76.539  -9.318  128.686 1.00 42.04  ? 270 GLU F OE2 1 
ATOM   10305 N  N   . ALA F 3 184 ? 72.475  -11.724 124.654 1.00 23.43  ? 271 ALA F N   1 
ATOM   10306 C  CA  . ALA F 3 184 ? 72.959  -12.517 123.547 1.00 23.89  ? 271 ALA F CA  1 
ATOM   10307 C  C   . ALA F 3 184 ? 72.702  -11.778 122.262 1.00 26.54  ? 271 ALA F C   1 
ATOM   10308 O  O   . ALA F 3 184 ? 73.272  -12.100 121.220 1.00 31.07  ? 271 ALA F O   1 
ATOM   10309 C  CB  . ALA F 3 184 ? 72.284  -13.840 123.532 1.00 30.59  ? 271 ALA F CB  1 
ATOM   10310 N  N   . ASP F 3 185 ? 71.833  -10.781 122.337 1.00 29.49  ? 272 ASP F N   1 
ATOM   10311 C  CA  . ASP F 3 185 ? 71.522  -9.991  121.165 1.00 28.35  ? 272 ASP F CA  1 
ATOM   10312 C  C   . ASP F 3 185 ? 72.054  -8.580  121.370 1.00 24.15  ? 272 ASP F C   1 
ATOM   10313 O  O   . ASP F 3 185 ? 71.636  -7.613  120.716 1.00 12.48  ? 272 ASP F O   1 
ATOM   10314 C  CB  . ASP F 3 185 ? 70.025  -9.992  120.910 1.00 31.26  ? 272 ASP F CB  1 
ATOM   10315 C  CG  . ASP F 3 185 ? 69.694  -9.604  119.502 1.00 33.42  ? 272 ASP F CG  1 
ATOM   10316 O  OD1 . ASP F 3 185 ? 70.543  -9.880  118.616 1.00 34.60  ? 272 ASP F OD1 1 
ATOM   10317 O  OD2 . ASP F 3 185 ? 68.603  -9.015  119.287 1.00 38.11  ? 272 ASP F OD2 1 
ATOM   10318 N  N   . LYS F 3 186 ? 73.015  -8.479  122.282 1.00 24.45  ? 273 LYS F N   1 
ATOM   10319 C  CA  . LYS F 3 186 ? 73.651  -7.210  122.590 1.00 23.46  ? 273 LYS F CA  1 
ATOM   10320 C  C   . LYS F 3 186 ? 72.585  -6.179  122.877 1.00 28.44  ? 273 LYS F C   1 
ATOM   10321 O  O   . LYS F 3 186 ? 72.662  -5.044  122.425 1.00 27.30  ? 273 LYS F O   1 
ATOM   10322 C  CB  . LYS F 3 186 ? 74.534  -6.754  121.428 1.00 17.88  ? 273 LYS F CB  1 
ATOM   10323 C  CG  . LYS F 3 186 ? 75.313  -7.886  120.797 1.00 19.83  ? 273 LYS F CG  1 
ATOM   10324 C  CD  . LYS F 3 186 ? 76.004  -8.755  121.845 1.00 28.93  ? 273 LYS F CD  1 
ATOM   10325 C  CE  . LYS F 3 186 ? 77.264  -8.095  122.409 1.00 31.07  ? 273 LYS F CE  1 
ATOM   10326 N  NZ  . LYS F 3 186 ? 78.348  -8.012  121.390 1.00 35.06  ? 273 LYS F NZ  1 
ATOM   10327 N  N   . TYR F 3 187 ? 71.544  -6.642  123.559 1.00 31.44  ? 274 TYR F N   1 
ATOM   10328 C  CA  . TYR F 3 187 ? 70.422  -5.819  123.973 1.00 33.52  ? 274 TYR F CA  1 
ATOM   10329 C  C   . TYR F 3 187 ? 69.916  -4.934  122.854 1.00 37.02  ? 274 TYR F C   1 
ATOM   10330 O  O   . TYR F 3 187 ? 69.702  -3.746  123.066 1.00 40.78  ? 274 TYR F O   1 
ATOM   10331 C  CB  . TYR F 3 187 ? 70.821  -4.966  125.184 1.00 33.04  ? 274 TYR F CB  1 
ATOM   10332 C  CG  . TYR F 3 187 ? 71.172  -5.778  126.416 1.00 38.74  ? 274 TYR F CG  1 
ATOM   10333 C  CD1 . TYR F 3 187 ? 70.188  -6.478  127.113 1.00 39.98  ? 274 TYR F CD1 1 
ATOM   10334 C  CD2 . TYR F 3 187 ? 72.482  -5.844  126.889 1.00 39.36  ? 274 TYR F CD2 1 
ATOM   10335 C  CE1 . TYR F 3 187 ? 70.493  -7.218  128.249 1.00 41.59  ? 274 TYR F CE1 1 
ATOM   10336 C  CE2 . TYR F 3 187 ? 72.798  -6.585  128.027 1.00 40.50  ? 274 TYR F CE2 1 
ATOM   10337 C  CZ  . TYR F 3 187 ? 71.793  -7.265  128.701 1.00 42.23  ? 274 TYR F CZ  1 
ATOM   10338 O  OH  . TYR F 3 187 ? 72.065  -7.968  129.846 1.00 46.03  ? 274 TYR F OH  1 
ATOM   10339 N  N   . ARG F 3 188 ? 69.736  -5.500  121.662 1.00 32.30  ? 275 ARG F N   1 
ATOM   10340 C  CA  . ARG F 3 188 ? 69.250  -4.723  120.531 1.00 24.24  ? 275 ARG F CA  1 
ATOM   10341 C  C   . ARG F 3 188 ? 67.962  -3.974  120.835 1.00 24.12  ? 275 ARG F C   1 
ATOM   10342 O  O   . ARG F 3 188 ? 67.147  -4.412  121.648 1.00 24.77  ? 275 ARG F O   1 
ATOM   10343 C  CB  . ARG F 3 188 ? 69.025  -5.628  119.345 1.00 24.75  ? 275 ARG F CB  1 
ATOM   10344 C  CG  . ARG F 3 188 ? 68.424  -4.915  118.151 1.00 23.73  ? 275 ARG F CG  1 
ATOM   10345 C  CD  . ARG F 3 188 ? 68.290  -5.866  116.973 1.00 24.25  ? 275 ARG F CD  1 
ATOM   10346 N  NE  . ARG F 3 188 ? 69.494  -5.890  116.146 1.00 23.74  ? 275 ARG F NE  1 
ATOM   10347 C  CZ  . ARG F 3 188 ? 70.411  -6.849  116.182 1.00 26.14  ? 275 ARG F CZ  1 
ATOM   10348 N  NH1 . ARG F 3 188 ? 70.264  -7.871  117.019 1.00 21.21  ? 275 ARG F NH1 1 
ATOM   10349 N  NH2 . ARG F 3 188 ? 71.463  -6.794  115.364 1.00 30.14  ? 275 ARG F NH2 1 
ATOM   10350 N  N   . LEU F 3 189 ? 67.771  -2.855  120.152 1.00 19.11  ? 276 LEU F N   1 
ATOM   10351 C  CA  . LEU F 3 189 ? 66.591  -2.038  120.346 1.00 12.83  ? 276 LEU F CA  1 
ATOM   10352 C  C   . LEU F 3 189 ? 65.666  -2.067  119.157 1.00 19.83  ? 276 LEU F C   1 
ATOM   10353 O  O   . LEU F 3 189 ? 66.107  -1.885  118.022 1.00 27.08  ? 276 LEU F O   1 
ATOM   10354 C  CB  . LEU F 3 189 ? 67.022  -0.608  120.556 1.00 16.96  ? 276 LEU F CB  1 
ATOM   10355 C  CG  . LEU F 3 189 ? 65.992  0.458   120.189 1.00 23.67  ? 276 LEU F CG  1 
ATOM   10356 C  CD1 . LEU F 3 189 ? 64.983  0.637   121.303 1.00 22.45  ? 276 LEU F CD1 1 
ATOM   10357 C  CD2 . LEU F 3 189 ? 66.723  1.772   119.912 1.00 27.09  ? 276 LEU F CD2 1 
ATOM   10358 N  N   . THR F 3 190 ? 64.376  -2.265  119.412 1.00 23.19  ? 277 THR F N   1 
ATOM   10359 C  CA  . THR F 3 190 ? 63.362  -2.265  118.332 1.00 27.30  ? 277 THR F CA  1 
ATOM   10360 C  C   . THR F 3 190 ? 62.013  -1.738  118.800 1.00 30.35  ? 277 THR F C   1 
ATOM   10361 O  O   . THR F 3 190 ? 61.617  -1.900  119.963 1.00 36.74  ? 277 THR F O   1 
ATOM   10362 C  CB  . THR F 3 190 ? 63.085  -3.676  117.659 1.00 26.23  ? 277 THR F CB  1 
ATOM   10363 O  OG1 . THR F 3 190 ? 62.438  -4.571  118.587 1.00 22.66  ? 277 THR F OG1 1 
ATOM   10364 C  CG2 . THR F 3 190 ? 64.371  -4.296  117.114 1.00 26.82  ? 277 THR F CG2 1 
ATOM   10365 N  N   . TYR F 3 191 ? 61.330  -1.087  117.868 1.00 29.76  ? 278 TYR F N   1 
ATOM   10366 C  CA  . TYR F 3 191 ? 60.000  -0.533  118.088 1.00 30.31  ? 278 TYR F CA  1 
ATOM   10367 C  C   . TYR F 3 191 ? 59.197  -0.664  116.791 1.00 29.66  ? 278 TYR F C   1 
ATOM   10368 O  O   . TYR F 3 191 ? 59.756  -0.663  115.678 1.00 24.67  ? 278 TYR F O   1 
ATOM   10369 C  CB  . TYR F 3 191 ? 60.064  0.931   118.552 1.00 33.05  ? 278 TYR F CB  1 
ATOM   10370 C  CG  . TYR F 3 191 ? 60.649  1.914   117.553 1.00 34.95  ? 278 TYR F CG  1 
ATOM   10371 C  CD1 . TYR F 3 191 ? 59.824  2.577   116.645 1.00 34.15  ? 278 TYR F CD1 1 
ATOM   10372 C  CD2 . TYR F 3 191 ? 62.017  2.212   117.542 1.00 33.61  ? 278 TYR F CD2 1 
ATOM   10373 C  CE1 . TYR F 3 191 ? 60.335  3.517   115.749 1.00 36.07  ? 278 TYR F CE1 1 
ATOM   10374 C  CE2 . TYR F 3 191 ? 62.540  3.153   116.651 1.00 34.67  ? 278 TYR F CE2 1 
ATOM   10375 C  CZ  . TYR F 3 191 ? 61.690  3.804   115.755 1.00 36.67  ? 278 TYR F CZ  1 
ATOM   10376 O  OH  . TYR F 3 191 ? 62.167  4.745   114.859 1.00 39.70  ? 278 TYR F OH  1 
ATOM   10377 N  N   . ALA F 3 192 ? 57.888  -0.811  116.945 1.00 34.37  ? 279 ALA F N   1 
ATOM   10378 C  CA  . ALA F 3 192 ? 57.003  -0.962  115.796 1.00 35.64  ? 279 ALA F CA  1 
ATOM   10379 C  C   . ALA F 3 192 ? 56.959  0.293   114.930 1.00 35.36  ? 279 ALA F C   1 
ATOM   10380 O  O   . ALA F 3 192 ? 57.213  0.242   113.716 1.00 37.62  ? 279 ALA F O   1 
ATOM   10381 C  CB  . ALA F 3 192 ? 55.609  -1.323  116.264 1.00 37.80  ? 279 ALA F CB  1 
ATOM   10382 N  N   . TYR F 3 193 ? 56.634  1.416   115.565 1.00 35.50  ? 280 TYR F N   1 
ATOM   10383 C  CA  . TYR F 3 193 ? 56.544  2.691   114.870 1.00 33.81  ? 280 TYR F CA  1 
ATOM   10384 C  C   . TYR F 3 193 ? 56.503  3.847   115.841 1.00 33.29  ? 280 TYR F C   1 
ATOM   10385 O  O   . TYR F 3 193 ? 56.132  3.700   117.004 1.00 32.35  ? 280 TYR F O   1 
ATOM   10386 C  CB  . TYR F 3 193 ? 55.276  2.741   114.026 1.00 34.04  ? 280 TYR F CB  1 
ATOM   10387 C  CG  . TYR F 3 193 ? 54.014  2.580   114.835 1.00 31.93  ? 280 TYR F CG  1 
ATOM   10388 C  CD1 . TYR F 3 193 ? 53.501  1.315   115.109 1.00 32.07  ? 280 TYR F CD1 1 
ATOM   10389 C  CD2 . TYR F 3 193 ? 53.328  3.690   115.323 1.00 30.36  ? 280 TYR F CD2 1 
ATOM   10390 C  CE1 . TYR F 3 193 ? 52.344  1.154   115.839 1.00 33.43  ? 280 TYR F CE1 1 
ATOM   10391 C  CE2 . TYR F 3 193 ? 52.165  3.541   116.057 1.00 33.03  ? 280 TYR F CE2 1 
ATOM   10392 C  CZ  . TYR F 3 193 ? 51.680  2.265   116.307 1.00 37.07  ? 280 TYR F CZ  1 
ATOM   10393 O  OH  . TYR F 3 193 ? 50.510  2.093   117.001 1.00 46.32  ? 280 TYR F OH  1 
ATOM   10394 N  N   . PHE F 3 194 ? 56.851  5.015   115.335 1.00 38.47  ? 281 PHE F N   1 
ATOM   10395 C  CA  . PHE F 3 194 ? 56.835  6.214   116.140 1.00 43.45  ? 281 PHE F CA  1 
ATOM   10396 C  C   . PHE F 3 194 ? 55.397  6.699   116.250 1.00 42.13  ? 281 PHE F C   1 
ATOM   10397 O  O   . PHE F 3 194 ? 54.763  6.979   115.235 1.00 50.03  ? 281 PHE F O   1 
ATOM   10398 C  CB  . PHE F 3 194 ? 57.689  7.279   115.471 1.00 42.29  ? 281 PHE F CB  1 
ATOM   10399 C  CG  . PHE F 3 194 ? 57.542  8.633   116.070 1.00 41.79  ? 281 PHE F CG  1 
ATOM   10400 C  CD1 . PHE F 3 194 ? 58.028  8.904   117.340 1.00 43.33  ? 281 PHE F CD1 1 
ATOM   10401 C  CD2 . PHE F 3 194 ? 56.942  9.656   115.352 1.00 44.11  ? 281 PHE F CD2 1 
ATOM   10402 C  CE1 . PHE F 3 194 ? 57.920  10.191  117.885 1.00 45.52  ? 281 PHE F CE1 1 
ATOM   10403 C  CE2 . PHE F 3 194 ? 56.830  10.946  115.890 1.00 42.23  ? 281 PHE F CE2 1 
ATOM   10404 C  CZ  . PHE F 3 194 ? 57.317  11.214  117.150 1.00 39.95  ? 281 PHE F CZ  1 
ATOM   10405 N  N   . ALA F 3 195 ? 54.873  6.727   117.476 1.00 40.94  ? 282 ALA F N   1 
ATOM   10406 C  CA  . ALA F 3 195 ? 53.516  7.206   117.752 1.00 38.06  ? 282 ALA F CA  1 
ATOM   10407 C  C   . ALA F 3 195 ? 53.594  8.738   117.816 1.00 36.95  ? 282 ALA F C   1 
ATOM   10408 O  O   . ALA F 3 195 ? 54.452  9.342   117.160 1.00 31.84  ? 282 ALA F O   1 
ATOM   10409 C  CB  . ALA F 3 195 ? 52.999  6.625   119.089 1.00 31.77  ? 282 ALA F CB  1 
ATOM   10410 N  N   . GLY F 3 196 ? 52.749  9.362   118.635 1.00 40.47  ? 283 GLY F N   1 
ATOM   10411 C  CA  . GLY F 3 196 ? 52.762  10.817  118.753 1.00 42.81  ? 283 GLY F CA  1 
ATOM   10412 C  C   . GLY F 3 196 ? 54.043  11.466  119.272 1.00 40.99  ? 283 GLY F C   1 
ATOM   10413 O  O   . GLY F 3 196 ? 55.150  11.033  118.954 1.00 36.76  ? 283 GLY F O   1 
ATOM   10414 N  N   . GLY F 3 197 ? 53.888  12.519  120.075 1.00 45.96  ? 284 GLY F N   1 
ATOM   10415 C  CA  . GLY F 3 197 ? 55.035  13.218  120.630 1.00 44.48  ? 284 GLY F CA  1 
ATOM   10416 C  C   . GLY F 3 197 ? 55.453  14.396  119.775 1.00 41.45  ? 284 GLY F C   1 
ATOM   10417 O  O   . GLY F 3 197 ? 55.675  14.263  118.577 1.00 41.28  ? 284 GLY F O   1 
ATOM   10418 N  N   . ASP F 3 198 ? 55.581  15.558  120.394 1.00 43.26  ? 285 ASP F N   1 
ATOM   10419 C  CA  . ASP F 3 198 ? 55.971  16.745  119.653 1.00 44.19  ? 285 ASP F CA  1 
ATOM   10420 C  C   . ASP F 3 198 ? 57.478  16.980  119.530 1.00 39.31  ? 285 ASP F C   1 
ATOM   10421 O  O   . ASP F 3 198 ? 57.890  17.992  118.976 1.00 37.48  ? 285 ASP F O   1 
ATOM   10422 C  CB  . ASP F 3 198 ? 55.297  17.980  120.244 1.00 51.57  ? 285 ASP F CB  1 
ATOM   10423 C  CG  . ASP F 3 198 ? 55.888  18.385  121.569 1.00 57.80  ? 285 ASP F CG  1 
ATOM   10424 O  OD1 . ASP F 3 198 ? 55.837  17.576  122.521 1.00 60.57  ? 285 ASP F OD1 1 
ATOM   10425 O  OD2 . ASP F 3 198 ? 56.403  19.517  121.654 1.00 63.38  ? 285 ASP F OD2 1 
ATOM   10426 N  N   . ALA F 3 199 ? 58.296  16.047  120.015 1.00 39.83  ? 286 ALA F N   1 
ATOM   10427 C  CA  . ALA F 3 199 ? 59.755  16.194  119.936 1.00 34.75  ? 286 ALA F CA  1 
ATOM   10428 C  C   . ALA F 3 199 ? 60.359  15.665  118.643 1.00 33.41  ? 286 ALA F C   1 
ATOM   10429 O  O   . ALA F 3 199 ? 61.489  16.023  118.302 1.00 35.92  ? 286 ALA F O   1 
ATOM   10430 C  CB  . ALA F 3 199 ? 60.428  15.549  121.121 1.00 34.78  ? 286 ALA F CB  1 
ATOM   10431 N  N   . GLY F 3 200 ? 59.634  14.775  117.962 1.00 27.15  ? 287 GLY F N   1 
ATOM   10432 C  CA  . GLY F 3 200 ? 60.109  14.245  116.693 1.00 28.80  ? 287 GLY F CA  1 
ATOM   10433 C  C   . GLY F 3 200 ? 60.835  12.912  116.722 1.00 27.65  ? 287 GLY F C   1 
ATOM   10434 O  O   . GLY F 3 200 ? 61.686  12.695  117.575 1.00 32.00  ? 287 GLY F O   1 
ATOM   10435 N  N   . ASP F 3 201 ? 60.538  12.045  115.753 1.00 26.36  ? 288 ASP F N   1 
ATOM   10436 C  CA  . ASP F 3 201 ? 61.146  10.731  115.665 1.00 24.45  ? 288 ASP F CA  1 
ATOM   10437 C  C   . ASP F 3 201 ? 62.620  10.851  115.330 1.00 27.78  ? 288 ASP F C   1 
ATOM   10438 O  O   . ASP F 3 201 ? 63.009  10.734  114.168 1.00 32.95  ? 288 ASP F O   1 
ATOM   10439 C  CB  . ASP F 3 201 ? 60.433  9.881   114.602 1.00 30.67  ? 288 ASP F CB  1 
ATOM   10440 C  CG  . ASP F 3 201 ? 60.910  8.423   114.579 1.00 42.14  ? 288 ASP F CG  1 
ATOM   10441 O  OD1 . ASP F 3 201 ? 61.826  8.078   115.356 1.00 47.70  ? 288 ASP F OD1 1 
ATOM   10442 O  OD2 . ASP F 3 201 ? 60.370  7.609   113.781 1.00 45.65  ? 288 ASP F OD2 1 
ATOM   10443 N  N   . ALA F 3 202 ? 63.442  11.066  116.352 1.00 28.31  ? 289 ALA F N   1 
ATOM   10444 C  CA  . ALA F 3 202 ? 64.877  11.164  116.149 1.00 30.05  ? 289 ALA F CA  1 
ATOM   10445 C  C   . ALA F 3 202 ? 65.422  9.765   115.936 1.00 29.85  ? 289 ALA F C   1 
ATOM   10446 O  O   . ALA F 3 202 ? 66.467  9.587   115.304 1.00 31.03  ? 289 ALA F O   1 
ATOM   10447 C  CB  . ALA F 3 202 ? 65.545  11.825  117.337 1.00 30.69  ? 289 ALA F CB  1 
ATOM   10448 N  N   . PHE F 3 203 ? 64.689  8.774   116.438 1.00 23.92  ? 290 PHE F N   1 
ATOM   10449 C  CA  . PHE F 3 203 ? 65.080  7.379   116.291 1.00 23.22  ? 290 PHE F CA  1 
ATOM   10450 C  C   . PHE F 3 203 ? 65.054  6.927   114.847 1.00 23.16  ? 290 PHE F C   1 
ATOM   10451 O  O   . PHE F 3 203 ? 65.700  5.948   114.477 1.00 27.99  ? 290 PHE F O   1 
ATOM   10452 C  CB  . PHE F 3 203 ? 64.162  6.500   117.122 1.00 23.74  ? 290 PHE F CB  1 
ATOM   10453 C  CG  . PHE F 3 203 ? 64.583  6.396   118.551 1.00 29.61  ? 290 PHE F CG  1 
ATOM   10454 C  CD1 . PHE F 3 203 ? 65.878  6.765   118.933 1.00 30.63  ? 290 PHE F CD1 1 
ATOM   10455 C  CD2 . PHE F 3 203 ? 63.712  5.917   119.518 1.00 24.29  ? 290 PHE F CD2 1 
ATOM   10456 C  CE1 . PHE F 3 203 ? 66.299  6.656   120.257 1.00 28.72  ? 290 PHE F CE1 1 
ATOM   10457 C  CE2 . PHE F 3 203 ? 64.127  5.806   120.842 1.00 22.96  ? 290 PHE F CE2 1 
ATOM   10458 C  CZ  . PHE F 3 203 ? 65.425  6.177   121.209 1.00 27.10  ? 290 PHE F CZ  1 
ATOM   10459 N  N   . ASP F 3 204 ? 64.317  7.681   114.039 1.00 26.85  ? 291 ASP F N   1 
ATOM   10460 C  CA  . ASP F 3 204 ? 64.150  7.417   112.623 1.00 34.92  ? 291 ASP F CA  1 
ATOM   10461 C  C   . ASP F 3 204 ? 65.315  7.953   111.802 1.00 35.91  ? 291 ASP F C   1 
ATOM   10462 O  O   . ASP F 3 204 ? 65.314  7.874   110.575 1.00 32.59  ? 291 ASP F O   1 
ATOM   10463 C  CB  . ASP F 3 204 ? 62.873  8.083   112.139 1.00 41.91  ? 291 ASP F CB  1 
ATOM   10464 C  CG  . ASP F 3 204 ? 62.521  7.696   110.738 1.00 51.80  ? 291 ASP F CG  1 
ATOM   10465 O  OD1 . ASP F 3 204 ? 62.557  6.487   110.435 1.00 62.49  ? 291 ASP F OD1 1 
ATOM   10466 O  OD2 . ASP F 3 204 ? 62.227  8.604   109.937 1.00 50.07  ? 291 ASP F OD2 1 
ATOM   10467 N  N   . GLY F 3 205 ? 66.320  8.485   112.481 1.00 36.85  ? 292 GLY F N   1 
ATOM   10468 C  CA  . GLY F 3 205 ? 67.447  9.039   111.764 1.00 35.03  ? 292 GLY F CA  1 
ATOM   10469 C  C   . GLY F 3 205 ? 67.100  10.456  111.363 1.00 37.59  ? 292 GLY F C   1 
ATOM   10470 O  O   . GLY F 3 205 ? 65.924  10.828  111.248 1.00 39.66  ? 292 GLY F O   1 
ATOM   10471 N  N   . PHE F 3 206 ? 68.123  11.240  111.086 1.00 36.27  ? 293 PHE F N   1 
ATOM   10472 C  CA  . PHE F 3 206 ? 67.905  12.629  110.740 1.00 39.47  ? 293 PHE F CA  1 
ATOM   10473 C  C   . PHE F 3 206 ? 68.918  13.061  109.702 1.00 39.00  ? 293 PHE F C   1 
ATOM   10474 O  O   . PHE F 3 206 ? 70.015  12.512  109.659 1.00 41.92  ? 293 PHE F O   1 
ATOM   10475 C  CB  . PHE F 3 206 ? 68.073  13.457  112.008 1.00 41.16  ? 293 PHE F CB  1 
ATOM   10476 C  CG  . PHE F 3 206 ? 67.801  14.911  111.825 1.00 44.13  ? 293 PHE F CG  1 
ATOM   10477 C  CD1 . PHE F 3 206 ? 66.495  15.373  111.649 1.00 45.78  ? 293 PHE F CD1 1 
ATOM   10478 C  CD2 . PHE F 3 206 ? 68.840  15.828  111.845 1.00 42.52  ? 293 PHE F CD2 1 
ATOM   10479 C  CE1 . PHE F 3 206 ? 66.234  16.721  111.500 1.00 39.70  ? 293 PHE F CE1 1 
ATOM   10480 C  CE2 . PHE F 3 206 ? 68.584  17.175  111.696 1.00 42.26  ? 293 PHE F CE2 1 
ATOM   10481 C  CZ  . PHE F 3 206 ? 67.274  17.616  111.523 1.00 39.77  ? 293 PHE F CZ  1 
ATOM   10482 N  N   . ASP F 3 207 ? 68.571  14.023  108.852 1.00 39.41  ? 294 ASP F N   1 
ATOM   10483 C  CA  . ASP F 3 207 ? 69.553  14.433  107.866 1.00 47.02  ? 294 ASP F CA  1 
ATOM   10484 C  C   . ASP F 3 207 ? 70.318  15.640  108.320 1.00 43.40  ? 294 ASP F C   1 
ATOM   10485 O  O   . ASP F 3 207 ? 69.831  16.757  108.258 1.00 37.90  ? 294 ASP F O   1 
ATOM   10486 C  CB  . ASP F 3 207 ? 68.967  14.652  106.473 1.00 55.74  ? 294 ASP F CB  1 
ATOM   10487 C  CG  . ASP F 3 207 ? 69.960  14.276  105.375 1.00 62.92  ? 294 ASP F CG  1 
ATOM   10488 O  OD1 . ASP F 3 207 ? 70.956  15.008  105.177 1.00 59.31  ? 294 ASP F OD1 1 
ATOM   10489 O  OD2 . ASP F 3 207 ? 69.771  13.213  104.742 1.00 68.19  ? 294 ASP F OD2 1 
ATOM   10490 N  N   . PHE F 3 208 ? 71.542  15.395  108.762 1.00 49.36  ? 295 PHE F N   1 
ATOM   10491 C  CA  . PHE F 3 208 ? 72.411  16.453  109.249 1.00 55.20  ? 295 PHE F CA  1 
ATOM   10492 C  C   . PHE F 3 208 ? 73.102  17.259  108.147 1.00 62.49  ? 295 PHE F C   1 
ATOM   10493 O  O   . PHE F 3 208 ? 73.797  18.232  108.434 1.00 66.98  ? 295 PHE F O   1 
ATOM   10494 C  CB  . PHE F 3 208 ? 73.444  15.870  110.219 1.00 55.78  ? 295 PHE F CB  1 
ATOM   10495 C  CG  . PHE F 3 208 ? 72.840  15.317  111.483 1.00 54.28  ? 295 PHE F CG  1 
ATOM   10496 C  CD1 . PHE F 3 208 ? 72.229  14.063  111.494 1.00 54.84  ? 295 PHE F CD1 1 
ATOM   10497 C  CD2 . PHE F 3 208 ? 72.839  16.065  112.647 1.00 49.72  ? 295 PHE F CD2 1 
ATOM   10498 C  CE1 . PHE F 3 208 ? 71.624  13.571  112.642 1.00 53.97  ? 295 PHE F CE1 1 
ATOM   10499 C  CE2 . PHE F 3 208 ? 72.237  15.579  113.797 1.00 52.61  ? 295 PHE F CE2 1 
ATOM   10500 C  CZ  . PHE F 3 208 ? 71.627  14.331  113.793 1.00 54.56  ? 295 PHE F CZ  1 
ATOM   10501 N  N   . GLY F 3 209 ? 72.926  16.857  106.892 1.00 66.42  ? 296 GLY F N   1 
ATOM   10502 C  CA  . GLY F 3 209 ? 73.547  17.591  105.800 1.00 66.60  ? 296 GLY F CA  1 
ATOM   10503 C  C   . GLY F 3 209 ? 74.943  17.130  105.408 1.00 69.91  ? 296 GLY F C   1 
ATOM   10504 O  O   . GLY F 3 209 ? 75.210  16.907  104.216 1.00 79.86  ? 296 GLY F O   1 
ATOM   10505 N  N   . ASP F 3 210 ? 75.825  16.984  106.398 1.00 59.82  ? 297 ASP F N   1 
ATOM   10506 C  CA  . ASP F 3 210 ? 77.214  16.544  106.195 1.00 58.46  ? 297 ASP F CA  1 
ATOM   10507 C  C   . ASP F 3 210 ? 77.404  15.597  105.001 1.00 57.99  ? 297 ASP F C   1 
ATOM   10508 O  O   . ASP F 3 210 ? 78.422  15.623  104.307 1.00 59.19  ? 297 ASP F O   1 
ATOM   10509 C  CB  . ASP F 3 210 ? 77.723  15.847  107.462 1.00 58.84  ? 297 ASP F CB  1 
ATOM   10510 C  CG  . ASP F 3 210 ? 77.662  16.743  108.701 1.00 57.60  ? 297 ASP F CG  1 
ATOM   10511 O  OD1 . ASP F 3 210 ? 76.928  17.761  108.682 1.00 51.76  ? 297 ASP F OD1 1 
ATOM   10512 O  OD2 . ASP F 3 210 ? 78.349  16.414  109.702 1.00 55.30  ? 297 ASP F OD2 1 
ATOM   10513 N  N   . ASP F 3 211 ? 76.404  14.761  104.779 1.00 53.50  ? 298 ASP F N   1 
ATOM   10514 C  CA  . ASP F 3 211 ? 76.431  13.814  103.702 1.00 52.35  ? 298 ASP F CA  1 
ATOM   10515 C  C   . ASP F 3 211 ? 74.983  13.399  103.528 1.00 54.65  ? 298 ASP F C   1 
ATOM   10516 O  O   . ASP F 3 211 ? 74.139  13.713  104.376 1.00 55.08  ? 298 ASP F O   1 
ATOM   10517 C  CB  . ASP F 3 211 ? 77.289  12.618  104.112 1.00 56.81  ? 298 ASP F CB  1 
ATOM   10518 C  CG  . ASP F 3 211 ? 77.708  11.774  102.941 1.00 61.44  ? 298 ASP F CG  1 
ATOM   10519 O  OD1 . ASP F 3 211 ? 78.688  12.156  102.277 1.00 63.39  ? 298 ASP F OD1 1 
ATOM   10520 O  OD2 . ASP F 3 211 ? 77.057  10.740  102.681 1.00 64.33  ? 298 ASP F OD2 1 
ATOM   10521 N  N   . PRO F 3 212 ? 74.648  12.810  102.368 1.00 54.32  ? 299 PRO F N   1 
ATOM   10522 C  CA  . PRO F 3 212 ? 73.272  12.372  102.133 1.00 56.45  ? 299 PRO F CA  1 
ATOM   10523 C  C   . PRO F 3 212 ? 72.903  11.115  102.928 1.00 58.39  ? 299 PRO F C   1 
ATOM   10524 O  O   . PRO F 3 212 ? 71.719  10.874  103.189 1.00 62.74  ? 299 PRO F O   1 
ATOM   10525 C  CB  . PRO F 3 212 ? 73.267  12.109  100.634 1.00 58.11  ? 299 PRO F CB  1 
ATOM   10526 C  CG  . PRO F 3 212 ? 74.264  13.099  100.128 1.00 52.20  ? 299 PRO F CG  1 
ATOM   10527 C  CD  . PRO F 3 212 ? 75.372  12.920  101.090 1.00 49.75  ? 299 PRO F CD  1 
ATOM   10528 N  N   . SER F 3 213 ? 73.924  10.351  103.335 1.00 55.57  ? 300 SER F N   1 
ATOM   10529 C  CA  . SER F 3 213 ? 73.760  9.100   104.095 1.00 58.13  ? 300 SER F CA  1 
ATOM   10530 C  C   . SER F 3 213 ? 73.425  9.254   105.587 1.00 47.30  ? 300 SER F C   1 
ATOM   10531 O  O   . SER F 3 213 ? 72.909  8.328   106.231 1.00 44.80  ? 300 SER F O   1 
ATOM   10532 C  CB  . SER F 3 213 ? 75.015  8.237   103.947 1.00 61.83  ? 300 SER F CB  1 
ATOM   10533 O  OG  . SER F 3 213 ? 76.155  8.897   104.472 1.00 57.90  ? 300 SER F OG  1 
ATOM   10534 N  N   . ASP F 3 214 ? 73.745  10.423  106.124 1.00 39.19  ? 301 ASP F N   1 
ATOM   10535 C  CA  . ASP F 3 214 ? 73.494  10.746  107.518 1.00 34.79  ? 301 ASP F CA  1 
ATOM   10536 C  C   . ASP F 3 214 ? 72.137  10.225  107.992 1.00 29.78  ? 301 ASP F C   1 
ATOM   10537 O  O   . ASP F 3 214 ? 72.040  9.543   109.019 1.00 28.48  ? 301 ASP F O   1 
ATOM   10538 C  CB  . ASP F 3 214 ? 73.518  12.268  107.707 1.00 35.90  ? 301 ASP F CB  1 
ATOM   10539 C  CG  . ASP F 3 214 ? 74.862  12.884  107.397 1.00 38.63  ? 301 ASP F CG  1 
ATOM   10540 O  OD1 . ASP F 3 214 ? 75.891  12.168  107.351 1.00 42.44  ? 301 ASP F OD1 1 
ATOM   10541 O  OD2 . ASP F 3 214 ? 74.882  14.112  107.216 1.00 35.45  ? 301 ASP F OD2 1 
ATOM   10542 N  N   . LYS F 3 215 ? 71.105  10.515  107.203 1.00 23.83  ? 302 LYS F N   1 
ATOM   10543 C  CA  . LYS F 3 215 ? 69.757  10.133  107.542 1.00 29.63  ? 302 LYS F CA  1 
ATOM   10544 C  C   . LYS F 3 215 ? 69.613  8.694   107.956 1.00 40.43  ? 302 LYS F C   1 
ATOM   10545 O  O   . LYS F 3 215 ? 69.021  8.436   108.992 1.00 45.79  ? 302 LYS F O   1 
ATOM   10546 C  CB  . LYS F 3 215 ? 68.805  10.485  106.421 1.00 35.09  ? 302 LYS F CB  1 
ATOM   10547 C  CG  . LYS F 3 215 ? 67.373  10.068  106.662 1.00 34.71  ? 302 LYS F CG  1 
ATOM   10548 C  CD  . LYS F 3 215 ? 66.813  10.662  107.907 1.00 32.25  ? 302 LYS F CD  1 
ATOM   10549 C  CE  . LYS F 3 215 ? 65.452  10.090  108.149 1.00 42.27  ? 302 LYS F CE  1 
ATOM   10550 N  NZ  . LYS F 3 215 ? 65.506  8.605   107.990 1.00 50.57  ? 302 LYS F NZ  1 
ATOM   10551 N  N   . PHE F 3 216 ? 70.134  7.742   107.190 1.00 46.84  ? 303 PHE F N   1 
ATOM   10552 C  CA  . PHE F 3 216 ? 69.992  6.381   107.662 1.00 52.56  ? 303 PHE F CA  1 
ATOM   10553 C  C   . PHE F 3 216 ? 70.911  6.185   108.840 1.00 51.38  ? 303 PHE F C   1 
ATOM   10554 O  O   . PHE F 3 216 ? 70.506  5.655   109.880 1.00 59.99  ? 303 PHE F O   1 
ATOM   10555 C  CB  . PHE F 3 216 ? 70.380  5.306   106.673 1.00 64.08  ? 303 PHE F CB  1 
ATOM   10556 C  CG  . PHE F 3 216 ? 70.732  4.012   107.374 1.00 78.13  ? 303 PHE F CG  1 
ATOM   10557 C  CD1 . PHE F 3 216 ? 69.761  3.314   108.104 1.00 80.93  ? 303 PHE F CD1 1 
ATOM   10558 C  CD2 . PHE F 3 216 ? 72.057  3.581   107.456 1.00 84.68  ? 303 PHE F CD2 1 
ATOM   10559 C  CE1 . PHE F 3 216 ? 70.109  2.215   108.911 1.00 85.16  ? 303 PHE F CE1 1 
ATOM   10560 C  CE2 . PHE F 3 216 ? 72.417  2.475   108.266 1.00 86.88  ? 303 PHE F CE2 1 
ATOM   10561 C  CZ  . PHE F 3 216 ? 71.440  1.796   108.993 1.00 86.15  ? 303 PHE F CZ  1 
ATOM   10562 N  N   . PHE F 3 217 ? 72.180  6.504   108.609 1.00 38.32  ? 304 PHE F N   1 
ATOM   10563 C  CA  . PHE F 3 217 ? 73.224  6.361   109.613 1.00 34.60  ? 304 PHE F CA  1 
ATOM   10564 C  C   . PHE F 3 217 ? 72.981  6.974   110.986 1.00 32.38  ? 304 PHE F C   1 
ATOM   10565 O  O   . PHE F 3 217 ? 73.888  7.016   111.816 1.00 32.36  ? 304 PHE F O   1 
ATOM   10566 C  CB  . PHE F 3 217 ? 74.522  6.898   109.067 1.00 32.79  ? 304 PHE F CB  1 
ATOM   10567 C  CG  . PHE F 3 217 ? 75.130  6.040   108.029 1.00 35.85  ? 304 PHE F CG  1 
ATOM   10568 C  CD1 . PHE F 3 217 ? 75.118  4.668   108.156 1.00 43.48  ? 304 PHE F CD1 1 
ATOM   10569 C  CD2 . PHE F 3 217 ? 75.730  6.596   106.931 1.00 36.40  ? 304 PHE F CD2 1 
ATOM   10570 C  CE1 . PHE F 3 217 ? 75.703  3.861   107.192 1.00 44.42  ? 304 PHE F CE1 1 
ATOM   10571 C  CE2 . PHE F 3 217 ? 76.313  5.807   105.969 1.00 40.89  ? 304 PHE F CE2 1 
ATOM   10572 C  CZ  . PHE F 3 217 ? 76.301  4.435   106.097 1.00 43.76  ? 304 PHE F CZ  1 
ATOM   10573 N  N   . THR F 3 218 ? 71.790  7.507   111.216 1.00 24.62  ? 305 THR F N   1 
ATOM   10574 C  CA  . THR F 3 218 ? 71.511  8.073   112.510 1.00 25.08  ? 305 THR F CA  1 
ATOM   10575 C  C   . THR F 3 218 ? 70.247  7.484   113.072 1.00 30.98  ? 305 THR F C   1 
ATOM   10576 O  O   . THR F 3 218 ? 69.757  7.946   114.096 1.00 39.05  ? 305 THR F O   1 
ATOM   10577 C  CB  . THR F 3 218 ? 71.410  9.601   112.462 1.00 25.28  ? 305 THR F CB  1 
ATOM   10578 O  OG1 . THR F 3 218 ? 70.366  9.995   111.563 1.00 28.90  ? 305 THR F OG1 1 
ATOM   10579 C  CG2 . THR F 3 218 ? 72.726  10.186  112.028 1.00 14.87  ? 305 THR F CG2 1 
ATOM   10580 N  N   . SER F 3 219 ? 69.695  6.486   112.391 1.00 29.04  ? 306 SER F N   1 
ATOM   10581 C  CA  . SER F 3 219 ? 68.490  5.842   112.888 1.00 28.24  ? 306 SER F CA  1 
ATOM   10582 C  C   . SER F 3 219 ? 68.942  4.863   113.965 1.00 30.88  ? 306 SER F C   1 
ATOM   10583 O  O   . SER F 3 219 ? 70.081  4.386   113.929 1.00 35.07  ? 306 SER F O   1 
ATOM   10584 C  CB  . SER F 3 219 ? 67.762  5.108   111.766 1.00 25.98  ? 306 SER F CB  1 
ATOM   10585 O  OG  . SER F 3 219 ? 68.436  3.913   111.418 1.00 37.81  ? 306 SER F OG  1 
ATOM   10586 N  N   . HIS F 3 220 ? 68.082  4.582   114.940 1.00 28.89  ? 307 HIS F N   1 
ATOM   10587 C  CA  . HIS F 3 220 ? 68.474  3.648   115.989 1.00 29.75  ? 307 HIS F CA  1 
ATOM   10588 C  C   . HIS F 3 220 ? 67.639  2.378   116.096 1.00 30.57  ? 307 HIS F C   1 
ATOM   10589 O  O   . HIS F 3 220 ? 67.995  1.462   116.838 1.00 33.40  ? 307 HIS F O   1 
ATOM   10590 C  CB  . HIS F 3 220 ? 68.524  4.361   117.327 1.00 28.52  ? 307 HIS F CB  1 
ATOM   10591 C  CG  . HIS F 3 220 ? 69.350  5.602   117.305 1.00 31.07  ? 307 HIS F CG  1 
ATOM   10592 N  ND1 . HIS F 3 220 ? 68.814  6.841   117.026 1.00 35.44  ? 307 HIS F ND1 1 
ATOM   10593 C  CD2 . HIS F 3 220 ? 70.676  5.798   117.494 1.00 25.13  ? 307 HIS F CD2 1 
ATOM   10594 C  CE1 . HIS F 3 220 ? 69.776  7.747   117.045 1.00 32.74  ? 307 HIS F CE1 1 
ATOM   10595 N  NE2 . HIS F 3 220 ? 70.915  7.140   117.324 1.00 27.02  ? 307 HIS F NE2 1 
ATOM   10596 N  N   . ASN F 3 221 ? 66.538  2.308   115.352 1.00 28.13  ? 308 ASN F N   1 
ATOM   10597 C  CA  . ASN F 3 221 ? 65.679  1.134   115.401 1.00 21.67  ? 308 ASN F CA  1 
ATOM   10598 C  C   . ASN F 3 221 ? 66.465  -0.034  114.842 1.00 14.43  ? 308 ASN F C   1 
ATOM   10599 O  O   . ASN F 3 221 ? 67.088  0.087   113.797 1.00 18.88  ? 308 ASN F O   1 
ATOM   10600 C  CB  . ASN F 3 221 ? 64.419  1.367   114.579 1.00 26.32  ? 308 ASN F CB  1 
ATOM   10601 C  CG  . ASN F 3 221 ? 63.356  0.319   114.841 1.00 36.45  ? 308 ASN F CG  1 
ATOM   10602 O  OD1 . ASN F 3 221 ? 63.557  -0.594  115.649 1.00 44.01  ? 308 ASN F OD1 1 
ATOM   10603 N  ND2 . ASN F 3 221 ? 62.209  0.453   114.177 1.00 33.93  ? 308 ASN F ND2 1 
ATOM   10604 N  N   . GLY F 3 222 ? 66.481  -1.148  115.560 1.00 7.95   ? 309 GLY F N   1 
ATOM   10605 C  CA  . GLY F 3 222 ? 67.227  -2.296  115.076 1.00 13.41  ? 309 GLY F CA  1 
ATOM   10606 C  C   . GLY F 3 222 ? 68.700  -2.236  115.433 1.00 16.00  ? 309 GLY F C   1 
ATOM   10607 O  O   . GLY F 3 222 ? 69.482  -3.112  115.057 1.00 21.34  ? 309 GLY F O   1 
ATOM   10608 N  N   . MET F 3 223 ? 69.096  -1.194  116.149 1.00 15.61  ? 310 MET F N   1 
ATOM   10609 C  CA  . MET F 3 223 ? 70.477  -1.080  116.555 1.00 24.02  ? 310 MET F CA  1 
ATOM   10610 C  C   . MET F 3 223 ? 70.724  -1.813  117.870 1.00 31.78  ? 310 MET F C   1 
ATOM   10611 O  O   . MET F 3 223 ? 69.829  -1.939  118.715 1.00 34.36  ? 310 MET F O   1 
ATOM   10612 C  CB  . MET F 3 223 ? 70.881  0.383   116.688 1.00 28.87  ? 310 MET F CB  1 
ATOM   10613 C  CG  . MET F 3 223 ? 70.761  1.195   115.406 1.00 33.26  ? 310 MET F CG  1 
ATOM   10614 S  SD  . MET F 3 223 ? 71.839  0.605   114.101 1.00 36.84  ? 310 MET F SD  1 
ATOM   10615 C  CE  . MET F 3 223 ? 70.636  -0.206  113.062 1.00 38.89  ? 310 MET F CE  1 
ATOM   10616 N  N   . GLN F 3 224 ? 71.932  -2.349  117.998 1.00 29.61  ? 311 GLN F N   1 
ATOM   10617 C  CA  . GLN F 3 224 ? 72.340  -3.058  119.193 1.00 26.30  ? 311 GLN F CA  1 
ATOM   10618 C  C   . GLN F 3 224 ? 72.948  -2.019  120.114 1.00 24.75  ? 311 GLN F C   1 
ATOM   10619 O  O   . GLN F 3 224 ? 73.348  -0.944  119.658 1.00 23.75  ? 311 GLN F O   1 
ATOM   10620 C  CB  . GLN F 3 224 ? 73.419  -4.095  118.859 1.00 33.40  ? 311 GLN F CB  1 
ATOM   10621 C  CG  . GLN F 3 224 ? 72.975  -5.246  117.952 1.00 37.22  ? 311 GLN F CG  1 
ATOM   10622 C  CD  . GLN F 3 224 ? 73.998  -6.397  117.879 1.00 36.93  ? 311 GLN F CD  1 
ATOM   10623 O  OE1 . GLN F 3 224 ? 75.148  -6.213  117.448 1.00 40.01  ? 311 GLN F OE1 1 
ATOM   10624 N  NE2 . GLN F 3 224 ? 73.573  -7.590  118.304 1.00 32.38  ? 311 GLN F NE2 1 
ATOM   10625 N  N   . PHE F 3 225 ? 73.072  -2.368  121.391 1.00 20.48  ? 312 PHE F N   1 
ATOM   10626 C  CA  . PHE F 3 225 ? 73.663  -1.484  122.380 1.00 18.21  ? 312 PHE F CA  1 
ATOM   10627 C  C   . PHE F 3 225 ? 75.200  -1.469  122.287 1.00 19.21  ? 312 PHE F C   1 
ATOM   10628 O  O   . PHE F 3 225 ? 75.835  -2.495  122.025 1.00 19.63  ? 312 PHE F O   1 
ATOM   10629 C  CB  . PHE F 3 225 ? 73.222  -1.894  123.778 1.00 20.20  ? 312 PHE F CB  1 
ATOM   10630 C  CG  . PHE F 3 225 ? 73.281  -0.777  124.757 1.00 16.72  ? 312 PHE F CG  1 
ATOM   10631 C  CD1 . PHE F 3 225 ? 72.268  0.170   124.786 1.00 15.02  ? 312 PHE F CD1 1 
ATOM   10632 C  CD2 . PHE F 3 225 ? 74.391  -0.611  125.574 1.00 15.86  ? 312 PHE F CD2 1 
ATOM   10633 C  CE1 . PHE F 3 225 ? 72.357  1.276   125.604 1.00 14.72  ? 312 PHE F CE1 1 
ATOM   10634 C  CE2 . PHE F 3 225 ? 74.498  0.478   126.392 1.00 15.50  ? 312 PHE F CE2 1 
ATOM   10635 C  CZ  . PHE F 3 225 ? 73.476  1.434   126.409 1.00 22.32  ? 312 PHE F CZ  1 
ATOM   10636 N  N   . SER F 3 226 ? 75.802  -0.310  122.540 1.00 21.79  ? 313 SER F N   1 
ATOM   10637 C  CA  . SER F 3 226 ? 77.253  -0.178  122.427 1.00 24.85  ? 313 SER F CA  1 
ATOM   10638 C  C   . SER F 3 226 ? 77.892  0.661   123.547 1.00 31.74  ? 313 SER F C   1 
ATOM   10639 O  O   . SER F 3 226 ? 77.329  1.675   123.972 1.00 39.53  ? 313 SER F O   1 
ATOM   10640 C  CB  . SER F 3 226 ? 77.605  0.446   121.063 1.00 19.68  ? 313 SER F CB  1 
ATOM   10641 O  OG  . SER F 3 226 ? 76.946  -0.199  119.963 1.00 18.46  ? 313 SER F OG  1 
ATOM   10642 N  N   . THR F 3 227 ? 79.055  0.215   124.026 1.00 27.87  ? 314 THR F N   1 
ATOM   10643 C  CA  . THR F 3 227 ? 79.830  0.896   125.072 1.00 27.48  ? 314 THR F CA  1 
ATOM   10644 C  C   . THR F 3 227 ? 81.275  0.940   124.599 1.00 27.97  ? 314 THR F C   1 
ATOM   10645 O  O   . THR F 3 227 ? 81.660  0.202   123.704 1.00 29.35  ? 314 THR F O   1 
ATOM   10646 C  CB  . THR F 3 227 ? 79.791  0.161   126.465 1.00 30.53  ? 314 THR F CB  1 
ATOM   10647 O  OG1 . THR F 3 227 ? 80.272  -1.189  126.344 1.00 27.69  ? 314 THR F OG1 1 
ATOM   10648 C  CG2 . THR F 3 227 ? 78.384  0.139   127.034 1.00 33.67  ? 314 THR F CG2 1 
ATOM   10649 N  N   . TRP F 3 228 ? 82.092  1.765   125.231 1.00 31.25  ? 315 TRP F N   1 
ATOM   10650 C  CA  . TRP F 3 228 ? 83.476  1.877   124.824 1.00 28.32  ? 315 TRP F CA  1 
ATOM   10651 C  C   . TRP F 3 228 ? 84.192  0.542   124.826 1.00 29.04  ? 315 TRP F C   1 
ATOM   10652 O  O   . TRP F 3 228 ? 85.149  0.357   124.083 1.00 31.73  ? 315 TRP F O   1 
ATOM   10653 C  CB  . TRP F 3 228 ? 84.209  2.845   125.738 1.00 35.26  ? 315 TRP F CB  1 
ATOM   10654 C  CG  . TRP F 3 228 ? 84.382  2.330   127.120 1.00 39.35  ? 315 TRP F CG  1 
ATOM   10655 C  CD1 . TRP F 3 228 ? 83.554  2.537   128.184 1.00 42.10  ? 315 TRP F CD1 1 
ATOM   10656 C  CD2 . TRP F 3 228 ? 85.432  1.480   127.586 1.00 42.95  ? 315 TRP F CD2 1 
ATOM   10657 N  NE1 . TRP F 3 228 ? 84.019  1.861   129.290 1.00 43.85  ? 315 TRP F NE1 1 
ATOM   10658 C  CE2 . TRP F 3 228 ? 85.171  1.202   128.946 1.00 44.06  ? 315 TRP F CE2 1 
ATOM   10659 C  CE3 . TRP F 3 228 ? 86.563  0.916   126.983 1.00 42.64  ? 315 TRP F CE3 1 
ATOM   10660 C  CZ2 . TRP F 3 228 ? 86.002  0.385   129.710 1.00 41.31  ? 315 TRP F CZ2 1 
ATOM   10661 C  CZ3 . TRP F 3 228 ? 87.383  0.107   127.739 1.00 40.02  ? 315 TRP F CZ3 1 
ATOM   10662 C  CH2 . TRP F 3 228 ? 87.100  -0.152  129.088 1.00 39.83  ? 315 TRP F CH2 1 
ATOM   10663 N  N   . ASP F 3 229 ? 83.757  -0.370  125.690 1.00 28.72  ? 316 ASP F N   1 
ATOM   10664 C  CA  . ASP F 3 229 ? 84.386  -1.679  125.788 1.00 30.04  ? 316 ASP F CA  1 
ATOM   10665 C  C   . ASP F 3 229 ? 83.542  -2.742  125.124 1.00 33.22  ? 316 ASP F C   1 
ATOM   10666 O  O   . ASP F 3 229 ? 83.681  -3.936  125.406 1.00 40.00  ? 316 ASP F O   1 
ATOM   10667 C  CB  . ASP F 3 229 ? 84.659  -2.053  127.252 1.00 31.26  ? 316 ASP F CB  1 
ATOM   10668 C  CG  . ASP F 3 229 ? 83.393  -2.220  128.064 1.00 29.08  ? 316 ASP F CG  1 
ATOM   10669 O  OD1 . ASP F 3 229 ? 82.382  -1.613  127.673 1.00 31.11  ? 316 ASP F OD1 1 
ATOM   10670 O  OD2 . ASP F 3 229 ? 83.404  -2.943  129.095 1.00 30.03  ? 316 ASP F OD2 1 
ATOM   10671 N  N   . ASN F 3 230 ? 82.682  -2.311  124.215 1.00 35.48  ? 317 ASN F N   1 
ATOM   10672 C  CA  . ASN F 3 230 ? 81.813  -3.242  123.513 1.00 39.24  ? 317 ASN F CA  1 
ATOM   10673 C  C   . ASN F 3 230 ? 81.151  -2.559  122.320 1.00 44.16  ? 317 ASN F C   1 
ATOM   10674 O  O   . ASN F 3 230 ? 80.063  -1.997  122.456 1.00 45.19  ? 317 ASN F O   1 
ATOM   10675 C  CB  . ASN F 3 230 ? 80.743  -3.747  124.468 1.00 37.16  ? 317 ASN F CB  1 
ATOM   10676 C  CG  . ASN F 3 230 ? 80.273  -5.123  124.124 1.00 40.67  ? 317 ASN F CG  1 
ATOM   10677 O  OD1 . ASN F 3 230 ? 80.063  -5.453  122.959 1.00 45.89  ? 317 ASN F OD1 1 
ATOM   10678 N  ND2 . ASN F 3 230 ? 80.121  -5.951  125.138 1.00 38.55  ? 317 ASN F ND2 1 
ATOM   10679 N  N   . ASP F 3 231 ? 81.794  -2.646  121.152 1.00 45.15  ? 318 ASP F N   1 
ATOM   10680 C  CA  . ASP F 3 231 ? 81.299  -2.026  119.928 1.00 45.70  ? 318 ASP F CA  1 
ATOM   10681 C  C   . ASP F 3 231 ? 79.885  -2.339  119.451 1.00 48.09  ? 318 ASP F C   1 
ATOM   10682 O  O   . ASP F 3 231 ? 78.938  -1.765  119.957 1.00 57.11  ? 318 ASP F O   1 
ATOM   10683 C  CB  . ASP F 3 231 ? 82.277  -2.249  118.809 1.00 51.42  ? 318 ASP F CB  1 
ATOM   10684 C  CG  . ASP F 3 231 ? 82.772  -0.962  118.255 1.00 56.34  ? 318 ASP F CG  1 
ATOM   10685 O  OD1 . ASP F 3 231 ? 81.932  -0.174  117.775 1.00 49.98  ? 318 ASP F OD1 1 
ATOM   10686 O  OD2 . ASP F 3 231 ? 83.991  -0.717  118.338 1.00 63.58  ? 318 ASP F OD2 1 
ATOM   10687 N  N   . ASN F 3 232 ? 79.729  -3.208  118.463 1.00 42.49  ? 319 ASN F N   1 
ATOM   10688 C  CA  . ASN F 3 232 ? 78.396  -3.537  117.958 1.00 42.13  ? 319 ASN F CA  1 
ATOM   10689 C  C   . ASN F 3 232 ? 77.653  -2.424  117.231 1.00 45.54  ? 319 ASN F C   1 
ATOM   10690 O  O   . ASN F 3 232 ? 76.439  -2.524  116.988 1.00 46.58  ? 319 ASN F O   1 
ATOM   10691 C  CB  . ASN F 3 232 ? 77.509  -4.071  119.062 1.00 38.10  ? 319 ASN F CB  1 
ATOM   10692 C  CG  . ASN F 3 232 ? 78.182  -5.136  119.845 1.00 40.54  ? 319 ASN F CG  1 
ATOM   10693 O  OD1 . ASN F 3 232 ? 78.006  -5.223  121.058 1.00 44.25  ? 319 ASN F OD1 1 
ATOM   10694 N  ND2 . ASN F 3 232 ? 79.013  -5.935  119.172 1.00 38.89  ? 319 ASN F ND2 1 
ATOM   10695 N  N   . ASP F 3 233 ? 78.364  -1.353  116.903 1.00 44.93  ? 320 ASP F N   1 
ATOM   10696 C  CA  . ASP F 3 233 ? 77.739  -0.279  116.160 1.00 42.54  ? 320 ASP F CA  1 
ATOM   10697 C  C   . ASP F 3 233 ? 78.090  -0.426  114.676 1.00 42.50  ? 320 ASP F C   1 
ATOM   10698 O  O   . ASP F 3 233 ? 79.039  -1.134  114.308 1.00 37.11  ? 320 ASP F O   1 
ATOM   10699 C  CB  . ASP F 3 233 ? 78.125  1.098   116.722 1.00 39.88  ? 320 ASP F CB  1 
ATOM   10700 C  CG  . ASP F 3 233 ? 79.561  1.525   116.378 1.00 43.90  ? 320 ASP F CG  1 
ATOM   10701 O  OD1 . ASP F 3 233 ? 80.294  0.799   115.680 1.00 40.26  ? 320 ASP F OD1 1 
ATOM   10702 O  OD2 . ASP F 3 233 ? 79.959  2.627   116.815 1.00 46.21  ? 320 ASP F OD2 1 
ATOM   10703 N  N   . LYS F 3 234 ? 77.319  0.256   113.842 1.00 44.78  ? 321 LYS F N   1 
ATOM   10704 C  CA  . LYS F 3 234 ? 77.494  0.236   112.396 1.00 44.45  ? 321 LYS F CA  1 
ATOM   10705 C  C   . LYS F 3 234 ? 78.700  1.056   111.932 1.00 44.59  ? 321 LYS F C   1 
ATOM   10706 O  O   . LYS F 3 234 ? 79.184  0.904   110.811 1.00 49.74  ? 321 LYS F O   1 
ATOM   10707 C  CB  . LYS F 3 234 ? 76.218  0.738   111.726 1.00 46.09  ? 321 LYS F CB  1 
ATOM   10708 C  CG  . LYS F 3 234 ? 75.000  -0.121  112.027 1.00 50.13  ? 321 LYS F CG  1 
ATOM   10709 C  CD  . LYS F 3 234 ? 75.205  -1.554  111.547 1.00 50.70  ? 321 LYS F CD  1 
ATOM   10710 C  CE  . LYS F 3 234 ? 73.999  -2.454  111.860 1.00 50.40  ? 321 LYS F CE  1 
ATOM   10711 N  NZ  . LYS F 3 234 ? 74.168  -3.854  111.338 1.00 52.31  ? 321 LYS F NZ  1 
ATOM   10712 N  N   . PHE F 3 235 ? 79.163  1.953   112.787 1.00 41.31  ? 322 PHE F N   1 
ATOM   10713 C  CA  . PHE F 3 235 ? 80.317  2.764   112.466 1.00 37.99  ? 322 PHE F CA  1 
ATOM   10714 C  C   . PHE F 3 235 ? 81.520  1.844   112.488 1.00 39.18  ? 322 PHE F C   1 
ATOM   10715 O  O   . PHE F 3 235 ? 81.547  0.884   113.236 1.00 43.72  ? 322 PHE F O   1 
ATOM   10716 C  CB  . PHE F 3 235 ? 80.470  3.854   113.519 1.00 38.55  ? 322 PHE F CB  1 
ATOM   10717 C  CG  . PHE F 3 235 ? 81.689  4.697   113.353 1.00 39.32  ? 322 PHE F CG  1 
ATOM   10718 C  CD1 . PHE F 3 235 ? 82.274  4.869   112.108 1.00 41.04  ? 322 PHE F CD1 1 
ATOM   10719 C  CD2 . PHE F 3 235 ? 82.249  5.335   114.446 1.00 40.07  ? 322 PHE F CD2 1 
ATOM   10720 C  CE1 . PHE F 3 235 ? 83.397  5.661   111.948 1.00 42.49  ? 322 PHE F CE1 1 
ATOM   10721 C  CE2 . PHE F 3 235 ? 83.377  6.135   114.296 1.00 42.54  ? 322 PHE F CE2 1 
ATOM   10722 C  CZ  . PHE F 3 235 ? 83.954  6.299   113.040 1.00 41.39  ? 322 PHE F CZ  1 
ATOM   10723 N  N   . GLU F 3 236 ? 82.495  2.126   111.641 1.00 42.57  ? 323 GLU F N   1 
ATOM   10724 C  CA  . GLU F 3 236 ? 83.708  1.332   111.568 1.00 48.93  ? 323 GLU F CA  1 
ATOM   10725 C  C   . GLU F 3 236 ? 84.781  1.858   112.513 1.00 46.23  ? 323 GLU F C   1 
ATOM   10726 O  O   . GLU F 3 236 ? 85.973  1.728   112.232 1.00 45.39  ? 323 GLU F O   1 
ATOM   10727 C  CB  . GLU F 3 236 ? 84.249  1.288   110.123 1.00 57.93  ? 323 GLU F CB  1 
ATOM   10728 C  CG  . GLU F 3 236 ? 84.559  2.644   109.454 1.00 67.15  ? 323 GLU F CG  1 
ATOM   10729 C  CD  . GLU F 3 236 ? 83.420  3.180   108.567 1.00 73.00  ? 323 GLU F CD  1 
ATOM   10730 O  OE1 . GLU F 3 236 ? 82.539  2.389   108.150 1.00 74.32  ? 323 GLU F OE1 1 
ATOM   10731 O  OE2 . GLU F 3 236 ? 83.418  4.401   108.274 1.00 74.11  ? 323 GLU F OE2 1 
ATOM   10732 N  N   . GLY F 3 237 ? 84.363  2.422   113.645 1.00 45.76  ? 324 GLY F N   1 
ATOM   10733 C  CA  . GLY F 3 237 ? 85.335  2.957   114.585 1.00 44.35  ? 324 GLY F CA  1 
ATOM   10734 C  C   . GLY F 3 237 ? 84.908  3.267   116.015 1.00 48.05  ? 324 GLY F C   1 
ATOM   10735 O  O   . GLY F 3 237 ? 85.618  3.988   116.731 1.00 51.00  ? 324 GLY F O   1 
ATOM   10736 N  N   . ASN F 3 238 ? 83.742  2.778   116.426 1.00 42.38  ? 325 ASN F N   1 
ATOM   10737 C  CA  . ASN F 3 238 ? 83.257  2.980   117.795 1.00 39.93  ? 325 ASN F CA  1 
ATOM   10738 C  C   . ASN F 3 238 ? 82.790  4.367   118.227 1.00 37.22  ? 325 ASN F C   1 
ATOM   10739 O  O   . ASN F 3 238 ? 83.537  5.146   118.822 1.00 29.69  ? 325 ASN F O   1 
ATOM   10740 C  CB  . ASN F 3 238 ? 84.288  2.481   118.810 1.00 38.92  ? 325 ASN F CB  1 
ATOM   10741 C  CG  . ASN F 3 238 ? 83.667  2.109   120.141 1.00 37.73  ? 325 ASN F CG  1 
ATOM   10742 O  OD1 . ASN F 3 238 ? 84.305  1.473   120.967 1.00 38.18  ? 325 ASN F OD1 1 
ATOM   10743 N  ND2 . ASN F 3 238 ? 82.410  2.483   120.345 1.00 37.10  ? 325 ASN F ND2 1 
ATOM   10744 N  N   . CYS F 3 239 ? 81.500  4.599   118.053 1.00 35.30  ? 326 CYS F N   1 
ATOM   10745 C  CA  . CYS F 3 239 ? 80.907  5.857   118.438 1.00 31.91  ? 326 CYS F CA  1 
ATOM   10746 C  C   . CYS F 3 239 ? 80.965  5.982   119.949 1.00 30.53  ? 326 CYS F C   1 
ATOM   10747 O  O   . CYS F 3 239 ? 81.465  6.975   120.459 1.00 32.36  ? 326 CYS F O   1 
ATOM   10748 C  CB  . CYS F 3 239 ? 79.458  5.911   117.977 1.00 34.99  ? 326 CYS F CB  1 
ATOM   10749 S  SG  . CYS F 3 239 ? 79.249  5.811   116.186 1.00 29.33  ? 326 CYS F SG  1 
ATOM   10750 N  N   . ALA F 3 240 ? 80.500  4.944   120.657 1.00 35.48  ? 327 ALA F N   1 
ATOM   10751 C  CA  . ALA F 3 240 ? 80.464  4.909   122.134 1.00 31.30  ? 327 ALA F CA  1 
ATOM   10752 C  C   . ALA F 3 240 ? 81.733  5.417   122.799 1.00 34.46  ? 327 ALA F C   1 
ATOM   10753 O  O   . ALA F 3 240 ? 81.677  6.238   123.708 1.00 27.22  ? 327 ALA F O   1 
ATOM   10754 C  CB  . ALA F 3 240 ? 80.156  3.520   122.621 1.00 22.78  ? 327 ALA F CB  1 
ATOM   10755 N  N   . GLU F 3 241 ? 82.872  4.913   122.339 1.00 39.51  ? 328 GLU F N   1 
ATOM   10756 C  CA  . GLU F 3 241 ? 84.169  5.310   122.858 1.00 41.99  ? 328 GLU F CA  1 
ATOM   10757 C  C   . GLU F 3 241 ? 84.386  6.786   122.573 1.00 42.25  ? 328 GLU F C   1 
ATOM   10758 O  O   . GLU F 3 241 ? 84.805  7.531   123.456 1.00 47.02  ? 328 GLU F O   1 
ATOM   10759 C  CB  . GLU F 3 241 ? 85.267  4.479   122.188 1.00 50.73  ? 328 GLU F CB  1 
ATOM   10760 C  CG  . GLU F 3 241 ? 86.666  5.090   122.219 1.00 63.36  ? 328 GLU F CG  1 
ATOM   10761 C  CD  . GLU F 3 241 ? 87.397  4.855   123.524 1.00 73.83  ? 328 GLU F CD  1 
ATOM   10762 O  OE1 . GLU F 3 241 ? 87.106  5.563   124.518 1.00 77.74  ? 328 GLU F OE1 1 
ATOM   10763 O  OE2 . GLU F 3 241 ? 88.278  3.963   123.544 1.00 81.32  ? 328 GLU F OE2 1 
ATOM   10764 N  N   . GLN F 3 242 ? 84.074  7.209   121.348 1.00 38.40  ? 329 GLN F N   1 
ATOM   10765 C  CA  . GLN F 3 242 ? 84.256  8.603   120.953 1.00 38.56  ? 329 GLN F CA  1 
ATOM   10766 C  C   . GLN F 3 242 ? 83.292  9.546   121.633 1.00 40.19  ? 329 GLN F C   1 
ATOM   10767 O  O   . GLN F 3 242 ? 83.711  10.472  122.341 1.00 46.84  ? 329 GLN F O   1 
ATOM   10768 C  CB  . GLN F 3 242 ? 84.138  8.765   119.445 1.00 39.67  ? 329 GLN F CB  1 
ATOM   10769 C  CG  . GLN F 3 242 ? 85.206  8.031   118.692 1.00 38.43  ? 329 GLN F CG  1 
ATOM   10770 C  CD  . GLN F 3 242 ? 85.187  8.358   117.234 1.00 40.52  ? 329 GLN F CD  1 
ATOM   10771 O  OE1 . GLN F 3 242 ? 84.156  8.765   116.676 1.00 40.60  ? 329 GLN F OE1 1 
ATOM   10772 N  NE2 . GLN F 3 242 ? 86.331  8.179   116.590 1.00 49.29  ? 329 GLN F NE2 1 
ATOM   10773 N  N   . ASP F 3 243 ? 81.999  9.317   121.412 1.00 33.95  ? 330 ASP F N   1 
ATOM   10774 C  CA  . ASP F 3 243 ? 80.983  10.160  122.013 1.00 30.57  ? 330 ASP F CA  1 
ATOM   10775 C  C   . ASP F 3 243 ? 80.811  9.927   123.514 1.00 26.09  ? 330 ASP F C   1 
ATOM   10776 O  O   . ASP F 3 243 ? 80.038  10.622  124.162 1.00 23.56  ? 330 ASP F O   1 
ATOM   10777 C  CB  . ASP F 3 243 ? 79.674  10.073  121.229 1.00 30.00  ? 330 ASP F CB  1 
ATOM   10778 C  CG  . ASP F 3 243 ? 79.758  10.796  119.883 1.00 32.58  ? 330 ASP F CG  1 
ATOM   10779 O  OD1 . ASP F 3 243 ? 80.817  11.410  119.575 1.00 30.43  ? 330 ASP F OD1 1 
ATOM   10780 O  OD2 . ASP F 3 243 ? 78.756  10.751  119.139 1.00 31.22  ? 330 ASP F OD2 1 
ATOM   10781 N  N   . GLY F 3 244 ? 81.577  8.973   124.050 1.00 24.45  ? 331 GLY F N   1 
ATOM   10782 C  CA  . GLY F 3 244 ? 81.603  8.659   125.474 1.00 22.05  ? 331 GLY F CA  1 
ATOM   10783 C  C   . GLY F 3 244 ? 80.327  8.395   126.233 1.00 25.03  ? 331 GLY F C   1 
ATOM   10784 O  O   . GLY F 3 244 ? 79.929  9.180   127.100 1.00 29.70  ? 331 GLY F O   1 
ATOM   10785 N  N   . SER F 3 245 ? 79.710  7.259   125.958 1.00 24.65  ? 332 SER F N   1 
ATOM   10786 C  CA  . SER F 3 245 ? 78.473  6.902   126.637 1.00 21.27  ? 332 SER F CA  1 
ATOM   10787 C  C   . SER F 3 245 ? 78.091  5.475   126.309 1.00 24.96  ? 332 SER F C   1 
ATOM   10788 O  O   . SER F 3 245 ? 78.919  4.663   125.885 1.00 28.42  ? 332 SER F O   1 
ATOM   10789 C  CB  . SER F 3 245 ? 77.339  7.829   126.208 1.00 11.99  ? 332 SER F CB  1 
ATOM   10790 O  OG  . SER F 3 245 ? 77.070  7.659   124.833 1.00 9.82   ? 332 SER F OG  1 
ATOM   10791 N  N   . GLY F 3 246 ? 76.829  5.170   126.553 1.00 22.83  ? 333 GLY F N   1 
ATOM   10792 C  CA  . GLY F 3 246 ? 76.315  3.857   126.261 1.00 18.65  ? 333 GLY F CA  1 
ATOM   10793 C  C   . GLY F 3 246 ? 75.024  4.142   125.557 1.00 15.22  ? 333 GLY F C   1 
ATOM   10794 O  O   . GLY F 3 246 ? 74.145  4.803   126.101 1.00 24.95  ? 333 GLY F O   1 
ATOM   10795 N  N   . TRP F 3 247 ? 74.911  3.660   124.340 1.00 10.54  ? 334 TRP F N   1 
ATOM   10796 C  CA  . TRP F 3 247 ? 73.709  3.884   123.560 1.00 20.03  ? 334 TRP F CA  1 
ATOM   10797 C  C   . TRP F 3 247 ? 73.708  2.906   122.374 1.00 26.48  ? 334 TRP F C   1 
ATOM   10798 O  O   . TRP F 3 247 ? 74.635  2.101   122.209 1.00 21.62  ? 334 TRP F O   1 
ATOM   10799 C  CB  . TRP F 3 247 ? 73.730  5.331   123.059 1.00 20.28  ? 334 TRP F CB  1 
ATOM   10800 C  CG  . TRP F 3 247 ? 72.400  5.908   122.690 1.00 17.08  ? 334 TRP F CG  1 
ATOM   10801 C  CD1 . TRP F 3 247 ? 71.982  6.260   121.450 1.00 18.15  ? 334 TRP F CD1 1 
ATOM   10802 C  CD2 . TRP F 3 247 ? 71.319  6.202   123.578 1.00 18.98  ? 334 TRP F CD2 1 
ATOM   10803 N  NE1 . TRP F 3 247 ? 70.695  6.748   121.498 1.00 22.60  ? 334 TRP F NE1 1 
ATOM   10804 C  CE2 . TRP F 3 247 ? 70.265  6.722   122.794 1.00 16.88  ? 334 TRP F CE2 1 
ATOM   10805 C  CE3 . TRP F 3 247 ? 71.140  6.086   124.962 1.00 17.46  ? 334 TRP F CE3 1 
ATOM   10806 C  CZ2 . TRP F 3 247 ? 69.049  7.118   123.346 1.00 13.67  ? 334 TRP F CZ2 1 
ATOM   10807 C  CZ3 . TRP F 3 247 ? 69.932  6.487   125.509 1.00 17.69  ? 334 TRP F CZ3 1 
ATOM   10808 C  CH2 . TRP F 3 247 ? 68.903  6.994   124.704 1.00 16.17  ? 334 TRP F CH2 1 
ATOM   10809 N  N   . TRP F 3 248 ? 72.644  2.951   121.584 1.00 23.90  ? 335 TRP F N   1 
ATOM   10810 C  CA  . TRP F 3 248 ? 72.533  2.114   120.400 1.00 28.14  ? 335 TRP F CA  1 
ATOM   10811 C  C   . TRP F 3 248 ? 72.941  2.966   119.204 1.00 26.91  ? 335 TRP F C   1 
ATOM   10812 O  O   . TRP F 3 248 ? 72.121  3.679   118.605 1.00 23.29  ? 335 TRP F O   1 
ATOM   10813 C  CB  . TRP F 3 248 ? 71.107  1.623   120.208 1.00 27.70  ? 335 TRP F CB  1 
ATOM   10814 C  CG  . TRP F 3 248 ? 70.301  1.926   121.346 1.00 31.23  ? 335 TRP F CG  1 
ATOM   10815 C  CD1 . TRP F 3 248 ? 69.905  3.171   121.765 1.00 42.09  ? 335 TRP F CD1 1 
ATOM   10816 C  CD2 . TRP F 3 248 ? 69.829  1.003   122.308 1.00 29.35  ? 335 TRP F CD2 1 
ATOM   10817 N  NE1 . TRP F 3 248 ? 69.213  3.078   122.953 1.00 43.71  ? 335 TRP F NE1 1 
ATOM   10818 C  CE2 . TRP F 3 248 ? 69.147  1.756   123.311 1.00 36.82  ? 335 TRP F CE2 1 
ATOM   10819 C  CE3 . TRP F 3 248 ? 69.914  -0.380  122.434 1.00 28.07  ? 335 TRP F CE3 1 
ATOM   10820 C  CZ2 . TRP F 3 248 ? 68.550  1.159   124.425 1.00 32.46  ? 335 TRP F CZ2 1 
ATOM   10821 C  CZ3 . TRP F 3 248 ? 69.324  -0.972  123.541 1.00 35.67  ? 335 TRP F CZ3 1 
ATOM   10822 C  CH2 . TRP F 3 248 ? 68.648  -0.200  124.525 1.00 36.97  ? 335 TRP F CH2 1 
ATOM   10823 N  N   . MET F 3 249 ? 74.230  2.939   118.902 1.00 23.59  ? 336 MET F N   1 
ATOM   10824 C  CA  . MET F 3 249 ? 74.742  3.689   117.781 1.00 23.11  ? 336 MET F CA  1 
ATOM   10825 C  C   . MET F 3 249 ? 74.425  2.929   116.496 1.00 28.33  ? 336 MET F C   1 
ATOM   10826 O  O   . MET F 3 249 ? 74.095  1.725   116.504 1.00 32.86  ? 336 MET F O   1 
ATOM   10827 C  CB  . MET F 3 249 ? 76.259  3.880   117.911 1.00 27.56  ? 336 MET F CB  1 
ATOM   10828 C  CG  . MET F 3 249 ? 76.706  4.432   119.246 1.00 32.06  ? 336 MET F CG  1 
ATOM   10829 S  SD  . MET F 3 249 ? 75.976  6.038   119.665 1.00 40.83  ? 336 MET F SD  1 
ATOM   10830 C  CE  . MET F 3 249 ? 77.349  6.910   120.362 1.00 39.66  ? 336 MET F CE  1 
ATOM   10831 N  N   . ASN F 3 250 ? 74.559  3.649   115.393 1.00 28.97  ? 337 ASN F N   1 
ATOM   10832 C  CA  . ASN F 3 250 ? 74.330  3.138   114.053 1.00 33.72  ? 337 ASN F CA  1 
ATOM   10833 C  C   . ASN F 3 250 ? 75.201  4.100   113.290 1.00 34.00  ? 337 ASN F C   1 
ATOM   10834 O  O   . ASN F 3 250 ? 74.689  5.026   112.673 1.00 36.48  ? 337 ASN F O   1 
ATOM   10835 C  CB  . ASN F 3 250 ? 72.861  3.356   113.673 1.00 31.19  ? 337 ASN F CB  1 
ATOM   10836 C  CG  . ASN F 3 250 ? 72.639  3.360   112.175 1.00 29.24  ? 337 ASN F CG  1 
ATOM   10837 O  OD1 . ASN F 3 250 ? 73.502  2.935   111.409 1.00 27.58  ? 337 ASN F OD1 1 
ATOM   10838 N  ND2 . ASN F 3 250 ? 71.505  3.888   111.747 1.00 30.22  ? 337 ASN F ND2 1 
ATOM   10839 N  N   . LYS F 3 251 ? 76.514  3.909   113.324 1.00 33.62  ? 338 LYS F N   1 
ATOM   10840 C  CA  . LYS F 3 251 ? 77.398  4.885   112.670 1.00 40.91  ? 338 LYS F CA  1 
ATOM   10841 C  C   . LYS F 3 251 ? 77.077  6.203   113.388 1.00 39.23  ? 338 LYS F C   1 
ATOM   10842 O  O   . LYS F 3 251 ? 76.932  7.277   112.778 1.00 20.67  ? 338 LYS F O   1 
ATOM   10843 C  CB  . LYS F 3 251 ? 77.116  5.015   111.177 1.00 42.78  ? 338 LYS F CB  1 
ATOM   10844 C  CG  . LYS F 3 251 ? 78.249  5.666   110.397 1.00 40.82  ? 338 LYS F CG  1 
ATOM   10845 C  CD  . LYS F 3 251 ? 79.243  4.634   109.890 1.00 43.56  ? 338 LYS F CD  1 
ATOM   10846 C  CE  . LYS F 3 251 ? 80.166  5.217   108.830 1.00 47.53  ? 338 LYS F CE  1 
ATOM   10847 N  NZ  . LYS F 3 251 ? 79.431  5.895   107.718 1.00 48.53  ? 338 LYS F NZ  1 
ATOM   10848 N  N   . CYS F 3 252 ? 76.825  5.999   114.686 1.00 40.71  ? 339 CYS F N   1 
ATOM   10849 C  CA  . CYS F 3 252 ? 76.496  6.971   115.717 1.00 31.65  ? 339 CYS F CA  1 
ATOM   10850 C  C   . CYS F 3 252 ? 75.031  7.304   115.957 1.00 30.42  ? 339 CYS F C   1 
ATOM   10851 O  O   . CYS F 3 252 ? 74.192  6.404   115.951 1.00 35.88  ? 339 CYS F O   1 
ATOM   10852 C  CB  . CYS F 3 252 ? 77.391  8.180   115.636 1.00 27.99  ? 339 CYS F CB  1 
ATOM   10853 S  SG  . CYS F 3 252 ? 79.160  7.747   115.642 1.00 32.10  ? 339 CYS F SG  1 
ATOM   10854 N  N   . HIS F 3 253 ? 74.681  8.572   116.098 1.00 26.66  ? 340 HIS F N   1 
ATOM   10855 C  CA  . HIS F 3 253 ? 73.296  8.890   116.449 1.00 29.14  ? 340 HIS F CA  1 
ATOM   10856 C  C   . HIS F 3 253 ? 72.663  10.176  115.960 1.00 32.81  ? 340 HIS F C   1 
ATOM   10857 O  O   . HIS F 3 253 ? 73.335  11.056  115.436 1.00 31.93  ? 340 HIS F O   1 
ATOM   10858 C  CB  . HIS F 3 253 ? 73.238  8.978   117.964 1.00 29.58  ? 340 HIS F CB  1 
ATOM   10859 C  CG  . HIS F 3 253 ? 74.198  9.983   118.531 1.00 32.31  ? 340 HIS F CG  1 
ATOM   10860 N  ND1 . HIS F 3 253 ? 73.848  11.297  118.763 1.00 32.29  ? 340 HIS F ND1 1 
ATOM   10861 C  CD2 . HIS F 3 253 ? 75.509  9.877   118.865 1.00 29.97  ? 340 HIS F CD2 1 
ATOM   10862 C  CE1 . HIS F 3 253 ? 74.903  11.955  119.214 1.00 30.94  ? 340 HIS F CE1 1 
ATOM   10863 N  NE2 . HIS F 3 253 ? 75.922  11.117  119.286 1.00 25.68  ? 340 HIS F NE2 1 
ATOM   10864 N  N   . ALA F 3 254 ? 71.384  10.315  116.324 1.00 36.03  ? 341 ALA F N   1 
ATOM   10865 C  CA  . ALA F 3 254 ? 70.532  11.479  116.040 1.00 31.35  ? 341 ALA F CA  1 
ATOM   10866 C  C   . ALA F 3 254 ? 69.844  11.816  117.360 1.00 36.26  ? 341 ALA F C   1 
ATOM   10867 O  O   . ALA F 3 254 ? 69.422  12.944  117.590 1.00 31.76  ? 341 ALA F O   1 
ATOM   10868 C  CB  . ALA F 3 254 ? 69.502  11.147  114.996 1.00 30.88  ? 341 ALA F CB  1 
ATOM   10869 N  N   . GLY F 3 255 ? 69.713  10.792  118.204 1.00 44.27  ? 342 GLY F N   1 
ATOM   10870 C  CA  . GLY F 3 255 ? 69.126  10.915  119.531 1.00 41.36  ? 342 GLY F CA  1 
ATOM   10871 C  C   . GLY F 3 255 ? 70.196  10.339  120.450 1.00 41.11  ? 342 GLY F C   1 
ATOM   10872 O  O   . GLY F 3 255 ? 70.662  9.217   120.233 1.00 41.84  ? 342 GLY F O   1 
ATOM   10873 N  N   . HIS F 3 256 ? 70.560  11.075  121.495 1.00 37.71  ? 343 HIS F N   1 
ATOM   10874 C  CA  . HIS F 3 256 ? 71.625  10.644  122.384 1.00 33.71  ? 343 HIS F CA  1 
ATOM   10875 C  C   . HIS F 3 256 ? 71.383  11.019  123.846 1.00 31.57  ? 343 HIS F C   1 
ATOM   10876 O  O   . HIS F 3 256 ? 72.062  11.880  124.392 1.00 33.50  ? 343 HIS F O   1 
ATOM   10877 C  CB  . HIS F 3 256 ? 72.891  11.310  121.896 1.00 32.44  ? 343 HIS F CB  1 
ATOM   10878 C  CG  . HIS F 3 256 ? 74.140  10.710  122.437 1.00 36.27  ? 343 HIS F CG  1 
ATOM   10879 N  ND1 . HIS F 3 256 ? 75.214  11.473  122.841 1.00 41.28  ? 343 HIS F ND1 1 
ATOM   10880 C  CD2 . HIS F 3 256 ? 74.521  9.420   122.575 1.00 38.55  ? 343 HIS F CD2 1 
ATOM   10881 C  CE1 . HIS F 3 256 ? 76.208  10.677  123.194 1.00 41.23  ? 343 HIS F CE1 1 
ATOM   10882 N  NE2 . HIS F 3 256 ? 75.814  9.426   123.042 1.00 39.08  ? 343 HIS F NE2 1 
ATOM   10883 N  N   . LEU F 3 257 ? 70.483  10.305  124.503 1.00 24.49  ? 344 LEU F N   1 
ATOM   10884 C  CA  . LEU F 3 257 ? 70.147  10.603  125.877 1.00 25.10  ? 344 LEU F CA  1 
ATOM   10885 C  C   . LEU F 3 257 ? 71.138  10.204  126.956 1.00 25.27  ? 344 LEU F C   1 
ATOM   10886 O  O   . LEU F 3 257 ? 70.908  10.460  128.137 1.00 30.14  ? 344 LEU F O   1 
ATOM   10887 C  CB  . LEU F 3 257 ? 68.781  10.032  126.198 1.00 23.78  ? 344 LEU F CB  1 
ATOM   10888 C  CG  . LEU F 3 257 ? 67.731  10.509  125.217 1.00 22.31  ? 344 LEU F CG  1 
ATOM   10889 C  CD1 . LEU F 3 257 ? 66.387  10.001  125.659 1.00 20.20  ? 344 LEU F CD1 1 
ATOM   10890 C  CD2 . LEU F 3 257 ? 67.747  12.015  125.144 1.00 24.32  ? 344 LEU F CD2 1 
ATOM   10891 N  N   . ASN F 3 258 ? 72.216  9.539   126.596 1.00 19.34  ? 345 ASN F N   1 
ATOM   10892 C  CA  . ASN F 3 258 ? 73.166  9.181   127.628 1.00 20.15  ? 345 ASN F CA  1 
ATOM   10893 C  C   . ASN F 3 258 ? 74.448  9.900   127.331 1.00 23.38  ? 345 ASN F C   1 
ATOM   10894 O  O   . ASN F 3 258 ? 75.529  9.534   127.809 1.00 24.46  ? 345 ASN F O   1 
ATOM   10895 C  CB  . ASN F 3 258 ? 73.357  7.673   127.712 1.00 24.45  ? 345 ASN F CB  1 
ATOM   10896 C  CG  . ASN F 3 258 ? 72.141  6.970   128.260 1.00 22.51  ? 345 ASN F CG  1 
ATOM   10897 O  OD1 . ASN F 3 258 ? 71.096  7.580   128.439 1.00 27.60  ? 345 ASN F OD1 1 
ATOM   10898 N  ND2 . ASN F 3 258 ? 72.266  5.682   128.524 1.00 22.03  ? 345 ASN F ND2 1 
ATOM   10899 N  N   . GLY F 3 259 ? 74.297  10.972  126.563 1.00 23.62  ? 346 GLY F N   1 
ATOM   10900 C  CA  . GLY F 3 259 ? 75.431  11.790  126.191 1.00 30.67  ? 346 GLY F CA  1 
ATOM   10901 C  C   . GLY F 3 259 ? 75.978  12.619  127.338 1.00 25.06  ? 346 GLY F C   1 
ATOM   10902 O  O   . GLY F 3 259 ? 75.471  12.576  128.453 1.00 19.02  ? 346 GLY F O   1 
ATOM   10903 N  N   . VAL F 3 260 ? 77.029  13.376  127.057 1.00 24.67  ? 347 VAL F N   1 
ATOM   10904 C  CA  . VAL F 3 260 ? 77.640  14.208  128.064 1.00 19.89  ? 347 VAL F CA  1 
ATOM   10905 C  C   . VAL F 3 260 ? 76.663  15.272  128.471 1.00 23.67  ? 347 VAL F C   1 
ATOM   10906 O  O   . VAL F 3 260 ? 75.854  15.717  127.674 1.00 33.97  ? 347 VAL F O   1 
ATOM   10907 C  CB  . VAL F 3 260 ? 78.902  14.875  127.547 1.00 19.73  ? 347 VAL F CB  1 
ATOM   10908 C  CG1 . VAL F 3 260 ? 79.464  15.850  128.587 1.00 16.71  ? 347 VAL F CG1 1 
ATOM   10909 C  CG2 . VAL F 3 260 ? 79.914  13.834  127.204 1.00 20.19  ? 347 VAL F CG2 1 
ATOM   10910 N  N   . TYR F 3 261 ? 76.723  15.658  129.732 1.00 25.68  ? 348 TYR F N   1 
ATOM   10911 C  CA  . TYR F 3 261 ? 75.834  16.682  130.225 1.00 32.55  ? 348 TYR F CA  1 
ATOM   10912 C  C   . TYR F 3 261 ? 76.516  18.035  130.139 1.00 38.29  ? 348 TYR F C   1 
ATOM   10913 O  O   . TYR F 3 261 ? 77.502  18.294  130.832 1.00 38.81  ? 348 TYR F O   1 
ATOM   10914 C  CB  . TYR F 3 261 ? 75.449  16.394  131.664 1.00 28.20  ? 348 TYR F CB  1 
ATOM   10915 C  CG  . TYR F 3 261 ? 74.225  17.144  132.119 1.00 23.81  ? 348 TYR F CG  1 
ATOM   10916 C  CD1 . TYR F 3 261 ? 74.332  18.403  132.701 1.00 20.20  ? 348 TYR F CD1 1 
ATOM   10917 C  CD2 . TYR F 3 261 ? 72.955  16.583  131.989 1.00 26.84  ? 348 TYR F CD2 1 
ATOM   10918 C  CE1 . TYR F 3 261 ? 73.204  19.086  133.150 1.00 21.06  ? 348 TYR F CE1 1 
ATOM   10919 C  CE2 . TYR F 3 261 ? 71.819  17.262  132.436 1.00 27.89  ? 348 TYR F CE2 1 
ATOM   10920 C  CZ  . TYR F 3 261 ? 71.958  18.513  133.016 1.00 26.22  ? 348 TYR F CZ  1 
ATOM   10921 O  OH  . TYR F 3 261 ? 70.851  19.184  133.467 1.00 29.63  ? 348 TYR F OH  1 
ATOM   10922 N  N   . TYR F 3 262 ? 75.990  18.888  129.272 1.00 38.79  ? 349 TYR F N   1 
ATOM   10923 C  CA  . TYR F 3 262 ? 76.529  20.222  129.092 1.00 38.43  ? 349 TYR F CA  1 
ATOM   10924 C  C   . TYR F 3 262 ? 75.600  21.200  129.764 1.00 43.21  ? 349 TYR F C   1 
ATOM   10925 O  O   . TYR F 3 262 ? 74.391  21.207  129.508 1.00 50.61  ? 349 TYR F O   1 
ATOM   10926 C  CB  . TYR F 3 262 ? 76.659  20.555  127.607 1.00 36.43  ? 349 TYR F CB  1 
ATOM   10927 C  CG  . TYR F 3 262 ? 77.730  19.756  126.939 1.00 32.83  ? 349 TYR F CG  1 
ATOM   10928 C  CD1 . TYR F 3 262 ? 79.060  20.139  127.045 1.00 31.52  ? 349 TYR F CD1 1 
ATOM   10929 C  CD2 . TYR F 3 262 ? 77.423  18.601  126.230 1.00 34.64  ? 349 TYR F CD2 1 
ATOM   10930 C  CE1 . TYR F 3 262 ? 80.058  19.399  126.467 1.00 35.27  ? 349 TYR F CE1 1 
ATOM   10931 C  CE2 . TYR F 3 262 ? 78.418  17.847  125.644 1.00 36.21  ? 349 TYR F CE2 1 
ATOM   10932 C  CZ  . TYR F 3 262 ? 79.735  18.256  125.768 1.00 39.86  ? 349 TYR F CZ  1 
ATOM   10933 O  OH  . TYR F 3 262 ? 80.741  17.532  125.185 1.00 45.69  ? 349 TYR F OH  1 
ATOM   10934 N  N   . GLN F 3 263 ? 76.170  22.008  130.646 1.00 42.51  ? 350 GLN F N   1 
ATOM   10935 C  CA  . GLN F 3 263 ? 75.411  23.008  131.371 1.00 45.57  ? 350 GLN F CA  1 
ATOM   10936 C  C   . GLN F 3 263 ? 75.007  24.178  130.456 1.00 49.27  ? 350 GLN F C   1 
ATOM   10937 O  O   . GLN F 3 263 ? 75.829  24.711  129.695 1.00 50.68  ? 350 GLN F O   1 
ATOM   10938 C  CB  . GLN F 3 263 ? 76.256  23.514  132.539 1.00 53.05  ? 350 GLN F CB  1 
ATOM   10939 C  CG  . GLN F 3 263 ? 75.599  23.440  133.919 1.00 60.38  ? 350 GLN F CG  1 
ATOM   10940 C  CD  . GLN F 3 263 ? 75.500  22.025  134.469 1.00 64.42  ? 350 GLN F CD  1 
ATOM   10941 O  OE1 . GLN F 3 263 ? 76.372  21.182  134.232 1.00 67.97  ? 350 GLN F OE1 1 
ATOM   10942 N  NE2 . GLN F 3 263 ? 74.434  21.759  135.218 1.00 66.82  ? 350 GLN F NE2 1 
ATOM   10943 N  N   . GLY F 3 264 ? 73.729  24.543  130.505 1.00 52.34  ? 351 GLY F N   1 
ATOM   10944 C  CA  . GLY F 3 264 ? 73.244  25.652  129.698 1.00 60.61  ? 351 GLY F CA  1 
ATOM   10945 C  C   . GLY F 3 264 ? 72.691  25.263  128.350 1.00 64.71  ? 351 GLY F C   1 
ATOM   10946 O  O   . GLY F 3 264 ? 72.032  26.066  127.692 1.00 66.88  ? 351 GLY F O   1 
ATOM   10947 N  N   . GLY F 3 265 ? 72.975  24.032  127.940 1.00 70.19  ? 352 GLY F N   1 
ATOM   10948 C  CA  . GLY F 3 265 ? 72.497  23.536  126.665 1.00 74.07  ? 352 GLY F CA  1 
ATOM   10949 C  C   . GLY F 3 265 ? 73.450  23.656  125.493 1.00 76.83  ? 352 GLY F C   1 
ATOM   10950 O  O   . GLY F 3 265 ? 73.902  22.647  124.953 1.00 81.20  ? 352 GLY F O   1 
ATOM   10951 N  N   . THR F 3 266 ? 73.774  24.885  125.105 1.00 76.49  ? 353 THR F N   1 
ATOM   10952 C  CA  . THR F 3 266 ? 74.644  25.129  123.958 1.00 73.45  ? 353 THR F CA  1 
ATOM   10953 C  C   . THR F 3 266 ? 76.108  24.765  124.169 1.00 67.12  ? 353 THR F C   1 
ATOM   10954 O  O   . THR F 3 266 ? 76.745  25.257  125.096 1.00 69.36  ? 353 THR F O   1 
ATOM   10955 C  CB  . THR F 3 266 ? 74.571  26.617  123.508 1.00 75.08  ? 353 THR F CB  1 
ATOM   10956 O  OG1 . THR F 3 266 ? 73.200  27.017  123.365 1.00 77.03  ? 353 THR F OG1 1 
ATOM   10957 C  CG2 . THR F 3 266 ? 75.289  26.814  122.172 1.00 74.71  ? 353 THR F CG2 1 
ATOM   10958 N  N   . TYR F 3 267 ? 76.629  23.885  123.316 1.00 58.62  ? 354 TYR F N   1 
ATOM   10959 C  CA  . TYR F 3 267 ? 78.035  23.505  123.381 1.00 50.26  ? 354 TYR F CA  1 
ATOM   10960 C  C   . TYR F 3 267 ? 78.651  23.636  122.009 1.00 50.01  ? 354 TYR F C   1 
ATOM   10961 O  O   . TYR F 3 267 ? 77.960  23.981  121.053 1.00 51.91  ? 354 TYR F O   1 
ATOM   10962 C  CB  . TYR F 3 267 ? 78.242  22.102  123.948 1.00 46.82  ? 354 TYR F CB  1 
ATOM   10963 C  CG  . TYR F 3 267 ? 77.724  20.936  123.138 1.00 47.96  ? 354 TYR F CG  1 
ATOM   10964 C  CD1 . TYR F 3 267 ? 76.358  20.659  123.069 1.00 50.39  ? 354 TYR F CD1 1 
ATOM   10965 C  CD2 . TYR F 3 267 ? 78.608  20.044  122.534 1.00 47.06  ? 354 TYR F CD2 1 
ATOM   10966 C  CE1 . TYR F 3 267 ? 75.880  19.510  122.425 1.00 52.73  ? 354 TYR F CE1 1 
ATOM   10967 C  CE2 . TYR F 3 267 ? 78.147  18.894  121.888 1.00 52.08  ? 354 TYR F CE2 1 
ATOM   10968 C  CZ  . TYR F 3 267 ? 76.779  18.626  121.836 1.00 54.66  ? 354 TYR F CZ  1 
ATOM   10969 O  OH  . TYR F 3 267 ? 76.308  17.474  121.221 1.00 53.45  ? 354 TYR F OH  1 
ATOM   10970 N  N   . SER F 3 268 ? 79.940  23.349  121.899 1.00 49.85  ? 355 SER F N   1 
ATOM   10971 C  CA  . SER F 3 268 ? 80.621  23.491  120.622 1.00 55.63  ? 355 SER F CA  1 
ATOM   10972 C  C   . SER F 3 268 ? 81.649  22.417  120.339 1.00 56.69  ? 355 SER F C   1 
ATOM   10973 O  O   . SER F 3 268 ? 82.128  21.738  121.242 1.00 54.61  ? 355 SER F O   1 
ATOM   10974 C  CB  . SER F 3 268 ? 81.293  24.857  120.551 1.00 61.27  ? 355 SER F CB  1 
ATOM   10975 O  OG  . SER F 3 268 ? 82.125  25.051  121.680 1.00 63.57  ? 355 SER F OG  1 
ATOM   10976 N  N   . LYS F 3 269 ? 82.018  22.312  119.071 1.00 61.30  ? 356 LYS F N   1 
ATOM   10977 C  CA  . LYS F 3 269 ? 82.985  21.332  118.614 1.00 66.15  ? 356 LYS F CA  1 
ATOM   10978 C  C   . LYS F 3 269 ? 84.292  21.366  119.402 1.00 65.47  ? 356 LYS F C   1 
ATOM   10979 O  O   . LYS F 3 269 ? 84.899  20.328  119.635 1.00 61.87  ? 356 LYS F O   1 
ATOM   10980 C  CB  . LYS F 3 269 ? 83.247  21.547  117.119 1.00 71.20  ? 356 LYS F CB  1 
ATOM   10981 C  CG  . LYS F 3 269 ? 84.344  20.683  116.518 1.00 74.51  ? 356 LYS F CG  1 
ATOM   10982 C  CD  . LYS F 3 269 ? 84.452  20.906  115.016 1.00 79.38  ? 356 LYS F CD  1 
ATOM   10983 C  CE  . LYS F 3 269 ? 83.203  20.428  114.287 1.00 84.48  ? 356 LYS F CE  1 
ATOM   10984 N  NZ  . LYS F 3 269 ? 82.962  18.965  114.466 1.00 88.20  ? 356 LYS F NZ  1 
ATOM   10985 N  N   . ALA F 3 270 ? 84.715  22.554  119.824 1.00 68.39  ? 357 ALA F N   1 
ATOM   10986 C  CA  . ALA F 3 270 ? 85.961  22.704  120.584 1.00 68.20  ? 357 ALA F CA  1 
ATOM   10987 C  C   . ALA F 3 270 ? 85.866  22.077  121.966 1.00 67.79  ? 357 ALA F C   1 
ATOM   10988 O  O   . ALA F 3 270 ? 86.826  21.481  122.456 1.00 70.52  ? 357 ALA F O   1 
ATOM   10989 C  CB  . ALA F 3 270 ? 86.336  24.168  120.710 1.00 69.07  ? 357 ALA F CB  1 
ATOM   10990 N  N   . SER F 3 271 ? 84.710  22.241  122.600 1.00 65.73  ? 358 SER F N   1 
ATOM   10991 C  CA  . SER F 3 271 ? 84.463  21.680  123.919 1.00 62.09  ? 358 SER F CA  1 
ATOM   10992 C  C   . SER F 3 271 ? 84.636  20.162  123.883 1.00 60.51  ? 358 SER F C   1 
ATOM   10993 O  O   . SER F 3 271 ? 85.292  19.592  124.749 1.00 59.85  ? 358 SER F O   1 
ATOM   10994 C  CB  . SER F 3 271 ? 83.044  22.019  124.373 1.00 65.74  ? 358 SER F CB  1 
ATOM   10995 O  OG  . SER F 3 271 ? 82.822  23.419  124.358 1.00 69.75  ? 358 SER F OG  1 
ATOM   10996 N  N   . THR F 3 272 ? 84.074  19.522  122.857 1.00 60.50  ? 359 THR F N   1 
ATOM   10997 C  CA  . THR F 3 272 ? 84.146  18.069  122.700 1.00 53.26  ? 359 THR F CA  1 
ATOM   10998 C  C   . THR F 3 272 ? 85.550  17.590  122.392 1.00 54.83  ? 359 THR F C   1 
ATOM   10999 O  O   . THR F 3 272 ? 86.306  18.256  121.696 1.00 58.01  ? 359 THR F O   1 
ATOM   11000 C  CB  . THR F 3 272 ? 83.226  17.561  121.578 1.00 53.33  ? 359 THR F CB  1 
ATOM   11001 O  OG1 . THR F 3 272 ? 83.722  18.008  120.314 1.00 53.10  ? 359 THR F OG1 1 
ATOM   11002 C  CG2 . THR F 3 272 ? 81.803  18.070  121.772 1.00 56.99  ? 359 THR F CG2 1 
ATOM   11003 N  N   . PRO F 3 273 ? 85.902  16.400  122.886 1.00 58.80  ? 360 PRO F N   1 
ATOM   11004 C  CA  . PRO F 3 273 ? 87.219  15.788  122.685 1.00 61.46  ? 360 PRO F CA  1 
ATOM   11005 C  C   . PRO F 3 273 ? 87.531  15.450  121.229 1.00 66.85  ? 360 PRO F C   1 
ATOM   11006 O  O   . PRO F 3 273 ? 88.379  16.090  120.600 1.00 69.82  ? 360 PRO F O   1 
ATOM   11007 C  CB  . PRO F 3 273 ? 87.137  14.529  123.544 1.00 58.55  ? 360 PRO F CB  1 
ATOM   11008 C  CG  . PRO F 3 273 ? 85.662  14.188  123.507 1.00 57.88  ? 360 PRO F CG  1 
ATOM   11009 C  CD  . PRO F 3 273 ? 85.041  15.533  12