data_1G1E
# 
_entry.id   1G1E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1G1E         
RCSB  RCSB012112   
WWPDB D_1000012112 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1G1E 
_pdbx_database_status.recvd_initial_deposition_date   2000-10-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Brubaker, K.'      1 
'Cowley, S.M.'      2 
'Huang, K.'         3 
'Eisenman, R.N.'    4 
'Radhakrishnan, I.' 5 
# 
_citation.id                        primary 
_citation.title                     
;Solution structure of the interacting domains of the Mad-Sin3 complex: implications for recruitment of a chromatin-modifying complex.
;
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            103 
_citation.page_first                655 
_citation.page_last                 665 
_citation.year                      2000 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11106735 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(00)00168-9' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Brubaker, K.'      1 
primary 'Cowley, S.M.'      2 
primary 'Huang, K.'         3 
primary 'Loo, L.'           4 
primary 'Yochum, G.S.'      5 
primary 'Ayer, D.E.'        6 
primary 'Eisenman, R.N.'    7 
primary 'Radhakrishnan, I.' 8 
# 
_cell.entry_id           1G1E 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1G1E 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 'MAD1 PROTEIN' 1968.302  1 ? ? 'SIN3 INTERACTION DOMAIN (SID) TRANSREPRESSION DOMAIN' ? 
2 polymer man SIN3A          10343.438 1 ? ? 'PAIRED AMPHIPATHIC HELIX 2 (PAH2 REPEAT)'             ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'MAX DIMERIZATION PROTEIN' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no RMNIQMLLEAADYLER                                                                             
RMNIQMLLEAADYLER                                                                             A ? 
2 'polypeptide(L)' no no 
;SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLS
EFGQFLPDA
;
;SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLS
EFGQFLPDA
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ARG n 
1 2  MET n 
1 3  ASN n 
1 4  ILE n 
1 5  GLN n 
1 6  MET n 
1 7  LEU n 
1 8  LEU n 
1 9  GLU n 
1 10 ALA n 
1 11 ALA n 
1 12 ASP n 
1 13 TYR n 
1 14 LEU n 
1 15 GLU n 
1 16 ARG n 
2 1  SER n 
2 2  LEU n 
2 3  GLN n 
2 4  ASN n 
2 5  ASN n 
2 6  GLN n 
2 7  PRO n 
2 8  VAL n 
2 9  GLU n 
2 10 PHE n 
2 11 ASN n 
2 12 HIS n 
2 13 ALA n 
2 14 ILE n 
2 15 ASN n 
2 16 TYR n 
2 17 VAL n 
2 18 ASN n 
2 19 LYS n 
2 20 ILE n 
2 21 LYS n 
2 22 ASN n 
2 23 ARG n 
2 24 PHE n 
2 25 GLN n 
2 26 GLY n 
2 27 GLN n 
2 28 PRO n 
2 29 ASP n 
2 30 ILE n 
2 31 TYR n 
2 32 LYS n 
2 33 ALA n 
2 34 PHE n 
2 35 LEU n 
2 36 GLU n 
2 37 ILE n 
2 38 LEU n 
2 39 HIS n 
2 40 THR n 
2 41 TYR n 
2 42 GLN n 
2 43 LYS n 
2 44 GLU n 
2 45 GLN n 
2 46 ARG n 
2 47 ASN n 
2 48 ALA n 
2 49 LYS n 
2 50 GLU n 
2 51 ALA n 
2 52 GLY n 
2 53 GLY n 
2 54 ASN n 
2 55 TYR n 
2 56 THR n 
2 57 PRO n 
2 58 ALA n 
2 59 LEU n 
2 60 THR n 
2 61 GLU n 
2 62 GLN n 
2 63 GLU n 
2 64 VAL n 
2 65 TYR n 
2 66 ALA n 
2 67 GLN n 
2 68 VAL n 
2 69 ALA n 
2 70 ARG n 
2 71 LEU n 
2 72 PHE n 
2 73 LYS n 
2 74 ASN n 
2 75 GLN n 
2 76 GLU n 
2 77 ASP n 
2 78 LEU n 
2 79 LEU n 
2 80 SER n 
2 81 GLU n 
2 82 PHE n 
2 83 GLY n 
2 84 GLN n 
2 85 PHE n 
2 86 LEU n 
2 87 PRO n 
2 88 ASP n 
2 89 ALA n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET24 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
'The peptide sequence was synthesized via automated methods. The sequence is naturally found in Homo sapiens (human).' 
# 
loop_
_struct_ref.id 
_struct_ref.db_code 
_struct_ref.db_name 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 NP_002348   GB  1 4505069 6   RMNIQMLLEAADYLER                                                                             ? 
2 SIN3A_MOUSE UNP 2 Q60520  295 
;SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLS
EFGQFLPDA
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1G1E A 1 ? 16 ? 4505069 6   ? 21  ? 6   21  
2 2 1G1E B 1 ? 89 ? Q60520  295 ? 383 ? 295 383 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 '3D 15N-separated_NOESY'                          
2 1 1 HNHA                                              
3 2 1 '2D 13C,15N-double-half-filtered NOESY'           
4 2 1 '2D 13C-double-half-filtered NOESY'               
5 3 1 '3D 13C-separated_NOESY'                          
6 3 1 '3D HACAHB'                                       
7 3 1 
;2D Spin-echo Difference for JNCgamma, JC'Cgamma
;
8 1 1 '3D HNHB'                                         
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         300 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '20 mM phosphate' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1.0 mM 1:1 SID unlabeled, PAH2 U-15N; 1.6 mM 1:1 SID unlabeled, PAH2 U-15N, U-13C.' '90% H2O/10% D2O' 
2 '1.6 mM 1:1 SID unlabeled, PAH2 U-15N,13C; 20 mM phosphate buffer pH 6.0, 0.2% NaN3' '90% H2O/10% D2O' 
3 '1.6 mM 1:1 SID unlabeled, PAH2 U-15N,13C; 20 mM phosphate buffer pH 6.0, 0.2% NaN3' '100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Varian INOVA 600 
2 ? Varian INOVA 500 
# 
_pdbx_nmr_refine.entry_id           1G1E 
_pdbx_nmr_refine.method             'distance geometry, simulated annealing' 
_pdbx_nmr_refine.details            
;The structures are based on 1612 unique distance constraints, 198 torsion angle constraints and 72 JHNHA coupling constant constraints.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1G1E 
_pdbx_nmr_details.text       'Interproton NOEs were assigned iteratively but manually during structure refinement.' 
# 
_pdbx_nmr_ensemble.entry_id                                      1G1E 
_pdbx_nmr_ensemble.conformers_calculated_total_number            25 
_pdbx_nmr_ensemble.conformers_submitted_total_number             15 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with favorable non-bond energy,structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1G1E 
_pdbx_nmr_representative.conformer_id         15 
_pdbx_nmr_representative.selection_criteria   'minimized average structure' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
FELIX 98  processing           'Molecular Simulations' 1 
FELIX 98  'data analysis'      'Molecular Simulations' 2 
DYANA 1.5 'structure solution' 'Guntert, Wuthrich'     3 
CNS   1.0 refinement           Brunger                 4 
# 
_exptl.entry_id          1G1E 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1G1E 
_struct.title                     
'NMR STRUCTURE OF THE HUMAN MAD1 TRANSREPRESSION DOMAIN SID IN COMPLEX WITH MAMMALIAN SIN3A PAH2 DOMAIN' 
_struct.pdbx_descriptor           'MAD1 PROTEIN/SIN3A' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   'minimized average' 
# 
_struct_keywords.entry_id        1G1E 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'Four-helix bundle, Protein-peptide Complex, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ILE A 4  ? GLU A 15 ? ILE A 9   GLU A 20  1 ? 12 
HELX_P HELX_P2 2 VAL B 8  ? ARG B 23 ? VAL B 302 ARG B 317 1 ? 16 
HELX_P HELX_P3 3 PRO B 28 ? ALA B 51 ? PRO B 322 ALA B 345 1 ? 24 
HELX_P HELX_P4 4 GLU B 61 ? LEU B 71 ? GLU B 355 LEU B 365 1 ? 11 
HELX_P HELX_P5 5 GLU B 76 ? GLY B 83 ? GLU B 370 GLY B 377 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1G1E 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1G1E 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ARG A 1 1  ? -0.934  12.225  -2.689  1.00 0.00 ? 6   ARG A N    1  
ATOM 2     C CA   . ARG A 1 1  ? 0.349   11.472  -2.808  1.00 0.00 ? 6   ARG A CA   1  
ATOM 3     C C    . ARG A 1 1  ? 0.183   10.223  -3.677  1.00 0.00 ? 6   ARG A C    1  
ATOM 4     O O    . ARG A 1 1  ? -0.898  9.634   -3.729  1.00 0.00 ? 6   ARG A O    1  
ATOM 5     C CB   . ARG A 1 1  ? 0.841   11.076  -1.407  1.00 0.00 ? 6   ARG A CB   1  
ATOM 6     C CG   . ARG A 1 1  ? 1.271   12.247  -0.530  1.00 0.00 ? 6   ARG A CG   1  
ATOM 7     C CD   . ARG A 1 1  ? 0.079   13.017  0.026   1.00 0.00 ? 6   ARG A CD   1  
ATOM 8     N NE   . ARG A 1 1  ? 0.488   14.075  0.952   1.00 0.00 ? 6   ARG A NE   1  
ATOM 9     C CZ   . ARG A 1 1  ? 0.996   13.857  2.170   1.00 0.00 ? 6   ARG A CZ   1  
ATOM 10    N NH1  . ARG A 1 1  ? 1.121   12.619  2.643   1.00 0.00 ? 6   ARG A NH1  1  
ATOM 11    N NH2  . ARG A 1 1  ? 1.367   14.886  2.925   1.00 0.00 ? 6   ARG A NH2  1  
ATOM 12    H H1   . ARG A 1 1  ? -1.497  12.031  -3.541  1.00 0.00 ? 6   ARG A H1   1  
ATOM 13    H H2   . ARG A 1 1  ? -0.701  13.237  -2.619  1.00 0.00 ? 6   ARG A H2   1  
ATOM 14    H H3   . ARG A 1 1  ? -1.425  11.892  -1.834  1.00 0.00 ? 6   ARG A H3   1  
ATOM 15    H HA   . ARG A 1 1  ? 1.080   12.120  -3.268  1.00 0.00 ? 6   ARG A HA   1  
ATOM 16    H HB2  . ARG A 1 1  ? 0.047   10.551  -0.898  1.00 0.00 ? 6   ARG A HB2  1  
ATOM 17    H HB3  . ARG A 1 1  ? 1.685   10.410  -1.514  1.00 0.00 ? 6   ARG A HB3  1  
ATOM 18    H HG2  . ARG A 1 1  ? 1.856   11.869  0.294   1.00 0.00 ? 6   ARG A HG2  1  
ATOM 19    H HG3  . ARG A 1 1  ? 1.876   12.920  -1.121  1.00 0.00 ? 6   ARG A HG3  1  
ATOM 20    H HD2  . ARG A 1 1  ? -0.461  13.462  -0.793  1.00 0.00 ? 6   ARG A HD2  1  
ATOM 21    H HD3  . ARG A 1 1  ? -0.566  12.325  0.548   1.00 0.00 ? 6   ARG A HD3  1  
ATOM 22    H HE   . ARG A 1 1  ? 0.389   15.001  0.646   1.00 0.00 ? 6   ARG A HE   1  
ATOM 23    H HH11 . ARG A 1 1  ? 0.834   11.838  2.088   1.00 0.00 ? 6   ARG A HH11 1  
ATOM 24    H HH12 . ARG A 1 1  ? 1.502   12.469  3.555   1.00 0.00 ? 6   ARG A HH12 1  
ATOM 25    H HH21 . ARG A 1 1  ? 1.268   15.820  2.582   1.00 0.00 ? 6   ARG A HH21 1  
ATOM 26    H HH22 . ARG A 1 1  ? 1.747   14.726  3.837   1.00 0.00 ? 6   ARG A HH22 1  
ATOM 27    N N    . MET A 1 2  ? 1.261   9.828   -4.358  1.00 0.00 ? 7   MET A N    1  
ATOM 28    C CA   . MET A 1 2  ? 1.232   8.651   -5.229  1.00 0.00 ? 7   MET A CA   1  
ATOM 29    C C    . MET A 1 2  ? 1.525   7.368   -4.445  1.00 0.00 ? 7   MET A C    1  
ATOM 30    O O    . MET A 1 2  ? 0.724   6.444   -4.467  1.00 0.00 ? 7   MET A O    1  
ATOM 31    C CB   . MET A 1 2  ? 2.212   8.820   -6.403  1.00 0.00 ? 7   MET A CB   1  
ATOM 32    C CG   . MET A 1 2  ? 3.663   9.041   -5.991  1.00 0.00 ? 7   MET A CG   1  
ATOM 33    S SD   . MET A 1 2  ? 4.710   9.547   -7.371  1.00 0.00 ? 7   MET A SD   1  
ATOM 34    C CE   . MET A 1 2  ? 4.470   8.187   -8.511  1.00 0.00 ? 7   MET A CE   1  
ATOM 35    H H    . MET A 1 2  ? 2.092   10.341  -4.275  1.00 0.00 ? 7   MET A H    1  
ATOM 36    H HA   . MET A 1 2  ? 0.231   8.577   -5.630  1.00 0.00 ? 7   MET A HA   1  
ATOM 37    H HB2  . MET A 1 2  ? 2.172   7.932   -7.015  1.00 0.00 ? 7   MET A HB2  1  
ATOM 38    H HB3  . MET A 1 2  ? 1.898   9.666   -6.996  1.00 0.00 ? 7   MET A HB3  1  
ATOM 39    H HG2  . MET A 1 2  ? 3.696   9.810   -5.235  1.00 0.00 ? 7   MET A HG2  1  
ATOM 40    H HG3  . MET A 1 2  ? 4.052   8.120   -5.583  1.00 0.00 ? 7   MET A HG3  1  
ATOM 41    H HE1  . MET A 1 2  ? 3.715   7.520   -8.123  1.00 0.00 ? 7   MET A HE1  1  
ATOM 42    H HE2  . MET A 1 2  ? 5.399   7.649   -8.630  1.00 0.00 ? 7   MET A HE2  1  
ATOM 43    H HE3  . MET A 1 2  ? 4.152   8.572   -9.469  1.00 0.00 ? 7   MET A HE3  1  
ATOM 44    N N    . ASN A 1 3  ? 2.663   7.344   -3.734  1.00 0.00 ? 8   ASN A N    1  
ATOM 45    C CA   . ASN A 1 3  ? 3.101   6.204   -2.901  1.00 0.00 ? 8   ASN A CA   1  
ATOM 46    C C    . ASN A 1 3  ? 2.062   5.065   -2.755  1.00 0.00 ? 8   ASN A C    1  
ATOM 47    O O    . ASN A 1 3  ? 1.984   4.187   -3.614  1.00 0.00 ? 8   ASN A O    1  
ATOM 48    C CB   . ASN A 1 3  ? 3.556   6.721   -1.522  1.00 0.00 ? 8   ASN A CB   1  
ATOM 49    C CG   . ASN A 1 3  ? 2.616   7.750   -0.881  1.00 0.00 ? 8   ASN A CG   1  
ATOM 50    O OD1  . ASN A 1 3  ? 2.979   8.383   0.109   1.00 0.00 ? 8   ASN A OD1  1  
ATOM 51    N ND2  . ASN A 1 3  ? 1.397   7.909   -1.410  1.00 0.00 ? 8   ASN A ND2  1  
ATOM 52    H H    . ASN A 1 3  ? 3.230   8.136   -3.748  1.00 0.00 ? 8   ASN A H    1  
ATOM 53    H HA   . ASN A 1 3  ? 3.966   5.785   -3.392  1.00 0.00 ? 8   ASN A HA   1  
ATOM 54    H HB2  . ASN A 1 3  ? 3.639   5.882   -0.848  1.00 0.00 ? 8   ASN A HB2  1  
ATOM 55    H HB3  . ASN A 1 3  ? 4.530   7.176   -1.630  1.00 0.00 ? 8   ASN A HB3  1  
ATOM 56    H HD21 . ASN A 1 3  ? 1.144   7.363   -2.184  1.00 0.00 ? 8   ASN A HD21 1  
ATOM 57    H HD22 . ASN A 1 3  ? 0.801   8.564   -0.997  1.00 0.00 ? 8   ASN A HD22 1  
ATOM 58    N N    . ILE A 1 4  ? 1.299   5.060   -1.652  1.00 0.00 ? 9   ILE A N    1  
ATOM 59    C CA   . ILE A 1 4  ? 0.304   4.013   -1.386  1.00 0.00 ? 9   ILE A CA   1  
ATOM 60    C C    . ILE A 1 4  ? -0.611  3.718   -2.562  1.00 0.00 ? 9   ILE A C    1  
ATOM 61    O O    . ILE A 1 4  ? -0.710  2.571   -2.994  1.00 0.00 ? 9   ILE A O    1  
ATOM 62    C CB   . ILE A 1 4  ? -0.602  4.333   -0.180  1.00 0.00 ? 9   ILE A CB   1  
ATOM 63    C CG1  . ILE A 1 4  ? -0.999  5.810   -0.127  1.00 0.00 ? 9   ILE A CG1  1  
ATOM 64    C CG2  . ILE A 1 4  ? 0.068   3.920   1.104   1.00 0.00 ? 9   ILE A CG2  1  
ATOM 65    C CD1  . ILE A 1 4  ? -2.190  6.060   0.763   1.00 0.00 ? 9   ILE A CD1  1  
ATOM 66    H H    . ILE A 1 4  ? 1.426   5.759   -0.989  1.00 0.00 ? 9   ILE A H    1  
ATOM 67    H HA   . ILE A 1 4  ? 0.848   3.110   -1.150  1.00 0.00 ? 9   ILE A HA   1  
ATOM 68    H HB   . ILE A 1 4  ? -1.499  3.740   -0.280  1.00 0.00 ? 9   ILE A HB   1  
ATOM 69    H HG12 . ILE A 1 4  ? -0.172  6.388   0.257   1.00 0.00 ? 9   ILE A HG12 1  
ATOM 70    H HG13 . ILE A 1 4  ? -1.245  6.156   -1.113  1.00 0.00 ? 9   ILE A HG13 1  
ATOM 71    H HG21 . ILE A 1 4  ? 0.018   4.735   1.814   1.00 0.00 ? 9   ILE A HG21 1  
ATOM 72    H HG22 . ILE A 1 4  ? 1.098   3.668   0.904   1.00 0.00 ? 9   ILE A HG22 1  
ATOM 73    H HG23 . ILE A 1 4  ? -0.444  3.059   1.499   1.00 0.00 ? 9   ILE A HG23 1  
ATOM 74    H HD11 . ILE A 1 4  ? -1.942  5.789   1.777   1.00 0.00 ? 9   ILE A HD11 1  
ATOM 75    H HD12 . ILE A 1 4  ? -3.023  5.459   0.426   1.00 0.00 ? 9   ILE A HD12 1  
ATOM 76    H HD13 . ILE A 1 4  ? -2.459  7.105   0.722   1.00 0.00 ? 9   ILE A HD13 1  
ATOM 77    N N    . GLN A 1 5  ? -1.306  4.739   -3.054  1.00 0.00 ? 10  GLN A N    1  
ATOM 78    C CA   . GLN A 1 5  ? -2.237  4.549   -4.152  1.00 0.00 ? 10  GLN A CA   1  
ATOM 79    C C    . GLN A 1 5  ? -1.515  3.985   -5.375  1.00 0.00 ? 10  GLN A C    1  
ATOM 80    O O    . GLN A 1 5  ? -2.059  3.163   -6.112  1.00 0.00 ? 10  GLN A O    1  
ATOM 81    C CB   . GLN A 1 5  ? -2.939  5.866   -4.500  1.00 0.00 ? 10  GLN A CB   1  
ATOM 82    C CG   . GLN A 1 5  ? -3.720  6.467   -3.338  1.00 0.00 ? 10  GLN A CG   1  
ATOM 83    C CD   . GLN A 1 5  ? -4.361  7.799   -3.686  1.00 0.00 ? 10  GLN A CD   1  
ATOM 84    O OE1  . GLN A 1 5  ? -3.674  8.754   -4.047  1.00 0.00 ? 10  GLN A OE1  1  
ATOM 85    N NE2  . GLN A 1 5  ? -5.683  7.872   -3.573  1.00 0.00 ? 10  GLN A NE2  1  
ATOM 86    H H    . GLN A 1 5  ? -1.206  5.626   -2.663  1.00 0.00 ? 10  GLN A H    1  
ATOM 87    H HA   . GLN A 1 5  ? -2.967  3.834   -3.809  1.00 0.00 ? 10  GLN A HA   1  
ATOM 88    H HB2  . GLN A 1 5  ? -2.196  6.584   -4.815  1.00 0.00 ? 10  GLN A HB2  1  
ATOM 89    H HB3  . GLN A 1 5  ? -3.626  5.691   -5.315  1.00 0.00 ? 10  GLN A HB3  1  
ATOM 90    H HG2  . GLN A 1 5  ? -4.498  5.776   -3.050  1.00 0.00 ? 10  GLN A HG2  1  
ATOM 91    H HG3  . GLN A 1 5  ? -3.046  6.615   -2.507  1.00 0.00 ? 10  GLN A HG3  1  
ATOM 92    H HE21 . GLN A 1 5  ? -6.169  7.074   -3.277  1.00 0.00 ? 10  GLN A HE21 1  
ATOM 93    H HE22 . GLN A 1 5  ? -6.119  8.722   -3.791  1.00 0.00 ? 10  GLN A HE22 1  
ATOM 94    N N    . MET A 1 6  ? -0.274  4.429   -5.554  1.00 0.00 ? 11  MET A N    1  
ATOM 95    C CA   . MET A 1 6  ? 0.579   3.987   -6.647  1.00 0.00 ? 11  MET A CA   1  
ATOM 96    C C    . MET A 1 6  ? 0.835   2.480   -6.548  1.00 0.00 ? 11  MET A C    1  
ATOM 97    O O    . MET A 1 6  ? 0.856   1.772   -7.556  1.00 0.00 ? 11  MET A O    1  
ATOM 98    C CB   . MET A 1 6  ? 1.906   4.758   -6.586  1.00 0.00 ? 11  MET A CB   1  
ATOM 99    C CG   . MET A 1 6  ? 2.887   4.388   -7.689  1.00 0.00 ? 11  MET A CG   1  
ATOM 100   S SD   . MET A 1 6  ? 4.492   5.190   -7.504  1.00 0.00 ? 11  MET A SD   1  
ATOM 101   C CE   . MET A 1 6  ? 5.104   4.404   -6.015  1.00 0.00 ? 11  MET A CE   1  
ATOM 102   H H    . MET A 1 6  ? 0.091   5.072   -4.910  1.00 0.00 ? 11  MET A H    1  
ATOM 103   H HA   . MET A 1 6  ? 0.080   4.205   -7.579  1.00 0.00 ? 11  MET A HA   1  
ATOM 104   H HB2  . MET A 1 6  ? 1.695   5.817   -6.657  1.00 0.00 ? 11  MET A HB2  1  
ATOM 105   H HB3  . MET A 1 6  ? 2.377   4.568   -5.632  1.00 0.00 ? 11  MET A HB3  1  
ATOM 106   H HG2  . MET A 1 6  ? 3.034   3.319   -7.675  1.00 0.00 ? 11  MET A HG2  1  
ATOM 107   H HG3  . MET A 1 6  ? 2.463   4.679   -8.639  1.00 0.00 ? 11  MET A HG3  1  
ATOM 108   H HE1  . MET A 1 6  ? 4.628   3.442   -5.894  1.00 0.00 ? 11  MET A HE1  1  
ATOM 109   H HE2  . MET A 1 6  ? 4.882   5.026   -5.161  1.00 0.00 ? 11  MET A HE2  1  
ATOM 110   H HE3  . MET A 1 6  ? 6.173   4.269   -6.095  1.00 0.00 ? 11  MET A HE3  1  
ATOM 111   N N    . LEU A 1 7  ? 1.022   2.007   -5.315  1.00 0.00 ? 12  LEU A N    1  
ATOM 112   C CA   . LEU A 1 7  ? 1.272   0.601   -5.037  1.00 0.00 ? 12  LEU A CA   1  
ATOM 113   C C    . LEU A 1 7  ? -0.034  -0.206  -5.022  1.00 0.00 ? 12  LEU A C    1  
ATOM 114   O O    . LEU A 1 7  ? -0.085  -1.311  -5.560  1.00 0.00 ? 12  LEU A O    1  
ATOM 115   C CB   . LEU A 1 7  ? 2.033   0.503   -3.713  1.00 0.00 ? 12  LEU A CB   1  
ATOM 116   C CG   . LEU A 1 7  ? 1.882   -0.796  -2.929  1.00 0.00 ? 12  LEU A CG   1  
ATOM 117   C CD1  . LEU A 1 7  ? 2.707   -1.899  -3.561  1.00 0.00 ? 12  LEU A CD1  1  
ATOM 118   C CD2  . LEU A 1 7  ? 2.288   -0.592  -1.477  1.00 0.00 ? 12  LEU A CD2  1  
ATOM 119   H H    . LEU A 1 7  ? 0.987   2.629   -4.559  1.00 0.00 ? 12  LEU A H    1  
ATOM 120   H HA   . LEU A 1 7  ? 1.901   0.219   -5.827  1.00 0.00 ? 12  LEU A HA   1  
ATOM 121   H HB2  . LEU A 1 7  ? 3.080   0.630   -3.941  1.00 0.00 ? 12  LEU A HB2  1  
ATOM 122   H HB3  . LEU A 1 7  ? 1.719   1.319   -3.083  1.00 0.00 ? 12  LEU A HB3  1  
ATOM 123   H HG   . LEU A 1 7  ? 0.846   -1.094  -2.949  1.00 0.00 ? 12  LEU A HG   1  
ATOM 124   H HD11 . LEU A 1 7  ? 2.546   -2.819  -3.021  1.00 0.00 ? 12  LEU A HD11 1  
ATOM 125   H HD12 . LEU A 1 7  ? 3.754   -1.636  -3.520  1.00 0.00 ? 12  LEU A HD12 1  
ATOM 126   H HD13 . LEU A 1 7  ? 2.407   -2.027  -4.590  1.00 0.00 ? 12  LEU A HD13 1  
ATOM 127   H HD21 . LEU A 1 7  ? 1.974   -1.444  -0.892  1.00 0.00 ? 12  LEU A HD21 1  
ATOM 128   H HD22 . LEU A 1 7  ? 1.818   0.301   -1.093  1.00 0.00 ? 12  LEU A HD22 1  
ATOM 129   H HD23 . LEU A 1 7  ? 3.362   -0.489  -1.414  1.00 0.00 ? 12  LEU A HD23 1  
ATOM 130   N N    . LEU A 1 8  ? -1.092  0.357   -4.427  1.00 0.00 ? 13  LEU A N    1  
ATOM 131   C CA   . LEU A 1 8  ? -2.403  -0.312  -4.381  1.00 0.00 ? 13  LEU A CA   1  
ATOM 132   C C    . LEU A 1 8  ? -2.886  -0.657  -5.786  1.00 0.00 ? 13  LEU A C    1  
ATOM 133   O O    . LEU A 1 8  ? -3.210  -1.812  -6.068  1.00 0.00 ? 13  LEU A O    1  
ATOM 134   C CB   . LEU A 1 8  ? -3.440  0.593   -3.710  1.00 0.00 ? 13  LEU A CB   1  
ATOM 135   C CG   . LEU A 1 8  ? -3.304  0.746   -2.200  1.00 0.00 ? 13  LEU A CG   1  
ATOM 136   C CD1  . LEU A 1 8  ? -4.043  1.988   -1.720  1.00 0.00 ? 13  LEU A CD1  1  
ATOM 137   C CD2  . LEU A 1 8  ? -3.842  -0.494  -1.506  1.00 0.00 ? 13  LEU A CD2  1  
ATOM 138   H H    . LEU A 1 8  ? -0.996  1.250   -4.018  1.00 0.00 ? 13  LEU A H    1  
ATOM 139   H HA   . LEU A 1 8  ? -2.296  -1.235  -3.815  1.00 0.00 ? 13  LEU A HA   1  
ATOM 140   H HB2  . LEU A 1 8  ? -3.368  1.575   -4.156  1.00 0.00 ? 13  LEU A HB2  1  
ATOM 141   H HB3  . LEU A 1 8  ? -4.422  0.195   -3.920  1.00 0.00 ? 13  LEU A HB3  1  
ATOM 142   H HG   . LEU A 1 8  ? -2.262  0.854   -1.944  1.00 0.00 ? 13  LEU A HG   1  
ATOM 143   H HD11 . LEU A 1 8  ? -3.425  2.523   -1.014  1.00 0.00 ? 13  LEU A HD11 1  
ATOM 144   H HD12 . LEU A 1 8  ? -4.965  1.697   -1.243  1.00 0.00 ? 13  LEU A HD12 1  
ATOM 145   H HD13 . LEU A 1 8  ? -4.259  2.627   -2.563  1.00 0.00 ? 13  LEU A HD13 1  
ATOM 146   H HD21 . LEU A 1 8  ? -3.290  -0.669  -0.596  1.00 0.00 ? 13  LEU A HD21 1  
ATOM 147   H HD22 . LEU A 1 8  ? -3.735  -1.346  -2.159  1.00 0.00 ? 13  LEU A HD22 1  
ATOM 148   H HD23 . LEU A 1 8  ? -4.884  -0.351  -1.271  1.00 0.00 ? 13  LEU A HD23 1  
ATOM 149   N N    . GLU A 1 9  ? -2.924  0.352   -6.664  1.00 0.00 ? 14  GLU A N    1  
ATOM 150   C CA   . GLU A 1 9  ? -3.355  0.155   -8.049  1.00 0.00 ? 14  GLU A CA   1  
ATOM 151   C C    . GLU A 1 9  ? -2.638  -1.043  -8.666  1.00 0.00 ? 14  GLU A C    1  
ATOM 152   O O    . GLU A 1 9  ? -3.204  -1.752  -9.501  1.00 0.00 ? 14  GLU A O    1  
ATOM 153   C CB   . GLU A 1 9  ? -3.090  1.413   -8.880  1.00 0.00 ? 14  GLU A CB   1  
ATOM 154   C CG   . GLU A 1 9  ? -3.981  2.589   -8.506  1.00 0.00 ? 14  GLU A CG   1  
ATOM 155   C CD   . GLU A 1 9  ? -3.611  3.862   -9.244  1.00 0.00 ? 14  GLU A CD   1  
ATOM 156   O OE1  . GLU A 1 9  ? -2.483  4.361   -9.041  1.00 0.00 ? 14  GLU A OE1  1  
ATOM 157   O OE2  . GLU A 1 9  ? -4.448  4.360   -10.026 1.00 0.00 ? 14  GLU A OE2  1  
ATOM 158   H H    . GLU A 1 9  ? -2.646  1.247   -6.374  1.00 0.00 ? 14  GLU A H    1  
ATOM 159   H HA   . GLU A 1 9  ? -4.417  -0.044  -8.039  1.00 0.00 ? 14  GLU A HA   1  
ATOM 160   H HB2  . GLU A 1 9  ? -2.061  1.712   -8.742  1.00 0.00 ? 14  GLU A HB2  1  
ATOM 161   H HB3  . GLU A 1 9  ? -3.253  1.183   -9.922  1.00 0.00 ? 14  GLU A HB3  1  
ATOM 162   H HG2  . GLU A 1 9  ? -5.004  2.338   -8.745  1.00 0.00 ? 14  GLU A HG2  1  
ATOM 163   H HG3  . GLU A 1 9  ? -3.895  2.767   -7.445  1.00 0.00 ? 14  GLU A HG3  1  
ATOM 164   N N    . ALA A 1 10 ? -1.395  -1.274  -8.228  1.00 0.00 ? 15  ALA A N    1  
ATOM 165   C CA   . ALA A 1 10 ? -0.602  -2.398  -8.709  1.00 0.00 ? 15  ALA A CA   1  
ATOM 166   C C    . ALA A 1 10 ? -1.369  -3.697  -8.562  1.00 0.00 ? 15  ALA A C    1  
ATOM 167   O O    . ALA A 1 10 ? -1.586  -4.404  -9.541  1.00 0.00 ? 15  ALA A O    1  
ATOM 168   C CB   . ALA A 1 10 ? 0.704   -2.501  -7.944  1.00 0.00 ? 15  ALA A CB   1  
ATOM 169   H H    . ALA A 1 10 ? -1.010  -0.680  -7.551  1.00 0.00 ? 15  ALA A H    1  
ATOM 170   H HA   . ALA A 1 10 ? -0.375  -2.233  -9.752  1.00 0.00 ? 15  ALA A HA   1  
ATOM 171   H HB1  . ALA A 1 10 ? 1.453   -2.952  -8.575  1.00 0.00 ? 15  ALA A HB1  1  
ATOM 172   H HB2  . ALA A 1 10 ? 0.558   -3.113  -7.066  1.00 0.00 ? 15  ALA A HB2  1  
ATOM 173   H HB3  . ALA A 1 10 ? 1.027   -1.516  -7.645  1.00 0.00 ? 15  ALA A HB3  1  
ATOM 174   N N    . ALA A 1 11 ? -1.772  -4.005  -7.325  1.00 0.00 ? 16  ALA A N    1  
ATOM 175   C CA   . ALA A 1 11 ? -2.510  -5.227  -7.040  1.00 0.00 ? 16  ALA A CA   1  
ATOM 176   C C    . ALA A 1 11 ? -3.607  -5.468  -8.068  1.00 0.00 ? 16  ALA A C    1  
ATOM 177   O O    . ALA A 1 11 ? -3.635  -6.511  -8.712  1.00 0.00 ? 16  ALA A O    1  
ATOM 178   C CB   . ALA A 1 11 ? -3.117  -5.192  -5.650  1.00 0.00 ? 16  ALA A CB   1  
ATOM 179   H H    . ALA A 1 11 ? -1.560  -3.394  -6.587  1.00 0.00 ? 16  ALA A H    1  
ATOM 180   H HA   . ALA A 1 11 ? -1.804  -6.043  -7.075  1.00 0.00 ? 16  ALA A HA   1  
ATOM 181   H HB1  . ALA A 1 11 ? -3.428  -4.184  -5.414  1.00 0.00 ? 16  ALA A HB1  1  
ATOM 182   H HB2  . ALA A 1 11 ? -2.387  -5.525  -4.930  1.00 0.00 ? 16  ALA A HB2  1  
ATOM 183   H HB3  . ALA A 1 11 ? -3.975  -5.851  -5.629  1.00 0.00 ? 16  ALA A HB3  1  
ATOM 184   N N    . ASP A 1 12 ? -4.503  -4.489  -8.221  1.00 0.00 ? 17  ASP A N    1  
ATOM 185   C CA   . ASP A 1 12 ? -5.604  -4.589  -9.182  1.00 0.00 ? 17  ASP A CA   1  
ATOM 186   C C    . ASP A 1 12 ? -5.094  -5.030  -10.554 1.00 0.00 ? 17  ASP A C    1  
ATOM 187   O O    . ASP A 1 12 ? -5.782  -5.750  -11.278 1.00 0.00 ? 17  ASP A O    1  
ATOM 188   C CB   . ASP A 1 12 ? -6.335  -3.246  -9.307  1.00 0.00 ? 17  ASP A CB   1  
ATOM 189   C CG   . ASP A 1 12 ? -6.960  -2.791  -7.999  1.00 0.00 ? 17  ASP A CG   1  
ATOM 190   O OD1  . ASP A 1 12 ? -6.206  -2.524  -7.038  1.00 0.00 ? 17  ASP A OD1  1  
ATOM 191   O OD2  . ASP A 1 12 ? -8.204  -2.703  -7.937  1.00 0.00 ? 17  ASP A OD2  1  
ATOM 192   H H    . ASP A 1 12 ? -4.418  -3.676  -7.678  1.00 0.00 ? 17  ASP A H    1  
ATOM 193   H HA   . ASP A 1 12 ? -6.296  -5.331  -8.815  1.00 0.00 ? 17  ASP A HA   1  
ATOM 194   H HB2  . ASP A 1 12 ? -5.634  -2.491  -9.629  1.00 0.00 ? 17  ASP A HB2  1  
ATOM 195   H HB3  . ASP A 1 12 ? -7.118  -3.340  -10.046 1.00 0.00 ? 17  ASP A HB3  1  
ATOM 196   N N    . TYR A 1 13 ? -3.881  -4.596  -10.897 1.00 0.00 ? 18  TYR A N    1  
ATOM 197   C CA   . TYR A 1 13 ? -3.265  -4.943  -12.172 1.00 0.00 ? 18  TYR A CA   1  
ATOM 198   C C    . TYR A 1 13 ? -2.653  -6.340  -12.127 1.00 0.00 ? 18  TYR A C    1  
ATOM 199   O O    . TYR A 1 13 ? -2.913  -7.159  -13.011 1.00 0.00 ? 18  TYR A O    1  
ATOM 200   C CB   . TYR A 1 13 ? -2.209  -3.890  -12.544 1.00 0.00 ? 18  TYR A CB   1  
ATOM 201   C CG   . TYR A 1 13 ? -1.495  -4.136  -13.859 1.00 0.00 ? 18  TYR A CG   1  
ATOM 202   C CD1  . TYR A 1 13 ? -0.631  -5.213  -14.020 1.00 0.00 ? 18  TYR A CD1  1  
ATOM 203   C CD2  . TYR A 1 13 ? -1.682  -3.280  -14.938 1.00 0.00 ? 18  TYR A CD2  1  
ATOM 204   C CE1  . TYR A 1 13 ? 0.026   -5.429  -15.217 1.00 0.00 ? 18  TYR A CE1  1  
ATOM 205   C CE2  . TYR A 1 13 ? -1.031  -3.491  -16.138 1.00 0.00 ? 18  TYR A CE2  1  
ATOM 206   C CZ   . TYR A 1 13 ? -0.178  -4.566  -16.272 1.00 0.00 ? 18  TYR A CZ   1  
ATOM 207   O OH   . TYR A 1 13 ? 0.476   -4.778  -17.465 1.00 0.00 ? 18  TYR A OH   1  
ATOM 208   H H    . TYR A 1 13 ? -3.384  -4.028  -10.272 1.00 0.00 ? 18  TYR A H    1  
ATOM 209   H HA   . TYR A 1 13 ? -4.041  -4.944  -12.912 1.00 0.00 ? 18  TYR A HA   1  
ATOM 210   H HB2  . TYR A 1 13 ? -2.687  -2.925  -12.609 1.00 0.00 ? 18  TYR A HB2  1  
ATOM 211   H HB3  . TYR A 1 13 ? -1.461  -3.858  -11.765 1.00 0.00 ? 18  TYR A HB3  1  
ATOM 212   H HD1  . TYR A 1 13 ? -0.473  -5.888  -13.192 1.00 0.00 ? 18  TYR A HD1  1  
ATOM 213   H HD2  . TYR A 1 13 ? -2.350  -2.439  -14.831 1.00 0.00 ? 18  TYR A HD2  1  
ATOM 214   H HE1  . TYR A 1 13 ? 0.694   -6.271  -15.321 1.00 0.00 ? 18  TYR A HE1  1  
ATOM 215   H HE2  . TYR A 1 13 ? -1.190  -2.815  -16.965 1.00 0.00 ? 18  TYR A HE2  1  
ATOM 216   H HH   . TYR A 1 13 ? -0.166  -4.928  -18.163 1.00 0.00 ? 18  TYR A HH   1  
ATOM 217   N N    . LEU A 1 14 ? -1.852  -6.617  -11.098 1.00 0.00 ? 19  LEU A N    1  
ATOM 218   C CA   . LEU A 1 14 ? -1.228  -7.935  -10.966 1.00 0.00 ? 19  LEU A CA   1  
ATOM 219   C C    . LEU A 1 14 ? -2.294  -9.012  -10.756 1.00 0.00 ? 19  LEU A C    1  
ATOM 220   O O    . LEU A 1 14 ? -2.089  -10.170 -11.124 1.00 0.00 ? 19  LEU A O    1  
ATOM 221   C CB   . LEU A 1 14 ? -0.226  -8.001  -9.801  1.00 0.00 ? 19  LEU A CB   1  
ATOM 222   C CG   . LEU A 1 14 ? 0.243   -6.673  -9.202  1.00 0.00 ? 19  LEU A CG   1  
ATOM 223   C CD1  . LEU A 1 14 ? 1.132   -6.944  -8.006  1.00 0.00 ? 19  LEU A CD1  1  
ATOM 224   C CD2  . LEU A 1 14 ? 0.982   -5.817  -10.228 1.00 0.00 ? 19  LEU A CD2  1  
ATOM 225   H H    . LEU A 1 14 ? -1.686  -5.930  -10.418 1.00 0.00 ? 19  LEU A H    1  
ATOM 226   H HA   . LEU A 1 14 ? -0.706  -8.143  -11.888 1.00 0.00 ? 19  LEU A HA   1  
ATOM 227   H HB2  . LEU A 1 14 ? -0.678  -8.579  -9.008  1.00 0.00 ? 19  LEU A HB2  1  
ATOM 228   H HB3  . LEU A 1 14 ? 0.647   -8.535  -10.148 1.00 0.00 ? 19  LEU A HB3  1  
ATOM 229   H HG   . LEU A 1 14 ? -0.616  -6.120  -8.854  1.00 0.00 ? 19  LEU A HG   1  
ATOM 230   H HD11 . LEU A 1 14 ? 1.671   -7.866  -8.159  1.00 0.00 ? 19  LEU A HD11 1  
ATOM 231   H HD12 . LEU A 1 14 ? 0.524   -7.026  -7.113  1.00 0.00 ? 19  LEU A HD12 1  
ATOM 232   H HD13 . LEU A 1 14 ? 1.833   -6.131  -7.895  1.00 0.00 ? 19  LEU A HD13 1  
ATOM 233   H HD21 . LEU A 1 14 ? 2.047   -5.893  -10.059 1.00 0.00 ? 19  LEU A HD21 1  
ATOM 234   H HD22 . LEU A 1 14 ? 0.678   -4.783  -10.123 1.00 0.00 ? 19  LEU A HD22 1  
ATOM 235   H HD23 . LEU A 1 14 ? 0.750   -6.163  -11.224 1.00 0.00 ? 19  LEU A HD23 1  
ATOM 236   N N    . GLU A 1 15 ? -3.431  -8.626  -10.155 1.00 0.00 ? 20  GLU A N    1  
ATOM 237   C CA   . GLU A 1 15 ? -4.522  -9.571  -9.894  1.00 0.00 ? 20  GLU A CA   1  
ATOM 238   C C    . GLU A 1 15 ? -4.931  -10.327 -11.159 1.00 0.00 ? 20  GLU A C    1  
ATOM 239   O O    . GLU A 1 15 ? -5.079  -11.550 -11.133 1.00 0.00 ? 20  GLU A O    1  
ATOM 240   C CB   . GLU A 1 15 ? -5.733  -8.851  -9.292  1.00 0.00 ? 20  GLU A CB   1  
ATOM 241   C CG   . GLU A 1 15 ? -5.577  -8.537  -7.810  1.00 0.00 ? 20  GLU A CG   1  
ATOM 242   C CD   . GLU A 1 15 ? -6.711  -7.689  -7.264  1.00 0.00 ? 20  GLU A CD   1  
ATOM 243   O OE1  . GLU A 1 15 ? -7.875  -8.138  -7.325  1.00 0.00 ? 20  GLU A OE1  1  
ATOM 244   O OE2  . GLU A 1 15 ? -6.432  -6.576  -6.769  1.00 0.00 ? 20  GLU A OE2  1  
ATOM 245   H H    . GLU A 1 15 ? -3.536  -7.678  -9.875  1.00 0.00 ? 20  GLU A H    1  
ATOM 246   H HA   . GLU A 1 15 ? -4.160  -10.289 -9.176  1.00 0.00 ? 20  GLU A HA   1  
ATOM 247   H HB2  . GLU A 1 15 ? -5.886  -7.923  -9.822  1.00 0.00 ? 20  GLU A HB2  1  
ATOM 248   H HB3  . GLU A 1 15 ? -6.606  -9.475  -9.416  1.00 0.00 ? 20  GLU A HB3  1  
ATOM 249   H HG2  . GLU A 1 15 ? -5.552  -9.466  -7.261  1.00 0.00 ? 20  GLU A HG2  1  
ATOM 250   H HG3  . GLU A 1 15 ? -4.648  -8.011  -7.661  1.00 0.00 ? 20  GLU A HG3  1  
ATOM 251   N N    . ARG A 1 16 ? -5.103  -9.600  -12.263 1.00 0.00 ? 21  ARG A N    1  
ATOM 252   C CA   . ARG A 1 16 ? -5.484  -10.217 -13.534 1.00 0.00 ? 21  ARG A CA   1  
ATOM 253   C C    . ARG A 1 16 ? -4.317  -11.005 -14.130 1.00 0.00 ? 21  ARG A C    1  
ATOM 254   O O    . ARG A 1 16 ? -4.556  -12.124 -14.631 1.00 0.00 ? 21  ARG A O    1  
ATOM 255   C CB   . ARG A 1 16 ? -5.968  -9.161  -14.537 1.00 0.00 ? 21  ARG A CB   1  
ATOM 256   C CG   . ARG A 1 16 ? -7.319  -8.544  -14.193 1.00 0.00 ? 21  ARG A CG   1  
ATOM 257   C CD   . ARG A 1 16 ? -7.269  -7.749  -12.897 1.00 0.00 ? 21  ARG A CD   1  
ATOM 258   N NE   . ARG A 1 16 ? -8.546  -7.102  -12.592 1.00 0.00 ? 21  ARG A NE   1  
ATOM 259   C CZ   . ARG A 1 16 ? -9.658  -7.756  -12.238 1.00 0.00 ? 21  ARG A CZ   1  
ATOM 260   N NH1  . ARG A 1 16 ? -9.651  -9.079  -12.097 1.00 0.00 ? 21  ARG A NH1  1  
ATOM 261   N NH2  . ARG A 1 16 ? -10.777 -7.079  -12.011 1.00 0.00 ? 21  ARG A NH2  1  
ATOM 262   O OXT  . ARG A 1 16 ? -3.174  -10.497 -14.092 1.00 0.00 ? 21  ARG A OXT  1  
ATOM 263   H H    . ARG A 1 16 ? -4.961  -8.630  -12.225 1.00 0.00 ? 21  ARG A H    1  
ATOM 264   H HA   . ARG A 1 16 ? -6.293  -10.903 -13.333 1.00 0.00 ? 21  ARG A HA   1  
ATOM 265   H HB2  . ARG A 1 16 ? -5.237  -8.367  -14.583 1.00 0.00 ? 21  ARG A HB2  1  
ATOM 266   H HB3  . ARG A 1 16 ? -6.046  -9.621  -15.512 1.00 0.00 ? 21  ARG A HB3  1  
ATOM 267   H HG2  . ARG A 1 16 ? -7.613  -7.884  -14.995 1.00 0.00 ? 21  ARG A HG2  1  
ATOM 268   H HG3  . ARG A 1 16 ? -8.047  -9.335  -14.093 1.00 0.00 ? 21  ARG A HG3  1  
ATOM 269   H HD2  . ARG A 1 16 ? -7.018  -8.418  -12.088 1.00 0.00 ? 21  ARG A HD2  1  
ATOM 270   H HD3  . ARG A 1 16 ? -6.505  -6.991  -12.986 1.00 0.00 ? 21  ARG A HD3  1  
ATOM 271   H HE   . ARG A 1 16 ? -8.582  -6.125  -12.665 1.00 0.00 ? 21  ARG A HE   1  
ATOM 272   H HH11 . ARG A 1 16 ? -8.811  -9.598  -12.254 1.00 0.00 ? 21  ARG A HH11 1  
ATOM 273   H HH12 . ARG A 1 16 ? -10.489 -9.557  -11.832 1.00 0.00 ? 21  ARG A HH12 1  
ATOM 274   H HH21 . ARG A 1 16 ? -10.788 -6.083  -12.104 1.00 0.00 ? 21  ARG A HH21 1  
ATOM 275   H HH22 . ARG A 1 16 ? -11.611 -7.564  -11.746 1.00 0.00 ? 21  ARG A HH22 1  
ATOM 276   N N    . SER B 2 1  ? -3.549  11.131  -15.243 1.00 0.00 ? 295 SER B N    1  
ATOM 277   C CA   . SER B 2 1  ? -2.960  11.030  -16.608 1.00 0.00 ? 295 SER B CA   1  
ATOM 278   C C    . SER B 2 1  ? -2.153  12.282  -16.964 1.00 0.00 ? 295 SER B C    1  
ATOM 279   O O    . SER B 2 1  ? -2.514  13.034  -17.873 1.00 0.00 ? 295 SER B O    1  
ATOM 280   C CB   . SER B 2 1  ? -4.095  10.807  -17.617 1.00 0.00 ? 295 SER B CB   1  
ATOM 281   O OG   . SER B 2 1  ? -5.071  11.833  -17.531 1.00 0.00 ? 295 SER B OG   1  
ATOM 282   H H1   . SER B 2 1  ? -4.351  11.791  -15.290 1.00 0.00 ? 295 SER B H1   1  
ATOM 283   H H2   . SER B 2 1  ? -2.808  11.484  -14.602 1.00 0.00 ? 295 SER B H2   1  
ATOM 284   H H3   . SER B 2 1  ? -3.864  10.181  -14.963 1.00 0.00 ? 295 SER B H3   1  
ATOM 285   H HA   . SER B 2 1  ? -2.299  10.175  -16.629 1.00 0.00 ? 295 SER B HA   1  
ATOM 286   H HB2  . SER B 2 1  ? -3.688  10.800  -18.617 1.00 0.00 ? 295 SER B HB2  1  
ATOM 287   H HB3  . SER B 2 1  ? -4.570  9.858   -17.417 1.00 0.00 ? 295 SER B HB3  1  
ATOM 288   H HG   . SER B 2 1  ? -4.696  12.662  -17.840 1.00 0.00 ? 295 SER B HG   1  
ATOM 289   N N    . LEU B 2 2  ? -1.053  12.493  -16.241 1.00 0.00 ? 296 LEU B N    1  
ATOM 290   C CA   . LEU B 2 2  ? -0.181  13.644  -16.471 1.00 0.00 ? 296 LEU B CA   1  
ATOM 291   C C    . LEU B 2 2  ? 1.202   13.187  -16.938 1.00 0.00 ? 296 LEU B C    1  
ATOM 292   O O    . LEU B 2 2  ? 1.422   11.998  -17.176 1.00 0.00 ? 296 LEU B O    1  
ATOM 293   C CB   . LEU B 2 2  ? -0.058  14.480  -15.190 1.00 0.00 ? 296 LEU B CB   1  
ATOM 294   C CG   . LEU B 2 2  ? -1.371  15.069  -14.665 1.00 0.00 ? 296 LEU B CG   1  
ATOM 295   C CD1  . LEU B 2 2  ? -1.128  15.861  -13.387 1.00 0.00 ? 296 LEU B CD1  1  
ATOM 296   C CD2  . LEU B 2 2  ? -2.026  15.948  -15.723 1.00 0.00 ? 296 LEU B CD2  1  
ATOM 297   H H    . LEU B 2 2  ? -0.818  11.854  -15.534 1.00 0.00 ? 296 LEU B H    1  
ATOM 298   H HA   . LEU B 2 2  ? -0.627  14.250  -17.245 1.00 0.00 ? 296 LEU B HA   1  
ATOM 299   H HB2  . LEU B 2 2  ? 0.365   13.854  -14.418 1.00 0.00 ? 296 LEU B HB2  1  
ATOM 300   H HB3  . LEU B 2 2  ? 0.623   15.295  -15.381 1.00 0.00 ? 296 LEU B HB3  1  
ATOM 301   H HG   . LEU B 2 2  ? -2.052  14.263  -14.431 1.00 0.00 ? 296 LEU B HG   1  
ATOM 302   H HD11 . LEU B 2 2  ? -1.607  15.361  -12.558 1.00 0.00 ? 296 LEU B HD11 1  
ATOM 303   H HD12 . LEU B 2 2  ? -1.538  16.854  -13.494 1.00 0.00 ? 296 LEU B HD12 1  
ATOM 304   H HD13 . LEU B 2 2  ? -0.066  15.929  -13.202 1.00 0.00 ? 296 LEU B HD13 1  
ATOM 305   H HD21 . LEU B 2 2  ? -2.727  15.359  -16.296 1.00 0.00 ? 296 LEU B HD21 1  
ATOM 306   H HD22 . LEU B 2 2  ? -1.268  16.346  -16.381 1.00 0.00 ? 296 LEU B HD22 1  
ATOM 307   H HD23 . LEU B 2 2  ? -2.549  16.762  -15.242 1.00 0.00 ? 296 LEU B HD23 1  
ATOM 308   N N    . GLN B 2 3  ? 2.133   14.134  -17.068 1.00 0.00 ? 297 GLN B N    1  
ATOM 309   C CA   . GLN B 2 3  ? 3.491   13.815  -17.504 1.00 0.00 ? 297 GLN B CA   1  
ATOM 310   C C    . GLN B 2 3  ? 4.283   13.155  -16.376 1.00 0.00 ? 297 GLN B C    1  
ATOM 311   O O    . GLN B 2 3  ? 4.893   13.837  -15.549 1.00 0.00 ? 297 GLN B O    1  
ATOM 312   C CB   . GLN B 2 3  ? 4.218   15.074  -17.989 1.00 0.00 ? 297 GLN B CB   1  
ATOM 313   C CG   . GLN B 2 3  ? 3.574   15.723  -19.207 1.00 0.00 ? 297 GLN B CG   1  
ATOM 314   C CD   . GLN B 2 3  ? 4.333   16.938  -19.734 1.00 0.00 ? 297 GLN B CD   1  
ATOM 315   O OE1  . GLN B 2 3  ? 3.902   17.567  -20.700 1.00 0.00 ? 297 GLN B OE1  1  
ATOM 316   N NE2  . GLN B 2 3  ? 5.467   17.280  -19.118 1.00 0.00 ? 297 GLN B NE2  1  
ATOM 317   H H    . GLN B 2 3  ? 1.903   15.065  -16.866 1.00 0.00 ? 297 GLN B H    1  
ATOM 318   H HA   . GLN B 2 3  ? 3.416   13.117  -18.325 1.00 0.00 ? 297 GLN B HA   1  
ATOM 319   H HB2  . GLN B 2 3  ? 4.232   15.798  -17.188 1.00 0.00 ? 297 GLN B HB2  1  
ATOM 320   H HB3  . GLN B 2 3  ? 5.234   14.811  -18.243 1.00 0.00 ? 297 GLN B HB3  1  
ATOM 321   H HG2  . GLN B 2 3  ? 3.518   14.990  -19.997 1.00 0.00 ? 297 GLN B HG2  1  
ATOM 322   H HG3  . GLN B 2 3  ? 2.574   16.034  -18.941 1.00 0.00 ? 297 GLN B HG3  1  
ATOM 323   H HE21 . GLN B 2 3  ? 5.767   16.744  -18.356 1.00 0.00 ? 297 GLN B HE21 1  
ATOM 324   H HE22 . GLN B 2 3  ? 5.956   18.059  -19.455 1.00 0.00 ? 297 GLN B HE22 1  
ATOM 325   N N    . ASN B 2 4  ? 4.271   11.822  -16.352 1.00 0.00 ? 298 ASN B N    1  
ATOM 326   C CA   . ASN B 2 4  ? 4.992   11.065  -15.331 1.00 0.00 ? 298 ASN B CA   1  
ATOM 327   C C    . ASN B 2 4  ? 6.462   10.901  -15.716 1.00 0.00 ? 298 ASN B C    1  
ATOM 328   O O    . ASN B 2 4  ? 6.856   11.208  -16.843 1.00 0.00 ? 298 ASN B O    1  
ATOM 329   C CB   . ASN B 2 4  ? 4.347   9.689   -15.121 1.00 0.00 ? 298 ASN B CB   1  
ATOM 330   C CG   . ASN B 2 4  ? 2.959   9.777   -14.511 1.00 0.00 ? 298 ASN B CG   1  
ATOM 331   O OD1  . ASN B 2 4  ? 2.048   10.365  -15.093 1.00 0.00 ? 298 ASN B OD1  1  
ATOM 332   N ND2  . ASN B 2 4  ? 2.788   9.191   -13.331 1.00 0.00 ? 298 ASN B ND2  1  
ATOM 333   H H    . ASN B 2 4  ? 3.769   11.336  -17.040 1.00 0.00 ? 298 ASN B H    1  
ATOM 334   H HA   . ASN B 2 4  ? 4.937   11.622  -14.407 1.00 0.00 ? 298 ASN B HA   1  
ATOM 335   H HB2  . ASN B 2 4  ? 4.269   9.187   -16.074 1.00 0.00 ? 298 ASN B HB2  1  
ATOM 336   H HB3  . ASN B 2 4  ? 4.973   9.103   -14.463 1.00 0.00 ? 298 ASN B HB3  1  
ATOM 337   H HD21 . ASN B 2 4  ? 3.556   8.739   -12.921 1.00 0.00 ? 298 ASN B HD21 1  
ATOM 338   H HD22 . ASN B 2 4  ? 1.901   9.234   -12.917 1.00 0.00 ? 298 ASN B HD22 1  
ATOM 339   N N    . ASN B 2 5  ? 7.268   10.418  -14.773 1.00 0.00 ? 299 ASN B N    1  
ATOM 340   C CA   . ASN B 2 5  ? 8.695   10.216  -15.014 1.00 0.00 ? 299 ASN B CA   1  
ATOM 341   C C    . ASN B 2 5  ? 9.271   9.171   -14.062 1.00 0.00 ? 299 ASN B C    1  
ATOM 342   O O    . ASN B 2 5  ? 8.840   9.060   -12.913 1.00 0.00 ? 299 ASN B O    1  
ATOM 343   C CB   . ASN B 2 5  ? 9.453   11.542  -14.868 1.00 0.00 ? 299 ASN B CB   1  
ATOM 344   C CG   . ASN B 2 5  ? 9.293   12.169  -13.492 1.00 0.00 ? 299 ASN B CG   1  
ATOM 345   O OD1  . ASN B 2 5  ? 9.752   11.622  -12.490 1.00 0.00 ? 299 ASN B OD1  1  
ATOM 346   N ND2  . ASN B 2 5  ? 8.633   13.322  -13.437 1.00 0.00 ? 299 ASN B ND2  1  
ATOM 347   H H    . ASN B 2 5  ? 6.896   10.193  -13.894 1.00 0.00 ? 299 ASN B H    1  
ATOM 348   H HA   . ASN B 2 5  ? 8.809   9.860   -16.027 1.00 0.00 ? 299 ASN B HA   1  
ATOM 349   H HB2  . ASN B 2 5  ? 10.505  11.367  -15.040 1.00 0.00 ? 299 ASN B HB2  1  
ATOM 350   H HB3  . ASN B 2 5  ? 9.086   12.240  -15.607 1.00 0.00 ? 299 ASN B HB3  1  
ATOM 351   H HD21 . ASN B 2 5  ? 8.290   13.701  -14.273 1.00 0.00 ? 299 ASN B HD21 1  
ATOM 352   H HD22 . ASN B 2 5  ? 8.517   13.745  -12.561 1.00 0.00 ? 299 ASN B HD22 1  
ATOM 353   N N    . GLN B 2 6  ? 10.246  8.405   -14.557 1.00 0.00 ? 300 GLN B N    1  
ATOM 354   C CA   . GLN B 2 6  ? 10.893  7.360   -13.766 1.00 0.00 ? 300 GLN B CA   1  
ATOM 355   C C    . GLN B 2 6  ? 9.869   6.350   -13.242 1.00 0.00 ? 300 GLN B C    1  
ATOM 356   O O    . GLN B 2 6  ? 9.382   6.471   -12.115 1.00 0.00 ? 300 GLN B O    1  
ATOM 357   C CB   . GLN B 2 6  ? 11.681  7.973   -12.602 1.00 0.00 ? 300 GLN B CB   1  
ATOM 358   C CG   . GLN B 2 6  ? 12.817  8.882   -13.046 1.00 0.00 ? 300 GLN B CG   1  
ATOM 359   C CD   . GLN B 2 6  ? 13.850  8.159   -13.893 1.00 0.00 ? 300 GLN B CD   1  
ATOM 360   O OE1  . GLN B 2 6  ? 14.492  7.214   -13.435 1.00 0.00 ? 300 GLN B OE1  1  
ATOM 361   N NE2  . GLN B 2 6  ? 14.012  8.597   -15.137 1.00 0.00 ? 300 GLN B NE2  1  
ATOM 362   H H    . GLN B 2 6  ? 10.537  8.547   -15.482 1.00 0.00 ? 300 GLN B H    1  
ATOM 363   H HA   . GLN B 2 6  ? 11.582  6.841   -14.416 1.00 0.00 ? 300 GLN B HA   1  
ATOM 364   H HB2  . GLN B 2 6  ? 11.006  8.550   -11.989 1.00 0.00 ? 300 GLN B HB2  1  
ATOM 365   H HB3  . GLN B 2 6  ? 12.100  7.175   -12.007 1.00 0.00 ? 300 GLN B HB3  1  
ATOM 366   H HG2  . GLN B 2 6  ? 12.405  9.695   -13.625 1.00 0.00 ? 300 GLN B HG2  1  
ATOM 367   H HG3  . GLN B 2 6  ? 13.307  9.278   -12.169 1.00 0.00 ? 300 GLN B HG3  1  
ATOM 368   H HE21 . GLN B 2 6  ? 13.465  9.352   -15.439 1.00 0.00 ? 300 GLN B HE21 1  
ATOM 369   H HE22 . GLN B 2 6  ? 14.672  8.145   -15.703 1.00 0.00 ? 300 GLN B HE22 1  
ATOM 370   N N    . PRO B 2 7  ? 9.534   5.330   -14.058 1.00 0.00 ? 301 PRO B N    1  
ATOM 371   C CA   . PRO B 2 7  ? 8.569   4.290   -13.675 1.00 0.00 ? 301 PRO B CA   1  
ATOM 372   C C    . PRO B 2 7  ? 9.122   3.310   -12.632 1.00 0.00 ? 301 PRO B C    1  
ATOM 373   O O    . PRO B 2 7  ? 8.444   2.350   -12.263 1.00 0.00 ? 301 PRO B O    1  
ATOM 374   C CB   . PRO B 2 7  ? 8.293   3.567   -14.994 1.00 0.00 ? 301 PRO B CB   1  
ATOM 375   C CG   . PRO B 2 7  ? 9.532   3.759   -15.798 1.00 0.00 ? 301 PRO B CG   1  
ATOM 376   C CD   . PRO B 2 7  ? 10.073  5.110   -15.415 1.00 0.00 ? 301 PRO B CD   1  
ATOM 377   H HA   . PRO B 2 7  ? 7.653   4.724   -13.303 1.00 0.00 ? 301 PRO B HA   1  
ATOM 378   H HB2  . PRO B 2 7  ? 8.102   2.521   -14.803 1.00 0.00 ? 301 PRO B HB2  1  
ATOM 379   H HB3  . PRO B 2 7  ? 7.436   4.012   -15.479 1.00 0.00 ? 301 PRO B HB3  1  
ATOM 380   H HG2  . PRO B 2 7  ? 10.248  2.987   -15.557 1.00 0.00 ? 301 PRO B HG2  1  
ATOM 381   H HG3  . PRO B 2 7  ? 9.294   3.735   -16.851 1.00 0.00 ? 301 PRO B HG3  1  
ATOM 382   H HD2  . PRO B 2 7  ? 11.153  5.093   -15.403 1.00 0.00 ? 301 PRO B HD2  1  
ATOM 383   H HD3  . PRO B 2 7  ? 9.715   5.866   -16.098 1.00 0.00 ? 301 PRO B HD3  1  
ATOM 384   N N    . VAL B 2 8  ? 10.349  3.555   -12.157 1.00 0.00 ? 302 VAL B N    1  
ATOM 385   C CA   . VAL B 2 8  ? 10.979  2.694   -11.158 1.00 0.00 ? 302 VAL B CA   1  
ATOM 386   C C    . VAL B 2 8  ? 10.172  2.673   -9.859  1.00 0.00 ? 302 VAL B C    1  
ATOM 387   O O    . VAL B 2 8  ? 10.029  1.624   -9.236  1.00 0.00 ? 302 VAL B O    1  
ATOM 388   C CB   . VAL B 2 8  ? 12.425  3.145   -10.850 1.00 0.00 ? 302 VAL B CB   1  
ATOM 389   C CG1  . VAL B 2 8  ? 13.075  2.218   -9.832  1.00 0.00 ? 302 VAL B CG1  1  
ATOM 390   C CG2  . VAL B 2 8  ? 13.254  3.207   -12.126 1.00 0.00 ? 302 VAL B CG2  1  
ATOM 391   H H    . VAL B 2 8  ? 10.842  4.333   -12.484 1.00 0.00 ? 302 VAL B H    1  
ATOM 392   H HA   . VAL B 2 8  ? 11.016  1.692   -11.561 1.00 0.00 ? 302 VAL B HA   1  
ATOM 393   H HB   . VAL B 2 8  ? 12.387  4.137   -10.423 1.00 0.00 ? 302 VAL B HB   1  
ATOM 394   H HG11 . VAL B 2 8  ? 12.989  1.195   -10.170 1.00 0.00 ? 302 VAL B HG11 1  
ATOM 395   H HG12 . VAL B 2 8  ? 12.580  2.324   -8.879  1.00 0.00 ? 302 VAL B HG12 1  
ATOM 396   H HG13 . VAL B 2 8  ? 14.119  2.474   -9.726  1.00 0.00 ? 302 VAL B HG13 1  
ATOM 397   H HG21 . VAL B 2 8  ? 13.424  2.206   -12.494 1.00 0.00 ? 302 VAL B HG21 1  
ATOM 398   H HG22 . VAL B 2 8  ? 14.203  3.679   -11.916 1.00 0.00 ? 302 VAL B HG22 1  
ATOM 399   H HG23 . VAL B 2 8  ? 12.725  3.780   -12.873 1.00 0.00 ? 302 VAL B HG23 1  
ATOM 400   N N    . GLU B 2 9  ? 9.640   3.833   -9.461  1.00 0.00 ? 303 GLU B N    1  
ATOM 401   C CA   . GLU B 2 9  ? 8.842   3.936   -8.238  1.00 0.00 ? 303 GLU B CA   1  
ATOM 402   C C    . GLU B 2 9  ? 7.586   3.071   -8.334  1.00 0.00 ? 303 GLU B C    1  
ATOM 403   O O    . GLU B 2 9  ? 7.309   2.264   -7.444  1.00 0.00 ? 303 GLU B O    1  
ATOM 404   C CB   . GLU B 2 9  ? 8.452   5.392   -7.973  1.00 0.00 ? 303 GLU B CB   1  
ATOM 405   C CG   . GLU B 2 9  ? 9.643   6.306   -7.738  1.00 0.00 ? 303 GLU B CG   1  
ATOM 406   C CD   . GLU B 2 9  ? 9.236   7.747   -7.491  1.00 0.00 ? 303 GLU B CD   1  
ATOM 407   O OE1  . GLU B 2 9  ? 8.627   8.357   -8.396  1.00 0.00 ? 303 GLU B OE1  1  
ATOM 408   O OE2  . GLU B 2 9  ? 9.524   8.265   -6.392  1.00 0.00 ? 303 GLU B OE2  1  
ATOM 409   H H    . GLU B 2 9  ? 9.784   4.636   -10.004 1.00 0.00 ? 303 GLU B H    1  
ATOM 410   H HA   . GLU B 2 9  ? 9.448   3.582   -7.417  1.00 0.00 ? 303 GLU B HA   1  
ATOM 411   H HB2  . GLU B 2 9  ? 7.900   5.766   -8.823  1.00 0.00 ? 303 GLU B HB2  1  
ATOM 412   H HB3  . GLU B 2 9  ? 7.819   5.430   -7.098  1.00 0.00 ? 303 GLU B HB3  1  
ATOM 413   H HG2  . GLU B 2 9  ? 10.189  5.948   -6.878  1.00 0.00 ? 303 GLU B HG2  1  
ATOM 414   H HG3  . GLU B 2 9  ? 10.283  6.272   -8.607  1.00 0.00 ? 303 GLU B HG3  1  
ATOM 415   N N    . PHE B 2 10 ? 6.838   3.241   -9.426  1.00 0.00 ? 304 PHE B N    1  
ATOM 416   C CA   . PHE B 2 10 ? 5.616   2.473   -9.655  1.00 0.00 ? 304 PHE B CA   1  
ATOM 417   C C    . PHE B 2 10 ? 5.939   0.985   -9.795  1.00 0.00 ? 304 PHE B C    1  
ATOM 418   O O    . PHE B 2 10 ? 5.400   0.155   -9.064  1.00 0.00 ? 304 PHE B O    1  
ATOM 419   C CB   . PHE B 2 10 ? 4.903   2.984   -10.915 1.00 0.00 ? 304 PHE B CB   1  
ATOM 420   C CG   . PHE B 2 10 ? 3.627   2.255   -11.244 1.00 0.00 ? 304 PHE B CG   1  
ATOM 421   C CD1  . PHE B 2 10 ? 2.548   2.283   -10.375 1.00 0.00 ? 304 PHE B CD1  1  
ATOM 422   C CD2  . PHE B 2 10 ? 3.508   1.546   -12.429 1.00 0.00 ? 304 PHE B CD2  1  
ATOM 423   C CE1  . PHE B 2 10 ? 1.376   1.618   -10.681 1.00 0.00 ? 304 PHE B CE1  1  
ATOM 424   C CE2  . PHE B 2 10 ? 2.339   0.878   -12.739 1.00 0.00 ? 304 PHE B CE2  1  
ATOM 425   C CZ   . PHE B 2 10 ? 1.271   0.914   -11.864 1.00 0.00 ? 304 PHE B CZ   1  
ATOM 426   H H    . PHE B 2 10 ? 7.121   3.896   -10.099 1.00 0.00 ? 304 PHE B H    1  
ATOM 427   H HA   . PHE B 2 10 ? 4.970   2.613   -8.802  1.00 0.00 ? 304 PHE B HA   1  
ATOM 428   H HB2  . PHE B 2 10 ? 4.659   4.027   -10.780 1.00 0.00 ? 304 PHE B HB2  1  
ATOM 429   H HB3  . PHE B 2 10 ? 5.570   2.885   -11.760 1.00 0.00 ? 304 PHE B HB3  1  
ATOM 430   H HD1  . PHE B 2 10 ? 2.628   2.832   -9.450  1.00 0.00 ? 304 PHE B HD1  1  
ATOM 431   H HD2  . PHE B 2 10 ? 4.342   1.516   -13.115 1.00 0.00 ? 304 PHE B HD2  1  
ATOM 432   H HE1  . PHE B 2 10 ? 0.543   1.648   -9.994  1.00 0.00 ? 304 PHE B HE1  1  
ATOM 433   H HE2  . PHE B 2 10 ? 2.259   0.328   -13.666 1.00 0.00 ? 304 PHE B HE2  1  
ATOM 434   H HZ   . PHE B 2 10 ? 0.356   0.394   -12.105 1.00 0.00 ? 304 PHE B HZ   1  
ATOM 435   N N    . ASN B 2 11 ? 6.831   0.664   -10.734 1.00 0.00 ? 305 ASN B N    1  
ATOM 436   C CA   . ASN B 2 11 ? 7.243   -0.719  -10.980 1.00 0.00 ? 305 ASN B CA   1  
ATOM 437   C C    . ASN B 2 11 ? 7.787   -1.381  -9.707  1.00 0.00 ? 305 ASN B C    1  
ATOM 438   O O    . ASN B 2 11 ? 7.593   -2.579  -9.497  1.00 0.00 ? 305 ASN B O    1  
ATOM 439   C CB   . ASN B 2 11 ? 8.301   -0.759  -12.089 1.00 0.00 ? 305 ASN B CB   1  
ATOM 440   C CG   . ASN B 2 11 ? 8.676   -2.173  -12.491 1.00 0.00 ? 305 ASN B CG   1  
ATOM 441   O OD1  . ASN B 2 11 ? 7.832   -2.945  -12.945 1.00 0.00 ? 305 ASN B OD1  1  
ATOM 442   N ND2  . ASN B 2 11 ? 9.948   -2.521  -12.328 1.00 0.00 ? 305 ASN B ND2  1  
ATOM 443   H H    . ASN B 2 11 ? 7.227   1.379   -11.276 1.00 0.00 ? 305 ASN B H    1  
ATOM 444   H HA   . ASN B 2 11 ? 6.373   -1.267  -11.309 1.00 0.00 ? 305 ASN B HA   1  
ATOM 445   H HB2  . ASN B 2 11 ? 7.917   -0.249  -12.960 1.00 0.00 ? 305 ASN B HB2  1  
ATOM 446   H HB3  . ASN B 2 11 ? 9.191   -0.253  -11.745 1.00 0.00 ? 305 ASN B HB3  1  
ATOM 447   H HD21 . ASN B 2 11 ? 10.568  -1.856  -11.961 1.00 0.00 ? 305 ASN B HD21 1  
ATOM 448   H HD22 . ASN B 2 11 ? 10.215  -3.429  -12.581 1.00 0.00 ? 305 ASN B HD22 1  
ATOM 449   N N    . HIS B 2 12 ? 8.463   -0.594  -8.862  1.00 0.00 ? 306 HIS B N    1  
ATOM 450   C CA   . HIS B 2 12 ? 9.028   -1.104  -7.610  1.00 0.00 ? 306 HIS B CA   1  
ATOM 451   C C    . HIS B 2 12 ? 7.929   -1.679  -6.718  1.00 0.00 ? 306 HIS B C    1  
ATOM 452   O O    . HIS B 2 12 ? 7.980   -2.850  -6.337  1.00 0.00 ? 306 HIS B O    1  
ATOM 453   C CB   . HIS B 2 12 ? 9.782   0.011   -6.873  1.00 0.00 ? 306 HIS B CB   1  
ATOM 454   C CG   . HIS B 2 12 ? 10.451  -0.424  -5.604  1.00 0.00 ? 306 HIS B CG   1  
ATOM 455   N ND1  . HIS B 2 12 ? 11.083  0.458   -4.753  1.00 0.00 ? 306 HIS B ND1  1  
ATOM 456   C CD2  . HIS B 2 12 ? 10.594  -1.650  -5.042  1.00 0.00 ? 306 HIS B CD2  1  
ATOM 457   C CE1  . HIS B 2 12 ? 11.584  -0.203  -3.726  1.00 0.00 ? 306 HIS B CE1  1  
ATOM 458   N NE2  . HIS B 2 12 ? 11.301  -1.483  -3.876  1.00 0.00 ? 306 HIS B NE2  1  
ATOM 459   H H    . HIS B 2 12 ? 8.583   0.353   -9.085  1.00 0.00 ? 306 HIS B H    1  
ATOM 460   H HA   . HIS B 2 12 ? 9.721   -1.895  -7.859  1.00 0.00 ? 306 HIS B HA   1  
ATOM 461   H HB2  . HIS B 2 12 ? 10.546  0.405   -7.524  1.00 0.00 ? 306 HIS B HB2  1  
ATOM 462   H HB3  . HIS B 2 12 ? 9.087   0.801   -6.628  1.00 0.00 ? 306 HIS B HB3  1  
ATOM 463   H HD1  . HIS B 2 12 ? 11.154  1.427   -4.884  1.00 0.00 ? 306 HIS B HD1  1  
ATOM 464   H HD2  . HIS B 2 12 ? 10.222  -2.584  -5.438  1.00 0.00 ? 306 HIS B HD2  1  
ATOM 465   H HE1  . HIS B 2 12 ? 12.130  0.231   -2.902  1.00 0.00 ? 306 HIS B HE1  1  
ATOM 466   H HE2  . HIS B 2 12 ? 11.660  -2.207  -3.322  1.00 0.00 ? 306 HIS B HE2  1  
ATOM 467   N N    . ALA B 2 13 ? 6.927   -0.854  -6.403  1.00 0.00 ? 307 ALA B N    1  
ATOM 468   C CA   . ALA B 2 13 ? 5.806   -1.291  -5.573  1.00 0.00 ? 307 ALA B CA   1  
ATOM 469   C C    . ALA B 2 13 ? 5.038   -2.408  -6.267  1.00 0.00 ? 307 ALA B C    1  
ATOM 470   O O    . ALA B 2 13 ? 4.648   -3.389  -5.638  1.00 0.00 ? 307 ALA B O    1  
ATOM 471   C CB   . ALA B 2 13 ? 4.877   -0.127  -5.268  1.00 0.00 ? 307 ALA B CB   1  
ATOM 472   H H    . ALA B 2 13 ? 6.936   0.064   -6.749  1.00 0.00 ? 307 ALA B H    1  
ATOM 473   H HA   . ALA B 2 13 ? 6.203   -1.664  -4.640  1.00 0.00 ? 307 ALA B HA   1  
ATOM 474   H HB1  . ALA B 2 13 ? 3.852   -0.467  -5.312  1.00 0.00 ? 307 ALA B HB1  1  
ATOM 475   H HB2  . ALA B 2 13 ? 5.029   0.656   -5.996  1.00 0.00 ? 307 ALA B HB2  1  
ATOM 476   H HB3  . ALA B 2 13 ? 5.088   0.253   -4.279  1.00 0.00 ? 307 ALA B HB3  1  
ATOM 477   N N    . ILE B 2 14 ? 4.847   -2.249  -7.575  1.00 0.00 ? 308 ILE B N    1  
ATOM 478   C CA   . ILE B 2 14 ? 4.151   -3.227  -8.397  1.00 0.00 ? 308 ILE B CA   1  
ATOM 479   C C    . ILE B 2 14 ? 4.736   -4.623  -8.216  1.00 0.00 ? 308 ILE B C    1  
ATOM 480   O O    . ILE B 2 14 ? 4.056   -5.531  -7.736  1.00 0.00 ? 308 ILE B O    1  
ATOM 481   C CB   . ILE B 2 14 ? 4.230   -2.798  -9.879  1.00 0.00 ? 308 ILE B CB   1  
ATOM 482   C CG1  . ILE B 2 14 ? 3.038   -1.918  -10.245 1.00 0.00 ? 308 ILE B CG1  1  
ATOM 483   C CG2  . ILE B 2 14 ? 4.312   -3.997  -10.795 1.00 0.00 ? 308 ILE B CG2  1  
ATOM 484   C CD1  . ILE B 2 14 ? 2.679   -0.915  -9.177  1.00 0.00 ? 308 ILE B CD1  1  
ATOM 485   H H    . ILE B 2 14 ? 5.199   -1.444  -8.010  1.00 0.00 ? 308 ILE B H    1  
ATOM 486   H HA   . ILE B 2 14 ? 3.113   -3.241  -8.098  1.00 0.00 ? 308 ILE B HA   1  
ATOM 487   H HB   . ILE B 2 14 ? 5.135   -2.224  -10.010 1.00 0.00 ? 308 ILE B HB   1  
ATOM 488   H HG12 . ILE B 2 14 ? 3.269   -1.371  -11.145 1.00 0.00 ? 308 ILE B HG12 1  
ATOM 489   H HG13 . ILE B 2 14 ? 2.176   -2.544  -10.419 1.00 0.00 ? 308 ILE B HG13 1  
ATOM 490   H HG21 . ILE B 2 14 ? 5.287   -4.462  -10.687 1.00 0.00 ? 308 ILE B HG21 1  
ATOM 491   H HG22 . ILE B 2 14 ? 4.171   -3.676  -11.814 1.00 0.00 ? 308 ILE B HG22 1  
ATOM 492   H HG23 . ILE B 2 14 ? 3.542   -4.700  -10.525 1.00 0.00 ? 308 ILE B HG23 1  
ATOM 493   H HD11 . ILE B 2 14 ? 3.279   -0.031  -9.295  1.00 0.00 ? 308 ILE B HD11 1  
ATOM 494   H HD12 . ILE B 2 14 ? 2.861   -1.349  -8.203  1.00 0.00 ? 308 ILE B HD12 1  
ATOM 495   H HD13 . ILE B 2 14 ? 1.636   -0.662  -9.266  1.00 0.00 ? 308 ILE B HD13 1  
ATOM 496   N N    . ASN B 2 15 ? 6.001   -4.780  -8.591  1.00 0.00 ? 309 ASN B N    1  
ATOM 497   C CA   . ASN B 2 15 ? 6.682   -6.058  -8.458  1.00 0.00 ? 309 ASN B CA   1  
ATOM 498   C C    . ASN B 2 15 ? 6.720   -6.497  -6.993  1.00 0.00 ? 309 ASN B C    1  
ATOM 499   O O    . ASN B 2 15 ? 6.692   -7.693  -6.697  1.00 0.00 ? 309 ASN B O    1  
ATOM 500   C CB   . ASN B 2 15 ? 8.084   -5.961  -9.051  1.00 0.00 ? 309 ASN B CB   1  
ATOM 501   C CG   . ASN B 2 15 ? 8.094   -6.198  -10.549 1.00 0.00 ? 309 ASN B CG   1  
ATOM 502   O OD1  . ASN B 2 15 ? 7.702   -7.265  -11.023 1.00 0.00 ? 309 ASN B OD1  1  
ATOM 503   N ND2  . ASN B 2 15 ? 8.543   -5.203  -11.305 1.00 0.00 ? 309 ASN B ND2  1  
ATOM 504   H H    . ASN B 2 15 ? 6.492   -4.012  -8.957  1.00 0.00 ? 309 ASN B H    1  
ATOM 505   H HA   . ASN B 2 15 ? 6.117   -6.788  -9.019  1.00 0.00 ? 309 ASN B HA   1  
ATOM 506   H HB2  . ASN B 2 15 ? 8.462   -4.968  -8.869  1.00 0.00 ? 309 ASN B HB2  1  
ATOM 507   H HB3  . ASN B 2 15 ? 8.726   -6.687  -8.579  1.00 0.00 ? 309 ASN B HB3  1  
ATOM 508   H HD21 . ASN B 2 15 ? 8.839   -4.381  -10.861 1.00 0.00 ? 309 ASN B HD21 1  
ATOM 509   H HD22 . ASN B 2 15 ? 8.558   -5.331  -12.276 1.00 0.00 ? 309 ASN B HD22 1  
ATOM 510   N N    . TYR B 2 16 ? 6.739   -5.521  -6.078  1.00 0.00 ? 310 TYR B N    1  
ATOM 511   C CA   . TYR B 2 16 ? 6.726   -5.813  -4.648  1.00 0.00 ? 310 TYR B CA   1  
ATOM 512   C C    . TYR B 2 16 ? 5.396   -6.465  -4.266  1.00 0.00 ? 310 TYR B C    1  
ATOM 513   O O    . TYR B 2 16 ? 5.370   -7.438  -3.510  1.00 0.00 ? 310 TYR B O    1  
ATOM 514   C CB   . TYR B 2 16 ? 6.955   -4.536  -3.828  1.00 0.00 ? 310 TYR B CB   1  
ATOM 515   C CG   . TYR B 2 16 ? 6.620   -4.686  -2.360  1.00 0.00 ? 310 TYR B CG   1  
ATOM 516   C CD1  . TYR B 2 16 ? 7.213   -5.676  -1.587  1.00 0.00 ? 310 TYR B CD1  1  
ATOM 517   C CD2  . TYR B 2 16 ? 5.700   -3.842  -1.752  1.00 0.00 ? 310 TYR B CD2  1  
ATOM 518   C CE1  . TYR B 2 16 ? 6.898   -5.821  -0.250  1.00 0.00 ? 310 TYR B CE1  1  
ATOM 519   C CE2  . TYR B 2 16 ? 5.383   -3.977  -0.416  1.00 0.00 ? 310 TYR B CE2  1  
ATOM 520   C CZ   . TYR B 2 16 ? 5.983   -4.969  0.331   1.00 0.00 ? 310 TYR B CZ   1  
ATOM 521   O OH   . TYR B 2 16 ? 5.664   -5.115  1.663   1.00 0.00 ? 310 TYR B OH   1  
ATOM 522   H H    . TYR B 2 16 ? 6.731   -4.587  -6.372  1.00 0.00 ? 310 TYR B H    1  
ATOM 523   H HA   . TYR B 2 16 ? 7.525   -6.511  -4.446  1.00 0.00 ? 310 TYR B HA   1  
ATOM 524   H HB2  . TYR B 2 16 ? 7.994   -4.252  -3.902  1.00 0.00 ? 310 TYR B HB2  1  
ATOM 525   H HB3  . TYR B 2 16 ? 6.342   -3.744  -4.230  1.00 0.00 ? 310 TYR B HB3  1  
ATOM 526   H HD1  . TYR B 2 16 ? 7.930   -6.342  -2.044  1.00 0.00 ? 310 TYR B HD1  1  
ATOM 527   H HD2  . TYR B 2 16 ? 5.231   -3.066  -2.340  1.00 0.00 ? 310 TYR B HD2  1  
ATOM 528   H HE1  . TYR B 2 16 ? 7.369   -6.596  0.334   1.00 0.00 ? 310 TYR B HE1  1  
ATOM 529   H HE2  . TYR B 2 16 ? 4.666   -3.309  0.038   1.00 0.00 ? 310 TYR B HE2  1  
ATOM 530   H HH   . TYR B 2 16 ? 4.737   -4.904  1.800   1.00 0.00 ? 310 TYR B HH   1  
ATOM 531   N N    . VAL B 2 17 ? 4.293   -5.940  -4.819  1.00 0.00 ? 311 VAL B N    1  
ATOM 532   C CA   . VAL B 2 17 ? 2.966   -6.496  -4.557  1.00 0.00 ? 311 VAL B CA   1  
ATOM 533   C C    . VAL B 2 17 ? 2.928   -7.960  -4.993  1.00 0.00 ? 311 VAL B C    1  
ATOM 534   O O    . VAL B 2 17 ? 2.259   -8.778  -4.368  1.00 0.00 ? 311 VAL B O    1  
ATOM 535   C CB   . VAL B 2 17 ? 1.841   -5.733  -5.296  1.00 0.00 ? 311 VAL B CB   1  
ATOM 536   C CG1  . VAL B 2 17 ? 0.472   -6.244  -4.878  1.00 0.00 ? 311 VAL B CG1  1  
ATOM 537   C CG2  . VAL B 2 17 ? 1.920   -4.241  -5.061  1.00 0.00 ? 311 VAL B CG2  1  
ATOM 538   H H    . VAL B 2 17 ? 4.380   -5.177  -5.430  1.00 0.00 ? 311 VAL B H    1  
ATOM 539   H HA   . VAL B 2 17 ? 2.782   -6.439  -3.493  1.00 0.00 ? 311 VAL B HA   1  
ATOM 540   H HB   . VAL B 2 17 ? 1.958   -5.909  -6.347  1.00 0.00 ? 311 VAL B HB   1  
ATOM 541   H HG11 . VAL B 2 17 ? -0.277  -5.495  -5.111  1.00 0.00 ? 311 VAL B HG11 1  
ATOM 542   H HG12 . VAL B 2 17 ? 0.468   -6.435  -3.815  1.00 0.00 ? 311 VAL B HG12 1  
ATOM 543   H HG13 . VAL B 2 17 ? 0.248   -7.161  -5.411  1.00 0.00 ? 311 VAL B HG13 1  
ATOM 544   H HG21 . VAL B 2 17 ? 2.359   -4.055  -4.096  1.00 0.00 ? 311 VAL B HG21 1  
ATOM 545   H HG22 . VAL B 2 17 ? 0.922   -3.824  -5.094  1.00 0.00 ? 311 VAL B HG22 1  
ATOM 546   H HG23 . VAL B 2 17 ? 2.525   -3.785  -5.830  1.00 0.00 ? 311 VAL B HG23 1  
ATOM 547   N N    . ASN B 2 18 ? 3.668   -8.282  -6.066  1.00 0.00 ? 312 ASN B N    1  
ATOM 548   C CA   . ASN B 2 18 ? 3.735   -9.652  -6.571  1.00 0.00 ? 312 ASN B CA   1  
ATOM 549   C C    . ASN B 2 18 ? 4.281   -10.579 -5.487  1.00 0.00 ? 312 ASN B C    1  
ATOM 550   O O    . ASN B 2 18 ? 3.703   -11.630 -5.218  1.00 0.00 ? 312 ASN B O    1  
ATOM 551   C CB   . ASN B 2 18 ? 4.610   -9.729  -7.827  1.00 0.00 ? 312 ASN B CB   1  
ATOM 552   C CG   . ASN B 2 18 ? 4.645   -11.123 -8.427  1.00 0.00 ? 312 ASN B CG   1  
ATOM 553   O OD1  . ASN B 2 18 ? 3.616   -11.660 -8.836  1.00 0.00 ? 312 ASN B OD1  1  
ATOM 554   N ND2  . ASN B 2 18 ? 5.831   -11.720 -8.478  1.00 0.00 ? 312 ASN B ND2  1  
ATOM 555   H H    . ASN B 2 18 ? 4.189   -7.584  -6.515  1.00 0.00 ? 312 ASN B H    1  
ATOM 556   H HA   . ASN B 2 18 ? 2.730   -9.963  -6.821  1.00 0.00 ? 312 ASN B HA   1  
ATOM 557   H HB2  . ASN B 2 18 ? 4.223   -9.048  -8.570  1.00 0.00 ? 312 ASN B HB2  1  
ATOM 558   H HB3  . ASN B 2 18 ? 5.619   -9.441  -7.572  1.00 0.00 ? 312 ASN B HB3  1  
ATOM 559   H HD21 . ASN B 2 18 ? 6.610   -11.236 -8.131  1.00 0.00 ? 312 ASN B HD21 1  
ATOM 560   H HD22 . ASN B 2 18 ? 5.879   -12.621 -8.860  1.00 0.00 ? 312 ASN B HD22 1  
ATOM 561   N N    . LYS B 2 19 ? 5.379   -10.160 -4.843  1.00 0.00 ? 313 LYS B N    1  
ATOM 562   C CA   . LYS B 2 19 ? 5.978   -10.935 -3.753  1.00 0.00 ? 313 LYS B CA   1  
ATOM 563   C C    . LYS B 2 19 ? 4.919   -11.252 -2.713  1.00 0.00 ? 313 LYS B C    1  
ATOM 564   O O    . LYS B 2 19 ? 4.766   -12.389 -2.275  1.00 0.00 ? 313 LYS B O    1  
ATOM 565   C CB   . LYS B 2 19 ? 7.097   -10.140 -3.071  1.00 0.00 ? 313 LYS B CB   1  
ATOM 566   C CG   . LYS B 2 19 ? 8.308   -9.891  -3.947  1.00 0.00 ? 313 LYS B CG   1  
ATOM 567   C CD   . LYS B 2 19 ? 9.330   -8.992  -3.265  1.00 0.00 ? 313 LYS B CD   1  
ATOM 568   C CE   . LYS B 2 19 ? 10.174  -9.762  -2.259  1.00 0.00 ? 313 LYS B CE   1  
ATOM 569   N NZ   . LYS B 2 19 ? 11.106  -8.870  -1.514  1.00 0.00 ? 313 LYS B NZ   1  
ATOM 570   H H    . LYS B 2 19 ? 5.776   -9.297  -5.089  1.00 0.00 ? 313 LYS B H    1  
ATOM 571   H HA   . LYS B 2 19 ? 6.376   -11.855 -4.158  1.00 0.00 ? 313 LYS B HA   1  
ATOM 572   H HB2  . LYS B 2 19 ? 6.700   -9.180  -2.755  1.00 0.00 ? 313 LYS B HB2  1  
ATOM 573   H HB3  . LYS B 2 19 ? 7.418   -10.685 -2.199  1.00 0.00 ? 313 LYS B HB3  1  
ATOM 574   H HG2  . LYS B 2 19 ? 8.773   -10.839 -4.154  1.00 0.00 ? 313 LYS B HG2  1  
ATOM 575   H HG3  . LYS B 2 19 ? 7.989   -9.430  -4.867  1.00 0.00 ? 313 LYS B HG3  1  
ATOM 576   H HD2  . LYS B 2 19 ? 9.981   -8.570  -4.016  1.00 0.00 ? 313 LYS B HD2  1  
ATOM 577   H HD3  . LYS B 2 19 ? 8.809   -8.197  -2.751  1.00 0.00 ? 313 LYS B HD3  1  
ATOM 578   H HE2  . LYS B 2 19 ? 9.519   -10.251 -1.556  1.00 0.00 ? 313 LYS B HE2  1  
ATOM 579   H HE3  . LYS B 2 19 ? 10.750  -10.506 -2.790  1.00 0.00 ? 313 LYS B HE3  1  
ATOM 580   H HZ1  . LYS B 2 19 ? 11.736  -8.374  -2.178  1.00 0.00 ? 313 LYS B HZ1  1  
ATOM 581   H HZ2  . LYS B 2 19 ? 11.687  -9.430  -0.857  1.00 0.00 ? 313 LYS B HZ2  1  
ATOM 582   H HZ3  . LYS B 2 19 ? 10.569  -8.165  -0.969  1.00 0.00 ? 313 LYS B HZ3  1  
ATOM 583   N N    . ILE B 2 20 ? 4.197   -10.207 -2.335  1.00 0.00 ? 314 ILE B N    1  
ATOM 584   C CA   . ILE B 2 20 ? 3.132   -10.284 -1.353  1.00 0.00 ? 314 ILE B CA   1  
ATOM 585   C C    . ILE B 2 20 ? 1.985   -11.165 -1.839  1.00 0.00 ? 314 ILE B C    1  
ATOM 586   O O    . ILE B 2 20 ? 1.615   -12.133 -1.177  1.00 0.00 ? 314 ILE B O    1  
ATOM 587   C CB   . ILE B 2 20 ? 2.647   -8.855  -1.048  1.00 0.00 ? 314 ILE B CB   1  
ATOM 588   C CG1  . ILE B 2 20 ? 3.754   -8.123  -0.297  1.00 0.00 ? 314 ILE B CG1  1  
ATOM 589   C CG2  . ILE B 2 20 ? 1.346   -8.843  -0.264  1.00 0.00 ? 314 ILE B CG2  1  
ATOM 590   C CD1  . ILE B 2 20 ? 3.460   -6.674  -0.034  1.00 0.00 ? 314 ILE B CD1  1  
ATOM 591   H H    . ILE B 2 20 ? 4.393   -9.335  -2.740  1.00 0.00 ? 314 ILE B H    1  
ATOM 592   H HA   . ILE B 2 20 ? 3.540   -10.704 -0.446  1.00 0.00 ? 314 ILE B HA   1  
ATOM 593   H HB   . ILE B 2 20 ? 2.474   -8.352  -1.986  1.00 0.00 ? 314 ILE B HB   1  
ATOM 594   H HG12 . ILE B 2 20 ? 3.911   -8.605  0.653   1.00 0.00 ? 314 ILE B HG12 1  
ATOM 595   H HG13 . ILE B 2 20 ? 4.665   -8.176  -0.875  1.00 0.00 ? 314 ILE B HG13 1  
ATOM 596   H HG21 . ILE B 2 20 ? 1.553   -8.606  0.767   1.00 0.00 ? 314 ILE B HG21 1  
ATOM 597   H HG22 . ILE B 2 20 ? 0.880   -9.810  -0.328  1.00 0.00 ? 314 ILE B HG22 1  
ATOM 598   H HG23 . ILE B 2 20 ? 0.685   -8.097  -0.678  1.00 0.00 ? 314 ILE B HG23 1  
ATOM 599   H HD11 . ILE B 2 20 ? 2.408   -6.486  -0.181  1.00 0.00 ? 314 ILE B HD11 1  
ATOM 600   H HD12 . ILE B 2 20 ? 4.037   -6.068  -0.716  1.00 0.00 ? 314 ILE B HD12 1  
ATOM 601   H HD13 . ILE B 2 20 ? 3.731   -6.438  0.984   1.00 0.00 ? 314 ILE B HD13 1  
ATOM 602   N N    . LYS B 2 21 ? 1.444   -10.834 -3.005  1.00 0.00 ? 315 LYS B N    1  
ATOM 603   C CA   . LYS B 2 21 ? 0.354   -11.599 -3.599  1.00 0.00 ? 315 LYS B CA   1  
ATOM 604   C C    . LYS B 2 21 ? 0.726   -13.082 -3.696  1.00 0.00 ? 315 LYS B C    1  
ATOM 605   O O    . LYS B 2 21 ? -0.069  -13.956 -3.346  1.00 0.00 ? 315 LYS B O    1  
ATOM 606   C CB   . LYS B 2 21 ? 0.027   -11.031 -4.983  1.00 0.00 ? 315 LYS B CB   1  
ATOM 607   C CG   . LYS B 2 21 ? -1.085  -11.751 -5.706  1.00 0.00 ? 315 LYS B CG   1  
ATOM 608   C CD   . LYS B 2 21 ? -1.495  -10.976 -6.941  1.00 0.00 ? 315 LYS B CD   1  
ATOM 609   C CE   . LYS B 2 21 ? -2.612  -11.674 -7.688  1.00 0.00 ? 315 LYS B CE   1  
ATOM 610   N NZ   . LYS B 2 21 ? -3.871  -11.743 -6.890  1.00 0.00 ? 315 LYS B NZ   1  
ATOM 611   H H    . LYS B 2 21 ? 1.797   -10.057 -3.490  1.00 0.00 ? 315 LYS B H    1  
ATOM 612   H HA   . LYS B 2 21 ? -0.512  -11.497 -2.961  1.00 0.00 ? 315 LYS B HA   1  
ATOM 613   H HB2  . LYS B 2 21 ? -0.269  -10.002 -4.878  1.00 0.00 ? 315 LYS B HB2  1  
ATOM 614   H HB3  . LYS B 2 21 ? 0.914   -11.075 -5.596  1.00 0.00 ? 315 LYS B HB3  1  
ATOM 615   H HG2  . LYS B 2 21 ? -0.741  -12.732 -6.000  1.00 0.00 ? 315 LYS B HG2  1  
ATOM 616   H HG3  . LYS B 2 21 ? -1.936  -11.843 -5.047  1.00 0.00 ? 315 LYS B HG3  1  
ATOM 617   H HD2  . LYS B 2 21 ? -1.830  -9.994  -6.642  1.00 0.00 ? 315 LYS B HD2  1  
ATOM 618   H HD3  . LYS B 2 21 ? -0.640  -10.881 -7.594  1.00 0.00 ? 315 LYS B HD3  1  
ATOM 619   H HE2  . LYS B 2 21 ? -2.802  -11.134 -8.600  1.00 0.00 ? 315 LYS B HE2  1  
ATOM 620   H HE3  . LYS B 2 21 ? -2.289  -12.675 -7.923  1.00 0.00 ? 315 LYS B HE3  1  
ATOM 621   H HZ1  . LYS B 2 21 ? -3.872  -11.009 -6.154  1.00 0.00 ? 315 LYS B HZ1  1  
ATOM 622   H HZ2  . LYS B 2 21 ? -3.954  -12.674 -6.435  1.00 0.00 ? 315 LYS B HZ2  1  
ATOM 623   H HZ3  . LYS B 2 21 ? -4.694  -11.599 -7.510  1.00 0.00 ? 315 LYS B HZ3  1  
ATOM 624   N N    . ASN B 2 22 ? 1.948   -13.348 -4.164  1.00 0.00 ? 316 ASN B N    1  
ATOM 625   C CA   . ASN B 2 22 ? 2.454   -14.714 -4.303  1.00 0.00 ? 316 ASN B CA   1  
ATOM 626   C C    . ASN B 2 22 ? 2.697   -15.359 -2.937  1.00 0.00 ? 316 ASN B C    1  
ATOM 627   O O    . ASN B 2 22 ? 2.233   -16.471 -2.680  1.00 0.00 ? 316 ASN B O    1  
ATOM 628   C CB   . ASN B 2 22 ? 3.751   -14.719 -5.124  1.00 0.00 ? 316 ASN B CB   1  
ATOM 629   C CG   . ASN B 2 22 ? 3.559   -14.343 -6.593  1.00 0.00 ? 316 ASN B CG   1  
ATOM 630   O OD1  . ASN B 2 22 ? 4.532   -14.260 -7.341  1.00 0.00 ? 316 ASN B OD1  1  
ATOM 631   N ND2  . ASN B 2 22 ? 2.316   -14.120 -7.025  1.00 0.00 ? 316 ASN B ND2  1  
ATOM 632   H H    . ASN B 2 22 ? 2.531   -12.601 -4.415  1.00 0.00 ? 316 ASN B H    1  
ATOM 633   H HA   . ASN B 2 22 ? 1.707   -15.291 -4.827  1.00 0.00 ? 316 ASN B HA   1  
ATOM 634   H HB2  . ASN B 2 22 ? 4.440   -14.012 -4.687  1.00 0.00 ? 316 ASN B HB2  1  
ATOM 635   H HB3  . ASN B 2 22 ? 4.189   -15.704 -5.080  1.00 0.00 ? 316 ASN B HB3  1  
ATOM 636   H HD21 . ASN B 2 22 ? 1.576   -14.205 -6.393  1.00 0.00 ? 316 ASN B HD21 1  
ATOM 637   H HD22 . ASN B 2 22 ? 2.195   -13.878 -7.967  1.00 0.00 ? 316 ASN B HD22 1  
ATOM 638   N N    . ARG B 2 23 ? 3.427   -14.655 -2.065  1.00 0.00 ? 317 ARG B N    1  
ATOM 639   C CA   . ARG B 2 23 ? 3.733   -15.157 -0.723  1.00 0.00 ? 317 ARG B CA   1  
ATOM 640   C C    . ARG B 2 23 ? 2.449   -15.490 0.036   1.00 0.00 ? 317 ARG B C    1  
ATOM 641   O O    . ARG B 2 23 ? 2.365   -16.519 0.707   1.00 0.00 ? 317 ARG B O    1  
ATOM 642   C CB   . ARG B 2 23 ? 4.558   -14.130 0.062   1.00 0.00 ? 317 ARG B CB   1  
ATOM 643   C CG   . ARG B 2 23 ? 5.066   -14.641 1.403   1.00 0.00 ? 317 ARG B CG   1  
ATOM 644   C CD   . ARG B 2 23 ? 5.988   -15.841 1.230   1.00 0.00 ? 317 ARG B CD   1  
ATOM 645   N NE   . ARG B 2 23 ? 6.528   -16.313 2.506   1.00 0.00 ? 317 ARG B NE   1  
ATOM 646   C CZ   . ARG B 2 23 ? 7.350   -17.360 2.627   1.00 0.00 ? 317 ARG B CZ   1  
ATOM 647   N NH1  . ARG B 2 23 ? 7.725   -18.053 1.555   1.00 0.00 ? 317 ARG B NH1  1  
ATOM 648   N NH2  . ARG B 2 23 ? 7.798   -17.714 3.826   1.00 0.00 ? 317 ARG B NH2  1  
ATOM 649   H H    . ARG B 2 23 ? 3.768   -13.774 -2.332  1.00 0.00 ? 317 ARG B H    1  
ATOM 650   H HA   . ARG B 2 23 ? 4.312   -16.062 -0.835  1.00 0.00 ? 317 ARG B HA   1  
ATOM 651   H HB2  . ARG B 2 23 ? 5.411   -13.842 -0.533  1.00 0.00 ? 317 ARG B HB2  1  
ATOM 652   H HB3  . ARG B 2 23 ? 3.947   -13.258 0.243   1.00 0.00 ? 317 ARG B HB3  1  
ATOM 653   H HG2  . ARG B 2 23 ? 5.611   -13.850 1.896   1.00 0.00 ? 317 ARG B HG2  1  
ATOM 654   H HG3  . ARG B 2 23 ? 4.221   -14.932 2.011   1.00 0.00 ? 317 ARG B HG3  1  
ATOM 655   H HD2  . ARG B 2 23 ? 5.430   -16.642 0.769   1.00 0.00 ? 317 ARG B HD2  1  
ATOM 656   H HD3  . ARG B 2 23 ? 6.807   -15.557 0.586   1.00 0.00 ? 317 ARG B HD3  1  
ATOM 657   H HE   . ARG B 2 23 ? 6.268   -15.825 3.316   1.00 0.00 ? 317 ARG B HE   1  
ATOM 658   H HH11 . ARG B 2 23 ? 7.393   -17.794 0.648   1.00 0.00 ? 317 ARG B HH11 1  
ATOM 659   H HH12 . ARG B 2 23 ? 8.341   -18.834 1.656   1.00 0.00 ? 317 ARG B HH12 1  
ATOM 660   H HH21 . ARG B 2 23 ? 7.520   -17.199 4.637   1.00 0.00 ? 317 ARG B HH21 1  
ATOM 661   H HH22 . ARG B 2 23 ? 8.413   -18.497 3.920   1.00 0.00 ? 317 ARG B HH22 1  
ATOM 662   N N    . PHE B 2 24 ? 1.445   -14.619 -0.093  1.00 0.00 ? 318 PHE B N    1  
ATOM 663   C CA   . PHE B 2 24 ? 0.156   -14.827 0.562   1.00 0.00 ? 318 PHE B CA   1  
ATOM 664   C C    . PHE B 2 24 ? -0.843  -15.417 -0.438  1.00 0.00 ? 318 PHE B C    1  
ATOM 665   O O    . PHE B 2 24 ? -2.017  -15.040 -0.457  1.00 0.00 ? 318 PHE B O    1  
ATOM 666   C CB   . PHE B 2 24 ? -0.373  -13.505 1.146   1.00 0.00 ? 318 PHE B CB   1  
ATOM 667   C CG   . PHE B 2 24 ? 0.676   -12.702 1.856   1.00 0.00 ? 318 PHE B CG   1  
ATOM 668   C CD1  . PHE B 2 24 ? 1.382   -13.236 2.918   1.00 0.00 ? 318 PHE B CD1  1  
ATOM 669   C CD2  . PHE B 2 24 ? 0.958   -11.415 1.453   1.00 0.00 ? 318 PHE B CD2  1  
ATOM 670   C CE1  . PHE B 2 24 ? 2.355   -12.493 3.561   1.00 0.00 ? 318 PHE B CE1  1  
ATOM 671   C CE2  . PHE B 2 24 ? 1.925   -10.669 2.091   1.00 0.00 ? 318 PHE B CE2  1  
ATOM 672   C CZ   . PHE B 2 24 ? 2.626   -11.205 3.143   1.00 0.00 ? 318 PHE B CZ   1  
ATOM 673   H H    . PHE B 2 24 ? 1.570   -13.824 -0.653  1.00 0.00 ? 318 PHE B H    1  
ATOM 674   H HA   . PHE B 2 24 ? 0.302   -15.535 1.366   1.00 0.00 ? 318 PHE B HA   1  
ATOM 675   H HB2  . PHE B 2 24 ? -0.781  -12.898 0.354   1.00 0.00 ? 318 PHE B HB2  1  
ATOM 676   H HB3  . PHE B 2 24 ? -1.152  -13.719 1.855   1.00 0.00 ? 318 PHE B HB3  1  
ATOM 677   H HD1  . PHE B 2 24 ? 1.165   -14.244 3.242   1.00 0.00 ? 318 PHE B HD1  1  
ATOM 678   H HD2  . PHE B 2 24 ? 0.406   -10.992 0.630   1.00 0.00 ? 318 PHE B HD2  1  
ATOM 679   H HE1  . PHE B 2 24 ? 2.898   -12.918 4.388   1.00 0.00 ? 318 PHE B HE1  1  
ATOM 680   H HE2  . PHE B 2 24 ? 2.136   -9.666  1.765   1.00 0.00 ? 318 PHE B HE2  1  
ATOM 681   H HZ   . PHE B 2 24 ? 3.385   -10.614 3.637   1.00 0.00 ? 318 PHE B HZ   1  
ATOM 682   N N    . GLN B 2 25 ? -0.353  -16.344 -1.275  1.00 0.00 ? 319 GLN B N    1  
ATOM 683   C CA   . GLN B 2 25 ? -1.172  -17.003 -2.294  1.00 0.00 ? 319 GLN B CA   1  
ATOM 684   C C    . GLN B 2 25 ? -2.492  -17.494 -1.704  1.00 0.00 ? 319 GLN B C    1  
ATOM 685   O O    . GLN B 2 25 ? -3.566  -17.186 -2.222  1.00 0.00 ? 319 GLN B O    1  
ATOM 686   C CB   . GLN B 2 25 ? -0.405  -18.179 -2.907  1.00 0.00 ? 319 GLN B CB   1  
ATOM 687   C CG   . GLN B 2 25 ? -0.521  -18.263 -4.420  1.00 0.00 ? 319 GLN B CG   1  
ATOM 688   C CD   . GLN B 2 25 ? -1.959  -18.350 -4.899  1.00 0.00 ? 319 GLN B CD   1  
ATOM 689   O OE1  . GLN B 2 25 ? -2.683  -19.285 -4.558  1.00 0.00 ? 319 GLN B OE1  1  
ATOM 690   N NE2  . GLN B 2 25 ? -2.381  -17.371 -5.692  1.00 0.00 ? 319 GLN B NE2  1  
ATOM 691   H H    . GLN B 2 25 ? 0.592   -16.590 -1.207  1.00 0.00 ? 319 GLN B H    1  
ATOM 692   H HA   . GLN B 2 25 ? -1.384  -16.280 -3.067  1.00 0.00 ? 319 GLN B HA   1  
ATOM 693   H HB2  . GLN B 2 25 ? 0.640   -18.085 -2.653  1.00 0.00 ? 319 GLN B HB2  1  
ATOM 694   H HB3  . GLN B 2 25 ? -0.785  -19.099 -2.488  1.00 0.00 ? 319 GLN B HB3  1  
ATOM 695   H HG2  . GLN B 2 25 ? -0.068  -17.382 -4.848  1.00 0.00 ? 319 GLN B HG2  1  
ATOM 696   H HG3  . GLN B 2 25 ? 0.010   -19.140 -4.759  1.00 0.00 ? 319 GLN B HG3  1  
ATOM 697   H HE21 . GLN B 2 25 ? -1.751  -16.655 -5.923  1.00 0.00 ? 319 GLN B HE21 1  
ATOM 698   H HE22 . GLN B 2 25 ? -3.305  -17.403 -6.015  1.00 0.00 ? 319 GLN B HE22 1  
ATOM 699   N N    . GLY B 2 26 ? -2.399  -18.246 -0.603  1.00 0.00 ? 320 GLY B N    1  
ATOM 700   C CA   . GLY B 2 26 ? -3.586  -18.754 0.059   1.00 0.00 ? 320 GLY B CA   1  
ATOM 701   C C    . GLY B 2 26 ? -3.978  -17.893 1.244   1.00 0.00 ? 320 GLY B C    1  
ATOM 702   O O    . GLY B 2 26 ? -4.480  -18.399 2.249   1.00 0.00 ? 320 GLY B O    1  
ATOM 703   H H    . GLY B 2 26 ? -1.514  -18.442 -0.228  1.00 0.00 ? 320 GLY B H    1  
ATOM 704   H HA2  . GLY B 2 26 ? -4.403  -18.775 -0.648  1.00 0.00 ? 320 GLY B HA2  1  
ATOM 705   H HA3  . GLY B 2 26 ? -3.393  -19.758 0.404   1.00 0.00 ? 320 GLY B HA3  1  
ATOM 706   N N    . GLN B 2 27 ? -3.738  -16.586 1.123   1.00 0.00 ? 321 GLN B N    1  
ATOM 707   C CA   . GLN B 2 27 ? -4.050  -15.639 2.181   1.00 0.00 ? 321 GLN B CA   1  
ATOM 708   C C    . GLN B 2 27 ? -4.799  -14.431 1.630   1.00 0.00 ? 321 GLN B C    1  
ATOM 709   O O    . GLN B 2 27 ? -4.267  -13.318 1.600   1.00 0.00 ? 321 GLN B O    1  
ATOM 710   C CB   . GLN B 2 27 ? -2.766  -15.166 2.860   1.00 0.00 ? 321 GLN B CB   1  
ATOM 711   C CG   . GLN B 2 27 ? -2.100  -16.197 3.748   1.00 0.00 ? 321 GLN B CG   1  
ATOM 712   C CD   . GLN B 2 27 ? -2.980  -16.703 4.888   1.00 0.00 ? 321 GLN B CD   1  
ATOM 713   O OE1  . GLN B 2 27 ? -2.679  -17.729 5.497   1.00 0.00 ? 321 GLN B OE1  1  
ATOM 714   N NE2  . GLN B 2 27 ? -4.052  -15.978 5.212   1.00 0.00 ? 321 GLN B NE2  1  
ATOM 715   H H    . GLN B 2 27 ? -3.329  -16.250 0.298   1.00 0.00 ? 321 GLN B H    1  
ATOM 716   H HA   . GLN B 2 27 ? -4.672  -16.138 2.907   1.00 0.00 ? 321 GLN B HA   1  
ATOM 717   H HB2  . GLN B 2 27 ? -2.065  -14.898 2.092   1.00 0.00 ? 321 GLN B HB2  1  
ATOM 718   H HB3  . GLN B 2 27 ? -2.981  -14.293 3.455   1.00 0.00 ? 321 GLN B HB3  1  
ATOM 719   H HG2  . GLN B 2 27 ? -1.805  -17.039 3.139   1.00 0.00 ? 321 GLN B HG2  1  
ATOM 720   H HG3  . GLN B 2 27 ? -1.220  -15.738 4.176   1.00 0.00 ? 321 GLN B HG3  1  
ATOM 721   H HE21 . GLN B 2 27 ? -4.231  -15.155 4.713   1.00 0.00 ? 321 GLN B HE21 1  
ATOM 722   H HE22 . GLN B 2 27 ? -4.621  -16.300 5.942   1.00 0.00 ? 321 GLN B HE22 1  
ATOM 723   N N    . PRO B 2 28 ? -6.058  -14.626 1.204   1.00 0.00 ? 322 PRO B N    1  
ATOM 724   C CA   . PRO B 2 28 ? -6.881  -13.534 0.683   1.00 0.00 ? 322 PRO B CA   1  
ATOM 725   C C    . PRO B 2 28 ? -7.082  -12.441 1.732   1.00 0.00 ? 322 PRO B C    1  
ATOM 726   O O    . PRO B 2 28 ? -7.328  -11.284 1.394   1.00 0.00 ? 322 PRO B O    1  
ATOM 727   C CB   . PRO B 2 28 ? -8.216  -14.209 0.339   1.00 0.00 ? 322 PRO B CB   1  
ATOM 728   C CG   . PRO B 2 28 ? -8.220  -15.483 1.114   1.00 0.00 ? 322 PRO B CG   1  
ATOM 729   C CD   . PRO B 2 28 ? -6.784  -15.907 1.222   1.00 0.00 ? 322 PRO B CD   1  
ATOM 730   H HA   . PRO B 2 28 ? -6.447  -13.101 -0.208  1.00 0.00 ? 322 PRO B HA   1  
ATOM 731   H HB2  . PRO B 2 28 ? -9.033  -13.566 0.633   1.00 0.00 ? 322 PRO B HB2  1  
ATOM 732   H HB3  . PRO B 2 28 ? -8.264  -14.396 -0.724  1.00 0.00 ? 322 PRO B HB3  1  
ATOM 733   H HG2  . PRO B 2 28 ? -8.636  -15.314 2.097   1.00 0.00 ? 322 PRO B HG2  1  
ATOM 734   H HG3  . PRO B 2 28 ? -8.793  -16.232 0.587   1.00 0.00 ? 322 PRO B HG3  1  
ATOM 735   H HD2  . PRO B 2 28 ? -6.614  -16.436 2.148   1.00 0.00 ? 322 PRO B HD2  1  
ATOM 736   H HD3  . PRO B 2 28 ? -6.505  -16.520 0.377   1.00 0.00 ? 322 PRO B HD3  1  
ATOM 737   N N    . ASP B 2 29 ? -6.957  -12.821 3.011   1.00 0.00 ? 323 ASP B N    1  
ATOM 738   C CA   . ASP B 2 29 ? -7.104  -11.884 4.116   1.00 0.00 ? 323 ASP B CA   1  
ATOM 739   C C    . ASP B 2 29 ? -5.943  -10.896 4.153   1.00 0.00 ? 323 ASP B C    1  
ATOM 740   O O    . ASP B 2 29 ? -6.130  -9.729  4.486   1.00 0.00 ? 323 ASP B O    1  
ATOM 741   C CB   . ASP B 2 29 ? -7.195  -12.636 5.448   1.00 0.00 ? 323 ASP B CB   1  
ATOM 742   C CG   . ASP B 2 29 ? -8.374  -13.591 5.499   1.00 0.00 ? 323 ASP B CG   1  
ATOM 743   O OD1  . ASP B 2 29 ? -9.527  -13.119 5.404   1.00 0.00 ? 323 ASP B OD1  1  
ATOM 744   O OD2  . ASP B 2 29 ? -8.143  -14.811 5.629   1.00 0.00 ? 323 ASP B OD2  1  
ATOM 745   H H    . ASP B 2 29 ? -6.738  -13.754 3.215   1.00 0.00 ? 323 ASP B H    1  
ATOM 746   H HA   . ASP B 2 29 ? -8.021  -11.334 3.961   1.00 0.00 ? 323 ASP B HA   1  
ATOM 747   H HB2  . ASP B 2 29 ? -6.289  -13.206 5.594   1.00 0.00 ? 323 ASP B HB2  1  
ATOM 748   H HB3  . ASP B 2 29 ? -7.299  -11.922 6.251   1.00 0.00 ? 323 ASP B HB3  1  
ATOM 749   N N    . ILE B 2 30 ? -4.741  -11.373 3.814   1.00 0.00 ? 324 ILE B N    1  
ATOM 750   C CA   . ILE B 2 30 ? -3.551  -10.531 3.817   1.00 0.00 ? 324 ILE B CA   1  
ATOM 751   C C    . ILE B 2 30 ? -3.562  -9.555  2.658   1.00 0.00 ? 324 ILE B C    1  
ATOM 752   O O    . ILE B 2 30 ? -3.368  -8.355  2.841   1.00 0.00 ? 324 ILE B O    1  
ATOM 753   C CB   . ILE B 2 30 ? -2.271  -11.359 3.713   1.00 0.00 ? 324 ILE B CB   1  
ATOM 754   C CG1  . ILE B 2 30 ? -2.222  -12.381 4.845   1.00 0.00 ? 324 ILE B CG1  1  
ATOM 755   C CG2  . ILE B 2 30 ? -1.057  -10.430 3.729   1.00 0.00 ? 324 ILE B CG2  1  
ATOM 756   C CD1  . ILE B 2 30 ? -1.014  -13.266 4.772   1.00 0.00 ? 324 ILE B CD1  1  
ATOM 757   H H    . ILE B 2 30 ? -4.652  -12.317 3.555   1.00 0.00 ? 324 ILE B H    1  
ATOM 758   H HA   . ILE B 2 30 ? -3.524  -9.985  4.746   1.00 0.00 ? 324 ILE B HA   1  
ATOM 759   H HB   . ILE B 2 30 ? -2.280  -11.886 2.768   1.00 0.00 ? 324 ILE B HB   1  
ATOM 760   H HG12 . ILE B 2 30 ? -2.209  -11.869 5.794   1.00 0.00 ? 324 ILE B HG12 1  
ATOM 761   H HG13 . ILE B 2 30 ? -3.102  -13.016 4.787   1.00 0.00 ? 324 ILE B HG13 1  
ATOM 762   H HG21 . ILE B 2 30 ? -0.179  -10.983 4.023   1.00 0.00 ? 324 ILE B HG21 1  
ATOM 763   H HG22 . ILE B 2 30 ? -1.230  -9.622  4.434   1.00 0.00 ? 324 ILE B HG22 1  
ATOM 764   H HG23 . ILE B 2 30 ? -0.908  -10.014 2.732   1.00 0.00 ? 324 ILE B HG23 1  
ATOM 765   H HD11 . ILE B 2 30 ? -0.885  -13.593 3.752   1.00 0.00 ? 324 ILE B HD11 1  
ATOM 766   H HD12 . ILE B 2 30 ? -1.152  -14.120 5.416   1.00 0.00 ? 324 ILE B HD12 1  
ATOM 767   H HD13 . ILE B 2 30 ? -0.145  -12.709 5.085   1.00 0.00 ? 324 ILE B HD13 1  
ATOM 768   N N    . TYR B 2 31 ? -3.770  -10.091 1.464   1.00 0.00 ? 325 TYR B N    1  
ATOM 769   C CA   . TYR B 2 31 ? -3.785  -9.277  0.256   1.00 0.00 ? 325 TYR B CA   1  
ATOM 770   C C    . TYR B 2 31 ? -4.894  -8.229  0.340   1.00 0.00 ? 325 TYR B C    1  
ATOM 771   O O    . TYR B 2 31 ? -4.648  -7.043  0.115   1.00 0.00 ? 325 TYR B O    1  
ATOM 772   C CB   . TYR B 2 31 ? -3.982  -10.169 -0.971  1.00 0.00 ? 325 TYR B CB   1  
ATOM 773   C CG   . TYR B 2 31 ? -3.430  -9.580  -2.248  1.00 0.00 ? 325 TYR B CG   1  
ATOM 774   C CD1  . TYR B 2 31 ? -2.096  -9.196  -2.339  1.00 0.00 ? 325 TYR B CD1  1  
ATOM 775   C CD2  . TYR B 2 31 ? -4.238  -9.427  -3.367  1.00 0.00 ? 325 TYR B CD2  1  
ATOM 776   C CE1  . TYR B 2 31 ? -1.587  -8.674  -3.520  1.00 0.00 ? 325 TYR B CE1  1  
ATOM 777   C CE2  . TYR B 2 31 ? -3.738  -8.906  -4.541  1.00 0.00 ? 325 TYR B CE2  1  
ATOM 778   C CZ   . TYR B 2 31 ? -2.417  -8.533  -4.613  1.00 0.00 ? 325 TYR B CZ   1  
ATOM 779   O OH   . TYR B 2 31 ? -1.919  -8.027  -5.788  1.00 0.00 ? 325 TYR B OH   1  
ATOM 780   H H    . TYR B 2 31 ? -3.893  -11.066 1.394   1.00 0.00 ? 325 TYR B H    1  
ATOM 781   H HA   . TYR B 2 31 ? -2.832  -8.775  0.181   1.00 0.00 ? 325 TYR B HA   1  
ATOM 782   H HB2  . TYR B 2 31 ? -3.489  -11.115 -0.803  1.00 0.00 ? 325 TYR B HB2  1  
ATOM 783   H HB3  . TYR B 2 31 ? -5.039  -10.342 -1.114  1.00 0.00 ? 325 TYR B HB3  1  
ATOM 784   H HD1  . TYR B 2 31 ? -1.453  -9.309  -1.466  1.00 0.00 ? 325 TYR B HD1  1  
ATOM 785   H HD2  . TYR B 2 31 ? -5.275  -9.718  -3.310  1.00 0.00 ? 325 TYR B HD2  1  
ATOM 786   H HE1  . TYR B 2 31 ? -0.548  -8.377  -3.586  1.00 0.00 ? 325 TYR B HE1  1  
ATOM 787   H HE2  . TYR B 2 31 ? -4.383  -8.793  -5.400  1.00 0.00 ? 325 TYR B HE2  1  
ATOM 788   H HH   . TYR B 2 31 ? -1.591  -7.143  -5.639  1.00 0.00 ? 325 TYR B HH   1  
ATOM 789   N N    . LYS B 2 32 ? -6.104  -8.665  0.697   1.00 0.00 ? 326 LYS B N    1  
ATOM 790   C CA   . LYS B 2 32 ? -7.234  -7.749  0.848   1.00 0.00 ? 326 LYS B CA   1  
ATOM 791   C C    . LYS B 2 32 ? -6.957  -6.729  1.951   1.00 0.00 ? 326 LYS B C    1  
ATOM 792   O O    . LYS B 2 32 ? -7.104  -5.524  1.742   1.00 0.00 ? 326 LYS B O    1  
ATOM 793   C CB   . LYS B 2 32 ? -8.523  -8.517  1.158   1.00 0.00 ? 326 LYS B CB   1  
ATOM 794   C CG   . LYS B 2 32 ? -9.097  -9.259  -0.039  1.00 0.00 ? 326 LYS B CG   1  
ATOM 795   C CD   . LYS B 2 32 ? -9.544  -8.291  -1.125  1.00 0.00 ? 326 LYS B CD   1  
ATOM 796   C CE   . LYS B 2 32 ? -10.122 -9.021  -2.327  1.00 0.00 ? 326 LYS B CE   1  
ATOM 797   N NZ   . LYS B 2 32 ? -10.578 -8.075  -3.385  1.00 0.00 ? 326 LYS B NZ   1  
ATOM 798   H H    . LYS B 2 32 ? -6.233  -9.619  0.889   1.00 0.00 ? 326 LYS B H    1  
ATOM 799   H HA   . LYS B 2 32 ? -7.356  -7.222  -0.087  1.00 0.00 ? 326 LYS B HA   1  
ATOM 800   H HB2  . LYS B 2 32 ? -8.321  -9.238  1.937   1.00 0.00 ? 326 LYS B HB2  1  
ATOM 801   H HB3  . LYS B 2 32 ? -9.268  -7.819  1.512   1.00 0.00 ? 326 LYS B HB3  1  
ATOM 802   H HG2  . LYS B 2 32 ? -8.338  -9.914  -0.442  1.00 0.00 ? 326 LYS B HG2  1  
ATOM 803   H HG3  . LYS B 2 32 ? -9.946  -9.843  0.285   1.00 0.00 ? 326 LYS B HG3  1  
ATOM 804   H HD2  . LYS B 2 32 ? -10.299 -7.636  -0.719  1.00 0.00 ? 326 LYS B HD2  1  
ATOM 805   H HD3  . LYS B 2 32 ? -8.693  -7.708  -1.445  1.00 0.00 ? 326 LYS B HD3  1  
ATOM 806   H HE2  . LYS B 2 32 ? -9.362  -9.668  -2.739  1.00 0.00 ? 326 LYS B HE2  1  
ATOM 807   H HE3  . LYS B 2 32 ? -10.962 -9.616  -2.001  1.00 0.00 ? 326 LYS B HE3  1  
ATOM 808   H HZ1  . LYS B 2 32 ? -11.484 -7.644  -3.112  1.00 0.00 ? 326 LYS B HZ1  1  
ATOM 809   H HZ2  . LYS B 2 32 ? -10.703 -8.579  -4.285  1.00 0.00 ? 326 LYS B HZ2  1  
ATOM 810   H HZ3  . LYS B 2 32 ? -9.874  -7.321  -3.519  1.00 0.00 ? 326 LYS B HZ3  1  
ATOM 811   N N    . ALA B 2 33 ? -6.548  -7.225  3.125   1.00 0.00 ? 327 ALA B N    1  
ATOM 812   C CA   . ALA B 2 33 ? -6.241  -6.363  4.267   1.00 0.00 ? 327 ALA B CA   1  
ATOM 813   C C    . ALA B 2 33 ? -5.178  -5.330  3.913   1.00 0.00 ? 327 ALA B C    1  
ATOM 814   O O    . ALA B 2 33 ? -5.376  -4.137  4.123   1.00 0.00 ? 327 ALA B O    1  
ATOM 815   C CB   . ALA B 2 33 ? -5.781  -7.194  5.458   1.00 0.00 ? 327 ALA B CB   1  
ATOM 816   H H    . ALA B 2 33 ? -6.447  -8.195  3.222   1.00 0.00 ? 327 ALA B H    1  
ATOM 817   H HA   . ALA B 2 33 ? -7.149  -5.848  4.548   1.00 0.00 ? 327 ALA B HA   1  
ATOM 818   H HB1  . ALA B 2 33 ? -5.504  -6.538  6.269   1.00 0.00 ? 327 ALA B HB1  1  
ATOM 819   H HB2  . ALA B 2 33 ? -4.927  -7.793  5.172   1.00 0.00 ? 327 ALA B HB2  1  
ATOM 820   H HB3  . ALA B 2 33 ? -6.584  -7.842  5.777   1.00 0.00 ? 327 ALA B HB3  1  
ATOM 821   N N    . PHE B 2 34 ? -4.054  -5.802  3.370   1.00 0.00 ? 328 PHE B N    1  
ATOM 822   C CA   . PHE B 2 34 ? -2.945  -4.928  2.982   1.00 0.00 ? 328 PHE B CA   1  
ATOM 823   C C    . PHE B 2 34 ? -3.442  -3.770  2.120   1.00 0.00 ? 328 PHE B C    1  
ATOM 824   O O    . PHE B 2 34 ? -3.134  -2.611  2.398   1.00 0.00 ? 328 PHE B O    1  
ATOM 825   C CB   . PHE B 2 34 ? -1.885  -5.743  2.230   1.00 0.00 ? 328 PHE B CB   1  
ATOM 826   C CG   . PHE B 2 34 ? -0.636  -4.979  1.883   1.00 0.00 ? 328 PHE B CG   1  
ATOM 827   C CD1  . PHE B 2 34 ? -0.653  -3.982  0.920   1.00 0.00 ? 328 PHE B CD1  1  
ATOM 828   C CD2  . PHE B 2 34 ? 0.559   -5.268  2.519   1.00 0.00 ? 328 PHE B CD2  1  
ATOM 829   C CE1  . PHE B 2 34 ? 0.499   -3.290  0.601   1.00 0.00 ? 328 PHE B CE1  1  
ATOM 830   C CE2  . PHE B 2 34 ? 1.714   -4.578  2.205   1.00 0.00 ? 328 PHE B CE2  1  
ATOM 831   C CZ   . PHE B 2 34 ? 1.684   -3.589  1.243   1.00 0.00 ? 328 PHE B CZ   1  
ATOM 832   H H    . PHE B 2 34 ? -3.966  -6.768  3.227   1.00 0.00 ? 328 PHE B H    1  
ATOM 833   H HA   . PHE B 2 34 ? -2.506  -4.525  3.884   1.00 0.00 ? 328 PHE B HA   1  
ATOM 834   H HB2  . PHE B 2 34 ? -1.595  -6.585  2.840   1.00 0.00 ? 328 PHE B HB2  1  
ATOM 835   H HB3  . PHE B 2 34 ? -2.316  -6.110  1.309   1.00 0.00 ? 328 PHE B HB3  1  
ATOM 836   H HD1  . PHE B 2 34 ? -1.579  -3.747  0.417   1.00 0.00 ? 328 PHE B HD1  1  
ATOM 837   H HD2  . PHE B 2 34 ? 0.584   -6.040  3.271   1.00 0.00 ? 328 PHE B HD2  1  
ATOM 838   H HE1  . PHE B 2 34 ? 0.474   -2.517  -0.152  1.00 0.00 ? 328 PHE B HE1  1  
ATOM 839   H HE2  . PHE B 2 34 ? 2.639   -4.814  2.709   1.00 0.00 ? 328 PHE B HE2  1  
ATOM 840   H HZ   . PHE B 2 34 ? 2.585   -3.050  0.994   1.00 0.00 ? 328 PHE B HZ   1  
ATOM 841   N N    . LEU B 2 35 ? -4.223  -4.083  1.089   1.00 0.00 ? 329 LEU B N    1  
ATOM 842   C CA   . LEU B 2 35 ? -4.770  -3.050  0.213   1.00 0.00 ? 329 LEU B CA   1  
ATOM 843   C C    . LEU B 2 35 ? -5.651  -2.083  1.006   1.00 0.00 ? 329 LEU B C    1  
ATOM 844   O O    . LEU B 2 35 ? -5.504  -0.866  0.890   1.00 0.00 ? 329 LEU B O    1  
ATOM 845   C CB   . LEU B 2 35 ? -5.555  -3.673  -0.945  1.00 0.00 ? 329 LEU B CB   1  
ATOM 846   C CG   . LEU B 2 35 ? -4.719  -4.532  -1.901  1.00 0.00 ? 329 LEU B CG   1  
ATOM 847   C CD1  . LEU B 2 35 ? -5.584  -5.065  -3.034  1.00 0.00 ? 329 LEU B CD1  1  
ATOM 848   C CD2  . LEU B 2 35 ? -3.541  -3.736  -2.452  1.00 0.00 ? 329 LEU B CD2  1  
ATOM 849   H H    . LEU B 2 35 ? -4.447  -5.024  0.923   1.00 0.00 ? 329 LEU B H    1  
ATOM 850   H HA   . LEU B 2 35 ? -3.937  -2.496  -0.191  1.00 0.00 ? 329 LEU B HA   1  
ATOM 851   H HB2  . LEU B 2 35 ? -6.340  -4.289  -0.531  1.00 0.00 ? 329 LEU B HB2  1  
ATOM 852   H HB3  . LEU B 2 35 ? -6.007  -2.876  -1.516  1.00 0.00 ? 329 LEU B HB3  1  
ATOM 853   H HG   . LEU B 2 35 ? -4.325  -5.379  -1.359  1.00 0.00 ? 329 LEU B HG   1  
ATOM 854   H HD11 . LEU B 2 35 ? -6.472  -5.523  -2.624  1.00 0.00 ? 329 LEU B HD11 1  
ATOM 855   H HD12 . LEU B 2 35 ? -5.027  -5.800  -3.596  1.00 0.00 ? 329 LEU B HD12 1  
ATOM 856   H HD13 . LEU B 2 35 ? -5.866  -4.251  -3.685  1.00 0.00 ? 329 LEU B HD13 1  
ATOM 857   H HD21 . LEU B 2 35 ? -3.893  -3.045  -3.203  1.00 0.00 ? 329 LEU B HD21 1  
ATOM 858   H HD22 . LEU B 2 35 ? -2.826  -4.414  -2.896  1.00 0.00 ? 329 LEU B HD22 1  
ATOM 859   H HD23 . LEU B 2 35 ? -3.065  -3.186  -1.650  1.00 0.00 ? 329 LEU B HD23 1  
ATOM 860   N N    . GLU B 2 36 ? -6.548  -2.632  1.832   1.00 0.00 ? 330 GLU B N    1  
ATOM 861   C CA   . GLU B 2 36 ? -7.432  -1.811  2.664   1.00 0.00 ? 330 GLU B CA   1  
ATOM 862   C C    . GLU B 2 36 ? -6.618  -0.931  3.611   1.00 0.00 ? 330 GLU B C    1  
ATOM 863   O O    . GLU B 2 36 ? -7.005  0.199   3.901   1.00 0.00 ? 330 GLU B O    1  
ATOM 864   C CB   . GLU B 2 36 ? -8.391  -2.692  3.474   1.00 0.00 ? 330 GLU B CB   1  
ATOM 865   C CG   . GLU B 2 36 ? -9.373  -3.487  2.621   1.00 0.00 ? 330 GLU B CG   1  
ATOM 866   C CD   . GLU B 2 36 ? -10.376 -2.618  1.871   1.00 0.00 ? 330 GLU B CD   1  
ATOM 867   O OE1  . GLU B 2 36 ? -10.365 -1.379  2.054   1.00 0.00 ? 330 GLU B OE1  1  
ATOM 868   O OE2  . GLU B 2 36 ? -11.180 -3.183  1.102   1.00 0.00 ? 330 GLU B OE2  1  
ATOM 869   H H    . GLU B 2 36 ? -6.605  -3.609  1.895   1.00 0.00 ? 330 GLU B H    1  
ATOM 870   H HA   . GLU B 2 36 ? -8.007  -1.173  2.007   1.00 0.00 ? 330 GLU B HA   1  
ATOM 871   H HB2  . GLU B 2 36 ? -7.810  -3.390  4.058   1.00 0.00 ? 330 GLU B HB2  1  
ATOM 872   H HB3  . GLU B 2 36 ? -8.958  -2.062  4.144   1.00 0.00 ? 330 GLU B HB3  1  
ATOM 873   H HG2  . GLU B 2 36 ? -8.815  -4.061  1.899   1.00 0.00 ? 330 GLU B HG2  1  
ATOM 874   H HG3  . GLU B 2 36 ? -9.919  -4.161  3.266   1.00 0.00 ? 330 GLU B HG3  1  
ATOM 875   N N    . ILE B 2 37 ? -5.479  -1.454  4.073   1.00 0.00 ? 331 ILE B N    1  
ATOM 876   C CA   . ILE B 2 37 ? -4.590  -0.721  4.969   1.00 0.00 ? 331 ILE B CA   1  
ATOM 877   C C    . ILE B 2 37 ? -4.135  0.578   4.311   1.00 0.00 ? 331 ILE B C    1  
ATOM 878   O O    . ILE B 2 37 ? -4.296  1.664   4.872   1.00 0.00 ? 331 ILE B O    1  
ATOM 879   C CB   . ILE B 2 37 ? -3.364  -1.578  5.338   1.00 0.00 ? 331 ILE B CB   1  
ATOM 880   C CG1  . ILE B 2 37 ? -3.795  -2.749  6.217   1.00 0.00 ? 331 ILE B CG1  1  
ATOM 881   C CG2  . ILE B 2 37 ? -2.301  -0.750  6.038   1.00 0.00 ? 331 ILE B CG2  1  
ATOM 882   C CD1  . ILE B 2 37 ? -2.703  -3.763  6.434   1.00 0.00 ? 331 ILE B CD1  1  
ATOM 883   H H    . ILE B 2 37 ? -5.222  -2.357  3.790   1.00 0.00 ? 331 ILE B H    1  
ATOM 884   H HA   . ILE B 2 37 ? -5.131  -0.496  5.875   1.00 0.00 ? 331 ILE B HA   1  
ATOM 885   H HB   . ILE B 2 37 ? -2.937  -1.965  4.427   1.00 0.00 ? 331 ILE B HB   1  
ATOM 886   H HG12 . ILE B 2 37 ? -4.094  -2.372  7.183   1.00 0.00 ? 331 ILE B HG12 1  
ATOM 887   H HG13 . ILE B 2 37 ? -4.630  -3.250  5.760   1.00 0.00 ? 331 ILE B HG13 1  
ATOM 888   H HG21 . ILE B 2 37 ? -2.689  -0.381  6.976   1.00 0.00 ? 331 ILE B HG21 1  
ATOM 889   H HG22 . ILE B 2 37 ? -2.020  0.083   5.411   1.00 0.00 ? 331 ILE B HG22 1  
ATOM 890   H HG23 . ILE B 2 37 ? -1.435  -1.367  6.224   1.00 0.00 ? 331 ILE B HG23 1  
ATOM 891   H HD11 . ILE B 2 37 ? -2.278  -4.042  5.484   1.00 0.00 ? 331 ILE B HD11 1  
ATOM 892   H HD12 . ILE B 2 37 ? -3.113  -4.636  6.917   1.00 0.00 ? 331 ILE B HD12 1  
ATOM 893   H HD13 . ILE B 2 37 ? -1.938  -3.331  7.057   1.00 0.00 ? 331 ILE B HD13 1  
ATOM 894   N N    . LEU B 2 38 ? -3.593  0.450   3.102   1.00 0.00 ? 332 LEU B N    1  
ATOM 895   C CA   . LEU B 2 38 ? -3.136  1.601   2.328   1.00 0.00 ? 332 LEU B CA   1  
ATOM 896   C C    . LEU B 2 38 ? -4.322  2.503   2.011   1.00 0.00 ? 332 LEU B C    1  
ATOM 897   O O    . LEU B 2 38 ? -4.286  3.711   2.246   1.00 0.00 ? 332 LEU B O    1  
ATOM 898   C CB   . LEU B 2 38 ? -2.488  1.136   1.023   1.00 0.00 ? 332 LEU B CB   1  
ATOM 899   C CG   . LEU B 2 38 ? -1.536  -0.053  1.154   1.00 0.00 ? 332 LEU B CG   1  
ATOM 900   C CD1  . LEU B 2 38 ? -0.998  -0.453  -0.206  1.00 0.00 ? 332 LEU B CD1  1  
ATOM 901   C CD2  . LEU B 2 38 ? -0.406  0.275   2.113   1.00 0.00 ? 332 LEU B CD2  1  
ATOM 902   H H    . LEU B 2 38 ? -3.518  -0.446  2.710   1.00 0.00 ? 332 LEU B H    1  
ATOM 903   H HA   . LEU B 2 38 ? -2.415  2.147   2.917   1.00 0.00 ? 332 LEU B HA   1  
ATOM 904   H HB2  . LEU B 2 38 ? -3.274  0.866   0.336   1.00 0.00 ? 332 LEU B HB2  1  
ATOM 905   H HB3  . LEU B 2 38 ? -1.937  1.965   0.605   1.00 0.00 ? 332 LEU B HB3  1  
ATOM 906   H HG   . LEU B 2 38 ? -2.079  -0.895  1.553   1.00 0.00 ? 332 LEU B HG   1  
ATOM 907   H HD11 . LEU B 2 38 ? 0.024   -0.780  -0.109  1.00 0.00 ? 332 LEU B HD11 1  
ATOM 908   H HD12 . LEU B 2 38 ? -1.045  0.395   -0.872  1.00 0.00 ? 332 LEU B HD12 1  
ATOM 909   H HD13 . LEU B 2 38 ? -1.601  -1.259  -0.606  1.00 0.00 ? 332 LEU B HD13 1  
ATOM 910   H HD21 . LEU B 2 38 ? 0.541   0.160   1.610   1.00 0.00 ? 332 LEU B HD21 1  
ATOM 911   H HD22 . LEU B 2 38 ? -0.451  -0.395  2.959   1.00 0.00 ? 332 LEU B HD22 1  
ATOM 912   H HD23 . LEU B 2 38 ? -0.513  1.293   2.456   1.00 0.00 ? 332 LEU B HD23 1  
ATOM 913   N N    . HIS B 2 39 ? -5.374  1.888   1.471   1.00 0.00 ? 333 HIS B N    1  
ATOM 914   C CA   . HIS B 2 39 ? -6.602  2.604   1.109   1.00 0.00 ? 333 HIS B CA   1  
ATOM 915   C C    . HIS B 2 39 ? -7.190  3.375   2.298   1.00 0.00 ? 333 HIS B C    1  
ATOM 916   O O    . HIS B 2 39 ? -7.745  4.456   2.120   1.00 0.00 ? 333 HIS B O    1  
ATOM 917   C CB   . HIS B 2 39 ? -7.650  1.639   0.545   1.00 0.00 ? 333 HIS B CB   1  
ATOM 918   C CG   . HIS B 2 39 ? -7.400  1.234   -0.875  1.00 0.00 ? 333 HIS B CG   1  
ATOM 919   N ND1  . HIS B 2 39 ? -7.316  2.138   -1.913  1.00 0.00 ? 333 HIS B ND1  1  
ATOM 920   C CD2  . HIS B 2 39 ? -7.223  0.013   -1.428  1.00 0.00 ? 333 HIS B CD2  1  
ATOM 921   C CE1  . HIS B 2 39 ? -7.099  1.489   -3.043  1.00 0.00 ? 333 HIS B CE1  1  
ATOM 922   N NE2  . HIS B 2 39 ? -7.039  0.198   -2.776  1.00 0.00 ? 333 HIS B NE2  1  
ATOM 923   H H    . HIS B 2 39 ? -5.316  0.918   1.308   1.00 0.00 ? 333 HIS B H    1  
ATOM 924   H HA   . HIS B 2 39 ? -6.335  3.321   0.338   1.00 0.00 ? 333 HIS B HA   1  
ATOM 925   H HB2  . HIS B 2 39 ? -7.660  0.742   1.146   1.00 0.00 ? 333 HIS B HB2  1  
ATOM 926   H HB3  . HIS B 2 39 ? -8.623  2.104   0.593   1.00 0.00 ? 333 HIS B HB3  1  
ATOM 927   H HD1  . HIS B 2 39 ? -7.403  3.111   -1.833  1.00 0.00 ? 333 HIS B HD1  1  
ATOM 928   H HD2  . HIS B 2 39 ? -7.224  -0.932  -0.905  1.00 0.00 ? 333 HIS B HD2  1  
ATOM 929   H HE1  . HIS B 2 39 ? -6.990  1.939   -4.019  1.00 0.00 ? 333 HIS B HE1  1  
ATOM 930   H HE2  . HIS B 2 39 ? -6.798  -0.501  -3.420  1.00 0.00 ? 333 HIS B HE2  1  
ATOM 931   N N    . THR B 2 40 ? -7.054  2.842   3.514   1.00 0.00 ? 334 THR B N    1  
ATOM 932   C CA   . THR B 2 40 ? -7.560  3.545   4.695   1.00 0.00 ? 334 THR B CA   1  
ATOM 933   C C    . THR B 2 40 ? -6.840  4.888   4.791   1.00 0.00 ? 334 THR B C    1  
ATOM 934   O O    . THR B 2 40 ? -7.462  5.938   4.958   1.00 0.00 ? 334 THR B O    1  
ATOM 935   C CB   . THR B 2 40 ? -7.338  2.709   5.969   1.00 0.00 ? 334 THR B CB   1  
ATOM 936   O OG1  . THR B 2 40 ? -8.114  1.524   5.931   1.00 0.00 ? 334 THR B OG1  1  
ATOM 937   C CG2  . THR B 2 40 ? -7.686  3.435   7.255   1.00 0.00 ? 334 THR B CG2  1  
ATOM 938   H H    . THR B 2 40 ? -6.590  1.985   3.621   1.00 0.00 ? 334 THR B H    1  
ATOM 939   H HA   . THR B 2 40 ? -8.618  3.719   4.556   1.00 0.00 ? 334 THR B HA   1  
ATOM 940   H HB   . THR B 2 40 ? -6.296  2.427   6.022   1.00 0.00 ? 334 THR B HB   1  
ATOM 941   H HG1  . THR B 2 40 ? -7.708  0.893   5.331   1.00 0.00 ? 334 THR B HG1  1  
ATOM 942   H HG21 . THR B 2 40 ? -7.092  3.037   8.069   1.00 0.00 ? 334 THR B HG21 1  
ATOM 943   H HG22 . THR B 2 40 ? -8.734  3.302   7.475   1.00 0.00 ? 334 THR B HG22 1  
ATOM 944   H HG23 . THR B 2 40 ? -7.474  4.487   7.143   1.00 0.00 ? 334 THR B HG23 1  
ATOM 945   N N    . TYR B 2 41 ? -5.520  4.827   4.634   1.00 0.00 ? 335 TYR B N    1  
ATOM 946   C CA   . TYR B 2 41 ? -4.656  6.002   4.646   1.00 0.00 ? 335 TYR B CA   1  
ATOM 947   C C    . TYR B 2 41 ? -5.067  6.998   3.550   1.00 0.00 ? 335 TYR B C    1  
ATOM 948   O O    . TYR B 2 41 ? -5.323  8.169   3.834   1.00 0.00 ? 335 TYR B O    1  
ATOM 949   C CB   . TYR B 2 41 ? -3.208  5.533   4.463   1.00 0.00 ? 335 TYR B CB   1  
ATOM 950   C CG   . TYR B 2 41 ? -2.179  6.631   4.358   1.00 0.00 ? 335 TYR B CG   1  
ATOM 951   C CD1  . TYR B 2 41 ? -2.162  7.486   3.272   1.00 0.00 ? 335 TYR B CD1  1  
ATOM 952   C CD2  . TYR B 2 41 ? -1.206  6.787   5.331   1.00 0.00 ? 335 TYR B CD2  1  
ATOM 953   C CE1  . TYR B 2 41 ? -1.205  8.468   3.155   1.00 0.00 ? 335 TYR B CE1  1  
ATOM 954   C CE2  . TYR B 2 41 ? -0.248  7.772   5.226   1.00 0.00 ? 335 TYR B CE2  1  
ATOM 955   C CZ   . TYR B 2 41 ? -0.249  8.610   4.135   1.00 0.00 ? 335 TYR B CZ   1  
ATOM 956   O OH   . TYR B 2 41 ? 0.709   9.591   4.022   1.00 0.00 ? 335 TYR B OH   1  
ATOM 957   H H    . TYR B 2 41 ? -5.109  3.950   4.472   1.00 0.00 ? 335 TYR B H    1  
ATOM 958   H HA   . TYR B 2 41 ? -4.746  6.484   5.607   1.00 0.00 ? 335 TYR B HA   1  
ATOM 959   H HB2  . TYR B 2 41 ? -2.936  4.915   5.304   1.00 0.00 ? 335 TYR B HB2  1  
ATOM 960   H HB3  . TYR B 2 41 ? -3.147  4.940   3.563   1.00 0.00 ? 335 TYR B HB3  1  
ATOM 961   H HD1  . TYR B 2 41 ? -2.917  7.376   2.506   1.00 0.00 ? 335 TYR B HD1  1  
ATOM 962   H HD2  . TYR B 2 41 ? -1.208  6.127   6.186   1.00 0.00 ? 335 TYR B HD2  1  
ATOM 963   H HE1  . TYR B 2 41 ? -1.208  9.114   2.299   1.00 0.00 ? 335 TYR B HE1  1  
ATOM 964   H HE2  . TYR B 2 41 ? 0.499   7.876   5.992   1.00 0.00 ? 335 TYR B HE2  1  
ATOM 965   H HH   . TYR B 2 41 ? 0.289   10.454  4.034   1.00 0.00 ? 335 TYR B HH   1  
ATOM 966   N N    . GLN B 2 42 ? -5.120  6.521   2.298   1.00 0.00 ? 336 GLN B N    1  
ATOM 967   C CA   . GLN B 2 42 ? -5.489  7.366   1.153   1.00 0.00 ? 336 GLN B CA   1  
ATOM 968   C C    . GLN B 2 42 ? -6.876  8.000   1.312   1.00 0.00 ? 336 GLN B C    1  
ATOM 969   O O    . GLN B 2 42 ? -7.065  9.167   0.965   1.00 0.00 ? 336 GLN B O    1  
ATOM 970   C CB   . GLN B 2 42 ? -5.395  6.576   -0.159  1.00 0.00 ? 336 GLN B CB   1  
ATOM 971   C CG   . GLN B 2 42 ? -6.385  5.453   -0.257  1.00 0.00 ? 336 GLN B CG   1  
ATOM 972   C CD   . GLN B 2 42 ? -7.753  5.831   -0.829  1.00 0.00 ? 336 GLN B CD   1  
ATOM 973   O OE1  . GLN B 2 42 ? -8.643  4.985   -0.900  1.00 0.00 ? 336 GLN B OE1  1  
ATOM 974   N NE2  . GLN B 2 42 ? -7.938  7.082   -1.253  1.00 0.00 ? 336 GLN B NE2  1  
ATOM 975   H H    . GLN B 2 42 ? -4.898  5.579   2.140   1.00 0.00 ? 336 GLN B H    1  
ATOM 976   H HA   . GLN B 2 42 ? -4.777  8.153   1.109   1.00 0.00 ? 336 GLN B HA   1  
ATOM 977   H HB2  . GLN B 2 42 ? -5.545  7.241   -0.989  1.00 0.00 ? 336 GLN B HB2  1  
ATOM 978   H HB3  . GLN B 2 42 ? -4.410  6.144   -0.231  1.00 0.00 ? 336 GLN B HB3  1  
ATOM 979   H HG2  . GLN B 2 42 ? -5.959  4.679   -0.869  1.00 0.00 ? 336 GLN B HG2  1  
ATOM 980   H HG3  . GLN B 2 42 ? -6.520  5.082   0.738   1.00 0.00 ? 336 GLN B HG3  1  
ATOM 981   H HE21 . GLN B 2 42 ? -7.198  7.716   -1.186  1.00 0.00 ? 336 GLN B HE21 1  
ATOM 982   H HE22 . GLN B 2 42 ? -8.816  7.317   -1.617  1.00 0.00 ? 336 GLN B HE22 1  
ATOM 983   N N    . LYS B 2 43 ? -7.845  7.230   1.822   1.00 0.00 ? 337 LYS B N    1  
ATOM 984   C CA   . LYS B 2 43 ? -9.212  7.732   2.003   1.00 0.00 ? 337 LYS B CA   1  
ATOM 985   C C    . LYS B 2 43 ? -9.264  8.917   2.965   1.00 0.00 ? 337 LYS B C    1  
ATOM 986   O O    . LYS B 2 43 ? -9.889  9.927   2.660   1.00 0.00 ? 337 LYS B O    1  
ATOM 987   C CB   . LYS B 2 43 ? -10.142 6.629   2.515   1.00 0.00 ? 337 LYS B CB   1  
ATOM 988   C CG   . LYS B 2 43 ? -10.455 5.548   1.492   1.00 0.00 ? 337 LYS B CG   1  
ATOM 989   C CD   . LYS B 2 43 ? -11.432 4.523   2.050   1.00 0.00 ? 337 LYS B CD   1  
ATOM 990   C CE   . LYS B 2 43 ? -10.882 3.839   3.295   1.00 0.00 ? 337 LYS B CE   1  
ATOM 991   N NZ   . LYS B 2 43 ? -11.868 2.899   3.898   1.00 0.00 ? 337 LYS B NZ   1  
ATOM 992   H H    . LYS B 2 43 ? -7.639  6.305   2.072   1.00 0.00 ? 337 LYS B H    1  
ATOM 993   H HA   . LYS B 2 43 ? -9.567  8.064   1.033   1.00 0.00 ? 337 LYS B HA   1  
ATOM 994   H HB2  . LYS B 2 43 ? -9.682  6.159   3.371   1.00 0.00 ? 337 LYS B HB2  1  
ATOM 995   H HB3  . LYS B 2 43 ? -11.074 7.080   2.824   1.00 0.00 ? 337 LYS B HB3  1  
ATOM 996   H HG2  . LYS B 2 43 ? -10.892 6.008   0.619   1.00 0.00 ? 337 LYS B HG2  1  
ATOM 997   H HG3  . LYS B 2 43 ? -9.540  5.048   1.218   1.00 0.00 ? 337 LYS B HG3  1  
ATOM 998   H HD2  . LYS B 2 43 ? -12.355 5.022   2.306   1.00 0.00 ? 337 LYS B HD2  1  
ATOM 999   H HD3  . LYS B 2 43 ? -11.623 3.775   1.295   1.00 0.00 ? 337 LYS B HD3  1  
ATOM 1000  H HE2  . LYS B 2 43 ? -9.994  3.288   3.024   1.00 0.00 ? 337 LYS B HE2  1  
ATOM 1001  H HE3  . LYS B 2 43 ? -10.627 4.595   4.023   1.00 0.00 ? 337 LYS B HE3  1  
ATOM 1002  H HZ1  . LYS B 2 43 ? -11.378 2.199   4.491   1.00 0.00 ? 337 LYS B HZ1  1  
ATOM 1003  H HZ2  . LYS B 2 43 ? -12.391 2.397   3.152   1.00 0.00 ? 337 LYS B HZ2  1  
ATOM 1004  H HZ3  . LYS B 2 43 ? -12.546 3.422   4.488   1.00 0.00 ? 337 LYS B HZ3  1  
ATOM 1005  N N    . GLU B 2 44 ? -8.619  8.788   4.128   1.00 0.00 ? 338 GLU B N    1  
ATOM 1006  C CA   . GLU B 2 44 ? -8.613  9.865   5.126   1.00 0.00 ? 338 GLU B CA   1  
ATOM 1007  C C    . GLU B 2 44 ? -8.195  11.199  4.505   1.00 0.00 ? 338 GLU B C    1  
ATOM 1008  O O    . GLU B 2 44 ? -8.734  12.247  4.866   1.00 0.00 ? 338 GLU B O    1  
ATOM 1009  C CB   . GLU B 2 44 ? -7.712  9.504   6.311   1.00 0.00 ? 338 GLU B CB   1  
ATOM 1010  C CG   . GLU B 2 44 ? -8.432  8.754   7.429   1.00 0.00 ? 338 GLU B CG   1  
ATOM 1011  C CD   . GLU B 2 44 ? -9.032  7.427   6.998   1.00 0.00 ? 338 GLU B CD   1  
ATOM 1012  O OE1  . GLU B 2 44 ? -9.955  7.428   6.154   1.00 0.00 ? 338 GLU B OE1  1  
ATOM 1013  O OE2  . GLU B 2 44 ? -8.586  6.385   7.516   1.00 0.00 ? 338 GLU B OE2  1  
ATOM 1014  H H    . GLU B 2 44 ? -8.142  7.953   4.322   1.00 0.00 ? 338 GLU B H    1  
ATOM 1015  H HA   . GLU B 2 44 ? -9.630  9.973   5.487   1.00 0.00 ? 338 GLU B HA   1  
ATOM 1016  H HB2  . GLU B 2 44 ? -6.902  8.885   5.957   1.00 0.00 ? 338 GLU B HB2  1  
ATOM 1017  H HB3  . GLU B 2 44 ? -7.303  10.413  6.726   1.00 0.00 ? 338 GLU B HB3  1  
ATOM 1018  H HG2  . GLU B 2 44 ? -7.727  8.563   8.222   1.00 0.00 ? 338 GLU B HG2  1  
ATOM 1019  H HG3  . GLU B 2 44 ? -9.227  9.382   7.805   1.00 0.00 ? 338 GLU B HG3  1  
ATOM 1020  N N    . GLN B 2 45 ? -7.271  11.157  3.538   1.00 0.00 ? 339 GLN B N    1  
ATOM 1021  C CA   . GLN B 2 45 ? -6.845  12.374  2.842   1.00 0.00 ? 339 GLN B CA   1  
ATOM 1022  C C    . GLN B 2 45 ? -8.047  12.947  2.108   1.00 0.00 ? 339 GLN B C    1  
ATOM 1023  O O    . GLN B 2 45 ? -8.315  14.149  2.147   1.00 0.00 ? 339 GLN B O    1  
ATOM 1024  C CB   . GLN B 2 45 ? -5.738  12.075  1.831   1.00 0.00 ? 339 GLN B CB   1  
ATOM 1025  C CG   . GLN B 2 45 ? -4.581  11.290  2.404   1.00 0.00 ? 339 GLN B CG   1  
ATOM 1026  C CD   . GLN B 2 45 ? -3.407  11.205  1.444   1.00 0.00 ? 339 GLN B CD   1  
ATOM 1027  O OE1  . GLN B 2 45 ? -2.882  12.225  0.999   1.00 0.00 ? 339 GLN B OE1  1  
ATOM 1028  N NE2  . GLN B 2 45 ? -2.983  9.989   1.124   1.00 0.00 ? 339 GLN B NE2  1  
ATOM 1029  H H    . GLN B 2 45 ? -6.899  10.292  3.264   1.00 0.00 ? 339 GLN B H    1  
ATOM 1030  H HA   . GLN B 2 45 ? -6.494  13.086  3.574   1.00 0.00 ? 339 GLN B HA   1  
ATOM 1031  H HB2  . GLN B 2 45 ? -6.157  11.502  1.017   1.00 0.00 ? 339 GLN B HB2  1  
ATOM 1032  H HB3  . GLN B 2 45 ? -5.356  13.009  1.445   1.00 0.00 ? 339 GLN B HB3  1  
ATOM 1033  H HG2  . GLN B 2 45 ? -4.254  11.764  3.317   1.00 0.00 ? 339 GLN B HG2  1  
ATOM 1034  H HG3  . GLN B 2 45 ? -4.930  10.291  2.619   1.00 0.00 ? 339 GLN B HG3  1  
ATOM 1035  H HE21 . GLN B 2 45 ? -3.440  9.220   1.519   1.00 0.00 ? 339 GLN B HE21 1  
ATOM 1036  H HE22 . GLN B 2 45 ? -2.230  9.911   0.502   1.00 0.00 ? 339 GLN B HE22 1  
ATOM 1037  N N    . ARG B 2 46 ? -8.779  12.040  1.463   1.00 0.00 ? 340 ARG B N    1  
ATOM 1038  C CA   . ARG B 2 46 ? -9.994  12.382  0.723   1.00 0.00 ? 340 ARG B CA   1  
ATOM 1039  C C    . ARG B 2 46 ? -11.047 12.938  1.683   1.00 0.00 ? 340 ARG B C    1  
ATOM 1040  O O    . ARG B 2 46 ? -11.736 13.910  1.372   1.00 0.00 ? 340 ARG B O    1  
ATOM 1041  C CB   . ARG B 2 46 ? -10.563 11.136  0.027   1.00 0.00 ? 340 ARG B CB   1  
ATOM 1042  C CG   . ARG B 2 46 ? -9.538  10.325  -0.757  1.00 0.00 ? 340 ARG B CG   1  
ATOM 1043  C CD   . ARG B 2 46 ? -9.236  10.943  -2.111  1.00 0.00 ? 340 ARG B CD   1  
ATOM 1044  N NE   . ARG B 2 46 ? -8.651  12.282  -2.003  1.00 0.00 ? 340 ARG B NE   1  
ATOM 1045  C CZ   . ARG B 2 46 ? -7.406  12.530  -1.584  1.00 0.00 ? 340 ARG B CZ   1  
ATOM 1046  N NH1  . ARG B 2 46 ? -6.581  11.531  -1.283  1.00 0.00 ? 340 ARG B NH1  1  
ATOM 1047  N NH2  . ARG B 2 46 ? -6.982  13.784  -1.481  1.00 0.00 ? 340 ARG B NH2  1  
ATOM 1048  H H    . ARG B 2 46 ? -8.494  11.099  1.505   1.00 0.00 ? 340 ARG B H    1  
ATOM 1049  H HA   . ARG B 2 46 ? -9.749  13.130  -0.015  1.00 0.00 ? 340 ARG B HA   1  
ATOM 1050  H HB2  . ARG B 2 46 ? -10.998 10.490  0.775   1.00 0.00 ? 340 ARG B HB2  1  
ATOM 1051  H HB3  . ARG B 2 46 ? -11.339 11.448  -0.656  1.00 0.00 ? 340 ARG B HB3  1  
ATOM 1052  H HG2  . ARG B 2 46 ? -8.624  10.274  -0.189  1.00 0.00 ? 340 ARG B HG2  1  
ATOM 1053  H HG3  . ARG B 2 46 ? -9.925  9.328   -0.906  1.00 0.00 ? 340 ARG B HG3  1  
ATOM 1054  H HD2  . ARG B 2 46 ? -8.543  10.299  -2.629  1.00 0.00 ? 340 ARG B HD2  1  
ATOM 1055  H HD3  . ARG B 2 46 ? -10.156 11.004  -2.672  1.00 0.00 ? 340 ARG B HD3  1  
ATOM 1056  H HE   . ARG B 2 46 ? -9.224  13.041  -2.242  1.00 0.00 ? 340 ARG B HE   1  
ATOM 1057  H HH11 . ARG B 2 46 ? -6.886  10.583  -1.368  1.00 0.00 ? 340 ARG B HH11 1  
ATOM 1058  H HH12 . ARG B 2 46 ? -5.650  11.728  -0.973  1.00 0.00 ? 340 ARG B HH12 1  
ATOM 1059  H HH21 . ARG B 2 46 ? -7.593  14.541  -1.716  1.00 0.00 ? 340 ARG B HH21 1  
ATOM 1060  H HH22 . ARG B 2 46 ? -6.051  13.974  -1.167  1.00 0.00 ? 340 ARG B HH22 1  
ATOM 1061  N N    . ASN B 2 47 ? -11.151 12.305  2.858   1.00 0.00 ? 341 ASN B N    1  
ATOM 1062  C CA   . ASN B 2 47 ? -12.101 12.710  3.893   1.00 0.00 ? 341 ASN B CA   1  
ATOM 1063  C C    . ASN B 2 47 ? -11.915 14.179  4.271   1.00 0.00 ? 341 ASN B C    1  
ATOM 1064  O O    . ASN B 2 47 ? -12.879 14.947  4.291   1.00 0.00 ? 341 ASN B O    1  
ATOM 1065  C CB   . ASN B 2 47 ? -11.937 11.818  5.132   1.00 0.00 ? 341 ASN B CB   1  
ATOM 1066  C CG   . ASN B 2 47 ? -12.536 10.435  4.943   1.00 0.00 ? 341 ASN B CG   1  
ATOM 1067  O OD1  . ASN B 2 47 ? -12.134 9.686   4.054   1.00 0.00 ? 341 ASN B OD1  1  
ATOM 1068  N ND2  . ASN B 2 47 ? -13.507 10.088  5.781   1.00 0.00 ? 341 ASN B ND2  1  
ATOM 1069  H H    . ASN B 2 47 ? -10.564 11.539  3.034   1.00 0.00 ? 341 ASN B H    1  
ATOM 1070  H HA   . ASN B 2 47 ? -13.097 12.578  3.496   1.00 0.00 ? 341 ASN B HA   1  
ATOM 1071  H HB2  . ASN B 2 47 ? -10.886 11.703  5.344   1.00 0.00 ? 341 ASN B HB2  1  
ATOM 1072  H HB3  . ASN B 2 47 ? -12.416 12.285  5.975   1.00 0.00 ? 341 ASN B HB3  1  
ATOM 1073  H HD21 . ASN B 2 47 ? -13.781 10.732  6.467   1.00 0.00 ? 341 ASN B HD21 1  
ATOM 1074  H HD22 . ASN B 2 47 ? -13.909 9.200   5.680   1.00 0.00 ? 341 ASN B HD22 1  
ATOM 1075  N N    . ALA B 2 48 ? -10.669 14.566  4.558   1.00 0.00 ? 342 ALA B N    1  
ATOM 1076  C CA   . ALA B 2 48 ? -10.351 15.948  4.923   1.00 0.00 ? 342 ALA B CA   1  
ATOM 1077  C C    . ALA B 2 48 ? -10.836 16.931  3.858   1.00 0.00 ? 342 ALA B C    1  
ATOM 1078  O O    . ALA B 2 48 ? -11.353 18.002  4.181   1.00 0.00 ? 342 ALA B O    1  
ATOM 1079  C CB   . ALA B 2 48 ? -8.853  16.104  5.148   1.00 0.00 ? 342 ALA B CB   1  
ATOM 1080  H H    . ALA B 2 48 ? -9.944  13.906  4.516   1.00 0.00 ? 342 ALA B H    1  
ATOM 1081  H HA   . ALA B 2 48 ? -10.854 16.169  5.852   1.00 0.00 ? 342 ALA B HA   1  
ATOM 1082  H HB1  . ALA B 2 48 ? -8.654  17.069  5.591   1.00 0.00 ? 342 ALA B HB1  1  
ATOM 1083  H HB2  . ALA B 2 48 ? -8.336  16.029  4.203   1.00 0.00 ? 342 ALA B HB2  1  
ATOM 1084  H HB3  . ALA B 2 48 ? -8.505  15.326  5.811   1.00 0.00 ? 342 ALA B HB3  1  
ATOM 1085  N N    . LYS B 2 49 ? -10.669 16.554  2.588   1.00 0.00 ? 343 LYS B N    1  
ATOM 1086  C CA   . LYS B 2 49 ? -11.089 17.393  1.468   1.00 0.00 ? 343 LYS B CA   1  
ATOM 1087  C C    . LYS B 2 49 ? -12.612 17.536  1.424   1.00 0.00 ? 343 LYS B C    1  
ATOM 1088  O O    . LYS B 2 49 ? -13.133 18.638  1.244   1.00 0.00 ? 343 LYS B O    1  
ATOM 1089  C CB   . LYS B 2 49 ? -10.583 16.801  0.147   1.00 0.00 ? 343 LYS B CB   1  
ATOM 1090  C CG   . LYS B 2 49 ? -10.910 17.649  -1.072  1.00 0.00 ? 343 LYS B CG   1  
ATOM 1091  C CD   . LYS B 2 49 ? -10.197 18.992  -1.028  1.00 0.00 ? 343 LYS B CD   1  
ATOM 1092  C CE   . LYS B 2 49 ? -10.582 19.873  -2.208  1.00 0.00 ? 343 LYS B CE   1  
ATOM 1093  N NZ   . LYS B 2 49 ? -10.203 19.263  -3.515  1.00 0.00 ? 343 LYS B NZ   1  
ATOM 1094  H H    . LYS B 2 49 ? -10.252 15.686  2.401   1.00 0.00 ? 343 LYS B H    1  
ATOM 1095  H HA   . LYS B 2 49 ? -10.651 18.371  1.604   1.00 0.00 ? 343 LYS B HA   1  
ATOM 1096  H HB2  . LYS B 2 49 ? -9.510  16.690  0.204   1.00 0.00 ? 343 LYS B HB2  1  
ATOM 1097  H HB3  . LYS B 2 49 ? -11.029 15.826  0.011   1.00 0.00 ? 343 LYS B HB3  1  
ATOM 1098  H HG2  . LYS B 2 49 ? -10.602 17.117  -1.960  1.00 0.00 ? 343 LYS B HG2  1  
ATOM 1099  H HG3  . LYS B 2 49 ? -11.977 17.818  -1.105  1.00 0.00 ? 343 LYS B HG3  1  
ATOM 1100  H HD2  . LYS B 2 49 ? -10.461 19.499  -0.113  1.00 0.00 ? 343 LYS B HD2  1  
ATOM 1101  H HD3  . LYS B 2 49 ? -9.130  18.821  -1.051  1.00 0.00 ? 343 LYS B HD3  1  
ATOM 1102  H HE2  . LYS B 2 49 ? -11.651 20.027  -2.191  1.00 0.00 ? 343 LYS B HE2  1  
ATOM 1103  H HE3  . LYS B 2 49 ? -10.082 20.825  -2.106  1.00 0.00 ? 343 LYS B HE3  1  
ATOM 1104  H HZ1  . LYS B 2 49 ? -9.169  19.161  -3.576  1.00 0.00 ? 343 LYS B HZ1  1  
ATOM 1105  H HZ2  . LYS B 2 49 ? -10.526 19.867  -4.297  1.00 0.00 ? 343 LYS B HZ2  1  
ATOM 1106  H HZ3  . LYS B 2 49 ? -10.641 18.325  -3.614  1.00 0.00 ? 343 LYS B HZ3  1  
ATOM 1107  N N    . GLU B 2 50 ? -13.317 16.413  1.588   1.00 0.00 ? 344 GLU B N    1  
ATOM 1108  C CA   . GLU B 2 50 ? -14.782 16.403  1.565   1.00 0.00 ? 344 GLU B CA   1  
ATOM 1109  C C    . GLU B 2 50 ? -15.372 17.256  2.691   1.00 0.00 ? 344 GLU B C    1  
ATOM 1110  O O    . GLU B 2 50 ? -16.412 17.892  2.513   1.00 0.00 ? 344 GLU B O    1  
ATOM 1111  C CB   . GLU B 2 50 ? -15.305 14.968  1.675   1.00 0.00 ? 344 GLU B CB   1  
ATOM 1112  C CG   . GLU B 2 50 ? -14.892 14.077  0.514   1.00 0.00 ? 344 GLU B CG   1  
ATOM 1113  C CD   . GLU B 2 50 ? -15.358 12.643  0.678   1.00 0.00 ? 344 GLU B CD   1  
ATOM 1114  O OE1  . GLU B 2 50 ? -16.587 12.417  0.718   1.00 0.00 ? 344 GLU B OE1  1  
ATOM 1115  O OE2  . GLU B 2 50 ? -14.494 11.746  0.770   1.00 0.00 ? 344 GLU B OE2  1  
ATOM 1116  H H    . GLU B 2 50 ? -12.839 15.568  1.725   1.00 0.00 ? 344 GLU B H    1  
ATOM 1117  H HA   . GLU B 2 50 ? -15.098 16.816  0.619   1.00 0.00 ? 344 GLU B HA   1  
ATOM 1118  H HB2  . GLU B 2 50 ? -14.931 14.529  2.588   1.00 0.00 ? 344 GLU B HB2  1  
ATOM 1119  H HB3  . GLU B 2 50 ? -16.385 14.992  1.715   1.00 0.00 ? 344 GLU B HB3  1  
ATOM 1120  H HG2  . GLU B 2 50 ? -15.317 14.474  -0.396  1.00 0.00 ? 344 GLU B HG2  1  
ATOM 1121  H HG3  . GLU B 2 50 ? -13.815 14.083  0.438   1.00 0.00 ? 344 GLU B HG3  1  
ATOM 1122  N N    . ALA B 2 51 ? -14.702 17.268  3.847   1.00 0.00 ? 345 ALA B N    1  
ATOM 1123  C CA   . ALA B 2 51 ? -15.163 18.046  4.997   1.00 0.00 ? 345 ALA B CA   1  
ATOM 1124  C C    . ALA B 2 51 ? -15.038 19.555  4.758   1.00 0.00 ? 345 ALA B C    1  
ATOM 1125  O O    . ALA B 2 51 ? -15.644 20.351  5.478   1.00 0.00 ? 345 ALA B O    1  
ATOM 1126  C CB   . ALA B 2 51 ? -14.393 17.644  6.248   1.00 0.00 ? 345 ALA B CB   1  
ATOM 1127  H H    . ALA B 2 51 ? -13.879 16.741  3.927   1.00 0.00 ? 345 ALA B H    1  
ATOM 1128  H HA   . ALA B 2 51 ? -16.205 17.808  5.158   1.00 0.00 ? 345 ALA B HA   1  
ATOM 1129  H HB1  . ALA B 2 51 ? -13.669 18.409  6.488   1.00 0.00 ? 345 ALA B HB1  1  
ATOM 1130  H HB2  . ALA B 2 51 ? -13.883 16.709  6.073   1.00 0.00 ? 345 ALA B HB2  1  
ATOM 1131  H HB3  . ALA B 2 51 ? -15.082 17.530  7.073   1.00 0.00 ? 345 ALA B HB3  1  
ATOM 1132  N N    . GLY B 2 52 ? -14.247 19.947  3.752   1.00 0.00 ? 346 GLY B N    1  
ATOM 1133  C CA   . GLY B 2 52 ? -14.062 21.358  3.451   1.00 0.00 ? 346 GLY B CA   1  
ATOM 1134  C C    . GLY B 2 52 ? -12.741 21.904  3.971   1.00 0.00 ? 346 GLY B C    1  
ATOM 1135  O O    . GLY B 2 52 ? -12.256 22.925  3.482   1.00 0.00 ? 346 GLY B O    1  
ATOM 1136  H H    . GLY B 2 52 ? -13.783 19.274  3.212   1.00 0.00 ? 346 GLY B H    1  
ATOM 1137  H HA2  . GLY B 2 52 ? -14.096 21.493  2.380   1.00 0.00 ? 346 GLY B HA2  1  
ATOM 1138  H HA3  . GLY B 2 52 ? -14.870 21.919  3.898   1.00 0.00 ? 346 GLY B HA3  1  
ATOM 1139  N N    . GLY B 2 53 ? -12.162 21.225  4.965   1.00 0.00 ? 347 GLY B N    1  
ATOM 1140  C CA   . GLY B 2 53 ? -10.900 21.664  5.538   1.00 0.00 ? 347 GLY B CA   1  
ATOM 1141  C C    . GLY B 2 53 ? -10.837 21.448  7.040   1.00 0.00 ? 347 GLY B C    1  
ATOM 1142  O O    . GLY B 2 53 ? -9.768  21.173  7.586   1.00 0.00 ? 347 GLY B O    1  
ATOM 1143  H H    . GLY B 2 53 ? -12.597 20.421  5.316   1.00 0.00 ? 347 GLY B H    1  
ATOM 1144  H HA2  . GLY B 2 53 ? -10.096 21.113  5.073   1.00 0.00 ? 347 GLY B HA2  1  
ATOM 1145  H HA3  . GLY B 2 53 ? -10.768 22.716  5.332   1.00 0.00 ? 347 GLY B HA3  1  
ATOM 1146  N N    . ASN B 2 54 ? -11.988 21.572  7.709   1.00 0.00 ? 348 ASN B N    1  
ATOM 1147  C CA   . ASN B 2 54 ? -12.066 21.389  9.158   1.00 0.00 ? 348 ASN B CA   1  
ATOM 1148  C C    . ASN B 2 54 ? -12.190 19.905  9.516   1.00 0.00 ? 348 ASN B C    1  
ATOM 1149  O O    . ASN B 2 54 ? -13.203 19.469  10.069  1.00 0.00 ? 348 ASN B O    1  
ATOM 1150  C CB   . ASN B 2 54 ? -13.256 22.174  9.725   1.00 0.00 ? 348 ASN B CB   1  
ATOM 1151  C CG   . ASN B 2 54 ? -13.191 23.653  9.389   1.00 0.00 ? 348 ASN B CG   1  
ATOM 1152  O OD1  . ASN B 2 54 ? -12.262 24.353  9.791   1.00 0.00 ? 348 ASN B OD1  1  
ATOM 1153  N ND2  . ASN B 2 54 ? -14.180 24.137  8.643   1.00 0.00 ? 348 ASN B ND2  1  
ATOM 1154  H H    . ASN B 2 54 ? -12.805 21.793  7.214   1.00 0.00 ? 348 ASN B H    1  
ATOM 1155  H HA   . ASN B 2 54 ? -11.154 21.775  9.589   1.00 0.00 ? 348 ASN B HA   1  
ATOM 1156  H HB2  . ASN B 2 54 ? -14.171 21.771  9.318   1.00 0.00 ? 348 ASN B HB2  1  
ATOM 1157  H HB3  . ASN B 2 54 ? -13.268 22.068  10.800  1.00 0.00 ? 348 ASN B HB3  1  
ATOM 1158  H HD21 . ASN B 2 54 ? -14.887 23.523  8.354   1.00 0.00 ? 348 ASN B HD21 1  
ATOM 1159  H HD22 . ASN B 2 54 ? -14.161 25.089  8.412   1.00 0.00 ? 348 ASN B HD22 1  
ATOM 1160  N N    . TYR B 2 55 ? -11.151 19.133  9.195   1.00 0.00 ? 349 TYR B N    1  
ATOM 1161  C CA   . TYR B 2 55 ? -11.136 17.698  9.478   1.00 0.00 ? 349 TYR B CA   1  
ATOM 1162  C C    . TYR B 2 55 ? -9.718  17.136  9.431   1.00 0.00 ? 349 TYR B C    1  
ATOM 1163  O O    . TYR B 2 55 ? -9.045  17.217  8.401   1.00 0.00 ? 349 TYR B O    1  
ATOM 1164  C CB   . TYR B 2 55 ? -12.001 16.934  8.466   1.00 0.00 ? 349 TYR B CB   1  
ATOM 1165  C CG   . TYR B 2 55 ? -11.831 15.427  8.546   1.00 0.00 ? 349 TYR B CG   1  
ATOM 1166  C CD1  . TYR B 2 55 ? -10.798 14.794  7.862   1.00 0.00 ? 349 TYR B CD1  1  
ATOM 1167  C CD2  . TYR B 2 55 ? -12.680 14.645  9.317   1.00 0.00 ? 349 TYR B CD2  1  
ATOM 1168  C CE1  . TYR B 2 55 ? -10.618 13.428  7.938   1.00 0.00 ? 349 TYR B CE1  1  
ATOM 1169  C CE2  . TYR B 2 55 ? -12.507 13.274  9.400   1.00 0.00 ? 349 TYR B CE2  1  
ATOM 1170  C CZ   . TYR B 2 55 ? -11.475 12.671  8.708   1.00 0.00 ? 349 TYR B CZ   1  
ATOM 1171  O OH   . TYR B 2 55 ? -11.301 11.308  8.788   1.00 0.00 ? 349 TYR B OH   1  
ATOM 1172  H H    . TYR B 2 55 ? -10.374 19.538  8.755   1.00 0.00 ? 349 TYR B H    1  
ATOM 1173  H HA   . TYR B 2 55 ? -11.540 17.549  10.467  1.00 0.00 ? 349 TYR B HA   1  
ATOM 1174  H HB2  . TYR B 2 55 ? -13.041 17.162  8.647   1.00 0.00 ? 349 TYR B HB2  1  
ATOM 1175  H HB3  . TYR B 2 55 ? -11.736 17.247  7.467   1.00 0.00 ? 349 TYR B HB3  1  
ATOM 1176  H HD1  . TYR B 2 55 ? -10.127 15.388  7.263   1.00 0.00 ? 349 TYR B HD1  1  
ATOM 1177  H HD2  . TYR B 2 55 ? -13.488 15.118  9.855   1.00 0.00 ? 349 TYR B HD2  1  
ATOM 1178  H HE1  . TYR B 2 55 ? -9.804  12.959  7.397   1.00 0.00 ? 349 TYR B HE1  1  
ATOM 1179  H HE2  . TYR B 2 55 ? -13.178 12.682  10.005  1.00 0.00 ? 349 TYR B HE2  1  
ATOM 1180  H HH   . TYR B 2 55 ? -10.545 11.113  9.347   1.00 0.00 ? 349 TYR B HH   1  
ATOM 1181  N N    . THR B 2 56 ? -9.286  16.532  10.535  1.00 0.00 ? 350 THR B N    1  
ATOM 1182  C CA   . THR B 2 56 ? -7.967  15.916  10.590  1.00 0.00 ? 350 THR B CA   1  
ATOM 1183  C C    . THR B 2 56 ? -8.086  14.429  10.239  1.00 0.00 ? 350 THR B C    1  
ATOM 1184  O O    . THR B 2 56 ? -9.028  13.759  10.668  1.00 0.00 ? 350 THR B O    1  
ATOM 1185  C CB   . THR B 2 56 ? -7.324  16.099  11.960  1.00 0.00 ? 350 THR B CB   1  
ATOM 1186  O OG1  . THR B 2 56 ? -5.913  16.010  11.864  1.00 0.00 ? 350 THR B OG1  1  
ATOM 1187  C CG2  . THR B 2 56 ? -7.766  15.059  12.942  1.00 0.00 ? 350 THR B CG2  1  
ATOM 1188  H H    . THR B 2 56 ? -9.877  16.471  11.314  1.00 0.00 ? 350 THR B H    1  
ATOM 1189  H HA   . THR B 2 56 ? -7.352  16.388  9.858   1.00 0.00 ? 350 THR B HA   1  
ATOM 1190  H HB   . THR B 2 56 ? -7.587  17.070  12.354  1.00 0.00 ? 350 THR B HB   1  
ATOM 1191  H HG1  . THR B 2 56 ? -5.510  16.485  12.594  1.00 0.00 ? 350 THR B HG1  1  
ATOM 1192  H HG21 . THR B 2 56 ? -8.841  15.005  12.936  1.00 0.00 ? 350 THR B HG21 1  
ATOM 1193  H HG22 . THR B 2 56 ? -7.415  15.318  13.927  1.00 0.00 ? 350 THR B HG22 1  
ATOM 1194  H HG23 . THR B 2 56 ? -7.356  14.109  12.642  1.00 0.00 ? 350 THR B HG23 1  
ATOM 1195  N N    . PRO B 2 57 ? -7.145  13.897  9.444   1.00 0.00 ? 351 PRO B N    1  
ATOM 1196  C CA   . PRO B 2 57 ? -7.157  12.487  9.026   1.00 0.00 ? 351 PRO B CA   1  
ATOM 1197  C C    . PRO B 2 57 ? -6.949  11.524  10.194  1.00 0.00 ? 351 PRO B C    1  
ATOM 1198  O O    . PRO B 2 57 ? -6.233  11.833  11.149  1.00 0.00 ? 351 PRO B O    1  
ATOM 1199  C CB   . PRO B 2 57 ? -5.993  12.395  8.029   1.00 0.00 ? 351 PRO B CB   1  
ATOM 1200  C CG   . PRO B 2 57 ? -5.708  13.806  7.648   1.00 0.00 ? 351 PRO B CG   1  
ATOM 1201  C CD   . PRO B 2 57 ? -6.003  14.615  8.874   1.00 0.00 ? 351 PRO B CD   1  
ATOM 1202  H HA   . PRO B 2 57 ? -8.081  12.238  8.524   1.00 0.00 ? 351 PRO B HA   1  
ATOM 1203  H HB2  . PRO B 2 57 ? -5.141  11.932  8.506   1.00 0.00 ? 351 PRO B HB2  1  
ATOM 1204  H HB3  . PRO B 2 57 ? -6.297  11.811  7.174   1.00 0.00 ? 351 PRO B HB3  1  
ATOM 1205  H HG2  . PRO B 2 57 ? -4.671  13.912  7.363   1.00 0.00 ? 351 PRO B HG2  1  
ATOM 1206  H HG3  . PRO B 2 57 ? -6.358  14.105  6.837   1.00 0.00 ? 351 PRO B HG3  1  
ATOM 1207  H HD2  . PRO B 2 57 ? -5.163  14.606  9.554   1.00 0.00 ? 351 PRO B HD2  1  
ATOM 1208  H HD3  . PRO B 2 57 ? -6.273  15.626  8.611   1.00 0.00 ? 351 PRO B HD3  1  
ATOM 1209  N N    . ALA B 2 58 ? -7.592  10.360  10.108  1.00 0.00 ? 352 ALA B N    1  
ATOM 1210  C CA   . ALA B 2 58 ? -7.502  9.340   11.152  1.00 0.00 ? 352 ALA B CA   1  
ATOM 1211  C C    . ALA B 2 58 ? -6.458  8.260   10.833  1.00 0.00 ? 352 ALA B C    1  
ATOM 1212  O O    . ALA B 2 58 ? -6.535  7.152   11.362  1.00 0.00 ? 352 ALA B O    1  
ATOM 1213  C CB   . ALA B 2 58 ? -8.869  8.704   11.365  1.00 0.00 ? 352 ALA B CB   1  
ATOM 1214  H H    . ALA B 2 58 ? -8.151  10.187  9.325   1.00 0.00 ? 352 ALA B H    1  
ATOM 1215  H HA   . ALA B 2 58 ? -7.220  9.833   12.071  1.00 0.00 ? 352 ALA B HA   1  
ATOM 1216  H HB1  . ALA B 2 58 ? -9.508  9.394   11.895  1.00 0.00 ? 352 ALA B HB1  1  
ATOM 1217  H HB2  . ALA B 2 58 ? -8.758  7.798   11.943  1.00 0.00 ? 352 ALA B HB2  1  
ATOM 1218  H HB3  . ALA B 2 58 ? -9.309  8.468   10.407  1.00 0.00 ? 352 ALA B HB3  1  
ATOM 1219  N N    . LEU B 2 59 ? -5.473  8.589   9.990   1.00 0.00 ? 353 LEU B N    1  
ATOM 1220  C CA   . LEU B 2 59 ? -4.417  7.642   9.630   1.00 0.00 ? 353 LEU B CA   1  
ATOM 1221  C C    . LEU B 2 59 ? -3.156  8.349   9.171   1.00 0.00 ? 353 LEU B C    1  
ATOM 1222  O O    . LEU B 2 59 ? -3.171  9.514   8.767   1.00 0.00 ? 353 LEU B O    1  
ATOM 1223  C CB   . LEU B 2 59 ? -4.824  6.713   8.481   1.00 0.00 ? 353 LEU B CB   1  
ATOM 1224  C CG   . LEU B 2 59 ? -5.007  5.241   8.831   1.00 0.00 ? 353 LEU B CG   1  
ATOM 1225  C CD1  . LEU B 2 59 ? -6.273  5.011   9.640   1.00 0.00 ? 353 LEU B CD1  1  
ATOM 1226  C CD2  . LEU B 2 59 ? -5.000  4.400   7.568   1.00 0.00 ? 353 LEU B CD2  1  
ATOM 1227  H H    . LEU B 2 59 ? -5.448  9.488   9.612   1.00 0.00 ? 353 LEU B H    1  
ATOM 1228  H HA   . LEU B 2 59 ? -4.190  7.046   10.500  1.00 0.00 ? 353 LEU B HA   1  
ATOM 1229  H HB2  . LEU B 2 59 ? -5.738  7.079   8.046   1.00 0.00 ? 353 LEU B HB2  1  
ATOM 1230  H HB3  . LEU B 2 59 ? -4.037  6.767   7.738   1.00 0.00 ? 353 LEU B HB3  1  
ATOM 1231  H HG   . LEU B 2 59 ? -4.172  4.931   9.423   1.00 0.00 ? 353 LEU B HG   1  
ATOM 1232  H HD11 . LEU B 2 59 ? -6.044  5.070   10.693  1.00 0.00 ? 353 LEU B HD11 1  
ATOM 1233  H HD12 . LEU B 2 59 ? -6.672  4.033   9.416   1.00 0.00 ? 353 LEU B HD12 1  
ATOM 1234  H HD13 . LEU B 2 59 ? -7.005  5.764   9.388   1.00 0.00 ? 353 LEU B HD13 1  
ATOM 1235  H HD21 . LEU B 2 59 ? -5.271  3.383   7.810   1.00 0.00 ? 353 LEU B HD21 1  
ATOM 1236  H HD22 . LEU B 2 59 ? -4.012  4.414   7.131   1.00 0.00 ? 353 LEU B HD22 1  
ATOM 1237  H HD23 . LEU B 2 59 ? -5.709  4.804   6.864   1.00 0.00 ? 353 LEU B HD23 1  
ATOM 1238  N N    . THR B 2 60 ? -2.081  7.585   9.197   1.00 0.00 ? 354 THR B N    1  
ATOM 1239  C CA   . THR B 2 60 ? -0.771  8.025   8.752   1.00 0.00 ? 354 THR B CA   1  
ATOM 1240  C C    . THR B 2 60 ? 0.009   6.791   8.331   1.00 0.00 ? 354 THR B C    1  
ATOM 1241  O O    . THR B 2 60 ? -0.497  5.672   8.459   1.00 0.00 ? 354 THR B O    1  
ATOM 1242  C CB   . THR B 2 60 ? -0.025  8.779   9.865   1.00 0.00 ? 354 THR B CB   1  
ATOM 1243  O OG1  . THR B 2 60 ? 0.070   8.000   11.050  1.00 0.00 ? 354 THR B OG1  1  
ATOM 1244  C CG2  . THR B 2 60 ? -0.668  10.098  10.236  1.00 0.00 ? 354 THR B CG2  1  
ATOM 1245  H H    . THR B 2 60 ? -2.181  6.653   9.500   1.00 0.00 ? 354 THR B H    1  
ATOM 1246  H HA   . THR B 2 60 ? -0.902  8.672   7.897   1.00 0.00 ? 354 THR B HA   1  
ATOM 1247  H HB   . THR B 2 60 ? 0.978   8.991   9.524   1.00 0.00 ? 354 THR B HB   1  
ATOM 1248  H HG1  . THR B 2 60 ? -0.288  7.122   10.897  1.00 0.00 ? 354 THR B HG1  1  
ATOM 1249  H HG21 . THR B 2 60 ? -1.633  9.915   10.686  1.00 0.00 ? 354 THR B HG21 1  
ATOM 1250  H HG22 . THR B 2 60 ? -0.794  10.699  9.347   1.00 0.00 ? 354 THR B HG22 1  
ATOM 1251  H HG23 . THR B 2 60 ? -0.037  10.622  10.938  1.00 0.00 ? 354 THR B HG23 1  
ATOM 1252  N N    . GLU B 2 61 ? 1.236   6.964   7.860   1.00 0.00 ? 355 GLU B N    1  
ATOM 1253  C CA   . GLU B 2 61 ? 2.038   5.809   7.481   1.00 0.00 ? 355 GLU B CA   1  
ATOM 1254  C C    . GLU B 2 61 ? 2.126   4.838   8.666   1.00 0.00 ? 355 GLU B C    1  
ATOM 1255  O O    . GLU B 2 61 ? 2.342   3.639   8.487   1.00 0.00 ? 355 GLU B O    1  
ATOM 1256  C CB   . GLU B 2 61 ? 3.429   6.236   7.016   1.00 0.00 ? 355 GLU B CB   1  
ATOM 1257  C CG   . GLU B 2 61 ? 3.425   7.165   5.802   1.00 0.00 ? 355 GLU B CG   1  
ATOM 1258  C CD   . GLU B 2 61 ? 2.767   6.570   4.560   1.00 0.00 ? 355 GLU B CD   1  
ATOM 1259  O OE1  . GLU B 2 61 ? 2.297   5.412   4.612   1.00 0.00 ? 355 GLU B OE1  1  
ATOM 1260  O OE2  . GLU B 2 61 ? 2.725   7.270   3.528   1.00 0.00 ? 355 GLU B OE2  1  
ATOM 1261  H H    . GLU B 2 61 ? 1.613   7.866   7.793   1.00 0.00 ? 355 GLU B H    1  
ATOM 1262  H HA   . GLU B 2 61 ? 1.529   5.310   6.669   1.00 0.00 ? 355 GLU B HA   1  
ATOM 1263  H HB2  . GLU B 2 61 ? 3.916   6.749   7.827   1.00 0.00 ? 355 GLU B HB2  1  
ATOM 1264  H HB3  . GLU B 2 61 ? 3.998   5.354   6.768   1.00 0.00 ? 355 GLU B HB3  1  
ATOM 1265  H HG2  . GLU B 2 61 ? 2.895   8.067   6.065   1.00 0.00 ? 355 GLU B HG2  1  
ATOM 1266  H HG3  . GLU B 2 61 ? 4.448   7.414   5.560   1.00 0.00 ? 355 GLU B HG3  1  
ATOM 1267  N N    . GLN B 2 62 ? 1.925   5.380   9.880   1.00 0.00 ? 356 GLN B N    1  
ATOM 1268  C CA   . GLN B 2 62 ? 1.945   4.593   11.109  1.00 0.00 ? 356 GLN B CA   1  
ATOM 1269  C C    . GLN B 2 62 ? 0.826   3.549   11.120  1.00 0.00 ? 356 GLN B C    1  
ATOM 1270  O O    . GLN B 2 62 ? 1.062   2.404   11.507  1.00 0.00 ? 356 GLN B O    1  
ATOM 1271  C CB   . GLN B 2 62 ? 1.816   5.504   12.333  1.00 0.00 ? 356 GLN B CB   1  
ATOM 1272  C CG   . GLN B 2 62 ? 2.951   6.507   12.471  1.00 0.00 ? 356 GLN B CG   1  
ATOM 1273  C CD   . GLN B 2 62 ? 2.812   7.382   13.703  1.00 0.00 ? 356 GLN B CD   1  
ATOM 1274  O OE1  . GLN B 2 62 ? 2.815   6.889   14.831  1.00 0.00 ? 356 GLN B OE1  1  
ATOM 1275  N NE2  . GLN B 2 62 ? 2.687   8.688   13.495  1.00 0.00 ? 356 GLN B NE2  1  
ATOM 1276  H H    . GLN B 2 62 ? 1.743   6.337   9.945   1.00 0.00 ? 356 GLN B H    1  
ATOM 1277  H HA   . GLN B 2 62 ? 2.894   4.081   11.156  1.00 0.00 ? 356 GLN B HA   1  
ATOM 1278  H HB2  . GLN B 2 62 ? 0.888   6.051   12.264  1.00 0.00 ? 356 GLN B HB2  1  
ATOM 1279  H HB3  . GLN B 2 62 ? 1.796   4.891   13.222  1.00 0.00 ? 356 GLN B HB3  1  
ATOM 1280  H HG2  . GLN B 2 62 ? 3.884   5.968   12.535  1.00 0.00 ? 356 GLN B HG2  1  
ATOM 1281  H HG3  . GLN B 2 62 ? 2.962   7.140   11.596  1.00 0.00 ? 356 GLN B HG3  1  
ATOM 1282  H HE21 . GLN B 2 62 ? 2.690   9.014   12.570  1.00 0.00 ? 356 GLN B HE21 1  
ATOM 1283  H HE22 . GLN B 2 62 ? 2.595   9.274   14.275  1.00 0.00 ? 356 GLN B HE22 1  
ATOM 1284  N N    . GLU B 2 63 ? -0.390  3.925   10.676  1.00 0.00 ? 357 GLU B N    1  
ATOM 1285  C CA   . GLU B 2 63 ? -1.497  2.971   10.637  1.00 0.00 ? 357 GLU B CA   1  
ATOM 1286  C C    . GLU B 2 63 ? -1.255  1.950   9.536   1.00 0.00 ? 357 GLU B C    1  
ATOM 1287  O O    . GLU B 2 63 ? -1.561  0.766   9.684   1.00 0.00 ? 357 GLU B O    1  
ATOM 1288  C CB   . GLU B 2 63 ? -2.822  3.678   10.351  1.00 0.00 ? 357 GLU B CB   1  
ATOM 1289  C CG   . GLU B 2 63 ? -3.310  4.633   11.434  1.00 0.00 ? 357 GLU B CG   1  
ATOM 1290  C CD   . GLU B 2 63 ? -3.467  3.973   12.794  1.00 0.00 ? 357 GLU B CD   1  
ATOM 1291  O OE1  . GLU B 2 63 ? -2.444  3.572   13.387  1.00 0.00 ? 357 GLU B OE1  1  
ATOM 1292  O OE2  . GLU B 2 63 ? -4.618  3.857   13.264  1.00 0.00 ? 357 GLU B OE2  1  
ATOM 1293  H H    . GLU B 2 63 ? -0.541  4.850   10.351  1.00 0.00 ? 357 GLU B H    1  
ATOM 1294  H HA   . GLU B 2 63 ? -1.552  2.467   11.589  1.00 0.00 ? 357 GLU B HA   1  
ATOM 1295  H HB2  . GLU B 2 63 ? -2.708  4.245   9.441   1.00 0.00 ? 357 GLU B HB2  1  
ATOM 1296  H HB3  . GLU B 2 63 ? -3.583  2.932   10.196  1.00 0.00 ? 357 GLU B HB3  1  
ATOM 1297  H HG2  . GLU B 2 63 ? -2.609  5.448   11.523  1.00 0.00 ? 357 GLU B HG2  1  
ATOM 1298  H HG3  . GLU B 2 63 ? -4.277  5.022   11.127  1.00 0.00 ? 357 GLU B HG3  1  
ATOM 1299  N N    . VAL B 2 64 ? -0.705  2.437   8.429   1.00 0.00 ? 358 VAL B N    1  
ATOM 1300  C CA   . VAL B 2 64 ? -0.410  1.607   7.274   1.00 0.00 ? 358 VAL B CA   1  
ATOM 1301  C C    . VAL B 2 64 ? 0.598   0.516   7.630   1.00 0.00 ? 358 VAL B C    1  
ATOM 1302  O O    . VAL B 2 64 ? 0.292   -0.673  7.538   1.00 0.00 ? 358 VAL B O    1  
ATOM 1303  C CB   . VAL B 2 64 ? 0.133   2.487   6.130   1.00 0.00 ? 358 VAL B CB   1  
ATOM 1304  C CG1  . VAL B 2 64 ? 0.404   1.672   4.877   1.00 0.00 ? 358 VAL B CG1  1  
ATOM 1305  C CG2  . VAL B 2 64 ? -0.842  3.622   5.846   1.00 0.00 ? 358 VAL B CG2  1  
ATOM 1306  H H    . VAL B 2 64 ? -0.493  3.395   8.388   1.00 0.00 ? 358 VAL B H    1  
ATOM 1307  H HA   . VAL B 2 64 ? -1.330  1.149   6.945   1.00 0.00 ? 358 VAL B HA   1  
ATOM 1308  H HB   . VAL B 2 64 ? 1.067   2.923   6.453   1.00 0.00 ? 358 VAL B HB   1  
ATOM 1309  H HG11 . VAL B 2 64 ? 1.078   2.221   4.232   1.00 0.00 ? 358 VAL B HG11 1  
ATOM 1310  H HG12 . VAL B 2 64 ? -0.525  1.490   4.357   1.00 0.00 ? 358 VAL B HG12 1  
ATOM 1311  H HG13 . VAL B 2 64 ? 0.855   0.730   5.149   1.00 0.00 ? 358 VAL B HG13 1  
ATOM 1312  H HG21 . VAL B 2 64 ? -1.459  3.798   6.723   1.00 0.00 ? 358 VAL B HG21 1  
ATOM 1313  H HG22 . VAL B 2 64 ? -1.472  3.356   5.011   1.00 0.00 ? 358 VAL B HG22 1  
ATOM 1314  H HG23 . VAL B 2 64 ? -0.289  4.518   5.611   1.00 0.00 ? 358 VAL B HG23 1  
ATOM 1315  N N    . TYR B 2 65 ? 1.786   0.928   8.070   1.00 0.00 ? 359 TYR B N    1  
ATOM 1316  C CA   . TYR B 2 65 ? 2.825   -0.015  8.477   1.00 0.00 ? 359 TYR B CA   1  
ATOM 1317  C C    . TYR B 2 65 ? 2.334   -0.908  9.620   1.00 0.00 ? 359 TYR B C    1  
ATOM 1318  O O    . TYR B 2 65 ? 2.714   -2.074  9.711   1.00 0.00 ? 359 TYR B O    1  
ATOM 1319  C CB   . TYR B 2 65 ? 4.093   0.740   8.898   1.00 0.00 ? 359 TYR B CB   1  
ATOM 1320  C CG   . TYR B 2 65 ? 5.252   -0.158  9.286   1.00 0.00 ? 359 TYR B CG   1  
ATOM 1321  C CD1  . TYR B 2 65 ? 5.231   -0.888  10.469  1.00 0.00 ? 359 TYR B CD1  1  
ATOM 1322  C CD2  . TYR B 2 65 ? 6.365   -0.278  8.463   1.00 0.00 ? 359 TYR B CD2  1  
ATOM 1323  C CE1  . TYR B 2 65 ? 6.284   -1.710  10.820  1.00 0.00 ? 359 TYR B CE1  1  
ATOM 1324  C CE2  . TYR B 2 65 ? 7.423   -1.098  8.808   1.00 0.00 ? 359 TYR B CE2  1  
ATOM 1325  C CZ   . TYR B 2 65 ? 7.377   -1.812  9.987   1.00 0.00 ? 359 TYR B CZ   1  
ATOM 1326  O OH   . TYR B 2 65 ? 8.428   -2.630  10.333  1.00 0.00 ? 359 TYR B OH   1  
ATOM 1327  H H    . TYR B 2 65 ? 1.960   1.890   8.145   1.00 0.00 ? 359 TYR B H    1  
ATOM 1328  H HA   . TYR B 2 65 ? 3.055   -0.638  7.626   1.00 0.00 ? 359 TYR B HA   1  
ATOM 1329  H HB2  . TYR B 2 65 ? 4.419   1.363   8.079   1.00 0.00 ? 359 TYR B HB2  1  
ATOM 1330  H HB3  . TYR B 2 65 ? 3.860   1.366   9.747   1.00 0.00 ? 359 TYR B HB3  1  
ATOM 1331  H HD1  . TYR B 2 65 ? 4.373   -0.807  11.121  1.00 0.00 ? 359 TYR B HD1  1  
ATOM 1332  H HD2  . TYR B 2 65 ? 6.399   0.283   7.540   1.00 0.00 ? 359 TYR B HD2  1  
ATOM 1333  H HE1  . TYR B 2 65 ? 6.248   -2.269  11.743  1.00 0.00 ? 359 TYR B HE1  1  
ATOM 1334  H HE2  . TYR B 2 65 ? 8.280   -1.177  8.155   1.00 0.00 ? 359 TYR B HE2  1  
ATOM 1335  H HH   . TYR B 2 65 ? 8.374   -3.450  9.836   1.00 0.00 ? 359 TYR B HH   1  
ATOM 1336  N N    . ALA B 2 66 ? 1.495   -0.342  10.495  1.00 0.00 ? 360 ALA B N    1  
ATOM 1337  C CA   . ALA B 2 66 ? 0.960   -1.074  11.645  1.00 0.00 ? 360 ALA B CA   1  
ATOM 1338  C C    . ALA B 2 66 ? 0.194   -2.328  11.227  1.00 0.00 ? 360 ALA B C    1  
ATOM 1339  O O    . ALA B 2 66 ? 0.555   -3.438  11.619  1.00 0.00 ? 360 ALA B O    1  
ATOM 1340  C CB   . ALA B 2 66 ? 0.068   -0.168  12.484  1.00 0.00 ? 360 ALA B CB   1  
ATOM 1341  H H    . ALA B 2 66 ? 1.235   0.598   10.367  1.00 0.00 ? 360 ALA B H    1  
ATOM 1342  H HA   . ALA B 2 66 ? 1.797   -1.372  12.260  1.00 0.00 ? 360 ALA B HA   1  
ATOM 1343  H HB1  . ALA B 2 66 ? 0.682   0.497   13.072  1.00 0.00 ? 360 ALA B HB1  1  
ATOM 1344  H HB2  . ALA B 2 66 ? -0.541  -0.771  13.141  1.00 0.00 ? 360 ALA B HB2  1  
ATOM 1345  H HB3  . ALA B 2 66 ? -0.569  0.412   11.833  1.00 0.00 ? 360 ALA B HB3  1  
ATOM 1346  N N    . GLN B 2 67 ? -0.868  -2.146  10.441  1.00 0.00 ? 361 GLN B N    1  
ATOM 1347  C CA   . GLN B 2 67 ? -1.687  -3.269  9.985   1.00 0.00 ? 361 GLN B CA   1  
ATOM 1348  C C    . GLN B 2 67 ? -0.899  -4.201  9.059   1.00 0.00 ? 361 GLN B C    1  
ATOM 1349  O O    . GLN B 2 67 ? -1.072  -5.420  9.111   1.00 0.00 ? 361 GLN B O    1  
ATOM 1350  C CB   . GLN B 2 67 ? -2.954  -2.768  9.281   1.00 0.00 ? 361 GLN B CB   1  
ATOM 1351  C CG   . GLN B 2 67 ? -4.044  -2.256  10.219  1.00 0.00 ? 361 GLN B CG   1  
ATOM 1352  C CD   . GLN B 2 67 ? -3.647  -1.009  10.993  1.00 0.00 ? 361 GLN B CD   1  
ATOM 1353  O OE1  . GLN B 2 67 ? -2.808  -1.061  11.892  1.00 0.00 ? 361 GLN B OE1  1  
ATOM 1354  N NE2  . GLN B 2 67 ? -4.250  0.123   10.646  1.00 0.00 ? 361 GLN B NE2  1  
ATOM 1355  H H    . GLN B 2 67 ? -1.109  -1.235  10.167  1.00 0.00 ? 361 GLN B H    1  
ATOM 1356  H HA   . GLN B 2 67 ? -1.980  -3.830  10.861  1.00 0.00 ? 361 GLN B HA   1  
ATOM 1357  H HB2  . GLN B 2 67 ? -2.684  -1.965  8.612   1.00 0.00 ? 361 GLN B HB2  1  
ATOM 1358  H HB3  . GLN B 2 67 ? -3.368  -3.579  8.700   1.00 0.00 ? 361 GLN B HB3  1  
ATOM 1359  H HG2  . GLN B 2 67 ? -4.922  -2.027  9.634   1.00 0.00 ? 361 GLN B HG2  1  
ATOM 1360  H HG3  . GLN B 2 67 ? -4.283  -3.037  10.926  1.00 0.00 ? 361 GLN B HG3  1  
ATOM 1361  H HE21 . GLN B 2 67 ? -4.909  0.096   9.920   1.00 0.00 ? 361 GLN B HE21 1  
ATOM 1362  H HE22 . GLN B 2 67 ? -4.011  0.941   11.130  1.00 0.00 ? 361 GLN B HE22 1  
ATOM 1363  N N    . VAL B 2 68 ? -0.029  -3.628  8.221   1.00 0.00 ? 362 VAL B N    1  
ATOM 1364  C CA   . VAL B 2 68 ? 0.789   -4.422  7.300   1.00 0.00 ? 362 VAL B CA   1  
ATOM 1365  C C    . VAL B 2 68 ? 1.766   -5.307  8.076   1.00 0.00 ? 362 VAL B C    1  
ATOM 1366  O O    . VAL B 2 68 ? 1.914   -6.491  7.774   1.00 0.00 ? 362 VAL B O    1  
ATOM 1367  C CB   . VAL B 2 68 ? 1.573   -3.522  6.314   1.00 0.00 ? 362 VAL B CB   1  
ATOM 1368  C CG1  . VAL B 2 68 ? 2.536   -4.346  5.470   1.00 0.00 ? 362 VAL B CG1  1  
ATOM 1369  C CG2  . VAL B 2 68 ? 0.617   -2.745  5.419   1.00 0.00 ? 362 VAL B CG2  1  
ATOM 1370  H H    . VAL B 2 68 ? 0.073   -2.652  8.229   1.00 0.00 ? 362 VAL B H    1  
ATOM 1371  H HA   . VAL B 2 68 ? 0.125   -5.058  6.728   1.00 0.00 ? 362 VAL B HA   1  
ATOM 1372  H HB   . VAL B 2 68 ? 2.151   -2.812  6.887   1.00 0.00 ? 362 VAL B HB   1  
ATOM 1373  H HG11 . VAL B 2 68 ? 3.477   -4.441  5.989   1.00 0.00 ? 362 VAL B HG11 1  
ATOM 1374  H HG12 . VAL B 2 68 ? 2.698   -3.853  4.523   1.00 0.00 ? 362 VAL B HG12 1  
ATOM 1375  H HG13 . VAL B 2 68 ? 2.119   -5.327  5.299   1.00 0.00 ? 362 VAL B HG13 1  
ATOM 1376  H HG21 . VAL B 2 68 ? 0.733   -3.071  4.396   1.00 0.00 ? 362 VAL B HG21 1  
ATOM 1377  H HG22 . VAL B 2 68 ? 0.838   -1.690  5.487   1.00 0.00 ? 362 VAL B HG22 1  
ATOM 1378  H HG23 . VAL B 2 68 ? -0.399  -2.921  5.739   1.00 0.00 ? 362 VAL B HG23 1  
ATOM 1379  N N    . ALA B 2 69 ? 2.419   -4.723  9.084   1.00 0.00 ? 363 ALA B N    1  
ATOM 1380  C CA   . ALA B 2 69 ? 3.371   -5.453  9.922   1.00 0.00 ? 363 ALA B CA   1  
ATOM 1381  C C    . ALA B 2 69 ? 2.740   -6.704  10.541  1.00 0.00 ? 363 ALA B C    1  
ATOM 1382  O O    . ALA B 2 69 ? 3.428   -7.700  10.775  1.00 0.00 ? 363 ALA B O    1  
ATOM 1383  C CB   . ALA B 2 69 ? 3.920   -4.544  11.013  1.00 0.00 ? 363 ALA B CB   1  
ATOM 1384  H H    . ALA B 2 69 ? 2.247   -3.776  9.277   1.00 0.00 ? 363 ALA B H    1  
ATOM 1385  H HA   . ALA B 2 69 ? 4.196   -5.755  9.295   1.00 0.00 ? 363 ALA B HA   1  
ATOM 1386  H HB1  . ALA B 2 69 ? 3.111   -3.980  11.454  1.00 0.00 ? 363 ALA B HB1  1  
ATOM 1387  H HB2  . ALA B 2 69 ? 4.642   -3.863  10.586  1.00 0.00 ? 363 ALA B HB2  1  
ATOM 1388  H HB3  . ALA B 2 69 ? 4.398   -5.143  11.775  1.00 0.00 ? 363 ALA B HB3  1  
ATOM 1389  N N    . ARG B 2 70 ? 1.428   -6.649  10.798  1.00 0.00 ? 364 ARG B N    1  
ATOM 1390  C CA   . ARG B 2 70 ? 0.704   -7.778  11.383  1.00 0.00 ? 364 ARG B CA   1  
ATOM 1391  C C    . ARG B 2 70 ? 0.562   -8.904  10.365  1.00 0.00 ? 364 ARG B C    1  
ATOM 1392  O O    . ARG B 2 70 ? 0.673   -10.078 10.703  1.00 0.00 ? 364 ARG B O    1  
ATOM 1393  C CB   . ARG B 2 70 ? -0.674  -7.325  11.874  1.00 0.00 ? 364 ARG B CB   1  
ATOM 1394  C CG   . ARG B 2 70 ? -0.608  -6.193  12.888  1.00 0.00 ? 364 ARG B CG   1  
ATOM 1395  C CD   . ARG B 2 70 ? -1.994  -5.725  13.299  1.00 0.00 ? 364 ARG B CD   1  
ATOM 1396  N NE   . ARG B 2 70 ? -1.944  -4.546  14.169  1.00 0.00 ? 364 ARG B NE   1  
ATOM 1397  C CZ   . ARG B 2 70 ? -1.456  -4.545  15.414  1.00 0.00 ? 364 ARG B CZ   1  
ATOM 1398  N NH1  . ARG B 2 70 ? -1.022  -5.671  15.975  1.00 0.00 ? 364 ARG B NH1  1  
ATOM 1399  N NH2  . ARG B 2 70 ? -1.416  -3.412  16.107  1.00 0.00 ? 364 ARG B NH2  1  
ATOM 1400  H H    . ARG B 2 70 ? 0.930   -5.832  10.577  1.00 0.00 ? 364 ARG B H    1  
ATOM 1401  H HA   . ARG B 2 70 ? 1.275   -8.142  12.225  1.00 0.00 ? 364 ARG B HA   1  
ATOM 1402  H HB2  . ARG B 2 70 ? -1.254  -6.989  11.027  1.00 0.00 ? 364 ARG B HB2  1  
ATOM 1403  H HB3  . ARG B 2 70 ? -1.174  -8.164  12.334  1.00 0.00 ? 364 ARG B HB3  1  
ATOM 1404  H HG2  . ARG B 2 70 ? -0.082  -6.540  13.765  1.00 0.00 ? 364 ARG B HG2  1  
ATOM 1405  H HG3  . ARG B 2 70 ? -0.073  -5.364  12.452  1.00 0.00 ? 364 ARG B HG3  1  
ATOM 1406  H HD2  . ARG B 2 70 ? -2.555  -5.480  12.409  1.00 0.00 ? 364 ARG B HD2  1  
ATOM 1407  H HD3  . ARG B 2 70 ? -2.489  -6.528  13.824  1.00 0.00 ? 364 ARG B HD3  1  
ATOM 1408  H HE   . ARG B 2 70 ? -2.280  -3.703  13.799  1.00 0.00 ? 364 ARG B HE   1  
ATOM 1409  H HH11 . ARG B 2 70 ? -1.059  -6.532  15.469  1.00 0.00 ? 364 ARG B HH11 1  
ATOM 1410  H HH12 . ARG B 2 70 ? -0.658  -5.657  16.907  1.00 0.00 ? 364 ARG B HH12 1  
ATOM 1411  H HH21 . ARG B 2 70 ? -1.750  -2.563  15.697  1.00 0.00 ? 364 ARG B HH21 1  
ATOM 1412  H HH22 . ARG B 2 70 ? -1.052  -3.407  17.038  1.00 0.00 ? 364 ARG B HH22 1  
ATOM 1413  N N    . LEU B 2 71 ? 0.318   -8.528  9.114   1.00 0.00 ? 365 LEU B N    1  
ATOM 1414  C CA   . LEU B 2 71 ? 0.170   -9.488  8.025   1.00 0.00 ? 365 LEU B CA   1  
ATOM 1415  C C    . LEU B 2 71 ? 1.481   -10.225 7.729   1.00 0.00 ? 365 LEU B C    1  
ATOM 1416  O O    . LEU B 2 71 ? 1.481   -11.428 7.465   1.00 0.00 ? 365 LEU B O    1  
ATOM 1417  C CB   . LEU B 2 71 ? -0.295  -8.767  6.754   1.00 0.00 ? 365 LEU B CB   1  
ATOM 1418  C CG   . LEU B 2 71 ? -1.633  -8.041  6.862   1.00 0.00 ? 365 LEU B CG   1  
ATOM 1419  C CD1  . LEU B 2 71 ? -1.907  -7.229  5.608   1.00 0.00 ? 365 LEU B CD1  1  
ATOM 1420  C CD2  . LEU B 2 71 ? -2.758  -9.028  7.128   1.00 0.00 ? 365 LEU B CD2  1  
ATOM 1421  H H    . LEU B 2 71 ? 0.244   -7.571  8.912   1.00 0.00 ? 365 LEU B H    1  
ATOM 1422  H HA   . LEU B 2 71 ? -0.580  -10.208 8.313   1.00 0.00 ? 365 LEU B HA   1  
ATOM 1423  H HB2  . LEU B 2 71 ? 0.458   -8.041  6.486   1.00 0.00 ? 365 LEU B HB2  1  
ATOM 1424  H HB3  . LEU B 2 71 ? -0.367  -9.491  5.960   1.00 0.00 ? 365 LEU B HB3  1  
ATOM 1425  H HG   . LEU B 2 71 ? -1.589  -7.359  7.688   1.00 0.00 ? 365 LEU B HG   1  
ATOM 1426  H HD11 . LEU B 2 71 ? -1.481  -6.242  5.724   1.00 0.00 ? 365 LEU B HD11 1  
ATOM 1427  H HD12 . LEU B 2 71 ? -2.972  -7.145  5.455   1.00 0.00 ? 365 LEU B HD12 1  
ATOM 1428  H HD13 . LEU B 2 71 ? -1.457  -7.716  4.756   1.00 0.00 ? 365 LEU B HD13 1  
ATOM 1429  H HD21 . LEU B 2 71 ? -2.619  -9.908  6.518   1.00 0.00 ? 365 LEU B HD21 1  
ATOM 1430  H HD22 . LEU B 2 71 ? -3.705  -8.569  6.888   1.00 0.00 ? 365 LEU B HD22 1  
ATOM 1431  H HD23 . LEU B 2 71 ? -2.748  -9.308  8.172   1.00 0.00 ? 365 LEU B HD23 1  
ATOM 1432  N N    . PHE B 2 72 ? 2.585   -9.472  7.714   1.00 0.00 ? 366 PHE B N    1  
ATOM 1433  C CA   . PHE B 2 72 ? 3.900   -10.010 7.382   1.00 0.00 ? 366 PHE B CA   1  
ATOM 1434  C C    . PHE B 2 72 ? 4.681   -10.526 8.598   1.00 0.00 ? 366 PHE B C    1  
ATOM 1435  O O    . PHE B 2 72 ? 5.882   -10.273 8.719   1.00 0.00 ? 366 PHE B O    1  
ATOM 1436  C CB   . PHE B 2 72 ? 4.685   -8.922  6.652   1.00 0.00 ? 366 PHE B CB   1  
ATOM 1437  C CG   . PHE B 2 72 ? 4.052   -8.502  5.350   1.00 0.00 ? 366 PHE B CG   1  
ATOM 1438  C CD1  . PHE B 2 72 ? 2.714   -8.137  5.295   1.00 0.00 ? 366 PHE B CD1  1  
ATOM 1439  C CD2  . PHE B 2 72 ? 4.787   -8.485  4.182   1.00 0.00 ? 366 PHE B CD2  1  
ATOM 1440  C CE1  . PHE B 2 72 ? 2.126   -7.771  4.109   1.00 0.00 ? 366 PHE B CE1  1  
ATOM 1441  C CE2  . PHE B 2 72 ? 4.202   -8.112  2.987   1.00 0.00 ? 366 PHE B CE2  1  
ATOM 1442  C CZ   . PHE B 2 72 ? 2.866   -7.757  2.953   1.00 0.00 ? 366 PHE B CZ   1  
ATOM 1443  H H    . PHE B 2 72 ? 2.510   -8.509  7.891   1.00 0.00 ? 366 PHE B H    1  
ATOM 1444  H HA   . PHE B 2 72 ? 3.749   -10.831 6.700   1.00 0.00 ? 366 PHE B HA   1  
ATOM 1445  H HB2  . PHE B 2 72 ? 4.744   -8.053  7.288   1.00 0.00 ? 366 PHE B HB2  1  
ATOM 1446  H HB3  . PHE B 2 72 ? 5.682   -9.282  6.442   1.00 0.00 ? 366 PHE B HB3  1  
ATOM 1447  H HD1  . PHE B 2 72 ? 2.129   -8.141  6.196   1.00 0.00 ? 366 PHE B HD1  1  
ATOM 1448  H HD2  . PHE B 2 72 ? 5.828   -8.761  4.210   1.00 0.00 ? 366 PHE B HD2  1  
ATOM 1449  H HE1  . PHE B 2 72 ? 1.083   -7.492  4.088   1.00 0.00 ? 366 PHE B HE1  1  
ATOM 1450  H HE2  . PHE B 2 72 ? 4.787   -8.101  2.080   1.00 0.00 ? 366 PHE B HE2  1  
ATOM 1451  H HZ   . PHE B 2 72 ? 2.400   -7.476  2.022   1.00 0.00 ? 366 PHE B HZ   1  
ATOM 1452  N N    . LYS B 2 73 ? 4.005   -11.260 9.484   1.00 0.00 ? 367 LYS B N    1  
ATOM 1453  C CA   . LYS B 2 73 ? 4.650   -11.823 10.674  1.00 0.00 ? 367 LYS B CA   1  
ATOM 1454  C C    . LYS B 2 73 ? 5.921   -12.607 10.320  1.00 0.00 ? 367 LYS B C    1  
ATOM 1455  O O    . LYS B 2 73 ? 7.030   -12.132 10.569  1.00 0.00 ? 367 LYS B O    1  
ATOM 1456  C CB   . LYS B 2 73 ? 3.669   -12.704 11.454  1.00 0.00 ? 367 LYS B CB   1  
ATOM 1457  C CG   . LYS B 2 73 ? 2.552   -11.907 12.104  1.00 0.00 ? 367 LYS B CG   1  
ATOM 1458  C CD   . LYS B 2 73 ? 1.507   -12.799 12.756  1.00 0.00 ? 367 LYS B CD   1  
ATOM 1459  C CE   . LYS B 2 73 ? 2.095   -13.634 13.885  1.00 0.00 ? 367 LYS B CE   1  
ATOM 1460  N NZ   . LYS B 2 73 ? 2.630   -12.789 14.990  1.00 0.00 ? 367 LYS B NZ   1  
ATOM 1461  H H    . LYS B 2 73 ? 3.055   -11.438 9.328   1.00 0.00 ? 367 LYS B H    1  
ATOM 1462  H HA   . LYS B 2 73 ? 4.935   -10.992 11.303  1.00 0.00 ? 367 LYS B HA   1  
ATOM 1463  H HB2  . LYS B 2 73 ? 3.228   -13.422 10.778  1.00 0.00 ? 367 LYS B HB2  1  
ATOM 1464  H HB3  . LYS B 2 73 ? 4.207   -13.229 12.228  1.00 0.00 ? 367 LYS B HB3  1  
ATOM 1465  H HG2  . LYS B 2 73 ? 2.976   -11.262 12.858  1.00 0.00 ? 367 LYS B HG2  1  
ATOM 1466  H HG3  . LYS B 2 73 ? 2.076   -11.307 11.348  1.00 0.00 ? 367 LYS B HG3  1  
ATOM 1467  H HD2  . LYS B 2 73 ? 0.721   -12.175 13.156  1.00 0.00 ? 367 LYS B HD2  1  
ATOM 1468  H HD3  . LYS B 2 73 ? 1.096   -13.460 12.006  1.00 0.00 ? 367 LYS B HD3  1  
ATOM 1469  H HE2  . LYS B 2 73 ? 1.321   -14.276 14.280  1.00 0.00 ? 367 LYS B HE2  1  
ATOM 1470  H HE3  . LYS B 2 73 ? 2.895   -14.242 13.487  1.00 0.00 ? 367 LYS B HE3  1  
ATOM 1471  H HZ1  . LYS B 2 73 ? 1.901   -12.123 15.318  1.00 0.00 ? 367 LYS B HZ1  1  
ATOM 1472  H HZ2  . LYS B 2 73 ? 3.454   -12.247 14.659  1.00 0.00 ? 367 LYS B HZ2  1  
ATOM 1473  H HZ3  . LYS B 2 73 ? 2.922   -13.387 15.788  1.00 0.00 ? 367 LYS B HZ3  1  
ATOM 1474  N N    . ASN B 2 74 ? 5.760   -13.811 9.751   1.00 0.00 ? 368 ASN B N    1  
ATOM 1475  C CA   . ASN B 2 74 ? 6.915   -14.644 9.385   1.00 0.00 ? 368 ASN B CA   1  
ATOM 1476  C C    . ASN B 2 74 ? 7.489   -14.312 7.993   1.00 0.00 ? 368 ASN B C    1  
ATOM 1477  O O    . ASN B 2 74 ? 8.083   -15.174 7.341   1.00 0.00 ? 368 ASN B O    1  
ATOM 1478  C CB   . ASN B 2 74 ? 6.586   -16.148 9.512   1.00 0.00 ? 368 ASN B CB   1  
ATOM 1479  C CG   . ASN B 2 74 ? 5.456   -16.658 8.614   1.00 0.00 ? 368 ASN B CG   1  
ATOM 1480  O OD1  . ASN B 2 74 ? 5.058   -17.817 8.725   1.00 0.00 ? 368 ASN B OD1  1  
ATOM 1481  N ND2  . ASN B 2 74 ? 4.938   -15.825 7.719   1.00 0.00 ? 368 ASN B ND2  1  
ATOM 1482  H H    . ASN B 2 74 ? 4.854   -14.145 9.582   1.00 0.00 ? 368 ASN B H    1  
ATOM 1483  H HA   . ASN B 2 74 ? 7.688   -14.419 10.107  1.00 0.00 ? 368 ASN B HA   1  
ATOM 1484  H HB2  . ASN B 2 74 ? 7.472   -16.713 9.273   1.00 0.00 ? 368 ASN B HB2  1  
ATOM 1485  H HB3  . ASN B 2 74 ? 6.315   -16.352 10.538  1.00 0.00 ? 368 ASN B HB3  1  
ATOM 1486  H HD21 . ASN B 2 74 ? 5.294   -14.922 7.662   1.00 0.00 ? 368 ASN B HD21 1  
ATOM 1487  H HD22 . ASN B 2 74 ? 4.215   -16.158 7.147   1.00 0.00 ? 368 ASN B HD22 1  
ATOM 1488  N N    . GLN B 2 75 ? 7.343   -13.054 7.560   1.00 0.00 ? 369 GLN B N    1  
ATOM 1489  C CA   . GLN B 2 75 ? 7.880   -12.605 6.270   1.00 0.00 ? 369 GLN B CA   1  
ATOM 1490  C C    . GLN B 2 75 ? 8.417   -11.177 6.388   1.00 0.00 ? 369 GLN B C    1  
ATOM 1491  O O    . GLN B 2 75 ? 8.103   -10.306 5.572   1.00 0.00 ? 369 GLN B O    1  
ATOM 1492  C CB   . GLN B 2 75 ? 6.841   -12.697 5.137   1.00 0.00 ? 369 GLN B CB   1  
ATOM 1493  C CG   . GLN B 2 75 ? 5.433   -12.262 5.517   1.00 0.00 ? 369 GLN B CG   1  
ATOM 1494  C CD   . GLN B 2 75 ? 4.515   -13.440 5.795   1.00 0.00 ? 369 GLN B CD   1  
ATOM 1495  O OE1  . GLN B 2 75 ? 4.465   -14.396 5.019   1.00 0.00 ? 369 GLN B OE1  1  
ATOM 1496  N NE2  . GLN B 2 75 ? 3.761   -13.371 6.886   1.00 0.00 ? 369 GLN B NE2  1  
ATOM 1497  H H    . GLN B 2 75 ? 6.886   -12.404 8.130   1.00 0.00 ? 369 GLN B H    1  
ATOM 1498  H HA   . GLN B 2 75 ? 8.710   -13.255 6.028   1.00 0.00 ? 369 GLN B HA   1  
ATOM 1499  H HB2  . GLN B 2 75 ? 7.169   -12.069 4.322   1.00 0.00 ? 369 GLN B HB2  1  
ATOM 1500  H HB3  . GLN B 2 75 ? 6.796   -13.716 4.786   1.00 0.00 ? 369 GLN B HB3  1  
ATOM 1501  H HG2  . GLN B 2 75 ? 5.488   -11.651 6.405   1.00 0.00 ? 369 GLN B HG2  1  
ATOM 1502  H HG3  . GLN B 2 75 ? 5.017   -11.683 4.706   1.00 0.00 ? 369 GLN B HG3  1  
ATOM 1503  H HE21 . GLN B 2 75 ? 3.833   -12.579 7.450   1.00 0.00 ? 369 GLN B HE21 1  
ATOM 1504  H HE22 . GLN B 2 75 ? 3.158   -14.119 7.078   1.00 0.00 ? 369 GLN B HE22 1  
ATOM 1505  N N    . GLU B 2 76 ? 9.238   -10.958 7.420   1.00 0.00 ? 370 GLU B N    1  
ATOM 1506  C CA   . GLU B 2 76 ? 9.854   -9.654  7.686   1.00 0.00 ? 370 GLU B CA   1  
ATOM 1507  C C    . GLU B 2 76 ? 10.564  -9.077  6.454   1.00 0.00 ? 370 GLU B C    1  
ATOM 1508  O O    . GLU B 2 76 ? 10.775  -7.865  6.371   1.00 0.00 ? 370 GLU B O    1  
ATOM 1509  C CB   . GLU B 2 76 ? 10.845  -9.766  8.849   1.00 0.00 ? 370 GLU B CB   1  
ATOM 1510  C CG   . GLU B 2 76 ? 10.201  -10.202 10.161  1.00 0.00 ? 370 GLU B CG   1  
ATOM 1511  C CD   . GLU B 2 76 ? 11.194  -10.342 11.307  1.00 0.00 ? 370 GLU B CD   1  
ATOM 1512  O OE1  . GLU B 2 76 ? 12.403  -10.100 11.094  1.00 0.00 ? 370 GLU B OE1  1  
ATOM 1513  O OE2  . GLU B 2 76 ? 10.759  -10.697 12.422  1.00 0.00 ? 370 GLU B OE2  1  
ATOM 1514  H H    . GLU B 2 76 ? 9.442   -11.704 8.023   1.00 0.00 ? 370 GLU B H    1  
ATOM 1515  H HA   . GLU B 2 76 ? 9.064   -8.975  7.973   1.00 0.00 ? 370 GLU B HA   1  
ATOM 1516  H HB2  . GLU B 2 76 ? 11.607  -10.486 8.590   1.00 0.00 ? 370 GLU B HB2  1  
ATOM 1517  H HB3  . GLU B 2 76 ? 11.310  -8.804  9.005   1.00 0.00 ? 370 GLU B HB3  1  
ATOM 1518  H HG2  . GLU B 2 76 ? 9.459   -9.470  10.441  1.00 0.00 ? 370 GLU B HG2  1  
ATOM 1519  H HG3  . GLU B 2 76 ? 9.719   -11.157 10.007  1.00 0.00 ? 370 GLU B HG3  1  
ATOM 1520  N N    . ASP B 2 77 ? 10.935  -9.942  5.502   1.00 0.00 ? 371 ASP B N    1  
ATOM 1521  C CA   . ASP B 2 77 ? 11.622  -9.501  4.288   1.00 0.00 ? 371 ASP B CA   1  
ATOM 1522  C C    . ASP B 2 77 ? 10.712  -8.600  3.460   1.00 0.00 ? 371 ASP B C    1  
ATOM 1523  O O    . ASP B 2 77 ? 11.077  -7.465  3.149   1.00 0.00 ? 371 ASP B O    1  
ATOM 1524  C CB   . ASP B 2 77 ? 12.068  -10.708 3.455   1.00 0.00 ? 371 ASP B CB   1  
ATOM 1525  C CG   . ASP B 2 77 ? 13.013  -11.622 4.213   1.00 0.00 ? 371 ASP B CG   1  
ATOM 1526  O OD1  . ASP B 2 77 ? 14.111  -11.162 4.592   1.00 0.00 ? 371 ASP B OD1  1  
ATOM 1527  O OD2  . ASP B 2 77 ? 12.653  -12.798 4.430   1.00 0.00 ? 371 ASP B OD2  1  
ATOM 1528  H H    . ASP B 2 77 ? 10.748  -10.893 5.620   1.00 0.00 ? 371 ASP B H    1  
ATOM 1529  H HA   . ASP B 2 77 ? 12.493  -8.937  4.586   1.00 0.00 ? 371 ASP B HA   1  
ATOM 1530  H HB2  . ASP B 2 77 ? 11.198  -11.279 3.167   1.00 0.00 ? 371 ASP B HB2  1  
ATOM 1531  H HB3  . ASP B 2 77 ? 12.572  -10.356 2.567   1.00 0.00 ? 371 ASP B HB3  1  
ATOM 1532  N N    . LEU B 2 78 ? 9.518   -9.098  3.127   1.00 0.00 ? 372 LEU B N    1  
ATOM 1533  C CA   . LEU B 2 78 ? 8.550   -8.312  2.363   1.00 0.00 ? 372 LEU B CA   1  
ATOM 1534  C C    . LEU B 2 78 ? 8.295   -6.965  3.051   1.00 0.00 ? 372 LEU B C    1  
ATOM 1535  O O    . LEU B 2 78 ? 8.147   -5.941  2.386   1.00 0.00 ? 372 LEU B O    1  
ATOM 1536  C CB   . LEU B 2 78 ? 7.233   -9.079  2.192   1.00 0.00 ? 372 LEU B CB   1  
ATOM 1537  C CG   . LEU B 2 78 ? 7.293   -10.318 1.293   1.00 0.00 ? 372 LEU B CG   1  
ATOM 1538  C CD1  . LEU B 2 78 ? 5.934   -11.009 1.251   1.00 0.00 ? 372 LEU B CD1  1  
ATOM 1539  C CD2  . LEU B 2 78 ? 7.748   -9.943  -0.114  1.00 0.00 ? 372 LEU B CD2  1  
ATOM 1540  H H    . LEU B 2 78 ? 9.276   -10.002 3.421   1.00 0.00 ? 372 LEU B H    1  
ATOM 1541  H HA   . LEU B 2 78 ? 8.977   -8.125  1.388   1.00 0.00 ? 372 LEU B HA   1  
ATOM 1542  H HB2  . LEU B 2 78 ? 6.901   -9.392  3.169   1.00 0.00 ? 372 LEU B HB2  1  
ATOM 1543  H HB3  . LEU B 2 78 ? 6.500   -8.401  1.782   1.00 0.00 ? 372 LEU B HB3  1  
ATOM 1544  H HG   . LEU B 2 78 ? 8.009   -11.017 1.702   1.00 0.00 ? 372 LEU B HG   1  
ATOM 1545  H HD11 . LEU B 2 78 ? 5.843   -11.569 0.332   1.00 0.00 ? 372 LEU B HD11 1  
ATOM 1546  H HD12 . LEU B 2 78 ? 5.146   -10.267 1.299   1.00 0.00 ? 372 LEU B HD12 1  
ATOM 1547  H HD13 . LEU B 2 78 ? 5.847   -11.683 2.094   1.00 0.00 ? 372 LEU B HD13 1  
ATOM 1548  H HD21 . LEU B 2 78 ? 8.011   -10.838 -0.663  1.00 0.00 ? 372 LEU B HD21 1  
ATOM 1549  H HD22 . LEU B 2 78 ? 8.610   -9.296  -0.055  1.00 0.00 ? 372 LEU B HD22 1  
ATOM 1550  H HD23 . LEU B 2 78 ? 6.949   -9.429  -0.629  1.00 0.00 ? 372 LEU B HD23 1  
ATOM 1551  N N    . LEU B 2 79 ? 8.270   -6.974  4.391   1.00 0.00 ? 373 LEU B N    1  
ATOM 1552  C CA   . LEU B 2 79 ? 8.055   -5.751  5.170   1.00 0.00 ? 373 LEU B CA   1  
ATOM 1553  C C    . LEU B 2 79 ? 9.189   -4.753  4.948   1.00 0.00 ? 373 LEU B C    1  
ATOM 1554  O O    . LEU B 2 79 ? 8.948   -3.551  4.828   1.00 0.00 ? 373 LEU B O    1  
ATOM 1555  C CB   . LEU B 2 79 ? 7.933   -6.072  6.665   1.00 0.00 ? 373 LEU B CB   1  
ATOM 1556  C CG   . LEU B 2 79 ? 6.532   -6.465  7.138   1.00 0.00 ? 373 LEU B CG   1  
ATOM 1557  C CD1  . LEU B 2 79 ? 6.559   -6.875  8.603   1.00 0.00 ? 373 LEU B CD1  1  
ATOM 1558  C CD2  . LEU B 2 79 ? 5.559   -5.314  6.921   1.00 0.00 ? 373 LEU B CD2  1  
ATOM 1559  H H    . LEU B 2 79 ? 8.411   -7.821  4.866   1.00 0.00 ? 373 LEU B H    1  
ATOM 1560  H HA   . LEU B 2 79 ? 7.132   -5.305  4.832   1.00 0.00 ? 373 LEU B HA   1  
ATOM 1561  H HB2  . LEU B 2 79 ? 8.607   -6.885  6.891   1.00 0.00 ? 373 LEU B HB2  1  
ATOM 1562  H HB3  . LEU B 2 79 ? 8.246   -5.203  7.224   1.00 0.00 ? 373 LEU B HB3  1  
ATOM 1563  H HG   . LEU B 2 79 ? 6.185   -7.310  6.563   1.00 0.00 ? 373 LEU B HG   1  
ATOM 1564  H HD11 . LEU B 2 79 ? 5.552   -6.887  8.992   1.00 0.00 ? 373 LEU B HD11 1  
ATOM 1565  H HD12 . LEU B 2 79 ? 7.154   -6.169  9.164   1.00 0.00 ? 373 LEU B HD12 1  
ATOM 1566  H HD13 . LEU B 2 79 ? 6.991   -7.861  8.693   1.00 0.00 ? 373 LEU B HD13 1  
ATOM 1567  H HD21 . LEU B 2 79 ? 5.310   -4.868  7.872   1.00 0.00 ? 373 LEU B HD21 1  
ATOM 1568  H HD22 . LEU B 2 79 ? 4.662   -5.687  6.452   1.00 0.00 ? 373 LEU B HD22 1  
ATOM 1569  H HD23 . LEU B 2 79 ? 6.016   -4.570  6.283   1.00 0.00 ? 373 LEU B HD23 1  
ATOM 1570  N N    . SER B 2 80 ? 10.422  -5.259  4.880   1.00 0.00 ? 374 SER B N    1  
ATOM 1571  C CA   . SER B 2 80 ? 11.590  -4.410  4.650   1.00 0.00 ? 374 SER B CA   1  
ATOM 1572  C C    . SER B 2 80 ? 11.416  -3.607  3.360   1.00 0.00 ? 374 SER B C    1  
ATOM 1573  O O    . SER B 2 80 ? 11.710  -2.411  3.316   1.00 0.00 ? 374 SER B O    1  
ATOM 1574  C CB   . SER B 2 80 ? 12.861  -5.262  4.579   1.00 0.00 ? 374 SER B CB   1  
ATOM 1575  O OG   . SER B 2 80 ? 13.116  -5.903  5.817   1.00 0.00 ? 374 SER B OG   1  
ATOM 1576  H H    . SER B 2 80 ? 10.548  -6.228  4.973   1.00 0.00 ? 374 SER B H    1  
ATOM 1577  H HA   . SER B 2 80 ? 11.670  -3.724  5.480   1.00 0.00 ? 374 SER B HA   1  
ATOM 1578  H HB2  . SER B 2 80 ? 12.742  -6.020  3.817   1.00 0.00 ? 374 SER B HB2  1  
ATOM 1579  H HB3  . SER B 2 80 ? 13.703  -4.632  4.332   1.00 0.00 ? 374 SER B HB3  1  
ATOM 1580  H HG   . SER B 2 80 ? 14.026  -6.210  5.838   1.00 0.00 ? 374 SER B HG   1  
ATOM 1581  N N    . GLU B 2 81 ? 10.916  -4.277  2.318   1.00 0.00 ? 375 GLU B N    1  
ATOM 1582  C CA   . GLU B 2 81 ? 10.672  -3.642  1.023   1.00 0.00 ? 375 GLU B CA   1  
ATOM 1583  C C    . GLU B 2 81 ? 9.592   -2.559  1.148   1.00 0.00 ? 375 GLU B C    1  
ATOM 1584  O O    . GLU B 2 81 ? 9.693   -1.491  0.541   1.00 0.00 ? 375 GLU B O    1  
ATOM 1585  C CB   . GLU B 2 81 ? 10.222  -4.698  0.005   1.00 0.00 ? 375 GLU B CB   1  
ATOM 1586  C CG   . GLU B 2 81 ? 10.312  -4.248  -1.443  1.00 0.00 ? 375 GLU B CG   1  
ATOM 1587  C CD   . GLU B 2 81 ? 11.700  -4.430  -2.031  1.00 0.00 ? 375 GLU B CD   1  
ATOM 1588  O OE1  . GLU B 2 81 ? 12.667  -3.883  -1.463  1.00 0.00 ? 375 GLU B OE1  1  
ATOM 1589  O OE2  . GLU B 2 81 ? 11.818  -5.124  -3.063  1.00 0.00 ? 375 GLU B OE2  1  
ATOM 1590  H H    . GLU B 2 81 ? 10.691  -5.225  2.429   1.00 0.00 ? 375 GLU B H    1  
ATOM 1591  H HA   . GLU B 2 81 ? 11.593  -3.190  0.687   1.00 0.00 ? 375 GLU B HA   1  
ATOM 1592  H HB2  . GLU B 2 81 ? 10.838  -5.575  0.119   1.00 0.00 ? 375 GLU B HB2  1  
ATOM 1593  H HB3  . GLU B 2 81 ? 9.196   -4.964  0.213   1.00 0.00 ? 375 GLU B HB3  1  
ATOM 1594  H HG2  . GLU B 2 81 ? 9.614   -4.827  -2.026  1.00 0.00 ? 375 GLU B HG2  1  
ATOM 1595  H HG3  . GLU B 2 81 ? 10.047  -3.203  -1.499  1.00 0.00 ? 375 GLU B HG3  1  
ATOM 1596  N N    . PHE B 2 82 ? 8.554   -2.863  1.937   1.00 0.00 ? 376 PHE B N    1  
ATOM 1597  C CA   . PHE B 2 82 ? 7.425   -1.952  2.161   1.00 0.00 ? 376 PHE B CA   1  
ATOM 1598  C C    . PHE B 2 82 ? 7.873   -0.569  2.641   1.00 0.00 ? 376 PHE B C    1  
ATOM 1599  O O    . PHE B 2 82 ? 7.485   0.449   2.064   1.00 0.00 ? 376 PHE B O    1  
ATOM 1600  C CB   . PHE B 2 82 ? 6.468   -2.561  3.191   1.00 0.00 ? 376 PHE B CB   1  
ATOM 1601  C CG   . PHE B 2 82 ? 5.177   -1.808  3.343   1.00 0.00 ? 376 PHE B CG   1  
ATOM 1602  C CD1  . PHE B 2 82 ? 4.350   -1.602  2.251   1.00 0.00 ? 376 PHE B CD1  1  
ATOM 1603  C CD2  . PHE B 2 82 ? 4.789   -1.313  4.577   1.00 0.00 ? 376 PHE B CD2  1  
ATOM 1604  C CE1  . PHE B 2 82 ? 3.161   -0.916  2.386   1.00 0.00 ? 376 PHE B CE1  1  
ATOM 1605  C CE2  . PHE B 2 82 ? 3.599   -0.624  4.718   1.00 0.00 ? 376 PHE B CE2  1  
ATOM 1606  C CZ   . PHE B 2 82 ? 2.785   -0.426  3.620   1.00 0.00 ? 376 PHE B CZ   1  
ATOM 1607  H H    . PHE B 2 82 ? 8.542   -3.738  2.378   1.00 0.00 ? 376 PHE B H    1  
ATOM 1608  H HA   . PHE B 2 82 ? 6.901   -1.841  1.224   1.00 0.00 ? 376 PHE B HA   1  
ATOM 1609  H HB2  . PHE B 2 82 ? 6.229   -3.570  2.899   1.00 0.00 ? 376 PHE B HB2  1  
ATOM 1610  H HB3  . PHE B 2 82 ? 6.955   -2.580  4.155   1.00 0.00 ? 376 PHE B HB3  1  
ATOM 1611  H HD1  . PHE B 2 82 ? 4.644   -1.984  1.285   1.00 0.00 ? 376 PHE B HD1  1  
ATOM 1612  H HD2  . PHE B 2 82 ? 5.426   -1.467  5.435   1.00 0.00 ? 376 PHE B HD2  1  
ATOM 1613  H HE1  . PHE B 2 82 ? 2.525   -0.762  1.526   1.00 0.00 ? 376 PHE B HE1  1  
ATOM 1614  H HE2  . PHE B 2 82 ? 3.307   -0.242  5.684   1.00 0.00 ? 376 PHE B HE2  1  
ATOM 1615  H HZ   . PHE B 2 82 ? 1.856   0.111   3.726   1.00 0.00 ? 376 PHE B HZ   1  
ATOM 1616  N N    . GLY B 2 83 ? 8.665   -0.543  3.717   1.00 0.00 ? 377 GLY B N    1  
ATOM 1617  C CA   . GLY B 2 83 ? 9.137   0.714   4.291   1.00 0.00 ? 377 GLY B CA   1  
ATOM 1618  C C    . GLY B 2 83 ? 9.791   1.664   3.291   1.00 0.00 ? 377 GLY B C    1  
ATOM 1619  O O    . GLY B 2 83 ? 9.820   2.874   3.524   1.00 0.00 ? 377 GLY B O    1  
ATOM 1620  H H    . GLY B 2 83 ? 8.917   -1.392  4.142   1.00 0.00 ? 377 GLY B H    1  
ATOM 1621  H HA2  . GLY B 2 83 ? 8.293   1.222   4.740   1.00 0.00 ? 377 GLY B HA2  1  
ATOM 1622  H HA3  . GLY B 2 83 ? 9.851   0.487   5.069   1.00 0.00 ? 377 GLY B HA3  1  
ATOM 1623  N N    . GLN B 2 84 ? 10.321  1.133   2.185   1.00 0.00 ? 378 GLN B N    1  
ATOM 1624  C CA   . GLN B 2 84 ? 10.974  1.970   1.171   1.00 0.00 ? 378 GLN B CA   1  
ATOM 1625  C C    . GLN B 2 84 ? 9.986   2.924   0.491   1.00 0.00 ? 378 GLN B C    1  
ATOM 1626  O O    . GLN B 2 84 ? 10.389  3.957   -0.048  1.00 0.00 ? 378 GLN B O    1  
ATOM 1627  C CB   . GLN B 2 84 ? 11.668  1.105   0.116   1.00 0.00 ? 378 GLN B CB   1  
ATOM 1628  C CG   . GLN B 2 84 ? 12.778  0.231   0.677   1.00 0.00 ? 378 GLN B CG   1  
ATOM 1629  C CD   . GLN B 2 84 ? 13.575  -0.463  -0.410  1.00 0.00 ? 378 GLN B CD   1  
ATOM 1630  O OE1  . GLN B 2 84 ? 13.024  -1.206  -1.219  1.00 0.00 ? 378 GLN B OE1  1  
ATOM 1631  N NE2  . GLN B 2 84 ? 14.882  -0.222  -0.436  1.00 0.00 ? 378 GLN B NE2  1  
ATOM 1632  H H    . GLN B 2 84 ? 10.276  0.163   2.048   1.00 0.00 ? 378 GLN B H    1  
ATOM 1633  H HA   . GLN B 2 84 ? 11.723  2.562   1.676   1.00 0.00 ? 378 GLN B HA   1  
ATOM 1634  H HB2  . GLN B 2 84 ? 10.933  0.464   -0.348  1.00 0.00 ? 378 GLN B HB2  1  
ATOM 1635  H HB3  . GLN B 2 84 ? 12.095  1.752   -0.637  1.00 0.00 ? 378 GLN B HB3  1  
ATOM 1636  H HG2  . GLN B 2 84 ? 13.447  0.848   1.257   1.00 0.00 ? 378 GLN B HG2  1  
ATOM 1637  H HG3  . GLN B 2 84 ? 12.337  -0.521  1.316   1.00 0.00 ? 378 GLN B HG3  1  
ATOM 1638  H HE21 . GLN B 2 84 ? 15.257  0.383   0.238   1.00 0.00 ? 378 GLN B HE21 1  
ATOM 1639  H HE22 . GLN B 2 84 ? 15.418  -0.659  -1.130  1.00 0.00 ? 378 GLN B HE22 1  
ATOM 1640  N N    . PHE B 2 85 ? 8.696   2.581   0.521   1.00 0.00 ? 379 PHE B N    1  
ATOM 1641  C CA   . PHE B 2 85 ? 7.660   3.415   -0.090  1.00 0.00 ? 379 PHE B CA   1  
ATOM 1642  C C    . PHE B 2 85 ? 7.118   4.429   0.919   1.00 0.00 ? 379 PHE B C    1  
ATOM 1643  O O    . PHE B 2 85 ? 6.703   5.527   0.546   1.00 0.00 ? 379 PHE B O    1  
ATOM 1644  C CB   . PHE B 2 85 ? 6.515   2.540   -0.609  1.00 0.00 ? 379 PHE B CB   1  
ATOM 1645  C CG   . PHE B 2 85 ? 6.971   1.442   -1.527  1.00 0.00 ? 379 PHE B CG   1  
ATOM 1646  C CD1  . PHE B 2 85 ? 7.528   1.735   -2.760  1.00 0.00 ? 379 PHE B CD1  1  
ATOM 1647  C CD2  . PHE B 2 85 ? 6.850   0.115   -1.148  1.00 0.00 ? 379 PHE B CD2  1  
ATOM 1648  C CE1  . PHE B 2 85 ? 7.955   0.725   -3.599  1.00 0.00 ? 379 PHE B CE1  1  
ATOM 1649  C CE2  . PHE B 2 85 ? 7.274   -0.898  -1.982  1.00 0.00 ? 379 PHE B CE2  1  
ATOM 1650  C CZ   . PHE B 2 85 ? 7.828   -0.594  -3.209  1.00 0.00 ? 379 PHE B CZ   1  
ATOM 1651  H H    . PHE B 2 85 ? 8.432   1.747   0.965   1.00 0.00 ? 379 PHE B H    1  
ATOM 1652  H HA   . PHE B 2 85 ? 8.102   3.947   -0.919  1.00 0.00 ? 379 PHE B HA   1  
ATOM 1653  H HB2  . PHE B 2 85 ? 6.011   2.084   0.230   1.00 0.00 ? 379 PHE B HB2  1  
ATOM 1654  H HB3  . PHE B 2 85 ? 5.815   3.159   -1.150  1.00 0.00 ? 379 PHE B HB3  1  
ATOM 1655  H HD1  . PHE B 2 85 ? 7.628   2.766   -3.066  1.00 0.00 ? 379 PHE B HD1  1  
ATOM 1656  H HD2  . PHE B 2 85 ? 6.416   -0.124  -0.188  1.00 0.00 ? 379 PHE B HD2  1  
ATOM 1657  H HE1  . PHE B 2 85 ? 8.388   0.965   -4.559  1.00 0.00 ? 379 PHE B HE1  1  
ATOM 1658  H HE2  . PHE B 2 85 ? 7.175   -1.927  -1.674  1.00 0.00 ? 379 PHE B HE2  1  
ATOM 1659  H HZ   . PHE B 2 85 ? 8.158   -1.386  -3.863  1.00 0.00 ? 379 PHE B HZ   1  
ATOM 1660  N N    . LEU B 2 86 ? 7.123   4.044   2.196   1.00 0.00 ? 380 LEU B N    1  
ATOM 1661  C CA   . LEU B 2 86 ? 6.634   4.893   3.266   1.00 0.00 ? 380 LEU B CA   1  
ATOM 1662  C C    . LEU B 2 86 ? 7.492   4.694   4.527   1.00 0.00 ? 380 LEU B C    1  
ATOM 1663  O O    . LEU B 2 86 ? 7.566   3.595   5.079   1.00 0.00 ? 380 LEU B O    1  
ATOM 1664  C CB   . LEU B 2 86 ? 5.162   4.561   3.513   1.00 0.00 ? 380 LEU B CB   1  
ATOM 1665  C CG   . LEU B 2 86 ? 4.872   3.228   4.164   1.00 0.00 ? 380 LEU B CG   1  
ATOM 1666  C CD1  . LEU B 2 86 ? 5.009   3.331   5.675   1.00 0.00 ? 380 LEU B CD1  1  
ATOM 1667  C CD2  . LEU B 2 86 ? 3.492   2.723   3.762   1.00 0.00 ? 380 LEU B CD2  1  
ATOM 1668  H H    . LEU B 2 86 ? 7.448   3.156   2.421   1.00 0.00 ? 380 LEU B H    1  
ATOM 1669  H HA   . LEU B 2 86 ? 6.716   5.919   2.942   1.00 0.00 ? 380 LEU B HA   1  
ATOM 1670  H HB2  . LEU B 2 86 ? 4.741   5.311   4.132   1.00 0.00 ? 380 LEU B HB2  1  
ATOM 1671  H HB3  . LEU B 2 86 ? 4.668   4.574   2.558   1.00 0.00 ? 380 LEU B HB3  1  
ATOM 1672  H HG   . LEU B 2 86 ? 5.596   2.533   3.818   1.00 0.00 ? 380 LEU B HG   1  
ATOM 1673  H HD11 . LEU B 2 86 ? 4.038   3.226   6.136   1.00 0.00 ? 380 LEU B HD11 1  
ATOM 1674  H HD12 . LEU B 2 86 ? 5.430   4.297   5.931   1.00 0.00 ? 380 LEU B HD12 1  
ATOM 1675  H HD13 . LEU B 2 86 ? 5.666   2.548   6.029   1.00 0.00 ? 380 LEU B HD13 1  
ATOM 1676  H HD21 . LEU B 2 86 ? 2.982   3.479   3.177   1.00 0.00 ? 380 LEU B HD21 1  
ATOM 1677  H HD22 . LEU B 2 86 ? 2.915   2.506   4.649   1.00 0.00 ? 380 LEU B HD22 1  
ATOM 1678  H HD23 . LEU B 2 86 ? 3.596   1.825   3.173   1.00 0.00 ? 380 LEU B HD23 1  
ATOM 1679  N N    . PRO B 2 87 ? 8.211   5.751   4.954   1.00 0.00 ? 381 PRO B N    1  
ATOM 1680  C CA   . PRO B 2 87 ? 9.120   5.711   6.096   1.00 0.00 ? 381 PRO B CA   1  
ATOM 1681  C C    . PRO B 2 87 ? 8.589   6.343   7.377   1.00 0.00 ? 381 PRO B C    1  
ATOM 1682  O O    . PRO B 2 87 ? 9.294   6.416   8.386   1.00 0.00 ? 381 PRO B O    1  
ATOM 1683  C CB   . PRO B 2 87 ? 10.284  6.534   5.569   1.00 0.00 ? 381 PRO B CB   1  
ATOM 1684  C CG   . PRO B 2 87 ? 9.671   7.531   4.619   1.00 0.00 ? 381 PRO B CG   1  
ATOM 1685  C CD   . PRO B 2 87 ? 8.260   7.065   4.319   1.00 0.00 ? 381 PRO B CD   1  
ATOM 1686  H HA   . PRO B 2 87 ? 9.435   4.721   6.305   1.00 0.00 ? 381 PRO B HA   1  
ATOM 1687  H HB2  . PRO B 2 87 ? 10.767  7.029   6.395   1.00 0.00 ? 381 PRO B HB2  1  
ATOM 1688  H HB3  . PRO B 2 87 ? 10.985  5.889   5.065   1.00 0.00 ? 381 PRO B HB3  1  
ATOM 1689  H HG2  . PRO B 2 87 ? 9.646   8.506   5.082   1.00 0.00 ? 381 PRO B HG2  1  
ATOM 1690  H HG3  . PRO B 2 87 ? 10.251  7.568   3.709   1.00 0.00 ? 381 PRO B HG3  1  
ATOM 1691  H HD2  . PRO B 2 87 ? 7.534   7.729   4.763   1.00 0.00 ? 381 PRO B HD2  1  
ATOM 1692  H HD3  . PRO B 2 87 ? 8.103   6.985   3.255   1.00 0.00 ? 381 PRO B HD3  1  
ATOM 1693  N N    . ASP B 2 88 ? 7.367   6.801   7.320   1.00 0.00 ? 382 ASP B N    1  
ATOM 1694  C CA   . ASP B 2 88 ? 6.723   7.449   8.466   1.00 0.00 ? 382 ASP B CA   1  
ATOM 1695  C C    . ASP B 2 88 ? 6.028   6.429   9.375   1.00 0.00 ? 382 ASP B C    1  
ATOM 1696  O O    . ASP B 2 88 ? 4.869   6.610   9.758   1.00 0.00 ? 382 ASP B O    1  
ATOM 1697  C CB   . ASP B 2 88 ? 5.727   8.511   7.984   1.00 0.00 ? 382 ASP B CB   1  
ATOM 1698  C CG   . ASP B 2 88 ? 6.381   9.573   7.120   1.00 0.00 ? 382 ASP B CG   1  
ATOM 1699  O OD1  . ASP B 2 88 ? 7.277   10.282  7.624   1.00 0.00 ? 382 ASP B OD1  1  
ATOM 1700  O OD2  . ASP B 2 88 ? 5.999   9.692   5.937   1.00 0.00 ? 382 ASP B OD2  1  
ATOM 1701  H H    . ASP B 2 88 ? 6.888   6.704   6.484   1.00 0.00 ? 382 ASP B H    1  
ATOM 1702  H HA   . ASP B 2 88 ? 7.498   7.939   9.037   1.00 0.00 ? 382 ASP B HA   1  
ATOM 1703  H HB2  . ASP B 2 88 ? 4.953   8.034   7.406   1.00 0.00 ? 382 ASP B HB2  1  
ATOM 1704  H HB3  . ASP B 2 88 ? 5.283   8.994   8.842   1.00 0.00 ? 382 ASP B HB3  1  
ATOM 1705  N N    . ALA B 2 89 ? 6.744   5.359   9.724   1.00 0.00 ? 383 ALA B N    1  
ATOM 1706  C CA   . ALA B 2 89 ? 6.197   4.316   10.589  1.00 0.00 ? 383 ALA B CA   1  
ATOM 1707  C C    . ALA B 2 89 ? 7.306   3.449   11.184  1.00 0.00 ? 383 ALA B C    1  
ATOM 1708  O O    . ALA B 2 89 ? 8.031   2.792   10.405  1.00 0.00 ? 383 ALA B O    1  
ATOM 1709  C CB   . ALA B 2 89 ? 5.207   3.458   9.815   1.00 0.00 ? 383 ALA B CB   1  
ATOM 1710  O OXT  . ALA B 2 89 ? 7.442   3.437   12.425  1.00 0.00 ? 383 ALA B OXT  1  
ATOM 1711  H H    . ALA B 2 89 ? 7.663   5.269   9.395   1.00 0.00 ? 383 ALA B H    1  
ATOM 1712  H HA   . ALA B 2 89 ? 5.663   4.800   11.394  1.00 0.00 ? 383 ALA B HA   1  
ATOM 1713  H HB1  . ALA B 2 89 ? 4.733   4.056   9.050   1.00 0.00 ? 383 ALA B HB1  1  
ATOM 1714  H HB2  . ALA B 2 89 ? 4.456   3.078   10.491  1.00 0.00 ? 383 ALA B HB2  1  
ATOM 1715  H HB3  . ALA B 2 89 ? 5.729   2.633   9.355   1.00 0.00 ? 383 ALA B HB3  1  
ATOM 1716  N N    . ARG A 1 1  ? -0.125  7.366   -9.399  1.00 0.00 ? 6   ARG A N    2  
ATOM 1717  C CA   . ARG A 1 1  ? 0.366   8.543   -8.618  1.00 0.00 ? 6   ARG A CA   2  
ATOM 1718  C C    . ARG A 1 1  ? 0.280   8.291   -7.112  1.00 0.00 ? 6   ARG A C    2  
ATOM 1719  O O    . ARG A 1 1  ? -0.146  7.219   -6.678  1.00 0.00 ? 6   ARG A O    2  
ATOM 1720  C CB   . ARG A 1 1  ? -0.463  9.781   -8.992  1.00 0.00 ? 6   ARG A CB   2  
ATOM 1721  C CG   . ARG A 1 1  ? -0.312  10.217  -10.445 1.00 0.00 ? 6   ARG A CG   2  
ATOM 1722  C CD   . ARG A 1 1  ? 1.144   10.479  -10.810 1.00 0.00 ? 6   ARG A CD   2  
ATOM 1723  N NE   . ARG A 1 1  ? 1.771   11.473  -9.933  1.00 0.00 ? 6   ARG A NE   2  
ATOM 1724  C CZ   . ARG A 1 1  ? 1.442   12.767  -9.900  1.00 0.00 ? 6   ARG A CZ   2  
ATOM 1725  N NH1  . ARG A 1 1  ? 0.521   13.257  -10.726 1.00 0.00 ? 6   ARG A NH1  2  
ATOM 1726  N NH2  . ARG A 1 1  ? 2.050   13.580  -9.043  1.00 0.00 ? 6   ARG A NH2  2  
ATOM 1727  H H1   . ARG A 1 1  ? 0.700   6.913   -9.840  1.00 0.00 ? 6   ARG A H1   2  
ATOM 1728  H H2   . ARG A 1 1  ? -0.792  7.711   -10.119 1.00 0.00 ? 6   ARG A H2   2  
ATOM 1729  H H3   . ARG A 1 1  ? -0.595  6.715   -8.735  1.00 0.00 ? 6   ARG A H3   2  
ATOM 1730  H HA   . ARG A 1 1  ? 1.398   8.718   -8.881  1.00 0.00 ? 6   ARG A HA   2  
ATOM 1731  H HB2  . ARG A 1 1  ? -1.507  9.567   -8.812  1.00 0.00 ? 6   ARG A HB2  2  
ATOM 1732  H HB3  . ARG A 1 1  ? -0.163  10.604  -8.360  1.00 0.00 ? 6   ARG A HB3  2  
ATOM 1733  H HG2  . ARG A 1 1  ? -0.698  9.440   -11.087 1.00 0.00 ? 6   ARG A HG2  2  
ATOM 1734  H HG3  . ARG A 1 1  ? -0.881  11.124  -10.596 1.00 0.00 ? 6   ARG A HG3  2  
ATOM 1735  H HD2  . ARG A 1 1  ? 1.692   9.552   -10.733 1.00 0.00 ? 6   ARG A HD2  2  
ATOM 1736  H HD3  . ARG A 1 1  ? 1.187   10.836  -11.829 1.00 0.00 ? 6   ARG A HD3  2  
ATOM 1737  H HE   . ARG A 1 1  ? 2.470   11.153  -9.325  1.00 0.00 ? 6   ARG A HE   2  
ATOM 1738  H HH11 . ARG A 1 1  ? 0.066   12.656  -11.382 1.00 0.00 ? 6   ARG A HH11 2  
ATOM 1739  H HH12 . ARG A 1 1  ? 0.284   14.226  -10.691 1.00 0.00 ? 6   ARG A HH12 2  
ATOM 1740  H HH21 . ARG A 1 1  ? 2.750   13.224  -8.426  1.00 0.00 ? 6   ARG A HH21 2  
ATOM 1741  H HH22 . ARG A 1 1  ? 1.807   14.550  -9.015  1.00 0.00 ? 6   ARG A HH22 2  
ATOM 1742  N N    . MET A 1 2  ? 0.687   9.291   -6.322  1.00 0.00 ? 7   MET A N    2  
ATOM 1743  C CA   . MET A 1 2  ? 0.660   9.196   -4.859  1.00 0.00 ? 7   MET A CA   2  
ATOM 1744  C C    . MET A 1 2  ? 1.631   8.128   -4.350  1.00 0.00 ? 7   MET A C    2  
ATOM 1745  O O    . MET A 1 2  ? 2.321   7.475   -5.135  1.00 0.00 ? 7   MET A O    2  
ATOM 1746  C CB   . MET A 1 2  ? -0.760  8.891   -4.365  1.00 0.00 ? 7   MET A CB   2  
ATOM 1747  C CG   . MET A 1 2  ? -1.780  9.961   -4.726  1.00 0.00 ? 7   MET A CG   2  
ATOM 1748  S SD   . MET A 1 2  ? -3.463  9.503   -4.261  1.00 0.00 ? 7   MET A SD   2  
ATOM 1749  C CE   . MET A 1 2  ? -3.290  9.288   -2.490  1.00 0.00 ? 7   MET A CE   2  
ATOM 1750  H H    . MET A 1 2  ? 1.015   10.118  -6.734  1.00 0.00 ? 7   MET A H    2  
ATOM 1751  H HA   . MET A 1 2  ? 0.966   10.153  -4.463  1.00 0.00 ? 7   MET A HA   2  
ATOM 1752  H HB2  . MET A 1 2  ? -1.084  7.958   -4.794  1.00 0.00 ? 7   MET A HB2  2  
ATOM 1753  H HB3  . MET A 1 2  ? -0.741  8.794   -3.290  1.00 0.00 ? 7   MET A HB3  2  
ATOM 1754  H HG2  . MET A 1 2  ? -1.519  10.876  -4.217  1.00 0.00 ? 7   MET A HG2  2  
ATOM 1755  H HG3  . MET A 1 2  ? -1.750  10.123  -5.794  1.00 0.00 ? 7   MET A HG3  2  
ATOM 1756  H HE1  . MET A 1 2  ? -2.419  8.684   -2.283  1.00 0.00 ? 7   MET A HE1  2  
ATOM 1757  H HE2  . MET A 1 2  ? -4.168  8.798   -2.100  1.00 0.00 ? 7   MET A HE2  2  
ATOM 1758  H HE3  . MET A 1 2  ? -3.176  10.254  -2.019  1.00 0.00 ? 7   MET A HE3  2  
ATOM 1759  N N    . ASN A 1 3  ? 1.680   7.959   -3.027  1.00 0.00 ? 8   ASN A N    2  
ATOM 1760  C CA   . ASN A 1 3  ? 2.562   6.976   -2.409  1.00 0.00 ? 8   ASN A CA   2  
ATOM 1761  C C    . ASN A 1 3  ? 1.902   5.593   -2.396  1.00 0.00 ? 8   ASN A C    2  
ATOM 1762  O O    . ASN A 1 3  ? 2.291   4.712   -3.165  1.00 0.00 ? 8   ASN A O    2  
ATOM 1763  C CB   . ASN A 1 3  ? 2.925   7.417   -0.983  1.00 0.00 ? 8   ASN A CB   2  
ATOM 1764  C CG   . ASN A 1 3  ? 3.917   6.495   -0.279  1.00 0.00 ? 8   ASN A CG   2  
ATOM 1765  O OD1  . ASN A 1 3  ? 4.171   6.658   0.912   1.00 0.00 ? 8   ASN A OD1  2  
ATOM 1766  N ND2  . ASN A 1 3  ? 4.501   5.538   -1.001  1.00 0.00 ? 8   ASN A ND2  2  
ATOM 1767  H H    . ASN A 1 3  ? 1.106   8.512   -2.455  1.00 0.00 ? 8   ASN A H    2  
ATOM 1768  H HA   . ASN A 1 3  ? 3.463   6.924   -3.001  1.00 0.00 ? 8   ASN A HA   2  
ATOM 1769  H HB2  . ASN A 1 3  ? 3.360   8.403   -1.025  1.00 0.00 ? 8   ASN A HB2  2  
ATOM 1770  H HB3  . ASN A 1 3  ? 2.022   7.458   -0.390  1.00 0.00 ? 8   ASN A HB3  2  
ATOM 1771  H HD21 . ASN A 1 3  ? 4.279   5.462   -1.952  1.00 0.00 ? 8   ASN A HD21 2  
ATOM 1772  H HD22 . ASN A 1 3  ? 5.132   4.946   -0.547  1.00 0.00 ? 8   ASN A HD22 2  
ATOM 1773  N N    . ILE A 1 4  ? 0.904   5.411   -1.528  1.00 0.00 ? 9   ILE A N    2  
ATOM 1774  C CA   . ILE A 1 4  ? 0.194   4.133   -1.431  1.00 0.00 ? 9   ILE A CA   2  
ATOM 1775  C C    . ILE A 1 4  ? -0.495  3.765   -2.726  1.00 0.00 ? 9   ILE A C    2  
ATOM 1776  O O    . ILE A 1 4  ? -0.430  2.620   -3.167  1.00 0.00 ? 9   ILE A O    2  
ATOM 1777  C CB   . ILE A 1 4  ? -0.905  4.127   -0.347  1.00 0.00 ? 9   ILE A CB   2  
ATOM 1778  C CG1  . ILE A 1 4  ? -1.685  5.442   -0.317  1.00 0.00 ? 9   ILE A CG1  2  
ATOM 1779  C CG2  . ILE A 1 4  ? -0.339  3.810   1.012   1.00 0.00 ? 9   ILE A CG2  2  
ATOM 1780  C CD1  . ILE A 1 4  ? -2.812  5.433   0.684   1.00 0.00 ? 9   ILE A CD1  2  
ATOM 1781  H H    . ILE A 1 4  ? 0.638   6.152   -0.946  1.00 0.00 ? 9   ILE A H    2  
ATOM 1782  H HA   . ILE A 1 4  ? 0.915   3.368   -1.186  1.00 0.00 ? 9   ILE A HA   2  
ATOM 1783  H HB   . ILE A 1 4  ? -1.594  3.333   -0.595  1.00 0.00 ? 9   ILE A HB   2  
ATOM 1784  H HG12 . ILE A 1 4  ? -1.016  6.248   -0.058  1.00 0.00 ? 9   ILE A HG12 2  
ATOM 1785  H HG13 . ILE A 1 4  ? -2.109  5.628   -1.292  1.00 0.00 ? 9   ILE A HG13 2  
ATOM 1786  H HG21 . ILE A 1 4  ? -0.934  3.026   1.450   1.00 0.00 ? 9   ILE A HG21 2  
ATOM 1787  H HG22 . ILE A 1 4  ? -0.386  4.695   1.633   1.00 0.00 ? 9   ILE A HG22 2  
ATOM 1788  H HG23 . ILE A 1 4  ? 0.684   3.483   0.914   1.00 0.00 ? 9   ILE A HG23 2  
ATOM 1789  H HD11 . ILE A 1 4  ? -3.306  6.392   0.679   1.00 0.00 ? 9   ILE A HD11 2  
ATOM 1790  H HD12 . ILE A 1 4  ? -2.416  5.237   1.670   1.00 0.00 ? 9   ILE A HD12 2  
ATOM 1791  H HD13 . ILE A 1 4  ? -3.521  4.661   0.422   1.00 0.00 ? 9   ILE A HD13 2  
ATOM 1792  N N    . GLN A 1 5  ? -1.201  4.733   -3.300  1.00 0.00 ? 10  GLN A N    2  
ATOM 1793  C CA   . GLN A 1 5  ? -1.961  4.501   -4.510  1.00 0.00 ? 10  GLN A CA   2  
ATOM 1794  C C    . GLN A 1 5  ? -1.115  3.871   -5.623  1.00 0.00 ? 10  GLN A C    2  
ATOM 1795  O O    . GLN A 1 5  ? -1.627  3.084   -6.413  1.00 0.00 ? 10  GLN A O    2  
ATOM 1796  C CB   . GLN A 1 5  ? -2.602  5.807   -4.998  1.00 0.00 ? 10  GLN A CB   2  
ATOM 1797  C CG   . GLN A 1 5  ? -3.449  5.650   -6.256  1.00 0.00 ? 10  GLN A CG   2  
ATOM 1798  C CD   . GLN A 1 5  ? -4.664  4.760   -6.044  1.00 0.00 ? 10  GLN A CD   2  
ATOM 1799  O OE1  . GLN A 1 5  ? -5.640  5.159   -5.416  1.00 0.00 ? 10  GLN A OE1  2  
ATOM 1800  N NE2  . GLN A 1 5  ? -4.597  3.541   -6.555  1.00 0.00 ? 10  GLN A NE2  2  
ATOM 1801  H H    . GLN A 1 5  ? -1.241  5.613   -2.873  1.00 0.00 ? 10  GLN A H    2  
ATOM 1802  H HA   . GLN A 1 5  ? -2.743  3.811   -4.235  1.00 0.00 ? 10  GLN A HA   2  
ATOM 1803  H HB2  . GLN A 1 5  ? -3.231  6.201   -4.215  1.00 0.00 ? 10  GLN A HB2  2  
ATOM 1804  H HB3  . GLN A 1 5  ? -1.819  6.519   -5.209  1.00 0.00 ? 10  GLN A HB3  2  
ATOM 1805  H HG2  . GLN A 1 5  ? -3.792  6.626   -6.565  1.00 0.00 ? 10  GLN A HG2  2  
ATOM 1806  H HG3  . GLN A 1 5  ? -2.838  5.222   -7.036  1.00 0.00 ? 10  GLN A HG3  2  
ATOM 1807  H HE21 . GLN A 1 5  ? -3.785  3.283   -7.030  1.00 0.00 ? 10  GLN A HE21 2  
ATOM 1808  H HE22 . GLN A 1 5  ? -5.367  2.946   -6.433  1.00 0.00 ? 10  GLN A HE22 2  
ATOM 1809  N N    . MET A 1 6  ? 0.170   4.222   -5.690  1.00 0.00 ? 11  MET A N    2  
ATOM 1810  C CA   . MET A 1 6  ? 1.058   3.682   -6.725  1.00 0.00 ? 11  MET A CA   2  
ATOM 1811  C C    . MET A 1 6  ? 1.268   2.171   -6.557  1.00 0.00 ? 11  MET A C    2  
ATOM 1812  O O    . MET A 1 6  ? 1.180   1.412   -7.525  1.00 0.00 ? 11  MET A O    2  
ATOM 1813  C CB   . MET A 1 6  ? 2.409   4.405   -6.693  1.00 0.00 ? 11  MET A CB   2  
ATOM 1814  C CG   . MET A 1 6  ? 3.268   4.136   -7.921  1.00 0.00 ? 11  MET A CG   2  
ATOM 1815  S SD   . MET A 1 6  ? 4.866   4.970   -7.856  1.00 0.00 ? 11  MET A SD   2  
ATOM 1816  C CE   . MET A 1 6  ? 5.653   4.088   -6.513  1.00 0.00 ? 11  MET A CE   2  
ATOM 1817  H H    . MET A 1 6  ? 0.529   4.860   -5.037  1.00 0.00 ? 11  MET A H    2  
ATOM 1818  H HA   . MET A 1 6  ? 0.591   3.861   -7.682  1.00 0.00 ? 11  MET A HA   2  
ATOM 1819  H HB2  . MET A 1 6  ? 2.235   5.469   -6.629  1.00 0.00 ? 11  MET A HB2  2  
ATOM 1820  H HB3  . MET A 1 6  ? 2.957   4.086   -5.817  1.00 0.00 ? 11  MET A HB3  2  
ATOM 1821  H HG2  . MET A 1 6  ? 3.438   3.073   -7.996  1.00 0.00 ? 11  MET A HG2  2  
ATOM 1822  H HG3  . MET A 1 6  ? 2.735   4.478   -8.795  1.00 0.00 ? 11  MET A HG3  2  
ATOM 1823  H HE1  . MET A 1 6  ? 5.394   4.555   -5.573  1.00 0.00 ? 11  MET A HE1  2  
ATOM 1824  H HE2  . MET A 1 6  ? 6.724   4.113   -6.645  1.00 0.00 ? 11  MET A HE2  2  
ATOM 1825  H HE3  . MET A 1 6  ? 5.314   3.063   -6.510  1.00 0.00 ? 11  MET A HE3  2  
ATOM 1826  N N    . LEU A 1 7  ? 1.554   1.750   -5.325  1.00 0.00 ? 12  LEU A N    2  
ATOM 1827  C CA   . LEU A 1 7  ? 1.788   0.340   -5.004  1.00 0.00 ? 12  LEU A CA   2  
ATOM 1828  C C    . LEU A 1 7  ? 0.481   -0.443  -4.847  1.00 0.00 ? 12  LEU A C    2  
ATOM 1829  O O    . LEU A 1 7  ? 0.422   -1.636  -5.143  1.00 0.00 ? 12  LEU A O    2  
ATOM 1830  C CB   . LEU A 1 7  ? 2.616   0.263   -3.716  1.00 0.00 ? 12  LEU A CB   2  
ATOM 1831  C CG   . LEU A 1 7  ? 2.400   -0.977  -2.842  1.00 0.00 ? 12  LEU A CG   2  
ATOM 1832  C CD1  . LEU A 1 7  ? 3.060   -2.197  -3.460  1.00 0.00 ? 12  LEU A CD1  2  
ATOM 1833  C CD2  . LEU A 1 7  ? 2.922   -0.737  -1.432  1.00 0.00 ? 12  LEU A CD2  2  
ATOM 1834  H H    . LEU A 1 7  ? 1.611   2.409   -4.603  1.00 0.00 ? 12  LEU A H    2  
ATOM 1835  H HA   . LEU A 1 7  ? 2.359   -0.095  -5.811  1.00 0.00 ? 12  LEU A HA   2  
ATOM 1836  H HB2  . LEU A 1 7  ? 3.656   0.297   -3.999  1.00 0.00 ? 12  LEU A HB2  2  
ATOM 1837  H HB3  . LEU A 1 7  ? 2.394   1.136   -3.122  1.00 0.00 ? 12  LEU A HB3  2  
ATOM 1838  H HG   . LEU A 1 7  ? 1.341   -1.172  -2.774  1.00 0.00 ? 12  LEU A HG   2  
ATOM 1839  H HD11 . LEU A 1 7  ? 4.132   -2.117  -3.360  1.00 0.00 ? 12  LEU A HD11 2  
ATOM 1840  H HD12 . LEU A 1 7  ? 2.799   -2.257  -4.505  1.00 0.00 ? 12  LEU A HD12 2  
ATOM 1841  H HD13 . LEU A 1 7  ? 2.717   -3.087  -2.951  1.00 0.00 ? 12  LEU A HD13 2  
ATOM 1842  H HD21 . LEU A 1 7  ? 3.994   -0.872  -1.416  1.00 0.00 ? 12  LEU A HD21 2  
ATOM 1843  H HD22 . LEU A 1 7  ? 2.462   -1.440  -0.753  1.00 0.00 ? 12  LEU A HD22 2  
ATOM 1844  H HD23 . LEU A 1 7  ? 2.681   0.269   -1.124  1.00 0.00 ? 12  LEU A HD23 2  
ATOM 1845  N N    . LEU A 1 8  ? -0.554  0.235   -4.370  1.00 0.00 ? 13  LEU A N    2  
ATOM 1846  C CA   . LEU A 1 8  ? -1.853  -0.361  -4.151  1.00 0.00 ? 13  LEU A CA   2  
ATOM 1847  C C    . LEU A 1 8  ? -2.574  -0.611  -5.476  1.00 0.00 ? 13  LEU A C    2  
ATOM 1848  O O    . LEU A 1 8  ? -3.131  -1.692  -5.679  1.00 0.00 ? 13  LEU A O    2  
ATOM 1849  C CB   . LEU A 1 8  ? -2.620  0.586   -3.226  1.00 0.00 ? 13  LEU A CB   2  
ATOM 1850  C CG   . LEU A 1 8  ? -4.106  0.351   -3.087  1.00 0.00 ? 13  LEU A CG   2  
ATOM 1851  C CD1  . LEU A 1 8  ? -4.393  -1.072  -2.629  1.00 0.00 ? 13  LEU A CD1  2  
ATOM 1852  C CD2  . LEU A 1 8  ? -4.695  1.365   -2.115  1.00 0.00 ? 13  LEU A CD2  2  
ATOM 1853  H H    . LEU A 1 8  ? -0.447  1.181   -4.148  1.00 0.00 ? 13  LEU A H    2  
ATOM 1854  H HA   . LEU A 1 8  ? -1.710  -1.320  -3.654  1.00 0.00 ? 13  LEU A HA   2  
ATOM 1855  H HB2  . LEU A 1 8  ? -2.178  0.523   -2.244  1.00 0.00 ? 13  LEU A HB2  2  
ATOM 1856  H HB3  . LEU A 1 8  ? -2.476  1.593   -3.592  1.00 0.00 ? 13  LEU A HB3  2  
ATOM 1857  H HG   . LEU A 1 8  ? -4.555  0.500   -4.050  1.00 0.00 ? 13  LEU A HG   2  
ATOM 1858  H HD11 . LEU A 1 8  ? -3.563  -1.710  -2.890  1.00 0.00 ? 13  LEU A HD11 2  
ATOM 1859  H HD12 . LEU A 1 8  ? -5.289  -1.431  -3.112  1.00 0.00 ? 13  LEU A HD12 2  
ATOM 1860  H HD13 . LEU A 1 8  ? -4.533  -1.084  -1.557  1.00 0.00 ? 13  LEU A HD13 2  
ATOM 1861  H HD21 . LEU A 1 8  ? -3.901  1.794   -1.510  1.00 0.00 ? 13  LEU A HD21 2  
ATOM 1862  H HD22 . LEU A 1 8  ? -5.411  0.875   -1.472  1.00 0.00 ? 13  LEU A HD22 2  
ATOM 1863  H HD23 . LEU A 1 8  ? -5.188  2.150   -2.669  1.00 0.00 ? 13  LEU A HD23 2  
ATOM 1864  N N    . GLU A 1 9  ? -2.531  0.364   -6.394  1.00 0.00 ? 14  GLU A N    2  
ATOM 1865  C CA   . GLU A 1 9  ? -3.150  0.194   -7.704  1.00 0.00 ? 14  GLU A CA   2  
ATOM 1866  C C    . GLU A 1 9  ? -2.525  -1.010  -8.411  1.00 0.00 ? 14  GLU A C    2  
ATOM 1867  O O    . GLU A 1 9  ? -3.186  -1.701  -9.183  1.00 0.00 ? 14  GLU A O    2  
ATOM 1868  C CB   . GLU A 1 9  ? -2.974  1.450   -8.555  1.00 0.00 ? 14  GLU A CB   2  
ATOM 1869  C CG   . GLU A 1 9  ? -4.254  1.895   -9.236  1.00 0.00 ? 14  GLU A CG   2  
ATOM 1870  C CD   . GLU A 1 9  ? -4.123  3.240   -9.930  1.00 0.00 ? 14  GLU A CD   2  
ATOM 1871  O OE1  . GLU A 1 9  ? -3.298  3.356   -10.859 1.00 0.00 ? 14  GLU A OE1  2  
ATOM 1872  O OE2  . GLU A 1 9  ? -4.849  4.179   -9.540  1.00 0.00 ? 14  GLU A OE2  2  
ATOM 1873  H H    . GLU A 1 9  ? -2.055  1.196   -6.199  1.00 0.00 ? 14  GLU A H    2  
ATOM 1874  H HA   . GLU A 1 9  ? -4.203  0.006   -7.556  1.00 0.00 ? 14  GLU A HA   2  
ATOM 1875  H HB2  . GLU A 1 9  ? -2.627  2.253   -7.930  1.00 0.00 ? 14  GLU A HB2  2  
ATOM 1876  H HB3  . GLU A 1 9  ? -2.238  1.255   -9.314  1.00 0.00 ? 14  GLU A HB3  2  
ATOM 1877  H HG2  . GLU A 1 9  ? -4.531  1.153   -9.968  1.00 0.00 ? 14  GLU A HG2  2  
ATOM 1878  H HG3  . GLU A 1 9  ? -5.026  1.966   -8.486  1.00 0.00 ? 14  GLU A HG3  2  
ATOM 1879  N N    . ALA A 1 10 ? -1.243  -1.265  -8.111  1.00 0.00 ? 15  ALA A N    2  
ATOM 1880  C CA   . ALA A 1 10 ? -0.518  -2.399  -8.679  1.00 0.00 ? 15  ALA A CA   2  
ATOM 1881  C C    . ALA A 1 10 ? -1.302  -3.678  -8.479  1.00 0.00 ? 15  ALA A C    2  
ATOM 1882  O O    . ALA A 1 10 ? -1.544  -4.404  -9.441  1.00 0.00 ? 15  ALA A O    2  
ATOM 1883  C CB   . ALA A 1 10 ? 0.863   -2.499  -8.051  1.00 0.00 ? 15  ALA A CB   2  
ATOM 1884  H H    . ALA A 1 10 ? -0.781  -0.682  -7.475  1.00 0.00 ? 15  ALA A H    2  
ATOM 1885  H HA   . ALA A 1 10 ? -0.400  -2.246  -9.742  1.00 0.00 ? 15  ALA A HA   2  
ATOM 1886  H HB1  . ALA A 1 10 ? 1.561   -2.879  -8.781  1.00 0.00 ? 15  ALA A HB1  2  
ATOM 1887  H HB2  . ALA A 1 10 ? 0.827   -3.167  -7.204  1.00 0.00 ? 15  ALA A HB2  2  
ATOM 1888  H HB3  . ALA A 1 10 ? 1.182   -1.519  -7.724  1.00 0.00 ? 15  ALA A HB3  2  
ATOM 1889  N N    . ALA A 1 11 ? -1.722  -3.945  -7.239  1.00 0.00 ? 16  ALA A N    2  
ATOM 1890  C CA   . ALA A 1 11 ? -2.506  -5.141  -6.959  1.00 0.00 ? 16  ALA A CA   2  
ATOM 1891  C C    . ALA A 1 11 ? -3.630  -5.275  -7.980  1.00 0.00 ? 16  ALA A C    2  
ATOM 1892  O O    . ALA A 1 11 ? -3.840  -6.341  -8.544  1.00 0.00 ? 16  ALA A O    2  
ATOM 1893  C CB   . ALA A 1 11 ? -3.078  -5.108  -5.549  1.00 0.00 ? 16  ALA A CB   2  
ATOM 1894  H H    . ALA A 1 11 ? -1.516  -3.321  -6.512  1.00 0.00 ? 16  ALA A H    2  
ATOM 1895  H HA   . ALA A 1 11 ? -1.849  -5.995  -7.040  1.00 0.00 ? 16  ALA A HA   2  
ATOM 1896  H HB1  . ALA A 1 11 ? -2.369  -4.639  -4.877  1.00 0.00 ? 16  ALA A HB1  2  
ATOM 1897  H HB2  . ALA A 1 11 ? -3.280  -6.123  -5.219  1.00 0.00 ? 16  ALA A HB2  2  
ATOM 1898  H HB3  . ALA A 1 11 ? -3.998  -4.546  -5.550  1.00 0.00 ? 16  ALA A HB3  2  
ATOM 1899  N N    . ASP A 1 12 ? -4.338  -4.169  -8.225  1.00 0.00 ? 17  ASP A N    2  
ATOM 1900  C CA   . ASP A 1 12 ? -5.436  -4.151  -9.189  1.00 0.00 ? 17  ASP A CA   2  
ATOM 1901  C C    . ASP A 1 12 ? -5.021  -4.764  -10.530 1.00 0.00 ? 17  ASP A C    2  
ATOM 1902  O O    . ASP A 1 12 ? -5.805  -5.488  -11.142 1.00 0.00 ? 17  ASP A O    2  
ATOM 1903  C CB   . ASP A 1 12 ? -5.955  -2.723  -9.409  1.00 0.00 ? 17  ASP A CB   2  
ATOM 1904  C CG   . ASP A 1 12 ? -6.488  -2.084  -8.139  1.00 0.00 ? 17  ASP A CG   2  
ATOM 1905  O OD1  . ASP A 1 12 ? -5.698  -1.883  -7.192  1.00 0.00 ? 17  ASP A OD1  2  
ATOM 1906  O OD2  . ASP A 1 12 ? -7.699  -1.784  -8.092  1.00 0.00 ? 17  ASP A OD2  2  
ATOM 1907  H H    . ASP A 1 12 ? -4.109  -3.341  -7.749  1.00 0.00 ? 17  ASP A H    2  
ATOM 1908  H HA   . ASP A 1 12 ? -6.236  -4.747  -8.777  1.00 0.00 ? 17  ASP A HA   2  
ATOM 1909  H HB2  . ASP A 1 12 ? -5.154  -2.109  -9.789  1.00 0.00 ? 17  ASP A HB2  2  
ATOM 1910  H HB3  . ASP A 1 12 ? -6.753  -2.750  -10.137 1.00 0.00 ? 17  ASP A HB3  2  
ATOM 1911  N N    . TYR A 1 13 ? -3.791  -4.478  -10.991 1.00 0.00 ? 18  TYR A N    2  
ATOM 1912  C CA   . TYR A 1 13 ? -3.322  -5.020  -12.254 1.00 0.00 ? 18  TYR A CA   2  
ATOM 1913  C C    . TYR A 1 13 ? -2.629  -6.354  -12.061 1.00 0.00 ? 18  TYR A C    2  
ATOM 1914  O O    . TYR A 1 13 ? -3.018  -7.363  -12.651 1.00 0.00 ? 18  TYR A O    2  
ATOM 1915  C CB   . TYR A 1 13 ? -2.274  -4.125  -12.906 1.00 0.00 ? 18  TYR A CB   2  
ATOM 1916  C CG   . TYR A 1 13 ? -2.178  -2.710  -12.458 1.00 0.00 ? 18  TYR A CG   2  
ATOM 1917  C CD1  . TYR A 1 13 ? -3.151  -1.760  -12.713 1.00 0.00 ? 18  TYR A CD1  2  
ATOM 1918  C CD2  . TYR A 1 13 ? -1.033  -2.336  -11.802 1.00 0.00 ? 18  TYR A CD2  2  
ATOM 1919  C CE1  . TYR A 1 13 ? -2.969  -0.449  -12.312 1.00 0.00 ? 18  TYR A CE1  2  
ATOM 1920  C CE2  . TYR A 1 13 ? -0.840  -1.043  -11.388 1.00 0.00 ? 18  TYR A CE2  2  
ATOM 1921  C CZ   . TYR A 1 13 ? -1.809  -0.095  -11.646 1.00 0.00 ? 18  TYR A CZ   2  
ATOM 1922  O OH   . TYR A 1 13 ? -1.614  1.210   -11.258 1.00 0.00 ? 18  TYR A OH   2  
ATOM 1923  H H    . TYR A 1 13 ? -3.194  -3.900  -10.478 1.00 0.00 ? 18  TYR A H    2  
ATOM 1924  H HA   . TYR A 1 13 ? -4.158  -5.143  -12.911 1.00 0.00 ? 18  TYR A HA   2  
ATOM 1925  H HB2  . TYR A 1 13 ? -1.313  -4.543  -12.670 1.00 0.00 ? 18  TYR A HB2  2  
ATOM 1926  H HB3  . TYR A 1 13 ? -2.414  -4.132  -13.973 1.00 0.00 ? 18  TYR A HB3  2  
ATOM 1927  H HD1  . TYR A 1 13 ? -4.054  -2.051  -13.228 1.00 0.00 ? 18  TYR A HD1  2  
ATOM 1928  H HD2  . TYR A 1 13 ? -0.279  -3.100  -11.604 1.00 0.00 ? 18  TYR A HD2  2  
ATOM 1929  H HE1  . TYR A 1 13 ? -3.731  0.289   -12.512 1.00 0.00 ? 18  TYR A HE1  2  
ATOM 1930  H HE2  . TYR A 1 13 ? 0.067   -0.781  -10.861 1.00 0.00 ? 18  TYR A HE2  2  
ATOM 1931  H HH   . TYR A 1 13 ? -0.884  1.258   -10.637 1.00 0.00 ? 18  TYR A HH   2  
ATOM 1932  N N    . LEU A 1 14 ? -1.551  -6.321  -11.272 1.00 0.00 ? 19  LEU A N    2  
ATOM 1933  C CA   . LEU A 1 14 ? -0.740  -7.498  -11.043 1.00 0.00 ? 19  LEU A CA   2  
ATOM 1934  C C    . LEU A 1 14 ? -1.554  -8.677  -10.501 1.00 0.00 ? 19  LEU A C    2  
ATOM 1935  O O    . LEU A 1 14 ? -1.153  -9.829  -10.672 1.00 0.00 ? 19  LEU A O    2  
ATOM 1936  C CB   . LEU A 1 14 ? 0.460   -7.181  -10.143 1.00 0.00 ? 19  LEU A CB   2  
ATOM 1937  C CG   . LEU A 1 14 ? 0.136   -6.666  -8.750  1.00 0.00 ? 19  LEU A CG   2  
ATOM 1938  C CD1  . LEU A 1 14 ? 0.339   -7.769  -7.726  1.00 0.00 ? 19  LEU A CD1  2  
ATOM 1939  C CD2  . LEU A 1 14 ? 0.998   -5.451  -8.432  1.00 0.00 ? 19  LEU A CD2  2  
ATOM 1940  H H    . LEU A 1 14 ? -1.278  -5.468  -10.873 1.00 0.00 ? 19  LEU A H    2  
ATOM 1941  H HA   . LEU A 1 14 ? -0.355  -7.765  -12.011 1.00 0.00 ? 19  LEU A HA   2  
ATOM 1942  H HB2  . LEU A 1 14 ? 1.045   -8.080  -10.035 1.00 0.00 ? 19  LEU A HB2  2  
ATOM 1943  H HB3  . LEU A 1 14 ? 1.066   -6.440  -10.640 1.00 0.00 ? 19  LEU A HB3  2  
ATOM 1944  H HG   . LEU A 1 14 ? -0.900  -6.364  -8.715  1.00 0.00 ? 19  LEU A HG   2  
ATOM 1945  H HD11 . LEU A 1 14 ? 1.381   -7.812  -7.442  1.00 0.00 ? 19  LEU A HD11 2  
ATOM 1946  H HD12 . LEU A 1 14 ? 0.042   -8.716  -8.153  1.00 0.00 ? 19  LEU A HD12 2  
ATOM 1947  H HD13 . LEU A 1 14 ? -0.262  -7.564  -6.856  1.00 0.00 ? 19  LEU A HD13 2  
ATOM 1948  H HD21 . LEU A 1 14 ? 0.823   -4.677  -9.173  1.00 0.00 ? 19  LEU A HD21 2  
ATOM 1949  H HD22 . LEU A 1 14 ? 2.039   -5.735  -8.448  1.00 0.00 ? 19  LEU A HD22 2  
ATOM 1950  H HD23 . LEU A 1 14 ? 0.742   -5.075  -7.453  1.00 0.00 ? 19  LEU A HD23 2  
ATOM 1951  N N    . GLU A 1 15 ? -2.706  -8.398  -9.863  1.00 0.00 ? 20  GLU A N    2  
ATOM 1952  C CA   . GLU A 1 15 ? -3.557  -9.472  -9.336  1.00 0.00 ? 20  GLU A CA   2  
ATOM 1953  C C    . GLU A 1 15 ? -3.878  -10.510 -10.415 1.00 0.00 ? 20  GLU A C    2  
ATOM 1954  O O    . GLU A 1 15 ? -3.967  -11.705 -10.127 1.00 0.00 ? 20  GLU A O    2  
ATOM 1955  C CB   . GLU A 1 15 ? -4.862  -8.922  -8.752  1.00 0.00 ? 20  GLU A CB   2  
ATOM 1956  C CG   . GLU A 1 15 ? -4.772  -8.591  -7.269  1.00 0.00 ? 20  GLU A CG   2  
ATOM 1957  C CD   . GLU A 1 15 ? -6.040  -7.954  -6.729  1.00 0.00 ? 20  GLU A CD   2  
ATOM 1958  O OE1  . GLU A 1 15 ? -6.411  -6.863  -7.210  1.00 0.00 ? 20  GLU A OE1  2  
ATOM 1959  O OE2  . GLU A 1 15 ? -6.662  -8.550  -5.824  1.00 0.00 ? 20  GLU A OE2  2  
ATOM 1960  H H    . GLU A 1 15 ? -2.994  -7.456  -9.756  1.00 0.00 ? 20  GLU A H    2  
ATOM 1961  H HA   . GLU A 1 15 ? -3.004  -9.957  -8.549  1.00 0.00 ? 20  GLU A HA   2  
ATOM 1962  H HB2  . GLU A 1 15 ? -5.131  -8.024  -9.285  1.00 0.00 ? 20  GLU A HB2  2  
ATOM 1963  H HB3  . GLU A 1 15 ? -5.641  -9.657  -8.887  1.00 0.00 ? 20  GLU A HB3  2  
ATOM 1964  H HG2  . GLU A 1 15 ? -4.590  -9.505  -6.723  1.00 0.00 ? 20  GLU A HG2  2  
ATOM 1965  H HG3  . GLU A 1 15 ? -3.950  -7.911  -7.112  1.00 0.00 ? 20  GLU A HG3  2  
ATOM 1966  N N    . ARG A 1 16 ? -4.045  -10.049 -11.658 1.00 0.00 ? 21  ARG A N    2  
ATOM 1967  C CA   . ARG A 1 16 ? -4.350  -10.943 -12.774 1.00 0.00 ? 21  ARG A CA   2  
ATOM 1968  C C    . ARG A 1 16 ? -3.177  -11.882 -13.057 1.00 0.00 ? 21  ARG A C    2  
ATOM 1969  O O    . ARG A 1 16 ? -3.397  -13.111 -13.078 1.00 0.00 ? 21  ARG A O    2  
ATOM 1970  C CB   . ARG A 1 16 ? -4.689  -10.139 -14.035 1.00 0.00 ? 21  ARG A CB   2  
ATOM 1971  C CG   . ARG A 1 16 ? -5.886  -9.218  -13.872 1.00 0.00 ? 21  ARG A CG   2  
ATOM 1972  C CD   . ARG A 1 16 ? -6.249  -8.537  -15.184 1.00 0.00 ? 21  ARG A CD   2  
ATOM 1973  N NE   . ARG A 1 16 ? -7.370  -7.610  -15.035 1.00 0.00 ? 21  ARG A NE   2  
ATOM 1974  C CZ   . ARG A 1 16 ? -7.306  -6.453  -14.369 1.00 0.00 ? 21  ARG A CZ   2  
ATOM 1975  N NH1  . ARG A 1 16 ? -6.159  -6.040  -13.839 1.00 0.00 ? 21  ARG A NH1  2  
ATOM 1976  N NH2  . ARG A 1 16 ? -8.390  -5.697  -14.249 1.00 0.00 ? 21  ARG A NH2  2  
ATOM 1977  O OXT  . ARG A 1 16 ? -2.046  -11.382 -13.252 1.00 0.00 ? 21  ARG A OXT  2  
ATOM 1978  H H    . ARG A 1 16 ? -3.958  -9.087  -11.828 1.00 0.00 ? 21  ARG A H    2  
ATOM 1979  H HA   . ARG A 1 16 ? -5.208  -11.536 -12.497 1.00 0.00 ? 21  ARG A HA   2  
ATOM 1980  H HB2  . ARG A 1 16 ? -3.832  -9.537  -14.304 1.00 0.00 ? 21  ARG A HB2  2  
ATOM 1981  H HB3  . ARG A 1 16 ? -4.897  -10.828 -14.840 1.00 0.00 ? 21  ARG A HB3  2  
ATOM 1982  H HG2  . ARG A 1 16 ? -6.731  -9.797  -13.533 1.00 0.00 ? 21  ARG A HG2  2  
ATOM 1983  H HG3  . ARG A 1 16 ? -5.649  -8.461  -13.138 1.00 0.00 ? 21  ARG A HG3  2  
ATOM 1984  H HD2  . ARG A 1 16 ? -5.387  -7.991  -15.541 1.00 0.00 ? 21  ARG A HD2  2  
ATOM 1985  H HD3  . ARG A 1 16 ? -6.515  -9.297  -15.905 1.00 0.00 ? 21  ARG A HD3  2  
ATOM 1986  H HE   . ARG A 1 16 ? -8.225  -7.870  -15.437 1.00 0.00 ? 21  ARG A HE   2  
ATOM 1987  H HH11 . ARG A 1 16 ? -5.334  -6.595  -13.935 1.00 0.00 ? 21  ARG A HH11 2  
ATOM 1988  H HH12 . ARG A 1 16 ? -6.122  -5.175  -13.342 1.00 0.00 ? 21  ARG A HH12 2  
ATOM 1989  H HH21 . ARG A 1 16 ? -9.255  -5.994  -14.653 1.00 0.00 ? 21  ARG A HH21 2  
ATOM 1990  H HH22 . ARG A 1 16 ? -8.345  -4.831  -13.750 1.00 0.00 ? 21  ARG A HH22 2  
ATOM 1991  N N    . SER B 2 1  ? 14.503  7.375   -23.997 1.00 0.00 ? 295 SER B N    2  
ATOM 1992  C CA   . SER B 2 1  ? 15.446  6.819   -22.985 1.00 0.00 ? 295 SER B CA   2  
ATOM 1993  C C    . SER B 2 1  ? 16.393  7.893   -22.450 1.00 0.00 ? 295 SER B C    2  
ATOM 1994  O O    . SER B 2 1  ? 16.487  8.984   -23.014 1.00 0.00 ? 295 SER B O    2  
ATOM 1995  C CB   . SER B 2 1  ? 16.248  5.682   -23.628 1.00 0.00 ? 295 SER B CB   2  
ATOM 1996  O OG   . SER B 2 1  ? 15.396  4.624   -24.037 1.00 0.00 ? 295 SER B OG   2  
ATOM 1997  H H1   . SER B 2 1  ? 15.033  8.040   -24.596 1.00 0.00 ? 295 SER B H1   2  
ATOM 1998  H H2   . SER B 2 1  ? 13.738  7.858   -23.483 1.00 0.00 ? 295 SER B H2   2  
ATOM 1999  H H3   . SER B 2 1  ? 14.132  6.581   -24.559 1.00 0.00 ? 295 SER B H3   2  
ATOM 2000  H HA   . SER B 2 1  ? 14.868  6.423   -22.164 1.00 0.00 ? 295 SER B HA   2  
ATOM 2001  H HB2  . SER B 2 1  ? 16.772  6.059   -24.494 1.00 0.00 ? 295 SER B HB2  2  
ATOM 2002  H HB3  . SER B 2 1  ? 16.961  5.298   -22.915 1.00 0.00 ? 295 SER B HB3  2  
ATOM 2003  H HG   . SER B 2 1  ? 15.434  4.530   -24.991 1.00 0.00 ? 295 SER B HG   2  
ATOM 2004  N N    . LEU B 2 2  ? 17.094  7.569   -21.357 1.00 0.00 ? 296 LEU B N    2  
ATOM 2005  C CA   . LEU B 2 2  ? 18.043  8.492   -20.731 1.00 0.00 ? 296 LEU B CA   2  
ATOM 2006  C C    . LEU B 2 2  ? 17.315  9.715   -20.169 1.00 0.00 ? 296 LEU B C    2  
ATOM 2007  O O    . LEU B 2 2  ? 17.140  10.721  -20.862 1.00 0.00 ? 296 LEU B O    2  
ATOM 2008  C CB   . LEU B 2 2  ? 19.124  8.910   -21.741 1.00 0.00 ? 296 LEU B CB   2  
ATOM 2009  C CG   . LEU B 2 2  ? 20.390  9.542   -21.145 1.00 0.00 ? 296 LEU B CG   2  
ATOM 2010  C CD1  . LEU B 2 2  ? 21.503  9.572   -22.182 1.00 0.00 ? 296 LEU B CD1  2  
ATOM 2011  C CD2  . LEU B 2 2  ? 20.114  10.951  -20.637 1.00 0.00 ? 296 LEU B CD2  2  
ATOM 2012  H H    . LEU B 2 2  ? 16.969  6.680   -20.962 1.00 0.00 ? 296 LEU B H    2  
ATOM 2013  H HA   . LEU B 2 2  ? 18.515  7.968   -19.913 1.00 0.00 ? 296 LEU B HA   2  
ATOM 2014  H HB2  . LEU B 2 2  ? 19.418  8.034   -22.301 1.00 0.00 ? 296 LEU B HB2  2  
ATOM 2015  H HB3  . LEU B 2 2  ? 18.687  9.621   -22.429 1.00 0.00 ? 296 LEU B HB3  2  
ATOM 2016  H HG   . LEU B 2 2  ? 20.727  8.943   -20.312 1.00 0.00 ? 296 LEU B HG   2  
ATOM 2017  H HD11 . LEU B 2 2  ? 21.957  8.595   -22.251 1.00 0.00 ? 296 LEU B HD11 2  
ATOM 2018  H HD12 . LEU B 2 2  ? 22.249  10.296  -21.889 1.00 0.00 ? 296 LEU B HD12 2  
ATOM 2019  H HD13 . LEU B 2 2  ? 21.094  9.846   -23.143 1.00 0.00 ? 296 LEU B HD13 2  
ATOM 2020  H HD21 . LEU B 2 2  ? 20.924  11.264  -19.993 1.00 0.00 ? 296 LEU B HD21 2  
ATOM 2021  H HD22 . LEU B 2 2  ? 19.191  10.962  -20.082 1.00 0.00 ? 296 LEU B HD22 2  
ATOM 2022  H HD23 . LEU B 2 2  ? 20.040  11.628  -21.475 1.00 0.00 ? 296 LEU B HD23 2  
ATOM 2023  N N    . GLN B 2 3  ? 16.887  9.610   -18.906 1.00 0.00 ? 297 GLN B N    2  
ATOM 2024  C CA   . GLN B 2 3  ? 16.174  10.684  -18.218 1.00 0.00 ? 297 GLN B CA   2  
ATOM 2025  C C    . GLN B 2 3  ? 14.746  10.826  -18.743 1.00 0.00 ? 297 GLN B C    2  
ATOM 2026  O O    . GLN B 2 3  ? 14.452  10.453  -19.882 1.00 0.00 ? 297 GLN B O    2  
ATOM 2027  C CB   . GLN B 2 3  ? 16.925  12.011  -18.345 1.00 0.00 ? 297 GLN B CB   2  
ATOM 2028  C CG   . GLN B 2 3  ? 18.359  11.965  -17.828 1.00 0.00 ? 297 GLN B CG   2  
ATOM 2029  C CD   . GLN B 2 3  ? 18.450  11.656  -16.344 1.00 0.00 ? 297 GLN B CD   2  
ATOM 2030  O OE1  . GLN B 2 3  ? 18.028  10.592  -15.892 1.00 0.00 ? 297 GLN B OE1  2  
ATOM 2031  N NE2  . GLN B 2 3  ? 19.003  12.588  -15.574 1.00 0.00 ? 297 GLN B NE2  2  
ATOM 2032  H H    . GLN B 2 3  ? 17.057  8.784   -18.418 1.00 0.00 ? 297 GLN B H    2  
ATOM 2033  H HA   . GLN B 2 3  ? 16.122  10.416  -17.173 1.00 0.00 ? 297 GLN B HA   2  
ATOM 2034  H HB2  . GLN B 2 3  ? 16.948  12.307  -19.382 1.00 0.00 ? 297 GLN B HB2  2  
ATOM 2035  H HB3  . GLN B 2 3  ? 16.391  12.754  -17.781 1.00 0.00 ? 297 GLN B HB3  2  
ATOM 2036  H HG2  . GLN B 2 3  ? 18.896  11.200  -18.368 1.00 0.00 ? 297 GLN B HG2  2  
ATOM 2037  H HG3  . GLN B 2 3  ? 18.822  12.923  -18.010 1.00 0.00 ? 297 GLN B HG3  2  
ATOM 2038  H HE21 . GLN B 2 3  ? 19.320  13.413  -15.999 1.00 0.00 ? 297 GLN B HE21 2  
ATOM 2039  H HE22 . GLN B 2 3  ? 19.074  12.410  -14.613 1.00 0.00 ? 297 GLN B HE22 2  
ATOM 2040  N N    . ASN B 2 4  ? 13.861  11.369  -17.899 1.00 0.00 ? 298 ASN B N    2  
ATOM 2041  C CA   . ASN B 2 4  ? 12.452  11.567  -18.257 1.00 0.00 ? 298 ASN B CA   2  
ATOM 2042  C C    . ASN B 2 4  ? 11.725  10.231  -18.421 1.00 0.00 ? 298 ASN B C    2  
ATOM 2043  O O    . ASN B 2 4  ? 12.343  9.218   -18.751 1.00 0.00 ? 298 ASN B O    2  
ATOM 2044  C CB   . ASN B 2 4  ? 12.324  12.391  -19.548 1.00 0.00 ? 298 ASN B CB   2  
ATOM 2045  C CG   . ASN B 2 4  ? 12.897  13.804  -19.444 1.00 0.00 ? 298 ASN B CG   2  
ATOM 2046  O OD1  . ASN B 2 4  ? 13.007  14.502  -20.450 1.00 0.00 ? 298 ASN B OD1  2  
ATOM 2047  N ND2  . ASN B 2 4  ? 13.248  14.247  -18.236 1.00 0.00 ? 298 ASN B ND2  2  
ATOM 2048  H H    . ASN B 2 4  ? 14.164  11.641  -17.009 1.00 0.00 ? 298 ASN B H    2  
ATOM 2049  H HA   . ASN B 2 4  ? 11.985  12.112  -17.450 1.00 0.00 ? 298 ASN B HA   2  
ATOM 2050  H HB2  . ASN B 2 4  ? 12.844  11.879  -20.344 1.00 0.00 ? 298 ASN B HB2  2  
ATOM 2051  H HB3  . ASN B 2 4  ? 11.278  12.470  -19.808 1.00 0.00 ? 298 ASN B HB3  2  
ATOM 2052  H HD21 . ASN B 2 4  ? 13.125  13.659  -17.466 1.00 0.00 ? 298 ASN B HD21 2  
ATOM 2053  H HD22 . ASN B 2 4  ? 13.616  15.153  -18.171 1.00 0.00 ? 298 ASN B HD22 2  
ATOM 2054  N N    . ASN B 2 5  ? 10.407  10.251  -18.185 1.00 0.00 ? 299 ASN B N    2  
ATOM 2055  C CA   . ASN B 2 5  ? 9.551   9.059   -18.297 1.00 0.00 ? 299 ASN B CA   2  
ATOM 2056  C C    . ASN B 2 5  ? 10.162  7.829   -17.604 1.00 0.00 ? 299 ASN B C    2  
ATOM 2057  O O    . ASN B 2 5  ? 11.129  7.946   -16.848 1.00 0.00 ? 299 ASN B O    2  
ATOM 2058  C CB   . ASN B 2 5  ? 9.221   8.770   -19.775 1.00 0.00 ? 299 ASN B CB   2  
ATOM 2059  C CG   . ASN B 2 5  ? 10.449  8.589   -20.653 1.00 0.00 ? 299 ASN B CG   2  
ATOM 2060  O OD1  . ASN B 2 5  ? 11.189  7.618   -20.516 1.00 0.00 ? 299 ASN B OD1  2  
ATOM 2061  N ND2  . ASN B 2 5  ? 10.675  9.534   -21.559 1.00 0.00 ? 299 ASN B ND2  2  
ATOM 2062  H H    . ASN B 2 5  ? 9.990   11.099  -17.926 1.00 0.00 ? 299 ASN B H    2  
ATOM 2063  H HA   . ASN B 2 5  ? 8.626   9.293   -17.788 1.00 0.00 ? 299 ASN B HA   2  
ATOM 2064  H HB2  . ASN B 2 5  ? 8.633   7.867   -19.833 1.00 0.00 ? 299 ASN B HB2  2  
ATOM 2065  H HB3  . ASN B 2 5  ? 8.641   9.590   -20.169 1.00 0.00 ? 299 ASN B HB3  2  
ATOM 2066  H HD21 . ASN B 2 5  ? 10.046  10.286  -21.614 1.00 0.00 ? 299 ASN B HD21 2  
ATOM 2067  H HD22 . ASN B 2 5  ? 11.461  9.441   -22.137 1.00 0.00 ? 299 ASN B HD22 2  
ATOM 2068  N N    . GLN B 2 6  ? 9.573   6.650   -17.848 1.00 0.00 ? 300 GLN B N    2  
ATOM 2069  C CA   . GLN B 2 6  ? 10.038  5.399   -17.241 1.00 0.00 ? 300 GLN B CA   2  
ATOM 2070  C C    . GLN B 2 6  ? 9.892   5.433   -15.717 1.00 0.00 ? 300 GLN B C    2  
ATOM 2071  O O    . GLN B 2 6  ? 10.835  5.782   -15.002 1.00 0.00 ? 300 GLN B O    2  
ATOM 2072  C CB   . GLN B 2 6  ? 11.497  5.114   -17.621 1.00 0.00 ? 300 GLN B CB   2  
ATOM 2073  C CG   . GLN B 2 6  ? 11.712  4.868   -19.104 1.00 0.00 ? 300 GLN B CG   2  
ATOM 2074  C CD   . GLN B 2 6  ? 13.174  4.654   -19.450 1.00 0.00 ? 300 GLN B CD   2  
ATOM 2075  O OE1  . GLN B 2 6  ? 13.791  3.685   -19.012 1.00 0.00 ? 300 GLN B OE1  2  
ATOM 2076  N NE2  . GLN B 2 6  ? 13.741  5.566   -20.232 1.00 0.00 ? 300 GLN B NE2  2  
ATOM 2077  H H    . GLN B 2 6  ? 8.794   6.623   -18.443 1.00 0.00 ? 300 GLN B H    2  
ATOM 2078  H HA   . GLN B 2 6  ? 9.418   4.602   -17.627 1.00 0.00 ? 300 GLN B HA   2  
ATOM 2079  H HB2  . GLN B 2 6  ? 12.104  5.956   -17.327 1.00 0.00 ? 300 GLN B HB2  2  
ATOM 2080  H HB3  . GLN B 2 6  ? 11.830  4.239   -17.082 1.00 0.00 ? 300 GLN B HB3  2  
ATOM 2081  H HG2  . GLN B 2 6  ? 11.157  3.989   -19.395 1.00 0.00 ? 300 GLN B HG2  2  
ATOM 2082  H HG3  . GLN B 2 6  ? 11.347  5.721   -19.654 1.00 0.00 ? 300 GLN B HG3  2  
ATOM 2083  H HE21 . GLN B 2 6  ? 13.195  6.318   -20.542 1.00 0.00 ? 300 GLN B HE21 2  
ATOM 2084  H HE22 . GLN B 2 6  ? 14.685  5.449   -20.466 1.00 0.00 ? 300 GLN B HE22 2  
ATOM 2085  N N    . PRO B 2 7  ? 8.703   5.066   -15.199 1.00 0.00 ? 301 PRO B N    2  
ATOM 2086  C CA   . PRO B 2 7  ? 8.441   5.054   -13.757 1.00 0.00 ? 301 PRO B CA   2  
ATOM 2087  C C    . PRO B 2 7  ? 9.045   3.826   -13.069 1.00 0.00 ? 301 PRO B C    2  
ATOM 2088  O O    . PRO B 2 7  ? 8.354   2.836   -12.816 1.00 0.00 ? 301 PRO B O    2  
ATOM 2089  C CB   . PRO B 2 7  ? 6.913   5.027   -13.687 1.00 0.00 ? 301 PRO B CB   2  
ATOM 2090  C CG   . PRO B 2 7  ? 6.491   4.313   -14.925 1.00 0.00 ? 301 PRO B CG   2  
ATOM 2091  C CD   . PRO B 2 7  ? 7.524   4.635   -15.976 1.00 0.00 ? 301 PRO B CD   2  
ATOM 2092  H HA   . PRO B 2 7  ? 8.812   5.949   -13.279 1.00 0.00 ? 301 PRO B HA   2  
ATOM 2093  H HB2  . PRO B 2 7  ? 6.599   4.501   -12.798 1.00 0.00 ? 301 PRO B HB2  2  
ATOM 2094  H HB3  . PRO B 2 7  ? 6.534   6.037   -13.667 1.00 0.00 ? 301 PRO B HB3  2  
ATOM 2095  H HG2  . PRO B 2 7  ? 6.464   3.249   -14.743 1.00 0.00 ? 301 PRO B HG2  2  
ATOM 2096  H HG3  . PRO B 2 7  ? 5.518   4.665   -15.237 1.00 0.00 ? 301 PRO B HG3  2  
ATOM 2097  H HD2  . PRO B 2 7  ? 7.751   3.757   -16.562 1.00 0.00 ? 301 PRO B HD2  2  
ATOM 2098  H HD3  . PRO B 2 7  ? 7.173   5.433   -16.615 1.00 0.00 ? 301 PRO B HD3  2  
ATOM 2099  N N    . VAL B 2 8  ? 10.344  3.901   -12.776 1.00 0.00 ? 302 VAL B N    2  
ATOM 2100  C CA   . VAL B 2 8  ? 11.056  2.799   -12.123 1.00 0.00 ? 302 VAL B CA   2  
ATOM 2101  C C    . VAL B 2 8  ? 10.521  2.553   -10.709 1.00 0.00 ? 302 VAL B C    2  
ATOM 2102  O O    . VAL B 2 8  ? 10.414  1.406   -10.272 1.00 0.00 ? 302 VAL B O    2  
ATOM 2103  C CB   . VAL B 2 8  ? 12.576  3.068   -12.052 1.00 0.00 ? 302 VAL B CB   2  
ATOM 2104  C CG1  . VAL B 2 8  ? 13.304  1.896   -11.409 1.00 0.00 ? 302 VAL B CG1  2  
ATOM 2105  C CG2  . VAL B 2 8  ? 13.137  3.350   -13.441 1.00 0.00 ? 302 VAL B CG2  2  
ATOM 2106  H H    . VAL B 2 8  ? 10.837  4.715   -13.007 1.00 0.00 ? 302 VAL B H    2  
ATOM 2107  H HA   . VAL B 2 8  ? 10.898  1.908   -12.712 1.00 0.00 ? 302 VAL B HA   2  
ATOM 2108  H HB   . VAL B 2 8  ? 12.738  3.943   -11.438 1.00 0.00 ? 302 VAL B HB   2  
ATOM 2109  H HG11 . VAL B 2 8  ? 14.362  2.109   -11.368 1.00 0.00 ? 302 VAL B HG11 2  
ATOM 2110  H HG12 . VAL B 2 8  ? 13.140  1.005   -11.996 1.00 0.00 ? 302 VAL B HG12 2  
ATOM 2111  H HG13 . VAL B 2 8  ? 12.927  1.743   -10.409 1.00 0.00 ? 302 VAL B HG13 2  
ATOM 2112  H HG21 . VAL B 2 8  ? 12.904  2.525   -14.097 1.00 0.00 ? 302 VAL B HG21 2  
ATOM 2113  H HG22 . VAL B 2 8  ? 14.209  3.470   -13.379 1.00 0.00 ? 302 VAL B HG22 2  
ATOM 2114  H HG23 . VAL B 2 8  ? 12.695  4.254   -13.831 1.00 0.00 ? 302 VAL B HG23 2  
ATOM 2115  N N    . GLU B 2 9  ? 10.177  3.636   -10.007 1.00 0.00 ? 303 GLU B N    2  
ATOM 2116  C CA   . GLU B 2 9  ? 9.642   3.536   -8.648  1.00 0.00 ? 303 GLU B CA   2  
ATOM 2117  C C    . GLU B 2 9  ? 8.324   2.764   -8.641  1.00 0.00 ? 303 GLU B C    2  
ATOM 2118  O O    . GLU B 2 9  ? 8.050   1.997   -7.717  1.00 0.00 ? 303 GLU B O    2  
ATOM 2119  C CB   . GLU B 2 9  ? 9.434   4.930   -8.034  1.00 0.00 ? 303 GLU B CB   2  
ATOM 2120  C CG   . GLU B 2 9  ? 10.727  5.701   -7.778  1.00 0.00 ? 303 GLU B CG   2  
ATOM 2121  C CD   . GLU B 2 9  ? 11.334  6.329   -9.028  1.00 0.00 ? 303 GLU B CD   2  
ATOM 2122  O OE1  . GLU B 2 9  ? 10.666  6.346   -10.086 1.00 0.00 ? 303 GLU B OE1  2  
ATOM 2123  O OE2  . GLU B 2 9  ? 12.478  6.824   -8.939  1.00 0.00 ? 303 GLU B OE2  2  
ATOM 2124  H H    . GLU B 2 9  ? 10.279  4.522   -10.415 1.00 0.00 ? 303 GLU B H    2  
ATOM 2125  H HA   . GLU B 2 9  ? 10.362  2.997   -8.050  1.00 0.00 ? 303 GLU B HA   2  
ATOM 2126  H HB2  . GLU B 2 9  ? 8.819   5.514   -8.701  1.00 0.00 ? 303 GLU B HB2  2  
ATOM 2127  H HB3  . GLU B 2 9  ? 8.917   4.818   -7.092  1.00 0.00 ? 303 GLU B HB3  2  
ATOM 2128  H HG2  . GLU B 2 9  ? 10.521  6.490   -7.071  1.00 0.00 ? 303 GLU B HG2  2  
ATOM 2129  H HG3  . GLU B 2 9  ? 11.450  5.024   -7.349  1.00 0.00 ? 303 GLU B HG3  2  
ATOM 2130  N N    . PHE B 2 10 ? 7.517   2.967   -9.685  1.00 0.00 ? 304 PHE B N    2  
ATOM 2131  C CA   . PHE B 2 10 ? 6.233   2.283   -9.813  1.00 0.00 ? 304 PHE B CA   2  
ATOM 2132  C C    . PHE B 2 10 ? 6.439   0.776   -9.961  1.00 0.00 ? 304 PHE B C    2  
ATOM 2133  O O    . PHE B 2 10 ? 5.873   -0.011  -9.199  1.00 0.00 ? 304 PHE B O    2  
ATOM 2134  C CB   . PHE B 2 10 ? 5.450   2.847   -11.005 1.00 0.00 ? 304 PHE B CB   2  
ATOM 2135  C CG   . PHE B 2 10 ? 4.204   2.077   -11.347 1.00 0.00 ? 304 PHE B CG   2  
ATOM 2136  C CD1  . PHE B 2 10 ? 4.268   0.944   -12.142 1.00 0.00 ? 304 PHE B CD1  2  
ATOM 2137  C CD2  . PHE B 2 10 ? 2.970   2.485   -10.868 1.00 0.00 ? 304 PHE B CD2  2  
ATOM 2138  C CE1  . PHE B 2 10 ? 3.126   0.234   -12.454 1.00 0.00 ? 304 PHE B CE1  2  
ATOM 2139  C CE2  . PHE B 2 10 ? 1.824   1.776   -11.176 1.00 0.00 ? 304 PHE B CE2  2  
ATOM 2140  C CZ   . PHE B 2 10 ? 1.904   0.650   -11.972 1.00 0.00 ? 304 PHE B CZ   2  
ATOM 2141  H H    . PHE B 2 10 ? 7.797   3.586   -10.391 1.00 0.00 ? 304 PHE B H    2  
ATOM 2142  H HA   . PHE B 2 10 ? 5.673   2.465   -8.908  1.00 0.00 ? 304 PHE B HA   2  
ATOM 2143  H HB2  . PHE B 2 10 ? 5.160   3.864   -10.786 1.00 0.00 ? 304 PHE B HB2  2  
ATOM 2144  H HB3  . PHE B 2 10 ? 6.091   2.844   -11.876 1.00 0.00 ? 304 PHE B HB3  2  
ATOM 2145  H HD1  . PHE B 2 10 ? 5.226   0.616   -12.521 1.00 0.00 ? 304 PHE B HD1  2  
ATOM 2146  H HD2  . PHE B 2 10 ? 2.909   3.364   -10.246 1.00 0.00 ? 304 PHE B HD2  2  
ATOM 2147  H HE1  . PHE B 2 10 ? 3.190   -0.648  -13.073 1.00 0.00 ? 304 PHE B HE1  2  
ATOM 2148  H HE2  . PHE B 2 10 ? 0.869   2.104   -10.796 1.00 0.00 ? 304 PHE B HE2  2  
ATOM 2149  H HZ   . PHE B 2 10 ? 1.009   0.097   -12.218 1.00 0.00 ? 304 PHE B HZ   2  
ATOM 2150  N N    . ASN B 2 11 ? 7.263   0.380   -10.935 1.00 0.00 ? 305 ASN B N    2  
ATOM 2151  C CA   . ASN B 2 11 ? 7.552   -1.036  -11.174 1.00 0.00 ? 305 ASN B CA   2  
ATOM 2152  C C    . ASN B 2 11 ? 8.085   -1.717  -9.908  1.00 0.00 ? 305 ASN B C    2  
ATOM 2153  O O    . ASN B 2 11 ? 7.860   -2.911  -9.700  1.00 0.00 ? 305 ASN B O    2  
ATOM 2154  C CB   . ASN B 2 11 ? 8.568   -1.193  -12.311 1.00 0.00 ? 305 ASN B CB   2  
ATOM 2155  C CG   . ASN B 2 11 ? 8.059   -0.640  -13.632 1.00 0.00 ? 305 ASN B CG   2  
ATOM 2156  O OD1  . ASN B 2 11 ? 7.034   -1.082  -14.150 1.00 0.00 ? 305 ASN B OD1  2  
ATOM 2157  N ND2  . ASN B 2 11 ? 8.777   0.331   -14.186 1.00 0.00 ? 305 ASN B ND2  2  
ATOM 2158  H H    . ASN B 2 11 ? 7.692   1.058   -11.500 1.00 0.00 ? 305 ASN B H    2  
ATOM 2159  H HA   . ASN B 2 11 ? 6.629   -1.516  -11.461 1.00 0.00 ? 305 ASN B HA   2  
ATOM 2160  H HB2  . ASN B 2 11 ? 9.476   -0.670  -12.049 1.00 0.00 ? 305 ASN B HB2  2  
ATOM 2161  H HB3  . ASN B 2 11 ? 8.788   -2.243  -12.443 1.00 0.00 ? 305 ASN B HB3  2  
ATOM 2162  H HD21 . ASN B 2 11 ? 9.585   0.635   -13.720 1.00 0.00 ? 305 ASN B HD21 2  
ATOM 2163  H HD22 . ASN B 2 11 ? 8.470   0.704   -15.038 1.00 0.00 ? 305 ASN B HD22 2  
ATOM 2164  N N    . HIS B 2 12 ? 8.788   -0.949  -9.069  1.00 0.00 ? 306 HIS B N    2  
ATOM 2165  C CA   . HIS B 2 12 ? 9.351   -1.474  -7.824  1.00 0.00 ? 306 HIS B CA   2  
ATOM 2166  C C    . HIS B 2 12 ? 8.246   -1.995  -6.901  1.00 0.00 ? 306 HIS B C    2  
ATOM 2167  O O    . HIS B 2 12 ? 8.264   -3.161  -6.505  1.00 0.00 ? 306 HIS B O    2  
ATOM 2168  C CB   . HIS B 2 12 ? 10.174  -0.388  -7.121  1.00 0.00 ? 306 HIS B CB   2  
ATOM 2169  C CG   . HIS B 2 12 ? 10.917  -0.867  -5.912  1.00 0.00 ? 306 HIS B CG   2  
ATOM 2170  N ND1  . HIS B 2 12 ? 10.293  -1.363  -4.788  1.00 0.00 ? 306 HIS B ND1  2  
ATOM 2171  C CD2  . HIS B 2 12 ? 12.244  -0.916  -5.651  1.00 0.00 ? 306 HIS B CD2  2  
ATOM 2172  C CE1  . HIS B 2 12 ? 11.200  -1.690  -3.890  1.00 0.00 ? 306 HIS B CE1  2  
ATOM 2173  N NE2  . HIS B 2 12 ? 12.395  -1.430  -4.388  1.00 0.00 ? 306 HIS B NE2  2  
ATOM 2174  H H    . HIS B 2 12 ? 8.932   -0.006  -9.291  1.00 0.00 ? 306 HIS B H    2  
ATOM 2175  H HA   . HIS B 2 12 ? 10.001  -2.297  -8.081  1.00 0.00 ? 306 HIS B HA   2  
ATOM 2176  H HB2  . HIS B 2 12 ? 10.898  0.008   -7.816  1.00 0.00 ? 306 HIS B HB2  2  
ATOM 2177  H HB3  . HIS B 2 12 ? 9.512   0.407   -6.809  1.00 0.00 ? 306 HIS B HB3  2  
ATOM 2178  H HD1  . HIS B 2 12 ? 9.327   -1.467  -4.671  1.00 0.00 ? 306 HIS B HD1  2  
ATOM 2179  H HD2  . HIS B 2 12 ? 13.040  -0.606  -6.315  1.00 0.00 ? 306 HIS B HD2  2  
ATOM 2180  H HE1  . HIS B 2 12 ? 11.000  -2.092  -2.909  1.00 0.00 ? 306 HIS B HE1  2  
ATOM 2181  H HE2  . HIS B 2 12 ? 13.241  -1.728  -3.995  1.00 0.00 ? 306 HIS B HE2  2  
ATOM 2182  N N    . ALA B 2 13 ? 7.280   -1.131  -6.571  1.00 0.00 ? 307 ALA B N    2  
ATOM 2183  C CA   . ALA B 2 13 ? 6.164   -1.522  -5.706  1.00 0.00 ? 307 ALA B CA   2  
ATOM 2184  C C    . ALA B 2 13 ? 5.337   -2.618  -6.362  1.00 0.00 ? 307 ALA B C    2  
ATOM 2185  O O    . ALA B 2 13 ? 4.940   -3.582  -5.713  1.00 0.00 ? 307 ALA B O    2  
ATOM 2186  C CB   . ALA B 2 13 ? 5.272   -0.334  -5.398  1.00 0.00 ? 307 ALA B CB   2  
ATOM 2187  H H    . ALA B 2 13 ? 7.313   -0.217  -6.925  1.00 0.00 ? 307 ALA B H    2  
ATOM 2188  H HA   . ALA B 2 13 ? 6.569   -1.894  -4.777  1.00 0.00 ? 307 ALA B HA   2  
ATOM 2189  H HB1  . ALA B 2 13 ? 5.556   0.096   -4.450  1.00 0.00 ? 307 ALA B HB1  2  
ATOM 2190  H HB2  . ALA B 2 13 ? 4.242   -0.670  -5.349  1.00 0.00 ? 307 ALA B HB2  2  
ATOM 2191  H HB3  . ALA B 2 13 ? 5.373   0.406   -6.178  1.00 0.00 ? 307 ALA B HB3  2  
ATOM 2192  N N    . ILE B 2 14 ? 5.098   -2.455  -7.657  1.00 0.00 ? 308 ILE B N    2  
ATOM 2193  C CA   . ILE B 2 14 ? 4.339   -3.415  -8.441  1.00 0.00 ? 308 ILE B CA   2  
ATOM 2194  C C    . ILE B 2 14 ? 4.870   -4.828  -8.239  1.00 0.00 ? 308 ILE B C    2  
ATOM 2195  O O    . ILE B 2 14 ? 4.160   -5.702  -7.739  1.00 0.00 ? 308 ILE B O    2  
ATOM 2196  C CB   . ILE B 2 14 ? 4.413   -3.020  -9.929  1.00 0.00 ? 308 ILE B CB   2  
ATOM 2197  C CG1  . ILE B 2 14 ? 3.258   -2.096  -10.289 1.00 0.00 ? 308 ILE B CG1  2  
ATOM 2198  C CG2  . ILE B 2 14 ? 4.432   -4.236  -10.821 1.00 0.00 ? 308 ILE B CG2  2  
ATOM 2199  C CD1  . ILE B 2 14 ? 3.086   -0.946  -9.325  1.00 0.00 ? 308 ILE B CD1  2  
ATOM 2200  H H    . ILE B 2 14 ? 5.452   -1.662  -8.111  1.00 0.00 ? 308 ILE B H    2  
ATOM 2201  H HA   . ILE B 2 14 ? 3.306   -3.375  -8.123  1.00 0.00 ? 308 ILE B HA   2  
ATOM 2202  H HB   . ILE B 2 14 ? 5.340   -2.489  -10.083 1.00 0.00 ? 308 ILE B HB   2  
ATOM 2203  H HG12 . ILE B 2 14 ? 3.435   -1.682  -11.267 1.00 0.00 ? 308 ILE B HG12 2  
ATOM 2204  H HG13 . ILE B 2 14 ? 2.341   -2.662  -10.301 1.00 0.00 ? 308 ILE B HG13 2  
ATOM 2205  H HG21 . ILE B 2 14 ? 3.626   -4.892  -10.541 1.00 0.00 ? 308 ILE B HG21 2  
ATOM 2206  H HG22 . ILE B 2 14 ? 5.383   -4.748  -10.701 1.00 0.00 ? 308 ILE B HG22 2  
ATOM 2207  H HG23 . ILE B 2 14 ? 4.311   -3.925  -11.845 1.00 0.00 ? 308 ILE B HG23 2  
ATOM 2208  H HD11 . ILE B 2 14 ? 3.762   -0.152  -9.594  1.00 0.00 ? 308 ILE B HD11 2  
ATOM 2209  H HD12 . ILE B 2 14 ? 3.307   -1.283  -8.320  1.00 0.00 ? 308 ILE B HD12 2  
ATOM 2210  H HD13 . ILE B 2 14 ? 2.073   -0.590  -9.369  1.00 0.00 ? 308 ILE B HD13 2  
ATOM 2211  N N    . ASN B 2 15 ? 6.126   -5.034  -8.614  1.00 0.00 ? 309 ASN B N    2  
ATOM 2212  C CA   . ASN B 2 15 ? 6.768   -6.327  -8.460  1.00 0.00 ? 309 ASN B CA   2  
ATOM 2213  C C    . ASN B 2 15 ? 6.795   -6.738  -6.985  1.00 0.00 ? 309 ASN B C    2  
ATOM 2214  O O    . ASN B 2 15 ? 6.745   -7.926  -6.663  1.00 0.00 ? 309 ASN B O    2  
ATOM 2215  C CB   . ASN B 2 15 ? 8.169   -6.276  -9.057  1.00 0.00 ? 309 ASN B CB   2  
ATOM 2216  C CG   . ASN B 2 15 ? 8.171   -6.524  -10.554 1.00 0.00 ? 309 ASN B CG   2  
ATOM 2217  O OD1  . ASN B 2 15 ? 7.588   -5.759  -11.321 1.00 0.00 ? 309 ASN B OD1  2  
ATOM 2218  N ND2  . ASN B 2 15 ? 8.823   -7.601  -10.979 1.00 0.00 ? 309 ASN B ND2  2  
ATOM 2219  H H    . ASN B 2 15 ? 6.641   -4.287  -8.992  1.00 0.00 ? 309 ASN B H    2  
ATOM 2220  H HA   . ASN B 2 15 ? 6.180   -7.051  -9.006  1.00 0.00 ? 309 ASN B HA   2  
ATOM 2221  H HB2  . ASN B 2 15 ? 8.573   -5.293  -8.887  1.00 0.00 ? 309 ASN B HB2  2  
ATOM 2222  H HB3  . ASN B 2 15 ? 8.792   -7.015  -8.580  1.00 0.00 ? 309 ASN B HB3  2  
ATOM 2223  H HD21 . ASN B 2 15 ? 9.263   -8.171  -10.313 1.00 0.00 ? 309 ASN B HD21 2  
ATOM 2224  H HD22 . ASN B 2 15 ? 8.838   -7.782  -11.942 1.00 0.00 ? 309 ASN B HD22 2  
ATOM 2225  N N    . TYR B 2 16 ? 6.826   -5.741  -6.090  1.00 0.00 ? 310 TYR B N    2  
ATOM 2226  C CA   . TYR B 2 16 ? 6.800   -5.996  -4.651  1.00 0.00 ? 310 TYR B CA   2  
ATOM 2227  C C    . TYR B 2 16 ? 5.459   -6.624  -4.267  1.00 0.00 ? 310 TYR B C    2  
ATOM 2228  O O    . TYR B 2 16 ? 5.413   -7.593  -3.506  1.00 0.00 ? 310 TYR B O    2  
ATOM 2229  C CB   . TYR B 2 16 ? 7.022   -4.696  -3.866  1.00 0.00 ? 310 TYR B CB   2  
ATOM 2230  C CG   . TYR B 2 16 ? 6.629   -4.787  -2.407  1.00 0.00 ? 310 TYR B CG   2  
ATOM 2231  C CD1  . TYR B 2 16 ? 6.941   -5.908  -1.645  1.00 0.00 ? 310 TYR B CD1  2  
ATOM 2232  C CD2  . TYR B 2 16 ? 5.939   -3.751  -1.795  1.00 0.00 ? 310 TYR B CD2  2  
ATOM 2233  C CE1  . TYR B 2 16 ? 6.574   -5.989  -0.318  1.00 0.00 ? 310 TYR B CE1  2  
ATOM 2234  C CE2  . TYR B 2 16 ? 5.568   -3.826  -0.467  1.00 0.00 ? 310 TYR B CE2  2  
ATOM 2235  C CZ   . TYR B 2 16 ? 5.888   -4.946  0.265   1.00 0.00 ? 310 TYR B CZ   2  
ATOM 2236  O OH   . TYR B 2 16 ? 5.514   -5.029  1.584   1.00 0.00 ? 310 TYR B OH   2  
ATOM 2237  H H    . TYR B 2 16 ? 6.831   -4.814  -6.407  1.00 0.00 ? 310 TYR B H    2  
ATOM 2238  H HA   . TYR B 2 16 ? 7.593   -6.691  -4.420  1.00 0.00 ? 310 TYR B HA   2  
ATOM 2239  H HB2  . TYR B 2 16 ? 8.068   -4.433  -3.909  1.00 0.00 ? 310 TYR B HB2  2  
ATOM 2240  H HB3  . TYR B 2 16 ? 6.441   -3.907  -4.317  1.00 0.00 ? 310 TYR B HB3  2  
ATOM 2241  H HD1  . TYR B 2 16 ? 7.480   -6.723  -2.106  1.00 0.00 ? 310 TYR B HD1  2  
ATOM 2242  H HD2  . TYR B 2 16 ? 5.689   -2.874  -2.373  1.00 0.00 ? 310 TYR B HD2  2  
ATOM 2243  H HE1  . TYR B 2 16 ? 6.825   -6.868  0.258   1.00 0.00 ? 310 TYR B HE1  2  
ATOM 2244  H HE2  . TYR B 2 16 ? 5.032   -3.008  -0.011  1.00 0.00 ? 310 TYR B HE2  2  
ATOM 2245  H HH   . TYR B 2 16 ? 4.586   -4.800  1.672   1.00 0.00 ? 310 TYR B HH   2  
ATOM 2246  N N    . VAL B 2 17 ? 4.367   -6.078  -4.819  1.00 0.00 ? 311 VAL B N    2  
ATOM 2247  C CA   . VAL B 2 17 ? 3.026   -6.605  -4.554  1.00 0.00 ? 311 VAL B CA   2  
ATOM 2248  C C    . VAL B 2 17 ? 2.968   -8.074  -4.955  1.00 0.00 ? 311 VAL B C    2  
ATOM 2249  O O    . VAL B 2 17 ? 2.373   -8.896  -4.256  1.00 0.00 ? 311 VAL B O    2  
ATOM 2250  C CB   . VAL B 2 17 ? 1.933   -5.846  -5.339  1.00 0.00 ? 311 VAL B CB   2  
ATOM 2251  C CG1  . VAL B 2 17 ? 0.553   -6.370  -4.976  1.00 0.00 ? 311 VAL B CG1  2  
ATOM 2252  C CG2  . VAL B 2 17 ? 2.002   -4.351  -5.087  1.00 0.00 ? 311 VAL B CG2  2  
ATOM 2253  H H    . VAL B 2 17 ? 4.469   -5.320  -5.432  1.00 0.00 ? 311 VAL B H    2  
ATOM 2254  H HA   . VAL B 2 17 ? 2.826   -6.513  -3.497  1.00 0.00 ? 311 VAL B HA   2  
ATOM 2255  H HB   . VAL B 2 17 ? 2.091   -6.019  -6.394  1.00 0.00 ? 311 VAL B HB   2  
ATOM 2256  H HG11 . VAL B 2 17 ? -0.196  -5.783  -5.490  1.00 0.00 ? 311 VAL B HG11 2  
ATOM 2257  H HG12 . VAL B 2 17 ? 0.405   -6.282  -3.908  1.00 0.00 ? 311 VAL B HG12 2  
ATOM 2258  H HG13 . VAL B 2 17 ? 0.465   -7.412  -5.273  1.00 0.00 ? 311 VAL B HG13 2  
ATOM 2259  H HG21 . VAL B 2 17 ? 2.846   -3.927  -5.616  1.00 0.00 ? 311 VAL B HG21 2  
ATOM 2260  H HG22 . VAL B 2 17 ? 2.114   -4.173  -4.031  1.00 0.00 ? 311 VAL B HG22 2  
ATOM 2261  H HG23 . VAL B 2 17 ? 1.090   -3.887  -5.434  1.00 0.00 ? 311 VAL B HG23 2  
ATOM 2262  N N    . ASN B 2 18 ? 3.610   -8.389  -6.083  1.00 0.00 ? 312 ASN B N    2  
ATOM 2263  C CA   . ASN B 2 18 ? 3.665   -9.754  -6.591  1.00 0.00 ? 312 ASN B CA   2  
ATOM 2264  C C    . ASN B 2 18 ? 4.250   -10.688 -5.528  1.00 0.00 ? 312 ASN B C    2  
ATOM 2265  O O    . ASN B 2 18 ? 3.774   -11.809 -5.349  1.00 0.00 ? 312 ASN B O    2  
ATOM 2266  C CB   . ASN B 2 18 ? 4.500   -9.790  -7.877  1.00 0.00 ? 312 ASN B CB   2  
ATOM 2267  C CG   . ASN B 2 18 ? 4.426   -11.121 -8.599  1.00 0.00 ? 312 ASN B CG   2  
ATOM 2268  O OD1  . ASN B 2 18 ? 3.355   -11.544 -9.034  1.00 0.00 ? 312 ASN B OD1  2  
ATOM 2269  N ND2  . ASN B 2 18 ? 5.568   -11.788 -8.735  1.00 0.00 ? 312 ASN B ND2  2  
ATOM 2270  H H    . ASN B 2 18 ? 4.070   -7.681  -6.581  1.00 0.00 ? 312 ASN B H    2  
ATOM 2271  H HA   . ASN B 2 18 ? 2.653   -10.067 -6.814  1.00 0.00 ? 312 ASN B HA   2  
ATOM 2272  H HB2  . ASN B 2 18 ? 4.144   -9.024  -8.548  1.00 0.00 ? 312 ASN B HB2  2  
ATOM 2273  H HB3  . ASN B 2 18 ? 5.531   -9.590  -7.630  1.00 0.00 ? 312 ASN B HB3  2  
ATOM 2274  H HD21 . ASN B 2 18 ? 6.386   -11.391 -8.367  1.00 0.00 ? 312 ASN B HD21 2  
ATOM 2275  H HD22 . ASN B 2 18 ? 5.546   -12.650 -9.200  1.00 0.00 ? 312 ASN B HD22 2  
ATOM 2276  N N    . LYS B 2 19 ? 5.264   -10.201 -4.798  1.00 0.00 ? 313 LYS B N    2  
ATOM 2277  C CA   . LYS B 2 19 ? 5.888   -10.974 -3.720  1.00 0.00 ? 313 LYS B CA   2  
ATOM 2278  C C    . LYS B 2 19 ? 4.865   -11.277 -2.637  1.00 0.00 ? 313 LYS B C    2  
ATOM 2279  O O    . LYS B 2 19 ? 4.687   -12.422 -2.242  1.00 0.00 ? 313 LYS B O    2  
ATOM 2280  C CB   . LYS B 2 19 ? 7.053   -10.196 -3.091  1.00 0.00 ? 313 LYS B CB   2  
ATOM 2281  C CG   . LYS B 2 19 ? 8.279   -10.096 -3.979  1.00 0.00 ? 313 LYS B CG   2  
ATOM 2282  C CD   . LYS B 2 19 ? 9.281   -9.073  -3.455  1.00 0.00 ? 313 LYS B CD   2  
ATOM 2283  C CE   . LYS B 2 19 ? 10.121  -9.624  -2.313  1.00 0.00 ? 313 LYS B CE   2  
ATOM 2284  N NZ   . LYS B 2 19 ? 10.841  -10.874 -2.690  1.00 0.00 ? 313 LYS B NZ   2  
ATOM 2285  H H    . LYS B 2 19 ? 5.582   -9.290  -4.972  1.00 0.00 ? 313 LYS B H    2  
ATOM 2286  H HA   . LYS B 2 19 ? 6.253   -11.905 -4.135  1.00 0.00 ? 313 LYS B HA   2  
ATOM 2287  H HB2  . LYS B 2 19 ? 6.718   -9.195  -2.860  1.00 0.00 ? 313 LYS B HB2  2  
ATOM 2288  H HB3  . LYS B 2 19 ? 7.339   -10.687 -2.175  1.00 0.00 ? 313 LYS B HB3  2  
ATOM 2289  H HG2  . LYS B 2 19 ? 8.758   -11.062 -4.000  1.00 0.00 ? 313 LYS B HG2  2  
ATOM 2290  H HG3  . LYS B 2 19 ? 7.973   -9.816  -4.974  1.00 0.00 ? 313 LYS B HG3  2  
ATOM 2291  H HD2  . LYS B 2 19 ? 9.937   -8.781  -4.261  1.00 0.00 ? 313 LYS B HD2  2  
ATOM 2292  H HD3  . LYS B 2 19 ? 8.737   -8.210  -3.101  1.00 0.00 ? 313 LYS B HD3  2  
ATOM 2293  H HE2  . LYS B 2 19 ? 10.847  -8.877  -2.027  1.00 0.00 ? 313 LYS B HE2  2  
ATOM 2294  H HE3  . LYS B 2 19 ? 9.476   -9.829  -1.476  1.00 0.00 ? 313 LYS B HE3  2  
ATOM 2295  H HZ1  . LYS B 2 19 ? 10.267  -11.706 -2.444  1.00 0.00 ? 313 LYS B HZ1  2  
ATOM 2296  H HZ2  . LYS B 2 19 ? 11.747  -10.932 -2.183  1.00 0.00 ? 313 LYS B HZ2  2  
ATOM 2297  H HZ3  . LYS B 2 19 ? 11.031  -10.886 -3.714  1.00 0.00 ? 313 LYS B HZ3  2  
ATOM 2298  N N    . ILE B 2 20 ? 4.195   -10.227 -2.175  1.00 0.00 ? 314 ILE B N    2  
ATOM 2299  C CA   . ILE B 2 20 ? 3.171   -10.340 -1.140  1.00 0.00 ? 314 ILE B CA   2  
ATOM 2300  C C    . ILE B 2 20 ? 2.068   -11.293 -1.579  1.00 0.00 ? 314 ILE B C    2  
ATOM 2301  O O    . ILE B 2 20 ? 1.755   -12.265 -0.888  1.00 0.00 ? 314 ILE B O    2  
ATOM 2302  C CB   . ILE B 2 20 ? 2.569   -8.949  -0.843  1.00 0.00 ? 314 ILE B CB   2  
ATOM 2303  C CG1  . ILE B 2 20 ? 3.672   -7.999  -0.373  1.00 0.00 ? 314 ILE B CG1  2  
ATOM 2304  C CG2  . ILE B 2 20 ? 1.458   -9.041  0.196   1.00 0.00 ? 314 ILE B CG2  2  
ATOM 2305  C CD1  . ILE B 2 20 ? 3.301   -6.540  -0.474  1.00 0.00 ? 314 ILE B CD1  2  
ATOM 2306  H H    . ILE B 2 20 ? 4.390   -9.341  -2.549  1.00 0.00 ? 314 ILE B H    2  
ATOM 2307  H HA   . ILE B 2 20 ? 3.632   -10.717 -0.241  1.00 0.00 ? 314 ILE B HA   2  
ATOM 2308  H HB   . ILE B 2 20 ? 2.141   -8.564  -1.756  1.00 0.00 ? 314 ILE B HB   2  
ATOM 2309  H HG12 . ILE B 2 20 ? 3.903   -8.208  0.661   1.00 0.00 ? 314 ILE B HG12 2  
ATOM 2310  H HG13 . ILE B 2 20 ? 4.556   -8.159  -0.972  1.00 0.00 ? 314 ILE B HG13 2  
ATOM 2311  H HG21 . ILE B 2 20 ? 0.814   -9.877  -0.035  1.00 0.00 ? 314 ILE B HG21 2  
ATOM 2312  H HG22 . ILE B 2 20 ? 0.880   -8.128  0.185   1.00 0.00 ? 314 ILE B HG22 2  
ATOM 2313  H HG23 . ILE B 2 20 ? 1.893   -9.179  1.174   1.00 0.00 ? 314 ILE B HG23 2  
ATOM 2314  H HD11 . ILE B 2 20 ? 2.260   -6.450  -0.747  1.00 0.00 ? 314 ILE B HD11 2  
ATOM 2315  H HD12 . ILE B 2 20 ? 3.915   -6.069  -1.228  1.00 0.00 ? 314 ILE B HD12 2  
ATOM 2316  H HD13 . ILE B 2 20 ? 3.467   -6.060  0.479   1.00 0.00 ? 314 ILE B HD13 2  
ATOM 2317  N N    . LYS B 2 21 ? 1.493   -11.003 -2.738  1.00 0.00 ? 315 LYS B N    2  
ATOM 2318  C CA   . LYS B 2 21 ? 0.428   -11.810 -3.312  1.00 0.00 ? 315 LYS B CA   2  
ATOM 2319  C C    . LYS B 2 21 ? 0.832   -13.286 -3.439  1.00 0.00 ? 315 LYS B C    2  
ATOM 2320  O O    . LYS B 2 21 ? 0.133   -14.171 -2.940  1.00 0.00 ? 315 LYS B O    2  
ATOM 2321  C CB   . LYS B 2 21 ? 0.045   -11.230 -4.671  1.00 0.00 ? 315 LYS B CB   2  
ATOM 2322  C CG   . LYS B 2 21 ? -1.150  -11.888 -5.302  1.00 0.00 ? 315 LYS B CG   2  
ATOM 2323  C CD   . LYS B 2 21 ? -1.468  -11.224 -6.618  1.00 0.00 ? 315 LYS B CD   2  
ATOM 2324  C CE   . LYS B 2 21 ? -2.497  -12.020 -7.388  1.00 0.00 ? 315 LYS B CE   2  
ATOM 2325  N NZ   . LYS B 2 21 ? -2.040  -13.411 -7.672  1.00 0.00 ? 315 LYS B NZ   2  
ATOM 2326  H H    . LYS B 2 21 ? 1.803   -10.212 -3.230  1.00 0.00 ? 315 LYS B H    2  
ATOM 2327  H HA   . LYS B 2 21 ? -0.425  -11.743 -2.653  1.00 0.00 ? 315 LYS B HA   2  
ATOM 2328  H HB2  . LYS B 2 21 ? -0.174  -10.183 -4.555  1.00 0.00 ? 315 LYS B HB2  2  
ATOM 2329  H HB3  . LYS B 2 21 ? 0.872   -11.335 -5.352  1.00 0.00 ? 315 LYS B HB3  2  
ATOM 2330  H HG2  . LYS B 2 21 ? -0.933  -12.933 -5.472  1.00 0.00 ? 315 LYS B HG2  2  
ATOM 2331  H HG3  . LYS B 2 21 ? -1.999  -11.792 -4.641  1.00 0.00 ? 315 LYS B HG3  2  
ATOM 2332  H HD2  . LYS B 2 21 ? -1.855  -10.231 -6.423  1.00 0.00 ? 315 LYS B HD2  2  
ATOM 2333  H HD3  . LYS B 2 21 ? -0.565  -11.151 -7.204  1.00 0.00 ? 315 LYS B HD3  2  
ATOM 2334  H HE2  . LYS B 2 21 ? -3.401  -12.060 -6.805  1.00 0.00 ? 315 LYS B HE2  2  
ATOM 2335  H HE3  . LYS B 2 21 ? -2.689  -11.519 -8.318  1.00 0.00 ? 315 LYS B HE3  2  
ATOM 2336  H HZ1  . LYS B 2 21 ? -1.017  -13.420 -7.864  1.00 0.00 ? 315 LYS B HZ1  2  
ATOM 2337  H HZ2  . LYS B 2 21 ? -2.539  -13.788 -8.503  1.00 0.00 ? 315 LYS B HZ2  2  
ATOM 2338  H HZ3  . LYS B 2 21 ? -2.236  -14.025 -6.857  1.00 0.00 ? 315 LYS B HZ3  2  
ATOM 2339  N N    . ASN B 2 22 ? 1.960   -13.542 -4.111  1.00 0.00 ? 316 ASN B N    2  
ATOM 2340  C CA   . ASN B 2 22 ? 2.459   -14.908 -4.312  1.00 0.00 ? 316 ASN B CA   2  
ATOM 2341  C C    . ASN B 2 22 ? 2.914   -15.550 -3.003  1.00 0.00 ? 316 ASN B C    2  
ATOM 2342  O O    . ASN B 2 22 ? 2.562   -16.695 -2.712  1.00 0.00 ? 316 ASN B O    2  
ATOM 2343  C CB   . ASN B 2 22 ? 3.617   -14.909 -5.313  1.00 0.00 ? 316 ASN B CB   2  
ATOM 2344  C CG   . ASN B 2 22 ? 3.142   -14.819 -6.750  1.00 0.00 ? 316 ASN B CG   2  
ATOM 2345  O OD1  . ASN B 2 22 ? 2.367   -15.653 -7.213  1.00 0.00 ? 316 ASN B OD1  2  
ATOM 2346  N ND2  . ASN B 2 22 ? 3.612   -13.807 -7.465  1.00 0.00 ? 316 ASN B ND2  2  
ATOM 2347  H H    . ASN B 2 22 ? 2.468   -12.791 -4.485  1.00 0.00 ? 316 ASN B H    2  
ATOM 2348  H HA   . ASN B 2 22 ? 1.650   -15.498 -4.717  1.00 0.00 ? 316 ASN B HA   2  
ATOM 2349  H HB2  . ASN B 2 22 ? 4.255   -14.061 -5.113  1.00 0.00 ? 316 ASN B HB2  2  
ATOM 2350  H HB3  . ASN B 2 22 ? 4.191   -15.815 -5.196  1.00 0.00 ? 316 ASN B HB3  2  
ATOM 2351  H HD21 . ASN B 2 22 ? 4.230   -13.182 -7.033  1.00 0.00 ? 316 ASN B HD21 2  
ATOM 2352  H HD22 . ASN B 2 22 ? 3.319   -13.725 -8.397  1.00 0.00 ? 316 ASN B HD22 2  
ATOM 2353  N N    . ARG B 2 23 ? 3.703   -14.818 -2.222  1.00 0.00 ? 317 ARG B N    2  
ATOM 2354  C CA   . ARG B 2 23 ? 4.202   -15.326 -0.948  1.00 0.00 ? 317 ARG B CA   2  
ATOM 2355  C C    . ARG B 2 23 ? 3.050   -15.792 -0.063  1.00 0.00 ? 317 ARG B C    2  
ATOM 2356  O O    . ARG B 2 23 ? 3.132   -16.852 0.563   1.00 0.00 ? 317 ARG B O    2  
ATOM 2357  C CB   . ARG B 2 23 ? 5.023   -14.251 -0.224  1.00 0.00 ? 317 ARG B CB   2  
ATOM 2358  C CG   . ARG B 2 23 ? 5.587   -14.697 1.118   1.00 0.00 ? 317 ARG B CG   2  
ATOM 2359  C CD   . ARG B 2 23 ? 6.571   -15.846 0.963   1.00 0.00 ? 317 ARG B CD   2  
ATOM 2360  N NE   . ARG B 2 23 ? 7.116   -16.277 2.252   1.00 0.00 ? 317 ARG B NE   2  
ATOM 2361  C CZ   . ARG B 2 23 ? 8.005   -17.263 2.395   1.00 0.00 ? 317 ARG B CZ   2  
ATOM 2362  N NH1  . ARG B 2 23 ? 8.459   -17.924 1.334   1.00 0.00 ? 317 ARG B NH1  2  
ATOM 2363  N NH2  . ARG B 2 23 ? 8.442   -17.588 3.606   1.00 0.00 ? 317 ARG B NH2  2  
ATOM 2364  H H    . ARG B 2 23 ? 3.955   -13.913 -2.508  1.00 0.00 ? 317 ARG B H    2  
ATOM 2365  H HA   . ARG B 2 23 ? 4.840   -16.172 -1.159  1.00 0.00 ? 317 ARG B HA   2  
ATOM 2366  H HB2  . ARG B 2 23 ? 5.849   -13.962 -0.856  1.00 0.00 ? 317 ARG B HB2  2  
ATOM 2367  H HB3  . ARG B 2 23 ? 4.394   -13.389 -0.056  1.00 0.00 ? 317 ARG B HB3  2  
ATOM 2368  H HG2  . ARG B 2 23 ? 6.095   -13.863 1.578   1.00 0.00 ? 317 ARG B HG2  2  
ATOM 2369  H HG3  . ARG B 2 23 ? 4.772   -15.015 1.752   1.00 0.00 ? 317 ARG B HG3  2  
ATOM 2370  H HD2  . ARG B 2 23 ? 6.062   -16.679 0.502   1.00 0.00 ? 317 ARG B HD2  2  
ATOM 2371  H HD3  . ARG B 2 23 ? 7.384   -15.524 0.329   1.00 0.00 ? 317 ARG B HD3  2  
ATOM 2372  H HE   . ARG B 2 23 ? 6.802   -15.809 3.053   1.00 0.00 ? 317 ARG B HE   2  
ATOM 2373  H HH11 . ARG B 2 23 ? 8.136   -17.684 0.419   1.00 0.00 ? 317 ARG B HH11 2  
ATOM 2374  H HH12 . ARG B 2 23 ? 9.125   -18.660 1.452   1.00 0.00 ? 317 ARG B HH12 2  
ATOM 2375  H HH21 . ARG B 2 23 ? 8.105   -17.093 4.409   1.00 0.00 ? 317 ARG B HH21 2  
ATOM 2376  H HH22 . ARG B 2 23 ? 9.107   -18.325 3.717   1.00 0.00 ? 317 ARG B HH22 2  
ATOM 2377  N N    . PHE B 2 24 ? 1.977   -14.997 -0.010  1.00 0.00 ? 318 PHE B N    2  
ATOM 2378  C CA   . PHE B 2 24 ? 0.819   -15.346 0.810   1.00 0.00 ? 318 PHE B CA   2  
ATOM 2379  C C    . PHE B 2 24 ? -0.313  -15.906 -0.055  1.00 0.00 ? 318 PHE B C    2  
ATOM 2380  O O    . PHE B 2 24 ? -1.481  -15.580 0.166   1.00 0.00 ? 318 PHE B O    2  
ATOM 2381  C CB   . PHE B 2 24 ? 0.285   -14.140 1.602   1.00 0.00 ? 318 PHE B CB   2  
ATOM 2382  C CG   . PHE B 2 24 ? 1.295   -13.094 1.991   1.00 0.00 ? 318 PHE B CG   2  
ATOM 2383  C CD1  . PHE B 2 24 ? 2.661   -13.335 1.976   1.00 0.00 ? 318 PHE B CD1  2  
ATOM 2384  C CD2  . PHE B 2 24 ? 0.851   -11.849 2.376   1.00 0.00 ? 318 PHE B CD2  2  
ATOM 2385  C CE1  . PHE B 2 24 ? 3.555   -12.347 2.336   1.00 0.00 ? 318 PHE B CE1  2  
ATOM 2386  C CE2  . PHE B 2 24 ? 1.737   -10.861 2.736   1.00 0.00 ? 318 PHE B CE2  2  
ATOM 2387  C CZ   . PHE B 2 24 ? 3.092   -11.107 2.715   1.00 0.00 ? 318 PHE B CZ   2  
ATOM 2388  H H    . PHE B 2 24 ? 1.965   -14.163 -0.528  1.00 0.00 ? 318 PHE B H    2  
ATOM 2389  H HA   . PHE B 2 24 ? 1.129   -16.111 1.507   1.00 0.00 ? 318 PHE B HA   2  
ATOM 2390  H HB2  . PHE B 2 24 ? -0.484  -13.649 1.026   1.00 0.00 ? 318 PHE B HB2  2  
ATOM 2391  H HB3  . PHE B 2 24 ? -0.154  -14.512 2.513   1.00 0.00 ? 318 PHE B HB3  2  
ATOM 2392  H HD1  . PHE B 2 24 ? 3.026   -14.306 1.687   1.00 0.00 ? 318 PHE B HD1  2  
ATOM 2393  H HD2  . PHE B 2 24 ? -0.212  -11.653 2.395   1.00 0.00 ? 318 PHE B HD2  2  
ATOM 2394  H HE1  . PHE B 2 24 ? 4.616   -12.546 2.317   1.00 0.00 ? 318 PHE B HE1  2  
ATOM 2395  H HE2  . PHE B 2 24 ? 1.368   -9.895  3.033   1.00 0.00 ? 318 PHE B HE2  2  
ATOM 2396  H HZ   . PHE B 2 24 ? 3.787   -10.330 2.996   1.00 0.00 ? 318 PHE B HZ   2  
ATOM 2397  N N    . GLN B 2 25 ? 0.025   -16.748 -1.034  1.00 0.00 ? 319 GLN B N    2  
ATOM 2398  C CA   . GLN B 2 25 ? -0.988  -17.346 -1.908  1.00 0.00 ? 319 GLN B CA   2  
ATOM 2399  C C    . GLN B 2 25 ? -2.136  -17.962 -1.100  1.00 0.00 ? 319 GLN B C    2  
ATOM 2400  O O    . GLN B 2 25 ? -3.276  -18.001 -1.568  1.00 0.00 ? 319 GLN B O    2  
ATOM 2401  C CB   . GLN B 2 25 ? -0.358  -18.390 -2.834  1.00 0.00 ? 319 GLN B CB   2  
ATOM 2402  C CG   . GLN B 2 25 ? 0.195   -17.800 -4.126  1.00 0.00 ? 319 GLN B CG   2  
ATOM 2403  C CD   . GLN B 2 25 ? 0.985   -18.790 -4.975  1.00 0.00 ? 319 GLN B CD   2  
ATOM 2404  O OE1  . GLN B 2 25 ? 1.487   -18.430 -6.040  1.00 0.00 ? 319 GLN B OE1  2  
ATOM 2405  N NE2  . GLN B 2 25 ? 1.107   -20.039 -4.524  1.00 0.00 ? 319 GLN B NE2  2  
ATOM 2406  H H    . GLN B 2 25 ? 0.969   -16.976 -1.167  1.00 0.00 ? 319 GLN B H    2  
ATOM 2407  H HA   . GLN B 2 25 ? -1.394  -16.551 -2.515  1.00 0.00 ? 319 GLN B HA   2  
ATOM 2408  H HB2  . GLN B 2 25 ? 0.454   -18.875 -2.311  1.00 0.00 ? 319 GLN B HB2  2  
ATOM 2409  H HB3  . GLN B 2 25 ? -1.103  -19.128 -3.089  1.00 0.00 ? 319 GLN B HB3  2  
ATOM 2410  H HG2  . GLN B 2 25 ? -0.635  -17.437 -4.715  1.00 0.00 ? 319 GLN B HG2  2  
ATOM 2411  H HG3  . GLN B 2 25 ? 0.838   -16.971 -3.877  1.00 0.00 ? 319 GLN B HG3  2  
ATOM 2412  H HE21 . GLN B 2 25 ? 0.689   -20.274 -3.671  1.00 0.00 ? 319 GLN B HE21 2  
ATOM 2413  H HE22 . GLN B 2 25 ? 1.616   -20.676 -5.068  1.00 0.00 ? 319 GLN B HE22 2  
ATOM 2414  N N    . GLY B 2 26 ? -1.834  -18.431 0.117   1.00 0.00 ? 320 GLY B N    2  
ATOM 2415  C CA   . GLY B 2 26 ? -2.855  -19.023 0.968   1.00 0.00 ? 320 GLY B CA   2  
ATOM 2416  C C    . GLY B 2 26 ? -3.438  -18.044 1.983   1.00 0.00 ? 320 GLY B C    2  
ATOM 2417  O O    . GLY B 2 26 ? -4.350  -18.401 2.727   1.00 0.00 ? 320 GLY B O    2  
ATOM 2418  H H    . GLY B 2 26 ? -0.912  -18.366 0.443   1.00 0.00 ? 320 GLY B H    2  
ATOM 2419  H HA2  . GLY B 2 26 ? -3.656  -19.391 0.345   1.00 0.00 ? 320 GLY B HA2  2  
ATOM 2420  H HA3  . GLY B 2 26 ? -2.420  -19.856 1.502   1.00 0.00 ? 320 GLY B HA3  2  
ATOM 2421  N N    . GLN B 2 27 ? -2.910  -16.812 2.017   1.00 0.00 ? 321 GLN B N    2  
ATOM 2422  C CA   . GLN B 2 27 ? -3.387  -15.787 2.947   1.00 0.00 ? 321 GLN B CA   2  
ATOM 2423  C C    . GLN B 2 27 ? -4.236  -14.733 2.239   1.00 0.00 ? 321 GLN B C    2  
ATOM 2424  O O    . GLN B 2 27 ? -3.754  -13.627 1.969   1.00 0.00 ? 321 GLN B O    2  
ATOM 2425  C CB   . GLN B 2 27 ? -2.219  -15.070 3.622   1.00 0.00 ? 321 GLN B CB   2  
ATOM 2426  C CG   . GLN B 2 27 ? -1.251  -15.970 4.365   1.00 0.00 ? 321 GLN B CG   2  
ATOM 2427  C CD   . GLN B 2 27 ? -1.904  -16.756 5.490   1.00 0.00 ? 321 GLN B CD   2  
ATOM 2428  O OE1  . GLN B 2 27 ? -2.801  -17.565 5.259   1.00 0.00 ? 321 GLN B OE1  2  
ATOM 2429  N NE2  . GLN B 2 27 ? -1.454  -16.520 6.719   1.00 0.00 ? 321 GLN B NE2  2  
ATOM 2430  H H    . GLN B 2 27 ? -2.184  -16.586 1.401   1.00 0.00 ? 321 GLN B H    2  
ATOM 2431  H HA   . GLN B 2 27 ? -3.987  -16.271 3.703   1.00 0.00 ? 321 GLN B HA   2  
ATOM 2432  H HB2  . GLN B 2 27 ? -1.668  -14.539 2.868   1.00 0.00 ? 321 GLN B HB2  2  
ATOM 2433  H HB3  . GLN B 2 27 ? -2.614  -14.351 4.324   1.00 0.00 ? 321 GLN B HB3  2  
ATOM 2434  H HG2  . GLN B 2 27 ? -0.815  -16.666 3.662   1.00 0.00 ? 321 GLN B HG2  2  
ATOM 2435  H HG3  . GLN B 2 27 ? -0.473  -15.348 4.785   1.00 0.00 ? 321 GLN B HG3  2  
ATOM 2436  H HE21 . GLN B 2 27 ? -0.736  -15.862 6.833   1.00 0.00 ? 321 GLN B HE21 2  
ATOM 2437  H HE22 . GLN B 2 27 ? -1.859  -17.015 7.461   1.00 0.00 ? 321 GLN B HE22 2  
ATOM 2438  N N    . PRO B 2 28 ? -5.514  -15.021 1.955   1.00 0.00 ? 322 PRO B N    2  
ATOM 2439  C CA   . PRO B 2 28 ? -6.393  -14.043 1.317   1.00 0.00 ? 322 PRO B CA   2  
ATOM 2440  C C    . PRO B 2 28 ? -6.707  -12.886 2.269   1.00 0.00 ? 322 PRO B C    2  
ATOM 2441  O O    . PRO B 2 28 ? -7.029  -11.783 1.833   1.00 0.00 ? 322 PRO B O    2  
ATOM 2442  C CB   . PRO B 2 28 ? -7.655  -14.848 0.998   1.00 0.00 ? 322 PRO B CB   2  
ATOM 2443  C CG   . PRO B 2 28 ? -7.657  -15.960 1.990   1.00 0.00 ? 322 PRO B CG   2  
ATOM 2444  C CD   . PRO B 2 28 ? -6.212  -16.283 2.260   1.00 0.00 ? 322 PRO B CD   2  
ATOM 2445  H HA   . PRO B 2 28 ? -5.958  -13.652 0.404   1.00 0.00 ? 322 PRO B HA   2  
ATOM 2446  H HB2  . PRO B 2 28 ? -8.525  -14.216 1.107   1.00 0.00 ? 322 PRO B HB2  2  
ATOM 2447  H HB3  . PRO B 2 28 ? -7.600  -15.222 -0.014  1.00 0.00 ? 322 PRO B HB3  2  
ATOM 2448  H HG2  . PRO B 2 28 ? -8.145  -15.639 2.899   1.00 0.00 ? 322 PRO B HG2  2  
ATOM 2449  H HG3  . PRO B 2 28 ? -8.162  -16.819 1.575   1.00 0.00 ? 322 PRO B HG3  2  
ATOM 2450  H HD2  . PRO B 2 28 ? -6.075  -16.561 3.295   1.00 0.00 ? 322 PRO B HD2  2  
ATOM 2451  H HD3  . PRO B 2 28 ? -5.877  -17.076 1.608   1.00 0.00 ? 322 PRO B HD3  2  
ATOM 2452  N N    . ASP B 2 29 ? -6.587  -13.152 3.576   1.00 0.00 ? 323 ASP B N    2  
ATOM 2453  C CA   . ASP B 2 29 ? -6.837  -12.145 4.598   1.00 0.00 ? 323 ASP B CA   2  
ATOM 2454  C C    . ASP B 2 29 ? -5.770  -11.054 4.569   1.00 0.00 ? 323 ASP B C    2  
ATOM 2455  O O    . ASP B 2 29 ? -6.057  -9.895  4.864   1.00 0.00 ? 323 ASP B O    2  
ATOM 2456  C CB   . ASP B 2 29 ? -6.878  -12.793 5.986   1.00 0.00 ? 323 ASP B CB   2  
ATOM 2457  C CG   . ASP B 2 29 ? -7.950  -13.862 6.100   1.00 0.00 ? 323 ASP B CG   2  
ATOM 2458  O OD1  . ASP B 2 29 ? -9.145  -13.525 5.957   1.00 0.00 ? 323 ASP B OD1  2  
ATOM 2459  O OD2  . ASP B 2 29 ? -7.595  -15.038 6.325   1.00 0.00 ? 323 ASP B OD2  2  
ATOM 2460  H H    . ASP B 2 29 ? -6.304  -14.046 3.858   1.00 0.00 ? 323 ASP B H    2  
ATOM 2461  H HA   . ASP B 2 29 ? -7.798  -11.697 4.393   1.00 0.00 ? 323 ASP B HA   2  
ATOM 2462  H HB2  . ASP B 2 29 ? -5.921  -13.250 6.192   1.00 0.00 ? 323 ASP B HB2  2  
ATOM 2463  H HB3  . ASP B 2 29 ? -7.075  -12.033 6.726   1.00 0.00 ? 323 ASP B HB3  2  
ATOM 2464  N N    . ILE B 2 30 ? -4.536  -11.431 4.221   1.00 0.00 ? 324 ILE B N    2  
ATOM 2465  C CA   . ILE B 2 30 ? -3.434  -10.480 4.169   1.00 0.00 ? 324 ILE B CA   2  
ATOM 2466  C C    . ILE B 2 30 ? -3.548  -9.552  2.973   1.00 0.00 ? 324 ILE B C    2  
ATOM 2467  O O    . ILE B 2 30 ? -3.466  -8.335  3.116   1.00 0.00 ? 324 ILE B O    2  
ATOM 2468  C CB   . ILE B 2 30 ? -2.077  -11.177 4.090   1.00 0.00 ? 324 ILE B CB   2  
ATOM 2469  C CG1  . ILE B 2 30 ? -1.910  -12.145 5.256   1.00 0.00 ? 324 ILE B CG1  2  
ATOM 2470  C CG2  . ILE B 2 30 ? -0.965  -10.132 4.080   1.00 0.00 ? 324 ILE B CG2  2  
ATOM 2471  C CD1  . ILE B 2 30 ? -0.617  -12.900 5.187   1.00 0.00 ? 324 ILE B CD1  2  
ATOM 2472  H H    . ILE B 2 30 ? -4.362  -12.374 3.999   1.00 0.00 ? 324 ILE B H    2  
ATOM 2473  H HA   . ILE B 2 30 ? -3.455  -9.896  5.075   1.00 0.00 ? 324 ILE B HA   2  
ATOM 2474  H HB   . ILE B 2 30 ? -2.028  -11.733 3.164   1.00 0.00 ? 324 ILE B HB   2  
ATOM 2475  H HG12 . ILE B 2 30 ? -1.933  -11.597 6.185   1.00 0.00 ? 324 ILE B HG12 2  
ATOM 2476  H HG13 . ILE B 2 30 ? -2.720  -12.867 5.239   1.00 0.00 ? 324 ILE B HG13 2  
ATOM 2477  H HG21 . ILE B 2 30 ? -0.749  -9.842  3.057   1.00 0.00 ? 324 ILE B HG21 2  
ATOM 2478  H HG22 . ILE B 2 30 ? -0.075  -10.540 4.534   1.00 0.00 ? 324 ILE B HG22 2  
ATOM 2479  H HG23 . ILE B 2 30 ? -1.286  -9.261  4.638   1.00 0.00 ? 324 ILE B HG23 2  
ATOM 2480  H HD11 . ILE B 2 30 ? 0.194   -12.243 5.457   1.00 0.00 ? 324 ILE B HD11 2  
ATOM 2481  H HD12 . ILE B 2 30 ? -0.475  -13.253 4.177   1.00 0.00 ? 324 ILE B HD12 2  
ATOM 2482  H HD13 . ILE B 2 30 ? -0.650  -13.737 5.865   1.00 0.00 ? 324 ILE B HD13 2  
ATOM 2483  N N    . TYR B 2 31 ? -3.707  -10.139 1.790   1.00 0.00 ? 325 TYR B N    2  
ATOM 2484  C CA   . TYR B 2 31 ? -3.797  -9.351  0.561   1.00 0.00 ? 325 TYR B CA   2  
ATOM 2485  C C    . TYR B 2 31 ? -4.994  -8.404  0.611   1.00 0.00 ? 325 TYR B C    2  
ATOM 2486  O O    . TYR B 2 31 ? -4.853  -7.214  0.329   1.00 0.00 ? 325 TYR B O    2  
ATOM 2487  C CB   . TYR B 2 31 ? -3.914  -10.262 -0.662  1.00 0.00 ? 325 TYR B CB   2  
ATOM 2488  C CG   . TYR B 2 31 ? -3.311  -9.665  -1.919  1.00 0.00 ? 325 TYR B CG   2  
ATOM 2489  C CD1  . TYR B 2 31 ? -1.952  -9.369  -1.992  1.00 0.00 ? 325 TYR B CD1  2  
ATOM 2490  C CD2  . TYR B 2 31 ? -4.093  -9.405  -3.038  1.00 0.00 ? 325 TYR B CD2  2  
ATOM 2491  C CE1  . TYR B 2 31 ? -1.400  -8.843  -3.140  1.00 0.00 ? 325 TYR B CE1  2  
ATOM 2492  C CE2  . TYR B 2 31 ? -3.545  -8.876  -4.184  1.00 0.00 ? 325 TYR B CE2  2  
ATOM 2493  C CZ   . TYR B 2 31 ? -2.203  -8.599  -4.231  1.00 0.00 ? 325 TYR B CZ   2  
ATOM 2494  O OH   . TYR B 2 31 ? -1.659  -8.085  -5.380  1.00 0.00 ? 325 TYR B OH   2  
ATOM 2495  H H    . TYR B 2 31 ? -3.733  -11.122 1.744   1.00 0.00 ? 325 TYR B H    2  
ATOM 2496  H HA   . TYR B 2 31 ? -2.894  -8.764  0.477   1.00 0.00 ? 325 TYR B HA   2  
ATOM 2497  H HB2  . TYR B 2 31 ? -3.412  -11.199 -0.459  1.00 0.00 ? 325 TYR B HB2  2  
ATOM 2498  H HB3  . TYR B 2 31 ? -4.958  -10.458 -0.855  1.00 0.00 ? 325 TYR B HB3  2  
ATOM 2499  H HD1  . TYR B 2 31 ? -1.325  -9.557  -1.135  1.00 0.00 ? 325 TYR B HD1  2  
ATOM 2500  H HD2  . TYR B 2 31 ? -5.146  -9.612  -3.007  1.00 0.00 ? 325 TYR B HD2  2  
ATOM 2501  H HE1  . TYR B 2 31 ? -0.344  -8.619  -3.177  1.00 0.00 ? 325 TYR B HE1  2  
ATOM 2502  H HE2  . TYR B 2 31 ? -4.172  -8.682  -5.040  1.00 0.00 ? 325 TYR B HE2  2  
ATOM 2503  H HH   . TYR B 2 31 ? -1.755  -7.135  -5.379  1.00 0.00 ? 325 TYR B HH   2  
ATOM 2504  N N    . LYS B 2 32 ? -6.164  -8.923  0.990   1.00 0.00 ? 326 LYS B N    2  
ATOM 2505  C CA   . LYS B 2 32 ? -7.364  -8.093  1.092   1.00 0.00 ? 326 LYS B CA   2  
ATOM 2506  C C    . LYS B 2 32 ? -7.155  -6.998  2.138   1.00 0.00 ? 326 LYS B C    2  
ATOM 2507  O O    . LYS B 2 32 ? -7.373  -5.818  1.862   1.00 0.00 ? 326 LYS B O    2  
ATOM 2508  C CB   . LYS B 2 32 ? -8.592  -8.942  1.451   1.00 0.00 ? 326 LYS B CB   2  
ATOM 2509  C CG   . LYS B 2 32 ? -8.908  -10.034 0.438   1.00 0.00 ? 326 LYS B CG   2  
ATOM 2510  C CD   . LYS B 2 32 ? -9.183  -9.467  -0.946  1.00 0.00 ? 326 LYS B CD   2  
ATOM 2511  C CE   . LYS B 2 32 ? -9.464  -10.572 -1.956  1.00 0.00 ? 326 LYS B CE   2  
ATOM 2512  N NZ   . LYS B 2 32 ? -8.319  -11.521 -2.084  1.00 0.00 ? 326 LYS B NZ   2  
ATOM 2513  H H    . LYS B 2 32 ? -6.216  -9.876  1.220   1.00 0.00 ? 326 LYS B H    2  
ATOM 2514  H HA   . LYS B 2 32 ? -7.526  -7.627  0.130   1.00 0.00 ? 326 LYS B HA   2  
ATOM 2515  H HB2  . LYS B 2 32 ? -8.422  -9.409  2.409   1.00 0.00 ? 326 LYS B HB2  2  
ATOM 2516  H HB3  . LYS B 2 32 ? -9.451  -8.291  1.526   1.00 0.00 ? 326 LYS B HB3  2  
ATOM 2517  H HG2  . LYS B 2 32 ? -8.066  -10.705 0.373   1.00 0.00 ? 326 LYS B HG2  2  
ATOM 2518  H HG3  . LYS B 2 32 ? -9.779  -10.579 0.773   1.00 0.00 ? 326 LYS B HG3  2  
ATOM 2519  H HD2  . LYS B 2 32 ? -10.043 -8.816  -0.894  1.00 0.00 ? 326 LYS B HD2  2  
ATOM 2520  H HD3  . LYS B 2 32 ? -8.322  -8.904  -1.274  1.00 0.00 ? 326 LYS B HD3  2  
ATOM 2521  H HE2  . LYS B 2 32 ? -10.338 -11.120 -1.637  1.00 0.00 ? 326 LYS B HE2  2  
ATOM 2522  H HE3  . LYS B 2 32 ? -9.655  -10.121 -2.920  1.00 0.00 ? 326 LYS B HE3  2  
ATOM 2523  H HZ1  . LYS B 2 32 ? -7.425  -10.996 -2.165  1.00 0.00 ? 326 LYS B HZ1  2  
ATOM 2524  H HZ2  . LYS B 2 32 ? -8.439  -12.114 -2.930  1.00 0.00 ? 326 LYS B HZ2  2  
ATOM 2525  H HZ3  . LYS B 2 32 ? -8.272  -12.139 -1.247  1.00 0.00 ? 326 LYS B HZ3  2  
ATOM 2526  N N    . ALA B 2 33 ? -6.711  -7.400  3.333   1.00 0.00 ? 327 ALA B N    2  
ATOM 2527  C CA   . ALA B 2 33 ? -6.446  -6.458  4.422   1.00 0.00 ? 327 ALA B CA   2  
ATOM 2528  C C    . ALA B 2 33 ? -5.413  -5.414  4.004   1.00 0.00 ? 327 ALA B C    2  
ATOM 2529  O O    . ALA B 2 33 ? -5.649  -4.216  4.135   1.00 0.00 ? 327 ALA B O    2  
ATOM 2530  C CB   . ALA B 2 33 ? -5.970  -7.195  5.665   1.00 0.00 ? 327 ALA B CB   2  
ATOM 2531  H H    . ALA B 2 33 ? -6.541  -8.356  3.482   1.00 0.00 ? 327 ALA B H    2  
ATOM 2532  H HA   . ALA B 2 33 ? -7.373  -5.957  4.660   1.00 0.00 ? 327 ALA B HA   2  
ATOM 2533  H HB1  . ALA B 2 33 ? -5.081  -7.764  5.430   1.00 0.00 ? 327 ALA B HB1  2  
ATOM 2534  H HB2  . ALA B 2 33 ? -6.746  -7.866  6.006   1.00 0.00 ? 327 ALA B HB2  2  
ATOM 2535  H HB3  . ALA B 2 33 ? -5.744  -6.481  6.444   1.00 0.00 ? 327 ALA B HB3  2  
ATOM 2536  N N    . PHE B 2 34 ? -4.271  -5.887  3.495   1.00 0.00 ? 328 PHE B N    2  
ATOM 2537  C CA   . PHE B 2 34 ? -3.183  -5.010  3.048   1.00 0.00 ? 328 PHE B CA   2  
ATOM 2538  C C    . PHE B 2 34 ? -3.704  -3.945  2.088   1.00 0.00 ? 328 PHE B C    2  
ATOM 2539  O O    . PHE B 2 34 ? -3.420  -2.759  2.258   1.00 0.00 ? 328 PHE B O    2  
ATOM 2540  C CB   . PHE B 2 34 ? -2.087  -5.850  2.378   1.00 0.00 ? 328 PHE B CB   2  
ATOM 2541  C CG   . PHE B 2 34 ? -0.895  -5.064  1.895   1.00 0.00 ? 328 PHE B CG   2  
ATOM 2542  C CD1  . PHE B 2 34 ? -0.993  -4.227  0.793   1.00 0.00 ? 328 PHE B CD1  2  
ATOM 2543  C CD2  . PHE B 2 34 ? 0.322   -5.167  2.544   1.00 0.00 ? 328 PHE B CD2  2  
ATOM 2544  C CE1  . PHE B 2 34 ? 0.104   -3.512  0.351   1.00 0.00 ? 328 PHE B CE1  2  
ATOM 2545  C CE2  . PHE B 2 34 ? 1.422   -4.454  2.106   1.00 0.00 ? 328 PHE B CE2  2  
ATOM 2546  C CZ   . PHE B 2 34 ? 1.312   -3.625  1.007   1.00 0.00 ? 328 PHE B CZ   2  
ATOM 2547  H H    . PHE B 2 34 ? -4.155  -6.858  3.417   1.00 0.00 ? 328 PHE B H    2  
ATOM 2548  H HA   . PHE B 2 34 ? -2.771  -4.523  3.918   1.00 0.00 ? 328 PHE B HA   2  
ATOM 2549  H HB2  . PHE B 2 34 ? -1.728  -6.585  3.083   1.00 0.00 ? 328 PHE B HB2  2  
ATOM 2550  H HB3  . PHE B 2 34 ? -2.512  -6.363  1.525   1.00 0.00 ? 328 PHE B HB3  2  
ATOM 2551  H HD1  . PHE B 2 34 ? -1.937  -4.138  0.277   1.00 0.00 ? 328 PHE B HD1  2  
ATOM 2552  H HD2  . PHE B 2 34 ? 0.411   -5.814  3.405   1.00 0.00 ? 328 PHE B HD2  2  
ATOM 2553  H HE1  . PHE B 2 34 ? 0.016   -2.866  -0.510  1.00 0.00 ? 328 PHE B HE1  2  
ATOM 2554  H HE2  . PHE B 2 34 ? 2.366   -4.544  2.622   1.00 0.00 ? 328 PHE B HE2  2  
ATOM 2555  H HZ   . PHE B 2 34 ? 2.171   -3.066  0.663   1.00 0.00 ? 328 PHE B HZ   2  
ATOM 2556  N N    . LEU B 2 35 ? -4.482  -4.370  1.097   1.00 0.00 ? 329 LEU B N    2  
ATOM 2557  C CA   . LEU B 2 35 ? -5.059  -3.436  0.129   1.00 0.00 ? 329 LEU B CA   2  
ATOM 2558  C C    . LEU B 2 35 ? -5.957  -2.423  0.838   1.00 0.00 ? 329 LEU B C    2  
ATOM 2559  O O    . LEU B 2 35 ? -5.820  -1.215  0.636   1.00 0.00 ? 329 LEU B O    2  
ATOM 2560  C CB   . LEU B 2 35 ? -5.842  -4.186  -0.955  1.00 0.00 ? 329 LEU B CB   2  
ATOM 2561  C CG   . LEU B 2 35 ? -4.996  -5.081  -1.867  1.00 0.00 ? 329 LEU B CG   2  
ATOM 2562  C CD1  . LEU B 2 35 ? -5.872  -5.771  -2.902  1.00 0.00 ? 329 LEU B CD1  2  
ATOM 2563  C CD2  . LEU B 2 35 ? -3.900  -4.271  -2.550  1.00 0.00 ? 329 LEU B CD2  2  
ATOM 2564  H H    . LEU B 2 35 ? -4.684  -5.328  1.025   1.00 0.00 ? 329 LEU B H    2  
ATOM 2565  H HA   . LEU B 2 35 ? -4.243  -2.903  -0.336  1.00 0.00 ? 329 LEU B HA   2  
ATOM 2566  H HB2  . LEU B 2 35 ? -6.586  -4.802  -0.471  1.00 0.00 ? 329 LEU B HB2  2  
ATOM 2567  H HB3  . LEU B 2 35 ? -6.348  -3.457  -1.571  1.00 0.00 ? 329 LEU B HB3  2  
ATOM 2568  H HG   . LEU B 2 35 ? -4.521  -5.845  -1.271  1.00 0.00 ? 329 LEU B HG   2  
ATOM 2569  H HD11 . LEU B 2 35 ? -6.849  -5.957  -2.481  1.00 0.00 ? 329 LEU B HD11 2  
ATOM 2570  H HD12 . LEU B 2 35 ? -5.419  -6.709  -3.189  1.00 0.00 ? 329 LEU B HD12 2  
ATOM 2571  H HD13 . LEU B 2 35 ? -5.970  -5.138  -3.772  1.00 0.00 ? 329 LEU B HD13 2  
ATOM 2572  H HD21 . LEU B 2 35 ? -3.159  -4.942  -2.958  1.00 0.00 ? 329 LEU B HD21 2  
ATOM 2573  H HD22 . LEU B 2 35 ? -3.434  -3.615  -1.830  1.00 0.00 ? 329 LEU B HD22 2  
ATOM 2574  H HD23 . LEU B 2 35 ? -4.331  -3.683  -3.347  1.00 0.00 ? 329 LEU B HD23 2  
ATOM 2575  N N    . GLU B 2 36 ? -6.863  -2.924  1.686   1.00 0.00 ? 330 GLU B N    2  
ATOM 2576  C CA   . GLU B 2 36 ? -7.775  -2.065  2.448   1.00 0.00 ? 330 GLU B CA   2  
ATOM 2577  C C    . GLU B 2 36 ? -6.998  -1.116  3.363   1.00 0.00 ? 330 GLU B C    2  
ATOM 2578  O O    . GLU B 2 36 ? -7.430  0.010   3.605   1.00 0.00 ? 330 GLU B O    2  
ATOM 2579  C CB   . GLU B 2 36 ? -8.742  -2.914  3.278   1.00 0.00 ? 330 GLU B CB   2  
ATOM 2580  C CG   . GLU B 2 36 ? -9.706  -3.737  2.435   1.00 0.00 ? 330 GLU B CG   2  
ATOM 2581  C CD   . GLU B 2 36 ? -10.567 -4.666  3.272   1.00 0.00 ? 330 GLU B CD   2  
ATOM 2582  O OE1  . GLU B 2 36 ? -10.004 -5.568  3.928   1.00 0.00 ? 330 GLU B OE1  2  
ATOM 2583  O OE2  . GLU B 2 36 ? -11.802 -4.488  3.271   1.00 0.00 ? 330 GLU B OE2  2  
ATOM 2584  H H    . GLU B 2 36 ? -6.908  -3.896  1.813   1.00 0.00 ? 330 GLU B H    2  
ATOM 2585  H HA   . GLU B 2 36 ? -8.342  -1.474  1.741   1.00 0.00 ? 330 GLU B HA   2  
ATOM 2586  H HB2  . GLU B 2 36 ? -8.170  -3.591  3.896   1.00 0.00 ? 330 GLU B HB2  2  
ATOM 2587  H HB3  . GLU B 2 36 ? -9.322  -2.260  3.913   1.00 0.00 ? 330 GLU B HB3  2  
ATOM 2588  H HG2  . GLU B 2 36 ? -10.353 -3.065  1.894   1.00 0.00 ? 330 GLU B HG2  2  
ATOM 2589  H HG3  . GLU B 2 36 ? -9.137  -4.330  1.736   1.00 0.00 ? 330 GLU B HG3  2  
ATOM 2590  N N    . ILE B 2 37 ? -5.835  -1.570  3.844   1.00 0.00 ? 331 ILE B N    2  
ATOM 2591  C CA   . ILE B 2 37 ? -4.982  -0.753  4.703   1.00 0.00 ? 331 ILE B CA   2  
ATOM 2592  C C    . ILE B 2 37 ? -4.602  0.524   3.961   1.00 0.00 ? 331 ILE B C    2  
ATOM 2593  O O    . ILE B 2 37 ? -4.790  1.635   4.459   1.00 0.00 ? 331 ILE B O    2  
ATOM 2594  C CB   . ILE B 2 37 ? -3.705  -1.520  5.101   1.00 0.00 ? 331 ILE B CB   2  
ATOM 2595  C CG1  . ILE B 2 37 ? -4.047  -2.644  6.075   1.00 0.00 ? 331 ILE B CG1  2  
ATOM 2596  C CG2  . ILE B 2 37 ? -2.673  -0.588  5.712   1.00 0.00 ? 331 ILE B CG2  2  
ATOM 2597  C CD1  . ILE B 2 37 ? -2.948  -3.667  6.207   1.00 0.00 ? 331 ILE B CD1  2  
ATOM 2598  H H    . ILE B 2 37 ? -5.532  -2.469  3.596   1.00 0.00 ? 331 ILE B H    2  
ATOM 2599  H HA   . ILE B 2 37 ? -5.529  -0.509  5.599   1.00 0.00 ? 331 ILE B HA   2  
ATOM 2600  H HB   . ILE B 2 37 ? -3.277  -1.948  4.209   1.00 0.00 ? 331 ILE B HB   2  
ATOM 2601  H HG12 . ILE B 2 37 ? -4.224  -2.223  7.053   1.00 0.00 ? 331 ILE B HG12 2  
ATOM 2602  H HG13 . ILE B 2 37 ? -4.937  -3.149  5.741   1.00 0.00 ? 331 ILE B HG13 2  
ATOM 2603  H HG21 . ILE B 2 37 ? -3.047  -0.201  6.648   1.00 0.00 ? 331 ILE B HG21 2  
ATOM 2604  H HG22 . ILE B 2 37 ? -2.479  0.231   5.035   1.00 0.00 ? 331 ILE B HG22 2  
ATOM 2605  H HG23 . ILE B 2 37 ? -1.758  -1.133  5.888   1.00 0.00 ? 331 ILE B HG23 2  
ATOM 2606  H HD11 . ILE B 2 37 ? -2.392  -3.483  7.110   1.00 0.00 ? 331 ILE B HD11 2  
ATOM 2607  H HD12 . ILE B 2 37 ? -2.287  -3.592  5.357   1.00 0.00 ? 331 ILE B HD12 2  
ATOM 2608  H HD13 . ILE B 2 37 ? -3.381  -4.655  6.243   1.00 0.00 ? 331 ILE B HD13 2  
ATOM 2609  N N    . LEU B 2 38 ? -4.090  0.333   2.748   1.00 0.00 ? 332 LEU B N    2  
ATOM 2610  C CA   . LEU B 2 38 ? -3.696  1.431   1.874   1.00 0.00 ? 332 LEU B CA   2  
ATOM 2611  C C    . LEU B 2 38 ? -4.916  2.276   1.504   1.00 0.00 ? 332 LEU B C    2  
ATOM 2612  O O    . LEU B 2 38 ? -4.896  3.502   1.615   1.00 0.00 ? 332 LEU B O    2  
ATOM 2613  C CB   . LEU B 2 38 ? -3.054  0.867   0.603   1.00 0.00 ? 332 LEU B CB   2  
ATOM 2614  C CG   . LEU B 2 38 ? -2.006  -0.227  0.828   1.00 0.00 ? 332 LEU B CG   2  
ATOM 2615  C CD1  . LEU B 2 38 ? -1.729  -0.965  -0.469  1.00 0.00 ? 332 LEU B CD1  2  
ATOM 2616  C CD2  . LEU B 2 38 ? -0.724  0.360   1.398   1.00 0.00 ? 332 LEU B CD2  2  
ATOM 2617  H H    . LEU B 2 38 ? -3.997  -0.587  2.419   1.00 0.00 ? 332 LEU B H    2  
ATOM 2618  H HA   . LEU B 2 38 ? -2.978  2.044   2.398   1.00 0.00 ? 332 LEU B HA   2  
ATOM 2619  H HB2  . LEU B 2 38 ? -3.839  0.460   -0.017  1.00 0.00 ? 332 LEU B HB2  2  
ATOM 2620  H HB3  . LEU B 2 38 ? -2.584  1.681   0.072   1.00 0.00 ? 332 LEU B HB3  2  
ATOM 2621  H HG   . LEU B 2 38 ? -2.389  -0.943  1.538   1.00 0.00 ? 332 LEU B HG   2  
ATOM 2622  H HD11 . LEU B 2 38 ? -2.526  -0.765  -1.169  1.00 0.00 ? 332 LEU B HD11 2  
ATOM 2623  H HD12 . LEU B 2 38 ? -1.684  -2.026  -0.274  1.00 0.00 ? 332 LEU B HD12 2  
ATOM 2624  H HD13 . LEU B 2 38 ? -0.789  -0.632  -0.884  1.00 0.00 ? 332 LEU B HD13 2  
ATOM 2625  H HD21 . LEU B 2 38 ? -0.918  1.353   1.771   1.00 0.00 ? 332 LEU B HD21 2  
ATOM 2626  H HD22 . LEU B 2 38 ? 0.030   0.406   0.623   1.00 0.00 ? 332 LEU B HD22 2  
ATOM 2627  H HD23 . LEU B 2 38 ? -0.373  -0.265  2.206   1.00 0.00 ? 332 LEU B HD23 2  
ATOM 2628  N N    . HIS B 2 39 ? -5.973  1.596   1.051   1.00 0.00 ? 333 HIS B N    2  
ATOM 2629  C CA   . HIS B 2 39 ? -7.218  2.254   0.640   1.00 0.00 ? 333 HIS B CA   2  
ATOM 2630  C C    . HIS B 2 39 ? -7.793  3.166   1.730   1.00 0.00 ? 333 HIS B C    2  
ATOM 2631  O O    . HIS B 2 39 ? -8.247  4.272   1.432   1.00 0.00 ? 333 HIS B O    2  
ATOM 2632  C CB   . HIS B 2 39 ? -8.265  1.210   0.239   1.00 0.00 ? 333 HIS B CB   2  
ATOM 2633  C CG   . HIS B 2 39 ? -8.007  0.575   -1.093  1.00 0.00 ? 333 HIS B CG   2  
ATOM 2634  N ND1  . HIS B 2 39 ? -7.925  1.292   -2.269  1.00 0.00 ? 333 HIS B ND1  2  
ATOM 2635  C CD2  . HIS B 2 39 ? -7.818  -0.719  -1.432  1.00 0.00 ? 333 HIS B CD2  2  
ATOM 2636  C CE1  . HIS B 2 39 ? -7.700  0.464   -3.273  1.00 0.00 ? 333 HIS B CE1  2  
ATOM 2637  N NE2  . HIS B 2 39 ? -7.630  -0.763  -2.791  1.00 0.00 ? 333 HIS B NE2  2  
ATOM 2638  H H    . HIS B 2 39 ? -5.908  0.618   0.980   1.00 0.00 ? 333 HIS B H    2  
ATOM 2639  H HA   . HIS B 2 39 ? -6.989  2.859   -0.223  1.00 0.00 ? 333 HIS B HA   2  
ATOM 2640  H HB2  . HIS B 2 39 ? -8.281  0.426   0.981   1.00 0.00 ? 333 HIS B HB2  2  
ATOM 2641  H HB3  . HIS B 2 39 ? -9.237  1.679   0.202   1.00 0.00 ? 333 HIS B HB3  2  
ATOM 2642  H HD1  . HIS B 2 39 ? -8.019  2.264   -2.354  1.00 0.00 ? 333 HIS B HD1  2  
ATOM 2643  H HD2  . HIS B 2 39 ? -7.812  -1.561  -0.757  1.00 0.00 ? 333 HIS B HD2  2  
ATOM 2644  H HE1  . HIS B 2 39 ? -7.590  0.743   -4.310  1.00 0.00 ? 333 HIS B HE1  2  
ATOM 2645  H HE2  . HIS B 2 39 ? -7.421  -1.565  -3.313  1.00 0.00 ? 333 HIS B HE2  2  
ATOM 2646  N N    . THR B 2 40 ? -7.774  2.706   2.986   1.00 0.00 ? 334 THR B N    2  
ATOM 2647  C CA   . THR B 2 40 ? -8.299  3.503   4.100   1.00 0.00 ? 334 THR B CA   2  
ATOM 2648  C C    . THR B 2 40 ? -7.531  4.815   4.220   1.00 0.00 ? 334 THR B C    2  
ATOM 2649  O O    . THR B 2 40 ? -8.127  5.877   4.394   1.00 0.00 ? 334 THR B O    2  
ATOM 2650  C CB   . THR B 2 40 ? -8.216  2.718   5.417   1.00 0.00 ? 334 THR B CB   2  
ATOM 2651  O OG1  . THR B 2 40 ? -9.051  1.574   5.369   1.00 0.00 ? 334 THR B OG1  2  
ATOM 2652  C CG2  . THR B 2 40 ? -8.617  3.527   6.638   1.00 0.00 ? 334 THR B CG2  2  
ATOM 2653  H H    . THR B 2 40 ? -7.399  1.816   3.166   1.00 0.00 ? 334 THR B H    2  
ATOM 2654  H HA   . THR B 2 40 ? -9.333  3.725   3.888   1.00 0.00 ? 334 THR B HA   2  
ATOM 2655  H HB   . THR B 2 40 ? -7.198  2.386   5.559   1.00 0.00 ? 334 THR B HB   2  
ATOM 2656  H HG1  . THR B 2 40 ? -8.595  0.828   5.767   1.00 0.00 ? 334 THR B HG1  2  
ATOM 2657  H HG21 . THR B 2 40 ? -9.296  4.311   6.343   1.00 0.00 ? 334 THR B HG21 2  
ATOM 2658  H HG22 . THR B 2 40 ? -7.735  3.966   7.089   1.00 0.00 ? 334 THR B HG22 2  
ATOM 2659  H HG23 . THR B 2 40 ? -9.100  2.882   7.357   1.00 0.00 ? 334 THR B HG23 2  
ATOM 2660  N N    . TYR B 2 41 ? -6.209  4.723   4.104   1.00 0.00 ? 335 TYR B N    2  
ATOM 2661  C CA   . TYR B 2 41 ? -5.327  5.884   4.177   1.00 0.00 ? 335 TYR B CA   2  
ATOM 2662  C C    . TYR B 2 41 ? -5.766  6.981   3.198   1.00 0.00 ? 335 TYR B C    2  
ATOM 2663  O O    . TYR B 2 41 ? -5.972  8.128   3.600   1.00 0.00 ? 335 TYR B O    2  
ATOM 2664  C CB   . TYR B 2 41 ? -3.897  5.428   3.883   1.00 0.00 ? 335 TYR B CB   2  
ATOM 2665  C CG   . TYR B 2 41 ? -2.858  6.522   3.884   1.00 0.00 ? 335 TYR B CG   2  
ATOM 2666  C CD1  . TYR B 2 41 ? -2.809  7.470   2.873   1.00 0.00 ? 335 TYR B CD1  2  
ATOM 2667  C CD2  . TYR B 2 41 ? -1.909  6.588   4.889   1.00 0.00 ? 335 TYR B CD2  2  
ATOM 2668  C CE1  . TYR B 2 41 ? -1.841  8.451   2.863   1.00 0.00 ? 335 TYR B CE1  2  
ATOM 2669  C CE2  . TYR B 2 41 ? -0.941  7.568   4.890   1.00 0.00 ? 335 TYR B CE2  2  
ATOM 2670  C CZ   . TYR B 2 41 ? -0.907  8.498   3.874   1.00 0.00 ? 335 TYR B CZ   2  
ATOM 2671  O OH   . TYR B 2 41 ? 0.061   9.476   3.869   1.00 0.00 ? 335 TYR B OH   2  
ATOM 2672  H H    . TYR B 2 41 ? -5.811  3.839   3.952   1.00 0.00 ? 335 TYR B H    2  
ATOM 2673  H HA   . TYR B 2 41 ? -5.368  6.277   5.181   1.00 0.00 ? 335 TYR B HA   2  
ATOM 2674  H HB2  . TYR B 2 41 ? -3.604  4.702   4.626   1.00 0.00 ? 335 TYR B HB2  2  
ATOM 2675  H HB3  . TYR B 2 41 ? -3.876  4.956   2.910   1.00 0.00 ? 335 TYR B HB3  2  
ATOM 2676  H HD1  . TYR B 2 41 ? -3.543  7.433   2.083   1.00 0.00 ? 335 TYR B HD1  2  
ATOM 2677  H HD2  . TYR B 2 41 ? -1.940  5.858   5.687   1.00 0.00 ? 335 TYR B HD2  2  
ATOM 2678  H HE1  . TYR B 2 41 ? -1.818  9.173   2.066   1.00 0.00 ? 335 TYR B HE1  2  
ATOM 2679  H HE2  . TYR B 2 41 ? -0.211  7.599   5.678   1.00 0.00 ? 335 TYR B HE2  2  
ATOM 2680  H HH   . TYR B 2 41 ? -0.039  10.033  4.646   1.00 0.00 ? 335 TYR B HH   2  
ATOM 2681  N N    . GLN B 2 42 ? -5.908  6.621   1.918   1.00 0.00 ? 336 GLN B N    2  
ATOM 2682  C CA   . GLN B 2 42 ? -6.322  7.577   0.882   1.00 0.00 ? 336 GLN B CA   2  
ATOM 2683  C C    . GLN B 2 42 ? -7.671  8.222   1.199   1.00 0.00 ? 336 GLN B C    2  
ATOM 2684  O O    . GLN B 2 42 ? -7.855  9.420   0.980   1.00 0.00 ? 336 GLN B O    2  
ATOM 2685  C CB   . GLN B 2 42 ? -6.398  6.899   -0.488  1.00 0.00 ? 336 GLN B CB   2  
ATOM 2686  C CG   . GLN B 2 42 ? -5.071  6.342   -0.963  1.00 0.00 ? 336 GLN B CG   2  
ATOM 2687  C CD   . GLN B 2 42 ? -5.119  5.858   -2.395  1.00 0.00 ? 336 GLN B CD   2  
ATOM 2688  O OE1  . GLN B 2 42 ? -5.412  6.628   -3.307  1.00 0.00 ? 336 GLN B OE1  2  
ATOM 2689  N NE2  . GLN B 2 42 ? -4.828  4.578   -2.599  1.00 0.00 ? 336 GLN B NE2  2  
ATOM 2690  H H    . GLN B 2 42 ? -5.729  5.690   1.663   1.00 0.00 ? 336 GLN B H    2  
ATOM 2691  H HA   . GLN B 2 42 ? -5.574  8.354   0.841   1.00 0.00 ? 336 GLN B HA   2  
ATOM 2692  H HB2  . GLN B 2 42 ? -7.107  6.087   -0.437  1.00 0.00 ? 336 GLN B HB2  2  
ATOM 2693  H HB3  . GLN B 2 42 ? -6.741  7.620   -1.214  1.00 0.00 ? 336 GLN B HB3  2  
ATOM 2694  H HG2  . GLN B 2 42 ? -4.319  7.112   -0.884  1.00 0.00 ? 336 GLN B HG2  2  
ATOM 2695  H HG3  . GLN B 2 42 ? -4.803  5.513   -0.330  1.00 0.00 ? 336 GLN B HG3  2  
ATOM 2696  H HE21 . GLN B 2 42 ? -4.599  4.025   -1.823  1.00 0.00 ? 336 GLN B HE21 2  
ATOM 2697  H HE22 . GLN B 2 42 ? -4.855  4.239   -3.518  1.00 0.00 ? 336 GLN B HE22 2  
ATOM 2698  N N    . LYS B 2 43 ? -8.615  7.422   1.701   1.00 0.00 ? 337 LYS B N    2  
ATOM 2699  C CA   . LYS B 2 43 ? -9.948  7.927   2.032   1.00 0.00 ? 337 LYS B CA   2  
ATOM 2700  C C    . LYS B 2 43 ? -9.876  9.059   3.055   1.00 0.00 ? 337 LYS B C    2  
ATOM 2701  O O    . LYS B 2 43 ? -10.556 10.072  2.908   1.00 0.00 ? 337 LYS B O    2  
ATOM 2702  C CB   . LYS B 2 43 ? -10.843 6.798   2.556   1.00 0.00 ? 337 LYS B CB   2  
ATOM 2703  C CG   . LYS B 2 43 ? -11.207 5.767   1.497   1.00 0.00 ? 337 LYS B CG   2  
ATOM 2704  C CD   . LYS B 2 43 ? -12.168 4.715   2.039   1.00 0.00 ? 337 LYS B CD   2  
ATOM 2705  C CE   . LYS B 2 43 ? -11.526 3.874   3.131   1.00 0.00 ? 337 LYS B CE   2  
ATOM 2706  N NZ   . LYS B 2 43 ? -12.471 2.863   3.685   1.00 0.00 ? 337 LYS B NZ   2  
ATOM 2707  H H    . LYS B 2 43 ? -8.413  6.473   1.844   1.00 0.00 ? 337 LYS B H    2  
ATOM 2708  H HA   . LYS B 2 43 ? -10.381 8.317   1.122   1.00 0.00 ? 337 LYS B HA   2  
ATOM 2709  H HB2  . LYS B 2 43 ? -10.329 6.292   3.360   1.00 0.00 ? 337 LYS B HB2  2  
ATOM 2710  H HB3  . LYS B 2 43 ? -11.757 7.229   2.940   1.00 0.00 ? 337 LYS B HB3  2  
ATOM 2711  H HG2  . LYS B 2 43 ? -11.677 6.270   0.666   1.00 0.00 ? 337 LYS B HG2  2  
ATOM 2712  H HG3  . LYS B 2 43 ? -10.306 5.277   1.160   1.00 0.00 ? 337 LYS B HG3  2  
ATOM 2713  H HD2  . LYS B 2 43 ? -13.037 5.212   2.445   1.00 0.00 ? 337 LYS B HD2  2  
ATOM 2714  H HD3  . LYS B 2 43 ? -12.468 4.068   1.228   1.00 0.00 ? 337 LYS B HD3  2  
ATOM 2715  H HE2  . LYS B 2 43 ? -10.671 3.362   2.717   1.00 0.00 ? 337 LYS B HE2  2  
ATOM 2716  H HE3  . LYS B 2 43 ? -11.203 4.528   3.929   1.00 0.00 ? 337 LYS B HE3  2  
ATOM 2717  H HZ1  . LYS B 2 43 ? -12.018 2.338   4.462   1.00 0.00 ? 337 LYS B HZ1  2  
ATOM 2718  H HZ2  . LYS B 2 43 ? -12.750 2.189   2.944   1.00 0.00 ? 337 LYS B HZ2  2  
ATOM 2719  H HZ3  . LYS B 2 43 ? -13.325 3.333   4.050   1.00 0.00 ? 337 LYS B HZ3  2  
ATOM 2720  N N    . GLU B 2 44 ? -9.044  8.887   4.082   1.00 0.00 ? 338 GLU B N    2  
ATOM 2721  C CA   . GLU B 2 44 ? -8.886  9.906   5.125   1.00 0.00 ? 338 GLU B CA   2  
ATOM 2722  C C    . GLU B 2 44 ? -8.401  11.226  4.525   1.00 0.00 ? 338 GLU B C    2  
ATOM 2723  O O    . GLU B 2 44 ? -8.811  12.301  4.967   1.00 0.00 ? 338 GLU B O    2  
ATOM 2724  C CB   . GLU B 2 44 ? -7.902  9.438   6.204   1.00 0.00 ? 338 GLU B CB   2  
ATOM 2725  C CG   . GLU B 2 44 ? -8.100  7.991   6.649   1.00 0.00 ? 338 GLU B CG   2  
ATOM 2726  C CD   . GLU B 2 44 ? -9.501  7.682   7.159   1.00 0.00 ? 338 GLU B CD   2  
ATOM 2727  O OE1  . GLU B 2 44 ? -10.310 8.622   7.324   1.00 0.00 ? 338 GLU B OE1  2  
ATOM 2728  O OE2  . GLU B 2 44 ? -9.782  6.493   7.409   1.00 0.00 ? 338 GLU B OE2  2  
ATOM 2729  H H    . GLU B 2 44 ? -8.520  8.059   4.139   1.00 0.00 ? 338 GLU B H    2  
ATOM 2730  H HA   . GLU B 2 44 ? -9.855  10.069  5.577   1.00 0.00 ? 338 GLU B HA   2  
ATOM 2731  H HB2  . GLU B 2 44 ? -6.896  9.536   5.823   1.00 0.00 ? 338 GLU B HB2  2  
ATOM 2732  H HB3  . GLU B 2 44 ? -8.011  10.074  7.070   1.00 0.00 ? 338 GLU B HB3  2  
ATOM 2733  H HG2  . GLU B 2 44 ? -7.894  7.347   5.813   1.00 0.00 ? 338 GLU B HG2  2  
ATOM 2734  H HG3  . GLU B 2 44 ? -7.395  7.779   7.437   1.00 0.00 ? 338 GLU B HG3  2  
ATOM 2735  N N    . GLN B 2 45 ? -7.533  11.135  3.513   1.00 0.00 ? 339 GLN B N    2  
ATOM 2736  C CA   . GLN B 2 45 ? -7.000  12.324  2.843   1.00 0.00 ? 339 GLN B CA   2  
ATOM 2737  C C    . GLN B 2 45 ? -8.146  13.164  2.287   1.00 0.00 ? 339 GLN B C    2  
ATOM 2738  O O    . GLN B 2 45 ? -8.242  14.363  2.556   1.00 0.00 ? 339 GLN B O    2  
ATOM 2739  C CB   . GLN B 2 45 ? -6.058  11.932  1.696   1.00 0.00 ? 339 GLN B CB   2  
ATOM 2740  C CG   . GLN B 2 45 ? -5.052  10.851  2.055   1.00 0.00 ? 339 GLN B CG   2  
ATOM 2741  C CD   . GLN B 2 45 ? -4.152  11.239  3.216   1.00 0.00 ? 339 GLN B CD   2  
ATOM 2742  O OE1  . GLN B 2 45 ? -3.425  12.228  3.147   1.00 0.00 ? 339 GLN B OE1  2  
ATOM 2743  N NE2  . GLN B 2 45 ? -4.193  10.456  4.289   1.00 0.00 ? 339 GLN B NE2  2  
ATOM 2744  H H    . GLN B 2 45 ? -7.251  10.249  3.205   1.00 0.00 ? 339 GLN B H    2  
ATOM 2745  H HA   . GLN B 2 45 ? -6.454  12.905  3.570   1.00 0.00 ? 339 GLN B HA   2  
ATOM 2746  H HB2  . GLN B 2 45 ? -6.652  11.574  0.867   1.00 0.00 ? 339 GLN B HB2  2  
ATOM 2747  H HB3  . GLN B 2 45 ? -5.513  12.809  1.380   1.00 0.00 ? 339 GLN B HB3  2  
ATOM 2748  H HG2  . GLN B 2 45 ? -5.591  9.956   2.322   1.00 0.00 ? 339 GLN B HG2  2  
ATOM 2749  H HG3  . GLN B 2 45 ? -4.435  10.652  1.193   1.00 0.00 ? 339 GLN B HG3  2  
ATOM 2750  H HE21 . GLN B 2 45 ? -4.793  9.680   4.276   1.00 0.00 ? 339 GLN B HE21 2  
ATOM 2751  H HE22 . GLN B 2 45 ? -3.621  10.685  5.050   1.00 0.00 ? 339 GLN B HE22 2  
ATOM 2752  N N    . ARG B 2 46 ? -9.017  12.511  1.517   1.00 0.00 ? 340 ARG B N    2  
ATOM 2753  C CA   . ARG B 2 46 ? -10.174 13.174  0.918   1.00 0.00 ? 340 ARG B CA   2  
ATOM 2754  C C    . ARG B 2 46 ? -11.180 13.606  1.984   1.00 0.00 ? 340 ARG B C    2  
ATOM 2755  O O    . ARG B 2 46 ? -11.767 14.682  1.883   1.00 0.00 ? 340 ARG B O    2  
ATOM 2756  C CB   . ARG B 2 46 ? -10.849 12.253  -0.102  1.00 0.00 ? 340 ARG B CB   2  
ATOM 2757  C CG   . ARG B 2 46 ? -9.987  11.966  -1.320  1.00 0.00 ? 340 ARG B CG   2  
ATOM 2758  C CD   . ARG B 2 46 ? -10.676 11.017  -2.287  1.00 0.00 ? 340 ARG B CD   2  
ATOM 2759  N NE   . ARG B 2 46 ? -9.895  10.809  -3.507  1.00 0.00 ? 340 ARG B NE   2  
ATOM 2760  C CZ   . ARG B 2 46 ? -8.707  10.196  -3.550  1.00 0.00 ? 340 ARG B CZ   2  
ATOM 2761  N NH1  . ARG B 2 46 ? -8.169  9.676   -2.450  1.00 0.00 ? 340 ARG B NH1  2  
ATOM 2762  N NH2  . ARG B 2 46 ? -8.060  10.092  -4.705  1.00 0.00 ? 340 ARG B NH2  2  
ATOM 2763  H H    . ARG B 2 46 ? -8.876  11.552  1.353   1.00 0.00 ? 340 ARG B H    2  
ATOM 2764  H HA   . ARG B 2 46 ? -9.817  14.055  0.406   1.00 0.00 ? 340 ARG B HA   2  
ATOM 2765  H HB2  . ARG B 2 46 ? -11.085 11.314  0.377   1.00 0.00 ? 340 ARG B HB2  2  
ATOM 2766  H HB3  . ARG B 2 46 ? -11.767 12.716  -0.436  1.00 0.00 ? 340 ARG B HB3  2  
ATOM 2767  H HG2  . ARG B 2 46 ? -9.785  12.896  -1.830  1.00 0.00 ? 340 ARG B HG2  2  
ATOM 2768  H HG3  . ARG B 2 46 ? -9.058  11.525  -0.993  1.00 0.00 ? 340 ARG B HG3  2  
ATOM 2769  H HD2  . ARG B 2 46 ? -10.818 10.065  -1.796  1.00 0.00 ? 340 ARG B HD2  2  
ATOM 2770  H HD3  . ARG B 2 46 ? -11.639 11.429  -2.552  1.00 0.00 ? 340 ARG B HD3  2  
ATOM 2771  H HE   . ARG B 2 46 ? -10.268 11.158  -4.342  1.00 0.00 ? 340 ARG B HE   2  
ATOM 2772  H HH11 . ARG B 2 46 ? -8.651  9.737   -1.577  1.00 0.00 ? 340 ARG B HH11 2  
ATOM 2773  H HH12 . ARG B 2 46 ? -7.279  9.222   -2.495  1.00 0.00 ? 340 ARG B HH12 2  
ATOM 2774  H HH21 . ARG B 2 46 ? -8.460  10.471  -5.538  1.00 0.00 ? 340 ARG B HH21 2  
ATOM 2775  H HH22 . ARG B 2 46 ? -7.171  9.635   -4.741  1.00 0.00 ? 340 ARG B HH22 2  
ATOM 2776  N N    . ASN B 2 47 ? -11.366 12.770  3.011   1.00 0.00 ? 341 ASN B N    2  
ATOM 2777  C CA   . ASN B 2 47 ? -12.294 13.081  4.100   1.00 0.00 ? 341 ASN B CA   2  
ATOM 2778  C C    . ASN B 2 47 ? -11.954 14.429  4.737   1.00 0.00 ? 341 ASN B C    2  
ATOM 2779  O O    . ASN B 2 47 ? -12.803 15.321  4.803   1.00 0.00 ? 341 ASN B O    2  
ATOM 2780  C CB   . ASN B 2 47 ? -12.273 11.970  5.155   1.00 0.00 ? 341 ASN B CB   2  
ATOM 2781  C CG   . ASN B 2 47 ? -13.163 10.795  4.791   1.00 0.00 ? 341 ASN B CG   2  
ATOM 2782  O OD1  . ASN B 2 47 ? -13.026 10.198  3.725   1.00 0.00 ? 341 ASN B OD1  2  
ATOM 2783  N ND2  . ASN B 2 47 ? -14.088 10.453  5.682   1.00 0.00 ? 341 ASN B ND2  2  
ATOM 2784  H H    . ASN B 2 47 ? -10.863 11.929  3.039   1.00 0.00 ? 341 ASN B H    2  
ATOM 2785  H HA   . ASN B 2 47 ? -13.287 13.141  3.677   1.00 0.00 ? 341 ASN B HA   2  
ATOM 2786  H HB2  . ASN B 2 47 ? -11.262 11.607  5.263   1.00 0.00 ? 341 ASN B HB2  2  
ATOM 2787  H HB3  . ASN B 2 47 ? -12.606 12.371  6.098   1.00 0.00 ? 341 ASN B HB3  2  
ATOM 2788  H HD21 . ASN B 2 47 ? -14.145 10.968  6.515   1.00 0.00 ? 341 ASN B HD21 2  
ATOM 2789  H HD22 . ASN B 2 47 ? -14.675 9.697   5.472   1.00 0.00 ? 341 ASN B HD22 2  
ATOM 2790  N N    . ALA B 2 48 ? -10.704 14.577  5.186   1.00 0.00 ? 342 ALA B N    2  
ATOM 2791  C CA   . ALA B 2 48 ? -10.245 15.827  5.794   1.00 0.00 ? 342 ALA B CA   2  
ATOM 2792  C C    . ALA B 2 48 ? -10.483 17.015  4.860   1.00 0.00 ? 342 ALA B C    2  
ATOM 2793  O O    . ALA B 2 48 ? -10.802 18.116  5.310   1.00 0.00 ? 342 ALA B O    2  
ATOM 2794  C CB   . ALA B 2 48 ? -8.770  15.729  6.164   1.00 0.00 ? 342 ALA B CB   2  
ATOM 2795  H H    . ALA B 2 48 ? -10.071 13.832  5.091   1.00 0.00 ? 342 ALA B H    2  
ATOM 2796  H HA   . ALA B 2 48 ? -10.808 15.983  6.703   1.00 0.00 ? 342 ALA B HA   2  
ATOM 2797  H HB1  . ALA B 2 48 ? -8.665  15.185  7.092   1.00 0.00 ? 342 ALA B HB1  2  
ATOM 2798  H HB2  . ALA B 2 48 ? -8.360  16.721  6.282   1.00 0.00 ? 342 ALA B HB2  2  
ATOM 2799  H HB3  . ALA B 2 48 ? -8.236  15.210  5.381   1.00 0.00 ? 342 ALA B HB3  2  
ATOM 2800  N N    . LYS B 2 49 ? -10.324 16.777  3.555   1.00 0.00 ? 343 LYS B N    2  
ATOM 2801  C CA   . LYS B 2 49 ? -10.521 17.812  2.542   1.00 0.00 ? 343 LYS B CA   2  
ATOM 2802  C C    . LYS B 2 49 ? -12.003 18.177  2.403   1.00 0.00 ? 343 LYS B C    2  
ATOM 2803  O O    . LYS B 2 49 ? -12.351 19.356  2.315   1.00 0.00 ? 343 LYS B O    2  
ATOM 2804  C CB   . LYS B 2 49 ? -9.967  17.335  1.196   1.00 0.00 ? 343 LYS B CB   2  
ATOM 2805  C CG   . LYS B 2 49 ? -10.110 18.350  0.074   1.00 0.00 ? 343 LYS B CG   2  
ATOM 2806  C CD   . LYS B 2 49 ? -9.537  17.816  -1.230  1.00 0.00 ? 343 LYS B CD   2  
ATOM 2807  C CE   . LYS B 2 49 ? -9.690  18.818  -2.365  1.00 0.00 ? 343 LYS B CE   2  
ATOM 2808  N NZ   . LYS B 2 49 ? -8.935  20.077  -2.108  1.00 0.00 ? 343 LYS B NZ   2  
ATOM 2809  H H    . LYS B 2 49 ? -10.069 15.875  3.265   1.00 0.00 ? 343 LYS B H    2  
ATOM 2810  H HA   . LYS B 2 49 ? -9.976  18.690  2.854   1.00 0.00 ? 343 LYS B HA   2  
ATOM 2811  H HB2  . LYS B 2 49 ? -8.917  17.109  1.314   1.00 0.00 ? 343 LYS B HB2  2  
ATOM 2812  H HB3  . LYS B 2 49 ? -10.488 16.434  0.906   1.00 0.00 ? 343 LYS B HB3  2  
ATOM 2813  H HG2  . LYS B 2 49 ? -11.158 18.570  -0.068  1.00 0.00 ? 343 LYS B HG2  2  
ATOM 2814  H HG3  . LYS B 2 49 ? -9.583  19.253  0.348   1.00 0.00 ? 343 LYS B HG3  2  
ATOM 2815  H HD2  . LYS B 2 49 ? -8.488  17.605  -1.091  1.00 0.00 ? 343 LYS B HD2  2  
ATOM 2816  H HD3  . LYS B 2 49 ? -10.057 16.906  -1.493  1.00 0.00 ? 343 LYS B HD3  2  
ATOM 2817  H HE2  . LYS B 2 49 ? -9.323  18.369  -3.275  1.00 0.00 ? 343 LYS B HE2  2  
ATOM 2818  H HE3  . LYS B 2 49 ? -10.738 19.053  -2.479  1.00 0.00 ? 343 LYS B HE3  2  
ATOM 2819  H HZ1  . LYS B 2 49 ? -9.364  20.597  -1.314  1.00 0.00 ? 343 LYS B HZ1  2  
ATOM 2820  H HZ2  . LYS B 2 49 ? -8.953  20.684  -2.952  1.00 0.00 ? 343 LYS B HZ2  2  
ATOM 2821  H HZ3  . LYS B 2 49 ? -7.944  19.860  -1.871  1.00 0.00 ? 343 LYS B HZ3  2  
ATOM 2822  N N    . GLU B 2 50 ? -12.866 17.156  2.384   1.00 0.00 ? 344 GLU B N    2  
ATOM 2823  C CA   . GLU B 2 50 ? -14.313 17.358  2.255   1.00 0.00 ? 344 GLU B CA   2  
ATOM 2824  C C    . GLU B 2 50 ? -14.837 18.329  3.314   1.00 0.00 ? 344 GLU B C    2  
ATOM 2825  O O    . GLU B 2 50 ? -15.479 19.327  2.983   1.00 0.00 ? 344 GLU B O    2  
ATOM 2826  C CB   . GLU B 2 50 ? -15.051 16.020  2.370   1.00 0.00 ? 344 GLU B CB   2  
ATOM 2827  C CG   . GLU B 2 50 ? -14.785 15.072  1.210   1.00 0.00 ? 344 GLU B CG   2  
ATOM 2828  C CD   . GLU B 2 50 ? -15.351 13.684  1.447   1.00 0.00 ? 344 GLU B CD   2  
ATOM 2829  O OE1  . GLU B 2 50 ? -16.587 13.559  1.579   1.00 0.00 ? 344 GLU B OE1  2  
ATOM 2830  O OE2  . GLU B 2 50 ? -14.557 12.722  1.501   1.00 0.00 ? 344 GLU B OE2  2  
ATOM 2831  H H    . GLU B 2 50 ? -12.521 16.242  2.457   1.00 0.00 ? 344 GLU B H    2  
ATOM 2832  H HA   . GLU B 2 50 ? -14.501 17.777  1.278   1.00 0.00 ? 344 GLU B HA   2  
ATOM 2833  H HB2  . GLU B 2 50 ? -14.745 15.530  3.283   1.00 0.00 ? 344 GLU B HB2  2  
ATOM 2834  H HB3  . GLU B 2 50 ? -16.113 16.210  2.414   1.00 0.00 ? 344 GLU B HB3  2  
ATOM 2835  H HG2  . GLU B 2 50 ? -15.237 15.480  0.319   1.00 0.00 ? 344 GLU B HG2  2  
ATOM 2836  H HG3  . GLU B 2 50 ? -13.720 14.990  1.065   1.00 0.00 ? 344 GLU B HG3  2  
ATOM 2837  N N    . ALA B 2 51 ? -14.556 18.033  4.583   1.00 0.00 ? 345 ALA B N    2  
ATOM 2838  C CA   . ALA B 2 51 ? -14.998 18.886  5.685   1.00 0.00 ? 345 ALA B CA   2  
ATOM 2839  C C    . ALA B 2 51 ? -14.184 20.177  5.744   1.00 0.00 ? 345 ALA B C    2  
ATOM 2840  O O    . ALA B 2 51 ? -14.742 21.261  5.929   1.00 0.00 ? 345 ALA B O    2  
ATOM 2841  C CB   . ALA B 2 51 ? -14.904 18.138  7.008   1.00 0.00 ? 345 ALA B CB   2  
ATOM 2842  H H    . ALA B 2 51 ? -14.037 17.225  4.783   1.00 0.00 ? 345 ALA B H    2  
ATOM 2843  H HA   . ALA B 2 51 ? -16.035 19.137  5.514   1.00 0.00 ? 345 ALA B HA   2  
ATOM 2844  H HB1  . ALA B 2 51 ? -15.883 17.777  7.288   1.00 0.00 ? 345 ALA B HB1  2  
ATOM 2845  H HB2  . ALA B 2 51 ? -14.533 18.804  7.774   1.00 0.00 ? 345 ALA B HB2  2  
ATOM 2846  H HB3  . ALA B 2 51 ? -14.229 17.301  6.902   1.00 0.00 ? 345 ALA B HB3  2  
ATOM 2847  N N    . GLY B 2 52 ? -12.863 20.053  5.579   1.00 0.00 ? 346 GLY B N    2  
ATOM 2848  C CA   . GLY B 2 52 ? -11.983 21.212  5.611   1.00 0.00 ? 346 GLY B CA   2  
ATOM 2849  C C    . GLY B 2 52 ? -12.181 22.073  6.848   1.00 0.00 ? 346 GLY B C    2  
ATOM 2850  O O    . GLY B 2 52 ? -12.294 23.295  6.744   1.00 0.00 ? 346 GLY B O    2  
ATOM 2851  H H    . GLY B 2 52 ? -12.481 19.162  5.431   1.00 0.00 ? 346 GLY B H    2  
ATOM 2852  H HA2  . GLY B 2 52 ? -10.958 20.871  5.585   1.00 0.00 ? 346 GLY B HA2  2  
ATOM 2853  H HA3  . GLY B 2 52 ? -12.171 21.815  4.735   1.00 0.00 ? 346 GLY B HA3  2  
ATOM 2854  N N    . GLY B 2 53 ? -12.225 21.434  8.018   1.00 0.00 ? 347 GLY B N    2  
ATOM 2855  C CA   . GLY B 2 53 ? -12.414 22.166  9.258   1.00 0.00 ? 347 GLY B CA   2  
ATOM 2856  C C    . GLY B 2 53 ? -11.895 21.417  10.472  1.00 0.00 ? 347 GLY B C    2  
ATOM 2857  O O    . GLY B 2 53 ? -10.703 21.117  10.560  1.00 0.00 ? 347 GLY B O    2  
ATOM 2858  H H    . GLY B 2 53 ? -12.131 20.458  8.038   1.00 0.00 ? 347 GLY B H    2  
ATOM 2859  H HA2  . GLY B 2 53 ? -11.895 23.112  9.187   1.00 0.00 ? 347 GLY B HA2  2  
ATOM 2860  H HA3  . GLY B 2 53 ? -13.469 22.359  9.392   1.00 0.00 ? 347 GLY B HA3  2  
ATOM 2861  N N    . ASN B 2 54 ? -12.792 21.123  11.413  1.00 0.00 ? 348 ASN B N    2  
ATOM 2862  C CA   . ASN B 2 54 ? -12.428 20.409  12.642  1.00 0.00 ? 348 ASN B CA   2  
ATOM 2863  C C    . ASN B 2 54 ? -12.388 18.884  12.450  1.00 0.00 ? 348 ASN B C    2  
ATOM 2864  O O    . ASN B 2 54 ? -12.566 18.133  13.412  1.00 0.00 ? 348 ASN B O    2  
ATOM 2865  C CB   . ASN B 2 54 ? -13.406 20.766  13.767  1.00 0.00 ? 348 ASN B CB   2  
ATOM 2866  C CG   . ASN B 2 54 ? -13.414 22.251  14.082  1.00 0.00 ? 348 ASN B CG   2  
ATOM 2867  O OD1  . ASN B 2 54 ? -12.395 22.819  14.474  1.00 0.00 ? 348 ASN B OD1  2  
ATOM 2868  N ND2  . ASN B 2 54 ? -14.566 22.890  13.911  1.00 0.00 ? 348 ASN B ND2  2  
ATOM 2869  H H    . ASN B 2 54 ? -13.725 21.394  11.283  1.00 0.00 ? 348 ASN B H    2  
ATOM 2870  H HA   . ASN B 2 54 ? -11.442 20.741  12.928  1.00 0.00 ? 348 ASN B HA   2  
ATOM 2871  H HB2  . ASN B 2 54 ? -14.404 20.474  13.474  1.00 0.00 ? 348 ASN B HB2  2  
ATOM 2872  H HB3  . ASN B 2 54 ? -13.128 20.229  14.661  1.00 0.00 ? 348 ASN B HB3  2  
ATOM 2873  H HD21 . ASN B 2 54 ? -15.341 22.377  13.594  1.00 0.00 ? 348 ASN B HD21 2  
ATOM 2874  H HD22 . ASN B 2 54 ? -14.597 23.850  14.108  1.00 0.00 ? 348 ASN B HD22 2  
ATOM 2875  N N    . TYR B 2 55 ? -12.148 18.421  11.218  1.00 0.00 ? 349 TYR B N    2  
ATOM 2876  C CA   . TYR B 2 55 ? -12.084 16.987  10.941  1.00 0.00 ? 349 TYR B CA   2  
ATOM 2877  C C    . TYR B 2 55 ? -10.729 16.409  11.349  1.00 0.00 ? 349 TYR B C    2  
ATOM 2878  O O    . TYR B 2 55 ? -9.746  17.139  11.502  1.00 0.00 ? 349 TYR B O    2  
ATOM 2879  C CB   . TYR B 2 55 ? -12.317 16.711  9.448   1.00 0.00 ? 349 TYR B CB   2  
ATOM 2880  C CG   . TYR B 2 55 ? -12.328 15.233  9.096   1.00 0.00 ? 349 TYR B CG   2  
ATOM 2881  C CD1  . TYR B 2 55 ? -13.460 14.455  9.311   1.00 0.00 ? 349 TYR B CD1  2  
ATOM 2882  C CD2  . TYR B 2 55 ? -11.198 14.612  8.570   1.00 0.00 ? 349 TYR B CD2  2  
ATOM 2883  C CE1  . TYR B 2 55 ? -13.467 13.106  9.010   1.00 0.00 ? 349 TYR B CE1  2  
ATOM 2884  C CE2  . TYR B 2 55 ? -11.199 13.264  8.265   1.00 0.00 ? 349 TYR B CE2  2  
ATOM 2885  C CZ   . TYR B 2 55 ? -12.335 12.515  8.486   1.00 0.00 ? 349 TYR B CZ   2  
ATOM 2886  O OH   . TYR B 2 55 ? -12.337 11.171  8.183   1.00 0.00 ? 349 TYR B OH   2  
ATOM 2887  H H    . TYR B 2 55 ? -12.003 19.052  10.485  1.00 0.00 ? 349 TYR B H    2  
ATOM 2888  H HA   . TYR B 2 55 ? -12.859 16.501  11.515  1.00 0.00 ? 349 TYR B HA   2  
ATOM 2889  H HB2  . TYR B 2 55 ? -13.271 17.127  9.157   1.00 0.00 ? 349 TYR B HB2  2  
ATOM 2890  H HB3  . TYR B 2 55 ? -11.533 17.184  8.875   1.00 0.00 ? 349 TYR B HB3  2  
ATOM 2891  H HD1  . TYR B 2 55 ? -14.345 14.919  9.717   1.00 0.00 ? 349 TYR B HD1  2  
ATOM 2892  H HD2  . TYR B 2 55 ? -10.307 15.195  8.400   1.00 0.00 ? 349 TYR B HD2  2  
ATOM 2893  H HE1  . TYR B 2 55 ? -14.356 12.520  9.184   1.00 0.00 ? 349 TYR B HE1  2  
ATOM 2894  H HE2  . TYR B 2 55 ? -10.309 12.801  7.856   1.00 0.00 ? 349 TYR B HE2  2  
ATOM 2895  H HH   . TYR B 2 55 ? -12.918 10.703  8.787   1.00 0.00 ? 349 TYR B HH   2  
ATOM 2896  N N    . THR B 2 56 ? -10.682 15.087  11.486  1.00 0.00 ? 350 THR B N    2  
ATOM 2897  C CA   . THR B 2 56 ? -9.457  14.384  11.832  1.00 0.00 ? 350 THR B CA   2  
ATOM 2898  C C    . THR B 2 56 ? -9.433  13.044  11.094  1.00 0.00 ? 350 THR B C    2  
ATOM 2899  O O    . THR B 2 56 ? -10.431 12.321  11.071  1.00 0.00 ? 350 THR B O    2  
ATOM 2900  C CB   . THR B 2 56 ? -9.338  14.183  13.342  1.00 0.00 ? 350 THR B CB   2  
ATOM 2901  O OG1  . THR B 2 56 ? -7.976  14.169  13.739  1.00 0.00 ? 350 THR B OG1  2  
ATOM 2902  C CG2  . THR B 2 56 ? -9.942  12.890  13.804  1.00 0.00 ? 350 THR B CG2  2  
ATOM 2903  H H    . THR B 2 56 ? -11.496 14.565  11.327  1.00 0.00 ? 350 THR B H    2  
ATOM 2904  H HA   . THR B 2 56 ? -8.631  14.973  11.496  1.00 0.00 ? 350 THR B HA   2  
ATOM 2905  H HB   . THR B 2 56 ? -9.840  14.990  13.853  1.00 0.00 ? 350 THR B HB   2  
ATOM 2906  H HG1  . THR B 2 56 ? -7.505  13.484  13.255  1.00 0.00 ? 350 THR B HG1  2  
ATOM 2907  H HG21 . THR B 2 56 ? -10.976 12.855  13.504  1.00 0.00 ? 350 THR B HG21 2  
ATOM 2908  H HG22 . THR B 2 56 ? -9.865  12.816  14.876  1.00 0.00 ? 350 THR B HG22 2  
ATOM 2909  H HG23 . THR B 2 56 ? -9.405  12.077  13.340  1.00 0.00 ? 350 THR B HG23 2  
ATOM 2910  N N    . PRO B 2 57 ? -8.302  12.713  10.454  1.00 0.00 ? 351 PRO B N    2  
ATOM 2911  C CA   . PRO B 2 57 ? -8.162  11.472  9.684   1.00 0.00 ? 351 PRO B CA   2  
ATOM 2912  C C    . PRO B 2 57 ? -8.179  10.221  10.561  1.00 0.00 ? 351 PRO B C    2  
ATOM 2913  O O    . PRO B 2 57 ? -7.677  10.231  11.686  1.00 0.00 ? 351 PRO B O    2  
ATOM 2914  C CB   . PRO B 2 57 ? -6.800  11.618  8.988   1.00 0.00 ? 351 PRO B CB   2  
ATOM 2915  C CG   . PRO B 2 57 ? -6.417  13.052  9.149   1.00 0.00 ? 351 PRO B CG   2  
ATOM 2916  C CD   . PRO B 2 57 ? -7.083  13.522  10.408  1.00 0.00 ? 351 PRO B CD   2  
ATOM 2917  H HA   . PRO B 2 57 ? -8.939  11.394  8.938   1.00 0.00 ? 351 PRO B HA   2  
ATOM 2918  H HB2  . PRO B 2 57 ? -6.082  10.965  9.459   1.00 0.00 ? 351 PRO B HB2  2  
ATOM 2919  H HB3  . PRO B 2 57 ? -6.903  11.356  7.946   1.00 0.00 ? 351 PRO B HB3  2  
ATOM 2920  H HG2  . PRO B 2 57 ? -5.345  13.139  9.237   1.00 0.00 ? 351 PRO B HG2  2  
ATOM 2921  H HG3  . PRO B 2 57 ? -6.773  13.624  8.303   1.00 0.00 ? 351 PRO B HG3  2  
ATOM 2922  H HD2  . PRO B 2 57 ? -6.458  13.325  11.268  1.00 0.00 ? 351 PRO B HD2  2  
ATOM 2923  H HD3  . PRO B 2 57 ? -7.321  14.573  10.343  1.00 0.00 ? 351 PRO B HD3  2  
ATOM 2924  N N    . ALA B 2 58 ? -8.758  9.145   10.027  1.00 0.00 ? 352 ALA B N    2  
ATOM 2925  C CA   . ALA B 2 58 ? -8.842  7.875   10.747  1.00 0.00 ? 352 ALA B CA   2  
ATOM 2926  C C    . ALA B 2 58 ? -7.656  6.952   10.426  1.00 0.00 ? 352 ALA B C    2  
ATOM 2927  O O    . ALA B 2 58 ? -7.576  5.844   10.955  1.00 0.00 ? 352 ALA B O    2  
ATOM 2928  C CB   . ALA B 2 58 ? -10.159 7.177   10.434  1.00 0.00 ? 352 ALA B CB   2  
ATOM 2929  H H    . ALA B 2 58 ? -9.134  9.205   9.124   1.00 0.00 ? 352 ALA B H    2  
ATOM 2930  H HA   . ALA B 2 58 ? -8.829  8.096   11.804  1.00 0.00 ? 352 ALA B HA   2  
ATOM 2931  H HB1  . ALA B 2 58 ? -9.995  6.112   10.356  1.00 0.00 ? 352 ALA B HB1  2  
ATOM 2932  H HB2  . ALA B 2 58 ? -10.553 7.550   9.500   1.00 0.00 ? 352 ALA B HB2  2  
ATOM 2933  H HB3  . ALA B 2 58 ? -10.867 7.374   11.225  1.00 0.00 ? 352 ALA B HB3  2  
ATOM 2934  N N    . LEU B 2 59 ? -6.729  7.422   9.581   1.00 0.00 ? 353 LEU B N    2  
ATOM 2935  C CA   . LEU B 2 59 ? -5.544  6.642   9.215   1.00 0.00 ? 353 LEU B CA   2  
ATOM 2936  C C    . LEU B 2 59 ? -4.410  7.541   8.749   1.00 0.00 ? 353 LEU B C    2  
ATOM 2937  O O    . LEU B 2 59 ? -4.623  8.661   8.282   1.00 0.00 ? 353 LEU B O    2  
ATOM 2938  C CB   . LEU B 2 59 ? -5.815  5.655   8.071   1.00 0.00 ? 353 LEU B CB   2  
ATOM 2939  C CG   . LEU B 2 59 ? -5.797  4.174   8.435   1.00 0.00 ? 353 LEU B CG   2  
ATOM 2940  C CD1  . LEU B 2 59 ? -7.047  3.765   9.201   1.00 0.00 ? 353 LEU B CD1  2  
ATOM 2941  C CD2  . LEU B 2 59 ? -5.608  3.326   7.185   1.00 0.00 ? 353 LEU B CD2  2  
ATOM 2942  H H    . LEU B 2 59 ? -6.836  8.319   9.204   1.00 0.00 ? 353 LEU B H    2  
ATOM 2943  H HA   . LEU B 2 59 ? -5.223  6.092   10.086  1.00 0.00 ? 353 LEU B HA   2  
ATOM 2944  H HB2  . LEU B 2 59 ? -6.766  5.889   7.628   1.00 0.00 ? 353 LEU B HB2  2  
ATOM 2945  H HB3  . LEU B 2 59 ? -5.036  5.809   7.333   1.00 0.00 ? 353 LEU B HB3  2  
ATOM 2946  H HG   . LEU B 2 59 ? -4.958  3.999   9.068   1.00 0.00 ? 353 LEU B HG   2  
ATOM 2947  H HD11 . LEU B 2 59 ? -6.839  3.773   10.260  1.00 0.00 ? 353 LEU B HD11 2  
ATOM 2948  H HD12 . LEU B 2 59 ? -7.343  2.770   8.902   1.00 0.00 ? 353 LEU B HD12 2  
ATOM 2949  H HD13 . LEU B 2 59 ? -7.847  4.458   8.986   1.00 0.00 ? 353 LEU B HD13 2  
ATOM 2950  H HD21 . LEU B 2 59 ? -6.114  3.791   6.354   1.00 0.00 ? 353 LEU B HD21 2  
ATOM 2951  H HD22 . LEU B 2 59 ? -6.015  2.340   7.351   1.00 0.00 ? 353 LEU B HD22 2  
ATOM 2952  H HD23 . LEU B 2 59 ? -4.552  3.247   6.963   1.00 0.00 ? 353 LEU B HD23 2  
ATOM 2953  N N    . THR B 2 60 ? -3.211  6.995   8.849   1.00 0.00 ? 354 THR B N    2  
ATOM 2954  C CA   . THR B 2 60 ? -1.992  7.662   8.420   1.00 0.00 ? 354 THR B CA   2  
ATOM 2955  C C    . THR B 2 60 ? -0.960  6.597   8.082   1.00 0.00 ? 354 THR B C    2  
ATOM 2956  O O    . THR B 2 60 ? -1.267  5.402   8.130   1.00 0.00 ? 354 THR B O    2  
ATOM 2957  C CB   . THR B 2 60 ? -1.452  8.593   9.518   1.00 0.00 ? 354 THR B CB   2  
ATOM 2958  O OG1  . THR B 2 60 ? -1.243  7.884   10.729  1.00 0.00 ? 354 THR B OG1  2  
ATOM 2959  C CG2  . THR B 2 60 ? -2.358  9.769   9.823   1.00 0.00 ? 354 THR B CG2  2  
ATOM 2960  H H    . THR B 2 60 ? -3.142  6.079   9.204   1.00 0.00 ? 354 THR B H    2  
ATOM 2961  H HA   . THR B 2 60 ? -2.212  8.238   7.533   1.00 0.00 ? 354 THR B HA   2  
ATOM 2962  H HB   . THR B 2 60 ? -0.500  8.990   9.198   1.00 0.00 ? 354 THR B HB   2  
ATOM 2963  H HG1  . THR B 2 60 ? -2.065  7.479   11.016  1.00 0.00 ? 354 THR B HG1  2  
ATOM 2964  H HG21 . THR B 2 60 ? -1.955  10.329  10.653  1.00 0.00 ? 354 THR B HG21 2  
ATOM 2965  H HG22 . THR B 2 60 ? -3.345  9.409   10.077  1.00 0.00 ? 354 THR B HG22 2  
ATOM 2966  H HG23 . THR B 2 60 ? -2.420  10.408  8.955   1.00 0.00 ? 354 THR B HG23 2  
ATOM 2967  N N    . GLU B 2 61 ? 0.267   7.008   7.782   1.00 0.00 ? 355 GLU B N    2  
ATOM 2968  C CA   . GLU B 2 61 ? 1.324   6.046   7.496   1.00 0.00 ? 355 GLU B CA   2  
ATOM 2969  C C    . GLU B 2 61 ? 1.439   5.068   8.671   1.00 0.00 ? 355 GLU B C    2  
ATOM 2970  O O    . GLU B 2 61 ? 1.872   3.927   8.508   1.00 0.00 ? 355 GLU B O    2  
ATOM 2971  C CB   . GLU B 2 61 ? 2.665   6.751   7.255   1.00 0.00 ? 355 GLU B CB   2  
ATOM 2972  C CG   . GLU B 2 61 ? 2.651   7.736   6.090   1.00 0.00 ? 355 GLU B CG   2  
ATOM 2973  C CD   . GLU B 2 61 ? 2.302   9.158   6.501   1.00 0.00 ? 355 GLU B CD   2  
ATOM 2974  O OE1  . GLU B 2 61 ? 1.147   9.401   6.910   1.00 0.00 ? 355 GLU B OE1  2  
ATOM 2975  O OE2  . GLU B 2 61 ? 3.190   10.030  6.411   1.00 0.00 ? 355 GLU B OE2  2  
ATOM 2976  H H    . GLU B 2 61 ? 0.473   7.967   7.785   1.00 0.00 ? 355 GLU B H    2  
ATOM 2977  H HA   . GLU B 2 61 ? 1.044   5.493   6.607   1.00 0.00 ? 355 GLU B HA   2  
ATOM 2978  H HB2  . GLU B 2 61 ? 2.939   7.290   8.150   1.00 0.00 ? 355 GLU B HB2  2  
ATOM 2979  H HB3  . GLU B 2 61 ? 3.418   6.003   7.055   1.00 0.00 ? 355 GLU B HB3  2  
ATOM 2980  H HG2  . GLU B 2 61 ? 3.626   7.743   5.633   1.00 0.00 ? 355 GLU B HG2  2  
ATOM 2981  H HG3  . GLU B 2 61 ? 1.922   7.400   5.367   1.00 0.00 ? 355 GLU B HG3  2  
ATOM 2982  N N    . GLN B 2 62 ? 1.018   5.542   9.855   1.00 0.00 ? 356 GLN B N    2  
ATOM 2983  C CA   . GLN B 2 62 ? 1.035   4.749   11.079  1.00 0.00 ? 356 GLN B CA   2  
ATOM 2984  C C    . GLN B 2 62 ? 0.121   3.530   10.976  1.00 0.00 ? 356 GLN B C    2  
ATOM 2985  O O    . GLN B 2 62 ? 0.535   2.426   11.323  1.00 0.00 ? 356 GLN B O    2  
ATOM 2986  C CB   . GLN B 2 62 ? 0.617   5.608   12.276  1.00 0.00 ? 356 GLN B CB   2  
ATOM 2987  C CG   . GLN B 2 62 ? 1.540   6.790   12.533  1.00 0.00 ? 356 GLN B CG   2  
ATOM 2988  C CD   . GLN B 2 62 ? 1.090   7.635   13.710  1.00 0.00 ? 356 GLN B CD   2  
ATOM 2989  O OE1  . GLN B 2 62 ? -0.007  8.194   13.703  1.00 0.00 ? 356 GLN B OE1  2  
ATOM 2990  N NE2  . GLN B 2 62 ? 1.935   7.734   14.730  1.00 0.00 ? 356 GLN B NE2  2  
ATOM 2991  H H    . GLN B 2 62 ? 0.676   6.457   9.901   1.00 0.00 ? 356 GLN B H    2  
ATOM 2992  H HA   . GLN B 2 62 ? 2.046   4.408   11.236  1.00 0.00 ? 356 GLN B HA   2  
ATOM 2993  H HB2  . GLN B 2 62 ? -0.379  5.987   12.100  1.00 0.00 ? 356 GLN B HB2  2  
ATOM 2994  H HB3  . GLN B 2 62 ? 0.605   4.989   13.161  1.00 0.00 ? 356 GLN B HB3  2  
ATOM 2995  H HG2  . GLN B 2 62 ? 2.532   6.418   12.735  1.00 0.00 ? 356 GLN B HG2  2  
ATOM 2996  H HG3  . GLN B 2 62 ? 1.562   7.412   11.651  1.00 0.00 ? 356 GLN B HG3  2  
ATOM 2997  H HE21 . GLN B 2 62 ? 2.793   7.264   14.670  1.00 0.00 ? 356 GLN B HE21 2  
ATOM 2998  H HE22 . GLN B 2 62 ? 1.667   8.274   15.502  1.00 0.00 ? 356 GLN B HE22 2  
ATOM 2999  N N    . GLU B 2 63 ? -1.121  3.715   10.495  1.00 0.00 ? 357 GLU B N    2  
ATOM 3000  C CA   . GLU B 2 63 ? -2.046  2.591   10.364  1.00 0.00 ? 357 GLU B CA   2  
ATOM 3001  C C    . GLU B 2 63 ? -1.611  1.665   9.237   1.00 0.00 ? 357 GLU B C    2  
ATOM 3002  O O    . GLU B 2 63 ? -1.784  0.447   9.314   1.00 0.00 ? 357 GLU B O    2  
ATOM 3003  C CB   . GLU B 2 63 ? -3.455  3.082   10.049  1.00 0.00 ? 357 GLU B CB   2  
ATOM 3004  C CG   . GLU B 2 63 ? -4.093  3.982   11.098  1.00 0.00 ? 357 GLU B CG   2  
ATOM 3005  C CD   . GLU B 2 63 ? -4.194  3.334   12.469  1.00 0.00 ? 357 GLU B CD   2  
ATOM 3006  O OE1  . GLU B 2 63 ? -3.139  3.082   13.089  1.00 0.00 ? 357 GLU B OE1  2  
ATOM 3007  O OE2  . GLU B 2 63 ? -5.329  3.078   12.920  1.00 0.00 ? 357 GLU B OE2  2  
ATOM 3008  H H    . GLU B 2 63 ? -1.419  4.617   10.213  1.00 0.00 ? 357 GLU B H    2  
ATOM 3009  H HA   . GLU B 2 63 ? -2.056  2.044   11.294  1.00 0.00 ? 357 GLU B HA   2  
ATOM 3010  H HB2  . GLU B 2 63 ? -3.413  3.635   9.123   1.00 0.00 ? 357 GLU B HB2  2  
ATOM 3011  H HB3  . GLU B 2 63 ? -4.093  2.226   9.908   1.00 0.00 ? 357 GLU B HB3  2  
ATOM 3012  H HG2  . GLU B 2 63 ? -3.510  4.884   11.184  1.00 0.00 ? 357 GLU B HG2  2  
ATOM 3013  H HG3  . GLU B 2 63 ? -5.096  4.234   10.760  1.00 0.00 ? 357 GLU B HG3  2  
ATOM 3014  N N    . VAL B 2 64 ? -1.076  2.266   8.179   1.00 0.00 ? 358 VAL B N    2  
ATOM 3015  C CA   . VAL B 2 64 ? -0.642  1.525   7.006   1.00 0.00 ? 358 VAL B CA   2  
ATOM 3016  C C    . VAL B 2 64 ? 0.484   0.553   7.345   1.00 0.00 ? 358 VAL B C    2  
ATOM 3017  O O    . VAL B 2 64 ? 0.318   -0.661  7.217   1.00 0.00 ? 358 VAL B O    2  
ATOM 3018  C CB   . VAL B 2 64 ? -0.184  2.505   5.906   1.00 0.00 ? 358 VAL B CB   2  
ATOM 3019  C CG1  . VAL B 2 64 ? 0.129   1.785   4.605   1.00 0.00 ? 358 VAL B CG1  2  
ATOM 3020  C CG2  . VAL B 2 64 ? -1.242  3.574   5.695   1.00 0.00 ? 358 VAL B CG2  2  
ATOM 3021  H H    . VAL B 2 64 ? -0.991  3.243   8.181   1.00 0.00 ? 358 VAL B H    2  
ATOM 3022  H HA   . VAL B 2 64 ? -1.486  0.970   6.632   1.00 0.00 ? 358 VAL B HA   2  
ATOM 3023  H HB   . VAL B 2 64 ? 0.719   2.992   6.245   1.00 0.00 ? 358 VAL B HB   2  
ATOM 3024  H HG11 . VAL B 2 64 ? -0.676  1.943   3.904   1.00 0.00 ? 358 VAL B HG11 2  
ATOM 3025  H HG12 . VAL B 2 64 ? 0.242   0.729   4.793   1.00 0.00 ? 358 VAL B HG12 2  
ATOM 3026  H HG13 . VAL B 2 64 ? 1.046   2.182   4.193   1.00 0.00 ? 358 VAL B HG13 2  
ATOM 3027  H HG21 . VAL B 2 64 ? -1.741  3.407   4.753   1.00 0.00 ? 358 VAL B HG21 2  
ATOM 3028  H HG22 . VAL B 2 64 ? -0.773  4.544   5.689   1.00 0.00 ? 358 VAL B HG22 2  
ATOM 3029  H HG23 . VAL B 2 64 ? -1.967  3.528   6.501   1.00 0.00 ? 358 VAL B HG23 2  
ATOM 3030  N N    . TYR B 2 65 ? 1.613   1.087   7.802   1.00 0.00 ? 359 TYR B N    2  
ATOM 3031  C CA   . TYR B 2 65 ? 2.749   0.256   8.187   1.00 0.00 ? 359 TYR B CA   2  
ATOM 3032  C C    . TYR B 2 65 ? 2.384   -0.679  9.344   1.00 0.00 ? 359 TYR B C    2  
ATOM 3033  O O    . TYR B 2 65 ? 2.848   -1.817  9.400   1.00 0.00 ? 359 TYR B O    2  
ATOM 3034  C CB   . TYR B 2 65 ? 3.953   1.126   8.563   1.00 0.00 ? 359 TYR B CB   2  
ATOM 3035  C CG   . TYR B 2 65 ? 5.223   0.335   8.811   1.00 0.00 ? 359 TYR B CG   2  
ATOM 3036  C CD1  . TYR B 2 65 ? 5.350   -0.489  9.924   1.00 0.00 ? 359 TYR B CD1  2  
ATOM 3037  C CD2  . TYR B 2 65 ? 6.288   0.402   7.921   1.00 0.00 ? 359 TYR B CD2  2  
ATOM 3038  C CE1  . TYR B 2 65 ? 6.503   -1.219  10.143  1.00 0.00 ? 359 TYR B CE1  2  
ATOM 3039  C CE2  . TYR B 2 65 ? 7.443   -0.325  8.135   1.00 0.00 ? 359 TYR B CE2  2  
ATOM 3040  C CZ   . TYR B 2 65 ? 7.546   -1.134  9.246   1.00 0.00 ? 359 TYR B CZ   2  
ATOM 3041  O OH   . TYR B 2 65 ? 8.694   -1.861  9.460   1.00 0.00 ? 359 TYR B OH   2  
ATOM 3042  H H    . TYR B 2 65 ? 1.676   2.060   7.903   1.00 0.00 ? 359 TYR B H    2  
ATOM 3043  H HA   . TYR B 2 65 ? 3.013   -0.349  7.332   1.00 0.00 ? 359 TYR B HA   2  
ATOM 3044  H HB2  . TYR B 2 65 ? 4.149   1.824   7.764   1.00 0.00 ? 359 TYR B HB2  2  
ATOM 3045  H HB3  . TYR B 2 65 ? 3.724   1.676   9.465   1.00 0.00 ? 359 TYR B HB3  2  
ATOM 3046  H HD1  . TYR B 2 65 ? 4.532   -0.552  10.626  1.00 0.00 ? 359 TYR B HD1  2  
ATOM 3047  H HD2  . TYR B 2 65 ? 6.206   1.038   7.050   1.00 0.00 ? 359 TYR B HD2  2  
ATOM 3048  H HE1  . TYR B 2 65 ? 6.581   -1.854  11.013  1.00 0.00 ? 359 TYR B HE1  2  
ATOM 3049  H HE2  . TYR B 2 65 ? 8.261   -0.258  7.432   1.00 0.00 ? 359 TYR B HE2  2  
ATOM 3050  H HH   . TYR B 2 65 ? 9.273   -1.377  10.053  1.00 0.00 ? 359 TYR B HH   2  
ATOM 3051  N N    . ALA B 2 66 ? 1.564   -0.177  10.275  1.00 0.00 ? 360 ALA B N    2  
ATOM 3052  C CA   . ALA B 2 66 ? 1.157   -0.952  11.455  1.00 0.00 ? 360 ALA B CA   2  
ATOM 3053  C C    . ALA B 2 66 ? 0.410   -2.234  11.090  1.00 0.00 ? 360 ALA B C    2  
ATOM 3054  O O    . ALA B 2 66 ? 0.806   -3.325  11.506  1.00 0.00 ? 360 ALA B O    2  
ATOM 3055  C CB   . ALA B 2 66 ? 0.306   -0.103  12.385  1.00 0.00 ? 360 ALA B CB   2  
ATOM 3056  H H    . ALA B 2 66 ? 1.236   0.747   10.175  1.00 0.00 ? 360 ALA B H    2  
ATOM 3057  H HA   . ALA B 2 66 ? 2.055   -1.223  11.991  1.00 0.00 ? 360 ALA B HA   2  
ATOM 3058  H HB1  . ALA B 2 66 ? -0.138  -0.732  13.143  1.00 0.00 ? 360 ALA B HB1  2  
ATOM 3059  H HB2  . ALA B 2 66 ? -0.475  0.382   11.817  1.00 0.00 ? 360 ALA B HB2  2  
ATOM 3060  H HB3  . ALA B 2 66 ? 0.925   0.645   12.856  1.00 0.00 ? 360 ALA B HB3  2  
ATOM 3061  N N    . GLN B 2 67 ? -0.675  -2.100  10.330  1.00 0.00 ? 361 GLN B N    2  
ATOM 3062  C CA   . GLN B 2 67 ? -1.478  -3.257  9.937   1.00 0.00 ? 361 GLN B CA   2  
ATOM 3063  C C    . GLN B 2 67 ? -0.696  -4.198  9.023   1.00 0.00 ? 361 GLN B C    2  
ATOM 3064  O O    . GLN B 2 67 ? -0.803  -5.417  9.153   1.00 0.00 ? 361 GLN B O    2  
ATOM 3065  C CB   . GLN B 2 67 ? -2.770  -2.811  9.249   1.00 0.00 ? 361 GLN B CB   2  
ATOM 3066  C CG   . GLN B 2 67 ? -3.733  -2.079  10.168  1.00 0.00 ? 361 GLN B CG   2  
ATOM 3067  C CD   . GLN B 2 67 ? -5.032  -1.709  9.475   1.00 0.00 ? 361 GLN B CD   2  
ATOM 3068  O OE1  . GLN B 2 67 ? -5.765  -2.579  9.004   1.00 0.00 ? 361 GLN B OE1  2  
ATOM 3069  N NE2  . GLN B 2 67 ? -5.325  -0.415  9.408   1.00 0.00 ? 361 GLN B NE2  2  
ATOM 3070  H H    . GLN B 2 67 ? -0.949  -1.204  10.037  1.00 0.00 ? 361 GLN B H    2  
ATOM 3071  H HA   . GLN B 2 67 ? -1.735  -3.794  10.838  1.00 0.00 ? 361 GLN B HA   2  
ATOM 3072  H HB2  . GLN B 2 67 ? -2.517  -2.153  8.430   1.00 0.00 ? 361 GLN B HB2  2  
ATOM 3073  H HB3  . GLN B 2 67 ? -3.273  -3.682  8.855   1.00 0.00 ? 361 GLN B HB3  2  
ATOM 3074  H HG2  . GLN B 2 67 ? -3.961  -2.716  11.009  1.00 0.00 ? 361 GLN B HG2  2  
ATOM 3075  H HG3  . GLN B 2 67 ? -3.259  -1.175  10.518  1.00 0.00 ? 361 GLN B HG3  2  
ATOM 3076  H HE21 . GLN B 2 67 ? -4.697  0.224   9.803   1.00 0.00 ? 361 GLN B HE21 2  
ATOM 3077  H HE22 . GLN B 2 67 ? -6.159  -0.154  8.965   1.00 0.00 ? 361 GLN B HE22 2  
ATOM 3078  N N    . VAL B 2 68 ? 0.098   -3.635  8.109   1.00 0.00 ? 362 VAL B N    2  
ATOM 3079  C CA   . VAL B 2 68 ? 0.894   -4.444  7.187   1.00 0.00 ? 362 VAL B CA   2  
ATOM 3080  C C    . VAL B 2 68 ? 1.953   -5.250  7.940   1.00 0.00 ? 362 VAL B C    2  
ATOM 3081  O O    . VAL B 2 68 ? 2.139   -6.440  7.671   1.00 0.00 ? 362 VAL B O    2  
ATOM 3082  C CB   . VAL B 2 68 ? 1.581   -3.578  6.109   1.00 0.00 ? 362 VAL B CB   2  
ATOM 3083  C CG1  . VAL B 2 68 ? 2.450   -4.439  5.206   1.00 0.00 ? 362 VAL B CG1  2  
ATOM 3084  C CG2  . VAL B 2 68 ? 0.543   -2.821  5.289   1.00 0.00 ? 362 VAL B CG2  2  
ATOM 3085  H H    . VAL B 2 68 ? 0.150   -2.656  8.054   1.00 0.00 ? 362 VAL B H    2  
ATOM 3086  H HA   . VAL B 2 68 ? 0.225   -5.133  6.691   1.00 0.00 ? 362 VAL B HA   2  
ATOM 3087  H HB   . VAL B 2 68 ? 2.216   -2.857  6.603   1.00 0.00 ? 362 VAL B HB   2  
ATOM 3088  H HG11 . VAL B 2 68 ? 2.752   -3.864  4.343   1.00 0.00 ? 362 VAL B HG11 2  
ATOM 3089  H HG12 . VAL B 2 68 ? 1.888   -5.304  4.884   1.00 0.00 ? 362 VAL B HG12 2  
ATOM 3090  H HG13 . VAL B 2 68 ? 3.327   -4.759  5.748   1.00 0.00 ? 362 VAL B HG13 2  
ATOM 3091  H HG21 . VAL B 2 68 ? 0.796   -1.772  5.270   1.00 0.00 ? 362 VAL B HG21 2  
ATOM 3092  H HG22 . VAL B 2 68 ? -0.432  -2.946  5.736   1.00 0.00 ? 362 VAL B HG22 2  
ATOM 3093  H HG23 . VAL B 2 68 ? 0.529   -3.206  4.281   1.00 0.00 ? 362 VAL B HG23 2  
ATOM 3094  N N    . ALA B 2 69 ? 2.635   -4.604  8.892   1.00 0.00 ? 363 ALA B N    2  
ATOM 3095  C CA   . ALA B 2 69 ? 3.663   -5.270  9.695   1.00 0.00 ? 363 ALA B CA   2  
ATOM 3096  C C    . ALA B 2 69 ? 3.105   -6.520  10.377  1.00 0.00 ? 363 ALA B C    2  
ATOM 3097  O O    . ALA B 2 69 ? 3.796   -7.533  10.494  1.00 0.00 ? 363 ALA B O    2  
ATOM 3098  C CB   . ALA B 2 69 ? 4.241   -4.317  10.732  1.00 0.00 ? 363 ALA B CB   2  
ATOM 3099  H H    . ALA B 2 69 ? 2.435   -3.659  9.065   1.00 0.00 ? 363 ALA B H    2  
ATOM 3100  H HA   . ALA B 2 69 ? 4.461   -5.567  9.030   1.00 0.00 ? 363 ALA B HA   2  
ATOM 3101  H HB1  . ALA B 2 69 ? 5.320   -4.375  10.712  1.00 0.00 ? 363 ALA B HB1  2  
ATOM 3102  H HB2  . ALA B 2 69 ? 3.884   -4.590  11.713  1.00 0.00 ? 363 ALA B HB2  2  
ATOM 3103  H HB3  . ALA B 2 69 ? 3.933   -3.307  10.506  1.00 0.00 ? 363 ALA B HB3  2  
ATOM 3104  N N    . ARG B 2 70 ? 1.846   -6.441  10.817  1.00 0.00 ? 364 ARG B N    2  
ATOM 3105  C CA   . ARG B 2 70 ? 1.186   -7.564  11.477  1.00 0.00 ? 364 ARG B CA   2  
ATOM 3106  C C    . ARG B 2 70 ? 0.870   -8.674  10.478  1.00 0.00 ? 364 ARG B C    2  
ATOM 3107  O O    . ARG B 2 70 ? 0.953   -9.852  10.807  1.00 0.00 ? 364 ARG B O    2  
ATOM 3108  C CB   . ARG B 2 70 ? -0.093  -7.095  12.175  1.00 0.00 ? 364 ARG B CB   2  
ATOM 3109  C CG   . ARG B 2 70 ? 0.163   -6.124  13.317  1.00 0.00 ? 364 ARG B CG   2  
ATOM 3110  C CD   . ARG B 2 70 ? -1.134  -5.634  13.941  1.00 0.00 ? 364 ARG B CD   2  
ATOM 3111  N NE   . ARG B 2 70 ? -0.894  -4.775  15.102  1.00 0.00 ? 364 ARG B NE   2  
ATOM 3112  C CZ   . ARG B 2 70 ? -1.860  -4.201  15.822  1.00 0.00 ? 364 ARG B CZ   2  
ATOM 3113  N NH1  . ARG B 2 70 ? -3.138  -4.370  15.495  1.00 0.00 ? 364 ARG B NH1  2  
ATOM 3114  N NH2  . ARG B 2 70 ? -1.546  -3.451  16.872  1.00 0.00 ? 364 ARG B NH2  2  
ATOM 3115  H H    . ARG B 2 70 ? 1.343   -5.610  10.683  1.00 0.00 ? 364 ARG B H    2  
ATOM 3116  H HA   . ARG B 2 70 ? 1.866   -7.954  12.222  1.00 0.00 ? 364 ARG B HA   2  
ATOM 3117  H HB2  . ARG B 2 70 ? -0.727  -6.605  11.449  1.00 0.00 ? 364 ARG B HB2  2  
ATOM 3118  H HB3  . ARG B 2 70 ? -0.612  -7.957  12.570  1.00 0.00 ? 364 ARG B HB3  2  
ATOM 3119  H HG2  . ARG B 2 70 ? 0.747   -6.625  14.075  1.00 0.00 ? 364 ARG B HG2  2  
ATOM 3120  H HG3  . ARG B 2 70 ? 0.715   -5.277  12.938  1.00 0.00 ? 364 ARG B HG3  2  
ATOM 3121  H HD2  . ARG B 2 70 ? -1.685  -5.075  13.199  1.00 0.00 ? 364 ARG B HD2  2  
ATOM 3122  H HD3  . ARG B 2 70 ? -1.715  -6.489  14.249  1.00 0.00 ? 364 ARG B HD3  2  
ATOM 3123  H HE   . ARG B 2 70 ? 0.039   -4.621  15.364  1.00 0.00 ? 364 ARG B HE   2  
ATOM 3124  H HH11 . ARG B 2 70 ? -3.384  -4.931  14.705  1.00 0.00 ? 364 ARG B HH11 2  
ATOM 3125  H HH12 . ARG B 2 70 ? -3.855  -3.937  16.041  1.00 0.00 ? 364 ARG B HH12 2  
ATOM 3126  H HH21 . ARG B 2 70 ? -0.587  -3.316  17.121  1.00 0.00 ? 364 ARG B HH21 2  
ATOM 3127  H HH22 . ARG B 2 70 ? -2.268  -3.019  17.413  1.00 0.00 ? 364 ARG B HH22 2  
ATOM 3128  N N    . LEU B 2 71 ? 0.510   -8.288  9.254   1.00 0.00 ? 365 LEU B N    2  
ATOM 3129  C CA   . LEU B 2 71 ? 0.193   -9.255  8.205   1.00 0.00 ? 365 LEU B CA   2  
ATOM 3130  C C    . LEU B 2 71 ? 1.424   -10.069 7.788   1.00 0.00 ? 365 LEU B C    2  
ATOM 3131  O O    . LEU B 2 71 ? 1.327   -11.276 7.559   1.00 0.00 ? 365 LEU B O    2  
ATOM 3132  C CB   . LEU B 2 71 ? -0.374  -8.551  6.964   1.00 0.00 ? 365 LEU B CB   2  
ATOM 3133  C CG   . LEU B 2 71 ? -1.636  -7.713  7.182   1.00 0.00 ? 365 LEU B CG   2  
ATOM 3134  C CD1  . LEU B 2 71 ? -2.141  -7.139  5.863   1.00 0.00 ? 365 LEU B CD1  2  
ATOM 3135  C CD2  . LEU B 2 71 ? -2.718  -8.535  7.865   1.00 0.00 ? 365 LEU B CD2  2  
ATOM 3136  H H    . LEU B 2 71 ? 0.462   -7.330  9.048   1.00 0.00 ? 365 LEU B H    2  
ATOM 3137  H HA   . LEU B 2 71 ? -0.554  -9.930  8.594   1.00 0.00 ? 365 LEU B HA   2  
ATOM 3138  H HB2  . LEU B 2 71 ? 0.392   -7.903  6.565   1.00 0.00 ? 365 LEU B HB2  2  
ATOM 3139  H HB3  . LEU B 2 71 ? -0.597  -9.306  6.226   1.00 0.00 ? 365 LEU B HB3  2  
ATOM 3140  H HG   . LEU B 2 71 ? -1.395  -6.886  7.823   1.00 0.00 ? 365 LEU B HG   2  
ATOM 3141  H HD11 . LEU B 2 71 ? -1.592  -7.576  5.042   1.00 0.00 ? 365 LEU B HD11 2  
ATOM 3142  H HD12 . LEU B 2 71 ? -1.997  -6.068  5.857   1.00 0.00 ? 365 LEU B HD12 2  
ATOM 3143  H HD13 . LEU B 2 71 ? -3.193  -7.358  5.750   1.00 0.00 ? 365 LEU B HD13 2  
ATOM 3144  H HD21 . LEU B 2 71 ? -2.429  -8.726  8.889   1.00 0.00 ? 365 LEU B HD21 2  
ATOM 3145  H HD22 . LEU B 2 71 ? -2.840  -9.474  7.345   1.00 0.00 ? 365 LEU B HD22 2  
ATOM 3146  H HD23 . LEU B 2 71 ? -3.650  -7.991  7.849   1.00 0.00 ? 365 LEU B HD23 2  
ATOM 3147  N N    . PHE B 2 72 ? 2.563   -9.384  7.628   1.00 0.00 ? 366 PHE B N    2  
ATOM 3148  C CA   . PHE B 2 72 ? 3.795   -10.020 7.163   1.00 0.00 ? 366 PHE B CA   2  
ATOM 3149  C C    . PHE B 2 72 ? 4.660   -10.603 8.294   1.00 0.00 ? 366 PHE B C    2  
ATOM 3150  O O    . PHE B 2 72 ? 5.885   -10.465 8.270   1.00 0.00 ? 366 PHE B O    2  
ATOM 3151  C CB   . PHE B 2 72 ? 4.607   -8.999  6.359   1.00 0.00 ? 366 PHE B CB   2  
ATOM 3152  C CG   . PHE B 2 72 ? 3.906   -8.444  5.139   1.00 0.00 ? 366 PHE B CG   2  
ATOM 3153  C CD1  . PHE B 2 72 ? 2.524   -8.522  4.998   1.00 0.00 ? 366 PHE B CD1  2  
ATOM 3154  C CD2  . PHE B 2 72 ? 4.634   -7.825  4.137   1.00 0.00 ? 366 PHE B CD2  2  
ATOM 3155  C CE1  . PHE B 2 72 ? 1.894   -8.002  3.890   1.00 0.00 ? 366 PHE B CE1  2  
ATOM 3156  C CE2  . PHE B 2 72 ? 4.004   -7.303  3.024   1.00 0.00 ? 366 PHE B CE2  2  
ATOM 3157  C CZ   . PHE B 2 72 ? 2.631   -7.393  2.902   1.00 0.00 ? 366 PHE B CZ   2  
ATOM 3158  H H    . PHE B 2 72 ? 2.565   -8.414  7.781   1.00 0.00 ? 366 PHE B H    2  
ATOM 3159  H HA   . PHE B 2 72 ? 3.513   -10.824 6.501   1.00 0.00 ? 366 PHE B HA   2  
ATOM 3160  H HB2  . PHE B 2 72 ? 4.831   -8.169  7.005   1.00 0.00 ? 366 PHE B HB2  2  
ATOM 3161  H HB3  . PHE B 2 72 ? 5.532   -9.456  6.036   1.00 0.00 ? 366 PHE B HB3  2  
ATOM 3162  H HD1  . PHE B 2 72 ? 1.939   -8.997  5.761   1.00 0.00 ? 366 PHE B HD1  2  
ATOM 3163  H HD2  . PHE B 2 72 ? 5.707   -7.754  4.229   1.00 0.00 ? 366 PHE B HD2  2  
ATOM 3164  H HE1  . PHE B 2 72 ? 0.820   -8.073  3.797   1.00 0.00 ? 366 PHE B HE1  2  
ATOM 3165  H HE2  . PHE B 2 72 ? 4.583   -6.826  2.249   1.00 0.00 ? 366 PHE B HE2  2  
ATOM 3166  H HZ   . PHE B 2 72 ? 2.133   -6.992  2.033   1.00 0.00 ? 366 PHE B HZ   2  
ATOM 3167  N N    . LYS B 2 73 ? 4.033   -11.266 9.268   1.00 0.00 ? 367 LYS B N    2  
ATOM 3168  C CA   . LYS B 2 73 ? 4.773   -11.877 10.380  1.00 0.00 ? 367 LYS B CA   2  
ATOM 3169  C C    . LYS B 2 73 ? 5.896   -12.799 9.890   1.00 0.00 ? 367 LYS B C    2  
ATOM 3170  O O    . LYS B 2 73 ? 7.070   -12.560 10.177  1.00 0.00 ? 367 LYS B O    2  
ATOM 3171  C CB   . LYS B 2 73 ? 3.829   -12.653 11.305  1.00 0.00 ? 367 LYS B CB   2  
ATOM 3172  C CG   . LYS B 2 73 ? 2.846   -11.761 12.039  1.00 0.00 ? 367 LYS B CG   2  
ATOM 3173  C CD   . LYS B 2 73 ? 1.933   -12.552 12.960  1.00 0.00 ? 367 LYS B CD   2  
ATOM 3174  C CE   . LYS B 2 73 ? 2.714   -13.242 14.068  1.00 0.00 ? 367 LYS B CE   2  
ATOM 3175  N NZ   . LYS B 2 73 ? 1.821   -13.996 14.993  1.00 0.00 ? 367 LYS B NZ   2  
ATOM 3176  H H    . LYS B 2 73 ? 3.058   -11.361 9.233   1.00 0.00 ? 367 LYS B H    2  
ATOM 3177  H HA   . LYS B 2 73 ? 5.220   -11.073 10.945  1.00 0.00 ? 367 LYS B HA   2  
ATOM 3178  H HB2  . LYS B 2 73 ? 3.270   -13.366 10.717  1.00 0.00 ? 367 LYS B HB2  2  
ATOM 3179  H HB3  . LYS B 2 73 ? 4.419   -13.185 12.037  1.00 0.00 ? 367 LYS B HB3  2  
ATOM 3180  H HG2  . LYS B 2 73 ? 3.397   -11.041 12.625  1.00 0.00 ? 367 LYS B HG2  2  
ATOM 3181  H HG3  . LYS B 2 73 ? 2.244   -11.244 11.310  1.00 0.00 ? 367 LYS B HG3  2  
ATOM 3182  H HD2  . LYS B 2 73 ? 1.218   -11.877 13.406  1.00 0.00 ? 367 LYS B HD2  2  
ATOM 3183  H HD3  . LYS B 2 73 ? 1.412   -13.299 12.380  1.00 0.00 ? 367 LYS B HD3  2  
ATOM 3184  H HE2  . LYS B 2 73 ? 3.417   -13.929 13.622  1.00 0.00 ? 367 LYS B HE2  2  
ATOM 3185  H HE3  . LYS B 2 73 ? 3.253   -12.494 14.632  1.00 0.00 ? 367 LYS B HE3  2  
ATOM 3186  H HZ1  . LYS B 2 73 ? 1.074   -14.479 14.455  1.00 0.00 ? 367 LYS B HZ1  2  
ATOM 3187  H HZ2  . LYS B 2 73 ? 1.377   -13.344 15.672  1.00 0.00 ? 367 LYS B HZ2  2  
ATOM 3188  H HZ3  . LYS B 2 73 ? 2.369   -14.705 15.519  1.00 0.00 ? 367 LYS B HZ3  2  
ATOM 3189  N N    . ASN B 2 74 ? 5.525   -13.864 9.168   1.00 0.00 ? 368 ASN B N    2  
ATOM 3190  C CA   . ASN B 2 74 ? 6.505   -14.835 8.659   1.00 0.00 ? 368 ASN B CA   2  
ATOM 3191  C C    . ASN B 2 74 ? 7.129   -14.411 7.316   1.00 0.00 ? 368 ASN B C    2  
ATOM 3192  O O    . ASN B 2 74 ? 7.688   -15.246 6.601   1.00 0.00 ? 368 ASN B O    2  
ATOM 3193  C CB   . ASN B 2 74 ? 5.857   -16.222 8.533   1.00 0.00 ? 368 ASN B CB   2  
ATOM 3194  C CG   . ASN B 2 74 ? 4.715   -16.260 7.532   1.00 0.00 ? 368 ASN B CG   2  
ATOM 3195  O OD1  . ASN B 2 74 ? 4.926   -16.124 6.327   1.00 0.00 ? 368 ASN B OD1  2  
ATOM 3196  N ND2  . ASN B 2 74 ? 3.494   -16.440 8.027   1.00 0.00 ? 368 ASN B ND2  2  
ATOM 3197  H H    . ASN B 2 74 ? 4.573   -14.008 8.985   1.00 0.00 ? 368 ASN B H    2  
ATOM 3198  H HA   . ASN B 2 74 ? 7.297   -14.898 9.389   1.00 0.00 ? 368 ASN B HA   2  
ATOM 3199  H HB2  . ASN B 2 74 ? 6.607   -16.933 8.216   1.00 0.00 ? 368 ASN B HB2  2  
ATOM 3200  H HB3  . ASN B 2 74 ? 5.474   -16.521 9.498   1.00 0.00 ? 368 ASN B HB3  2  
ATOM 3201  H HD21 . ASN B 2 74 ? 3.397   -16.537 8.997   1.00 0.00 ? 368 ASN B HD21 2  
ATOM 3202  H HD22 . ASN B 2 74 ? 2.743   -16.466 7.400   1.00 0.00 ? 368 ASN B HD22 2  
ATOM 3203  N N    . GLN B 2 75 ? 7.055   -13.120 6.988   1.00 0.00 ? 369 GLN B N    2  
ATOM 3204  C CA   . GLN B 2 75 ? 7.635   -12.603 5.748   1.00 0.00 ? 369 GLN B CA   2  
ATOM 3205  C C    . GLN B 2 75 ? 8.251   -11.218 5.973   1.00 0.00 ? 369 GLN B C    2  
ATOM 3206  O O    . GLN B 2 75 ? 7.952   -10.262 5.253   1.00 0.00 ? 369 GLN B O    2  
ATOM 3207  C CB   . GLN B 2 75 ? 6.594   -12.555 4.621   1.00 0.00 ? 369 GLN B CB   2  
ATOM 3208  C CG   . GLN B 2 75 ? 5.202   -12.138 5.070   1.00 0.00 ? 369 GLN B CG   2  
ATOM 3209  C CD   . GLN B 2 75 ? 4.301   -13.327 5.364   1.00 0.00 ? 369 GLN B CD   2  
ATOM 3210  O OE1  . GLN B 2 75 ? 4.099   -14.191 4.511   1.00 0.00 ? 369 GLN B OE1  2  
ATOM 3211  N NE2  . GLN B 2 75 ? 3.748   -13.381 6.569   1.00 0.00 ? 369 GLN B NE2  2  
ATOM 3212  H H    . GLN B 2 75 ? 6.615   -12.496 7.600   1.00 0.00 ? 369 GLN B H    2  
ATOM 3213  H HA   . GLN B 2 75 ? 8.427   -13.279 5.458   1.00 0.00 ? 369 GLN B HA   2  
ATOM 3214  H HB2  . GLN B 2 75 ? 6.927   -11.854 3.872   1.00 0.00 ? 369 GLN B HB2  2  
ATOM 3215  H HB3  . GLN B 2 75 ? 6.523   -13.535 4.171   1.00 0.00 ? 369 GLN B HB3  2  
ATOM 3216  H HG2  . GLN B 2 75 ? 5.291   -11.545 5.966   1.00 0.00 ? 369 GLN B HG2  2  
ATOM 3217  H HG3  . GLN B 2 75 ? 4.749   -11.546 4.291   1.00 0.00 ? 369 GLN B HG3  2  
ATOM 3218  H HE21 . GLN B 2 75 ? 3.946   -12.662 7.201   1.00 0.00 ? 369 GLN B HE21 2  
ATOM 3219  H HE22 . GLN B 2 75 ? 3.161   -14.136 6.775   1.00 0.00 ? 369 GLN B HE22 2  
ATOM 3220  N N    . GLU B 2 76 ? 9.118   -11.134 6.987   1.00 0.00 ? 370 GLU B N    2  
ATOM 3221  C CA   . GLU B 2 76 ? 9.807   -9.889  7.344   1.00 0.00 ? 370 GLU B CA   2  
ATOM 3222  C C    . GLU B 2 76 ? 10.500  -9.229  6.143   1.00 0.00 ? 370 GLU B C    2  
ATOM 3223  O O    . GLU B 2 76 ? 10.756  -8.024  6.161   1.00 0.00 ? 370 GLU B O    2  
ATOM 3224  C CB   . GLU B 2 76 ? 10.827  -10.152 8.453   1.00 0.00 ? 370 GLU B CB   2  
ATOM 3225  C CG   . GLU B 2 76 ? 10.202  -10.658 9.745   1.00 0.00 ? 370 GLU B CG   2  
ATOM 3226  C CD   . GLU B 2 76 ? 11.229  -10.927 10.830  1.00 0.00 ? 370 GLU B CD   2  
ATOM 3227  O OE1  . GLU B 2 76 ? 11.918  -9.973  11.248  1.00 0.00 ? 370 GLU B OE1  2  
ATOM 3228  O OE2  . GLU B 2 76 ? 11.341  -12.093 11.262  1.00 0.00 ? 370 GLU B OE2  2  
ATOM 3229  H H    . GLU B 2 76 ? 9.305   -11.941 7.512   1.00 0.00 ? 370 GLU B H    2  
ATOM 3230  H HA   . GLU B 2 76 ? 9.061   -9.206  7.720   1.00 0.00 ? 370 GLU B HA   2  
ATOM 3231  H HB2  . GLU B 2 76 ? 11.537  -10.888 8.108   1.00 0.00 ? 370 GLU B HB2  2  
ATOM 3232  H HB3  . GLU B 2 76 ? 11.353  -9.233  8.670   1.00 0.00 ? 370 GLU B HB3  2  
ATOM 3233  H HG2  . GLU B 2 76 ? 9.507   -9.918  10.108  1.00 0.00 ? 370 GLU B HG2  2  
ATOM 3234  H HG3  . GLU B 2 76 ? 9.671   -11.576 9.537   1.00 0.00 ? 370 GLU B HG3  2  
ATOM 3235  N N    . ASP B 2 77 ? 10.809  -10.017 5.104   1.00 0.00 ? 371 ASP B N    2  
ATOM 3236  C CA   . ASP B 2 77 ? 11.477  -9.489  3.913   1.00 0.00 ? 371 ASP B CA   2  
ATOM 3237  C C    . ASP B 2 77 ? 10.578  -8.485  3.194   1.00 0.00 ? 371 ASP B C    2  
ATOM 3238  O O    . ASP B 2 77 ? 10.969  -7.335  2.983   1.00 0.00 ? 371 ASP B O    2  
ATOM 3239  C CB   . ASP B 2 77 ? 11.857  -10.627 2.959   1.00 0.00 ? 371 ASP B CB   2  
ATOM 3240  C CG   . ASP B 2 77 ? 12.782  -11.643 3.602   1.00 0.00 ? 371 ASP B CG   2  
ATOM 3241  O OD1  . ASP B 2 77 ? 13.905  -11.262 3.995   1.00 0.00 ? 371 ASP B OD1  2  
ATOM 3242  O OD2  . ASP B 2 77 ? 12.381  -12.821 3.716   1.00 0.00 ? 371 ASP B OD2  2  
ATOM 3243  H H    . ASP B 2 77 ? 10.589  -10.970 5.142   1.00 0.00 ? 371 ASP B H    2  
ATOM 3244  H HA   . ASP B 2 77 ? 12.376  -8.982  4.233   1.00 0.00 ? 371 ASP B HA   2  
ATOM 3245  H HB2  . ASP B 2 77 ? 10.960  -11.136 2.642   1.00 0.00 ? 371 ASP B HB2  2  
ATOM 3246  H HB3  . ASP B 2 77 ? 12.355  -10.212 2.096   1.00 0.00 ? 371 ASP B HB3  2  
ATOM 3247  N N    . LEU B 2 78 ? 9.369   -8.921  2.840   1.00 0.00 ? 372 LEU B N    2  
ATOM 3248  C CA   . LEU B 2 78 ? 8.402   -8.053  2.169   1.00 0.00 ? 372 LEU B CA   2  
ATOM 3249  C C    . LEU B 2 78 ? 8.166   -6.760  2.956   1.00 0.00 ? 372 LEU B C    2  
ATOM 3250  O O    . LEU B 2 78 ? 7.950   -5.704  2.362   1.00 0.00 ? 372 LEU B O    2  
ATOM 3251  C CB   . LEU B 2 78 ? 7.079   -8.794  1.947   1.00 0.00 ? 372 LEU B CB   2  
ATOM 3252  C CG   . LEU B 2 78 ? 6.953   -9.546  0.613   1.00 0.00 ? 372 LEU B CG   2  
ATOM 3253  C CD1  . LEU B 2 78 ? 8.211   -10.342 0.289   1.00 0.00 ? 372 LEU B CD1  2  
ATOM 3254  C CD2  . LEU B 2 78 ? 5.748   -10.469 0.652   1.00 0.00 ? 372 LEU B CD2  2  
ATOM 3255  H H    . LEU B 2 78 ? 9.113   -9.845  3.052   1.00 0.00 ? 372 LEU B H    2  
ATOM 3256  H HA   . LEU B 2 78 ? 8.816   -7.793  1.206   1.00 0.00 ? 372 LEU B HA   2  
ATOM 3257  H HB2  . LEU B 2 78 ? 6.954   -9.506  2.750   1.00 0.00 ? 372 LEU B HB2  2  
ATOM 3258  H HB3  . LEU B 2 78 ? 6.276   -8.075  2.003   1.00 0.00 ? 372 LEU B HB3  2  
ATOM 3259  H HG   . LEU B 2 78 ? 6.797   -8.831  -0.181  1.00 0.00 ? 372 LEU B HG   2  
ATOM 3260  H HD11 . LEU B 2 78 ? 8.209   -10.607 -0.762  1.00 0.00 ? 372 LEU B HD11 2  
ATOM 3261  H HD12 . LEU B 2 78 ? 8.236   -11.239 0.888   1.00 0.00 ? 372 LEU B HD12 2  
ATOM 3262  H HD13 . LEU B 2 78 ? 9.082   -9.741  0.503   1.00 0.00 ? 372 LEU B HD13 2  
ATOM 3263  H HD21 . LEU B 2 78 ? 5.662   -10.987 -0.291  1.00 0.00 ? 372 LEU B HD21 2  
ATOM 3264  H HD22 . LEU B 2 78 ? 4.856   -9.885  0.825   1.00 0.00 ? 372 LEU B HD22 2  
ATOM 3265  H HD23 . LEU B 2 78 ? 5.869   -11.186 1.449   1.00 0.00 ? 372 LEU B HD23 2  
ATOM 3266  N N    . LEU B 2 79 ? 8.226   -6.838  4.291   1.00 0.00 ? 373 LEU B N    2  
ATOM 3267  C CA   . LEU B 2 79 ? 8.030   -5.654  5.131   1.00 0.00 ? 373 LEU B CA   2  
ATOM 3268  C C    . LEU B 2 79 ? 9.123   -4.621  4.882   1.00 0.00 ? 373 LEU B C    2  
ATOM 3269  O O    . LEU B 2 79 ? 8.839   -3.426  4.793   1.00 0.00 ? 373 LEU B O    2  
ATOM 3270  C CB   . LEU B 2 79 ? 7.995   -6.031  6.616   1.00 0.00 ? 373 LEU B CB   2  
ATOM 3271  C CG   . LEU B 2 79 ? 6.630   -6.480  7.138   1.00 0.00 ? 373 LEU B CG   2  
ATOM 3272  C CD1  . LEU B 2 79 ? 6.723   -6.867  8.607   1.00 0.00 ? 373 LEU B CD1  2  
ATOM 3273  C CD2  . LEU B 2 79 ? 5.596   -5.380  6.938   1.00 0.00 ? 373 LEU B CD2  2  
ATOM 3274  H H    . LEU B 2 79 ? 8.414   -7.702  4.715   1.00 0.00 ? 373 LEU B H    2  
ATOM 3275  H HA   . LEU B 2 79 ? 7.080   -5.218  4.859   1.00 0.00 ? 373 LEU B HA   2  
ATOM 3276  H HB2  . LEU B 2 79 ? 8.699   -6.832  6.780   1.00 0.00 ? 373 LEU B HB2  2  
ATOM 3277  H HB3  . LEU B 2 79 ? 8.309   -5.173  7.192   1.00 0.00 ? 373 LEU B HB3  2  
ATOM 3278  H HG   . LEU B 2 79 ? 6.308   -7.348  6.584   1.00 0.00 ? 373 LEU B HG   2  
ATOM 3279  H HD11 . LEU B 2 79 ? 6.690   -5.976  9.216   1.00 0.00 ? 373 LEU B HD11 2  
ATOM 3280  H HD12 . LEU B 2 79 ? 7.651   -7.390  8.784   1.00 0.00 ? 373 LEU B HD12 2  
ATOM 3281  H HD13 . LEU B 2 79 ? 5.894   -7.509  8.864   1.00 0.00 ? 373 LEU B HD13 2  
ATOM 3282  H HD21 . LEU B 2 79 ? 5.725   -4.937  5.961   1.00 0.00 ? 373 LEU B HD21 2  
ATOM 3283  H HD22 . LEU B 2 79 ? 5.726   -4.622  7.696   1.00 0.00 ? 373 LEU B HD22 2  
ATOM 3284  H HD23 . LEU B 2 79 ? 4.605   -5.801  7.014   1.00 0.00 ? 373 LEU B HD23 2  
ATOM 3285  N N    . SER B 2 80 ? 10.365  -5.087  4.737   1.00 0.00 ? 374 SER B N    2  
ATOM 3286  C CA   . SER B 2 80 ? 11.483  -4.190  4.460   1.00 0.00 ? 374 SER B CA   2  
ATOM 3287  C C    . SER B 2 80 ? 11.202  -3.403  3.181   1.00 0.00 ? 374 SER B C    2  
ATOM 3288  O O    . SER B 2 80 ? 11.455  -2.200  3.113   1.00 0.00 ? 374 SER B O    2  
ATOM 3289  C CB   . SER B 2 80 ? 12.787  -4.983  4.317   1.00 0.00 ? 374 SER B CB   2  
ATOM 3290  O OG   . SER B 2 80 ? 13.888  -4.120  4.084   1.00 0.00 ? 374 SER B OG   2  
ATOM 3291  H H    . SER B 2 80 ? 10.527  -6.053  4.797   1.00 0.00 ? 374 SER B H    2  
ATOM 3292  H HA   . SER B 2 80 ? 11.573  -3.501  5.286   1.00 0.00 ? 374 SER B HA   2  
ATOM 3293  H HB2  . SER B 2 80 ? 12.969  -5.540  5.224   1.00 0.00 ? 374 SER B HB2  2  
ATOM 3294  H HB3  . SER B 2 80 ? 12.700  -5.666  3.484   1.00 0.00 ? 374 SER B HB3  2  
ATOM 3295  H HG   . SER B 2 80 ? 14.017  -4.011  3.139   1.00 0.00 ? 374 SER B HG   2  
ATOM 3296  N N    . GLU B 2 81 ? 10.655  -4.099  2.180   1.00 0.00 ? 375 GLU B N    2  
ATOM 3297  C CA   . GLU B 2 81 ? 10.306  -3.492  0.895   1.00 0.00 ? 375 GLU B CA   2  
ATOM 3298  C C    . GLU B 2 81 ? 9.204   -2.441  1.077   1.00 0.00 ? 375 GLU B C    2  
ATOM 3299  O O    . GLU B 2 81 ? 9.255   -1.363  0.483   1.00 0.00 ? 375 GLU B O    2  
ATOM 3300  C CB   . GLU B 2 81 ? 9.823   -4.579  -0.073  1.00 0.00 ? 375 GLU B CB   2  
ATOM 3301  C CG   . GLU B 2 81 ? 9.874   -4.177  -1.538  1.00 0.00 ? 375 GLU B CG   2  
ATOM 3302  C CD   . GLU B 2 81 ? 11.260  -4.322  -2.140  1.00 0.00 ? 375 GLU B CD   2  
ATOM 3303  O OE1  . GLU B 2 81 ? 12.210  -3.710  -1.610  1.00 0.00 ? 375 GLU B OE1  2  
ATOM 3304  O OE2  . GLU B 2 81 ? 11.394  -5.050  -3.146  1.00 0.00 ? 375 GLU B OE2  2  
ATOM 3305  H H    . GLU B 2 81 ? 10.469  -5.052  2.314   1.00 0.00 ? 375 GLU B H    2  
ATOM 3306  H HA   . GLU B 2 81 ? 11.187  -3.018  0.492   1.00 0.00 ? 375 GLU B HA   2  
ATOM 3307  H HB2  . GLU B 2 81 ? 10.438  -5.457  0.052   1.00 0.00 ? 375 GLU B HB2  2  
ATOM 3308  H HB3  . GLU B 2 81 ? 8.802   -4.833  0.170   1.00 0.00 ? 375 GLU B HB3  2  
ATOM 3309  H HG2  . GLU B 2 81 ? 9.192   -4.806  -2.091  1.00 0.00 ? 375 GLU B HG2  2  
ATOM 3310  H HG3  . GLU B 2 81 ? 9.564   -3.148  -1.628  1.00 0.00 ? 375 GLU B HG3  2  
ATOM 3311  N N    . PHE B 2 82 ? 8.207   -2.780  1.903   1.00 0.00 ? 376 PHE B N    2  
ATOM 3312  C CA   . PHE B 2 82 ? 7.071   -1.896  2.184   1.00 0.00 ? 376 PHE B CA   2  
ATOM 3313  C C    . PHE B 2 82 ? 7.516   -0.512  2.664   1.00 0.00 ? 376 PHE B C    2  
ATOM 3314  O O    . PHE B 2 82 ? 7.117   0.506   2.096   1.00 0.00 ? 376 PHE B O    2  
ATOM 3315  C CB   . PHE B 2 82 ? 6.157   -2.547  3.231   1.00 0.00 ? 376 PHE B CB   2  
ATOM 3316  C CG   . PHE B 2 82 ? 4.998   -1.692  3.660   1.00 0.00 ? 376 PHE B CG   2  
ATOM 3317  C CD1  . PHE B 2 82 ? 5.176   -0.671  4.578   1.00 0.00 ? 376 PHE B CD1  2  
ATOM 3318  C CD2  . PHE B 2 82 ? 3.734   -1.909  3.139   1.00 0.00 ? 376 PHE B CD2  2  
ATOM 3319  C CE1  . PHE B 2 82 ? 4.113   0.116   4.970   1.00 0.00 ? 376 PHE B CE1  2  
ATOM 3320  C CE2  . PHE B 2 82 ? 2.668   -1.123  3.527   1.00 0.00 ? 376 PHE B CE2  2  
ATOM 3321  C CZ   . PHE B 2 82 ? 2.858   -0.110  4.444   1.00 0.00 ? 376 PHE B CZ   2  
ATOM 3322  H H    . PHE B 2 82 ? 8.232   -3.660  2.335   1.00 0.00 ? 376 PHE B H    2  
ATOM 3323  H HA   . PHE B 2 82 ? 6.514   -1.778  1.266   1.00 0.00 ? 376 PHE B HA   2  
ATOM 3324  H HB2  . PHE B 2 82 ? 5.757   -3.461  2.828   1.00 0.00 ? 376 PHE B HB2  2  
ATOM 3325  H HB3  . PHE B 2 82 ? 6.741   -2.777  4.109   1.00 0.00 ? 376 PHE B HB3  2  
ATOM 3326  H HD1  . PHE B 2 82 ? 6.158   -0.493  4.991   1.00 0.00 ? 376 PHE B HD1  2  
ATOM 3327  H HD2  . PHE B 2 82 ? 3.585   -2.702  2.420   1.00 0.00 ? 376 PHE B HD2  2  
ATOM 3328  H HE1  . PHE B 2 82 ? 4.264   0.910   5.688   1.00 0.00 ? 376 PHE B HE1  2  
ATOM 3329  H HE2  . PHE B 2 82 ? 1.686   -1.302  3.112   1.00 0.00 ? 376 PHE B HE2  2  
ATOM 3330  H HZ   . PHE B 2 82 ? 2.029   0.507   4.749   1.00 0.00 ? 376 PHE B HZ   2  
ATOM 3331  N N    . GLY B 2 83 ? 8.326   -0.485  3.723   1.00 0.00 ? 377 GLY B N    2  
ATOM 3332  C CA   . GLY B 2 83 ? 8.797   0.777   4.281   1.00 0.00 ? 377 GLY B CA   2  
ATOM 3333  C C    . GLY B 2 83 ? 9.629   1.618   3.319   1.00 0.00 ? 377 GLY B C    2  
ATOM 3334  O O    . GLY B 2 83 ? 9.892   2.786   3.595   1.00 0.00 ? 377 GLY B O    2  
ATOM 3335  H H    . GLY B 2 83 ? 8.596   -1.332  4.143   1.00 0.00 ? 377 GLY B H    2  
ATOM 3336  H HA2  . GLY B 2 83 ? 7.941   1.356   4.587   1.00 0.00 ? 377 GLY B HA2  2  
ATOM 3337  H HA3  . GLY B 2 83 ? 9.395   0.563   5.156   1.00 0.00 ? 377 GLY B HA3  2  
ATOM 3338  N N    . GLN B 2 84 ? 10.063  1.035   2.200   1.00 0.00 ? 378 GLN B N    2  
ATOM 3339  C CA   . GLN B 2 84 ? 10.878  1.765   1.227   1.00 0.00 ? 378 GLN B CA   2  
ATOM 3340  C C    . GLN B 2 84 ? 10.086  2.815   0.440   1.00 0.00 ? 378 GLN B C    2  
ATOM 3341  O O    . GLN B 2 84 ? 10.683  3.694   -0.184  1.00 0.00 ? 378 GLN B O    2  
ATOM 3342  C CB   . GLN B 2 84 ? 11.563  0.796   0.259   1.00 0.00 ? 378 GLN B CB   2  
ATOM 3343  C CG   . GLN B 2 84 ? 12.497  -0.187  0.948   1.00 0.00 ? 378 GLN B CG   2  
ATOM 3344  C CD   . GLN B 2 84 ? 13.214  -1.135  -0.007  1.00 0.00 ? 378 GLN B CD   2  
ATOM 3345  O OE1  . GLN B 2 84 ? 13.921  -2.041  0.433   1.00 0.00 ? 378 GLN B OE1  2  
ATOM 3346  N NE2  . GLN B 2 84 ? 13.054  -0.938  -1.314  1.00 0.00 ? 378 GLN B NE2  2  
ATOM 3347  H H    . GLN B 2 84 ? 9.841   0.097   2.028   1.00 0.00 ? 378 GLN B H    2  
ATOM 3348  H HA   . GLN B 2 84 ? 11.638  2.283   1.784   1.00 0.00 ? 378 GLN B HA   2  
ATOM 3349  H HB2  . GLN B 2 84 ? 10.805  0.234   -0.267  1.00 0.00 ? 378 GLN B HB2  2  
ATOM 3350  H HB3  . GLN B 2 84 ? 12.138  1.366   -0.455  1.00 0.00 ? 378 GLN B HB3  2  
ATOM 3351  H HG2  . GLN B 2 84 ? 13.243  0.371   1.492   1.00 0.00 ? 378 GLN B HG2  2  
ATOM 3352  H HG3  . GLN B 2 84 ? 11.921  -0.776  1.643   1.00 0.00 ? 378 GLN B HG3  2  
ATOM 3353  H HE21 . GLN B 2 84 ? 12.487  -0.197  -1.612  1.00 0.00 ? 378 GLN B HE21 2  
ATOM 3354  H HE22 . GLN B 2 84 ? 13.512  -1.546  -1.929  1.00 0.00 ? 378 GLN B HE22 2  
ATOM 3355  N N    . PHE B 2 85 ? 8.754   2.736   0.464   1.00 0.00 ? 379 PHE B N    2  
ATOM 3356  C CA   . PHE B 2 85 ? 7.927   3.696   -0.259  1.00 0.00 ? 379 PHE B CA   2  
ATOM 3357  C C    . PHE B 2 85 ? 7.451   4.783   0.690   1.00 0.00 ? 379 PHE B C    2  
ATOM 3358  O O    . PHE B 2 85 ? 7.666   5.974   0.459   1.00 0.00 ? 379 PHE B O    2  
ATOM 3359  C CB   . PHE B 2 85 ? 6.715   2.995   -0.882  1.00 0.00 ? 379 PHE B CB   2  
ATOM 3360  C CG   . PHE B 2 85 ? 7.052   1.715   -1.587  1.00 0.00 ? 379 PHE B CG   2  
ATOM 3361  C CD1  . PHE B 2 85 ? 7.774   1.722   -2.768  1.00 0.00 ? 379 PHE B CD1  2  
ATOM 3362  C CD2  . PHE B 2 85 ? 6.654   0.501   -1.055  1.00 0.00 ? 379 PHE B CD2  2  
ATOM 3363  C CE1  . PHE B 2 85 ? 8.092   0.540   -3.406  1.00 0.00 ? 379 PHE B CE1  2  
ATOM 3364  C CE2  . PHE B 2 85 ? 6.967   -0.682  -1.688  1.00 0.00 ? 379 PHE B CE2  2  
ATOM 3365  C CZ   . PHE B 2 85 ? 7.686   -0.665  -2.864  1.00 0.00 ? 379 PHE B CZ   2  
ATOM 3366  H H    . PHE B 2 85 ? 8.314   2.026   0.978   1.00 0.00 ? 379 PHE B H    2  
ATOM 3367  H HA   . PHE B 2 85 ? 8.524   4.141   -1.040  1.00 0.00 ? 379 PHE B HA   2  
ATOM 3368  H HB2  . PHE B 2 85 ? 6.001   2.766   -0.103  1.00 0.00 ? 379 PHE B HB2  2  
ATOM 3369  H HB3  . PHE B 2 85 ? 6.255   3.658   -1.599  1.00 0.00 ? 379 PHE B HB3  2  
ATOM 3370  H HD1  . PHE B 2 85 ? 8.091   2.665   -3.191  1.00 0.00 ? 379 PHE B HD1  2  
ATOM 3371  H HD2  . PHE B 2 85 ? 6.090   0.485   -0.133  1.00 0.00 ? 379 PHE B HD2  2  
ATOM 3372  H HE1  . PHE B 2 85 ? 8.655   0.557   -4.328  1.00 0.00 ? 379 PHE B HE1  2  
ATOM 3373  H HE2  . PHE B 2 85 ? 6.650   -1.620  -1.262  1.00 0.00 ? 379 PHE B HE2  2  
ATOM 3374  H HZ   . PHE B 2 85 ? 7.931   -1.592  -3.359  1.00 0.00 ? 379 PHE B HZ   2  
ATOM 3375  N N    . LEU B 2 86 ? 6.802   4.345   1.762   1.00 0.00 ? 380 LEU B N    2  
ATOM 3376  C CA   . LEU B 2 86 ? 6.276   5.243   2.779   1.00 0.00 ? 380 LEU B CA   2  
ATOM 3377  C C    . LEU B 2 86 ? 7.244   5.347   3.965   1.00 0.00 ? 380 LEU B C    2  
ATOM 3378  O O    . LEU B 2 86 ? 8.238   4.630   4.014   1.00 0.00 ? 380 LEU B O    2  
ATOM 3379  C CB   . LEU B 2 86 ? 4.872   4.775   3.190   1.00 0.00 ? 380 LEU B CB   2  
ATOM 3380  C CG   . LEU B 2 86 ? 4.758   3.393   3.792   1.00 0.00 ? 380 LEU B CG   2  
ATOM 3381  C CD1  . LEU B 2 86 ? 5.042   3.423   5.286   1.00 0.00 ? 380 LEU B CD1  2  
ATOM 3382  C CD2  . LEU B 2 86 ? 3.379   2.804   3.501   1.00 0.00 ? 380 LEU B CD2  2  
ATOM 3383  H H    . LEU B 2 86 ? 6.683   3.377   1.875   1.00 0.00 ? 380 LEU B H    2  
ATOM 3384  H HA   . LEU B 2 86 ? 6.193   6.222   2.330   1.00 0.00 ? 380 LEU B HA   2  
ATOM 3385  H HB2  . LEU B 2 86 ? 4.482   5.459   3.901   1.00 0.00 ? 380 LEU B HB2  2  
ATOM 3386  H HB3  . LEU B 2 86 ? 4.254   4.798   2.308   1.00 0.00 ? 380 LEU B HB3  2  
ATOM 3387  H HG   . LEU B 2 86 ? 5.488   2.775   3.334   1.00 0.00 ? 380 LEU B HG   2  
ATOM 3388  H HD11 . LEU B 2 86 ? 5.817   2.707   5.520   1.00 0.00 ? 380 LEU B HD11 2  
ATOM 3389  H HD12 . LEU B 2 86 ? 4.144   3.172   5.831   1.00 0.00 ? 380 LEU B HD12 2  
ATOM 3390  H HD13 . LEU B 2 86 ? 5.370   4.412   5.572   1.00 0.00 ? 380 LEU B HD13 2  
ATOM 3391  H HD21 . LEU B 2 86 ? 2.832   2.695   4.426   1.00 0.00 ? 380 LEU B HD21 2  
ATOM 3392  H HD22 . LEU B 2 86 ? 3.494   1.838   3.035   1.00 0.00 ? 380 LEU B HD22 2  
ATOM 3393  H HD23 . LEU B 2 86 ? 2.832   3.461   2.834   1.00 0.00 ? 380 LEU B HD23 2  
ATOM 3394  N N    . PRO B 2 87 ? 6.982   6.251   4.931   1.00 0.00 ? 381 PRO B N    2  
ATOM 3395  C CA   . PRO B 2 87 ? 7.855   6.443   6.099   1.00 0.00 ? 381 PRO B CA   2  
ATOM 3396  C C    . PRO B 2 87 ? 7.916   5.210   7.006   1.00 0.00 ? 381 PRO B C    2  
ATOM 3397  O O    . PRO B 2 87 ? 7.606   4.095   6.583   1.00 0.00 ? 381 PRO B O    2  
ATOM 3398  C CB   . PRO B 2 87 ? 7.215   7.631   6.839   1.00 0.00 ? 381 PRO B CB   2  
ATOM 3399  C CG   . PRO B 2 87 ? 6.328   8.280   5.836   1.00 0.00 ? 381 PRO B CG   2  
ATOM 3400  C CD   . PRO B 2 87 ? 5.837   7.168   4.961   1.00 0.00 ? 381 PRO B CD   2  
ATOM 3401  H HA   . PRO B 2 87 ? 8.858   6.707   5.797   1.00 0.00 ? 381 PRO B HA   2  
ATOM 3402  H HB2  . PRO B 2 87 ? 6.653   7.268   7.687   1.00 0.00 ? 381 PRO B HB2  2  
ATOM 3403  H HB3  . PRO B 2 87 ? 7.988   8.305   7.176   1.00 0.00 ? 381 PRO B HB3  2  
ATOM 3404  H HG2  . PRO B 2 87 ? 5.499   8.762   6.333   1.00 0.00 ? 381 PRO B HG2  2  
ATOM 3405  H HG3  . PRO B 2 87 ? 6.889   8.995   5.255   1.00 0.00 ? 381 PRO B HG3  2  
ATOM 3406  H HD2  . PRO B 2 87 ? 4.978   6.690   5.406   1.00 0.00 ? 381 PRO B HD2  2  
ATOM 3407  H HD3  . PRO B 2 87 ? 5.604   7.533   3.972   1.00 0.00 ? 381 PRO B HD3  2  
ATOM 3408  N N    . ASP B 2 88 ? 8.319   5.421   8.256   1.00 0.00 ? 382 ASP B N    2  
ATOM 3409  C CA   . ASP B 2 88 ? 8.424   4.332   9.226   1.00 0.00 ? 382 ASP B CA   2  
ATOM 3410  C C    . ASP B 2 88 ? 7.062   4.027   9.842   1.00 0.00 ? 382 ASP B C    2  
ATOM 3411  O O    . ASP B 2 88 ? 6.492   2.961   9.600   1.00 0.00 ? 382 ASP B O    2  
ATOM 3412  C CB   . ASP B 2 88 ? 9.441   4.678   10.324  1.00 0.00 ? 382 ASP B CB   2  
ATOM 3413  C CG   . ASP B 2 88 ? 10.869  4.809   9.809   1.00 0.00 ? 382 ASP B CG   2  
ATOM 3414  O OD1  . ASP B 2 88 ? 11.100  4.591   8.599   1.00 0.00 ? 382 ASP B OD1  2  
ATOM 3415  O OD2  . ASP B 2 88 ? 11.760  5.125   10.624  1.00 0.00 ? 382 ASP B OD2  2  
ATOM 3416  H H    . ASP B 2 88 ? 8.550   6.331   8.533   1.00 0.00 ? 382 ASP B H    2  
ATOM 3417  H HA   . ASP B 2 88 ? 8.766   3.455   8.697   1.00 0.00 ? 382 ASP B HA   2  
ATOM 3418  H HB2  . ASP B 2 88 ? 9.162   5.616   10.780  1.00 0.00 ? 382 ASP B HB2  2  
ATOM 3419  H HB3  . ASP B 2 88 ? 9.421   3.902   11.077  1.00 0.00 ? 382 ASP B HB3  2  
ATOM 3420  N N    . ALA B 2 89 ? 6.542   4.971   10.635  1.00 0.00 ? 383 ALA B N    2  
ATOM 3421  C CA   . ALA B 2 89 ? 5.238   4.819   11.287  1.00 0.00 ? 383 ALA B CA   2  
ATOM 3422  C C    . ALA B 2 89 ? 5.279   3.809   12.439  1.00 0.00 ? 383 ALA B C    2  
ATOM 3423  O O    . ALA B 2 89 ? 6.281   3.069   12.557  1.00 0.00 ? 383 ALA B O    2  
ATOM 3424  C CB   . ALA B 2 89 ? 4.177   4.427   10.267  1.00 0.00 ? 383 ALA B CB   2  
ATOM 3425  O OXT  . ALA B 2 89 ? 4.302   3.768   13.216  1.00 0.00 ? 383 ALA B OXT  2  
ATOM 3426  H H    . ALA B 2 89 ? 7.048   5.799   10.779  1.00 0.00 ? 383 ALA B H    2  
ATOM 3427  H HA   . ALA B 2 89 ? 4.964   5.783   11.690  1.00 0.00 ? 383 ALA B HA   2  
ATOM 3428  H HB1  . ALA B 2 89 ? 4.637   4.287   9.299   1.00 0.00 ? 383 ALA B HB1  2  
ATOM 3429  H HB2  . ALA B 2 89 ? 3.436   5.208   10.202  1.00 0.00 ? 383 ALA B HB2  2  
ATOM 3430  H HB3  . ALA B 2 89 ? 3.703   3.506   10.575  1.00 0.00 ? 383 ALA B HB3  2  
ATOM 3431  N N    . ARG A 1 1  ? 2.546   12.040  -3.002  1.00 0.00 ? 6   ARG A N    3  
ATOM 3432  C CA   . ARG A 1 1  ? 1.194   11.824  -2.412  1.00 0.00 ? 6   ARG A CA   3  
ATOM 3433  C C    . ARG A 1 1  ? 0.610   10.461  -2.801  1.00 0.00 ? 6   ARG A C    3  
ATOM 3434  O O    . ARG A 1 1  ? -0.185  9.889   -2.053  1.00 0.00 ? 6   ARG A O    3  
ATOM 3435  C CB   . ARG A 1 1  ? 0.268   12.957  -2.875  1.00 0.00 ? 6   ARG A CB   3  
ATOM 3436  C CG   . ARG A 1 1  ? -1.137  12.877  -2.292  1.00 0.00 ? 6   ARG A CG   3  
ATOM 3437  C CD   . ARG A 1 1  ? -1.980  14.085  -2.681  1.00 0.00 ? 6   ARG A CD   3  
ATOM 3438  N NE   . ARG A 1 1  ? -2.180  14.186  -4.128  1.00 0.00 ? 6   ARG A NE   3  
ATOM 3439  C CZ   . ARG A 1 1  ? -2.876  15.160  -4.721  1.00 0.00 ? 6   ARG A CZ   3  
ATOM 3440  N NH1  . ARG A 1 1  ? -3.445  16.121  -3.994  1.00 0.00 ? 6   ARG A NH1  3  
ATOM 3441  N NH2  . ARG A 1 1  ? -3.006  15.173  -6.042  1.00 0.00 ? 6   ARG A NH2  3  
ATOM 3442  H H1   . ARG A 1 1  ? 3.006   12.807  -2.470  1.00 0.00 ? 6   ARG A H1   3  
ATOM 3443  H H2   . ARG A 1 1  ? 2.419   12.300  -4.002  1.00 0.00 ? 6   ARG A H2   3  
ATOM 3444  H H3   . ARG A 1 1  ? 3.081   11.152  -2.909  1.00 0.00 ? 6   ARG A H3   3  
ATOM 3445  H HA   . ARG A 1 1  ? 1.286   11.865  -1.336  1.00 0.00 ? 6   ARG A HA   3  
ATOM 3446  H HB2  . ARG A 1 1  ? 0.701   13.902  -2.582  1.00 0.00 ? 6   ARG A HB2  3  
ATOM 3447  H HB3  . ARG A 1 1  ? 0.190   12.924  -3.952  1.00 0.00 ? 6   ARG A HB3  3  
ATOM 3448  H HG2  . ARG A 1 1  ? -1.619  11.985  -2.661  1.00 0.00 ? 6   ARG A HG2  3  
ATOM 3449  H HG3  . ARG A 1 1  ? -1.068  12.830  -1.215  1.00 0.00 ? 6   ARG A HG3  3  
ATOM 3450  H HD2  . ARG A 1 1  ? -2.943  14.004  -2.202  1.00 0.00 ? 6   ARG A HD2  3  
ATOM 3451  H HD3  . ARG A 1 1  ? -1.482  14.979  -2.333  1.00 0.00 ? 6   ARG A HD3  3  
ATOM 3452  H HE   . ARG A 1 1  ? -1.774  13.493  -4.690  1.00 0.00 ? 6   ARG A HE   3  
ATOM 3453  H HH11 . ARG A 1 1  ? -3.354  16.122  -2.999  1.00 0.00 ? 6   ARG A HH11 3  
ATOM 3454  H HH12 . ARG A 1 1  ? -3.964  16.847  -4.447  1.00 0.00 ? 6   ARG A HH12 3  
ATOM 3455  H HH21 . ARG A 1 1  ? -2.583  14.454  -6.593  1.00 0.00 ? 6   ARG A HH21 3  
ATOM 3456  H HH22 . ARG A 1 1  ? -3.527  15.902  -6.487  1.00 0.00 ? 6   ARG A HH22 3  
ATOM 3457  N N    . MET A 1 2  ? 1.004   9.945   -3.969  1.00 0.00 ? 7   MET A N    3  
ATOM 3458  C CA   . MET A 1 2  ? 0.510   8.654   -4.441  1.00 0.00 ? 7   MET A CA   3  
ATOM 3459  C C    . MET A 1 2  ? 1.598   7.587   -4.383  1.00 0.00 ? 7   MET A C    3  
ATOM 3460  O O    . MET A 1 2  ? 2.455   7.503   -5.267  1.00 0.00 ? 7   MET A O    3  
ATOM 3461  C CB   . MET A 1 2  ? -0.025  8.768   -5.869  1.00 0.00 ? 7   MET A CB   3  
ATOM 3462  C CG   . MET A 1 2  ? -1.233  9.681   -6.000  1.00 0.00 ? 7   MET A CG   3  
ATOM 3463  S SD   . MET A 1 2  ? -1.784  9.862   -7.709  1.00 0.00 ? 7   MET A SD   3  
ATOM 3464  C CE   . MET A 1 2  ? -2.139  8.159   -8.138  1.00 0.00 ? 7   MET A CE   3  
ATOM 3465  H H    . MET A 1 2  ? 1.637   10.443  -4.527  1.00 0.00 ? 7   MET A H    3  
ATOM 3466  H HA   . MET A 1 2  ? -0.299  8.355   -3.792  1.00 0.00 ? 7   MET A HA   3  
ATOM 3467  H HB2  . MET A 1 2  ? 0.761   9.149   -6.504  1.00 0.00 ? 7   MET A HB2  3  
ATOM 3468  H HB3  . MET A 1 2  ? -0.304  7.782   -6.208  1.00 0.00 ? 7   MET A HB3  3  
ATOM 3469  H HG2  . MET A 1 2  ? -2.044  9.267   -5.419  1.00 0.00 ? 7   MET A HG2  3  
ATOM 3470  H HG3  . MET A 1 2  ? -0.975  10.656  -5.614  1.00 0.00 ? 7   MET A HG3  3  
ATOM 3471  H HE1  . MET A 1 2  ? -2.771  7.720   -7.381  1.00 0.00 ? 7   MET A HE1  3  
ATOM 3472  H HE2  . MET A 1 2  ? -1.214  7.604   -8.201  1.00 0.00 ? 7   MET A HE2  3  
ATOM 3473  H HE3  . MET A 1 2  ? -2.644  8.126   -9.093  1.00 0.00 ? 7   MET A HE3  3  
ATOM 3474  N N    . ASN A 1 3  ? 1.544   6.766   -3.340  1.00 0.00 ? 8   ASN A N    3  
ATOM 3475  C CA   . ASN A 1 3  ? 2.505   5.680   -3.145  1.00 0.00 ? 8   ASN A CA   3  
ATOM 3476  C C    . ASN A 1 3  ? 1.777   4.357   -2.945  1.00 0.00 ? 8   ASN A C    3  
ATOM 3477  O O    . ASN A 1 3  ? 2.040   3.384   -3.653  1.00 0.00 ? 8   ASN A O    3  
ATOM 3478  C CB   . ASN A 1 3  ? 3.418   5.965   -1.943  1.00 0.00 ? 8   ASN A CB   3  
ATOM 3479  C CG   . ASN A 1 3  ? 4.444   7.069   -2.192  1.00 0.00 ? 8   ASN A CG   3  
ATOM 3480  O OD1  . ASN A 1 3  ? 5.088   7.537   -1.253  1.00 0.00 ? 8   ASN A OD1  3  
ATOM 3481  N ND2  . ASN A 1 3  ? 4.629   7.474   -3.449  1.00 0.00 ? 8   ASN A ND2  3  
ATOM 3482  H H    . ASN A 1 3  ? 0.826   6.886   -2.685  1.00 0.00 ? 8   ASN A H    3  
ATOM 3483  H HA   . ASN A 1 3  ? 3.109   5.606   -4.037  1.00 0.00 ? 8   ASN A HA   3  
ATOM 3484  H HB2  . ASN A 1 3  ? 2.807   6.259   -1.103  1.00 0.00 ? 8   ASN A HB2  3  
ATOM 3485  H HB3  . ASN A 1 3  ? 3.951   5.060   -1.689  1.00 0.00 ? 8   ASN A HB3  3  
ATOM 3486  H HD21 . ASN A 1 3  ? 4.108   7.053   -4.162  1.00 0.00 ? 8   ASN A HD21 3  
ATOM 3487  H HD22 . ASN A 1 3  ? 5.286   8.185   -3.610  1.00 0.00 ? 8   ASN A HD22 3  
ATOM 3488  N N    . ILE A 1 4  ? 0.852   4.329   -1.983  1.00 0.00 ? 9   ILE A N    3  
ATOM 3489  C CA   . ILE A 1 4  ? 0.081   3.122   -1.709  1.00 0.00 ? 9   ILE A CA   3  
ATOM 3490  C C    . ILE A 1 4  ? -0.893  2.821   -2.813  1.00 0.00 ? 9   ILE A C    3  
ATOM 3491  O O    . ILE A 1 4  ? -1.026  1.672   -3.230  1.00 0.00 ? 9   ILE A O    3  
ATOM 3492  C CB   . ILE A 1 4  ? -0.742  3.201   -0.418  1.00 0.00 ? 9   ILE A CB   3  
ATOM 3493  C CG1  . ILE A 1 4  ? -1.589  4.470   -0.351  1.00 0.00 ? 9   ILE A CG1  3  
ATOM 3494  C CG2  . ILE A 1 4  ? 0.150   3.097   0.775   1.00 0.00 ? 9   ILE A CG2  3  
ATOM 3495  C CD1  . ILE A 1 4  ? -2.536  4.476   0.823   1.00 0.00 ? 9   ILE A CD1  3  
ATOM 3496  H H    . ILE A 1 4  ? 0.681   5.138   -1.457  1.00 0.00 ? 9   ILE A H    3  
ATOM 3497  H HA   . ILE A 1 4  ? 0.773   2.297   -1.617  1.00 0.00 ? 9   ILE A HA   3  
ATOM 3498  H HB   . ILE A 1 4  ? -1.397  2.348   -0.405  1.00 0.00 ? 9   ILE A HB   3  
ATOM 3499  H HG12 . ILE A 1 4  ? -0.943  5.330   -0.260  1.00 0.00 ? 9   ILE A HG12 3  
ATOM 3500  H HG13 . ILE A 1 4  ? -2.178  4.557   -1.250  1.00 0.00 ? 9   ILE A HG13 3  
ATOM 3501  H HG21 . ILE A 1 4  ? 0.453   4.086   1.083   1.00 0.00 ? 9   ILE A HG21 3  
ATOM 3502  H HG22 . ILE A 1 4  ? 1.011   2.508   0.513   1.00 0.00 ? 9   ILE A HG22 3  
ATOM 3503  H HG23 . ILE A 1 4  ? -0.393  2.618   1.570   1.00 0.00 ? 9   ILE A HG23 3  
ATOM 3504  H HD11 . ILE A 1 4  ? -1.972  4.528   1.742   1.00 0.00 ? 9   ILE A HD11 3  
ATOM 3505  H HD12 . ILE A 1 4  ? -3.120  3.569   0.810   1.00 0.00 ? 9   ILE A HD12 3  
ATOM 3506  H HD13 . ILE A 1 4  ? -3.194  5.327   0.754   1.00 0.00 ? 9   ILE A HD13 3  
ATOM 3507  N N    . GLN A 1 5  ? -1.601  3.848   -3.263  1.00 0.00 ? 10  GLN A N    3  
ATOM 3508  C CA   . GLN A 1 5  ? -2.585  3.657   -4.296  1.00 0.00 ? 10  GLN A CA   3  
ATOM 3509  C C    . GLN A 1 5  ? -1.926  3.079   -5.544  1.00 0.00 ? 10  GLN A C    3  
ATOM 3510  O O    . GLN A 1 5  ? -2.526  2.279   -6.262  1.00 0.00 ? 10  GLN A O    3  
ATOM 3511  C CB   . GLN A 1 5  ? -3.318  4.962   -4.613  1.00 0.00 ? 10  GLN A CB   3  
ATOM 3512  C CG   . GLN A 1 5  ? -4.451  4.803   -5.616  1.00 0.00 ? 10  GLN A CG   3  
ATOM 3513  C CD   . GLN A 1 5  ? -5.222  6.092   -5.833  1.00 0.00 ? 10  GLN A CD   3  
ATOM 3514  O OE1  . GLN A 1 5  ? -4.666  7.094   -6.283  1.00 0.00 ? 10  GLN A OE1  3  
ATOM 3515  N NE2  . GLN A 1 5  ? -6.512  6.077   -5.511  1.00 0.00 ? 10  GLN A NE2  3  
ATOM 3516  H H    . GLN A 1 5  ? -1.469  4.740   -2.880  1.00 0.00 ? 10  GLN A H    3  
ATOM 3517  H HA   . GLN A 1 5  ? -3.285  2.939   -3.899  1.00 0.00 ? 10  GLN A HA   3  
ATOM 3518  H HB2  . GLN A 1 5  ? -3.734  5.355   -3.699  1.00 0.00 ? 10  GLN A HB2  3  
ATOM 3519  H HB3  . GLN A 1 5  ? -2.610  5.672   -5.012  1.00 0.00 ? 10  GLN A HB3  3  
ATOM 3520  H HG2  . GLN A 1 5  ? -4.036  4.485   -6.560  1.00 0.00 ? 10  GLN A HG2  3  
ATOM 3521  H HG3  . GLN A 1 5  ? -5.135  4.048   -5.252  1.00 0.00 ? 10  GLN A HG3  3  
ATOM 3522  H HE21 . GLN A 1 5  ? -6.893  5.246   -5.154  1.00 0.00 ? 10  GLN A HE21 3  
ATOM 3523  H HE22 . GLN A 1 5  ? -7.032  6.898   -5.642  1.00 0.00 ? 10  GLN A HE22 3  
ATOM 3524  N N    . MET A 1 6  ? -0.665  3.466   -5.767  1.00 0.00 ? 11  MET A N    3  
ATOM 3525  C CA   . MET A 1 6  ? 0.104   2.963   -6.896  1.00 0.00 ? 11  MET A CA   3  
ATOM 3526  C C    . MET A 1 6  ? 0.215   1.440   -6.785  1.00 0.00 ? 11  MET A C    3  
ATOM 3527  O O    . MET A 1 6  ? 0.072   0.724   -7.778  1.00 0.00 ? 11  MET A O    3  
ATOM 3528  C CB   . MET A 1 6  ? 1.487   3.621   -6.922  1.00 0.00 ? 11  MET A CB   3  
ATOM 3529  C CG   . MET A 1 6  ? 2.248   3.405   -8.217  1.00 0.00 ? 11  MET A CG   3  
ATOM 3530  S SD   . MET A 1 6  ? 3.676   4.494   -8.360  1.00 0.00 ? 11  MET A SD   3  
ATOM 3531  C CE   . MET A 1 6  ? 4.601   4.030   -6.901  1.00 0.00 ? 11  MET A CE   3  
ATOM 3532  H H    . MET A 1 6  ? -0.235  4.085   -5.140  1.00 0.00 ? 11  MET A H    3  
ATOM 3533  H HA   . MET A 1 6  ? -0.429  3.212   -7.802  1.00 0.00 ? 11  MET A HA   3  
ATOM 3534  H HB2  . MET A 1 6  ? 1.370   4.686   -6.773  1.00 0.00 ? 11  MET A HB2  3  
ATOM 3535  H HB3  . MET A 1 6  ? 2.078   3.221   -6.111  1.00 0.00 ? 11  MET A HB3  3  
ATOM 3536  H HG2  . MET A 1 6  ? 2.587   2.381   -8.253  1.00 0.00 ? 11  MET A HG2  3  
ATOM 3537  H HG3  . MET A 1 6  ? 1.582   3.592   -9.045  1.00 0.00 ? 11  MET A HG3  3  
ATOM 3538  H HE1  . MET A 1 6  ? 5.649   3.968   -7.145  1.00 0.00 ? 11  MET A HE1  3  
ATOM 3539  H HE2  . MET A 1 6  ? 4.256   3.069   -6.549  1.00 0.00 ? 11  MET A HE2  3  
ATOM 3540  H HE3  . MET A 1 6  ? 4.452   4.771   -6.130  1.00 0.00 ? 11  MET A HE3  3  
ATOM 3541  N N    . LEU A 1 7  ? 0.419   0.955   -5.551  1.00 0.00 ? 12  LEU A N    3  
ATOM 3542  C CA   . LEU A 1 7  ? 0.488   -0.480  -5.281  1.00 0.00 ? 12  LEU A CA   3  
ATOM 3543  C C    . LEU A 1 7  ? -0.904  -1.083  -5.395  1.00 0.00 ? 12  LEU A C    3  
ATOM 3544  O O    . LEU A 1 7  ? -1.118  -2.042  -6.133  1.00 0.00 ? 12  LEU A O    3  
ATOM 3545  C CB   . LEU A 1 7  ? 1.007   -0.758  -3.869  1.00 0.00 ? 12  LEU A CB   3  
ATOM 3546  C CG   . LEU A 1 7  ? 2.471   -0.426  -3.604  1.00 0.00 ? 12  LEU A CG   3  
ATOM 3547  C CD1  . LEU A 1 7  ? 2.612   0.382   -2.321  1.00 0.00 ? 12  LEU A CD1  3  
ATOM 3548  C CD2  . LEU A 1 7  ? 3.278   -1.712  -3.513  1.00 0.00 ? 12  LEU A CD2  3  
ATOM 3549  H H    . LEU A 1 7  ? 0.486   1.581   -4.799  1.00 0.00 ? 12  LEU A H    3  
ATOM 3550  H HA   . LEU A 1 7  ? 1.142   -0.938  -6.008  1.00 0.00 ? 12  LEU A HA   3  
ATOM 3551  H HB2  . LEU A 1 7  ? 0.404   -0.198  -3.175  1.00 0.00 ? 12  LEU A HB2  3  
ATOM 3552  H HB3  . LEU A 1 7  ? 0.865   -1.809  -3.674  1.00 0.00 ? 12  LEU A HB3  3  
ATOM 3553  H HG   . LEU A 1 7  ? 2.857   0.164   -4.420  1.00 0.00 ? 12  LEU A HG   3  
ATOM 3554  H HD11 . LEU A 1 7  ? 2.944   1.381   -2.561  1.00 0.00 ? 12  LEU A HD11 3  
ATOM 3555  H HD12 . LEU A 1 7  ? 3.334   -0.093  -1.674  1.00 0.00 ? 12  LEU A HD12 3  
ATOM 3556  H HD13 . LEU A 1 7  ? 1.657   0.432   -1.820  1.00 0.00 ? 12  LEU A HD13 3  
ATOM 3557  H HD21 . LEU A 1 7  ? 3.520   -2.052  -4.507  1.00 0.00 ? 12  LEU A HD21 3  
ATOM 3558  H HD22 . LEU A 1 7  ? 2.692   -2.471  -3.009  1.00 0.00 ? 12  LEU A HD22 3  
ATOM 3559  H HD23 . LEU A 1 7  ? 4.187   -1.531  -2.961  1.00 0.00 ? 12  LEU A HD23 3  
ATOM 3560  N N    . LEU A 1 8  ? -1.842  -0.507  -4.634  1.00 0.00 ? 13  LEU A N    3  
ATOM 3561  C CA   . LEU A 1 8  ? -3.233  -0.967  -4.618  1.00 0.00 ? 13  LEU A CA   3  
ATOM 3562  C C    . LEU A 1 8  ? -3.749  -1.279  -6.025  1.00 0.00 ? 13  LEU A C    3  
ATOM 3563  O O    . LEU A 1 8  ? -4.135  -2.414  -6.311  1.00 0.00 ? 13  LEU A O    3  
ATOM 3564  C CB   . LEU A 1 8  ? -4.126  0.099   -3.973  1.00 0.00 ? 13  LEU A CB   3  
ATOM 3565  C CG   . LEU A 1 8  ? -3.890  0.327   -2.481  1.00 0.00 ? 13  LEU A CG   3  
ATOM 3566  C CD1  . LEU A 1 8  ? -4.552  1.620   -2.021  1.00 0.00 ? 13  LEU A CD1  3  
ATOM 3567  C CD2  . LEU A 1 8  ? -4.423  -0.851  -1.689  1.00 0.00 ? 13  LEU A CD2  3  
ATOM 3568  H H    . LEU A 1 8  ? -1.584  0.253   -4.051  1.00 0.00 ? 13  LEU A H    3  
ATOM 3569  H HA   . LEU A 1 8  ? -3.269  -1.873  -4.026  1.00 0.00 ? 13  LEU A HA   3  
ATOM 3570  H HB2  . LEU A 1 8  ? -3.964  1.033   -4.488  1.00 0.00 ? 13  LEU A HB2  3  
ATOM 3571  H HB3  . LEU A 1 8  ? -5.156  -0.194  -4.110  1.00 0.00 ? 13  LEU A HB3  3  
ATOM 3572  H HG   . LEU A 1 8  ? -2.831  0.408   -2.295  1.00 0.00 ? 13  LEU A HG   3  
ATOM 3573  H HD11 . LEU A 1 8  ? -4.688  2.278   -2.866  1.00 0.00 ? 13  LEU A HD11 3  
ATOM 3574  H HD12 . LEU A 1 8  ? -3.924  2.103   -1.285  1.00 0.00 ? 13  LEU A HD12 3  
ATOM 3575  H HD13 . LEU A 1 8  ? -5.513  1.395   -1.581  1.00 0.00 ? 13  LEU A HD13 3  
ATOM 3576  H HD21 . LEU A 1 8  ? -3.770  -1.050  -0.856  1.00 0.00 ? 13  LEU A HD21 3  
ATOM 3577  H HD22 . LEU A 1 8  ? -4.471  -1.721  -2.326  1.00 0.00 ? 13  LEU A HD22 3  
ATOM 3578  H HD23 . LEU A 1 8  ? -5.410  -0.619  -1.325  1.00 0.00 ? 13  LEU A HD23 3  
ATOM 3579  N N    . GLU A 1 9  ? -3.752  -0.267  -6.896  1.00 0.00 ? 14  GLU A N    3  
ATOM 3580  C CA   . GLU A 1 9  ? -4.218  -0.439  -8.273  1.00 0.00 ? 14  GLU A CA   3  
ATOM 3581  C C    . GLU A 1 9  ? -3.391  -1.509  -8.984  1.00 0.00 ? 14  GLU A C    3  
ATOM 3582  O O    . GLU A 1 9  ? -3.927  -2.319  -9.744  1.00 0.00 ? 14  GLU A O    3  
ATOM 3583  C CB   . GLU A 1 9  ? -4.143  0.885   -9.040  1.00 0.00 ? 14  GLU A CB   3  
ATOM 3584  C CG   . GLU A 1 9  ? -4.949  2.011   -8.400  1.00 0.00 ? 14  GLU A CG   3  
ATOM 3585  C CD   . GLU A 1 9  ? -6.408  1.648   -8.188  1.00 0.00 ? 14  GLU A CD   3  
ATOM 3586  O OE1  . GLU A 1 9  ? -7.109  1.385   -9.189  1.00 0.00 ? 14  GLU A OE1  3  
ATOM 3587  O OE2  . GLU A 1 9  ? -6.849  1.624   -7.019  1.00 0.00 ? 14  GLU A OE2  3  
ATOM 3588  H H    . GLU A 1 9  ? -3.430  0.613   -6.608  1.00 0.00 ? 14  GLU A H    3  
ATOM 3589  H HA   . GLU A 1 9  ? -5.246  -0.767  -8.234  1.00 0.00 ? 14  GLU A HA   3  
ATOM 3590  H HB2  . GLU A 1 9  ? -3.112  1.197   -9.095  1.00 0.00 ? 14  GLU A HB2  3  
ATOM 3591  H HB3  . GLU A 1 9  ? -4.518  0.728   -10.041 1.00 0.00 ? 14  GLU A HB3  3  
ATOM 3592  H HG2  . GLU A 1 9  ? -4.511  2.247   -7.442  1.00 0.00 ? 14  GLU A HG2  3  
ATOM 3593  H HG3  . GLU A 1 9  ? -4.898  2.878   -9.041  1.00 0.00 ? 14  GLU A HG3  3  
ATOM 3594  N N    . ALA A 1 10 ? -2.086  -1.517  -8.708  1.00 0.00 ? 15  ALA A N    3  
ATOM 3595  C CA   . ALA A 1 10 ? -1.172  -2.495  -9.288  1.00 0.00 ? 15  ALA A CA   3  
ATOM 3596  C C    . ALA A 1 10 ? -1.588  -3.912  -8.928  1.00 0.00 ? 15  ALA A C    3  
ATOM 3597  O O    . ALA A 1 10 ? -1.685  -4.761  -9.805  1.00 0.00 ? 15  ALA A O    3  
ATOM 3598  C CB   . ALA A 1 10 ? 0.240   -2.239  -8.813  1.00 0.00 ? 15  ALA A CB   3  
ATOM 3599  H H    . ALA A 1 10 ? -1.730  -0.854  -8.080  1.00 0.00 ? 15  ALA A H    3  
ATOM 3600  H HA   . ALA A 1 10 ? -1.182  -2.387  -10.364 1.00 0.00 ? 15  ALA A HA   3  
ATOM 3601  H HB1  . ALA A 1 10 ? 0.216   -1.735  -7.860  1.00 0.00 ? 15  ALA A HB1  3  
ATOM 3602  H HB2  . ALA A 1 10 ? 0.744   -1.621  -9.536  1.00 0.00 ? 15  ALA A HB2  3  
ATOM 3603  H HB3  . ALA A 1 10 ? 0.765   -3.178  -8.713  1.00 0.00 ? 15  ALA A HB3  3  
ATOM 3604  N N    . ALA A 1 11 ? -1.829  -4.157  -7.634  1.00 0.00 ? 16  ALA A N    3  
ATOM 3605  C CA   . ALA A 1 11 ? -2.228  -5.483  -7.167  1.00 0.00 ? 16  ALA A CA   3  
ATOM 3606  C C    . ALA A 1 11 ? -3.268  -6.111  -8.085  1.00 0.00 ? 16  ALA A C    3  
ATOM 3607  O O    . ALA A 1 11 ? -3.077  -7.221  -8.569  1.00 0.00 ? 16  ALA A O    3  
ATOM 3608  C CB   . ALA A 1 11 ? -2.785  -5.434  -5.762  1.00 0.00 ? 16  ALA A CB   3  
ATOM 3609  H H    . ALA A 1 11 ? -1.730  -3.432  -6.984  1.00 0.00 ? 16  ALA A H    3  
ATOM 3610  H HA   . ALA A 1 11 ? -1.341  -6.100  -7.151  1.00 0.00 ? 16  ALA A HA   3  
ATOM 3611  H HB1  . ALA A 1 11 ? -3.392  -6.316  -5.603  1.00 0.00 ? 16  ALA A HB1  3  
ATOM 3612  H HB2  . ALA A 1 11 ? -3.390  -4.550  -5.643  1.00 0.00 ? 16  ALA A HB2  3  
ATOM 3613  H HB3  . ALA A 1 11 ? -1.974  -5.421  -5.052  1.00 0.00 ? 16  ALA A HB3  3  
ATOM 3614  N N    . ASP A 1 12 ? -4.367  -5.383  -8.321  1.00 0.00 ? 17  ASP A N    3  
ATOM 3615  C CA   . ASP A 1 12 ? -5.444  -5.862  -9.195  1.00 0.00 ? 17  ASP A CA   3  
ATOM 3616  C C    . ASP A 1 12 ? -4.868  -6.332  -10.529 1.00 0.00 ? 17  ASP A C    3  
ATOM 3617  O O    . ASP A 1 12 ? -5.286  -7.353  -11.075 1.00 0.00 ? 17  ASP A O    3  
ATOM 3618  C CB   . ASP A 1 12 ? -6.480  -4.754  -9.431  1.00 0.00 ? 17  ASP A CB   3  
ATOM 3619  C CG   . ASP A 1 12 ? -7.155  -4.269  -8.153  1.00 0.00 ? 17  ASP A CG   3  
ATOM 3620  O OD1  . ASP A 1 12 ? -6.868  -4.820  -7.066  1.00 0.00 ? 17  ASP A OD1  3  
ATOM 3621  O OD2  . ASP A 1 12 ? -7.979  -3.335  -8.243  1.00 0.00 ? 17  ASP A OD2  3  
ATOM 3622  H H    . ASP A 1 12 ? -4.452  -4.500  -7.904  1.00 0.00 ? 17  ASP A H    3  
ATOM 3623  H HA   . ASP A 1 12 ? -5.923  -6.698  -8.706  1.00 0.00 ? 17  ASP A HA   3  
ATOM 3624  H HB2  . ASP A 1 12 ? -5.990  -3.911  -9.893  1.00 0.00 ? 17  ASP A HB2  3  
ATOM 3625  H HB3  . ASP A 1 12 ? -7.244  -5.125  -10.098 1.00 0.00 ? 17  ASP A HB3  3  
ATOM 3626  N N    . TYR A 1 13 ? -3.887  -5.583  -11.027 1.00 0.00 ? 18  TYR A N    3  
ATOM 3627  C CA   . TYR A 1 13 ? -3.210  -5.909  -12.276 1.00 0.00 ? 18  TYR A CA   3  
ATOM 3628  C C    . TYR A 1 13 ? -2.311  -7.126  -12.085 1.00 0.00 ? 18  TYR A C    3  
ATOM 3629  O O    . TYR A 1 13 ? -2.240  -8.000  -12.951 1.00 0.00 ? 18  TYR A O    3  
ATOM 3630  C CB   . TYR A 1 13 ? -2.396  -4.694  -12.749 1.00 0.00 ? 18  TYR A CB   3  
ATOM 3631  C CG   . TYR A 1 13 ? -1.548  -4.933  -13.977 1.00 0.00 ? 18  TYR A CG   3  
ATOM 3632  C CD1  . TYR A 1 13 ? -2.118  -5.033  -15.239 1.00 0.00 ? 18  TYR A CD1  3  
ATOM 3633  C CD2  . TYR A 1 13 ? -0.167  -5.056  -13.871 1.00 0.00 ? 18  TYR A CD2  3  
ATOM 3634  C CE1  . TYR A 1 13 ? -1.339  -5.246  -16.359 1.00 0.00 ? 18  TYR A CE1  3  
ATOM 3635  C CE2  . TYR A 1 13 ? 0.619   -5.271  -14.986 1.00 0.00 ? 18  TYR A CE2  3  
ATOM 3636  C CZ   . TYR A 1 13 ? 0.028   -5.365  -16.228 1.00 0.00 ? 18  TYR A CZ   3  
ATOM 3637  O OH   . TYR A 1 13 ? 0.807   -5.577  -17.342 1.00 0.00 ? 18  TYR A OH   3  
ATOM 3638  H H    . TYR A 1 13 ? -3.595  -4.792  -10.526 1.00 0.00 ? 18  TYR A H    3  
ATOM 3639  H HA   . TYR A 1 13 ? -3.962  -6.151  -13.001 1.00 0.00 ? 18  TYR A HA   3  
ATOM 3640  H HB2  . TYR A 1 13 ? -3.076  -3.888  -12.977 1.00 0.00 ? 18  TYR A HB2  3  
ATOM 3641  H HB3  . TYR A 1 13 ? -1.740  -4.382  -11.950 1.00 0.00 ? 18  TYR A HB3  3  
ATOM 3642  H HD1  . TYR A 1 13 ? -3.190  -4.937  -15.338 1.00 0.00 ? 18  TYR A HD1  3  
ATOM 3643  H HD2  . TYR A 1 13 ? 0.293   -4.984  -12.896 1.00 0.00 ? 18  TYR A HD2  3  
ATOM 3644  H HE1  . TYR A 1 13 ? -1.803  -5.319  -17.332 1.00 0.00 ? 18  TYR A HE1  3  
ATOM 3645  H HE2  . TYR A 1 13 ? 1.690   -5.364  -14.882 1.00 0.00 ? 18  TYR A HE2  3  
ATOM 3646  H HH   . TYR A 1 13 ? 1.376   -4.817  -17.485 1.00 0.00 ? 18  TYR A HH   3  
ATOM 3647  N N    . LEU A 1 14 ? -1.651  -7.183  -10.931 1.00 0.00 ? 19  LEU A N    3  
ATOM 3648  C CA   . LEU A 1 14 ? -0.777  -8.298  -10.593 1.00 0.00 ? 19  LEU A CA   3  
ATOM 3649  C C    . LEU A 1 14 ? -1.601  -9.571  -10.415 1.00 0.00 ? 19  LEU A C    3  
ATOM 3650  O O    . LEU A 1 14 ? -1.131  -10.668 -10.716 1.00 0.00 ? 19  LEU A O    3  
ATOM 3651  C CB   . LEU A 1 14 ? -0.016  -8.008  -9.296  1.00 0.00 ? 19  LEU A CB   3  
ATOM 3652  C CG   . LEU A 1 14 ? 0.634   -6.629  -9.209  1.00 0.00 ? 19  LEU A CG   3  
ATOM 3653  C CD1  . LEU A 1 14 ? 1.171   -6.384  -7.812  1.00 0.00 ? 19  LEU A CD1  3  
ATOM 3654  C CD2  . LEU A 1 14 ? 1.741   -6.482  -10.243 1.00 0.00 ? 19  LEU A CD2  3  
ATOM 3655  H H    . LEU A 1 14 ? -1.770  -6.462  -10.281 1.00 0.00 ? 19  LEU A H    3  
ATOM 3656  H HA   . LEU A 1 14 ? -0.073  -8.438  -11.400 1.00 0.00 ? 19  LEU A HA   3  
ATOM 3657  H HB2  . LEU A 1 14 ? -0.707  -8.107  -8.470  1.00 0.00 ? 19  LEU A HB2  3  
ATOM 3658  H HB3  . LEU A 1 14 ? 0.758   -8.751  -9.184  1.00 0.00 ? 19  LEU A HB3  3  
ATOM 3659  H HG   . LEU A 1 14 ? -0.108  -5.880  -9.409  1.00 0.00 ? 19  LEU A HG   3  
ATOM 3660  H HD11 . LEU A 1 14 ? 1.283   -5.319  -7.651  1.00 0.00 ? 19  LEU A HD11 3  
ATOM 3661  H HD12 . LEU A 1 14 ? 2.131   -6.868  -7.706  1.00 0.00 ? 19  LEU A HD12 3  
ATOM 3662  H HD13 . LEU A 1 14 ? 0.480   -6.790  -7.079  1.00 0.00 ? 19  LEU A HD13 3  
ATOM 3663  H HD21 . LEU A 1 14 ? 2.674   -6.832  -9.825  1.00 0.00 ? 19  LEU A HD21 3  
ATOM 3664  H HD22 . LEU A 1 14 ? 1.838   -5.441  -10.518 1.00 0.00 ? 19  LEU A HD22 3  
ATOM 3665  H HD23 . LEU A 1 14 ? 1.497   -7.065  -11.119 1.00 0.00 ? 19  LEU A HD23 3  
ATOM 3666  N N    . GLU A 1 15 ? -2.836  -9.408  -9.912  1.00 0.00 ? 20  GLU A N    3  
ATOM 3667  C CA   . GLU A 1 15 ? -3.738  -10.547 -9.677  1.00 0.00 ? 20  GLU A CA   3  
ATOM 3668  C C    . GLU A 1 15 ? -3.677  -11.568 -10.814 1.00 0.00 ? 20  GLU A C    3  
ATOM 3669  O O    . GLU A 1 15 ? -3.509  -12.763 -10.570 1.00 0.00 ? 20  GLU A O    3  
ATOM 3670  C CB   . GLU A 1 15 ? -5.183  -10.069 -9.489  1.00 0.00 ? 20  GLU A CB   3  
ATOM 3671  C CG   . GLU A 1 15 ? -5.427  -9.312  -8.187  1.00 0.00 ? 20  GLU A CG   3  
ATOM 3672  C CD   . GLU A 1 15 ? -5.307  -10.190 -6.952  1.00 0.00 ? 20  GLU A CD   3  
ATOM 3673  O OE1  . GLU A 1 15 ? -4.210  -10.735 -6.708  1.00 0.00 ? 20  GLU A OE1  3  
ATOM 3674  O OE2  . GLU A 1 15 ? -6.314  -10.329 -6.227  1.00 0.00 ? 20  GLU A OE2  3  
ATOM 3675  H H    . GLU A 1 15 ? -3.148  -8.490  -9.686  1.00 0.00 ? 20  GLU A H    3  
ATOM 3676  H HA   . GLU A 1 15 ? -3.414  -11.031 -8.771  1.00 0.00 ? 20  GLU A HA   3  
ATOM 3677  H HB2  . GLU A 1 15 ? -5.444  -9.419  -10.309 1.00 0.00 ? 20  GLU A HB2  3  
ATOM 3678  H HB3  . GLU A 1 15 ? -5.836  -10.930 -9.504  1.00 0.00 ? 20  GLU A HB3  3  
ATOM 3679  H HG2  . GLU A 1 15 ? -4.705  -8.515  -8.112  1.00 0.00 ? 20  GLU A HG2  3  
ATOM 3680  H HG3  . GLU A 1 15 ? -6.423  -8.890  -8.216  1.00 0.00 ? 20  GLU A HG3  3  
ATOM 3681  N N    . ARG A 1 16 ? -3.807  -11.090 -12.053 1.00 0.00 ? 21  ARG A N    3  
ATOM 3682  C CA   . ARG A 1 16 ? -3.759  -11.969 -13.221 1.00 0.00 ? 21  ARG A CA   3  
ATOM 3683  C C    . ARG A 1 16 ? -2.342  -12.491 -13.452 1.00 0.00 ? 21  ARG A C    3  
ATOM 3684  O O    . ARG A 1 16 ? -1.417  -11.660 -13.591 1.00 0.00 ? 21  ARG A O    3  
ATOM 3685  C CB   . ARG A 1 16 ? -4.254  -11.233 -14.467 1.00 0.00 ? 21  ARG A CB   3  
ATOM 3686  C CG   . ARG A 1 16 ? -5.709  -10.794 -14.383 1.00 0.00 ? 21  ARG A CG   3  
ATOM 3687  C CD   . ARG A 1 16 ? -6.144  -10.012 -15.617 1.00 0.00 ? 21  ARG A CD   3  
ATOM 3688  N NE   . ARG A 1 16 ? -5.375  -8.777  -15.796 1.00 0.00 ? 21  ARG A NE   3  
ATOM 3689  C CZ   . ARG A 1 16 ? -4.163  -8.714  -16.360 1.00 0.00 ? 21  ARG A CZ   3  
ATOM 3690  N NH1  . ARG A 1 16 ? -3.610  -9.791  -16.914 1.00 0.00 ? 21  ARG A NH1  3  
ATOM 3691  N NH2  . ARG A 1 16 ? -3.518  -7.557  -16.399 1.00 0.00 ? 21  ARG A NH2  3  
ATOM 3692  O OXT  . ARG A 1 16 ? -2.168  -13.727 -13.490 1.00 0.00 ? 21  ARG A OXT  3  
ATOM 3693  H H    . ARG A 1 16 ? -3.933  -10.127 -12.184 1.00 0.00 ? 21  ARG A H    3  
ATOM 3694  H HA   . ARG A 1 16 ? -4.410  -12.809 -13.027 1.00 0.00 ? 21  ARG A HA   3  
ATOM 3695  H HB2  . ARG A 1 16 ? -3.643  -10.357 -14.617 1.00 0.00 ? 21  ARG A HB2  3  
ATOM 3696  H HB3  . ARG A 1 16 ? -4.149  -11.886 -15.321 1.00 0.00 ? 21  ARG A HB3  3  
ATOM 3697  H HG2  . ARG A 1 16 ? -6.332  -11.670 -14.287 1.00 0.00 ? 21  ARG A HG2  3  
ATOM 3698  H HG3  . ARG A 1 16 ? -5.832  -10.167 -13.510 1.00 0.00 ? 21  ARG A HG3  3  
ATOM 3699  H HD2  . ARG A 1 16 ? -6.011  -10.637 -16.487 1.00 0.00 ? 21  ARG A HD2  3  
ATOM 3700  H HD3  . ARG A 1 16 ? -7.189  -9.760  -15.514 1.00 0.00 ? 21  ARG A HD3  3  
ATOM 3701  H HE   . ARG A 1 16 ? -5.770  -7.952  -15.449 1.00 0.00 ? 21  ARG A HE   3  
ATOM 3702  H HH11 . ARG A 1 16 ? -4.098  -10.662 -16.918 1.00 0.00 ? 21  ARG A HH11 3  
ATOM 3703  H HH12 . ARG A 1 16 ? -2.702  -9.728  -17.329 1.00 0.00 ? 21  ARG A HH12 3  
ATOM 3704  H HH21 . ARG A 1 16 ? -3.936  -6.738  -16.009 1.00 0.00 ? 21  ARG A HH21 3  
ATOM 3705  H HH22 . ARG A 1 16 ? -2.610  -7.504  -16.818 1.00 0.00 ? 21  ARG A HH22 3  
ATOM 3706  N N    . SER B 2 1  ? 13.039  14.242  -16.805 1.00 0.00 ? 295 SER B N    3  
ATOM 3707  C CA   . SER B 2 1  ? 12.688  15.285  -15.798 1.00 0.00 ? 295 SER B CA   3  
ATOM 3708  C C    . SER B 2 1  ? 12.250  14.660  -14.472 1.00 0.00 ? 295 SER B C    3  
ATOM 3709  O O    . SER B 2 1  ? 12.142  13.436  -14.358 1.00 0.00 ? 295 SER B O    3  
ATOM 3710  C CB   . SER B 2 1  ? 11.566  16.161  -16.367 1.00 0.00 ? 295 SER B CB   3  
ATOM 3711  O OG   . SER B 2 1  ? 11.991  16.842  -17.536 1.00 0.00 ? 295 SER B OG   3  
ATOM 3712  H H1   . SER B 2 1  ? 13.580  13.500  -16.318 1.00 0.00 ? 295 SER B H1   3  
ATOM 3713  H H2   . SER B 2 1  ? 13.609  14.697  -17.546 1.00 0.00 ? 295 SER B H2   3  
ATOM 3714  H H3   . SER B 2 1  ? 12.151  13.862  -17.193 1.00 0.00 ? 295 SER B H3   3  
ATOM 3715  H HA   . SER B 2 1  ? 13.560  15.897  -15.625 1.00 0.00 ? 295 SER B HA   3  
ATOM 3716  H HB2  . SER B 2 1  ? 10.719  15.540  -16.617 1.00 0.00 ? 295 SER B HB2  3  
ATOM 3717  H HB3  . SER B 2 1  ? 11.271  16.889  -15.627 1.00 0.00 ? 295 SER B HB3  3  
ATOM 3718  H HG   . SER B 2 1  ? 12.008  16.230  -18.276 1.00 0.00 ? 295 SER B HG   3  
ATOM 3719  N N    . LEU B 2 2  ? 12.007  15.509  -13.472 1.00 0.00 ? 296 LEU B N    3  
ATOM 3720  C CA   . LEU B 2 2  ? 11.587  15.044  -12.152 1.00 0.00 ? 296 LEU B CA   3  
ATOM 3721  C C    . LEU B 2 2  ? 10.129  15.416  -11.879 1.00 0.00 ? 296 LEU B C    3  
ATOM 3722  O O    . LEU B 2 2  ? 9.270   14.538  -11.789 1.00 0.00 ? 296 LEU B O    3  
ATOM 3723  C CB   . LEU B 2 2  ? 12.498  15.636  -11.070 1.00 0.00 ? 296 LEU B CB   3  
ATOM 3724  C CG   . LEU B 2 2  ? 13.994  15.359  -11.253 1.00 0.00 ? 296 LEU B CG   3  
ATOM 3725  C CD1  . LEU B 2 2  ? 14.800  16.038  -10.155 1.00 0.00 ? 296 LEU B CD1  3  
ATOM 3726  C CD2  . LEU B 2 2  ? 14.266  13.861  -11.268 1.00 0.00 ? 296 LEU B CD2  3  
ATOM 3727  H H    . LEU B 2 2  ? 12.115  16.472  -13.626 1.00 0.00 ? 296 LEU B H    3  
ATOM 3728  H HA   . LEU B 2 2  ? 11.678  13.968  -12.135 1.00 0.00 ? 296 LEU B HA   3  
ATOM 3729  H HB2  . LEU B 2 2  ? 12.351  16.705  -11.051 1.00 0.00 ? 296 LEU B HB2  3  
ATOM 3730  H HB3  . LEU B 2 2  ? 12.195  15.232  -10.114 1.00 0.00 ? 296 LEU B HB3  3  
ATOM 3731  H HG   . LEU B 2 2  ? 14.313  15.768  -12.200 1.00 0.00 ? 296 LEU B HG   3  
ATOM 3732  H HD11 . LEU B 2 2  ? 14.335  16.977  -9.895  1.00 0.00 ? 296 LEU B HD11 3  
ATOM 3733  H HD12 . LEU B 2 2  ? 15.805  16.219  -10.508 1.00 0.00 ? 296 LEU B HD12 3  
ATOM 3734  H HD13 . LEU B 2 2  ? 14.834  15.398  -9.285  1.00 0.00 ? 296 LEU B HD13 3  
ATOM 3735  H HD21 . LEU B 2 2  ? 13.617  13.384  -11.989 1.00 0.00 ? 296 LEU B HD21 3  
ATOM 3736  H HD22 . LEU B 2 2  ? 14.078  13.449  -10.288 1.00 0.00 ? 296 LEU B HD22 3  
ATOM 3737  H HD23 . LEU B 2 2  ? 15.296  13.686  -11.542 1.00 0.00 ? 296 LEU B HD23 3  
ATOM 3738  N N    . GLN B 2 3  ? 9.863   16.725  -11.755 1.00 0.00 ? 297 GLN B N    3  
ATOM 3739  C CA   . GLN B 2 3  ? 8.519   17.240  -11.504 1.00 0.00 ? 297 GLN B CA   3  
ATOM 3740  C C    . GLN B 2 3  ? 8.110   17.042  -10.040 1.00 0.00 ? 297 GLN B C    3  
ATOM 3741  O O    . GLN B 2 3  ? 8.226   17.961  -9.228  1.00 0.00 ? 297 GLN B O    3  
ATOM 3742  C CB   . GLN B 2 3  ? 7.498   16.591  -12.444 1.00 0.00 ? 297 GLN B CB   3  
ATOM 3743  C CG   . GLN B 2 3  ? 7.826   16.744  -13.920 1.00 0.00 ? 297 GLN B CG   3  
ATOM 3744  C CD   . GLN B 2 3  ? 6.863   15.982  -14.812 1.00 0.00 ? 297 GLN B CD   3  
ATOM 3745  O OE1  . GLN B 2 3  ? 6.766   14.757  -14.734 1.00 0.00 ? 297 GLN B OE1  3  
ATOM 3746  N NE2  . GLN B 2 3  ? 6.141   16.702  -15.665 1.00 0.00 ? 297 GLN B NE2  3  
ATOM 3747  H H    . GLN B 2 3  ? 10.590  17.365  -11.848 1.00 0.00 ? 297 GLN B H    3  
ATOM 3748  H HA   . GLN B 2 3  ? 8.542   18.301  -11.706 1.00 0.00 ? 297 GLN B HA   3  
ATOM 3749  H HB2  . GLN B 2 3  ? 7.432   15.538  -12.219 1.00 0.00 ? 297 GLN B HB2  3  
ATOM 3750  H HB3  . GLN B 2 3  ? 6.542   17.045  -12.265 1.00 0.00 ? 297 GLN B HB3  3  
ATOM 3751  H HG2  . GLN B 2 3  ? 7.782   17.791  -14.180 1.00 0.00 ? 297 GLN B HG2  3  
ATOM 3752  H HG3  . GLN B 2 3  ? 8.827   16.373  -14.095 1.00 0.00 ? 297 GLN B HG3  3  
ATOM 3753  H HE21 . GLN B 2 3  ? 6.266   17.674  -15.675 1.00 0.00 ? 297 GLN B HE21 3  
ATOM 3754  H HE22 . GLN B 2 3  ? 5.513   16.230  -16.251 1.00 0.00 ? 297 GLN B HE22 3  
ATOM 3755  N N    . ASN B 2 4  ? 7.628   15.839  -9.719  1.00 0.00 ? 298 ASN B N    3  
ATOM 3756  C CA   . ASN B 2 4  ? 7.187   15.501  -8.359  1.00 0.00 ? 298 ASN B CA   3  
ATOM 3757  C C    . ASN B 2 4  ? 7.357   14.004  -8.045  1.00 0.00 ? 298 ASN B C    3  
ATOM 3758  O O    . ASN B 2 4  ? 7.515   13.629  -6.881  1.00 0.00 ? 298 ASN B O    3  
ATOM 3759  C CB   . ASN B 2 4  ? 5.719   15.897  -8.160  1.00 0.00 ? 298 ASN B CB   3  
ATOM 3760  C CG   . ASN B 2 4  ? 5.496   17.397  -8.257  1.00 0.00 ? 298 ASN B CG   3  
ATOM 3761  O OD1  . ASN B 2 4  ? 6.017   18.167  -7.448  1.00 0.00 ? 298 ASN B OD1  3  
ATOM 3762  N ND2  . ASN B 2 4  ? 4.723   17.822  -9.250  1.00 0.00 ? 298 ASN B ND2  3  
ATOM 3763  H H    . ASN B 2 4  ? 7.562   15.164  -10.420 1.00 0.00 ? 298 ASN B H    3  
ATOM 3764  H HA   . ASN B 2 4  ? 7.793   16.068  -7.668  1.00 0.00 ? 298 ASN B HA   3  
ATOM 3765  H HB2  . ASN B 2 4  ? 5.118   15.415  -8.916  1.00 0.00 ? 298 ASN B HB2  3  
ATOM 3766  H HB3  . ASN B 2 4  ? 5.394   15.567  -7.185  1.00 0.00 ? 298 ASN B HB3  3  
ATOM 3767  H HD21 . ASN B 2 4  ? 4.341   17.155  -9.860  1.00 0.00 ? 298 ASN B HD21 3  
ATOM 3768  H HD22 . ASN B 2 4  ? 4.563   18.785  -9.332  1.00 0.00 ? 298 ASN B HD22 3  
ATOM 3769  N N    . ASN B 2 5  ? 7.319   13.155  -9.078  1.00 0.00 ? 299 ASN B N    3  
ATOM 3770  C CA   . ASN B 2 5  ? 7.462   11.712  -8.909  1.00 0.00 ? 299 ASN B CA   3  
ATOM 3771  C C    . ASN B 2 5  ? 7.992   11.080  -10.200 1.00 0.00 ? 299 ASN B C    3  
ATOM 3772  O O    . ASN B 2 5  ? 8.373   11.792  -11.131 1.00 0.00 ? 299 ASN B O    3  
ATOM 3773  C CB   . ASN B 2 5  ? 6.115   11.084  -8.525  1.00 0.00 ? 299 ASN B CB   3  
ATOM 3774  C CG   . ASN B 2 5  ? 5.038   11.323  -9.570  1.00 0.00 ? 299 ASN B CG   3  
ATOM 3775  O OD1  . ASN B 2 5  ? 4.642   12.462  -9.821  1.00 0.00 ? 299 ASN B OD1  3  
ATOM 3776  N ND2  . ASN B 2 5  ? 4.560   10.248  -10.192 1.00 0.00 ? 299 ASN B ND2  3  
ATOM 3777  H H    . ASN B 2 5  ? 7.182   13.503  -9.978  1.00 0.00 ? 299 ASN B H    3  
ATOM 3778  H HA   . ASN B 2 5  ? 8.175   11.537  -8.116  1.00 0.00 ? 299 ASN B HA   3  
ATOM 3779  H HB2  . ASN B 2 5  ? 6.242   10.018  -8.404  1.00 0.00 ? 299 ASN B HB2  3  
ATOM 3780  H HB3  . ASN B 2 5  ? 5.783   11.509  -7.589  1.00 0.00 ? 299 ASN B HB3  3  
ATOM 3781  H HD21 . ASN B 2 5  ? 4.922   9.371   -9.948  1.00 0.00 ? 299 ASN B HD21 3  
ATOM 3782  H HD22 . ASN B 2 5  ? 3.866   10.378  -10.871 1.00 0.00 ? 299 ASN B HD22 3  
ATOM 3783  N N    . GLN B 2 6  ? 8.026   9.748   -10.252 1.00 0.00 ? 300 GLN B N    3  
ATOM 3784  C CA   . GLN B 2 6  ? 8.526   9.052   -11.434 1.00 0.00 ? 300 GLN B CA   3  
ATOM 3785  C C    . GLN B 2 6  ? 7.927   7.653   -11.567 1.00 0.00 ? 300 GLN B C    3  
ATOM 3786  O O    . GLN B 2 6  ? 7.627   6.998   -10.567 1.00 0.00 ? 300 GLN B O    3  
ATOM 3787  C CB   . GLN B 2 6  ? 10.050  8.955   -11.380 1.00 0.00 ? 300 GLN B CB   3  
ATOM 3788  C CG   . GLN B 2 6  ? 10.549  8.252   -10.134 1.00 0.00 ? 300 GLN B CG   3  
ATOM 3789  C CD   . GLN B 2 6  ? 12.066  8.092   -10.068 1.00 0.00 ? 300 GLN B CD   3  
ATOM 3790  O OE1  . GLN B 2 6  ? 12.591  7.558   -9.091  1.00 0.00 ? 300 GLN B OE1  3  
ATOM 3791  N NE2  . GLN B 2 6  ? 12.784  8.544   -11.097 1.00 0.00 ? 300 GLN B NE2  3  
ATOM 3792  H H    . GLN B 2 6  ? 7.719   9.228   -9.481  1.00 0.00 ? 300 GLN B H    3  
ATOM 3793  H HA   . GLN B 2 6  ? 8.252   9.628   -12.293 1.00 0.00 ? 300 GLN B HA   3  
ATOM 3794  H HB2  . GLN B 2 6  ? 10.398  8.409   -12.245 1.00 0.00 ? 300 GLN B HB2  3  
ATOM 3795  H HB3  . GLN B 2 6  ? 10.466  9.951   -11.399 1.00 0.00 ? 300 GLN B HB3  3  
ATOM 3796  H HG2  . GLN B 2 6  ? 10.229  8.819   -9.278  1.00 0.00 ? 300 GLN B HG2  3  
ATOM 3797  H HG3  . GLN B 2 6  ? 10.098  7.272   -10.100 1.00 0.00 ? 300 GLN B HG3  3  
ATOM 3798  H HE21 . GLN B 2 6  ? 12.317  8.956   -11.852 1.00 0.00 ? 300 GLN B HE21 3  
ATOM 3799  H HE22 . GLN B 2 6  ? 13.759  8.442   -11.058 1.00 0.00 ? 300 GLN B HE22 3  
ATOM 3800  N N    . PRO B 2 7  ? 7.762   7.172   -12.818 1.00 0.00 ? 301 PRO B N    3  
ATOM 3801  C CA   . PRO B 2 7  ? 7.211   5.837   -13.096 1.00 0.00 ? 301 PRO B CA   3  
ATOM 3802  C C    . PRO B 2 7  ? 8.091   4.712   -12.541 1.00 0.00 ? 301 PRO B C    3  
ATOM 3803  O O    . PRO B 2 7  ? 7.641   3.572   -12.419 1.00 0.00 ? 301 PRO B O    3  
ATOM 3804  C CB   . PRO B 2 7  ? 7.163   5.771   -14.630 1.00 0.00 ? 301 PRO B CB   3  
ATOM 3805  C CG   . PRO B 2 7  ? 7.268   7.185   -15.087 1.00 0.00 ? 301 PRO B CG   3  
ATOM 3806  C CD   . PRO B 2 7  ? 8.104   7.886   -14.059 1.00 0.00 ? 301 PRO B CD   3  
ATOM 3807  H HA   . PRO B 2 7  ? 6.212   5.736   -12.699 1.00 0.00 ? 301 PRO B HA   3  
ATOM 3808  H HB2  . PRO B 2 7  ? 7.990   5.177   -14.993 1.00 0.00 ? 301 PRO B HB2  3  
ATOM 3809  H HB3  . PRO B 2 7  ? 6.231   5.324   -14.942 1.00 0.00 ? 301 PRO B HB3  3  
ATOM 3810  H HG2  . PRO B 2 7  ? 7.747   7.225   -16.054 1.00 0.00 ? 301 PRO B HG2  3  
ATOM 3811  H HG3  . PRO B 2 7  ? 6.284   7.629   -15.137 1.00 0.00 ? 301 PRO B HG3  3  
ATOM 3812  H HD2  . PRO B 2 7  ? 9.154   7.783   -14.290 1.00 0.00 ? 301 PRO B HD2  3  
ATOM 3813  H HD3  . PRO B 2 7  ? 7.829   8.928   -13.994 1.00 0.00 ? 301 PRO B HD3  3  
ATOM 3814  N N    . VAL B 2 8  ? 9.344   5.038   -12.197 1.00 0.00 ? 302 VAL B N    3  
ATOM 3815  C CA   . VAL B 2 8  ? 10.272  4.054   -11.643 1.00 0.00 ? 302 VAL B CA   3  
ATOM 3816  C C    . VAL B 2 8  ? 9.734   3.500   -10.326 1.00 0.00 ? 302 VAL B C    3  
ATOM 3817  O O    . VAL B 2 8  ? 9.801   2.296   -10.073 1.00 0.00 ? 302 VAL B O    3  
ATOM 3818  C CB   . VAL B 2 8  ? 11.672  4.663   -11.401 1.00 0.00 ? 302 VAL B CB   3  
ATOM 3819  C CG1  . VAL B 2 8  ? 12.633  3.615   -10.861 1.00 0.00 ? 302 VAL B CG1  3  
ATOM 3820  C CG2  . VAL B 2 8  ? 12.217  5.287   -12.680 1.00 0.00 ? 302 VAL B CG2  3  
ATOM 3821  H H    . VAL B 2 8  ? 9.647   5.963   -12.310 1.00 0.00 ? 302 VAL B H    3  
ATOM 3822  H HA   . VAL B 2 8  ? 10.368  3.245   -12.353 1.00 0.00 ? 302 VAL B HA   3  
ATOM 3823  H HB   . VAL B 2 8  ? 11.576  5.444   -10.660 1.00 0.00 ? 302 VAL B HB   3  
ATOM 3824  H HG11 . VAL B 2 8  ? 12.514  3.533   -9.790  1.00 0.00 ? 302 VAL B HG11 3  
ATOM 3825  H HG12 . VAL B 2 8  ? 13.649  3.906   -11.088 1.00 0.00 ? 302 VAL B HG12 3  
ATOM 3826  H HG13 . VAL B 2 8  ? 12.423  2.661   -11.321 1.00 0.00 ? 302 VAL B HG13 3  
ATOM 3827  H HG21 . VAL B 2 8  ? 13.162  5.767   -12.471 1.00 0.00 ? 302 VAL B HG21 3  
ATOM 3828  H HG22 . VAL B 2 8  ? 11.517  6.020   -13.051 1.00 0.00 ? 302 VAL B HG22 3  
ATOM 3829  H HG23 . VAL B 2 8  ? 12.361  4.517   -13.424 1.00 0.00 ? 302 VAL B HG23 3  
ATOM 3830  N N    . GLU B 2 9  ? 9.179   4.391   -9.499  1.00 0.00 ? 303 GLU B N    3  
ATOM 3831  C CA   . GLU B 2 9  ? 8.602   4.002   -8.214  1.00 0.00 ? 303 GLU B CA   3  
ATOM 3832  C C    . GLU B 2 9  ? 7.412   3.064   -8.421  1.00 0.00 ? 303 GLU B C    3  
ATOM 3833  O O    . GLU B 2 9  ? 7.153   2.188   -7.592  1.00 0.00 ? 303 GLU B O    3  
ATOM 3834  C CB   . GLU B 2 9  ? 8.154   5.240   -7.435  1.00 0.00 ? 303 GLU B CB   3  
ATOM 3835  C CG   . GLU B 2 9  ? 9.291   6.186   -7.098  1.00 0.00 ? 303 GLU B CG   3  
ATOM 3836  C CD   . GLU B 2 9  ? 8.822   7.432   -6.367  1.00 0.00 ? 303 GLU B CD   3  
ATOM 3837  O OE1  . GLU B 2 9  ? 8.282   7.298   -5.248  1.00 0.00 ? 303 GLU B OE1  3  
ATOM 3838  O OE2  . GLU B 2 9  ? 8.993   8.540   -6.917  1.00 0.00 ? 303 GLU B OE2  3  
ATOM 3839  H H    . GLU B 2 9  ? 9.144   5.334   -9.769  1.00 0.00 ? 303 GLU B H    3  
ATOM 3840  H HA   . GLU B 2 9  ? 9.364   3.487   -7.650  1.00 0.00 ? 303 GLU B HA   3  
ATOM 3841  H HB2  . GLU B 2 9  ? 7.427   5.779   -8.023  1.00 0.00 ? 303 GLU B HB2  3  
ATOM 3842  H HB3  . GLU B 2 9  ? 7.693   4.921   -6.511  1.00 0.00 ? 303 GLU B HB3  3  
ATOM 3843  H HG2  . GLU B 2 9  ? 9.999   5.664   -6.472  1.00 0.00 ? 303 GLU B HG2  3  
ATOM 3844  H HG3  . GLU B 2 9  ? 9.778   6.486   -8.015  1.00 0.00 ? 303 GLU B HG3  3  
ATOM 3845  N N    . PHE B 2 10 ? 6.694   3.258   -9.532  1.00 0.00 ? 304 PHE B N    3  
ATOM 3846  C CA   . PHE B 2 10 ? 5.529   2.437   -9.859  1.00 0.00 ? 304 PHE B CA   3  
ATOM 3847  C C    . PHE B 2 10 ? 5.918   0.966   -9.958  1.00 0.00 ? 304 PHE B C    3  
ATOM 3848  O O    . PHE B 2 10 ? 5.437   0.144   -9.182  1.00 0.00 ? 304 PHE B O    3  
ATOM 3849  C CB   . PHE B 2 10 ? 4.890   2.922   -11.168 1.00 0.00 ? 304 PHE B CB   3  
ATOM 3850  C CG   . PHE B 2 10 ? 3.625   2.203   -11.546 1.00 0.00 ? 304 PHE B CG   3  
ATOM 3851  C CD1  . PHE B 2 10 ? 3.668   0.945   -12.128 1.00 0.00 ? 304 PHE B CD1  3  
ATOM 3852  C CD2  . PHE B 2 10 ? 2.391   2.787   -11.316 1.00 0.00 ? 304 PHE B CD2  3  
ATOM 3853  C CE1  . PHE B 2 10 ? 2.503   0.288   -12.476 1.00 0.00 ? 304 PHE B CE1  3  
ATOM 3854  C CE2  . PHE B 2 10 ? 1.224   2.133   -11.660 1.00 0.00 ? 304 PHE B CE2  3  
ATOM 3855  C CZ   . PHE B 2 10 ? 1.280   0.882   -12.243 1.00 0.00 ? 304 PHE B CZ   3  
ATOM 3856  H H    . PHE B 2 10 ? 6.953   3.972   -10.149 1.00 0.00 ? 304 PHE B H    3  
ATOM 3857  H HA   . PHE B 2 10 ? 4.815   2.548   -9.060  1.00 0.00 ? 304 PHE B HA   3  
ATOM 3858  H HB2  . PHE B 2 10 ? 4.656   3.972   -11.074 1.00 0.00 ? 304 PHE B HB2  3  
ATOM 3859  H HB3  . PHE B 2 10 ? 5.599   2.791   -11.972 1.00 0.00 ? 304 PHE B HB3  3  
ATOM 3860  H HD1  . PHE B 2 10 ? 4.625   0.479   -12.312 1.00 0.00 ? 304 PHE B HD1  3  
ATOM 3861  H HD2  . PHE B 2 10 ? 2.347   3.765   -10.858 1.00 0.00 ? 304 PHE B HD2  3  
ATOM 3862  H HE1  . PHE B 2 10 ? 2.551   -0.691  -12.930 1.00 0.00 ? 304 PHE B HE1  3  
ATOM 3863  H HE2  . PHE B 2 10 ? 0.268   2.601   -11.476 1.00 0.00 ? 304 PHE B HE2  3  
ATOM 3864  H HZ   . PHE B 2 10 ? 0.369   0.370   -12.514 1.00 0.00 ? 304 PHE B HZ   3  
ATOM 3865  N N    . ASN B 2 11 ? 6.799   0.635   -10.900 1.00 0.00 ? 305 ASN B N    3  
ATOM 3866  C CA   . ASN B 2 11 ? 7.245   -0.746  -11.070 1.00 0.00 ? 305 ASN B CA   3  
ATOM 3867  C C    . ASN B 2 11 ? 7.873   -1.284  -9.781  1.00 0.00 ? 305 ASN B C    3  
ATOM 3868  O O    . ASN B 2 11 ? 7.775   -2.476  -9.491  1.00 0.00 ? 305 ASN B O    3  
ATOM 3869  C CB   . ASN B 2 11 ? 8.246   -0.853  -12.226 1.00 0.00 ? 305 ASN B CB   3  
ATOM 3870  C CG   . ASN B 2 11 ? 8.731   -2.277  -12.446 1.00 0.00 ? 305 ASN B CG   3  
ATOM 3871  O OD1  . ASN B 2 11 ? 7.943   -3.172  -12.754 1.00 0.00 ? 305 ASN B OD1  3  
ATOM 3872  N ND2  . ASN B 2 11 ? 10.032  -2.495  -12.285 1.00 0.00 ? 305 ASN B ND2  3  
ATOM 3873  H H    . ASN B 2 11 ? 7.161   1.333   -11.486 1.00 0.00 ? 305 ASN B H    3  
ATOM 3874  H HA   . ASN B 2 11 ? 6.374   -1.342  -11.302 1.00 0.00 ? 305 ASN B HA   3  
ATOM 3875  H HB2  . ASN B 2 11 ? 7.775   -0.509  -13.134 1.00 0.00 ? 305 ASN B HB2  3  
ATOM 3876  H HB3  . ASN B 2 11 ? 9.102   -0.230  -12.010 1.00 0.00 ? 305 ASN B HB3  3  
ATOM 3877  H HD21 . ASN B 2 11 ? 10.603  -1.738  -12.036 1.00 0.00 ? 305 ASN B HD21 3  
ATOM 3878  H HD22 . ASN B 2 11 ? 10.368  -3.405  -12.421 1.00 0.00 ? 305 ASN B HD22 3  
ATOM 3879  N N    . HIS B 2 12 ? 8.514   -0.400  -9.010  1.00 0.00 ? 306 HIS B N    3  
ATOM 3880  C CA   . HIS B 2 12 ? 9.149   -0.792  -7.753  1.00 0.00 ? 306 HIS B CA   3  
ATOM 3881  C C    . HIS B 2 12 ? 8.111   -1.357  -6.785  1.00 0.00 ? 306 HIS B C    3  
ATOM 3882  O O    . HIS B 2 12 ? 8.244   -2.488  -6.314  1.00 0.00 ? 306 HIS B O    3  
ATOM 3883  C CB   . HIS B 2 12 ? 9.868   0.410   -7.124  1.00 0.00 ? 306 HIS B CB   3  
ATOM 3884  C CG   . HIS B 2 12 ? 10.781  0.055   -5.989  1.00 0.00 ? 306 HIS B CG   3  
ATOM 3885  N ND1  . HIS B 2 12 ? 11.427  1.003   -5.223  1.00 0.00 ? 306 HIS B ND1  3  
ATOM 3886  C CD2  . HIS B 2 12 ? 11.171  -1.146  -5.502  1.00 0.00 ? 306 HIS B CD2  3  
ATOM 3887  C CE1  . HIS B 2 12 ? 12.175  0.400   -4.317  1.00 0.00 ? 306 HIS B CE1  3  
ATOM 3888  N NE2  . HIS B 2 12 ? 12.038  -0.904  -4.465  1.00 0.00 ? 306 HIS B NE2  3  
ATOM 3889  H H    . HIS B 2 12 ? 8.557   0.538   -9.293  1.00 0.00 ? 306 HIS B H    3  
ATOM 3890  H HA   . HIS B 2 12 ? 9.868   -1.565  -7.976  1.00 0.00 ? 306 HIS B HA   3  
ATOM 3891  H HB2  . HIS B 2 12 ? 10.461  0.898   -7.881  1.00 0.00 ? 306 HIS B HB2  3  
ATOM 3892  H HB3  . HIS B 2 12 ? 9.130   1.104   -6.752  1.00 0.00 ? 306 HIS B HB3  3  
ATOM 3893  H HD1  . HIS B 2 12 ? 11.350  1.974   -5.328  1.00 0.00 ? 306 HIS B HD1  3  
ATOM 3894  H HD2  . HIS B 2 12 ? 10.859  -2.118  -5.863  1.00 0.00 ? 306 HIS B HD2  3  
ATOM 3895  H HE1  . HIS B 2 12 ? 12.792  0.890   -3.578  1.00 0.00 ? 306 HIS B HE1  3  
ATOM 3896  H HE2  . HIS B 2 12 ? 12.401  -1.581  -3.858  1.00 0.00 ? 306 HIS B HE2  3  
ATOM 3897  N N    . ALA B 2 13 ? 7.064   -0.573  -6.512  1.00 0.00 ? 307 ALA B N    3  
ATOM 3898  C CA   . ALA B 2 13 ? 5.988   -1.009  -5.624  1.00 0.00 ? 307 ALA B CA   3  
ATOM 3899  C C    . ALA B 2 13 ? 5.247   -2.183  -6.240  1.00 0.00 ? 307 ALA B C    3  
ATOM 3900  O O    . ALA B 2 13 ? 4.970   -3.176  -5.578  1.00 0.00 ? 307 ALA B O    3  
ATOM 3901  C CB   . ALA B 2 13 ? 5.014   0.126   -5.359  1.00 0.00 ? 307 ALA B CB   3  
ATOM 3902  H H    . ALA B 2 13 ? 7.006   0.310   -6.934  1.00 0.00 ? 307 ALA B H    3  
ATOM 3903  H HA   . ALA B 2 13 ? 6.423   -1.315  -4.683  1.00 0.00 ? 307 ALA B HA   3  
ATOM 3904  H HB1  . ALA B 2 13 ? 5.278   0.981   -5.965  1.00 0.00 ? 307 ALA B HB1  3  
ATOM 3905  H HB2  . ALA B 2 13 ? 5.053   0.399   -4.315  1.00 0.00 ? 307 ALA B HB2  3  
ATOM 3906  H HB3  . ALA B 2 13 ? 4.014   -0.199  -5.610  1.00 0.00 ? 307 ALA B HB3  3  
ATOM 3907  N N    . ILE B 2 14 ? 4.940   -2.050  -7.524  1.00 0.00 ? 308 ILE B N    3  
ATOM 3908  C CA   . ILE B 2 14 ? 4.238   -3.080  -8.277  1.00 0.00 ? 308 ILE B CA   3  
ATOM 3909  C C    . ILE B 2 14 ? 4.890   -4.440  -8.090  1.00 0.00 ? 308 ILE B C    3  
ATOM 3910  O O    . ILE B 2 14 ? 4.271   -5.370  -7.568  1.00 0.00 ? 308 ILE B O    3  
ATOM 3911  C CB   . ILE B 2 14 ? 4.218   -2.705  -9.770  1.00 0.00 ? 308 ILE B CB   3  
ATOM 3912  C CG1  . ILE B 2 14 ? 3.026   -1.802  -10.065 1.00 0.00 ? 308 ILE B CG1  3  
ATOM 3913  C CG2  . ILE B 2 14 ? 4.186   -3.942  -10.637 1.00 0.00 ? 308 ILE B CG2  3  
ATOM 3914  C CD1  . ILE B 2 14 ? 2.672   -0.888  -8.914  1.00 0.00 ? 308 ILE B CD1  3  
ATOM 3915  H H    . ILE B 2 14 ? 5.201   -1.227  -7.988  1.00 0.00 ? 308 ILE B H    3  
ATOM 3916  H HA   . ILE B 2 14 ? 3.220   -3.124  -7.921  1.00 0.00 ? 308 ILE B HA   3  
ATOM 3917  H HB   . ILE B 2 14 ? 5.126   -2.167  -9.993  1.00 0.00 ? 308 ILE B HB   3  
ATOM 3918  H HG12 . ILE B 2 14 ? 3.255   -1.187  -10.919 1.00 0.00 ? 308 ILE B HG12 3  
ATOM 3919  H HG13 . ILE B 2 14 ? 2.164   -2.413  -10.285 1.00 0.00 ? 308 ILE B HG13 3  
ATOM 3920  H HG21 . ILE B 2 14 ? 4.083   -3.654  -11.671 1.00 0.00 ? 308 ILE B HG21 3  
ATOM 3921  H HG22 . ILE B 2 14 ? 3.342   -4.551  -10.347 1.00 0.00 ? 308 ILE B HG22 3  
ATOM 3922  H HG23 . ILE B 2 14 ? 5.115   -4.497  -10.499 1.00 0.00 ? 308 ILE B HG23 3  
ATOM 3923  H HD11 . ILE B 2 14 ? 3.543   -0.327  -8.621  1.00 0.00 ? 308 ILE B HD11 3  
ATOM 3924  H HD12 . ILE B 2 14 ? 2.331   -1.488  -8.077  1.00 0.00 ? 308 ILE B HD12 3  
ATOM 3925  H HD13 . ILE B 2 14 ? 1.889   -0.212  -9.217  1.00 0.00 ? 308 ILE B HD13 3  
ATOM 3926  N N    . ASN B 2 15 ? 6.147   -4.539  -8.501  1.00 0.00 ? 309 ASN B N    3  
ATOM 3927  C CA   . ASN B 2 15 ? 6.899   -5.772  -8.363  1.00 0.00 ? 309 ASN B CA   3  
ATOM 3928  C C    . ASN B 2 15 ? 7.001   -6.166  -6.887  1.00 0.00 ? 309 ASN B C    3  
ATOM 3929  O O    . ASN B 2 15 ? 7.062   -7.353  -6.559  1.00 0.00 ? 309 ASN B O    3  
ATOM 3930  C CB   . ASN B 2 15 ? 8.269   -5.598  -9.005  1.00 0.00 ? 309 ASN B CB   3  
ATOM 3931  C CG   . ASN B 2 15 ? 8.322   -5.986  -10.482 1.00 0.00 ? 309 ASN B CG   3  
ATOM 3932  O OD1  . ASN B 2 15 ? 9.403   -6.060  -11.064 1.00 0.00 ? 309 ASN B OD1  3  
ATOM 3933  N ND2  . ASN B 2 15 ? 7.167   -6.211  -11.111 1.00 0.00 ? 309 ASN B ND2  3  
ATOM 3934  H H    . ASN B 2 15 ? 6.588   -3.751  -8.892  1.00 0.00 ? 309 ASN B H    3  
ATOM 3935  H HA   . ASN B 2 15 ? 6.360   -6.547  -8.886  1.00 0.00 ? 309 ASN B HA   3  
ATOM 3936  H HB2  . ASN B 2 15 ? 8.525   -4.556  -8.944  1.00 0.00 ? 309 ASN B HB2  3  
ATOM 3937  H HB3  . ASN B 2 15 ? 8.996   -6.183  -8.467  1.00 0.00 ? 309 ASN B HB3  3  
ATOM 3938  H HD21 . ASN B 2 15 ? 6.332   -6.120  -10.610 1.00 0.00 ? 309 ASN B HD21 3  
ATOM 3939  H HD22 . ASN B 2 15 ? 7.202   -6.463  -12.059 1.00 0.00 ? 309 ASN B HD22 3  
ATOM 3940  N N    . TYR B 2 16 ? 6.961   -5.166  -5.996  1.00 0.00 ? 310 TYR B N    3  
ATOM 3941  C CA   . TYR B 2 16 ? 6.981   -5.423  -4.559  1.00 0.00 ? 310 TYR B CA   3  
ATOM 3942  C C    . TYR B 2 16 ? 5.699   -6.154  -4.162  1.00 0.00 ? 310 TYR B C    3  
ATOM 3943  O O    . TYR B 2 16 ? 5.741   -7.160  -3.455  1.00 0.00 ? 310 TYR B O    3  
ATOM 3944  C CB   . TYR B 2 16 ? 7.112   -4.114  -3.764  1.00 0.00 ? 310 TYR B CB   3  
ATOM 3945  C CG   . TYR B 2 16 ? 6.738   -4.250  -2.301  1.00 0.00 ? 310 TYR B CG   3  
ATOM 3946  C CD1  . TYR B 2 16 ? 6.979   -5.428  -1.601  1.00 0.00 ? 310 TYR B CD1  3  
ATOM 3947  C CD2  . TYR B 2 16 ? 6.131   -3.202  -1.624  1.00 0.00 ? 310 TYR B CD2  3  
ATOM 3948  C CE1  . TYR B 2 16 ? 6.627   -5.557  -0.276  1.00 0.00 ? 310 TYR B CE1  3  
ATOM 3949  C CE2  . TYR B 2 16 ? 5.771   -3.326  -0.298  1.00 0.00 ? 310 TYR B CE2  3  
ATOM 3950  C CZ   . TYR B 2 16 ? 6.021   -4.506  0.370   1.00 0.00 ? 310 TYR B CZ   3  
ATOM 3951  O OH   . TYR B 2 16 ? 5.652   -4.639  1.684   1.00 0.00 ? 310 TYR B OH   3  
ATOM 3952  H H    . TYR B 2 16 ? 6.871   -4.244  -6.313  1.00 0.00 ? 310 TYR B H    3  
ATOM 3953  H HA   . TYR B 2 16 ? 7.827   -6.057  -4.345  1.00 0.00 ? 310 TYR B HA   3  
ATOM 3954  H HB2  . TYR B 2 16 ? 8.135   -3.775  -3.811  1.00 0.00 ? 310 TYR B HB2  3  
ATOM 3955  H HB3  . TYR B 2 16 ? 6.472   -3.365  -4.201  1.00 0.00 ? 310 TYR B HB3  3  
ATOM 3956  H HD1  . TYR B 2 16 ? 7.458   -6.251  -2.109  1.00 0.00 ? 310 TYR B HD1  3  
ATOM 3957  H HD2  . TYR B 2 16 ? 5.936   -2.280  -2.150  1.00 0.00 ? 310 TYR B HD2  3  
ATOM 3958  H HE1  . TYR B 2 16 ? 6.827   -6.479  0.250   1.00 0.00 ? 310 TYR B HE1  3  
ATOM 3959  H HE2  . TYR B 2 16 ? 5.301   -2.500  0.210   1.00 0.00 ? 310 TYR B HE2  3  
ATOM 3960  H HH   . TYR B 2 16 ? 6.403   -4.939  2.202   1.00 0.00 ? 310 TYR B HH   3  
ATOM 3961  N N    . VAL B 2 17 ? 4.558   -5.651  -4.653  1.00 0.00 ? 311 VAL B N    3  
ATOM 3962  C CA   . VAL B 2 17 ? 3.265   -6.271  -4.370  1.00 0.00 ? 311 VAL B CA   3  
ATOM 3963  C C    . VAL B 2 17 ? 3.285   -7.726  -4.843  1.00 0.00 ? 311 VAL B C    3  
ATOM 3964  O O    . VAL B 2 17 ? 2.680   -8.596  -4.218  1.00 0.00 ? 311 VAL B O    3  
ATOM 3965  C CB   . VAL B 2 17 ? 2.091   -5.550  -5.077  1.00 0.00 ? 311 VAL B CB   3  
ATOM 3966  C CG1  . VAL B 2 17 ? 0.759   -6.075  -4.574  1.00 0.00 ? 311 VAL B CG1  3  
ATOM 3967  C CG2  . VAL B 2 17 ? 2.140   -4.045  -4.903  1.00 0.00 ? 311 VAL B CG2  3  
ATOM 3968  H H    . VAL B 2 17 ? 4.591   -4.859  -5.226  1.00 0.00 ? 311 VAL B H    3  
ATOM 3969  H HA   . VAL B 2 17 ? 3.099   -6.245  -3.303  1.00 0.00 ? 311 VAL B HA   3  
ATOM 3970  H HB   . VAL B 2 17 ? 2.161   -5.764  -6.128  1.00 0.00 ? 311 VAL B HB   3  
ATOM 3971  H HG11 . VAL B 2 17 ? -0.040  -5.450  -4.956  1.00 0.00 ? 311 VAL B HG11 3  
ATOM 3972  H HG12 . VAL B 2 17 ? 0.752   -6.040  -3.495  1.00 0.00 ? 311 VAL B HG12 3  
ATOM 3973  H HG13 . VAL B 2 17 ? 0.618   -7.097  -4.912  1.00 0.00 ? 311 VAL B HG13 3  
ATOM 3974  H HG21 . VAL B 2 17 ? 2.286   -3.809  -3.863  1.00 0.00 ? 311 VAL B HG21 3  
ATOM 3975  H HG22 . VAL B 2 17 ? 1.202   -3.622  -5.243  1.00 0.00 ? 311 VAL B HG22 3  
ATOM 3976  H HG23 . VAL B 2 17 ? 2.949   -3.634  -5.487  1.00 0.00 ? 311 VAL B HG23 3  
ATOM 3977  N N    . ASN B 2 18 ? 4.004   -7.976  -5.947  1.00 0.00 ? 312 ASN B N    3  
ATOM 3978  C CA   . ASN B 2 18 ? 4.133   -9.319  -6.508  1.00 0.00 ? 312 ASN B CA   3  
ATOM 3979  C C    . ASN B 2 18 ? 4.638   -10.289 -5.437  1.00 0.00 ? 312 ASN B C    3  
ATOM 3980  O O    . ASN B 2 18 ? 4.075   -11.369 -5.260  1.00 0.00 ? 312 ASN B O    3  
ATOM 3981  C CB   . ASN B 2 18 ? 5.083   -9.301  -7.711  1.00 0.00 ? 312 ASN B CB   3  
ATOM 3982  C CG   . ASN B 2 18 ? 5.094   -10.611 -8.475  1.00 0.00 ? 312 ASN B CG   3  
ATOM 3983  O OD1  . ASN B 2 18 ? 4.066   -11.047 -8.995  1.00 0.00 ? 312 ASN B OD1  3  
ATOM 3984  N ND2  . ASN B 2 18 ? 6.259   -11.247 -8.550  1.00 0.00 ? 312 ASN B ND2  3  
ATOM 3985  H H    . ASN B 2 18 ? 4.468   -7.234  -6.391  1.00 0.00 ? 312 ASN B H    3  
ATOM 3986  H HA   . ASN B 2 18 ? 3.154   -9.637  -6.834  1.00 0.00 ? 312 ASN B HA   3  
ATOM 3987  H HB2  . ASN B 2 18 ? 4.779   -8.517  -8.388  1.00 0.00 ? 312 ASN B HB2  3  
ATOM 3988  H HB3  . ASN B 2 18 ? 6.085   -9.102  -7.365  1.00 0.00 ? 312 ASN B HB3  3  
ATOM 3989  H HD21 . ASN B 2 18 ? 7.038   -10.841 -8.116  1.00 0.00 ? 312 ASN B HD21 3  
ATOM 3990  H HD22 . ASN B 2 18 ? 6.292   -12.097 -9.039  1.00 0.00 ? 312 ASN B HD22 3  
ATOM 3991  N N    . LYS B 2 19 ? 5.681   -9.878  -4.703  1.00 0.00 ? 313 LYS B N    3  
ATOM 3992  C CA   . LYS B 2 19 ? 6.236   -10.693 -3.617  1.00 0.00 ? 313 LYS B CA   3  
ATOM 3993  C C    . LYS B 2 19 ? 5.143   -11.120 -2.651  1.00 0.00 ? 313 LYS B C    3  
ATOM 3994  O O    . LYS B 2 19 ? 4.995   -12.298 -2.346  1.00 0.00 ? 313 LYS B O    3  
ATOM 3995  C CB   . LYS B 2 19 ? 7.288   -9.906  -2.827  1.00 0.00 ? 313 LYS B CB   3  
ATOM 3996  C CG   . LYS B 2 19 ? 8.710   -10.082 -3.316  1.00 0.00 ? 313 LYS B CG   3  
ATOM 3997  C CD   . LYS B 2 19 ? 9.675   -9.154  -2.588  1.00 0.00 ? 313 LYS B CD   3  
ATOM 3998  C CE   . LYS B 2 19 ? 9.413   -7.692  -2.915  1.00 0.00 ? 313 LYS B CE   3  
ATOM 3999  N NZ   . LYS B 2 19 ? 9.726   -7.370  -4.337  1.00 0.00 ? 313 LYS B NZ   3  
ATOM 4000  H H    . LYS B 2 19 ? 6.068   -8.994  -4.878  1.00 0.00 ? 313 LYS B H    3  
ATOM 4001  H HA   . LYS B 2 19 ? 6.692   -11.573 -4.049  1.00 0.00 ? 313 LYS B HA   3  
ATOM 4002  H HB2  . LYS B 2 19 ? 7.043   -8.855  -2.875  1.00 0.00 ? 313 LYS B HB2  3  
ATOM 4003  H HB3  . LYS B 2 19 ? 7.246   -10.222 -1.798  1.00 0.00 ? 313 LYS B HB3  3  
ATOM 4004  H HG2  . LYS B 2 19 ? 9.007   -11.101 -3.121  1.00 0.00 ? 313 LYS B HG2  3  
ATOM 4005  H HG3  . LYS B 2 19 ? 8.750   -9.881  -4.374  1.00 0.00 ? 313 LYS B HG3  3  
ATOM 4006  H HD2  . LYS B 2 19 ? 9.560   -9.296  -1.524  1.00 0.00 ? 313 LYS B HD2  3  
ATOM 4007  H HD3  . LYS B 2 19 ? 10.684  -9.403  -2.878  1.00 0.00 ? 313 LYS B HD3  3  
ATOM 4008  H HE2  . LYS B 2 19 ? 8.372   -7.480  -2.728  1.00 0.00 ? 313 LYS B HE2  3  
ATOM 4009  H HE3  . LYS B 2 19 ? 10.025  -7.077  -2.271  1.00 0.00 ? 313 LYS B HE3  3  
ATOM 4010  H HZ1  . LYS B 2 19 ? 8.980   -7.742  -4.961  1.00 0.00 ? 313 LYS B HZ1  3  
ATOM 4011  H HZ2  . LYS B 2 19 ? 10.634  -7.797  -4.609  1.00 0.00 ? 313 LYS B HZ2  3  
ATOM 4012  H HZ3  . LYS B 2 19 ? 9.788   -6.339  -4.464  1.00 0.00 ? 313 LYS B HZ3  3  
ATOM 4013  N N    . ILE B 2 20 ? 4.397   -10.137 -2.170  1.00 0.00 ? 314 ILE B N    3  
ATOM 4014  C CA   . ILE B 2 20 ? 3.316   -10.366 -1.225  1.00 0.00 ? 314 ILE B CA   3  
ATOM 4015  C C    . ILE B 2 20 ? 2.205   -11.209 -1.842  1.00 0.00 ? 314 ILE B C    3  
ATOM 4016  O O    . ILE B 2 20 ? 1.806   -12.230 -1.297  1.00 0.00 ? 314 ILE B O    3  
ATOM 4017  C CB   . ILE B 2 20 ? 2.752   -9.024  -0.732  1.00 0.00 ? 314 ILE B CB   3  
ATOM 4018  C CG1  . ILE B 2 20 ? 3.891   -8.184  -0.149  1.00 0.00 ? 314 ILE B CG1  3  
ATOM 4019  C CG2  . ILE B 2 20 ? 1.661   -9.247  0.303   1.00 0.00 ? 314 ILE B CG2  3  
ATOM 4020  C CD1  . ILE B 2 20 ? 3.516   -6.753  0.123   1.00 0.00 ? 314 ILE B CD1  3  
ATOM 4021  H H    . ILE B 2 20 ? 4.585   -9.219  -2.457  1.00 0.00 ? 314 ILE B H    3  
ATOM 4022  H HA   . ILE B 2 20 ? 3.724   -10.893 -0.376  1.00 0.00 ? 314 ILE B HA   3  
ATOM 4023  H HB   . ILE B 2 20 ? 2.322   -8.503  -1.572  1.00 0.00 ? 314 ILE B HB   3  
ATOM 4024  H HG12 . ILE B 2 20 ? 4.208   -8.621  0.786   1.00 0.00 ? 314 ILE B HG12 3  
ATOM 4025  H HG13 . ILE B 2 20 ? 4.720   -8.184  -0.840  1.00 0.00 ? 314 ILE B HG13 3  
ATOM 4026  H HG21 . ILE B 2 20 ? 2.105   -9.284  1.286   1.00 0.00 ? 314 ILE B HG21 3  
ATOM 4027  H HG22 . ILE B 2 20 ? 1.157   -10.180 0.099   1.00 0.00 ? 314 ILE B HG22 3  
ATOM 4028  H HG23 . ILE B 2 20 ? 0.950   -8.436  0.255   1.00 0.00 ? 314 ILE B HG23 3  
ATOM 4029  H HD11 . ILE B 2 20 ? 2.442   -6.664  0.158   1.00 0.00 ? 314 ILE B HD11 3  
ATOM 4030  H HD12 . ILE B 2 20 ? 3.909   -6.125  -0.664  1.00 0.00 ? 314 ILE B HD12 3  
ATOM 4031  H HD13 . ILE B 2 20 ? 3.934   -6.452  1.069   1.00 0.00 ? 314 ILE B HD13 3  
ATOM 4032  N N    . LYS B 2 21 ? 1.711   -10.786 -2.989  1.00 0.00 ? 315 LYS B N    3  
ATOM 4033  C CA   . LYS B 2 21 ? 0.658   -11.519 -3.667  1.00 0.00 ? 315 LYS B CA   3  
ATOM 4034  C C    . LYS B 2 21 ? 1.051   -12.994 -3.826  1.00 0.00 ? 315 LYS B C    3  
ATOM 4035  O O    . LYS B 2 21 ? 0.268   -13.890 -3.509  1.00 0.00 ? 315 LYS B O    3  
ATOM 4036  C CB   . LYS B 2 21 ? 0.390   -10.856 -5.014  1.00 0.00 ? 315 LYS B CB   3  
ATOM 4037  C CG   . LYS B 2 21 ? -0.773  -11.439 -5.787  1.00 0.00 ? 315 LYS B CG   3  
ATOM 4038  C CD   . LYS B 2 21 ? -0.943  -10.705 -7.101  1.00 0.00 ? 315 LYS B CD   3  
ATOM 4039  C CE   . LYS B 2 21 ? 0.224   -10.974 -8.040  1.00 0.00 ? 315 LYS B CE   3  
ATOM 4040  N NZ   . LYS B 2 21 ? 0.319   -12.411 -8.424  1.00 0.00 ? 315 LYS B NZ   3  
ATOM 4041  H H    . LYS B 2 21 ? 2.063   -9.966  -3.394  1.00 0.00 ? 315 LYS B H    3  
ATOM 4042  H HA   . LYS B 2 21 ? -0.228  -11.463 -3.056  1.00 0.00 ? 315 LYS B HA   3  
ATOM 4043  H HB2  . LYS B 2 21 ? 0.182   -9.811  -4.843  1.00 0.00 ? 315 LYS B HB2  3  
ATOM 4044  H HB3  . LYS B 2 21 ? 1.277   -10.930 -5.623  1.00 0.00 ? 315 LYS B HB3  3  
ATOM 4045  H HG2  . LYS B 2 21 ? -0.581  -12.483 -5.985  1.00 0.00 ? 315 LYS B HG2  3  
ATOM 4046  H HG3  . LYS B 2 21 ? -1.675  -11.334 -5.204  1.00 0.00 ? 315 LYS B HG3  3  
ATOM 4047  H HD2  . LYS B 2 21 ? -1.860  -11.023 -7.572  1.00 0.00 ? 315 LYS B HD2  3  
ATOM 4048  H HD3  . LYS B 2 21 ? -0.984  -9.640  -6.895  1.00 0.00 ? 315 LYS B HD3  3  
ATOM 4049  H HE2  . LYS B 2 21 ? 0.092   -10.383 -8.931  1.00 0.00 ? 315 LYS B HE2  3  
ATOM 4050  H HE3  . LYS B 2 21 ? 1.138   -10.679 -7.547  1.00 0.00 ? 315 LYS B HE3  3  
ATOM 4051  H HZ1  . LYS B 2 21 ? -0.581  -12.732 -8.837  1.00 0.00 ? 315 LYS B HZ1  3  
ATOM 4052  H HZ2  . LYS B 2 21 ? 0.531   -12.993 -7.588  1.00 0.00 ? 315 LYS B HZ2  3  
ATOM 4053  H HZ3  . LYS B 2 21 ? 1.076   -12.543 -9.125  1.00 0.00 ? 315 LYS B HZ3  3  
ATOM 4054  N N    . ASN B 2 22 ? 2.282   -13.231 -4.286  1.00 0.00 ? 316 ASN B N    3  
ATOM 4055  C CA   . ASN B 2 22 ? 2.809   -14.588 -4.455  1.00 0.00 ? 316 ASN B CA   3  
ATOM 4056  C C    . ASN B 2 22 ? 3.079   -15.267 -3.111  1.00 0.00 ? 316 ASN B C    3  
ATOM 4057  O O    . ASN B 2 22 ? 2.568   -16.352 -2.847  1.00 0.00 ? 316 ASN B O    3  
ATOM 4058  C CB   . ASN B 2 22 ? 4.094   -14.559 -5.288  1.00 0.00 ? 316 ASN B CB   3  
ATOM 4059  C CG   . ASN B 2 22 ? 3.822   -14.396 -6.771  1.00 0.00 ? 316 ASN B CG   3  
ATOM 4060  O OD1  . ASN B 2 22 ? 3.123   -15.208 -7.378  1.00 0.00 ? 316 ASN B OD1  3  
ATOM 4061  N ND2  . ASN B 2 22 ? 4.379   -13.349 -7.365  1.00 0.00 ? 316 ASN B ND2  3  
ATOM 4062  H H    . ASN B 2 22 ? 2.863   -12.470 -4.496  1.00 0.00 ? 316 ASN B H    3  
ATOM 4063  H HA   . ASN B 2 22 ? 2.065   -15.167 -4.983  1.00 0.00 ? 316 ASN B HA   3  
ATOM 4064  H HB2  . ASN B 2 22 ? 4.704   -13.729 -4.962  1.00 0.00 ? 316 ASN B HB2  3  
ATOM 4065  H HB3  . ASN B 2 22 ? 4.640   -15.476 -5.136  1.00 0.00 ? 316 ASN B HB3  3  
ATOM 4066  H HD21 . ASN B 2 22 ? 4.930   -12.745 -6.822  1.00 0.00 ? 316 ASN B HD21 3  
ATOM 4067  H HD22 . ASN B 2 22 ? 4.219   -13.222 -8.323  1.00 0.00 ? 316 ASN B HD22 3  
ATOM 4068  N N    . ARG B 2 23 ? 3.908   -14.630 -2.282  1.00 0.00 ? 317 ARG B N    3  
ATOM 4069  C CA   . ARG B 2 23 ? 4.275   -15.175 -0.972  1.00 0.00 ? 317 ARG B CA   3  
ATOM 4070  C C    . ARG B 2 23 ? 3.053   -15.460 -0.099  1.00 0.00 ? 317 ARG B C    3  
ATOM 4071  O O    . ARG B 2 23 ? 3.007   -16.488 0.580   1.00 0.00 ? 317 ARG B O    3  
ATOM 4072  C CB   . ARG B 2 23 ? 5.232   -14.226 -0.243  1.00 0.00 ? 317 ARG B CB   3  
ATOM 4073  C CG   . ARG B 2 23 ? 5.733   -14.747 1.101   1.00 0.00 ? 317 ARG B CG   3  
ATOM 4074  C CD   . ARG B 2 23 ? 6.572   -16.014 0.963   1.00 0.00 ? 317 ARG B CD   3  
ATOM 4075  N NE   . ARG B 2 23 ? 5.762   -17.202 0.683   1.00 0.00 ? 317 ARG B NE   3  
ATOM 4076  C CZ   . ARG B 2 23 ? 6.266   -18.427 0.512   1.00 0.00 ? 317 ARG B CZ   3  
ATOM 4077  N NH1  . ARG B 2 23 ? 7.576   -18.638 0.607   1.00 0.00 ? 317 ARG B NH1  3  
ATOM 4078  N NH2  . ARG B 2 23 ? 5.453   -19.445 0.254   1.00 0.00 ? 317 ARG B NH2  3  
ATOM 4079  H H    . ARG B 2 23 ? 4.294   -13.775 -2.562  1.00 0.00 ? 317 ARG B H    3  
ATOM 4080  H HA   . ARG B 2 23 ? 4.789   -16.109 -1.149  1.00 0.00 ? 317 ARG B HA   3  
ATOM 4081  H HB2  . ARG B 2 23 ? 6.089   -14.046 -0.873  1.00 0.00 ? 317 ARG B HB2  3  
ATOM 4082  H HB3  . ARG B 2 23 ? 4.723   -13.289 -0.071  1.00 0.00 ? 317 ARG B HB3  3  
ATOM 4083  H HG2  . ARG B 2 23 ? 6.341   -13.984 1.561   1.00 0.00 ? 317 ARG B HG2  3  
ATOM 4084  H HG3  . ARG B 2 23 ? 4.883   -14.957 1.733   1.00 0.00 ? 317 ARG B HG3  3  
ATOM 4085  H HD2  . ARG B 2 23 ? 7.275   -15.875 0.157   1.00 0.00 ? 317 ARG B HD2  3  
ATOM 4086  H HD3  . ARG B 2 23 ? 7.113   -16.169 1.885   1.00 0.00 ? 317 ARG B HD3  3  
ATOM 4087  H HE   . ARG B 2 23 ? 4.793   -17.084 0.620   1.00 0.00 ? 317 ARG B HE   3  
ATOM 4088  H HH11 . ARG B 2 23 ? 8.195   -17.878 0.806   1.00 0.00 ? 317 ARG B HH11 3  
ATOM 4089  H HH12 . ARG B 2 23 ? 7.944   -19.560 0.477   1.00 0.00 ? 317 ARG B HH12 3  
ATOM 4090  H HH21 . ARG B 2 23 ? 4.465   -19.295 0.187   1.00 0.00 ? 317 ARG B HH21 3  
ATOM 4091  H HH22 . ARG B 2 23 ? 5.827   -20.364 0.126   1.00 0.00 ? 317 ARG B HH22 3  
ATOM 4092  N N    . PHE B 2 24 ? 2.059   -14.567 -0.114  1.00 0.00 ? 318 PHE B N    3  
ATOM 4093  C CA   . PHE B 2 24 ? 0.859   -14.778 0.688   1.00 0.00 ? 318 PHE B CA   3  
ATOM 4094  C C    . PHE B 2 24 ? -0.262  -15.364 -0.173  1.00 0.00 ? 318 PHE B C    3  
ATOM 4095  O O    . PHE B 2 24 ? -1.441  -15.176 0.124   1.00 0.00 ? 318 PHE B O    3  
ATOM 4096  C CB   . PHE B 2 24 ? 0.376   -13.487 1.367   1.00 0.00 ? 318 PHE B CB   3  
ATOM 4097  C CG   . PHE B 2 24 ? 1.446   -12.704 2.092   1.00 0.00 ? 318 PHE B CG   3  
ATOM 4098  C CD1  . PHE B 2 24 ? 2.539   -12.193 1.418   1.00 0.00 ? 318 PHE B CD1  3  
ATOM 4099  C CD2  . PHE B 2 24 ? 1.323   -12.439 3.440   1.00 0.00 ? 318 PHE B CD2  3  
ATOM 4100  C CE1  . PHE B 2 24 ? 3.484   -11.431 2.064   1.00 0.00 ? 318 PHE B CE1  3  
ATOM 4101  C CE2  . PHE B 2 24 ? 2.275   -11.684 4.103   1.00 0.00 ? 318 PHE B CE2  3  
ATOM 4102  C CZ   . PHE B 2 24 ? 3.356   -11.175 3.406   1.00 0.00 ? 318 PHE B CZ   3  
ATOM 4103  H H    . PHE B 2 24 ? 2.129   -13.764 -0.681  1.00 0.00 ? 318 PHE B H    3  
ATOM 4104  H HA   . PHE B 2 24 ? 1.110   -15.493 1.457   1.00 0.00 ? 318 PHE B HA   3  
ATOM 4105  H HB2  . PHE B 2 24 ? -0.071  -12.838 0.630   1.00 0.00 ? 318 PHE B HB2  3  
ATOM 4106  H HB3  . PHE B 2 24 ? -0.380  -13.749 2.094   1.00 0.00 ? 318 PHE B HB3  3  
ATOM 4107  H HD1  . PHE B 2 24 ? 2.655   -12.399 0.376   1.00 0.00 ? 318 PHE B HD1  3  
ATOM 4108  H HD2  . PHE B 2 24 ? 0.480   -12.842 3.982   1.00 0.00 ? 318 PHE B HD2  3  
ATOM 4109  H HE1  . PHE B 2 24 ? 4.331   -11.044 1.518   1.00 0.00 ? 318 PHE B HE1  3  
ATOM 4110  H HE2  . PHE B 2 24 ? 2.170   -11.485 5.158   1.00 0.00 ? 318 PHE B HE2  3  
ATOM 4111  H HZ   . PHE B 2 24 ? 4.093   -10.566 3.908   1.00 0.00 ? 318 PHE B HZ   3  
ATOM 4112  N N    . GLN B 2 25 ? 0.117   -16.081 -1.244  1.00 0.00 ? 319 GLN B N    3  
ATOM 4113  C CA   . GLN B 2 25 ? -0.857  -16.711 -2.141  1.00 0.00 ? 319 GLN B CA   3  
ATOM 4114  C C    . GLN B 2 25 ? -1.878  -17.529 -1.352  1.00 0.00 ? 319 GLN B C    3  
ATOM 4115  O O    . GLN B 2 25 ? -3.060  -17.563 -1.698  1.00 0.00 ? 319 GLN B O    3  
ATOM 4116  C CB   . GLN B 2 25 ? -0.155  -17.588 -3.180  1.00 0.00 ? 319 GLN B CB   3  
ATOM 4117  C CG   . GLN B 2 25 ? 0.794   -18.598 -2.568  1.00 0.00 ? 319 GLN B CG   3  
ATOM 4118  C CD   . GLN B 2 25 ? 1.496   -19.494 -3.583  1.00 0.00 ? 319 GLN B CD   3  
ATOM 4119  O OE1  . GLN B 2 25 ? 2.271   -20.373 -3.202  1.00 0.00 ? 319 GLN B OE1  3  
ATOM 4120  N NE2  . GLN B 2 25 ? 1.244   -19.287 -4.877  1.00 0.00 ? 319 GLN B NE2  3  
ATOM 4121  H H    . GLN B 2 25 ? 1.070   -16.199 -1.426  1.00 0.00 ? 319 GLN B H    3  
ATOM 4122  H HA   . GLN B 2 25 ? -1.374  -15.925 -2.653  1.00 0.00 ? 319 GLN B HA   3  
ATOM 4123  H HB2  . GLN B 2 25 ? -0.902  -18.123 -3.747  1.00 0.00 ? 319 GLN B HB2  3  
ATOM 4124  H HB3  . GLN B 2 25 ? 0.409   -16.955 -3.849  1.00 0.00 ? 319 GLN B HB3  3  
ATOM 4125  H HG2  . GLN B 2 25 ? 1.543   -18.055 -2.016  1.00 0.00 ? 319 GLN B HG2  3  
ATOM 4126  H HG3  . GLN B 2 25 ? 0.232   -19.216 -1.888  1.00 0.00 ? 319 GLN B HG3  3  
ATOM 4127  H HE21 . GLN B 2 25 ? 0.623   -18.572 -5.125  1.00 0.00 ? 319 GLN B HE21 3  
ATOM 4128  H HE22 . GLN B 2 25 ? 1.695   -19.861 -5.529  1.00 0.00 ? 319 GLN B HE22 3  
ATOM 4129  N N    . GLY B 2 26 ? -1.412  -18.176 -0.276  1.00 0.00 ? 320 GLY B N    3  
ATOM 4130  C CA   . GLY B 2 26 ? -2.291  -18.968 0.564   1.00 0.00 ? 320 GLY B CA   3  
ATOM 4131  C C    . GLY B 2 26 ? -2.984  -18.139 1.636   1.00 0.00 ? 320 GLY B C    3  
ATOM 4132  O O    . GLY B 2 26 ? -3.564  -18.692 2.572   1.00 0.00 ? 320 GLY B O    3  
ATOM 4133  H H    . GLY B 2 26 ? -0.463  -18.100 -0.044  1.00 0.00 ? 320 GLY B H    3  
ATOM 4134  H HA2  . GLY B 2 26 ? -3.044  -19.433 -0.057  1.00 0.00 ? 320 GLY B HA2  3  
ATOM 4135  H HA3  . GLY B 2 26 ? -1.710  -19.742 1.045   1.00 0.00 ? 320 GLY B HA3  3  
ATOM 4136  N N    . GLN B 2 27 ? -2.933  -16.808 1.495   1.00 0.00 ? 321 GLN B N    3  
ATOM 4137  C CA   . GLN B 2 27 ? -3.563  -15.902 2.446   1.00 0.00 ? 321 GLN B CA   3  
ATOM 4138  C C    . GLN B 2 27 ? -4.291  -14.781 1.711   1.00 0.00 ? 321 GLN B C    3  
ATOM 4139  O O    . GLN B 2 27 ? -3.803  -13.649 1.662   1.00 0.00 ? 321 GLN B O    3  
ATOM 4140  C CB   . GLN B 2 27 ? -2.541  -15.249 3.384   1.00 0.00 ? 321 GLN B CB   3  
ATOM 4141  C CG   . GLN B 2 27 ? -1.529  -16.177 4.018   1.00 0.00 ? 321 GLN B CG   3  
ATOM 4142  C CD   . GLN B 2 27 ? -2.136  -17.277 4.887   1.00 0.00 ? 321 GLN B CD   3  
ATOM 4143  O OE1  . GLN B 2 27 ? -1.446  -18.223 5.264   1.00 0.00 ? 321 GLN B OE1  3  
ATOM 4144  N NE2  . GLN B 2 27 ? -3.419  -17.156 5.238   1.00 0.00 ? 321 GLN B NE2  3  
ATOM 4145  H H    . GLN B 2 27 ? -2.464  -16.428 0.727   1.00 0.00 ? 321 GLN B H    3  
ATOM 4146  H HA   . GLN B 2 27 ? -4.276  -16.463 3.029   1.00 0.00 ? 321 GLN B HA   3  
ATOM 4147  H HB2  . GLN B 2 27 ? -1.997  -14.502 2.830   1.00 0.00 ? 321 GLN B HB2  3  
ATOM 4148  H HB3  . GLN B 2 27 ? -3.083  -14.761 4.179   1.00 0.00 ? 321 GLN B HB3  3  
ATOM 4149  H HG2  . GLN B 2 27 ? -0.945  -16.636 3.237   1.00 0.00 ? 321 GLN B HG2  3  
ATOM 4150  H HG3  . GLN B 2 27 ? -0.881  -15.569 4.640   1.00 0.00 ? 321 GLN B HG3  3  
ATOM 4151  H HE21 . GLN B 2 27 ? -3.916  -16.371 4.930   1.00 0.00 ? 321 GLN B HE21 3  
ATOM 4152  H HE22 . GLN B 2 27 ? -3.812  -17.861 5.792   1.00 0.00 ? 321 GLN B HE22 3  
ATOM 4153  N N    . PRO B 2 28 ? -5.478  -15.058 1.151   1.00 0.00 ? 322 PRO B N    3  
ATOM 4154  C CA   . PRO B 2 28 ? -6.256  -14.030 0.457   1.00 0.00 ? 322 PRO B CA   3  
ATOM 4155  C C    . PRO B 2 28 ? -6.587  -12.869 1.398   1.00 0.00 ? 322 PRO B C    3  
ATOM 4156  O O    . PRO B 2 28 ? -6.829  -11.746 0.954   1.00 0.00 ? 322 PRO B O    3  
ATOM 4157  C CB   . PRO B 2 28 ? -7.533  -14.765 0.026   1.00 0.00 ? 322 PRO B CB   3  
ATOM 4158  C CG   . PRO B 2 28 ? -7.590  -15.990 0.873   1.00 0.00 ? 322 PRO B CG   3  
ATOM 4159  C CD   . PRO B 2 28 ? -6.165  -16.358 1.172   1.00 0.00 ? 322 PRO B CD   3  
ATOM 4160  H HA   . PRO B 2 28 ? -5.734  -13.653 -0.411  1.00 0.00 ? 322 PRO B HA   3  
ATOM 4161  H HB2  . PRO B 2 28 ? -8.389  -14.128 0.197   1.00 0.00 ? 322 PRO B HB2  3  
ATOM 4162  H HB3  . PRO B 2 28 ? -7.469  -15.014 -1.023  1.00 0.00 ? 322 PRO B HB3  3  
ATOM 4163  H HG2  . PRO B 2 28 ? -8.122  -15.780 1.789   1.00 0.00 ? 322 PRO B HG2  3  
ATOM 4164  H HG3  . PRO B 2 28 ? -8.076  -16.788 0.332   1.00 0.00 ? 322 PRO B HG3  3  
ATOM 4165  H HD2  . PRO B 2 28 ? -6.089  -16.821 2.144   1.00 0.00 ? 322 PRO B HD2  3  
ATOM 4166  H HD3  . PRO B 2 28 ? -5.774  -17.013 0.408   1.00 0.00 ? 322 PRO B HD3  3  
ATOM 4167  N N    . ASP B 2 29 ? -6.581  -13.157 2.706   1.00 0.00 ? 323 ASP B N    3  
ATOM 4168  C CA   . ASP B 2 29 ? -6.864  -12.162 3.731   1.00 0.00 ? 323 ASP B CA   3  
ATOM 4169  C C    . ASP B 2 29 ? -5.745  -11.127 3.840   1.00 0.00 ? 323 ASP B C    3  
ATOM 4170  O O    . ASP B 2 29 ? -6.007  -9.966  4.139   1.00 0.00 ? 323 ASP B O    3  
ATOM 4171  C CB   . ASP B 2 29 ? -7.080  -12.838 5.090   1.00 0.00 ? 323 ASP B CB   3  
ATOM 4172  C CG   . ASP B 2 29 ? -8.264  -13.790 5.093   1.00 0.00 ? 323 ASP B CG   3  
ATOM 4173  O OD1  . ASP B 2 29 ? -8.224  -14.799 4.354   1.00 0.00 ? 323 ASP B OD1  3  
ATOM 4174  O OD2  . ASP B 2 29 ? -9.233  -13.528 5.836   1.00 0.00 ? 323 ASP B OD2  3  
ATOM 4175  H H    . ASP B 2 29 ? -6.365  -14.070 2.991   1.00 0.00 ? 323 ASP B H    3  
ATOM 4176  H HA   . ASP B 2 29 ? -7.774  -11.653 3.449   1.00 0.00 ? 323 ASP B HA   3  
ATOM 4177  H HB2  . ASP B 2 29 ? -6.194  -13.400 5.349   1.00 0.00 ? 323 ASP B HB2  3  
ATOM 4178  H HB3  . ASP B 2 29 ? -7.250  -12.079 5.839   1.00 0.00 ? 323 ASP B HB3  3  
ATOM 4179  N N    . ILE B 2 30 ? -4.496  -11.549 3.607   1.00 0.00 ? 324 ILE B N    3  
ATOM 4180  C CA   . ILE B 2 30 ? -3.353  -10.642 3.699   1.00 0.00 ? 324 ILE B CA   3  
ATOM 4181  C C    . ILE B 2 30 ? -3.367  -9.637  2.576   1.00 0.00 ? 324 ILE B C    3  
ATOM 4182  O O    . ILE B 2 30 ? -3.187  -8.439  2.786   1.00 0.00 ? 324 ILE B O    3  
ATOM 4183  C CB   . ILE B 2 30 ? -2.012  -11.393 3.636   1.00 0.00 ? 324 ILE B CB   3  
ATOM 4184  C CG1  . ILE B 2 30 ? -2.002  -12.519 4.659   1.00 0.00 ? 324 ILE B CG1  3  
ATOM 4185  C CG2  . ILE B 2 30 ? -0.865  -10.411 3.851   1.00 0.00 ? 324 ILE B CG2  3  
ATOM 4186  C CD1  . ILE B 2 30 ? -2.438  -12.090 6.025   1.00 0.00 ? 324 ILE B CD1  3  
ATOM 4187  H H    . ILE B 2 30 ? -4.335  -12.491 3.374   1.00 0.00 ? 324 ILE B H    3  
ATOM 4188  H HA   . ILE B 2 30 ? -3.409  -10.119 4.643   1.00 0.00 ? 324 ILE B HA   3  
ATOM 4189  H HB   . ILE B 2 30 ? -1.906  -11.824 2.650   1.00 0.00 ? 324 ILE B HB   3  
ATOM 4190  H HG12 . ILE B 2 30 ? -2.685  -13.282 4.330   1.00 0.00 ? 324 ILE B HG12 3  
ATOM 4191  H HG13 . ILE B 2 30 ? -1.008  -12.931 4.735   1.00 0.00 ? 324 ILE B HG13 3  
ATOM 4192  H HG21 . ILE B 2 30 ? -0.041  -10.913 4.327   1.00 0.00 ? 324 ILE B HG21 3  
ATOM 4193  H HG22 . ILE B 2 30 ? -1.201  -9.596  4.480   1.00 0.00 ? 324 ILE B HG22 3  
ATOM 4194  H HG23 . ILE B 2 30 ? -0.544  -10.016 2.888   1.00 0.00 ? 324 ILE B HG23 3  
ATOM 4195  H HD11 . ILE B 2 30 ? -2.513  -12.957 6.662   1.00 0.00 ? 324 ILE B HD11 3  
ATOM 4196  H HD12 . ILE B 2 30 ? -3.404  -11.609 5.944   1.00 0.00 ? 324 ILE B HD12 3  
ATOM 4197  H HD13 . ILE B 2 30 ? -1.721  -11.397 6.431   1.00 0.00 ? 324 ILE B HD13 3  
ATOM 4198  N N    . TYR B 2 31 ? -3.567  -10.151 1.380   1.00 0.00 ? 325 TYR B N    3  
ATOM 4199  C CA   . TYR B 2 31 ? -3.591  -9.319  0.190   1.00 0.00 ? 325 TYR B CA   3  
ATOM 4200  C C    . TYR B 2 31 ? -4.766  -8.350  0.253   1.00 0.00 ? 325 TYR B C    3  
ATOM 4201  O O    . TYR B 2 31 ? -4.590  -7.147  0.071   1.00 0.00 ? 325 TYR B O    3  
ATOM 4202  C CB   . TYR B 2 31 ? -3.668  -10.188 -1.067  1.00 0.00 ? 325 TYR B CB   3  
ATOM 4203  C CG   . TYR B 2 31 ? -3.005  -9.559  -2.271  1.00 0.00 ? 325 TYR B CG   3  
ATOM 4204  C CD1  . TYR B 2 31 ? -1.680  -9.131  -2.214  1.00 0.00 ? 325 TYR B CD1  3  
ATOM 4205  C CD2  . TYR B 2 31 ? -3.697  -9.405  -3.467  1.00 0.00 ? 325 TYR B CD2  3  
ATOM 4206  C CE1  . TYR B 2 31 ? -1.070  -8.563  -3.322  1.00 0.00 ? 325 TYR B CE1  3  
ATOM 4207  C CE2  . TYR B 2 31 ? -3.092  -8.838  -4.571  1.00 0.00 ? 325 TYR B CE2  3  
ATOM 4208  C CZ   . TYR B 2 31 ? -1.783  -8.421  -4.495  1.00 0.00 ? 325 TYR B CZ   3  
ATOM 4209  O OH   . TYR B 2 31 ? -1.179  -7.864  -5.599  1.00 0.00 ? 325 TYR B OH   3  
ATOM 4210  H H    . TYR B 2 31 ? -3.687  -11.121 1.304   1.00 0.00 ? 325 TYR B H    3  
ATOM 4211  H HA   . TYR B 2 31 ? -2.673  -8.750  0.168   1.00 0.00 ? 325 TYR B HA   3  
ATOM 4212  H HB2  . TYR B 2 31 ? -3.183  -11.134 -0.875  1.00 0.00 ? 325 TYR B HB2  3  
ATOM 4213  H HB3  . TYR B 2 31 ? -4.706  -10.365 -1.311  1.00 0.00 ? 325 TYR B HB3  3  
ATOM 4214  H HD1  . TYR B 2 31 ? -1.128  -9.245  -1.283  1.00 0.00 ? 325 TYR B HD1  3  
ATOM 4215  H HD2  . TYR B 2 31 ? -4.724  -9.731  -3.525  1.00 0.00 ? 325 TYR B HD2  3  
ATOM 4216  H HE1  . TYR B 2 31 ? -0.039  -8.235  -3.270  1.00 0.00 ? 325 TYR B HE1  3  
ATOM 4217  H HE2  . TYR B 2 31 ? -3.642  -8.725  -5.491  1.00 0.00 ? 325 TYR B HE2  3  
ATOM 4218  H HH   . TYR B 2 31 ? -1.740  -7.979  -6.370  1.00 0.00 ? 325 TYR B HH   3  
ATOM 4219  N N    . LYS B 2 32 ? -5.958  -8.874  0.544   1.00 0.00 ? 326 LYS B N    3  
ATOM 4220  C CA   . LYS B 2 32 ? -7.152  -8.038  0.665   1.00 0.00 ? 326 LYS B CA   3  
ATOM 4221  C C    . LYS B 2 32 ? -6.989  -7.032  1.803   1.00 0.00 ? 326 LYS B C    3  
ATOM 4222  O O    . LYS B 2 32 ? -7.224  -5.838  1.621   1.00 0.00 ? 326 LYS B O    3  
ATOM 4223  C CB   . LYS B 2 32 ? -8.398  -8.899  0.894   1.00 0.00 ? 326 LYS B CB   3  
ATOM 4224  C CG   . LYS B 2 32 ? -8.758  -9.774  -0.294  1.00 0.00 ? 326 LYS B CG   3  
ATOM 4225  C CD   . LYS B 2 32 ? -9.983  -10.629 -0.008  1.00 0.00 ? 326 LYS B CD   3  
ATOM 4226  C CE   . LYS B 2 32 ? -10.367 -11.479 -1.211  1.00 0.00 ? 326 LYS B CE   3  
ATOM 4227  N NZ   . LYS B 2 32 ? -9.284  -12.426 -1.606  1.00 0.00 ? 326 LYS B NZ   3  
ATOM 4228  H H    . LYS B 2 32 ? -6.032  -9.839  0.704   1.00 0.00 ? 326 LYS B H    3  
ATOM 4229  H HA   . LYS B 2 32 ? -7.267  -7.495  -0.262  1.00 0.00 ? 326 LYS B HA   3  
ATOM 4230  H HB2  . LYS B 2 32 ? -8.227  -9.538  1.749   1.00 0.00 ? 326 LYS B HB2  3  
ATOM 4231  H HB3  . LYS B 2 32 ? -9.236  -8.250  1.103   1.00 0.00 ? 326 LYS B HB3  3  
ATOM 4232  H HG2  . LYS B 2 32 ? -8.963  -9.144  -1.145  1.00 0.00 ? 326 LYS B HG2  3  
ATOM 4233  H HG3  . LYS B 2 32 ? -7.922  -10.423 -0.516  1.00 0.00 ? 326 LYS B HG3  3  
ATOM 4234  H HD2  . LYS B 2 32 ? -9.768  -11.280 0.826   1.00 0.00 ? 326 LYS B HD2  3  
ATOM 4235  H HD3  . LYS B 2 32 ? -10.809 -9.982  0.243   1.00 0.00 ? 326 LYS B HD3  3  
ATOM 4236  H HE2  . LYS B 2 32 ? -11.253 -12.046 -0.966  1.00 0.00 ? 326 LYS B HE2  3  
ATOM 4237  H HE3  . LYS B 2 32 ? -10.581 -10.823 -2.044  1.00 0.00 ? 326 LYS B HE3  3  
ATOM 4238  H HZ1  . LYS B 2 32 ? -9.646  -13.401 -1.610  1.00 0.00 ? 326 LYS B HZ1  3  
ATOM 4239  H HZ2  . LYS B 2 32 ? -8.491  -12.367 -0.937  1.00 0.00 ? 326 LYS B HZ2  3  
ATOM 4240  H HZ3  . LYS B 2 32 ? -8.936  -12.193 -2.559  1.00 0.00 ? 326 LYS B HZ3  3  
ATOM 4241  N N    . ALA B 2 33 ? -6.569  -7.524  2.976   1.00 0.00 ? 327 ALA B N    3  
ATOM 4242  C CA   . ALA B 2 33 ? -6.360  -6.667  4.144   1.00 0.00 ? 327 ALA B CA   3  
ATOM 4243  C C    . ALA B 2 33 ? -5.342  -5.575  3.842   1.00 0.00 ? 327 ALA B C    3  
ATOM 4244  O O    . ALA B 2 33 ? -5.618  -4.395  4.038   1.00 0.00 ? 327 ALA B O    3  
ATOM 4245  C CB   . ALA B 2 33 ? -5.904  -7.490  5.342   1.00 0.00 ? 327 ALA B CB   3  
ATOM 4246  H H    . ALA B 2 33 ? -6.390  -8.486  3.053   1.00 0.00 ? 327 ALA B H    3  
ATOM 4247  H HA   . ALA B 2 33 ? -7.305  -6.206  4.393   1.00 0.00 ? 327 ALA B HA   3  
ATOM 4248  H HB1  . ALA B 2 33 ? -5.729  -6.835  6.183   1.00 0.00 ? 327 ALA B HB1  3  
ATOM 4249  H HB2  . ALA B 2 33 ? -4.989  -8.011  5.096   1.00 0.00 ? 327 ALA B HB2  3  
ATOM 4250  H HB3  . ALA B 2 33 ? -6.669  -8.209  5.598   1.00 0.00 ? 327 ALA B HB3  3  
ATOM 4251  N N    . PHE B 2 34 ? -4.168  -5.981  3.349   1.00 0.00 ? 328 PHE B N    3  
ATOM 4252  C CA   . PHE B 2 34 ? -3.098  -5.043  3.004   1.00 0.00 ? 328 PHE B CA   3  
ATOM 4253  C C    . PHE B 2 34 ? -3.627  -3.929  2.107   1.00 0.00 ? 328 PHE B C    3  
ATOM 4254  O O    . PHE B 2 34 ? -3.419  -2.749  2.384   1.00 0.00 ? 328 PHE B O    3  
ATOM 4255  C CB   . PHE B 2 34 ? -1.960  -5.786  2.291   1.00 0.00 ? 328 PHE B CB   3  
ATOM 4256  C CG   . PHE B 2 34 ? -0.823  -4.908  1.832   1.00 0.00 ? 328 PHE B CG   3  
ATOM 4257  C CD1  . PHE B 2 34 ? -0.654  -3.629  2.340   1.00 0.00 ? 328 PHE B CD1  3  
ATOM 4258  C CD2  . PHE B 2 34 ? 0.085   -5.374  0.894   1.00 0.00 ? 328 PHE B CD2  3  
ATOM 4259  C CE1  . PHE B 2 34 ? 0.392   -2.833  1.919   1.00 0.00 ? 328 PHE B CE1  3  
ATOM 4260  C CE2  . PHE B 2 34 ? 1.135   -4.580  0.472   1.00 0.00 ? 328 PHE B CE2  3  
ATOM 4261  C CZ   . PHE B 2 34 ? 1.288   -3.309  0.985   1.00 0.00 ? 328 PHE B CZ   3  
ATOM 4262  H H    . PHE B 2 34 ? -4.020  -6.940  3.208   1.00 0.00 ? 328 PHE B H    3  
ATOM 4263  H HA   . PHE B 2 34 ? -2.721  -4.606  3.920   1.00 0.00 ? 328 PHE B HA   3  
ATOM 4264  H HB2  . PHE B 2 34 ? -1.550  -6.525  2.963   1.00 0.00 ? 328 PHE B HB2  3  
ATOM 4265  H HB3  . PHE B 2 34 ? -2.363  -6.287  1.422   1.00 0.00 ? 328 PHE B HB3  3  
ATOM 4266  H HD1  . PHE B 2 34 ? -1.352  -3.254  3.072   1.00 0.00 ? 328 PHE B HD1  3  
ATOM 4267  H HD2  . PHE B 2 34 ? -0.036  -6.366  0.488   1.00 0.00 ? 328 PHE B HD2  3  
ATOM 4268  H HE1  . PHE B 2 34 ? 0.510   -1.840  2.322   1.00 0.00 ? 328 PHE B HE1  3  
ATOM 4269  H HE2  . PHE B 2 34 ? 1.835   -4.954  -0.260  1.00 0.00 ? 328 PHE B HE2  3  
ATOM 4270  H HZ   . PHE B 2 34 ? 2.108   -2.689  0.657   1.00 0.00 ? 328 PHE B HZ   3  
ATOM 4271  N N    . LEU B 2 35 ? -4.317  -4.308  1.035   1.00 0.00 ? 329 LEU B N    3  
ATOM 4272  C CA   . LEU B 2 35 ? -4.872  -3.326  0.112   1.00 0.00 ? 329 LEU B CA   3  
ATOM 4273  C C    . LEU B 2 35 ? -5.863  -2.408  0.828   1.00 0.00 ? 329 LEU B C    3  
ATOM 4274  O O    . LEU B 2 35 ? -5.741  -1.186  0.757   1.00 0.00 ? 329 LEU B O    3  
ATOM 4275  C CB   . LEU B 2 35 ? -5.530  -4.010  -1.090  1.00 0.00 ? 329 LEU B CB   3  
ATOM 4276  C CG   . LEU B 2 35 ? -4.586  -4.865  -1.948  1.00 0.00 ? 329 LEU B CG   3  
ATOM 4277  C CD1  . LEU B 2 35 ? -5.297  -5.353  -3.202  1.00 0.00 ? 329 LEU B CD1  3  
ATOM 4278  C CD2  . LEU B 2 35 ? -3.325  -4.090  -2.310  1.00 0.00 ? 329 LEU B CD2  3  
ATOM 4279  H H    . LEU B 2 35 ? -4.457  -5.265  0.867   1.00 0.00 ? 329 LEU B H    3  
ATOM 4280  H HA   . LEU B 2 35 ? -4.049  -2.722  -0.243  1.00 0.00 ? 329 LEU B HA   3  
ATOM 4281  H HB2  . LEU B 2 35 ? -6.326  -4.643  -0.727  1.00 0.00 ? 329 LEU B HB2  3  
ATOM 4282  H HB3  . LEU B 2 35 ? -5.961  -3.247  -1.722  1.00 0.00 ? 329 LEU B HB3  3  
ATOM 4283  H HG   . LEU B 2 35 ? -4.290  -5.734  -1.383  1.00 0.00 ? 329 LEU B HG   3  
ATOM 4284  H HD11 . LEU B 2 35 ? -4.824  -6.259  -3.553  1.00 0.00 ? 329 LEU B HD11 3  
ATOM 4285  H HD12 . LEU B 2 35 ? -5.235  -4.595  -3.969  1.00 0.00 ? 329 LEU B HD12 3  
ATOM 4286  H HD13 . LEU B 2 35 ? -6.333  -5.553  -2.975  1.00 0.00 ? 329 LEU B HD13 3  
ATOM 4287  H HD21 . LEU B 2 35 ? -3.596  -3.175  -2.812  1.00 0.00 ? 329 LEU B HD21 3  
ATOM 4288  H HD22 . LEU B 2 35 ? -2.708  -4.690  -2.962  1.00 0.00 ? 329 LEU B HD22 3  
ATOM 4289  H HD23 . LEU B 2 35 ? -2.774  -3.857  -1.407  1.00 0.00 ? 329 LEU B HD23 3  
ATOM 4290  N N    . GLU B 2 36 ? -6.830  -2.995  1.540   1.00 0.00 ? 330 GLU B N    3  
ATOM 4291  C CA   . GLU B 2 36 ? -7.818  -2.207  2.283   1.00 0.00 ? 330 GLU B CA   3  
ATOM 4292  C C    . GLU B 2 36 ? -7.125  -1.268  3.275   1.00 0.00 ? 330 GLU B C    3  
ATOM 4293  O O    . GLU B 2 36 ? -7.599  -0.156  3.516   1.00 0.00 ? 330 GLU B O    3  
ATOM 4294  C CB   . GLU B 2 36 ? -8.805  -3.121  3.016   1.00 0.00 ? 330 GLU B CB   3  
ATOM 4295  C CG   . GLU B 2 36 ? -9.661  -3.975  2.086   1.00 0.00 ? 330 GLU B CG   3  
ATOM 4296  C CD   . GLU B 2 36 ? -10.575 -3.165  1.173   1.00 0.00 ? 330 GLU B CD   3  
ATOM 4297  O OE1  . GLU B 2 36 ? -10.625 -1.922  1.307   1.00 0.00 ? 330 GLU B OE1  3  
ATOM 4298  O OE2  . GLU B 2 36 ? -11.253 -3.781  0.324   1.00 0.00 ? 330 GLU B OE2  3  
ATOM 4299  H H    . GLU B 2 36 ? -6.870  -3.974  1.577   1.00 0.00 ? 330 GLU B H    3  
ATOM 4300  H HA   . GLU B 2 36 ? -8.361  -1.604  1.568   1.00 0.00 ? 330 GLU B HA   3  
ATOM 4301  H HB2  . GLU B 2 36 ? -8.251  -3.783  3.666   1.00 0.00 ? 330 GLU B HB2  3  
ATOM 4302  H HB3  . GLU B 2 36 ? -9.465  -2.511  3.617   1.00 0.00 ? 330 GLU B HB3  3  
ATOM 4303  H HG2  . GLU B 2 36 ? -9.008  -4.571  1.468   1.00 0.00 ? 330 GLU B HG2  3  
ATOM 4304  H HG3  . GLU B 2 36 ? -10.274 -4.630  2.689   1.00 0.00 ? 330 GLU B HG3  3  
ATOM 4305  N N    . ILE B 2 37 ? -5.984  -1.709  3.817   1.00 0.00 ? 331 ILE B N    3  
ATOM 4306  C CA   . ILE B 2 37 ? -5.202  -0.897  4.746   1.00 0.00 ? 331 ILE B CA   3  
ATOM 4307  C C    . ILE B 2 37 ? -4.795  0.401   4.054   1.00 0.00 ? 331 ILE B C    3  
ATOM 4308  O O    . ILE B 2 37 ? -5.032  1.499   4.563   1.00 0.00 ? 331 ILE B O    3  
ATOM 4309  C CB   . ILE B 2 37 ? -3.944  -1.657  5.216   1.00 0.00 ? 331 ILE B CB   3  
ATOM 4310  C CG1  . ILE B 2 37 ? -4.344  -2.818  6.121   1.00 0.00 ? 331 ILE B CG1  3  
ATOM 4311  C CG2  . ILE B 2 37 ? -2.975  -0.732  5.940   1.00 0.00 ? 331 ILE B CG2  3  
ATOM 4312  C CD1  . ILE B 2 37 ? -3.260  -3.855  6.273   1.00 0.00 ? 331 ILE B CD1  3  
ATOM 4313  H H    . ILE B 2 37 ? -5.645  -2.593  3.563   1.00 0.00 ? 331 ILE B H    3  
ATOM 4314  H HA   . ILE B 2 37 ? -5.812  -0.679  5.608   1.00 0.00 ? 331 ILE B HA   3  
ATOM 4315  H HB   . ILE B 2 37 ? -3.442  -2.047  4.348   1.00 0.00 ? 331 ILE B HB   3  
ATOM 4316  H HG12 . ILE B 2 37 ? -4.573  -2.436  7.102   1.00 0.00 ? 331 ILE B HG12 3  
ATOM 4317  H HG13 . ILE B 2 37 ? -5.217  -3.301  5.717   1.00 0.00 ? 331 ILE B HG13 3  
ATOM 4318  H HG21 . ILE B 2 37 ? -2.765  0.127   5.321   1.00 0.00 ? 331 ILE B HG21 3  
ATOM 4319  H HG22 . ILE B 2 37 ? -2.057  -1.266  6.138   1.00 0.00 ? 331 ILE B HG22 3  
ATOM 4320  H HG23 . ILE B 2 37 ? -3.413  -0.409  6.873   1.00 0.00 ? 331 ILE B HG23 3  
ATOM 4321  H HD11 . ILE B 2 37 ? -2.303  -3.403  6.062   1.00 0.00 ? 331 ILE B HD11 3  
ATOM 4322  H HD12 . ILE B 2 37 ? -3.439  -4.660  5.581   1.00 0.00 ? 331 ILE B HD12 3  
ATOM 4323  H HD13 . ILE B 2 37 ? -3.267  -4.235  7.280   1.00 0.00 ? 331 ILE B HD13 3  
ATOM 4324  N N    . LEU B 2 38 ? -4.202  0.246   2.871   1.00 0.00 ? 332 LEU B N    3  
ATOM 4325  C CA   . LEU B 2 38 ? -3.773  1.373   2.050   1.00 0.00 ? 332 LEU B CA   3  
ATOM 4326  C C    . LEU B 2 38 ? -4.971  2.215   1.631   1.00 0.00 ? 332 LEU B C    3  
ATOM 4327  O O    . LEU B 2 38 ? -4.976  3.435   1.778   1.00 0.00 ? 332 LEU B O    3  
ATOM 4328  C CB   . LEU B 2 38 ? -3.074  0.862   0.791   1.00 0.00 ? 332 LEU B CB   3  
ATOM 4329  C CG   . LEU B 2 38 ? -2.011  -0.211  1.014   1.00 0.00 ? 332 LEU B CG   3  
ATOM 4330  C CD1  . LEU B 2 38 ? -1.378  -0.609  -0.305  1.00 0.00 ? 332 LEU B CD1  3  
ATOM 4331  C CD2  . LEU B 2 38 ? -0.964  0.279   1.995   1.00 0.00 ? 332 LEU B CD2  3  
ATOM 4332  H H    . LEU B 2 38 ? -4.070  -0.663  2.529   1.00 0.00 ? 332 LEU B H    3  
ATOM 4333  H HA   . LEU B 2 38 ? -3.088  1.976   2.623   1.00 0.00 ? 332 LEU B HA   3  
ATOM 4334  H HB2  . LEU B 2 38 ? -3.827  0.456   0.135   1.00 0.00 ? 332 LEU B HB2  3  
ATOM 4335  H HB3  . LEU B 2 38 ? -2.612  1.700   0.303   1.00 0.00 ? 332 LEU B HB3  3  
ATOM 4336  H HG   . LEU B 2 38 ? -2.478  -1.087  1.434   1.00 0.00 ? 332 LEU B HG   3  
ATOM 4337  H HD11 . LEU B 2 38 ? -2.080  -1.204  -0.869  1.00 0.00 ? 332 LEU B HD11 3  
ATOM 4338  H HD12 . LEU B 2 38 ? -0.483  -1.183  -0.120  1.00 0.00 ? 332 LEU B HD12 3  
ATOM 4339  H HD13 . LEU B 2 38 ? -1.128  0.279   -0.866  1.00 0.00 ? 332 LEU B HD13 3  
ATOM 4340  H HD21 . LEU B 2 38 ? -1.289  1.214   2.423   1.00 0.00 ? 332 LEU B HD21 3  
ATOM 4341  H HD22 . LEU B 2 38 ? -0.024  0.420   1.483   1.00 0.00 ? 332 LEU B HD22 3  
ATOM 4342  H HD23 . LEU B 2 38 ? -0.842  -0.451  2.782   1.00 0.00 ? 332 LEU B HD23 3  
ATOM 4343  N N    . HIS B 2 39 ? -5.978  1.535   1.089   1.00 0.00 ? 333 HIS B N    3  
ATOM 4344  C CA   . HIS B 2 39 ? -7.198  2.191   0.611   1.00 0.00 ? 333 HIS B CA   3  
ATOM 4345  C C    . HIS B 2 39 ? -7.758  3.176   1.641   1.00 0.00 ? 333 HIS B C    3  
ATOM 4346  O O    . HIS B 2 39 ? -8.131  4.296   1.286   1.00 0.00 ? 333 HIS B O    3  
ATOM 4347  C CB   . HIS B 2 39 ? -8.262  1.147   0.258   1.00 0.00 ? 333 HIS B CB   3  
ATOM 4348  C CG   . HIS B 2 39 ? -7.998  0.429   -1.029  1.00 0.00 ? 333 HIS B CG   3  
ATOM 4349  N ND1  . HIS B 2 39 ? -7.870  1.076   -2.242  1.00 0.00 ? 333 HIS B ND1  3  
ATOM 4350  C CD2  . HIS B 2 39 ? -7.842  -0.887  -1.290  1.00 0.00 ? 333 HIS B CD2  3  
ATOM 4351  C CE1  . HIS B 2 39 ? -7.648  0.186   -3.192  1.00 0.00 ? 333 HIS B CE1  3  
ATOM 4352  N NE2  . HIS B 2 39 ? -7.626  -1.014  -2.639  1.00 0.00 ? 333 HIS B NE2  3  
ATOM 4353  H H    . HIS B 2 39 ? -5.882  0.560   0.989   1.00 0.00 ? 333 HIS B H    3  
ATOM 4354  H HA   . HIS B 2 39 ? -6.940  2.735   -0.284  1.00 0.00 ? 333 HIS B HA   3  
ATOM 4355  H HB2  . HIS B 2 39 ? -8.305  0.409   1.045   1.00 0.00 ? 333 HIS B HB2  3  
ATOM 4356  H HB3  . HIS B 2 39 ? -9.224  1.631   0.179   1.00 0.00 ? 333 HIS B HB3  3  
ATOM 4357  H HD1  . HIS B 2 39 ? -7.934  2.043   -2.384  1.00 0.00 ? 333 HIS B HD1  3  
ATOM 4358  H HD2  . HIS B 2 39 ? -7.877  -1.688  -0.569  1.00 0.00 ? 333 HIS B HD2  3  
ATOM 4359  H HE1  . HIS B 2 39 ? -7.508  0.401   -4.241  1.00 0.00 ? 333 HIS B HE1  3  
ATOM 4360  H HE2  . HIS B 2 39 ? -7.390  -1.845  -3.104  1.00 0.00 ? 333 HIS B HE2  3  
ATOM 4361  N N    . THR B 2 40 ? -7.793  2.774   2.912   1.00 0.00 ? 334 THR B N    3  
ATOM 4362  C CA   . THR B 2 40 ? -8.287  3.649   3.979   1.00 0.00 ? 334 THR B CA   3  
ATOM 4363  C C    . THR B 2 40 ? -7.426  4.911   4.075   1.00 0.00 ? 334 THR B C    3  
ATOM 4364  O O    . THR B 2 40 ? -7.943  6.014   4.249   1.00 0.00 ? 334 THR B O    3  
ATOM 4365  C CB   . THR B 2 40 ? -8.290  2.907   5.322   1.00 0.00 ? 334 THR B CB   3  
ATOM 4366  O OG1  . THR B 2 40 ? -9.224  1.843   5.305   1.00 0.00 ? 334 THR B OG1  3  
ATOM 4367  C CG2  . THR B 2 40 ? -8.620  3.794   6.510   1.00 0.00 ? 334 THR B CG2  3  
ATOM 4368  H H    . THR B 2 40 ? -7.467  1.878   3.141   1.00 0.00 ? 334 THR B H    3  
ATOM 4369  H HA   . THR B 2 40 ? -9.298  3.935   3.731   1.00 0.00 ? 334 THR B HA   3  
ATOM 4370  H HB   . THR B 2 40 ? -7.309  2.488   5.487   1.00 0.00 ? 334 THR B HB   3  
ATOM 4371  H HG1  . THR B 2 40 ? -8.825  1.071   4.893   1.00 0.00 ? 334 THR B HG1  3  
ATOM 4372  H HG21 . THR B 2 40 ? -9.209  3.237   7.225   1.00 0.00 ? 334 THR B HG21 3  
ATOM 4373  H HG22 . THR B 2 40 ? -9.178  4.655   6.174   1.00 0.00 ? 334 THR B HG22 3  
ATOM 4374  H HG23 . THR B 2 40 ? -7.703  4.123   6.983   1.00 0.00 ? 334 THR B HG23 3  
ATOM 4375  N N    . TYR B 2 41 ? -6.109  4.724   3.958   1.00 0.00 ? 335 TYR B N    3  
ATOM 4376  C CA   . TYR B 2 41 ? -5.147  5.823   4.024   1.00 0.00 ? 335 TYR B CA   3  
ATOM 4377  C C    . TYR B 2 41 ? -5.418  6.883   2.947   1.00 0.00 ? 335 TYR B C    3  
ATOM 4378  O O    . TYR B 2 41 ? -5.623  8.048   3.266   1.00 0.00 ? 335 TYR B O    3  
ATOM 4379  C CB   . TYR B 2 41 ? -3.728  5.258   3.909   1.00 0.00 ? 335 TYR B CB   3  
ATOM 4380  C CG   . TYR B 2 41 ? -2.627  6.293   3.854   1.00 0.00 ? 335 TYR B CG   3  
ATOM 4381  C CD1  . TYR B 2 41 ? -2.239  6.857   2.647   1.00 0.00 ? 335 TYR B CD1  3  
ATOM 4382  C CD2  . TYR B 2 41 ? -1.966  6.688   5.004   1.00 0.00 ? 335 TYR B CD2  3  
ATOM 4383  C CE1  . TYR B 2 41 ? -1.223  7.785   2.587   1.00 0.00 ? 335 TYR B CE1  3  
ATOM 4384  C CE2  . TYR B 2 41 ? -0.949  7.623   4.955   1.00 0.00 ? 335 TYR B CE2  3  
ATOM 4385  C CZ   . TYR B 2 41 ? -0.579  8.166   3.742   1.00 0.00 ? 335 TYR B CZ   3  
ATOM 4386  O OH   . TYR B 2 41 ? 0.436   9.094   3.688   1.00 0.00 ? 335 TYR B OH   3  
ATOM 4387  H H    . TYR B 2 41 ? -5.773  3.814   3.820   1.00 0.00 ? 335 TYR B H    3  
ATOM 4388  H HA   . TYR B 2 41 ? -5.254  6.291   4.992   1.00 0.00 ? 335 TYR B HA   3  
ATOM 4389  H HB2  . TYR B 2 41 ? -3.536  4.627   4.764   1.00 0.00 ? 335 TYR B HB2  3  
ATOM 4390  H HB3  . TYR B 2 41 ? -3.662  4.660   3.013   1.00 0.00 ? 335 TYR B HB3  3  
ATOM 4391  H HD1  . TYR B 2 41 ? -2.748  6.562   1.745   1.00 0.00 ? 335 TYR B HD1  3  
ATOM 4392  H HD2  . TYR B 2 41 ? -2.258  6.257   5.953   1.00 0.00 ? 335 TYR B HD2  3  
ATOM 4393  H HE1  . TYR B 2 41 ? -0.934  8.201   1.634   1.00 0.00 ? 335 TYR B HE1  3  
ATOM 4394  H HE2  . TYR B 2 41 ? -0.446  7.922   5.860   1.00 0.00 ? 335 TYR B HE2  3  
ATOM 4395  H HH   . TYR B 2 41 ? 1.238   8.674   3.367   1.00 0.00 ? 335 TYR B HH   3  
ATOM 4396  N N    . GLN B 2 42 ? -5.423  6.485   1.673   1.00 0.00 ? 336 GLN B N    3  
ATOM 4397  C CA   . GLN B 2 42 ? -5.680  7.442   0.589   1.00 0.00 ? 336 GLN B CA   3  
ATOM 4398  C C    . GLN B 2 42 ? -6.965  8.240   0.832   1.00 0.00 ? 336 GLN B C    3  
ATOM 4399  O O    . GLN B 2 42 ? -6.993  9.452   0.623   1.00 0.00 ? 336 GLN B O    3  
ATOM 4400  C CB   . GLN B 2 42 ? -5.768  6.738   -0.769  1.00 0.00 ? 336 GLN B CB   3  
ATOM 4401  C CG   . GLN B 2 42 ? -4.443  6.199   -1.286  1.00 0.00 ? 336 GLN B CG   3  
ATOM 4402  C CD   . GLN B 2 42 ? -3.355  7.261   -1.360  1.00 0.00 ? 336 GLN B CD   3  
ATOM 4403  O OE1  . GLN B 2 42 ? -2.888  7.760   -0.336  1.00 0.00 ? 336 GLN B OE1  3  
ATOM 4404  N NE2  . GLN B 2 42 ? -2.953  7.622   -2.575  1.00 0.00 ? 336 GLN B NE2  3  
ATOM 4405  H H    . GLN B 2 42 ? -5.252  5.541   1.459   1.00 0.00 ? 336 GLN B H    3  
ATOM 4406  H HA   . GLN B 2 42 ? -4.852  8.136   0.567   1.00 0.00 ? 336 GLN B HA   3  
ATOM 4407  H HB2  . GLN B 2 42 ? -6.456  5.909   -0.684  1.00 0.00 ? 336 GLN B HB2  3  
ATOM 4408  H HB3  . GLN B 2 42 ? -6.154  7.437   -1.496  1.00 0.00 ? 336 GLN B HB3  3  
ATOM 4409  H HG2  . GLN B 2 42 ? -4.112  5.412   -0.631  1.00 0.00 ? 336 GLN B HG2  3  
ATOM 4410  H HG3  . GLN B 2 42 ? -4.599  5.796   -2.276  1.00 0.00 ? 336 GLN B HG3  3  
ATOM 4411  H HE21 . GLN B 2 42 ? -3.371  7.194   -3.350  1.00 0.00 ? 336 GLN B HE21 3  
ATOM 4412  H HE22 . GLN B 2 42 ? -2.252  8.303   -2.645  1.00 0.00 ? 336 GLN B HE22 3  
ATOM 4413  N N    . LYS B 2 43 ? -8.025  7.552   1.259   1.00 0.00 ? 337 LYS B N    3  
ATOM 4414  C CA   . LYS B 2 43 ? -9.320  8.196   1.509   1.00 0.00 ? 337 LYS B CA   3  
ATOM 4415  C C    . LYS B 2 43 ? -9.253  9.241   2.629   1.00 0.00 ? 337 LYS B C    3  
ATOM 4416  O O    . LYS B 2 43 ? -9.685  10.378  2.435   1.00 0.00 ? 337 LYS B O    3  
ATOM 4417  C CB   . LYS B 2 43 ? -10.385 7.144   1.833   1.00 0.00 ? 337 LYS B CB   3  
ATOM 4418  C CG   . LYS B 2 43 ? -10.677 6.200   0.675   1.00 0.00 ? 337 LYS B CG   3  
ATOM 4419  C CD   . LYS B 2 43 ? -11.763 5.192   1.023   1.00 0.00 ? 337 LYS B CD   3  
ATOM 4420  C CE   . LYS B 2 43 ? -11.344 4.281   2.166   1.00 0.00 ? 337 LYS B CE   3  
ATOM 4421  N NZ   . LYS B 2 43 ? -12.387 3.265   2.482   1.00 0.00 ? 337 LYS B NZ   3  
ATOM 4422  H H    . LYS B 2 43 ? -7.942  6.585   1.398   1.00 0.00 ? 337 LYS B H    3  
ATOM 4423  H HA   . LYS B 2 43 ? -9.607  8.699   0.598   1.00 0.00 ? 337 LYS B HA   3  
ATOM 4424  H HB2  . LYS B 2 43 ? -10.048 6.555   2.674   1.00 0.00 ? 337 LYS B HB2  3  
ATOM 4425  H HB3  . LYS B 2 43 ? -11.303 7.647   2.100   1.00 0.00 ? 337 LYS B HB3  3  
ATOM 4426  H HG2  . LYS B 2 43 ? -11.002 6.782   -0.175  1.00 0.00 ? 337 LYS B HG2  3  
ATOM 4427  H HG3  . LYS B 2 43 ? -9.773  5.667   0.421   1.00 0.00 ? 337 LYS B HG3  3  
ATOM 4428  H HD2  . LYS B 2 43 ? -12.655 5.727   1.312   1.00 0.00 ? 337 LYS B HD2  3  
ATOM 4429  H HD3  . LYS B 2 43 ? -11.971 4.589   0.151   1.00 0.00 ? 337 LYS B HD3  3  
ATOM 4430  H HE2  . LYS B 2 43 ? -10.433 3.773   1.890   1.00 0.00 ? 337 LYS B HE2  3  
ATOM 4431  H HE3  . LYS B 2 43 ? -11.166 4.885   3.044   1.00 0.00 ? 337 LYS B HE3  3  
ATOM 4432  H HZ1  . LYS B 2 43 ? -12.389 2.519   1.758   1.00 0.00 ? 337 LYS B HZ1  3  
ATOM 4433  H HZ2  . LYS B 2 43 ? -13.326 3.711   2.507   1.00 0.00 ? 337 LYS B HZ2  3  
ATOM 4434  H HZ3  . LYS B 2 43 ? -12.197 2.834   3.409   1.00 0.00 ? 337 LYS B HZ3  3  
ATOM 4435  N N    . GLU B 2 44 ? -8.734  8.853   3.801   1.00 0.00 ? 338 GLU B N    3  
ATOM 4436  C CA   . GLU B 2 44 ? -8.644  9.774   4.946   1.00 0.00 ? 338 GLU B CA   3  
ATOM 4437  C C    . GLU B 2 44 ? -7.925  11.082  4.591   1.00 0.00 ? 338 GLU B C    3  
ATOM 4438  O O    . GLU B 2 44 ? -8.203  12.121  5.193   1.00 0.00 ? 338 GLU B O    3  
ATOM 4439  C CB   . GLU B 2 44 ? -7.994  9.094   6.165   1.00 0.00 ? 338 GLU B CB   3  
ATOM 4440  C CG   . GLU B 2 44 ? -6.678  8.367   5.888   1.00 0.00 ? 338 GLU B CG   3  
ATOM 4441  C CD   . GLU B 2 44 ? -5.453  9.274   5.801   1.00 0.00 ? 338 GLU B CD   3  
ATOM 4442  O OE1  . GLU B 2 44 ? -5.577  10.497  6.015   1.00 0.00 ? 338 GLU B OE1  3  
ATOM 4443  O OE2  . GLU B 2 44 ? -4.353  8.744   5.536   1.00 0.00 ? 338 GLU B OE2  3  
ATOM 4444  H H    . GLU B 2 44 ? -8.419  7.931   3.903   1.00 0.00 ? 338 GLU B H    3  
ATOM 4445  H HA   . GLU B 2 44 ? -9.660  10.032  5.214   1.00 0.00 ? 338 GLU B HA   3  
ATOM 4446  H HB2  . GLU B 2 44 ? -7.807  9.842   6.917   1.00 0.00 ? 338 GLU B HB2  3  
ATOM 4447  H HB3  . GLU B 2 44 ? -8.693  8.373   6.566   1.00 0.00 ? 338 GLU B HB3  3  
ATOM 4448  H HG2  . GLU B 2 44 ? -6.511  7.656   6.682   1.00 0.00 ? 338 GLU B HG2  3  
ATOM 4449  H HG3  . GLU B 2 44 ? -6.777  7.834   4.958   1.00 0.00 ? 338 GLU B HG3  3  
ATOM 4450  N N    . GLN B 2 45 ? -7.018  11.039  3.610   1.00 0.00 ? 339 GLN B N    3  
ATOM 4451  C CA   . GLN B 2 45 ? -6.293  12.241  3.187   1.00 0.00 ? 339 GLN B CA   3  
ATOM 4452  C C    . GLN B 2 45 ? -7.268  13.250  2.601   1.00 0.00 ? 339 GLN B C    3  
ATOM 4453  O O    . GLN B 2 45 ? -7.342  14.399  3.040   1.00 0.00 ? 339 GLN B O    3  
ATOM 4454  C CB   . GLN B 2 45 ? -5.238  11.903  2.129   1.00 0.00 ? 339 GLN B CB   3  
ATOM 4455  C CG   . GLN B 2 45 ? -4.276  10.811  2.548   1.00 0.00 ? 339 GLN B CG   3  
ATOM 4456  C CD   . GLN B 2 45 ? -3.324  11.207  3.675   1.00 0.00 ? 339 GLN B CD   3  
ATOM 4457  O OE1  . GLN B 2 45 ? -2.553  10.376  4.153   1.00 0.00 ? 339 GLN B OE1  3  
ATOM 4458  N NE2  . GLN B 2 45 ? -3.346  12.472  4.100   1.00 0.00 ? 339 GLN B NE2  3  
ATOM 4459  H H    . GLN B 2 45 ? -6.842  10.189  3.155   1.00 0.00 ? 339 GLN B H    3  
ATOM 4460  H HA   . GLN B 2 45 ? -5.812  12.671  4.052   1.00 0.00 ? 339 GLN B HA   3  
ATOM 4461  H HB2  . GLN B 2 45 ? -5.740  11.577  1.229   1.00 0.00 ? 339 GLN B HB2  3  
ATOM 4462  H HB3  . GLN B 2 45 ? -4.667  12.793  1.907   1.00 0.00 ? 339 GLN B HB3  3  
ATOM 4463  H HG2  . GLN B 2 45 ? -4.860  9.968   2.875   1.00 0.00 ? 339 GLN B HG2  3  
ATOM 4464  H HG3  . GLN B 2 45 ? -3.694  10.524  1.685   1.00 0.00 ? 339 GLN B HG3  3  
ATOM 4465  H HE21 . GLN B 2 45 ? -3.966  13.099  3.678   1.00 0.00 ? 339 GLN B HE21 3  
ATOM 4466  H HE22 . GLN B 2 45 ? -2.736  12.723  4.825   1.00 0.00 ? 339 GLN B HE22 3  
ATOM 4467  N N    . ARG B 2 46 ? -8.019  12.791  1.606   1.00 0.00 ? 340 ARG B N    3  
ATOM 4468  C CA   . ARG B 2 46 ? -9.015  13.623  0.932   1.00 0.00 ? 340 ARG B CA   3  
ATOM 4469  C C    . ARG B 2 46 ? -10.117 14.054  1.898   1.00 0.00 ? 340 ARG B C    3  
ATOM 4470  O O    . ARG B 2 46 ? -10.580 15.195  1.854   1.00 0.00 ? 340 ARG B O    3  
ATOM 4471  C CB   . ARG B 2 46 ? -9.630  12.874  -0.257  1.00 0.00 ? 340 ARG B CB   3  
ATOM 4472  C CG   . ARG B 2 46 ? -8.685  12.693  -1.436  1.00 0.00 ? 340 ARG B CG   3  
ATOM 4473  C CD   . ARG B 2 46 ? -7.524  11.765  -1.106  1.00 0.00 ? 340 ARG B CD   3  
ATOM 4474  N NE   . ARG B 2 46 ? -6.650  11.530  -2.258  1.00 0.00 ? 340 ARG B NE   3  
ATOM 4475  C CZ   . ARG B 2 46 ? -5.868  12.461  -2.815  1.00 0.00 ? 340 ARG B CZ   3  
ATOM 4476  N NH1  . ARG B 2 46 ? -5.811  13.691  -2.309  1.00 0.00 ? 340 ARG B NH1  3  
ATOM 4477  N NH2  . ARG B 2 46 ? -5.128  12.154  -3.875  1.00 0.00 ? 340 ARG B NH2  3  
ATOM 4478  H H    . ARG B 2 46 ? -7.897  11.855  1.322   1.00 0.00 ? 340 ARG B H    3  
ATOM 4479  H HA   . ARG B 2 46 ? -8.510  14.506  0.564   1.00 0.00 ? 340 ARG B HA   3  
ATOM 4480  H HB2  . ARG B 2 46 ? -9.942  11.894  0.076   1.00 0.00 ? 340 ARG B HB2  3  
ATOM 4481  H HB3  . ARG B 2 46 ? -10.497 13.420  -0.599  1.00 0.00 ? 340 ARG B HB3  3  
ATOM 4482  H HG2  . ARG B 2 46 ? -9.238  12.277  -2.262  1.00 0.00 ? 340 ARG B HG2  3  
ATOM 4483  H HG3  . ARG B 2 46 ? -8.293  13.659  -1.714  1.00 0.00 ? 340 ARG B HG3  3  
ATOM 4484  H HD2  . ARG B 2 46 ? -6.940  12.207  -0.314  1.00 0.00 ? 340 ARG B HD2  3  
ATOM 4485  H HD3  . ARG B 2 46 ? -7.923  10.820  -0.773  1.00 0.00 ? 340 ARG B HD3  3  
ATOM 4486  H HE   . ARG B 2 46 ? -6.651  10.628  -2.644  1.00 0.00 ? 340 ARG B HE   3  
ATOM 4487  H HH11 . ARG B 2 46 ? -6.352  13.931  -1.505  1.00 0.00 ? 340 ARG B HH11 3  
ATOM 4488  H HH12 . ARG B 2 46 ? -5.223  14.379  -2.737  1.00 0.00 ? 340 ARG B HH12 3  
ATOM 4489  H HH21 . ARG B 2 46 ? -5.156  11.228  -4.254  1.00 0.00 ? 340 ARG B HH21 3  
ATOM 4490  H HH22 . ARG B 2 46 ? -4.544  12.848  -4.296  1.00 0.00 ? 340 ARG B HH22 3  
ATOM 4491  N N    . ASN B 2 47 ? -10.527 13.133  2.772   1.00 0.00 ? 341 ASN B N    3  
ATOM 4492  C CA   . ASN B 2 47 ? -11.574 13.408  3.762   1.00 0.00 ? 341 ASN B CA   3  
ATOM 4493  C C    . ASN B 2 47 ? -11.234 14.623  4.628   1.00 0.00 ? 341 ASN B C    3  
ATOM 4494  O O    . ASN B 2 47 ? -12.100 15.462  4.887   1.00 0.00 ? 341 ASN B O    3  
ATOM 4495  C CB   . ASN B 2 47 ? -11.808 12.179  4.647   1.00 0.00 ? 341 ASN B CB   3  
ATOM 4496  C CG   . ASN B 2 47 ? -12.658 11.124  3.961   1.00 0.00 ? 341 ASN B CG   3  
ATOM 4497  O OD1  . ASN B 2 47 ? -13.777 11.400  3.530   1.00 0.00 ? 341 ASN B OD1  3  
ATOM 4498  N ND2  . ASN B 2 47 ? -12.139 9.905   3.866   1.00 0.00 ? 341 ASN B ND2  3  
ATOM 4499  H H    . ASN B 2 47 ? -10.113 12.245  2.748   1.00 0.00 ? 341 ASN B H    3  
ATOM 4500  H HA   . ASN B 2 47 ? -12.483 13.620  3.221   1.00 0.00 ? 341 ASN B HA   3  
ATOM 4501  H HB2  . ASN B 2 47 ? -10.853 11.739  4.898   1.00 0.00 ? 341 ASN B HB2  3  
ATOM 4502  H HB3  . ASN B 2 47 ? -12.305 12.484  5.554   1.00 0.00 ? 341 ASN B HB3  3  
ATOM 4503  H HD21 . ASN B 2 47 ? -11.248 9.751   4.239   1.00 0.00 ? 341 ASN B HD21 3  
ATOM 4504  H HD22 . ASN B 2 47 ? -12.670 9.209   3.426   1.00 0.00 ? 341 ASN B HD22 3  
ATOM 4505  N N    . ALA B 2 48 ? -9.976  14.720  5.064   1.00 0.00 ? 342 ALA B N    3  
ATOM 4506  C CA   . ALA B 2 48 ? -9.530  15.848  5.887   1.00 0.00 ? 342 ALA B CA   3  
ATOM 4507  C C    . ALA B 2 48 ? -9.823  17.182  5.197   1.00 0.00 ? 342 ALA B C    3  
ATOM 4508  O O    . ALA B 2 48 ? -10.265 18.138  5.838   1.00 0.00 ? 342 ALA B O    3  
ATOM 4509  C CB   . ALA B 2 48 ? -8.048  15.722  6.210   1.00 0.00 ? 342 ALA B CB   3  
ATOM 4510  H H    . ALA B 2 48 ? -9.329  14.026  4.818   1.00 0.00 ? 342 ALA B H    3  
ATOM 4511  H HA   . ALA B 2 48 ? -10.080 15.817  6.819   1.00 0.00 ? 342 ALA B HA   3  
ATOM 4512  H HB1  . ALA B 2 48 ? -7.531  16.611  5.881   1.00 0.00 ? 342 ALA B HB1  3  
ATOM 4513  H HB2  . ALA B 2 48 ? -7.640  14.860  5.702   1.00 0.00 ? 342 ALA B HB2  3  
ATOM 4514  H HB3  . ALA B 2 48 ? -7.920  15.604  7.275   1.00 0.00 ? 342 ALA B HB3  3  
ATOM 4515  N N    . LYS B 2 49 ? -9.580  17.233  3.884   1.00 0.00 ? 343 LYS B N    3  
ATOM 4516  C CA   . LYS B 2 49 ? -9.823  18.441  3.096   1.00 0.00 ? 343 LYS B CA   3  
ATOM 4517  C C    . LYS B 2 49 ? -11.320 18.742  2.999   1.00 0.00 ? 343 LYS B C    3  
ATOM 4518  O O    . LYS B 2 49 ? -11.734 19.897  3.118   1.00 0.00 ? 343 LYS B O    3  
ATOM 4519  C CB   . LYS B 2 49 ? -9.232  18.287  1.691   1.00 0.00 ? 343 LYS B CB   3  
ATOM 4520  C CG   . LYS B 2 49 ? -9.460  19.496  0.798   1.00 0.00 ? 343 LYS B CG   3  
ATOM 4521  C CD   . LYS B 2 49 ? -8.895  19.275  -0.592  1.00 0.00 ? 343 LYS B CD   3  
ATOM 4522  C CE   . LYS B 2 49 ? -9.171  20.463  -1.501  1.00 0.00 ? 343 LYS B CE   3  
ATOM 4523  N NZ   . LYS B 2 49 ? -8.651  20.244  -2.878  1.00 0.00 ? 343 LYS B NZ   3  
ATOM 4524  H H    . LYS B 2 49 ? -9.233  16.434  3.432   1.00 0.00 ? 343 LYS B H    3  
ATOM 4525  H HA   . LYS B 2 49 ? -9.333  19.266  3.591   1.00 0.00 ? 343 LYS B HA   3  
ATOM 4526  H HB2  . LYS B 2 49 ? -8.169  18.124  1.776   1.00 0.00 ? 343 LYS B HB2  3  
ATOM 4527  H HB3  . LYS B 2 49 ? -9.683  17.427  1.216   1.00 0.00 ? 343 LYS B HB3  3  
ATOM 4528  H HG2  . LYS B 2 49 ? -10.521 19.680  0.720   1.00 0.00 ? 343 LYS B HG2  3  
ATOM 4529  H HG3  . LYS B 2 49 ? -8.977  20.355  1.243   1.00 0.00 ? 343 LYS B HG3  3  
ATOM 4530  H HD2  . LYS B 2 49 ? -7.827  19.134  -0.517  1.00 0.00 ? 343 LYS B HD2  3  
ATOM 4531  H HD3  . LYS B 2 49 ? -9.349  18.392  -1.018  1.00 0.00 ? 343 LYS B HD3  3  
ATOM 4532  H HE2  . LYS B 2 49 ? -10.238 20.621  -1.549  1.00 0.00 ? 343 LYS B HE2  3  
ATOM 4533  H HE3  . LYS B 2 49 ? -8.698  21.339  -1.080  1.00 0.00 ? 343 LYS B HE3  3  
ATOM 4534  H HZ1  . LYS B 2 49 ? -8.850  21.077  -3.470  1.00 0.00 ? 343 LYS B HZ1  3  
ATOM 4535  H HZ2  . LYS B 2 49 ? -9.106  19.413  -3.305  1.00 0.00 ? 343 LYS B HZ2  3  
ATOM 4536  H HZ3  . LYS B 2 49 ? -7.623  20.089  -2.853  1.00 0.00 ? 343 LYS B HZ3  3  
ATOM 4537  N N    . GLU B 2 50 ? -12.123 17.696  2.778   1.00 0.00 ? 344 GLU B N    3  
ATOM 4538  C CA   . GLU B 2 50 ? -13.577 17.837  2.659   1.00 0.00 ? 344 GLU B CA   3  
ATOM 4539  C C    . GLU B 2 50 ? -14.162 18.609  3.841   1.00 0.00 ? 344 GLU B C    3  
ATOM 4540  O O    . GLU B 2 50 ? -14.981 19.511  3.655   1.00 0.00 ? 344 GLU B O    3  
ATOM 4541  C CB   . GLU B 2 50 ? -14.241 16.460  2.554   1.00 0.00 ? 344 GLU B CB   3  
ATOM 4542  C CG   . GLU B 2 50 ? -13.860 15.691  1.298   1.00 0.00 ? 344 GLU B CG   3  
ATOM 4543  C CD   . GLU B 2 50 ? -14.466 14.299  1.252   1.00 0.00 ? 344 GLU B CD   3  
ATOM 4544  O OE1  . GLU B 2 50 ? -15.710 14.189  1.266   1.00 0.00 ? 344 GLU B OE1  3  
ATOM 4545  O OE2  . GLU B 2 50 ? -13.693 13.319  1.199   1.00 0.00 ? 344 GLU B OE2  3  
ATOM 4546  H H    . GLU B 2 50 ? -11.725 16.803  2.689   1.00 0.00 ? 344 GLU B H    3  
ATOM 4547  H HA   . GLU B 2 50 ? -13.778 18.390  1.752   1.00 0.00 ? 344 GLU B HA   3  
ATOM 4548  H HB2  . GLU B 2 50 ? -13.955 15.869  3.412   1.00 0.00 ? 344 GLU B HB2  3  
ATOM 4549  H HB3  . GLU B 2 50 ? -15.313 16.590  2.559   1.00 0.00 ? 344 GLU B HB3  3  
ATOM 4550  H HG2  . GLU B 2 50 ? -14.203 16.242  0.435   1.00 0.00 ? 344 GLU B HG2  3  
ATOM 4551  H HG3  . GLU B 2 50 ? -12.784 15.601  1.260   1.00 0.00 ? 344 GLU B HG3  3  
ATOM 4552  N N    . ALA B 2 51 ? -13.734 18.257  5.055   1.00 0.00 ? 345 ALA B N    3  
ATOM 4553  C CA   . ALA B 2 51 ? -14.216 18.925  6.263   1.00 0.00 ? 345 ALA B CA   3  
ATOM 4554  C C    . ALA B 2 51 ? -13.701 20.362  6.342   1.00 0.00 ? 345 ALA B C    3  
ATOM 4555  O O    . ALA B 2 51 ? -14.453 21.278  6.683   1.00 0.00 ? 345 ALA B O    3  
ATOM 4556  C CB   . ALA B 2 51 ? -13.799 18.146  7.502   1.00 0.00 ? 345 ALA B CB   3  
ATOM 4557  H H    . ALA B 2 51 ? -13.078 17.533  5.139   1.00 0.00 ? 345 ALA B H    3  
ATOM 4558  H HA   . ALA B 2 51 ? -15.297 18.943  6.225   1.00 0.00 ? 345 ALA B HA   3  
ATOM 4559  H HB1  . ALA B 2 51 ? -14.011 18.731  8.384   1.00 0.00 ? 345 ALA B HB1  3  
ATOM 4560  H HB2  . ALA B 2 51 ? -12.741 17.935  7.456   1.00 0.00 ? 345 ALA B HB2  3  
ATOM 4561  H HB3  . ALA B 2 51 ? -14.349 17.217  7.546   1.00 0.00 ? 345 ALA B HB3  3  
ATOM 4562  N N    . GLY B 2 52 ? -12.417 20.551  6.023   1.00 0.00 ? 346 GLY B N    3  
ATOM 4563  C CA   . GLY B 2 52 ? -11.820 21.876  6.060   1.00 0.00 ? 346 GLY B CA   3  
ATOM 4564  C C    . GLY B 2 52 ? -11.834 22.492  7.449   1.00 0.00 ? 346 GLY B C    3  
ATOM 4565  O O    . GLY B 2 52 ? -12.105 23.685  7.599   1.00 0.00 ? 346 GLY B O    3  
ATOM 4566  H H    . GLY B 2 52 ? -11.871 19.780  5.757   1.00 0.00 ? 346 GLY B H    3  
ATOM 4567  H HA2  . GLY B 2 52 ? -10.795 21.805  5.724   1.00 0.00 ? 346 GLY B HA2  3  
ATOM 4568  H HA3  . GLY B 2 52 ? -12.363 22.522  5.387   1.00 0.00 ? 346 GLY B HA3  3  
ATOM 4569  N N    . GLY B 2 53 ? -11.543 21.678  8.466   1.00 0.00 ? 347 GLY B N    3  
ATOM 4570  C CA   . GLY B 2 53 ? -11.530 22.167  9.834   1.00 0.00 ? 347 GLY B CA   3  
ATOM 4571  C C    . GLY B 2 53 ? -10.744 21.265  10.768  1.00 0.00 ? 347 GLY B C    3  
ATOM 4572  O O    . GLY B 2 53 ? -9.640  20.830  10.434  1.00 0.00 ? 347 GLY B O    3  
ATOM 4573  H H    . GLY B 2 53 ? -11.335 20.737  8.284   1.00 0.00 ? 347 GLY B H    3  
ATOM 4574  H HA2  . GLY B 2 53 ? -11.088 23.151  9.848   1.00 0.00 ? 347 GLY B HA2  3  
ATOM 4575  H HA3  . GLY B 2 53 ? -12.547 22.235  10.189  1.00 0.00 ? 347 GLY B HA3  3  
ATOM 4576  N N    . ASN B 2 54 ? -11.314 20.986  11.940  1.00 0.00 ? 348 ASN B N    3  
ATOM 4577  C CA   . ASN B 2 54 ? -10.665 20.128  12.936  1.00 0.00 ? 348 ASN B CA   3  
ATOM 4578  C C    . ASN B 2 54 ? -10.905 18.636  12.654  1.00 0.00 ? 348 ASN B C    3  
ATOM 4579  O O    . ASN B 2 54 ? -11.011 17.836  13.587  1.00 0.00 ? 348 ASN B O    3  
ATOM 4580  C CB   . ASN B 2 54 ? -11.167 20.481  14.345  1.00 0.00 ? 348 ASN B CB   3  
ATOM 4581  C CG   . ASN B 2 54 ? -10.844 21.910  14.783  1.00 0.00 ? 348 ASN B CG   3  
ATOM 4582  O OD1  . ASN B 2 54 ? -11.308 22.355  15.832  1.00 0.00 ? 348 ASN B OD1  3  
ATOM 4583  N ND2  . ASN B 2 54 ? -10.039 22.637  14.005  1.00 0.00 ? 348 ASN B ND2  3  
ATOM 4584  H H    . ASN B 2 54 ? -12.196 21.365  12.143  1.00 0.00 ? 348 ASN B H    3  
ATOM 4585  H HA   . ASN B 2 54 ? -9.603  20.318  12.889  1.00 0.00 ? 348 ASN B HA   3  
ATOM 4586  H HB2  . ASN B 2 54 ? -12.238 20.358  14.375  1.00 0.00 ? 348 ASN B HB2  3  
ATOM 4587  H HB3  . ASN B 2 54 ? -10.716 19.801  15.055  1.00 0.00 ? 348 ASN B HB3  3  
ATOM 4588  H HD21 . ASN B 2 54 ? -9.684  22.233  13.188  1.00 0.00 ? 348 ASN B HD21 3  
ATOM 4589  H HD22 . ASN B 2 54 ? -9.835  23.553  14.284  1.00 0.00 ? 348 ASN B HD22 3  
ATOM 4590  N N    . TYR B 2 55 ? -10.990 18.261  11.373  1.00 0.00 ? 349 TYR B N    3  
ATOM 4591  C CA   . TYR B 2 55 ? -11.216 16.868  10.997  1.00 0.00 ? 349 TYR B CA   3  
ATOM 4592  C C    . TYR B 2 55 ? -9.915  16.073  11.001  1.00 0.00 ? 349 TYR B C    3  
ATOM 4593  O O    . TYR B 2 55 ? -9.016  16.330  10.199  1.00 0.00 ? 349 TYR B O    3  
ATOM 4594  C CB   . TYR B 2 55 ? -11.876 16.785  9.614   1.00 0.00 ? 349 TYR B CB   3  
ATOM 4595  C CG   . TYR B 2 55 ? -12.029 15.368  9.089   1.00 0.00 ? 349 TYR B CG   3  
ATOM 4596  C CD1  . TYR B 2 55 ? -10.921 14.632  8.680   1.00 0.00 ? 349 TYR B CD1  3  
ATOM 4597  C CD2  . TYR B 2 55 ? -13.277 14.768  9.012   1.00 0.00 ? 349 TYR B CD2  3  
ATOM 4598  C CE1  . TYR B 2 55 ? -11.053 13.341  8.208   1.00 0.00 ? 349 TYR B CE1  3  
ATOM 4599  C CE2  . TYR B 2 55 ? -13.420 13.475  8.540   1.00 0.00 ? 349 TYR B CE2  3  
ATOM 4600  C CZ   . TYR B 2 55 ? -12.305 12.767  8.140   1.00 0.00 ? 349 TYR B CZ   3  
ATOM 4601  O OH   . TYR B 2 55 ? -12.442 11.479  7.673   1.00 0.00 ? 349 TYR B OH   3  
ATOM 4602  H H    . TYR B 2 55 ? -10.895 18.931  10.668  1.00 0.00 ? 349 TYR B H    3  
ATOM 4603  H HA   . TYR B 2 55 ? -11.886 16.437  11.724  1.00 0.00 ? 349 TYR B HA   3  
ATOM 4604  H HB2  . TYR B 2 55 ? -12.859 17.225  9.667   1.00 0.00 ? 349 TYR B HB2  3  
ATOM 4605  H HB3  . TYR B 2 55 ? -11.278 17.338  8.904   1.00 0.00 ? 349 TYR B HB3  3  
ATOM 4606  H HD1  . TYR B 2 55 ? -9.944  15.083  8.731   1.00 0.00 ? 349 TYR B HD1  3  
ATOM 4607  H HD2  . TYR B 2 55 ? -14.147 15.325  9.326   1.00 0.00 ? 349 TYR B HD2  3  
ATOM 4608  H HE1  . TYR B 2 55 ? -10.177 12.787  7.898   1.00 0.00 ? 349 TYR B HE1  3  
ATOM 4609  H HE2  . TYR B 2 55 ? -14.400 13.027  8.487   1.00 0.00 ? 349 TYR B HE2  3  
ATOM 4610  H HH   . TYR B 2 55 ? -12.678 10.897  8.399   1.00 0.00 ? 349 TYR B HH   3  
ATOM 4611  N N    . THR B 2 56 ? -9.836  15.084  11.890  1.00 0.00 ? 350 THR B N    3  
ATOM 4612  C CA   . THR B 2 56 ? -8.663  14.226  11.964  1.00 0.00 ? 350 THR B CA   3  
ATOM 4613  C C    . THR B 2 56 ? -8.902  12.963  11.133  1.00 0.00 ? 350 THR B C    3  
ATOM 4614  O O    . THR B 2 56 ? -9.993  12.389  11.165  1.00 0.00 ? 350 THR B O    3  
ATOM 4615  C CB   . THR B 2 56 ? -8.325  13.869  13.409  1.00 0.00 ? 350 THR B CB   3  
ATOM 4616  O OG1  . THR B 2 56 ? -6.946  13.568  13.539  1.00 0.00 ? 350 THR B OG1  3  
ATOM 4617  C CG2  . THR B 2 56 ? -9.083  12.675  13.897  1.00 0.00 ? 350 THR B CG2  3  
ATOM 4618  H H    . THR B 2 56 ? -10.593 14.913  12.488  1.00 0.00 ? 350 THR B H    3  
ATOM 4619  H HA   . THR B 2 56 ? -7.840  14.757  11.543  1.00 0.00 ? 350 THR B HA   3  
ATOM 4620  H HB   . THR B 2 56 ? -8.560  14.706  14.051  1.00 0.00 ? 350 THR B HB   3  
ATOM 4621  H HG1  . THR B 2 56 ? -6.428  14.366  13.402  1.00 0.00 ? 350 THR B HG1  3  
ATOM 4622  H HG21 . THR B 2 56 ? -9.014  12.616  14.972  1.00 0.00 ? 350 THR B HG21 3  
ATOM 4623  H HG22 . THR B 2 56 ? -8.655  11.791  13.453  1.00 0.00 ? 350 THR B HG22 3  
ATOM 4624  H HG23 . THR B 2 56 ? -10.113 12.768  13.600  1.00 0.00 ? 350 THR B HG23 3  
ATOM 4625  N N    . PRO B 2 57 ? -7.895  12.521  10.365  1.00 0.00 ? 351 PRO B N    3  
ATOM 4626  C CA   . PRO B 2 57 ? -8.005  11.330  9.512   1.00 0.00 ? 351 PRO B CA   3  
ATOM 4627  C C    . PRO B 2 57 ? -8.121  10.033  10.313  1.00 0.00 ? 351 PRO B C    3  
ATOM 4628  O O    . PRO B 2 57 ? -7.673  9.957   11.460  1.00 0.00 ? 351 PRO B O    3  
ATOM 4629  C CB   . PRO B 2 57 ? -6.702  11.342  8.703   1.00 0.00 ? 351 PRO B CB   3  
ATOM 4630  C CG   . PRO B 2 57 ? -6.147  12.714  8.879   1.00 0.00 ? 351 PRO B CG   3  
ATOM 4631  C CD   . PRO B 2 57 ? -6.575  13.144  10.248  1.00 0.00 ? 351 PRO B CD   3  
ATOM 4632  H HA   . PRO B 2 57 ? -8.847  11.408  8.839   1.00 0.00 ? 351 PRO B HA   3  
ATOM 4633  H HB2  . PRO B 2 57 ? -6.027  10.590  9.086   1.00 0.00 ? 351 PRO B HB2  3  
ATOM 4634  H HB3  . PRO B 2 57 ? -6.921  11.140  7.666   1.00 0.00 ? 351 PRO B HB3  3  
ATOM 4635  H HG2  . PRO B 2 57 ? -5.070  12.689  8.809   1.00 0.00 ? 351 PRO B HG2  3  
ATOM 4636  H HG3  . PRO B 2 57 ? -6.562  13.375  8.132   1.00 0.00 ? 351 PRO B HG3  3  
ATOM 4637  H HD2  . PRO B 2 57 ? -5.899  12.764  11.000  1.00 0.00 ? 351 PRO B HD2  3  
ATOM 4638  H HD3  . PRO B 2 57 ? -6.648  14.219  10.306  1.00 0.00 ? 351 PRO B HD3  3  
ATOM 4639  N N    . ALA B 2 58 ? -8.721  9.016   9.693   1.00 0.00 ? 352 ALA B N    3  
ATOM 4640  C CA   . ALA B 2 58 ? -8.899  7.713   10.333  1.00 0.00 ? 352 ALA B CA   3  
ATOM 4641  C C    . ALA B 2 58 ? -7.657  6.824   10.175  1.00 0.00 ? 352 ALA B C    3  
ATOM 4642  O O    . ALA B 2 58 ? -7.578  5.757   10.783  1.00 0.00 ? 352 ALA B O    3  
ATOM 4643  C CB   . ALA B 2 58 ? -10.121 7.010   9.759   1.00 0.00 ? 352 ALA B CB   3  
ATOM 4644  H H    . ALA B 2 58 ? -9.050  9.145   8.778   1.00 0.00 ? 352 ALA B H    3  
ATOM 4645  H HA   . ALA B 2 58 ? -9.072  7.881   11.385  1.00 0.00 ? 352 ALA B HA   3  
ATOM 4646  H HB1  . ALA B 2 58 ? -10.992 7.635   9.897   1.00 0.00 ? 352 ALA B HB1  3  
ATOM 4647  H HB2  . ALA B 2 58 ? -10.269 6.070   10.270  1.00 0.00 ? 352 ALA B HB2  3  
ATOM 4648  H HB3  . ALA B 2 58 ? -9.971  6.829   8.705   1.00 0.00 ? 352 ALA B HB3  3  
ATOM 4649  N N    . LEU B 2 59 ? -6.691  7.275   9.364   1.00 0.00 ? 353 LEU B N    3  
ATOM 4650  C CA   . LEU B 2 59 ? -5.458  6.531   9.121   1.00 0.00 ? 353 LEU B CA   3  
ATOM 4651  C C    . LEU B 2 59 ? -4.320  7.461   8.720   1.00 0.00 ? 353 LEU B C    3  
ATOM 4652  O O    . LEU B 2 59 ? -4.531  8.602   8.315   1.00 0.00 ? 353 LEU B O    3  
ATOM 4653  C CB   . LEU B 2 59 ? -5.626  5.525   7.971   1.00 0.00 ? 353 LEU B CB   3  
ATOM 4654  C CG   . LEU B 2 59 ? -5.754  4.050   8.350   1.00 0.00 ? 353 LEU B CG   3  
ATOM 4655  C CD1  . LEU B 2 59 ? -7.080  3.748   9.032   1.00 0.00 ? 353 LEU B CD1  3  
ATOM 4656  C CD2  . LEU B 2 59 ? -5.554  3.181   7.117   1.00 0.00 ? 353 LEU B CD2  3  
ATOM 4657  H H    . LEU B 2 59 ? -6.811  8.129   8.916   1.00 0.00 ? 353 LEU B H    3  
ATOM 4658  H HA   . LEU B 2 59 ? -5.192  6.003   10.022  1.00 0.00 ? 353 LEU B HA   3  
ATOM 4659  H HB2  . LEU B 2 59 ? -6.495  5.804   7.401   1.00 0.00 ? 353 LEU B HB2  3  
ATOM 4660  H HB3  . LEU B 2 59 ? -4.753  5.620   7.335   1.00 0.00 ? 353 LEU B HB3  3  
ATOM 4661  H HG   . LEU B 2 59 ? -4.976  3.810   9.036   1.00 0.00 ? 353 LEU B HG   3  
ATOM 4662  H HD11 . LEU B 2 59 ? -6.923  3.667   10.098  1.00 0.00 ? 353 LEU B HD11 3  
ATOM 4663  H HD12 . LEU B 2 59 ? -7.475  2.816   8.655   1.00 0.00 ? 353 LEU B HD12 3  
ATOM 4664  H HD13 . LEU B 2 59 ? -7.780  4.545   8.831   1.00 0.00 ? 353 LEU B HD13 3  
ATOM 4665  H HD21 . LEU B 2 59 ? -4.504  3.164   6.857   1.00 0.00 ? 353 LEU B HD21 3  
ATOM 4666  H HD22 . LEU B 2 59 ? -6.118  3.592   6.292   1.00 0.00 ? 353 LEU B HD22 3  
ATOM 4667  H HD23 . LEU B 2 59 ? -5.893  2.177   7.321   1.00 0.00 ? 353 LEU B HD23 3  
ATOM 4668  N N    . THR B 2 60 ? -3.116  6.919   8.809   1.00 0.00 ? 354 THR B N    3  
ATOM 4669  C CA   . THR B 2 60 ? -1.891  7.605   8.428   1.00 0.00 ? 354 THR B CA   3  
ATOM 4670  C C    . THR B 2 60 ? -0.859  6.540   8.079   1.00 0.00 ? 354 THR B C    3  
ATOM 4671  O O    . THR B 2 60 ? -1.157  5.345   8.182   1.00 0.00 ? 354 THR B O    3  
ATOM 4672  C CB   . THR B 2 60 ? -1.367  8.503   9.562   1.00 0.00 ? 354 THR B CB   3  
ATOM 4673  O OG1  . THR B 2 60 ? -0.972  7.735   10.687  1.00 0.00 ? 354 THR B OG1  3  
ATOM 4674  C CG2  . THR B 2 60 ? -2.376  9.527   10.041  1.00 0.00 ? 354 THR B CG2  3  
ATOM 4675  H H    . THR B 2 60 ? -3.049  5.992   9.116   1.00 0.00 ? 354 THR B H    3  
ATOM 4676  H HA   . THR B 2 60 ? -2.093  8.205   7.552   1.00 0.00 ? 354 THR B HA   3  
ATOM 4677  H HB   . THR B 2 60 ? -0.501  9.042   9.204   1.00 0.00 ? 354 THR B HB   3  
ATOM 4678  H HG1  . THR B 2 60 ? -1.671  7.120   10.921  1.00 0.00 ? 354 THR B HG1  3  
ATOM 4679  H HG21 . THR B 2 60 ? -2.834  10.007  9.189   1.00 0.00 ? 354 THR B HG21 3  
ATOM 4680  H HG22 . THR B 2 60 ? -1.877  10.269  10.646  1.00 0.00 ? 354 THR B HG22 3  
ATOM 4681  H HG23 . THR B 2 60 ? -3.137  9.034   10.628  1.00 0.00 ? 354 THR B HG23 3  
ATOM 4682  N N    . GLU B 2 61 ? 0.350   6.936   7.702   1.00 0.00 ? 355 GLU B N    3  
ATOM 4683  C CA   . GLU B 2 61 ? 1.384   5.950   7.400   1.00 0.00 ? 355 GLU B CA   3  
ATOM 4684  C C    . GLU B 2 61 ? 1.557   5.012   8.603   1.00 0.00 ? 355 GLU B C    3  
ATOM 4685  O O    . GLU B 2 61 ? 1.941   3.852   8.450   1.00 0.00 ? 355 GLU B O    3  
ATOM 4686  C CB   . GLU B 2 61 ? 2.700   6.636   7.029   1.00 0.00 ? 355 GLU B CB   3  
ATOM 4687  C CG   . GLU B 2 61 ? 2.633   7.363   5.694   1.00 0.00 ? 355 GLU B CG   3  
ATOM 4688  C CD   . GLU B 2 61 ? 3.768   8.347   5.497   1.00 0.00 ? 355 GLU B CD   3  
ATOM 4689  O OE1  . GLU B 2 61 ? 3.763   9.397   6.175   1.00 0.00 ? 355 GLU B OE1  3  
ATOM 4690  O OE2  . GLU B 2 61 ? 4.665   8.067   4.674   1.00 0.00 ? 355 GLU B OE2  3  
ATOM 4691  H H    . GLU B 2 61 ? 0.559   7.893   7.655   1.00 0.00 ? 355 GLU B H    3  
ATOM 4692  H HA   . GLU B 2 61 ? 1.042   5.365   6.558   1.00 0.00 ? 355 GLU B HA   3  
ATOM 4693  H HB2  . GLU B 2 61 ? 2.951   7.348   7.795   1.00 0.00 ? 355 GLU B HB2  3  
ATOM 4694  H HB3  . GLU B 2 61 ? 3.479   5.891   6.972   1.00 0.00 ? 355 GLU B HB3  3  
ATOM 4695  H HG2  . GLU B 2 61 ? 2.671   6.633   4.899   1.00 0.00 ? 355 GLU B HG2  3  
ATOM 4696  H HG3  . GLU B 2 61 ? 1.697   7.901   5.639   1.00 0.00 ? 355 GLU B HG3  3  
ATOM 4697  N N    . GLN B 2 62 ? 1.222   5.529   9.799   1.00 0.00 ? 356 GLN B N    3  
ATOM 4698  C CA   . GLN B 2 62 ? 1.284   4.759   11.040  1.00 0.00 ? 356 GLN B CA   3  
ATOM 4699  C C    . GLN B 2 62 ? 0.312   3.579   10.991  1.00 0.00 ? 356 GLN B C    3  
ATOM 4700  O O    . GLN B 2 62 ? 0.664   2.468   11.380  1.00 0.00 ? 356 GLN B O    3  
ATOM 4701  C CB   . GLN B 2 62 ? 0.950   5.649   12.243  1.00 0.00 ? 356 GLN B CB   3  
ATOM 4702  C CG   . GLN B 2 62 ? 1.923   6.799   12.454  1.00 0.00 ? 356 GLN B CG   3  
ATOM 4703  C CD   . GLN B 2 62 ? 3.302   6.333   12.883  1.00 0.00 ? 356 GLN B CD   3  
ATOM 4704  O OE1  . GLN B 2 62 ? 3.973   5.597   12.163  1.00 0.00 ? 356 GLN B OE1  3  
ATOM 4705  N NE2  . GLN B 2 62 ? 3.734   6.759   14.068  1.00 0.00 ? 356 GLN B NE2  3  
ATOM 4706  H H    . GLN B 2 62 ? 0.897   6.450   9.841   1.00 0.00 ? 356 GLN B H    3  
ATOM 4707  H HA   . GLN B 2 62 ? 2.289   4.379   11.148  1.00 0.00 ? 356 GLN B HA   3  
ATOM 4708  H HB2  . GLN B 2 62 ? -0.036  6.065   12.102  1.00 0.00 ? 356 GLN B HB2  3  
ATOM 4709  H HB3  . GLN B 2 62 ? 0.948   5.040   13.135  1.00 0.00 ? 356 GLN B HB3  3  
ATOM 4710  H HG2  . GLN B 2 62 ? 2.019   7.348   11.530  1.00 0.00 ? 356 GLN B HG2  3  
ATOM 4711  H HG3  . GLN B 2 62 ? 1.526   7.452   13.218  1.00 0.00 ? 356 GLN B HG3  3  
ATOM 4712  H HE21 . GLN B 2 62 ? 3.147   7.343   14.593  1.00 0.00 ? 356 GLN B HE21 3  
ATOM 4713  H HE22 . GLN B 2 62 ? 4.622   6.470   14.367  1.00 0.00 ? 356 GLN B HE22 3  
ATOM 4714  N N    . GLU B 2 63 ? -0.911  3.826   10.493  1.00 0.00 ? 357 GLU B N    3  
ATOM 4715  C CA   . GLU B 2 63 ? -1.926  2.780   10.378  1.00 0.00 ? 357 GLU B CA   3  
ATOM 4716  C C    . GLU B 2 63 ? -1.543  1.800   9.278   1.00 0.00 ? 357 GLU B C    3  
ATOM 4717  O O    . GLU B 2 63 ? -1.702  0.589   9.416   1.00 0.00 ? 357 GLU B O    3  
ATOM 4718  C CB   . GLU B 2 63 ? -3.282  3.383   9.995   1.00 0.00 ? 357 GLU B CB   3  
ATOM 4719  C CG   . GLU B 2 63 ? -4.163  3.898   11.136  1.00 0.00 ? 357 GLU B CG   3  
ATOM 4720  C CD   . GLU B 2 63 ? -3.580  5.072   11.911  1.00 0.00 ? 357 GLU B CD   3  
ATOM 4721  O OE1  . GLU B 2 63 ? -2.583  5.666   11.457  1.00 0.00 ? 357 GLU B OE1  3  
ATOM 4722  O OE2  . GLU B 2 63 ? -4.147  5.416   12.969  1.00 0.00 ? 357 GLU B OE2  3  
ATOM 4723  H H    . GLU B 2 63 ? -1.133  4.734   10.181  1.00 0.00 ? 357 GLU B H    3  
ATOM 4724  H HA   . GLU B 2 63 ? -2.007  2.263   11.321  1.00 0.00 ? 357 GLU B HA   3  
ATOM 4725  H HB2  . GLU B 2 63 ? -3.108  4.205   9.323   1.00 0.00 ? 357 GLU B HB2  3  
ATOM 4726  H HB3  . GLU B 2 63 ? -3.843  2.626   9.464   1.00 0.00 ? 357 GLU B HB3  3  
ATOM 4727  H HG2  . GLU B 2 63 ? -5.112  4.222   10.703  1.00 0.00 ? 357 GLU B HG2  3  
ATOM 4728  H HG3  . GLU B 2 63 ? -4.347  3.085   11.822  1.00 0.00 ? 357 GLU B HG3  3  
ATOM 4729  N N    . VAL B 2 64 ? -1.067  2.362   8.172   1.00 0.00 ? 358 VAL B N    3  
ATOM 4730  C CA   . VAL B 2 64 ? -0.680  1.586   7.000   1.00 0.00 ? 358 VAL B CA   3  
ATOM 4731  C C    . VAL B 2 64 ? 0.428   0.593   7.325   1.00 0.00 ? 358 VAL B C    3  
ATOM 4732  O O    . VAL B 2 64 ? 0.233   -0.618  7.216   1.00 0.00 ? 358 VAL B O    3  
ATOM 4733  C CB   . VAL B 2 64 ? -0.217  2.542   5.881   1.00 0.00 ? 358 VAL B CB   3  
ATOM 4734  C CG1  . VAL B 2 64 ? 0.039   1.803   4.581   1.00 0.00 ? 358 VAL B CG1  3  
ATOM 4735  C CG2  . VAL B 2 64 ? -1.243  3.645   5.688   1.00 0.00 ? 358 VAL B CG2  3  
ATOM 4736  H H    . VAL B 2 64 ? -0.990  3.340   8.135   1.00 0.00 ? 358 VAL B H    3  
ATOM 4737  H HA   . VAL B 2 64 ? -1.549  1.049   6.651   1.00 0.00 ? 358 VAL B HA   3  
ATOM 4738  H HB   . VAL B 2 64 ? 0.710   3.001   6.193   1.00 0.00 ? 358 VAL B HB   3  
ATOM 4739  H HG11 . VAL B 2 64 ? 0.929   2.202   4.113   1.00 0.00 ? 358 VAL B HG11 3  
ATOM 4740  H HG12 . VAL B 2 64 ? -0.805  1.934   3.922   1.00 0.00 ? 358 VAL B HG12 3  
ATOM 4741  H HG13 . VAL B 2 64 ? 0.180   0.753   4.784   1.00 0.00 ? 358 VAL B HG13 3  
ATOM 4742  H HG21 . VAL B 2 64 ? -1.702  3.545   4.716   1.00 0.00 ? 358 VAL B HG21 3  
ATOM 4743  H HG22 . VAL B 2 64 ? -0.754  4.602   5.762   1.00 0.00 ? 358 VAL B HG22 3  
ATOM 4744  H HG23 . VAL B 2 64 ? -2.001  3.566   6.457   1.00 0.00 ? 358 VAL B HG23 3  
ATOM 4745  N N    . TYR B 2 65 ? 1.580   1.107   7.747   1.00 0.00 ? 359 TYR B N    3  
ATOM 4746  C CA   . TYR B 2 65 ? 2.712   0.264   8.114   1.00 0.00 ? 359 TYR B CA   3  
ATOM 4747  C C    . TYR B 2 65 ? 2.347   -0.691  9.250   1.00 0.00 ? 359 TYR B C    3  
ATOM 4748  O O    . TYR B 2 65 ? 2.788   -1.840  9.269   1.00 0.00 ? 359 TYR B O    3  
ATOM 4749  C CB   . TYR B 2 65 ? 3.903   1.128   8.533   1.00 0.00 ? 359 TYR B CB   3  
ATOM 4750  C CG   . TYR B 2 65 ? 5.132   0.328   8.905   1.00 0.00 ? 359 TYR B CG   3  
ATOM 4751  C CD1  . TYR B 2 65 ? 5.869   -0.344  7.938   1.00 0.00 ? 359 TYR B CD1  3  
ATOM 4752  C CD2  . TYR B 2 65 ? 5.547   0.238   10.226  1.00 0.00 ? 359 TYR B CD2  3  
ATOM 4753  C CE1  . TYR B 2 65 ? 6.986   -1.081  8.275   1.00 0.00 ? 359 TYR B CE1  3  
ATOM 4754  C CE2  . TYR B 2 65 ? 6.665   -0.496  10.574  1.00 0.00 ? 359 TYR B CE2  3  
ATOM 4755  C CZ   . TYR B 2 65 ? 7.382   -1.154  9.595   1.00 0.00 ? 359 TYR B CZ   3  
ATOM 4756  O OH   . TYR B 2 65 ? 8.495   -1.887  9.937   1.00 0.00 ? 359 TYR B OH   3  
ATOM 4757  H H    . TYR B 2 65 ? 1.663   2.080   7.832   1.00 0.00 ? 359 TYR B H    3  
ATOM 4758  H HA   . TYR B 2 65 ? 2.988   -0.317  7.247   1.00 0.00 ? 359 TYR B HA   3  
ATOM 4759  H HB2  . TYR B 2 65 ? 4.168   1.783   7.717   1.00 0.00 ? 359 TYR B HB2  3  
ATOM 4760  H HB3  . TYR B 2 65 ? 3.622   1.722   9.389   1.00 0.00 ? 359 TYR B HB3  3  
ATOM 4761  H HD1  . TYR B 2 65 ? 5.558   -0.283  6.905   1.00 0.00 ? 359 TYR B HD1  3  
ATOM 4762  H HD2  . TYR B 2 65 ? 4.982   0.752   10.992  1.00 0.00 ? 359 TYR B HD2  3  
ATOM 4763  H HE1  . TYR B 2 65 ? 7.546   -1.595  7.509   1.00 0.00 ? 359 TYR B HE1  3  
ATOM 4764  H HE2  . TYR B 2 65 ? 6.974   -0.553  11.608  1.00 0.00 ? 359 TYR B HE2  3  
ATOM 4765  H HH   . TYR B 2 65 ? 9.281   -1.347  9.827   1.00 0.00 ? 359 TYR B HH   3  
ATOM 4766  N N    . ALA B 2 66 ? 1.561   -0.192  10.206  1.00 0.00 ? 360 ALA B N    3  
ATOM 4767  C CA   . ALA B 2 66 ? 1.154   -0.983  11.372  1.00 0.00 ? 360 ALA B CA   3  
ATOM 4768  C C    . ALA B 2 66 ? 0.327   -2.212  10.997  1.00 0.00 ? 360 ALA B C    3  
ATOM 4769  O O    . ALA B 2 66 ? 0.640   -3.326  11.420  1.00 0.00 ? 360 ALA B O    3  
ATOM 4770  C CB   . ALA B 2 66 ? 0.390   -0.116  12.360  1.00 0.00 ? 360 ALA B CB   3  
ATOM 4771  H H    . ALA B 2 66 ? 1.256   0.744   10.131  1.00 0.00 ? 360 ALA B H    3  
ATOM 4772  H HA   . ALA B 2 66 ? 2.056   -1.318  11.863  1.00 0.00 ? 360 ALA B HA   3  
ATOM 4773  H HB1  . ALA B 2 66 ? 1.050   0.640   12.755  1.00 0.00 ? 360 ALA B HB1  3  
ATOM 4774  H HB2  . ALA B 2 66 ? 0.021   -0.731  13.168  1.00 0.00 ? 360 ALA B HB2  3  
ATOM 4775  H HB3  . ALA B 2 66 ? -0.440  0.356   11.859  1.00 0.00 ? 360 ALA B HB3  3  
ATOM 4776  N N    . GLN B 2 67 ? -0.736  -2.005  10.217  1.00 0.00 ? 361 GLN B N    3  
ATOM 4777  C CA   . GLN B 2 67 ? -1.614  -3.104  9.812   1.00 0.00 ? 361 GLN B CA   3  
ATOM 4778  C C    . GLN B 2 67 ? -0.882  -4.100  8.911   1.00 0.00 ? 361 GLN B C    3  
ATOM 4779  O O    . GLN B 2 67 ? -1.064  -5.310  9.047   1.00 0.00 ? 361 GLN B O    3  
ATOM 4780  C CB   . GLN B 2 67 ? -2.862  -2.565  9.109   1.00 0.00 ? 361 GLN B CB   3  
ATOM 4781  C CG   . GLN B 2 67 ? -3.722  -1.674  9.995   1.00 0.00 ? 361 GLN B CG   3  
ATOM 4782  C CD   . GLN B 2 67 ? -4.954  -1.148  9.282   1.00 0.00 ? 361 GLN B CD   3  
ATOM 4783  O OE1  . GLN B 2 67 ? -5.825  -1.918  8.873   1.00 0.00 ? 361 GLN B OE1  3  
ATOM 4784  N NE2  . GLN B 2 67 ? -5.035  0.169   9.126   1.00 0.00 ? 361 GLN B NE2  3  
ATOM 4785  H H    . GLN B 2 67 ? -0.943  -1.094  9.921   1.00 0.00 ? 361 GLN B H    3  
ATOM 4786  H HA   . GLN B 2 67 ? -1.920  -3.621  10.711  1.00 0.00 ? 361 GLN B HA   3  
ATOM 4787  H HB2  . GLN B 2 67 ? -2.557  -1.991  8.247   1.00 0.00 ? 361 GLN B HB2  3  
ATOM 4788  H HB3  . GLN B 2 67 ? -3.465  -3.397  8.782   1.00 0.00 ? 361 GLN B HB3  3  
ATOM 4789  H HG2  . GLN B 2 67 ? -4.041  -2.245  10.855  1.00 0.00 ? 361 GLN B HG2  3  
ATOM 4790  H HG3  . GLN B 2 67 ? -3.129  -0.835  10.325  1.00 0.00 ? 361 GLN B HG3  3  
ATOM 4791  H HE21 . GLN B 2 67 ? -4.307  0.723   9.474   1.00 0.00 ? 361 GLN B HE21 3  
ATOM 4792  H HE22 . GLN B 2 67 ? -5.823  0.533   8.668   1.00 0.00 ? 361 GLN B HE22 3  
ATOM 4793  N N    . VAL B 2 68 ? -0.037  -3.594  8.010   1.00 0.00 ? 362 VAL B N    3  
ATOM 4794  C CA   . VAL B 2 68 ? 0.734   -4.459  7.116   1.00 0.00 ? 362 VAL B CA   3  
ATOM 4795  C C    . VAL B 2 68 ? 1.745   -5.275  7.923   1.00 0.00 ? 362 VAL B C    3  
ATOM 4796  O O    . VAL B 2 68 ? 1.928   -6.468  7.678   1.00 0.00 ? 362 VAL B O    3  
ATOM 4797  C CB   . VAL B 2 68 ? 1.480   -3.649  6.030   1.00 0.00 ? 362 VAL B CB   3  
ATOM 4798  C CG1  . VAL B 2 68 ? 2.185   -4.576  5.049   1.00 0.00 ? 362 VAL B CG1  3  
ATOM 4799  C CG2  . VAL B 2 68 ? 0.522   -2.725  5.295   1.00 0.00 ? 362 VAL B CG2  3  
ATOM 4800  H H    . VAL B 2 68 ? 0.083   -2.622  7.956   1.00 0.00 ? 362 VAL B H    3  
ATOM 4801  H HA   . VAL B 2 68 ? 0.045   -5.138  6.628   1.00 0.00 ? 362 VAL B HA   3  
ATOM 4802  H HB   . VAL B 2 68 ? 2.230   -3.041  6.516   1.00 0.00 ? 362 VAL B HB   3  
ATOM 4803  H HG11 . VAL B 2 68 ? 1.496   -4.862  4.268   1.00 0.00 ? 362 VAL B HG11 3  
ATOM 4804  H HG12 . VAL B 2 68 ? 2.527   -5.459  5.568   1.00 0.00 ? 362 VAL B HG12 3  
ATOM 4805  H HG13 . VAL B 2 68 ? 3.030   -4.064  4.613   1.00 0.00 ? 362 VAL B HG13 3  
ATOM 4806  H HG21 . VAL B 2 68 ? 0.839   -1.701  5.425   1.00 0.00 ? 362 VAL B HG21 3  
ATOM 4807  H HG22 . VAL B 2 68 ? -0.476  -2.846  5.691   1.00 0.00 ? 362 VAL B HG22 3  
ATOM 4808  H HG23 . VAL B 2 68 ? 0.523   -2.969  4.246   1.00 0.00 ? 362 VAL B HG23 3  
ATOM 4809  N N    . ALA B 2 69 ? 2.384   -4.617  8.896   1.00 0.00 ? 363 ALA B N    3  
ATOM 4810  C CA   . ALA B 2 69 ? 3.365   -5.269  9.766   1.00 0.00 ? 363 ALA B CA   3  
ATOM 4811  C C    . ALA B 2 69 ? 2.774   -6.501  10.450  1.00 0.00 ? 363 ALA B C    3  
ATOM 4812  O O    . ALA B 2 69 ? 3.481   -7.480  10.689  1.00 0.00 ? 363 ALA B O    3  
ATOM 4813  C CB   . ALA B 2 69 ? 3.891   -4.287  10.805  1.00 0.00 ? 363 ALA B CB   3  
ATOM 4814  H H    . ALA B 2 69 ? 2.181   -3.669  9.043   1.00 0.00 ? 363 ALA B H    3  
ATOM 4815  H HA   . ALA B 2 69 ? 4.195   -5.579  9.153   1.00 0.00 ? 363 ALA B HA   3  
ATOM 4816  H HB1  . ALA B 2 69 ? 4.797   -3.826  10.439  1.00 0.00 ? 363 ALA B HB1  3  
ATOM 4817  H HB2  . ALA B 2 69 ? 4.102   -4.812  11.725  1.00 0.00 ? 363 ALA B HB2  3  
ATOM 4818  H HB3  . ALA B 2 69 ? 3.148   -3.523  10.989  1.00 0.00 ? 363 ALA B HB3  3  
ATOM 4819  N N    . ARG B 2 70 ? 1.473   -6.446  10.755  1.00 0.00 ? 364 ARG B N    3  
ATOM 4820  C CA   . ARG B 2 70 ? 0.785   -7.562  11.401  1.00 0.00 ? 364 ARG B CA   3  
ATOM 4821  C C    . ARG B 2 70 ? 0.649   -8.734  10.434  1.00 0.00 ? 364 ARG B C    3  
ATOM 4822  O O    . ARG B 2 70 ? 0.848   -9.891  10.811  1.00 0.00 ? 364 ARG B O    3  
ATOM 4823  C CB   . ARG B 2 70 ? -0.593  -7.119  11.898  1.00 0.00 ? 364 ARG B CB   3  
ATOM 4824  C CG   . ARG B 2 70 ? -0.530  -6.043  12.969  1.00 0.00 ? 364 ARG B CG   3  
ATOM 4825  C CD   . ARG B 2 70 ? -1.918  -5.573  13.375  1.00 0.00 ? 364 ARG B CD   3  
ATOM 4826  N NE   . ARG B 2 70 ? -1.873  -4.553  14.423  1.00 0.00 ? 364 ARG B NE   3  
ATOM 4827  C CZ   . ARG B 2 70 ? -1.464  -4.778  15.677  1.00 0.00 ? 364 ARG B CZ   3  
ATOM 4828  N NH1  . ARG B 2 70 ? -1.103  -6.001  16.065  1.00 0.00 ? 364 ARG B NH1  3  
ATOM 4829  N NH2  . ARG B 2 70 ? -1.427  -3.778  16.550  1.00 0.00 ? 364 ARG B NH2  3  
ATOM 4830  H H    . ARG B 2 70 ? 0.961   -5.641  10.529  1.00 0.00 ? 364 ARG B H    3  
ATOM 4831  H HA   . ARG B 2 70 ? 1.380   -7.873  12.247  1.00 0.00 ? 364 ARG B HA   3  
ATOM 4832  H HB2  . ARG B 2 70 ? -1.158  -6.735  11.062  1.00 0.00 ? 364 ARG B HB2  3  
ATOM 4833  H HB3  . ARG B 2 70 ? -1.108  -7.975  12.307  1.00 0.00 ? 364 ARG B HB3  3  
ATOM 4834  H HG2  . ARG B 2 70 ? -0.029  -6.442  13.837  1.00 0.00 ? 364 ARG B HG2  3  
ATOM 4835  H HG3  . ARG B 2 70 ? 0.027   -5.200  12.586  1.00 0.00 ? 364 ARG B HG3  3  
ATOM 4836  H HD2  . ARG B 2 70 ? -2.410  -5.161  12.506  1.00 0.00 ? 364 ARG B HD2  3  
ATOM 4837  H HD3  . ARG B 2 70 ? -2.480  -6.422  13.733  1.00 0.00 ? 364 ARG B HD3  3  
ATOM 4838  H HE   . ARG B 2 70 ? -2.152  -3.645  14.178  1.00 0.00 ? 364 ARG B HE   3  
ATOM 4839  H HH11 . ARG B 2 70 ? -1.137  -6.763  15.420  1.00 0.00 ? 364 ARG B HH11 3  
ATOM 4840  H HH12 . ARG B 2 70 ? -0.797  -6.156  17.004  1.00 0.00 ? 364 ARG B HH12 3  
ATOM 4841  H HH21 . ARG B 2 70 ? -1.706  -2.859  16.271  1.00 0.00 ? 364 ARG B HH21 3  
ATOM 4842  H HH22 . ARG B 2 70 ? -1.122  -3.943  17.489  1.00 0.00 ? 364 ARG B HH22 3  
ATOM 4843  N N    . LEU B 2 71 ? 0.324   -8.422  9.182   1.00 0.00 ? 365 LEU B N    3  
ATOM 4844  C CA   . LEU B 2 71 ? 0.180   -9.437  8.144   1.00 0.00 ? 365 LEU B CA   3  
ATOM 4845  C C    . LEU B 2 71 ? 1.521   -10.118 7.867   1.00 0.00 ? 365 LEU B C    3  
ATOM 4846  O O    . LEU B 2 71 ? 1.591   -11.338 7.708   1.00 0.00 ? 365 LEU B O    3  
ATOM 4847  C CB   . LEU B 2 71 ? -0.339  -8.807  6.844   1.00 0.00 ? 365 LEU B CB   3  
ATOM 4848  C CG   . LEU B 2 71 ? -1.639  -8.006  6.965   1.00 0.00 ? 365 LEU B CG   3  
ATOM 4849  C CD1  . LEU B 2 71 ? -2.023  -7.384  5.628   1.00 0.00 ? 365 LEU B CD1  3  
ATOM 4850  C CD2  . LEU B 2 71 ? -2.764  -8.881  7.499   1.00 0.00 ? 365 LEU B CD2  3  
ATOM 4851  H H    . LEU B 2 71 ? 0.189   -7.480  8.945   1.00 0.00 ? 365 LEU B H    3  
ATOM 4852  H HA   . LEU B 2 71 ? -0.528  -10.175 8.490   1.00 0.00 ? 365 LEU B HA   3  
ATOM 4853  H HB2  . LEU B 2 71 ? 0.425   -8.147  6.461   1.00 0.00 ? 365 LEU B HB2  3  
ATOM 4854  H HB3  . LEU B 2 71 ? -0.498  -9.596  6.127   1.00 0.00 ? 365 LEU B HB3  3  
ATOM 4855  H HG   . LEU B 2 71 ? -1.485  -7.205  7.663   1.00 0.00 ? 365 LEU B HG   3  
ATOM 4856  H HD11 . LEU B 2 71 ? -1.603  -6.391  5.563   1.00 0.00 ? 365 LEU B HD11 3  
ATOM 4857  H HD12 . LEU B 2 71 ? -3.099  -7.325  5.553   1.00 0.00 ? 365 LEU B HD12 3  
ATOM 4858  H HD13 . LEU B 2 71 ? -1.638  -7.990  4.823   1.00 0.00 ? 365 LEU B HD13 3  
ATOM 4859  H HD21 . LEU B 2 71 ? -3.149  -8.452  8.413   1.00 0.00 ? 365 LEU B HD21 3  
ATOM 4860  H HD22 . LEU B 2 71 ? -2.386  -9.873  7.699   1.00 0.00 ? 365 LEU B HD22 3  
ATOM 4861  H HD23 . LEU B 2 71 ? -3.556  -8.939  6.767   1.00 0.00 ? 365 LEU B HD23 3  
ATOM 4862  N N    . PHE B 2 72 ? 2.576   -9.303  7.770   1.00 0.00 ? 366 PHE B N    3  
ATOM 4863  C CA   . PHE B 2 72 ? 3.917   -9.788  7.466   1.00 0.00 ? 366 PHE B CA   3  
ATOM 4864  C C    . PHE B 2 72 ? 4.730   -10.170 8.710   1.00 0.00 ? 366 PHE B C    3  
ATOM 4865  O O    . PHE B 2 72 ? 5.949   -10.317 8.621   1.00 0.00 ? 366 PHE B O    3  
ATOM 4866  C CB   . PHE B 2 72 ? 4.656   -8.705  6.691   1.00 0.00 ? 366 PHE B CB   3  
ATOM 4867  C CG   . PHE B 2 72 ? 4.020   -8.319  5.381   1.00 0.00 ? 366 PHE B CG   3  
ATOM 4868  C CD1  . PHE B 2 72 ? 2.758   -8.776  5.026   1.00 0.00 ? 366 PHE B CD1  3  
ATOM 4869  C CD2  . PHE B 2 72 ? 4.691   -7.487  4.503   1.00 0.00 ? 366 PHE B CD2  3  
ATOM 4870  C CE1  . PHE B 2 72 ? 2.186   -8.414  3.827   1.00 0.00 ? 366 PHE B CE1  3  
ATOM 4871  C CE2  . PHE B 2 72 ? 4.123   -7.123  3.302   1.00 0.00 ? 366 PHE B CE2  3  
ATOM 4872  C CZ   . PHE B 2 72 ? 2.868   -7.589  2.965   1.00 0.00 ? 366 PHE B CZ   3  
ATOM 4873  H H    . PHE B 2 72 ? 2.447   -8.337  7.879   1.00 0.00 ? 366 PHE B H    3  
ATOM 4874  H HA   . PHE B 2 72 ? 3.819   -10.658 6.834   1.00 0.00 ? 366 PHE B HA   3  
ATOM 4875  H HB2  . PHE B 2 72 ? 4.686   -7.821  7.302   1.00 0.00 ? 366 PHE B HB2  3  
ATOM 4876  H HB3  . PHE B 2 72 ? 5.665   -9.036  6.489   1.00 0.00 ? 366 PHE B HB3  3  
ATOM 4877  H HD1  . PHE B 2 72 ? 2.219   -9.424  5.696   1.00 0.00 ? 366 PHE B HD1  3  
ATOM 4878  H HD2  . PHE B 2 72 ? 5.674   -7.124  4.766   1.00 0.00 ? 366 PHE B HD2  3  
ATOM 4879  H HE1  . PHE B 2 72 ? 1.204   -8.778  3.564   1.00 0.00 ? 366 PHE B HE1  3  
ATOM 4880  H HE2  . PHE B 2 72 ? 4.658   -6.474  2.628   1.00 0.00 ? 366 PHE B HE2  3  
ATOM 4881  H HZ   . PHE B 2 72 ? 2.425   -7.314  2.022   1.00 0.00 ? 366 PHE B HZ   3  
ATOM 4882  N N    . LYS B 2 73 ? 4.074   -10.323 9.864   1.00 0.00 ? 367 LYS B N    3  
ATOM 4883  C CA   . LYS B 2 73 ? 4.774   -10.685 11.104  1.00 0.00 ? 367 LYS B CA   3  
ATOM 4884  C C    . LYS B 2 73 ? 5.696   -11.897 10.916  1.00 0.00 ? 367 LYS B C    3  
ATOM 4885  O O    . LYS B 2 73 ? 6.760   -11.972 11.534  1.00 0.00 ? 367 LYS B O    3  
ATOM 4886  C CB   . LYS B 2 73 ? 3.774   -10.961 12.229  1.00 0.00 ? 367 LYS B CB   3  
ATOM 4887  C CG   . LYS B 2 73 ? 3.091   -9.707  12.751  1.00 0.00 ? 367 LYS B CG   3  
ATOM 4888  C CD   . LYS B 2 73 ? 2.053   -10.028 13.816  1.00 0.00 ? 367 LYS B CD   3  
ATOM 4889  C CE   . LYS B 2 73 ? 2.687   -10.656 15.049  1.00 0.00 ? 367 LYS B CE   3  
ATOM 4890  N NZ   . LYS B 2 73 ? 1.681   -10.940 16.109  1.00 0.00 ? 367 LYS B NZ   3  
ATOM 4891  H H    . LYS B 2 73 ? 3.104   -10.189 9.886   1.00 0.00 ? 367 LYS B H    3  
ATOM 4892  H HA   . LYS B 2 73 ? 5.381   -9.839  11.386  1.00 0.00 ? 367 LYS B HA   3  
ATOM 4893  H HB2  . LYS B 2 73 ? 3.013   -11.635 11.863  1.00 0.00 ? 367 LYS B HB2  3  
ATOM 4894  H HB3  . LYS B 2 73 ? 4.294   -11.430 13.050  1.00 0.00 ? 367 LYS B HB3  3  
ATOM 4895  H HG2  . LYS B 2 73 ? 3.838   -9.055  13.178  1.00 0.00 ? 367 LYS B HG2  3  
ATOM 4896  H HG3  . LYS B 2 73 ? 2.606   -9.208  11.928  1.00 0.00 ? 367 LYS B HG3  3  
ATOM 4897  H HD2  . LYS B 2 73 ? 1.557   -9.114  14.107  1.00 0.00 ? 367 LYS B HD2  3  
ATOM 4898  H HD3  . LYS B 2 73 ? 1.330   -10.716 13.403  1.00 0.00 ? 367 LYS B HD3  3  
ATOM 4899  H HE2  . LYS B 2 73 ? 3.164   -11.581 14.761  1.00 0.00 ? 367 LYS B HE2  3  
ATOM 4900  H HE3  . LYS B 2 73 ? 3.429   -9.976  15.442  1.00 0.00 ? 367 LYS B HE3  3  
ATOM 4901  H HZ1  . LYS B 2 73 ? 0.850   -11.413 15.698  1.00 0.00 ? 367 LYS B HZ1  3  
ATOM 4902  H HZ2  . LYS B 2 73 ? 1.373   -10.055 16.558  1.00 0.00 ? 367 LYS B HZ2  3  
ATOM 4903  H HZ3  . LYS B 2 73 ? 2.093   -11.559 16.836  1.00 0.00 ? 367 LYS B HZ3  3  
ATOM 4904  N N    . ASN B 2 74 ? 5.280   -12.847 10.075  1.00 0.00 ? 368 ASN B N    3  
ATOM 4905  C CA   . ASN B 2 74 ? 6.068   -14.059 9.820   1.00 0.00 ? 368 ASN B CA   3  
ATOM 4906  C C    . ASN B 2 74 ? 7.136   -13.859 8.732   1.00 0.00 ? 368 ASN B C    3  
ATOM 4907  O O    . ASN B 2 74 ? 7.884   -14.789 8.424   1.00 0.00 ? 368 ASN B O    3  
ATOM 4908  C CB   . ASN B 2 74 ? 5.139   -15.217 9.436   1.00 0.00 ? 368 ASN B CB   3  
ATOM 4909  C CG   . ASN B 2 74 ? 4.357   -14.947 8.162   1.00 0.00 ? 368 ASN B CG   3  
ATOM 4910  O OD1  . ASN B 2 74 ? 4.931   -14.846 7.078   1.00 0.00 ? 368 ASN B OD1  3  
ATOM 4911  N ND2  . ASN B 2 74 ? 3.040   -14.822 8.287   1.00 0.00 ? 368 ASN B ND2  3  
ATOM 4912  H H    . ASN B 2 74 ? 4.420   -12.736 9.617   1.00 0.00 ? 368 ASN B H    3  
ATOM 4913  H HA   . ASN B 2 74 ? 6.568   -14.315 10.742  1.00 0.00 ? 368 ASN B HA   3  
ATOM 4914  H HB2  . ASN B 2 74 ? 5.731   -16.109 9.290   1.00 0.00 ? 368 ASN B HB2  3  
ATOM 4915  H HB3  . ASN B 2 74 ? 4.437   -15.386 10.240  1.00 0.00 ? 368 ASN B HB3  3  
ATOM 4916  H HD21 . ASN B 2 74 ? 2.647   -14.909 9.181   1.00 0.00 ? 368 ASN B HD21 3  
ATOM 4917  H HD22 . ASN B 2 74 ? 2.514   -14.647 7.478   1.00 0.00 ? 368 ASN B HD22 3  
ATOM 4918  N N    . GLN B 2 75 ? 7.205   -12.659 8.147   1.00 0.00 ? 369 GLN B N    3  
ATOM 4919  C CA   . GLN B 2 75 ? 8.181   -12.371 7.094   1.00 0.00 ? 369 GLN B CA   3  
ATOM 4920  C C    . GLN B 2 75 ? 8.626   -10.908 7.120   1.00 0.00 ? 369 GLN B C    3  
ATOM 4921  O O    . GLN B 2 75 ? 8.168   -10.086 6.320   1.00 0.00 ? 369 GLN B O    3  
ATOM 4922  C CB   . GLN B 2 75 ? 7.611   -12.738 5.719   1.00 0.00 ? 369 GLN B CB   3  
ATOM 4923  C CG   . GLN B 2 75 ? 6.161   -12.324 5.521   1.00 0.00 ? 369 GLN B CG   3  
ATOM 4924  C CD   . GLN B 2 75 ? 5.557   -12.935 4.275   1.00 0.00 ? 369 GLN B CD   3  
ATOM 4925  O OE1  . GLN B 2 75 ? 6.014   -12.680 3.164   1.00 0.00 ? 369 GLN B OE1  3  
ATOM 4926  N NE2  . GLN B 2 75 ? 4.523   -13.753 4.451   1.00 0.00 ? 369 GLN B NE2  3  
ATOM 4927  H H    . GLN B 2 75 ? 6.585   -11.953 8.423   1.00 0.00 ? 369 GLN B H    3  
ATOM 4928  H HA   . GLN B 2 75 ? 9.047   -12.989 7.282   1.00 0.00 ? 369 GLN B HA   3  
ATOM 4929  H HB2  . GLN B 2 75 ? 8.205   -12.254 4.959   1.00 0.00 ? 369 GLN B HB2  3  
ATOM 4930  H HB3  . GLN B 2 75 ? 7.679   -13.806 5.585   1.00 0.00 ? 369 GLN B HB3  3  
ATOM 4931  H HG2  . GLN B 2 75 ? 5.586   -12.642 6.377   1.00 0.00 ? 369 GLN B HG2  3  
ATOM 4932  H HG3  . GLN B 2 75 ? 6.116   -11.248 5.436   1.00 0.00 ? 369 GLN B HG3  3  
ATOM 4933  H HE21 . GLN B 2 75 ? 4.211   -13.915 5.365   1.00 0.00 ? 369 GLN B HE21 3  
ATOM 4934  H HE22 . GLN B 2 75 ? 4.114   -14.158 3.658   1.00 0.00 ? 369 GLN B HE22 3  
ATOM 4935  N N    . GLU B 2 76 ? 9.534   -10.599 8.049   1.00 0.00 ? 370 GLU B N    3  
ATOM 4936  C CA   . GLU B 2 76 ? 10.084  -9.248  8.209   1.00 0.00 ? 370 GLU B CA   3  
ATOM 4937  C C    . GLU B 2 76 ? 10.617  -8.668  6.892   1.00 0.00 ? 370 GLU B C    3  
ATOM 4938  O O    . GLU B 2 76 ? 10.698  -7.449  6.735   1.00 0.00 ? 370 GLU B O    3  
ATOM 4939  C CB   . GLU B 2 76 ? 11.205  -9.258  9.242   1.00 0.00 ? 370 GLU B CB   3  
ATOM 4940  C CG   . GLU B 2 76 ? 12.358  -10.162 8.855   1.00 0.00 ? 370 GLU B CG   3  
ATOM 4941  C CD   . GLU B 2 76 ? 13.499  -10.166 9.862   1.00 0.00 ? 370 GLU B CD   3  
ATOM 4942  O OE1  . GLU B 2 76 ? 13.403  -9.460  10.891  1.00 0.00 ? 370 GLU B OE1  3  
ATOM 4943  O OE2  . GLU B 2 76 ? 14.496  -10.880 9.619   1.00 0.00 ? 370 GLU B OE2  3  
ATOM 4944  H H    . GLU B 2 76 ? 9.855   -11.310 8.645   1.00 0.00 ? 370 GLU B H    3  
ATOM 4945  H HA   . GLU B 2 76 ? 9.297   -8.616  8.566   1.00 0.00 ? 370 GLU B HA   3  
ATOM 4946  H HB2  . GLU B 2 76 ? 11.584  -8.253  9.355   1.00 0.00 ? 370 GLU B HB2  3  
ATOM 4947  H HB3  . GLU B 2 76 ? 10.808  -9.597  10.186  1.00 0.00 ? 370 GLU B HB3  3  
ATOM 4948  H HG2  . GLU B 2 76 ? 11.980  -11.166 8.758   1.00 0.00 ? 370 GLU B HG2  3  
ATOM 4949  H HG3  . GLU B 2 76 ? 12.738  -9.832  7.901   1.00 0.00 ? 370 GLU B HG3  3  
ATOM 4950  N N    . ASP B 2 77 ? 10.998  -9.547  5.962   1.00 0.00 ? 371 ASP B N    3  
ATOM 4951  C CA   . ASP B 2 77 ? 11.549  -9.123  4.672   1.00 0.00 ? 371 ASP B CA   3  
ATOM 4952  C C    . ASP B 2 77 ? 10.525  -8.327  3.868   1.00 0.00 ? 371 ASP B C    3  
ATOM 4953  O O    . ASP B 2 77 ? 10.803  -7.204  3.447   1.00 0.00 ? 371 ASP B O    3  
ATOM 4954  C CB   . ASP B 2 77 ? 12.007  -10.342 3.860   1.00 0.00 ? 371 ASP B CB   3  
ATOM 4955  C CG   . ASP B 2 77 ? 13.133  -11.126 4.525   1.00 0.00 ? 371 ASP B CG   3  
ATOM 4956  O OD1  . ASP B 2 77 ? 13.601  -10.719 5.612   1.00 0.00 ? 371 ASP B OD1  3  
ATOM 4957  O OD2  . ASP B 2 77 ? 13.550  -12.154 3.951   1.00 0.00 ? 371 ASP B OD2  3  
ATOM 4958  H H    . ASP B 2 77 ? 10.927  -10.503 6.157   1.00 0.00 ? 371 ASP B H    3  
ATOM 4959  H HA   . ASP B 2 77 ? 12.404  -8.492  4.868   1.00 0.00 ? 371 ASP B HA   3  
ATOM 4960  H HB2  . ASP B 2 77 ? 11.167  -11.006 3.725   1.00 0.00 ? 371 ASP B HB2  3  
ATOM 4961  H HB3  . ASP B 2 77 ? 12.350  -10.008 2.892   1.00 0.00 ? 371 ASP B HB3  3  
ATOM 4962  N N    . LEU B 2 78 ? 9.337   -8.903  3.674   1.00 0.00 ? 372 LEU B N    3  
ATOM 4963  C CA   . LEU B 2 78 ? 8.270   -8.223  2.938   1.00 0.00 ? 372 LEU B CA   3  
ATOM 4964  C C    . LEU B 2 78 ? 7.995   -6.840  3.535   1.00 0.00 ? 372 LEU B C    3  
ATOM 4965  O O    . LEU B 2 78 ? 7.723   -5.888  2.806   1.00 0.00 ? 372 LEU B O    3  
ATOM 4966  C CB   . LEU B 2 78 ? 6.991   -9.069  2.928   1.00 0.00 ? 372 LEU B CB   3  
ATOM 4967  C CG   . LEU B 2 78 ? 6.925   -10.168 1.859   1.00 0.00 ? 372 LEU B CG   3  
ATOM 4968  C CD1  . LEU B 2 78 ? 6.804   -9.561  0.468   1.00 0.00 ? 372 LEU B CD1  3  
ATOM 4969  C CD2  . LEU B 2 78 ? 8.141   -11.085 1.940   1.00 0.00 ? 372 LEU B CD2  3  
ATOM 4970  H H    . LEU B 2 78 ? 9.168   -9.795  4.046   1.00 0.00 ? 372 LEU B H    3  
ATOM 4971  H HA   . LEU B 2 78 ? 8.609   -8.095  1.920   1.00 0.00 ? 372 LEU B HA   3  
ATOM 4972  H HB2  . LEU B 2 78 ? 6.887   -9.533  3.898   1.00 0.00 ? 372 LEU B HB2  3  
ATOM 4973  H HB3  . LEU B 2 78 ? 6.152   -8.407  2.778   1.00 0.00 ? 372 LEU B HB3  3  
ATOM 4974  H HG   . LEU B 2 78 ? 6.045   -10.770 2.033   1.00 0.00 ? 372 LEU B HG   3  
ATOM 4975  H HD11 . LEU B 2 78 ? 5.757   -9.527  0.184   1.00 0.00 ? 372 LEU B HD11 3  
ATOM 4976  H HD12 . LEU B 2 78 ? 7.354   -10.169 -0.243  1.00 0.00 ? 372 LEU B HD12 3  
ATOM 4977  H HD13 . LEU B 2 78 ? 7.207   -8.560  0.473   1.00 0.00 ? 372 LEU B HD13 3  
ATOM 4978  H HD21 . LEU B 2 78 ? 8.136   -11.762 1.099   1.00 0.00 ? 372 LEU B HD21 3  
ATOM 4979  H HD22 . LEU B 2 78 ? 8.106   -11.653 2.861   1.00 0.00 ? 372 LEU B HD22 3  
ATOM 4980  H HD23 . LEU B 2 78 ? 9.042   -10.492 1.918   1.00 0.00 ? 372 LEU B HD23 3  
ATOM 4981  N N    . LEU B 2 79 ? 8.085   -6.737  4.868   1.00 0.00 ? 373 LEU B N    3  
ATOM 4982  C CA   . LEU B 2 79 ? 7.862   -5.464  5.559   1.00 0.00 ? 373 LEU B CA   3  
ATOM 4983  C C    . LEU B 2 79 ? 8.967   -4.463  5.249   1.00 0.00 ? 373 LEU B C    3  
ATOM 4984  O O    . LEU B 2 79 ? 8.695   -3.279  5.045   1.00 0.00 ? 373 LEU B O    3  
ATOM 4985  C CB   . LEU B 2 79 ? 7.767   -5.674  7.073   1.00 0.00 ? 373 LEU B CB   3  
ATOM 4986  C CG   . LEU B 2 79 ? 6.446   -6.264  7.558   1.00 0.00 ? 373 LEU B CG   3  
ATOM 4987  C CD1  . LEU B 2 79 ? 6.471   -6.462  9.067   1.00 0.00 ? 373 LEU B CD1  3  
ATOM 4988  C CD2  . LEU B 2 79 ? 5.284   -5.365  7.149   1.00 0.00 ? 373 LEU B CD2  3  
ATOM 4989  H H    . LEU B 2 79 ? 8.320   -7.531  5.393   1.00 0.00 ? 373 LEU B H    3  
ATOM 4990  H HA   . LEU B 2 79 ? 6.927   -5.060  5.204   1.00 0.00 ? 373 LEU B HA   3  
ATOM 4991  H HB2  . LEU B 2 79 ? 8.566   -6.335  7.375   1.00 0.00 ? 373 LEU B HB2  3  
ATOM 4992  H HB3  . LEU B 2 79 ? 7.908   -4.720  7.558   1.00 0.00 ? 373 LEU B HB3  3  
ATOM 4993  H HG   . LEU B 2 79 ? 6.302   -7.229  7.100   1.00 0.00 ? 373 LEU B HG   3  
ATOM 4994  H HD11 . LEU B 2 79 ? 6.470   -5.501  9.557   1.00 0.00 ? 373 LEU B HD11 3  
ATOM 4995  H HD12 . LEU B 2 79 ? 7.361   -7.008  9.343   1.00 0.00 ? 373 LEU B HD12 3  
ATOM 4996  H HD13 . LEU B 2 79 ? 5.599   -7.023  9.370   1.00 0.00 ? 373 LEU B HD13 3  
ATOM 4997  H HD21 . LEU B 2 79 ? 5.433   -5.022  6.135   1.00 0.00 ? 373 LEU B HD21 3  
ATOM 4998  H HD22 . LEU B 2 79 ? 5.238   -4.512  7.811   1.00 0.00 ? 373 LEU B HD22 3  
ATOM 4999  H HD23 . LEU B 2 79 ? 4.360   -5.919  7.210   1.00 0.00 ? 373 LEU B HD23 3  
ATOM 5000  N N    . SER B 2 80 ? 10.212  -4.944  5.212   1.00 0.00 ? 374 SER B N    3  
ATOM 5001  C CA   . SER B 2 80 ? 11.358  -4.088  4.917   1.00 0.00 ? 374 SER B CA   3  
ATOM 5002  C C    . SER B 2 80 ? 11.110  -3.287  3.640   1.00 0.00 ? 374 SER B C    3  
ATOM 5003  O O    . SER B 2 80 ? 11.376  -2.086  3.589   1.00 0.00 ? 374 SER B O    3  
ATOM 5004  C CB   . SER B 2 80 ? 12.631  -4.927  4.772   1.00 0.00 ? 374 SER B CB   3  
ATOM 5005  O OG   . SER B 2 80 ? 12.912  -5.642  5.963   1.00 0.00 ? 374 SER B OG   3  
ATOM 5006  H H    . SER B 2 80 ? 10.361  -5.899  5.381   1.00 0.00 ? 374 SER B H    3  
ATOM 5007  H HA   . SER B 2 80 ? 11.480  -3.400  5.742   1.00 0.00 ? 374 SER B HA   3  
ATOM 5008  H HB2  . SER B 2 80 ? 12.505  -5.633  3.966   1.00 0.00 ? 374 SER B HB2  3  
ATOM 5009  H HB3  . SER B 2 80 ? 13.466  -4.276  4.552   1.00 0.00 ? 374 SER B HB3  3  
ATOM 5010  H HG   . SER B 2 80 ? 13.610  -5.198  6.448   1.00 0.00 ? 374 SER B HG   3  
ATOM 5011  N N    . GLU B 2 81 ? 10.579  -3.965  2.617   1.00 0.00 ? 375 GLU B N    3  
ATOM 5012  C CA   . GLU B 2 81 ? 10.272  -3.325  1.342   1.00 0.00 ? 375 GLU B CA   3  
ATOM 5013  C C    . GLU B 2 81 ? 9.182   -2.262  1.508   1.00 0.00 ? 375 GLU B C    3  
ATOM 5014  O O    . GLU B 2 81 ? 9.304   -1.158  0.978   1.00 0.00 ? 375 GLU B O    3  
ATOM 5015  C CB   . GLU B 2 81 ? 9.837   -4.379  0.316   1.00 0.00 ? 375 GLU B CB   3  
ATOM 5016  C CG   . GLU B 2 81 ? 9.530   -3.813  -1.065  1.00 0.00 ? 375 GLU B CG   3  
ATOM 5017  C CD   . GLU B 2 81 ? 10.730  -3.190  -1.762  1.00 0.00 ? 375 GLU B CD   3  
ATOM 5018  O OE1  . GLU B 2 81 ? 11.852  -3.237  -1.207  1.00 0.00 ? 375 GLU B OE1  3  
ATOM 5019  O OE2  . GLU B 2 81 ? 10.545  -2.662  -2.874  1.00 0.00 ? 375 GLU B OE2  3  
ATOM 5020  H H    . GLU B 2 81 ? 10.376  -4.919  2.728   1.00 0.00 ? 375 GLU B H    3  
ATOM 5021  H HA   . GLU B 2 81 ? 11.172  -2.844  0.991   1.00 0.00 ? 375 GLU B HA   3  
ATOM 5022  H HB2  . GLU B 2 81 ? 10.625  -5.109  0.212   1.00 0.00 ? 375 GLU B HB2  3  
ATOM 5023  H HB3  . GLU B 2 81 ? 8.950   -4.872  0.682   1.00 0.00 ? 375 GLU B HB3  3  
ATOM 5024  H HG2  . GLU B 2 81 ? 9.161   -4.614  -1.685  1.00 0.00 ? 375 GLU B HG2  3  
ATOM 5025  H HG3  . GLU B 2 81 ? 8.764   -3.060  -0.964  1.00 0.00 ? 375 GLU B HG3  3  
ATOM 5026  N N    . PHE B 2 82 ? 8.118   -2.607  2.246   1.00 0.00 ? 376 PHE B N    3  
ATOM 5027  C CA   . PHE B 2 82 ? 7.001   -1.685  2.480   1.00 0.00 ? 376 PHE B CA   3  
ATOM 5028  C C    . PHE B 2 82 ? 7.491   -0.357  3.051   1.00 0.00 ? 376 PHE B C    3  
ATOM 5029  O O    . PHE B 2 82 ? 7.187   0.707   2.511   1.00 0.00 ? 376 PHE B O    3  
ATOM 5030  C CB   . PHE B 2 82 ? 5.976   -2.299  3.439   1.00 0.00 ? 376 PHE B CB   3  
ATOM 5031  C CG   . PHE B 2 82 ? 4.664   -1.566  3.452   1.00 0.00 ? 376 PHE B CG   3  
ATOM 5032  C CD1  . PHE B 2 82 ? 3.971   -1.347  2.273   1.00 0.00 ? 376 PHE B CD1  3  
ATOM 5033  C CD2  . PHE B 2 82 ? 4.125   -1.096  4.638   1.00 0.00 ? 376 PHE B CD2  3  
ATOM 5034  C CE1  . PHE B 2 82 ? 2.768   -0.676  2.275   1.00 0.00 ? 376 PHE B CE1  3  
ATOM 5035  C CE2  . PHE B 2 82 ? 2.919   -0.422  4.645   1.00 0.00 ? 376 PHE B CE2  3  
ATOM 5036  C CZ   . PHE B 2 82 ? 2.241   -0.213  3.460   1.00 0.00 ? 376 PHE B CZ   3  
ATOM 5037  H H    . PHE B 2 82 ? 8.082   -3.505  2.637   1.00 0.00 ? 376 PHE B H    3  
ATOM 5038  H HA   . PHE B 2 82 ? 6.524   -1.498  1.531   1.00 0.00 ? 376 PHE B HA   3  
ATOM 5039  H HB2  . PHE B 2 82 ? 5.785   -3.318  3.154   1.00 0.00 ? 376 PHE B HB2  3  
ATOM 5040  H HB3  . PHE B 2 82 ? 6.377   -2.280  4.442   1.00 0.00 ? 376 PHE B HB3  3  
ATOM 5041  H HD1  . PHE B 2 82 ? 4.380   -1.709  1.345   1.00 0.00 ? 376 PHE B HD1  3  
ATOM 5042  H HD2  . PHE B 2 82 ? 4.656   -1.260  5.565   1.00 0.00 ? 376 PHE B HD2  3  
ATOM 5043  H HE1  . PHE B 2 82 ? 2.238   -0.513  1.347   1.00 0.00 ? 376 PHE B HE1  3  
ATOM 5044  H HE2  . PHE B 2 82 ? 2.506   -0.060  5.573   1.00 0.00 ? 376 PHE B HE2  3  
ATOM 5045  H HZ   . PHE B 2 82 ? 1.300   0.312   3.461   1.00 0.00 ? 376 PHE B HZ   3  
ATOM 5046  N N    . GLY B 2 83 ? 8.242   -0.436  4.153   1.00 0.00 ? 377 GLY B N    3  
ATOM 5047  C CA   . GLY B 2 83 ? 8.765   0.758   4.804   1.00 0.00 ? 377 GLY B CA   3  
ATOM 5048  C C    . GLY B 2 83 ? 9.498   1.703   3.860   1.00 0.00 ? 377 GLY B C    3  
ATOM 5049  O O    . GLY B 2 83 ? 9.594   2.896   4.139   1.00 0.00 ? 377 GLY B O    3  
ATOM 5050  H H    . GLY B 2 83 ? 8.437   -1.319  4.535   1.00 0.00 ? 377 GLY B H    3  
ATOM 5051  H HA2  . GLY B 2 83 ? 7.943   1.293   5.256   1.00 0.00 ? 377 GLY B HA2  3  
ATOM 5052  H HA3  . GLY B 2 83 ? 9.446   0.452   5.585   1.00 0.00 ? 377 GLY B HA3  3  
ATOM 5053  N N    . GLN B 2 84 ? 10.019  1.178   2.748   1.00 0.00 ? 378 GLN B N    3  
ATOM 5054  C CA   . GLN B 2 84 ? 10.746  1.997   1.775   1.00 0.00 ? 378 GLN B CA   3  
ATOM 5055  C C    . GLN B 2 84 ? 9.824   2.987   1.050   1.00 0.00 ? 378 GLN B C    3  
ATOM 5056  O O    . GLN B 2 84 ? 10.280  4.027   0.575   1.00 0.00 ? 378 GLN B O    3  
ATOM 5057  C CB   . GLN B 2 84 ? 11.455  1.106   0.746   1.00 0.00 ? 378 GLN B CB   3  
ATOM 5058  C CG   . GLN B 2 84 ? 12.410  0.090   1.360   1.00 0.00 ? 378 GLN B CG   3  
ATOM 5059  C CD   . GLN B 2 84 ? 13.523  0.734   2.171   1.00 0.00 ? 378 GLN B CD   3  
ATOM 5060  O OE1  . GLN B 2 84 ? 13.269  1.394   3.179   1.00 0.00 ? 378 GLN B OE1  3  
ATOM 5061  N NE2  . GLN B 2 84 ? 14.764  0.544   1.735   1.00 0.00 ? 378 GLN B NE2  3  
ATOM 5062  H H    . GLN B 2 84 ? 9.915   0.218   2.578   1.00 0.00 ? 378 GLN B H    3  
ATOM 5063  H HA   . GLN B 2 84 ? 11.492  2.560   2.316   1.00 0.00 ? 378 GLN B HA   3  
ATOM 5064  H HB2  . GLN B 2 84 ? 10.709  0.567   0.181   1.00 0.00 ? 378 GLN B HB2  3  
ATOM 5065  H HB3  . GLN B 2 84 ? 12.018  1.734   0.073   1.00 0.00 ? 378 GLN B HB3  3  
ATOM 5066  H HG2  . GLN B 2 84 ? 11.850  -0.565  2.008   1.00 0.00 ? 378 GLN B HG2  3  
ATOM 5067  H HG3  . GLN B 2 84 ? 12.855  -0.490  0.564   1.00 0.00 ? 378 GLN B HG3  3  
ATOM 5068  H HE21 . GLN B 2 84 ? 14.896  0.007   0.925   1.00 0.00 ? 378 GLN B HE21 3  
ATOM 5069  H HE22 . GLN B 2 84 ? 15.498  0.950   2.240   1.00 0.00 ? 378 GLN B HE22 3  
ATOM 5070  N N    . PHE B 2 85 ? 8.530   2.658   0.960   1.00 0.00 ? 379 PHE B N    3  
ATOM 5071  C CA   . PHE B 2 85 ? 7.559   3.522   0.282   1.00 0.00 ? 379 PHE B CA   3  
ATOM 5072  C C    . PHE B 2 85 ? 6.922   4.529   1.246   1.00 0.00 ? 379 PHE B C    3  
ATOM 5073  O O    . PHE B 2 85 ? 6.521   5.618   0.836   1.00 0.00 ? 379 PHE B O    3  
ATOM 5074  C CB   . PHE B 2 85 ? 6.476   2.678   -0.397  1.00 0.00 ? 379 PHE B CB   3  
ATOM 5075  C CG   . PHE B 2 85 ? 7.027   1.726   -1.425  1.00 0.00 ? 379 PHE B CG   3  
ATOM 5076  C CD1  . PHE B 2 85 ? 7.701   0.577   -1.035  1.00 0.00 ? 379 PHE B CD1  3  
ATOM 5077  C CD2  . PHE B 2 85 ? 6.894   1.993   -2.776  1.00 0.00 ? 379 PHE B CD2  3  
ATOM 5078  C CE1  . PHE B 2 85 ? 8.227   -0.287  -1.975  1.00 0.00 ? 379 PHE B CE1  3  
ATOM 5079  C CE2  . PHE B 2 85 ? 7.415   1.130   -3.721  1.00 0.00 ? 379 PHE B CE2  3  
ATOM 5080  C CZ   . PHE B 2 85 ? 8.083   -0.010  -3.320  1.00 0.00 ? 379 PHE B CZ   3  
ATOM 5081  H H    . PHE B 2 85 ? 8.223   1.814   1.352   1.00 0.00 ? 379 PHE B H    3  
ATOM 5082  H HA   . PHE B 2 85 ? 8.091   4.072   -0.479  1.00 0.00 ? 379 PHE B HA   3  
ATOM 5083  H HB2  . PHE B 2 85 ? 5.958   2.096   0.350   1.00 0.00 ? 379 PHE B HB2  3  
ATOM 5084  H HB3  . PHE B 2 85 ? 5.773   3.331   -0.892  1.00 0.00 ? 379 PHE B HB3  3  
ATOM 5085  H HD1  . PHE B 2 85 ? 7.811   0.358   0.016   1.00 0.00 ? 379 PHE B HD1  3  
ATOM 5086  H HD2  . PHE B 2 85 ? 6.372   2.884   -3.092  1.00 0.00 ? 379 PHE B HD2  3  
ATOM 5087  H HE1  . PHE B 2 85 ? 8.749   -1.176  -1.659  1.00 0.00 ? 379 PHE B HE1  3  
ATOM 5088  H HE2  . PHE B 2 85 ? 7.303   1.349   -4.772  1.00 0.00 ? 379 PHE B HE2  3  
ATOM 5089  H HZ   . PHE B 2 85 ? 8.493   -0.686  -4.058  1.00 0.00 ? 379 PHE B HZ   3  
ATOM 5090  N N    . LEU B 2 86 ? 6.846   4.162   2.526   1.00 0.00 ? 380 LEU B N    3  
ATOM 5091  C CA   . LEU B 2 86 ? 6.274   5.028   3.552   1.00 0.00 ? 380 LEU B CA   3  
ATOM 5092  C C    . LEU B 2 86 ? 7.027   4.829   4.873   1.00 0.00 ? 380 LEU B C    3  
ATOM 5093  O O    . LEU B 2 86 ? 6.527   4.257   5.841   1.00 0.00 ? 380 LEU B O    3  
ATOM 5094  C CB   . LEU B 2 86 ? 4.775   4.755   3.680   1.00 0.00 ? 380 LEU B CB   3  
ATOM 5095  C CG   . LEU B 2 86 ? 4.359   3.515   4.471   1.00 0.00 ? 380 LEU B CG   3  
ATOM 5096  C CD1  . LEU B 2 86 ? 2.850   3.344   4.421   1.00 0.00 ? 380 LEU B CD1  3  
ATOM 5097  C CD2  . LEU B 2 86 ? 5.074   2.282   3.946   1.00 0.00 ? 380 LEU B CD2  3  
ATOM 5098  H H    . LEU B 2 86 ? 7.181   3.287   2.787   1.00 0.00 ? 380 LEU B H    3  
ATOM 5099  H HA   . LEU B 2 86 ? 6.417   6.050   3.228   1.00 0.00 ? 380 LEU B HA   3  
ATOM 5100  H HB2  . LEU B 2 86 ? 4.306   5.613   4.131   1.00 0.00 ? 380 LEU B HB2  3  
ATOM 5101  H HB3  . LEU B 2 86 ? 4.397   4.646   2.679   1.00 0.00 ? 380 LEU B HB3  3  
ATOM 5102  H HG   . LEU B 2 86 ? 4.636   3.648   5.506   1.00 0.00 ? 380 LEU B HG   3  
ATOM 5103  H HD11 . LEU B 2 86 ? 2.585   2.383   4.833   1.00 0.00 ? 380 LEU B HD11 3  
ATOM 5104  H HD12 . LEU B 2 86 ? 2.508   3.404   3.392   1.00 0.00 ? 380 LEU B HD12 3  
ATOM 5105  H HD13 . LEU B 2 86 ? 2.384   4.127   5.004   1.00 0.00 ? 380 LEU B HD13 3  
ATOM 5106  H HD21 . LEU B 2 86 ? 4.848   1.437   4.579   1.00 0.00 ? 380 LEU B HD21 3  
ATOM 5107  H HD22 . LEU B 2 86 ? 6.141   2.461   3.949   1.00 0.00 ? 380 LEU B HD22 3  
ATOM 5108  H HD23 . LEU B 2 86 ? 4.745   2.077   2.938   1.00 0.00 ? 380 LEU B HD23 3  
ATOM 5109  N N    . PRO B 2 87 ? 8.286   5.298   4.886   1.00 0.00 ? 381 PRO B N    3  
ATOM 5110  C CA   . PRO B 2 87 ? 9.201   5.188   6.034   1.00 0.00 ? 381 PRO B CA   3  
ATOM 5111  C C    . PRO B 2 87 ? 8.817   6.035   7.241   1.00 0.00 ? 381 PRO B C    3  
ATOM 5112  O O    . PRO B 2 87 ? 9.564   6.112   8.219   1.00 0.00 ? 381 PRO B O    3  
ATOM 5113  C CB   . PRO B 2 87 ? 10.555  5.645   5.471   1.00 0.00 ? 381 PRO B CB   3  
ATOM 5114  C CG   . PRO B 2 87 ? 10.382  5.723   3.988   1.00 0.00 ? 381 PRO B CG   3  
ATOM 5115  C CD   . PRO B 2 87 ? 8.918   5.945   3.742   1.00 0.00 ? 381 PRO B CD   3  
ATOM 5116  H HA   . PRO B 2 87 ? 9.270   4.173   6.353   1.00 0.00 ? 381 PRO B HA   3  
ATOM 5117  H HB2  . PRO B 2 87 ? 10.807  6.610   5.886   1.00 0.00 ? 381 PRO B HB2  3  
ATOM 5118  H HB3  . PRO B 2 87 ? 11.316  4.927   5.740   1.00 0.00 ? 381 PRO B HB3  3  
ATOM 5119  H HG2  . PRO B 2 87 ? 10.955  6.550   3.595   1.00 0.00 ? 381 PRO B HG2  3  
ATOM 5120  H HG3  . PRO B 2 87 ? 10.702  4.797   3.533   1.00 0.00 ? 381 PRO B HG3  3  
ATOM 5121  H HD2  . PRO B 2 87 ? 8.685   6.996   3.720   1.00 0.00 ? 381 PRO B HD2  3  
ATOM 5122  H HD3  . PRO B 2 87 ? 8.602   5.465   2.823   1.00 0.00 ? 381 PRO B HD3  3  
ATOM 5123  N N    . ASP B 2 88 ? 7.648   6.641   7.182   1.00 0.00 ? 382 ASP B N    3  
ATOM 5124  C CA   . ASP B 2 88 ? 7.141   7.460   8.279   1.00 0.00 ? 382 ASP B CA   3  
ATOM 5125  C C    . ASP B 2 88 ? 6.333   6.607   9.263   1.00 0.00 ? 382 ASP B C    3  
ATOM 5126  O O    . ASP B 2 88 ? 5.378   7.089   9.879   1.00 0.00 ? 382 ASP B O    3  
ATOM 5127  C CB   . ASP B 2 88 ? 6.284   8.609   7.734   1.00 0.00 ? 382 ASP B CB   3  
ATOM 5128  C CG   . ASP B 2 88 ? 7.060   9.569   6.837   1.00 0.00 ? 382 ASP B CG   3  
ATOM 5129  O OD1  . ASP B 2 88 ? 8.280   9.369   6.643   1.00 0.00 ? 382 ASP B OD1  3  
ATOM 5130  O OD2  . ASP B 2 88 ? 6.442   10.527  6.327   1.00 0.00 ? 382 ASP B OD2  3  
ATOM 5131  H H    . ASP B 2 88 ? 7.103   6.515   6.391   1.00 0.00 ? 382 ASP B H    3  
ATOM 5132  H HA   . ASP B 2 88 ? 7.991   7.875   8.801   1.00 0.00 ? 382 ASP B HA   3  
ATOM 5133  H HB2  . ASP B 2 88 ? 5.470   8.195   7.161   1.00 0.00 ? 382 ASP B HB2  3  
ATOM 5134  H HB3  . ASP B 2 88 ? 5.881   9.172   8.564   1.00 0.00 ? 382 ASP B HB3  3  
ATOM 5135  N N    . ALA B 2 89 ? 6.717   5.332   9.402   1.00 0.00 ? 383 ALA B N    3  
ATOM 5136  C CA   . ALA B 2 89 ? 6.030   4.410   10.297  1.00 0.00 ? 383 ALA B CA   3  
ATOM 5137  C C    . ALA B 2 89 ? 6.915   3.213   10.644  1.00 0.00 ? 383 ALA B C    3  
ATOM 5138  O O    . ALA B 2 89 ? 7.537   2.645   9.718   1.00 0.00 ? 383 ALA B O    3  
ATOM 5139  C CB   . ALA B 2 89 ? 4.725   3.940   9.666   1.00 0.00 ? 383 ALA B CB   3  
ATOM 5140  O OXT  . ALA B 2 89 ? 6.978   2.853   11.838  1.00 0.00 ? 383 ALA B OXT  3  
ATOM 5141  H H    . ALA B 2 89 ? 7.478   5.005   8.884   1.00 0.00 ? 383 ALA B H    3  
ATOM 5142  H HA   . ALA B 2 89 ? 5.792   4.941   11.205  1.00 0.00 ? 383 ALA B HA   3  
ATOM 5143  H HB1  . ALA B 2 89 ? 4.320   3.123   10.243  1.00 0.00 ? 383 ALA B HB1  3  
ATOM 5144  H HB2  . ALA B 2 89 ? 4.913   3.610   8.652   1.00 0.00 ? 383 ALA B HB2  3  
ATOM 5145  H HB3  . ALA B 2 89 ? 4.018   4.757   9.652   1.00 0.00 ? 383 ALA B HB3  3  
ATOM 5146  N N    . ARG A 1 1  ? 2.895   13.049  -6.544  1.00 0.00 ? 6   ARG A N    4  
ATOM 5147  C CA   . ARG A 1 1  ? 3.492   12.214  -5.463  1.00 0.00 ? 6   ARG A CA   4  
ATOM 5148  C C    . ARG A 1 1  ? 2.894   10.807  -5.458  1.00 0.00 ? 6   ARG A C    4  
ATOM 5149  O O    . ARG A 1 1  ? 1.718   10.623  -5.781  1.00 0.00 ? 6   ARG A O    4  
ATOM 5150  C CB   . ARG A 1 1  ? 3.249   12.896  -4.111  1.00 0.00 ? 6   ARG A CB   4  
ATOM 5151  C CG   . ARG A 1 1  ? 3.919   14.256  -3.981  1.00 0.00 ? 6   ARG A CG   4  
ATOM 5152  C CD   . ARG A 1 1  ? 3.713   14.852  -2.597  1.00 0.00 ? 6   ARG A CD   4  
ATOM 5153  N NE   . ARG A 1 1  ? 4.312   16.183  -2.476  1.00 0.00 ? 6   ARG A NE   4  
ATOM 5154  C CZ   . ARG A 1 1  ? 4.297   16.910  -1.356  1.00 0.00 ? 6   ARG A CZ   4  
ATOM 5155  N NH1  . ARG A 1 1  ? 3.730   16.437  -0.249  1.00 0.00 ? 6   ARG A NH1  4  
ATOM 5156  N NH2  . ARG A 1 1  ? 4.857   18.116  -1.342  1.00 0.00 ? 6   ARG A NH2  4  
ATOM 5157  H H1   . ARG A 1 1  ? 3.180   12.639  -7.456  1.00 0.00 ? 6   ARG A H1   4  
ATOM 5158  H H2   . ARG A 1 1  ? 3.260   14.017  -6.439  1.00 0.00 ? 6   ARG A H2   4  
ATOM 5159  H H3   . ARG A 1 1  ? 1.861   13.025  -6.433  1.00 0.00 ? 6   ARG A H3   4  
ATOM 5160  H HA   . ARG A 1 1  ? 4.556   12.141  -5.638  1.00 0.00 ? 6   ARG A HA   4  
ATOM 5161  H HB2  . ARG A 1 1  ? 2.185   13.029  -3.975  1.00 0.00 ? 6   ARG A HB2  4  
ATOM 5162  H HB3  . ARG A 1 1  ? 3.626   12.257  -3.326  1.00 0.00 ? 6   ARG A HB3  4  
ATOM 5163  H HG2  . ARG A 1 1  ? 4.977   14.142  -4.159  1.00 0.00 ? 6   ARG A HG2  4  
ATOM 5164  H HG3  . ARG A 1 1  ? 3.499   14.926  -4.717  1.00 0.00 ? 6   ARG A HG3  4  
ATOM 5165  H HD2  . ARG A 1 1  ? 2.653   14.927  -2.406  1.00 0.00 ? 6   ARG A HD2  4  
ATOM 5166  H HD3  . ARG A 1 1  ? 4.164   14.197  -1.868  1.00 0.00 ? 6   ARG A HD3  4  
ATOM 5167  H HE   . ARG A 1 1  ? 4.743   16.558  -3.273  1.00 0.00 ? 6   ARG A HE   4  
ATOM 5168  H HH11 . ARG A 1 1  ? 3.308   15.529  -0.250  1.00 0.00 ? 6   ARG A HH11 4  
ATOM 5169  H HH12 . ARG A 1 1  ? 3.725   16.987  0.585   1.00 0.00 ? 6   ARG A HH12 4  
ATOM 5170  H HH21 . ARG A 1 1  ? 5.287   18.477  -2.169  1.00 0.00 ? 6   ARG A HH21 4  
ATOM 5171  H HH22 . ARG A 1 1  ? 4.847   18.661  -0.504  1.00 0.00 ? 6   ARG A HH22 4  
ATOM 5172  N N    . MET A 1 2  ? 3.711   9.819   -5.091  1.00 0.00 ? 7   MET A N    4  
ATOM 5173  C CA   . MET A 1 2  ? 3.264   8.427   -5.048  1.00 0.00 ? 7   MET A CA   4  
ATOM 5174  C C    . MET A 1 2  ? 3.409   7.833   -3.646  1.00 0.00 ? 7   MET A C    4  
ATOM 5175  O O    . MET A 1 2  ? 4.043   8.424   -2.769  1.00 0.00 ? 7   MET A O    4  
ATOM 5176  C CB   . MET A 1 2  ? 4.051   7.583   -6.054  1.00 0.00 ? 7   MET A CB   4  
ATOM 5177  C CG   . MET A 1 2  ? 3.862   8.013   -7.502  1.00 0.00 ? 7   MET A CG   4  
ATOM 5178  S SD   . MET A 1 2  ? 2.132   7.997   -8.018  1.00 0.00 ? 7   MET A SD   4  
ATOM 5179  C CE   . MET A 1 2  ? 1.693   6.288   -7.712  1.00 0.00 ? 7   MET A CE   4  
ATOM 5180  H H    . MET A 1 2  ? 4.638   10.030  -4.848  1.00 0.00 ? 7   MET A H    4  
ATOM 5181  H HA   . MET A 1 2  ? 2.220   8.409   -5.322  1.00 0.00 ? 7   MET A HA   4  
ATOM 5182  H HB2  . MET A 1 2  ? 5.103   7.648   -5.817  1.00 0.00 ? 7   MET A HB2  4  
ATOM 5183  H HB3  . MET A 1 2  ? 3.735   6.553   -5.964  1.00 0.00 ? 7   MET A HB3  4  
ATOM 5184  H HG2  . MET A 1 2  ? 4.246   9.015   -7.618  1.00 0.00 ? 7   MET A HG2  4  
ATOM 5185  H HG3  . MET A 1 2  ? 4.420   7.341   -8.138  1.00 0.00 ? 7   MET A HG3  4  
ATOM 5186  H HE1  . MET A 1 2  ? 2.357   5.640   -8.266  1.00 0.00 ? 7   MET A HE1  4  
ATOM 5187  H HE2  . MET A 1 2  ? 0.675   6.115   -8.029  1.00 0.00 ? 7   MET A HE2  4  
ATOM 5188  H HE3  . MET A 1 2  ? 1.782   6.077   -6.656  1.00 0.00 ? 7   MET A HE3  4  
ATOM 5189  N N    . ASN A 1 3  ? 2.806   6.658   -3.449  1.00 0.00 ? 8   ASN A N    4  
ATOM 5190  C CA   . ASN A 1 3  ? 2.847   5.958   -2.162  1.00 0.00 ? 8   ASN A CA   4  
ATOM 5191  C C    . ASN A 1 3  ? 2.149   4.584   -2.263  1.00 0.00 ? 8   ASN A C    4  
ATOM 5192  O O    . ASN A 1 3  ? 2.482   3.792   -3.145  1.00 0.00 ? 8   ASN A O    4  
ATOM 5193  C CB   . ASN A 1 3  ? 2.232   6.838   -1.049  1.00 0.00 ? 8   ASN A CB   4  
ATOM 5194  C CG   . ASN A 1 3  ? 0.821   7.360   -1.338  1.00 0.00 ? 8   ASN A CG   4  
ATOM 5195  O OD1  . ASN A 1 3  ? 0.289   8.155   -0.563  1.00 0.00 ? 8   ASN A OD1  4  
ATOM 5196  N ND2  . ASN A 1 3  ? 0.190   6.921   -2.430  1.00 0.00 ? 8   ASN A ND2  4  
ATOM 5197  H H    . ASN A 1 3  ? 2.319   6.247   -4.194  1.00 0.00 ? 8   ASN A H    4  
ATOM 5198  H HA   . ASN A 1 3  ? 3.887   5.788   -1.927  1.00 0.00 ? 8   ASN A HA   4  
ATOM 5199  H HB2  . ASN A 1 3  ? 2.191   6.263   -0.138  1.00 0.00 ? 8   ASN A HB2  4  
ATOM 5200  H HB3  . ASN A 1 3  ? 2.878   7.690   -0.890  1.00 0.00 ? 8   ASN A HB3  4  
ATOM 5201  H HD21 . ASN A 1 3  ? 0.642   6.280   -3.008  1.00 0.00 ? 8   ASN A HD21 4  
ATOM 5202  H HD22 . ASN A 1 3  ? -0.706  7.264   -2.610  1.00 0.00 ? 8   ASN A HD22 4  
ATOM 5203  N N    . ILE A 1 4  ? 1.189   4.302   -1.370  1.00 0.00 ? 9   ILE A N    4  
ATOM 5204  C CA   . ILE A 1 4  ? 0.466   3.025   -1.390  1.00 0.00 ? 9   ILE A CA   4  
ATOM 5205  C C    . ILE A 1 4  ? -0.330  2.828   -2.659  1.00 0.00 ? 9   ILE A C    4  
ATOM 5206  O O    . ILE A 1 4  ? -0.372  1.723   -3.203  1.00 0.00 ? 9   ILE A O    4  
ATOM 5207  C CB   . ILE A 1 4  ? -0.541  2.888   -0.239  1.00 0.00 ? 9   ILE A CB   4  
ATOM 5208  C CG1  . ILE A 1 4  ? -1.318  4.189   -0.012  1.00 0.00 ? 9   ILE A CG1  4  
ATOM 5209  C CG2  . ILE A 1 4  ? 0.146   2.430   1.015   1.00 0.00 ? 9   ILE A CG2  4  
ATOM 5210  C CD1  . ILE A 1 4  ? -2.511  4.025   0.898   1.00 0.00 ? 9   ILE A CD1  4  
ATOM 5211  H H    . ILE A 1 4  ? 0.959   4.961   -0.687  1.00 0.00 ? 9   ILE A H    4  
ATOM 5212  H HA   . ILE A 1 4  ? 1.188   2.226   -1.301  1.00 0.00 ? 9   ILE A HA   4  
ATOM 5213  H HB   . ILE A 1 4  ? -1.244  2.118   -0.517  1.00 0.00 ? 9   ILE A HB   4  
ATOM 5214  H HG12 . ILE A 1 4  ? -0.660  4.921   0.435   1.00 0.00 ? 9   ILE A HG12 4  
ATOM 5215  H HG13 . ILE A 1 4  ? -1.673  4.562   -0.960  1.00 0.00 ? 9   ILE A HG13 4  
ATOM 5216  H HG21 . ILE A 1 4  ? 1.031   3.025   1.186   1.00 0.00 ? 9   ILE A HG21 4  
ATOM 5217  H HG22 . ILE A 1 4  ? 0.417   1.395   0.897   1.00 0.00 ? 9   ILE A HG22 4  
ATOM 5218  H HG23 . ILE A 1 4  ? -0.533  2.538   1.845   1.00 0.00 ? 9   ILE A HG23 4  
ATOM 5219  H HD11 . ILE A 1 4  ? -2.969  4.986   1.066   1.00 0.00 ? 9   ILE A HD11 4  
ATOM 5220  H HD12 . ILE A 1 4  ? -2.193  3.609   1.841   1.00 0.00 ? 9   ILE A HD12 4  
ATOM 5221  H HD13 . ILE A 1 4  ? -3.233  3.362   0.433   1.00 0.00 ? 9   ILE A HD13 4  
ATOM 5222  N N    . GLN A 1 5  ? -1.006  3.885   -3.093  1.00 0.00 ? 10  GLN A N    4  
ATOM 5223  C CA   . GLN A 1 5  ? -1.850  3.803   -4.266  1.00 0.00 ? 10  GLN A CA   4  
ATOM 5224  C C    . GLN A 1 5  ? -1.123  3.123   -5.424  1.00 0.00 ? 10  GLN A C    4  
ATOM 5225  O O    . GLN A 1 5  ? -1.721  2.346   -6.170  1.00 0.00 ? 10  GLN A O    4  
ATOM 5226  C CB   . GLN A 1 5  ? -2.345  5.191   -4.681  1.00 0.00 ? 10  GLN A CB   4  
ATOM 5227  C CG   . GLN A 1 5  ? -3.280  5.174   -5.879  1.00 0.00 ? 10  GLN A CG   4  
ATOM 5228  C CD   . GLN A 1 5  ? -3.765  6.562   -6.261  1.00 0.00 ? 10  GLN A CD   4  
ATOM 5229  O OE1  . GLN A 1 5  ? -4.413  7.245   -5.466  1.00 0.00 ? 10  GLN A OE1  4  
ATOM 5230  N NE2  . GLN A 1 5  ? -3.455  6.986   -7.481  1.00 0.00 ? 10  GLN A NE2  4  
ATOM 5231  H H    . GLN A 1 5  ? -0.962  4.724   -2.594  1.00 0.00 ? 10  GLN A H    4  
ATOM 5232  H HA   . GLN A 1 5  ? -2.690  3.196   -3.977  1.00 0.00 ? 10  GLN A HA   4  
ATOM 5233  H HB2  . GLN A 1 5  ? -2.870  5.634   -3.849  1.00 0.00 ? 10  GLN A HB2  4  
ATOM 5234  H HB3  . GLN A 1 5  ? -1.491  5.805   -4.925  1.00 0.00 ? 10  GLN A HB3  4  
ATOM 5235  H HG2  . GLN A 1 5  ? -2.756  4.749   -6.723  1.00 0.00 ? 10  GLN A HG2  4  
ATOM 5236  H HG3  . GLN A 1 5  ? -4.137  4.561   -5.643  1.00 0.00 ? 10  GLN A HG3  4  
ATOM 5237  H HE21 . GLN A 1 5  ? -2.937  6.391   -8.064  1.00 0.00 ? 10  GLN A HE21 4  
ATOM 5238  H HE22 . GLN A 1 5  ? -3.757  7.879   -7.751  1.00 0.00 ? 10  GLN A HE22 4  
ATOM 5239  N N    . MET A 1 6  ? 0.176   3.406   -5.552  1.00 0.00 ? 11  MET A N    4  
ATOM 5240  C CA   . MET A 1 6  ? 0.999   2.811   -6.598  1.00 0.00 ? 11  MET A CA   4  
ATOM 5241  C C    . MET A 1 6  ? 0.854   1.288   -6.588  1.00 0.00 ? 11  MET A C    4  
ATOM 5242  O O    . MET A 1 6  ? 0.611   0.674   -7.627  1.00 0.00 ? 11  MET A O    4  
ATOM 5243  C CB   . MET A 1 6  ? 2.464   3.203   -6.393  1.00 0.00 ? 11  MET A CB   4  
ATOM 5244  C CG   . MET A 1 6  ? 3.398   2.684   -7.469  1.00 0.00 ? 11  MET A CG   4  
ATOM 5245  S SD   . MET A 1 6  ? 5.128   3.041   -7.111  1.00 0.00 ? 11  MET A SD   4  
ATOM 5246  C CE   . MET A 1 6  ? 5.122   4.830   -7.098  1.00 0.00 ? 11  MET A CE   4  
ATOM 5247  H H    . MET A 1 6  ? 0.594   4.023   -4.913  1.00 0.00 ? 11  MET A H    4  
ATOM 5248  H HA   . MET A 1 6  ? 0.658   3.190   -7.550  1.00 0.00 ? 11  MET A HA   4  
ATOM 5249  H HB2  . MET A 1 6  ? 2.536   4.279   -6.373  1.00 0.00 ? 11  MET A HB2  4  
ATOM 5250  H HB3  . MET A 1 6  ? 2.797   2.812   -5.441  1.00 0.00 ? 11  MET A HB3  4  
ATOM 5251  H HG2  . MET A 1 6  ? 3.275   1.614   -7.553  1.00 0.00 ? 11  MET A HG2  4  
ATOM 5252  H HG3  . MET A 1 6  ? 3.135   3.149   -8.408  1.00 0.00 ? 11  MET A HG3  4  
ATOM 5253  H HE1  . MET A 1 6  ? 4.266   5.191   -7.649  1.00 0.00 ? 11  MET A HE1  4  
ATOM 5254  H HE2  . MET A 1 6  ? 6.028   5.196   -7.559  1.00 0.00 ? 11  MET A HE2  4  
ATOM 5255  H HE3  . MET A 1 6  ? 5.069   5.181   -6.079  1.00 0.00 ? 11  MET A HE3  4  
ATOM 5256  N N    . LEU A 1 7  ? 0.986   0.690   -5.400  1.00 0.00 ? 12  LEU A N    4  
ATOM 5257  C CA   . LEU A 1 7  ? 0.853   -0.758  -5.249  1.00 0.00 ? 12  LEU A CA   4  
ATOM 5258  C C    . LEU A 1 7  ? -0.570  -1.205  -5.551  1.00 0.00 ? 12  LEU A C    4  
ATOM 5259  O O    . LEU A 1 7  ? -0.786  -2.090  -6.374  1.00 0.00 ? 12  LEU A O    4  
ATOM 5260  C CB   . LEU A 1 7  ? 1.177   -1.202  -3.827  1.00 0.00 ? 12  LEU A CB   4  
ATOM 5261  C CG   . LEU A 1 7  ? 2.536   -0.793  -3.267  1.00 0.00 ? 12  LEU A CG   4  
ATOM 5262  C CD1  . LEU A 1 7  ? 2.372   -0.180  -1.883  1.00 0.00 ? 12  LEU A CD1  4  
ATOM 5263  C CD2  . LEU A 1 7  ? 3.459   -1.999  -3.201  1.00 0.00 ? 12  LEU A CD2  4  
ATOM 5264  H H    . LEU A 1 7  ? 1.168   1.238   -4.607  1.00 0.00 ? 12  LEU A H    4  
ATOM 5265  H HA   . LEU A 1 7  ? 1.532   -1.237  -5.937  1.00 0.00 ? 12  LEU A HA   4  
ATOM 5266  H HB2  . LEU A 1 7  ? 0.416   -0.815  -3.174  1.00 0.00 ? 12  LEU A HB2  4  
ATOM 5267  H HB3  . LEU A 1 7  ? 1.125   -2.278  -3.815  1.00 0.00 ? 12  LEU A HB3  4  
ATOM 5268  H HG   . LEU A 1 7  ? 2.984   -0.054  -3.912  1.00 0.00 ? 12  LEU A HG   4  
ATOM 5269  H HD11 . LEU A 1 7  ? 1.363   0.188   -1.769  1.00 0.00 ? 12  LEU A HD11 4  
ATOM 5270  H HD12 . LEU A 1 7  ? 3.068   0.636   -1.766  1.00 0.00 ? 12  LEU A HD12 4  
ATOM 5271  H HD13 . LEU A 1 7  ? 2.567   -0.932  -1.132  1.00 0.00 ? 12  LEU A HD13 4  
ATOM 5272  H HD21 . LEU A 1 7  ? 3.873   -2.077  -2.210  1.00 0.00 ? 12  LEU A HD21 4  
ATOM 5273  H HD22 . LEU A 1 7  ? 4.256   -1.884  -3.918  1.00 0.00 ? 12  LEU A HD22 4  
ATOM 5274  H HD23 . LEU A 1 7  ? 2.897   -2.898  -3.426  1.00 0.00 ? 12  LEU A HD23 4  
ATOM 5275  N N    . LEU A 1 8  ? -1.533  -0.597  -4.848  1.00 0.00 ? 13  LEU A N    4  
ATOM 5276  C CA   . LEU A 1 8  ? -2.952  -0.933  -5.006  1.00 0.00 ? 13  LEU A CA   4  
ATOM 5277  C C    . LEU A 1 8  ? -3.333  -1.120  -6.474  1.00 0.00 ? 13  LEU A C    4  
ATOM 5278  O O    . LEU A 1 8  ? -3.809  -2.187  -6.861  1.00 0.00 ? 13  LEU A O    4  
ATOM 5279  C CB   . LEU A 1 8  ? -3.829  0.160   -4.382  1.00 0.00 ? 13  LEU A CB   4  
ATOM 5280  C CG   . LEU A 1 8  ? -3.606  0.411   -2.888  1.00 0.00 ? 13  LEU A CG   4  
ATOM 5281  C CD1  . LEU A 1 8  ? -4.392  1.631   -2.429  1.00 0.00 ? 13  LEU A CD1  4  
ATOM 5282  C CD2  . LEU A 1 8  ? -4.002  -0.816  -2.080  1.00 0.00 ? 13  LEU A CD2  4  
ATOM 5283  H H    . LEU A 1 8  ? -1.279  0.087   -4.187  1.00 0.00 ? 13  LEU A H    4  
ATOM 5284  H HA   . LEU A 1 8  ? -3.122  -1.868  -4.484  1.00 0.00 ? 13  LEU A HA   4  
ATOM 5285  H HB2  . LEU A 1 8  ? -3.643  1.084   -4.910  1.00 0.00 ? 13  LEU A HB2  4  
ATOM 5286  H HB3  . LEU A 1 8  ? -4.863  -0.113  -4.527  1.00 0.00 ? 13  LEU A HB3  4  
ATOM 5287  H HG   . LEU A 1 8  ? -2.558  0.604   -2.713  1.00 0.00 ? 13  LEU A HG   4  
ATOM 5288  H HD11 . LEU A 1 8  ? -5.406  1.563   -2.795  1.00 0.00 ? 13  LEU A HD11 4  
ATOM 5289  H HD12 . LEU A 1 8  ? -3.929  2.524   -2.820  1.00 0.00 ? 13  LEU A HD12 4  
ATOM 5290  H HD13 . LEU A 1 8  ? -4.400  1.670   -1.351  1.00 0.00 ? 13  LEU A HD13 4  
ATOM 5291  H HD21 . LEU A 1 8  ? -4.980  -1.151  -2.390  1.00 0.00 ? 13  LEU A HD21 4  
ATOM 5292  H HD22 . LEU A 1 8  ? -4.022  -0.566  -1.032  1.00 0.00 ? 13  LEU A HD22 4  
ATOM 5293  H HD23 . LEU A 1 8  ? -3.282  -1.603  -2.248  1.00 0.00 ? 13  LEU A HD23 4  
ATOM 5294  N N    . GLU A 1 9  ? -3.109  -0.080  -7.286  1.00 0.00 ? 14  GLU A N    4  
ATOM 5295  C CA   . GLU A 1 9  ? -3.419  -0.137  -8.718  1.00 0.00 ? 14  GLU A CA   4  
ATOM 5296  C C    . GLU A 1 9  ? -2.819  -1.393  -9.345  1.00 0.00 ? 14  GLU A C    4  
ATOM 5297  O O    . GLU A 1 9  ? -3.441  -2.037  -10.191 1.00 0.00 ? 14  GLU A O    4  
ATOM 5298  C CB   . GLU A 1 9  ? -2.886  1.111   -9.433  1.00 0.00 ? 14  GLU A CB   4  
ATOM 5299  C CG   . GLU A 1 9  ? -3.490  2.422   -8.944  1.00 0.00 ? 14  GLU A CG   4  
ATOM 5300  C CD   . GLU A 1 9  ? -4.991  2.509   -9.162  1.00 0.00 ? 14  GLU A CD   4  
ATOM 5301  O OE1  . GLU A 1 9  ? -5.736  1.733   -8.525  1.00 0.00 ? 14  GLU A OE1  4  
ATOM 5302  O OE2  . GLU A 1 9  ? -5.423  3.354   -9.973  1.00 0.00 ? 14  GLU A OE2  4  
ATOM 5303  H H    . GLU A 1 9  ? -2.721  0.740   -6.915  1.00 0.00 ? 14  GLU A H    4  
ATOM 5304  H HA   . GLU A 1 9  ? -4.493  -0.175  -8.826  1.00 0.00 ? 14  GLU A HA   4  
ATOM 5305  H HB2  . GLU A 1 9  ? -1.817  1.162   -9.291  1.00 0.00 ? 14  GLU A HB2  4  
ATOM 5306  H HB3  . GLU A 1 9  ? -3.092  1.019   -10.491 1.00 0.00 ? 14  GLU A HB3  4  
ATOM 5307  H HG2  . GLU A 1 9  ? -3.294  2.519   -7.887  1.00 0.00 ? 14  GLU A HG2  4  
ATOM 5308  H HG3  . GLU A 1 9  ? -3.018  3.238   -9.470  1.00 0.00 ? 14  GLU A HG3  4  
ATOM 5309  N N    . ALA A 1 10 ? -1.611  -1.740  -8.903  1.00 0.00 ? 15  ALA A N    4  
ATOM 5310  C CA   . ALA A 1 10 ? -0.914  -2.924  -9.389  1.00 0.00 ? 15  ALA A CA   4  
ATOM 5311  C C    . ALA A 1 10 ? -1.598  -4.195  -8.925  1.00 0.00 ? 15  ALA A C    4  
ATOM 5312  O O    . ALA A 1 10 ? -1.895  -5.069  -9.735  1.00 0.00 ? 15  ALA A O    4  
ATOM 5313  C CB   . ALA A 1 10 ? 0.517   -2.928  -8.899  1.00 0.00 ? 15  ALA A CB   4  
ATOM 5314  H H    . ALA A 1 10 ? -1.179  -1.186  -8.218  1.00 0.00 ? 15  ALA A H    4  
ATOM 5315  H HA   . ALA A 1 10 ? -0.902  -2.897  -10.468 1.00 0.00 ? 15  ALA A HA   4  
ATOM 5316  H HB1  . ALA A 1 10 ? 0.724   -1.996  -8.400  1.00 0.00 ? 15  ALA A HB1  4  
ATOM 5317  H HB2  . ALA A 1 10 ? 1.181   -3.050  -9.737  1.00 0.00 ? 15  ALA A HB2  4  
ATOM 5318  H HB3  . ALA A 1 10 ? 0.659   -3.744  -8.207  1.00 0.00 ? 15  ALA A HB3  4  
ATOM 5319  N N    . ALA A 1 11 ? -1.828  -4.299  -7.610  1.00 0.00 ? 16  ALA A N    4  
ATOM 5320  C CA   . ALA A 1 11 ? -2.462  -5.479  -7.033  1.00 0.00 ? 16  ALA A CA   4  
ATOM 5321  C C    . ALA A 1 11 ? -3.659  -5.935  -7.867  1.00 0.00 ? 16  ALA A C    4  
ATOM 5322  O O    . ALA A 1 11 ? -3.886  -7.131  -8.026  1.00 0.00 ? 16  ALA A O    4  
ATOM 5323  C CB   . ALA A 1 11 ? -2.902  -5.224  -5.605  1.00 0.00 ? 16  ALA A CB   4  
ATOM 5324  H H    . ALA A 1 11 ? -1.551  -3.568  -7.018  1.00 0.00 ? 16  ALA A H    4  
ATOM 5325  H HA   . ALA A 1 11 ? -1.717  -6.259  -7.015  1.00 0.00 ? 16  ALA A HA   4  
ATOM 5326  H HB1  . ALA A 1 11 ? -2.033  -5.112  -4.975  1.00 0.00 ? 16  ALA A HB1  4  
ATOM 5327  H HB2  . ALA A 1 11 ? -3.489  -6.066  -5.263  1.00 0.00 ? 16  ALA A HB2  4  
ATOM 5328  H HB3  . ALA A 1 11 ? -3.499  -4.327  -5.564  1.00 0.00 ? 16  ALA A HB3  4  
ATOM 5329  N N    . ASP A 1 12 ? -4.413  -4.968  -8.403  1.00 0.00 ? 17  ASP A N    4  
ATOM 5330  C CA   . ASP A 1 12 ? -5.581  -5.264  -9.235  1.00 0.00 ? 17  ASP A CA   4  
ATOM 5331  C C    . ASP A 1 12 ? -5.179  -6.103  -10.447 1.00 0.00 ? 17  ASP A C    4  
ATOM 5332  O O    . ASP A 1 12 ? -5.812  -7.114  -10.751 1.00 0.00 ? 17  ASP A O    4  
ATOM 5333  C CB   . ASP A 1 12 ? -6.249  -3.964  -9.698  1.00 0.00 ? 17  ASP A CB   4  
ATOM 5334  C CG   . ASP A 1 12 ? -6.756  -3.120  -8.541  1.00 0.00 ? 17  ASP A CG   4  
ATOM 5335  O OD1  . ASP A 1 12 ? -7.622  -3.607  -7.783  1.00 0.00 ? 17  ASP A OD1  4  
ATOM 5336  O OD2  . ASP A 1 12 ? -6.284  -1.972  -8.392  1.00 0.00 ? 17  ASP A OD2  4  
ATOM 5337  H H    . ASP A 1 12 ? -4.173  -4.031  -8.240  1.00 0.00 ? 17  ASP A H    4  
ATOM 5338  H HA   . ASP A 1 12 ? -6.281  -5.827  -8.636  1.00 0.00 ? 17  ASP A HA   4  
ATOM 5339  H HB2  . ASP A 1 12 ? -5.534  -3.377  -10.256 1.00 0.00 ? 17  ASP A HB2  4  
ATOM 5340  H HB3  . ASP A 1 12 ? -7.087  -4.205  -10.337 1.00 0.00 ? 17  ASP A HB3  4  
ATOM 5341  N N    . TYR A 1 13 ? -4.108  -5.678  -11.123 1.00 0.00 ? 18  TYR A N    4  
ATOM 5342  C CA   . TYR A 1 13 ? -3.599  -6.390  -12.293 1.00 0.00 ? 18  TYR A CA   4  
ATOM 5343  C C    . TYR A 1 13 ? -2.840  -7.640  -11.868 1.00 0.00 ? 18  TYR A C    4  
ATOM 5344  O O    . TYR A 1 13 ? -3.076  -8.727  -12.400 1.00 0.00 ? 18  TYR A O    4  
ATOM 5345  C CB   . TYR A 1 13 ? -2.706  -5.459  -13.129 1.00 0.00 ? 18  TYR A CB   4  
ATOM 5346  C CG   . TYR A 1 13 ? -1.992  -6.134  -14.286 1.00 0.00 ? 18  TYR A CG   4  
ATOM 5347  C CD1  . TYR A 1 13 ? -0.963  -7.043  -14.060 1.00 0.00 ? 18  TYR A CD1  4  
ATOM 5348  C CD2  . TYR A 1 13 ? -2.344  -5.858  -15.602 1.00 0.00 ? 18  TYR A CD2  4  
ATOM 5349  C CE1  . TYR A 1 13 ? -0.309  -7.655  -15.112 1.00 0.00 ? 18  TYR A CE1  4  
ATOM 5350  C CE2  . TYR A 1 13 ? -1.694  -6.468  -16.658 1.00 0.00 ? 18  TYR A CE2  4  
ATOM 5351  C CZ   . TYR A 1 13 ? -0.678  -7.365  -16.407 1.00 0.00 ? 18  TYR A CZ   4  
ATOM 5352  O OH   . TYR A 1 13 ? -0.028  -7.972  -17.457 1.00 0.00 ? 18  TYR A OH   4  
ATOM 5353  H H    . TYR A 1 13 ? -3.643  -4.871  -10.820 1.00 0.00 ? 18  TYR A H    4  
ATOM 5354  H HA   . TYR A 1 13 ? -4.445  -6.696  -12.879 1.00 0.00 ? 18  TYR A HA   4  
ATOM 5355  H HB2  . TYR A 1 13 ? -3.315  -4.667  -13.539 1.00 0.00 ? 18  TYR A HB2  4  
ATOM 5356  H HB3  . TYR A 1 13 ? -1.953  -5.024  -12.485 1.00 0.00 ? 18  TYR A HB3  4  
ATOM 5357  H HD1  . TYR A 1 13 ? -0.676  -7.270  -13.045 1.00 0.00 ? 18  TYR A HD1  4  
ATOM 5358  H HD2  . TYR A 1 13 ? -3.140  -5.153  -15.794 1.00 0.00 ? 18  TYR A HD2  4  
ATOM 5359  H HE1  . TYR A 1 13 ? 0.486   -8.359  -14.915 1.00 0.00 ? 18  TYR A HE1  4  
ATOM 5360  H HE2  . TYR A 1 13 ? -1.984  -6.239  -17.673 1.00 0.00 ? 18  TYR A HE2  4  
ATOM 5361  H HH   . TYR A 1 13 ? -0.063  -8.927  -17.351 1.00 0.00 ? 18  TYR A HH   4  
ATOM 5362  N N    . LEU A 1 14 ? -1.950  -7.484  -10.891 1.00 0.00 ? 19  LEU A N    4  
ATOM 5363  C CA   . LEU A 1 14 ? -1.175  -8.603  -10.369 1.00 0.00 ? 19  LEU A CA   4  
ATOM 5364  C C    . LEU A 1 14 ? -2.113  -9.725  -9.945  1.00 0.00 ? 19  LEU A C    4  
ATOM 5365  O O    . LEU A 1 14 ? -1.812  -10.905 -10.128 1.00 0.00 ? 19  LEU A O    4  
ATOM 5366  C CB   . LEU A 1 14 ? -0.349  -8.162  -9.157  1.00 0.00 ? 19  LEU A CB   4  
ATOM 5367  C CG   . LEU A 1 14 ? 0.528   -6.931  -9.370  1.00 0.00 ? 19  LEU A CG   4  
ATOM 5368  C CD1  . LEU A 1 14 ? 1.067   -6.436  -8.039  1.00 0.00 ? 19  LEU A CD1  4  
ATOM 5369  C CD2  . LEU A 1 14 ? 1.672   -7.239  -10.326 1.00 0.00 ? 19  LEU A CD2  4  
ATOM 5370  H H    . LEU A 1 14 ? -1.825  -6.594  -10.500 1.00 0.00 ? 19  LEU A H    4  
ATOM 5371  H HA   . LEU A 1 14 ? -0.515  -8.959  -11.147 1.00 0.00 ? 19  LEU A HA   4  
ATOM 5372  H HB2  . LEU A 1 14 ? -1.029  -7.954  -8.346  1.00 0.00 ? 19  LEU A HB2  4  
ATOM 5373  H HB3  . LEU A 1 14 ? 0.289   -8.983  -8.867  1.00 0.00 ? 19  LEU A HB3  4  
ATOM 5374  H HG   . LEU A 1 14 ? -0.071  -6.147  -9.803  1.00 0.00 ? 19  LEU A HG   4  
ATOM 5375  H HD11 . LEU A 1 14 ? 1.985   -6.958  -7.805  1.00 0.00 ? 19  LEU A HD11 4  
ATOM 5376  H HD12 . LEU A 1 14 ? 0.339   -6.626  -7.259  1.00 0.00 ? 19  LEU A HD12 4  
ATOM 5377  H HD13 . LEU A 1 14 ? 1.263   -5.373  -8.100  1.00 0.00 ? 19  LEU A HD13 4  
ATOM 5378  H HD21 . LEU A 1 14 ? 2.557   -6.703  -10.014 1.00 0.00 ? 19  LEU A HD21 4  
ATOM 5379  H HD22 . LEU A 1 14 ? 1.399   -6.932  -11.325 1.00 0.00 ? 19  LEU A HD22 4  
ATOM 5380  H HD23 . LEU A 1 14 ? 1.873   -8.301  -10.318 1.00 0.00 ? 19  LEU A HD23 4  
ATOM 5381  N N    . GLU A 1 15 ? -3.258  -9.329  -9.372  1.00 0.00 ? 20  GLU A N    4  
ATOM 5382  C CA   . GLU A 1 15 ? -4.271  -10.272 -8.897  1.00 0.00 ? 20  GLU A CA   4  
ATOM 5383  C C    . GLU A 1 15 ? -4.403  -11.470 -9.838  1.00 0.00 ? 20  GLU A C    4  
ATOM 5384  O O    . GLU A 1 15 ? -4.200  -12.614 -9.429  1.00 0.00 ? 20  GLU A O    4  
ATOM 5385  C CB   . GLU A 1 15 ? -5.620  -9.563  -8.761  1.00 0.00 ? 20  GLU A CB   4  
ATOM 5386  C CG   . GLU A 1 15 ? -6.406  -9.998  -7.542  1.00 0.00 ? 20  GLU A CG   4  
ATOM 5387  C CD   . GLU A 1 15 ? -7.742  -9.287  -7.418  1.00 0.00 ? 20  GLU A CD   4  
ATOM 5388  O OE1  . GLU A 1 15 ? -8.590  -9.457  -8.321  1.00 0.00 ? 20  GLU A OE1  4  
ATOM 5389  O OE2  . GLU A 1 15 ? -7.938  -8.561  -6.423  1.00 0.00 ? 20  GLU A OE2  4  
ATOM 5390  H H    . GLU A 1 15 ? -3.424  -8.360  -9.261  1.00 0.00 ? 20  GLU A H    4  
ATOM 5391  H HA   . GLU A 1 15 ? -3.962  -10.626 -7.925  1.00 0.00 ? 20  GLU A HA   4  
ATOM 5392  H HB2  . GLU A 1 15 ? -5.452  -8.499  -8.696  1.00 0.00 ? 20  GLU A HB2  4  
ATOM 5393  H HB3  . GLU A 1 15 ? -6.214  -9.771  -9.639  1.00 0.00 ? 20  GLU A HB3  4  
ATOM 5394  H HG2  . GLU A 1 15 ? -6.582  -11.060 -7.603  1.00 0.00 ? 20  GLU A HG2  4  
ATOM 5395  H HG3  . GLU A 1 15 ? -5.817  -9.781  -6.663  1.00 0.00 ? 20  GLU A HG3  4  
ATOM 5396  N N    . ARG A 1 16 ? -4.735  -11.195 -11.099 1.00 0.00 ? 21  ARG A N    4  
ATOM 5397  C CA   . ARG A 1 16 ? -4.883  -12.246 -12.103 1.00 0.00 ? 21  ARG A CA   4  
ATOM 5398  C C    . ARG A 1 16 ? -3.523  -12.817 -12.501 1.00 0.00 ? 21  ARG A C    4  
ATOM 5399  O O    . ARG A 1 16 ? -2.658  -12.034 -12.955 1.00 0.00 ? 21  ARG A O    4  
ATOM 5400  C CB   . ARG A 1 16 ? -5.613  -11.704 -13.334 1.00 0.00 ? 21  ARG A CB   4  
ATOM 5401  C CG   . ARG A 1 16 ? -7.028  -11.228 -13.041 1.00 0.00 ? 21  ARG A CG   4  
ATOM 5402  C CD   . ARG A 1 16 ? -7.676  -10.605 -14.266 1.00 0.00 ? 21  ARG A CD   4  
ATOM 5403  N NE   . ARG A 1 16 ? -6.977  -9.397  -14.708 1.00 0.00 ? 21  ARG A NE   4  
ATOM 5404  C CZ   . ARG A 1 16 ? -7.332  -8.675  -15.773 1.00 0.00 ? 21  ARG A CZ   4  
ATOM 5405  N NH1  . ARG A 1 16 ? -8.373  -9.037  -16.519 1.00 0.00 ? 21  ARG A NH1  4  
ATOM 5406  N NH2  . ARG A 1 16 ? -6.639  -7.587  -16.097 1.00 0.00 ? 21  ARG A NH2  4  
ATOM 5407  O OXT  . ARG A 1 16 ? -3.331  -14.042 -12.350 1.00 0.00 ? 21  ARG A OXT  4  
ATOM 5408  H H    . ARG A 1 16 ? -4.874  -10.261 -11.363 1.00 0.00 ? 21  ARG A H    4  
ATOM 5409  H HA   . ARG A 1 16 ? -5.476  -13.036 -11.666 1.00 0.00 ? 21  ARG A HA   4  
ATOM 5410  H HB2  . ARG A 1 16 ? -5.051  -10.872 -13.735 1.00 0.00 ? 21  ARG A HB2  4  
ATOM 5411  H HB3  . ARG A 1 16 ? -5.665  -12.483 -14.081 1.00 0.00 ? 21  ARG A HB3  4  
ATOM 5412  H HG2  . ARG A 1 16 ? -7.622  -12.073 -12.723 1.00 0.00 ? 21  ARG A HG2  4  
ATOM 5413  H HG3  . ARG A 1 16 ? -6.993  -10.493 -12.249 1.00 0.00 ? 21  ARG A HG3  4  
ATOM 5414  H HD2  . ARG A 1 16 ? -7.669  -11.326 -15.069 1.00 0.00 ? 21  ARG A HD2  4  
ATOM 5415  H HD3  . ARG A 1 16 ? -8.697  -10.350 -14.024 1.00 0.00 ? 21  ARG A HD3  4  
ATOM 5416  H HE   . ARG A 1 16 ? -6.203  -9.105  -14.180 1.00 0.00 ? 21  ARG A HE   4  
ATOM 5417  H HH11 . ARG A 1 16 ? -8.898  -9.854  -16.285 1.00 0.00 ? 21  ARG A HH11 4  
ATOM 5418  H HH12 . ARG A 1 16 ? -8.631  -8.491  -17.316 1.00 0.00 ? 21  ARG A HH12 4  
ATOM 5419  H HH21 . ARG A 1 16 ? -5.854  -7.310  -15.540 1.00 0.00 ? 21  ARG A HH21 4  
ATOM 5420  H HH22 . ARG A 1 16 ? -6.903  -7.046  -16.894 1.00 0.00 ? 21  ARG A HH22 4  
ATOM 5421  N N    . SER B 2 1  ? -6.913  -1.048  -19.747 1.00 0.00 ? 295 SER B N    4  
ATOM 5422  C CA   . SER B 2 1  ? -5.799  -0.585  -18.872 1.00 0.00 ? 295 SER B CA   4  
ATOM 5423  C C    . SER B 2 1  ? -4.640  -0.016  -19.693 1.00 0.00 ? 295 SER B C    4  
ATOM 5424  O O    . SER B 2 1  ? -3.754  -0.752  -20.134 1.00 0.00 ? 295 SER B O    4  
ATOM 5425  C CB   . SER B 2 1  ? -5.325  -1.765  -18.011 1.00 0.00 ? 295 SER B CB   4  
ATOM 5426  O OG   . SER B 2 1  ? -4.922  -2.862  -18.816 1.00 0.00 ? 295 SER B OG   4  
ATOM 5427  H H1   . SER B 2 1  ? -6.721  -2.033  -20.017 1.00 0.00 ? 295 SER B H1   4  
ATOM 5428  H H2   . SER B 2 1  ? -6.939  -0.429  -20.583 1.00 0.00 ? 295 SER B H2   4  
ATOM 5429  H H3   . SER B 2 1  ? -7.796  -0.976  -19.201 1.00 0.00 ? 295 SER B H3   4  
ATOM 5430  H HA   . SER B 2 1  ? -6.179  0.192   -18.224 1.00 0.00 ? 295 SER B HA   4  
ATOM 5431  H HB2  . SER B 2 1  ? -4.484  -1.451  -17.409 1.00 0.00 ? 295 SER B HB2  4  
ATOM 5432  H HB3  . SER B 2 1  ? -6.130  -2.083  -17.366 1.00 0.00 ? 295 SER B HB3  4  
ATOM 5433  H HG   . SER B 2 1  ? -4.092  -3.213  -18.487 1.00 0.00 ? 295 SER B HG   4  
ATOM 5434  N N    . LEU B 2 2  ? -4.656  1.303   -19.895 1.00 0.00 ? 296 LEU B N    4  
ATOM 5435  C CA   . LEU B 2 2  ? -3.612  1.980   -20.660 1.00 0.00 ? 296 LEU B CA   4  
ATOM 5436  C C    . LEU B 2 2  ? -2.677  2.752   -19.733 1.00 0.00 ? 296 LEU B C    4  
ATOM 5437  O O    . LEU B 2 2  ? -3.117  3.623   -18.978 1.00 0.00 ? 296 LEU B O    4  
ATOM 5438  C CB   . LEU B 2 2  ? -4.221  2.933   -21.698 1.00 0.00 ? 296 LEU B CB   4  
ATOM 5439  C CG   . LEU B 2 2  ? -4.949  2.263   -22.874 1.00 0.00 ? 296 LEU B CG   4  
ATOM 5440  C CD1  . LEU B 2 2  ? -6.269  1.647   -22.429 1.00 0.00 ? 296 LEU B CD1  4  
ATOM 5441  C CD2  . LEU B 2 2  ? -5.182  3.269   -23.995 1.00 0.00 ? 296 LEU B CD2  4  
ATOM 5442  H H    . LEU B 2 2  ? -5.390  1.833   -19.517 1.00 0.00 ? 296 LEU B H    4  
ATOM 5443  H HA   . LEU B 2 2  ? -3.039  1.222   -21.175 1.00 0.00 ? 296 LEU B HA   4  
ATOM 5444  H HB2  . LEU B 2 2  ? -4.922  3.579   -21.191 1.00 0.00 ? 296 LEU B HB2  4  
ATOM 5445  H HB3  . LEU B 2 2  ? -3.426  3.543   -22.101 1.00 0.00 ? 296 LEU B HB3  4  
ATOM 5446  H HG   . LEU B 2 2  ? -4.328  1.469   -23.264 1.00 0.00 ? 296 LEU B HG   4  
ATOM 5447  H HD11 . LEU B 2 2  ? -6.533  0.843   -23.099 1.00 0.00 ? 296 LEU B HD11 4  
ATOM 5448  H HD12 . LEU B 2 2  ? -7.042  2.399   -22.448 1.00 0.00 ? 296 LEU B HD12 4  
ATOM 5449  H HD13 . LEU B 2 2  ? -6.169  1.260   -21.427 1.00 0.00 ? 296 LEU B HD13 4  
ATOM 5450  H HD21 . LEU B 2 2  ? -6.214  3.226   -24.310 1.00 0.00 ? 296 LEU B HD21 4  
ATOM 5451  H HD22 . LEU B 2 2  ? -4.540  3.030   -24.830 1.00 0.00 ? 296 LEU B HD22 4  
ATOM 5452  H HD23 . LEU B 2 2  ? -4.955  4.263   -23.640 1.00 0.00 ? 296 LEU B HD23 4  
ATOM 5453  N N    . GLN B 2 3  ? -1.384  2.431   -19.798 1.00 0.00 ? 297 GLN B N    4  
ATOM 5454  C CA   . GLN B 2 3  ? -0.381  3.097   -18.968 1.00 0.00 ? 297 GLN B CA   4  
ATOM 5455  C C    . GLN B 2 3  ? -0.121  4.517   -19.466 1.00 0.00 ? 297 GLN B C    4  
ATOM 5456  O O    . GLN B 2 3  ? -0.080  4.762   -20.674 1.00 0.00 ? 297 GLN B O    4  
ATOM 5457  C CB   . GLN B 2 3  ? 0.925   2.296   -18.955 1.00 0.00 ? 297 GLN B CB   4  
ATOM 5458  C CG   . GLN B 2 3  ? 0.779   0.876   -18.420 1.00 0.00 ? 297 GLN B CG   4  
ATOM 5459  C CD   . GLN B 2 3  ? 0.315   0.834   -16.973 1.00 0.00 ? 297 GLN B CD   4  
ATOM 5460  O OE1  . GLN B 2 3  ? -0.785  1.280   -16.646 1.00 0.00 ? 297 GLN B OE1  4  
ATOM 5461  N NE2  . GLN B 2 3  ? 1.155   0.293   -16.095 1.00 0.00 ? 297 GLN B NE2  4  
ATOM 5462  H H    . GLN B 2 3  ? -1.097  1.730   -20.422 1.00 0.00 ? 297 GLN B H    4  
ATOM 5463  H HA   . GLN B 2 3  ? -0.769  3.149   -17.962 1.00 0.00 ? 297 GLN B HA   4  
ATOM 5464  H HB2  . GLN B 2 3  ? 1.306   2.237   -19.965 1.00 0.00 ? 297 GLN B HB2  4  
ATOM 5465  H HB3  . GLN B 2 3  ? 1.647   2.816   -18.340 1.00 0.00 ? 297 GLN B HB3  4  
ATOM 5466  H HG2  . GLN B 2 3  ? 0.057   0.351   -19.026 1.00 0.00 ? 297 GLN B HG2  4  
ATOM 5467  H HG3  . GLN B 2 3  ? 1.735   0.379   -18.491 1.00 0.00 ? 297 GLN B HG3  4  
ATOM 5468  H HE21 . GLN B 2 3  ? 2.015   -0.045  -16.422 1.00 0.00 ? 297 GLN B HE21 4  
ATOM 5469  H HE22 . GLN B 2 3  ? 0.878   0.252   -15.157 1.00 0.00 ? 297 GLN B HE22 4  
ATOM 5470  N N    . ASN B 2 4  ? 0.046   5.451   -18.530 1.00 0.00 ? 298 ASN B N    4  
ATOM 5471  C CA   . ASN B 2 4  ? 0.292   6.851   -18.875 1.00 0.00 ? 298 ASN B CA   4  
ATOM 5472  C C    . ASN B 2 4  ? 1.787   7.126   -19.055 1.00 0.00 ? 298 ASN B C    4  
ATOM 5473  O O    . ASN B 2 4  ? 2.271   7.212   -20.186 1.00 0.00 ? 298 ASN B O    4  
ATOM 5474  C CB   . ASN B 2 4  ? -0.297  7.780   -17.805 1.00 0.00 ? 298 ASN B CB   4  
ATOM 5475  C CG   . ASN B 2 4  ? -1.809  7.674   -17.710 1.00 0.00 ? 298 ASN B CG   4  
ATOM 5476  O OD1  . ASN B 2 4  ? -2.352  6.612   -17.404 1.00 0.00 ? 298 ASN B OD1  4  
ATOM 5477  N ND2  . ASN B 2 4  ? -2.501  8.779   -17.974 1.00 0.00 ? 298 ASN B ND2  4  
ATOM 5478  H H    . ASN B 2 4  ? -0.003  5.194   -17.584 1.00 0.00 ? 298 ASN B H    4  
ATOM 5479  H HA   . ASN B 2 4  ? -0.205  7.044   -19.814 1.00 0.00 ? 298 ASN B HA   4  
ATOM 5480  H HB2  . ASN B 2 4  ? 0.122   7.523   -16.845 1.00 0.00 ? 298 ASN B HB2  4  
ATOM 5481  H HB3  . ASN B 2 4  ? -0.039  8.802   -18.045 1.00 0.00 ? 298 ASN B HB3  4  
ATOM 5482  H HD21 . ASN B 2 4  ? -2.006  9.591   -18.212 1.00 0.00 ? 298 ASN B HD21 4  
ATOM 5483  H HD22 . ASN B 2 4  ? -3.478  8.737   -17.919 1.00 0.00 ? 298 ASN B HD22 4  
ATOM 5484  N N    . ASN B 2 5  ? 2.512   7.270   -17.943 1.00 0.00 ? 299 ASN B N    4  
ATOM 5485  C CA   . ASN B 2 5  ? 3.949   7.544   -17.992 1.00 0.00 ? 299 ASN B CA   4  
ATOM 5486  C C    . ASN B 2 5  ? 4.627   7.242   -16.653 1.00 0.00 ? 299 ASN B C    4  
ATOM 5487  O O    . ASN B 2 5  ? 3.961   6.905   -15.671 1.00 0.00 ? 299 ASN B O    4  
ATOM 5488  C CB   . ASN B 2 5  ? 4.197   9.006   -18.391 1.00 0.00 ? 299 ASN B CB   4  
ATOM 5489  C CG   . ASN B 2 5  ? 3.530   9.995   -17.448 1.00 0.00 ? 299 ASN B CG   4  
ATOM 5490  O OD1  . ASN B 2 5  ? 3.851   10.052  -16.261 1.00 0.00 ? 299 ASN B OD1  4  
ATOM 5491  N ND2  . ASN B 2 5  ? 2.594   10.778  -17.973 1.00 0.00 ? 299 ASN B ND2  4  
ATOM 5492  H H    . ASN B 2 5  ? 2.072   7.195   -17.070 1.00 0.00 ? 299 ASN B H    4  
ATOM 5493  H HA   . ASN B 2 5  ? 4.378   6.901   -18.747 1.00 0.00 ? 299 ASN B HA   4  
ATOM 5494  H HB2  . ASN B 2 5  ? 5.259   9.197   -18.387 1.00 0.00 ? 299 ASN B HB2  4  
ATOM 5495  H HB3  . ASN B 2 5  ? 3.810   9.169   -19.386 1.00 0.00 ? 299 ASN B HB3  4  
ATOM 5496  H HD21 . ASN B 2 5  ? 2.385   10.678  -18.925 1.00 0.00 ? 299 ASN B HD21 4  
ATOM 5497  H HD22 . ASN B 2 5  ? 2.149   11.424  -17.386 1.00 0.00 ? 299 ASN B HD22 4  
ATOM 5498  N N    . GLN B 2 6  ? 5.959   7.369   -16.629 1.00 0.00 ? 300 GLN B N    4  
ATOM 5499  C CA   . GLN B 2 6  ? 6.747   7.113   -15.422 1.00 0.00 ? 300 GLN B CA   4  
ATOM 5500  C C    . GLN B 2 6  ? 6.500   5.699   -14.886 1.00 0.00 ? 300 GLN B C    4  
ATOM 5501  O O    . GLN B 2 6  ? 5.990   5.522   -13.777 1.00 0.00 ? 300 GLN B O    4  
ATOM 5502  C CB   . GLN B 2 6  ? 6.436   8.158   -14.344 1.00 0.00 ? 300 GLN B CB   4  
ATOM 5503  C CG   . GLN B 2 6  ? 6.811   9.577   -14.743 1.00 0.00 ? 300 GLN B CG   4  
ATOM 5504  C CD   . GLN B 2 6  ? 6.488   10.595  -13.665 1.00 0.00 ? 300 GLN B CD   4  
ATOM 5505  O OE1  . GLN B 2 6  ? 6.994   10.511  -12.546 1.00 0.00 ? 300 GLN B OE1  4  
ATOM 5506  N NE2  . GLN B 2 6  ? 5.641   11.565  -13.996 1.00 0.00 ? 300 GLN B NE2  4  
ATOM 5507  H H    . GLN B 2 6  ? 6.423   7.641   -17.447 1.00 0.00 ? 300 GLN B H    4  
ATOM 5508  H HA   . GLN B 2 6  ? 7.790   7.196   -15.693 1.00 0.00 ? 300 GLN B HA   4  
ATOM 5509  H HB2  . GLN B 2 6  ? 5.377   8.136   -14.131 1.00 0.00 ? 300 GLN B HB2  4  
ATOM 5510  H HB3  . GLN B 2 6  ? 6.980   7.905   -13.445 1.00 0.00 ? 300 GLN B HB3  4  
ATOM 5511  H HG2  . GLN B 2 6  ? 7.872   9.612   -14.943 1.00 0.00 ? 300 GLN B HG2  4  
ATOM 5512  H HG3  . GLN B 2 6  ? 6.270   9.839   -15.640 1.00 0.00 ? 300 GLN B HG3  4  
ATOM 5513  H HE21 . GLN B 2 6  ? 5.275   11.571  -14.907 1.00 0.00 ? 300 GLN B HE21 4  
ATOM 5514  H HE22 . GLN B 2 6  ? 5.417   12.234  -13.318 1.00 0.00 ? 300 GLN B HE22 4  
ATOM 5515  N N    . PRO B 2 7  ? 6.861   4.668   -15.678 1.00 0.00 ? 301 PRO B N    4  
ATOM 5516  C CA   . PRO B 2 7  ? 6.679   3.267   -15.289 1.00 0.00 ? 301 PRO B CA   4  
ATOM 5517  C C    . PRO B 2 7  ? 7.732   2.780   -14.288 1.00 0.00 ? 301 PRO B C    4  
ATOM 5518  O O    . PRO B 2 7  ? 7.511   1.791   -13.592 1.00 0.00 ? 301 PRO B O    4  
ATOM 5519  C CB   . PRO B 2 7  ? 6.818   2.521   -16.615 1.00 0.00 ? 301 PRO B CB   4  
ATOM 5520  C CG   . PRO B 2 7  ? 7.739   3.366   -17.427 1.00 0.00 ? 301 PRO B CG   4  
ATOM 5521  C CD   . PRO B 2 7  ? 7.474   4.791   -17.018 1.00 0.00 ? 301 PRO B CD   4  
ATOM 5522  H HA   . PRO B 2 7  ? 5.694   3.096   -14.881 1.00 0.00 ? 301 PRO B HA   4  
ATOM 5523  H HB2  . PRO B 2 7  ? 7.231   1.539   -16.439 1.00 0.00 ? 301 PRO B HB2  4  
ATOM 5524  H HB3  . PRO B 2 7  ? 5.848   2.433   -17.085 1.00 0.00 ? 301 PRO B HB3  4  
ATOM 5525  H HG2  . PRO B 2 7  ? 8.763   3.099   -17.212 1.00 0.00 ? 301 PRO B HG2  4  
ATOM 5526  H HG3  . PRO B 2 7  ? 7.528   3.233   -18.477 1.00 0.00 ? 301 PRO B HG3  4  
ATOM 5527  H HD2  . PRO B 2 7  ? 8.400   5.345   -16.966 1.00 0.00 ? 301 PRO B HD2  4  
ATOM 5528  H HD3  . PRO B 2 7  ? 6.792   5.262   -17.712 1.00 0.00 ? 301 PRO B HD3  4  
ATOM 5529  N N    . VAL B 2 8  ? 8.872   3.475   -14.219 1.00 0.00 ? 302 VAL B N    4  
ATOM 5530  C CA   . VAL B 2 8  ? 9.947   3.102   -13.299 1.00 0.00 ? 302 VAL B CA   4  
ATOM 5531  C C    . VAL B 2 8  ? 9.474   3.178   -11.848 1.00 0.00 ? 302 VAL B C    4  
ATOM 5532  O O    . VAL B 2 8  ? 9.632   2.223   -11.085 1.00 0.00 ? 302 VAL B O    4  
ATOM 5533  C CB   . VAL B 2 8  ? 11.190  4.003   -13.476 1.00 0.00 ? 302 VAL B CB   4  
ATOM 5534  C CG1  . VAL B 2 8  ? 12.308  3.573   -12.535 1.00 0.00 ? 302 VAL B CG1  4  
ATOM 5535  C CG2  . VAL B 2 8  ? 11.666  3.984   -14.922 1.00 0.00 ? 302 VAL B CG2  4  
ATOM 5536  H H    . VAL B 2 8  ? 8.993   4.255   -14.799 1.00 0.00 ? 302 VAL B H    4  
ATOM 5537  H HA   . VAL B 2 8  ? 10.232  2.084   -13.518 1.00 0.00 ? 302 VAL B HA   4  
ATOM 5538  H HB   . VAL B 2 8  ? 10.912  5.016   -13.226 1.00 0.00 ? 302 VAL B HB   4  
ATOM 5539  H HG11 . VAL B 2 8  ? 12.020  3.781   -11.516 1.00 0.00 ? 302 VAL B HG11 4  
ATOM 5540  H HG12 . VAL B 2 8  ? 13.208  4.120   -12.773 1.00 0.00 ? 302 VAL B HG12 4  
ATOM 5541  H HG13 . VAL B 2 8  ? 12.488  2.515   -12.651 1.00 0.00 ? 302 VAL B HG13 4  
ATOM 5542  H HG21 . VAL B 2 8  ? 12.728  4.177   -14.955 1.00 0.00 ? 302 VAL B HG21 4  
ATOM 5543  H HG22 . VAL B 2 8  ? 11.145  4.745   -15.484 1.00 0.00 ? 302 VAL B HG22 4  
ATOM 5544  H HG23 . VAL B 2 8  ? 11.464  3.015   -15.356 1.00 0.00 ? 302 VAL B HG23 4  
ATOM 5545  N N    . GLU B 2 9  ? 8.887   4.319   -11.477 1.00 0.00 ? 303 GLU B N    4  
ATOM 5546  C CA   . GLU B 2 9  ? 8.382   4.519   -10.119 1.00 0.00 ? 303 GLU B CA   4  
ATOM 5547  C C    . GLU B 2 9  ? 7.251   3.543   -9.811  1.00 0.00 ? 303 GLU B C    4  
ATOM 5548  O O    . GLU B 2 9  ? 7.271   2.870   -8.782  1.00 0.00 ? 303 GLU B O    4  
ATOM 5549  C CB   . GLU B 2 9  ? 7.886   5.957   -9.935  1.00 0.00 ? 303 GLU B CB   4  
ATOM 5550  C CG   . GLU B 2 9  ? 8.983   7.003   -10.079 1.00 0.00 ? 303 GLU B CG   4  
ATOM 5551  C CD   . GLU B 2 9  ? 8.482   8.430   -9.902  1.00 0.00 ? 303 GLU B CD   4  
ATOM 5552  O OE1  . GLU B 2 9  ? 7.267   8.624   -9.668  1.00 0.00 ? 303 GLU B OE1  4  
ATOM 5553  O OE2  . GLU B 2 9  ? 9.309   9.361   -9.999  1.00 0.00 ? 303 GLU B OE2  4  
ATOM 5554  H H    . GLU B 2 9  ? 8.786   5.039   -12.133 1.00 0.00 ? 303 GLU B H    4  
ATOM 5555  H HA   . GLU B 2 9  ? 9.197   4.340   -9.433  1.00 0.00 ? 303 GLU B HA   4  
ATOM 5556  H HB2  . GLU B 2 9  ? 7.126   6.160   -10.675 1.00 0.00 ? 303 GLU B HB2  4  
ATOM 5557  H HB3  . GLU B 2 9  ? 7.454   6.053   -8.950  1.00 0.00 ? 303 GLU B HB3  4  
ATOM 5558  H HG2  . GLU B 2 9  ? 9.740   6.811   -9.333  1.00 0.00 ? 303 GLU B HG2  4  
ATOM 5559  H HG3  . GLU B 2 9  ? 9.420   6.912   -11.062 1.00 0.00 ? 303 GLU B HG3  4  
ATOM 5560  N N    . PHE B 2 10 ? 6.273   3.470   -10.716 1.00 0.00 ? 304 PHE B N    4  
ATOM 5561  C CA   . PHE B 2 10 ? 5.124   2.577   -10.555 1.00 0.00 ? 304 PHE B CA   4  
ATOM 5562  C C    . PHE B 2 10 ? 5.571   1.119   -10.432 1.00 0.00 ? 304 PHE B C    4  
ATOM 5563  O O    . PHE B 2 10 ? 5.120   0.400   -9.543  1.00 0.00 ? 304 PHE B O    4  
ATOM 5564  C CB   . PHE B 2 10 ? 4.172   2.737   -11.748 1.00 0.00 ? 304 PHE B CB   4  
ATOM 5565  C CG   . PHE B 2 10 ? 2.919   1.905   -11.664 1.00 0.00 ? 304 PHE B CG   4  
ATOM 5566  C CD1  . PHE B 2 10 ? 1.963   2.156   -10.690 1.00 0.00 ? 304 PHE B CD1  4  
ATOM 5567  C CD2  . PHE B 2 10 ? 2.697   0.875   -12.564 1.00 0.00 ? 304 PHE B CD2  4  
ATOM 5568  C CE1  . PHE B 2 10 ? 0.811   1.396   -10.618 1.00 0.00 ? 304 PHE B CE1  4  
ATOM 5569  C CE2  . PHE B 2 10 ? 1.548   0.109   -12.495 1.00 0.00 ? 304 PHE B CE2  4  
ATOM 5570  C CZ   . PHE B 2 10 ? 0.603   0.371   -11.521 1.00 0.00 ? 304 PHE B CZ   4  
ATOM 5571  H H    . PHE B 2 10 ? 6.324   4.033   -11.517 1.00 0.00 ? 304 PHE B H    4  
ATOM 5572  H HA   . PHE B 2 10 ? 4.606   2.861   -9.652  1.00 0.00 ? 304 PHE B HA   4  
ATOM 5573  H HB2  . PHE B 2 10 ? 3.873   3.772   -11.823 1.00 0.00 ? 304 PHE B HB2  4  
ATOM 5574  H HB3  . PHE B 2 10 ? 4.695   2.457   -12.652 1.00 0.00 ? 304 PHE B HB3  4  
ATOM 5575  H HD1  . PHE B 2 10 ? 2.124   2.957   -9.985  1.00 0.00 ? 304 PHE B HD1  4  
ATOM 5576  H HD2  . PHE B 2 10 ? 3.434   0.668   -13.325 1.00 0.00 ? 304 PHE B HD2  4  
ATOM 5577  H HE1  . PHE B 2 10 ? 0.074   1.601   -9.856  1.00 0.00 ? 304 PHE B HE1  4  
ATOM 5578  H HE2  . PHE B 2 10 ? 1.388   -0.691  -13.203 1.00 0.00 ? 304 PHE B HE2  4  
ATOM 5579  H HZ   . PHE B 2 10 ? -0.297  -0.227  -11.467 1.00 0.00 ? 304 PHE B HZ   4  
ATOM 5580  N N    . ASN B 2 11 ? 6.461   0.695   -11.329 1.00 0.00 ? 305 ASN B N    4  
ATOM 5581  C CA   . ASN B 2 11 ? 6.974   -0.676  -11.330 1.00 0.00 ? 305 ASN B CA   4  
ATOM 5582  C C    . ASN B 2 11 ? 7.623   -1.046  -9.990  1.00 0.00 ? 305 ASN B C    4  
ATOM 5583  O O    . ASN B 2 11 ? 7.602   -2.211  -9.593  1.00 0.00 ? 305 ASN B O    4  
ATOM 5584  C CB   . ASN B 2 11 ? 7.984   -0.864  -12.466 1.00 0.00 ? 305 ASN B CB   4  
ATOM 5585  C CG   . ASN B 2 11 ? 8.452   -2.302  -12.599 1.00 0.00 ? 305 ASN B CG   4  
ATOM 5586  O OD1  . ASN B 2 11 ? 7.661   -3.197  -12.898 1.00 0.00 ? 305 ASN B OD1  4  
ATOM 5587  N ND2  . ASN B 2 11 ? 9.741   -2.533  -12.373 1.00 0.00 ? 305 ASN B ND2  4  
ATOM 5588  H H    . ASN B 2 11 ? 6.782   1.321   -12.012 1.00 0.00 ? 305 ASN B H    4  
ATOM 5589  H HA   . ASN B 2 11 ? 6.135   -1.335  -11.498 1.00 0.00 ? 305 ASN B HA   4  
ATOM 5590  H HB2  . ASN B 2 11 ? 7.524   -0.571  -13.398 1.00 0.00 ? 305 ASN B HB2  4  
ATOM 5591  H HB3  . ASN B 2 11 ? 8.844   -0.239  -12.282 1.00 0.00 ? 305 ASN B HB3  4  
ATOM 5592  H HD21 . ASN B 2 11 ? 10.314  -1.772  -12.136 1.00 0.00 ? 305 ASN B HD21 4  
ATOM 5593  H HD22 . ASN B 2 11 ? 10.067  -3.453  -12.452 1.00 0.00 ? 305 ASN B HD22 4  
ATOM 5594  N N    . HIS B 2 12 ? 8.202   -0.056  -9.303  1.00 0.00 ? 306 HIS B N    4  
ATOM 5595  C CA   . HIS B 2 12 ? 8.855   -0.292  -8.012  1.00 0.00 ? 306 HIS B CA   4  
ATOM 5596  C C    . HIS B 2 12 ? 7.893   -0.951  -7.023  1.00 0.00 ? 306 HIS B C    4  
ATOM 5597  O O    . HIS B 2 12 ? 8.117   -2.087  -6.599  1.00 0.00 ? 306 HIS B O    4  
ATOM 5598  C CB   . HIS B 2 12 ? 9.401   1.026   -7.447  1.00 0.00 ? 306 HIS B CB   4  
ATOM 5599  C CG   . HIS B 2 12 ? 10.058  0.894   -6.106  1.00 0.00 ? 306 HIS B CG   4  
ATOM 5600  N ND1  . HIS B 2 12 ? 9.362   0.606   -4.950  1.00 0.00 ? 306 HIS B ND1  4  
ATOM 5601  C CD2  . HIS B 2 12 ? 11.355  1.015   -5.740  1.00 0.00 ? 306 HIS B CD2  4  
ATOM 5602  C CE1  . HIS B 2 12 ? 10.202  0.557   -3.934  1.00 0.00 ? 306 HIS B CE1  4  
ATOM 5603  N NE2  . HIS B 2 12 ? 11.418  0.799   -4.387  1.00 0.00 ? 306 HIS B NE2  4  
ATOM 5604  H H    . HIS B 2 12 ? 8.193   0.851   -9.671  1.00 0.00 ? 306 HIS B H    4  
ATOM 5605  H HA   . HIS B 2 12 ? 9.680   -0.967  -8.186  1.00 0.00 ? 306 HIS B HA   4  
ATOM 5606  H HB2  . HIS B 2 12 ? 10.133  1.426   -8.132  1.00 0.00 ? 306 HIS B HB2  4  
ATOM 5607  H HB3  . HIS B 2 12 ? 8.588   1.729   -7.350  1.00 0.00 ? 306 HIS B HB3  4  
ATOM 5608  H HD1  . HIS B 2 12 ? 8.396   0.463   -4.883  1.00 0.00 ? 306 HIS B HD1  4  
ATOM 5609  H HD2  . HIS B 2 12 ? 12.188  1.237   -6.394  1.00 0.00 ? 306 HIS B HD2  4  
ATOM 5610  H HE1  . HIS B 2 12 ? 9.939   0.348   -2.908  1.00 0.00 ? 306 HIS B HE1  4  
ATOM 5611  H HE2  . HIS B 2 12 ? 12.216  0.905   -3.830  1.00 0.00 ? 306 HIS B HE2  4  
ATOM 5612  N N    . ALA B 2 13 ? 6.813   -0.248  -6.673  1.00 0.00 ? 307 ALA B N    4  
ATOM 5613  C CA   . ALA B 2 13 ? 5.811   -0.790  -5.755  1.00 0.00 ? 307 ALA B CA   4  
ATOM 5614  C C    . ALA B 2 13 ? 5.163   -2.024  -6.363  1.00 0.00 ? 307 ALA B C    4  
ATOM 5615  O O    . ALA B 2 13 ? 4.898   -3.008  -5.678  1.00 0.00 ? 307 ALA B O    4  
ATOM 5616  C CB   . ALA B 2 13 ? 4.748   0.252   -5.447  1.00 0.00 ? 307 ALA B CB   4  
ATOM 5617  H H    . ALA B 2 13 ? 6.679   0.645   -7.056  1.00 0.00 ? 307 ALA B H    4  
ATOM 5618  H HA   . ALA B 2 13 ? 6.305   -1.062  -4.833  1.00 0.00 ? 307 ALA B HA   4  
ATOM 5619  H HB1  . ALA B 2 13 ? 4.751   1.006   -6.216  1.00 0.00 ? 307 ALA B HB1  4  
ATOM 5620  H HB2  . ALA B 2 13 ? 4.953   0.709   -4.491  1.00 0.00 ? 307 ALA B HB2  4  
ATOM 5621  H HB3  . ALA B 2 13 ? 3.779   -0.224  -5.418  1.00 0.00 ? 307 ALA B HB3  4  
ATOM 5622  N N    . ILE B 2 14 ? 4.927   -1.949  -7.665  1.00 0.00 ? 308 ILE B N    4  
ATOM 5623  C CA   . ILE B 2 14 ? 4.325   -3.030  -8.432  1.00 0.00 ? 308 ILE B CA   4  
ATOM 5624  C C    . ILE B 2 14 ? 5.023   -4.359  -8.188  1.00 0.00 ? 308 ILE B C    4  
ATOM 5625  O O    . ILE B 2 14 ? 4.414   -5.304  -7.684  1.00 0.00 ? 308 ILE B O    4  
ATOM 5626  C CB   . ILE B 2 14 ? 4.369   -2.671  -9.930  1.00 0.00 ? 308 ILE B CB   4  
ATOM 5627  C CG1  . ILE B 2 14 ? 3.141   -1.836  -10.302 1.00 0.00 ? 308 ILE B CG1  4  
ATOM 5628  C CG2  . ILE B 2 14 ? 4.482   -3.916  -10.791 1.00 0.00 ? 308 ILE B CG2  4  
ATOM 5629  C CD1  . ILE B 2 14 ? 2.564   -1.055  -9.134  1.00 0.00 ? 308 ILE B CD1  4  
ATOM 5630  H H    . ILE B 2 14 ? 5.177   -1.128  -8.139  1.00 0.00 ? 308 ILE B H    4  
ATOM 5631  H HA   . ILE B 2 14 ? 3.290   -3.122  -8.133  1.00 0.00 ? 308 ILE B HA   4  
ATOM 5632  H HB   . ILE B 2 14 ? 5.253   -2.077  -10.098 1.00 0.00 ? 308 ILE B HB   4  
ATOM 5633  H HG12 . ILE B 2 14 ? 3.421   -1.125  -11.066 1.00 0.00 ? 308 ILE B HG12 4  
ATOM 5634  H HG13 . ILE B 2 14 ? 2.373   -2.486  -10.687 1.00 0.00 ? 308 ILE B HG13 4  
ATOM 5635  H HG21 . ILE B 2 14 ? 3.719   -4.622  -10.499 1.00 0.00 ? 308 ILE B HG21 4  
ATOM 5636  H HG22 . ILE B 2 14 ? 5.466   -4.359  -10.646 1.00 0.00 ? 308 ILE B HG22 4  
ATOM 5637  H HG23 . ILE B 2 14 ? 4.353   -3.649  -11.828 1.00 0.00 ? 308 ILE B HG23 4  
ATOM 5638  H HD11 . ILE B 2 14 ? 1.622   -0.618  -9.423  1.00 0.00 ? 308 ILE B HD11 4  
ATOM 5639  H HD12 . ILE B 2 14 ? 3.248   -0.277  -8.842  1.00 0.00 ? 308 ILE B HD12 4  
ATOM 5640  H HD13 . ILE B 2 14 ? 2.402   -1.727  -8.292  1.00 0.00 ? 308 ILE B HD13 4  
ATOM 5641  N N    . ASN B 2 15 ? 6.303   -4.420  -8.538  1.00 0.00 ? 309 ASN B N    4  
ATOM 5642  C CA   . ASN B 2 15 ? 7.082   -5.629  -8.342  1.00 0.00 ? 309 ASN B CA   4  
ATOM 5643  C C    . ASN B 2 15 ? 7.120   -6.005  -6.860  1.00 0.00 ? 309 ASN B C    4  
ATOM 5644  O O    . ASN B 2 15 ? 7.178   -7.186  -6.516  1.00 0.00 ? 309 ASN B O    4  
ATOM 5645  C CB   . ASN B 2 15 ? 8.477   -5.437  -8.924  1.00 0.00 ? 309 ASN B CB   4  
ATOM 5646  C CG   . ASN B 2 15 ? 8.558   -5.865  -10.378 1.00 0.00 ? 309 ASN B CG   4  
ATOM 5647  O OD1  . ASN B 2 15 ? 7.850   -5.332  -11.231 1.00 0.00 ? 309 ASN B OD1  4  
ATOM 5648  N ND2  . ASN B 2 15 ? 9.420   -6.834  -10.668 1.00 0.00 ? 309 ASN B ND2  4  
ATOM 5649  H H    . ASN B 2 15 ? 6.735   -3.626  -8.925  1.00 0.00 ? 309 ASN B H    4  
ATOM 5650  H HA   . ASN B 2 15 ? 6.587   -6.424  -8.882  1.00 0.00 ? 309 ASN B HA   4  
ATOM 5651  H HB2  . ASN B 2 15 ? 8.721   -4.389  -8.875  1.00 0.00 ? 309 ASN B HB2  4  
ATOM 5652  H HB3  . ASN B 2 15 ? 9.191   -6.006  -8.351  1.00 0.00 ? 309 ASN B HB3  4  
ATOM 5653  H HD21 . ASN B 2 15 ? 9.951   -7.217  -9.939  1.00 0.00 ? 309 ASN B HD21 4  
ATOM 5654  H HD22 . ASN B 2 15 ? 9.489   -7.127  -11.600 1.00 0.00 ? 309 ASN B HD22 4  
ATOM 5655  N N    . TYR B 2 16 ? 7.027   -4.998  -5.985  1.00 0.00 ? 310 TYR B N    4  
ATOM 5656  C CA   . TYR B 2 16 ? 6.984   -5.239  -4.547  1.00 0.00 ? 310 TYR B CA   4  
ATOM 5657  C C    . TYR B 2 16 ? 5.692   -5.984  -4.193  1.00 0.00 ? 310 TYR B C    4  
ATOM 5658  O O    . TYR B 2 16 ? 5.716   -6.946  -3.425  1.00 0.00 ? 310 TYR B O    4  
ATOM 5659  C CB   . TYR B 2 16 ? 7.081   -3.922  -3.767  1.00 0.00 ? 310 TYR B CB   4  
ATOM 5660  C CG   . TYR B 2 16 ? 6.637   -4.029  -2.323  1.00 0.00 ? 310 TYR B CG   4  
ATOM 5661  C CD1  . TYR B 2 16 ? 6.913   -5.158  -1.557  1.00 0.00 ? 310 TYR B CD1  4  
ATOM 5662  C CD2  . TYR B 2 16 ? 5.927   -2.999  -1.731  1.00 0.00 ? 310 TYR B CD2  4  
ATOM 5663  C CE1  . TYR B 2 16 ? 6.489   -5.248  -0.246  1.00 0.00 ? 310 TYR B CE1  4  
ATOM 5664  C CE2  . TYR B 2 16 ? 5.494   -3.084  -0.426  1.00 0.00 ? 310 TYR B CE2  4  
ATOM 5665  C CZ   . TYR B 2 16 ? 5.777   -4.208  0.312   1.00 0.00 ? 310 TYR B CZ   4  
ATOM 5666  O OH   . TYR B 2 16 ? 5.331   -4.300  1.607   1.00 0.00 ? 310 TYR B OH   4  
ATOM 5667  H H    . TYR B 2 16 ? 6.943   -4.079  -6.316  1.00 0.00 ? 310 TYR B H    4  
ATOM 5668  H HA   . TYR B 2 16 ? 7.826   -5.867  -4.291  1.00 0.00 ? 310 TYR B HA   4  
ATOM 5669  H HB2  . TYR B 2 16 ? 8.106   -3.586  -3.771  1.00 0.00 ? 310 TYR B HB2  4  
ATOM 5670  H HB3  . TYR B 2 16 ? 6.465   -3.179  -4.249  1.00 0.00 ? 310 TYR B HB3  4  
ATOM 5671  H HD1  . TYR B 2 16 ? 7.473   -5.969  -1.999  1.00 0.00 ? 310 TYR B HD1  4  
ATOM 5672  H HD2  . TYR B 2 16 ? 5.706   -2.117  -2.313  1.00 0.00 ? 310 TYR B HD2  4  
ATOM 5673  H HE1  . TYR B 2 16 ? 6.716   -6.129  0.335   1.00 0.00 ? 310 TYR B HE1  4  
ATOM 5674  H HE2  . TYR B 2 16 ? 4.942   -2.267  0.015   1.00 0.00 ? 310 TYR B HE2  4  
ATOM 5675  H HH   . TYR B 2 16 ? 6.054   -4.569  2.178   1.00 0.00 ? 310 TYR B HH   4  
ATOM 5676  N N    . VAL B 2 17 ? 4.563   -5.551  -4.781  1.00 0.00 ? 311 VAL B N    4  
ATOM 5677  C CA   . VAL B 2 17 ? 3.276   -6.210  -4.537  1.00 0.00 ? 311 VAL B CA   4  
ATOM 5678  C C    . VAL B 2 17 ? 3.382   -7.683  -4.920  1.00 0.00 ? 311 VAL B C    4  
ATOM 5679  O O    . VAL B 2 17 ? 2.795   -8.543  -4.269  1.00 0.00 ? 311 VAL B O    4  
ATOM 5680  C CB   . VAL B 2 17 ? 2.105   -5.590  -5.339  1.00 0.00 ? 311 VAL B CB   4  
ATOM 5681  C CG1  . VAL B 2 17 ? 0.783   -6.189  -4.902  1.00 0.00 ? 311 VAL B CG1  4  
ATOM 5682  C CG2  . VAL B 2 17 ? 2.026   -4.090  -5.190  1.00 0.00 ? 311 VAL B CG2  4  
ATOM 5683  H H    . VAL B 2 17 ? 4.604   -4.793  -5.401  1.00 0.00 ? 311 VAL B H    4  
ATOM 5684  H HA   . VAL B 2 17 ? 3.055   -6.134  -3.481  1.00 0.00 ? 311 VAL B HA   4  
ATOM 5685  H HB   . VAL B 2 17 ? 2.255   -5.818  -6.380  1.00 0.00 ? 311 VAL B HB   4  
ATOM 5686  H HG11 . VAL B 2 17 ? 0.681   -7.186  -5.312  1.00 0.00 ? 311 VAL B HG11 4  
ATOM 5687  H HG12 . VAL B 2 17 ? -0.027  -5.560  -5.253  1.00 0.00 ? 311 VAL B HG12 4  
ATOM 5688  H HG13 . VAL B 2 17 ? 0.758   -6.234  -3.823  1.00 0.00 ? 311 VAL B HG13 4  
ATOM 5689  H HG21 . VAL B 2 17 ? 1.893   -3.845  -4.148  1.00 0.00 ? 311 VAL B HG21 4  
ATOM 5690  H HG22 . VAL B 2 17 ? 1.173   -3.728  -5.755  1.00 0.00 ? 311 VAL B HG22 4  
ATOM 5691  H HG23 . VAL B 2 17 ? 2.928   -3.635  -5.562  1.00 0.00 ? 311 VAL B HG23 4  
ATOM 5692  N N    . ASN B 2 18 ? 4.157   -7.962  -5.979  1.00 0.00 ? 312 ASN B N    4  
ATOM 5693  C CA   . ASN B 2 18 ? 4.369   -9.328  -6.448  1.00 0.00 ? 312 ASN B CA   4  
ATOM 5694  C C    . ASN B 2 18 ? 4.869   -10.206 -5.300  1.00 0.00 ? 312 ASN B C    4  
ATOM 5695  O O    . ASN B 2 18 ? 4.386   -11.321 -5.113  1.00 0.00 ? 312 ASN B O    4  
ATOM 5696  C CB   . ASN B 2 18 ? 5.355   -9.334  -7.625  1.00 0.00 ? 312 ASN B CB   4  
ATOM 5697  C CG   . ASN B 2 18 ? 5.667   -10.727 -8.137  1.00 0.00 ? 312 ASN B CG   4  
ATOM 5698  O OD1  . ASN B 2 18 ? 6.327   -11.516 -7.460  1.00 0.00 ? 312 ASN B OD1  4  
ATOM 5699  N ND2  . ASN B 2 18 ? 5.191   -11.041 -9.338  1.00 0.00 ? 312 ASN B ND2  4  
ATOM 5700  H H    . ASN B 2 18 ? 4.607   -7.226  -6.446  1.00 0.00 ? 312 ASN B H    4  
ATOM 5701  H HA   . ASN B 2 18 ? 3.418   -9.709  -6.785  1.00 0.00 ? 312 ASN B HA   4  
ATOM 5702  H HB2  . ASN B 2 18 ? 4.933   -8.763  -8.437  1.00 0.00 ? 312 ASN B HB2  4  
ATOM 5703  H HB3  . ASN B 2 18 ? 6.275   -8.872  -7.313  1.00 0.00 ? 312 ASN B HB3  4  
ATOM 5704  H HD21 . ASN B 2 18 ? 4.670   -10.364 -9.822  1.00 0.00 ? 312 ASN B HD21 4  
ATOM 5705  H HD22 . ASN B 2 18 ? 5.378   -11.935 -9.690  1.00 0.00 ? 312 ASN B HD22 4  
ATOM 5706  N N    . LYS B 2 19 ? 5.807   -9.674  -4.505  1.00 0.00 ? 313 LYS B N    4  
ATOM 5707  C CA   . LYS B 2 19 ? 6.333   -10.393 -3.341  1.00 0.00 ? 313 LYS B CA   4  
ATOM 5708  C C    . LYS B 2 19 ? 5.192   -10.793 -2.423  1.00 0.00 ? 313 LYS B C    4  
ATOM 5709  O O    . LYS B 2 19 ? 5.064   -11.947 -2.029  1.00 0.00 ? 313 LYS B O    4  
ATOM 5710  C CB   . LYS B 2 19 ? 7.300   -9.505  -2.541  1.00 0.00 ? 313 LYS B CB   4  
ATOM 5711  C CG   . LYS B 2 19 ? 8.724   -9.503  -3.060  1.00 0.00 ? 313 LYS B CG   4  
ATOM 5712  C CD   . LYS B 2 19 ? 9.573   -8.444  -2.372  1.00 0.00 ? 313 LYS B CD   4  
ATOM 5713  C CE   . LYS B 2 19 ? 9.753   -8.744  -0.891  1.00 0.00 ? 313 LYS B CE   4  
ATOM 5714  N NZ   . LYS B 2 19 ? 10.564  -7.701  -0.203  1.00 0.00 ? 313 LYS B NZ   4  
ATOM 5715  H H    . LYS B 2 19 ? 6.130   -8.767  -4.687  1.00 0.00 ? 313 LYS B H    4  
ATOM 5716  H HA   . LYS B 2 19 ? 6.844   -11.282 -3.683  1.00 0.00 ? 313 LYS B HA   4  
ATOM 5717  H HB2  . LYS B 2 19 ? 6.931   -8.487  -2.558  1.00 0.00 ? 313 LYS B HB2  4  
ATOM 5718  H HB3  . LYS B 2 19 ? 7.313   -9.849  -1.519  1.00 0.00 ? 313 LYS B HB3  4  
ATOM 5719  H HG2  . LYS B 2 19 ? 9.158   -10.472 -2.864  1.00 0.00 ? 313 LYS B HG2  4  
ATOM 5720  H HG3  . LYS B 2 19 ? 8.713   -9.314  -4.123  1.00 0.00 ? 313 LYS B HG3  4  
ATOM 5721  H HD2  . LYS B 2 19 ? 10.543  -8.411  -2.843  1.00 0.00 ? 313 LYS B HD2  4  
ATOM 5722  H HD3  . LYS B 2 19 ? 9.087   -7.485  -2.479  1.00 0.00 ? 313 LYS B HD3  4  
ATOM 5723  H HE2  . LYS B 2 19 ? 8.781   -8.793  -0.426  1.00 0.00 ? 313 LYS B HE2  4  
ATOM 5724  H HE3  . LYS B 2 19 ? 10.248  -9.698  -0.789  1.00 0.00 ? 313 LYS B HE3  4  
ATOM 5725  H HZ1  . LYS B 2 19 ? 9.994   -6.843  -0.056  1.00 0.00 ? 313 LYS B HZ1  4  
ATOM 5726  H HZ2  . LYS B 2 19 ? 11.397  -7.458  -0.776  1.00 0.00 ? 313 LYS B HZ2  4  
ATOM 5727  H HZ3  . LYS B 2 19 ? 10.885  -8.052  0.723   1.00 0.00 ? 313 LYS B HZ3  4  
ATOM 5728  N N    . ILE B 2 20 ? 4.377   -9.804  -2.091  1.00 0.00 ? 314 ILE B N    4  
ATOM 5729  C CA   . ILE B 2 20 ? 3.233   -9.983  -1.216  1.00 0.00 ? 314 ILE B CA   4  
ATOM 5730  C C    . ILE B 2 20 ? 2.212   -10.938 -1.829  1.00 0.00 ? 314 ILE B C    4  
ATOM 5731  O O    . ILE B 2 20 ? 1.877   -11.962 -1.238  1.00 0.00 ? 314 ILE B O    4  
ATOM 5732  C CB   . ILE B 2 20 ? 2.605   -8.602  -0.934  1.00 0.00 ? 314 ILE B CB   4  
ATOM 5733  C CG1  . ILE B 2 20 ? 3.613   -7.764  -0.153  1.00 0.00 ? 314 ILE B CG1  4  
ATOM 5734  C CG2  . ILE B 2 20 ? 1.287   -8.708  -0.182  1.00 0.00 ? 314 ILE B CG2  4  
ATOM 5735  C CD1  . ILE B 2 20 ? 3.186   -6.344  0.086   1.00 0.00 ? 314 ILE B CD1  4  
ATOM 5736  H H    . ILE B 2 20 ? 4.558   -8.907  -2.447  1.00 0.00 ? 314 ILE B H    4  
ATOM 5737  H HA   . ILE B 2 20 ? 3.585   -10.394 -0.282  1.00 0.00 ? 314 ILE B HA   4  
ATOM 5738  H HB   . ILE B 2 20 ? 2.410   -8.119  -1.879  1.00 0.00 ? 314 ILE B HB   4  
ATOM 5739  H HG12 . ILE B 2 20 ? 3.778   -8.221  0.811   1.00 0.00 ? 314 ILE B HG12 4  
ATOM 5740  H HG13 . ILE B 2 20 ? 4.546   -7.741  -0.697  1.00 0.00 ? 314 ILE B HG13 4  
ATOM 5741  H HG21 . ILE B 2 20 ? 0.800   -9.634  -0.438  1.00 0.00 ? 314 ILE B HG21 4  
ATOM 5742  H HG22 . ILE B 2 20 ? 0.650   -7.881  -0.456  1.00 0.00 ? 314 ILE B HG22 4  
ATOM 5743  H HG23 . ILE B 2 20 ? 1.478   -8.678  0.878   1.00 0.00 ? 314 ILE B HG23 4  
ATOM 5744  H HD11 . ILE B 2 20 ? 3.314   -6.112  1.132   1.00 0.00 ? 314 ILE B HD11 4  
ATOM 5745  H HD12 . ILE B 2 20 ? 2.151   -6.227  -0.190  1.00 0.00 ? 314 ILE B HD12 4  
ATOM 5746  H HD13 . ILE B 2 20 ? 3.800   -5.686  -0.511  1.00 0.00 ? 314 ILE B HD13 4  
ATOM 5747  N N    . LYS B 2 21 ? 1.745   -10.615 -3.024  1.00 0.00 ? 315 LYS B N    4  
ATOM 5748  C CA   . LYS B 2 21 ? 0.781   -11.450 -3.726  1.00 0.00 ? 315 LYS B CA   4  
ATOM 5749  C C    . LYS B 2 21 ? 1.236   -12.914 -3.760  1.00 0.00 ? 315 LYS B C    4  
ATOM 5750  O O    . LYS B 2 21 ? 0.473   -13.817 -3.412  1.00 0.00 ? 315 LYS B O    4  
ATOM 5751  C CB   . LYS B 2 21 ? 0.588   -10.915 -5.142  1.00 0.00 ? 315 LYS B CB   4  
ATOM 5752  C CG   . LYS B 2 21 ? -0.496  -11.624 -5.930  1.00 0.00 ? 315 LYS B CG   4  
ATOM 5753  C CD   . LYS B 2 21 ? -0.697  -10.981 -7.291  1.00 0.00 ? 315 LYS B CD   4  
ATOM 5754  C CE   . LYS B 2 21 ? 0.409   -11.355 -8.269  1.00 0.00 ? 315 LYS B CE   4  
ATOM 5755  N NZ   . LYS B 2 21 ? 1.721   -10.742 -7.918  1.00 0.00 ? 315 LYS B NZ   4  
ATOM 5756  H H    . LYS B 2 21 ? 2.065   -9.795  -3.456  1.00 0.00 ? 315 LYS B H    4  
ATOM 5757  H HA   . LYS B 2 21 ? -0.158  -11.390 -3.196  1.00 0.00 ? 315 LYS B HA   4  
ATOM 5758  H HB2  . LYS B 2 21 ? 0.330   -9.867  -5.083  1.00 0.00 ? 315 LYS B HB2  4  
ATOM 5759  H HB3  . LYS B 2 21 ? 1.518   -11.013 -5.677  1.00 0.00 ? 315 LYS B HB3  4  
ATOM 5760  H HG2  . LYS B 2 21 ? -0.211  -12.656 -6.069  1.00 0.00 ? 315 LYS B HG2  4  
ATOM 5761  H HG3  . LYS B 2 21 ? -1.422  -11.575 -5.376  1.00 0.00 ? 315 LYS B HG3  4  
ATOM 5762  H HD2  . LYS B 2 21 ? -1.644  -11.302 -7.695  1.00 0.00 ? 315 LYS B HD2  4  
ATOM 5763  H HD3  . LYS B 2 21 ? -0.703  -9.904  -7.167  1.00 0.00 ? 315 LYS B HD3  4  
ATOM 5764  H HE2  . LYS B 2 21 ? 0.515   -12.428 -8.273  1.00 0.00 ? 315 LYS B HE2  4  
ATOM 5765  H HE3  . LYS B 2 21 ? 0.122   -11.022 -9.254  1.00 0.00 ? 315 LYS B HE3  4  
ATOM 5766  H HZ1  . LYS B 2 21 ? 2.284   -11.405 -7.344  1.00 0.00 ? 315 LYS B HZ1  4  
ATOM 5767  H HZ2  . LYS B 2 21 ? 1.576   -9.867  -7.375  1.00 0.00 ? 315 LYS B HZ2  4  
ATOM 5768  H HZ3  . LYS B 2 21 ? 2.251   -10.516 -8.782  1.00 0.00 ? 315 LYS B HZ3  4  
ATOM 5769  N N    . ASN B 2 22 ? 2.486   -13.135 -4.175  1.00 0.00 ? 316 ASN B N    4  
ATOM 5770  C CA   . ASN B 2 22 ? 3.058   -14.482 -4.251  1.00 0.00 ? 316 ASN B CA   4  
ATOM 5771  C C    . ASN B 2 22 ? 3.286   -15.093 -2.866  1.00 0.00 ? 316 ASN B C    4  
ATOM 5772  O O    . ASN B 2 22 ? 2.869   -16.221 -2.602  1.00 0.00 ? 316 ASN B O    4  
ATOM 5773  C CB   . ASN B 2 22 ? 4.368   -14.455 -5.042  1.00 0.00 ? 316 ASN B CB   4  
ATOM 5774  C CG   . ASN B 2 22 ? 4.130   -14.540 -6.538  1.00 0.00 ? 316 ASN B CG   4  
ATOM 5775  O OD1  . ASN B 2 22 ? 3.653   -15.557 -7.043  1.00 0.00 ? 316 ASN B OD1  4  
ATOM 5776  N ND2  . ASN B 2 22 ? 4.446   -13.470 -7.254  1.00 0.00 ? 316 ASN B ND2  4  
ATOM 5777  H H    . ASN B 2 22 ? 3.044   -12.369 -4.432  1.00 0.00 ? 316 ASN B H    4  
ATOM 5778  H HA   . ASN B 2 22 ? 2.350   -15.101 -4.782  1.00 0.00 ? 316 ASN B HA   4  
ATOM 5779  H HB2  . ASN B 2 22 ? 4.887   -13.532 -4.832  1.00 0.00 ? 316 ASN B HB2  4  
ATOM 5780  H HB3  . ASN B 2 22 ? 4.986   -15.285 -4.741  1.00 0.00 ? 316 ASN B HB3  4  
ATOM 5781  H HD21 . ASN B 2 22 ? 4.810   -12.691 -6.786  1.00 0.00 ? 316 ASN B HD21 4  
ATOM 5782  H HD22 . ASN B 2 22 ? 4.301   -13.502 -8.222  1.00 0.00 ? 316 ASN B HD22 4  
ATOM 5783  N N    . ARG B 2 23 ? 3.962   -14.352 -1.988  1.00 0.00 ? 317 ARG B N    4  
ATOM 5784  C CA   . ARG B 2 23 ? 4.252   -14.833 -0.637  1.00 0.00 ? 317 ARG B CA   4  
ATOM 5785  C C    . ARG B 2 23 ? 2.974   -15.219 0.112   1.00 0.00 ? 317 ARG B C    4  
ATOM 5786  O O    . ARG B 2 23 ? 2.966   -16.192 0.871   1.00 0.00 ? 317 ARG B O    4  
ATOM 5787  C CB   . ARG B 2 23 ? 5.025   -13.773 0.157   1.00 0.00 ? 317 ARG B CB   4  
ATOM 5788  C CG   . ARG B 2 23 ? 5.527   -14.261 1.508   1.00 0.00 ? 317 ARG B CG   4  
ATOM 5789  C CD   . ARG B 2 23 ? 6.459   -15.457 1.358   1.00 0.00 ? 317 ARG B CD   4  
ATOM 5790  N NE   . ARG B 2 23 ? 6.956   -15.940 2.648   1.00 0.00 ? 317 ARG B NE   4  
ATOM 5791  C CZ   . ARG B 2 23 ? 7.811   -15.269 3.426   1.00 0.00 ? 317 ARG B CZ   4  
ATOM 5792  N NH1  . ARG B 2 23 ? 8.311   -14.099 3.034   1.00 0.00 ? 317 ARG B NH1  4  
ATOM 5793  N NH2  . ARG B 2 23 ? 8.177   -15.780 4.598   1.00 0.00 ? 317 ARG B NH2  4  
ATOM 5794  H H    . ARG B 2 23 ? 4.279   -13.465 -2.258  1.00 0.00 ? 317 ARG B H    4  
ATOM 5795  H HA   . ARG B 2 23 ? 4.872   -15.711 -0.732  1.00 0.00 ? 317 ARG B HA   4  
ATOM 5796  H HB2  . ARG B 2 23 ? 5.877   -13.455 -0.425  1.00 0.00 ? 317 ARG B HB2  4  
ATOM 5797  H HB3  . ARG B 2 23 ? 4.379   -12.924 0.324   1.00 0.00 ? 317 ARG B HB3  4  
ATOM 5798  H HG2  . ARG B 2 23 ? 6.063   -13.459 1.992   1.00 0.00 ? 317 ARG B HG2  4  
ATOM 5799  H HG3  . ARG B 2 23 ? 4.681   -14.549 2.114   1.00 0.00 ? 317 ARG B HG3  4  
ATOM 5800  H HD2  . ARG B 2 23 ? 5.921   -16.256 0.871   1.00 0.00 ? 317 ARG B HD2  4  
ATOM 5801  H HD3  . ARG B 2 23 ? 7.300   -15.166 0.745   1.00 0.00 ? 317 ARG B HD3  4  
ATOM 5802  H HE   . ARG B 2 23 ? 6.625   -16.809 2.957   1.00 0.00 ? 317 ARG B HE   4  
ATOM 5803  H HH11 . ARG B 2 23 ? 8.051   -13.710 2.153   1.00 0.00 ? 317 ARG B HH11 4  
ATOM 5804  H HH12 . ARG B 2 23 ? 8.952   -13.607 3.626   1.00 0.00 ? 317 ARG B HH12 4  
ATOM 5805  H HH21 . ARG B 2 23 ? 7.814   -16.662 4.893   1.00 0.00 ? 317 ARG B HH21 4  
ATOM 5806  H HH22 . ARG B 2 23 ? 8.817   -15.281 5.183   1.00 0.00 ? 317 ARG B HH22 4  
ATOM 5807  N N    . PHE B 2 24 ? 1.901   -14.452 -0.093  1.00 0.00 ? 318 PHE B N    4  
ATOM 5808  C CA   . PHE B 2 24 ? 0.628   -14.718 0.576   1.00 0.00 ? 318 PHE B CA   4  
ATOM 5809  C C    . PHE B 2 24 ? -0.356  -15.461 -0.333  1.00 0.00 ? 318 PHE B C    4  
ATOM 5810  O O    . PHE B 2 24 ? -1.571  -15.351 -0.148  1.00 0.00 ? 318 PHE B O    4  
ATOM 5811  C CB   . PHE B 2 24 ? -0.001  -13.409 1.065   1.00 0.00 ? 318 PHE B CB   4  
ATOM 5812  C CG   . PHE B 2 24 ? 0.947   -12.550 1.853   1.00 0.00 ? 318 PHE B CG   4  
ATOM 5813  C CD1  . PHE B 2 24 ? 1.415   -12.947 3.095   1.00 0.00 ? 318 PHE B CD1  4  
ATOM 5814  C CD2  . PHE B 2 24 ? 1.386   -11.353 1.331   1.00 0.00 ? 318 PHE B CD2  4  
ATOM 5815  C CE1  . PHE B 2 24 ? 2.309   -12.152 3.792   1.00 0.00 ? 318 PHE B CE1  4  
ATOM 5816  C CE2  . PHE B 2 24 ? 2.272   -10.560 2.021   1.00 0.00 ? 318 PHE B CE2  4  
ATOM 5817  C CZ   . PHE B 2 24 ? 2.737   -10.954 3.246   1.00 0.00 ? 318 PHE B CZ   4  
ATOM 5818  H H    . PHE B 2 24 ? 1.968   -13.686 -0.704  1.00 0.00 ? 318 PHE B H    4  
ATOM 5819  H HA   . PHE B 2 24 ? 0.835   -15.340 1.433   1.00 0.00 ? 318 PHE B HA   4  
ATOM 5820  H HB2  . PHE B 2 24 ? -0.335  -12.837 0.213   1.00 0.00 ? 318 PHE B HB2  4  
ATOM 5821  H HB3  . PHE B 2 24 ? -0.847  -13.636 1.695   1.00 0.00 ? 318 PHE B HB3  4  
ATOM 5822  H HD1  . PHE B 2 24 ? 1.077   -13.883 3.518   1.00 0.00 ? 318 PHE B HD1  4  
ATOM 5823  H HD2  . PHE B 2 24 ? 1.021   -11.037 0.371   1.00 0.00 ? 318 PHE B HD2  4  
ATOM 5824  H HE1  . PHE B 2 24 ? 2.669   -12.465 4.760   1.00 0.00 ? 318 PHE B HE1  4  
ATOM 5825  H HE2  . PHE B 2 24 ? 2.607   -9.628  1.594   1.00 0.00 ? 318 PHE B HE2  4  
ATOM 5826  H HZ   . PHE B 2 24 ? 3.435   -10.325 3.777   1.00 0.00 ? 318 PHE B HZ   4  
ATOM 5827  N N    . GLN B 2 25 ? 0.158   -16.235 -1.299  1.00 0.00 ? 319 GLN B N    4  
ATOM 5828  C CA   . GLN B 2 25 ? -0.706  -17.009 -2.197  1.00 0.00 ? 319 GLN B CA   4  
ATOM 5829  C C    . GLN B 2 25 ? -1.727  -17.818 -1.394  1.00 0.00 ? 319 GLN B C    4  
ATOM 5830  O O    . GLN B 2 25 ? -2.889  -17.933 -1.786  1.00 0.00 ? 319 GLN B O    4  
ATOM 5831  C CB   . GLN B 2 25 ? 0.117   -17.940 -3.092  1.00 0.00 ? 319 GLN B CB   4  
ATOM 5832  C CG   . GLN B 2 25 ? 0.744   -17.246 -4.295  1.00 0.00 ? 319 GLN B CG   4  
ATOM 5833  C CD   . GLN B 2 25 ? -0.283  -16.788 -5.317  1.00 0.00 ? 319 GLN B CD   4  
ATOM 5834  O OE1  . GLN B 2 25 ? -1.140  -15.955 -5.023  1.00 0.00 ? 319 GLN B OE1  4  
ATOM 5835  N NE2  . GLN B 2 25 ? -0.202  -17.333 -6.526  1.00 0.00 ? 319 GLN B NE2  4  
ATOM 5836  H H    . GLN B 2 25 ? 1.130   -16.303 -1.395  1.00 0.00 ? 319 GLN B H    4  
ATOM 5837  H HA   . GLN B 2 25 ? -1.241  -16.307 -2.818  1.00 0.00 ? 319 GLN B HA   4  
ATOM 5838  H HB2  . GLN B 2 25 ? 0.912   -18.376 -2.504  1.00 0.00 ? 319 GLN B HB2  4  
ATOM 5839  H HB3  . GLN B 2 25 ? -0.522  -18.732 -3.455  1.00 0.00 ? 319 GLN B HB3  4  
ATOM 5840  H HG2  . GLN B 2 25 ? 1.287   -16.382 -3.949  1.00 0.00 ? 319 GLN B HG2  4  
ATOM 5841  H HG3  . GLN B 2 25 ? 1.427   -17.932 -4.774  1.00 0.00 ? 319 GLN B HG3  4  
ATOM 5842  H HE21 . GLN B 2 25 ? 0.504   -17.992 -6.692  1.00 0.00 ? 319 GLN B HE21 4  
ATOM 5843  H HE22 . GLN B 2 25 ? -0.853  -17.055 -7.203  1.00 0.00 ? 319 GLN B HE22 4  
ATOM 5844  N N    . GLY B 2 26 ? -1.282  -18.357 -0.254  1.00 0.00 ? 320 GLY B N    4  
ATOM 5845  C CA   . GLY B 2 26 ? -2.161  -19.127 0.607   1.00 0.00 ? 320 GLY B CA   4  
ATOM 5846  C C    . GLY B 2 26 ? -2.981  -18.241 1.529   1.00 0.00 ? 320 GLY B C    4  
ATOM 5847  O O    . GLY B 2 26 ? -4.017  -18.668 2.042   1.00 0.00 ? 320 GLY B O    4  
ATOM 5848  H H    . GLY B 2 26 ? -0.348  -18.216 0.015   1.00 0.00 ? 320 GLY B H    4  
ATOM 5849  H HA2  . GLY B 2 26 ? -2.831  -19.710 -0.008  1.00 0.00 ? 320 GLY B HA2  4  
ATOM 5850  H HA3  . GLY B 2 26 ? -1.564  -19.797 1.208   1.00 0.00 ? 320 GLY B HA3  4  
ATOM 5851  N N    . GLN B 2 27 ? -2.516  -17.003 1.737   1.00 0.00 ? 321 GLN B N    4  
ATOM 5852  C CA   . GLN B 2 27 ? -3.207  -16.044 2.595   1.00 0.00 ? 321 GLN B CA   4  
ATOM 5853  C C    . GLN B 2 27 ? -3.955  -15.003 1.761   1.00 0.00 ? 321 GLN B C    4  
ATOM 5854  O O    . GLN B 2 27 ? -3.467  -13.883 1.586   1.00 0.00 ? 321 GLN B O    4  
ATOM 5855  C CB   . GLN B 2 27 ? -2.225  -15.297 3.505   1.00 0.00 ? 321 GLN B CB   4  
ATOM 5856  C CG   . GLN B 2 27 ? -1.082  -16.120 4.059   1.00 0.00 ? 321 GLN B CG   4  
ATOM 5857  C CD   . GLN B 2 27 ? -1.513  -17.280 4.953   1.00 0.00 ? 321 GLN B CD   4  
ATOM 5858  O OE1  . GLN B 2 27 ? -0.698  -18.139 5.290   1.00 0.00 ? 321 GLN B OE1  4  
ATOM 5859  N NE2  . GLN B 2 27 ? -2.782  -17.309 5.369   1.00 0.00 ? 321 GLN B NE2  4  
ATOM 5860  H H    . GLN B 2 27 ? -1.688  -16.728 1.301   1.00 0.00 ? 321 GLN B H    4  
ATOM 5861  H HA   . GLN B 2 27 ? -3.915  -16.585 3.204   1.00 0.00 ? 321 GLN B HA   4  
ATOM 5862  H HB2  . GLN B 2 27 ? -1.798  -14.480 2.946   1.00 0.00 ? 321 GLN B HB2  4  
ATOM 5863  H HB3  . GLN B 2 27 ? -2.776  -14.890 4.338   1.00 0.00 ? 321 GLN B HB3  4  
ATOM 5864  H HG2  . GLN B 2 27 ? -0.514  -16.515 3.229   1.00 0.00 ? 321 GLN B HG2  4  
ATOM 5865  H HG3  . GLN B 2 27 ? -0.454  -15.451 4.637   1.00 0.00 ? 321 GLN B HG3  4  
ATOM 5866  H HE21 . GLN B 2 27 ? -3.384  -16.591 5.090   1.00 0.00 ? 321 GLN B HE21 4  
ATOM 5867  H HE22 . GLN B 2 27 ? -3.060  -18.054 5.941   1.00 0.00 ? 321 GLN B HE22 4  
ATOM 5868  N N    . PRO B 2 28 ? -5.155  -15.326 1.255   1.00 0.00 ? 322 PRO B N    4  
ATOM 5869  C CA   . PRO B 2 28 ? -5.941  -14.366 0.476   1.00 0.00 ? 322 PRO B CA   4  
ATOM 5870  C C    . PRO B 2 28 ? -6.352  -13.168 1.337   1.00 0.00 ? 322 PRO B C    4  
ATOM 5871  O O    . PRO B 2 28 ? -6.625  -12.083 0.821   1.00 0.00 ? 322 PRO B O    4  
ATOM 5872  C CB   . PRO B 2 28 ? -7.168  -15.169 0.036   1.00 0.00 ? 322 PRO B CB   4  
ATOM 5873  C CG   . PRO B 2 28 ? -7.263  -16.293 1.012   1.00 0.00 ? 322 PRO B CG   4  
ATOM 5874  C CD   . PRO B 2 28 ? -5.852  -16.611 1.419   1.00 0.00 ? 322 PRO B CD   4  
ATOM 5875  H HA   . PRO B 2 28 ? -5.398  -14.018 -0.391  1.00 0.00 ? 322 PRO B HA   4  
ATOM 5876  H HB2  . PRO B 2 28 ? -8.045  -14.540 0.070   1.00 0.00 ? 322 PRO B HB2  4  
ATOM 5877  H HB3  . PRO B 2 28 ? -7.020  -15.534 -0.970  1.00 0.00 ? 322 PRO B HB3  4  
ATOM 5878  H HG2  . PRO B 2 28 ? -7.840  -15.984 1.871   1.00 0.00 ? 322 PRO B HG2  4  
ATOM 5879  H HG3  . PRO B 2 28 ? -7.719  -17.151 0.540   1.00 0.00 ? 322 PRO B HG3  4  
ATOM 5880  H HD2  . PRO B 2 28 ? -5.819  -16.939 2.447   1.00 0.00 ? 322 PRO B HD2  4  
ATOM 5881  H HD3  . PRO B 2 28 ? -5.429  -17.361 0.767   1.00 0.00 ? 322 PRO B HD3  4  
ATOM 5882  N N    . ASP B 2 29 ? -6.373  -13.379 2.661   1.00 0.00 ? 323 ASP B N    4  
ATOM 5883  C CA   . ASP B 2 29 ? -6.728  -12.337 3.616   1.00 0.00 ? 323 ASP B CA   4  
ATOM 5884  C C    . ASP B 2 29 ? -5.651  -11.255 3.684   1.00 0.00 ? 323 ASP B C    4  
ATOM 5885  O O    . ASP B 2 29 ? -5.959  -10.092 3.923   1.00 0.00 ? 323 ASP B O    4  
ATOM 5886  C CB   . ASP B 2 29 ? -6.955  -12.938 5.008   1.00 0.00 ? 323 ASP B CB   4  
ATOM 5887  C CG   . ASP B 2 29 ? -8.105  -13.930 5.040   1.00 0.00 ? 323 ASP B CG   4  
ATOM 5888  O OD1  . ASP B 2 29 ? -8.009  -14.978 4.365   1.00 0.00 ? 323 ASP B OD1  4  
ATOM 5889  O OD2  . ASP B 2 29 ? -9.102  -13.659 5.741   1.00 0.00 ? 323 ASP B OD2  4  
ATOM 5890  H H    . ASP B 2 29 ? -6.126  -14.263 3.006   1.00 0.00 ? 323 ASP B H    4  
ATOM 5891  H HA   . ASP B 2 29 ? -7.649  -11.884 3.281   1.00 0.00 ? 323 ASP B HA   4  
ATOM 5892  H HB2  . ASP B 2 29 ? -6.057  -13.450 5.321   1.00 0.00 ? 323 ASP B HB2  4  
ATOM 5893  H HB3  . ASP B 2 29 ? -7.170  -12.142 5.705   1.00 0.00 ? 323 ASP B HB3  4  
ATOM 5894  N N    . ILE B 2 30 ? -4.389  -11.646 3.483   1.00 0.00 ? 324 ILE B N    4  
ATOM 5895  C CA   . ILE B 2 30 ? -3.272  -10.700 3.534   1.00 0.00 ? 324 ILE B CA   4  
ATOM 5896  C C    . ILE B 2 30 ? -3.332  -9.717  2.392   1.00 0.00 ? 324 ILE B C    4  
ATOM 5897  O O    . ILE B 2 30 ? -3.205  -8.509  2.581   1.00 0.00 ? 324 ILE B O    4  
ATOM 5898  C CB   . ILE B 2 30 ? -1.903  -11.400 3.447   1.00 0.00 ? 324 ILE B CB   4  
ATOM 5899  C CG1  . ILE B 2 30 ? -1.798  -12.480 4.513   1.00 0.00 ? 324 ILE B CG1  4  
ATOM 5900  C CG2  . ILE B 2 30 ? -0.792  -10.360 3.567   1.00 0.00 ? 324 ILE B CG2  4  
ATOM 5901  C CD1  . ILE B 2 30 ? -2.201  -12.010 5.875   1.00 0.00 ? 324 ILE B CD1  4  
ATOM 5902  H H    . ILE B 2 30 ? -4.204  -12.593 3.303   1.00 0.00 ? 324 ILE B H    4  
ATOM 5903  H HA   . ILE B 2 30 ? -3.323  -10.163 4.469   1.00 0.00 ? 324 ILE B HA   4  
ATOM 5904  H HB   . ILE B 2 30 ? -1.820  -11.869 2.475   1.00 0.00 ? 324 ILE B HB   4  
ATOM 5905  H HG12 . ILE B 2 30 ? -2.456  -13.292 4.246   1.00 0.00 ? 324 ILE B HG12 4  
ATOM 5906  H HG13 . ILE B 2 30 ? -0.782  -12.840 4.565   1.00 0.00 ? 324 ILE B HG13 4  
ATOM 5907  H HG21 . ILE B 2 30 ? -1.069  -9.623  4.313   1.00 0.00 ? 324 ILE B HG21 4  
ATOM 5908  H HG22 . ILE B 2 30 ? -0.658  -9.864  2.605   1.00 0.00 ? 324 ILE B HG22 4  
ATOM 5909  H HG23 . ILE B 2 30 ? 0.128   -10.841 3.856   1.00 0.00 ? 324 ILE B HG23 4  
ATOM 5910  H HD11 . ILE B 2 30 ? -1.480  -11.298 6.237   1.00 0.00 ? 324 ILE B HD11 4  
ATOM 5911  H HD12 . ILE B 2 30 ? -2.249  -12.858 6.542   1.00 0.00 ? 324 ILE B HD12 4  
ATOM 5912  H HD13 . ILE B 2 30 ? -3.172  -11.541 5.804   1.00 0.00 ? 324 ILE B HD13 4  
ATOM 5913  N N    . TYR B 2 31 ? -3.503  -10.260 1.204   1.00 0.00 ? 325 TYR B N    4  
ATOM 5914  C CA   . TYR B 2 31 ? -3.554  -9.448  -0.002  1.00 0.00 ? 325 TYR B CA   4  
ATOM 5915  C C    . TYR B 2 31 ? -4.756  -8.507  0.061   1.00 0.00 ? 325 TYR B C    4  
ATOM 5916  O O    . TYR B 2 31 ? -4.618  -7.303  -0.148  1.00 0.00 ? 325 TYR B O    4  
ATOM 5917  C CB   . TYR B 2 31 ? -3.635  -10.340 -1.247  1.00 0.00 ? 325 TYR B CB   4  
ATOM 5918  C CG   . TYR B 2 31 ? -2.982  -9.740  -2.477  1.00 0.00 ? 325 TYR B CG   4  
ATOM 5919  C CD1  . TYR B 2 31 ? -1.939  -8.822  -2.367  1.00 0.00 ? 325 TYR B CD1  4  
ATOM 5920  C CD2  . TYR B 2 31 ? -3.398  -10.109 -3.753  1.00 0.00 ? 325 TYR B CD2  4  
ATOM 5921  C CE1  . TYR B 2 31 ? -1.341  -8.286  -3.497  1.00 0.00 ? 325 TYR B CE1  4  
ATOM 5922  C CE2  . TYR B 2 31 ? -2.803  -9.577  -4.880  1.00 0.00 ? 325 TYR B CE2  4  
ATOM 5923  C CZ   . TYR B 2 31 ? -1.779  -8.667  -4.747  1.00 0.00 ? 325 TYR B CZ   4  
ATOM 5924  O OH   . TYR B 2 31 ? -1.187  -8.138  -5.871  1.00 0.00 ? 325 TYR B OH   4  
ATOM 5925  H H    . TYR B 2 31 ? -3.574  -11.237 1.144   1.00 0.00 ? 325 TYR B H    4  
ATOM 5926  H HA   . TYR B 2 31 ? -2.652  -8.859  -0.043  1.00 0.00 ? 325 TYR B HA   4  
ATOM 5927  H HB2  . TYR B 2 31 ? -3.145  -11.280 -1.041  1.00 0.00 ? 325 TYR B HB2  4  
ATOM 5928  H HB3  . TYR B 2 31 ? -4.674  -10.526 -1.480  1.00 0.00 ? 325 TYR B HB3  4  
ATOM 5929  H HD1  . TYR B 2 31 ? -1.593  -8.533  -1.374  1.00 0.00 ? 325 TYR B HD1  4  
ATOM 5930  H HD2  . TYR B 2 31 ? -4.206  -10.818 -3.855  1.00 0.00 ? 325 TYR B HD2  4  
ATOM 5931  H HE1  . TYR B 2 31 ? -0.535  -7.571  -3.403  1.00 0.00 ? 325 TYR B HE1  4  
ATOM 5932  H HE2  . TYR B 2 31 ? -3.136  -9.878  -5.863  1.00 0.00 ? 325 TYR B HE2  4  
ATOM 5933  H HH   . TYR B 2 31 ? -1.801  -8.173  -6.607  1.00 0.00 ? 325 TYR B HH   4  
ATOM 5934  N N    . LYS B 2 32 ? -5.926  -9.062  0.387   1.00 0.00 ? 326 LYS B N    4  
ATOM 5935  C CA   . LYS B 2 32 ? -7.142  -8.275  0.520   1.00 0.00 ? 326 LYS B CA   4  
ATOM 5936  C C    . LYS B 2 32 ? -7.001  -7.247  1.651   1.00 0.00 ? 326 LYS B C    4  
ATOM 5937  O O    . LYS B 2 32 ? -7.283  -6.064  1.461   1.00 0.00 ? 326 LYS B O    4  
ATOM 5938  C CB   . LYS B 2 32 ? -8.335  -9.214  0.759   1.00 0.00 ? 326 LYS B CB   4  
ATOM 5939  C CG   . LYS B 2 32 ? -9.330  -8.710  1.787   1.00 0.00 ? 326 LYS B CG   4  
ATOM 5940  C CD   . LYS B 2 32 ? -10.516 -9.654  1.936   1.00 0.00 ? 326 LYS B CD   4  
ATOM 5941  C CE   . LYS B 2 32 ? -11.344 -9.731  0.661   1.00 0.00 ? 326 LYS B CE   4  
ATOM 5942  N NZ   . LYS B 2 32 ? -11.968 -8.422  0.316   1.00 0.00 ? 326 LYS B NZ   4  
ATOM 5943  H H    . LYS B 2 32 ? -5.966  -10.022 0.572   1.00 0.00 ? 326 LYS B H    4  
ATOM 5944  H HA   . LYS B 2 32 ? -7.294  -7.746  -0.410  1.00 0.00 ? 326 LYS B HA   4  
ATOM 5945  H HB2  . LYS B 2 32 ? -8.859  -9.351  -0.175  1.00 0.00 ? 326 LYS B HB2  4  
ATOM 5946  H HB3  . LYS B 2 32 ? -7.960  -10.171 1.092   1.00 0.00 ? 326 LYS B HB3  4  
ATOM 5947  H HG2  . LYS B 2 32 ? -8.826  -8.631  2.738   1.00 0.00 ? 326 LYS B HG2  4  
ATOM 5948  H HG3  . LYS B 2 32 ? -9.686  -7.739  1.482   1.00 0.00 ? 326 LYS B HG3  4  
ATOM 5949  H HD2  . LYS B 2 32 ? -10.148 -10.641 2.172   1.00 0.00 ? 326 LYS B HD2  4  
ATOM 5950  H HD3  . LYS B 2 32 ? -11.143 -9.301  2.742   1.00 0.00 ? 326 LYS B HD3  4  
ATOM 5951  H HE2  . LYS B 2 32 ? -10.704 -10.038 -0.152  1.00 0.00 ? 326 LYS B HE2  4  
ATOM 5952  H HE3  . LYS B 2 32 ? -12.124 -10.466 0.798   1.00 0.00 ? 326 LYS B HE3  4  
ATOM 5953  H HZ1  . LYS B 2 32 ? -12.520 -8.511  -0.561  1.00 0.00 ? 326 LYS B HZ1  4  
ATOM 5954  H HZ2  . LYS B 2 32 ? -11.233 -7.700  0.178   1.00 0.00 ? 326 LYS B HZ2  4  
ATOM 5955  H HZ3  . LYS B 2 32 ? -12.601 -8.114  1.082   1.00 0.00 ? 326 LYS B HZ3  4  
ATOM 5956  N N    . ALA B 2 33 ? -6.563  -7.716  2.825   1.00 0.00 ? 327 ALA B N    4  
ATOM 5957  C CA   . ALA B 2 33 ? -6.378  -6.854  3.996   1.00 0.00 ? 327 ALA B CA   4  
ATOM 5958  C C    . ALA B 2 33 ? -5.402  -5.718  3.712   1.00 0.00 ? 327 ALA B C    4  
ATOM 5959  O O    . ALA B 2 33 ? -5.741  -4.549  3.880   1.00 0.00 ? 327 ALA B O    4  
ATOM 5960  C CB   . ALA B 2 33 ? -5.891  -7.668  5.187   1.00 0.00 ? 327 ALA B CB   4  
ATOM 5961  H H    . ALA B 2 33 ? -6.356  -8.672  2.905   1.00 0.00 ? 327 ALA B H    4  
ATOM 5962  H HA   . ALA B 2 33 ? -7.340  -6.432  4.250   1.00 0.00 ? 327 ALA B HA   4  
ATOM 5963  H HB1  . ALA B 2 33 ? -5.745  -7.015  6.035   1.00 0.00 ? 327 ALA B HB1  4  
ATOM 5964  H HB2  . ALA B 2 33 ? -4.954  -8.149  4.938   1.00 0.00 ? 327 ALA B HB2  4  
ATOM 5965  H HB3  . ALA B 2 33 ? -6.626  -8.421  5.435   1.00 0.00 ? 327 ALA B HB3  4  
ATOM 5966  N N    . PHE B 2 34 ? -4.190  -6.076  3.283   1.00 0.00 ? 328 PHE B N    4  
ATOM 5967  C CA   . PHE B 2 34 ? -3.146  -5.094  2.978   1.00 0.00 ? 328 PHE B CA   4  
ATOM 5968  C C    . PHE B 2 34 ? -3.682  -3.992  2.070   1.00 0.00 ? 328 PHE B C    4  
ATOM 5969  O O    . PHE B 2 34 ? -3.484  -2.811  2.345   1.00 0.00 ? 328 PHE B O    4  
ATOM 5970  C CB   . PHE B 2 34 ? -1.957  -5.793  2.309   1.00 0.00 ? 328 PHE B CB   4  
ATOM 5971  C CG   . PHE B 2 34 ? -0.819  -4.876  1.958   1.00 0.00 ? 328 PHE B CG   4  
ATOM 5972  C CD1  . PHE B 2 34 ? -0.105  -4.230  2.949   1.00 0.00 ? 328 PHE B CD1  4  
ATOM 5973  C CD2  . PHE B 2 34 ? -0.465  -4.663  0.634   1.00 0.00 ? 328 PHE B CD2  4  
ATOM 5974  C CE1  . PHE B 2 34 ? 0.943   -3.389  2.632   1.00 0.00 ? 328 PHE B CE1  4  
ATOM 5975  C CE2  . PHE B 2 34 ? 0.583   -3.822  0.311   1.00 0.00 ? 328 PHE B CE2  4  
ATOM 5976  C CZ   . PHE B 2 34 ? 1.288   -3.185  1.313   1.00 0.00 ? 328 PHE B CZ   4  
ATOM 5977  H H    . PHE B 2 34 ? -3.989  -7.028  3.173   1.00 0.00 ? 328 PHE B H    4  
ATOM 5978  H HA   . PHE B 2 34 ? -2.819  -4.651  3.908   1.00 0.00 ? 328 PHE B HA   4  
ATOM 5979  H HB2  . PHE B 2 34 ? -1.574  -6.549  2.977   1.00 0.00 ? 328 PHE B HB2  4  
ATOM 5980  H HB3  . PHE B 2 34 ? -2.298  -6.266  1.401   1.00 0.00 ? 328 PHE B HB3  4  
ATOM 5981  H HD1  . PHE B 2 34 ? -0.373  -4.390  3.982   1.00 0.00 ? 328 PHE B HD1  4  
ATOM 5982  H HD2  . PHE B 2 34 ? -1.017  -5.160  -0.150  1.00 0.00 ? 328 PHE B HD2  4  
ATOM 5983  H HE1  . PHE B 2 34 ? 1.492   -2.890  3.416   1.00 0.00 ? 328 PHE B HE1  4  
ATOM 5984  H HE2  . PHE B 2 34 ? 0.850   -3.664  -0.723  1.00 0.00 ? 328 PHE B HE2  4  
ATOM 5985  H HZ   . PHE B 2 34 ? 2.108   -2.528  1.067   1.00 0.00 ? 328 PHE B HZ   4  
ATOM 5986  N N    . LEU B 2 35 ? -4.370  -4.385  0.999   1.00 0.00 ? 329 LEU B N    4  
ATOM 5987  C CA   . LEU B 2 35 ? -4.943  -3.419  0.062   1.00 0.00 ? 329 LEU B CA   4  
ATOM 5988  C C    . LEU B 2 35 ? -5.949  -2.508  0.768   1.00 0.00 ? 329 LEU B C    4  
ATOM 5989  O O    . LEU B 2 35 ? -5.844  -1.284  0.687   1.00 0.00 ? 329 LEU B O    4  
ATOM 5990  C CB   . LEU B 2 35 ? -5.608  -4.135  -1.119  1.00 0.00 ? 329 LEU B CB   4  
ATOM 5991  C CG   . LEU B 2 35 ? -4.654  -4.926  -2.018  1.00 0.00 ? 329 LEU B CG   4  
ATOM 5992  C CD1  . LEU B 2 35 ? -5.422  -5.631  -3.129  1.00 0.00 ? 329 LEU B CD1  4  
ATOM 5993  C CD2  . LEU B 2 35 ? -3.584  -4.013  -2.604  1.00 0.00 ? 329 LEU B CD2  4  
ATOM 5994  H H    . LEU B 2 35 ? -4.501  -5.345  0.844   1.00 0.00 ? 329 LEU B H    4  
ATOM 5995  H HA   . LEU B 2 35 ? -4.134  -2.809  -0.312  1.00 0.00 ? 329 LEU B HA   4  
ATOM 5996  H HB2  . LEU B 2 35 ? -6.351  -4.815  -0.728  1.00 0.00 ? 329 LEU B HB2  4  
ATOM 5997  H HB3  . LEU B 2 35 ? -6.107  -3.394  -1.727  1.00 0.00 ? 329 LEU B HB3  4  
ATOM 5998  H HG   . LEU B 2 35 ? -4.158  -5.682  -1.428  1.00 0.00 ? 329 LEU B HG   4  
ATOM 5999  H HD11 . LEU B 2 35 ? -6.465  -5.702  -2.856  1.00 0.00 ? 329 LEU B HD11 4  
ATOM 6000  H HD12 . LEU B 2 35 ? -5.018  -6.621  -3.272  1.00 0.00 ? 329 LEU B HD12 4  
ATOM 6001  H HD13 . LEU B 2 35 ? -5.327  -5.068  -4.046  1.00 0.00 ? 329 LEU B HD13 4  
ATOM 6002  H HD21 . LEU B 2 35 ? -4.039  -3.335  -3.310  1.00 0.00 ? 329 LEU B HD21 4  
ATOM 6003  H HD22 . LEU B 2 35 ? -2.838  -4.610  -3.107  1.00 0.00 ? 329 LEU B HD22 4  
ATOM 6004  H HD23 . LEU B 2 35 ? -3.118  -3.448  -1.809  1.00 0.00 ? 329 LEU B HD23 4  
ATOM 6005  N N    . GLU B 2 36 ? -6.909  -3.112  1.479   1.00 0.00 ? 330 GLU B N    4  
ATOM 6006  C CA   . GLU B 2 36 ? -7.923  -2.352  2.221   1.00 0.00 ? 330 GLU B CA   4  
ATOM 6007  C C    . GLU B 2 36 ? -7.267  -1.400  3.224   1.00 0.00 ? 330 GLU B C    4  
ATOM 6008  O O    . GLU B 2 36 ? -7.757  -0.294  3.451   1.00 0.00 ? 330 GLU B O    4  
ATOM 6009  C CB   . GLU B 2 36 ? -8.874  -3.305  2.952   1.00 0.00 ? 330 GLU B CB   4  
ATOM 6010  C CG   . GLU B 2 36 ? -9.702  -4.177  2.019   1.00 0.00 ? 330 GLU B CG   4  
ATOM 6011  C CD   . GLU B 2 36 ? -10.509 -5.226  2.761   1.00 0.00 ? 330 GLU B CD   4  
ATOM 6012  O OE1  . GLU B 2 36 ? -9.896  -6.074  3.443   1.00 0.00 ? 330 GLU B OE1  4  
ATOM 6013  O OE2  . GLU B 2 36 ? -11.753 -5.198  2.660   1.00 0.00 ? 330 GLU B OE2  4  
ATOM 6014  H H    . GLU B 2 36 ? -6.927  -4.091  1.516   1.00 0.00 ? 330 GLU B H    4  
ATOM 6015  H HA   . GLU B 2 36 ? -8.489  -1.768  1.508   1.00 0.00 ? 330 GLU B HA   4  
ATOM 6016  H HB2  . GLU B 2 36 ? -8.293  -3.952  3.593   1.00 0.00 ? 330 GLU B HB2  4  
ATOM 6017  H HB3  . GLU B 2 36 ? -9.550  -2.722  3.560   1.00 0.00 ? 330 GLU B HB3  4  
ATOM 6018  H HG2  . GLU B 2 36 ? -10.383 -3.544  1.468   1.00 0.00 ? 330 GLU B HG2  4  
ATOM 6019  H HG3  . GLU B 2 36 ? -9.039  -4.674  1.328   1.00 0.00 ? 330 GLU B HG3  4  
ATOM 6020  N N    . ILE B 2 37 ? -6.145  -1.835  3.804   1.00 0.00 ? 331 ILE B N    4  
ATOM 6021  C CA   . ILE B 2 37 ? -5.399  -1.020  4.760   1.00 0.00 ? 331 ILE B CA   4  
ATOM 6022  C C    . ILE B 2 37 ? -4.979  0.292   4.103   1.00 0.00 ? 331 ILE B C    4  
ATOM 6023  O O    . ILE B 2 37 ? -5.234  1.377   4.629   1.00 0.00 ? 331 ILE B O    4  
ATOM 6024  C CB   . ILE B 2 37 ? -4.150  -1.773  5.266   1.00 0.00 ? 331 ILE B CB   4  
ATOM 6025  C CG1  . ILE B 2 37 ? -4.568  -2.948  6.146   1.00 0.00 ? 331 ILE B CG1  4  
ATOM 6026  C CG2  . ILE B 2 37 ? -3.214  -0.847  6.026   1.00 0.00 ? 331 ILE B CG2  4  
ATOM 6027  C CD1  . ILE B 2 37 ? -3.419  -3.844  6.534   1.00 0.00 ? 331 ILE B CD1  4  
ATOM 6028  H H    . ILE B 2 37 ? -5.799  -2.721  3.568   1.00 0.00 ? 331 ILE B H    4  
ATOM 6029  H HA   . ILE B 2 37 ? -6.039  -0.810  5.605   1.00 0.00 ? 331 ILE B HA   4  
ATOM 6030  H HB   . ILE B 2 37 ? -3.617  -2.153  4.409   1.00 0.00 ? 331 ILE B HB   4  
ATOM 6031  H HG12 . ILE B 2 37 ? -5.009  -2.566  7.053   1.00 0.00 ? 331 ILE B HG12 4  
ATOM 6032  H HG13 . ILE B 2 37 ? -5.296  -3.546  5.622   1.00 0.00 ? 331 ILE B HG13 4  
ATOM 6033  H HG21 . ILE B 2 37 ? -3.085  0.070   5.474   1.00 0.00 ? 331 ILE B HG21 4  
ATOM 6034  H HG22 . ILE B 2 37 ? -2.256  -1.332  6.148   1.00 0.00 ? 331 ILE B HG22 4  
ATOM 6035  H HG23 . ILE B 2 37 ? -3.634  -0.630  6.997   1.00 0.00 ? 331 ILE B HG23 4  
ATOM 6036  H HD11 . ILE B 2 37 ? -3.800  -4.713  7.046   1.00 0.00 ? 331 ILE B HD11 4  
ATOM 6037  H HD12 . ILE B 2 37 ? -2.749  -3.304  7.185   1.00 0.00 ? 331 ILE B HD12 4  
ATOM 6038  H HD13 . ILE B 2 37 ? -2.889  -4.153  5.644   1.00 0.00 ? 331 ILE B HD13 4  
ATOM 6039  N N    . LEU B 2 38 ? -4.356  0.172   2.932   1.00 0.00 ? 332 LEU B N    4  
ATOM 6040  C CA   . LEU B 2 38 ? -3.913  1.332   2.159   1.00 0.00 ? 332 LEU B CA   4  
ATOM 6041  C C    . LEU B 2 38 ? -5.117  2.166   1.743   1.00 0.00 ? 332 LEU B C    4  
ATOM 6042  O O    . LEU B 2 38 ? -5.074  3.396   1.740   1.00 0.00 ? 332 LEU B O    4  
ATOM 6043  C CB   . LEU B 2 38 ? -3.159  0.887   0.901   1.00 0.00 ? 332 LEU B CB   4  
ATOM 6044  C CG   . LEU B 2 38 ? -2.310  -0.375  1.050   1.00 0.00 ? 332 LEU B CG   4  
ATOM 6045  C CD1  . LEU B 2 38 ? -1.459  -0.595  -0.189  1.00 0.00 ? 332 LEU B CD1  4  
ATOM 6046  C CD2  . LEU B 2 38 ? -1.456  -0.297  2.304   1.00 0.00 ? 332 LEU B CD2  4  
ATOM 6047  H H    . LEU B 2 38 ? -4.206  -0.726  2.567   1.00 0.00 ? 332 LEU B H    4  
ATOM 6048  H HA   . LEU B 2 38 ? -3.261  1.928   2.780   1.00 0.00 ? 332 LEU B HA   4  
ATOM 6049  H HB2  . LEU B 2 38 ? -3.882  0.717   0.118   1.00 0.00 ? 332 LEU B HB2  4  
ATOM 6050  H HB3  . LEU B 2 38 ? -2.512  1.692   0.596   1.00 0.00 ? 332 LEU B HB3  4  
ATOM 6051  H HG   . LEU B 2 38 ? -2.967  -1.223  1.146   1.00 0.00 ? 332 LEU B HG   4  
ATOM 6052  H HD11 . LEU B 2 38 ? -1.757  -1.516  -0.667  1.00 0.00 ? 332 LEU B HD11 4  
ATOM 6053  H HD12 . LEU B 2 38 ? -0.418  -0.654  0.093   1.00 0.00 ? 332 LEU B HD12 4  
ATOM 6054  H HD13 . LEU B 2 38 ? -1.602  0.227   -0.873  1.00 0.00 ? 332 LEU B HD13 4  
ATOM 6055  H HD21 . LEU B 2 38 ? -1.107  -1.284  2.564   1.00 0.00 ? 332 LEU B HD21 4  
ATOM 6056  H HD22 . LEU B 2 38 ? -2.053  0.101   3.114   1.00 0.00 ? 332 LEU B HD22 4  
ATOM 6057  H HD23 . LEU B 2 38 ? -0.613  0.351   2.128   1.00 0.00 ? 332 LEU B HD23 4  
ATOM 6058  N N    . HIS B 2 39 ? -6.187  1.469   1.375   1.00 0.00 ? 333 HIS B N    4  
ATOM 6059  C CA   . HIS B 2 39 ? -7.423  2.114   0.927   1.00 0.00 ? 333 HIS B CA   4  
ATOM 6060  C C    . HIS B 2 39 ? -7.921  3.150   1.938   1.00 0.00 ? 333 HIS B C    4  
ATOM 6061  O O    . HIS B 2 39 ? -8.168  4.299   1.574   1.00 0.00 ? 333 HIS B O    4  
ATOM 6062  C CB   . HIS B 2 39 ? -8.519  1.066   0.677   1.00 0.00 ? 333 HIS B CB   4  
ATOM 6063  C CG   . HIS B 2 39 ? -8.246  0.158   -0.484  1.00 0.00 ? 333 HIS B CG   4  
ATOM 6064  N ND1  . HIS B 2 39 ? -9.051  -0.915  -0.803  1.00 0.00 ? 333 HIS B ND1  4  
ATOM 6065  C CD2  . HIS B 2 39 ? -7.258  0.170   -1.409  1.00 0.00 ? 333 HIS B CD2  4  
ATOM 6066  C CE1  . HIS B 2 39 ? -8.570  -1.523  -1.872  1.00 0.00 ? 333 HIS B CE1  4  
ATOM 6067  N NE2  . HIS B 2 39 ? -7.482  -0.884  -2.260  1.00 0.00 ? 333 HIS B NE2  4  
ATOM 6068  H H    . HIS B 2 39 ? -6.133  0.489   1.390   1.00 0.00 ? 333 HIS B H    4  
ATOM 6069  H HA   . HIS B 2 39 ? -7.200  2.619   0.000   1.00 0.00 ? 333 HIS B HA   4  
ATOM 6070  H HB2  . HIS B 2 39 ? -8.622  0.452   1.555   1.00 0.00 ? 333 HIS B HB2  4  
ATOM 6071  H HB3  . HIS B 2 39 ? -9.453  1.572   0.490   1.00 0.00 ? 333 HIS B HB3  4  
ATOM 6072  H HD1  . HIS B 2 39 ? -9.857  -1.190  -0.317  1.00 0.00 ? 333 HIS B HD1  4  
ATOM 6073  H HD2  . HIS B 2 39 ? -6.445  0.878   -1.466  1.00 0.00 ? 333 HIS B HD2  4  
ATOM 6074  H HE1  . HIS B 2 39 ? -8.994  -2.394  -2.348  1.00 0.00 ? 333 HIS B HE1  4  
ATOM 6075  H HE2  . HIS B 2 39 ? -6.987  -1.062  -3.086  1.00 0.00 ? 333 HIS B HE2  4  
ATOM 6076  N N    . THR B 2 40 ? -8.051  2.749   3.208   1.00 0.00 ? 334 THR B N    4  
ATOM 6077  C CA   . THR B 2 40 ? -8.503  3.669   4.255   1.00 0.00 ? 334 THR B CA   4  
ATOM 6078  C C    . THR B 2 40 ? -7.535  4.842   4.376   1.00 0.00 ? 334 THR B C    4  
ATOM 6079  O O    . THR B 2 40 ? -7.949  5.990   4.539   1.00 0.00 ? 334 THR B O    4  
ATOM 6080  C CB   . THR B 2 40 ? -8.617  2.941   5.602   1.00 0.00 ? 334 THR B CB   4  
ATOM 6081  O OG1  . THR B 2 40 ? -9.668  1.993   5.569   1.00 0.00 ? 334 THR B OG1  4  
ATOM 6082  C CG2  . THR B 2 40 ? -8.868  3.874   6.777   1.00 0.00 ? 334 THR B CG2  4  
ATOM 6083  H H    . THR B 2 40 ? -7.827  1.824   3.443   1.00 0.00 ? 334 THR B H    4  
ATOM 6084  H HA   . THR B 2 40 ? -9.475  4.045   3.971   1.00 0.00 ? 334 THR B HA   4  
ATOM 6085  H HB   . THR B 2 40 ? -7.692  2.412   5.790   1.00 0.00 ? 334 THR B HB   4  
ATOM 6086  H HG1  . THR B 2 40 ? -9.440  1.242   6.125   1.00 0.00 ? 334 THR B HG1  4  
ATOM 6087  H HG21 . THR B 2 40 ? -9.140  4.853   6.413   1.00 0.00 ? 334 THR B HG21 4  
ATOM 6088  H HG22 . THR B 2 40 ? -7.971  3.952   7.376   1.00 0.00 ? 334 THR B HG22 4  
ATOM 6089  H HG23 . THR B 2 40 ? -9.668  3.481   7.386   1.00 0.00 ? 334 THR B HG23 4  
ATOM 6090  N N    . TYR B 2 41 ? -6.244  4.534   4.277   1.00 0.00 ? 335 TYR B N    4  
ATOM 6091  C CA   . TYR B 2 41 ? -5.192  5.540   4.356   1.00 0.00 ? 335 TYR B CA   4  
ATOM 6092  C C    . TYR B 2 41 ? -5.371  6.609   3.270   1.00 0.00 ? 335 TYR B C    4  
ATOM 6093  O O    . TYR B 2 41 ? -5.549  7.785   3.585   1.00 0.00 ? 335 TYR B O    4  
ATOM 6094  C CB   . TYR B 2 41 ? -3.833  4.851   4.227   1.00 0.00 ? 335 TYR B CB   4  
ATOM 6095  C CG   . TYR B 2 41 ? -2.642  5.775   4.319   1.00 0.00 ? 335 TYR B CG   4  
ATOM 6096  C CD1  . TYR B 2 41 ? -2.204  6.264   5.541   1.00 0.00 ? 335 TYR B CD1  4  
ATOM 6097  C CD2  . TYR B 2 41 ? -1.952  6.146   3.178   1.00 0.00 ? 335 TYR B CD2  4  
ATOM 6098  C CE1  . TYR B 2 41 ? -1.103  7.101   5.618   1.00 0.00 ? 335 TYR B CE1  4  
ATOM 6099  C CE2  . TYR B 2 41 ? -0.859  6.975   3.240   1.00 0.00 ? 335 TYR B CE2  4  
ATOM 6100  C CZ   . TYR B 2 41 ? -0.434  7.453   4.462   1.00 0.00 ? 335 TYR B CZ   4  
ATOM 6101  O OH   . TYR B 2 41 ? 0.661   8.283   4.526   1.00 0.00 ? 335 TYR B OH   4  
ATOM 6102  H H    . TYR B 2 41 ? -5.989  3.597   4.137   1.00 0.00 ? 335 TYR B H    4  
ATOM 6103  H HA   . TYR B 2 41 ? -5.258  6.013   5.326   1.00 0.00 ? 335 TYR B HA   4  
ATOM 6104  H HB2  . TYR B 2 41 ? -3.741  4.122   5.017   1.00 0.00 ? 335 TYR B HB2  4  
ATOM 6105  H HB3  . TYR B 2 41 ? -3.787  4.343   3.279   1.00 0.00 ? 335 TYR B HB3  4  
ATOM 6106  H HD1  . TYR B 2 41 ? -2.735  5.981   6.442   1.00 0.00 ? 335 TYR B HD1  4  
ATOM 6107  H HD2  . TYR B 2 41 ? -2.284  5.779   2.227   1.00 0.00 ? 335 TYR B HD2  4  
ATOM 6108  H HE1  . TYR B 2 41 ? -0.770  7.472   6.577   1.00 0.00 ? 335 TYR B HE1  4  
ATOM 6109  H HE2  . TYR B 2 41 ? -0.341  7.246   2.334   1.00 0.00 ? 335 TYR B HE2  4  
ATOM 6110  H HH   . TYR B 2 41 ? 0.435   9.142   4.159   1.00 0.00 ? 335 TYR B HH   4  
ATOM 6111  N N    . GLN B 2 42 ? -5.327  6.192   1.993   1.00 0.00 ? 336 GLN B N    4  
ATOM 6112  C CA   . GLN B 2 42 ? -5.489  7.122   0.861   1.00 0.00 ? 336 GLN B CA   4  
ATOM 6113  C C    . GLN B 2 42 ? -6.745  7.984   0.988   1.00 0.00 ? 336 GLN B C    4  
ATOM 6114  O O    . GLN B 2 42 ? -6.685  9.199   0.792   1.00 0.00 ? 336 GLN B O    4  
ATOM 6115  C CB   . GLN B 2 42 ? -5.541  6.373   -0.475  1.00 0.00 ? 336 GLN B CB   4  
ATOM 6116  C CG   . GLN B 2 42 ? -4.181  5.992   -1.038  1.00 0.00 ? 336 GLN B CG   4  
ATOM 6117  C CD   . GLN B 2 42 ? -3.211  7.160   -1.077  1.00 0.00 ? 336 GLN B CD   4  
ATOM 6118  O OE1  . GLN B 2 42 ? -2.668  7.565   -0.049  1.00 0.00 ? 336 GLN B OE1  4  
ATOM 6119  N NE2  . GLN B 2 42 ? -3.002  7.722   -2.263  1.00 0.00 ? 336 GLN B NE2  4  
ATOM 6120  H H    . GLN B 2 42 ? -5.183  5.239   1.808   1.00 0.00 ? 336 GLN B H    4  
ATOM 6121  H HA   . GLN B 2 42 ? -4.631  7.775   0.857   1.00 0.00 ? 336 GLN B HA   4  
ATOM 6122  H HB2  . GLN B 2 42 ? -6.112  5.467   -0.341  1.00 0.00 ? 336 GLN B HB2  4  
ATOM 6123  H HB3  . GLN B 2 42 ? -6.042  6.995   -1.202  1.00 0.00 ? 336 GLN B HB3  4  
ATOM 6124  H HG2  . GLN B 2 42 ? -3.760  5.212   -0.428  1.00 0.00 ? 336 GLN B HG2  4  
ATOM 6125  H HG3  . GLN B 2 42 ? -4.316  5.622   -2.046  1.00 0.00 ? 336 GLN B HG3  4  
ATOM 6126  H HE21 . GLN B 2 42 ? -3.479  7.360   -3.039  1.00 0.00 ? 336 GLN B HE21 4  
ATOM 6127  H HE22 . GLN B 2 42 ? -2.384  8.480   -2.313  1.00 0.00 ? 336 GLN B HE22 4  
ATOM 6128  N N    . LYS B 2 43 ? -7.878  7.353   1.302   1.00 0.00 ? 337 LYS B N    4  
ATOM 6129  C CA   . LYS B 2 43 ? -9.140  8.078   1.436   1.00 0.00 ? 337 LYS B CA   4  
ATOM 6130  C C    . LYS B 2 43 ? -9.021  9.168   2.494   1.00 0.00 ? 337 LYS B C    4  
ATOM 6131  O O    . LYS B 2 43 ? -9.351  10.325  2.237   1.00 0.00 ? 337 LYS B O    4  
ATOM 6132  C CB   . LYS B 2 43 ? -10.278 7.118   1.796   1.00 0.00 ? 337 LYS B CB   4  
ATOM 6133  C CG   . LYS B 2 43 ? -10.613 6.131   0.688   1.00 0.00 ? 337 LYS B CG   4  
ATOM 6134  C CD   . LYS B 2 43 ? -11.737 5.192   1.093   1.00 0.00 ? 337 LYS B CD   4  
ATOM 6135  C CE   . LYS B 2 43 ? -11.329 4.290   2.249   1.00 0.00 ? 337 LYS B CE   4  
ATOM 6136  N NZ   . LYS B 2 43 ? -12.419 3.352   2.640   1.00 0.00 ? 337 LYS B NZ   4  
ATOM 6137  H H    . LYS B 2 43 ? -7.865  6.382   1.438   1.00 0.00 ? 337 LYS B H    4  
ATOM 6138  H HA   . LYS B 2 43 ? -9.361  8.540   0.485   1.00 0.00 ? 337 LYS B HA   4  
ATOM 6139  H HB2  . LYS B 2 43 ? -9.996  6.558   2.674   1.00 0.00 ? 337 LYS B HB2  4  
ATOM 6140  H HB3  . LYS B 2 43 ? -11.163 7.693   2.016   1.00 0.00 ? 337 LYS B HB3  4  
ATOM 6141  H HG2  . LYS B 2 43 ? -10.919 6.681   -0.191  1.00 0.00 ? 337 LYS B HG2  4  
ATOM 6142  H HG3  . LYS B 2 43 ? -9.733  5.548   0.460   1.00 0.00 ? 337 LYS B HG3  4  
ATOM 6143  H HD2  . LYS B 2 43 ? -12.590 5.782   1.395   1.00 0.00 ? 337 LYS B HD2  4  
ATOM 6144  H HD3  . LYS B 2 43 ? -12.004 4.579   0.246   1.00 0.00 ? 337 LYS B HD3  4  
ATOM 6145  H HE2  . LYS B 2 43 ? -10.465 3.716   1.952   1.00 0.00 ? 337 LYS B HE2  4  
ATOM 6146  H HE3  . LYS B 2 43 ? -11.075 4.908   3.098   1.00 0.00 ? 337 LYS B HE3  4  
ATOM 6147  H HZ1  . LYS B 2 43 ? -12.838 2.918   1.793   1.00 0.00 ? 337 LYS B HZ1  4  
ATOM 6148  H HZ2  . LYS B 2 43 ? -13.162 3.864   3.157   1.00 0.00 ? 337 LYS B HZ2  4  
ATOM 6149  H HZ3  . LYS B 2 43 ? -12.041 2.602   3.252   1.00 0.00 ? 337 LYS B HZ3  4  
ATOM 6150  N N    . GLU B 2 44 ? -8.539  8.791   3.676   1.00 0.00 ? 338 GLU B N    4  
ATOM 6151  C CA   . GLU B 2 44 ? -8.353  9.702   4.774   1.00 0.00 ? 338 GLU B CA   4  
ATOM 6152  C C    . GLU B 2 44 ? -7.570  10.952  4.362   1.00 0.00 ? 338 GLU B C    4  
ATOM 6153  O O    . GLU B 2 44 ? -7.954  12.064  4.712   1.00 0.00 ? 338 GLU B O    4  
ATOM 6154  C CB   . GLU B 2 44 ? -7.618  8.938   5.864   1.00 0.00 ? 338 GLU B CB   4  
ATOM 6155  C CG   . GLU B 2 44 ? -7.523  9.671   7.159   1.00 0.00 ? 338 GLU B CG   4  
ATOM 6156  C CD   . GLU B 2 44 ? -6.497  10.791  7.137   1.00 0.00 ? 338 GLU B CD   4  
ATOM 6157  O OE1  . GLU B 2 44 ? -5.304  10.502  6.898   1.00 0.00 ? 338 GLU B OE1  4  
ATOM 6158  O OE2  . GLU B 2 44 ? -6.885  11.955  7.357   1.00 0.00 ? 338 GLU B OE2  4  
ATOM 6159  H H    . GLU B 2 44 ? -8.291  7.860   3.824   1.00 0.00 ? 338 GLU B H    4  
ATOM 6160  H HA   . GLU B 2 44 ? -9.327  9.998   5.141   1.00 0.00 ? 338 GLU B HA   4  
ATOM 6161  H HB2  . GLU B 2 44 ? -8.137  8.009   6.047   1.00 0.00 ? 338 GLU B HB2  4  
ATOM 6162  H HB3  . GLU B 2 44 ? -6.618  8.719   5.524   1.00 0.00 ? 338 GLU B HB3  4  
ATOM 6163  H HG2  . GLU B 2 44 ? -8.490  10.085  7.368   1.00 0.00 ? 338 GLU B HG2  4  
ATOM 6164  H HG3  . GLU B 2 44 ? -7.258  8.965   7.918   1.00 0.00 ? 338 GLU B HG3  4  
ATOM 6165  N N    . GLN B 2 45 ? -6.477  10.761  3.615   1.00 0.00 ? 339 GLN B N    4  
ATOM 6166  C CA   . GLN B 2 45 ? -5.650  11.885  3.161   1.00 0.00 ? 339 GLN B CA   4  
ATOM 6167  C C    . GLN B 2 45 ? -6.513  12.930  2.463   1.00 0.00 ? 339 GLN B C    4  
ATOM 6168  O O    . GLN B 2 45 ? -6.516  14.105  2.839   1.00 0.00 ? 339 GLN B O    4  
ATOM 6169  C CB   . GLN B 2 45 ? -4.556  11.409  2.195   1.00 0.00 ? 339 GLN B CB   4  
ATOM 6170  C CG   . GLN B 2 45 ? -3.786  10.191  2.682   1.00 0.00 ? 339 GLN B CG   4  
ATOM 6171  C CD   . GLN B 2 45 ? -3.091  10.390  4.026   1.00 0.00 ? 339 GLN B CD   4  
ATOM 6172  O OE1  . GLN B 2 45 ? -2.718  9.417   4.681   1.00 0.00 ? 339 GLN B OE1  4  
ATOM 6173  N NE2  . GLN B 2 45 ? -2.884  11.640  4.439   1.00 0.00 ? 339 GLN B NE2  4  
ATOM 6174  H H    . GLN B 2 45 ? -6.222  9.849   3.366   1.00 0.00 ? 339 GLN B H    4  
ATOM 6175  H HA   . GLN B 2 45 ? -5.189  12.334  4.029   1.00 0.00 ? 339 GLN B HA   4  
ATOM 6176  H HB2  . GLN B 2 45 ? -5.014  11.158  1.250   1.00 0.00 ? 339 GLN B HB2  4  
ATOM 6177  H HB3  . GLN B 2 45 ? -3.854  12.214  2.040   1.00 0.00 ? 339 GLN B HB3  4  
ATOM 6178  H HG2  . GLN B 2 45 ? -4.477  9.371   2.772   1.00 0.00 ? 339 GLN B HG2  4  
ATOM 6179  H HG3  . GLN B 2 45 ? -3.038  9.944   1.944   1.00 0.00 ? 339 GLN B HG3  4  
ATOM 6180  H HE21 . GLN B 2 45 ? -3.179  12.378  3.867   1.00 0.00 ? 339 GLN B HE21 4  
ATOM 6181  H HE22 . GLN B 2 45 ? -2.440  11.771  5.302   1.00 0.00 ? 339 GLN B HE22 4  
ATOM 6182  N N    . ARG B 2 46 ? -7.245  12.484  1.446   1.00 0.00 ? 340 ARG B N    4  
ATOM 6183  C CA   . ARG B 2 46 ? -8.127  13.363  0.679   1.00 0.00 ? 340 ARG B CA   4  
ATOM 6184  C C    . ARG B 2 46 ? -9.304  13.853  1.526   1.00 0.00 ? 340 ARG B C    4  
ATOM 6185  O O    . ARG B 2 46 ? -9.670  15.027  1.466   1.00 0.00 ? 340 ARG B O    4  
ATOM 6186  C CB   . ARG B 2 46 ? -8.638  12.640  -0.571  1.00 0.00 ? 340 ARG B CB   4  
ATOM 6187  C CG   . ARG B 2 46 ? -7.541  12.338  -1.583  1.00 0.00 ? 340 ARG B CG   4  
ATOM 6188  C CD   . ARG B 2 46 ? -8.090  11.639  -2.817  1.00 0.00 ? 340 ARG B CD   4  
ATOM 6189  N NE   . ARG B 2 46 ? -7.053  11.411  -3.826  1.00 0.00 ? 340 ARG B NE   4  
ATOM 6190  C CZ   . ARG B 2 46 ? -7.271  10.818  -5.002  1.00 0.00 ? 340 ARG B CZ   4  
ATOM 6191  N NH1  . ARG B 2 46 ? -8.485  10.376  -5.323  1.00 0.00 ? 340 ARG B NH1  4  
ATOM 6192  N NH2  . ARG B 2 46 ? -6.268  10.664  -5.861  1.00 0.00 ? 340 ARG B NH2  4  
ATOM 6193  H H    . ARG B 2 46 ? -7.191  11.531  1.208   1.00 0.00 ? 340 ARG B H    4  
ATOM 6194  H HA   . ARG B 2 46 ? -7.546  14.218  0.370   1.00 0.00 ? 340 ARG B HA   4  
ATOM 6195  H HB2  . ARG B 2 46 ? -9.091  11.704  -0.273  1.00 0.00 ? 340 ARG B HB2  4  
ATOM 6196  H HB3  . ARG B 2 46 ? -9.383  13.255  -1.052  1.00 0.00 ? 340 ARG B HB3  4  
ATOM 6197  H HG2  . ARG B 2 46 ? -7.079  13.266  -1.885  1.00 0.00 ? 340 ARG B HG2  4  
ATOM 6198  H HG3  . ARG B 2 46 ? -6.804  11.700  -1.118  1.00 0.00 ? 340 ARG B HG3  4  
ATOM 6199  H HD2  . ARG B 2 46 ? -8.504  10.687  -2.521  1.00 0.00 ? 340 ARG B HD2  4  
ATOM 6200  H HD3  . ARG B 2 46 ? -8.869  12.252  -3.246  1.00 0.00 ? 340 ARG B HD3  4  
ATOM 6201  H HE   . ARG B 2 46 ? -6.147  11.721  -3.618  1.00 0.00 ? 340 ARG B HE   4  
ATOM 6202  H HH11 . ARG B 2 46 ? -9.245  10.488  -4.684  1.00 0.00 ? 340 ARG B HH11 4  
ATOM 6203  H HH12 . ARG B 2 46 ? -8.638  9.934   -6.207  1.00 0.00 ? 340 ARG B HH12 4  
ATOM 6204  H HH21 . ARG B 2 46 ? -5.354  10.993  -5.626  1.00 0.00 ? 340 ARG B HH21 4  
ATOM 6205  H HH22 . ARG B 2 46 ? -6.428  10.220  -6.743  1.00 0.00 ? 340 ARG B HH22 4  
ATOM 6206  N N    . ASN B 2 47 ? -9.890  12.950  2.316   1.00 0.00 ? 341 ASN B N    4  
ATOM 6207  C CA   . ASN B 2 47 ? -11.024 13.287  3.180   1.00 0.00 ? 341 ASN B CA   4  
ATOM 6208  C C    . ASN B 2 47 ? -10.668 14.390  4.179   1.00 0.00 ? 341 ASN B C    4  
ATOM 6209  O O    . ASN B 2 47 ? -11.360 15.405  4.263   1.00 0.00 ? 341 ASN B O    4  
ATOM 6210  C CB   . ASN B 2 47 ? -11.515 12.042  3.926   1.00 0.00 ? 341 ASN B CB   4  
ATOM 6211  C CG   . ASN B 2 47 ? -12.367 11.136  3.054   1.00 0.00 ? 341 ASN B CG   4  
ATOM 6212  O OD1  . ASN B 2 47 ? -13.319 11.586  2.417   1.00 0.00 ? 341 ASN B OD1  4  
ATOM 6213  N ND2  . ASN B 2 47 ? -12.042 9.847   3.037   1.00 0.00 ? 341 ASN B ND2  4  
ATOM 6214  H H    . ASN B 2 47 ? -9.548  12.030  2.320   1.00 0.00 ? 341 ASN B H    4  
ATOM 6215  H HA   . ASN B 2 47 ? -11.820 13.646  2.545   1.00 0.00 ? 341 ASN B HA   4  
ATOM 6216  H HB2  . ASN B 2 47 ? -10.659 11.477  4.266   1.00 0.00 ? 341 ASN B HB2  4  
ATOM 6217  H HB3  . ASN B 2 47 ? -12.098 12.344  4.780   1.00 0.00 ? 341 ASN B HB3  4  
ATOM 6218  H HD21 . ASN B 2 47 ? -11.284 9.552   3.582   1.00 0.00 ? 341 ASN B HD21 4  
ATOM 6219  H HD22 . ASN B 2 47 ? -12.576 9.243   2.480   1.00 0.00 ? 341 ASN B HD22 4  
ATOM 6220  N N    . ALA B 2 48 ? -9.589  14.181  4.938   1.00 0.00 ? 342 ALA B N    4  
ATOM 6221  C CA   . ALA B 2 48 ? -9.137  15.150  5.938   1.00 0.00 ? 342 ALA B CA   4  
ATOM 6222  C C    . ALA B 2 48 ? -8.915  16.535  5.332   1.00 0.00 ? 342 ALA B C    4  
ATOM 6223  O O    . ALA B 2 48 ? -9.248  17.545  5.950   1.00 0.00 ? 342 ALA B O    4  
ATOM 6224  C CB   . ALA B 2 48 ? -7.863  14.665  6.613   1.00 0.00 ? 342 ALA B CB   4  
ATOM 6225  H H    . ALA B 2 48 ? -9.084  13.348  4.823   1.00 0.00 ? 342 ALA B H    4  
ATOM 6226  H HA   . ALA B 2 48 ? -9.904  15.226  6.695   1.00 0.00 ? 342 ALA B HA   4  
ATOM 6227  H HB1  . ALA B 2 48 ? -8.103  14.245  7.578   1.00 0.00 ? 342 ALA B HB1  4  
ATOM 6228  H HB2  . ALA B 2 48 ? -7.184  15.494  6.741   1.00 0.00 ? 342 ALA B HB2  4  
ATOM 6229  H HB3  . ALA B 2 48 ? -7.396  13.909  5.999   1.00 0.00 ? 342 ALA B HB3  4  
ATOM 6230  N N    . LYS B 2 49 ? -8.348  16.576  4.127   1.00 0.00 ? 343 LYS B N    4  
ATOM 6231  C CA   . LYS B 2 49 ? -8.083  17.842  3.447   1.00 0.00 ? 343 LYS B CA   4  
ATOM 6232  C C    . LYS B 2 49 ? -9.387  18.537  3.044   1.00 0.00 ? 343 LYS B C    4  
ATOM 6233  O O    . LYS B 2 49 ? -9.525  19.752  3.199   1.00 0.00 ? 343 LYS B O    4  
ATOM 6234  C CB   . LYS B 2 49 ? -7.211  17.602  2.209   1.00 0.00 ? 343 LYS B CB   4  
ATOM 6235  C CG   . LYS B 2 49 ? -6.863  18.872  1.451   1.00 0.00 ? 343 LYS B CG   4  
ATOM 6236  C CD   . LYS B 2 49 ? -5.944  18.583  0.273   1.00 0.00 ? 343 LYS B CD   4  
ATOM 6237  C CE   . LYS B 2 49 ? -5.517  19.861  -0.439  1.00 0.00 ? 343 LYS B CE   4  
ATOM 6238  N NZ   . LYS B 2 49 ? -6.668  20.578  -1.060  1.00 0.00 ? 343 LYS B NZ   4  
ATOM 6239  H H    . LYS B 2 49 ? -8.101  15.736  3.686   1.00 0.00 ? 343 LYS B H    4  
ATOM 6240  H HA   . LYS B 2 49 ? -7.547  18.480  4.133   1.00 0.00 ? 343 LYS B HA   4  
ATOM 6241  H HB2  . LYS B 2 49 ? -6.289  17.130  2.519   1.00 0.00 ? 343 LYS B HB2  4  
ATOM 6242  H HB3  . LYS B 2 49 ? -7.736  16.938  1.537   1.00 0.00 ? 343 LYS B HB3  4  
ATOM 6243  H HG2  . LYS B 2 49 ? -7.776  19.316  1.082   1.00 0.00 ? 343 LYS B HG2  4  
ATOM 6244  H HG3  . LYS B 2 49 ? -6.371  19.558  2.123   1.00 0.00 ? 343 LYS B HG3  4  
ATOM 6245  H HD2  . LYS B 2 49 ? -5.061  18.076  0.635   1.00 0.00 ? 343 LYS B HD2  4  
ATOM 6246  H HD3  . LYS B 2 49 ? -6.464  17.947  -0.429  1.00 0.00 ? 343 LYS B HD3  4  
ATOM 6247  H HE2  . LYS B 2 49 ? -5.043  20.514  0.278   1.00 0.00 ? 343 LYS B HE2  4  
ATOM 6248  H HE3  . LYS B 2 49 ? -4.807  19.603  -1.211  1.00 0.00 ? 343 LYS B HE3  4  
ATOM 6249  H HZ1  . LYS B 2 49 ? -6.573  21.604  -0.908  1.00 0.00 ? 343 LYS B HZ1  4  
ATOM 6250  H HZ2  . LYS B 2 49 ? -7.564  20.261  -0.638  1.00 0.00 ? 343 LYS B HZ2  4  
ATOM 6251  H HZ3  . LYS B 2 49 ? -6.695  20.393  -2.082  1.00 0.00 ? 343 LYS B HZ3  4  
ATOM 6252  N N    . GLU B 2 50 ? -10.332 17.756  2.522   1.00 0.00 ? 344 GLU B N    4  
ATOM 6253  C CA   . GLU B 2 50 ? -11.628 18.280  2.083   1.00 0.00 ? 344 GLU B CA   4  
ATOM 6254  C C    . GLU B 2 50 ? -12.420 18.900  3.239   1.00 0.00 ? 344 GLU B C    4  
ATOM 6255  O O    . GLU B 2 50 ? -12.715 20.096  3.222   1.00 0.00 ? 344 GLU B O    4  
ATOM 6256  C CB   . GLU B 2 50 ? -12.449 17.167  1.425   1.00 0.00 ? 344 GLU B CB   4  
ATOM 6257  C CG   . GLU B 2 50 ? -11.851 16.658  0.119   1.00 0.00 ? 344 GLU B CG   4  
ATOM 6258  C CD   . GLU B 2 50 ? -12.521 15.395  -0.404  1.00 0.00 ? 344 GLU B CD   4  
ATOM 6259  O OE1  . GLU B 2 50 ? -13.451 14.882  0.261   1.00 0.00 ? 344 GLU B OE1  4  
ATOM 6260  O OE2  . GLU B 2 50 ? -12.111 14.913  -1.479  1.00 0.00 ? 344 GLU B OE2  4  
ATOM 6261  H H    . GLU B 2 50 ? -10.152 16.799  2.421   1.00 0.00 ? 344 GLU B H    4  
ATOM 6262  H HA   . GLU B 2 50 ? -11.437 19.048  1.349   1.00 0.00 ? 344 GLU B HA   4  
ATOM 6263  H HB2  . GLU B 2 50 ? -12.520 16.335  2.112   1.00 0.00 ? 344 GLU B HB2  4  
ATOM 6264  H HB3  . GLU B 2 50 ? -13.441 17.540  1.221   1.00 0.00 ? 344 GLU B HB3  4  
ATOM 6265  H HG2  . GLU B 2 50 ? -11.951 17.430  -0.628  1.00 0.00 ? 344 GLU B HG2  4  
ATOM 6266  H HG3  . GLU B 2 50 ? -10.803 16.452  0.278   1.00 0.00 ? 344 GLU B HG3  4  
ATOM 6267  N N    . ALA B 2 51 ? -12.774 18.080  4.235   1.00 0.00 ? 345 ALA B N    4  
ATOM 6268  C CA   . ALA B 2 51 ? -13.546 18.556  5.386   1.00 0.00 ? 345 ALA B CA   4  
ATOM 6269  C C    . ALA B 2 51 ? -12.701 19.423  6.320   1.00 0.00 ? 345 ALA B C    4  
ATOM 6270  O O    . ALA B 2 51 ? -13.159 20.470  6.783   1.00 0.00 ? 345 ALA B O    4  
ATOM 6271  C CB   . ALA B 2 51 ? -14.135 17.377  6.148   1.00 0.00 ? 345 ALA B CB   4  
ATOM 6272  H H    . ALA B 2 51 ? -12.517 17.135  4.189   1.00 0.00 ? 345 ALA B H    4  
ATOM 6273  H HA   . ALA B 2 51 ? -14.365 19.150  5.009   1.00 0.00 ? 345 ALA B HA   4  
ATOM 6274  H HB1  . ALA B 2 51 ? -15.150 17.207  5.818   1.00 0.00 ? 345 ALA B HB1  4  
ATOM 6275  H HB2  . ALA B 2 51 ? -14.132 17.595  7.206   1.00 0.00 ? 345 ALA B HB2  4  
ATOM 6276  H HB3  . ALA B 2 51 ? -13.544 16.493  5.959   1.00 0.00 ? 345 ALA B HB3  4  
ATOM 6277  N N    . GLY B 2 52 ? -11.470 18.987  6.590   1.00 0.00 ? 346 GLY B N    4  
ATOM 6278  C CA   . GLY B 2 52 ? -10.584 19.735  7.463   1.00 0.00 ? 346 GLY B CA   4  
ATOM 6279  C C    . GLY B 2 52 ? -10.593 19.218  8.889   1.00 0.00 ? 346 GLY B C    4  
ATOM 6280  O O    . GLY B 2 52 ? -9.789  18.356  9.247   1.00 0.00 ? 346 GLY B O    4  
ATOM 6281  H H    . GLY B 2 52 ? -11.161 18.147  6.192   1.00 0.00 ? 346 GLY B H    4  
ATOM 6282  H HA2  . GLY B 2 52 ? -9.578  19.670  7.076   1.00 0.00 ? 346 GLY B HA2  4  
ATOM 6283  H HA3  . GLY B 2 52 ? -10.889 20.772  7.466   1.00 0.00 ? 346 GLY B HA3  4  
ATOM 6284  N N    . GLY B 2 53 ? -11.501 19.753  9.705   1.00 0.00 ? 347 GLY B N    4  
ATOM 6285  C CA   . GLY B 2 53 ? -11.600 19.342  11.098  1.00 0.00 ? 347 GLY B CA   4  
ATOM 6286  C C    . GLY B 2 53 ? -12.870 18.563  11.414  1.00 0.00 ? 347 GLY B C    4  
ATOM 6287  O O    . GLY B 2 53 ? -12.942 17.893  12.446  1.00 0.00 ? 347 GLY B O    4  
ATOM 6288  H H    . GLY B 2 53 ? -12.109 20.439  9.356   1.00 0.00 ? 347 GLY B H    4  
ATOM 6289  H HA2  . GLY B 2 53 ? -10.749 18.723  11.337  1.00 0.00 ? 347 GLY B HA2  4  
ATOM 6290  H HA3  . GLY B 2 53 ? -11.572 20.225  11.719  1.00 0.00 ? 347 GLY B HA3  4  
ATOM 6291  N N    . ASN B 2 54 ? -13.874 18.649  10.537  1.00 0.00 ? 348 ASN B N    4  
ATOM 6292  C CA   . ASN B 2 54 ? -15.142 17.945  10.744  1.00 0.00 ? 348 ASN B CA   4  
ATOM 6293  C C    . ASN B 2 54 ? -15.017 16.455  10.411  1.00 0.00 ? 348 ASN B C    4  
ATOM 6294  O O    . ASN B 2 54 ? -15.738 15.628  10.974  1.00 0.00 ? 348 ASN B O    4  
ATOM 6295  C CB   . ASN B 2 54 ? -16.249 18.578  9.895   1.00 0.00 ? 348 ASN B CB   4  
ATOM 6296  C CG   . ASN B 2 54 ? -16.491 20.036  10.249  1.00 0.00 ? 348 ASN B CG   4  
ATOM 6297  O OD1  . ASN B 2 54 ? -16.853 20.358  11.381  1.00 0.00 ? 348 ASN B OD1  4  
ATOM 6298  N ND2  . ASN B 2 54 ? -16.291 20.925  9.282   1.00 0.00 ? 348 ASN B ND2  4  
ATOM 6299  H H    . ASN B 2 54 ? -13.764 19.200  9.733   1.00 0.00 ? 348 ASN B H    4  
ATOM 6300  H HA   . ASN B 2 54 ? -15.404 18.044  11.787  1.00 0.00 ? 348 ASN B HA   4  
ATOM 6301  H HB2  . ASN B 2 54 ? -15.971 18.522  8.853   1.00 0.00 ? 348 ASN B HB2  4  
ATOM 6302  H HB3  . ASN B 2 54 ? -17.168 18.033  10.048  1.00 0.00 ? 348 ASN B HB3  4  
ATOM 6303  H HD21 . ASN B 2 54 ? -16.002 20.601  8.404   1.00 0.00 ? 348 ASN B HD21 4  
ATOM 6304  H HD22 . ASN B 2 54 ? -16.441 21.872  9.487   1.00 0.00 ? 348 ASN B HD22 4  
ATOM 6305  N N    . TYR B 2 55 ? -14.104 16.120  9.496   1.00 0.00 ? 349 TYR B N    4  
ATOM 6306  C CA   . TYR B 2 55 ? -13.889 14.732  9.090   1.00 0.00 ? 349 TYR B CA   4  
ATOM 6307  C C    . TYR B 2 55 ? -13.092 13.950  10.133  1.00 0.00 ? 349 TYR B C    4  
ATOM 6308  O O    . TYR B 2 55 ? -13.531 12.896  10.586  1.00 0.00 ? 349 TYR B O    4  
ATOM 6309  C CB   . TYR B 2 55 ? -13.141 14.674  7.750   1.00 0.00 ? 349 TYR B CB   4  
ATOM 6310  C CG   . TYR B 2 55 ? -12.497 13.328  7.475   1.00 0.00 ? 349 TYR B CG   4  
ATOM 6311  C CD1  . TYR B 2 55 ? -13.262 12.224  7.126   1.00 0.00 ? 349 TYR B CD1  4  
ATOM 6312  C CD2  . TYR B 2 55 ? -11.122 13.162  7.598   1.00 0.00 ? 349 TYR B CD2  4  
ATOM 6313  C CE1  . TYR B 2 55 ? -12.676 10.992  6.901   1.00 0.00 ? 349 TYR B CE1  4  
ATOM 6314  C CE2  . TYR B 2 55 ? -10.526 11.935  7.373   1.00 0.00 ? 349 TYR B CE2  4  
ATOM 6315  C CZ   . TYR B 2 55 ? -11.308 10.853  7.026   1.00 0.00 ? 349 TYR B CZ   4  
ATOM 6316  O OH   . TYR B 2 55 ? -10.724 9.627   6.805   1.00 0.00 ? 349 TYR B OH   4  
ATOM 6317  H H    . TYR B 2 55 ? -13.561 16.824  9.083   1.00 0.00 ? 349 TYR B H    4  
ATOM 6318  H HA   . TYR B 2 55 ? -14.855 14.268  8.969   1.00 0.00 ? 349 TYR B HA   4  
ATOM 6319  H HB2  . TYR B 2 55 ? -13.835 14.880  6.949   1.00 0.00 ? 349 TYR B HB2  4  
ATOM 6320  H HB3  . TYR B 2 55 ? -12.362 15.423  7.747   1.00 0.00 ? 349 TYR B HB3  4  
ATOM 6321  H HD1  . TYR B 2 55 ? -14.332 12.336  7.026   1.00 0.00 ? 349 TYR B HD1  4  
ATOM 6322  H HD2  . TYR B 2 55 ? -10.513 14.010  7.872   1.00 0.00 ? 349 TYR B HD2  4  
ATOM 6323  H HE1  . TYR B 2 55 ? -13.288 10.145  6.629   1.00 0.00 ? 349 TYR B HE1  4  
ATOM 6324  H HE2  . TYR B 2 55 ? -9.453  11.828  7.477   1.00 0.00 ? 349 TYR B HE2  4  
ATOM 6325  H HH   . TYR B 2 55 ? -11.046 8.995   7.452   1.00 0.00 ? 349 TYR B HH   4  
ATOM 6326  N N    . THR B 2 56 ? -11.902 14.465  10.457  1.00 0.00 ? 350 THR B N    4  
ATOM 6327  C CA   . THR B 2 56 ? -10.970 13.832  11.395  1.00 0.00 ? 350 THR B CA   4  
ATOM 6328  C C    . THR B 2 56 ? -10.453 12.520  10.787  1.00 0.00 ? 350 THR B C    4  
ATOM 6329  O O    . THR B 2 56 ? -11.231 11.679  10.333  1.00 0.00 ? 350 THR B O    4  
ATOM 6330  C CB   . THR B 2 56 ? -11.589 13.594  12.781  1.00 0.00 ? 350 THR B CB   4  
ATOM 6331  O OG1  . THR B 2 56 ? -10.601 13.745  13.788  1.00 0.00 ? 350 THR B OG1  4  
ATOM 6332  C CG2  . THR B 2 56 ? -12.140 12.208  12.960  1.00 0.00 ? 350 THR B CG2  4  
ATOM 6333  H H    . THR B 2 56 ? -11.619 15.294  10.016  1.00 0.00 ? 350 THR B H    4  
ATOM 6334  H HA   . THR B 2 56 ? -10.136 14.492  11.510  1.00 0.00 ? 350 THR B HA   4  
ATOM 6335  H HB   . THR B 2 56 ? -12.383 14.304  12.955  1.00 0.00 ? 350 THR B HB   4  
ATOM 6336  H HG1  . THR B 2 56 ? -9.854  13.173  13.599  1.00 0.00 ? 350 THR B HG1  4  
ATOM 6337  H HG21 . THR B 2 56 ? -12.960 12.052  12.285  1.00 0.00 ? 350 THR B HG21 4  
ATOM 6338  H HG22 . THR B 2 56 ? -12.475 12.081  13.976  1.00 0.00 ? 350 THR B HG22 4  
ATOM 6339  H HG23 . THR B 2 56 ? -11.355 11.499  12.744  1.00 0.00 ? 350 THR B HG23 4  
ATOM 6340  N N    . PRO B 2 57 ? -9.122  12.350  10.740  1.00 0.00 ? 351 PRO B N    4  
ATOM 6341  C CA   . PRO B 2 57 ? -8.481  11.163  10.152  1.00 0.00 ? 351 PRO B CA   4  
ATOM 6342  C C    . PRO B 2 57 ? -8.884  9.849   10.811  1.00 0.00 ? 351 PRO B C    4  
ATOM 6343  O O    . PRO B 2 57 ? -8.658  9.642   12.007  1.00 0.00 ? 351 PRO B O    4  
ATOM 6344  C CB   . PRO B 2 57 ? -6.986  11.423  10.368  1.00 0.00 ? 351 PRO B CB   4  
ATOM 6345  C CG   . PRO B 2 57 ? -6.880  12.897  10.515  1.00 0.00 ? 351 PRO B CG   4  
ATOM 6346  C CD   . PRO B 2 57 ? -8.130  13.317  11.229  1.00 0.00 ? 351 PRO B CD   4  
ATOM 6347  H HA   . PRO B 2 57 ? -8.677  11.096  9.092   1.00 0.00 ? 351 PRO B HA   4  
ATOM 6348  H HB2  . PRO B 2 57 ? -6.652  10.909  11.258  1.00 0.00 ? 351 PRO B HB2  4  
ATOM 6349  H HB3  . PRO B 2 57 ? -6.432  11.070  9.512   1.00 0.00 ? 351 PRO B HB3  4  
ATOM 6350  H HG2  . PRO B 2 57 ? -6.007  13.149  11.100  1.00 0.00 ? 351 PRO B HG2  4  
ATOM 6351  H HG3  . PRO B 2 57 ? -6.832  13.361  9.541   1.00 0.00 ? 351 PRO B HG3  4  
ATOM 6352  H HD2  . PRO B 2 57 ? -8.009  13.230  12.299  1.00 0.00 ? 351 PRO B HD2  4  
ATOM 6353  H HD3  . PRO B 2 57 ? -8.405  14.324  10.956  1.00 0.00 ? 351 PRO B HD3  4  
ATOM 6354  N N    . ALA B 2 58 ? -9.451  8.949   10.007  1.00 0.00 ? 352 ALA B N    4  
ATOM 6355  C CA   . ALA B 2 58 ? -9.852  7.629   10.483  1.00 0.00 ? 352 ALA B CA   4  
ATOM 6356  C C    . ALA B 2 58 ? -8.654  6.671   10.470  1.00 0.00 ? 352 ALA B C    4  
ATOM 6357  O O    . ALA B 2 58 ? -8.692  5.609   11.090  1.00 0.00 ? 352 ALA B O    4  
ATOM 6358  C CB   . ALA B 2 58 ? -10.988 7.078   9.629   1.00 0.00 ? 352 ALA B CB   4  
ATOM 6359  H H    . ALA B 2 58 ? -9.575  9.172   9.060   1.00 0.00 ? 352 ALA B H    4  
ATOM 6360  H HA   . ALA B 2 58 ? -10.210 7.731   11.497  1.00 0.00 ? 352 ALA B HA   4  
ATOM 6361  H HB1  . ALA B 2 58 ? -11.609 7.892   9.288   1.00 0.00 ? 352 ALA B HB1  4  
ATOM 6362  H HB2  . ALA B 2 58 ? -11.580 6.394   10.218  1.00 0.00 ? 352 ALA B HB2  4  
ATOM 6363  H HB3  . ALA B 2 58 ? -10.576 6.557   8.776   1.00 0.00 ? 352 ALA B HB3  4  
ATOM 6364  N N    . LEU B 2 59 ? -7.587  7.076   9.768   1.00 0.00 ? 353 LEU B N    4  
ATOM 6365  C CA   . LEU B 2 59 ? -6.358  6.293   9.664   1.00 0.00 ? 353 LEU B CA   4  
ATOM 6366  C C    . LEU B 2 59 ? -5.174  7.187   9.332   1.00 0.00 ? 353 LEU B C    4  
ATOM 6367  O O    . LEU B 2 59 ? -5.330  8.331   8.902   1.00 0.00 ? 353 LEU B O    4  
ATOM 6368  C CB   . LEU B 2 59 ? -6.438  5.239   8.555   1.00 0.00 ? 353 LEU B CB   4  
ATOM 6369  C CG   . LEU B 2 59 ? -6.493  3.781   9.003   1.00 0.00 ? 353 LEU B CG   4  
ATOM 6370  C CD1  . LEU B 2 59 ? -7.872  3.402   9.524   1.00 0.00 ? 353 LEU B CD1  4  
ATOM 6371  C CD2  . LEU B 2 59 ? -6.053  2.867   7.863   1.00 0.00 ? 353 LEU B CD2  4  
ATOM 6372  H H    . LEU B 2 59 ? -7.625  7.938   9.310   1.00 0.00 ? 353 LEU B H    4  
ATOM 6373  H HA   . LEU B 2 59 ? -6.184  5.805   10.610  1.00 0.00 ? 353 LEU B HA   4  
ATOM 6374  H HB2  . LEU B 2 59 ? -7.303  5.445   7.948   1.00 0.00 ? 353 LEU B HB2  4  
ATOM 6375  H HB3  . LEU B 2 59 ? -5.551  5.353   7.942   1.00 0.00 ? 353 LEU B HB3  4  
ATOM 6376  H HG   . LEU B 2 59 ? -5.802  3.650   9.804   1.00 0.00 ? 353 LEU B HG   4  
ATOM 6377  H HD11 . LEU B 2 59 ? -8.195  2.484   9.057   1.00 0.00 ? 353 LEU B HD11 4  
ATOM 6378  H HD12 . LEU B 2 59 ? -8.575  4.188   9.291   1.00 0.00 ? 353 LEU B HD12 4  
ATOM 6379  H HD13 . LEU B 2 59 ? -7.826  3.265   10.594  1.00 0.00 ? 353 LEU B HD13 4  
ATOM 6380  H HD21 . LEU B 2 59 ? -6.916  2.393   7.424   1.00 0.00 ? 353 LEU B HD21 4  
ATOM 6381  H HD22 . LEU B 2 59 ? -5.385  2.109   8.248   1.00 0.00 ? 353 LEU B HD22 4  
ATOM 6382  H HD23 . LEU B 2 59 ? -5.535  3.451   7.109   1.00 0.00 ? 353 LEU B HD23 4  
ATOM 6383  N N    . THR B 2 60 ? -3.992  6.622   9.500   1.00 0.00 ? 354 THR B N    4  
ATOM 6384  C CA   . THR B 2 60 ? -2.740  7.294   9.198   1.00 0.00 ? 354 THR B CA   4  
ATOM 6385  C C    . THR B 2 60 ? -1.689  6.237   8.891   1.00 0.00 ? 354 THR B C    4  
ATOM 6386  O O    . THR B 2 60 ? -1.996  5.042   8.890   1.00 0.00 ? 354 THR B O    4  
ATOM 6387  C CB   . THR B 2 60 ? -2.288  8.174   10.370  1.00 0.00 ? 354 THR B CB   4  
ATOM 6388  O OG1  . THR B 2 60 ? -2.180  7.415   11.562  1.00 0.00 ? 354 THR B OG1  4  
ATOM 6389  C CG2  . THR B 2 60 ? -3.217  9.339   10.649  1.00 0.00 ? 354 THR B CG2  4  
ATOM 6390  H H    . THR B 2 60 ? -3.959  5.694   9.819   1.00 0.00 ? 354 THR B H    4  
ATOM 6391  H HA   . THR B 2 60 ? -2.890  7.908   8.320   1.00 0.00 ? 354 THR B HA   4  
ATOM 6392  H HB   . THR B 2 60 ? -1.313  8.581   10.143  1.00 0.00 ? 354 THR B HB   4  
ATOM 6393  H HG1  . THR B 2 60 ? -1.322  7.567   11.962  1.00 0.00 ? 354 THR B HG1  4  
ATOM 6394  H HG21 . THR B 2 60 ? -4.128  8.974   11.099  1.00 0.00 ? 354 THR B HG21 4  
ATOM 6395  H HG22 . THR B 2 60 ? -3.450  9.842   9.721   1.00 0.00 ? 354 THR B HG22 4  
ATOM 6396  H HG23 . THR B 2 60 ? -2.736  10.031  11.322  1.00 0.00 ? 354 THR B HG23 4  
ATOM 6397  N N    . GLU B 2 61 ? -0.452  6.658   8.662   1.00 0.00 ? 355 GLU B N    4  
ATOM 6398  C CA   . GLU B 2 61 ? 0.620   5.702   8.397   1.00 0.00 ? 355 GLU B CA   4  
ATOM 6399  C C    . GLU B 2 61 ? 0.682   4.691   9.547   1.00 0.00 ? 355 GLU B C    4  
ATOM 6400  O O    . GLU B 2 61 ? 1.076   3.540   9.359   1.00 0.00 ? 355 GLU B O    4  
ATOM 6401  C CB   . GLU B 2 61 ? 1.980   6.402   8.262   1.00 0.00 ? 355 GLU B CB   4  
ATOM 6402  C CG   . GLU B 2 61 ? 2.027   7.529   7.242   1.00 0.00 ? 355 GLU B CG   4  
ATOM 6403  C CD   . GLU B 2 61 ? 1.473   8.843   7.769   1.00 0.00 ? 355 GLU B CD   4  
ATOM 6404  O OE1  . GLU B 2 61 ? 2.040   9.375   8.746   1.00 0.00 ? 355 GLU B OE1  4  
ATOM 6405  O OE2  . GLU B 2 61 ? 0.476   9.339   7.205   1.00 0.00 ? 355 GLU B OE2  4  
ATOM 6406  H H    . GLU B 2 61 ? -0.253  7.614   8.696   1.00 0.00 ? 355 GLU B H    4  
ATOM 6407  H HA   . GLU B 2 61 ? 0.389   5.179   7.479   1.00 0.00 ? 355 GLU B HA   4  
ATOM 6408  H HB2  . GLU B 2 61 ? 2.249   6.812   9.217   1.00 0.00 ? 355 GLU B HB2  4  
ATOM 6409  H HB3  . GLU B 2 61 ? 2.717   5.665   7.981   1.00 0.00 ? 355 GLU B HB3  4  
ATOM 6410  H HG2  . GLU B 2 61 ? 3.053   7.683   6.958   1.00 0.00 ? 355 GLU B HG2  4  
ATOM 6411  H HG3  . GLU B 2 61 ? 1.457   7.234   6.373   1.00 0.00 ? 355 GLU B HG3  4  
ATOM 6412  N N    . GLN B 2 62 ? 0.280   5.152   10.739  1.00 0.00 ? 356 GLN B N    4  
ATOM 6413  C CA   . GLN B 2 62 ? 0.272   4.334   11.947  1.00 0.00 ? 356 GLN B CA   4  
ATOM 6414  C C    . GLN B 2 62 ? -0.681  3.146   11.830  1.00 0.00 ? 356 GLN B C    4  
ATOM 6415  O O    . GLN B 2 62 ? -0.309  2.030   12.186  1.00 0.00 ? 356 GLN B O    4  
ATOM 6416  C CB   . GLN B 2 62 ? -0.107  5.189   13.159  1.00 0.00 ? 356 GLN B CB   4  
ATOM 6417  C CG   . GLN B 2 62 ? 0.854   6.340   13.416  1.00 0.00 ? 356 GLN B CG   4  
ATOM 6418  C CD   . GLN B 2 62 ? 0.425   7.214   14.579  1.00 0.00 ? 356 GLN B CD   4  
ATOM 6419  O OE1  . GLN B 2 62 ? 0.320   6.749   15.714  1.00 0.00 ? 356 GLN B OE1  4  
ATOM 6420  N NE2  . GLN B 2 62 ? 0.171   8.490   14.302  1.00 0.00 ? 356 GLN B NE2  4  
ATOM 6421  H H    . GLN B 2 62 ? -0.022  6.079   10.805  1.00 0.00 ? 356 GLN B H    4  
ATOM 6422  H HA   . GLN B 2 62 ? 1.273   3.957   12.092  1.00 0.00 ? 356 GLN B HA   4  
ATOM 6423  H HB2  . GLN B 2 62 ? -1.093  5.601   12.999  1.00 0.00 ? 356 GLN B HB2  4  
ATOM 6424  H HB3  . GLN B 2 62 ? -0.126  4.561   14.036  1.00 0.00 ? 356 GLN B HB3  4  
ATOM 6425  H HG2  . GLN B 2 62 ? 1.831   5.933   13.633  1.00 0.00 ? 356 GLN B HG2  4  
ATOM 6426  H HG3  . GLN B 2 62 ? 0.911   6.951   12.526  1.00 0.00 ? 356 GLN B HG3  4  
ATOM 6427  H HE21 . GLN B 2 62 ? 0.272   8.793   13.375  1.00 0.00 ? 356 GLN B HE21 4  
ATOM 6428  H HE22 . GLN B 2 62 ? -0.109  9.074   15.036  1.00 0.00 ? 356 GLN B HE22 4  
ATOM 6429  N N    . GLU B 2 63 ? -1.906  3.369   11.328  1.00 0.00 ? 357 GLU B N    4  
ATOM 6430  C CA   . GLU B 2 63 ? -2.862  2.273   11.180  1.00 0.00 ? 357 GLU B CA   4  
ATOM 6431  C C    . GLU B 2 63 ? -2.424  1.343   10.062  1.00 0.00 ? 357 GLU B C    4  
ATOM 6432  O O    . GLU B 2 63 ? -2.602  0.127   10.138  1.00 0.00 ? 357 GLU B O    4  
ATOM 6433  C CB   . GLU B 2 63 ? -4.256  2.789   10.831  1.00 0.00 ? 357 GLU B CB   4  
ATOM 6434  C CG   . GLU B 2 63 ? -4.815  3.872   11.744  1.00 0.00 ? 357 GLU B CG   4  
ATOM 6435  C CD   . GLU B 2 63 ? -4.965  3.424   13.186  1.00 0.00 ? 357 GLU B CD   4  
ATOM 6436  O OE1  . GLU B 2 63 ? -3.933  3.150   13.838  1.00 0.00 ? 357 GLU B OE1  4  
ATOM 6437  O OE2  . GLU B 2 63 ? -6.115  3.345   13.665  1.00 0.00 ? 357 GLU B OE2  4  
ATOM 6438  H H    . GLU B 2 63 ? -2.167  4.279   11.038  1.00 0.00 ? 357 GLU B H    4  
ATOM 6439  H HA   . GLU B 2 63 ? -2.903  1.725   12.110  1.00 0.00 ? 357 GLU B HA   4  
ATOM 6440  H HB2  . GLU B 2 63 ? -4.224  3.189   9.829   1.00 0.00 ? 357 GLU B HB2  4  
ATOM 6441  H HB3  . GLU B 2 63 ? -4.942  1.955   10.844  1.00 0.00 ? 357 GLU B HB3  4  
ATOM 6442  H HG2  . GLU B 2 63 ? -4.155  4.725   11.713  1.00 0.00 ? 357 GLU B HG2  4  
ATOM 6443  H HG3  . GLU B 2 63 ? -5.793  4.162   11.364  1.00 0.00 ? 357 GLU B HG3  4  
ATOM 6444  N N    . VAL B 2 64 ? -1.872  1.943   9.011   1.00 0.00 ? 358 VAL B N    4  
ATOM 6445  C CA   . VAL B 2 64 ? -1.426  1.202   7.843   1.00 0.00 ? 358 VAL B CA   4  
ATOM 6446  C C    . VAL B 2 64 ? -0.274  0.265   8.183   1.00 0.00 ? 358 VAL B C    4  
ATOM 6447  O O    . VAL B 2 64 ? -0.408  -0.953  8.067   1.00 0.00 ? 358 VAL B O    4  
ATOM 6448  C CB   . VAL B 2 64 ? -0.997  2.186   6.737   1.00 0.00 ? 358 VAL B CB   4  
ATOM 6449  C CG1  . VAL B 2 64 ? -0.575  1.461   5.473   1.00 0.00 ? 358 VAL B CG1  4  
ATOM 6450  C CG2  . VAL B 2 64 ? -2.124  3.159   6.447   1.00 0.00 ? 358 VAL B CG2  4  
ATOM 6451  H H    . VAL B 2 64 ? -1.779  2.922   9.016   1.00 0.00 ? 358 VAL B H    4  
ATOM 6452  H HA   . VAL B 2 64 ? -2.258  0.622   7.476   1.00 0.00 ? 358 VAL B HA   4  
ATOM 6453  H HB   . VAL B 2 64 ? -0.152  2.753   7.097   1.00 0.00 ? 358 VAL B HB   4  
ATOM 6454  H HG11 . VAL B 2 64 ? -1.309  1.625   4.699   1.00 0.00 ? 358 VAL B HG11 4  
ATOM 6455  H HG12 . VAL B 2 64 ? -0.492  0.403   5.674   1.00 0.00 ? 358 VAL B HG12 4  
ATOM 6456  H HG13 . VAL B 2 64 ? 0.384   1.845   5.147   1.00 0.00 ? 358 VAL B HG13 4  
ATOM 6457  H HG21 . VAL B 2 64 ? -2.547  2.942   5.478   1.00 0.00 ? 358 VAL B HG21 4  
ATOM 6458  H HG22 . VAL B 2 64 ? -1.738  4.166   6.457   1.00 0.00 ? 358 VAL B HG22 4  
ATOM 6459  H HG23 . VAL B 2 64 ? -2.889  3.060   7.207   1.00 0.00 ? 358 VAL B HG23 4  
ATOM 6460  N N    . TYR B 2 65 ? 0.842   0.832   8.630   1.00 0.00 ? 359 TYR B N    4  
ATOM 6461  C CA   . TYR B 2 65 ? 2.005   0.039   9.013   1.00 0.00 ? 359 TYR B CA   4  
ATOM 6462  C C    . TYR B 2 65 ? 1.655   -0.945  10.133  1.00 0.00 ? 359 TYR B C    4  
ATOM 6463  O O    . TYR B 2 65 ? 2.207   -2.042  10.198  1.00 0.00 ? 359 TYR B O    4  
ATOM 6464  C CB   . TYR B 2 65 ? 3.160   0.958   9.433   1.00 0.00 ? 359 TYR B CB   4  
ATOM 6465  C CG   . TYR B 2 65 ? 4.439   0.225   9.775   1.00 0.00 ? 359 TYR B CG   4  
ATOM 6466  C CD1  . TYR B 2 65 ? 4.574   -0.462  10.976  1.00 0.00 ? 359 TYR B CD1  4  
ATOM 6467  C CD2  . TYR B 2 65 ? 5.510   0.211   8.890   1.00 0.00 ? 359 TYR B CD2  4  
ATOM 6468  C CE1  . TYR B 2 65 ? 5.738   -1.138  11.285  1.00 0.00 ? 359 TYR B CE1  4  
ATOM 6469  C CE2  . TYR B 2 65 ? 6.677   -0.463  9.191   1.00 0.00 ? 359 TYR B CE2  4  
ATOM 6470  C CZ   . TYR B 2 65 ? 6.787   -1.136  10.389  1.00 0.00 ? 359 TYR B CZ   4  
ATOM 6471  O OH   . TYR B 2 65 ? 7.949   -1.808  10.693  1.00 0.00 ? 359 TYR B OH   4  
ATOM 6472  H H    . TYR B 2 65 ? 0.879   1.809   8.721   1.00 0.00 ? 359 TYR B H    4  
ATOM 6473  H HA   . TYR B 2 65 ? 2.312   -0.527  8.146   1.00 0.00 ? 359 TYR B HA   4  
ATOM 6474  H HB2  . TYR B 2 65 ? 3.376   1.639   8.626   1.00 0.00 ? 359 TYR B HB2  4  
ATOM 6475  H HB3  . TYR B 2 65 ? 2.859   1.526   10.301  1.00 0.00 ? 359 TYR B HB3  4  
ATOM 6476  H HD1  . TYR B 2 65 ? 3.752   -0.461  11.677  1.00 0.00 ? 359 TYR B HD1  4  
ATOM 6477  H HD2  . TYR B 2 65 ? 5.422   0.739   7.952   1.00 0.00 ? 359 TYR B HD2  4  
ATOM 6478  H HE1  . TYR B 2 65 ? 5.824   -1.665  12.223  1.00 0.00 ? 359 TYR B HE1  4  
ATOM 6479  H HE2  . TYR B 2 65 ? 7.496   -0.462  8.487   1.00 0.00 ? 359 TYR B HE2  4  
ATOM 6480  H HH   . TYR B 2 65 ? 7.749   -2.727  10.885  1.00 0.00 ? 359 TYR B HH   4  
ATOM 6481  N N    . ALA B 2 66 ? 0.734   -0.538  11.015  1.00 0.00 ? 360 ALA B N    4  
ATOM 6482  C CA   . ALA B 2 66 ? 0.312   -1.376  12.140  1.00 0.00 ? 360 ALA B CA   4  
ATOM 6483  C C    . ALA B 2 66 ? -0.340  -2.681  11.678  1.00 0.00 ? 360 ALA B C    4  
ATOM 6484  O O    . ALA B 2 66 ? 0.130   -3.768  12.017  1.00 0.00 ? 360 ALA B O    4  
ATOM 6485  C CB   . ALA B 2 66 ? -0.641  -0.611  13.048  1.00 0.00 ? 360 ALA B CB   4  
ATOM 6486  H H    . ALA B 2 66 ? 0.332   0.355   10.905  1.00 0.00 ? 360 ALA B H    4  
ATOM 6487  H HA   . ALA B 2 66 ? 1.194   -1.618  12.716  1.00 0.00 ? 360 ALA B HA   4  
ATOM 6488  H HB1  . ALA B 2 66 ? -1.388  -0.114  12.449  1.00 0.00 ? 360 ALA B HB1  4  
ATOM 6489  H HB2  . ALA B 2 66 ? -0.086  0.123   13.614  1.00 0.00 ? 360 ALA B HB2  4  
ATOM 6490  H HB3  . ALA B 2 66 ? -1.122  -1.299  13.727  1.00 0.00 ? 360 ALA B HB3  4  
ATOM 6491  N N    . GLN B 2 67 ? -1.431  -2.565  10.919  1.00 0.00 ? 361 GLN B N    4  
ATOM 6492  C CA   . GLN B 2 67 ? -2.156  -3.740  10.430  1.00 0.00 ? 361 GLN B CA   4  
ATOM 6493  C C    . GLN B 2 67 ? -1.312  -4.559  9.450   1.00 0.00 ? 361 GLN B C    4  
ATOM 6494  O O    . GLN B 2 67 ? -1.392  -5.788  9.437   1.00 0.00 ? 361 GLN B O    4  
ATOM 6495  C CB   . GLN B 2 67 ? -3.479  -3.322  9.777   1.00 0.00 ? 361 GLN B CB   4  
ATOM 6496  C CG   . GLN B 2 67 ? -4.402  -2.558  10.722  1.00 0.00 ? 361 GLN B CG   4  
ATOM 6497  C CD   . GLN B 2 67 ? -5.758  -2.203  10.119  1.00 0.00 ? 361 GLN B CD   4  
ATOM 6498  O OE1  . GLN B 2 67 ? -6.485  -1.378  10.671  1.00 0.00 ? 361 GLN B OE1  4  
ATOM 6499  N NE2  . GLN B 2 67 ? -6.127  -2.838  9.007   1.00 0.00 ? 361 GLN B NE2  4  
ATOM 6500  H H    . GLN B 2 67 ? -1.764  -1.671  10.692  1.00 0.00 ? 361 GLN B H    4  
ATOM 6501  H HA   . GLN B 2 67 ? -2.377  -4.362  11.285  1.00 0.00 ? 361 GLN B HA   4  
ATOM 6502  H HB2  . GLN B 2 67 ? -3.267  -2.693  8.926   1.00 0.00 ? 361 GLN B HB2  4  
ATOM 6503  H HB3  . GLN B 2 67 ? -3.996  -4.208  9.441   1.00 0.00 ? 361 GLN B HB3  4  
ATOM 6504  H HG2  . GLN B 2 67 ? -4.571  -3.163  11.599  1.00 0.00 ? 361 GLN B HG2  4  
ATOM 6505  H HG3  . GLN B 2 67 ? -3.908  -1.643  11.014  1.00 0.00 ? 361 GLN B HG3  4  
ATOM 6506  H HE21 . GLN B 2 67 ? -5.521  -3.502  8.624   1.00 0.00 ? 361 GLN B HE21 4  
ATOM 6507  H HE22 . GLN B 2 67 ? -6.995  -2.608  8.614   1.00 0.00 ? 361 GLN B HE22 4  
ATOM 6508  N N    . VAL B 2 68 ? -0.493  -3.880  8.643   1.00 0.00 ? 362 VAL B N    4  
ATOM 6509  C CA   . VAL B 2 68 ? 0.374   -4.561  7.677   1.00 0.00 ? 362 VAL B CA   4  
ATOM 6510  C C    . VAL B 2 68 ? 1.470   -5.346  8.396   1.00 0.00 ? 362 VAL B C    4  
ATOM 6511  O O    . VAL B 2 68 ? 1.826   -6.449  7.978   1.00 0.00 ? 362 VAL B O    4  
ATOM 6512  C CB   . VAL B 2 68 ? 1.029   -3.568  6.696   1.00 0.00 ? 362 VAL B CB   4  
ATOM 6513  C CG1  . VAL B 2 68 ? 1.933   -4.296  5.709   1.00 0.00 ? 362 VAL B CG1  4  
ATOM 6514  C CG2  . VAL B 2 68 ? -0.030  -2.758  5.960   1.00 0.00 ? 362 VAL B CG2  4  
ATOM 6515  H H    . VAL B 2 68 ? -0.462  -2.901  8.704   1.00 0.00 ? 362 VAL B H    4  
ATOM 6516  H HA   . VAL B 2 68 ? -0.236  -5.248  7.109   1.00 0.00 ? 362 VAL B HA   4  
ATOM 6517  H HB   . VAL B 2 68 ? 1.639   -2.885  7.270   1.00 0.00 ? 362 VAL B HB   4  
ATOM 6518  H HG11 . VAL B 2 68 ? 1.432   -5.185  5.352   1.00 0.00 ? 362 VAL B HG11 4  
ATOM 6519  H HG12 . VAL B 2 68 ? 2.854   -4.574  6.198   1.00 0.00 ? 362 VAL B HG12 4  
ATOM 6520  H HG13 . VAL B 2 68 ? 2.151   -3.648  4.872   1.00 0.00 ? 362 VAL B HG13 4  
ATOM 6521  H HG21 . VAL B 2 68 ? -1.010  -3.034  6.319   1.00 0.00 ? 362 VAL B HG21 4  
ATOM 6522  H HG22 . VAL B 2 68 ? 0.034   -2.958  4.903   1.00 0.00 ? 362 VAL B HG22 4  
ATOM 6523  H HG23 . VAL B 2 68 ? 0.133   -1.706  6.135   1.00 0.00 ? 362 VAL B HG23 4  
ATOM 6524  N N    . ALA B 2 69 ? 1.995   -4.772  9.484   1.00 0.00 ? 363 ALA B N    4  
ATOM 6525  C CA   . ALA B 2 69 ? 3.043   -5.419  10.273  1.00 0.00 ? 363 ALA B CA   4  
ATOM 6526  C C    . ALA B 2 69 ? 2.611   -6.814  10.726  1.00 0.00 ? 363 ALA B C    4  
ATOM 6527  O O    . ALA B 2 69 ? 3.428   -7.735  10.782  1.00 0.00 ? 363 ALA B O    4  
ATOM 6528  C CB   . ALA B 2 69 ? 3.409   -4.561  11.478  1.00 0.00 ? 363 ALA B CB   4  
ATOM 6529  H H    . ALA B 2 69 ? 1.663   -3.893  9.767   1.00 0.00 ? 363 ALA B H    4  
ATOM 6530  H HA   . ALA B 2 69 ? 3.919   -5.510  9.648   1.00 0.00 ? 363 ALA B HA   4  
ATOM 6531  H HB1  . ALA B 2 69 ? 3.989   -3.710  11.151  1.00 0.00 ? 363 ALA B HB1  4  
ATOM 6532  H HB2  . ALA B 2 69 ? 3.990   -5.147  12.175  1.00 0.00 ? 363 ALA B HB2  4  
ATOM 6533  H HB3  . ALA B 2 69 ? 2.507   -4.217  11.962  1.00 0.00 ? 363 ALA B HB3  4  
ATOM 6534  N N    . ARG B 2 70 ? 1.316   -6.967  11.027  1.00 0.00 ? 364 ARG B N    4  
ATOM 6535  C CA   . ARG B 2 70 ? 0.777   -8.259  11.451  1.00 0.00 ? 364 ARG B CA   4  
ATOM 6536  C C    . ARG B 2 70 ? 0.756   -9.247  10.288  1.00 0.00 ? 364 ARG B C    4  
ATOM 6537  O O    . ARG B 2 70 ? 0.988   -10.439 10.475  1.00 0.00 ? 364 ARG B O    4  
ATOM 6538  C CB   . ARG B 2 70 ? -0.629  -8.103  12.042  1.00 0.00 ? 364 ARG B CB   4  
ATOM 6539  C CG   . ARG B 2 70 ? -0.634  -7.882  13.546  1.00 0.00 ? 364 ARG B CG   4  
ATOM 6540  C CD   . ARG B 2 70 ? -2.049  -7.751  14.090  1.00 0.00 ? 364 ARG B CD   4  
ATOM 6541  N NE   . ARG B 2 70 ? -2.101  -7.906  15.546  1.00 0.00 ? 364 ARG B NE   4  
ATOM 6542  C CZ   . ARG B 2 70 ? -1.534  -7.067  16.420  1.00 0.00 ? 364 ARG B CZ   4  
ATOM 6543  N NH1  . ARG B 2 70 ? -0.910  -5.966  16.004  1.00 0.00 ? 364 ARG B NH1  4  
ATOM 6544  N NH2  . ARG B 2 70 ? -1.608  -7.324  17.723  1.00 0.00 ? 364 ARG B NH2  4  
ATOM 6545  H H    . ARG B 2 70 ? 0.710   -6.199  10.943  1.00 0.00 ? 364 ARG B H    4  
ATOM 6546  H HA   . ARG B 2 70 ? 1.433   -8.649  12.216  1.00 0.00 ? 364 ARG B HA   4  
ATOM 6547  H HB2  . ARG B 2 70 ? -1.113  -7.259  11.573  1.00 0.00 ? 364 ARG B HB2  4  
ATOM 6548  H HB3  . ARG B 2 70 ? -1.198  -8.996  11.830  1.00 0.00 ? 364 ARG B HB3  4  
ATOM 6549  H HG2  . ARG B 2 70 ? -0.151  -8.721  14.025  1.00 0.00 ? 364 ARG B HG2  4  
ATOM 6550  H HG3  . ARG B 2 70 ? -0.085  -6.977  13.766  1.00 0.00 ? 364 ARG B HG3  4  
ATOM 6551  H HD2  . ARG B 2 70 ? -2.432  -6.777  13.828  1.00 0.00 ? 364 ARG B HD2  4  
ATOM 6552  H HD3  . ARG B 2 70 ? -2.666  -8.512  13.635  1.00 0.00 ? 364 ARG B HD3  4  
ATOM 6553  H HE   . ARG B 2 70 ? -2.574  -8.691  15.895  1.00 0.00 ? 364 ARG B HE   4  
ATOM 6554  H HH11 . ARG B 2 70 ? -0.859  -5.755  15.030  1.00 0.00 ? 364 ARG B HH11 4  
ATOM 6555  H HH12 . ARG B 2 70 ? -0.490  -5.350  16.671  1.00 0.00 ? 364 ARG B HH12 4  
ATOM 6556  H HH21 . ARG B 2 70 ? -2.084  -8.142  18.045  1.00 0.00 ? 364 ARG B HH21 4  
ATOM 6557  H HH22 . ARG B 2 70 ? -1.185  -6.701  18.382  1.00 0.00 ? 364 ARG B HH22 4  
ATOM 6558  N N    . LEU B 2 71 ? 0.488   -8.745  9.084   1.00 0.00 ? 365 LEU B N    4  
ATOM 6559  C CA   . LEU B 2 71 ? 0.465   -9.593  7.899   1.00 0.00 ? 365 LEU B CA   4  
ATOM 6560  C C    . LEU B 2 71 ? 1.863   -10.149 7.610   1.00 0.00 ? 365 LEU B C    4  
ATOM 6561  O O    . LEU B 2 71 ? 2.031   -11.343 7.356   1.00 0.00 ? 365 LEU B O    4  
ATOM 6562  C CB   . LEU B 2 71 ? -0.028  -8.813  6.666   1.00 0.00 ? 365 LEU B CB   4  
ATOM 6563  C CG   . LEU B 2 71 ? -1.389  -8.120  6.802   1.00 0.00 ? 365 LEU B CG   4  
ATOM 6564  C CD1  . LEU B 2 71 ? -1.780  -7.443  5.493   1.00 0.00 ? 365 LEU B CD1  4  
ATOM 6565  C CD2  . LEU B 2 71 ? -2.464  -9.106  7.240   1.00 0.00 ? 365 LEU B CD2  4  
ATOM 6566  H H    . LEU B 2 71 ? 0.317   -7.784  8.989   1.00 0.00 ? 365 LEU B H    4  
ATOM 6567  H HA   . LEU B 2 71 ? -0.207  -10.417 8.089   1.00 0.00 ? 365 LEU B HA   4  
ATOM 6568  H HB2  . LEU B 2 71 ? 0.708   -8.059  6.433   1.00 0.00 ? 365 LEU B HB2  4  
ATOM 6569  H HB3  . LEU B 2 71 ? -0.083  -9.501  5.837   1.00 0.00 ? 365 LEU B HB3  4  
ATOM 6570  H HG   . LEU B 2 71 ? -1.314  -7.356  7.554   1.00 0.00 ? 365 LEU B HG   4  
ATOM 6571  H HD11 . LEU B 2 71 ? -1.122  -7.774  4.702   1.00 0.00 ? 365 LEU B HD11 4  
ATOM 6572  H HD12 . LEU B 2 71 ? -1.696  -6.372  5.602   1.00 0.00 ? 365 LEU B HD12 4  
ATOM 6573  H HD13 . LEU B 2 71 ? -2.800  -7.697  5.241   1.00 0.00 ? 365 LEU B HD13 4  
ATOM 6574  H HD21 . LEU B 2 71 ? -2.000  -10.020 7.577   1.00 0.00 ? 365 LEU B HD21 4  
ATOM 6575  H HD22 . LEU B 2 71 ? -3.120  -9.319  6.408   1.00 0.00 ? 365 LEU B HD22 4  
ATOM 6576  H HD23 . LEU B 2 71 ? -3.037  -8.676  8.048   1.00 0.00 ? 365 LEU B HD23 4  
ATOM 6577  N N    . PHE B 2 72 ? 2.854   -9.248  7.599   1.00 0.00 ? 366 PHE B N    4  
ATOM 6578  C CA   . PHE B 2 72 ? 4.238   -9.593  7.287   1.00 0.00 ? 366 PHE B CA   4  
ATOM 6579  C C    . PHE B 2 72 ? 5.063   -9.952  8.537   1.00 0.00 ? 366 PHE B C    4  
ATOM 6580  O O    . PHE B 2 72 ? 6.218   -9.533  8.657   1.00 0.00 ? 366 PHE B O    4  
ATOM 6581  C CB   . PHE B 2 72 ? 4.859   -8.394  6.564   1.00 0.00 ? 366 PHE B CB   4  
ATOM 6582  C CG   . PHE B 2 72 ? 4.056   -7.883  5.387   1.00 0.00 ? 366 PHE B CG   4  
ATOM 6583  C CD1  . PHE B 2 72 ? 2.888   -8.518  4.984   1.00 0.00 ? 366 PHE B CD1  4  
ATOM 6584  C CD2  . PHE B 2 72 ? 4.463   -6.755  4.693   1.00 0.00 ? 366 PHE B CD2  4  
ATOM 6585  C CE1  . PHE B 2 72 ? 2.151   -8.044  3.922   1.00 0.00 ? 366 PHE B CE1  4  
ATOM 6586  C CE2  . PHE B 2 72 ? 3.724   -6.275  3.626   1.00 0.00 ? 366 PHE B CE2  4  
ATOM 6587  C CZ   . PHE B 2 72 ? 2.564   -6.924  3.243   1.00 0.00 ? 366 PHE B CZ   4  
ATOM 6588  H H    . PHE B 2 72 ? 2.644   -8.303  7.773   1.00 0.00 ? 366 PHE B H    4  
ATOM 6589  H HA   . PHE B 2 72 ? 4.230   -10.437 6.616   1.00 0.00 ? 366 PHE B HA   4  
ATOM 6590  H HB2  . PHE B 2 72 ? 4.933   -7.586  7.271   1.00 0.00 ? 366 PHE B HB2  4  
ATOM 6591  H HB3  . PHE B 2 72 ? 5.846   -8.656  6.215   1.00 0.00 ? 366 PHE B HB3  4  
ATOM 6592  H HD1  . PHE B 2 72 ? 2.558   -9.399  5.508   1.00 0.00 ? 366 PHE B HD1  4  
ATOM 6593  H HD2  . PHE B 2 72 ? 5.368   -6.248  4.990   1.00 0.00 ? 366 PHE B HD2  4  
ATOM 6594  H HE1  . PHE B 2 72 ? 1.245   -8.552  3.625   1.00 0.00 ? 366 PHE B HE1  4  
ATOM 6595  H HE2  . PHE B 2 72 ? 4.050   -5.395  3.095   1.00 0.00 ? 366 PHE B HE2  4  
ATOM 6596  H HZ   . PHE B 2 72 ? 1.982   -6.557  2.412   1.00 0.00 ? 366 PHE B HZ   4  
ATOM 6597  N N    . LYS B 2 73 ? 4.475   -10.716 9.466   1.00 0.00 ? 367 LYS B N    4  
ATOM 6598  C CA   . LYS B 2 73 ? 5.172   -11.112 10.702  1.00 0.00 ? 367 LYS B CA   4  
ATOM 6599  C C    . LYS B 2 73 ? 6.567   -11.694 10.443  1.00 0.00 ? 367 LYS B C    4  
ATOM 6600  O O    . LYS B 2 73 ? 7.576   -11.062 10.760  1.00 0.00 ? 367 LYS B O    4  
ATOM 6601  C CB   . LYS B 2 73 ? 4.341   -12.119 11.505  1.00 0.00 ? 367 LYS B CB   4  
ATOM 6602  C CG   . LYS B 2 73 ? 3.187   -11.495 12.273  1.00 0.00 ? 367 LYS B CG   4  
ATOM 6603  C CD   . LYS B 2 73 ? 3.670   -10.476 13.299  1.00 0.00 ? 367 LYS B CD   4  
ATOM 6604  C CE   . LYS B 2 73 ? 4.585   -11.111 14.338  1.00 0.00 ? 367 LYS B CE   4  
ATOM 6605  N NZ   . LYS B 2 73 ? 5.050   -10.122 15.352  1.00 0.00 ? 367 LYS B NZ   4  
ATOM 6606  H H    . LYS B 2 73 ? 3.555   -11.016 9.322   1.00 0.00 ? 367 LYS B H    4  
ATOM 6607  H HA   . LYS B 2 73 ? 5.289   -10.219 11.299  1.00 0.00 ? 367 LYS B HA   4  
ATOM 6608  H HB2  . LYS B 2 73 ? 3.933   -12.853 10.824  1.00 0.00 ? 367 LYS B HB2  4  
ATOM 6609  H HB3  . LYS B 2 73 ? 4.987   -12.618 12.211  1.00 0.00 ? 367 LYS B HB3  4  
ATOM 6610  H HG2  . LYS B 2 73 ? 2.536   -10.999 11.577  1.00 0.00 ? 367 LYS B HG2  4  
ATOM 6611  H HG3  . LYS B 2 73 ? 2.643   -12.276 12.783  1.00 0.00 ? 367 LYS B HG3  4  
ATOM 6612  H HD2  . LYS B 2 73 ? 4.211   -9.695  12.788  1.00 0.00 ? 367 LYS B HD2  4  
ATOM 6613  H HD3  . LYS B 2 73 ? 2.811   -10.054 13.800  1.00 0.00 ? 367 LYS B HD3  4  
ATOM 6614  H HE2  . LYS B 2 73 ? 4.046   -11.900 14.841  1.00 0.00 ? 367 LYS B HE2  4  
ATOM 6615  H HE3  . LYS B 2 73 ? 5.444   -11.528 13.835  1.00 0.00 ? 367 LYS B HE3  4  
ATOM 6616  H HZ1  . LYS B 2 73 ? 6.064   -10.255 15.541  1.00 0.00 ? 367 LYS B HZ1  4  
ATOM 6617  H HZ2  . LYS B 2 73 ? 4.524   -10.248 16.241  1.00 0.00 ? 367 LYS B HZ2  4  
ATOM 6618  H HZ3  . LYS B 2 73 ? 4.896   -9.152  15.007  1.00 0.00 ? 367 LYS B HZ3  4  
ATOM 6619  N N    . ASN B 2 74 ? 6.615   -12.912 9.894   1.00 0.00 ? 368 ASN B N    4  
ATOM 6620  C CA   . ASN B 2 74 ? 7.888   -13.596 9.628   1.00 0.00 ? 368 ASN B CA   4  
ATOM 6621  C C    . ASN B 2 74 ? 8.507   -13.200 8.280   1.00 0.00 ? 368 ASN B C    4  
ATOM 6622  O O    . ASN B 2 74 ? 9.158   -14.021 7.628   1.00 0.00 ? 368 ASN B O    4  
ATOM 6623  C CB   . ASN B 2 74 ? 7.691   -15.118 9.689   1.00 0.00 ? 368 ASN B CB   4  
ATOM 6624  C CG   . ASN B 2 74 ? 6.625   -15.619 8.726   1.00 0.00 ? 368 ASN B CG   4  
ATOM 6625  O OD1  . ASN B 2 74 ? 6.750   -15.470 7.509   1.00 0.00 ? 368 ASN B OD1  4  
ATOM 6626  N ND2  . ASN B 2 74 ? 5.567   -16.214 9.267   1.00 0.00 ? 368 ASN B ND2  4  
ATOM 6627  H H    . ASN B 2 74 ? 5.776   -13.373 9.684   1.00 0.00 ? 368 ASN B H    4  
ATOM 6628  H HA   . ASN B 2 74 ? 8.574   -13.311 10.410  1.00 0.00 ? 368 ASN B HA   4  
ATOM 6629  H HB2  . ASN B 2 74 ? 8.622   -15.604 9.444   1.00 0.00 ? 368 ASN B HB2  4  
ATOM 6630  H HB3  . ASN B 2 74 ? 7.400   -15.395 10.692  1.00 0.00 ? 368 ASN B HB3  4  
ATOM 6631  H HD21 . ASN B 2 74 ? 5.530   -16.298 10.243  1.00 0.00 ? 368 ASN B HD21 4  
ATOM 6632  H HD22 . ASN B 2 74 ? 4.867   -16.546 8.668   1.00 0.00 ? 368 ASN B HD22 4  
ATOM 6633  N N    . GLN B 2 75 ? 8.322   -11.947 7.869   1.00 0.00 ? 369 GLN B N    4  
ATOM 6634  C CA   . GLN B 2 75 ? 8.881   -11.469 6.609   1.00 0.00 ? 369 GLN B CA   4  
ATOM 6635  C C    . GLN B 2 75 ? 9.200   -9.976  6.670   1.00 0.00 ? 369 GLN B C    4  
ATOM 6636  O O    . GLN B 2 75 ? 8.621   -9.170  5.939   1.00 0.00 ? 369 GLN B O    4  
ATOM 6637  C CB   . GLN B 2 75 ? 7.932   -11.789 5.449   1.00 0.00 ? 369 GLN B CB   4  
ATOM 6638  C CG   . GLN B 2 75 ? 6.476   -11.466 5.734   1.00 0.00 ? 369 GLN B CG   4  
ATOM 6639  C CD   . GLN B 2 75 ? 5.536   -12.218 4.816   1.00 0.00 ? 369 GLN B CD   4  
ATOM 6640  O OE1  . GLN B 2 75 ? 5.500   -11.974 3.610   1.00 0.00 ? 369 GLN B OE1  4  
ATOM 6641  N NE2  . GLN B 2 75 ? 4.781   -13.156 5.382   1.00 0.00 ? 369 GLN B NE2  4  
ATOM 6642  H H    . GLN B 2 75 ? 7.807   -11.329 8.427   1.00 0.00 ? 369 GLN B H    4  
ATOM 6643  H HA   . GLN B 2 75 ? 9.807   -12.002 6.448   1.00 0.00 ? 369 GLN B HA   4  
ATOM 6644  H HB2  . GLN B 2 75 ? 8.239   -11.223 4.583   1.00 0.00 ? 369 GLN B HB2  4  
ATOM 6645  H HB3  . GLN B 2 75 ? 8.006   -12.842 5.220   1.00 0.00 ? 369 GLN B HB3  4  
ATOM 6646  H HG2  . GLN B 2 75 ? 6.252   -11.733 6.756   1.00 0.00 ? 369 GLN B HG2  4  
ATOM 6647  H HG3  . GLN B 2 75 ? 6.323   -10.406 5.595   1.00 0.00 ? 369 GLN B HG3  4  
ATOM 6648  H HE21 . GLN B 2 75 ? 4.871   -13.304 6.347   1.00 0.00 ? 369 GLN B HE21 4  
ATOM 6649  H HE22 . GLN B 2 75 ? 4.171   -13.665 4.810   1.00 0.00 ? 369 GLN B HE22 4  
ATOM 6650  N N    . GLU B 2 76 ? 10.143  -9.624  7.552   1.00 0.00 ? 370 GLU B N    4  
ATOM 6651  C CA   . GLU B 2 76 ? 10.578  -8.235  7.723   1.00 0.00 ? 370 GLU B CA   4  
ATOM 6652  C C    . GLU B 2 76 ? 10.958  -7.586  6.389   1.00 0.00 ? 370 GLU B C    4  
ATOM 6653  O O    . GLU B 2 76 ? 10.928  -6.362  6.264   1.00 0.00 ? 370 GLU B O    4  
ATOM 6654  C CB   . GLU B 2 76 ? 11.757  -8.158  8.699   1.00 0.00 ? 370 GLU B CB   4  
ATOM 6655  C CG   . GLU B 2 76 ? 11.431  -8.667  10.101  1.00 0.00 ? 370 GLU B CG   4  
ATOM 6656  C CD   . GLU B 2 76 ? 10.371  -7.842  10.822  1.00 0.00 ? 370 GLU B CD   4  
ATOM 6657  O OE1  . GLU B 2 76 ? 9.941   -6.797  10.285  1.00 0.00 ? 370 GLU B OE1  4  
ATOM 6658  O OE2  . GLU B 2 76 ? 9.975   -8.242  11.938  1.00 0.00 ? 370 GLU B OE2  4  
ATOM 6659  H H    . GLU B 2 76 ? 10.566  -10.323 8.095   1.00 0.00 ? 370 GLU B H    4  
ATOM 6660  H HA   . GLU B 2 76 ? 9.746   -7.687  8.142   1.00 0.00 ? 370 GLU B HA   4  
ATOM 6661  H HB2  . GLU B 2 76 ? 12.573  -8.747  8.307   1.00 0.00 ? 370 GLU B HB2  4  
ATOM 6662  H HB3  . GLU B 2 76 ? 12.076  -7.129  8.779   1.00 0.00 ? 370 GLU B HB3  4  
ATOM 6663  H HG2  . GLU B 2 76 ? 11.077  -9.683  10.024  1.00 0.00 ? 370 GLU B HG2  4  
ATOM 6664  H HG3  . GLU B 2 76 ? 12.336  -8.651  10.690  1.00 0.00 ? 370 GLU B HG3  4  
ATOM 6665  N N    . ASP B 2 77 ? 11.306  -8.410  5.392   1.00 0.00 ? 371 ASP B N    4  
ATOM 6666  C CA   . ASP B 2 77 ? 11.678  -7.905  4.071   1.00 0.00 ? 371 ASP B CA   4  
ATOM 6667  C C    . ASP B 2 77 ? 10.483  -7.219  3.426   1.00 0.00 ? 371 ASP B C    4  
ATOM 6668  O O    . ASP B 2 77 ? 10.571  -6.064  3.006   1.00 0.00 ? 371 ASP B O    4  
ATOM 6669  C CB   . ASP B 2 77 ? 12.163  -9.050  3.176   1.00 0.00 ? 371 ASP B CB   4  
ATOM 6670  C CG   . ASP B 2 77 ? 13.427  -9.731  3.686   1.00 0.00 ? 371 ASP B CG   4  
ATOM 6671  O OD1  . ASP B 2 77 ? 13.971  -9.300  4.728   1.00 0.00 ? 371 ASP B OD1  4  
ATOM 6672  O OD2  . ASP B 2 77 ? 13.876  -10.699 3.037   1.00 0.00 ? 371 ASP B OD2  4  
ATOM 6673  H H    . ASP B 2 77 ? 11.309  -9.376  5.547   1.00 0.00 ? 371 ASP B H    4  
ATOM 6674  H HA   . ASP B 2 77 ? 12.475  -7.186  4.195   1.00 0.00 ? 371 ASP B HA   4  
ATOM 6675  H HB2  . ASP B 2 77 ? 11.381  -9.792  3.111   1.00 0.00 ? 371 ASP B HB2  4  
ATOM 6676  H HB3  . ASP B 2 77 ? 12.360  -8.661  2.188   1.00 0.00 ? 371 ASP B HB3  4  
ATOM 6677  N N    . LEU B 2 78 ? 9.353   -7.930  3.383   1.00 0.00 ? 372 LEU B N    4  
ATOM 6678  C CA   . LEU B 2 78 ? 8.119   -7.380  2.830   1.00 0.00 ? 372 LEU B CA   4  
ATOM 6679  C C    . LEU B 2 78 ? 7.788   -6.053  3.516   1.00 0.00 ? 372 LEU B C    4  
ATOM 6680  O O    . LEU B 2 78 ? 7.384   -5.093  2.865   1.00 0.00 ? 372 LEU B O    4  
ATOM 6681  C CB   . LEU B 2 78 ? 6.959   -8.375  3.003   1.00 0.00 ? 372 LEU B CB   4  
ATOM 6682  C CG   . LEU B 2 78 ? 6.804   -9.434  1.898   1.00 0.00 ? 372 LEU B CG   4  
ATOM 6683  C CD1  . LEU B 2 78 ? 6.253   -8.804  0.627   1.00 0.00 ? 372 LEU B CD1  4  
ATOM 6684  C CD2  . LEU B 2 78 ? 8.129   -10.135 1.613   1.00 0.00 ? 372 LEU B CD2  4  
ATOM 6685  H H    . LEU B 2 78 ? 9.344   -8.836  3.758   1.00 0.00 ? 372 LEU B H    4  
ATOM 6686  H HA   . LEU B 2 78 ? 8.276   -7.199  1.777   1.00 0.00 ? 372 LEU B HA   4  
ATOM 6687  H HB2  . LEU B 2 78 ? 7.097   -8.890  3.942   1.00 0.00 ? 372 LEU B HB2  4  
ATOM 6688  H HB3  . LEU B 2 78 ? 6.040   -7.811  3.057   1.00 0.00 ? 372 LEU B HB3  4  
ATOM 6689  H HG   . LEU B 2 78 ? 6.097   -10.180 2.227   1.00 0.00 ? 372 LEU B HG   4  
ATOM 6690  H HD11 . LEU B 2 78 ? 7.013   -8.804  -0.141  1.00 0.00 ? 372 LEU B HD11 4  
ATOM 6691  H HD12 . LEU B 2 78 ? 5.945   -7.788  0.832   1.00 0.00 ? 372 LEU B HD12 4  
ATOM 6692  H HD13 . LEU B 2 78 ? 5.396   -9.373  0.286   1.00 0.00 ? 372 LEU B HD13 4  
ATOM 6693  H HD21 . LEU B 2 78 ? 8.129   -10.508 0.596   1.00 0.00 ? 372 LEU B HD21 4  
ATOM 6694  H HD22 . LEU B 2 78 ? 8.253   -10.962 2.299   1.00 0.00 ? 372 LEU B HD22 4  
ATOM 6695  H HD23 . LEU B 2 78 ? 8.943   -9.438  1.739   1.00 0.00 ? 372 LEU B HD23 4  
ATOM 6696  N N    . LEU B 2 79 ? 7.985   -6.007  4.838   1.00 0.00 ? 373 LEU B N    4  
ATOM 6697  C CA   . LEU B 2 79 ? 7.727   -4.792  5.618   1.00 0.00 ? 373 LEU B CA   4  
ATOM 6698  C C    . LEU B 2 79 ? 8.710   -3.678  5.260   1.00 0.00 ? 373 LEU B C    4  
ATOM 6699  O O    . LEU B 2 79 ? 8.321   -2.515  5.154   1.00 0.00 ? 373 LEU B O    4  
ATOM 6700  C CB   . LEU B 2 79 ? 7.799   -5.083  7.122   1.00 0.00 ? 373 LEU B CB   4  
ATOM 6701  C CG   . LEU B 2 79 ? 6.559   -5.750  7.722   1.00 0.00 ? 373 LEU B CG   4  
ATOM 6702  C CD1  . LEU B 2 79 ? 6.766   -6.023  9.206   1.00 0.00 ? 373 LEU B CD1  4  
ATOM 6703  C CD2  . LEU B 2 79 ? 5.326   -4.880  7.507   1.00 0.00 ? 373 LEU B CD2  4  
ATOM 6704  H H    . LEU B 2 79 ? 8.330   -6.806  5.297   1.00 0.00 ? 373 LEU B H    4  
ATOM 6705  H HA   . LEU B 2 79 ? 6.730   -4.458  5.376   1.00 0.00 ? 373 LEU B HA   4  
ATOM 6706  H HB2  . LEU B 2 79 ? 8.646   -5.728  7.301   1.00 0.00 ? 373 LEU B HB2  4  
ATOM 6707  H HB3  . LEU B 2 79 ? 7.963   -4.150  7.640   1.00 0.00 ? 373 LEU B HB3  4  
ATOM 6708  H HG   . LEU B 2 79 ? 6.391   -6.695  7.232   1.00 0.00 ? 373 LEU B HG   4  
ATOM 6709  H HD11 . LEU B 2 79 ? 7.720   -5.620  9.517   1.00 0.00 ? 373 LEU B HD11 4  
ATOM 6710  H HD12 . LEU B 2 79 ? 6.751   -7.089  9.380   1.00 0.00 ? 373 LEU B HD12 4  
ATOM 6711  H HD13 . LEU B 2 79 ? 5.976   -5.555  9.774   1.00 0.00 ? 373 LEU B HD13 4  
ATOM 6712  H HD21 . LEU B 2 79 ? 5.388   -4.396  6.542   1.00 0.00 ? 373 LEU B HD21 4  
ATOM 6713  H HD22 . LEU B 2 79 ? 5.275   -4.128  8.281   1.00 0.00 ? 373 LEU B HD22 4  
ATOM 6714  H HD23 . LEU B 2 79 ? 4.439   -5.495  7.544   1.00 0.00 ? 373 LEU B HD23 4  
ATOM 6715  N N    . SER B 2 80 ? 9.982   -4.040  5.075   1.00 0.00 ? 374 SER B N    4  
ATOM 6716  C CA   . SER B 2 80 ? 11.016  -3.066  4.727   1.00 0.00 ? 374 SER B CA   4  
ATOM 6717  C C    . SER B 2 80 ? 10.636  -2.306  3.458   1.00 0.00 ? 374 SER B C    4  
ATOM 6718  O O    . SER B 2 80 ? 10.697  -1.076  3.420   1.00 0.00 ? 374 SER B O    4  
ATOM 6719  C CB   . SER B 2 80 ? 12.366  -3.764  4.536   1.00 0.00 ? 374 SER B CB   4  
ATOM 6720  O OG   . SER B 2 80 ? 13.388  -2.830  4.228   1.00 0.00 ? 374 SER B OG   4  
ATOM 6721  H H    . SER B 2 80 ? 10.231  -4.983  5.174   1.00 0.00 ? 374 SER B H    4  
ATOM 6722  H HA   . SER B 2 80 ? 11.096  -2.363  5.542   1.00 0.00 ? 374 SER B HA   4  
ATOM 6723  H HB2  . SER B 2 80 ? 12.633  -4.281  5.446   1.00 0.00 ? 374 SER B HB2  4  
ATOM 6724  H HB3  . SER B 2 80 ? 12.290  -4.476  3.727   1.00 0.00 ? 374 SER B HB3  4  
ATOM 6725  H HG   . SER B 2 80 ? 14.225  -3.290  4.136   1.00 0.00 ? 374 SER B HG   4  
ATOM 6726  N N    . GLU B 2 81 ? 10.230  -3.048  2.426   1.00 0.00 ? 375 GLU B N    4  
ATOM 6727  C CA   . GLU B 2 81 ? 9.824   -2.452  1.156   1.00 0.00 ? 375 GLU B CA   4  
ATOM 6728  C C    . GLU B 2 81 ? 8.569   -1.591  1.338   1.00 0.00 ? 375 GLU B C    4  
ATOM 6729  O O    . GLU B 2 81 ? 8.427   -0.543  0.705   1.00 0.00 ? 375 GLU B O    4  
ATOM 6730  C CB   . GLU B 2 81 ? 9.562   -3.555  0.123   1.00 0.00 ? 375 GLU B CB   4  
ATOM 6731  C CG   . GLU B 2 81 ? 9.480   -3.058  -1.316  1.00 0.00 ? 375 GLU B CG   4  
ATOM 6732  C CD   . GLU B 2 81 ? 10.823  -2.627  -1.889  1.00 0.00 ? 375 GLU B CD   4  
ATOM 6733  O OE1  . GLU B 2 81 ? 11.846  -2.712  -1.174  1.00 0.00 ? 375 GLU B OE1  4  
ATOM 6734  O OE2  . GLU B 2 81 ? 10.852  -2.210  -3.066  1.00 0.00 ? 375 GLU B OE2  4  
ATOM 6735  H H    . GLU B 2 81 ? 10.193  -4.025  2.522   1.00 0.00 ? 375 GLU B H    4  
ATOM 6736  H HA   . GLU B 2 81 ? 10.631  -1.826  0.807   1.00 0.00 ? 375 GLU B HA   4  
ATOM 6737  H HB2  . GLU B 2 81 ? 10.359  -4.282  0.182   1.00 0.00 ? 375 GLU B HB2  4  
ATOM 6738  H HB3  . GLU B 2 81 ? 8.628   -4.040  0.365   1.00 0.00 ? 375 GLU B HB3  4  
ATOM 6739  H HG2  . GLU B 2 81 ? 9.089   -3.853  -1.931  1.00 0.00 ? 375 GLU B HG2  4  
ATOM 6740  H HG3  . GLU B 2 81 ? 8.805   -2.215  -1.351  1.00 0.00 ? 375 GLU B HG3  4  
ATOM 6741  N N    . PHE B 2 82 ? 7.659   -2.055  2.204   1.00 0.00 ? 376 PHE B N    4  
ATOM 6742  C CA   . PHE B 2 82 ? 6.403   -1.354  2.484   1.00 0.00 ? 376 PHE B CA   4  
ATOM 6743  C C    . PHE B 2 82 ? 6.621   0.103   2.903   1.00 0.00 ? 376 PHE B C    4  
ATOM 6744  O O    . PHE B 2 82 ? 6.152   1.025   2.234   1.00 0.00 ? 376 PHE B O    4  
ATOM 6745  C CB   . PHE B 2 82 ? 5.630   -2.069  3.596   1.00 0.00 ? 376 PHE B CB   4  
ATOM 6746  C CG   . PHE B 2 82 ? 4.280   -1.468  3.864   1.00 0.00 ? 376 PHE B CG   4  
ATOM 6747  C CD1  . PHE B 2 82 ? 3.567   -0.852  2.846   1.00 0.00 ? 376 PHE B CD1  4  
ATOM 6748  C CD2  . PHE B 2 82 ? 3.724   -1.523  5.130   1.00 0.00 ? 376 PHE B CD2  4  
ATOM 6749  C CE1  . PHE B 2 82 ? 2.327   -0.301  3.087   1.00 0.00 ? 376 PHE B CE1  4  
ATOM 6750  C CE2  . PHE B 2 82 ? 2.482   -0.972  5.375   1.00 0.00 ? 376 PHE B CE2  4  
ATOM 6751  C CZ   . PHE B 2 82 ? 1.785   -0.361  4.353   1.00 0.00 ? 376 PHE B CZ   4  
ATOM 6752  H H    . PHE B 2 82 ? 7.838   -2.902  2.665   1.00 0.00 ? 376 PHE B H    4  
ATOM 6753  H HA   . PHE B 2 82 ? 5.809   -1.370  1.584   1.00 0.00 ? 376 PHE B HA   4  
ATOM 6754  H HB2  . PHE B 2 82 ? 5.484   -3.102  3.323   1.00 0.00 ? 376 PHE B HB2  4  
ATOM 6755  H HB3  . PHE B 2 82 ? 6.201   -2.023  4.511   1.00 0.00 ? 376 PHE B HB3  4  
ATOM 6756  H HD1  . PHE B 2 82 ? 3.991   -0.806  1.855   1.00 0.00 ? 376 PHE B HD1  4  
ATOM 6757  H HD2  . PHE B 2 82 ? 4.272   -1.997  5.932   1.00 0.00 ? 376 PHE B HD2  4  
ATOM 6758  H HE1  . PHE B 2 82 ? 1.781   0.176   2.287   1.00 0.00 ? 376 PHE B HE1  4  
ATOM 6759  H HE2  . PHE B 2 82 ? 2.057   -1.021  6.367   1.00 0.00 ? 376 PHE B HE2  4  
ATOM 6760  H HZ   . PHE B 2 82 ? 0.817   0.068   4.541   1.00 0.00 ? 376 PHE B HZ   4  
ATOM 6761  N N    . GLY B 2 83 ? 7.302   0.292   4.039   1.00 0.00 ? 377 GLY B N    4  
ATOM 6762  C CA   . GLY B 2 83 ? 7.548   1.628   4.574   1.00 0.00 ? 377 GLY B CA   4  
ATOM 6763  C C    . GLY B 2 83 ? 8.280   2.578   3.631   1.00 0.00 ? 377 GLY B C    4  
ATOM 6764  O O    . GLY B 2 83 ? 8.419   3.759   3.944   1.00 0.00 ? 377 GLY B O    4  
ATOM 6765  H H    . GLY B 2 83 ? 7.623   -0.491  4.537   1.00 0.00 ? 377 GLY B H    4  
ATOM 6766  H HA2  . GLY B 2 83 ? 6.592   2.072   4.826   1.00 0.00 ? 377 GLY B HA2  4  
ATOM 6767  H HA3  . GLY B 2 83 ? 8.126   1.530   5.482   1.00 0.00 ? 377 GLY B HA3  4  
ATOM 6768  N N    . GLN B 2 84 ? 8.753   2.085   2.486   1.00 0.00 ? 378 GLN B N    4  
ATOM 6769  C CA   . GLN B 2 84 ? 9.463   2.936   1.531   1.00 0.00 ? 378 GLN B CA   4  
ATOM 6770  C C    . GLN B 2 84 ? 8.519   3.927   0.830   1.00 0.00 ? 378 GLN B C    4  
ATOM 6771  O O    . GLN B 2 84 ? 8.982   4.883   0.204   1.00 0.00 ? 378 GLN B O    4  
ATOM 6772  C CB   . GLN B 2 84 ? 10.197  2.079   0.495   1.00 0.00 ? 378 GLN B CB   4  
ATOM 6773  C CG   . GLN B 2 84 ? 11.240  1.152   1.112   1.00 0.00 ? 378 GLN B CG   4  
ATOM 6774  C CD   . GLN B 2 84 ? 11.996  0.300   0.100   1.00 0.00 ? 378 GLN B CD   4  
ATOM 6775  O OE1  . GLN B 2 84 ? 12.835  -0.515  0.480   1.00 0.00 ? 378 GLN B OE1  4  
ATOM 6776  N NE2  . GLN B 2 84 ? 11.717  0.476   -1.193  1.00 0.00 ? 378 GLN B NE2  4  
ATOM 6777  H H    . GLN B 2 84 ? 8.628   1.139   2.277   1.00 0.00 ? 378 GLN B H    4  
ATOM 6778  H HA   . GLN B 2 84 ? 10.195  3.502   2.087   1.00 0.00 ? 378 GLN B HA   4  
ATOM 6779  H HB2  . GLN B 2 84 ? 9.476   1.474   -0.034  1.00 0.00 ? 378 GLN B HB2  4  
ATOM 6780  H HB3  . GLN B 2 84 ? 10.696  2.731   -0.206  1.00 0.00 ? 378 GLN B HB3  4  
ATOM 6781  H HG2  . GLN B 2 84 ? 11.956  1.755   1.648   1.00 0.00 ? 378 GLN B HG2  4  
ATOM 6782  H HG3  . GLN B 2 84 ? 10.741  0.495   1.808   1.00 0.00 ? 378 GLN B HG3  4  
ATOM 6783  H HE21 . GLN B 2 84 ? 11.043  1.140   -1.439  1.00 0.00 ? 378 GLN B HE21 4  
ATOM 6784  H HE22 . GLN B 2 84 ? 12.201  -0.074  -1.844  1.00 0.00 ? 378 GLN B HE22 4  
ATOM 6785  N N    . PHE B 2 85 ? 7.201   3.707   0.940   1.00 0.00 ? 379 PHE B N    4  
ATOM 6786  C CA   . PHE B 2 85 ? 6.216   4.591   0.317   1.00 0.00 ? 379 PHE B CA   4  
ATOM 6787  C C    . PHE B 2 85 ? 5.665   5.573   1.342   1.00 0.00 ? 379 PHE B C    4  
ATOM 6788  O O    . PHE B 2 85 ? 5.665   6.785   1.123   1.00 0.00 ? 379 PHE B O    4  
ATOM 6789  C CB   . PHE B 2 85 ? 5.076   3.768   -0.285  1.00 0.00 ? 379 PHE B CB   4  
ATOM 6790  C CG   . PHE B 2 85 ? 5.558   2.627   -1.129  1.00 0.00 ? 379 PHE B CG   4  
ATOM 6791  C CD1  . PHE B 2 85 ? 6.255   2.860   -2.303  1.00 0.00 ? 379 PHE B CD1  4  
ATOM 6792  C CD2  . PHE B 2 85 ? 5.334   1.322   -0.734  1.00 0.00 ? 379 PHE B CD2  4  
ATOM 6793  C CE1  . PHE B 2 85 ? 6.717   1.807   -3.068  1.00 0.00 ? 379 PHE B CE1  4  
ATOM 6794  C CE2  . PHE B 2 85 ? 5.790   0.267   -1.494  1.00 0.00 ? 379 PHE B CE2  4  
ATOM 6795  C CZ   . PHE B 2 85 ? 6.483   0.508   -2.663  1.00 0.00 ? 379 PHE B CZ   4  
ATOM 6796  H H    . PHE B 2 85 ? 6.878   2.938   1.456   1.00 0.00 ? 379 PHE B H    4  
ATOM 6797  H HA   . PHE B 2 85 ? 6.709   5.143   -0.470  1.00 0.00 ? 379 PHE B HA   4  
ATOM 6798  H HB2  . PHE B 2 85 ? 4.472   3.361   0.513   1.00 0.00 ? 379 PHE B HB2  4  
ATOM 6799  H HB3  . PHE B 2 85 ? 4.465   4.408   -0.902  1.00 0.00 ? 379 PHE B HB3  4  
ATOM 6800  H HD1  . PHE B 2 85 ? 6.435   3.877   -2.622  1.00 0.00 ? 379 PHE B HD1  4  
ATOM 6801  H HD2  . PHE B 2 85 ? 4.790   1.131   0.180   1.00 0.00 ? 379 PHE B HD2  4  
ATOM 6802  H HE1  . PHE B 2 85 ? 7.258   2.000   -3.982  1.00 0.00 ? 379 PHE B HE1  4  
ATOM 6803  H HE2  . PHE B 2 85 ? 5.605   -0.745  -1.173  1.00 0.00 ? 379 PHE B HE2  4  
ATOM 6804  H HZ   . PHE B 2 85 ? 6.844   -0.318  -3.256  1.00 0.00 ? 379 PHE B HZ   4  
ATOM 6805  N N    . LEU B 2 86 ? 5.206   5.029   2.469   1.00 0.00 ? 380 LEU B N    4  
ATOM 6806  C CA   . LEU B 2 86 ? 4.659   5.839   3.548   1.00 0.00 ? 380 LEU B CA   4  
ATOM 6807  C C    . LEU B 2 86 ? 5.759   6.191   4.556   1.00 0.00 ? 380 LEU B C    4  
ATOM 6808  O O    . LEU B 2 86 ? 6.718   5.439   4.716   1.00 0.00 ? 380 LEU B O    4  
ATOM 6809  C CB   . LEU B 2 86 ? 3.443   5.143   4.211   1.00 0.00 ? 380 LEU B CB   4  
ATOM 6810  C CG   . LEU B 2 86 ? 3.648   3.760   4.864   1.00 0.00 ? 380 LEU B CG   4  
ATOM 6811  C CD1  . LEU B 2 86 ? 3.849   2.673   3.815   1.00 0.00 ? 380 LEU B CD1  4  
ATOM 6812  C CD2  . LEU B 2 86 ? 4.788   3.776   5.872   1.00 0.00 ? 380 LEU B CD2  4  
ATOM 6813  H H    . LEU B 2 86 ? 5.248   4.061   2.575   1.00 0.00 ? 380 LEU B H    4  
ATOM 6814  H HA   . LEU B 2 86 ? 4.318   6.764   3.101   1.00 0.00 ? 380 LEU B HA   4  
ATOM 6815  H HB2  . LEU B 2 86 ? 3.047   5.804   4.964   1.00 0.00 ? 380 LEU B HB2  4  
ATOM 6816  H HB3  . LEU B 2 86 ? 2.695   5.026   3.442   1.00 0.00 ? 380 LEU B HB3  4  
ATOM 6817  H HG   . LEU B 2 86 ? 2.750   3.506   5.405   1.00 0.00 ? 380 LEU B HG   4  
ATOM 6818  H HD11 . LEU B 2 86 ? 3.533   1.724   4.219   1.00 0.00 ? 380 LEU B HD11 4  
ATOM 6819  H HD12 . LEU B 2 86 ? 4.893   2.617   3.546   1.00 0.00 ? 380 LEU B HD12 4  
ATOM 6820  H HD13 . LEU B 2 86 ? 3.255   2.904   2.934   1.00 0.00 ? 380 LEU B HD13 4  
ATOM 6821  H HD21 . LEU B 2 86 ? 4.634   2.994   6.602   1.00 0.00 ? 380 LEU B HD21 4  
ATOM 6822  H HD22 . LEU B 2 86 ? 4.811   4.734   6.375   1.00 0.00 ? 380 LEU B HD22 4  
ATOM 6823  H HD23 . LEU B 2 86 ? 5.725   3.613   5.363   1.00 0.00 ? 380 LEU B HD23 4  
ATOM 6824  N N    . PRO B 2 87 ? 5.659   7.365   5.215   1.00 0.00 ? 381 PRO B N    4  
ATOM 6825  C CA   . PRO B 2 87 ? 6.670   7.840   6.178   1.00 0.00 ? 381 PRO B CA   4  
ATOM 6826  C C    . PRO B 2 87 ? 6.941   6.873   7.340   1.00 0.00 ? 381 PRO B C    4  
ATOM 6827  O O    . PRO B 2 87 ? 6.744   5.663   7.228   1.00 0.00 ? 381 PRO B O    4  
ATOM 6828  C CB   . PRO B 2 87 ? 6.071   9.153   6.696   1.00 0.00 ? 381 PRO B CB   4  
ATOM 6829  C CG   . PRO B 2 87 ? 5.165   9.604   5.610   1.00 0.00 ? 381 PRO B CG   4  
ATOM 6830  C CD   . PRO B 2 87 ? 4.580   8.349   5.037   1.00 0.00 ? 381 PRO B CD   4  
ATOM 6831  H HA   . PRO B 2 87 ? 7.605   8.051   5.680   1.00 0.00 ? 381 PRO B HA   4  
ATOM 6832  H HB2  . PRO B 2 87 ? 5.530   8.970   7.613   1.00 0.00 ? 381 PRO B HB2  4  
ATOM 6833  H HB3  . PRO B 2 87 ? 6.860   9.867   6.875   1.00 0.00 ? 381 PRO B HB3  4  
ATOM 6834  H HG2  . PRO B 2 87 ? 4.386   10.233  6.016   1.00 0.00 ? 381 PRO B HG2  4  
ATOM 6835  H HG3  . PRO B 2 87 ? 5.729   10.134  4.856   1.00 0.00 ? 381 PRO B HG3  4  
ATOM 6836  H HD2  . PRO B 2 87 ? 3.706   8.059   5.588   1.00 0.00 ? 381 PRO B HD2  4  
ATOM 6837  H HD3  . PRO B 2 87 ? 4.348   8.482   3.994   1.00 0.00 ? 381 PRO B HD3  4  
ATOM 6838  N N    . ASP B 2 88 ? 7.416   7.429   8.452   1.00 0.00 ? 382 ASP B N    4  
ATOM 6839  C CA   . ASP B 2 88 ? 7.745   6.644   9.639   1.00 0.00 ? 382 ASP B CA   4  
ATOM 6840  C C    . ASP B 2 88 ? 6.530   6.461   10.541  1.00 0.00 ? 382 ASP B C    4  
ATOM 6841  O O    . ASP B 2 88 ? 6.278   7.264   11.442  1.00 0.00 ? 382 ASP B O    4  
ATOM 6842  C CB   . ASP B 2 88 ? 8.891   7.301   10.421  1.00 0.00 ? 382 ASP B CB   4  
ATOM 6843  C CG   . ASP B 2 88 ? 10.199  7.311   9.648   1.00 0.00 ? 382 ASP B CG   4  
ATOM 6844  O OD1  . ASP B 2 88 ? 10.259  7.959   8.580   1.00 0.00 ? 382 ASP B OD1  4  
ATOM 6845  O OD2  . ASP B 2 88 ? 11.166  6.669   10.110  1.00 0.00 ? 382 ASP B OD2  4  
ATOM 6846  H H    . ASP B 2 88 ? 7.555   8.393   8.469   1.00 0.00 ? 382 ASP B H    4  
ATOM 6847  H HA   . ASP B 2 88 ? 8.072   5.669   9.304   1.00 0.00 ? 382 ASP B HA   4  
ATOM 6848  H HB2  . ASP B 2 88 ? 8.624   8.321   10.648  1.00 0.00 ? 382 ASP B HB2  4  
ATOM 6849  H HB3  . ASP B 2 88 ? 9.044   6.760   11.343  1.00 0.00 ? 382 ASP B HB3  4  
ATOM 6850  N N    . ALA B 2 89 ? 5.785   5.392   10.285  1.00 0.00 ? 383 ALA B N    4  
ATOM 6851  C CA   . ALA B 2 89 ? 4.591   5.075   11.062  1.00 0.00 ? 383 ALA B CA   4  
ATOM 6852  C C    . ALA B 2 89 ? 4.957   4.475   12.420  1.00 0.00 ? 383 ALA B C    4  
ATOM 6853  O O    . ALA B 2 89 ? 4.567   5.064   13.449  1.00 0.00 ? 383 ALA B O    4  
ATOM 6854  C CB   . ALA B 2 89 ? 3.700   4.121   10.285  1.00 0.00 ? 383 ALA B CB   4  
ATOM 6855  O OXT  . ALA B 2 89 ? 5.629   3.421   12.441  1.00 0.00 ? 383 ALA B OXT  4  
ATOM 6856  H H    . ALA B 2 89 ? 6.048   4.798   9.552   1.00 0.00 ? 383 ALA B H    4  
ATOM 6857  H HA   . ALA B 2 89 ? 4.043   5.991   11.222  1.00 0.00 ? 383 ALA B HA   4  
ATOM 6858  H HB1  . ALA B 2 89 ? 3.163   4.669   9.528   1.00 0.00 ? 383 ALA B HB1  4  
ATOM 6859  H HB2  . ALA B 2 89 ? 2.998   3.653   10.958  1.00 0.00 ? 383 ALA B HB2  4  
ATOM 6860  H HB3  . ALA B 2 89 ? 4.308   3.362   9.816   1.00 0.00 ? 383 ALA B HB3  4  
ATOM 6861  N N    . ARG A 1 1  ? 5.307   12.303  -4.031  1.00 0.00 ? 6   ARG A N    5  
ATOM 6862  C CA   . ARG A 1 1  ? 4.398   12.311  -5.214  1.00 0.00 ? 6   ARG A CA   5  
ATOM 6863  C C    . ARG A 1 1  ? 3.613   11.002  -5.340  1.00 0.00 ? 6   ARG A C    5  
ATOM 6864  O O    . ARG A 1 1  ? 2.493   10.994  -5.852  1.00 0.00 ? 6   ARG A O    5  
ATOM 6865  C CB   . ARG A 1 1  ? 5.232   12.561  -6.477  1.00 0.00 ? 6   ARG A CB   5  
ATOM 6866  C CG   . ARG A 1 1  ? 5.959   13.898  -6.465  1.00 0.00 ? 6   ARG A CG   5  
ATOM 6867  C CD   . ARG A 1 1  ? 6.726   14.138  -7.756  1.00 0.00 ? 6   ARG A CD   5  
ATOM 6868  N NE   . ARG A 1 1  ? 7.445   15.413  -7.734  1.00 0.00 ? 6   ARG A NE   5  
ATOM 6869  C CZ   . ARG A 1 1  ? 8.173   15.882  -8.750  1.00 0.00 ? 6   ARG A CZ   5  
ATOM 6870  N NH1  . ARG A 1 1  ? 8.279   15.193  -9.883  1.00 0.00 ? 6   ARG A NH1  5  
ATOM 6871  N NH2  . ARG A 1 1  ? 8.798   17.050  -8.633  1.00 0.00 ? 6   ARG A NH2  5  
ATOM 6872  H H1   . ARG A 1 1  ? 4.790   11.877  -3.234  1.00 0.00 ? 6   ARG A H1   5  
ATOM 6873  H H2   . ARG A 1 1  ? 5.565   13.290  -3.823  1.00 0.00 ? 6   ARG A H2   5  
ATOM 6874  H H3   . ARG A 1 1  ? 6.146   11.739  -4.276  1.00 0.00 ? 6   ARG A H3   5  
ATOM 6875  H HA   . ARG A 1 1  ? 3.696   13.122  -5.092  1.00 0.00 ? 6   ARG A HA   5  
ATOM 6876  H HB2  . ARG A 1 1  ? 5.967   11.775  -6.571  1.00 0.00 ? 6   ARG A HB2  5  
ATOM 6877  H HB3  . ARG A 1 1  ? 4.579   12.538  -7.336  1.00 0.00 ? 6   ARG A HB3  5  
ATOM 6878  H HG2  . ARG A 1 1  ? 5.235   14.687  -6.338  1.00 0.00 ? 6   ARG A HG2  5  
ATOM 6879  H HG3  . ARG A 1 1  ? 6.655   13.910  -5.638  1.00 0.00 ? 6   ARG A HG3  5  
ATOM 6880  H HD2  . ARG A 1 1  ? 7.436   13.337  -7.894  1.00 0.00 ? 6   ARG A HD2  5  
ATOM 6881  H HD3  . ARG A 1 1  ? 6.025   14.143  -8.579  1.00 0.00 ? 6   ARG A HD3  5  
ATOM 6882  H HE   . ARG A 1 1  ? 7.385   15.950  -6.915  1.00 0.00 ? 6   ARG A HE   5  
ATOM 6883  H HH11 . ARG A 1 1  ? 7.812   14.314  -9.982  1.00 0.00 ? 6   ARG A HH11 5  
ATOM 6884  H HH12 . ARG A 1 1  ? 8.827   15.553  -10.639 1.00 0.00 ? 6   ARG A HH12 5  
ATOM 6885  H HH21 . ARG A 1 1  ? 8.721   17.576  -7.785  1.00 0.00 ? 6   ARG A HH21 5  
ATOM 6886  H HH22 . ARG A 1 1  ? 9.345   17.405  -9.391  1.00 0.00 ? 6   ARG A HH22 5  
ATOM 6887  N N    . MET A 1 2  ? 4.202   9.898   -4.868  1.00 0.00 ? 7   MET A N    5  
ATOM 6888  C CA   . MET A 1 2  ? 3.549   8.592   -4.927  1.00 0.00 ? 7   MET A CA   5  
ATOM 6889  C C    . MET A 1 2  ? 3.922   7.738   -3.711  1.00 0.00 ? 7   MET A C    5  
ATOM 6890  O O    . MET A 1 2  ? 5.060   7.775   -3.238  1.00 0.00 ? 7   MET A O    5  
ATOM 6891  C CB   . MET A 1 2  ? 3.907   7.875   -6.234  1.00 0.00 ? 7   MET A CB   5  
ATOM 6892  C CG   . MET A 1 2  ? 5.397   7.650   -6.436  1.00 0.00 ? 7   MET A CG   5  
ATOM 6893  S SD   . MET A 1 2  ? 5.809   7.184   -8.131  1.00 0.00 ? 7   MET A SD   5  
ATOM 6894  C CE   . MET A 1 2  ? 4.727   5.776   -8.378  1.00 0.00 ? 7   MET A CE   5  
ATOM 6895  H H    . MET A 1 2  ? 5.093   9.964   -4.468  1.00 0.00 ? 7   MET A H    5  
ATOM 6896  H HA   . MET A 1 2  ? 2.482   8.762   -4.907  1.00 0.00 ? 7   MET A HA   5  
ATOM 6897  H HB2  . MET A 1 2  ? 3.418   6.913   -6.248  1.00 0.00 ? 7   MET A HB2  5  
ATOM 6898  H HB3  . MET A 1 2  ? 3.539   8.464   -7.062  1.00 0.00 ? 7   MET A HB3  5  
ATOM 6899  H HG2  . MET A 1 2  ? 5.922   8.564   -6.194  1.00 0.00 ? 7   MET A HG2  5  
ATOM 6900  H HG3  . MET A 1 2  ? 5.723   6.864   -5.772  1.00 0.00 ? 7   MET A HG3  5  
ATOM 6901  H HE1  . MET A 1 2  ? 4.239   5.530   -7.448  1.00 0.00 ? 7   MET A HE1  5  
ATOM 6902  H HE2  . MET A 1 2  ? 5.310   4.931   -8.714  1.00 0.00 ? 7   MET A HE2  5  
ATOM 6903  H HE3  . MET A 1 2  ? 3.985   6.020   -9.123  1.00 0.00 ? 7   MET A HE3  5  
ATOM 6904  N N    . ASN A 1 3  ? 2.945   6.983   -3.203  1.00 0.00 ? 8   ASN A N    5  
ATOM 6905  C CA   . ASN A 1 3  ? 3.151   6.129   -2.026  1.00 0.00 ? 8   ASN A CA   5  
ATOM 6906  C C    . ASN A 1 3  ? 2.284   4.855   -2.092  1.00 0.00 ? 8   ASN A C    5  
ATOM 6907  O O    . ASN A 1 3  ? 2.440   4.063   -3.016  1.00 0.00 ? 8   ASN A O    5  
ATOM 6908  C CB   . ASN A 1 3  ? 2.895   6.934   -0.734  1.00 0.00 ? 8   ASN A CB   5  
ATOM 6909  C CG   . ASN A 1 3  ? 1.550   7.669   -0.680  1.00 0.00 ? 8   ASN A CG   5  
ATOM 6910  O OD1  . ASN A 1 3  ? 1.334   8.486   0.213   1.00 0.00 ? 8   ASN A OD1  5  
ATOM 6911  N ND2  . ASN A 1 3  ? 0.628   7.379   -1.602  1.00 0.00 ? 8   ASN A ND2  5  
ATOM 6912  H H    . ASN A 1 3  ? 2.063   7.010   -3.624  1.00 0.00 ? 8   ASN A H    5  
ATOM 6913  H HA   . ASN A 1 3  ? 4.188   5.823   -2.036  1.00 0.00 ? 8   ASN A HA   5  
ATOM 6914  H HB2  . ASN A 1 3  ? 2.937   6.259   0.106   1.00 0.00 ? 8   ASN A HB2  5  
ATOM 6915  H HB3  . ASN A 1 3  ? 3.683   7.668   -0.627  1.00 0.00 ? 8   ASN A HB3  5  
ATOM 6916  H HD21 . ASN A 1 3  ? 0.834   6.708   -2.280  1.00 0.00 ? 8   ASN A HD21 5  
ATOM 6917  H HD22 . ASN A 1 3  ? -0.227  7.856   -1.560  1.00 0.00 ? 8   ASN A HD22 5  
ATOM 6918  N N    . ILE A 1 4  ? 1.377   4.652   -1.124  1.00 0.00 ? 9   ILE A N    5  
ATOM 6919  C CA   . ILE A 1 4  ? 0.516   3.467   -1.122  1.00 0.00 ? 9   ILE A CA   5  
ATOM 6920  C C    . ILE A 1 4  ? -0.271  3.335   -2.400  1.00 0.00 ? 9   ILE A C    5  
ATOM 6921  O O    . ILE A 1 4  ? -0.404  2.237   -2.944  1.00 0.00 ? 9   ILE A O    5  
ATOM 6922  C CB   . ILE A 1 4  ? -0.515  3.471   0.015   1.00 0.00 ? 9   ILE A CB   5  
ATOM 6923  C CG1  . ILE A 1 4  ? -1.280  4.799   0.088   1.00 0.00 ? 9   ILE A CG1  5  
ATOM 6924  C CG2  . ILE A 1 4  ? 0.154   3.161   1.320   1.00 0.00 ? 9   ILE A CG2  5  
ATOM 6925  C CD1  . ILE A 1 4  ? -2.458  4.760   1.035   1.00 0.00 ? 9   ILE A CD1  5  
ATOM 6926  H H    . ILE A 1 4  ? 1.286   5.303   -0.402  1.00 0.00 ? 9   ILE A H    5  
ATOM 6927  H HA   . ILE A 1 4  ? 1.144   2.597   -1.003  1.00 0.00 ? 9   ILE A HA   5  
ATOM 6928  H HB   . ILE A 1 4  ? -1.219  2.679   -0.186  1.00 0.00 ? 9   ILE A HB   5  
ATOM 6929  H HG12 . ILE A 1 4  ? -0.612  5.577   0.421   1.00 0.00 ? 9   ILE A HG12 5  
ATOM 6930  H HG13 . ILE A 1 4  ? -1.656  5.047   -0.891  1.00 0.00 ? 9   ILE A HG13 5  
ATOM 6931  H HG21 . ILE A 1 4  ? -0.096  2.156   1.604   1.00 0.00 ? 9   ILE A HG21 5  
ATOM 6932  H HG22 . ILE A 1 4  ? -0.193  3.854   2.068   1.00 0.00 ? 9   ILE A HG22 5  
ATOM 6933  H HG23 . ILE A 1 4  ? 1.221   3.252   1.199   1.00 0.00 ? 9   ILE A HG23 5  
ATOM 6934  H HD11 . ILE A 1 4  ? -2.926  5.733   1.069   1.00 0.00 ? 9   ILE A HD11 5  
ATOM 6935  H HD12 . ILE A 1 4  ? -2.117  4.491   2.025   1.00 0.00 ? 9   ILE A HD12 5  
ATOM 6936  H HD13 . ILE A 1 4  ? -3.174  4.027   0.689   1.00 0.00 ? 9   ILE A HD13 5  
ATOM 6937  N N    . GLN A 1 5  ? -0.826  4.450   -2.854  1.00 0.00 ? 10  GLN A N    5  
ATOM 6938  C CA   . GLN A 1 5  ? -1.640  4.449   -4.046  1.00 0.00 ? 10  GLN A CA   5  
ATOM 6939  C C    . GLN A 1 5  ? -0.901  3.761   -5.193  1.00 0.00 ? 10  GLN A C    5  
ATOM 6940  O O    . GLN A 1 5  ? -1.500  3.052   -6.003  1.00 0.00 ? 10  GLN A O    5  
ATOM 6941  C CB   . GLN A 1 5  ? -2.033  5.877   -4.439  1.00 0.00 ? 10  GLN A CB   5  
ATOM 6942  C CG   . GLN A 1 5  ? -2.769  6.633   -3.345  1.00 0.00 ? 10  GLN A CG   5  
ATOM 6943  C CD   . GLN A 1 5  ? -3.086  8.068   -3.733  1.00 0.00 ? 10  GLN A CD   5  
ATOM 6944  O OE1  . GLN A 1 5  ? -3.762  8.317   -4.731  1.00 0.00 ? 10  GLN A OE1  5  
ATOM 6945  N NE2  . GLN A 1 5  ? -2.601  9.019   -2.941  1.00 0.00 ? 10  GLN A NE2  5  
ATOM 6946  H H    . GLN A 1 5  ? -0.703  5.285   -2.359  1.00 0.00 ? 10  GLN A H    5  
ATOM 6947  H HA   . GLN A 1 5  ? -2.522  3.885   -3.796  1.00 0.00 ? 10  GLN A HA   5  
ATOM 6948  H HB2  . GLN A 1 5  ? -1.136  6.428   -4.687  1.00 0.00 ? 10  GLN A HB2  5  
ATOM 6949  H HB3  . GLN A 1 5  ? -2.670  5.835   -5.310  1.00 0.00 ? 10  GLN A HB3  5  
ATOM 6950  H HG2  . GLN A 1 5  ? -3.694  6.121   -3.134  1.00 0.00 ? 10  GLN A HG2  5  
ATOM 6951  H HG3  . GLN A 1 5  ? -2.155  6.645   -2.456  1.00 0.00 ? 10  GLN A HG3  5  
ATOM 6952  H HE21 . GLN A 1 5  ? -2.073  8.751   -2.161  1.00 0.00 ? 10  GLN A HE21 5  
ATOM 6953  H HE22 . GLN A 1 5  ? -2.792  9.953   -3.170  1.00 0.00 ? 10  GLN A HE22 5  
ATOM 6954  N N    . MET A 1 6  ? 0.415   3.970   -5.224  1.00 0.00 ? 11  MET A N    5  
ATOM 6955  C CA   . MET A 1 6  ? 1.292   3.376   -6.225  1.00 0.00 ? 11  MET A CA   5  
ATOM 6956  C C    . MET A 1 6  ? 1.134   1.853   -6.253  1.00 0.00 ? 11  MET A C    5  
ATOM 6957  O O    . MET A 1 6  ? 0.903   1.265   -7.312  1.00 0.00 ? 11  MET A O    5  
ATOM 6958  C CB   . MET A 1 6  ? 2.734   3.763   -5.888  1.00 0.00 ? 11  MET A CB   5  
ATOM 6959  C CG   . MET A 1 6  ? 3.795   3.136   -6.772  1.00 0.00 ? 11  MET A CG   5  
ATOM 6960  S SD   . MET A 1 6  ? 5.454   3.548   -6.205  1.00 0.00 ? 11  MET A SD   5  
ATOM 6961  C CE   . MET A 1 6  ? 6.453   2.637   -7.371  1.00 0.00 ? 11  MET A CE   5  
ATOM 6962  H H    . MET A 1 6  ? 0.816   4.535   -4.530  1.00 0.00 ? 11  MET A H    5  
ATOM 6963  H HA   . MET A 1 6  ? 1.027   3.779   -7.191  1.00 0.00 ? 11  MET A HA   5  
ATOM 6964  H HB2  . MET A 1 6  ? 2.828   4.837   -5.962  1.00 0.00 ? 11  MET A HB2  5  
ATOM 6965  H HB3  . MET A 1 6  ? 2.936   3.471   -4.869  1.00 0.00 ? 11  MET A HB3  5  
ATOM 6966  H HG2  . MET A 1 6  ? 3.674   2.062   -6.753  1.00 0.00 ? 11  MET A HG2  5  
ATOM 6967  H HG3  . MET A 1 6  ? 3.670   3.498   -7.780  1.00 0.00 ? 11  MET A HG3  5  
ATOM 6968  H HE1  . MET A 1 6  ? 5.853   1.863   -7.828  1.00 0.00 ? 11  MET A HE1  5  
ATOM 6969  H HE2  . MET A 1 6  ? 7.288   2.186   -6.855  1.00 0.00 ? 11  MET A HE2  5  
ATOM 6970  H HE3  . MET A 1 6  ? 6.817   3.308   -8.133  1.00 0.00 ? 11  MET A HE3  5  
ATOM 6971  N N    . LEU A 1 7  ? 1.249   1.223   -5.080  1.00 0.00 ? 12  LEU A N    5  
ATOM 6972  C CA   . LEU A 1 7  ? 1.105   -0.229  -4.968  1.00 0.00 ? 12  LEU A CA   5  
ATOM 6973  C C    . LEU A 1 7  ? -0.344  -0.652  -5.180  1.00 0.00 ? 12  LEU A C    5  
ATOM 6974  O O    . LEU A 1 7  ? -0.621  -1.548  -5.972  1.00 0.00 ? 12  LEU A O    5  
ATOM 6975  C CB   . LEU A 1 7  ? 1.552   -0.723  -3.596  1.00 0.00 ? 12  LEU A CB   5  
ATOM 6976  C CG   . LEU A 1 7  ? 3.012   -0.469  -3.226  1.00 0.00 ? 12  LEU A CG   5  
ATOM 6977  C CD1  . LEU A 1 7  ? 3.123   -0.044  -1.766  1.00 0.00 ? 12  LEU A CD1  5  
ATOM 6978  C CD2  . LEU A 1 7  ? 3.827   -1.727  -3.473  1.00 0.00 ? 12  LEU A CD2  5  
ATOM 6979  H H    . LEU A 1 7  ? 1.424   1.749   -4.271  1.00 0.00 ? 12  LEU A H    5  
ATOM 6980  H HA   . LEU A 1 7  ? 1.722   -0.686  -5.728  1.00 0.00 ? 12  LEU A HA   5  
ATOM 6981  H HB2  . LEU A 1 7  ? 0.926   -0.260  -2.850  1.00 0.00 ? 12  LEU A HB2  5  
ATOM 6982  H HB3  . LEU A 1 7  ? 1.386   -1.789  -3.570  1.00 0.00 ? 12  LEU A HB3  5  
ATOM 6983  H HG   . LEU A 1 7  ? 3.409   0.323   -3.844  1.00 0.00 ? 12  LEU A HG   5  
ATOM 6984  H HD11 . LEU A 1 7  ? 3.466   0.978   -1.716  1.00 0.00 ? 12  LEU A HD11 5  
ATOM 6985  H HD12 . LEU A 1 7  ? 3.825   -0.686  -1.257  1.00 0.00 ? 12  LEU A HD12 5  
ATOM 6986  H HD13 . LEU A 1 7  ? 2.155   -0.123  -1.294  1.00 0.00 ? 12  LEU A HD13 5  
ATOM 6987  H HD21 . LEU A 1 7  ? 4.871   -1.471  -3.561  1.00 0.00 ? 12  LEU A HD21 5  
ATOM 6988  H HD22 . LEU A 1 7  ? 3.492   -2.195  -4.386  1.00 0.00 ? 12  LEU A HD22 5  
ATOM 6989  H HD23 . LEU A 1 7  ? 3.690   -2.415  -2.649  1.00 0.00 ? 12  LEU A HD23 5  
ATOM 6990  N N    . LEU A 1 8  ? -1.261  -0.015  -4.444  1.00 0.00 ? 13  LEU A N    5  
ATOM 6991  C CA   . LEU A 1 8  ? -2.689  -0.333  -4.532  1.00 0.00 ? 13  LEU A CA   5  
ATOM 6992  C C    . LEU A 1 8  ? -3.155  -0.440  -5.982  1.00 0.00 ? 13  LEU A C    5  
ATOM 6993  O O    . LEU A 1 8  ? -3.636  -1.492  -6.407  1.00 0.00 ? 13  LEU A O    5  
ATOM 6994  C CB   . LEU A 1 8  ? -3.517  0.735   -3.809  1.00 0.00 ? 13  LEU A CB   5  
ATOM 6995  C CG   . LEU A 1 8  ? -3.284  0.838   -2.304  1.00 0.00 ? 13  LEU A CG   5  
ATOM 6996  C CD1  . LEU A 1 8  ? -3.936  2.099   -1.751  1.00 0.00 ? 13  LEU A CD1  5  
ATOM 6997  C CD2  . LEU A 1 8  ? -3.825  -0.399  -1.603  1.00 0.00 ? 13  LEU A CD2  5  
ATOM 6998  H H    . LEU A 1 8  ? -0.964  0.680   -3.811  1.00 0.00 ? 13  LEU A H    5  
ATOM 6999  H HA   . LEU A 1 8  ? -2.837  -1.291  -4.047  1.00 0.00 ? 13  LEU A HA   5  
ATOM 7000  H HB2  . LEU A 1 8  ? -3.290  1.693   -4.252  1.00 0.00 ? 13  LEU A HB2  5  
ATOM 7001  H HB3  . LEU A 1 8  ? -4.562  0.520   -3.974  1.00 0.00 ? 13  LEU A HB3  5  
ATOM 7002  H HG   . LEU A 1 8  ? -2.223  0.898   -2.110  1.00 0.00 ? 13  LEU A HG   5  
ATOM 7003  H HD11 . LEU A 1 8  ? -3.171  2.817   -1.495  1.00 0.00 ? 13  LEU A HD11 5  
ATOM 7004  H HD12 . LEU A 1 8  ? -4.507  1.854   -0.868  1.00 0.00 ? 13  LEU A HD12 5  
ATOM 7005  H HD13 . LEU A 1 8  ? -4.592  2.522   -2.497  1.00 0.00 ? 13  LEU A HD13 5  
ATOM 7006  H HD21 . LEU A 1 8  ? -4.761  -0.159  -1.122  1.00 0.00 ? 13  LEU A HD21 5  
ATOM 7007  H HD22 . LEU A 1 8  ? -3.117  -0.733  -0.862  1.00 0.00 ? 13  LEU A HD22 5  
ATOM 7008  H HD23 . LEU A 1 8  ? -3.983  -1.183  -2.328  1.00 0.00 ? 13  LEU A HD23 5  
ATOM 7009  N N    . GLU A 1 9  ? -3.004  0.654   -6.737  1.00 0.00 ? 14  GLU A N    5  
ATOM 7010  C CA   . GLU A 1 9  ? -3.401  0.683   -8.146  1.00 0.00 ? 14  GLU A CA   5  
ATOM 7011  C C    . GLU A 1 9  ? -2.812  -0.512  -8.895  1.00 0.00 ? 14  GLU A C    5  
ATOM 7012  O O    . GLU A 1 9  ? -3.458  -1.089  -9.771  1.00 0.00 ? 14  GLU A O    5  
ATOM 7013  C CB   . GLU A 1 9  ? -2.953  1.992   -8.805  1.00 0.00 ? 14  GLU A CB   5  
ATOM 7014  C CG   . GLU A 1 9  ? -3.683  3.228   -8.292  1.00 0.00 ? 14  GLU A CG   5  
ATOM 7015  C CD   . GLU A 1 9  ? -5.166  3.226   -8.627  1.00 0.00 ? 14  GLU A CD   5  
ATOM 7016  O OE1  . GLU A 1 9  ? -5.900  2.365   -8.096  1.00 0.00 ? 14  GLU A OE1  5  
ATOM 7017  O OE2  . GLU A 1 9  ? -5.595  4.089   -9.422  1.00 0.00 ? 14  GLU A OE2  5  
ATOM 7018  H H    . GLU A 1 9  ? -2.610  1.458   -6.337  1.00 0.00 ? 14  GLU A H    5  
ATOM 7019  H HA   . GLU A 1 9  ? -4.478  0.617   -8.187  1.00 0.00 ? 14  GLU A HA   5  
ATOM 7020  H HB2  . GLU A 1 9  ? -1.894  2.129   -8.621  1.00 0.00 ? 14  GLU A HB2  5  
ATOM 7021  H HB3  . GLU A 1 9  ? -3.116  1.920   -9.870  1.00 0.00 ? 14  GLU A HB3  5  
ATOM 7022  H HG2  . GLU A 1 9  ? -3.575  3.273   -7.219  1.00 0.00 ? 14  GLU A HG2  5  
ATOM 7023  H HG3  . GLU A 1 9  ? -3.232  4.104   -8.735  1.00 0.00 ? 14  GLU A HG3  5  
ATOM 7024  N N    . ALA A 1 10 ? -1.589  -0.883  -8.521  1.00 0.00 ? 15  ALA A N    5  
ATOM 7025  C CA   . ALA A 1 10 ? -0.904  -2.016  -9.125  1.00 0.00 ? 15  ALA A CA   5  
ATOM 7026  C C    . ALA A 1 10 ? -1.537  -3.331  -8.702  1.00 0.00 ? 15  ALA A C    5  
ATOM 7027  O O    . ALA A 1 10 ? -1.904  -4.135  -9.551  1.00 0.00 ? 15  ALA A O    5  
ATOM 7028  C CB   . ALA A 1 10 ? 0.557   -2.001  -8.748  1.00 0.00 ? 15  ALA A CB   5  
ATOM 7029  H H    . ALA A 1 10 ? -1.139  -0.387  -7.805  1.00 0.00 ? 15  ALA A H    5  
ATOM 7030  H HA   . ALA A 1 10 ? -0.967  -1.925  -10.200 1.00 0.00 ? 15  ALA A HA   5  
ATOM 7031  H HB1  . ALA A 1 10 ? 0.670   -1.618  -7.745  1.00 0.00 ? 15  ALA A HB1  5  
ATOM 7032  H HB2  . ALA A 1 10 ? 1.089   -1.367  -9.436  1.00 0.00 ? 15  ALA A HB2  5  
ATOM 7033  H HB3  . ALA A 1 10 ? 0.955   -3.004  -8.799  1.00 0.00 ? 15  ALA A HB3  5  
ATOM 7034  N N    . ALA A 1 11 ? -1.656  -3.548  -7.383  1.00 0.00 ? 16  ALA A N    5  
ATOM 7035  C CA   . ALA A 1 11 ? -2.237  -4.783  -6.858  1.00 0.00 ? 16  ALA A CA   5  
ATOM 7036  C C    . ALA A 1 11 ? -3.493  -5.180  -7.623  1.00 0.00 ? 16  ALA A C    5  
ATOM 7037  O O    . ALA A 1 11 ? -3.642  -6.333  -8.019  1.00 0.00 ? 16  ALA A O    5  
ATOM 7038  C CB   . ALA A 1 11 ? -2.570  -4.671  -5.383  1.00 0.00 ? 16  ALA A CB   5  
ATOM 7039  H H    . ALA A 1 11 ? -1.337  -2.866  -6.756  1.00 0.00 ? 16  ALA A H    5  
ATOM 7040  H HA   . ALA A 1 11 ? -1.487  -5.555  -6.969  1.00 0.00 ? 16  ALA A HA   5  
ATOM 7041  H HB1  . ALA A 1 11 ? -3.138  -5.547  -5.088  1.00 0.00 ? 16  ALA A HB1  5  
ATOM 7042  H HB2  . ALA A 1 11 ? -3.159  -3.784  -5.212  1.00 0.00 ? 16  ALA A HB2  5  
ATOM 7043  H HB3  . ALA A 1 11 ? -1.660  -4.623  -4.808  1.00 0.00 ? 16  ALA A HB3  5  
ATOM 7044  N N    . ASP A 1 12 ? -4.394  -4.211  -7.828  1.00 0.00 ? 17  ASP A N    5  
ATOM 7045  C CA   . ASP A 1 12 ? -5.638  -4.454  -8.558  1.00 0.00 ? 17  ASP A CA   5  
ATOM 7046  C C    . ASP A 1 12 ? -5.332  -5.102  -9.906  1.00 0.00 ? 17  ASP A C    5  
ATOM 7047  O O    . ASP A 1 12 ? -5.974  -6.078  -10.297 1.00 0.00 ? 17  ASP A O    5  
ATOM 7048  C CB   . ASP A 1 12 ? -6.401  -3.136  -8.755  1.00 0.00 ? 17  ASP A CB   5  
ATOM 7049  C CG   . ASP A 1 12 ? -7.762  -3.328  -9.406  1.00 0.00 ? 17  ASP A CG   5  
ATOM 7050  O OD1  . ASP A 1 12 ? -7.810  -3.737  -10.585 1.00 0.00 ? 17  ASP A OD1  5  
ATOM 7051  O OD2  . ASP A 1 12 ? -8.780  -3.067  -8.732  1.00 0.00 ? 17  ASP A OD2  5  
ATOM 7052  H H    . ASP A 1 12 ? -4.209  -3.311  -7.488  1.00 0.00 ? 17  ASP A H    5  
ATOM 7053  H HA   . ASP A 1 12 ? -6.242  -5.131  -7.972  1.00 0.00 ? 17  ASP A HA   5  
ATOM 7054  H HB2  . ASP A 1 12 ? -6.547  -2.668  -7.795  1.00 0.00 ? 17  ASP A HB2  5  
ATOM 7055  H HB3  . ASP A 1 12 ? -5.813  -2.481  -9.383  1.00 0.00 ? 17  ASP A HB3  5  
ATOM 7056  N N    . TYR A 1 13 ? -4.326  -4.563  -10.595 1.00 0.00 ? 18  TYR A N    5  
ATOM 7057  C CA   . TYR A 1 13 ? -3.902  -5.093  -11.884 1.00 0.00 ? 18  TYR A CA   5  
ATOM 7058  C C    . TYR A 1 13 ? -3.192  -6.428  -11.697 1.00 0.00 ? 18  TYR A C    5  
ATOM 7059  O O    . TYR A 1 13 ? -3.430  -7.373  -12.447 1.00 0.00 ? 18  TYR A O    5  
ATOM 7060  C CB   . TYR A 1 13 ? -2.994  -4.082  -12.603 1.00 0.00 ? 18  TYR A CB   5  
ATOM 7061  C CG   . TYR A 1 13 ? -2.481  -4.548  -13.951 1.00 0.00 ? 18  TYR A CG   5  
ATOM 7062  C CD1  . TYR A 1 13 ? -1.559  -5.585  -14.048 1.00 0.00 ? 18  TYR A CD1  5  
ATOM 7063  C CD2  . TYR A 1 13 ? -2.922  -3.951  -15.125 1.00 0.00 ? 18  TYR A CD2  5  
ATOM 7064  C CE1  . TYR A 1 13 ? -1.091  -6.011  -15.276 1.00 0.00 ? 18  TYR A CE1  5  
ATOM 7065  C CE2  . TYR A 1 13 ? -2.458  -4.373  -16.357 1.00 0.00 ? 18  TYR A CE2  5  
ATOM 7066  C CZ   . TYR A 1 13 ? -1.544  -5.403  -16.429 1.00 0.00 ? 18  TYR A CZ   5  
ATOM 7067  O OH   . TYR A 1 13 ? -1.083  -5.823  -17.657 1.00 0.00 ? 18  TYR A OH   5  
ATOM 7068  H H    . TYR A 1 13 ? -3.844  -3.798  -10.215 1.00 0.00 ? 18  TYR A H    5  
ATOM 7069  H HA   . TYR A 1 13 ? -4.785  -5.263  -12.470 1.00 0.00 ? 18  TYR A HA   5  
ATOM 7070  H HB2  . TYR A 1 13 ? -3.545  -3.167  -12.762 1.00 0.00 ? 18  TYR A HB2  5  
ATOM 7071  H HB3  . TYR A 1 13 ? -2.139  -3.872  -11.977 1.00 0.00 ? 18  TYR A HB3  5  
ATOM 7072  H HD1  . TYR A 1 13 ? -1.205  -6.058  -13.145 1.00 0.00 ? 18  TYR A HD1  5  
ATOM 7073  H HD2  . TYR A 1 13 ? -3.637  -3.145  -15.069 1.00 0.00 ? 18  TYR A HD2  5  
ATOM 7074  H HE1  . TYR A 1 13 ? -0.375  -6.817  -15.329 1.00 0.00 ? 18  TYR A HE1  5  
ATOM 7075  H HE2  . TYR A 1 13 ? -2.814  -3.895  -17.259 1.00 0.00 ? 18  TYR A HE2  5  
ATOM 7076  H HH   . TYR A 1 13 ? -0.261  -6.308  -17.547 1.00 0.00 ? 18  TYR A HH   5  
ATOM 7077  N N    . LEU A 1 14 ? -2.344  -6.507  -10.671 1.00 0.00 ? 19  LEU A N    5  
ATOM 7078  C CA   . LEU A 1 14 ? -1.628  -7.740  -10.361 1.00 0.00 ? 19  LEU A CA   5  
ATOM 7079  C C    . LEU A 1 14 ? -2.639  -8.856  -10.108 1.00 0.00 ? 19  LEU A C    5  
ATOM 7080  O O    . LEU A 1 14 ? -2.431  -10.002 -10.509 1.00 0.00 ? 19  LEU A O    5  
ATOM 7081  C CB   . LEU A 1 14 ? -0.735  -7.546  -9.130  1.00 0.00 ? 19  LEU A CB   5  
ATOM 7082  C CG   . LEU A 1 14 ? 0.192   -6.330  -9.191  1.00 0.00 ? 19  LEU A CG   5  
ATOM 7083  C CD1  . LEU A 1 14 ? 0.917   -6.135  -7.869  1.00 0.00 ? 19  LEU A CD1  5  
ATOM 7084  C CD2  . LEU A 1 14 ? 1.191   -6.465  -10.331 1.00 0.00 ? 19  LEU A CD2  5  
ATOM 7085  H H    . LEU A 1 14 ? -2.216  -5.724  -10.095 1.00 0.00 ? 19  LEU A H    5  
ATOM 7086  H HA   . LEU A 1 14 ? -1.018  -8.001  -11.212 1.00 0.00 ? 19  LEU A HA   5  
ATOM 7087  H HB2  . LEU A 1 14 ? -1.370  -7.447  -8.262  1.00 0.00 ? 19  LEU A HB2  5  
ATOM 7088  H HB3  . LEU A 1 14 ? -0.125  -8.428  -9.011  1.00 0.00 ? 19  LEU A HB3  5  
ATOM 7089  H HG   . LEU A 1 14 ? -0.403  -5.453  -9.372  1.00 0.00 ? 19  LEU A HG   5  
ATOM 7090  H HD11 . LEU A 1 14 ? 0.250   -6.373  -7.052  1.00 0.00 ? 19  LEU A HD11 5  
ATOM 7091  H HD12 . LEU A 1 14 ? 1.238   -5.103  -7.784  1.00 0.00 ? 19  LEU A HD12 5  
ATOM 7092  H HD13 . LEU A 1 14 ? 1.779   -6.783  -7.831  1.00 0.00 ? 19  LEU A HD13 5  
ATOM 7093  H HD21 . LEU A 1 14 ? 1.609   -5.494  -10.559 1.00 0.00 ? 19  LEU A HD21 5  
ATOM 7094  H HD22 . LEU A 1 14 ? 0.689   -6.855  -11.205 1.00 0.00 ? 19  LEU A HD22 5  
ATOM 7095  H HD23 . LEU A 1 14 ? 1.983   -7.139  -10.040 1.00 0.00 ? 19  LEU A HD23 5  
ATOM 7096  N N    . GLU A 1 15 ? -3.753  -8.493  -9.463  1.00 0.00 ? 20  GLU A N    5  
ATOM 7097  C CA   . GLU A 1 15 ? -4.825  -9.448  -9.174  1.00 0.00 ? 20  GLU A CA   5  
ATOM 7098  C C    . GLU A 1 15 ? -5.501  -9.915  -10.461 1.00 0.00 ? 20  GLU A C    5  
ATOM 7099  O O    . GLU A 1 15 ? -5.676  -11.115 -10.679 1.00 0.00 ? 20  GLU A O    5  
ATOM 7100  C CB   . GLU A 1 15 ? -5.874  -8.827  -8.244  1.00 0.00 ? 20  GLU A CB   5  
ATOM 7101  C CG   . GLU A 1 15 ? -5.450  -8.752  -6.787  1.00 0.00 ? 20  GLU A CG   5  
ATOM 7102  C CD   . GLU A 1 15 ? -5.390  -10.116 -6.119  1.00 0.00 ? 20  GLU A CD   5  
ATOM 7103  O OE1  . GLU A 1 15 ? -4.539  -10.941 -6.514  1.00 0.00 ? 20  GLU A OE1  5  
ATOM 7104  O OE2  . GLU A 1 15 ? -6.199  -10.360 -5.199  1.00 0.00 ? 20  GLU A OE2  5  
ATOM 7105  H H    . GLU A 1 15 ? -3.860  -7.544  -9.187  1.00 0.00 ? 20  GLU A H    5  
ATOM 7106  H HA   . GLU A 1 15 ? -4.382  -10.302 -8.685  1.00 0.00 ? 20  GLU A HA   5  
ATOM 7107  H HB2  . GLU A 1 15 ? -6.087  -7.824  -8.584  1.00 0.00 ? 20  GLU A HB2  5  
ATOM 7108  H HB3  . GLU A 1 15 ? -6.780  -9.414  -8.302  1.00 0.00 ? 20  GLU A HB3  5  
ATOM 7109  H HG2  . GLU A 1 15 ? -4.472  -8.300  -6.735  1.00 0.00 ? 20  GLU A HG2  5  
ATOM 7110  H HG3  . GLU A 1 15 ? -6.158  -8.136  -6.251  1.00 0.00 ? 20  GLU A HG3  5  
ATOM 7111  N N    . ARG A 1 16 ? -5.881  -8.955  -11.305 1.00 0.00 ? 21  ARG A N    5  
ATOM 7112  C CA   . ARG A 1 16 ? -6.544  -9.256  -12.572 1.00 0.00 ? 21  ARG A CA   5  
ATOM 7113  C C    . ARG A 1 16 ? -5.626  -10.046 -13.506 1.00 0.00 ? 21  ARG A C    5  
ATOM 7114  O O    . ARG A 1 16 ? -6.049  -11.123 -13.973 1.00 0.00 ? 21  ARG A O    5  
ATOM 7115  C CB   . ARG A 1 16 ? -7.003  -7.957  -13.249 1.00 0.00 ? 21  ARG A CB   5  
ATOM 7116  C CG   . ARG A 1 16 ? -7.708  -8.171  -14.579 1.00 0.00 ? 21  ARG A CG   5  
ATOM 7117  C CD   . ARG A 1 16 ? -8.937  -9.057  -14.428 1.00 0.00 ? 21  ARG A CD   5  
ATOM 7118  N NE   . ARG A 1 16 ? -9.605  -9.301  -15.707 1.00 0.00 ? 21  ARG A NE   5  
ATOM 7119  C CZ   . ARG A 1 16 ? -9.072  -10.001 -16.715 1.00 0.00 ? 21  ARG A CZ   5  
ATOM 7120  N NH1  . ARG A 1 16 ? -7.879  -10.577 -16.588 1.00 0.00 ? 21  ARG A NH1  5  
ATOM 7121  N NH2  . ARG A 1 16 ? -9.747  -10.138 -17.852 1.00 0.00 ? 21  ARG A NH2  5  
ATOM 7122  O OXT  . ARG A 1 16 ? -4.493  -9.584  -13.762 1.00 0.00 ? 21  ARG A OXT  5  
ATOM 7123  H H    . ARG A 1 16 ? -5.714  -8.018  -11.066 1.00 0.00 ? 21  ARG A H    5  
ATOM 7124  H HA   . ARG A 1 16 ? -7.414  -9.858  -12.351 1.00 0.00 ? 21  ARG A HA   5  
ATOM 7125  H HB2  . ARG A 1 16 ? -7.682  -7.442  -12.585 1.00 0.00 ? 21  ARG A HB2  5  
ATOM 7126  H HB3  . ARG A 1 16 ? -6.139  -7.332  -13.420 1.00 0.00 ? 21  ARG A HB3  5  
ATOM 7127  H HG2  . ARG A 1 16 ? -8.016  -7.213  -14.969 1.00 0.00 ? 21  ARG A HG2  5  
ATOM 7128  H HG3  . ARG A 1 16 ? -7.020  -8.637  -15.268 1.00 0.00 ? 21  ARG A HG3  5  
ATOM 7129  H HD2  . ARG A 1 16 ? -8.632  -10.005 -14.007 1.00 0.00 ? 21  ARG A HD2  5  
ATOM 7130  H HD3  . ARG A 1 16 ? -9.632  -8.574  -13.755 1.00 0.00 ? 21  ARG A HD3  5  
ATOM 7131  H HE   . ARG A 1 16 ? -10.496 -8.910  -15.828 1.00 0.00 ? 21  ARG A HE   5  
ATOM 7132  H HH11 . ARG A 1 16 ? -7.368  -10.493 -15.732 1.00 0.00 ? 21  ARG A HH11 5  
ATOM 7133  H HH12 . ARG A 1 16 ? -7.490  -11.097 -17.348 1.00 0.00 ? 21  ARG A HH12 5  
ATOM 7134  H HH21 . ARG A 1 16 ? -10.648 -9.718  -17.952 1.00 0.00 ? 21  ARG A HH21 5  
ATOM 7135  H HH22 . ARG A 1 16 ? -9.352  -10.660 -18.607 1.00 0.00 ? 21  ARG A HH22 5  
ATOM 7136  N N    . SER B 2 1  ? -4.442  10.166  -25.666 1.00 0.00 ? 295 SER B N    5  
ATOM 7137  C CA   . SER B 2 1  ? -5.294  10.299  -24.452 1.00 0.00 ? 295 SER B CA   5  
ATOM 7138  C C    . SER B 2 1  ? -4.568  9.794   -23.206 1.00 0.00 ? 295 SER B C    5  
ATOM 7139  O O    . SER B 2 1  ? -4.122  8.646   -23.162 1.00 0.00 ? 295 SER B O    5  
ATOM 7140  C CB   . SER B 2 1  ? -6.592  9.513   -24.669 1.00 0.00 ? 295 SER B CB   5  
ATOM 7141  O OG   . SER B 2 1  ? -6.327  8.140   -24.910 1.00 0.00 ? 295 SER B OG   5  
ATOM 7142  H H1   . SER B 2 1  ? -4.256  9.153   -25.814 1.00 0.00 ? 295 SER B H1   5  
ATOM 7143  H H2   . SER B 2 1  ? -3.559  10.687  -25.493 1.00 0.00 ? 295 SER B H2   5  
ATOM 7144  H H3   . SER B 2 1  ? -4.966  10.570  -26.468 1.00 0.00 ? 295 SER B H3   5  
ATOM 7145  H HA   . SER B 2 1  ? -5.533  11.345  -24.317 1.00 0.00 ? 295 SER B HA   5  
ATOM 7146  H HB2  . SER B 2 1  ? -7.211  9.597   -23.789 1.00 0.00 ? 295 SER B HB2  5  
ATOM 7147  H HB3  . SER B 2 1  ? -7.118  9.920   -25.520 1.00 0.00 ? 295 SER B HB3  5  
ATOM 7148  H HG   . SER B 2 1  ? -6.749  7.871   -25.729 1.00 0.00 ? 295 SER B HG   5  
ATOM 7149  N N    . LEU B 2 2  ? -4.455  10.665  -22.198 1.00 0.00 ? 296 LEU B N    5  
ATOM 7150  C CA   . LEU B 2 2  ? -3.785  10.328  -20.939 1.00 0.00 ? 296 LEU B CA   5  
ATOM 7151  C C    . LEU B 2 2  ? -2.313  9.985   -21.175 1.00 0.00 ? 296 LEU B C    5  
ATOM 7152  O O    . LEU B 2 2  ? -1.981  8.865   -21.575 1.00 0.00 ? 296 LEU B O    5  
ATOM 7153  C CB   . LEU B 2 2  ? -4.492  9.164   -20.230 1.00 0.00 ? 296 LEU B CB   5  
ATOM 7154  C CG   . LEU B 2 2  ? -5.940  9.433   -19.798 1.00 0.00 ? 296 LEU B CG   5  
ATOM 7155  C CD1  . LEU B 2 2  ? -6.862  9.525   -21.006 1.00 0.00 ? 296 LEU B CD1  5  
ATOM 7156  C CD2  . LEU B 2 2  ? -6.418  8.350   -18.840 1.00 0.00 ? 296 LEU B CD2  5  
ATOM 7157  H H    . LEU B 2 2  ? -4.835  11.563  -22.303 1.00 0.00 ? 296 LEU B H    5  
ATOM 7158  H HA   . LEU B 2 2  ? -3.834  11.200  -20.304 1.00 0.00 ? 296 LEU B HA   5  
ATOM 7159  H HB2  . LEU B 2 2  ? -4.491  8.312   -20.894 1.00 0.00 ? 296 LEU B HB2  5  
ATOM 7160  H HB3  . LEU B 2 2  ? -3.922  8.909   -19.349 1.00 0.00 ? 296 LEU B HB3  5  
ATOM 7161  H HG   . LEU B 2 2  ? -5.981  10.379  -19.278 1.00 0.00 ? 296 LEU B HG   5  
ATOM 7162  H HD11 . LEU B 2 2  ? -7.867  9.265   -20.711 1.00 0.00 ? 296 LEU B HD11 5  
ATOM 7163  H HD12 . LEU B 2 2  ? -6.523  8.841   -21.771 1.00 0.00 ? 296 LEU B HD12 5  
ATOM 7164  H HD13 . LEU B 2 2  ? -6.847  10.532  -21.394 1.00 0.00 ? 296 LEU B HD13 5  
ATOM 7165  H HD21 . LEU B 2 2  ? -5.722  8.263   -18.019 1.00 0.00 ? 296 LEU B HD21 5  
ATOM 7166  H HD22 . LEU B 2 2  ? -6.478  7.407   -19.364 1.00 0.00 ? 296 LEU B HD22 5  
ATOM 7167  H HD23 . LEU B 2 2  ? -7.394  8.613   -18.459 1.00 0.00 ? 296 LEU B HD23 5  
ATOM 7168  N N    . GLN B 2 3  ? -1.436  10.957  -20.924 1.00 0.00 ? 297 GLN B N    5  
ATOM 7169  C CA   . GLN B 2 3  ? 0.001   10.765  -21.108 1.00 0.00 ? 297 GLN B CA   5  
ATOM 7170  C C    . GLN B 2 3  ? 0.567   9.815   -20.055 1.00 0.00 ? 297 GLN B C    5  
ATOM 7171  O O    . GLN B 2 3  ? 0.612   10.145  -18.868 1.00 0.00 ? 297 GLN B O    5  
ATOM 7172  C CB   . GLN B 2 3  ? 0.734   12.108  -21.048 1.00 0.00 ? 297 GLN B CB   5  
ATOM 7173  C CG   . GLN B 2 3  ? 0.305   13.087  -22.132 1.00 0.00 ? 297 GLN B CG   5  
ATOM 7174  C CD   . GLN B 2 3  ? 1.064   14.401  -22.068 1.00 0.00 ? 297 GLN B CD   5  
ATOM 7175  O OE1  . GLN B 2 3  ? 1.009   15.114  -21.066 1.00 0.00 ? 297 GLN B OE1  5  
ATOM 7176  N NE2  . GLN B 2 3  ? 1.776   14.729  -23.141 1.00 0.00 ? 297 GLN B NE2  5  
ATOM 7177  H H    . GLN B 2 3  ? -1.765  11.824  -20.607 1.00 0.00 ? 297 GLN B H    5  
ATOM 7178  H HA   . GLN B 2 3  ? 0.152   10.329  -22.085 1.00 0.00 ? 297 GLN B HA   5  
ATOM 7179  H HB2  . GLN B 2 3  ? 0.548   12.565  -20.088 1.00 0.00 ? 297 GLN B HB2  5  
ATOM 7180  H HB3  . GLN B 2 3  ? 1.795   11.932  -21.153 1.00 0.00 ? 297 GLN B HB3  5  
ATOM 7181  H HG2  . GLN B 2 3  ? 0.480   12.634  -23.097 1.00 0.00 ? 297 GLN B HG2  5  
ATOM 7182  H HG3  . GLN B 2 3  ? -0.749  13.290  -22.016 1.00 0.00 ? 297 GLN B HG3  5  
ATOM 7183  H HE21 . GLN B 2 3  ? 1.775   14.114  -23.906 1.00 0.00 ? 297 GLN B HE21 5  
ATOM 7184  H HE22 . GLN B 2 3  ? 2.274   15.572  -23.125 1.00 0.00 ? 297 GLN B HE22 5  
ATOM 7185  N N    . ASN B 2 4  ? 1.000   8.633   -20.500 1.00 0.00 ? 298 ASN B N    5  
ATOM 7186  C CA   . ASN B 2 4  ? 1.565   7.623   -19.601 1.00 0.00 ? 298 ASN B CA   5  
ATOM 7187  C C    . ASN B 2 4  ? 2.599   6.764   -20.329 1.00 0.00 ? 298 ASN B C    5  
ATOM 7188  O O    . ASN B 2 4  ? 2.634   6.722   -21.560 1.00 0.00 ? 298 ASN B O    5  
ATOM 7189  C CB   . ASN B 2 4  ? 0.464   6.716   -19.030 1.00 0.00 ? 298 ASN B CB   5  
ATOM 7190  C CG   . ASN B 2 4  ? -0.559  7.466   -18.191 1.00 0.00 ? 298 ASN B CG   5  
ATOM 7191  O OD1  . ASN B 2 4  ? -1.360  8.243   -18.713 1.00 0.00 ? 298 ASN B OD1  5  
ATOM 7192  N ND2  . ASN B 2 4  ? -0.536  7.238   -16.882 1.00 0.00 ? 298 ASN B ND2  5  
ATOM 7193  H H    . ASN B 2 4  ? 0.935   8.432   -21.458 1.00 0.00 ? 298 ASN B H    5  
ATOM 7194  H HA   . ASN B 2 4  ? 2.052   8.141   -18.789 1.00 0.00 ? 298 ASN B HA   5  
ATOM 7195  H HB2  . ASN B 2 4  ? -0.055  6.237   -19.845 1.00 0.00 ? 298 ASN B HB2  5  
ATOM 7196  H HB3  . ASN B 2 4  ? 0.923   5.960   -18.409 1.00 0.00 ? 298 ASN B HB3  5  
ATOM 7197  H HD21 . ASN B 2 4  ? 0.128   6.610   -16.530 1.00 0.00 ? 298 ASN B HD21 5  
ATOM 7198  H HD22 . ASN B 2 4  ? -1.187  7.710   -16.319 1.00 0.00 ? 298 ASN B HD22 5  
ATOM 7199  N N    . ASN B 2 5  ? 3.441   6.081   -19.553 1.00 0.00 ? 299 ASN B N    5  
ATOM 7200  C CA   . ASN B 2 5  ? 4.484   5.221   -20.110 1.00 0.00 ? 299 ASN B CA   5  
ATOM 7201  C C    . ASN B 2 5  ? 4.908   4.154   -19.097 1.00 0.00 ? 299 ASN B C    5  
ATOM 7202  O O    . ASN B 2 5  ? 4.273   3.996   -18.055 1.00 0.00 ? 299 ASN B O    5  
ATOM 7203  C CB   . ASN B 2 5  ? 5.695   6.066   -20.535 1.00 0.00 ? 299 ASN B CB   5  
ATOM 7204  C CG   . ASN B 2 5  ? 6.310   6.842   -19.381 1.00 0.00 ? 299 ASN B CG   5  
ATOM 7205  O OD1  . ASN B 2 5  ? 6.806   6.257   -18.417 1.00 0.00 ? 299 ASN B OD1  5  
ATOM 7206  N ND2  . ASN B 2 5  ? 6.278   8.168   -19.471 1.00 0.00 ? 299 ASN B ND2  5  
ATOM 7207  H H    . ASN B 2 5  ? 3.361   6.162   -18.578 1.00 0.00 ? 299 ASN B H    5  
ATOM 7208  H HA   . ASN B 2 5  ? 4.077   4.730   -20.981 1.00 0.00 ? 299 ASN B HA   5  
ATOM 7209  H HB2  . ASN B 2 5  ? 6.452   5.417   -20.947 1.00 0.00 ? 299 ASN B HB2  5  
ATOM 7210  H HB3  . ASN B 2 5  ? 5.382   6.771   -21.292 1.00 0.00 ? 299 ASN B HB3  5  
ATOM 7211  H HD21 . ASN B 2 5  ? 5.866   8.570   -20.265 1.00 0.00 ? 299 ASN B HD21 5  
ATOM 7212  H HD22 . ASN B 2 5  ? 6.668   8.691   -18.740 1.00 0.00 ? 299 ASN B HD22 5  
ATOM 7213  N N    . GLN B 2 6  ? 5.987   3.429   -19.408 1.00 0.00 ? 300 GLN B N    5  
ATOM 7214  C CA   . GLN B 2 6  ? 6.496   2.384   -18.521 1.00 0.00 ? 300 GLN B CA   5  
ATOM 7215  C C    . GLN B 2 6  ? 7.407   2.988   -17.451 1.00 0.00 ? 300 GLN B C    5  
ATOM 7216  O O    . GLN B 2 6  ? 8.528   3.406   -17.747 1.00 0.00 ? 300 GLN B O    5  
ATOM 7217  C CB   . GLN B 2 6  ? 7.262   1.309   -19.308 1.00 0.00 ? 300 GLN B CB   5  
ATOM 7218  C CG   . GLN B 2 6  ? 6.413   0.554   -20.331 1.00 0.00 ? 300 GLN B CG   5  
ATOM 7219  C CD   . GLN B 2 6  ? 6.144   1.323   -21.621 1.00 0.00 ? 300 GLN B CD   5  
ATOM 7220  O OE1  . GLN B 2 6  ? 5.143   1.076   -22.294 1.00 0.00 ? 300 GLN B OE1  5  
ATOM 7221  N NE2  . GLN B 2 6  ? 7.050   2.223   -22.007 1.00 0.00 ? 300 GLN B NE2  5  
ATOM 7222  H H    . GLN B 2 6  ? 6.453   3.607   -20.250 1.00 0.00 ? 300 GLN B H    5  
ATOM 7223  H HA   . GLN B 2 6  ? 5.649   1.924   -18.037 1.00 0.00 ? 300 GLN B HA   5  
ATOM 7224  H HB2  . GLN B 2 6  ? 8.084   1.777   -19.826 1.00 0.00 ? 300 GLN B HB2  5  
ATOM 7225  H HB3  . GLN B 2 6  ? 7.660   0.589   -18.607 1.00 0.00 ? 300 GLN B HB3  5  
ATOM 7226  H HG2  . GLN B 2 6  ? 6.924   -0.362  -20.585 1.00 0.00 ? 300 GLN B HG2  5  
ATOM 7227  H HG3  . GLN B 2 6  ? 5.465   0.313   -19.872 1.00 0.00 ? 300 GLN B HG3  5  
ATOM 7228  H HE21 . GLN B 2 6  ? 7.846   2.353   -21.454 1.00 0.00 ? 300 GLN B HE21 5  
ATOM 7229  H HE22 . GLN B 2 6  ? 6.879   2.720   -22.834 1.00 0.00 ? 300 GLN B HE22 5  
ATOM 7230  N N    . PRO B 2 7  ? 6.932   3.055   -16.191 1.00 0.00 ? 301 PRO B N    5  
ATOM 7231  C CA   . PRO B 2 7  ? 7.688   3.615   -15.080 1.00 0.00 ? 301 PRO B CA   5  
ATOM 7232  C C    . PRO B 2 7  ? 8.506   2.558   -14.342 1.00 0.00 ? 301 PRO B C    5  
ATOM 7233  O O    . PRO B 2 7  ? 7.946   1.646   -13.731 1.00 0.00 ? 301 PRO B O    5  
ATOM 7234  C CB   . PRO B 2 7  ? 6.589   4.183   -14.168 1.00 0.00 ? 301 PRO B CB   5  
ATOM 7235  C CG   . PRO B 2 7  ? 5.287   3.609   -14.663 1.00 0.00 ? 301 PRO B CG   5  
ATOM 7236  C CD   . PRO B 2 7  ? 5.619   2.606   -15.734 1.00 0.00 ? 301 PRO B CD   5  
ATOM 7237  H HA   . PRO B 2 7  ? 8.339   4.414   -15.405 1.00 0.00 ? 301 PRO B HA   5  
ATOM 7238  H HB2  . PRO B 2 7  ? 6.782   3.887   -13.147 1.00 0.00 ? 301 PRO B HB2  5  
ATOM 7239  H HB3  . PRO B 2 7  ? 6.591   5.261   -14.235 1.00 0.00 ? 301 PRO B HB3  5  
ATOM 7240  H HG2  . PRO B 2 7  ? 4.771   3.126   -13.848 1.00 0.00 ? 301 PRO B HG2  5  
ATOM 7241  H HG3  . PRO B 2 7  ? 4.675   4.401   -15.069 1.00 0.00 ? 301 PRO B HG3  5  
ATOM 7242  H HD2  . PRO B 2 7  ? 5.673   1.609   -15.317 1.00 0.00 ? 301 PRO B HD2  5  
ATOM 7243  H HD3  . PRO B 2 7  ? 4.894   2.645   -16.531 1.00 0.00 ? 301 PRO B HD3  5  
ATOM 7244  N N    . VAL B 2 8  ? 9.834   2.687   -14.395 1.00 0.00 ? 302 VAL B N    5  
ATOM 7245  C CA   . VAL B 2 8  ? 10.723  1.740   -13.722 1.00 0.00 ? 302 VAL B CA   5  
ATOM 7246  C C    . VAL B 2 8  ? 10.483  1.755   -12.213 1.00 0.00 ? 302 VAL B C    5  
ATOM 7247  O O    . VAL B 2 8  ? 10.437  0.701   -11.574 1.00 0.00 ? 302 VAL B O    5  
ATOM 7248  C CB   . VAL B 2 8  ? 12.212  2.046   -14.008 1.00 0.00 ? 302 VAL B CB   5  
ATOM 7249  C CG1  . VAL B 2 8  ? 13.115  1.026   -13.327 1.00 0.00 ? 302 VAL B CG1  5  
ATOM 7250  C CG2  . VAL B 2 8  ? 12.475  2.080   -15.508 1.00 0.00 ? 302 VAL B CG2  5  
ATOM 7251  H H    . VAL B 2 8  ? 10.221  3.438   -14.894 1.00 0.00 ? 302 VAL B H    5  
ATOM 7252  H HA   . VAL B 2 8  ? 10.502  0.751   -14.100 1.00 0.00 ? 302 VAL B HA   5  
ATOM 7253  H HB   . VAL B 2 8  ? 12.441  3.022   -13.603 1.00 0.00 ? 302 VAL B HB   5  
ATOM 7254  H HG11 . VAL B 2 8  ? 13.759  0.567   -14.061 1.00 0.00 ? 302 VAL B HG11 5  
ATOM 7255  H HG12 . VAL B 2 8  ? 12.509  0.266   -12.854 1.00 0.00 ? 302 VAL B HG12 5  
ATOM 7256  H HG13 . VAL B 2 8  ? 13.717  1.520   -12.578 1.00 0.00 ? 302 VAL B HG13 5  
ATOM 7257  H HG21 . VAL B 2 8  ? 13.503  1.813   -15.700 1.00 0.00 ? 302 VAL B HG21 5  
ATOM 7258  H HG22 . VAL B 2 8  ? 12.284  3.075   -15.884 1.00 0.00 ? 302 VAL B HG22 5  
ATOM 7259  H HG23 . VAL B 2 8  ? 11.820  1.378   -16.004 1.00 0.00 ? 302 VAL B HG23 5  
ATOM 7260  N N    . GLU B 2 9  ? 10.309  2.955   -11.654 1.00 0.00 ? 303 GLU B N    5  
ATOM 7261  C CA   . GLU B 2 9  ? 10.047  3.107   -10.225 1.00 0.00 ? 303 GLU B CA   5  
ATOM 7262  C C    . GLU B 2 9  ? 8.730   2.432   -9.851  1.00 0.00 ? 303 GLU B C    5  
ATOM 7263  O O    . GLU B 2 9  ? 8.637   1.773   -8.816  1.00 0.00 ? 303 GLU B O    5  
ATOM 7264  C CB   . GLU B 2 9  ? 10.003  4.588   -9.838  1.00 0.00 ? 303 GLU B CB   5  
ATOM 7265  C CG   . GLU B 2 9  ? 11.320  5.314   -10.061 1.00 0.00 ? 303 GLU B CG   5  
ATOM 7266  C CD   . GLU B 2 9  ? 11.259  6.775   -9.655  1.00 0.00 ? 303 GLU B CD   5  
ATOM 7267  O OE1  . GLU B 2 9  ? 11.024  7.052   -8.459  1.00 0.00 ? 303 GLU B OE1  5  
ATOM 7268  O OE2  . GLU B 2 9  ? 11.447  7.643   -10.534 1.00 0.00 ? 303 GLU B OE2  5  
ATOM 7269  H H    . GLU B 2 9  ? 10.342  3.755   -12.220 1.00 0.00 ? 303 GLU B H    5  
ATOM 7270  H HA   . GLU B 2 9  ? 10.852  2.627   -9.688  1.00 0.00 ? 303 GLU B HA   5  
ATOM 7271  H HB2  . GLU B 2 9  ? 9.242   5.079   -10.425 1.00 0.00 ? 303 GLU B HB2  5  
ATOM 7272  H HB3  . GLU B 2 9  ? 9.746   4.667   -8.791  1.00 0.00 ? 303 GLU B HB3  5  
ATOM 7273  H HG2  . GLU B 2 9  ? 12.087  4.826   -9.478  1.00 0.00 ? 303 GLU B HG2  5  
ATOM 7274  H HG3  . GLU B 2 9  ? 11.575  5.256   -11.109 1.00 0.00 ? 303 GLU B HG3  5  
ATOM 7275  N N    . PHE B 2 10 ? 7.720   2.594   -10.716 1.00 0.00 ? 304 PHE B N    5  
ATOM 7276  C CA   . PHE B 2 10 ? 6.404   1.996   -10.495 1.00 0.00 ? 304 PHE B CA   5  
ATOM 7277  C C    . PHE B 2 10 ? 6.514   0.478   -10.380 1.00 0.00 ? 304 PHE B C    5  
ATOM 7278  O O    . PHE B 2 10 ? 5.950   -0.124  -9.467  1.00 0.00 ? 304 PHE B O    5  
ATOM 7279  C CB   . PHE B 2 10 ? 5.457   2.367   -11.644 1.00 0.00 ? 304 PHE B CB   5  
ATOM 7280  C CG   . PHE B 2 10 ? 4.050   1.857   -11.474 1.00 0.00 ? 304 PHE B CG   5  
ATOM 7281  C CD1  . PHE B 2 10 ? 3.255   2.305   -10.430 1.00 0.00 ? 304 PHE B CD1  5  
ATOM 7282  C CD2  . PHE B 2 10 ? 3.524   0.935   -12.364 1.00 0.00 ? 304 PHE B CD2  5  
ATOM 7283  C CE1  . PHE B 2 10 ? 1.961   1.841   -10.278 1.00 0.00 ? 304 PHE B CE1  5  
ATOM 7284  C CE2  . PHE B 2 10 ? 2.232   0.466   -12.215 1.00 0.00 ? 304 PHE B CE2  5  
ATOM 7285  C CZ   . PHE B 2 10 ? 1.449   0.920   -11.172 1.00 0.00 ? 304 PHE B CZ   5  
ATOM 7286  H H    . PHE B 2 10 ? 7.870   3.123   -11.527 1.00 0.00 ? 304 PHE B H    5  
ATOM 7287  H HA   . PHE B 2 10 ? 6.009   2.389   -9.573  1.00 0.00 ? 304 PHE B HA   5  
ATOM 7288  H HB2  . PHE B 2 10 ? 5.409   3.442   -11.723 1.00 0.00 ? 304 PHE B HB2  5  
ATOM 7289  H HB3  . PHE B 2 10 ? 5.849   1.962   -12.564 1.00 0.00 ? 304 PHE B HB3  5  
ATOM 7290  H HD1  . PHE B 2 10 ? 3.654   3.025   -9.731  1.00 0.00 ? 304 PHE B HD1  5  
ATOM 7291  H HD2  . PHE B 2 10 ? 4.134   0.579   -13.180 1.00 0.00 ? 304 PHE B HD2  5  
ATOM 7292  H HE1  . PHE B 2 10 ? 1.352   2.196   -9.460  1.00 0.00 ? 304 PHE B HE1  5  
ATOM 7293  H HE2  . PHE B 2 10 ? 1.834   -0.253  -12.916 1.00 0.00 ? 304 PHE B HE2  5  
ATOM 7294  H HZ   . PHE B 2 10 ? 0.439   0.553   -11.055 1.00 0.00 ? 304 PHE B HZ   5  
ATOM 7295  N N    . ASN B 2 11 ? 7.254   -0.134  -11.307 1.00 0.00 ? 305 ASN B N    5  
ATOM 7296  C CA   . ASN B 2 11 ? 7.449   -1.582  -11.308 1.00 0.00 ? 305 ASN B CA   5  
ATOM 7297  C C    . ASN B 2 11 ? 8.081   -2.074  -10.003 1.00 0.00 ? 305 ASN B C    5  
ATOM 7298  O O    . ASN B 2 11 ? 7.833   -3.201  -9.586  1.00 0.00 ? 305 ASN B O    5  
ATOM 7299  C CB   . ASN B 2 11 ? 8.316   -2.009  -12.497 1.00 0.00 ? 305 ASN B CB   5  
ATOM 7300  C CG   . ASN B 2 11 ? 7.588   -1.897  -13.824 1.00 0.00 ? 305 ASN B CG   5  
ATOM 7301  O OD1  . ASN B 2 11 ? 7.101   -0.828  -14.192 1.00 0.00 ? 305 ASN B OD1  5  
ATOM 7302  N ND2  . ASN B 2 11 ? 7.514   -3.003  -14.558 1.00 0.00 ? 305 ASN B ND2  5  
ATOM 7303  H H    . ASN B 2 11 ? 7.684   0.406   -12.005 1.00 0.00 ? 305 ASN B H    5  
ATOM 7304  H HA   . ASN B 2 11 ? 6.477   -2.039  -11.408 1.00 0.00 ? 305 ASN B HA   5  
ATOM 7305  H HB2  . ASN B 2 11 ? 9.194   -1.383  -12.536 1.00 0.00 ? 305 ASN B HB2  5  
ATOM 7306  H HB3  . ASN B 2 11 ? 8.619   -3.036  -12.359 1.00 0.00 ? 305 ASN B HB3  5  
ATOM 7307  H HD21 . ASN B 2 11 ? 7.928   -3.821  -14.207 1.00 0.00 ? 305 ASN B HD21 5  
ATOM 7308  H HD22 . ASN B 2 11 ? 7.050   -2.957  -15.419 1.00 0.00 ? 305 ASN B HD22 5  
ATOM 7309  N N    . HIS B 2 12 ? 8.900   -1.231  -9.366  1.00 0.00 ? 306 HIS B N    5  
ATOM 7310  C CA   . HIS B 2 12 ? 9.557   -1.606  -8.112  1.00 0.00 ? 306 HIS B CA   5  
ATOM 7311  C C    . HIS B 2 12 ? 8.524   -1.993  -7.052  1.00 0.00 ? 306 HIS B C    5  
ATOM 7312  O O    . HIS B 2 12 ? 8.550   -3.114  -6.542  1.00 0.00 ? 306 HIS B O    5  
ATOM 7313  C CB   . HIS B 2 12 ? 10.445  -0.467  -7.611  1.00 0.00 ? 306 HIS B CB   5  
ATOM 7314  C CG   . HIS B 2 12 ? 11.411  -0.890  -6.551  1.00 0.00 ? 306 HIS B CG   5  
ATOM 7315  N ND1  . HIS B 2 12 ? 12.384  -1.847  -6.755  1.00 0.00 ? 306 HIS B ND1  5  
ATOM 7316  C CD2  . HIS B 2 12 ? 11.554  -0.480  -5.273  1.00 0.00 ? 306 HIS B CD2  5  
ATOM 7317  C CE1  . HIS B 2 12 ? 13.083  -2.006  -5.645  1.00 0.00 ? 306 HIS B CE1  5  
ATOM 7318  N NE2  . HIS B 2 12 ? 12.599  -1.187  -4.731  1.00 0.00 ? 306 HIS B NE2  5  
ATOM 7319  H H    . HIS B 2 12 ? 9.069   -0.343  -9.746  1.00 0.00 ? 306 HIS B H    5  
ATOM 7320  H HA   . HIS B 2 12 ? 10.175  -2.466  -8.313  1.00 0.00 ? 306 HIS B HA   5  
ATOM 7321  H HB2  . HIS B 2 12 ? 11.014  -0.071  -8.439  1.00 0.00 ? 306 HIS B HB2  5  
ATOM 7322  H HB3  . HIS B 2 12 ? 9.821   0.315   -7.202  1.00 0.00 ? 306 HIS B HB3  5  
ATOM 7323  H HD1  . HIS B 2 12 ? 12.537  -2.339  -7.588  1.00 0.00 ? 306 HIS B HD1  5  
ATOM 7324  H HD2  . HIS B 2 12 ? 10.951  0.259   -4.770  1.00 0.00 ? 306 HIS B HD2  5  
ATOM 7325  H HE1  . HIS B 2 12 ? 13.909  -2.688  -5.510  1.00 0.00 ? 306 HIS B HE1  5  
ATOM 7326  H HE2  . HIS B 2 12 ? 12.896  -1.142  -3.798  1.00 0.00 ? 306 HIS B HE2  5  
ATOM 7327  N N    . ALA B 2 13 ? 7.598   -1.077  -6.746  1.00 0.00 ? 307 ALA B N    5  
ATOM 7328  C CA   . ALA B 2 13 ? 6.541   -1.360  -5.772  1.00 0.00 ? 307 ALA B CA   5  
ATOM 7329  C C    . ALA B 2 13 ? 5.629   -2.452  -6.306  1.00 0.00 ? 307 ALA B C    5  
ATOM 7330  O O    . ALA B 2 13 ? 5.245   -3.366  -5.585  1.00 0.00 ? 307 ALA B O    5  
ATOM 7331  C CB   . ALA B 2 13 ? 5.718   -0.115  -5.474  1.00 0.00 ? 307 ALA B CB   5  
ATOM 7332  H H    . ALA B 2 13 ? 7.611   -0.208  -7.202  1.00 0.00 ? 307 ALA B H    5  
ATOM 7333  H HA   . ALA B 2 13 ? 7.004   -1.696  -4.855  1.00 0.00 ? 307 ALA B HA   5  
ATOM 7334  H HB1  . ALA B 2 13 ? 4.666   -0.365  -5.519  1.00 0.00 ? 307 ALA B HB1  5  
ATOM 7335  H HB2  . ALA B 2 13 ? 5.938   0.647   -6.205  1.00 0.00 ? 307 ALA B HB2  5  
ATOM 7336  H HB3  . ALA B 2 13 ? 5.957   0.249   -4.487  1.00 0.00 ? 307 ALA B HB3  5  
ATOM 7337  N N    . ILE B 2 14 ? 5.303   -2.334  -7.589  1.00 0.00 ? 308 ILE B N    5  
ATOM 7338  C CA   . ILE B 2 14 ? 4.446   -3.284  -8.285  1.00 0.00 ? 308 ILE B CA   5  
ATOM 7339  C C    . ILE B 2 14 ? 4.934   -4.712  -8.114  1.00 0.00 ? 308 ILE B C    5  
ATOM 7340  O O    . ILE B 2 14 ? 4.243   -5.545  -7.527  1.00 0.00 ? 308 ILE B O    5  
ATOM 7341  C CB   . ILE B 2 14 ? 4.383   -2.919  -9.781  1.00 0.00 ? 308 ILE B CB   5  
ATOM 7342  C CG1  . ILE B 2 14 ? 3.310   -1.858  -10.006 1.00 0.00 ? 308 ILE B CG1  5  
ATOM 7343  C CG2  . ILE B 2 14 ? 4.128   -4.147  -10.630 1.00 0.00 ? 308 ILE B CG2  5  
ATOM 7344  C CD1  . ILE B 2 14 ? 3.121   -0.943  -8.813  1.00 0.00 ? 308 ILE B CD1  5  
ATOM 7345  H H    . ILE B 2 14 ? 5.661   -1.573  -8.093  1.00 0.00 ? 308 ILE B H    5  
ATOM 7346  H HA   . ILE B 2 14 ? 3.451   -3.202  -7.874  1.00 0.00 ? 308 ILE B HA   5  
ATOM 7347  H HB   . ILE B 2 14 ? 5.339   -2.513  -10.066 1.00 0.00 ? 308 ILE B HB   5  
ATOM 7348  H HG12 . ILE B 2 14 ? 3.587   -1.249  -10.853 1.00 0.00 ? 308 ILE B HG12 5  
ATOM 7349  H HG13 . ILE B 2 14 ? 2.368   -2.344  -10.210 1.00 0.00 ? 308 ILE B HG13 5  
ATOM 7350  H HG21 . ILE B 2 14 ? 3.994   -3.851  -11.657 1.00 0.00 ? 308 ILE B HG21 5  
ATOM 7351  H HG22 . ILE B 2 14 ? 3.234   -4.641  -10.276 1.00 0.00 ? 308 ILE B HG22 5  
ATOM 7352  H HG23 . ILE B 2 14 ? 4.983   -4.821  -10.548 1.00 0.00 ? 308 ILE B HG23 5  
ATOM 7353  H HD11 . ILE B 2 14 ? 4.062   -0.485  -8.561  1.00 0.00 ? 308 ILE B HD11 5  
ATOM 7354  H HD12 . ILE B 2 14 ? 2.763   -1.527  -7.968  1.00 0.00 ? 308 ILE B HD12 5  
ATOM 7355  H HD13 . ILE B 2 14 ? 2.398   -0.182  -9.053  1.00 0.00 ? 308 ILE B HD13 5  
ATOM 7356  N N    . ASN B 2 15 ? 6.133   -4.979  -8.611  1.00 0.00 ? 309 ASN B N    5  
ATOM 7357  C CA   . ASN B 2 15 ? 6.724   -6.296  -8.495  1.00 0.00 ? 309 ASN B CA   5  
ATOM 7358  C C    . ASN B 2 15 ? 6.881   -6.668  -7.018  1.00 0.00 ? 309 ASN B C    5  
ATOM 7359  O O    . ASN B 2 15 ? 6.797   -7.840  -6.657  1.00 0.00 ? 309 ASN B O    5  
ATOM 7360  C CB   . ASN B 2 15 ? 8.047   -6.329  -9.247  1.00 0.00 ? 309 ASN B CB   5  
ATOM 7361  C CG   . ASN B 2 15 ? 7.880   -6.766  -10.691 1.00 0.00 ? 309 ASN B CG   5  
ATOM 7362  O OD1  . ASN B 2 15 ? 7.195   -6.108  -11.475 1.00 0.00 ? 309 ASN B OD1  5  
ATOM 7363  N ND2  . ASN B 2 15 ? 8.506   -7.882  -11.052 1.00 0.00 ? 309 ASN B ND2  5  
ATOM 7364  H H    . ASN B 2 15 ? 6.640   -4.264  -9.055  1.00 0.00 ? 309 ASN B H    5  
ATOM 7365  H HA   . ASN B 2 15 ? 6.043   -7.001  -8.952  1.00 0.00 ? 309 ASN B HA   5  
ATOM 7366  H HB2  . ASN B 2 15 ? 8.450   -5.331  -9.255  1.00 0.00 ? 309 ASN B HB2  5  
ATOM 7367  H HB3  . ASN B 2 15 ? 8.730   -6.999  -8.754  1.00 0.00 ? 309 ASN B HB3  5  
ATOM 7368  H HD21 . ASN B 2 15 ? 9.035   -8.357  -10.378 1.00 0.00 ? 309 ASN B HD21 5  
ATOM 7369  H HD22 . ASN B 2 15 ? 8.413   -8.186  -11.979 1.00 0.00 ? 309 ASN B HD22 5  
ATOM 7370  N N    . TYR B 2 16 ? 7.035   -5.649  -6.159  1.00 0.00 ? 310 TYR B N    5  
ATOM 7371  C CA   . TYR B 2 16 ? 7.110   -5.875  -4.719  1.00 0.00 ? 310 TYR B CA   5  
ATOM 7372  C C    . TYR B 2 16 ? 5.759   -6.411  -4.243  1.00 0.00 ? 310 TYR B C    5  
ATOM 7373  O O    . TYR B 2 16 ? 5.702   -7.366  -3.467  1.00 0.00 ? 310 TYR B O    5  
ATOM 7374  C CB   . TYR B 2 16 ? 7.488   -4.583  -3.976  1.00 0.00 ? 310 TYR B CB   5  
ATOM 7375  C CG   . TYR B 2 16 ? 6.993   -4.528  -2.546  1.00 0.00 ? 310 TYR B CG   5  
ATOM 7376  C CD1  . TYR B 2 16 ? 7.282   -5.546  -1.645  1.00 0.00 ? 310 TYR B CD1  5  
ATOM 7377  C CD2  . TYR B 2 16 ? 6.230   -3.456  -2.102  1.00 0.00 ? 310 TYR B CD2  5  
ATOM 7378  C CE1  . TYR B 2 16 ? 6.821   -5.498  -0.345  1.00 0.00 ? 310 TYR B CE1  5  
ATOM 7379  C CE2  . TYR B 2 16 ? 5.770   -3.398  -0.802  1.00 0.00 ? 310 TYR B CE2  5  
ATOM 7380  C CZ   . TYR B 2 16 ? 6.065   -4.421  0.072   1.00 0.00 ? 310 TYR B CZ   5  
ATOM 7381  O OH   . TYR B 2 16 ? 5.602   -4.370  1.366   1.00 0.00 ? 310 TYR B OH   5  
ATOM 7382  H H    . TYR B 2 16 ? 7.045   -4.730  -6.499  1.00 0.00 ? 310 TYR B H    5  
ATOM 7383  H HA   . TYR B 2 16 ? 7.865   -6.628  -4.537  1.00 0.00 ? 310 TYR B HA   5  
ATOM 7384  H HB2  . TYR B 2 16 ? 8.563   -4.494  -3.957  1.00 0.00 ? 310 TYR B HB2  5  
ATOM 7385  H HB3  . TYR B 2 16 ? 7.073   -3.738  -4.504  1.00 0.00 ? 310 TYR B HB3  5  
ATOM 7386  H HD1  . TYR B 2 16 ? 7.873   -6.388  -1.973  1.00 0.00 ? 310 TYR B HD1  5  
ATOM 7387  H HD2  . TYR B 2 16 ? 6.002   -2.656  -2.789  1.00 0.00 ? 310 TYR B HD2  5  
ATOM 7388  H HE1  . TYR B 2 16 ? 7.056   -6.297  0.341   1.00 0.00 ? 310 TYR B HE1  5  
ATOM 7389  H HE2  . TYR B 2 16 ? 5.179   -2.555  -0.477  1.00 0.00 ? 310 TYR B HE2  5  
ATOM 7390  H HH   . TYR B 2 16 ? 4.642   -4.408  1.365   1.00 0.00 ? 310 TYR B HH   5  
ATOM 7391  N N    . VAL B 2 17 ? 4.670   -5.818  -4.757  1.00 0.00 ? 311 VAL B N    5  
ATOM 7392  C CA   . VAL B 2 17 ? 3.326   -6.280  -4.424  1.00 0.00 ? 311 VAL B CA   5  
ATOM 7393  C C    . VAL B 2 17 ? 3.187   -7.723  -4.896  1.00 0.00 ? 311 VAL B C    5  
ATOM 7394  O O    . VAL B 2 17 ? 2.580   -8.551  -4.222  1.00 0.00 ? 311 VAL B O    5  
ATOM 7395  C CB   . VAL B 2 17 ? 2.206   -5.448  -5.095  1.00 0.00 ? 311 VAL B CB   5  
ATOM 7396  C CG1  . VAL B 2 17 ? 0.856   -5.816  -4.518  1.00 0.00 ? 311 VAL B CG1  5  
ATOM 7397  C CG2  . VAL B 2 17 ? 2.415   -3.963  -4.941  1.00 0.00 ? 311 VAL B CG2  5  
ATOM 7398  H H    . VAL B 2 17 ? 4.779   -5.087  -5.399  1.00 0.00 ? 311 VAL B H    5  
ATOM 7399  H HA   . VAL B 2 17 ? 3.204   -6.240  -3.350  1.00 0.00 ? 311 VAL B HA   5  
ATOM 7400  H HB   . VAL B 2 17 ? 2.198   -5.681  -6.147  1.00 0.00 ? 311 VAL B HB   5  
ATOM 7401  H HG11 . VAL B 2 17 ? 0.602   -6.829  -4.808  1.00 0.00 ? 311 VAL B HG11 5  
ATOM 7402  H HG12 . VAL B 2 17 ? 0.108   -5.125  -4.889  1.00 0.00 ? 311 VAL B HG12 5  
ATOM 7403  H HG13 . VAL B 2 17 ? 0.901   -5.743  -3.441  1.00 0.00 ? 311 VAL B HG13 5  
ATOM 7404  H HG21 . VAL B 2 17 ? 3.196   -3.633  -5.605  1.00 0.00 ? 311 VAL B HG21 5  
ATOM 7405  H HG22 . VAL B 2 17 ? 2.687   -3.743  -3.918  1.00 0.00 ? 311 VAL B HG22 5  
ATOM 7406  H HG23 . VAL B 2 17 ? 1.491   -3.454  -5.191  1.00 0.00 ? 311 VAL B HG23 5  
ATOM 7407  N N    . ASN B 2 18 ? 3.788   -8.011  -6.063  1.00 0.00 ? 312 ASN B N    5  
ATOM 7408  C CA   . ASN B 2 18 ? 3.773   -9.351  -6.636  1.00 0.00 ? 312 ASN B CA   5  
ATOM 7409  C C    . ASN B 2 18 ? 4.354   -10.347 -5.641  1.00 0.00 ? 312 ASN B C    5  
ATOM 7410  O O    . ASN B 2 18 ? 3.838   -11.451 -5.491  1.00 0.00 ? 312 ASN B O    5  
ATOM 7411  C CB   . ASN B 2 18 ? 4.568   -9.382  -7.949  1.00 0.00 ? 312 ASN B CB   5  
ATOM 7412  C CG   . ASN B 2 18 ? 4.477   -10.718 -8.662  1.00 0.00 ? 312 ASN B CG   5  
ATOM 7413  O OD1  . ASN B 2 18 ? 3.421   -11.091 -9.172  1.00 0.00 ? 312 ASN B OD1  5  
ATOM 7414  N ND2  . ASN B 2 18 ? 5.584   -11.452 -8.697  1.00 0.00 ? 312 ASN B ND2  5  
ATOM 7415  H H    . ASN B 2 18 ? 4.268   -7.300  -6.536  1.00 0.00 ? 312 ASN B H    5  
ATOM 7416  H HA   . ASN B 2 18 ? 2.749   -9.615  -6.836  1.00 0.00 ? 312 ASN B HA   5  
ATOM 7417  H HB2  . ASN B 2 18 ? 4.189   -8.618  -8.609  1.00 0.00 ? 312 ASN B HB2  5  
ATOM 7418  H HB3  . ASN B 2 18 ? 5.607   -9.182  -7.736  1.00 0.00 ? 312 ASN B HB3  5  
ATOM 7419  H HD21 . ASN B 2 18 ? 6.390   -11.097 -8.266  1.00 0.00 ? 312 ASN B HD21 5  
ATOM 7420  H HD22 . ASN B 2 18 ? 5.550   -12.319 -9.152  1.00 0.00 ? 312 ASN B HD22 5  
ATOM 7421  N N    . LYS B 2 19 ? 5.414   -9.934  -4.938  1.00 0.00 ? 313 LYS B N    5  
ATOM 7422  C CA   . LYS B 2 19 ? 6.043   -10.782 -3.928  1.00 0.00 ? 313 LYS B CA   5  
ATOM 7423  C C    . LYS B 2 19 ? 5.004   -11.187 -2.890  1.00 0.00 ? 313 LYS B C    5  
ATOM 7424  O O    . LYS B 2 19 ? 4.817   -12.367 -2.611  1.00 0.00 ? 313 LYS B O    5  
ATOM 7425  C CB   . LYS B 2 19 ? 7.188   -10.032 -3.231  1.00 0.00 ? 313 LYS B CB   5  
ATOM 7426  C CG   . LYS B 2 19 ? 8.276   -9.549  -4.174  1.00 0.00 ? 313 LYS B CG   5  
ATOM 7427  C CD   . LYS B 2 19 ? 9.349   -8.751  -3.447  1.00 0.00 ? 313 LYS B CD   5  
ATOM 7428  C CE   . LYS B 2 19 ? 10.307  -9.657  -2.684  1.00 0.00 ? 313 LYS B CE   5  
ATOM 7429  N NZ   . LYS B 2 19 ? 11.304  -8.881  -1.894  1.00 0.00 ? 313 LYS B NZ   5  
ATOM 7430  H H    . LYS B 2 19 ? 5.766   -9.032  -5.090  1.00 0.00 ? 313 LYS B H    5  
ATOM 7431  H HA   . LYS B 2 19 ? 6.428   -11.668 -4.414  1.00 0.00 ? 313 LYS B HA   5  
ATOM 7432  H HB2  . LYS B 2 19 ? 6.779   -9.168  -2.721  1.00 0.00 ? 313 LYS B HB2  5  
ATOM 7433  H HB3  . LYS B 2 19 ? 7.636   -10.688 -2.503  1.00 0.00 ? 313 LYS B HB3  5  
ATOM 7434  H HG2  . LYS B 2 19 ? 8.738   -10.407 -4.633  1.00 0.00 ? 313 LYS B HG2  5  
ATOM 7435  H HG3  . LYS B 2 19 ? 7.831   -8.927  -4.931  1.00 0.00 ? 313 LYS B HG3  5  
ATOM 7436  H HD2  . LYS B 2 19 ? 9.911   -8.180  -4.170  1.00 0.00 ? 313 LYS B HD2  5  
ATOM 7437  H HD3  . LYS B 2 19 ? 8.871   -8.080  -2.749  1.00 0.00 ? 313 LYS B HD3  5  
ATOM 7438  H HE2  . LYS B 2 19 ? 9.738   -10.282 -2.016  1.00 0.00 ? 313 LYS B HE2  5  
ATOM 7439  H HE3  . LYS B 2 19 ? 10.832  -10.280 -3.395  1.00 0.00 ? 313 LYS B HE3  5  
ATOM 7440  H HZ1  . LYS B 2 19 ? 12.266  -9.080  -2.237  1.00 0.00 ? 313 LYS B HZ1  5  
ATOM 7441  H HZ2  . LYS B 2 19 ? 11.246  -9.142  -0.889  1.00 0.00 ? 313 LYS B HZ2  5  
ATOM 7442  H HZ3  . LYS B 2 19 ? 11.121  -7.860  -1.985  1.00 0.00 ? 313 LYS B HZ3  5  
ATOM 7443  N N    . ILE B 2 20 ? 4.325   -10.185 -2.339  1.00 0.00 ? 314 ILE B N    5  
ATOM 7444  C CA   . ILE B 2 20 ? 3.281   -10.395 -1.342  1.00 0.00 ? 314 ILE B CA   5  
ATOM 7445  C C    . ILE B 2 20 ? 2.101   -11.162 -1.938  1.00 0.00 ? 314 ILE B C    5  
ATOM 7446  O O    . ILE B 2 20 ? 1.665   -12.173 -1.399  1.00 0.00 ? 314 ILE B O    5  
ATOM 7447  C CB   . ILE B 2 20 ? 2.797   -9.046  -0.777  1.00 0.00 ? 314 ILE B CB   5  
ATOM 7448  C CG1  . ILE B 2 20 ? 3.988   -8.286  -0.189  1.00 0.00 ? 314 ILE B CG1  5  
ATOM 7449  C CG2  . ILE B 2 20 ? 1.711   -9.252  0.272   1.00 0.00 ? 314 ILE B CG2  5  
ATOM 7450  C CD1  . ILE B 2 20 ? 3.686   -6.848  0.150   1.00 0.00 ? 314 ILE B CD1  5  
ATOM 7451  H H    . ILE B 2 20 ? 4.523   -9.269  -2.626  1.00 0.00 ? 314 ILE B H    5  
ATOM 7452  H HA   . ILE B 2 20 ? 3.705   -10.972 -0.535  1.00 0.00 ? 314 ILE B HA   5  
ATOM 7453  H HB   . ILE B 2 20 ? 2.378   -8.469  -1.587  1.00 0.00 ? 314 ILE B HB   5  
ATOM 7454  H HG12 . ILE B 2 20 ? 4.307   -8.777  0.716   1.00 0.00 ? 314 ILE B HG12 5  
ATOM 7455  H HG13 . ILE B 2 20 ? 4.800   -8.295  -0.900  1.00 0.00 ? 314 ILE B HG13 5  
ATOM 7456  H HG21 . ILE B 2 20 ? 0.870   -8.612  0.048   1.00 0.00 ? 314 ILE B HG21 5  
ATOM 7457  H HG22 . ILE B 2 20 ? 2.101   -9.008  1.249   1.00 0.00 ? 314 ILE B HG22 5  
ATOM 7458  H HG23 . ILE B 2 20 ? 1.390   -10.283 0.261   1.00 0.00 ? 314 ILE B HG23 5  
ATOM 7459  H HD11 . ILE B 2 20 ? 3.812   -6.236  -0.734  1.00 0.00 ? 314 ILE B HD11 5  
ATOM 7460  H HD12 . ILE B 2 20 ? 4.366   -6.518  0.921   1.00 0.00 ? 314 ILE B HD12 5  
ATOM 7461  H HD13 . ILE B 2 20 ? 2.672   -6.768  0.506   1.00 0.00 ? 314 ILE B HD13 5  
ATOM 7462  N N    . LYS B 2 21 ? 1.590   -10.676 -3.060  1.00 0.00 ? 315 LYS B N    5  
ATOM 7463  C CA   . LYS B 2 21 ? 0.471   -11.319 -3.735  1.00 0.00 ? 315 LYS B CA   5  
ATOM 7464  C C    . LYS B 2 21 ? 0.771   -12.799 -3.991  1.00 0.00 ? 315 LYS B C    5  
ATOM 7465  O O    . LYS B 2 21 ? -0.042  -13.669 -3.678  1.00 0.00 ? 315 LYS B O    5  
ATOM 7466  C CB   . LYS B 2 21 ? 0.176   -10.583 -5.043  1.00 0.00 ? 315 LYS B CB   5  
ATOM 7467  C CG   . LYS B 2 21 ? -1.027  -11.118 -5.800  1.00 0.00 ? 315 LYS B CG   5  
ATOM 7468  C CD   . LYS B 2 21 ? -1.298  -10.305 -7.058  1.00 0.00 ? 315 LYS B CD   5  
ATOM 7469  C CE   . LYS B 2 21 ? -0.402  -10.728 -8.213  1.00 0.00 ? 315 LYS B CE   5  
ATOM 7470  N NZ   . LYS B 2 21 ? 1.015   -10.328 -8.003  1.00 0.00 ? 315 LYS B NZ   5  
ATOM 7471  H H    . LYS B 2 21 ? 1.982   -9.867  -3.451  1.00 0.00 ? 315 LYS B H    5  
ATOM 7472  H HA   . LYS B 2 21 ? -0.388  -11.249 -3.085  1.00 0.00 ? 315 LYS B HA   5  
ATOM 7473  H HB2  . LYS B 2 21 ? -0.005  -9.546  -4.816  1.00 0.00 ? 315 LYS B HB2  5  
ATOM 7474  H HB3  . LYS B 2 21 ? 1.041   -10.648 -5.682  1.00 0.00 ? 315 LYS B HB3  5  
ATOM 7475  H HG2  . LYS B 2 21 ? -0.835  -12.144 -6.082  1.00 0.00 ? 315 LYS B HG2  5  
ATOM 7476  H HG3  . LYS B 2 21 ? -1.893  -11.074 -5.158  1.00 0.00 ? 315 LYS B HG3  5  
ATOM 7477  H HD2  . LYS B 2 21 ? -2.329  -10.439 -7.347  1.00 0.00 ? 315 LYS B HD2  5  
ATOM 7478  H HD3  . LYS B 2 21 ? -1.113  -9.260  -6.838  1.00 0.00 ? 315 LYS B HD3  5  
ATOM 7479  H HE2  . LYS B 2 21 ? -0.449  -11.802 -8.315  1.00 0.00 ? 315 LYS B HE2  5  
ATOM 7480  H HE3  . LYS B 2 21 ? -0.764  -10.268 -9.119  1.00 0.00 ? 315 LYS B HE3  5  
ATOM 7481  H HZ1  . LYS B 2 21 ? 1.523   -11.071 -7.481  1.00 0.00 ? 315 LYS B HZ1  5  
ATOM 7482  H HZ2  . LYS B 2 21 ? 1.059   -9.444  -7.457  1.00 0.00 ? 315 LYS B HZ2  5  
ATOM 7483  H HZ3  . LYS B 2 21 ? 1.485   -10.180 -8.919  1.00 0.00 ? 315 LYS B HZ3  5  
ATOM 7484  N N    . ASN B 2 22 ? 1.952   -13.065 -4.550  1.00 0.00 ? 316 ASN B N    5  
ATOM 7485  C CA   . ASN B 2 22 ? 2.395   -14.428 -4.845  1.00 0.00 ? 316 ASN B CA   5  
ATOM 7486  C C    . ASN B 2 22 ? 2.687   -15.220 -3.568  1.00 0.00 ? 316 ASN B C    5  
ATOM 7487  O O    . ASN B 2 22 ? 2.118   -16.289 -3.345  1.00 0.00 ? 316 ASN B O    5  
ATOM 7488  C CB   . ASN B 2 22 ? 3.644   -14.388 -5.734  1.00 0.00 ? 316 ASN B CB   5  
ATOM 7489  C CG   . ASN B 2 22 ? 3.319   -14.023 -7.172  1.00 0.00 ? 316 ASN B CG   5  
ATOM 7490  O OD1  . ASN B 2 22 ? 2.677   -13.008 -7.436  1.00 0.00 ? 316 ASN B OD1  5  
ATOM 7491  N ND2  . ASN B 2 22 ? 3.768   -14.849 -8.111  1.00 0.00 ? 316 ASN B ND2  5  
ATOM 7492  H H    . ASN B 2 22 ? 2.551   -12.319 -4.760  1.00 0.00 ? 316 ASN B H    5  
ATOM 7493  H HA   . ASN B 2 22 ? 1.602   -14.921 -5.385  1.00 0.00 ? 316 ASN B HA   5  
ATOM 7494  H HB2  . ASN B 2 22 ? 4.331   -13.651 -5.343  1.00 0.00 ? 316 ASN B HB2  5  
ATOM 7495  H HB3  . ASN B 2 22 ? 4.122   -15.354 -5.722  1.00 0.00 ? 316 ASN B HB3  5  
ATOM 7496  H HD21 . ASN B 2 22 ? 4.275   -15.639 -7.832  1.00 0.00 ? 316 ASN B HD21 5  
ATOM 7497  H HD22 . ASN B 2 22 ? 3.571   -14.634 -9.047  1.00 0.00 ? 316 ASN B HD22 5  
ATOM 7498  N N    . ARG B 2 23 ? 3.597   -14.698 -2.747  1.00 0.00 ? 317 ARG B N    5  
ATOM 7499  C CA   . ARG B 2 23 ? 3.991   -15.355 -1.499  1.00 0.00 ? 317 ARG B CA   5  
ATOM 7500  C C    . ARG B 2 23 ? 2.793   -15.609 -0.577  1.00 0.00 ? 317 ARG B C    5  
ATOM 7501  O O    . ARG B 2 23 ? 2.727   -16.654 0.073   1.00 0.00 ? 317 ARG B O    5  
ATOM 7502  C CB   . ARG B 2 23 ? 5.061   -14.525 -0.777  1.00 0.00 ? 317 ARG B CB   5  
ATOM 7503  C CG   . ARG B 2 23 ? 5.850   -15.304 0.267   1.00 0.00 ? 317 ARG B CG   5  
ATOM 7504  C CD   . ARG B 2 23 ? 5.111   -15.407 1.596   1.00 0.00 ? 317 ARG B CD   5  
ATOM 7505  N NE   . ARG B 2 23 ? 5.770   -16.329 2.524   1.00 0.00 ? 317 ARG B NE   5  
ATOM 7506  C CZ   . ARG B 2 23 ? 7.005   -16.160 3.010   1.00 0.00 ? 317 ARG B CZ   5  
ATOM 7507  N NH1  . ARG B 2 23 ? 7.712   -15.073 2.714   1.00 0.00 ? 317 ARG B NH1  5  
ATOM 7508  N NH2  . ARG B 2 23 ? 7.529   -17.082 3.812   1.00 0.00 ? 317 ARG B NH2  5  
ATOM 7509  H H    . ARG B 2 23 ? 4.024   -13.850 -2.991  1.00 0.00 ? 317 ARG B H    5  
ATOM 7510  H HA   . ARG B 2 23 ? 4.420   -16.310 -1.763  1.00 0.00 ? 317 ARG B HA   5  
ATOM 7511  H HB2  . ARG B 2 23 ? 5.758   -14.146 -1.509  1.00 0.00 ? 317 ARG B HB2  5  
ATOM 7512  H HB3  . ARG B 2 23 ? 4.582   -13.691 -0.286  1.00 0.00 ? 317 ARG B HB3  5  
ATOM 7513  H HG2  . ARG B 2 23 ? 6.031   -16.302 -0.106  1.00 0.00 ? 317 ARG B HG2  5  
ATOM 7514  H HG3  . ARG B 2 23 ? 6.794   -14.805 0.429   1.00 0.00 ? 317 ARG B HG3  5  
ATOM 7515  H HD2  . ARG B 2 23 ? 5.072   -14.427 2.046   1.00 0.00 ? 317 ARG B HD2  5  
ATOM 7516  H HD3  . ARG B 2 23 ? 4.108   -15.755 1.410   1.00 0.00 ? 317 ARG B HD3  5  
ATOM 7517  H HE   . ARG B 2 23 ? 5.271   -17.130 2.787   1.00 0.00 ? 317 ARG B HE   5  
ATOM 7518  H HH11 . ARG B 2 23 ? 7.325   -14.365 2.126   1.00 0.00 ? 317 ARG B HH11 5  
ATOM 7519  H HH12 . ARG B 2 23 ? 8.637   -14.965 3.082   1.00 0.00 ? 317 ARG B HH12 5  
ATOM 7520  H HH21 . ARG B 2 23 ? 7.001   -17.897 4.051   1.00 0.00 ? 317 ARG B HH21 5  
ATOM 7521  H HH22 . ARG B 2 23 ? 8.453   -16.960 4.178   1.00 0.00 ? 317 ARG B HH22 5  
ATOM 7522  N N    . PHE B 2 24 ? 1.848   -14.663 -0.518  1.00 0.00 ? 318 PHE B N    5  
ATOM 7523  C CA   . PHE B 2 24 ? 0.673   -14.821 0.339   1.00 0.00 ? 318 PHE B CA   5  
ATOM 7524  C C    . PHE B 2 24 ? -0.540  -15.303 -0.465  1.00 0.00 ? 318 PHE B C    5  
ATOM 7525  O O    . PHE B 2 24 ? -1.681  -15.081 -0.054  1.00 0.00 ? 318 PHE B O    5  
ATOM 7526  C CB   . PHE B 2 24 ? 0.305   -13.516 1.072   1.00 0.00 ? 318 PHE B CB   5  
ATOM 7527  C CG   . PHE B 2 24 ? 1.442   -12.816 1.784   1.00 0.00 ? 318 PHE B CG   5  
ATOM 7528  C CD1  . PHE B 2 24 ? 2.624   -12.504 1.134   1.00 0.00 ? 318 PHE B CD1  5  
ATOM 7529  C CD2  . PHE B 2 24 ? 1.295   -12.422 3.100   1.00 0.00 ? 318 PHE B CD2  5  
ATOM 7530  C CE1  . PHE B 2 24 ? 3.629   -11.816 1.777   1.00 0.00 ? 318 PHE B CE1  5  
ATOM 7531  C CE2  . PHE B 2 24 ? 2.302   -11.740 3.755   1.00 0.00 ? 318 PHE B CE2  5  
ATOM 7532  C CZ   . PHE B 2 24 ? 3.470   -11.431 3.088   1.00 0.00 ? 318 PHE B CZ   5  
ATOM 7533  H H    . PHE B 2 24 ? 1.941   -13.848 -1.060  1.00 0.00 ? 318 PHE B H    5  
ATOM 7534  H HA   . PHE B 2 24 ? 0.912   -15.570 1.079   1.00 0.00 ? 318 PHE B HA   5  
ATOM 7535  H HB2  . PHE B 2 24 ? -0.124  -12.819 0.369   1.00 0.00 ? 318 PHE B HB2  5  
ATOM 7536  H HB3  . PHE B 2 24 ? -0.445  -13.750 1.815   1.00 0.00 ? 318 PHE B HB3  5  
ATOM 7537  H HD1  . PHE B 2 24 ? 2.762   -12.807 0.114   1.00 0.00 ? 318 PHE B HD1  5  
ATOM 7538  H HD2  . PHE B 2 24 ? 0.384   -12.665 3.622   1.00 0.00 ? 318 PHE B HD2  5  
ATOM 7539  H HE1  . PHE B 2 24 ? 4.542   -11.583 1.254   1.00 0.00 ? 318 PHE B HE1  5  
ATOM 7540  H HE2  . PHE B 2 24 ? 2.173   -11.440 4.785   1.00 0.00 ? 318 PHE B HE2  5  
ATOM 7541  H HZ   . PHE B 2 24 ? 4.253   -10.882 3.587   1.00 0.00 ? 318 PHE B HZ   5  
ATOM 7542  N N    . GLN B 2 25 ? -0.300  -15.969 -1.603  1.00 0.00 ? 319 GLN B N    5  
ATOM 7543  C CA   . GLN B 2 25 ? -1.390  -16.489 -2.436  1.00 0.00 ? 319 GLN B CA   5  
ATOM 7544  C C    . GLN B 2 25 ? -2.383  -17.305 -1.609  1.00 0.00 ? 319 GLN B C    5  
ATOM 7545  O O    . GLN B 2 25 ? -3.583  -17.308 -1.895  1.00 0.00 ? 319 GLN B O    5  
ATOM 7546  C CB   . GLN B 2 25 ? -0.845  -17.334 -3.592  1.00 0.00 ? 319 GLN B CB   5  
ATOM 7547  C CG   . GLN B 2 25 ? -0.370  -16.505 -4.777  1.00 0.00 ? 319 GLN B CG   5  
ATOM 7548  C CD   . GLN B 2 25 ? 0.281   -17.324 -5.889  1.00 0.00 ? 319 GLN B CD   5  
ATOM 7549  O OE1  . GLN B 2 25 ? 0.728   -16.765 -6.890  1.00 0.00 ? 319 GLN B OE1  5  
ATOM 7550  N NE2  . GLN B 2 25 ? 0.341   -18.648 -5.733  1.00 0.00 ? 319 GLN B NE2  5  
ATOM 7551  H H    . GLN B 2 25 ? 0.626   -16.124 -1.882  1.00 0.00 ? 319 GLN B H    5  
ATOM 7552  H HA   . GLN B 2 25 ? -1.912  -15.638 -2.849  1.00 0.00 ? 319 GLN B HA   5  
ATOM 7553  H HB2  . GLN B 2 25 ? -0.013  -17.921 -3.230  1.00 0.00 ? 319 GLN B HB2  5  
ATOM 7554  H HB3  . GLN B 2 25 ? -1.623  -18.000 -3.934  1.00 0.00 ? 319 GLN B HB3  5  
ATOM 7555  H HG2  . GLN B 2 25 ? -1.220  -15.987 -5.194  1.00 0.00 ? 319 GLN B HG2  5  
ATOM 7556  H HG3  . GLN B 2 25 ? 0.344   -15.780 -4.423  1.00 0.00 ? 319 GLN B HG3  5  
ATOM 7557  H HE21 . GLN B 2 25 ? -0.032  -19.042 -4.920  1.00 0.00 ? 319 GLN B HE21 5  
ATOM 7558  H HE22 . GLN B 2 25 ? 0.759   -19.175 -6.446  1.00 0.00 ? 319 GLN B HE22 5  
ATOM 7559  N N    . GLY B 2 26 ? -1.881  -17.982 -0.569  1.00 0.00 ? 320 GLY B N    5  
ATOM 7560  C CA   . GLY B 2 26 ? -2.742  -18.771 0.293   1.00 0.00 ? 320 GLY B CA   5  
ATOM 7561  C C    . GLY B 2 26 ? -3.495  -17.904 1.283   1.00 0.00 ? 320 GLY B C    5  
ATOM 7562  O O    . GLY B 2 26 ? -4.538  -18.306 1.798   1.00 0.00 ? 320 GLY B O    5  
ATOM 7563  H H    . GLY B 2 26 ? -0.921  -17.929 -0.373  1.00 0.00 ? 320 GLY B H    5  
ATOM 7564  H HA2  . GLY B 2 26 ? -3.453  -19.308 -0.317  1.00 0.00 ? 320 GLY B HA2  5  
ATOM 7565  H HA3  . GLY B 2 26 ? -2.139  -19.481 0.836   1.00 0.00 ? 320 GLY B HA3  5  
ATOM 7566  N N    . GLN B 2 27 ? -2.957  -16.709 1.548   1.00 0.00 ? 321 GLN B N    5  
ATOM 7567  C CA   . GLN B 2 27 ? -3.568  -15.767 2.474   1.00 0.00 ? 321 GLN B CA   5  
ATOM 7568  C C    . GLN B 2 27 ? -4.266  -14.635 1.723   1.00 0.00 ? 321 GLN B C    5  
ATOM 7569  O O    . GLN B 2 27 ? -3.727  -13.527 1.634   1.00 0.00 ? 321 GLN B O    5  
ATOM 7570  C CB   . GLN B 2 27 ? -2.518  -15.139 3.393   1.00 0.00 ? 321 GLN B CB   5  
ATOM 7571  C CG   . GLN B 2 27 ? -1.422  -16.069 3.864   1.00 0.00 ? 321 GLN B CG   5  
ATOM 7572  C CD   . GLN B 2 27 ? -1.938  -17.223 4.707   1.00 0.00 ? 321 GLN B CD   5  
ATOM 7573  O OE1  . GLN B 2 27 ? -2.721  -18.050 4.238   1.00 0.00 ? 321 GLN B OE1  5  
ATOM 7574  N NE2  . GLN B 2 27 ? -1.503  -17.282 5.962   1.00 0.00 ? 321 GLN B NE2  5  
ATOM 7575  H H    . GLN B 2 27 ? -2.122  -16.456 1.105   1.00 0.00 ? 321 GLN B H    5  
ATOM 7576  H HA   . GLN B 2 27 ? -4.292  -16.298 3.073   1.00 0.00 ? 321 GLN B HA   5  
ATOM 7577  H HB2  . GLN B 2 27 ? -2.050  -14.321 2.869   1.00 0.00 ? 321 GLN B HB2  5  
ATOM 7578  H HB3  . GLN B 2 27 ? -3.020  -14.748 4.265   1.00 0.00 ? 321 GLN B HB3  5  
ATOM 7579  H HG2  . GLN B 2 27 ? -0.913  -16.468 2.995   1.00 0.00 ? 321 GLN B HG2  5  
ATOM 7580  H HG3  . GLN B 2 27 ? -0.730  -15.484 4.457   1.00 0.00 ? 321 GLN B HG3  5  
ATOM 7581  H HE21 . GLN B 2 27 ? -0.881  -16.590 6.272   1.00 0.00 ? 321 GLN B HE21 5  
ATOM 7582  H HE22 . GLN B 2 27 ? -1.821  -18.017 6.527   1.00 0.00 ? 321 GLN B HE22 5  
ATOM 7583  N N    . PRO B 2 28 ? -5.481  -14.857 1.195   1.00 0.00 ? 322 PRO B N    5  
ATOM 7584  C CA   . PRO B 2 28 ? -6.214  -13.800 0.497   1.00 0.00 ? 322 PRO B CA   5  
ATOM 7585  C C    . PRO B 2 28 ? -6.507  -12.633 1.444   1.00 0.00 ? 322 PRO B C    5  
ATOM 7586  O O    . PRO B 2 28 ? -6.717  -11.501 1.006   1.00 0.00 ? 322 PRO B O    5  
ATOM 7587  C CB   . PRO B 2 28 ? -7.514  -14.483 0.055   1.00 0.00 ? 322 PRO B CB   5  
ATOM 7588  C CG   . PRO B 2 28 ? -7.646  -15.679 0.936   1.00 0.00 ? 322 PRO B CG   5  
ATOM 7589  C CD   . PRO B 2 28 ? -6.243  -16.114 1.260   1.00 0.00 ? 322 PRO B CD   5  
ATOM 7590  H HA   . PRO B 2 28 ? -5.672  -13.440 -0.365  1.00 0.00 ? 322 PRO B HA   5  
ATOM 7591  H HB2  . PRO B 2 28 ? -8.345  -13.804 0.186   1.00 0.00 ? 322 PRO B HB2  5  
ATOM 7592  H HB3  . PRO B 2 28 ? -7.437  -14.767 -0.984  1.00 0.00 ? 322 PRO B HB3  5  
ATOM 7593  H HG2  . PRO B 2 28 ? -8.173  -15.412 1.841   1.00 0.00 ? 322 PRO B HG2  5  
ATOM 7594  H HG3  . PRO B 2 28 ? -8.171  -16.465 0.414   1.00 0.00 ? 322 PRO B HG3  5  
ATOM 7595  H HD2  . PRO B 2 28 ? -6.200  -16.542 2.250   1.00 0.00 ? 322 PRO B HD2  5  
ATOM 7596  H HD3  . PRO B 2 28 ? -5.888  -16.821 0.525   1.00 0.00 ? 322 PRO B HD3  5  
ATOM 7597  N N    . ASP B 2 29 ? -6.500  -12.928 2.750   1.00 0.00 ? 323 ASP B N    5  
ATOM 7598  C CA   . ASP B 2 29 ? -6.744  -11.931 3.783   1.00 0.00 ? 323 ASP B CA   5  
ATOM 7599  C C    . ASP B 2 29 ? -5.596  -10.927 3.883   1.00 0.00 ? 323 ASP B C    5  
ATOM 7600  O O    . ASP B 2 29 ? -5.820  -9.770  4.223   1.00 0.00 ? 323 ASP B O    5  
ATOM 7601  C CB   . ASP B 2 29 ? -6.958  -12.610 5.141   1.00 0.00 ? 323 ASP B CB   5  
ATOM 7602  C CG   . ASP B 2 29 ? -8.150  -13.550 5.151   1.00 0.00 ? 323 ASP B CG   5  
ATOM 7603  O OD1  . ASP B 2 29 ? -8.120  -14.561 4.416   1.00 0.00 ? 323 ASP B OD1  5  
ATOM 7604  O OD2  . ASP B 2 29 ? -9.116  -13.275 5.893   1.00 0.00 ? 323 ASP B OD2  5  
ATOM 7605  H H    . ASP B 2 29 ? -6.307  -13.848 3.028   1.00 0.00 ? 323 ASP B H    5  
ATOM 7606  H HA   . ASP B 2 29 ? -7.644  -11.398 3.517   1.00 0.00 ? 323 ASP B HA   5  
ATOM 7607  H HB2  . ASP B 2 29 ? -6.075  -13.178 5.395   1.00 0.00 ? 323 ASP B HB2  5  
ATOM 7608  H HB3  . ASP B 2 29 ? -7.116  -11.849 5.894   1.00 0.00 ? 323 ASP B HB3  5  
ATOM 7609  N N    . ILE B 2 30 ? -4.364  -11.372 3.599   1.00 0.00 ? 324 ILE B N    5  
ATOM 7610  C CA   . ILE B 2 30 ? -3.201  -10.493 3.679   1.00 0.00 ? 324 ILE B CA   5  
ATOM 7611  C C    . ILE B 2 30 ? -3.219  -9.466  2.576   1.00 0.00 ? 324 ILE B C    5  
ATOM 7612  O O    . ILE B 2 30 ? -3.000  -8.278  2.806   1.00 0.00 ? 324 ILE B O    5  
ATOM 7613  C CB   . ILE B 2 30 ? -1.878  -11.269 3.567   1.00 0.00 ? 324 ILE B CB   5  
ATOM 7614  C CG1  . ILE B 2 30 ? -1.865  -12.424 4.560   1.00 0.00 ? 324 ILE B CG1  5  
ATOM 7615  C CG2  . ILE B 2 30 ? -0.707  -10.313 3.774   1.00 0.00 ? 324 ILE B CG2  5  
ATOM 7616  C CD1  . ILE B 2 30 ? -2.275  -12.030 5.945   1.00 0.00 ? 324 ILE B CD1  5  
ATOM 7617  H H    . ILE B 2 30 ? -4.234  -12.311 3.332   1.00 0.00 ? 324 ILE B H    5  
ATOM 7618  H HA   . ILE B 2 30 ? -3.222  -9.990  4.634   1.00 0.00 ? 324 ILE B HA   5  
ATOM 7619  H HB   . ILE B 2 30 ? -1.805  -11.677 2.567   1.00 0.00 ? 324 ILE B HB   5  
ATOM 7620  H HG12 . ILE B 2 30 ? -2.564  -13.174 4.222   1.00 0.00 ? 324 ILE B HG12 5  
ATOM 7621  H HG13 . ILE B 2 30 ? -0.877  -12.849 4.610   1.00 0.00 ? 324 ILE B HG13 5  
ATOM 7622  H HG21 . ILE B 2 30 ? 0.100   -10.829 4.266   1.00 0.00 ? 324 ILE B HG21 5  
ATOM 7623  H HG22 . ILE B 2 30 ? -1.028  -9.478  4.386   1.00 0.00 ? 324 ILE B HG22 5  
ATOM 7624  H HG23 . ILE B 2 30 ? -0.369  -9.941  2.810   1.00 0.00 ? 324 ILE B HG23 5  
ATOM 7625  H HD11 . ILE B 2 30 ? -3.234  -11.535 5.894   1.00 0.00 ? 324 ILE B HD11 5  
ATOM 7626  H HD12 . ILE B 2 30 ? -1.539  -11.358 6.358   1.00 0.00 ? 324 ILE B HD12 5  
ATOM 7627  H HD13 . ILE B 2 30 ? -2.351  -12.915 6.556   1.00 0.00 ? 324 ILE B HD13 5  
ATOM 7628  N N    . TYR B 2 31 ? -3.458  -9.948  1.375   1.00 0.00 ? 325 TYR B N    5  
ATOM 7629  C CA   . TYR B 2 31 ? -3.483  -9.088  0.204   1.00 0.00 ? 325 TYR B CA   5  
ATOM 7630  C C    . TYR B 2 31 ? -4.622  -8.083  0.302   1.00 0.00 ? 325 TYR B C    5  
ATOM 7631  O O    . TYR B 2 31 ? -4.413  -6.881  0.133   1.00 0.00 ? 325 TYR B O    5  
ATOM 7632  C CB   . TYR B 2 31 ? -3.626  -9.913  -1.071  1.00 0.00 ? 325 TYR B CB   5  
ATOM 7633  C CG   . TYR B 2 31 ? -2.959  -9.275  -2.264  1.00 0.00 ? 325 TYR B CG   5  
ATOM 7634  C CD1  . TYR B 2 31 ? -1.745  -8.607  -2.129  1.00 0.00 ? 325 TYR B CD1  5  
ATOM 7635  C CD2  . TYR B 2 31 ? -3.524  -9.358  -3.526  1.00 0.00 ? 325 TYR B CD2  5  
ATOM 7636  C CE1  . TYR B 2 31 ? -1.125  -8.036  -3.223  1.00 0.00 ? 325 TYR B CE1  5  
ATOM 7637  C CE2  . TYR B 2 31 ? -2.909  -8.792  -4.620  1.00 0.00 ? 325 TYR B CE2  5  
ATOM 7638  C CZ   . TYR B 2 31 ? -1.717  -8.134  -4.465  1.00 0.00 ? 325 TYR B CZ   5  
ATOM 7639  O OH   . TYR B 2 31 ? -1.109  -7.583  -5.564  1.00 0.00 ? 325 TYR B OH   5  
ATOM 7640  H H    . TYR B 2 31 ? -3.602  -10.913 1.279   1.00 0.00 ? 325 TYR B H    5  
ATOM 7641  H HA   . TYR B 2 31 ? -2.547  -8.549  0.171   1.00 0.00 ? 325 TYR B HA   5  
ATOM 7642  H HB2  . TYR B 2 31 ? -3.182  -10.886 -0.919  1.00 0.00 ? 325 TYR B HB2  5  
ATOM 7643  H HB3  . TYR B 2 31 ? -4.676  -10.031 -1.301  1.00 0.00 ? 325 TYR B HB3  5  
ATOM 7644  H HD1  . TYR B 2 31 ? -1.287  -8.537  -1.145  1.00 0.00 ? 325 TYR B HD1  5  
ATOM 7645  H HD2  . TYR B 2 31 ? -4.465  -9.868  -3.648  1.00 0.00 ? 325 TYR B HD2  5  
ATOM 7646  H HE1  . TYR B 2 31 ? -0.186  -7.517  -3.105  1.00 0.00 ? 325 TYR B HE1  5  
ATOM 7647  H HE2  . TYR B 2 31 ? -3.365  -8.867  -5.594  1.00 0.00 ? 325 TYR B HE2  5  
ATOM 7648  H HH   . TYR B 2 31 ? -1.255  -6.641  -5.566  1.00 0.00 ? 325 TYR B HH   5  
ATOM 7649  N N    . LYS B 2 32 ? -5.826  -8.577  0.597   1.00 0.00 ? 326 LYS B N    5  
ATOM 7650  C CA   . LYS B 2 32 ? -6.991  -7.712  0.739   1.00 0.00 ? 326 LYS B CA   5  
ATOM 7651  C C    . LYS B 2 32 ? -6.778  -6.733  1.891   1.00 0.00 ? 326 LYS B C    5  
ATOM 7652  O O    . LYS B 2 32 ? -6.972  -5.530  1.732   1.00 0.00 ? 326 LYS B O    5  
ATOM 7653  C CB   . LYS B 2 32 ? -8.258  -8.540  0.971   1.00 0.00 ? 326 LYS B CB   5  
ATOM 7654  C CG   . LYS B 2 32 ? -8.618  -9.439  -0.203  1.00 0.00 ? 326 LYS B CG   5  
ATOM 7655  C CD   . LYS B 2 32 ? -9.853  -10.278 0.086   1.00 0.00 ? 326 LYS B CD   5  
ATOM 7656  C CE   . LYS B 2 32 ? -11.089 -9.410  0.282   1.00 0.00 ? 326 LYS B CE   5  
ATOM 7657  N NZ   . LYS B 2 32 ? -12.310 -10.223 0.549   1.00 0.00 ? 326 LYS B NZ   5  
ATOM 7658  H H    . LYS B 2 32 ? -5.926  -9.543  0.735   1.00 0.00 ? 326 LYS B H    5  
ATOM 7659  H HA   . LYS B 2 32 ? -7.099  -7.150  -0.178  1.00 0.00 ? 326 LYS B HA   5  
ATOM 7660  H HB2  . LYS B 2 32 ? -8.113  -9.161  1.843   1.00 0.00 ? 326 LYS B HB2  5  
ATOM 7661  H HB3  . LYS B 2 32 ? -9.085  -7.869  1.149   1.00 0.00 ? 326 LYS B HB3  5  
ATOM 7662  H HG2  . LYS B 2 32 ? -8.809  -8.823  -1.069  1.00 0.00 ? 326 LYS B HG2  5  
ATOM 7663  H HG3  . LYS B 2 32 ? -7.786  -10.098 -0.406  1.00 0.00 ? 326 LYS B HG3  5  
ATOM 7664  H HD2  . LYS B 2 32 ? -10.025 -10.945 -0.746  1.00 0.00 ? 326 LYS B HD2  5  
ATOM 7665  H HD3  . LYS B 2 32 ? -9.682  -10.854 0.982   1.00 0.00 ? 326 LYS B HD3  5  
ATOM 7666  H HE2  . LYS B 2 32 ? -10.919 -8.750  1.120   1.00 0.00 ? 326 LYS B HE2  5  
ATOM 7667  H HE3  . LYS B 2 32 ? -11.245 -8.822  -0.610  1.00 0.00 ? 326 LYS B HE3  5  
ATOM 7668  H HZ1  . LYS B 2 32 ? -13.023 -10.045 -0.187  1.00 0.00 ? 326 LYS B HZ1  5  
ATOM 7669  H HZ2  . LYS B 2 32 ? -12.712 -9.971  1.473   1.00 0.00 ? 326 LYS B HZ2  5  
ATOM 7670  H HZ3  . LYS B 2 32 ? -12.075 -11.236 0.550   1.00 0.00 ? 326 LYS B HZ3  5  
ATOM 7671  N N    . ALA B 2 33 ? -6.358  -7.258  3.045   1.00 0.00 ? 327 ALA B N    5  
ATOM 7672  C CA   . ALA B 2 33 ? -6.094  -6.430  4.219   1.00 0.00 ? 327 ALA B CA   5  
ATOM 7673  C C    . ALA B 2 33 ? -5.043  -5.369  3.916   1.00 0.00 ? 327 ALA B C    5  
ATOM 7674  O O    . ALA B 2 33 ? -5.267  -4.189  4.152   1.00 0.00 ? 327 ALA B O    5  
ATOM 7675  C CB   . ALA B 2 33 ? -5.650  -7.287  5.397   1.00 0.00 ? 327 ALA B CB   5  
ATOM 7676  H H    . ALA B 2 33 ? -6.207  -8.225  3.101   1.00 0.00 ? 327 ALA B H    5  
ATOM 7677  H HA   . ALA B 2 33 ? -7.018  -5.939  4.492   1.00 0.00 ? 327 ALA B HA   5  
ATOM 7678  H HB1  . ALA B 2 33 ? -5.459  -6.653  6.251   1.00 0.00 ? 327 ALA B HB1  5  
ATOM 7679  H HB2  . ALA B 2 33 ? -4.748  -7.820  5.135   1.00 0.00 ? 327 ALA B HB2  5  
ATOM 7680  H HB3  . ALA B 2 33 ? -6.429  -7.995  5.642   1.00 0.00 ? 327 ALA B HB3  5  
ATOM 7681  N N    . PHE B 2 34 ? -3.896  -5.802  3.380   1.00 0.00 ? 328 PHE B N    5  
ATOM 7682  C CA   . PHE B 2 34 ? -2.802  -4.889  3.038   1.00 0.00 ? 328 PHE B CA   5  
ATOM 7683  C C    . PHE B 2 34 ? -3.309  -3.735  2.178   1.00 0.00 ? 328 PHE B C    5  
ATOM 7684  O O    . PHE B 2 34 ? -3.112  -2.571  2.518   1.00 0.00 ? 328 PHE B O    5  
ATOM 7685  C CB   . PHE B 2 34 ? -1.694  -5.648  2.296   1.00 0.00 ? 328 PHE B CB   5  
ATOM 7686  C CG   . PHE B 2 34 ? -0.514  -4.797  1.913   1.00 0.00 ? 328 PHE B CG   5  
ATOM 7687  C CD1  . PHE B 2 34 ? 0.269   -4.201  2.887   1.00 0.00 ? 328 PHE B CD1  5  
ATOM 7688  C CD2  . PHE B 2 34 ? -0.188  -4.592  0.581   1.00 0.00 ? 328 PHE B CD2  5  
ATOM 7689  C CE1  . PHE B 2 34 ? 1.353   -3.417  2.543   1.00 0.00 ? 328 PHE B CE1  5  
ATOM 7690  C CE2  . PHE B 2 34 ? 0.896   -3.808  0.231   1.00 0.00 ? 328 PHE B CE2  5  
ATOM 7691  C CZ   . PHE B 2 34 ? 1.667   -3.221  1.215   1.00 0.00 ? 328 PHE B CZ   5  
ATOM 7692  H H    . PHE B 2 34 ? -3.784  -6.760  3.211   1.00 0.00 ? 328 PHE B H    5  
ATOM 7693  H HA   . PHE B 2 34 ? -2.400  -4.487  3.958   1.00 0.00 ? 328 PHE B HA   5  
ATOM 7694  H HB2  . PHE B 2 34 ? -1.332  -6.446  2.927   1.00 0.00 ? 328 PHE B HB2  5  
ATOM 7695  H HB3  . PHE B 2 34 ? -2.104  -6.074  1.390   1.00 0.00 ? 328 PHE B HB3  5  
ATOM 7696  H HD1  . PHE B 2 34 ? 0.026   -4.356  3.927   1.00 0.00 ? 328 PHE B HD1  5  
ATOM 7697  H HD2  . PHE B 2 34 ? -0.791  -5.050  -0.188  1.00 0.00 ? 328 PHE B HD2  5  
ATOM 7698  H HE1  . PHE B 2 34 ? 1.954   -2.958  3.312   1.00 0.00 ? 328 PHE B HE1  5  
ATOM 7699  H HE2  . PHE B 2 34 ? 1.140   -3.657  -0.810  1.00 0.00 ? 328 PHE B HE2  5  
ATOM 7700  H HZ   . PHE B 2 34 ? 2.515   -2.610  0.948   1.00 0.00 ? 328 PHE B HZ   5  
ATOM 7701  N N    . LEU B 2 35 ? -3.970  -4.067  1.071   1.00 0.00 ? 329 LEU B N    5  
ATOM 7702  C CA   . LEU B 2 35 ? -4.518  -3.053  0.175   1.00 0.00 ? 329 LEU B CA   5  
ATOM 7703  C C    . LEU B 2 35 ? -5.538  -2.175  0.903   1.00 0.00 ? 329 LEU B C    5  
ATOM 7704  O O    . LEU B 2 35 ? -5.460  -0.951  0.843   1.00 0.00 ? 329 LEU B O    5  
ATOM 7705  C CB   . LEU B 2 35 ? -5.147  -3.707  -1.057  1.00 0.00 ? 329 LEU B CB   5  
ATOM 7706  C CG   . LEU B 2 35 ? -4.173  -4.505  -1.930  1.00 0.00 ? 329 LEU B CG   5  
ATOM 7707  C CD1  . LEU B 2 35 ? -4.906  -5.162  -3.089  1.00 0.00 ? 329 LEU B CD1  5  
ATOM 7708  C CD2  . LEU B 2 35 ? -3.054  -3.605  -2.443  1.00 0.00 ? 329 LEU B CD2  5  
ATOM 7709  H H    . LEU B 2 35 ? -4.103  -5.015  0.858   1.00 0.00 ? 329 LEU B H    5  
ATOM 7710  H HA   . LEU B 2 35 ? -3.697  -2.427  -0.146  1.00 0.00 ? 329 LEU B HA   5  
ATOM 7711  H HB2  . LEU B 2 35 ? -5.931  -4.375  -0.724  1.00 0.00 ? 329 LEU B HB2  5  
ATOM 7712  H HB3  . LEU B 2 35 ? -5.590  -2.934  -1.665  1.00 0.00 ? 329 LEU B HB3  5  
ATOM 7713  H HG   . LEU B 2 35 ? -3.725  -5.286  -1.334  1.00 0.00 ? 329 LEU B HG   5  
ATOM 7714  H HD11 . LEU B 2 35 ? -5.168  -4.413  -3.821  1.00 0.00 ? 329 LEU B HD11 5  
ATOM 7715  H HD12 . LEU B 2 35 ? -5.804  -5.638  -2.724  1.00 0.00 ? 329 LEU B HD12 5  
ATOM 7716  H HD13 . LEU B 2 35 ? -4.267  -5.904  -3.544  1.00 0.00 ? 329 LEU B HD13 5  
ATOM 7717  H HD21 . LEU B 2 35 ? -2.223  -4.215  -2.768  1.00 0.00 ? 329 LEU B HD21 5  
ATOM 7718  H HD22 . LEU B 2 35 ? -2.726  -2.946  -1.650  1.00 0.00 ? 329 LEU B HD22 5  
ATOM 7719  H HD23 . LEU B 2 35 ? -3.416  -3.017  -3.272  1.00 0.00 ? 329 LEU B HD23 5  
ATOM 7720  N N    . GLU B 2 36 ? -6.477  -2.814  1.607   1.00 0.00 ? 330 GLU B N    5  
ATOM 7721  C CA   . GLU B 2 36 ? -7.502  -2.089  2.366   1.00 0.00 ? 330 GLU B CA   5  
ATOM 7722  C C    . GLU B 2 36 ? -6.864  -1.198  3.433   1.00 0.00 ? 330 GLU B C    5  
ATOM 7723  O O    . GLU B 2 36 ? -7.373  -0.117  3.731   1.00 0.00 ? 330 GLU B O    5  
ATOM 7724  C CB   . GLU B 2 36 ? -8.486  -3.067  3.012   1.00 0.00 ? 330 GLU B CB   5  
ATOM 7725  C CG   . GLU B 2 36 ? -9.360  -3.804  2.005   1.00 0.00 ? 330 GLU B CG   5  
ATOM 7726  C CD   . GLU B 2 36 ? -10.235 -4.878  2.636   1.00 0.00 ? 330 GLU B CD   5  
ATOM 7727  O OE1  . GLU B 2 36 ? -10.172 -5.060  3.873   1.00 0.00 ? 330 GLU B OE1  5  
ATOM 7728  O OE2  . GLU B 2 36 ? -10.983 -5.542  1.888   1.00 0.00 ? 330 GLU B OE2  5  
ATOM 7729  H H    . GLU B 2 36 ? -6.475  -3.794  1.628   1.00 0.00 ? 330 GLU B H    5  
ATOM 7730  H HA   . GLU B 2 36 ? -8.038  -1.459  1.669   1.00 0.00 ? 330 GLU B HA   5  
ATOM 7731  H HB2  . GLU B 2 36 ? -7.929  -3.798  3.578   1.00 0.00 ? 330 GLU B HB2  5  
ATOM 7732  H HB3  . GLU B 2 36 ? -9.131  -2.520  3.684   1.00 0.00 ? 330 GLU B HB3  5  
ATOM 7733  H HG2  . GLU B 2 36 ? -10.001 -3.086  1.516   1.00 0.00 ? 330 GLU B HG2  5  
ATOM 7734  H HG3  . GLU B 2 36 ? -8.722  -4.268  1.269   1.00 0.00 ? 330 GLU B HG3  5  
ATOM 7735  N N    . ILE B 2 37 ? -5.729  -1.644  3.980   1.00 0.00 ? 331 ILE B N    5  
ATOM 7736  C CA   . ILE B 2 37 ? -4.997  -0.872  4.980   1.00 0.00 ? 331 ILE B CA   5  
ATOM 7737  C C    . ILE B 2 37 ? -4.621  0.477   4.382   1.00 0.00 ? 331 ILE B C    5  
ATOM 7738  O O    . ILE B 2 37 ? -4.913  1.532   4.949   1.00 0.00 ? 331 ILE B O    5  
ATOM 7739  C CB   . ILE B 2 37 ? -3.724  -1.622  5.430   1.00 0.00 ? 331 ILE B CB   5  
ATOM 7740  C CG1  . ILE B 2 37 ? -4.096  -2.775  6.359   1.00 0.00 ? 331 ILE B CG1  5  
ATOM 7741  C CG2  . ILE B 2 37 ? -2.738  -0.687  6.112   1.00 0.00 ? 331 ILE B CG2  5  
ATOM 7742  C CD1  . ILE B 2 37 ? -2.974  -3.763  6.555   1.00 0.00 ? 331 ILE B CD1  5  
ATOM 7743  H H    . ILE B 2 37 ? -5.361  -2.502  3.683   1.00 0.00 ? 331 ILE B H    5  
ATOM 7744  H HA   . ILE B 2 37 ? -5.634  -0.726  5.838   1.00 0.00 ? 331 ILE B HA   5  
ATOM 7745  H HB   . ILE B 2 37 ? -3.244  -2.023  4.554   1.00 0.00 ? 331 ILE B HB   5  
ATOM 7746  H HG12 . ILE B 2 37 ? -4.358  -2.377  7.327   1.00 0.00 ? 331 ILE B HG12 5  
ATOM 7747  H HG13 . ILE B 2 37 ? -4.942  -3.304  5.953   1.00 0.00 ? 331 ILE B HG13 5  
ATOM 7748  H HG21 . ILE B 2 37 ? -1.819  -1.219  6.303   1.00 0.00 ? 331 ILE B HG21 5  
ATOM 7749  H HG22 . ILE B 2 37 ? -3.155  -0.341  7.046   1.00 0.00 ? 331 ILE B HG22 5  
ATOM 7750  H HG23 . ILE B 2 37 ? -2.538  0.157   5.471   1.00 0.00 ? 331 ILE B HG23 5  
ATOM 7751  H HD11 . ILE B 2 37 ? -2.320  -3.410  7.335   1.00 0.00 ? 331 ILE B HD11 5  
ATOM 7752  H HD12 . ILE B 2 37 ? -2.419  -3.859  5.636   1.00 0.00 ? 331 ILE B HD12 5  
ATOM 7753  H HD13 . ILE B 2 37 ? -3.383  -4.722  6.833   1.00 0.00 ? 331 ILE B HD13 5  
ATOM 7754  N N    . LEU B 2 38 ? -4.003  0.418   3.203   1.00 0.00 ? 332 LEU B N    5  
ATOM 7755  C CA   . LEU B 2 38 ? -3.611  1.612   2.465   1.00 0.00 ? 332 LEU B CA   5  
ATOM 7756  C C    . LEU B 2 38 ? -4.857  2.401   2.085   1.00 0.00 ? 332 LEU B C    5  
ATOM 7757  O O    . LEU B 2 38 ? -4.893  3.627   2.186   1.00 0.00 ? 332 LEU B O    5  
ATOM 7758  C CB   . LEU B 2 38 ? -2.849  1.229   1.194   1.00 0.00 ? 332 LEU B CB   5  
ATOM 7759  C CG   . LEU B 2 38 ? -1.925  0.015   1.314   1.00 0.00 ? 332 LEU B CG   5  
ATOM 7760  C CD1  . LEU B 2 38 ? -1.070  -0.136  0.069   1.00 0.00 ? 332 LEU B CD1  5  
ATOM 7761  C CD2  . LEU B 2 38 ? -1.067  0.117   2.563   1.00 0.00 ? 332 LEU B CD2  5  
ATOM 7762  H H    . LEU B 2 38 ? -3.834  -0.462  2.804   1.00 0.00 ? 332 LEU B H    5  
ATOM 7763  H HA   . LEU B 2 38 ? -2.980  2.217   3.098   1.00 0.00 ? 332 LEU B HA   5  
ATOM 7764  H HB2  . LEU B 2 38 ? -3.570  1.027   0.417   1.00 0.00 ? 332 LEU B HB2  5  
ATOM 7765  H HB3  . LEU B 2 38 ? -2.254  2.074   0.894   1.00 0.00 ? 332 LEU B HB3  5  
ATOM 7766  H HG   . LEU B 2 38 ? -2.531  -0.874  1.401   1.00 0.00 ? 332 LEU B HG   5  
ATOM 7767  H HD11 . LEU B 2 38 ? -0.035  -0.247  0.352   1.00 0.00 ? 332 LEU B HD11 5  
ATOM 7768  H HD12 . LEU B 2 38 ? -1.184  0.739   -0.551  1.00 0.00 ? 332 LEU B HD12 5  
ATOM 7769  H HD13 . LEU B 2 38 ? -1.390  -1.010  -0.481  1.00 0.00 ? 332 LEU B HD13 5  
ATOM 7770  H HD21 . LEU B 2 38 ? -0.075  0.447   2.294   1.00 0.00 ? 332 LEU B HD21 5  
ATOM 7771  H HD22 . LEU B 2 38 ? -1.011  -0.849  3.040   1.00 0.00 ? 332 LEU B HD22 5  
ATOM 7772  H HD23 . LEU B 2 38 ? -1.514  0.828   3.243   1.00 0.00 ? 332 LEU B HD23 5  
ATOM 7773  N N    . HIS B 2 39 ? -5.876  1.664   1.644   1.00 0.00 ? 333 HIS B N    5  
ATOM 7774  C CA   . HIS B 2 39 ? -7.155  2.253   1.232   1.00 0.00 ? 333 HIS B CA   5  
ATOM 7775  C C    . HIS B 2 39 ? -7.731  3.149   2.324   1.00 0.00 ? 333 HIS B C    5  
ATOM 7776  O O    . HIS B 2 39 ? -8.130  4.280   2.048   1.00 0.00 ? 333 HIS B O    5  
ATOM 7777  C CB   . HIS B 2 39 ? -8.176  1.158   0.889   1.00 0.00 ? 333 HIS B CB   5  
ATOM 7778  C CG   . HIS B 2 39 ? -7.870  0.395   -0.364  1.00 0.00 ? 333 HIS B CG   5  
ATOM 7779  N ND1  . HIS B 2 39 ? -8.577  -0.724  -0.754  1.00 0.00 ? 333 HIS B ND1  5  
ATOM 7780  C CD2  . HIS B 2 39 ? -6.939  0.600   -1.321  1.00 0.00 ? 333 HIS B CD2  5  
ATOM 7781  C CE1  . HIS B 2 39 ? -8.092  -1.173  -1.898  1.00 0.00 ? 333 HIS B CE1  5  
ATOM 7782  N NE2  . HIS B 2 39 ? -7.097  -0.386  -2.263  1.00 0.00 ? 333 HIS B NE2  5  
ATOM 7783  H H    . HIS B 2 39 ? -5.755  0.690   1.590   1.00 0.00 ? 333 HIS B H    5  
ATOM 7784  H HA   . HIS B 2 39 ? -6.972  2.851   0.351   1.00 0.00 ? 333 HIS B HA   5  
ATOM 7785  H HB2  . HIS B 2 39 ? -8.216  0.450   1.701   1.00 0.00 ? 333 HIS B HB2  5  
ATOM 7786  H HB3  . HIS B 2 39 ? -9.149  1.613   0.770   1.00 0.00 ? 333 HIS B HB3  5  
ATOM 7787  H HD1  . HIS B 2 39 ? -9.324  -1.128  -0.265  1.00 0.00 ? 333 HIS B HD1  5  
ATOM 7788  H HD2  . HIS B 2 39 ? -6.207  1.390   -1.338  1.00 0.00 ? 333 HIS B HD2  5  
ATOM 7789  H HE1  . HIS B 2 39 ? -8.448  -2.035  -2.441  1.00 0.00 ? 333 HIS B HE1  5  
ATOM 7790  H HE2  . HIS B 2 39 ? -6.511  -0.537  -3.034  1.00 0.00 ? 333 HIS B HE2  5  
ATOM 7791  N N    . THR B 2 40 ? -7.762  2.653   3.564   1.00 0.00 ? 334 THR B N    5  
ATOM 7792  C CA   . THR B 2 40 ? -8.286  3.435   4.682   1.00 0.00 ? 334 THR B CA   5  
ATOM 7793  C C    . THR B 2 40 ? -7.459  4.708   4.847   1.00 0.00 ? 334 THR B C    5  
ATOM 7794  O O    . THR B 2 40 ? -8.010  5.804   4.932   1.00 0.00 ? 334 THR B O    5  
ATOM 7795  C CB   . THR B 2 40 ? -8.280  2.615   5.980   1.00 0.00 ? 334 THR B CB   5  
ATOM 7796  O OG1  . THR B 2 40 ? -9.025  1.420   5.820   1.00 0.00 ? 334 THR B OG1  5  
ATOM 7797  C CG2  . THR B 2 40 ? -8.862  3.358   7.170   1.00 0.00 ? 334 THR B CG2  5  
ATOM 7798  H H    . THR B 2 40 ? -7.422  1.747   3.728   1.00 0.00 ? 334 THR B H    5  
ATOM 7799  H HA   . THR B 2 40 ? -9.301  3.712   4.443   1.00 0.00 ? 334 THR B HA   5  
ATOM 7800  H HB   . THR B 2 40 ? -7.261  2.349   6.220   1.00 0.00 ? 334 THR B HB   5  
ATOM 7801  H HG1  . THR B 2 40 ? -8.454  0.728   5.478   1.00 0.00 ? 334 THR B HG1  5  
ATOM 7802  H HG21 . THR B 2 40 ? -9.308  4.283   6.837   1.00 0.00 ? 334 THR B HG21 5  
ATOM 7803  H HG22 . THR B 2 40 ? -8.078  3.575   7.883   1.00 0.00 ? 334 THR B HG22 5  
ATOM 7804  H HG23 . THR B 2 40 ? -9.615  2.747   7.645   1.00 0.00 ? 334 THR B HG23 5  
ATOM 7805  N N    . TYR B 2 41 ? -6.133  4.553   4.850   1.00 0.00 ? 335 TYR B N    5  
ATOM 7806  C CA   . TYR B 2 41 ? -5.219  5.689   4.961   1.00 0.00 ? 335 TYR B CA   5  
ATOM 7807  C C    . TYR B 2 41 ? -5.558  6.729   3.894   1.00 0.00 ? 335 TYR B C    5  
ATOM 7808  O O    . TYR B 2 41 ? -5.859  7.878   4.211   1.00 0.00 ? 335 TYR B O    5  
ATOM 7809  C CB   . TYR B 2 41 ? -3.775  5.205   4.786   1.00 0.00 ? 335 TYR B CB   5  
ATOM 7810  C CG   . TYR B 2 41 ? -2.719  6.294   4.829   1.00 0.00 ? 335 TYR B CG   5  
ATOM 7811  C CD1  . TYR B 2 41 ? -2.305  6.855   6.032   1.00 0.00 ? 335 TYR B CD1  5  
ATOM 7812  C CD2  . TYR B 2 41 ? -2.124  6.747   3.658   1.00 0.00 ? 335 TYR B CD2  5  
ATOM 7813  C CE1  . TYR B 2 41 ? -1.327  7.837   6.062   1.00 0.00 ? 335 TYR B CE1  5  
ATOM 7814  C CE2  . TYR B 2 41 ? -1.152  7.727   3.681   1.00 0.00 ? 335 TYR B CE2  5  
ATOM 7815  C CZ   . TYR B 2 41 ? -0.756  8.267   4.885   1.00 0.00 ? 335 TYR B CZ   5  
ATOM 7816  O OH   . TYR B 2 41 ? 0.216   9.242   4.912   1.00 0.00 ? 335 TYR B OH   5  
ATOM 7817  H H    . TYR B 2 41 ? -5.760  3.652   4.749   1.00 0.00 ? 335 TYR B H    5  
ATOM 7818  H HA   . TYR B 2 41 ? -5.337  6.128   5.940   1.00 0.00 ? 335 TYR B HA   5  
ATOM 7819  H HB2  . TYR B 2 41 ? -3.549  4.503   5.573   1.00 0.00 ? 335 TYR B HB2  5  
ATOM 7820  H HB3  . TYR B 2 41 ? -3.689  4.700   3.834   1.00 0.00 ? 335 TYR B HB3  5  
ATOM 7821  H HD1  . TYR B 2 41 ? -2.756  6.516   6.952   1.00 0.00 ? 335 TYR B HD1  5  
ATOM 7822  H HD2  . TYR B 2 41 ? -2.435  6.325   2.716   1.00 0.00 ? 335 TYR B HD2  5  
ATOM 7823  H HE1  . TYR B 2 41 ? -1.011  8.258   7.008   1.00 0.00 ? 335 TYR B HE1  5  
ATOM 7824  H HE2  . TYR B 2 41 ? -0.703  8.062   2.758   1.00 0.00 ? 335 TYR B HE2  5  
ATOM 7825  H HH   . TYR B 2 41 ? -0.166  10.083  4.650   1.00 0.00 ? 335 TYR B HH   5  
ATOM 7826  N N    . GLN B 2 42 ? -5.509  6.295   2.629   1.00 0.00 ? 336 GLN B N    5  
ATOM 7827  C CA   . GLN B 2 42 ? -5.802  7.135   1.488   1.00 0.00 ? 336 GLN B CA   5  
ATOM 7828  C C    . GLN B 2 42 ? -7.131  7.875   1.636   1.00 0.00 ? 336 GLN B C    5  
ATOM 7829  O O    . GLN B 2 42 ? -7.194  9.086   1.429   1.00 0.00 ? 336 GLN B O    5  
ATOM 7830  C CB   . GLN B 2 42 ? -5.851  6.259   0.242   1.00 0.00 ? 336 GLN B CB   5  
ATOM 7831  C CG   . GLN B 2 42 ? -5.574  7.023   -1.024  1.00 0.00 ? 336 GLN B CG   5  
ATOM 7832  C CD   . GLN B 2 42 ? -5.904  6.256   -2.300  1.00 0.00 ? 336 GLN B CD   5  
ATOM 7833  O OE1  . GLN B 2 42 ? -5.882  6.825   -3.391  1.00 0.00 ? 336 GLN B OE1  5  
ATOM 7834  N NE2  . GLN B 2 42 ? -6.201  4.960   -2.186  1.00 0.00 ? 336 GLN B NE2  5  
ATOM 7835  H H    . GLN B 2 42 ? -5.262  5.370   2.454   1.00 0.00 ? 336 GLN B H    5  
ATOM 7836  H HA   . GLN B 2 42 ? -5.003  7.853   1.382   1.00 0.00 ? 336 GLN B HA   5  
ATOM 7837  H HB2  . GLN B 2 42 ? -5.114  5.474   0.334   1.00 0.00 ? 336 GLN B HB2  5  
ATOM 7838  H HB3  . GLN B 2 42 ? -6.831  5.815   0.164   1.00 0.00 ? 336 GLN B HB3  5  
ATOM 7839  H HG2  . GLN B 2 42 ? -6.152  7.930   -1.004  1.00 0.00 ? 336 GLN B HG2  5  
ATOM 7840  H HG3  . GLN B 2 42 ? -4.524  7.268   -1.029  1.00 0.00 ? 336 GLN B HG3  5  
ATOM 7841  H HE21 . GLN B 2 42 ? -6.196  4.553   -1.295  1.00 0.00 ? 336 GLN B HE21 5  
ATOM 7842  H HE22 . GLN B 2 42 ? -6.415  4.464   -3.004  1.00 0.00 ? 336 GLN B HE22 5  
ATOM 7843  N N    . LYS B 2 43 ? -8.193  7.139   1.977   1.00 0.00 ? 337 LYS B N    5  
ATOM 7844  C CA   . LYS B 2 43 ? -9.524  7.732   2.123   1.00 0.00 ? 337 LYS B CA   5  
ATOM 7845  C C    . LYS B 2 43 ? -9.522  8.862   3.142   1.00 0.00 ? 337 LYS B C    5  
ATOM 7846  O O    . LYS B 2 43 ? -10.032 9.944   2.865   1.00 0.00 ? 337 LYS B O    5  
ATOM 7847  C CB   . LYS B 2 43 ? -10.553 6.676   2.540   1.00 0.00 ? 337 LYS B CB   5  
ATOM 7848  C CG   . LYS B 2 43 ? -10.838 5.633   1.471   1.00 0.00 ? 337 LYS B CG   5  
ATOM 7849  C CD   . LYS B 2 43 ? -11.948 4.672   1.888   1.00 0.00 ? 337 LYS B CD   5  
ATOM 7850  C CE   . LYS B 2 43 ? -11.593 3.883   3.147   1.00 0.00 ? 337 LYS B CE   5  
ATOM 7851  N NZ   . LYS B 2 43 ? -11.697 4.706   4.390   1.00 0.00 ? 337 LYS B NZ   5  
ATOM 7852  H H    . LYS B 2 43 ? -8.082  6.175   2.115   1.00 0.00 ? 337 LYS B H    5  
ATOM 7853  H HA   . LYS B 2 43 ? -9.810  8.135   1.162   1.00 0.00 ? 337 LYS B HA   5  
ATOM 7854  H HB2  . LYS B 2 43 ? -10.183 6.167   3.417   1.00 0.00 ? 337 LYS B HB2  5  
ATOM 7855  H HB3  . LYS B 2 43 ? -11.480 7.172   2.786   1.00 0.00 ? 337 LYS B HB3  5  
ATOM 7856  H HG2  . LYS B 2 43 ? -11.142 6.139   0.566   1.00 0.00 ? 337 LYS B HG2  5  
ATOM 7857  H HG3  . LYS B 2 43 ? -9.939  5.070   1.283   1.00 0.00 ? 337 LYS B HG3  5  
ATOM 7858  H HD2  . LYS B 2 43 ? -12.846 5.239   2.077   1.00 0.00 ? 337 LYS B HD2  5  
ATOM 7859  H HD3  . LYS B 2 43 ? -12.125 3.978   1.080   1.00 0.00 ? 337 LYS B HD3  5  
ATOM 7860  H HE2  . LYS B 2 43 ? -12.268 3.044   3.229   1.00 0.00 ? 337 LYS B HE2  5  
ATOM 7861  H HE3  . LYS B 2 43 ? -10.581 3.520   3.053   1.00 0.00 ? 337 LYS B HE3  5  
ATOM 7862  H HZ1  . LYS B 2 43 ? -12.183 4.166   5.134   1.00 0.00 ? 337 LYS B HZ1  5  
ATOM 7863  H HZ2  . LYS B 2 43 ? -12.238 5.576   4.203   1.00 0.00 ? 337 LYS B HZ2  5  
ATOM 7864  H HZ3  . LYS B 2 43 ? -10.750 4.965   4.729   1.00 0.00 ? 337 LYS B HZ3  5  
ATOM 7865  N N    . GLU B 2 44 ? -8.949  8.609   4.317   1.00 0.00 ? 338 GLU B N    5  
ATOM 7866  C CA   . GLU B 2 44 ? -8.892  9.620   5.372   1.00 0.00 ? 338 GLU B CA   5  
ATOM 7867  C C    . GLU B 2 44 ? -8.174  10.889  4.895   1.00 0.00 ? 338 GLU B C    5  
ATOM 7868  O O    . GLU B 2 44 ? -8.442  11.981  5.401   1.00 0.00 ? 338 GLU B O    5  
ATOM 7869  C CB   . GLU B 2 44 ? -8.213  9.053   6.624   1.00 0.00 ? 338 GLU B CB   5  
ATOM 7870  C CG   . GLU B 2 44 ? -8.849  7.762   7.138   1.00 0.00 ? 338 GLU B CG   5  
ATOM 7871  C CD   . GLU B 2 44 ? -10.319 7.903   7.510   1.00 0.00 ? 338 GLU B CD   5  
ATOM 7872  O OE1  . GLU B 2 44 ? -10.831 9.045   7.552   1.00 0.00 ? 338 GLU B OE1  5  
ATOM 7873  O OE2  . GLU B 2 44 ? -10.957 6.864   7.780   1.00 0.00 ? 338 GLU B OE2  5  
ATOM 7874  H H    . GLU B 2 44 ? -8.558  7.725   4.478   1.00 0.00 ? 338 GLU B H    5  
ATOM 7875  H HA   . GLU B 2 44 ? -9.911  9.884   5.620   1.00 0.00 ? 338 GLU B HA   5  
ATOM 7876  H HB2  . GLU B 2 44 ? -7.176  8.851   6.398   1.00 0.00 ? 338 GLU B HB2  5  
ATOM 7877  H HB3  . GLU B 2 44 ? -8.266  9.788   7.410   1.00 0.00 ? 338 GLU B HB3  5  
ATOM 7878  H HG2  . GLU B 2 44 ? -8.766  7.011   6.373   1.00 0.00 ? 338 GLU B HG2  5  
ATOM 7879  H HG3  . GLU B 2 44 ? -8.304  7.439   8.013   1.00 0.00 ? 338 GLU B HG3  5  
ATOM 7880  N N    . GLN B 2 45 ? -7.278  10.748  3.907   1.00 0.00 ? 339 GLN B N    5  
ATOM 7881  C CA   . GLN B 2 45 ? -6.554  11.898  3.358   1.00 0.00 ? 339 GLN B CA   5  
ATOM 7882  C C    . GLN B 2 45 ? -7.513  12.782  2.566   1.00 0.00 ? 339 GLN B C    5  
ATOM 7883  O O    . GLN B 2 45 ? -7.656  13.973  2.851   1.00 0.00 ? 339 GLN B O    5  
ATOM 7884  C CB   . GLN B 2 45 ? -5.410  11.448  2.437   1.00 0.00 ? 339 GLN B CB   5  
ATOM 7885  C CG   . GLN B 2 45 ? -4.535  10.354  3.019   1.00 0.00 ? 339 GLN B CG   5  
ATOM 7886  C CD   . GLN B 2 45 ? -3.898  10.739  4.343   1.00 0.00 ? 339 GLN B CD   5  
ATOM 7887  O OE1  . GLN B 2 45 ? -3.142  11.708  4.423   1.00 0.00 ? 339 GLN B OE1  5  
ATOM 7888  N NE2  . GLN B 2 45 ? -4.197  9.979   5.392   1.00 0.00 ? 339 GLN B NE2  5  
ATOM 7889  H H    . GLN B 2 45 ? -7.117  9.860   3.530   1.00 0.00 ? 339 GLN B H    5  
ATOM 7890  H HA   . GLN B 2 45 ? -6.148  12.467  4.182   1.00 0.00 ? 339 GLN B HA   5  
ATOM 7891  H HB2  . GLN B 2 45 ? -5.832  11.085  1.513   1.00 0.00 ? 339 GLN B HB2  5  
ATOM 7892  H HB3  . GLN B 2 45 ? -4.784  12.302  2.222   1.00 0.00 ? 339 GLN B HB3  5  
ATOM 7893  H HG2  . GLN B 2 45 ? -5.143  9.479   3.171   1.00 0.00 ? 339 GLN B HG2  5  
ATOM 7894  H HG3  . GLN B 2 45 ? -3.752  10.125  2.313   1.00 0.00 ? 339 GLN B HG3  5  
ATOM 7895  H HE21 . GLN B 2 45 ? -4.804  9.220   5.259   1.00 0.00 ? 339 GLN B HE21 5  
ATOM 7896  H HE22 . GLN B 2 45 ? -3.797  10.207  6.258   1.00 0.00 ? 339 GLN B HE22 5  
ATOM 7897  N N    . ARG B 2 46 ? -8.179  12.176  1.579   1.00 0.00 ? 340 ARG B N    5  
ATOM 7898  C CA   . ARG B 2 46 ? -9.146  12.892  0.743   1.00 0.00 ? 340 ARG B CA   5  
ATOM 7899  C C    . ARG B 2 46 ? -10.350 13.337  1.567   1.00 0.00 ? 340 ARG B C    5  
ATOM 7900  O O    . ARG B 2 46 ? -10.867 14.436  1.378   1.00 0.00 ? 340 ARG B O    5  
ATOM 7901  C CB   . ARG B 2 46 ? -9.619  12.021  -0.429  1.00 0.00 ? 340 ARG B CB   5  
ATOM 7902  C CG   . ARG B 2 46 ? -8.578  11.830  -1.522  1.00 0.00 ? 340 ARG B CG   5  
ATOM 7903  C CD   . ARG B 2 46 ? -7.529  10.794  -1.146  1.00 0.00 ? 340 ARG B CD   5  
ATOM 7904  N NE   . ARG B 2 46 ? -8.090  9.444   -1.069  1.00 0.00 ? 340 ARG B NE   5  
ATOM 7905  C CZ   . ARG B 2 46 ? -8.439  8.710   -2.128  1.00 0.00 ? 340 ARG B CZ   5  
ATOM 7906  N NH1  . ARG B 2 46 ? -8.252  9.169   -3.364  1.00 0.00 ? 340 ARG B NH1  5  
ATOM 7907  N NH2  . ARG B 2 46 ? -8.966  7.502   -1.951  1.00 0.00 ? 340 ARG B NH2  5  
ATOM 7908  H H    . ARG B 2 46 ? -8.021  11.220  1.419   1.00 0.00 ? 340 ARG B H    5  
ATOM 7909  H HA   . ARG B 2 46 ? -8.654  13.769  0.350   1.00 0.00 ? 340 ARG B HA   5  
ATOM 7910  H HB2  . ARG B 2 46 ? -9.891  11.048  -0.049  1.00 0.00 ? 340 ARG B HB2  5  
ATOM 7911  H HB3  . ARG B 2 46 ? -10.492 12.479  -0.870  1.00 0.00 ? 340 ARG B HB3  5  
ATOM 7912  H HG2  . ARG B 2 46 ? -9.076  11.509  -2.422  1.00 0.00 ? 340 ARG B HG2  5  
ATOM 7913  H HG3  . ARG B 2 46 ? -8.088  12.774  -1.698  1.00 0.00 ? 340 ARG B HG3  5  
ATOM 7914  H HD2  . ARG B 2 46 ? -6.749  10.804  -1.892  1.00 0.00 ? 340 ARG B HD2  5  
ATOM 7915  H HD3  . ARG B 2 46 ? -7.109  11.055  -0.187  1.00 0.00 ? 340 ARG B HD3  5  
ATOM 7916  H HE   . ARG B 2 46 ? -8.228  9.068   -0.176  1.00 0.00 ? 340 ARG B HE   5  
ATOM 7917  H HH11 . ARG B 2 46 ? -7.847  10.071  -3.510  1.00 0.00 ? 340 ARG B HH11 5  
ATOM 7918  H HH12 . ARG B 2 46 ? -8.516  8.609   -4.150  1.00 0.00 ? 340 ARG B HH12 5  
ATOM 7919  H HH21 . ARG B 2 46 ? -9.100  7.146   -1.025  1.00 0.00 ? 340 ARG B HH21 5  
ATOM 7920  H HH22 . ARG B 2 46 ? -9.227  6.948   -2.742  1.00 0.00 ? 340 ARG B HH22 5  
ATOM 7921  N N    . ASN B 2 47 ? -10.784 12.474  2.485   1.00 0.00 ? 341 ASN B N    5  
ATOM 7922  C CA   . ASN B 2 47 ? -11.926 12.765  3.355   1.00 0.00 ? 341 ASN B CA   5  
ATOM 7923  C C    . ASN B 2 47 ? -11.714 14.078  4.108   1.00 0.00 ? 341 ASN B C    5  
ATOM 7924  O O    . ASN B 2 47 ? -12.592 14.942  4.117   1.00 0.00 ? 341 ASN B O    5  
ATOM 7925  C CB   . ASN B 2 47 ? -12.146 11.620  4.357   1.00 0.00 ? 341 ASN B CB   5  
ATOM 7926  C CG   . ASN B 2 47 ? -12.680 10.332  3.729   1.00 0.00 ? 341 ASN B CG   5  
ATOM 7927  O OD1  . ASN B 2 47 ? -12.834 9.326   4.420   1.00 0.00 ? 341 ASN B OD1  5  
ATOM 7928  N ND2  . ASN B 2 47 ? -12.972 10.345  2.427   1.00 0.00 ? 341 ASN B ND2  5  
ATOM 7929  H H    . ASN B 2 47 ? -10.319 11.615  2.581   1.00 0.00 ? 341 ASN B H    5  
ATOM 7930  H HA   . ASN B 2 47 ? -12.801 12.862  2.731   1.00 0.00 ? 341 ASN B HA   5  
ATOM 7931  H HB2  . ASN B 2 47 ? -11.205 11.391  4.832   1.00 0.00 ? 341 ASN B HB2  5  
ATOM 7932  H HB3  . ASN B 2 47 ? -12.847 11.945  5.111   1.00 0.00 ? 341 ASN B HB3  5  
ATOM 7933  H HD21 . ASN B 2 47 ? -12.835 11.171  1.922   1.00 0.00 ? 341 ASN B HD21 5  
ATOM 7934  H HD22 . ASN B 2 47 ? -13.314 9.519   2.025   1.00 0.00 ? 341 ASN B HD22 5  
ATOM 7935  N N    . ALA B 2 48 ? -10.538 14.228  4.724   1.00 0.00 ? 342 ALA B N    5  
ATOM 7936  C CA   . ALA B 2 48 ? -10.202 15.446  5.463   1.00 0.00 ? 342 ALA B CA   5  
ATOM 7937  C C    . ALA B 2 48 ? -10.355 16.686  4.583   1.00 0.00 ? 342 ALA B C    5  
ATOM 7938  O O    . ALA B 2 48 ? -10.855 17.719  5.033   1.00 0.00 ? 342 ALA B O    5  
ATOM 7939  C CB   . ALA B 2 48 ? -8.788  15.356  6.021   1.00 0.00 ? 342 ALA B CB   5  
ATOM 7940  H H    . ALA B 2 48 ? -9.876  13.506  4.670   1.00 0.00 ? 342 ALA B H    5  
ATOM 7941  H HA   . ALA B 2 48 ? -10.885 15.526  6.294   1.00 0.00 ? 342 ALA B HA   5  
ATOM 7942  H HB1  . ALA B 2 48 ? -8.766  15.773  7.018   1.00 0.00 ? 342 ALA B HB1  5  
ATOM 7943  H HB2  . ALA B 2 48 ? -8.114  15.910  5.386   1.00 0.00 ? 342 ALA B HB2  5  
ATOM 7944  H HB3  . ALA B 2 48 ? -8.478  14.322  6.057   1.00 0.00 ? 342 ALA B HB3  5  
ATOM 7945  N N    . LYS B 2 49 ? -9.922  16.572  3.324   1.00 0.00 ? 343 LYS B N    5  
ATOM 7946  C CA   . LYS B 2 49 ? -10.006 17.676  2.370   1.00 0.00 ? 343 LYS B CA   5  
ATOM 7947  C C    . LYS B 2 49 ? -11.455 17.937  1.953   1.00 0.00 ? 343 LYS B C    5  
ATOM 7948  O O    . LYS B 2 49 ? -11.894 19.087  1.902   1.00 0.00 ? 343 LYS B O    5  
ATOM 7949  C CB   . LYS B 2 49 ? -9.151  17.368  1.136   1.00 0.00 ? 343 LYS B CB   5  
ATOM 7950  C CG   . LYS B 2 49 ? -9.120  18.492  0.112   1.00 0.00 ? 343 LYS B CG   5  
ATOM 7951  C CD   . LYS B 2 49 ? -8.593  19.789  0.712   1.00 0.00 ? 343 LYS B CD   5  
ATOM 7952  C CE   . LYS B 2 49 ? -7.183  19.629  1.266   1.00 0.00 ? 343 LYS B CE   5  
ATOM 7953  N NZ   . LYS B 2 49 ? -6.206  19.232  0.212   1.00 0.00 ? 343 LYS B NZ   5  
ATOM 7954  H H    . LYS B 2 49 ? -9.534  15.721  3.030   1.00 0.00 ? 343 LYS B H    5  
ATOM 7955  H HA   . LYS B 2 49 ? -9.618  18.561  2.852   1.00 0.00 ? 343 LYS B HA   5  
ATOM 7956  H HB2  . LYS B 2 49 ? -8.137  17.174  1.455   1.00 0.00 ? 343 LYS B HB2  5  
ATOM 7957  H HB3  . LYS B 2 49 ? -9.541  16.483  0.656   1.00 0.00 ? 343 LYS B HB3  5  
ATOM 7958  H HG2  . LYS B 2 49 ? -8.480  18.201  -0.708  1.00 0.00 ? 343 LYS B HG2  5  
ATOM 7959  H HG3  . LYS B 2 49 ? -10.124 18.656  -0.254  1.00 0.00 ? 343 LYS B HG3  5  
ATOM 7960  H HD2  . LYS B 2 49 ? -8.582  20.550  -0.054  1.00 0.00 ? 343 LYS B HD2  5  
ATOM 7961  H HD3  . LYS B 2 49 ? -9.251  20.094  1.512   1.00 0.00 ? 343 LYS B HD3  5  
ATOM 7962  H HE2  . LYS B 2 49 ? -6.871  20.568  1.696   1.00 0.00 ? 343 LYS B HE2  5  
ATOM 7963  H HE3  . LYS B 2 49 ? -7.196  18.870  2.035   1.00 0.00 ? 343 LYS B HE3  5  
ATOM 7964  H HZ1  . LYS B 2 49 ? -5.237  19.298  0.583   1.00 0.00 ? 343 LYS B HZ1  5  
ATOM 7965  H HZ2  . LYS B 2 49 ? -6.293  19.860  -0.612  1.00 0.00 ? 343 LYS B HZ2  5  
ATOM 7966  H HZ3  . LYS B 2 49 ? -6.385  18.254  -0.091  1.00 0.00 ? 343 LYS B HZ3  5  
ATOM 7967  N N    . GLU B 2 50 ? -12.189 16.859  1.656   1.00 0.00 ? 344 GLU B N    5  
ATOM 7968  C CA   . GLU B 2 50 ? -13.593 16.960  1.244   1.00 0.00 ? 344 GLU B CA   5  
ATOM 7969  C C    . GLU B 2 50 ? -14.413 17.770  2.248   1.00 0.00 ? 344 GLU B C    5  
ATOM 7970  O O    . GLU B 2 50 ? -15.235 18.602  1.856   1.00 0.00 ? 344 GLU B O    5  
ATOM 7971  C CB   . GLU B 2 50 ? -14.202 15.565  1.082   1.00 0.00 ? 344 GLU B CB   5  
ATOM 7972  C CG   . GLU B 2 50 ? -13.609 14.765  -0.072  1.00 0.00 ? 344 GLU B CG   5  
ATOM 7973  C CD   . GLU B 2 50 ? -14.119 13.332  -0.142  1.00 0.00 ? 344 GLU B CD   5  
ATOM 7974  O OE1  . GLU B 2 50 ? -14.946 12.940  0.711   1.00 0.00 ? 344 GLU B OE1  5  
ATOM 7975  O OE2  . GLU B 2 50 ? -13.688 12.598  -1.056  1.00 0.00 ? 344 GLU B OE2  5  
ATOM 7976  H H    . GLU B 2 50 ? -11.776 15.973  1.717   1.00 0.00 ? 344 GLU B H    5  
ATOM 7977  H HA   . GLU B 2 50 ? -13.618 17.464  0.290   1.00 0.00 ? 344 GLU B HA   5  
ATOM 7978  H HB2  . GLU B 2 50 ? -14.046 15.007  1.994   1.00 0.00 ? 344 GLU B HB2  5  
ATOM 7979  H HB3  . GLU B 2 50 ? -15.265 15.665  0.912   1.00 0.00 ? 344 GLU B HB3  5  
ATOM 7980  H HG2  . GLU B 2 50 ? -13.860 15.261  -0.999  1.00 0.00 ? 344 GLU B HG2  5  
ATOM 7981  H HG3  . GLU B 2 50 ? -12.537 14.743  0.038   1.00 0.00 ? 344 GLU B HG3  5  
ATOM 7982  N N    . ALA B 2 51 ? -14.184 17.528  3.542   1.00 0.00 ? 345 ALA B N    5  
ATOM 7983  C CA   . ALA B 2 51 ? -14.902 18.244  4.597   1.00 0.00 ? 345 ALA B CA   5  
ATOM 7984  C C    . ALA B 2 51 ? -14.584 19.739  4.561   1.00 0.00 ? 345 ALA B C    5  
ATOM 7985  O O    . ALA B 2 51 ? -15.482 20.573  4.690   1.00 0.00 ? 345 ALA B O    5  
ATOM 7986  C CB   . ALA B 2 51 ? -14.560 17.661  5.962   1.00 0.00 ? 345 ALA B CB   5  
ATOM 7987  H H    . ALA B 2 51 ? -13.515 16.857  3.792   1.00 0.00 ? 345 ALA B H    5  
ATOM 7988  H HA   . ALA B 2 51 ? -15.960 18.108  4.428   1.00 0.00 ? 345 ALA B HA   5  
ATOM 7989  H HB1  . ALA B 2 51 ? -14.692 18.420  6.720   1.00 0.00 ? 345 ALA B HB1  5  
ATOM 7990  H HB2  . ALA B 2 51 ? -13.534 17.325  5.965   1.00 0.00 ? 345 ALA B HB2  5  
ATOM 7991  H HB3  . ALA B 2 51 ? -15.214 16.827  6.171   1.00 0.00 ? 345 ALA B HB3  5  
ATOM 7992  N N    . GLY B 2 52 ? -13.302 20.067  4.377   1.00 0.00 ? 346 GLY B N    5  
ATOM 7993  C CA   . GLY B 2 52 ? -12.882 21.460  4.319   1.00 0.00 ? 346 GLY B CA   5  
ATOM 7994  C C    . GLY B 2 52 ? -12.978 22.181  5.656   1.00 0.00 ? 346 GLY B C    5  
ATOM 7995  O O    . GLY B 2 52 ? -12.975 23.412  5.695   1.00 0.00 ? 346 GLY B O    5  
ATOM 7996  H H    . GLY B 2 52 ? -12.634 19.356  4.277   1.00 0.00 ? 346 GLY B H    5  
ATOM 7997  H HA2  . GLY B 2 52 ? -11.857 21.498  3.980   1.00 0.00 ? 346 GLY B HA2  5  
ATOM 7998  H HA3  . GLY B 2 52 ? -13.502 21.978  3.600   1.00 0.00 ? 346 GLY B HA3  5  
ATOM 7999  N N    . GLY B 2 53 ? -13.062 21.422  6.752   1.00 0.00 ? 347 GLY B N    5  
ATOM 8000  C CA   . GLY B 2 53 ? -13.154 22.024  8.070   1.00 0.00 ? 347 GLY B CA   5  
ATOM 8001  C C    . GLY B 2 53 ? -12.214 21.375  9.067   1.00 0.00 ? 347 GLY B C    5  
ATOM 8002  O O    . GLY B 2 53 ? -11.086 21.016  8.724   1.00 0.00 ? 347 GLY B O    5  
ATOM 8003  H H    . GLY B 2 53 ? -13.059 20.447  6.668   1.00 0.00 ? 347 GLY B H    5  
ATOM 8004  H HA2  . GLY B 2 53 ? -12.914 23.074  7.995   1.00 0.00 ? 347 GLY B HA2  5  
ATOM 8005  H HA3  . GLY B 2 53 ? -14.168 21.923  8.430   1.00 0.00 ? 347 GLY B HA3  5  
ATOM 8006  N N    . ASN B 2 54 ? -12.680 21.225  10.305  1.00 0.00 ? 348 ASN B N    5  
ATOM 8007  C CA   . ASN B 2 54 ? -11.881 20.611  11.368  1.00 0.00 ? 348 ASN B CA   5  
ATOM 8008  C C    . ASN B 2 54 ? -11.969 19.076  11.339  1.00 0.00 ? 348 ASN B C    5  
ATOM 8009  O O    . ASN B 2 54 ? -11.905 18.429  12.387  1.00 0.00 ? 348 ASN B O    5  
ATOM 8010  C CB   . ASN B 2 54 ? -12.326 21.139  12.736  1.00 0.00 ? 348 ASN B CB   5  
ATOM 8011  C CG   . ASN B 2 54 ? -12.151 22.643  12.865  1.00 0.00 ? 348 ASN B CG   5  
ATOM 8012  O OD1  . ASN B 2 54 ? -11.040 23.159  12.757  1.00 0.00 ? 348 ASN B OD1  5  
ATOM 8013  N ND2  . ASN B 2 54 ? -13.251 23.352  13.095  1.00 0.00 ? 348 ASN B ND2  5  
ATOM 8014  H H    . ASN B 2 54 ? -13.589 21.529  10.509  1.00 0.00 ? 348 ASN B H    5  
ATOM 8015  H HA   . ASN B 2 54 ? -10.852 20.897  11.207  1.00 0.00 ? 348 ASN B HA   5  
ATOM 8016  H HB2  . ASN B 2 54 ? -13.370 20.904  12.883  1.00 0.00 ? 348 ASN B HB2  5  
ATOM 8017  H HB3  . ASN B 2 54 ? -11.742 20.660  13.507  1.00 0.00 ? 348 ASN B HB3  5  
ATOM 8018  H HD21 . ASN B 2 54 ? -14.105 22.877  13.169  1.00 0.00 ? 348 ASN B HD21 5  
ATOM 8019  H HD22 . ASN B 2 54 ? -13.164 24.324  13.181  1.00 0.00 ? 348 ASN B HD22 5  
ATOM 8020  N N    . TYR B 2 55 ? -12.109 18.497  10.143  1.00 0.00 ? 349 TYR B N    5  
ATOM 8021  C CA   . TYR B 2 55 ? -12.201 17.047  10.000  1.00 0.00 ? 349 TYR B CA   5  
ATOM 8022  C C    . TYR B 2 55 ? -10.825 16.394  10.097  1.00 0.00 ? 349 TYR B C    5  
ATOM 8023  O O    . TYR B 2 55 ? -9.969  16.598  9.232   1.00 0.00 ? 349 TYR B O    5  
ATOM 8024  C CB   . TYR B 2 55 ? -12.861 16.673  8.666   1.00 0.00 ? 349 TYR B CB   5  
ATOM 8025  C CG   . TYR B 2 55 ? -12.888 15.179  8.384   1.00 0.00 ? 349 TYR B CG   5  
ATOM 8026  C CD1  . TYR B 2 55 ? -11.716 14.474  8.134   1.00 0.00 ? 349 TYR B CD1  5  
ATOM 8027  C CD2  . TYR B 2 55 ? -14.085 14.478  8.376   1.00 0.00 ? 349 TYR B CD2  5  
ATOM 8028  C CE1  . TYR B 2 55 ? -11.732 13.118  7.879   1.00 0.00 ? 349 TYR B CE1  5  
ATOM 8029  C CE2  . TYR B 2 55 ? -14.113 13.119  8.122   1.00 0.00 ? 349 TYR B CE2  5  
ATOM 8030  C CZ   . TYR B 2 55 ? -12.934 12.444  7.874   1.00 0.00 ? 349 TYR B CZ   5  
ATOM 8031  O OH   . TYR B 2 55 ? -12.960 11.092  7.619   1.00 0.00 ? 349 TYR B OH   5  
ATOM 8032  H H    . TYR B 2 55 ? -12.149 19.054  9.340   1.00 0.00 ? 349 TYR B H    5  
ATOM 8033  H HA   . TYR B 2 55 ? -12.816 16.674  10.805  1.00 0.00 ? 349 TYR B HA   5  
ATOM 8034  H HB2  . TYR B 2 55 ? -13.881 17.027  8.667   1.00 0.00 ? 349 TYR B HB2  5  
ATOM 8035  H HB3  . TYR B 2 55 ? -12.322 17.152  7.861   1.00 0.00 ? 349 TYR B HB3  5  
ATOM 8036  H HD1  . TYR B 2 55 ? -10.777 15.003  8.137   1.00 0.00 ? 349 TYR B HD1  5  
ATOM 8037  H HD2  . TYR B 2 55 ? -15.005 15.009  8.571   1.00 0.00 ? 349 TYR B HD2  5  
ATOM 8038  H HE1  . TYR B 2 55 ? -10.803 12.594  7.687   1.00 0.00 ? 349 TYR B HE1  5  
ATOM 8039  H HE2  . TYR B 2 55 ? -15.057 12.591  8.117   1.00 0.00 ? 349 TYR B HE2  5  
ATOM 8040  H HH   . TYR B 2 55 ? -13.362 10.631  8.361   1.00 0.00 ? 349 TYR B HH   5  
ATOM 8041  N N    . THR B 2 56 ? -10.631 15.592  11.141  1.00 0.00 ? 350 THR B N    5  
ATOM 8042  C CA   . THR B 2 56 ? -9.375  14.881  11.327  1.00 0.00 ? 350 THR B CA   5  
ATOM 8043  C C    . THR B 2 56 ? -9.503  13.461  10.767  1.00 0.00 ? 350 THR B C    5  
ATOM 8044  O O    . THR B 2 56 ? -10.537 12.810  10.936  1.00 0.00 ? 350 THR B O    5  
ATOM 8045  C CB   . THR B 2 56 ? -8.972  14.852  12.798  1.00 0.00 ? 350 THR B CB   5  
ATOM 8046  O OG1  . THR B 2 56 ? -7.568  14.690  12.933  1.00 0.00 ? 350 THR B OG1  5  
ATOM 8047  C CG2  . THR B 2 56 ? -9.624  13.733  13.550  1.00 0.00 ? 350 THR B CG2  5  
ATOM 8048  H H    . THR B 2 56 ? -11.358 15.456  11.784  1.00 0.00 ? 350 THR B H    5  
ATOM 8049  H HA   . THR B 2 56 ? -8.621  15.395  10.778  1.00 0.00 ? 350 THR B HA   5  
ATOM 8050  H HB   . THR B 2 56 ? -9.258  15.783  13.265  1.00 0.00 ? 350 THR B HB   5  
ATOM 8051  H HG1  . THR B 2 56 ? -7.306  13.835  12.581  1.00 0.00 ? 350 THR B HG1  5  
ATOM 8052  H HG21 . THR B 2 56 ? -9.393  13.817  14.599  1.00 0.00 ? 350 THR B HG21 5  
ATOM 8053  H HG22 . THR B 2 56 ? -9.249  12.799  13.165  1.00 0.00 ? 350 THR B HG22 5  
ATOM 8054  H HG23 . THR B 2 56 ? -10.689 13.784  13.403  1.00 0.00 ? 350 THR B HG23 5  
ATOM 8055  N N    . PRO B 2 57 ? -8.463  12.964  10.078  1.00 0.00 ? 351 PRO B N    5  
ATOM 8056  C CA   . PRO B 2 57 ? -8.468  11.620  9.481   1.00 0.00 ? 351 PRO B CA   5  
ATOM 8057  C C    . PRO B 2 57 ? -8.458  10.508  10.530  1.00 0.00 ? 351 PRO B C    5  
ATOM 8058  O O    . PRO B 2 57 ? -7.915  10.678  11.624  1.00 0.00 ? 351 PRO B O    5  
ATOM 8059  C CB   . PRO B 2 57 ? -7.178  11.594  8.644   1.00 0.00 ? 351 PRO B CB   5  
ATOM 8060  C CG   . PRO B 2 57 ? -6.753  13.018  8.540   1.00 0.00 ? 351 PRO B CG   5  
ATOM 8061  C CD   . PRO B 2 57 ? -7.205  13.664  9.812   1.00 0.00 ? 351 PRO B CD   5  
ATOM 8062  H HA   . PRO B 2 57 ? -9.320  11.487  8.831   1.00 0.00 ? 351 PRO B HA   5  
ATOM 8063  H HB2  . PRO B 2 57 ? -6.432  10.994  9.144   1.00 0.00 ? 351 PRO B HB2  5  
ATOM 8064  H HB3  . PRO B 2 57 ? -7.388  11.178  7.671   1.00 0.00 ? 351 PRO B HB3  5  
ATOM 8065  H HG2  . PRO B 2 57 ? -5.679  13.080  8.444   1.00 0.00 ? 351 PRO B HG2  5  
ATOM 8066  H HG3  . PRO B 2 57 ? -7.239  13.483  7.692   1.00 0.00 ? 351 PRO B HG3  5  
ATOM 8067  H HD2  . PRO B 2 57 ? -6.491  13.493  10.606  1.00 0.00 ? 351 PRO B HD2  5  
ATOM 8068  H HD3  . PRO B 2 57 ? -7.373  14.720  9.667   1.00 0.00 ? 351 PRO B HD3  5  
ATOM 8069  N N    . ALA B 2 58 ? -9.071  9.373   10.189  1.00 0.00 ? 352 ALA B N    5  
ATOM 8070  C CA   . ALA B 2 58 ? -9.149  8.225   11.097  1.00 0.00 ? 352 ALA B CA   5  
ATOM 8071  C C    . ALA B 2 58 ? -7.981  7.245   10.908  1.00 0.00 ? 352 ALA B C    5  
ATOM 8072  O O    . ALA B 2 58 ? -7.988  6.156   11.483  1.00 0.00 ? 352 ALA B O    5  
ATOM 8073  C CB   . ALA B 2 58 ? -10.477 7.503   10.917  1.00 0.00 ? 352 ALA B CB   5  
ATOM 8074  H H    . ALA B 2 58 ? -9.487  9.308   9.306   1.00 0.00 ? 352 ALA B H    5  
ATOM 8075  H HA   . ALA B 2 58 ? -9.116  8.605   12.108  1.00 0.00 ? 352 ALA B HA   5  
ATOM 8076  H HB1  . ALA B 2 58 ? -10.368 6.730   10.172  1.00 0.00 ? 352 ALA B HB1  5  
ATOM 8077  H HB2  . ALA B 2 58 ? -11.229 8.209   10.596  1.00 0.00 ? 352 ALA B HB2  5  
ATOM 8078  H HB3  . ALA B 2 58 ? -10.776 7.061   11.856  1.00 0.00 ? 352 ALA B HB3  5  
ATOM 8079  N N    . LEU B 2 59 ? -6.972  7.644   10.126  1.00 0.00 ? 353 LEU B N    5  
ATOM 8080  C CA   . LEU B 2 59 ? -5.793  6.817   9.880   1.00 0.00 ? 353 LEU B CA   5  
ATOM 8081  C C    . LEU B 2 59 ? -4.599  7.676   9.508   1.00 0.00 ? 353 LEU B C    5  
ATOM 8082  O O    . LEU B 2 59 ? -4.736  8.825   9.081   1.00 0.00 ? 353 LEU B O    5  
ATOM 8083  C CB   . LEU B 2 59 ? -5.996  5.825   8.726   1.00 0.00 ? 353 LEU B CB   5  
ATOM 8084  C CG   . LEU B 2 59 ? -6.096  4.353   9.109   1.00 0.00 ? 353 LEU B CG   5  
ATOM 8085  C CD1  . LEU B 2 59 ? -7.387  4.049   9.856   1.00 0.00 ? 353 LEU B CD1  5  
ATOM 8086  C CD2  . LEU B 2 59 ? -5.946  3.471   7.879   1.00 0.00 ? 353 LEU B CD2  5  
ATOM 8087  H H    . LEU B 2 59 ? -7.013  8.522   9.715   1.00 0.00 ? 353 LEU B H    5  
ATOM 8088  H HA   . LEU B 2 59 ? -5.570  6.271   10.782  1.00 0.00 ? 353 LEU B HA   5  
ATOM 8089  H HB2  . LEU B 2 59 ? -6.881  6.101   8.180   1.00 0.00 ? 353 LEU B HB2  5  
ATOM 8090  H HB3  . LEU B 2 59 ? -5.137  5.925   8.071   1.00 0.00 ? 353 LEU B HB3  5  
ATOM 8091  H HG   . LEU B 2 59 ? -5.284  4.125   9.757   1.00 0.00 ? 353 LEU B HG   5  
ATOM 8092  H HD11 . LEU B 2 59 ? -7.711  3.045   9.622   1.00 0.00 ? 353 LEU B HD11 5  
ATOM 8093  H HD12 . LEU B 2 59 ? -8.150  4.752   9.558   1.00 0.00 ? 353 LEU B HD12 5  
ATOM 8094  H HD13 . LEU B 2 59 ? -7.214  4.132   10.918  1.00 0.00 ? 353 LEU B HD13 5  
ATOM 8095  H HD21 . LEU B 2 59 ? -6.446  2.530   8.046   1.00 0.00 ? 353 LEU B HD21 5  
ATOM 8096  H HD22 . LEU B 2 59 ? -4.898  3.293   7.689   1.00 0.00 ? 353 LEU B HD22 5  
ATOM 8097  H HD23 . LEU B 2 59 ? -6.385  3.966   7.027   1.00 0.00 ? 353 LEU B HD23 5  
ATOM 8098  N N    . THR B 2 60 ? -3.435  7.073   9.646   1.00 0.00 ? 354 THR B N    5  
ATOM 8099  C CA   . THR B 2 60 ? -2.172  7.700   9.311   1.00 0.00 ? 354 THR B CA   5  
ATOM 8100  C C    . THR B 2 60 ? -1.171  6.603   8.981   1.00 0.00 ? 354 THR B C    5  
ATOM 8101  O O    . THR B 2 60 ? -1.514  5.419   9.025   1.00 0.00 ? 354 THR B O    5  
ATOM 8102  C CB   . THR B 2 60 ? -1.656  8.560   10.479  1.00 0.00 ? 354 THR B CB   5  
ATOM 8103  O OG1  . THR B 2 60 ? -1.533  7.797   11.672  1.00 0.00 ? 354 THR B OG1  5  
ATOM 8104  C CG2  . THR B 2 60 ? -2.538  9.751   10.787  1.00 0.00 ? 354 THR B CG2  5  
ATOM 8105  H H    . THR B 2 60 ? -3.424  6.146   9.968   1.00 0.00 ? 354 THR B H    5  
ATOM 8106  H HA   . THR B 2 60 ? -2.320  8.321   8.440   1.00 0.00 ? 354 THR B HA   5  
ATOM 8107  H HB   . THR B 2 60 ? -0.677  8.938   10.221  1.00 0.00 ? 354 THR B HB   5  
ATOM 8108  H HG1  . THR B 2 60 ? -1.590  6.861   11.471  1.00 0.00 ? 354 THR B HG1  5  
ATOM 8109  H HG21 . THR B 2 60 ? -1.994  10.453  11.403  1.00 0.00 ? 354 THR B HG21 5  
ATOM 8110  H HG22 . THR B 2 60 ? -3.420  9.419   11.314  1.00 0.00 ? 354 THR B HG22 5  
ATOM 8111  H HG23 . THR B 2 60 ? -2.829  10.233  9.865   1.00 0.00 ? 354 THR B HG23 5  
ATOM 8112  N N    . GLU B 2 61 ? 0.062   6.978   8.679   1.00 0.00 ? 355 GLU B N    5  
ATOM 8113  C CA   . GLU B 2 61 ? 1.090   5.988   8.389   1.00 0.00 ? 355 GLU B CA   5  
ATOM 8114  C C    . GLU B 2 61 ? 1.172   4.973   9.533   1.00 0.00 ? 355 GLU B C    5  
ATOM 8115  O O    . GLU B 2 61 ? 1.536   3.814   9.325   1.00 0.00 ? 355 GLU B O    5  
ATOM 8116  C CB   . GLU B 2 61 ? 2.431   6.676   8.190   1.00 0.00 ? 355 GLU B CB   5  
ATOM 8117  C CG   . GLU B 2 61 ? 2.616   7.278   6.812   1.00 0.00 ? 355 GLU B CG   5  
ATOM 8118  C CD   . GLU B 2 61 ? 3.891   8.085   6.714   1.00 0.00 ? 355 GLU B CD   5  
ATOM 8119  O OE1  . GLU B 2 61 ? 3.898   9.251   7.162   1.00 0.00 ? 355 GLU B OE1  5  
ATOM 8120  O OE2  . GLU B 2 61 ? 4.894   7.536   6.225   1.00 0.00 ? 355 GLU B OE2  5  
ATOM 8121  H H    . GLU B 2 61 ? 0.292   7.931   8.677   1.00 0.00 ? 355 GLU B H    5  
ATOM 8122  H HA   . GLU B 2 61 ? 0.814   5.474   7.479   1.00 0.00 ? 355 GLU B HA   5  
ATOM 8123  H HB2  . GLU B 2 61 ? 2.513   7.471   8.912   1.00 0.00 ? 355 GLU B HB2  5  
ATOM 8124  H HB3  . GLU B 2 61 ? 3.222   5.961   8.359   1.00 0.00 ? 355 GLU B HB3  5  
ATOM 8125  H HG2  . GLU B 2 61 ? 2.651   6.481   6.085   1.00 0.00 ? 355 GLU B HG2  5  
ATOM 8126  H HG3  . GLU B 2 61 ? 1.778   7.927   6.599   1.00 0.00 ? 355 GLU B HG3  5  
ATOM 8127  N N    . GLN B 2 62 ? 0.807   5.427   10.739  1.00 0.00 ? 356 GLN B N    5  
ATOM 8128  C CA   . GLN B 2 62 ? 0.805   4.581   11.928  1.00 0.00 ? 356 GLN B CA   5  
ATOM 8129  C C    . GLN B 2 62 ? -0.189  3.429   11.780  1.00 0.00 ? 356 GLN B C    5  
ATOM 8130  O O    . GLN B 2 62 ? 0.130   2.292   12.122  1.00 0.00 ? 356 GLN B O    5  
ATOM 8131  C CB   . GLN B 2 62 ? 0.462   5.406   13.171  1.00 0.00 ? 356 GLN B CB   5  
ATOM 8132  C CG   . GLN B 2 62 ? 1.442   6.539   13.440  1.00 0.00 ? 356 GLN B CG   5  
ATOM 8133  C CD   . GLN B 2 62 ? 1.076   7.349   14.669  1.00 0.00 ? 356 GLN B CD   5  
ATOM 8134  O OE1  . GLN B 2 62 ? 1.036   6.824   15.783  1.00 0.00 ? 356 GLN B OE1  5  
ATOM 8135  N NE2  . GLN B 2 62 ? 0.801   8.635   14.475  1.00 0.00 ? 356 GLN B NE2  5  
ATOM 8136  H H    . GLN B 2 62 ? 0.514   6.355   10.826  1.00 0.00 ? 356 GLN B H    5  
ATOM 8137  H HA   . GLN B 2 62 ? 1.796   4.170   12.042  1.00 0.00 ? 356 GLN B HA   5  
ATOM 8138  H HB2  . GLN B 2 62 ? -0.522  5.833   13.045  1.00 0.00 ? 356 GLN B HB2  5  
ATOM 8139  H HB3  . GLN B 2 62 ? 0.455   4.754   14.032  1.00 0.00 ? 356 GLN B HB3  5  
ATOM 8140  H HG2  . GLN B 2 62 ? 2.426   6.120   13.585  1.00 0.00 ? 356 GLN B HG2  5  
ATOM 8141  H HG3  . GLN B 2 62 ? 1.453   7.197   12.583  1.00 0.00 ? 356 GLN B HG3  5  
ATOM 8142  H HE21 . GLN B 2 62 ? 0.851   8.988   13.561  1.00 0.00 ? 356 GLN B HE21 5  
ATOM 8143  H HE22 . GLN B 2 62 ? 0.563   9.180   15.254  1.00 0.00 ? 356 GLN B HE22 5  
ATOM 8144  N N    . GLU B 2 63 ? -1.391  3.719   11.255  1.00 0.00 ? 357 GLU B N    5  
ATOM 8145  C CA   . GLU B 2 63 ? -2.403  2.688   11.060  1.00 0.00 ? 357 GLU B CA   5  
ATOM 8146  C C    . GLU B 2 63 ? -1.995  1.756   9.925   1.00 0.00 ? 357 GLU B C    5  
ATOM 8147  O O    . GLU B 2 63 ? -2.220  0.546   9.978   1.00 0.00 ? 357 GLU B O    5  
ATOM 8148  C CB   . GLU B 2 63 ? -3.744  3.322   10.690  1.00 0.00 ? 357 GLU B CB   5  
ATOM 8149  C CG   . GLU B 2 63 ? -4.526  3.989   11.823  1.00 0.00 ? 357 GLU B CG   5  
ATOM 8150  C CD   . GLU B 2 63 ? -3.710  4.976   12.642  1.00 0.00 ? 357 GLU B CD   5  
ATOM 8151  O OE1  . GLU B 2 63 ? -2.850  4.531   13.434  1.00 0.00 ? 357 GLU B OE1  5  
ATOM 8152  O OE2  . GLU B 2 63 ? -3.928  6.196   12.491  1.00 0.00 ? 357 GLU B OE2  5  
ATOM 8153  H H    . GLU B 2 63 ? -1.600  4.647   10.979  1.00 0.00 ? 357 GLU B H    5  
ATOM 8154  H HA   . GLU B 2 63 ? -2.507  2.124   11.974  1.00 0.00 ? 357 GLU B HA   5  
ATOM 8155  H HB2  . GLU B 2 63 ? -3.564  4.070   9.936   1.00 0.00 ? 357 GLU B HB2  5  
ATOM 8156  H HB3  . GLU B 2 63 ? -4.373  2.553   10.263  1.00 0.00 ? 357 GLU B HB3  5  
ATOM 8157  H HG2  . GLU B 2 63 ? -5.368  4.524   11.382  1.00 0.00 ? 357 GLU B HG2  5  
ATOM 8158  H HG3  . GLU B 2 63 ? -4.906  3.218   12.479  1.00 0.00 ? 357 GLU B HG3  5  
ATOM 8159  N N    . VAL B 2 64 ? -1.428  2.353   8.880   1.00 0.00 ? 358 VAL B N    5  
ATOM 8160  C CA   . VAL B 2 64 ? -1.013  1.622   7.688   1.00 0.00 ? 358 VAL B CA   5  
ATOM 8161  C C    . VAL B 2 64 ? 0.070   0.592   7.991   1.00 0.00 ? 358 VAL B C    5  
ATOM 8162  O O    . VAL B 2 64 ? -0.148  -0.609  7.829   1.00 0.00 ? 358 VAL B O    5  
ATOM 8163  C CB   . VAL B 2 64 ? -0.497  2.618   6.630   1.00 0.00 ? 358 VAL B CB   5  
ATOM 8164  C CG1  . VAL B 2 64 ? -0.136  1.922   5.325   1.00 0.00 ? 358 VAL B CG1  5  
ATOM 8165  C CG2  . VAL B 2 64 ? -1.530  3.708   6.403   1.00 0.00 ? 358 VAL B CG2  5  
ATOM 8166  H H    . VAL B 2 64 ? -1.305  3.327   8.902   1.00 0.00 ? 358 VAL B H    5  
ATOM 8167  H HA   . VAL B 2 64 ? -1.877  1.119   7.286   1.00 0.00 ? 358 VAL B HA   5  
ATOM 8168  H HB   . VAL B 2 64 ? 0.397   3.085   7.015   1.00 0.00 ? 358 VAL B HB   5  
ATOM 8169  H HG11 . VAL B 2 64 ? -0.953  2.020   4.628   1.00 0.00 ? 358 VAL B HG11 5  
ATOM 8170  H HG12 . VAL B 2 64 ? 0.056   0.876   5.513   1.00 0.00 ? 358 VAL B HG12 5  
ATOM 8171  H HG13 . VAL B 2 64 ? 0.752   2.382   4.907   1.00 0.00 ? 358 VAL B HG13 5  
ATOM 8172  H HG21 . VAL B 2 64 ? -1.975  3.585   5.428   1.00 0.00 ? 358 VAL B HG21 5  
ATOM 8173  H HG22 . VAL B 2 64 ? -1.052  4.673   6.465   1.00 0.00 ? 358 VAL B HG22 5  
ATOM 8174  H HG23 . VAL B 2 64 ? -2.303  3.638   7.164   1.00 0.00 ? 358 VAL B HG23 5  
ATOM 8175  N N    . TYR B 2 65 ? 1.229   1.059   8.445   1.00 0.00 ? 359 TYR B N    5  
ATOM 8176  C CA   . TYR B 2 65 ? 2.334   0.168   8.781   1.00 0.00 ? 359 TYR B CA   5  
ATOM 8177  C C    . TYR B 2 65 ? 1.952   -0.816  9.890   1.00 0.00 ? 359 TYR B C    5  
ATOM 8178  O O    . TYR B 2 65 ? 2.442   -1.945  9.924   1.00 0.00 ? 359 TYR B O    5  
ATOM 8179  C CB   . TYR B 2 65 ? 3.572   0.978   9.182   1.00 0.00 ? 359 TYR B CB   5  
ATOM 8180  C CG   . TYR B 2 65 ? 4.799   0.128   9.430   1.00 0.00 ? 359 TYR B CG   5  
ATOM 8181  C CD1  . TYR B 2 65 ? 4.915   -0.646  10.580  1.00 0.00 ? 359 TYR B CD1  5  
ATOM 8182  C CD2  . TYR B 2 65 ? 5.835   0.088   8.505   1.00 0.00 ? 359 TYR B CD2  5  
ATOM 8183  C CE1  . TYR B 2 65 ? 6.029   -1.433  10.799  1.00 0.00 ? 359 TYR B CE1  5  
ATOM 8184  C CE2  . TYR B 2 65 ? 6.953   -0.697  8.719   1.00 0.00 ? 359 TYR B CE2  5  
ATOM 8185  C CZ   . TYR B 2 65 ? 7.045   -1.455  9.865   1.00 0.00 ? 359 TYR B CZ   5  
ATOM 8186  O OH   . TYR B 2 65 ? 8.155   -2.240  10.079  1.00 0.00 ? 359 TYR B OH   5  
ATOM 8187  H H    . TYR B 2 65 ? 1.341   2.026   8.566   1.00 0.00 ? 359 TYR B H    5  
ATOM 8188  H HA   . TYR B 2 65 ? 2.570   -0.401  7.893   1.00 0.00 ? 359 TYR B HA   5  
ATOM 8189  H HB2  . TYR B 2 65 ? 3.805   1.675   8.392   1.00 0.00 ? 359 TYR B HB2  5  
ATOM 8190  H HB3  . TYR B 2 65 ? 3.357   1.526   10.085  1.00 0.00 ? 359 TYR B HB3  5  
ATOM 8191  H HD1  . TYR B 2 65 ? 4.119   -0.623  11.310  1.00 0.00 ? 359 TYR B HD1  5  
ATOM 8192  H HD2  . TYR B 2 65 ? 5.761   0.685   7.606   1.00 0.00 ? 359 TYR B HD2  5  
ATOM 8193  H HE1  . TYR B 2 65 ? 6.101   -2.028  11.697  1.00 0.00 ? 359 TYR B HE1  5  
ATOM 8194  H HE2  . TYR B 2 65 ? 7.748   -0.714  7.986   1.00 0.00 ? 359 TYR B HE2  5  
ATOM 8195  H HH   . TYR B 2 65 ? 8.790   -1.758  10.615  1.00 0.00 ? 359 TYR B HH   5  
ATOM 8196  N N    . ALA B 2 66 ? 1.087   -0.370  10.805  1.00 0.00 ? 360 ALA B N    5  
ATOM 8197  C CA   . ALA B 2 66 ? 0.656   -1.200  11.934  1.00 0.00 ? 360 ALA B CA   5  
ATOM 8198  C C    . ALA B 2 66 ? -0.058  -2.478  11.492  1.00 0.00 ? 360 ALA B C    5  
ATOM 8199  O O    . ALA B 2 66 ? 0.352   -3.579  11.867  1.00 0.00 ? 360 ALA B O    5  
ATOM 8200  C CB   . ALA B 2 66 ? -0.236  -0.398  12.869  1.00 0.00 ? 360 ALA B CB   5  
ATOM 8201  H H    . ALA B 2 66 ? 0.740   0.547   10.725  1.00 0.00 ? 360 ALA B H    5  
ATOM 8202  H HA   . ALA B 2 66 ? 1.542   -1.478  12.486  1.00 0.00 ? 360 ALA B HA   5  
ATOM 8203  H HB1  . ALA B 2 66 ? 0.373   0.282   13.447  1.00 0.00 ? 360 ALA B HB1  5  
ATOM 8204  H HB2  . ALA B 2 66 ? -0.756  -1.068  13.535  1.00 0.00 ? 360 ALA B HB2  5  
ATOM 8205  H HB3  . ALA B 2 66 ? -0.953  0.165   12.290  1.00 0.00 ? 360 ALA B HB3  5  
ATOM 8206  N N    . GLN B 2 67 ? -1.130  -2.334  10.711  1.00 0.00 ? 361 GLN B N    5  
ATOM 8207  C CA   . GLN B 2 67 ? -1.898  -3.490  10.245  1.00 0.00 ? 361 GLN B CA   5  
ATOM 8208  C C    . GLN B 2 67 ? -1.073  -4.374  9.307   1.00 0.00 ? 361 GLN B C    5  
ATOM 8209  O O    . GLN B 2 67 ? -1.178  -5.600  9.355   1.00 0.00 ? 361 GLN B O    5  
ATOM 8210  C CB   . GLN B 2 67 ? -3.190  -3.045  9.548   1.00 0.00 ? 361 GLN B CB   5  
ATOM 8211  C CG   . GLN B 2 67 ? -4.318  -2.648  10.496  1.00 0.00 ? 361 GLN B CG   5  
ATOM 8212  C CD   . GLN B 2 67 ? -4.018  -1.405  11.316  1.00 0.00 ? 361 GLN B CD   5  
ATOM 8213  O OE1  . GLN B 2 67 ? -3.145  -1.412  12.184  1.00 0.00 ? 361 GLN B OE1  5  
ATOM 8214  N NE2  . GLN B 2 67 ? -4.743  -0.324  11.043  1.00 0.00 ? 361 GLN B NE2  5  
ATOM 8215  H H    . GLN B 2 67 ? -1.417  -1.432  10.452  1.00 0.00 ? 361 GLN B H    5  
ATOM 8216  H HA   . GLN B 2 67 ? -2.161  -4.076  11.115  1.00 0.00 ? 361 GLN B HA   5  
ATOM 8217  H HB2  . GLN B 2 67 ? -2.969  -2.196  8.918   1.00 0.00 ? 361 GLN B HB2  5  
ATOM 8218  H HB3  . GLN B 2 67 ? -3.545  -3.856  8.927   1.00 0.00 ? 361 GLN B HB3  5  
ATOM 8219  H HG2  . GLN B 2 67 ? -5.208  -2.464  9.912   1.00 0.00 ? 361 GLN B HG2  5  
ATOM 8220  H HG3  . GLN B 2 67 ? -4.503  -3.470  11.173  1.00 0.00 ? 361 GLN B HG3  5  
ATOM 8221  H HE21 . GLN B 2 67 ? -5.422  -0.386  10.338  1.00 0.00 ? 361 GLN B HE21 5  
ATOM 8222  H HE22 . GLN B 2 67 ? -4.568  0.492   11.557  1.00 0.00 ? 361 GLN B HE22 5  
ATOM 8223  N N    . VAL B 2 68 ? -0.249  -3.751  8.461   1.00 0.00 ? 362 VAL B N    5  
ATOM 8224  C CA   . VAL B 2 68 ? 0.596   -4.497  7.527   1.00 0.00 ? 362 VAL B CA   5  
ATOM 8225  C C    . VAL B 2 68 ? 1.631   -5.333  8.280   1.00 0.00 ? 362 VAL B C    5  
ATOM 8226  O O    . VAL B 2 68 ? 1.858   -6.494  7.942   1.00 0.00 ? 362 VAL B O    5  
ATOM 8227  C CB   . VAL B 2 68 ? 1.312   -3.557  6.531   1.00 0.00 ? 362 VAL B CB   5  
ATOM 8228  C CG1  . VAL B 2 68 ? 2.259   -4.337  5.627   1.00 0.00 ? 362 VAL B CG1  5  
ATOM 8229  C CG2  . VAL B 2 68 ? 0.290   -2.792  5.702   1.00 0.00 ? 362 VAL B CG2  5  
ATOM 8230  H H    . VAL B 2 68 ? -0.201  -2.772  8.470   1.00 0.00 ? 362 VAL B H    5  
ATOM 8231  H HA   . VAL B 2 68 ? -0.043  -5.164  6.963   1.00 0.00 ? 362 VAL B HA   5  
ATOM 8232  H HB   . VAL B 2 68 ? 1.893   -2.842  7.094   1.00 0.00 ? 362 VAL B HB   5  
ATOM 8233  H HG11 . VAL B 2 68 ? 1.831   -5.304  5.406   1.00 0.00 ? 362 VAL B HG11 5  
ATOM 8234  H HG12 . VAL B 2 68 ? 3.206   -4.467  6.128   1.00 0.00 ? 362 VAL B HG12 5  
ATOM 8235  H HG13 . VAL B 2 68 ? 2.410   -3.792  4.707   1.00 0.00 ? 362 VAL B HG13 5  
ATOM 8236  H HG21 . VAL B 2 68 ? -0.487  -3.467  5.373   1.00 0.00 ? 362 VAL B HG21 5  
ATOM 8237  H HG22 . VAL B 2 68 ? 0.775   -2.357  4.842   1.00 0.00 ? 362 VAL B HG22 5  
ATOM 8238  H HG23 . VAL B 2 68 ? -0.148  -2.009  6.299   1.00 0.00 ? 362 VAL B HG23 5  
ATOM 8239  N N    . ALA B 2 69 ? 2.239   -4.742  9.312   1.00 0.00 ? 363 ALA B N    5  
ATOM 8240  C CA   . ALA B 2 69 ? 3.233   -5.440  10.127  1.00 0.00 ? 363 ALA B CA   5  
ATOM 8241  C C    . ALA B 2 69 ? 2.669   -6.748  10.691  1.00 0.00 ? 363 ALA B C    5  
ATOM 8242  O O    . ALA B 2 69 ? 3.401   -7.726  10.856  1.00 0.00 ? 363 ALA B O    5  
ATOM 8243  C CB   . ALA B 2 69 ? 3.720   -4.544  11.259  1.00 0.00 ? 363 ALA B CB   5  
ATOM 8244  H H    . ALA B 2 69 ? 2.002   -3.816  9.538   1.00 0.00 ? 363 ALA B H    5  
ATOM 8245  H HA   . ALA B 2 69 ? 4.078   -5.670  9.494   1.00 0.00 ? 363 ALA B HA   5  
ATOM 8246  H HB1  . ALA B 2 69 ? 4.412   -5.094  11.880  1.00 0.00 ? 363 ALA B HB1  5  
ATOM 8247  H HB2  . ALA B 2 69 ? 2.877   -4.225  11.853  1.00 0.00 ? 363 ALA B HB2  5  
ATOM 8248  H HB3  . ALA B 2 69 ? 4.216   -3.679  10.844  1.00 0.00 ? 363 ALA B HB3  5  
ATOM 8249  N N    . ARG B 2 70 ? 1.361   -6.758  10.973  1.00 0.00 ? 364 ARG B N    5  
ATOM 8250  C CA   . ARG B 2 70 ? 0.691   -7.943  11.509  1.00 0.00 ? 364 ARG B CA   5  
ATOM 8251  C C    . ARG B 2 70 ? 0.583   -9.037  10.448  1.00 0.00 ? 364 ARG B C    5  
ATOM 8252  O O    . ARG B 2 70 ? 0.794   -10.215 10.738  1.00 0.00 ? 364 ARG B O    5  
ATOM 8253  C CB   . ARG B 2 70 ? -0.710  -7.581  12.017  1.00 0.00 ? 364 ARG B CB   5  
ATOM 8254  C CG   . ARG B 2 70 ? -0.726  -6.509  13.097  1.00 0.00 ? 364 ARG B CG   5  
ATOM 8255  C CD   . ARG B 2 70 ? 0.050   -6.938  14.331  1.00 0.00 ? 364 ARG B CD   5  
ATOM 8256  N NE   . ARG B 2 70 ? -0.060  -5.962  15.416  1.00 0.00 ? 364 ARG B NE   5  
ATOM 8257  C CZ   . ARG B 2 70 ? 0.541   -6.088  16.603  1.00 0.00 ? 364 ARG B CZ   5  
ATOM 8258  N NH1  . ARG B 2 70 ? 1.311   -7.142  16.862  1.00 0.00 ? 364 ARG B NH1  5  
ATOM 8259  N NH2  . ARG B 2 70 ? 0.371   -5.154  17.533  1.00 0.00 ? 364 ARG B NH2  5  
ATOM 8260  H H    . ARG B 2 70 ? 0.832   -5.948  10.811  1.00 0.00 ? 364 ARG B H    5  
ATOM 8261  H HA   . ARG B 2 70 ? 1.280   -8.312  12.334  1.00 0.00 ? 364 ARG B HA   5  
ATOM 8262  H HB2  . ARG B 2 70 ? -1.299  -7.227  11.185  1.00 0.00 ? 364 ARG B HB2  5  
ATOM 8263  H HB3  . ARG B 2 70 ? -1.172  -8.472  12.419  1.00 0.00 ? 364 ARG B HB3  5  
ATOM 8264  H HG2  . ARG B 2 70 ? -0.280  -5.609  12.701  1.00 0.00 ? 364 ARG B HG2  5  
ATOM 8265  H HG3  . ARG B 2 70 ? -1.750  -6.311  13.377  1.00 0.00 ? 364 ARG B HG3  5  
ATOM 8266  H HD2  . ARG B 2 70 ? -0.339  -7.886  14.673  1.00 0.00 ? 364 ARG B HD2  5  
ATOM 8267  H HD3  . ARG B 2 70 ? 1.090   -7.050  14.066  1.00 0.00 ? 364 ARG B HD3  5  
ATOM 8268  H HE   . ARG B 2 70 ? -0.615  -5.170  15.255  1.00 0.00 ? 364 ARG B HE   5  
ATOM 8269  H HH11 . ARG B 2 70 ? 1.446   -7.849  16.168  1.00 0.00 ? 364 ARG B HH11 5  
ATOM 8270  H HH12 . ARG B 2 70 ? 1.757   -7.228  17.754  1.00 0.00 ? 364 ARG B HH12 5  
ATOM 8271  H HH21 . ARG B 2 70 ? -0.206  -4.358  17.344  1.00 0.00 ? 364 ARG B HH21 5  
ATOM 8272  H HH22 . ARG B 2 70 ? 0.819   -5.247  18.423  1.00 0.00 ? 364 ARG B HH22 5  
ATOM 8273  N N    . LEU B 2 71 ? 0.242   -8.635  9.221   1.00 0.00 ? 365 LEU B N    5  
ATOM 8274  C CA   . LEU B 2 71 ? 0.094   -9.573  8.108   1.00 0.00 ? 365 LEU B CA   5  
ATOM 8275  C C    . LEU B 2 71 ? 1.385   -10.345 7.845   1.00 0.00 ? 365 LEU B C    5  
ATOM 8276  O O    . LEU B 2 71 ? 1.350   -11.546 7.573   1.00 0.00 ? 365 LEU B O    5  
ATOM 8277  C CB   . LEU B 2 71 ? -0.317  -8.835  6.829   1.00 0.00 ? 365 LEU B CB   5  
ATOM 8278  C CG   . LEU B 2 71 ? -1.600  -8.008  6.924   1.00 0.00 ? 365 LEU B CG   5  
ATOM 8279  C CD1  . LEU B 2 71 ? -1.930  -7.376  5.580   1.00 0.00 ? 365 LEU B CD1  5  
ATOM 8280  C CD2  . LEU B 2 71 ? -2.760  -8.863  7.419   1.00 0.00 ? 365 LEU B CD2  5  
ATOM 8281  H H    . LEU B 2 71 ? 0.083   -7.681  9.060   1.00 0.00 ? 365 LEU B H    5  
ATOM 8282  H HA   . LEU B 2 71 ? -0.683  -10.276 8.369   1.00 0.00 ? 365 LEU B HA   5  
ATOM 8283  H HB2  . LEU B 2 71 ? 0.489   -8.172  6.549   1.00 0.00 ? 365 LEU B HB2  5  
ATOM 8284  H HB3  . LEU B 2 71 ? -0.444  -9.565  6.046   1.00 0.00 ? 365 LEU B HB3  5  
ATOM 8285  H HG   . LEU B 2 71 ? -1.448  -7.212  7.628   1.00 0.00 ? 365 LEU B HG   5  
ATOM 8286  H HD11 . LEU B 2 71 ? -2.257  -6.358  5.733   1.00 0.00 ? 365 LEU B HD11 5  
ATOM 8287  H HD12 . LEU B 2 71 ? -2.717  -7.939  5.101   1.00 0.00 ? 365 LEU B HD12 5  
ATOM 8288  H HD13 . LEU B 2 71 ? -1.050  -7.382  4.954   1.00 0.00 ? 365 LEU B HD13 5  
ATOM 8289  H HD21 . LEU B 2 71 ? -2.501  -9.908  7.330   1.00 0.00 ? 365 LEU B HD21 5  
ATOM 8290  H HD22 . LEU B 2 71 ? -3.638  -8.658  6.826   1.00 0.00 ? 365 LEU B HD22 5  
ATOM 8291  H HD23 . LEU B 2 71 ? -2.961  -8.628  8.455   1.00 0.00 ? 365 LEU B HD23 5  
ATOM 8292  N N    . PHE B 2 72 ? 2.521   -9.648  7.910   1.00 0.00 ? 366 PHE B N    5  
ATOM 8293  C CA   . PHE B 2 72 ? 3.809   -10.262 7.662   1.00 0.00 ? 366 PHE B CA   5  
ATOM 8294  C C    . PHE B 2 72 ? 4.385   -10.845 8.960   1.00 0.00 ? 366 PHE B C    5  
ATOM 8295  O O    . PHE B 2 72 ? 3.635   -11.415 9.751   1.00 0.00 ? 366 PHE B O    5  
ATOM 8296  C CB   . PHE B 2 72 ? 4.742   -9.226  7.012   1.00 0.00 ? 366 PHE B CB   5  
ATOM 8297  C CG   . PHE B 2 72 ? 4.229   -8.703  5.691   1.00 0.00 ? 366 PHE B CG   5  
ATOM 8298  C CD1  . PHE B 2 72 ? 2.979   -8.105  5.599   1.00 0.00 ? 366 PHE B CD1  5  
ATOM 8299  C CD2  . PHE B 2 72 ? 4.990   -8.822  4.541   1.00 0.00 ? 366 PHE B CD2  5  
ATOM 8300  C CE1  . PHE B 2 72 ? 2.501   -7.640  4.392   1.00 0.00 ? 366 PHE B CE1  5  
ATOM 8301  C CE2  . PHE B 2 72 ? 4.515   -8.353  3.329   1.00 0.00 ? 366 PHE B CE2  5  
ATOM 8302  C CZ   . PHE B 2 72 ? 3.268   -7.765  3.256   1.00 0.00 ? 366 PHE B CZ   5  
ATOM 8303  H H    . PHE B 2 72 ? 2.493   -8.691  8.121   1.00 0.00 ? 366 PHE B H    5  
ATOM 8304  H HA   . PHE B 2 72 ? 3.653   -11.072 6.964   1.00 0.00 ? 366 PHE B HA   5  
ATOM 8305  H HB2  . PHE B 2 72 ? 4.858   -8.388  7.681   1.00 0.00 ? 366 PHE B HB2  5  
ATOM 8306  H HB3  . PHE B 2 72 ? 5.707   -9.678  6.837   1.00 0.00 ? 366 PHE B HB3  5  
ATOM 8307  H HD1  . PHE B 2 72 ? 2.376   -8.002  6.483   1.00 0.00 ? 366 PHE B HD1  5  
ATOM 8308  H HD2  . PHE B 2 72 ? 5.965   -9.280  4.596   1.00 0.00 ? 366 PHE B HD2  5  
ATOM 8309  H HE1  . PHE B 2 72 ? 1.527   -7.178  4.339   1.00 0.00 ? 366 PHE B HE1  5  
ATOM 8310  H HE2  . PHE B 2 72 ? 5.118   -8.452  2.440   1.00 0.00 ? 366 PHE B HE2  5  
ATOM 8311  H HZ   . PHE B 2 72 ? 2.891   -7.407  2.312   1.00 0.00 ? 366 PHE B HZ   5  
ATOM 8312  N N    . LYS B 2 73 ? 5.710   -10.713 9.146   1.00 0.00 ? 367 LYS B N    5  
ATOM 8313  C CA   . LYS B 2 73 ? 6.444   -11.222 10.323  1.00 0.00 ? 367 LYS B CA   5  
ATOM 8314  C C    . LYS B 2 73 ? 7.394   -12.337 9.896   1.00 0.00 ? 367 LYS B C    5  
ATOM 8315  O O    . LYS B 2 73 ? 8.591   -12.287 10.180  1.00 0.00 ? 367 LYS B O    5  
ATOM 8316  C CB   . LYS B 2 73 ? 5.529   -11.711 11.459  1.00 0.00 ? 367 LYS B CB   5  
ATOM 8317  C CG   . LYS B 2 73 ? 4.750   -10.595 12.149  1.00 0.00 ? 367 LYS B CG   5  
ATOM 8318  C CD   . LYS B 2 73 ? 5.676   -9.566  12.787  1.00 0.00 ? 367 LYS B CD   5  
ATOM 8319  C CE   . LYS B 2 73 ? 6.570   -10.186 13.856  1.00 0.00 ? 367 LYS B CE   5  
ATOM 8320  N NZ   . LYS B 2 73 ? 5.790   -10.701 15.019  1.00 0.00 ? 367 LYS B NZ   5  
ATOM 8321  H H    . LYS B 2 73 ? 6.225   -10.255 8.456   1.00 0.00 ? 367 LYS B H    5  
ATOM 8322  H HA   . LYS B 2 73 ? 7.045   -10.403 10.694  1.00 0.00 ? 367 LYS B HA   5  
ATOM 8323  H HB2  . LYS B 2 73 ? 4.825   -12.424 11.061  1.00 0.00 ? 367 LYS B HB2  5  
ATOM 8324  H HB3  . LYS B 2 73 ? 6.138   -12.204 12.202  1.00 0.00 ? 367 LYS B HB3  5  
ATOM 8325  H HG2  . LYS B 2 73 ? 4.131   -10.096 11.419  1.00 0.00 ? 367 LYS B HG2  5  
ATOM 8326  H HG3  . LYS B 2 73 ? 4.125   -11.028 12.914  1.00 0.00 ? 367 LYS B HG3  5  
ATOM 8327  H HD2  . LYS B 2 73 ? 6.302   -9.135  12.020  1.00 0.00 ? 367 LYS B HD2  5  
ATOM 8328  H HD3  . LYS B 2 73 ? 5.076   -8.791  13.240  1.00 0.00 ? 367 LYS B HD3  5  
ATOM 8329  H HE2  . LYS B 2 73 ? 7.122   -11.003 13.417  1.00 0.00 ? 367 LYS B HE2  5  
ATOM 8330  H HE3  . LYS B 2 73 ? 7.263   -9.434  14.205  1.00 0.00 ? 367 LYS B HE3  5  
ATOM 8331  H HZ1  . LYS B 2 73 ? 6.296   -11.492 15.466  1.00 0.00 ? 367 LYS B HZ1  5  
ATOM 8332  H HZ2  . LYS B 2 73 ? 4.855   -11.035 14.708  1.00 0.00 ? 367 LYS B HZ2  5  
ATOM 8333  H HZ3  . LYS B 2 73 ? 5.658   -9.947  15.723  1.00 0.00 ? 367 LYS B HZ3  5  
ATOM 8334  N N    . ASN B 2 74 ? 6.850   -13.330 9.186   1.00 0.00 ? 368 ASN B N    5  
ATOM 8335  C CA   . ASN B 2 74 ? 7.651   -14.451 8.686   1.00 0.00 ? 368 ASN B CA   5  
ATOM 8336  C C    . ASN B 2 74 ? 8.421   -14.052 7.418   1.00 0.00 ? 368 ASN B C    5  
ATOM 8337  O O    . ASN B 2 74 ? 9.232   -14.829 6.905   1.00 0.00 ? 368 ASN B O    5  
ATOM 8338  C CB   . ASN B 2 74 ? 6.764   -15.673 8.411   1.00 0.00 ? 368 ASN B CB   5  
ATOM 8339  C CG   . ASN B 2 74 ? 5.643   -15.391 7.423   1.00 0.00 ? 368 ASN B CG   5  
ATOM 8340  O OD1  . ASN B 2 74 ? 4.747   -14.591 7.696   1.00 0.00 ? 368 ASN B OD1  5  
ATOM 8341  N ND2  . ASN B 2 74 ? 5.689   -16.048 6.269   1.00 0.00 ? 368 ASN B ND2  5  
ATOM 8342  H H    . ASN B 2 74 ? 5.894   -13.299 8.977   1.00 0.00 ? 368 ASN B H    5  
ATOM 8343  H HA   . ASN B 2 74 ? 8.365   -14.706 9.454   1.00 0.00 ? 368 ASN B HA   5  
ATOM 8344  H HB2  . ASN B 2 74 ? 7.374   -16.469 8.010   1.00 0.00 ? 368 ASN B HB2  5  
ATOM 8345  H HB3  . ASN B 2 74 ? 6.321   -16.003 9.341   1.00 0.00 ? 368 ASN B HB3  5  
ATOM 8346  H HD21 . ASN B 2 74 ? 6.431   -16.670 6.117   1.00 0.00 ? 368 ASN B HD21 5  
ATOM 8347  H HD22 . ASN B 2 74 ? 4.977   -15.884 5.615   1.00 0.00 ? 368 ASN B HD22 5  
ATOM 8348  N N    . GLN B 2 75 ? 8.173   -12.831 6.928   1.00 0.00 ? 369 GLN B N    5  
ATOM 8349  C CA   . GLN B 2 75 ? 8.842   -12.305 5.744   1.00 0.00 ? 369 GLN B CA   5  
ATOM 8350  C C    . GLN B 2 75 ? 9.127   -10.815 5.935   1.00 0.00 ? 369 GLN B C    5  
ATOM 8351  O O    . GLN B 2 75 ? 8.681   -9.969  5.155   1.00 0.00 ? 369 GLN B O    5  
ATOM 8352  C CB   . GLN B 2 75 ? 8.008   -12.551 4.473   1.00 0.00 ? 369 GLN B CB   5  
ATOM 8353  C CG   . GLN B 2 75 ? 6.627   -11.898 4.457   1.00 0.00 ? 369 GLN B CG   5  
ATOM 8354  C CD   . GLN B 2 75 ? 5.651   -12.513 5.445   1.00 0.00 ? 369 GLN B CD   5  
ATOM 8355  O OE1  . GLN B 2 75 ? 5.703   -12.241 6.640   1.00 0.00 ? 369 GLN B OE1  5  
ATOM 8356  N NE2  . GLN B 2 75 ? 4.760   -13.365 4.947   1.00 0.00 ? 369 GLN B NE2  5  
ATOM 8357  H H    . GLN B 2 75 ? 7.527   -12.258 7.387   1.00 0.00 ? 369 GLN B H    5  
ATOM 8358  H HA   . GLN B 2 75 ? 9.786   -12.824 5.648   1.00 0.00 ? 369 GLN B HA   5  
ATOM 8359  H HB2  . GLN B 2 75 ? 8.559   -12.177 3.624   1.00 0.00 ? 369 GLN B HB2  5  
ATOM 8360  H HB3  . GLN B 2 75 ? 7.873   -13.614 4.355   1.00 0.00 ? 369 GLN B HB3  5  
ATOM 8361  H HG2  . GLN B 2 75 ? 6.737   -10.852 4.698   1.00 0.00 ? 369 GLN B HG2  5  
ATOM 8362  H HG3  . GLN B 2 75 ? 6.214   -11.991 3.463   1.00 0.00 ? 369 GLN B HG3  5  
ATOM 8363  H HE21 . GLN B 2 75 ? 4.779   -13.549 3.985   1.00 0.00 ? 369 GLN B HE21 5  
ATOM 8364  H HE22 . GLN B 2 75 ? 4.117   -13.773 5.563   1.00 0.00 ? 369 GLN B HE22 5  
ATOM 8365  N N    . GLU B 2 76 ? 9.877   -10.511 6.999   1.00 0.00 ? 370 GLU B N    5  
ATOM 8366  C CA   . GLU B 2 76 ? 10.247  -9.135  7.346   1.00 0.00 ? 370 GLU B CA   5  
ATOM 8367  C C    . GLU B 2 76 ? 10.864  -8.377  6.165   1.00 0.00 ? 370 GLU B C    5  
ATOM 8368  O O    . GLU B 2 76 ? 10.870  -7.145  6.158   1.00 0.00 ? 370 GLU B O    5  
ATOM 8369  C CB   . GLU B 2 76 ? 11.218  -9.131  8.530   1.00 0.00 ? 370 GLU B CB   5  
ATOM 8370  C CG   . GLU B 2 76 ? 10.640  -9.747  9.796   1.00 0.00 ? 370 GLU B CG   5  
ATOM 8371  C CD   . GLU B 2 76 ? 11.634  -9.775  10.944  1.00 0.00 ? 370 GLU B CD   5  
ATOM 8372  O OE1  . GLU B 2 76 ? 12.685  -10.437 10.804  1.00 0.00 ? 370 GLU B OE1  5  
ATOM 8373  O OE2  . GLU B 2 76 ? 11.359  -9.138  11.982  1.00 0.00 ? 370 GLU B OE2  5  
ATOM 8374  H H    . GLU B 2 76 ? 10.190  -11.240 7.575   1.00 0.00 ? 370 GLU B H    5  
ATOM 8375  H HA   . GLU B 2 76 ? 9.340   -8.622  7.642   1.00 0.00 ? 370 GLU B HA   5  
ATOM 8376  H HB2  . GLU B 2 76 ? 12.103  -9.688  8.256   1.00 0.00 ? 370 GLU B HB2  5  
ATOM 8377  H HB3  . GLU B 2 76 ? 11.499  -8.111  8.748   1.00 0.00 ? 370 GLU B HB3  5  
ATOM 8378  H HG2  . GLU B 2 76 ? 9.779   -9.171  10.100  1.00 0.00 ? 370 GLU B HG2  5  
ATOM 8379  H HG3  . GLU B 2 76 ? 10.333  -10.760 9.580   1.00 0.00 ? 370 GLU B HG3  5  
ATOM 8380  N N    . ASP B 2 77 ? 11.371  -9.107  5.164   1.00 0.00 ? 371 ASP B N    5  
ATOM 8381  C CA   . ASP B 2 77 ? 11.968  -8.474  3.990   1.00 0.00 ? 371 ASP B CA   5  
ATOM 8382  C C    . ASP B 2 77 ? 10.897  -7.675  3.253   1.00 0.00 ? 371 ASP B C    5  
ATOM 8383  O O    . ASP B 2 77 ? 11.041  -6.467  3.056   1.00 0.00 ? 371 ASP B O    5  
ATOM 8384  C CB   . ASP B 2 77 ? 12.578  -9.534  3.060   1.00 0.00 ? 371 ASP B CB   5  
ATOM 8385  C CG   . ASP B 2 77 ? 13.323  -8.945  1.867   1.00 0.00 ? 371 ASP B CG   5  
ATOM 8386  O OD1  . ASP B 2 77 ? 13.454  -7.703  1.782   1.00 0.00 ? 371 ASP B OD1  5  
ATOM 8387  O OD2  . ASP B 2 77 ? 13.784  -9.735  1.017   1.00 0.00 ? 371 ASP B OD2  5  
ATOM 8388  H H    . ASP B 2 77 ? 11.338  -10.084 5.213   1.00 0.00 ? 371 ASP B H    5  
ATOM 8389  H HA   . ASP B 2 77 ? 12.744  -7.800  4.327   1.00 0.00 ? 371 ASP B HA   5  
ATOM 8390  H HB2  . ASP B 2 77 ? 13.273  -10.137 3.625   1.00 0.00 ? 371 ASP B HB2  5  
ATOM 8391  H HB3  . ASP B 2 77 ? 11.786  -10.167 2.688   1.00 0.00 ? 371 ASP B HB3  5  
ATOM 8392  N N    . LEU B 2 78 ? 9.811   -8.353  2.879   1.00 0.00 ? 372 LEU B N    5  
ATOM 8393  C CA   . LEU B 2 78 ? 8.692   -7.702  2.202   1.00 0.00 ? 372 LEU B CA   5  
ATOM 8394  C C    . LEU B 2 78 ? 8.199   -6.500  3.014   1.00 0.00 ? 372 LEU B C    5  
ATOM 8395  O O    . LEU B 2 78 ? 7.829   -5.471  2.450   1.00 0.00 ? 372 LEU B O    5  
ATOM 8396  C CB   . LEU B 2 78 ? 7.550   -8.695  1.968   1.00 0.00 ? 372 LEU B CB   5  
ATOM 8397  C CG   . LEU B 2 78 ? 7.872   -9.834  0.994   1.00 0.00 ? 372 LEU B CG   5  
ATOM 8398  C CD1  . LEU B 2 78 ? 6.729   -10.835 0.944   1.00 0.00 ? 372 LEU B CD1  5  
ATOM 8399  C CD2  . LEU B 2 78 ? 8.157   -9.280  -0.396  1.00 0.00 ? 372 LEU B CD2  5  
ATOM 8400  H H    . LEU B 2 78 ? 9.749   -9.309  3.089   1.00 0.00 ? 372 LEU B H    5  
ATOM 8401  H HA   . LEU B 2 78 ? 9.049   -7.347  1.246   1.00 0.00 ? 372 LEU B HA   5  
ATOM 8402  H HB2  . LEU B 2 78 ? 7.278   -9.128  2.920   1.00 0.00 ? 372 LEU B HB2  5  
ATOM 8403  H HB3  . LEU B 2 78 ? 6.701   -8.152  1.582   1.00 0.00 ? 372 LEU B HB3  5  
ATOM 8404  H HG   . LEU B 2 78 ? 8.755   -10.353 1.337   1.00 0.00 ? 372 LEU B HG   5  
ATOM 8405  H HD11 . LEU B 2 78 ? 6.813   -11.521 1.775   1.00 0.00 ? 372 LEU B HD11 5  
ATOM 8406  H HD12 . LEU B 2 78 ? 6.772   -11.387 0.016   1.00 0.00 ? 372 LEU B HD12 5  
ATOM 8407  H HD13 . LEU B 2 78 ? 5.787   -10.309 1.006   1.00 0.00 ? 372 LEU B HD13 5  
ATOM 8408  H HD21 . LEU B 2 78 ? 9.028   -8.644  -0.360  1.00 0.00 ? 372 LEU B HD21 5  
ATOM 8409  H HD22 . LEU B 2 78 ? 7.308   -8.708  -0.739  1.00 0.00 ? 372 LEU B HD22 5  
ATOM 8410  H HD23 . LEU B 2 78 ? 8.337   -10.097 -1.080  1.00 0.00 ? 372 LEU B HD23 5  
ATOM 8411  N N    . LEU B 2 79 ? 8.215   -6.633  4.348   1.00 0.00 ? 373 LEU B N    5  
ATOM 8412  C CA   . LEU B 2 79 ? 7.786   -5.549  5.234   1.00 0.00 ? 373 LEU B CA   5  
ATOM 8413  C C    . LEU B 2 79 ? 8.698   -4.334  5.086   1.00 0.00 ? 373 LEU B C    5  
ATOM 8414  O O    . LEU B 2 79 ? 8.217   -3.206  4.964   1.00 0.00 ? 373 LEU B O    5  
ATOM 8415  C CB   . LEU B 2 79 ? 7.770   -6.006  6.698   1.00 0.00 ? 373 LEU B CB   5  
ATOM 8416  C CG   . LEU B 2 79 ? 6.399   -6.411  7.241   1.00 0.00 ? 373 LEU B CG   5  
ATOM 8417  C CD1  . LEU B 2 79 ? 6.489   -6.713  8.730   1.00 0.00 ? 373 LEU B CD1  5  
ATOM 8418  C CD2  . LEU B 2 79 ? 5.378   -5.312  6.973   1.00 0.00 ? 373 LEU B CD2  5  
ATOM 8419  H H    . LEU B 2 79 ? 8.534   -7.473  4.741   1.00 0.00 ? 373 LEU B H    5  
ATOM 8420  H HA   . LEU B 2 79 ? 6.786   -5.266  4.944   1.00 0.00 ? 373 LEU B HA   5  
ATOM 8421  H HB2  . LEU B 2 79 ? 8.437   -6.851  6.795   1.00 0.00 ? 373 LEU B HB2  5  
ATOM 8422  H HB3  . LEU B 2 79 ? 8.149   -5.199  7.308   1.00 0.00 ? 373 LEU B HB3  5  
ATOM 8423  H HG   . LEU B 2 79 ? 6.067   -7.311  6.743   1.00 0.00 ? 373 LEU B HG   5  
ATOM 8424  H HD11 . LEU B 2 79 ? 6.895   -5.857  9.248   1.00 0.00 ? 373 LEU B HD11 5  
ATOM 8425  H HD12 . LEU B 2 79 ? 7.130   -7.567  8.885   1.00 0.00 ? 373 LEU B HD12 5  
ATOM 8426  H HD13 . LEU B 2 79 ? 5.502   -6.931  9.113   1.00 0.00 ? 373 LEU B HD13 5  
ATOM 8427  H HD21 . LEU B 2 79 ? 5.868   -4.469  6.499   1.00 0.00 ? 373 LEU B HD21 5  
ATOM 8428  H HD22 . LEU B 2 79 ? 4.936   -4.992  7.904   1.00 0.00 ? 373 LEU B HD22 5  
ATOM 8429  H HD23 . LEU B 2 79 ? 4.606   -5.690  6.319   1.00 0.00 ? 373 LEU B HD23 5  
ATOM 8430  N N    . SER B 2 80 ? 10.011  -4.572  5.085   1.00 0.00 ? 374 SER B N    5  
ATOM 8431  C CA   . SER B 2 80 ? 10.983  -3.492  4.933   1.00 0.00 ? 374 SER B CA   5  
ATOM 8432  C C    . SER B 2 80 ? 10.720  -2.724  3.639   1.00 0.00 ? 374 SER B C    5  
ATOM 8433  O O    . SER B 2 80 ? 10.778  -1.493  3.618   1.00 0.00 ? 374 SER B O    5  
ATOM 8434  C CB   . SER B 2 80 ? 12.411  -4.048  4.933   1.00 0.00 ? 374 SER B CB   5  
ATOM 8435  O OG   . SER B 2 80 ? 13.367  -3.015  4.765   1.00 0.00 ? 374 SER B OG   5  
ATOM 8436  H H    . SER B 2 80 ? 10.332  -5.494  5.175   1.00 0.00 ? 374 SER B H    5  
ATOM 8437  H HA   . SER B 2 80 ? 10.865  -2.819  5.770   1.00 0.00 ? 374 SER B HA   5  
ATOM 8438  H HB2  . SER B 2 80 ? 12.600  -4.546  5.873   1.00 0.00 ? 374 SER B HB2  5  
ATOM 8439  H HB3  . SER B 2 80 ? 12.518  -4.756  4.124   1.00 0.00 ? 374 SER B HB3  5  
ATOM 8440  H HG   . SER B 2 80 ? 13.203  -2.317  5.405   1.00 0.00 ? 374 SER B HG   5  
ATOM 8441  N N    . GLU B 2 81 ? 10.413  -3.464  2.569   1.00 0.00 ? 375 GLU B N    5  
ATOM 8442  C CA   . GLU B 2 81 ? 10.122  -2.867  1.269   1.00 0.00 ? 375 GLU B CA   5  
ATOM 8443  C C    . GLU B 2 81 ? 8.911   -1.934  1.349   1.00 0.00 ? 375 GLU B C    5  
ATOM 8444  O O    . GLU B 2 81 ? 8.880   -0.893  0.693   1.00 0.00 ? 375 GLU B O    5  
ATOM 8445  C CB   . GLU B 2 81 ? 9.879   -3.963  0.224   1.00 0.00 ? 375 GLU B CB   5  
ATOM 8446  C CG   . GLU B 2 81 ? 9.563   -3.434  -1.169  1.00 0.00 ? 375 GLU B CG   5  
ATOM 8447  C CD   . GLU B 2 81 ? 10.693  -2.634  -1.802  1.00 0.00 ? 375 GLU B CD   5  
ATOM 8448  O OE1  . GLU B 2 81 ? 11.786  -2.541  -1.200  1.00 0.00 ? 375 GLU B OE1  5  
ATOM 8449  O OE2  . GLU B 2 81 ? 10.481  -2.103  -2.910  1.00 0.00 ? 375 GLU B OE2  5  
ATOM 8450  H H    . GLU B 2 81 ? 10.375  -4.440  2.661   1.00 0.00 ? 375 GLU B H    5  
ATOM 8451  H HA   . GLU B 2 81 ? 10.984  -2.288  0.973   1.00 0.00 ? 375 GLU B HA   5  
ATOM 8452  H HB2  . GLU B 2 81 ? 10.760  -4.582  0.159   1.00 0.00 ? 375 GLU B HB2  5  
ATOM 8453  H HB3  . GLU B 2 81 ? 9.049   -4.571  0.550   1.00 0.00 ? 375 GLU B HB3  5  
ATOM 8454  H HG2  . GLU B 2 81 ? 9.348   -4.274  -1.813  1.00 0.00 ? 375 GLU B HG2  5  
ATOM 8455  H HG3  . GLU B 2 81 ? 8.689   -2.802  -1.107  1.00 0.00 ? 375 GLU B HG3  5  
ATOM 8456  N N    . PHE B 2 82 ? 7.917   -2.313  2.161   1.00 0.00 ? 376 PHE B N    5  
ATOM 8457  C CA   . PHE B 2 82 ? 6.710   -1.503  2.334   1.00 0.00 ? 376 PHE B CA   5  
ATOM 8458  C C    . PHE B 2 82 ? 7.070   -0.071  2.732   1.00 0.00 ? 376 PHE B C    5  
ATOM 8459  O O    . PHE B 2 82 ? 6.688   0.886   2.057   1.00 0.00 ? 376 PHE B O    5  
ATOM 8460  C CB   . PHE B 2 82 ? 5.801   -2.112  3.410   1.00 0.00 ? 376 PHE B CB   5  
ATOM 8461  C CG   . PHE B 2 82 ? 4.485   -1.400  3.569   1.00 0.00 ? 376 PHE B CG   5  
ATOM 8462  C CD1  . PHE B 2 82 ? 3.912   -0.717  2.505   1.00 0.00 ? 376 PHE B CD1  5  
ATOM 8463  C CD2  . PHE B 2 82 ? 3.818   -1.420  4.782   1.00 0.00 ? 376 PHE B CD2  5  
ATOM 8464  C CE1  . PHE B 2 82 ? 2.701   -0.069  2.651   1.00 0.00 ? 376 PHE B CE1  5  
ATOM 8465  C CE2  . PHE B 2 82 ? 2.608   -0.773  4.934   1.00 0.00 ? 376 PHE B CE2  5  
ATOM 8466  C CZ   . PHE B 2 82 ? 2.049   -0.096  3.867   1.00 0.00 ? 376 PHE B CZ   5  
ATOM 8467  H H    . PHE B 2 82 ? 8.002   -3.152  2.660   1.00 0.00 ? 376 PHE B H    5  
ATOM 8468  H HA   . PHE B 2 82 ? 6.181   -1.485  1.394   1.00 0.00 ? 376 PHE B HA   5  
ATOM 8469  H HB2  . PHE B 2 82 ? 5.591   -3.140  3.156   1.00 0.00 ? 376 PHE B HB2  5  
ATOM 8470  H HB3  . PHE B 2 82 ? 6.313   -2.081  4.361   1.00 0.00 ? 376 PHE B HB3  5  
ATOM 8471  H HD1  . PHE B 2 82 ? 4.420   -0.695  1.553   1.00 0.00 ? 376 PHE B HD1  5  
ATOM 8472  H HD2  . PHE B 2 82 ? 4.254   -1.946  5.619   1.00 0.00 ? 376 PHE B HD2  5  
ATOM 8473  H HE1  . PHE B 2 82 ? 2.266   0.461   1.817   1.00 0.00 ? 376 PHE B HE1  5  
ATOM 8474  H HE2  . PHE B 2 82 ? 2.097   -0.797  5.886   1.00 0.00 ? 376 PHE B HE2  5  
ATOM 8475  H HZ   . PHE B 2 82 ? 1.103   0.410   3.985   1.00 0.00 ? 376 PHE B HZ   5  
ATOM 8476  N N    . GLY B 2 83 ? 7.803   0.057   3.843   1.00 0.00 ? 377 GLY B N    5  
ATOM 8477  C CA   . GLY B 2 83 ? 8.208   1.367   4.339   1.00 0.00 ? 377 GLY B CA   5  
ATOM 8478  C C    . GLY B 2 83 ? 9.152   2.128   3.410   1.00 0.00 ? 377 GLY B C    5  
ATOM 8479  O O    . GLY B 2 83 ? 9.474   3.285   3.681   1.00 0.00 ? 377 GLY B O    5  
ATOM 8480  H H    . GLY B 2 83 ? 8.065   -0.752  4.339   1.00 0.00 ? 377 GLY B H    5  
ATOM 8481  H HA2  . GLY B 2 83 ? 7.323   1.965   4.491   1.00 0.00 ? 377 GLY B HA2  5  
ATOM 8482  H HA3  . GLY B 2 83 ? 8.699   1.234   5.293   1.00 0.00 ? 377 GLY B HA3  5  
ATOM 8483  N N    . GLN B 2 84 ? 9.599   1.497   2.320   1.00 0.00 ? 378 GLN B N    5  
ATOM 8484  C CA   . GLN B 2 84 ? 10.504  2.153   1.374   1.00 0.00 ? 378 GLN B CA   5  
ATOM 8485  C C    . GLN B 2 84 ? 9.789   3.244   0.574   1.00 0.00 ? 378 GLN B C    5  
ATOM 8486  O O    . GLN B 2 84 ? 10.419  4.208   0.137   1.00 0.00 ? 378 GLN B O    5  
ATOM 8487  C CB   . GLN B 2 84 ? 11.118  1.132   0.409   1.00 0.00 ? 378 GLN B CB   5  
ATOM 8488  C CG   . GLN B 2 84 ? 11.928  0.044   1.096   1.00 0.00 ? 378 GLN B CG   5  
ATOM 8489  C CD   . GLN B 2 84 ? 13.088  0.594   1.906   1.00 0.00 ? 378 GLN B CD   5  
ATOM 8490  O OE1  . GLN B 2 84 ? 13.987  1.237   1.364   1.00 0.00 ? 378 GLN B OE1  5  
ATOM 8491  N NE2  . GLN B 2 84 ? 13.073  0.347   3.212   1.00 0.00 ? 378 GLN B NE2  5  
ATOM 8492  H H    . GLN B 2 84 ? 9.318   0.576   2.148   1.00 0.00 ? 378 GLN B H    5  
ATOM 8493  H HA   . GLN B 2 84 ? 11.297  2.612   1.945   1.00 0.00 ? 378 GLN B HA   5  
ATOM 8494  H HB2  . GLN B 2 84 ? 10.325  0.660   -0.151  1.00 0.00 ? 378 GLN B HB2  5  
ATOM 8495  H HB3  . GLN B 2 84 ? 11.768  1.652   -0.279  1.00 0.00 ? 378 GLN B HB3  5  
ATOM 8496  H HG2  . GLN B 2 84 ? 11.277  -0.506  1.757   1.00 0.00 ? 378 GLN B HG2  5  
ATOM 8497  H HG3  . GLN B 2 84 ? 12.321  -0.624  0.342   1.00 0.00 ? 378 GLN B HG3  5  
ATOM 8498  H HE21 . GLN B 2 84 ? 12.324  -0.171  3.577   1.00 0.00 ? 378 GLN B HE21 5  
ATOM 8499  H HE22 . GLN B 2 84 ? 13.811  0.693   3.756   1.00 0.00 ? 378 GLN B HE22 5  
ATOM 8500  N N    . PHE B 2 85 ? 8.478   3.083   0.372   1.00 0.00 ? 379 PHE B N    5  
ATOM 8501  C CA   . PHE B 2 85 ? 7.696   4.056   -0.390  1.00 0.00 ? 379 PHE B CA   5  
ATOM 8502  C C    . PHE B 2 85 ? 7.055   5.090   0.531   1.00 0.00 ? 379 PHE B C    5  
ATOM 8503  O O    . PHE B 2 85 ? 7.152   6.293   0.278   1.00 0.00 ? 379 PHE B O    5  
ATOM 8504  C CB   . PHE B 2 85 ? 6.635   3.345   -1.235  1.00 0.00 ? 379 PHE B CB   5  
ATOM 8505  C CG   . PHE B 2 85 ? 7.214   2.269   -2.113  1.00 0.00 ? 379 PHE B CG   5  
ATOM 8506  C CD1  . PHE B 2 85 ? 7.534   1.026   -1.587  1.00 0.00 ? 379 PHE B CD1  5  
ATOM 8507  C CD2  . PHE B 2 85 ? 7.466   2.511   -3.453  1.00 0.00 ? 379 PHE B CD2  5  
ATOM 8508  C CE1  . PHE B 2 85 ? 8.091   0.044   -2.383  1.00 0.00 ? 379 PHE B CE1  5  
ATOM 8509  C CE2  . PHE B 2 85 ? 8.022   1.530   -4.254  1.00 0.00 ? 379 PHE B CE2  5  
ATOM 8510  C CZ   . PHE B 2 85 ? 8.335   0.297   -3.718  1.00 0.00 ? 379 PHE B CZ   5  
ATOM 8511  H H    . PHE B 2 85 ? 8.029   2.292   0.737   1.00 0.00 ? 379 PHE B H    5  
ATOM 8512  H HA   . PHE B 2 85 ? 8.376   4.570   -1.053  1.00 0.00 ? 379 PHE B HA   5  
ATOM 8513  H HB2  . PHE B 2 85 ? 5.906   2.888   -0.581  1.00 0.00 ? 379 PHE B HB2  5  
ATOM 8514  H HB3  . PHE B 2 85 ? 6.142   4.067   -1.870  1.00 0.00 ? 379 PHE B HB3  5  
ATOM 8515  H HD1  . PHE B 2 85 ? 7.340   0.827   -0.544  1.00 0.00 ? 379 PHE B HD1  5  
ATOM 8516  H HD2  . PHE B 2 85 ? 7.222   3.475   -3.874  1.00 0.00 ? 379 PHE B HD2  5  
ATOM 8517  H HE1  . PHE B 2 85 ? 8.335   -0.918  -1.959  1.00 0.00 ? 379 PHE B HE1  5  
ATOM 8518  H HE2  . PHE B 2 85 ? 8.213   1.729   -5.298  1.00 0.00 ? 379 PHE B HE2  5  
ATOM 8519  H HZ   . PHE B 2 85 ? 8.771   -0.470  -4.342  1.00 0.00 ? 379 PHE B HZ   5  
ATOM 8520  N N    . LEU B 2 86 ? 6.424   4.627   1.613   1.00 0.00 ? 380 LEU B N    5  
ATOM 8521  C CA   . LEU B 2 86 ? 5.804   5.538   2.571   1.00 0.00 ? 380 LEU B CA   5  
ATOM 8522  C C    . LEU B 2 86 ? 6.849   5.979   3.599   1.00 0.00 ? 380 LEU B C    5  
ATOM 8523  O O    . LEU B 2 86 ? 7.712   5.189   3.981   1.00 0.00 ? 380 LEU B O    5  
ATOM 8524  C CB   . LEU B 2 86 ? 4.576   4.887   3.245   1.00 0.00 ? 380 LEU B CB   5  
ATOM 8525  C CG   . LEU B 2 86 ? 4.846   3.723   4.180   1.00 0.00 ? 380 LEU B CG   5  
ATOM 8526  C CD1  . LEU B 2 86 ? 4.954   4.202   5.624   1.00 0.00 ? 380 LEU B CD1  5  
ATOM 8527  C CD2  . LEU B 2 86 ? 3.761   2.665   4.039   1.00 0.00 ? 380 LEU B CD2  5  
ATOM 8528  H H    . LEU B 2 86 ? 6.395   3.661   1.777   1.00 0.00 ? 380 LEU B H    5  
ATOM 8529  H HA   . LEU B 2 86 ? 5.476   6.409   2.024   1.00 0.00 ? 380 LEU B HA   5  
ATOM 8530  H HB2  . LEU B 2 86 ? 4.075   5.633   3.817   1.00 0.00 ? 380 LEU B HB2  5  
ATOM 8531  H HB3  . LEU B 2 86 ? 3.909   4.546   2.468   1.00 0.00 ? 380 LEU B HB3  5  
ATOM 8532  H HG   . LEU B 2 86 ? 5.780   3.290   3.908   1.00 0.00 ? 380 LEU B HG   5  
ATOM 8533  H HD11 . LEU B 2 86 ? 5.058   5.279   5.642   1.00 0.00 ? 380 LEU B HD11 5  
ATOM 8534  H HD12 . LEU B 2 86 ? 5.815   3.750   6.091   1.00 0.00 ? 380 LEU B HD12 5  
ATOM 8535  H HD13 . LEU B 2 86 ? 4.062   3.921   6.167   1.00 0.00 ? 380 LEU B HD13 5  
ATOM 8536  H HD21 . LEU B 2 86 ? 3.327   2.722   3.049   1.00 0.00 ? 380 LEU B HD21 5  
ATOM 8537  H HD22 . LEU B 2 86 ? 2.993   2.836   4.780   1.00 0.00 ? 380 LEU B HD22 5  
ATOM 8538  H HD23 . LEU B 2 86 ? 4.191   1.686   4.189   1.00 0.00 ? 380 LEU B HD23 5  
ATOM 8539  N N    . PRO B 2 87 ? 6.815   7.258   4.029   1.00 0.00 ? 381 PRO B N    5  
ATOM 8540  C CA   . PRO B 2 87 ? 7.792   7.839   4.994   1.00 0.00 ? 381 PRO B CA   5  
ATOM 8541  C C    . PRO B 2 87 ? 7.868   7.164   6.375   1.00 0.00 ? 381 PRO B C    5  
ATOM 8542  O O    . PRO B 2 87 ? 8.361   7.762   7.333   1.00 0.00 ? 381 PRO B O    5  
ATOM 8543  C CB   . PRO B 2 87 ? 7.299   9.269   5.169   1.00 0.00 ? 381 PRO B CB   5  
ATOM 8544  C CG   . PRO B 2 87 ? 6.515   9.557   3.939   1.00 0.00 ? 381 PRO B CG   5  
ATOM 8545  C CD   . PRO B 2 87 ? 5.850   8.269   3.566   1.00 0.00 ? 381 PRO B CD   5  
ATOM 8546  H HA   . PRO B 2 87 ? 8.779   7.853   4.571   1.00 0.00 ? 381 PRO B HA   5  
ATOM 8547  H HB2  . PRO B 2 87 ? 6.681   9.323   6.053   1.00 0.00 ? 381 PRO B HB2  5  
ATOM 8548  H HB3  . PRO B 2 87 ? 8.142   9.935   5.267   1.00 0.00 ? 381 PRO B HB3  5  
ATOM 8549  H HG2  . PRO B 2 87 ? 5.776   10.314  4.146   1.00 0.00 ? 381 PRO B HG2  5  
ATOM 8550  H HG3  . PRO B 2 87 ? 7.176   9.876   3.152   1.00 0.00 ? 381 PRO B HG3  5  
ATOM 8551  H HD2  . PRO B 2 87 ? 4.903   8.168   4.076   1.00 0.00 ? 381 PRO B HD2  5  
ATOM 8552  H HD3  . PRO B 2 87 ? 5.713   8.210   2.497   1.00 0.00 ? 381 PRO B HD3  5  
ATOM 8553  N N    . ASP B 2 88 ? 7.399   5.934   6.458   1.00 0.00 ? 382 ASP B N    5  
ATOM 8554  C CA   . ASP B 2 88 ? 7.410   5.146   7.689   1.00 0.00 ? 382 ASP B CA   5  
ATOM 8555  C C    . ASP B 2 88 ? 6.465   5.730   8.737   1.00 0.00 ? 382 ASP B C    5  
ATOM 8556  O O    . ASP B 2 88 ? 5.349   5.235   8.907   1.00 0.00 ? 382 ASP B O    5  
ATOM 8557  C CB   . ASP B 2 88 ? 8.833   5.023   8.244   1.00 0.00 ? 382 ASP B CB   5  
ATOM 8558  C CG   . ASP B 2 88 ? 9.775   4.301   7.295   1.00 0.00 ? 382 ASP B CG   5  
ATOM 8559  O OD1  . ASP B 2 88 ? 10.033  4.830   6.192   1.00 0.00 ? 382 ASP B OD1  5  
ATOM 8560  O OD2  . ASP B 2 88 ? 10.253  3.205   7.654   1.00 0.00 ? 382 ASP B OD2  5  
ATOM 8561  H H    . ASP B 2 88 ? 7.043   5.538   5.666   1.00 0.00 ? 382 ASP B H    5  
ATOM 8562  H HA   . ASP B 2 88 ? 7.058   4.158   7.434   1.00 0.00 ? 382 ASP B HA   5  
ATOM 8563  H HB2  . ASP B 2 88 ? 9.230   6.008   8.433   1.00 0.00 ? 382 ASP B HB2  5  
ATOM 8564  H HB3  . ASP B 2 88 ? 8.794   4.473   9.168   1.00 0.00 ? 382 ASP B HB3  5  
ATOM 8565  N N    . ALA B 2 89 ? 6.912   6.778   9.438   1.00 0.00 ? 383 ALA B N    5  
ATOM 8566  C CA   . ALA B 2 89 ? 6.101   7.429   10.469  1.00 0.00 ? 383 ALA B CA   5  
ATOM 8567  C C    . ALA B 2 89 ? 5.955   6.553   11.722  1.00 0.00 ? 383 ALA B C    5  
ATOM 8568  O O    . ALA B 2 89 ? 5.242   6.977   12.657  1.00 0.00 ? 383 ALA B O    5  
ATOM 8569  C CB   . ALA B 2 89 ? 4.732   7.799   9.906   1.00 0.00 ? 383 ALA B CB   5  
ATOM 8570  O OXT  . ALA B 2 89 ? 6.555   5.456   11.760  1.00 0.00 ? 383 ALA B OXT  5  
ATOM 8571  H H    . ALA B 2 89 ? 7.809   7.126   9.256   1.00 0.00 ? 383 ALA B H    5  
ATOM 8572  H HA   . ALA B 2 89 ? 6.601   8.346   10.748  1.00 0.00 ? 383 ALA B HA   5  
ATOM 8573  H HB1  . ALA B 2 89 ? 4.609   7.339   8.935   1.00 0.00 ? 383 ALA B HB1  5  
ATOM 8574  H HB2  . ALA B 2 89 ? 4.662   8.871   9.807   1.00 0.00 ? 383 ALA B HB2  5  
ATOM 8575  H HB3  . ALA B 2 89 ? 3.960   7.446   10.572  1.00 0.00 ? 383 ALA B HB3  5  
ATOM 8576  N N    . ARG A 1 1  ? 0.550   9.565   0.385   1.00 0.00 ? 6   ARG A N    6  
ATOM 8577  C CA   . ARG A 1 1  ? 1.424   10.454  -0.433  1.00 0.00 ? 6   ARG A CA   6  
ATOM 8578  C C    . ARG A 1 1  ? 1.430   10.037  -1.914  1.00 0.00 ? 6   ARG A C    6  
ATOM 8579  O O    . ARG A 1 1  ? 2.406   10.277  -2.626  1.00 0.00 ? 6   ARG A O    6  
ATOM 8580  C CB   . ARG A 1 1  ? 2.845   10.397  0.156   1.00 0.00 ? 6   ARG A CB   6  
ATOM 8581  C CG   . ARG A 1 1  ? 3.824   11.393  -0.459  1.00 0.00 ? 6   ARG A CG   6  
ATOM 8582  C CD   . ARG A 1 1  ? 3.317   12.825  -0.350  1.00 0.00 ? 6   ARG A CD   6  
ATOM 8583  N NE   . ARG A 1 1  ? 3.150   13.251  1.039   1.00 0.00 ? 6   ARG A NE   6  
ATOM 8584  C CZ   . ARG A 1 1  ? 2.676   14.445  1.403   1.00 0.00 ? 6   ARG A CZ   6  
ATOM 8585  N NH1  . ARG A 1 1  ? 2.306   15.334  0.483   1.00 0.00 ? 6   ARG A NH1  6  
ATOM 8586  N NH2  . ARG A 1 1  ? 2.565   14.750  2.691   1.00 0.00 ? 6   ARG A NH2  6  
ATOM 8587  H H1   . ARG A 1 1  ? 0.713   8.584   0.076   1.00 0.00 ? 6   ARG A H1   6  
ATOM 8588  H H2   . ARG A 1 1  ? -0.436  9.852   0.221   1.00 0.00 ? 6   ARG A H2   6  
ATOM 8589  H H3   . ARG A 1 1  ? 0.814   9.688   1.384   1.00 0.00 ? 6   ARG A H3   6  
ATOM 8590  H HA   . ARG A 1 1  ? 1.051   11.464  -0.355  1.00 0.00 ? 6   ARG A HA   6  
ATOM 8591  H HB2  . ARG A 1 1  ? 2.790   10.596  1.215   1.00 0.00 ? 6   ARG A HB2  6  
ATOM 8592  H HB3  . ARG A 1 1  ? 3.241   9.403   0.008   1.00 0.00 ? 6   ARG A HB3  6  
ATOM 8593  H HG2  . ARG A 1 1  ? 4.768   11.318  0.059   1.00 0.00 ? 6   ARG A HG2  6  
ATOM 8594  H HG3  . ARG A 1 1  ? 3.967   11.149  -1.501  1.00 0.00 ? 6   ARG A HG3  6  
ATOM 8595  H HD2  . ARG A 1 1  ? 4.026   13.480  -0.833  1.00 0.00 ? 6   ARG A HD2  6  
ATOM 8596  H HD3  . ARG A 1 1  ? 2.366   12.895  -0.855  1.00 0.00 ? 6   ARG A HD3  6  
ATOM 8597  H HE   . ARG A 1 1  ? 3.411   12.616  1.741   1.00 0.00 ? 6   ARG A HE   6  
ATOM 8598  H HH11 . ARG A 1 1  ? 2.383   15.111  -0.490  1.00 0.00 ? 6   ARG A HH11 6  
ATOM 8599  H HH12 . ARG A 1 1  ? 1.951   16.224  0.763   1.00 0.00 ? 6   ARG A HH12 6  
ATOM 8600  H HH21 . ARG A 1 1  ? 2.839   14.086  3.388   1.00 0.00 ? 6   ARG A HH21 6  
ATOM 8601  H HH22 . ARG A 1 1  ? 2.210   15.644  2.966   1.00 0.00 ? 6   ARG A HH22 6  
ATOM 8602  N N    . MET A 1 2  ? 0.334   9.408   -2.366  1.00 0.00 ? 7   MET A N    6  
ATOM 8603  C CA   . MET A 1 2  ? 0.198   8.949   -3.758  1.00 0.00 ? 7   MET A CA   6  
ATOM 8604  C C    . MET A 1 2  ? 1.006   7.673   -4.036  1.00 0.00 ? 7   MET A C    6  
ATOM 8605  O O    . MET A 1 2  ? 0.726   6.962   -5.004  1.00 0.00 ? 7   MET A O    6  
ATOM 8606  C CB   . MET A 1 2  ? 0.609   10.046  -4.749  1.00 0.00 ? 7   MET A CB   6  
ATOM 8607  C CG   . MET A 1 2  ? -0.214  11.319  -4.634  1.00 0.00 ? 7   MET A CG   6  
ATOM 8608  S SD   . MET A 1 2  ? 0.320   12.600  -5.788  1.00 0.00 ? 7   MET A SD   6  
ATOM 8609  C CE   . MET A 1 2  ? 0.086   11.769  -7.358  1.00 0.00 ? 7   MET A CE   6  
ATOM 8610  H H    . MET A 1 2  ? -0.408  9.246   -1.748  1.00 0.00 ? 7   MET A H    6  
ATOM 8611  H HA   . MET A 1 2  ? -0.848  8.723   -3.917  1.00 0.00 ? 7   MET A HA   6  
ATOM 8612  H HB2  . MET A 1 2  ? 1.646   10.298  -4.584  1.00 0.00 ? 7   MET A HB2  6  
ATOM 8613  H HB3  . MET A 1 2  ? 0.501   9.664   -5.753  1.00 0.00 ? 7   MET A HB3  6  
ATOM 8614  H HG2  . MET A 1 2  ? -1.248  11.082  -4.837  1.00 0.00 ? 7   MET A HG2  6  
ATOM 8615  H HG3  . MET A 1 2  ? -0.125  11.701  -3.628  1.00 0.00 ? 7   MET A HG3  6  
ATOM 8616  H HE1  . MET A 1 2  ? -0.601  12.337  -7.967  1.00 0.00 ? 7   MET A HE1  6  
ATOM 8617  H HE2  . MET A 1 2  ? -0.316  10.781  -7.187  1.00 0.00 ? 7   MET A HE2  6  
ATOM 8618  H HE3  . MET A 1 2  ? 1.036   11.688  -7.865  1.00 0.00 ? 7   MET A HE3  6  
ATOM 8619  N N    . ASN A 1 3  ? 2.007   7.385   -3.198  1.00 0.00 ? 8   ASN A N    6  
ATOM 8620  C CA   . ASN A 1 3  ? 2.844   6.200   -3.372  1.00 0.00 ? 8   ASN A CA   6  
ATOM 8621  C C    . ASN A 1 3  ? 2.066   4.923   -3.050  1.00 0.00 ? 8   ASN A C    6  
ATOM 8622  O O    . ASN A 1 3  ? 2.276   3.890   -3.688  1.00 0.00 ? 8   ASN A O    6  
ATOM 8623  C CB   . ASN A 1 3  ? 4.094   6.301   -2.489  1.00 0.00 ? 8   ASN A CB   6  
ATOM 8624  C CG   . ASN A 1 3  ? 4.986   7.499   -2.824  1.00 0.00 ? 8   ASN A CG   6  
ATOM 8625  O OD1  . ASN A 1 3  ? 5.907   7.819   -2.075  1.00 0.00 ? 8   ASN A OD1  6  
ATOM 8626  N ND2  . ASN A 1 3  ? 4.738   8.164   -3.955  1.00 0.00 ? 8   ASN A ND2  6  
ATOM 8627  H H    . ASN A 1 3  ? 2.191   7.981   -2.447  1.00 0.00 ? 8   ASN A H    6  
ATOM 8628  H HA   . ASN A 1 3  ? 3.149   6.164   -4.406  1.00 0.00 ? 8   ASN A HA   6  
ATOM 8629  H HB2  . ASN A 1 3  ? 3.789   6.389   -1.457  1.00 0.00 ? 8   ASN A HB2  6  
ATOM 8630  H HB3  . ASN A 1 3  ? 4.680   5.401   -2.607  1.00 0.00 ? 8   ASN A HB3  6  
ATOM 8631  H HD21 . ASN A 1 3  ? 4.005   7.862   -4.527  1.00 0.00 ? 8   ASN A HD21 6  
ATOM 8632  H HD22 . ASN A 1 3  ? 5.307   8.933   -4.169  1.00 0.00 ? 8   ASN A HD22 6  
ATOM 8633  N N    . ILE A 1 4  ? 1.158   5.000   -2.071  1.00 0.00 ? 9   ILE A N    6  
ATOM 8634  C CA   . ILE A 1 4  ? 0.346   3.842   -1.693  1.00 0.00 ? 9   ILE A CA   6  
ATOM 8635  C C    . ILE A 1 4  ? -0.555  3.398   -2.819  1.00 0.00 ? 9   ILE A C    6  
ATOM 8636  O O    . ILE A 1 4  ? -0.610  2.212   -3.146  1.00 0.00 ? 9   ILE A O    6  
ATOM 8637  C CB   . ILE A 1 4  ? -0.557  4.090   -0.470  1.00 0.00 ? 9   ILE A CB   6  
ATOM 8638  C CG1  . ILE A 1 4  ? -1.121  5.514   -0.454  1.00 0.00 ? 9   ILE A CG1  6  
ATOM 8639  C CG2  . ILE A 1 4  ? 0.193   3.780   0.798   1.00 0.00 ? 9   ILE A CG2  6  
ATOM 8640  C CD1  . ILE A 1 4  ? -2.319  5.664   0.451   1.00 0.00 ? 9   ILE A CD1  6  
ATOM 8641  H H    . ILE A 1 4  ? 1.028   5.851   -1.603  1.00 0.00 ? 9   ILE A H    6  
ATOM 8642  H HA   . ILE A 1 4  ? 1.021   3.033   -1.452  1.00 0.00 ? 9   ILE A HA   6  
ATOM 8643  H HB   . ILE A 1 4  ? -1.382  3.395   -0.530  1.00 0.00 ? 9   ILE A HB   6  
ATOM 8644  H HG12 . ILE A 1 4  ? -0.357  6.195   -0.109  1.00 0.00 ? 9   ILE A HG12 6  
ATOM 8645  H HG13 . ILE A 1 4  ? -1.421  5.791   -1.451  1.00 0.00 ? 9   ILE A HG13 6  
ATOM 8646  H HG21 . ILE A 1 4  ? 0.428   2.726   0.808   1.00 0.00 ? 9   ILE A HG21 6  
ATOM 8647  H HG22 . ILE A 1 4  ? -0.423  4.024   1.648   1.00 0.00 ? 9   ILE A HG22 6  
ATOM 8648  H HG23 . ILE A 1 4  ? 1.103   4.355   0.831   1.00 0.00 ? 9   ILE A HG23 6  
ATOM 8649  H HD11 . ILE A 1 4  ? -3.132  5.057   0.079   1.00 0.00 ? 9   ILE A HD11 6  
ATOM 8650  H HD12 . ILE A 1 4  ? -2.625  6.699   0.475   1.00 0.00 ? 9   ILE A HD12 6  
ATOM 8651  H HD13 . ILE A 1 4  ? -2.059  5.340   1.448   1.00 0.00 ? 9   ILE A HD13 6  
ATOM 8652  N N    . GLN A 1 5  ? -1.282  4.346   -3.399  1.00 0.00 ? 10  GLN A N    6  
ATOM 8653  C CA   . GLN A 1 5  ? -2.196  4.028   -4.473  1.00 0.00 ? 10  GLN A CA   6  
ATOM 8654  C C    . GLN A 1 5  ? -1.425  3.482   -5.670  1.00 0.00 ? 10  GLN A C    6  
ATOM 8655  O O    . GLN A 1 5  ? -1.849  2.520   -6.304  1.00 0.00 ? 10  GLN A O    6  
ATOM 8656  C CB   . GLN A 1 5  ? -3.015  5.258   -4.869  1.00 0.00 ? 10  GLN A CB   6  
ATOM 8657  C CG   . GLN A 1 5  ? -4.129  4.967   -5.866  1.00 0.00 ? 10  GLN A CG   6  
ATOM 8658  C CD   . GLN A 1 5  ? -5.191  4.037   -5.305  1.00 0.00 ? 10  GLN A CD   6  
ATOM 8659  O OE1  . GLN A 1 5  ? -5.798  4.320   -4.271  1.00 0.00 ? 10  GLN A OE1  6  
ATOM 8660  N NE2  . GLN A 1 5  ? -5.425  2.921   -5.987  1.00 0.00 ? 10  GLN A NE2  6  
ATOM 8661  H H    . GLN A 1 5  ? -1.209  5.272   -3.089  1.00 0.00 ? 10  GLN A H    6  
ATOM 8662  H HA   . GLN A 1 5  ? -2.853  3.263   -4.091  1.00 0.00 ? 10  GLN A HA   6  
ATOM 8663  H HB2  . GLN A 1 5  ? -3.462  5.676   -3.980  1.00 0.00 ? 10  GLN A HB2  6  
ATOM 8664  H HB3  . GLN A 1 5  ? -2.354  5.990   -5.306  1.00 0.00 ? 10  GLN A HB3  6  
ATOM 8665  H HG2  . GLN A 1 5  ? -4.600  5.899   -6.141  1.00 0.00 ? 10  GLN A HG2  6  
ATOM 8666  H HG3  . GLN A 1 5  ? -3.698  4.511   -6.744  1.00 0.00 ? 10  GLN A HG3  6  
ATOM 8667  H HE21 . GLN A 1 5  ? -4.911  2.760   -6.803  1.00 0.00 ? 10  GLN A HE21 6  
ATOM 8668  H HE22 . GLN A 1 5  ? -6.107  2.307   -5.649  1.00 0.00 ? 10  GLN A HE22 6  
ATOM 8669  N N    . MET A 1 6  ? -0.267  4.092   -5.944  1.00 0.00 ? 11  MET A N    6  
ATOM 8670  C CA   . MET A 1 6  ? 0.601   3.660   -7.036  1.00 0.00 ? 11  MET A CA   6  
ATOM 8671  C C    . MET A 1 6  ? 0.900   2.164   -6.900  1.00 0.00 ? 11  MET A C    6  
ATOM 8672  O O    . MET A 1 6  ? 0.949   1.431   -7.889  1.00 0.00 ? 11  MET A O    6  
ATOM 8673  C CB   . MET A 1 6  ? 1.905   4.465   -7.007  1.00 0.00 ? 11  MET A CB   6  
ATOM 8674  C CG   . MET A 1 6  ? 2.887   4.106   -8.110  1.00 0.00 ? 11  MET A CG   6  
ATOM 8675  S SD   . MET A 1 6  ? 4.468   4.955   -7.931  1.00 0.00 ? 11  MET A SD   6  
ATOM 8676  C CE   . MET A 1 6  ? 5.056   4.262   -6.385  1.00 0.00 ? 11  MET A CE   6  
ATOM 8677  H H    . MET A 1 6  ? 0.021   4.841   -5.379  1.00 0.00 ? 11  MET A H    6  
ATOM 8678  H HA   . MET A 1 6  ? 0.088   3.837   -7.969  1.00 0.00 ? 11  MET A HA   6  
ATOM 8679  H HB2  . MET A 1 6  ? 1.665   5.514   -7.100  1.00 0.00 ? 11  MET A HB2  6  
ATOM 8680  H HB3  . MET A 1 6  ? 2.391   4.301   -6.057  1.00 0.00 ? 11  MET A HB3  6  
ATOM 8681  H HG2  . MET A 1 6  ? 3.060   3.042   -8.086  1.00 0.00 ? 11  MET A HG2  6  
ATOM 8682  H HG3  . MET A 1 6  ? 2.453   4.378   -9.061  1.00 0.00 ? 11  MET A HG3  6  
ATOM 8683  H HE1  . MET A 1 6  ? 4.238   4.208   -5.681  1.00 0.00 ? 11  MET A HE1  6  
ATOM 8684  H HE2  . MET A 1 6  ? 5.835   4.891   -5.982  1.00 0.00 ? 11  MET A HE2  6  
ATOM 8685  H HE3  . MET A 1 6  ? 5.447   3.271   -6.560  1.00 0.00 ? 11  MET A HE3  6  
ATOM 8686  N N    . LEU A 1 7  ? 1.079   1.727   -5.652  1.00 0.00 ? 12  LEU A N    6  
ATOM 8687  C CA   . LEU A 1 7  ? 1.353   0.336   -5.335  1.00 0.00 ? 12  LEU A CA   6  
ATOM 8688  C C    . LEU A 1 7  ? 0.057   -0.482  -5.328  1.00 0.00 ? 12  LEU A C    6  
ATOM 8689  O O    . LEU A 1 7  ? 0.006   -1.570  -5.898  1.00 0.00 ? 12  LEU A O    6  
ATOM 8690  C CB   . LEU A 1 7  ? 2.080   0.279   -3.992  1.00 0.00 ? 12  LEU A CB   6  
ATOM 8691  C CG   . LEU A 1 7  ? 1.928   -1.007  -3.187  1.00 0.00 ? 12  LEU A CG   6  
ATOM 8692  C CD1  . LEU A 1 7  ? 2.836   -2.089  -3.738  1.00 0.00 ? 12  LEU A CD1  6  
ATOM 8693  C CD2  . LEU A 1 7  ? 2.224   -0.754  -1.716  1.00 0.00 ? 12  LEU A CD2  6  
ATOM 8694  H H    . LEU A 1 7  ? 1.011   2.364   -4.913  1.00 0.00 ? 12  LEU A H    6  
ATOM 8695  H HA   . LEU A 1 7  ? 2.005   -0.056  -6.103  1.00 0.00 ? 12  LEU A HA   6  
ATOM 8696  H HB2  . LEU A 1 7  ? 3.129   0.419   -4.195  1.00 0.00 ? 12  LEU A HB2  6  
ATOM 8697  H HB3  . LEU A 1 7  ? 1.735   1.102   -3.386  1.00 0.00 ? 12  LEU A HB3  6  
ATOM 8698  H HG   . LEU A 1 7  ? 0.908   -1.348  -3.269  1.00 0.00 ? 12  LEU A HG   6  
ATOM 8699  H HD11 . LEU A 1 7  ? 2.573   -2.289  -4.765  1.00 0.00 ? 12  LEU A HD11 6  
ATOM 8700  H HD12 . LEU A 1 7  ? 2.718   -2.988  -3.153  1.00 0.00 ? 12  LEU A HD12 6  
ATOM 8701  H HD13 . LEU A 1 7  ? 3.862   -1.758  -3.688  1.00 0.00 ? 12  LEU A HD13 6  
ATOM 8702  H HD21 . LEU A 1 7  ? 2.469   -1.688  -1.232  1.00 0.00 ? 12  LEU A HD21 6  
ATOM 8703  H HD22 . LEU A 1 7  ? 1.355   -0.320  -1.243  1.00 0.00 ? 12  LEU A HD22 6  
ATOM 8704  H HD23 . LEU A 1 7  ? 3.058   -0.073  -1.627  1.00 0.00 ? 12  LEU A HD23 6  
ATOM 8705  N N    . LEU A 1 8  ? -0.998  0.061   -4.705  1.00 0.00 ? 13  LEU A N    6  
ATOM 8706  C CA   . LEU A 1 8  ? -2.302  -0.613  -4.664  1.00 0.00 ? 13  LEU A CA   6  
ATOM 8707  C C    . LEU A 1 8  ? -2.769  -0.980  -6.072  1.00 0.00 ? 13  LEU A C    6  
ATOM 8708  O O    . LEU A 1 8  ? -3.154  -2.123  -6.324  1.00 0.00 ? 13  LEU A O    6  
ATOM 8709  C CB   . LEU A 1 8  ? -3.354  0.294   -4.013  1.00 0.00 ? 13  LEU A CB   6  
ATOM 8710  C CG   . LEU A 1 8  ? -3.286  0.400   -2.493  1.00 0.00 ? 13  LEU A CG   6  
ATOM 8711  C CD1  . LEU A 1 8  ? -4.117  1.578   -2.004  1.00 0.00 ? 13  LEU A CD1  6  
ATOM 8712  C CD2  . LEU A 1 8  ? -3.774  -0.894  -1.864  1.00 0.00 ? 13  LEU A CD2  6  
ATOM 8713  H H    . LEU A 1 8  ? -0.900  0.944   -4.275  1.00 0.00 ? 13  LEU A H    6  
ATOM 8714  H HA   . LEU A 1 8  ? -2.195  -1.524  -4.083  1.00 0.00 ? 13  LEU A HA   6  
ATOM 8715  H HB2  . LEU A 1 8  ? -3.242  1.287   -4.425  1.00 0.00 ? 13  LEU A HB2  6  
ATOM 8716  H HB3  . LEU A 1 8  ? -4.332  -0.078  -4.281  1.00 0.00 ? 13  LEU A HB3  6  
ATOM 8717  H HG   . LEU A 1 8  ? -2.263  0.560   -2.191  1.00 0.00 ? 13  LEU A HG   6  
ATOM 8718  H HD11 . LEU A 1 8  ? -4.664  2.002   -2.832  1.00 0.00 ? 13  LEU A HD11 6  
ATOM 8719  H HD12 . LEU A 1 8  ? -3.464  2.327   -1.582  1.00 0.00 ? 13  LEU A HD12 6  
ATOM 8720  H HD13 . LEU A 1 8  ? -4.813  1.239   -1.249  1.00 0.00 ? 13  LEU A HD13 6  
ATOM 8721  H HD21 . LEU A 1 8  ? -3.145  -1.710  -2.187  1.00 0.00 ? 13  LEU A HD21 6  
ATOM 8722  H HD22 . LEU A 1 8  ? -4.793  -1.083  -2.170  1.00 0.00 ? 13  LEU A HD22 6  
ATOM 8723  H HD23 . LEU A 1 8  ? -3.731  -0.811  -0.790  1.00 0.00 ? 13  LEU A HD23 6  
ATOM 8724  N N    . GLU A 1 9  ? -2.720  0.000   -6.985  1.00 0.00 ? 14  GLU A N    6  
ATOM 8725  C CA   . GLU A 1 9  ? -3.123  -0.214  -8.377  1.00 0.00 ? 14  GLU A CA   6  
ATOM 8726  C C    . GLU A 1 9  ? -2.483  -1.479  -8.934  1.00 0.00 ? 14  GLU A C    6  
ATOM 8727  O O    . GLU A 1 9  ? -3.102  -2.209  -9.710  1.00 0.00 ? 14  GLU A O    6  
ATOM 8728  C CB   . GLU A 1 9  ? -2.733  0.989   -9.243  1.00 0.00 ? 14  GLU A CB   6  
ATOM 8729  C CG   . GLU A 1 9  ? -3.499  2.258   -8.910  1.00 0.00 ? 14  GLU A CG   6  
ATOM 8730  C CD   . GLU A 1 9  ? -3.033  3.454   -9.720  1.00 0.00 ? 14  GLU A CD   6  
ATOM 8731  O OE1  . GLU A 1 9  ? -1.851  3.838   -9.586  1.00 0.00 ? 14  GLU A OE1  6  
ATOM 8732  O OE2  . GLU A 1 9  ? -3.849  4.003   -10.489 1.00 0.00 ? 14  GLU A OE2  6  
ATOM 8733  H H    . GLU A 1 9  ? -2.396  0.886   -6.715  1.00 0.00 ? 14  GLU A H    6  
ATOM 8734  H HA   . GLU A 1 9  ? -4.197  -0.327  -8.398  1.00 0.00 ? 14  GLU A HA   6  
ATOM 8735  H HB2  . GLU A 1 9  ? -1.679  1.184   -9.112  1.00 0.00 ? 14  GLU A HB2  6  
ATOM 8736  H HB3  . GLU A 1 9  ? -2.917  0.745   -10.280 1.00 0.00 ? 14  GLU A HB3  6  
ATOM 8737  H HG2  . GLU A 1 9  ? -4.546  2.094   -9.111  1.00 0.00 ? 14  GLU A HG2  6  
ATOM 8738  H HG3  . GLU A 1 9  ? -3.365  2.478   -7.864  1.00 0.00 ? 14  GLU A HG3  6  
ATOM 8739  N N    . ALA A 1 10 ? -1.242  -1.739  -8.511  1.00 0.00 ? 15  ALA A N    6  
ATOM 8740  C CA   . ALA A 1 10 ? -0.510  -2.922  -8.941  1.00 0.00 ? 15  ALA A CA   6  
ATOM 8741  C C    . ALA A 1 10 ? -1.340  -4.175  -8.735  1.00 0.00 ? 15  ALA A C    6  
ATOM 8742  O O    . ALA A 1 10 ? -1.685  -4.857  -9.698  1.00 0.00 ? 15  ALA A O    6  
ATOM 8743  C CB   . ALA A 1 10 ? 0.793   -3.052  -8.172  1.00 0.00 ? 15  ALA A CB   6  
ATOM 8744  H H    . ALA A 1 10 ? -0.813  -1.120  -7.884  1.00 0.00 ? 15  ALA A H    6  
ATOM 8745  H HA   . ALA A 1 10 ? -0.279  -2.815  -9.990  1.00 0.00 ? 15  ALA A HA   6  
ATOM 8746  H HB1  . ALA A 1 10 ? 1.549   -3.476  -8.815  1.00 0.00 ? 15  ALA A HB1  6  
ATOM 8747  H HB2  . ALA A 1 10 ? 0.647   -3.697  -7.318  1.00 0.00 ? 15  ALA A HB2  6  
ATOM 8748  H HB3  . ALA A 1 10 ? 1.111   -2.077  -7.833  1.00 0.00 ? 15  ALA A HB3  6  
ATOM 8749  N N    . ALA A 1 11 ? -1.638  -4.476  -7.468  1.00 0.00 ? 16  ALA A N    6  
ATOM 8750  C CA   . ALA A 1 11 ? -2.408  -5.661  -7.112  1.00 0.00 ? 16  ALA A CA   6  
ATOM 8751  C C    . ALA A 1 11 ? -3.561  -5.919  -8.079  1.00 0.00 ? 16  ALA A C    6  
ATOM 8752  O O    . ALA A 1 11 ? -3.704  -7.023  -8.596  1.00 0.00 ? 16  ALA A O    6  
ATOM 8753  C CB   . ALA A 1 11 ? -2.948  -5.559  -5.698  1.00 0.00 ? 16  ALA A CB   6  
ATOM 8754  H H    . ALA A 1 11 ? -1.318  -3.887  -6.752  1.00 0.00 ? 16  ALA A H    6  
ATOM 8755  H HA   . ALA A 1 11 ? -1.726  -6.494  -7.144  1.00 0.00 ? 16  ALA A HA   6  
ATOM 8756  H HB1  . ALA A 1 11 ? -3.294  -4.551  -5.515  1.00 0.00 ? 16  ALA A HB1  6  
ATOM 8757  H HB2  . ALA A 1 11 ? -2.169  -5.809  -4.996  1.00 0.00 ? 16  ALA A HB2  6  
ATOM 8758  H HB3  . ALA A 1 11 ? -3.771  -6.250  -5.587  1.00 0.00 ? 16  ALA A HB3  6  
ATOM 8759  N N    . ASP A 1 12 ? -4.382  -4.891  -8.313  1.00 0.00 ? 17  ASP A N    6  
ATOM 8760  C CA   . ASP A 1 12 ? -5.529  -5.002  -9.219  1.00 0.00 ? 17  ASP A CA   6  
ATOM 8761  C C    . ASP A 1 12 ? -5.136  -5.675  -10.533 1.00 0.00 ? 17  ASP A C    6  
ATOM 8762  O O    . ASP A 1 12 ? -5.878  -6.504  -11.063 1.00 0.00 ? 17  ASP A O    6  
ATOM 8763  C CB   . ASP A 1 12 ? -6.123  -3.616  -9.498  1.00 0.00 ? 17  ASP A CB   6  
ATOM 8764  C CG   . ASP A 1 12 ? -6.578  -2.912  -8.232  1.00 0.00 ? 17  ASP A CG   6  
ATOM 8765  O OD1  . ASP A 1 12 ? -7.493  -3.430  -7.557  1.00 0.00 ? 17  ASP A OD1  6  
ATOM 8766  O OD2  . ASP A 1 12 ? -6.013  -1.845  -7.912  1.00 0.00 ? 17  ASP A OD2  6  
ATOM 8767  H H    . ASP A 1 12 ? -4.212  -4.036  -7.864  1.00 0.00 ? 17  ASP A H    6  
ATOM 8768  H HA   . ASP A 1 12 ? -6.276  -5.609  -8.730  1.00 0.00 ? 17  ASP A HA   6  
ATOM 8769  H HB2  . ASP A 1 12 ? -5.377  -3.003  -9.980  1.00 0.00 ? 17  ASP A HB2  6  
ATOM 8770  H HB3  . ASP A 1 12 ? -6.975  -3.723  -10.154 1.00 0.00 ? 17  ASP A HB3  6  
ATOM 8771  N N    . TYR A 1 13 ? -3.959  -5.317  -11.048 1.00 0.00 ? 18  TYR A N    6  
ATOM 8772  C CA   . TYR A 1 13 ? -3.450  -5.887  -12.292 1.00 0.00 ? 18  TYR A CA   6  
ATOM 8773  C C    . TYR A 1 13 ? -2.743  -7.215  -12.040 1.00 0.00 ? 18  TYR A C    6  
ATOM 8774  O O    . TYR A 1 13 ? -2.969  -8.186  -12.762 1.00 0.00 ? 18  TYR A O    6  
ATOM 8775  C CB   . TYR A 1 13 ? -2.490  -4.906  -12.971 1.00 0.00 ? 18  TYR A CB   6  
ATOM 8776  C CG   . TYR A 1 13 ? -1.884  -5.434  -14.253 1.00 0.00 ? 18  TYR A CG   6  
ATOM 8777  C CD1  . TYR A 1 13 ? -2.649  -5.565  -15.404 1.00 0.00 ? 18  TYR A CD1  6  
ATOM 8778  C CD2  . TYR A 1 13 ? -0.547  -5.809  -14.306 1.00 0.00 ? 18  TYR A CD2  6  
ATOM 8779  C CE1  . TYR A 1 13 ? -2.098  -6.051  -16.574 1.00 0.00 ? 18  TYR A CE1  6  
ATOM 8780  C CE2  . TYR A 1 13 ? 0.011   -6.296  -15.472 1.00 0.00 ? 18  TYR A CE2  6  
ATOM 8781  C CZ   . TYR A 1 13 ? -0.768  -6.415  -16.604 1.00 0.00 ? 18  TYR A CZ   6  
ATOM 8782  O OH   . TYR A 1 13 ? -0.215  -6.900  -17.767 1.00 0.00 ? 18  TYR A OH   6  
ATOM 8783  H H    . TYR A 1 13 ? -3.412  -4.655  -10.571 1.00 0.00 ? 18  TYR A H    6  
ATOM 8784  H HA   . TYR A 1 13 ? -4.291  -6.066  -12.936 1.00 0.00 ? 18  TYR A HA   6  
ATOM 8785  H HB2  . TYR A 1 13 ? -3.023  -3.997  -13.207 1.00 0.00 ? 18  TYR A HB2  6  
ATOM 8786  H HB3  . TYR A 1 13 ? -1.682  -4.677  -12.291 1.00 0.00 ? 18  TYR A HB3  6  
ATOM 8787  H HD1  . TYR A 1 13 ? -3.689  -5.277  -15.379 1.00 0.00 ? 18  TYR A HD1  6  
ATOM 8788  H HD2  . TYR A 1 13 ? 0.060   -5.718  -13.415 1.00 0.00 ? 18  TYR A HD2  6  
ATOM 8789  H HE1  . TYR A 1 13 ? -2.709  -6.146  -17.460 1.00 0.00 ? 18  TYR A HE1  6  
ATOM 8790  H HE2  . TYR A 1 13 ? 1.053   -6.581  -15.494 1.00 0.00 ? 18  TYR A HE2  6  
ATOM 8791  H HH   . TYR A 1 13 ? -0.043  -6.172  -18.369 1.00 0.00 ? 18  TYR A HH   6  
ATOM 8792  N N    . LEU A 1 14 ? -1.893  -7.250  -11.014 1.00 0.00 ? 19  LEU A N    6  
ATOM 8793  C CA   . LEU A 1 14 ? -1.158  -8.465  -10.664 1.00 0.00 ? 19  LEU A CA   6  
ATOM 8794  C C    . LEU A 1 14 ? -2.132  -9.625  -10.458 1.00 0.00 ? 19  LEU A C    6  
ATOM 8795  O O    . LEU A 1 14 ? -1.828  -10.769 -10.801 1.00 0.00 ? 19  LEU A O    6  
ATOM 8796  C CB   . LEU A 1 14 ? -0.327  -8.248  -9.394  1.00 0.00 ? 19  LEU A CB   6  
ATOM 8797  C CG   . LEU A 1 14 ? 0.498   -6.958  -9.361  1.00 0.00 ? 19  LEU A CG   6  
ATOM 8798  C CD1  . LEU A 1 14 ? 1.185   -6.798  -8.019  1.00 0.00 ? 19  LEU A CD1  6  
ATOM 8799  C CD2  . LEU A 1 14 ? 1.519   -6.926  -10.489 1.00 0.00 ? 19  LEU A CD2  6  
ATOM 8800  H H    . LEU A 1 14 ? -1.762  -6.441  -10.477 1.00 0.00 ? 19  LEU A H    6  
ATOM 8801  H HA   . LEU A 1 14 ? -0.498  -8.703  -11.485 1.00 0.00 ? 19  LEU A HA   6  
ATOM 8802  H HB2  . LEU A 1 14 ? -0.998  -8.242  -8.549  1.00 0.00 ? 19  LEU A HB2  6  
ATOM 8803  H HB3  . LEU A 1 14 ? 0.349   -9.083  -9.289  1.00 0.00 ? 19  LEU A HB3  6  
ATOM 8804  H HG   . LEU A 1 14 ? -0.164  -6.123  -9.490  1.00 0.00 ? 19  LEU A HG   6  
ATOM 8805  H HD11 . LEU A 1 14 ? 0.521   -7.129  -7.229  1.00 0.00 ? 19  LEU A HD11 6  
ATOM 8806  H HD12 . LEU A 1 14 ? 1.435   -5.754  -7.870  1.00 0.00 ? 19  LEU A HD12 6  
ATOM 8807  H HD13 . LEU A 1 14 ? 2.086   -7.390  -8.003  1.00 0.00 ? 19  LEU A HD13 6  
ATOM 8808  H HD21 . LEU A 1 14 ? 2.314   -7.625  -10.277 1.00 0.00 ? 19  LEU A HD21 6  
ATOM 8809  H HD22 . LEU A 1 14 ? 1.931   -5.928  -10.569 1.00 0.00 ? 19  LEU A HD22 6  
ATOM 8810  H HD23 . LEU A 1 14 ? 1.041   -7.194  -11.419 1.00 0.00 ? 19  LEU A HD23 6  
ATOM 8811  N N    . GLU A 1 15 ? -3.311  -9.311  -9.908  1.00 0.00 ? 20  GLU A N    6  
ATOM 8812  C CA   . GLU A 1 15 ? -4.345  -10.321 -9.671  1.00 0.00 ? 20  GLU A CA   6  
ATOM 8813  C C    . GLU A 1 15 ? -4.929  -10.826 -10.989 1.00 0.00 ? 20  GLU A C    6  
ATOM 8814  O O    . GLU A 1 15 ? -5.112  -12.030 -11.174 1.00 0.00 ? 20  GLU A O    6  
ATOM 8815  C CB   . GLU A 1 15 ? -5.462  -9.749  -8.795  1.00 0.00 ? 20  GLU A CB   6  
ATOM 8816  C CG   . GLU A 1 15 ? -5.024  -9.455  -7.370  1.00 0.00 ? 20  GLU A CG   6  
ATOM 8817  C CD   . GLU A 1 15 ? -6.093  -8.746  -6.558  1.00 0.00 ? 20  GLU A CD   6  
ATOM 8818  O OE1  . GLU A 1 15 ? -6.470  -7.614  -6.931  1.00 0.00 ? 20  GLU A OE1  6  
ATOM 8819  O OE2  . GLU A 1 15 ? -6.550  -9.322  -5.549  1.00 0.00 ? 20  GLU A OE2  6  
ATOM 8820  H H    . GLU A 1 15 ? -3.494  -8.369  -9.667  1.00 0.00 ? 20  GLU A H    6  
ATOM 8821  H HA   . GLU A 1 15 ? -3.887  -11.150 -9.155  1.00 0.00 ? 20  GLU A HA   6  
ATOM 8822  H HB2  . GLU A 1 15 ? -5.816  -8.829  -9.238  1.00 0.00 ? 20  GLU A HB2  6  
ATOM 8823  H HB3  . GLU A 1 15 ? -6.277  -10.458 -8.760  1.00 0.00 ? 20  GLU A HB3  6  
ATOM 8824  H HG2  . GLU A 1 15 ? -4.785  -10.387 -6.883  1.00 0.00 ? 20  GLU A HG2  6  
ATOM 8825  H HG3  . GLU A 1 15 ? -4.143  -8.831  -7.400  1.00 0.00 ? 20  GLU A HG3  6  
ATOM 8826  N N    . ARG A 1 16 ? -5.218  -9.894  -11.898 1.00 0.00 ? 21  ARG A N    6  
ATOM 8827  C CA   . ARG A 1 16 ? -5.783  -10.235 -13.204 1.00 0.00 ? 21  ARG A CA   6  
ATOM 8828  C C    . ARG A 1 16 ? -4.796  -11.055 -14.036 1.00 0.00 ? 21  ARG A C    6  
ATOM 8829  O O    . ARG A 1 16 ? -3.606  -10.673 -14.099 1.00 0.00 ? 21  ARG A O    6  
ATOM 8830  C CB   . ARG A 1 16 ? -6.171  -8.956  -13.955 1.00 0.00 ? 21  ARG A CB   6  
ATOM 8831  C CG   . ARG A 1 16 ? -6.884  -9.210  -15.273 1.00 0.00 ? 21  ARG A CG   6  
ATOM 8832  C CD   . ARG A 1 16 ? -7.265  -7.905  -15.958 1.00 0.00 ? 21  ARG A CD   6  
ATOM 8833  N NE   . ARG A 1 16 ? -8.156  -7.086  -15.133 1.00 0.00 ? 21  ARG A NE   6  
ATOM 8834  C CZ   . ARG A 1 16 ? -8.599  -5.876  -15.483 1.00 0.00 ? 21  ARG A CZ   6  
ATOM 8835  N NH1  . ARG A 1 16 ? -8.240  -5.334  -16.646 1.00 0.00 ? 21  ARG A NH1  6  
ATOM 8836  N NH2  . ARG A 1 16 ? -9.404  -5.204  -14.667 1.00 0.00 ? 21  ARG A NH2  6  
ATOM 8837  O OXT  . ARG A 1 16 ? -5.220  -12.076 -14.617 1.00 0.00 ? 21  ARG A OXT  6  
ATOM 8838  H H    . ARG A 1 16 ? -5.047  -8.952  -11.686 1.00 0.00 ? 21  ARG A H    6  
ATOM 8839  H HA   . ARG A 1 16 ? -6.670  -10.825 -13.035 1.00 0.00 ? 21  ARG A HA   6  
ATOM 8840  H HB2  . ARG A 1 16 ? -6.823  -8.371  -13.324 1.00 0.00 ? 21  ARG A HB2  6  
ATOM 8841  H HB3  . ARG A 1 16 ? -5.275  -8.389  -14.157 1.00 0.00 ? 21  ARG A HB3  6  
ATOM 8842  H HG2  . ARG A 1 16 ? -6.230  -9.769  -15.925 1.00 0.00 ? 21  ARG A HG2  6  
ATOM 8843  H HG3  . ARG A 1 16 ? -7.781  -9.781  -15.083 1.00 0.00 ? 21  ARG A HG3  6  
ATOM 8844  H HD2  . ARG A 1 16 ? -6.364  -7.345  -16.162 1.00 0.00 ? 21  ARG A HD2  6  
ATOM 8845  H HD3  . ARG A 1 16 ? -7.762  -8.135  -16.889 1.00 0.00 ? 21  ARG A HD3  6  
ATOM 8846  H HE   . ARG A 1 16 ? -8.440  -7.457  -14.271 1.00 0.00 ? 21  ARG A HE   6  
ATOM 8847  H HH11 . ARG A 1 16 ? -7.636  -5.833  -17.266 1.00 0.00 ? 21  ARG A HH11 6  
ATOM 8848  H HH12 . ARG A 1 16 ? -8.577  -4.428  -16.899 1.00 0.00 ? 21  ARG A HH12 6  
ATOM 8849  H HH21 . ARG A 1 16 ? -9.677  -5.604  -13.791 1.00 0.00 ? 21  ARG A HH21 6  
ATOM 8850  H HH22 . ARG A 1 16 ? -9.736  -4.297  -14.925 1.00 0.00 ? 21  ARG A HH22 6  
ATOM 8851  N N    . SER B 2 1  ? 2.245   6.723   -18.233 1.00 0.00 ? 295 SER B N    6  
ATOM 8852  C CA   . SER B 2 1  ? 1.729   8.118   -18.293 1.00 0.00 ? 295 SER B CA   6  
ATOM 8853  C C    . SER B 2 1  ? 2.869   9.134   -18.376 1.00 0.00 ? 295 SER B C    6  
ATOM 8854  O O    . SER B 2 1  ? 2.885   9.986   -19.266 1.00 0.00 ? 295 SER B O    6  
ATOM 8855  C CB   . SER B 2 1  ? 0.872   8.384   -17.051 1.00 0.00 ? 295 SER B CB   6  
ATOM 8856  O OG   . SER B 2 1  ? -0.236  7.502   -16.994 1.00 0.00 ? 295 SER B OG   6  
ATOM 8857  H H1   . SER B 2 1  ? 2.696   6.587   -17.305 1.00 0.00 ? 295 SER B H1   6  
ATOM 8858  H H2   . SER B 2 1  ? 2.932   6.603   -19.005 1.00 0.00 ? 295 SER B H2   6  
ATOM 8859  H H3   . SER B 2 1  ? 1.434   6.080   -18.350 1.00 0.00 ? 295 SER B H3   6  
ATOM 8860  H HA   . SER B 2 1  ? 1.112   8.216   -19.175 1.00 0.00 ? 295 SER B HA   6  
ATOM 8861  H HB2  . SER B 2 1  ? 1.473   8.242   -16.165 1.00 0.00 ? 295 SER B HB2  6  
ATOM 8862  H HB3  . SER B 2 1  ? 0.507   9.400   -17.079 1.00 0.00 ? 295 SER B HB3  6  
ATOM 8863  H HG   . SER B 2 1  ? -1.048  8.000   -17.109 1.00 0.00 ? 295 SER B HG   6  
ATOM 8864  N N    . LEU B 2 2  ? 3.819   9.038   -17.438 1.00 0.00 ? 296 LEU B N    6  
ATOM 8865  C CA   . LEU B 2 2  ? 4.970   9.946   -17.391 1.00 0.00 ? 296 LEU B CA   6  
ATOM 8866  C C    . LEU B 2 2  ? 4.526   11.396  -17.134 1.00 0.00 ? 296 LEU B C    6  
ATOM 8867  O O    . LEU B 2 2  ? 5.252   12.341  -17.449 1.00 0.00 ? 296 LEU B O    6  
ATOM 8868  C CB   . LEU B 2 2  ? 5.767   9.852   -18.702 1.00 0.00 ? 296 LEU B CB   6  
ATOM 8869  C CG   . LEU B 2 2  ? 7.146   10.523  -18.688 1.00 0.00 ? 296 LEU B CG   6  
ATOM 8870  C CD1  . LEU B 2 2  ? 8.058   9.852   -17.671 1.00 0.00 ? 296 LEU B CD1  6  
ATOM 8871  C CD2  . LEU B 2 2  ? 7.771   10.484  -20.077 1.00 0.00 ? 296 LEU B CD2  6  
ATOM 8872  H H    . LEU B 2 2  ? 3.744   8.337   -16.756 1.00 0.00 ? 296 LEU B H    6  
ATOM 8873  H HA   . LEU B 2 2  ? 5.602   9.630   -16.576 1.00 0.00 ? 296 LEU B HA   6  
ATOM 8874  H HB2  . LEU B 2 2  ? 5.902   8.808   -18.940 1.00 0.00 ? 296 LEU B HB2  6  
ATOM 8875  H HB3  . LEU B 2 2  ? 5.181   10.308  -19.487 1.00 0.00 ? 296 LEU B HB3  6  
ATOM 8876  H HG   . LEU B 2 2  ? 7.034   11.558  -18.402 1.00 0.00 ? 296 LEU B HG   6  
ATOM 8877  H HD11 . LEU B 2 2  ? 9.089   10.020  -17.944 1.00 0.00 ? 296 LEU B HD11 6  
ATOM 8878  H HD12 . LEU B 2 2  ? 7.858   8.790   -17.653 1.00 0.00 ? 296 LEU B HD12 6  
ATOM 8879  H HD13 . LEU B 2 2  ? 7.873   10.270  -16.692 1.00 0.00 ? 296 LEU B HD13 6  
ATOM 8880  H HD21 . LEU B 2 2  ? 8.746   10.023  -20.021 1.00 0.00 ? 296 LEU B HD21 6  
ATOM 8881  H HD22 . LEU B 2 2  ? 7.869   11.491  -20.456 1.00 0.00 ? 296 LEU B HD22 6  
ATOM 8882  H HD23 . LEU B 2 2  ? 7.140   9.910   -20.740 1.00 0.00 ? 296 LEU B HD23 6  
ATOM 8883  N N    . GLN B 2 3  ? 3.335   11.565  -16.552 1.00 0.00 ? 297 GLN B N    6  
ATOM 8884  C CA   . GLN B 2 3  ? 2.806   12.894  -16.248 1.00 0.00 ? 297 GLN B CA   6  
ATOM 8885  C C    . GLN B 2 3  ? 3.514   13.490  -15.030 1.00 0.00 ? 297 GLN B C    6  
ATOM 8886  O O    . GLN B 2 3  ? 4.145   14.544  -15.121 1.00 0.00 ? 297 GLN B O    6  
ATOM 8887  C CB   . GLN B 2 3  ? 1.295   12.824  -15.989 1.00 0.00 ? 297 GLN B CB   6  
ATOM 8888  C CG   . GLN B 2 3  ? 0.502   12.162  -17.109 1.00 0.00 ? 297 GLN B CG   6  
ATOM 8889  C CD   . GLN B 2 3  ? 0.547   12.941  -18.414 1.00 0.00 ? 297 GLN B CD   6  
ATOM 8890  O OE1  . GLN B 2 3  ? 1.615   13.145  -18.992 1.00 0.00 ? 297 GLN B OE1  6  
ATOM 8891  N NE2  . GLN B 2 3  ? -0.616  13.379  -18.885 1.00 0.00 ? 297 GLN B NE2  6  
ATOM 8892  H H    . GLN B 2 3  ? 2.802   10.778  -16.314 1.00 0.00 ? 297 GLN B H    6  
ATOM 8893  H HA   . GLN B 2 3  ? 2.989   13.528  -17.103 1.00 0.00 ? 297 GLN B HA   6  
ATOM 8894  H HB2  . GLN B 2 3  ? 1.123   12.266  -15.081 1.00 0.00 ? 297 GLN B HB2  6  
ATOM 8895  H HB3  . GLN B 2 3  ? 0.920   13.828  -15.859 1.00 0.00 ? 297 GLN B HB3  6  
ATOM 8896  H HG2  . GLN B 2 3  ? 0.908   11.179  -17.286 1.00 0.00 ? 297 GLN B HG2  6  
ATOM 8897  H HG3  . GLN B 2 3  ? -0.528  12.073  -16.798 1.00 0.00 ? 297 GLN B HG3  6  
ATOM 8898  H HE21 . GLN B 2 3  ? -1.429  13.178  -18.375 1.00 0.00 ? 297 GLN B HE21 6  
ATOM 8899  H HE22 . GLN B 2 3  ? -0.614  13.883  -19.725 1.00 0.00 ? 297 GLN B HE22 6  
ATOM 8900  N N    . ASN B 2 4  ? 3.395   12.797  -13.894 1.00 0.00 ? 298 ASN B N    6  
ATOM 8901  C CA   . ASN B 2 4  ? 4.009   13.240  -12.636 1.00 0.00 ? 298 ASN B CA   6  
ATOM 8902  C C    . ASN B 2 4  ? 4.389   12.056  -11.731 1.00 0.00 ? 298 ASN B C    6  
ATOM 8903  O O    . ASN B 2 4  ? 5.333   12.160  -10.946 1.00 0.00 ? 298 ASN B O    6  
ATOM 8904  C CB   . ASN B 2 4  ? 3.065   14.174  -11.867 1.00 0.00 ? 298 ASN B CB   6  
ATOM 8905  C CG   . ASN B 2 4  ? 2.762   15.466  -12.608 1.00 0.00 ? 298 ASN B CG   6  
ATOM 8906  O OD1  . ASN B 2 4  ? 2.055   15.469  -13.616 1.00 0.00 ? 298 ASN B OD1  6  
ATOM 8907  N ND2  . ASN B 2 4  ? 3.303   16.574  -12.112 1.00 0.00 ? 298 ASN B ND2  6  
ATOM 8908  H H    . ASN B 2 4  ? 2.873   11.972  -13.907 1.00 0.00 ? 298 ASN B H    6  
ATOM 8909  H HA   . ASN B 2 4  ? 4.907   13.784  -12.885 1.00 0.00 ? 298 ASN B HA   6  
ATOM 8910  H HB2  . ASN B 2 4  ? 2.131   13.660  -11.692 1.00 0.00 ? 298 ASN B HB2  6  
ATOM 8911  H HB3  . ASN B 2 4  ? 3.514   14.422  -10.916 1.00 0.00 ? 298 ASN B HB3  6  
ATOM 8912  H HD21 . ASN B 2 4  ? 3.860   16.502  -11.308 1.00 0.00 ? 298 ASN B HD21 6  
ATOM 8913  H HD22 . ASN B 2 4  ? 3.125   17.422  -12.572 1.00 0.00 ? 298 ASN B HD22 6  
ATOM 8914  N N    . ASN B 2 5  ? 3.657   10.940  -11.836 1.00 0.00 ? 299 ASN B N    6  
ATOM 8915  C CA   . ASN B 2 5  ? 3.930   9.759   -11.017 1.00 0.00 ? 299 ASN B CA   6  
ATOM 8916  C C    . ASN B 2 5  ? 5.143   8.989   -11.543 1.00 0.00 ? 299 ASN B C    6  
ATOM 8917  O O    . ASN B 2 5  ? 5.971   8.525   -10.758 1.00 0.00 ? 299 ASN B O    6  
ATOM 8918  C CB   . ASN B 2 5  ? 2.704   8.834   -10.982 1.00 0.00 ? 299 ASN B CB   6  
ATOM 8919  C CG   . ASN B 2 5  ? 2.293   8.346   -12.364 1.00 0.00 ? 299 ASN B CG   6  
ATOM 8920  O OD1  . ASN B 2 5  ? 1.901   9.136   -13.223 1.00 0.00 ? 299 ASN B OD1  6  
ATOM 8921  N ND2  . ASN B 2 5  ? 2.387   7.038   -12.586 1.00 0.00 ? 299 ASN B ND2  6  
ATOM 8922  H H    . ASN B 2 5  ? 2.914   10.910  -12.469 1.00 0.00 ? 299 ASN B H    6  
ATOM 8923  H HA   . ASN B 2 5  ? 4.142   10.095  -10.013 1.00 0.00 ? 299 ASN B HA   6  
ATOM 8924  H HB2  . ASN B 2 5  ? 2.928   7.974   -10.370 1.00 0.00 ? 299 ASN B HB2  6  
ATOM 8925  H HB3  . ASN B 2 5  ? 1.871   9.369   -10.549 1.00 0.00 ? 299 ASN B HB3  6  
ATOM 8926  H HD21 . ASN B 2 5  ? 2.712   6.464   -11.859 1.00 0.00 ? 299 ASN B HD21 6  
ATOM 8927  H HD22 . ASN B 2 5  ? 2.129   6.699   -13.469 1.00 0.00 ? 299 ASN B HD22 6  
ATOM 8928  N N    . GLN B 2 6  ? 5.241   8.862   -12.874 1.00 0.00 ? 300 GLN B N    6  
ATOM 8929  C CA   . GLN B 2 6  ? 6.351   8.154   -13.517 1.00 0.00 ? 300 GLN B CA   6  
ATOM 8930  C C    . GLN B 2 6  ? 6.288   6.649   -13.244 1.00 0.00 ? 300 GLN B C    6  
ATOM 8931  O O    . GLN B 2 6  ? 6.010   6.220   -12.121 1.00 0.00 ? 300 GLN B O    6  
ATOM 8932  C CB   . GLN B 2 6  ? 7.698   8.718   -13.048 1.00 0.00 ? 300 GLN B CB   6  
ATOM 8933  C CG   . GLN B 2 6  ? 7.886   10.196  -13.362 1.00 0.00 ? 300 GLN B CG   6  
ATOM 8934  C CD   . GLN B 2 6  ? 9.196   10.780  -12.841 1.00 0.00 ? 300 GLN B CD   6  
ATOM 8935  O OE1  . GLN B 2 6  ? 9.477   11.959  -13.052 1.00 0.00 ? 300 GLN B OE1  6  
ATOM 8936  N NE2  . GLN B 2 6  ? 10.009  9.972   -12.156 1.00 0.00 ? 300 GLN B NE2  6  
ATOM 8937  H H    . GLN B 2 6  ? 4.545   9.261   -13.440 1.00 0.00 ? 300 GLN B H    6  
ATOM 8938  H HA   . GLN B 2 6  ? 6.261   8.314   -14.581 1.00 0.00 ? 300 GLN B HA   6  
ATOM 8939  H HB2  . GLN B 2 6  ? 7.780   8.584   -11.980 1.00 0.00 ? 300 GLN B HB2  6  
ATOM 8940  H HB3  . GLN B 2 6  ? 8.492   8.166   -13.531 1.00 0.00 ? 300 GLN B HB3  6  
ATOM 8941  H HG2  . GLN B 2 6  ? 7.860   10.324  -14.433 1.00 0.00 ? 300 GLN B HG2  6  
ATOM 8942  H HG3  . GLN B 2 6  ? 7.067   10.746  -12.920 1.00 0.00 ? 300 GLN B HG3  6  
ATOM 8943  H HE21 . GLN B 2 6  ? 9.737   9.043   -12.015 1.00 0.00 ? 300 GLN B HE21 6  
ATOM 8944  H HE22 . GLN B 2 6  ? 10.850  10.346  -11.821 1.00 0.00 ? 300 GLN B HE22 6  
ATOM 8945  N N    . PRO B 2 7  ? 6.554   5.822   -14.276 1.00 0.00 ? 301 PRO B N    6  
ATOM 8946  C CA   . PRO B 2 7  ? 6.533   4.356   -14.148 1.00 0.00 ? 301 PRO B CA   6  
ATOM 8947  C C    . PRO B 2 7  ? 7.745   3.793   -13.394 1.00 0.00 ? 301 PRO B C    6  
ATOM 8948  O O    . PRO B 2 7  ? 7.837   2.581   -13.187 1.00 0.00 ? 301 PRO B O    6  
ATOM 8949  C CB   . PRO B 2 7  ? 6.539   3.884   -15.603 1.00 0.00 ? 301 PRO B CB   6  
ATOM 8950  C CG   . PRO B 2 7  ? 7.241   4.965   -16.349 1.00 0.00 ? 301 PRO B CG   6  
ATOM 8951  C CD   . PRO B 2 7  ? 6.898   6.251   -15.647 1.00 0.00 ? 301 PRO B CD   6  
ATOM 8952  H HA   . PRO B 2 7  ? 5.626   4.019   -13.666 1.00 0.00 ? 301 PRO B HA   6  
ATOM 8953  H HB2  . PRO B 2 7  ? 7.066   2.943   -15.677 1.00 0.00 ? 301 PRO B HB2  6  
ATOM 8954  H HB3  . PRO B 2 7  ? 5.524   3.763   -15.949 1.00 0.00 ? 301 PRO B HB3  6  
ATOM 8955  H HG2  . PRO B 2 7  ? 8.308   4.796   -16.320 1.00 0.00 ? 301 PRO B HG2  6  
ATOM 8956  H HG3  . PRO B 2 7  ? 6.893   4.991   -17.371 1.00 0.00 ? 301 PRO B HG3  6  
ATOM 8957  H HD2  . PRO B 2 7  ? 7.749   6.916   -15.640 1.00 0.00 ? 301 PRO B HD2  6  
ATOM 8958  H HD3  . PRO B 2 7  ? 6.052   6.725   -16.124 1.00 0.00 ? 301 PRO B HD3  6  
ATOM 8959  N N    . VAL B 2 8  ? 8.670   4.669   -12.985 1.00 0.00 ? 302 VAL B N    6  
ATOM 8960  C CA   . VAL B 2 8  ? 9.866   4.245   -12.258 1.00 0.00 ? 302 VAL B CA   6  
ATOM 8961  C C    . VAL B 2 8  ? 9.495   3.655   -10.894 1.00 0.00 ? 302 VAL B C    6  
ATOM 8962  O O    . VAL B 2 8  ? 9.717   2.470   -10.643 1.00 0.00 ? 302 VAL B O    6  
ATOM 8963  C CB   . VAL B 2 8  ? 10.854  5.420   -12.054 1.00 0.00 ? 302 VAL B CB   6  
ATOM 8964  C CG1  . VAL B 2 8  ? 12.122  4.949   -11.354 1.00 0.00 ? 302 VAL B CG1  6  
ATOM 8965  C CG2  . VAL B 2 8  ? 11.189  6.083   -13.385 1.00 0.00 ? 302 VAL B CG2  6  
ATOM 8966  H H    . VAL B 2 8  ? 8.547   5.620   -13.176 1.00 0.00 ? 302 VAL B H    6  
ATOM 8967  H HA   . VAL B 2 8  ? 10.362  3.484   -12.844 1.00 0.00 ? 302 VAL B HA   6  
ATOM 8968  H HB   . VAL B 2 8  ? 10.378  6.156   -11.422 1.00 0.00 ? 302 VAL B HB   6  
ATOM 8969  H HG11 . VAL B 2 8  ? 12.963  5.050   -12.025 1.00 0.00 ? 302 VAL B HG11 6  
ATOM 8970  H HG12 . VAL B 2 8  ? 12.014  3.914   -11.067 1.00 0.00 ? 302 VAL B HG12 6  
ATOM 8971  H HG13 . VAL B 2 8  ? 12.292  5.550   -10.473 1.00 0.00 ? 302 VAL B HG13 6  
ATOM 8972  H HG21 . VAL B 2 8  ? 10.280  6.239   -13.948 1.00 0.00 ? 302 VAL B HG21 6  
ATOM 8973  H HG22 . VAL B 2 8  ? 11.856  5.446   -13.947 1.00 0.00 ? 302 VAL B HG22 6  
ATOM 8974  H HG23 . VAL B 2 8  ? 11.666  7.034   -13.203 1.00 0.00 ? 302 VAL B HG23 6  
ATOM 8975  N N    . GLU B 2 9  ? 8.922   4.491   -10.026 1.00 0.00 ? 303 GLU B N    6  
ATOM 8976  C CA   . GLU B 2 9  ? 8.508   4.057   -8.690  1.00 0.00 ? 303 GLU B CA   6  
ATOM 8977  C C    . GLU B 2 9  ? 7.334   3.077   -8.760  1.00 0.00 ? 303 GLU B C    6  
ATOM 8978  O O    . GLU B 2 9  ? 7.196   2.204   -7.900  1.00 0.00 ? 303 GLU B O    6  
ATOM 8979  C CB   . GLU B 2 9  ? 8.126   5.264   -7.831  1.00 0.00 ? 303 GLU B CB   6  
ATOM 8980  C CG   . GLU B 2 9  ? 9.278   6.225   -7.586  1.00 0.00 ? 303 GLU B CG   6  
ATOM 8981  C CD   . GLU B 2 9  ? 8.871   7.428   -6.757  1.00 0.00 ? 303 GLU B CD   6  
ATOM 8982  O OE1  . GLU B 2 9  ? 8.001   8.199   -7.214  1.00 0.00 ? 303 GLU B OE1  6  
ATOM 8983  O OE2  . GLU B 2 9  ? 9.423   7.599   -5.650  1.00 0.00 ? 303 GLU B OE2  6  
ATOM 8984  H H    . GLU B 2 9  ? 8.767   5.422   -10.291 1.00 0.00 ? 303 GLU B H    6  
ATOM 8985  H HA   . GLU B 2 9  ? 9.348   3.557   -8.232  1.00 0.00 ? 303 GLU B HA   6  
ATOM 8986  H HB2  . GLU B 2 9  ? 7.330   5.806   -8.324  1.00 0.00 ? 303 GLU B HB2  6  
ATOM 8987  H HB3  . GLU B 2 9  ? 7.769   4.912   -6.874  1.00 0.00 ? 303 GLU B HB3  6  
ATOM 8988  H HG2  . GLU B 2 9  ? 10.063  5.696   -7.067  1.00 0.00 ? 303 GLU B HG2  6  
ATOM 8989  H HG3  . GLU B 2 9  ? 9.649   6.570   -8.539  1.00 0.00 ? 303 GLU B HG3  6  
ATOM 8990  N N    . PHE B 2 10 ? 6.491   3.234   -9.783  1.00 0.00 ? 304 PHE B N    6  
ATOM 8991  C CA   . PHE B 2 10 ? 5.323   2.375   -9.971  1.00 0.00 ? 304 PHE B CA   6  
ATOM 8992  C C    . PHE B 2 10 ? 5.730   0.906   -10.100 1.00 0.00 ? 304 PHE B C    6  
ATOM 8993  O O    . PHE B 2 10 ? 5.282   0.063   -9.324  1.00 0.00 ? 304 PHE B O    6  
ATOM 8994  C CB   . PHE B 2 10 ? 4.542   2.821   -11.215 1.00 0.00 ? 304 PHE B CB   6  
ATOM 8995  C CG   . PHE B 2 10 ? 3.325   1.986   -11.514 1.00 0.00 ? 304 PHE B CG   6  
ATOM 8996  C CD1  . PHE B 2 10 ? 2.258   1.944   -10.632 1.00 0.00 ? 304 PHE B CD1  6  
ATOM 8997  C CD2  . PHE B 2 10 ? 3.250   1.243   -12.682 1.00 0.00 ? 304 PHE B CD2  6  
ATOM 8998  C CE1  . PHE B 2 10 ? 1.140   1.179   -10.907 1.00 0.00 ? 304 PHE B CE1  6  
ATOM 8999  C CE2  . PHE B 2 10 ? 2.135   0.478   -12.964 1.00 0.00 ? 304 PHE B CE2  6  
ATOM 9000  C CZ   . PHE B 2 10 ? 1.079   0.446   -12.076 1.00 0.00 ? 304 PHE B CZ   6  
ATOM 9001  H H    . PHE B 2 10 ? 6.655   3.953   -10.429 1.00 0.00 ? 304 PHE B H    6  
ATOM 9002  H HA   . PHE B 2 10 ? 4.691   2.483   -9.103  1.00 0.00 ? 304 PHE B HA   6  
ATOM 9003  H HB2  . PHE B 2 10 ? 4.215   3.840   -11.076 1.00 0.00 ? 304 PHE B HB2  6  
ATOM 9004  H HB3  . PHE B 2 10 ? 5.196   2.775   -12.073 1.00 0.00 ? 304 PHE B HB3  6  
ATOM 9005  H HD1  . PHE B 2 10 ? 2.303   2.517   -9.720  1.00 0.00 ? 304 PHE B HD1  6  
ATOM 9006  H HD2  . PHE B 2 10 ? 4.076   1.266   -13.378 1.00 0.00 ? 304 PHE B HD2  6  
ATOM 9007  H HE1  . PHE B 2 10 ? 0.316   1.157   -10.211 1.00 0.00 ? 304 PHE B HE1  6  
ATOM 9008  H HE2  . PHE B 2 10 ? 2.090   -0.096  -13.878 1.00 0.00 ? 304 PHE B HE2  6  
ATOM 9009  H HZ   . PHE B 2 10 ? 0.206   -0.152  -12.293 1.00 0.00 ? 304 PHE B HZ   6  
ATOM 9010  N N    . ASN B 2 11 ? 6.579   0.611   -11.086 1.00 0.00 ? 305 ASN B N    6  
ATOM 9011  C CA   . ASN B 2 11 ? 7.045   -0.757  -11.324 1.00 0.00 ? 305 ASN B CA   6  
ATOM 9012  C C    . ASN B 2 11 ? 7.685   -1.367  -10.070 1.00 0.00 ? 305 ASN B C    6  
ATOM 9013  O O    . ASN B 2 11 ? 7.571   -2.572  -9.836  1.00 0.00 ? 305 ASN B O    6  
ATOM 9014  C CB   . ASN B 2 11 ? 8.043   -0.773  -12.489 1.00 0.00 ? 305 ASN B CB   6  
ATOM 9015  C CG   . ASN B 2 11 ? 8.479   -2.176  -12.875 1.00 0.00 ? 305 ASN B CG   6  
ATOM 9016  O OD1  . ASN B 2 11 ? 9.148   -2.866  -12.105 1.00 0.00 ? 305 ASN B OD1  6  
ATOM 9017  N ND2  . ASN B 2 11 ? 8.098   -2.609  -14.072 1.00 0.00 ? 305 ASN B ND2  6  
ATOM 9018  H H    . ASN B 2 11 ? 6.898   1.330   -11.670 1.00 0.00 ? 305 ASN B H    6  
ATOM 9019  H HA   . ASN B 2 11 ? 6.186   -1.353  -11.596 1.00 0.00 ? 305 ASN B HA   6  
ATOM 9020  H HB2  . ASN B 2 11 ? 7.586   -0.310  -13.349 1.00 0.00 ? 305 ASN B HB2  6  
ATOM 9021  H HB3  . ASN B 2 11 ? 8.920   -0.209  -12.206 1.00 0.00 ? 305 ASN B HB3  6  
ATOM 9022  H HD21 . ASN B 2 11 ? 7.565   -2.008  -14.634 1.00 0.00 ? 305 ASN B HD21 6  
ATOM 9023  H HD22 . ASN B 2 11 ? 8.365   -3.510  -14.345 1.00 0.00 ? 305 ASN B HD22 6  
ATOM 9024  N N    . HIS B 2 12 ? 8.359   -0.535  -9.272  1.00 0.00 ? 306 HIS B N    6  
ATOM 9025  C CA   . HIS B 2 12 ? 9.017   -1.001  -8.051  1.00 0.00 ? 306 HIS B CA   6  
ATOM 9026  C C    . HIS B 2 12 ? 8.010   -1.628  -7.082  1.00 0.00 ? 306 HIS B C    6  
ATOM 9027  O O    . HIS B 2 12 ? 8.173   -2.781  -6.677  1.00 0.00 ? 306 HIS B O    6  
ATOM 9028  C CB   . HIS B 2 12 ? 9.757   0.160   -7.374  1.00 0.00 ? 306 HIS B CB   6  
ATOM 9029  C CG   . HIS B 2 12 ? 10.628  -0.257  -6.229  1.00 0.00 ? 306 HIS B CG   6  
ATOM 9030  N ND1  . HIS B 2 12 ? 10.145  -0.883  -5.100  1.00 0.00 ? 306 HIS B ND1  6  
ATOM 9031  C CD2  . HIS B 2 12 ? 11.963  -0.126  -6.040  1.00 0.00 ? 306 HIS B CD2  6  
ATOM 9032  C CE1  . HIS B 2 12 ? 11.142  -1.116  -4.266  1.00 0.00 ? 306 HIS B CE1  6  
ATOM 9033  N NE2  . HIS B 2 12 ? 12.255  -0.668  -4.813  1.00 0.00 ? 306 HIS B NE2  6  
ATOM 9034  H H    . HIS B 2 12 ? 8.418   0.414   -9.512  1.00 0.00 ? 306 HIS B H    6  
ATOM 9035  H HA   . HIS B 2 12 ? 9.735   -1.755  -8.334  1.00 0.00 ? 306 HIS B HA   6  
ATOM 9036  H HB2  . HIS B 2 12 ? 10.384  0.649   -8.104  1.00 0.00 ? 306 HIS B HB2  6  
ATOM 9037  H HB3  . HIS B 2 12 ? 9.033   0.868   -7.000  1.00 0.00 ? 306 HIS B HB3  6  
ATOM 9038  H HD1  . HIS B 2 12 ? 9.211   -1.125  -4.936  1.00 0.00 ? 306 HIS B HD1  6  
ATOM 9039  H HD2  . HIS B 2 12 ? 12.667  0.321   -6.727  1.00 0.00 ? 306 HIS B HD2  6  
ATOM 9040  H HE1  . HIS B 2 12 ? 11.059  -1.588  -3.302  1.00 0.00 ? 306 HIS B HE1  6  
ATOM 9041  H HE2  . HIS B 2 12 ? 13.153  -0.772  -4.435  1.00 0.00 ? 306 HIS B HE2  6  
ATOM 9042  N N    . ALA B 2 13 ? 6.969   -0.871  -6.721  1.00 0.00 ? 307 ALA B N    6  
ATOM 9043  C CA   . ALA B 2 13 ? 5.939   -1.372  -5.807  1.00 0.00 ? 307 ALA B CA   6  
ATOM 9044  C C    . ALA B 2 13 ? 5.209   -2.563  -6.414  1.00 0.00 ? 307 ALA B C    6  
ATOM 9045  O O    . ALA B 2 13 ? 4.877   -3.519  -5.717  1.00 0.00 ? 307 ALA B O    6  
ATOM 9046  C CB   . ALA B 2 13 ? 4.944   -0.275  -5.465  1.00 0.00 ? 307 ALA B CB   6  
ATOM 9047  H H    . ALA B 2 13 ? 6.890   0.036   -7.081  1.00 0.00 ? 307 ALA B H    6  
ATOM 9048  H HA   . ALA B 2 13 ? 6.423   -1.685  -4.894  1.00 0.00 ? 307 ALA B HA   6  
ATOM 9049  H HB1  . ALA B 2 13 ? 5.089   0.039   -4.444  1.00 0.00 ? 307 ALA B HB1  6  
ATOM 9050  H HB2  . ALA B 2 13 ? 3.938   -0.657  -5.586  1.00 0.00 ? 307 ALA B HB2  6  
ATOM 9051  H HB3  . ALA B 2 13 ? 5.090   0.566   -6.127  1.00 0.00 ? 307 ALA B HB3  6  
ATOM 9052  N N    . ILE B 2 14 ? 4.976   -2.492  -7.721  1.00 0.00 ? 308 ILE B N    6  
ATOM 9053  C CA   . ILE B 2 14 ? 4.301   -3.548  -8.463  1.00 0.00 ? 308 ILE B CA   6  
ATOM 9054  C C    . ILE B 2 14 ? 4.919   -4.915  -8.192  1.00 0.00 ? 308 ILE B C    6  
ATOM 9055  O O    . ILE B 2 14 ? 4.252   -5.812  -7.675  1.00 0.00 ? 308 ILE B O    6  
ATOM 9056  C CB   . ILE B 2 14 ? 4.354   -3.222  -9.974  1.00 0.00 ? 308 ILE B CB   6  
ATOM 9057  C CG1  . ILE B 2 14 ? 3.130   -2.408  -10.388 1.00 0.00 ? 308 ILE B CG1  6  
ATOM 9058  C CG2  . ILE B 2 14 ? 4.471   -4.482  -10.803 1.00 0.00 ? 308 ILE B CG2  6  
ATOM 9059  C CD1  . ILE B 2 14 ? 2.686   -1.411  -9.343  1.00 0.00 ? 308 ILE B CD1  6  
ATOM 9060  H H    . ILE B 2 14 ? 5.277   -1.699  -8.213  1.00 0.00 ? 308 ILE B H    6  
ATOM 9061  H HA   . ILE B 2 14 ? 3.264   -3.568  -8.155  1.00 0.00 ? 308 ILE B HA   6  
ATOM 9062  H HB   . ILE B 2 14 ? 5.239   -2.630  -10.152 1.00 0.00 ? 308 ILE B HB   6  
ATOM 9063  H HG12 . ILE B 2 14 ? 3.361   -1.859  -11.288 1.00 0.00 ? 308 ILE B HG12 6  
ATOM 9064  H HG13 . ILE B 2 14 ? 2.305   -3.078  -10.580 1.00 0.00 ? 308 ILE B HG13 6  
ATOM 9065  H HG21 . ILE B 2 14 ? 5.452   -4.920  -10.647 1.00 0.00 ? 308 ILE B HG21 6  
ATOM 9066  H HG22 . ILE B 2 14 ? 4.342   -4.236  -11.845 1.00 0.00 ? 308 ILE B HG22 6  
ATOM 9067  H HG23 . ILE B 2 14 ? 3.709   -5.178  -10.495 1.00 0.00 ? 308 ILE B HG23 6  
ATOM 9068  H HD11 . ILE B 2 14 ? 1.633   -1.222  -9.457  1.00 0.00 ? 308 ILE B HD11 6  
ATOM 9069  H HD12 . ILE B 2 14 ? 3.234   -0.492  -9.460  1.00 0.00 ? 308 ILE B HD12 6  
ATOM 9070  H HD13 . ILE B 2 14 ? 2.871   -1.820  -8.357  1.00 0.00 ? 308 ILE B HD13 6  
ATOM 9071  N N    . ASN B 2 15 ? 6.194   -5.061  -8.537  1.00 0.00 ? 309 ASN B N    6  
ATOM 9072  C CA   . ASN B 2 15 ? 6.901   -6.315  -8.323  1.00 0.00 ? 309 ASN B CA   6  
ATOM 9073  C C    . ASN B 2 15 ? 6.925   -6.679  -6.834  1.00 0.00 ? 309 ASN B C    6  
ATOM 9074  O O    . ASN B 2 15 ? 6.925   -7.860  -6.480  1.00 0.00 ? 309 ASN B O    6  
ATOM 9075  C CB   . ASN B 2 15 ? 8.306   -6.218  -8.906  1.00 0.00 ? 309 ASN B CB   6  
ATOM 9076  C CG   . ASN B 2 15 ? 8.345   -6.584  -10.378 1.00 0.00 ? 309 ASN B CG   6  
ATOM 9077  O OD1  . ASN B 2 15 ? 8.014   -7.708  -10.758 1.00 0.00 ? 309 ASN B OD1  6  
ATOM 9078  N ND2  . ASN B 2 15 ? 8.749   -5.635  -11.219 1.00 0.00 ? 309 ASN B ND2  6  
ATOM 9079  H H    . ASN B 2 15 ? 6.674   -4.303  -8.939  1.00 0.00 ? 309 ASN B H    6  
ATOM 9080  H HA   . ASN B 2 15 ? 6.359   -7.086  -8.852  1.00 0.00 ? 309 ASN B HA   6  
ATOM 9081  H HB2  . ASN B 2 15 ? 8.645   -5.200  -8.808  1.00 0.00 ? 309 ASN B HB2  6  
ATOM 9082  H HB3  . ASN B 2 15 ? 8.967   -6.876  -8.366  1.00 0.00 ? 309 ASN B HB3  6  
ATOM 9083  H HD21 . ASN B 2 15 ? 8.997   -4.761  -10.849 1.00 0.00 ? 309 ASN B HD21 6  
ATOM 9084  H HD22 . ASN B 2 15 ? 8.782   -5.849  -12.174 1.00 0.00 ? 309 ASN B HD22 6  
ATOM 9085  N N    . TYR B 2 16 ? 6.896   -5.659  -5.969  1.00 0.00 ? 310 TYR B N    6  
ATOM 9086  C CA   . TYR B 2 16 ? 6.862   -5.876  -4.523  1.00 0.00 ? 310 TYR B CA   6  
ATOM 9087  C C    . TYR B 2 16 ? 5.545   -6.547  -4.135  1.00 0.00 ? 310 TYR B C    6  
ATOM 9088  O O    . TYR B 2 16 ? 5.536   -7.505  -3.360  1.00 0.00 ? 310 TYR B O    6  
ATOM 9089  C CB   . TYR B 2 16 ? 7.035   -4.548  -3.776  1.00 0.00 ? 310 TYR B CB   6  
ATOM 9090  C CG   . TYR B 2 16 ? 6.582   -4.592  -2.334  1.00 0.00 ? 310 TYR B CG   6  
ATOM 9091  C CD1  . TYR B 2 16 ? 7.181   -5.448  -1.420  1.00 0.00 ? 310 TYR B CD1  6  
ATOM 9092  C CD2  . TYR B 2 16 ? 5.545   -3.782  -1.894  1.00 0.00 ? 310 TYR B CD2  6  
ATOM 9093  C CE1  . TYR B 2 16 ? 6.757   -5.495  -0.107  1.00 0.00 ? 310 TYR B CE1  6  
ATOM 9094  C CE2  . TYR B 2 16 ? 5.117   -3.821  -0.584  1.00 0.00 ? 310 TYR B CE2  6  
ATOM 9095  C CZ   . TYR B 2 16 ? 5.727   -4.678  0.307   1.00 0.00 ? 310 TYR B CZ   6  
ATOM 9096  O OH   . TYR B 2 16 ? 5.303   -4.722  1.614   1.00 0.00 ? 310 TYR B OH   6  
ATOM 9097  H H    . TYR B 2 16 ? 6.865   -4.741  -6.311  1.00 0.00 ? 310 TYR B H    6  
ATOM 9098  H HA   . TYR B 2 16 ? 7.677   -6.539  -4.264  1.00 0.00 ? 310 TYR B HA   6  
ATOM 9099  H HB2  . TYR B 2 16 ? 8.079   -4.272  -3.784  1.00 0.00 ? 310 TYR B HB2  6  
ATOM 9100  H HB3  . TYR B 2 16 ? 6.466   -3.781  -4.279  1.00 0.00 ? 310 TYR B HB3  6  
ATOM 9101  H HD1  . TYR B 2 16 ? 7.990   -6.086  -1.747  1.00 0.00 ? 310 TYR B HD1  6  
ATOM 9102  H HD2  . TYR B 2 16 ? 5.070   -3.111  -2.595  1.00 0.00 ? 310 TYR B HD2  6  
ATOM 9103  H HE1  . TYR B 2 16 ? 7.234   -6.169  0.590   1.00 0.00 ? 310 TYR B HE1  6  
ATOM 9104  H HE2  . TYR B 2 16 ? 4.309   -3.181  -0.261  1.00 0.00 ? 310 TYR B HE2  6  
ATOM 9105  H HH   . TYR B 2 16 ? 4.353   -4.583  1.653   1.00 0.00 ? 310 TYR B HH   6  
ATOM 9106  N N    . VAL B 2 17 ? 4.435   -6.058  -4.704  1.00 0.00 ? 311 VAL B N    6  
ATOM 9107  C CA   . VAL B 2 17 ? 3.120   -6.641  -4.442  1.00 0.00 ? 311 VAL B CA   6  
ATOM 9108  C C    . VAL B 2 17 ? 3.139   -8.118  -4.828  1.00 0.00 ? 311 VAL B C    6  
ATOM 9109  O O    . VAL B 2 17 ? 2.583   -8.961  -4.126  1.00 0.00 ? 311 VAL B O    6  
ATOM 9110  C CB   . VAL B 2 17 ? 1.992   -5.961  -5.251  1.00 0.00 ? 311 VAL B CB   6  
ATOM 9111  C CG1  . VAL B 2 17 ? 0.639   -6.513  -4.854  1.00 0.00 ? 311 VAL B CG1  6  
ATOM 9112  C CG2  . VAL B 2 17 ? 1.981   -4.459  -5.088  1.00 0.00 ? 311 VAL B CG2  6  
ATOM 9113  H H    . VAL B 2 17 ? 4.509   -5.308  -5.331  1.00 0.00 ? 311 VAL B H    6  
ATOM 9114  H HA   . VAL B 2 17 ? 2.904   -6.545  -3.387  1.00 0.00 ? 311 VAL B HA   6  
ATOM 9115  H HB   . VAL B 2 17 ? 2.154   -6.181  -6.290  1.00 0.00 ? 311 VAL B HB   6  
ATOM 9116  H HG11 . VAL B 2 17 ? -0.136  -5.834  -5.196  1.00 0.00 ? 311 VAL B HG11 6  
ATOM 9117  H HG12 . VAL B 2 17 ? 0.591   -6.599  -3.780  1.00 0.00 ? 311 VAL B HG12 6  
ATOM 9118  H HG13 . VAL B 2 17 ? 0.497   -7.486  -5.307  1.00 0.00 ? 311 VAL B HG13 6  
ATOM 9119  H HG21 . VAL B 2 17 ? 2.797   -4.023  -5.643  1.00 0.00 ? 311 VAL B HG21 6  
ATOM 9120  H HG22 . VAL B 2 17 ? 2.077   -4.214  -4.044  1.00 0.00 ? 311 VAL B HG22 6  
ATOM 9121  H HG23 . VAL B 2 17 ? 1.040   -4.076  -5.467  1.00 0.00 ? 311 VAL B HG23 6  
ATOM 9122  N N    . ASN B 2 18 ? 3.799   -8.413  -5.957  1.00 0.00 ? 312 ASN B N    6  
ATOM 9123  C CA   . ASN B 2 18 ? 3.920   -9.777  -6.462  1.00 0.00 ? 312 ASN B CA   6  
ATOM 9124  C C    . ASN B 2 18 ? 4.496   -10.697 -5.383  1.00 0.00 ? 312 ASN B C    6  
ATOM 9125  O O    . ASN B 2 18 ? 4.016   -11.813 -5.197  1.00 0.00 ? 312 ASN B O    6  
ATOM 9126  C CB   . ASN B 2 18 ? 4.813   -9.798  -7.712  1.00 0.00 ? 312 ASN B CB   6  
ATOM 9127  C CG   . ASN B 2 18 ? 4.757   -11.105 -8.499  1.00 0.00 ? 312 ASN B CG   6  
ATOM 9128  O OD1  . ASN B 2 18 ? 5.562   -11.316 -9.407  1.00 0.00 ? 312 ASN B OD1  6  
ATOM 9129  N ND2  . ASN B 2 18 ? 3.806   -11.983 -8.185  1.00 0.00 ? 312 ASN B ND2  6  
ATOM 9130  H H    . ASN B 2 18 ? 4.221   -7.686  -6.462  1.00 0.00 ? 312 ASN B H    6  
ATOM 9131  H HA   . ASN B 2 18 ? 2.931   -10.121 -6.726  1.00 0.00 ? 312 ASN B HA   6  
ATOM 9132  H HB2  . ASN B 2 18 ? 4.507   -9.000  -8.371  1.00 0.00 ? 312 ASN B HB2  6  
ATOM 9133  H HB3  . ASN B 2 18 ? 5.835   -9.630  -7.410  1.00 0.00 ? 312 ASN B HB3  6  
ATOM 9134  H HD21 . ASN B 2 18 ? 3.180   -11.761 -7.467  1.00 0.00 ? 312 ASN B HD21 6  
ATOM 9135  H HD22 . ASN B 2 18 ? 3.770   -12.820 -8.693  1.00 0.00 ? 312 ASN B HD22 6  
ATOM 9136  N N    . LYS B 2 19 ? 5.512   -10.208 -4.663  1.00 0.00 ? 313 LYS B N    6  
ATOM 9137  C CA   . LYS B 2 19 ? 6.133   -10.979 -3.584  1.00 0.00 ? 313 LYS B CA   6  
ATOM 9138  C C    . LYS B 2 19 ? 5.088   -11.352 -2.542  1.00 0.00 ? 313 LYS B C    6  
ATOM 9139  O O    . LYS B 2 19 ? 4.939   -12.517 -2.186  1.00 0.00 ? 313 LYS B O    6  
ATOM 9140  C CB   . LYS B 2 19 ? 7.247   -10.171 -2.907  1.00 0.00 ? 313 LYS B CB   6  
ATOM 9141  C CG   . LYS B 2 19 ? 8.424   -9.858  -3.811  1.00 0.00 ? 313 LYS B CG   6  
ATOM 9142  C CD   . LYS B 2 19 ? 9.488   -9.035  -3.099  1.00 0.00 ? 313 LYS B CD   6  
ATOM 9143  C CE   . LYS B 2 19 ? 10.304  -9.882  -2.131  1.00 0.00 ? 313 LYS B CE   6  
ATOM 9144  N NZ   . LYS B 2 19 ? 11.298  -9.069  -1.375  1.00 0.00 ? 313 LYS B NZ   6  
ATOM 9145  H H    . LYS B 2 19 ? 5.839   -9.303  -4.851  1.00 0.00 ? 313 LYS B H    6  
ATOM 9146  H HA   . LYS B 2 19 ? 6.547   -11.884 -4.008  1.00 0.00 ? 313 LYS B HA   6  
ATOM 9147  H HB2  . LYS B 2 19 ? 6.834   -9.231  -2.557  1.00 0.00 ? 313 LYS B HB2  6  
ATOM 9148  H HB3  . LYS B 2 19 ? 7.611   -10.731 -2.059  1.00 0.00 ? 313 LYS B HB3  6  
ATOM 9149  H HG2  . LYS B 2 19 ? 8.865   -10.786 -4.129  1.00 0.00 ? 313 LYS B HG2  6  
ATOM 9150  H HG3  . LYS B 2 19 ? 8.068   -9.309  -4.666  1.00 0.00 ? 313 LYS B HG3  6  
ATOM 9151  H HD2  . LYS B 2 19 ? 10.153  -8.612  -3.836  1.00 0.00 ? 313 LYS B HD2  6  
ATOM 9152  H HD3  . LYS B 2 19 ? 9.006   -8.241  -2.548  1.00 0.00 ? 313 LYS B HD3  6  
ATOM 9153  H HE2  . LYS B 2 19 ? 9.634   -10.357 -1.432  1.00 0.00 ? 313 LYS B HE2  6  
ATOM 9154  H HE3  . LYS B 2 19 ? 10.828  -10.641 -2.695  1.00 0.00 ? 313 LYS B HE3  6  
ATOM 9155  H HZ1  . LYS B 2 19 ? 11.075  -9.088  -0.358  1.00 0.00 ? 313 LYS B HZ1  6  
ATOM 9156  H HZ2  . LYS B 2 19 ? 11.280  -8.083  -1.701  1.00 0.00 ? 313 LYS B HZ2  6  
ATOM 9157  H HZ3  . LYS B 2 19 ? 12.254  -9.451  -1.516  1.00 0.00 ? 313 LYS B HZ3  6  
ATOM 9158  N N    . ILE B 2 20 ? 4.361   -10.342 -2.073  1.00 0.00 ? 314 ILE B N    6  
ATOM 9159  C CA   . ILE B 2 20 ? 3.309   -10.529 -1.081  1.00 0.00 ? 314 ILE B CA   6  
ATOM 9160  C C    . ILE B 2 20 ? 2.239   -11.485 -1.604  1.00 0.00 ? 314 ILE B C    6  
ATOM 9161  O O    . ILE B 2 20 ? 1.930   -12.493 -0.971  1.00 0.00 ? 314 ILE B O    6  
ATOM 9162  C CB   . ILE B 2 20 ? 2.669   -9.169  -0.729  1.00 0.00 ? 314 ILE B CB   6  
ATOM 9163  C CG1  . ILE B 2 20 ? 3.722   -8.245  -0.114  1.00 0.00 ? 314 ILE B CG1  6  
ATOM 9164  C CG2  . ILE B 2 20 ? 1.484   -9.343  0.214   1.00 0.00 ? 314 ILE B CG2  6  
ATOM 9165  C CD1  . ILE B 2 20 ? 3.337   -6.786  -0.140  1.00 0.00 ? 314 ILE B CD1  6  
ATOM 9166  H H    . ILE B 2 20 ? 4.532   -9.439  -2.415  1.00 0.00 ? 314 ILE B H    6  
ATOM 9167  H HA   . ILE B 2 20 ? 3.753   -10.943 -0.187  1.00 0.00 ? 314 ILE B HA   6  
ATOM 9168  H HB   . ILE B 2 20 ? 2.304   -8.723  -1.641  1.00 0.00 ? 314 ILE B HB   6  
ATOM 9169  H HG12 . ILE B 2 20 ? 3.882   -8.526  0.916   1.00 0.00 ? 314 ILE B HG12 6  
ATOM 9170  H HG13 . ILE B 2 20 ? 4.650   -8.354  -0.658  1.00 0.00 ? 314 ILE B HG13 6  
ATOM 9171  H HG21 . ILE B 2 20 ? 1.300   -10.396 0.371   1.00 0.00 ? 314 ILE B HG21 6  
ATOM 9172  H HG22 . ILE B 2 20 ? 0.608   -8.889  -0.221  1.00 0.00 ? 314 ILE B HG22 6  
ATOM 9173  H HG23 . ILE B 2 20 ? 1.703   -8.872  1.160   1.00 0.00 ? 314 ILE B HG23 6  
ATOM 9174  H HD11 . ILE B 2 20 ? 3.720   -6.298  0.742   1.00 0.00 ? 314 ILE B HD11 6  
ATOM 9175  H HD12 . ILE B 2 20 ? 2.262   -6.697  -0.163  1.00 0.00 ? 314 ILE B HD12 6  
ATOM 9176  H HD13 . ILE B 2 20 ? 3.759   -6.322  -1.019  1.00 0.00 ? 314 ILE B HD13 6  
ATOM 9177  N N    . LYS B 2 21 ? 1.685   -11.152 -2.766  1.00 0.00 ? 315 LYS B N    6  
ATOM 9178  C CA   . LYS B 2 21 ? 0.651   -11.961 -3.406  1.00 0.00 ? 315 LYS B CA   6  
ATOM 9179  C C    . LYS B 2 21 ? 1.096   -13.418 -3.583  1.00 0.00 ? 315 LYS B C    6  
ATOM 9180  O O    . LYS B 2 21 ? 0.423   -14.339 -3.119  1.00 0.00 ? 315 LYS B O    6  
ATOM 9181  C CB   . LYS B 2 21 ? 0.287   -11.344 -4.758  1.00 0.00 ? 315 LYS B CB   6  
ATOM 9182  C CG   . LYS B 2 21 ? -0.875  -12.011 -5.452  1.00 0.00 ? 315 LYS B CG   6  
ATOM 9183  C CD   . LYS B 2 21 ? -1.071  -11.414 -6.827  1.00 0.00 ? 315 LYS B CD   6  
ATOM 9184  C CE   . LYS B 2 21 ? -2.246  -12.040 -7.539  1.00 0.00 ? 315 LYS B CE   6  
ATOM 9185  N NZ   . LYS B 2 21 ? -2.104  -13.518 -7.680  1.00 0.00 ? 315 LYS B NZ   6  
ATOM 9186  H H    . LYS B 2 21 ? 1.985   -10.332 -3.213  1.00 0.00 ? 315 LYS B H    6  
ATOM 9187  H HA   . LYS B 2 21 ? -0.219  -11.943 -2.769  1.00 0.00 ? 315 LYS B HA   6  
ATOM 9188  H HB2  . LYS B 2 21 ? 0.033   -10.309 -4.608  1.00 0.00 ? 315 LYS B HB2  6  
ATOM 9189  H HB3  . LYS B 2 21 ? 1.136   -11.396 -5.417  1.00 0.00 ? 315 LYS B HB3  6  
ATOM 9190  H HG2  . LYS B 2 21 ? -0.672  -13.068 -5.547  1.00 0.00 ? 315 LYS B HG2  6  
ATOM 9191  H HG3  . LYS B 2 21 ? -1.771  -11.860 -4.868  1.00 0.00 ? 315 LYS B HG3  6  
ATOM 9192  H HD2  . LYS B 2 21 ? -1.247  -10.354 -6.724  1.00 0.00 ? 315 LYS B HD2  6  
ATOM 9193  H HD3  . LYS B 2 21 ? -0.177  -11.577 -7.410  1.00 0.00 ? 315 LYS B HD3  6  
ATOM 9194  H HE2  . LYS B 2 21 ? -3.138  -11.826 -6.975  1.00 0.00 ? 315 LYS B HE2  6  
ATOM 9195  H HE3  . LYS B 2 21 ? -2.324  -11.599 -8.517  1.00 0.00 ? 315 LYS B HE3  6  
ATOM 9196  H HZ1  . LYS B 2 21 ? -2.747  -13.869 -8.419  1.00 0.00 ? 315 LYS B HZ1  6  
ATOM 9197  H HZ2  . LYS B 2 21 ? -2.338  -13.987 -6.782  1.00 0.00 ? 315 LYS B HZ2  6  
ATOM 9198  H HZ3  . LYS B 2 21 ? -1.126  -13.761 -7.940  1.00 0.00 ? 315 LYS B HZ3  6  
ATOM 9199  N N    . ASN B 2 22 ? 2.228   -13.612 -4.264  1.00 0.00 ? 316 ASN B N    6  
ATOM 9200  C CA   . ASN B 2 22 ? 2.770   -14.952 -4.517  1.00 0.00 ? 316 ASN B CA   6  
ATOM 9201  C C    . ASN B 2 22 ? 3.161   -15.664 -3.229  1.00 0.00 ? 316 ASN B C    6  
ATOM 9202  O O    . ASN B 2 22 ? 2.727   -16.791 -2.989  1.00 0.00 ? 316 ASN B O    6  
ATOM 9203  C CB   . ASN B 2 22 ? 3.981   -14.870 -5.454  1.00 0.00 ? 316 ASN B CB   6  
ATOM 9204  C CG   . ASN B 2 22 ? 3.614   -14.725 -6.929  1.00 0.00 ? 316 ASN B CG   6  
ATOM 9205  O OD1  . ASN B 2 22 ? 4.492   -14.750 -7.791  1.00 0.00 ? 316 ASN B OD1  6  
ATOM 9206  N ND2  . ASN B 2 22 ? 2.325   -14.562 -7.240  1.00 0.00 ? 316 ASN B ND2  6  
ATOM 9207  H H    . ASN B 2 22 ? 2.713   -12.834 -4.611  1.00 0.00 ? 316 ASN B H    6  
ATOM 9208  H HA   . ASN B 2 22 ? 1.998   -15.534 -4.997  1.00 0.00 ? 316 ASN B HA   6  
ATOM 9209  H HB2  . ASN B 2 22 ? 4.576   -14.013 -5.175  1.00 0.00 ? 316 ASN B HB2  6  
ATOM 9210  H HB3  . ASN B 2 22 ? 4.581   -15.759 -5.337  1.00 0.00 ? 316 ASN B HB3  6  
ATOM 9211  H HD21 . ASN B 2 22 ? 1.666   -14.540 -6.518  1.00 0.00 ? 316 ASN B HD21 6  
ATOM 9212  H HD22 . ASN B 2 22 ? 2.089   -14.471 -8.186  1.00 0.00 ? 316 ASN B HD22 6  
ATOM 9213  N N    . ARG B 2 23 ? 3.978   -15.014 -2.401  1.00 0.00 ? 317 ARG B N    6  
ATOM 9214  C CA   . ARG B 2 23 ? 4.411   -15.610 -1.141  1.00 0.00 ? 317 ARG B CA   6  
ATOM 9215  C C    . ARG B 2 23 ? 3.194   -16.006 -0.308  1.00 0.00 ? 317 ARG B C    6  
ATOM 9216  O O    . ARG B 2 23 ? 3.130   -17.121 0.215   1.00 0.00 ? 317 ARG B O    6  
ATOM 9217  C CB   . ARG B 2 23 ? 5.317   -14.644 -0.357  1.00 0.00 ? 317 ARG B CB   6  
ATOM 9218  C CG   . ARG B 2 23 ? 6.088   -15.299 0.787   1.00 0.00 ? 317 ARG B CG   6  
ATOM 9219  C CD   . ARG B 2 23 ? 5.180   -15.690 1.944   1.00 0.00 ? 317 ARG B CD   6  
ATOM 9220  N NE   . ARG B 2 23 ? 5.743   -16.758 2.768   1.00 0.00 ? 317 ARG B NE   6  
ATOM 9221  C CZ   . ARG B 2 23 ? 5.052   -17.403 3.713   1.00 0.00 ? 317 ARG B CZ   6  
ATOM 9222  N NH1  . ARG B 2 23 ? 3.781   -17.087 3.952   1.00 0.00 ? 317 ARG B NH1  6  
ATOM 9223  N NH2  . ARG B 2 23 ? 5.633   -18.368 4.418   1.00 0.00 ? 317 ARG B NH2  6  
ATOM 9224  H H    . ARG B 2 23 ? 4.295   -14.117 -2.643  1.00 0.00 ? 317 ARG B H    6  
ATOM 9225  H HA   . ARG B 2 23 ? 4.971   -16.503 -1.378  1.00 0.00 ? 317 ARG B HA   6  
ATOM 9226  H HB2  . ARG B 2 23 ? 6.032   -14.212 -1.038  1.00 0.00 ? 317 ARG B HB2  6  
ATOM 9227  H HB3  . ARG B 2 23 ? 4.707   -13.855 0.056   1.00 0.00 ? 317 ARG B HB3  6  
ATOM 9228  H HG2  . ARG B 2 23 ? 6.580   -16.185 0.415   1.00 0.00 ? 317 ARG B HG2  6  
ATOM 9229  H HG3  . ARG B 2 23 ? 6.831   -14.599 1.148   1.00 0.00 ? 317 ARG B HG3  6  
ATOM 9230  H HD2  . ARG B 2 23 ? 5.026   -14.824 2.566   1.00 0.00 ? 317 ARG B HD2  6  
ATOM 9231  H HD3  . ARG B 2 23 ? 4.234   -16.017 1.553   1.00 0.00 ? 317 ARG B HD3  6  
ATOM 9232  H HE   . ARG B 2 23 ? 6.676   -17.010 2.610   1.00 0.00 ? 317 ARG B HE   6  
ATOM 9233  H HH11 . ARG B 2 23 ? 3.333   -16.366 3.423   1.00 0.00 ? 317 ARG B HH11 6  
ATOM 9234  H HH12 . ARG B 2 23 ? 3.270   -17.574 4.661   1.00 0.00 ? 317 ARG B HH12 6  
ATOM 9235  H HH21 . ARG B 2 23 ? 6.586   -18.613 4.241   1.00 0.00 ? 317 ARG B HH21 6  
ATOM 9236  H HH22 . ARG B 2 23 ? 5.116   -18.850 5.125   1.00 0.00 ? 317 ARG B HH22 6  
ATOM 9237  N N    . PHE B 2 24 ? 2.219   -15.095 -0.196  1.00 0.00 ? 318 PHE B N    6  
ATOM 9238  C CA   . PHE B 2 24 ? 1.010   -15.375 0.574   1.00 0.00 ? 318 PHE B CA   6  
ATOM 9239  C C    . PHE B 2 24 ? -0.117  -15.842 -0.352  1.00 0.00 ? 318 PHE B C    6  
ATOM 9240  O O    . PHE B 2 24 ? -1.277  -15.482 -0.153  1.00 0.00 ? 318 PHE B O    6  
ATOM 9241  C CB   . PHE B 2 24 ? 0.529   -14.144 1.368   1.00 0.00 ? 318 PHE B CB   6  
ATOM 9242  C CG   . PHE B 2 24 ? 1.594   -13.193 1.851   1.00 0.00 ? 318 PHE B CG   6  
ATOM 9243  C CD1  . PHE B 2 24 ? 2.931   -13.551 1.915   1.00 0.00 ? 318 PHE B CD1  6  
ATOM 9244  C CD2  . PHE B 2 24 ? 1.232   -11.925 2.249   1.00 0.00 ? 318 PHE B CD2  6  
ATOM 9245  C CE1  . PHE B 2 24 ? 3.881   -12.653 2.365   1.00 0.00 ? 318 PHE B CE1  6  
ATOM 9246  C CE2  . PHE B 2 24 ? 2.172   -11.028 2.700   1.00 0.00 ? 318 PHE B CE2  6  
ATOM 9247  C CZ   . PHE B 2 24 ? 3.499   -11.388 2.757   1.00 0.00 ? 318 PHE B CZ   6  
ATOM 9248  H H    . PHE B 2 24 ? 2.315   -14.226 -0.643  1.00 0.00 ? 318 PHE B H    6  
ATOM 9249  H HA   . PHE B 2 24 ? 1.238   -16.171 1.267   1.00 0.00 ? 318 PHE B HA   6  
ATOM 9250  H HB2  . PHE B 2 24 ? -0.165  -13.579 0.766   1.00 0.00 ? 318 PHE B HB2  6  
ATOM 9251  H HB3  . PHE B 2 24 ? 0.007   -14.501 2.243   1.00 0.00 ? 318 PHE B HB3  6  
ATOM 9252  H HD1  . PHE B 2 24 ? 3.231   -14.539 1.613   1.00 0.00 ? 318 PHE B HD1  6  
ATOM 9253  H HD2  . PHE B 2 24 ? 0.193   -11.637 2.203   1.00 0.00 ? 318 PHE B HD2  6  
ATOM 9254  H HE1  . PHE B 2 24 ? 4.921   -12.942 2.407   1.00 0.00 ? 318 PHE B HE1  6  
ATOM 9255  H HE2  . PHE B 2 24 ? 1.868   -10.043 3.004   1.00 0.00 ? 318 PHE B HE2  6  
ATOM 9256  H HZ   . PHE B 2 24 ? 4.237   -10.682 3.110   1.00 0.00 ? 318 PHE B HZ   6  
ATOM 9257  N N    . GLN B 2 25 ? 0.229   -16.645 -1.365  1.00 0.00 ? 319 GLN B N    6  
ATOM 9258  C CA   . GLN B 2 25 ? -0.762  -17.166 -2.311  1.00 0.00 ? 319 GLN B CA   6  
ATOM 9259  C C    . GLN B 2 25 ? -1.967  -17.766 -1.581  1.00 0.00 ? 319 GLN B C    6  
ATOM 9260  O O    . GLN B 2 25 ? -3.103  -17.644 -2.044  1.00 0.00 ? 319 GLN B O    6  
ATOM 9261  C CB   . GLN B 2 25 ? -0.133  -18.194 -3.253  1.00 0.00 ? 319 GLN B CB   6  
ATOM 9262  C CG   . GLN B 2 25 ? 0.813   -19.150 -2.560  1.00 0.00 ? 319 GLN B CG   6  
ATOM 9263  C CD   . GLN B 2 25 ? 1.359   -20.220 -3.488  1.00 0.00 ? 319 GLN B CD   6  
ATOM 9264  O OE1  . GLN B 2 25 ? 2.004   -19.915 -4.492  1.00 0.00 ? 319 GLN B OE1  6  
ATOM 9265  N NE2  . GLN B 2 25 ? 1.106   -21.482 -3.156  1.00 0.00 ? 319 GLN B NE2  6  
ATOM 9266  H H    . GLN B 2 25 ? 1.167   -16.896 -1.475  1.00 0.00 ? 319 GLN B H    6  
ATOM 9267  H HA   . GLN B 2 25 ? -1.105  -16.334 -2.898  1.00 0.00 ? 319 GLN B HA   6  
ATOM 9268  H HB2  . GLN B 2 25 ? -0.920  -18.773 -3.716  1.00 0.00 ? 319 GLN B HB2  6  
ATOM 9269  H HB3  . GLN B 2 25 ? 0.416   -17.673 -4.023  1.00 0.00 ? 319 GLN B HB3  6  
ATOM 9270  H HG2  . GLN B 2 25 ? 1.639   -18.578 -2.171  1.00 0.00 ? 319 GLN B HG2  6  
ATOM 9271  H HG3  . GLN B 2 25 ? 0.288   -19.625 -1.747  1.00 0.00 ? 319 GLN B HG3  6  
ATOM 9272  H HE21 . GLN B 2 25 ? 0.589   -21.655 -2.342  1.00 0.00 ? 319 GLN B HE21 6  
ATOM 9273  H HE22 . GLN B 2 25 ? 1.450   -22.190 -3.740  1.00 0.00 ? 319 GLN B HE22 6  
ATOM 9274  N N    . GLY B 2 26 ? -1.711  -18.392 -0.426  1.00 0.00 ? 320 GLY B N    6  
ATOM 9275  C CA   . GLY B 2 26 ? -2.783  -18.979 0.362   1.00 0.00 ? 320 GLY B CA   6  
ATOM 9276  C C    . GLY B 2 26 ? -3.227  -18.075 1.505   1.00 0.00 ? 320 GLY B C    6  
ATOM 9277  O O    . GLY B 2 26 ? -3.763  -18.552 2.506   1.00 0.00 ? 320 GLY B O    6  
ATOM 9278  H H    . GLY B 2 26 ? -0.789  -18.443 -0.100  1.00 0.00 ? 320 GLY B H    6  
ATOM 9279  H HA2  . GLY B 2 26 ? -3.631  -19.167 -0.281  1.00 0.00 ? 320 GLY B HA2  6  
ATOM 9280  H HA3  . GLY B 2 26 ? -2.441  -19.917 0.773   1.00 0.00 ? 320 GLY B HA3  6  
ATOM 9281  N N    . GLN B 2 27 ? -3.008  -16.765 1.349   1.00 0.00 ? 321 GLN B N    6  
ATOM 9282  C CA   . GLN B 2 27 ? -3.387  -15.784 2.363   1.00 0.00 ? 321 GLN B CA   6  
ATOM 9283  C C    . GLN B 2 27 ? -4.217  -14.664 1.750   1.00 0.00 ? 321 GLN B C    6  
ATOM 9284  O O    . GLN B 2 27 ? -3.789  -13.506 1.729   1.00 0.00 ? 321 GLN B O    6  
ATOM 9285  C CB   . GLN B 2 27 ? -2.155  -15.156 3.016   1.00 0.00 ? 321 GLN B CB   6  
ATOM 9286  C CG   . GLN B 2 27 ? -1.299  -16.107 3.827   1.00 0.00 ? 321 GLN B CG   6  
ATOM 9287  C CD   . GLN B 2 27 ? -2.064  -16.785 4.948   1.00 0.00 ? 321 GLN B CD   6  
ATOM 9288  O OE1  . GLN B 2 27 ? -2.611  -16.122 5.831   1.00 0.00 ? 321 GLN B OE1  6  
ATOM 9289  N NE2  . GLN B 2 27 ? -2.106  -18.113 4.924   1.00 0.00 ? 321 GLN B NE2  6  
ATOM 9290  H H    . GLN B 2 27 ? -2.582  -16.448 0.527   1.00 0.00 ? 321 GLN B H    6  
ATOM 9291  H HA   . GLN B 2 27 ? -3.972  -16.286 3.118   1.00 0.00 ? 321 GLN B HA   6  
ATOM 9292  H HB2  . GLN B 2 27 ? -1.542  -14.735 2.240   1.00 0.00 ? 321 GLN B HB2  6  
ATOM 9293  H HB3  . GLN B 2 27 ? -2.480  -14.358 3.667   1.00 0.00 ? 321 GLN B HB3  6  
ATOM 9294  H HG2  . GLN B 2 27 ? -0.899  -16.864 3.169   1.00 0.00 ? 321 GLN B HG2  6  
ATOM 9295  H HG3  . GLN B 2 27 ? -0.487  -15.539 4.260   1.00 0.00 ? 321 GLN B HG3  6  
ATOM 9296  H HE21 . GLN B 2 27 ? -1.645  -18.578 4.195   1.00 0.00 ? 321 GLN B HE21 6  
ATOM 9297  H HE22 . GLN B 2 27 ? -2.595  -18.573 5.639   1.00 0.00 ? 321 GLN B HE22 6  
ATOM 9298  N N    . PRO B 2 28 ? -5.427  -14.974 1.261   1.00 0.00 ? 322 PRO B N    6  
ATOM 9299  C CA   . PRO B 2 28 ? -6.305  -13.959 0.681   1.00 0.00 ? 322 PRO B CA   6  
ATOM 9300  C C    . PRO B 2 28 ? -6.615  -12.852 1.691   1.00 0.00 ? 322 PRO B C    6  
ATOM 9301  O O    . PRO B 2 28 ? -6.959  -11.734 1.311   1.00 0.00 ? 322 PRO B O    6  
ATOM 9302  C CB   . PRO B 2 28 ? -7.577  -14.735 0.311   1.00 0.00 ? 322 PRO B CB   6  
ATOM 9303  C CG   . PRO B 2 28 ? -7.504  -16.007 1.089   1.00 0.00 ? 322 PRO B CG   6  
ATOM 9304  C CD   . PRO B 2 28 ? -6.043  -16.311 1.257   1.00 0.00 ? 322 PRO B CD   6  
ATOM 9305  H HA   . PRO B 2 28 ? -5.869  -13.521 -0.208  1.00 0.00 ? 322 PRO B HA   6  
ATOM 9306  H HB2  . PRO B 2 28 ? -8.446  -14.156 0.586   1.00 0.00 ? 322 PRO B HB2  6  
ATOM 9307  H HB3  . PRO B 2 28 ? -7.588  -14.925 -0.752  1.00 0.00 ? 322 PRO B HB3  6  
ATOM 9308  H HG2  . PRO B 2 28 ? -7.972  -15.877 2.052   1.00 0.00 ? 322 PRO B HG2  6  
ATOM 9309  H HG3  . PRO B 2 28 ? -7.990  -16.801 0.539   1.00 0.00 ? 322 PRO B HG3  6  
ATOM 9310  H HD2  . PRO B 2 28 ? -5.867  -16.821 2.192   1.00 0.00 ? 322 PRO B HD2  6  
ATOM 9311  H HD3  . PRO B 2 28 ? -5.680  -16.899 0.427   1.00 0.00 ? 322 PRO B HD3  6  
ATOM 9312  N N    . ASP B 2 29 ? -6.467  -13.172 2.984   1.00 0.00 ? 323 ASP B N    6  
ATOM 9313  C CA   . ASP B 2 29 ? -6.707  -12.211 4.052   1.00 0.00 ? 323 ASP B CA   6  
ATOM 9314  C C    . ASP B 2 29 ? -5.637  -11.126 4.064   1.00 0.00 ? 323 ASP B C    6  
ATOM 9315  O O    . ASP B 2 29 ? -5.935  -9.963  4.315   1.00 0.00 ? 323 ASP B O    6  
ATOM 9316  C CB   . ASP B 2 29 ? -6.747  -12.920 5.409   1.00 0.00 ? 323 ASP B CB   6  
ATOM 9317  C CG   . ASP B 2 29 ? -7.844  -13.968 5.486   1.00 0.00 ? 323 ASP B CG   6  
ATOM 9318  O OD1  . ASP B 2 29 ? -9.030  -13.596 5.366   1.00 0.00 ? 323 ASP B OD1  6  
ATOM 9319  O OD2  . ASP B 2 29 ? -7.514  -15.159 5.663   1.00 0.00 ? 323 ASP B OD2  6  
ATOM 9320  H H    . ASP B 2 29 ? -6.166  -14.073 3.225   1.00 0.00 ? 323 ASP B H    6  
ATOM 9321  H HA   . ASP B 2 29 ? -7.665  -11.749 3.870   1.00 0.00 ? 323 ASP B HA   6  
ATOM 9322  H HB2  . ASP B 2 29 ? -5.798  -13.406 5.583   1.00 0.00 ? 323 ASP B HB2  6  
ATOM 9323  H HB3  . ASP B 2 29 ? -6.918  -12.187 6.186   1.00 0.00 ? 323 ASP B HB3  6  
ATOM 9324  N N    . ILE B 2 30 ? -4.385  -11.516 3.797   1.00 0.00 ? 324 ILE B N    6  
ATOM 9325  C CA   . ILE B 2 30 ? -3.274  -10.571 3.788   1.00 0.00 ? 324 ILE B CA   6  
ATOM 9326  C C    . ILE B 2 30 ? -3.335  -9.651  2.588   1.00 0.00 ? 324 ILE B C    6  
ATOM 9327  O O    . ILE B 2 30 ? -3.234  -8.434  2.721   1.00 0.00 ? 324 ILE B O    6  
ATOM 9328  C CB   . ILE B 2 30 ? -1.923  -11.279 3.745   1.00 0.00 ? 324 ILE B CB   6  
ATOM 9329  C CG1  . ILE B 2 30 ? -1.809  -12.276 4.892   1.00 0.00 ? 324 ILE B CG1  6  
ATOM 9330  C CG2  . ILE B 2 30 ? -0.806  -10.237 3.785   1.00 0.00 ? 324 ILE B CG2  6  
ATOM 9331  C CD1  . ILE B 2 30 ? -0.507  -13.023 4.880   1.00 0.00 ? 324 ILE B CD1  6  
ATOM 9332  H H    . ILE B 2 30 ? -4.205  -12.463 3.604   1.00 0.00 ? 324 ILE B H    6  
ATOM 9333  H HA   . ILE B 2 30 ? -3.318  -9.989  4.695   1.00 0.00 ? 324 ILE B HA   6  
ATOM 9334  H HB   . ILE B 2 30 ? -1.849  -11.814 2.807   1.00 0.00 ? 324 ILE B HB   6  
ATOM 9335  H HG12 . ILE B 2 30 ? -1.890  -11.754 5.833   1.00 0.00 ? 324 ILE B HG12 6  
ATOM 9336  H HG13 . ILE B 2 30 ? -2.613  -13.004 4.810   1.00 0.00 ? 324 ILE B HG13 6  
ATOM 9337  H HG21 . ILE B 2 30 ? -0.560  -9.931  2.771   1.00 0.00 ? 324 ILE B HG21 6  
ATOM 9338  H HG22 . ILE B 2 30 ? 0.067   -10.657 4.259   1.00 0.00 ? 324 ILE B HG22 6  
ATOM 9339  H HG23 . ILE B 2 30 ? -1.143  -9.373  4.347   1.00 0.00 ? 324 ILE B HG23 6  
ATOM 9340  H HD11 . ILE B 2 30 ? -0.272  -13.295 3.861   1.00 0.00 ? 324 ILE B HD11 6  
ATOM 9341  H HD12 . ILE B 2 30 ? -0.593  -13.912 5.485   1.00 0.00 ? 324 ILE B HD12 6  
ATOM 9342  H HD13 . ILE B 2 30 ? 0.271   -12.389 5.272   1.00 0.00 ? 324 ILE B HD13 6  
ATOM 9343  N N    . TYR B 2 31 ? -3.464  -10.252 1.415   1.00 0.00 ? 325 TYR B N    6  
ATOM 9344  C CA   . TYR B 2 31 ? -3.499  -9.496  0.171   1.00 0.00 ? 325 TYR B CA   6  
ATOM 9345  C C    . TYR B 2 31 ? -4.686  -8.532  0.165   1.00 0.00 ? 325 TYR B C    6  
ATOM 9346  O O    . TYR B 2 31 ? -4.514  -7.341  -0.094  1.00 0.00 ? 325 TYR B O    6  
ATOM 9347  C CB   . TYR B 2 31 ? -3.573  -10.457 -1.014  1.00 0.00 ? 325 TYR B CB   6  
ATOM 9348  C CG   . TYR B 2 31 ? -3.004  -9.893  -2.296  1.00 0.00 ? 325 TYR B CG   6  
ATOM 9349  C CD1  . TYR B 2 31 ? -1.730  -9.330  -2.328  1.00 0.00 ? 325 TYR B CD1  6  
ATOM 9350  C CD2  . TYR B 2 31 ? -3.731  -9.937  -3.475  1.00 0.00 ? 325 TYR B CD2  6  
ATOM 9351  C CE1  . TYR B 2 31 ? -1.206  -8.831  -3.510  1.00 0.00 ? 325 TYR B CE1  6  
ATOM 9352  C CE2  . TYR B 2 31 ? -3.214  -9.440  -4.649  1.00 0.00 ? 325 TYR B CE2  6  
ATOM 9353  C CZ   . TYR B 2 31 ? -1.957  -8.891  -4.664  1.00 0.00 ? 325 TYR B CZ   6  
ATOM 9354  O OH   . TYR B 2 31 ? -1.444  -8.409  -5.840  1.00 0.00 ? 325 TYR B OH   6  
ATOM 9355  H H    . TYR B 2 31 ? -3.505  -11.235 1.384   1.00 0.00 ? 325 TYR B H    6  
ATOM 9356  H HA   . TYR B 2 31 ? -2.585  -8.923  0.107   1.00 0.00 ? 325 TYR B HA   6  
ATOM 9357  H HB2  . TYR B 2 31 ? -3.025  -11.357 -0.777  1.00 0.00 ? 325 TYR B HB2  6  
ATOM 9358  H HB3  . TYR B 2 31 ? -4.607  -10.713 -1.196  1.00 0.00 ? 325 TYR B HB3  6  
ATOM 9359  H HD1  . TYR B 2 31 ? -1.147  -9.288  -1.411  1.00 0.00 ? 325 TYR B HD1  6  
ATOM 9360  H HD2  . TYR B 2 31 ? -4.720  -10.368 -3.465  1.00 0.00 ? 325 TYR B HD2  6  
ATOM 9361  H HE1  . TYR B 2 31 ? -0.215  -8.396  -3.529  1.00 0.00 ? 325 TYR B HE1  6  
ATOM 9362  H HE2  . TYR B 2 31 ? -3.797  -9.484  -5.554  1.00 0.00 ? 325 TYR B HE2  6  
ATOM 9363  H HH   . TYR B 2 31 ? -1.328  -7.465  -5.771  1.00 0.00 ? 325 TYR B HH   6  
ATOM 9364  N N    . LYS B 2 32 ? -5.880  -9.040  0.479   1.00 0.00 ? 326 LYS B N    6  
ATOM 9365  C CA   . LYS B 2 32 ? -7.073  -8.197  0.538   1.00 0.00 ? 326 LYS B CA   6  
ATOM 9366  C C    . LYS B 2 32 ? -6.920  -7.119  1.614   1.00 0.00 ? 326 LYS B C    6  
ATOM 9367  O O    . LYS B 2 32 ? -7.136  -5.935  1.351   1.00 0.00 ? 326 LYS B O    6  
ATOM 9368  C CB   . LYS B 2 32 ? -8.324  -9.040  0.808   1.00 0.00 ? 326 LYS B CB   6  
ATOM 9369  C CG   . LYS B 2 32 ? -8.679  -9.993  -0.327  1.00 0.00 ? 326 LYS B CG   6  
ATOM 9370  C CD   . LYS B 2 32 ? -8.965  -9.247  -1.623  1.00 0.00 ? 326 LYS B CD   6  
ATOM 9371  C CE   . LYS B 2 32 ? -10.146 -8.298  -1.479  1.00 0.00 ? 326 LYS B CE   6  
ATOM 9372  N NZ   . LYS B 2 32 ? -10.421 -7.555  -2.740  1.00 0.00 ? 326 LYS B NZ   6  
ATOM 9373  H H    . LYS B 2 32 ? -5.953  -9.993  0.703   1.00 0.00 ? 326 LYS B H    6  
ATOM 9374  H HA   . LYS B 2 32 ? -7.179  -7.712  -0.421  1.00 0.00 ? 326 LYS B HA   6  
ATOM 9375  H HB2  . LYS B 2 32 ? -8.163  -9.624  1.702   1.00 0.00 ? 326 LYS B HB2  6  
ATOM 9376  H HB3  . LYS B 2 32 ? -9.163  -8.379  0.970   1.00 0.00 ? 326 LYS B HB3  6  
ATOM 9377  H HG2  . LYS B 2 32 ? -7.852  -10.666 -0.489  1.00 0.00 ? 326 LYS B HG2  6  
ATOM 9378  H HG3  . LYS B 2 32 ? -9.556  -10.558 -0.046  1.00 0.00 ? 326 LYS B HG3  6  
ATOM 9379  H HD2  . LYS B 2 32 ? -8.091  -8.677  -1.898  1.00 0.00 ? 326 LYS B HD2  6  
ATOM 9380  H HD3  . LYS B 2 32 ? -9.185  -9.967  -2.398  1.00 0.00 ? 326 LYS B HD3  6  
ATOM 9381  H HE2  . LYS B 2 32 ? -11.021 -8.871  -1.212  1.00 0.00 ? 326 LYS B HE2  6  
ATOM 9382  H HE3  . LYS B 2 32 ? -9.929  -7.589  -0.693  1.00 0.00 ? 326 LYS B HE3  6  
ATOM 9383  H HZ1  . LYS B 2 32 ? -11.276 -6.973  -2.632  1.00 0.00 ? 326 LYS B HZ1  6  
ATOM 9384  H HZ2  . LYS B 2 32 ? -10.567 -8.221  -3.525  1.00 0.00 ? 326 LYS B HZ2  6  
ATOM 9385  H HZ3  . LYS B 2 32 ? -9.618  -6.935  -2.971  1.00 0.00 ? 326 LYS B HZ3  6  
ATOM 9386  N N    . ALA B 2 33 ? -6.535  -7.542  2.825   1.00 0.00 ? 327 ALA B N    6  
ATOM 9387  C CA   . ALA B 2 33 ? -6.339  -6.621  3.948   1.00 0.00 ? 327 ALA B CA   6  
ATOM 9388  C C    . ALA B 2 33 ? -5.297  -5.556  3.621   1.00 0.00 ? 327 ALA B C    6  
ATOM 9389  O O    . ALA B 2 33 ? -5.549  -4.366  3.790   1.00 0.00 ? 327 ALA B O    6  
ATOM 9390  C CB   . ALA B 2 33 ? -5.919  -7.384  5.199   1.00 0.00 ? 327 ALA B CB   6  
ATOM 9391  H H    . ALA B 2 33 ? -6.374  -8.499  2.964   1.00 0.00 ? 327 ALA B H    6  
ATOM 9392  H HA   . ALA B 2 33 ? -7.284  -6.138  4.152   1.00 0.00 ? 327 ALA B HA   6  
ATOM 9393  H HB1  . ALA B 2 33 ? -4.987  -7.903  5.008   1.00 0.00 ? 327 ALA B HB1  6  
ATOM 9394  H HB2  . ALA B 2 33 ? -6.684  -8.099  5.459   1.00 0.00 ? 327 ALA B HB2  6  
ATOM 9395  H HB3  . ALA B 2 33 ? -5.781  -6.690  6.015   1.00 0.00 ? 327 ALA B HB3  6  
ATOM 9396  N N    . PHE B 2 34 ? -4.131  -5.999  3.149   1.00 0.00 ? 328 PHE B N    6  
ATOM 9397  C CA   . PHE B 2 34 ? -3.033  -5.097  2.795   1.00 0.00 ? 328 PHE B CA   6  
ATOM 9398  C C    . PHE B 2 34 ? -3.528  -3.964  1.905   1.00 0.00 ? 328 PHE B C    6  
ATOM 9399  O O    . PHE B 2 34 ? -3.246  -2.797  2.167   1.00 0.00 ? 328 PHE B O    6  
ATOM 9400  C CB   . PHE B 2 34 ? -1.928  -5.882  2.074   1.00 0.00 ? 328 PHE B CB   6  
ATOM 9401  C CG   . PHE B 2 34 ? -0.736  -5.052  1.684   1.00 0.00 ? 328 PHE B CG   6  
ATOM 9402  C CD1  . PHE B 2 34 ? 0.019   -4.415  2.650   1.00 0.00 ? 328 PHE B CD1  6  
ATOM 9403  C CD2  . PHE B 2 34 ? -0.370  -4.914  0.354   1.00 0.00 ? 328 PHE B CD2  6  
ATOM 9404  C CE1  . PHE B 2 34 ? 1.118   -3.654  2.303   1.00 0.00 ? 328 PHE B CE1  6  
ATOM 9405  C CE2  . PHE B 2 34 ? 0.730   -4.153  0.000   1.00 0.00 ? 328 PHE B CE2  6  
ATOM 9406  C CZ   . PHE B 2 34 ? 1.473   -3.525  0.979   1.00 0.00 ? 328 PHE B CZ   6  
ATOM 9407  H H    . PHE B 2 34 ? -4.002  -6.965  3.039   1.00 0.00 ? 328 PHE B H    6  
ATOM 9408  H HA   . PHE B 2 34 ? -2.633  -4.677  3.707   1.00 0.00 ? 328 PHE B HA   6  
ATOM 9409  H HB2  . PHE B 2 34 ? -1.580  -6.672  2.721   1.00 0.00 ? 328 PHE B HB2  6  
ATOM 9410  H HB3  . PHE B 2 34 ? -2.338  -6.317  1.174   1.00 0.00 ? 328 PHE B HB3  6  
ATOM 9411  H HD1  . PHE B 2 34 ? -0.258  -4.519  3.688   1.00 0.00 ? 328 PHE B HD1  6  
ATOM 9412  H HD2  . PHE B 2 34 ? -0.952  -5.407  -0.411  1.00 0.00 ? 328 PHE B HD2  6  
ATOM 9413  H HE1  . PHE B 2 34 ? 1.699   -3.162  3.069   1.00 0.00 ? 328 PHE B HE1  6  
ATOM 9414  H HE2  . PHE B 2 34 ? 1.005   -4.052  -1.039  1.00 0.00 ? 328 PHE B HE2  6  
ATOM 9415  H HZ   . PHE B 2 34 ? 2.334   -2.931  0.709   1.00 0.00 ? 328 PHE B HZ   6  
ATOM 9416  N N    . LEU B 2 35 ? -4.271  -4.316  0.863   1.00 0.00 ? 329 LEU B N    6  
ATOM 9417  C CA   . LEU B 2 35 ? -4.813  -3.321  -0.060  1.00 0.00 ? 329 LEU B CA   6  
ATOM 9418  C C    . LEU B 2 35 ? -5.738  -2.343  0.668   1.00 0.00 ? 329 LEU B C    6  
ATOM 9419  O O    . LEU B 2 35 ? -5.554  -1.128  0.582   1.00 0.00 ? 329 LEU B O    6  
ATOM 9420  C CB   . LEU B 2 35 ? -5.552  -3.998  -1.220  1.00 0.00 ? 329 LEU B CB   6  
ATOM 9421  C CG   . LEU B 2 35 ? -4.681  -4.895  -2.108  1.00 0.00 ? 329 LEU B CG   6  
ATOM 9422  C CD1  . LEU B 2 35 ? -5.500  -5.477  -3.252  1.00 0.00 ? 329 LEU B CD1  6  
ATOM 9423  C CD2  . LEU B 2 35 ? -3.482  -4.123  -2.645  1.00 0.00 ? 329 LEU B CD2  6  
ATOM 9424  H H    . LEU B 2 35 ? -4.465  -5.268  0.715   1.00 0.00 ? 329 LEU B H    6  
ATOM 9425  H HA   . LEU B 2 35 ? -3.978  -2.766  -0.458  1.00 0.00 ? 329 LEU B HA   6  
ATOM 9426  H HB2  . LEU B 2 35 ? -6.349  -4.601  -0.809  1.00 0.00 ? 329 LEU B HB2  6  
ATOM 9427  H HB3  . LEU B 2 35 ? -5.987  -3.230  -1.839  1.00 0.00 ? 329 LEU B HB3  6  
ATOM 9428  H HG   . LEU B 2 35 ? -4.307  -5.718  -1.518  1.00 0.00 ? 329 LEU B HG   6  
ATOM 9429  H HD11 . LEU B 2 35 ? -5.222  -4.995  -4.177  1.00 0.00 ? 329 LEU B HD11 6  
ATOM 9430  H HD12 . LEU B 2 35 ? -6.550  -5.312  -3.062  1.00 0.00 ? 329 LEU B HD12 6  
ATOM 9431  H HD13 . LEU B 2 35 ? -5.311  -6.537  -3.327  1.00 0.00 ? 329 LEU B HD13 6  
ATOM 9432  H HD21 . LEU B 2 35 ? -3.810  -3.430  -3.407  1.00 0.00 ? 329 LEU B HD21 6  
ATOM 9433  H HD22 . LEU B 2 35 ? -2.770  -4.814  -3.070  1.00 0.00 ? 329 LEU B HD22 6  
ATOM 9434  H HD23 . LEU B 2 35 ? -3.014  -3.574  -1.840  1.00 0.00 ? 329 LEU B HD23 6  
ATOM 9435  N N    . GLU B 2 36 ? -6.724  -2.878  1.396   1.00 0.00 ? 330 GLU B N    6  
ATOM 9436  C CA   . GLU B 2 36 ? -7.671  -2.047  2.148   1.00 0.00 ? 330 GLU B CA   6  
ATOM 9437  C C    . GLU B 2 36 ? -6.948  -1.159  3.163   1.00 0.00 ? 330 GLU B C    6  
ATOM 9438  O O    . GLU B 2 36 ? -7.375  -0.033  3.420   1.00 0.00 ? 330 GLU B O    6  
ATOM 9439  C CB   . GLU B 2 36 ? -8.706  -2.923  2.863   1.00 0.00 ? 330 GLU B CB   6  
ATOM 9440  C CG   . GLU B 2 36 ? -9.568  -3.745  1.916   1.00 0.00 ? 330 GLU B CG   6  
ATOM 9441  C CD   . GLU B 2 36 ? -10.317 -2.889  0.912   1.00 0.00 ? 330 GLU B CD   6  
ATOM 9442  O OE1  . GLU B 2 36 ? -11.154 -2.065  1.338   1.00 0.00 ? 330 GLU B OE1  6  
ATOM 9443  O OE2  . GLU B 2 36 ? -10.062 -3.038  -0.302  1.00 0.00 ? 330 GLU B OE2  6  
ATOM 9444  H H    . GLU B 2 36 ? -6.812  -3.853  1.432   1.00 0.00 ? 330 GLU B H    6  
ATOM 9445  H HA   . GLU B 2 36 ? -8.184  -1.410  1.439   1.00 0.00 ? 330 GLU B HA   6  
ATOM 9446  H HB2  . GLU B 2 36 ? -8.188  -3.601  3.525   1.00 0.00 ? 330 GLU B HB2  6  
ATOM 9447  H HB3  . GLU B 2 36 ? -9.355  -2.288  3.448   1.00 0.00 ? 330 GLU B HB3  6  
ATOM 9448  H HG2  . GLU B 2 36 ? -8.934  -4.433  1.377   1.00 0.00 ? 330 GLU B HG2  6  
ATOM 9449  H HG3  . GLU B 2 36 ? -10.287 -4.302  2.499   1.00 0.00 ? 330 GLU B HG3  6  
ATOM 9450  N N    . ILE B 2 37 ? -5.842  -1.663  3.718   1.00 0.00 ? 331 ILE B N    6  
ATOM 9451  C CA   . ILE B 2 37 ? -5.044  -0.907  4.683   1.00 0.00 ? 331 ILE B CA   6  
ATOM 9452  C C    . ILE B 2 37 ? -4.563  0.397   4.048   1.00 0.00 ? 331 ILE B C    6  
ATOM 9453  O O    . ILE B 2 37 ? -4.773  1.485   4.591   1.00 0.00 ? 331 ILE B O    6  
ATOM 9454  C CB   . ILE B 2 37 ? -3.836  -1.740  5.160   1.00 0.00 ? 331 ILE B CB   6  
ATOM 9455  C CG1  . ILE B 2 37 ? -4.316  -2.891  6.043   1.00 0.00 ? 331 ILE B CG1  6  
ATOM 9456  C CG2  . ILE B 2 37 ? -2.829  -0.881  5.911   1.00 0.00 ? 331 ILE B CG2  6  
ATOM 9457  C CD1  . ILE B 2 37 ? -3.249  -3.921  6.314   1.00 0.00 ? 331 ILE B CD1  6  
ATOM 9458  H H    . ILE B 2 37 ? -5.543  -2.559  3.457   1.00 0.00 ? 331 ILE B H    6  
ATOM 9459  H HA   . ILE B 2 37 ? -5.664  -0.686  5.537   1.00 0.00 ? 331 ILE B HA   6  
ATOM 9460  H HB   . ILE B 2 37 ? -3.343  -2.148  4.292   1.00 0.00 ? 331 ILE B HB   6  
ATOM 9461  H HG12 . ILE B 2 37 ? -4.643  -2.497  6.992   1.00 0.00 ? 331 ILE B HG12 6  
ATOM 9462  H HG13 . ILE B 2 37 ? -5.143  -3.387  5.562   1.00 0.00 ? 331 ILE B HG13 6  
ATOM 9463  H HG21 . ILE B 2 37 ? -3.152  -0.756  6.933   1.00 0.00 ? 331 ILE B HG21 6  
ATOM 9464  H HG22 . ILE B 2 37 ? -2.750  0.085   5.436   1.00 0.00 ? 331 ILE B HG22 6  
ATOM 9465  H HG23 . ILE B 2 37 ? -1.864  -1.370  5.895   1.00 0.00 ? 331 ILE B HG23 6  
ATOM 9466  H HD11 . ILE B 2 37 ? -2.468  -3.476  6.910   1.00 0.00 ? 331 ILE B HD11 6  
ATOM 9467  H HD12 . ILE B 2 37 ? -2.837  -4.264  5.378   1.00 0.00 ? 331 ILE B HD12 6  
ATOM 9468  H HD13 . ILE B 2 37 ? -3.681  -4.754  6.845   1.00 0.00 ? 331 ILE B HD13 6  
ATOM 9469  N N    . LEU B 2 38 ? -3.937  0.263   2.880   1.00 0.00 ? 332 LEU B N    6  
ATOM 9470  C CA   . LEU B 2 38 ? -3.432  1.405   2.117   1.00 0.00 ? 332 LEU B CA   6  
ATOM 9471  C C    . LEU B 2 38 ? -4.587  2.307   1.696   1.00 0.00 ? 332 LEU B C    6  
ATOM 9472  O O    . LEU B 2 38 ? -4.541  3.525   1.869   1.00 0.00 ? 332 LEU B O    6  
ATOM 9473  C CB   . LEU B 2 38 ? -2.695  0.909   0.872   1.00 0.00 ? 332 LEU B CB   6  
ATOM 9474  C CG   . LEU B 2 38 ? -1.740  -0.259  1.109   1.00 0.00 ? 332 LEU B CG   6  
ATOM 9475  C CD1  . LEU B 2 38 ? -1.223  -0.804  -0.208  1.00 0.00 ? 332 LEU B CD1  6  
ATOM 9476  C CD2  . LEU B 2 38 ? -0.597  0.165   2.006   1.00 0.00 ? 332 LEU B CD2  6  
ATOM 9477  H H    . LEU B 2 38 ? -3.827  -0.637  2.508   1.00 0.00 ? 332 LEU B H    6  
ATOM 9478  H HA   . LEU B 2 38 ? -2.750  1.961   2.743   1.00 0.00 ? 332 LEU B HA   6  
ATOM 9479  H HB2  . LEU B 2 38 ? -3.430  0.604   0.146   1.00 0.00 ? 332 LEU B HB2  6  
ATOM 9480  H HB3  . LEU B 2 38 ? -2.128  1.731   0.463   1.00 0.00 ? 332 LEU B HB3  6  
ATOM 9481  H HG   . LEU B 2 38 ? -2.273  -1.053  1.605   1.00 0.00 ? 332 LEU B HG   6  
ATOM 9482  H HD11 . LEU B 2 38 ? -1.117  0.005   -0.914  1.00 0.00 ? 332 LEU B HD11 6  
ATOM 9483  H HD12 . LEU B 2 38 ? -1.928  -1.528  -0.593  1.00 0.00 ? 332 LEU B HD12 6  
ATOM 9484  H HD13 . LEU B 2 38 ? -0.267  -1.279  -0.053  1.00 0.00 ? 332 LEU B HD13 6  
ATOM 9485  H HD21 . LEU B 2 38 ? -0.005  -0.698  2.267   1.00 0.00 ? 332 LEU B HD21 6  
ATOM 9486  H HD22 . LEU B 2 38 ? -1.000  0.611   2.904   1.00 0.00 ? 332 LEU B HD22 6  
ATOM 9487  H HD23 . LEU B 2 38 ? 0.018   0.886   1.491   1.00 0.00 ? 332 LEU B HD23 6  
ATOM 9488  N N    . HIS B 2 39 ? -5.618  1.680   1.130   1.00 0.00 ? 333 HIS B N    6  
ATOM 9489  C CA   . HIS B 2 39 ? -6.813  2.389   0.656   1.00 0.00 ? 333 HIS B CA   6  
ATOM 9490  C C    . HIS B 2 39 ? -7.441  3.260   1.751   1.00 0.00 ? 333 HIS B C    6  
ATOM 9491  O O    . HIS B 2 39 ? -7.848  4.390   1.483   1.00 0.00 ? 333 HIS B O    6  
ATOM 9492  C CB   . HIS B 2 39 ? -7.853  1.395   0.130   1.00 0.00 ? 333 HIS B CB   6  
ATOM 9493  C CG   . HIS B 2 39 ? -7.522  0.829   -1.217  1.00 0.00 ? 333 HIS B CG   6  
ATOM 9494  N ND1  . HIS B 2 39 ? -7.347  1.611   -2.341  1.00 0.00 ? 333 HIS B ND1  6  
ATOM 9495  C CD2  . HIS B 2 39 ? -7.341  -0.449  -1.620  1.00 0.00 ? 333 HIS B CD2  6  
ATOM 9496  C CE1  . HIS B 2 39 ? -7.076  0.835   -3.375  1.00 0.00 ? 333 HIS B CE1  6  
ATOM 9497  N NE2  . HIS B 2 39 ? -7.067  -0.419  -2.965  1.00 0.00 ? 333 HIS B NE2  6  
ATOM 9498  H H    . HIS B 2 39 ? -5.565  0.703   1.017   1.00 0.00 ? 333 HIS B H    6  
ATOM 9499  H HA   . HIS B 2 39 ? -6.507  3.031   -0.156  1.00 0.00 ? 333 HIS B HA   6  
ATOM 9500  H HB2  . HIS B 2 39 ? -7.930  0.569   0.822   1.00 0.00 ? 333 HIS B HB2  6  
ATOM 9501  H HB3  . HIS B 2 39 ? -8.811  1.885   0.060   1.00 0.00 ? 333 HIS B HB3  6  
ATOM 9502  H HD1  . HIS B 2 39 ? -7.412  2.587   -2.375  1.00 0.00 ? 333 HIS B HD1  6  
ATOM 9503  H HD2  . HIS B 2 39 ? -7.403  -1.328  -0.996  1.00 0.00 ? 333 HIS B HD2  6  
ATOM 9504  H HE1  . HIS B 2 39 ? -6.896  1.169   -4.385  1.00 0.00 ? 333 HIS B HE1  6  
ATOM 9505  H HE2  . HIS B 2 39 ? -6.785  -1.187  -3.503  1.00 0.00 ? 333 HIS B HE2  6  
ATOM 9506  N N    . THR B 2 40 ? -7.511  2.738   2.982   1.00 0.00 ? 334 THR B N    6  
ATOM 9507  C CA   . THR B 2 40 ? -8.086  3.491   4.102   1.00 0.00 ? 334 THR B CA   6  
ATOM 9508  C C    . THR B 2 40 ? -7.290  4.775   4.332   1.00 0.00 ? 334 THR B C    6  
ATOM 9509  O O    . THR B 2 40 ? -7.863  5.850   4.498   1.00 0.00 ? 334 THR B O    6  
ATOM 9510  C CB   . THR B 2 40 ? -8.097  2.634   5.380   1.00 0.00 ? 334 THR B CB   6  
ATOM 9511  O OG1  . THR B 2 40 ? -8.915  1.490   5.206   1.00 0.00 ? 334 THR B OG1  6  
ATOM 9512  C CG2  . THR B 2 40 ? -8.596  3.368   6.616   1.00 0.00 ? 334 THR B CG2  6  
ATOM 9513  H H    . THR B 2 40 ? -7.165  1.834   3.140   1.00 0.00 ? 334 THR B H    6  
ATOM 9514  H HA   . THR B 2 40 ? -9.101  3.752   3.841   1.00 0.00 ? 334 THR B HA   6  
ATOM 9515  H HB   . THR B 2 40 ? -7.089  2.298   5.580   1.00 0.00 ? 334 THR B HB   6  
ATOM 9516  H HG1  . THR B 2 40 ? -8.410  0.700   5.414   1.00 0.00 ? 334 THR B HG1  6  
ATOM 9517  H HG21 . THR B 2 40 ? -7.930  3.171   7.450   1.00 0.00 ? 334 THR B HG21 6  
ATOM 9518  H HG22 . THR B 2 40 ? -9.589  3.025   6.863   1.00 0.00 ? 334 THR B HG22 6  
ATOM 9519  H HG23 . THR B 2 40 ? -8.619  4.430   6.421   1.00 0.00 ? 334 THR B HG23 6  
ATOM 9520  N N    . TYR B 2 41 ? -5.965  4.642   4.321   1.00 0.00 ? 335 TYR B N    6  
ATOM 9521  C CA   . TYR B 2 41 ? -5.054  5.769   4.510   1.00 0.00 ? 335 TYR B CA   6  
ATOM 9522  C C    . TYR B 2 41 ? -5.360  6.924   3.550   1.00 0.00 ? 335 TYR B C    6  
ATOM 9523  O O    . TYR B 2 41 ? -5.647  8.037   3.995   1.00 0.00 ? 335 TYR B O    6  
ATOM 9524  C CB   . TYR B 2 41 ? -3.618  5.270   4.338   1.00 0.00 ? 335 TYR B CB   6  
ATOM 9525  C CG   . TYR B 2 41 ? -2.566  6.348   4.304   1.00 0.00 ? 335 TYR B CG   6  
ATOM 9526  C CD1  . TYR B 2 41 ? -2.307  7.050   3.139   1.00 0.00 ? 335 TYR B CD1  6  
ATOM 9527  C CD2  . TYR B 2 41 ? -1.820  6.648   5.429   1.00 0.00 ? 335 TYR B CD2  6  
ATOM 9528  C CE1  . TYR B 2 41 ? -1.332  8.019   3.092   1.00 0.00 ? 335 TYR B CE1  6  
ATOM 9529  C CE2  . TYR B 2 41 ? -0.843  7.621   5.396   1.00 0.00 ? 335 TYR B CE2  6  
ATOM 9530  C CZ   . TYR B 2 41 ? -0.599  8.303   4.223   1.00 0.00 ? 335 TYR B CZ   6  
ATOM 9531  O OH   . TYR B 2 41 ? 0.378   9.270   4.179   1.00 0.00 ? 335 TYR B OH   6  
ATOM 9532  H H    . TYR B 2 41 ? -5.583  3.751   4.169   1.00 0.00 ? 335 TYR B H    6  
ATOM 9533  H HA   . TYR B 2 41 ? -5.170  6.126   5.523   1.00 0.00 ? 335 TYR B HA   6  
ATOM 9534  H HB2  . TYR B 2 41 ? -3.383  4.611   5.156   1.00 0.00 ? 335 TYR B HB2  6  
ATOM 9535  H HB3  . TYR B 2 41 ? -3.552  4.716   3.413   1.00 0.00 ? 335 TYR B HB3  6  
ATOM 9536  H HD1  . TYR B 2 41 ? -2.884  6.829   2.258   1.00 0.00 ? 335 TYR B HD1  6  
ATOM 9537  H HD2  . TYR B 2 41 ? -2.016  6.109   6.347   1.00 0.00 ? 335 TYR B HD2  6  
ATOM 9538  H HE1  . TYR B 2 41 ? -1.145  8.546   2.173   1.00 0.00 ? 335 TYR B HE1  6  
ATOM 9539  H HE2  . TYR B 2 41 ? -0.273  7.838   6.283   1.00 0.00 ? 335 TYR B HE2  6  
ATOM 9540  H HH   . TYR B 2 41 ? 1.226   8.861   3.986   1.00 0.00 ? 335 TYR B HH   6  
ATOM 9541  N N    . GLN B 2 42 ? -5.284  6.664   2.241   1.00 0.00 ? 336 GLN B N    6  
ATOM 9542  C CA   . GLN B 2 42 ? -5.536  7.676   1.234   1.00 0.00 ? 336 GLN B CA   6  
ATOM 9543  C C    . GLN B 2 42 ? -6.868  8.399   1.446   1.00 0.00 ? 336 GLN B C    6  
ATOM 9544  O O    . GLN B 2 42 ? -6.941  9.621   1.307   1.00 0.00 ? 336 GLN B O    6  
ATOM 9545  C CB   . GLN B 2 42 ? -5.524  7.039   -0.151  1.00 0.00 ? 336 GLN B CB   6  
ATOM 9546  C CG   . GLN B 2 42 ? -5.166  8.036   -1.219  1.00 0.00 ? 336 GLN B CG   6  
ATOM 9547  C CD   . GLN B 2 42 ? -5.377  7.521   -2.630  1.00 0.00 ? 336 GLN B CD   6  
ATOM 9548  O OE1  . GLN B 2 42 ? -6.447  7.014   -2.965  1.00 0.00 ? 336 GLN B OE1  6  
ATOM 9549  N NE2  . GLN B 2 42 ? -4.362  7.673   -3.474  1.00 0.00 ? 336 GLN B NE2  6  
ATOM 9550  H H    . GLN B 2 42 ? -5.035  5.772   1.939   1.00 0.00 ? 336 GLN B H    6  
ATOM 9551  H HA   . GLN B 2 42 ? -4.738  8.399   1.286   1.00 0.00 ? 336 GLN B HA   6  
ATOM 9552  H HB2  . GLN B 2 42 ? -4.799  6.237   -0.167  1.00 0.00 ? 336 GLN B HB2  6  
ATOM 9553  H HB3  . GLN B 2 42 ? -6.503  6.638   -0.367  1.00 0.00 ? 336 GLN B HB3  6  
ATOM 9554  H HG2  . GLN B 2 42 ? -5.768  8.915   -1.074  1.00 0.00 ? 336 GLN B HG2  6  
ATOM 9555  H HG3  . GLN B 2 42 ? -4.127  8.285   -1.090  1.00 0.00 ? 336 GLN B HG3  6  
ATOM 9556  H HE21 . GLN B 2 42 ? -3.544  8.099   -3.144  1.00 0.00 ? 336 GLN B HE21 6  
ATOM 9557  H HE22 . GLN B 2 42 ? -4.476  7.358   -4.395  1.00 0.00 ? 336 GLN B HE22 6  
ATOM 9558  N N    . LYS B 2 43 ? -7.920  7.641   1.766   1.00 0.00 ? 337 LYS B N    6  
ATOM 9559  C CA   . LYS B 2 43 ? -9.247  8.221   1.978   1.00 0.00 ? 337 LYS B CA   6  
ATOM 9560  C C    . LYS B 2 43 ? -9.234  9.266   3.090   1.00 0.00 ? 337 LYS B C    6  
ATOM 9561  O O    . LYS B 2 43 ? -9.739  10.370  2.910   1.00 0.00 ? 337 LYS B O    6  
ATOM 9562  C CB   . LYS B 2 43 ? -10.269 7.130   2.314   1.00 0.00 ? 337 LYS B CB   6  
ATOM 9563  C CG   . LYS B 2 43 ? -10.532 6.155   1.176   1.00 0.00 ? 337 LYS B CG   6  
ATOM 9564  C CD   . LYS B 2 43 ? -11.612 5.146   1.538   1.00 0.00 ? 337 LYS B CD   6  
ATOM 9565  C CE   . LYS B 2 43 ? -11.208 4.289   2.730   1.00 0.00 ? 337 LYS B CE   6  
ATOM 9566  N NZ   . LYS B 2 43 ? -12.274 3.320   3.112   1.00 0.00 ? 337 LYS B NZ   6  
ATOM 9567  H H    . LYS B 2 43 ? -7.803  6.671   1.852   1.00 0.00 ? 337 LYS B H    6  
ATOM 9568  H HA   . LYS B 2 43 ? -9.544  8.701   1.057   1.00 0.00 ? 337 LYS B HA   6  
ATOM 9569  H HB2  . LYS B 2 43 ? -9.911  6.568   3.164   1.00 0.00 ? 337 LYS B HB2  6  
ATOM 9570  H HB3  . LYS B 2 43 ? -11.206 7.602   2.578   1.00 0.00 ? 337 LYS B HB3  6  
ATOM 9571  H HG2  . LYS B 2 43 ? -10.850 6.711   0.307   1.00 0.00 ? 337 LYS B HG2  6  
ATOM 9572  H HG3  . LYS B 2 43 ? -9.618  5.626   0.951   1.00 0.00 ? 337 LYS B HG3  6  
ATOM 9573  H HD2  . LYS B 2 43 ? -12.519 5.678   1.784   1.00 0.00 ? 337 LYS B HD2  6  
ATOM 9574  H HD3  . LYS B 2 43 ? -11.789 4.504   0.689   1.00 0.00 ? 337 LYS B HD3  6  
ATOM 9575  H HE2  . LYS B 2 43 ? -10.314 3.741   2.475   1.00 0.00 ? 337 LYS B HE2  6  
ATOM 9576  H HE3  . LYS B 2 43 ? -11.004 4.937   3.571   1.00 0.00 ? 337 LYS B HE3  6  
ATOM 9577  H HZ1  . LYS B 2 43 ? -12.243 3.141   4.137   1.00 0.00 ? 337 LYS B HZ1  6  
ATOM 9578  H HZ2  . LYS B 2 43 ? -12.138 2.421   2.610   1.00 0.00 ? 337 LYS B HZ2  6  
ATOM 9579  H HZ3  . LYS B 2 43 ? -13.210 3.702   2.868   1.00 0.00 ? 337 LYS B HZ3  6  
ATOM 9580  N N    . GLU B 2 44 ? -8.663  8.904   4.237   1.00 0.00 ? 338 GLU B N    6  
ATOM 9581  C CA   . GLU B 2 44 ? -8.592  9.803   5.393   1.00 0.00 ? 338 GLU B CA   6  
ATOM 9582  C C    . GLU B 2 44 ? -7.954  11.146  5.035   1.00 0.00 ? 338 GLU B C    6  
ATOM 9583  O O    . GLU B 2 44 ? -8.465  12.198  5.421   1.00 0.00 ? 338 GLU B O    6  
ATOM 9584  C CB   . GLU B 2 44 ? -7.813  9.138   6.529   1.00 0.00 ? 338 GLU B CB   6  
ATOM 9585  C CG   . GLU B 2 44 ? -8.319  7.752   6.894   1.00 0.00 ? 338 GLU B CG   6  
ATOM 9586  C CD   . GLU B 2 44 ? -9.730  7.750   7.449   1.00 0.00 ? 338 GLU B CD   6  
ATOM 9587  O OE1  . GLU B 2 44 ? -10.667 8.110   6.705   1.00 0.00 ? 338 GLU B OE1  6  
ATOM 9588  O OE2  . GLU B 2 44 ? -9.902  7.381   8.628   1.00 0.00 ? 338 GLU B OE2  6  
ATOM 9589  H H    . GLU B 2 44 ? -8.285  8.003   4.312   1.00 0.00 ? 338 GLU B H    6  
ATOM 9590  H HA   . GLU B 2 44 ? -9.605  9.987   5.727   1.00 0.00 ? 338 GLU B HA   6  
ATOM 9591  H HB2  . GLU B 2 44 ? -6.777  9.054   6.239   1.00 0.00 ? 338 GLU B HB2  6  
ATOM 9592  H HB3  . GLU B 2 44 ? -7.880  9.760   7.408   1.00 0.00 ? 338 GLU B HB3  6  
ATOM 9593  H HG2  . GLU B 2 44 ? -8.300  7.135   6.014   1.00 0.00 ? 338 GLU B HG2  6  
ATOM 9594  H HG3  . GLU B 2 44 ? -7.660  7.335   7.633   1.00 0.00 ? 338 GLU B HG3  6  
ATOM 9595  N N    . GLN B 2 45 ? -6.842  11.110  4.290   1.00 0.00 ? 339 GLN B N    6  
ATOM 9596  C CA   . GLN B 2 45 ? -6.157  12.342  3.882   1.00 0.00 ? 339 GLN B CA   6  
ATOM 9597  C C    . GLN B 2 45 ? -7.133  13.262  3.165   1.00 0.00 ? 339 GLN B C    6  
ATOM 9598  O O    . GLN B 2 45 ? -7.300  14.426  3.534   1.00 0.00 ? 339 GLN B O    6  
ATOM 9599  C CB   . GLN B 2 45 ? -4.983  12.039  2.944   1.00 0.00 ? 339 GLN B CB   6  
ATOM 9600  C CG   . GLN B 2 45 ? -4.056  10.955  3.450   1.00 0.00 ? 339 GLN B CG   6  
ATOM 9601  C CD   . GLN B 2 45 ? -2.829  10.785  2.572   1.00 0.00 ? 339 GLN B CD   6  
ATOM 9602  O OE1  . GLN B 2 45 ? -2.932  10.379  1.414   1.00 0.00 ? 339 GLN B OE1  6  
ATOM 9603  N NE2  . GLN B 2 45 ? -1.659  11.107  3.115   1.00 0.00 ? 339 GLN B NE2  6  
ATOM 9604  H H    . GLN B 2 45 ? -6.484  10.244  4.006   1.00 0.00 ? 339 GLN B H    6  
ATOM 9605  H HA   . GLN B 2 45 ? -5.788  12.835  4.769   1.00 0.00 ? 339 GLN B HA   6  
ATOM 9606  H HB2  . GLN B 2 45 ? -5.376  11.726  1.987   1.00 0.00 ? 339 GLN B HB2  6  
ATOM 9607  H HB3  . GLN B 2 45 ? -4.408  12.941  2.806   1.00 0.00 ? 339 GLN B HB3  6  
ATOM 9608  H HG2  . GLN B 2 45 ? -3.738  11.206  4.450   1.00 0.00 ? 339 GLN B HG2  6  
ATOM 9609  H HG3  . GLN B 2 45 ? -4.601  10.024  3.465   1.00 0.00 ? 339 GLN B HG3  6  
ATOM 9610  H HE21 . GLN B 2 45 ? -1.649  11.431  4.040   1.00 0.00 ? 339 GLN B HE21 6  
ATOM 9611  H HE22 . GLN B 2 45 ? -0.852  11.006  2.568   1.00 0.00 ? 339 GLN B HE22 6  
ATOM 9612  N N    . ARG B 2 46 ? -7.775  12.713  2.138   1.00 0.00 ? 340 ARG B N    6  
ATOM 9613  C CA   . ARG B 2 46 ? -8.751  13.457  1.345   1.00 0.00 ? 340 ARG B CA   6  
ATOM 9614  C C    . ARG B 2 46 ? -9.982  13.821  2.178   1.00 0.00 ? 340 ARG B C    6  
ATOM 9615  O O    . ARG B 2 46 ? -10.575 14.879  1.973   1.00 0.00 ? 340 ARG B O    6  
ATOM 9616  C CB   . ARG B 2 46 ? -9.166  12.645  0.114   1.00 0.00 ? 340 ARG B CB   6  
ATOM 9617  C CG   . ARG B 2 46 ? -8.017  12.379  -0.847  1.00 0.00 ? 340 ARG B CG   6  
ATOM 9618  C CD   . ARG B 2 46 ? -8.476  11.605  -2.072  1.00 0.00 ? 340 ARG B CD   6  
ATOM 9619  N NE   . ARG B 2 46 ? -7.383  11.388  -3.022  1.00 0.00 ? 340 ARG B NE   6  
ATOM 9620  C CZ   . ARG B 2 46 ? -7.522  10.757  -4.190  1.00 0.00 ? 340 ARG B CZ   6  
ATOM 9621  N NH1  . ARG B 2 46 ? -8.705  10.273  -4.562  1.00 0.00 ? 340 ARG B NH1  6  
ATOM 9622  N NH2  . ARG B 2 46 ? -6.471  10.612  -4.993  1.00 0.00 ? 340 ARG B NH2  6  
ATOM 9623  H H    . ARG B 2 46 ? -7.584  11.775  1.910   1.00 0.00 ? 340 ARG B H    6  
ATOM 9624  H HA   . ARG B 2 46 ? -8.278  14.369  1.016   1.00 0.00 ? 340 ARG B HA   6  
ATOM 9625  H HB2  . ARG B 2 46 ? -9.565  11.696  0.439   1.00 0.00 ? 340 ARG B HB2  6  
ATOM 9626  H HB3  . ARG B 2 46 ? -9.935  13.186  -0.418  1.00 0.00 ? 340 ARG B HB3  6  
ATOM 9627  H HG2  . ARG B 2 46 ? -7.602  13.323  -1.165  1.00 0.00 ? 340 ARG B HG2  6  
ATOM 9628  H HG3  . ARG B 2 46 ? -7.258  11.806  -0.334  1.00 0.00 ? 340 ARG B HG3  6  
ATOM 9629  H HD2  . ARG B 2 46 ? -8.858  10.646  -1.755  1.00 0.00 ? 340 ARG B HD2  6  
ATOM 9630  H HD3  . ARG B 2 46 ? -9.262  12.163  -2.561  1.00 0.00 ? 340 ARG B HD3  6  
ATOM 9631  H HE   . ARG B 2 46 ? -6.499  11.732  -2.778  1.00 0.00 ? 340 ARG B HE   6  
ATOM 9632  H HH11 . ARG B 2 46 ? -9.500  10.379  -3.967  1.00 0.00 ? 340 ARG B HH11 6  
ATOM 9633  H HH12 . ARG B 2 46 ? -8.798  9.803   -5.441  1.00 0.00 ? 340 ARG B HH12 6  
ATOM 9634  H HH21 . ARG B 2 46 ? -5.580  10.973  -4.720  1.00 0.00 ? 340 ARG B HH21 6  
ATOM 9635  H HH22 . ARG B 2 46 ? -6.573  10.140  -5.870  1.00 0.00 ? 340 ARG B HH22 6  
ATOM 9636  N N    . ASN B 2 47 ? -10.356 12.949  3.119   1.00 0.00 ? 341 ASN B N    6  
ATOM 9637  C CA   . ASN B 2 47 ? -11.513 13.190  3.984   1.00 0.00 ? 341 ASN B CA   6  
ATOM 9638  C C    . ASN B 2 47 ? -11.378 14.527  4.714   1.00 0.00 ? 341 ASN B C    6  
ATOM 9639  O O    . ASN B 2 47 ? -12.271 15.372  4.639   1.00 0.00 ? 341 ASN B O    6  
ATOM 9640  C CB   . ASN B 2 47 ? -11.673 12.046  4.998   1.00 0.00 ? 341 ASN B CB   6  
ATOM 9641  C CG   . ASN B 2 47 ? -12.193 10.743  4.391   1.00 0.00 ? 341 ASN B CG   6  
ATOM 9642  O OD1  . ASN B 2 47 ? -12.325 9.742   5.094   1.00 0.00 ? 341 ASN B OD1  6  
ATOM 9643  N ND2  . ASN B 2 47 ? -12.498 10.735  3.091   1.00 0.00 ? 341 ASN B ND2  6  
ATOM 9644  H H    . ASN B 2 47 ? -9.837  12.125  3.237   1.00 0.00 ? 341 ASN B H    6  
ATOM 9645  H HA   . ASN B 2 47 ? -12.390 13.229  3.358   1.00 0.00 ? 341 ASN B HA   6  
ATOM 9646  H HB2  . ASN B 2 47 ? -10.715 11.844  5.447   1.00 0.00 ? 341 ASN B HB2  6  
ATOM 9647  H HB3  . ASN B 2 47 ? -12.359 12.355  5.771   1.00 0.00 ? 341 ASN B HB3  6  
ATOM 9648  H HD21 . ASN B 2 47 ? -12.380 11.558  2.576   1.00 0.00 ? 341 ASN B HD21 6  
ATOM 9649  H HD22 . ASN B 2 47 ? -12.829 9.898   2.704   1.00 0.00 ? 341 ASN B HD22 6  
ATOM 9650  N N    . ALA B 2 48 ? -10.254 14.713  5.408   1.00 0.00 ? 342 ALA B N    6  
ATOM 9651  C CA   . ALA B 2 48 ? -9.991  15.953  6.141   1.00 0.00 ? 342 ALA B CA   6  
ATOM 9652  C C    . ALA B 2 48 ? -10.100 17.177  5.230   1.00 0.00 ? 342 ALA B C    6  
ATOM 9653  O O    . ALA B 2 48 ? -10.675 18.197  5.614   1.00 0.00 ? 342 ALA B O    6  
ATOM 9654  C CB   . ALA B 2 48 ? -8.617  15.900  6.794   1.00 0.00 ? 342 ALA B CB   6  
ATOM 9655  H H    . ALA B 2 48 ? -9.577  14.002  5.420   1.00 0.00 ? 342 ALA B H    6  
ATOM 9656  H HA   . ALA B 2 48 ? -10.730 16.039  6.922   1.00 0.00 ? 342 ALA B HA   6  
ATOM 9657  H HB1  . ALA B 2 48 ? -7.935  15.358  6.156   1.00 0.00 ? 342 ALA B HB1  6  
ATOM 9658  H HB2  . ALA B 2 48 ? -8.692  15.399  7.749   1.00 0.00 ? 342 ALA B HB2  6  
ATOM 9659  H HB3  . ALA B 2 48 ? -8.249  16.904  6.944   1.00 0.00 ? 342 ALA B HB3  6  
ATOM 9660  N N    . LYS B 2 49 ? -9.541  17.064  4.020   1.00 0.00 ? 343 LYS B N    6  
ATOM 9661  C CA   . LYS B 2 49 ? -9.570  18.158  3.048   1.00 0.00 ? 343 LYS B CA   6  
ATOM 9662  C C    . LYS B 2 49 ? -10.988 18.411  2.530   1.00 0.00 ? 343 LYS B C    6  
ATOM 9663  O O    . LYS B 2 49 ? -11.423 19.561  2.436   1.00 0.00 ? 343 LYS B O    6  
ATOM 9664  C CB   . LYS B 2 49 ? -8.632  17.844  1.878   1.00 0.00 ? 343 LYS B CB   6  
ATOM 9665  C CG   . LYS B 2 49 ? -8.566  18.946  0.832   1.00 0.00 ? 343 LYS B CG   6  
ATOM 9666  C CD   . LYS B 2 49 ? -7.614  18.585  -0.298  1.00 0.00 ? 343 LYS B CD   6  
ATOM 9667  C CE   . LYS B 2 49 ? -7.566  19.672  -1.363  1.00 0.00 ? 343 LYS B CE   6  
ATOM 9668  N NZ   . LYS B 2 49 ? -8.885  19.869  -2.031  1.00 0.00 ? 343 LYS B NZ   6  
ATOM 9669  H H    . LYS B 2 49 ? -9.098  16.225  3.777   1.00 0.00 ? 343 LYS B H    6  
ATOM 9670  H HA   . LYS B 2 49 ? -9.220  19.049  3.546   1.00 0.00 ? 343 LYS B HA   6  
ATOM 9671  H HB2  . LYS B 2 49 ? -7.636  17.686  2.264   1.00 0.00 ? 343 LYS B HB2  6  
ATOM 9672  H HB3  . LYS B 2 49 ? -8.969  16.939  1.395   1.00 0.00 ? 343 LYS B HB3  6  
ATOM 9673  H HG2  . LYS B 2 49 ? -9.553  19.100  0.422   1.00 0.00 ? 343 LYS B HG2  6  
ATOM 9674  H HG3  . LYS B 2 49 ? -8.223  19.857  1.303   1.00 0.00 ? 343 LYS B HG3  6  
ATOM 9675  H HD2  . LYS B 2 49 ? -6.623  18.451  0.109   1.00 0.00 ? 343 LYS B HD2  6  
ATOM 9676  H HD3  . LYS B 2 49 ? -7.945  17.662  -0.753  1.00 0.00 ? 343 LYS B HD3  6  
ATOM 9677  H HE2  . LYS B 2 49 ? -7.267  20.600  -0.896  1.00 0.00 ? 343 LYS B HE2  6  
ATOM 9678  H HE3  . LYS B 2 49 ? -6.834  19.394  -2.106  1.00 0.00 ? 343 LYS B HE3  6  
ATOM 9679  H HZ1  . LYS B 2 49 ? -9.576  19.174  -1.680  1.00 0.00 ? 343 LYS B HZ1  6  
ATOM 9680  H HZ2  . LYS B 2 49 ? -8.786  19.752  -3.058  1.00 0.00 ? 343 LYS B HZ2  6  
ATOM 9681  H HZ3  . LYS B 2 49 ? -9.244  20.827  -1.836  1.00 0.00 ? 343 LYS B HZ3  6  
ATOM 9682  N N    . GLU B 2 50 ? -11.704 17.333  2.197   1.00 0.00 ? 344 GLU B N    6  
ATOM 9683  C CA   . GLU B 2 50 ? -13.073 17.437  1.689   1.00 0.00 ? 344 GLU B CA   6  
ATOM 9684  C C    . GLU B 2 50 ? -14.010 18.083  2.711   1.00 0.00 ? 344 GLU B C    6  
ATOM 9685  O O    . GLU B 2 50 ? -14.994 18.723  2.337   1.00 0.00 ? 344 GLU B O    6  
ATOM 9686  C CB   . GLU B 2 50 ? -13.608 16.055  1.293   1.00 0.00 ? 344 GLU B CB   6  
ATOM 9687  C CG   . GLU B 2 50 ? -12.889 15.429  0.102   1.00 0.00 ? 344 GLU B CG   6  
ATOM 9688  C CD   . GLU B 2 50 ? -13.105 16.175  -1.209  1.00 0.00 ? 344 GLU B CD   6  
ATOM 9689  O OE1  . GLU B 2 50 ? -13.881 17.156  -1.230  1.00 0.00 ? 344 GLU B OE1  6  
ATOM 9690  O OE2  . GLU B 2 50 ? -12.499 15.767  -2.222  1.00 0.00 ? 344 GLU B OE2  6  
ATOM 9691  H H    . GLU B 2 50 ? -11.299 16.445  2.296   1.00 0.00 ? 344 GLU B H    6  
ATOM 9692  H HA   . GLU B 2 50 ? -13.046 18.062  0.808   1.00 0.00 ? 344 GLU B HA   6  
ATOM 9693  H HB2  . GLU B 2 50 ? -13.507 15.389  2.136   1.00 0.00 ? 344 GLU B HB2  6  
ATOM 9694  H HB3  . GLU B 2 50 ? -14.656 16.146  1.045   1.00 0.00 ? 344 GLU B HB3  6  
ATOM 9695  H HG2  . GLU B 2 50 ? -11.830 15.413  0.311   1.00 0.00 ? 344 GLU B HG2  6  
ATOM 9696  H HG3  . GLU B 2 50 ? -13.241 14.415  -0.017  1.00 0.00 ? 344 GLU B HG3  6  
ATOM 9697  N N    . ALA B 2 51 ? -13.702 17.917  4.001   1.00 0.00 ? 345 ALA B N    6  
ATOM 9698  C CA   . ALA B 2 51 ? -14.523 18.491  5.068   1.00 0.00 ? 345 ALA B CA   6  
ATOM 9699  C C    . ALA B 2 51 ? -14.535 20.017  4.994   1.00 0.00 ? 345 ALA B C    6  
ATOM 9700  O O    . ALA B 2 51 ? -15.587 20.642  5.145   1.00 0.00 ? 345 ALA B O    6  
ATOM 9701  C CB   . ALA B 2 51 ? -14.023 18.030  6.430   1.00 0.00 ? 345 ALA B CB   6  
ATOM 9702  H H    . ALA B 2 51 ? -12.905 17.397  4.241   1.00 0.00 ? 345 ALA B H    6  
ATOM 9703  H HA   . ALA B 2 51 ? -15.533 18.127  4.941   1.00 0.00 ? 345 ALA B HA   6  
ATOM 9704  H HB1  . ALA B 2 51 ? -13.436 18.814  6.885   1.00 0.00 ? 345 ALA B HB1  6  
ATOM 9705  H HB2  . ALA B 2 51 ? -13.411 17.146  6.311   1.00 0.00 ? 345 ALA B HB2  6  
ATOM 9706  H HB3  . ALA B 2 51 ? -14.865 17.799  7.064   1.00 0.00 ? 345 ALA B HB3  6  
ATOM 9707  N N    . GLY B 2 52 ? -13.361 20.609  4.756   1.00 0.00 ? 346 GLY B N    6  
ATOM 9708  C CA   . GLY B 2 52 ? -13.253 22.059  4.661   1.00 0.00 ? 346 GLY B CA   6  
ATOM 9709  C C    . GLY B 2 52 ? -13.755 22.773  5.904   1.00 0.00 ? 346 GLY B C    6  
ATOM 9710  O O    . GLY B 2 52 ? -14.392 23.824  5.802   1.00 0.00 ? 346 GLY B O    6  
ATOM 9711  H H    . GLY B 2 52 ? -12.559 20.057  4.642   1.00 0.00 ? 346 GLY B H    6  
ATOM 9712  H HA2  . GLY B 2 52 ? -12.217 22.321  4.505   1.00 0.00 ? 346 GLY B HA2  6  
ATOM 9713  H HA3  . GLY B 2 52 ? -13.828 22.394  3.810   1.00 0.00 ? 346 GLY B HA3  6  
ATOM 9714  N N    . GLY B 2 53 ? -13.469 22.204  7.075   1.00 0.00 ? 347 GLY B N    6  
ATOM 9715  C CA   . GLY B 2 53 ? -13.903 22.806  8.325   1.00 0.00 ? 347 GLY B CA   6  
ATOM 9716  C C    . GLY B 2 53 ? -12.999 22.444  9.486   1.00 0.00 ? 347 GLY B C    6  
ATOM 9717  O O    . GLY B 2 53 ? -12.065 23.183  9.801   1.00 0.00 ? 347 GLY B O    6  
ATOM 9718  H H    . GLY B 2 53 ? -12.959 21.367  7.091   1.00 0.00 ? 347 GLY B H    6  
ATOM 9719  H HA2  . GLY B 2 53 ? -13.914 23.880  8.211   1.00 0.00 ? 347 GLY B HA2  6  
ATOM 9720  H HA3  . GLY B 2 53 ? -14.906 22.469  8.544   1.00 0.00 ? 347 GLY B HA3  6  
ATOM 9721  N N    . ASN B 2 54 ? -13.278 21.303  10.120  1.00 0.00 ? 348 ASN B N    6  
ATOM 9722  C CA   . ASN B 2 54 ? -12.488 20.831  11.260  1.00 0.00 ? 348 ASN B CA   6  
ATOM 9723  C C    . ASN B 2 54 ? -12.622 19.316  11.423  1.00 0.00 ? 348 ASN B C    6  
ATOM 9724  O O    . ASN B 2 54 ? -13.544 18.831  12.086  1.00 0.00 ? 348 ASN B O    6  
ATOM 9725  C CB   . ASN B 2 54 ? -12.934 21.529  12.553  1.00 0.00 ? 348 ASN B CB   6  
ATOM 9726  C CG   . ASN B 2 54 ? -12.655 23.023  12.549  1.00 0.00 ? 348 ASN B CG   6  
ATOM 9727  O OD1  . ASN B 2 54 ? -11.501 23.449  12.509  1.00 0.00 ? 348 ASN B OD1  6  
ATOM 9728  N ND2  . ASN B 2 54 ? -13.714 23.826  12.588  1.00 0.00 ? 348 ASN B ND2  6  
ATOM 9729  H H    . ASN B 2 54 ? -14.037 20.763  9.813   1.00 0.00 ? 348 ASN B H    6  
ATOM 9730  H HA   . ASN B 2 54 ? -11.453 21.070  11.069  1.00 0.00 ? 348 ASN B HA   6  
ATOM 9731  H HB2  . ASN B 2 54 ? -13.996 21.383  12.684  1.00 0.00 ? 348 ASN B HB2  6  
ATOM 9732  H HB3  . ASN B 2 54 ? -12.411 21.087  13.389  1.00 0.00 ? 348 ASN B HB3  6  
ATOM 9733  H HD21 . ASN B 2 54 ? -14.605 23.417  12.617  1.00 0.00 ? 348 ASN B HD21 6  
ATOM 9734  H HD22 . ASN B 2 54 ? -13.561 24.793  12.587  1.00 0.00 ? 348 ASN B HD22 6  
ATOM 9735  N N    . TYR B 2 55 ? -11.697 18.575  10.814  1.00 0.00 ? 349 TYR B N    6  
ATOM 9736  C CA   . TYR B 2 55 ? -11.707 17.114  10.892  1.00 0.00 ? 349 TYR B CA   6  
ATOM 9737  C C    . TYR B 2 55 ? -10.327 16.528  10.622  1.00 0.00 ? 349 TYR B C    6  
ATOM 9738  O O    . TYR B 2 55 ? -9.775  16.694  9.533   1.00 0.00 ? 349 TYR B O    6  
ATOM 9739  C CB   . TYR B 2 55 ? -12.694 16.514  9.883   1.00 0.00 ? 349 TYR B CB   6  
ATOM 9740  C CG   . TYR B 2 55 ? -12.578 15.004  9.765   1.00 0.00 ? 349 TYR B CG   6  
ATOM 9741  C CD1  . TYR B 2 55 ? -11.684 14.429  8.865   1.00 0.00 ? 349 TYR B CD1  6  
ATOM 9742  C CD2  . TYR B 2 55 ? -13.329 14.157  10.569  1.00 0.00 ? 349 TYR B CD2  6  
ATOM 9743  C CE1  . TYR B 2 55 ? -11.550 13.059  8.763   1.00 0.00 ? 349 TYR B CE1  6  
ATOM 9744  C CE2  . TYR B 2 55 ? -13.198 12.783  10.476  1.00 0.00 ? 349 TYR B CE2  6  
ATOM 9745  C CZ   . TYR B 2 55 ? -12.308 12.240  9.571   1.00 0.00 ? 349 TYR B CZ   6  
ATOM 9746  O OH   . TYR B 2 55 ? -12.174 10.873  9.476   1.00 0.00 ? 349 TYR B OH   6  
ATOM 9747  H H    . TYR B 2 55 ? -10.989 19.019  10.301  1.00 0.00 ? 349 TYR B H    6  
ATOM 9748  H HA   . TYR B 2 55 ? -12.016 16.837  11.888  1.00 0.00 ? 349 TYR B HA   6  
ATOM 9749  H HB2  . TYR B 2 55 ? -13.703 16.748  10.190  1.00 0.00 ? 349 TYR B HB2  6  
ATOM 9750  H HB3  . TYR B 2 55 ? -12.509 16.940  8.908   1.00 0.00 ? 349 TYR B HB3  6  
ATOM 9751  H HD1  . TYR B 2 55 ? -11.089 15.070  8.237   1.00 0.00 ? 349 TYR B HD1  6  
ATOM 9752  H HD2  . TYR B 2 55 ? -14.027 14.583  11.275  1.00 0.00 ? 349 TYR B HD2  6  
ATOM 9753  H HE1  . TYR B 2 55 ? -10.847 12.640  8.057   1.00 0.00 ? 349 TYR B HE1  6  
ATOM 9754  H HE2  . TYR B 2 55 ? -13.791 12.140  11.110  1.00 0.00 ? 349 TYR B HE2  6  
ATOM 9755  H HH   . TYR B 2 55 ? -11.486 10.574  10.075  1.00 0.00 ? 349 TYR B HH   6  
ATOM 9756  N N    . THR B 2 56 ? -9.795  15.800  11.599  1.00 0.00 ? 350 THR B N    6  
ATOM 9757  C CA   . THR B 2 56 ? -8.509  15.142  11.434  1.00 0.00 ? 350 THR B CA   6  
ATOM 9758  C C    . THR B 2 56 ? -8.738  13.701  10.972  1.00 0.00 ? 350 THR B C    6  
ATOM 9759  O O    . THR B 2 56 ? -9.670  13.038  11.437  1.00 0.00 ? 350 THR B O    6  
ATOM 9760  C CB   . THR B 2 56 ? -7.694  15.173  12.724  1.00 0.00 ? 350 THR B CB   6  
ATOM 9761  O OG1  . THR B 2 56 ? -6.312  15.004  12.448  1.00 0.00 ? 350 THR B OG1  6  
ATOM 9762  C CG2  . THR B 2 56 ? -8.090  14.088  13.673  1.00 0.00 ? 350 THR B CG2  6  
ATOM 9763  H H    . THR B 2 56 ? -10.296 15.671  12.433  1.00 0.00 ? 350 THR B H    6  
ATOM 9764  H HA   . THR B 2 56 ? -7.969  15.660  10.676  1.00 0.00 ? 350 THR B HA   6  
ATOM 9765  H HB   . THR B 2 56 ? -7.838  16.123  13.217  1.00 0.00 ? 350 THR B HB   6  
ATOM 9766  H HG1  . THR B 2 56 ? -6.014  15.701  11.859  1.00 0.00 ? 350 THR B HG1  6  
ATOM 9767  H HG21 . THR B 2 56 ? -7.626  13.169  13.359  1.00 0.00 ? 350 THR B HG21 6  
ATOM 9768  H HG22 . THR B 2 56 ? -9.162  13.979  13.649  1.00 0.00 ? 350 THR B HG22 6  
ATOM 9769  H HG23 . THR B 2 56 ? -7.768  14.340  14.669  1.00 0.00 ? 350 THR B HG23 6  
ATOM 9770  N N    . PRO B 2 57 ? -7.911  13.198  10.045  1.00 0.00 ? 351 PRO B N    6  
ATOM 9771  C CA   . PRO B 2 57 ? -8.043  11.835  9.522   1.00 0.00 ? 351 PRO B CA   6  
ATOM 9772  C C    . PRO B 2 57 ? -7.689  10.781  10.566  1.00 0.00 ? 351 PRO B C    6  
ATOM 9773  O O    . PRO B 2 57 ? -6.724  10.941  11.315  1.00 0.00 ? 351 PRO B O    6  
ATOM 9774  C CB   . PRO B 2 57 ? -7.044  11.791  8.356   1.00 0.00 ? 351 PRO B CB   6  
ATOM 9775  C CG   . PRO B 2 57 ? -6.678  13.213  8.101   1.00 0.00 ? 351 PRO B CG   6  
ATOM 9776  C CD   . PRO B 2 57 ? -6.788  13.905  9.427   1.00 0.00 ? 351 PRO B CD   6  
ATOM 9777  H HA   . PRO B 2 57 ? -9.042  11.654  9.150   1.00 0.00 ? 351 PRO B HA   6  
ATOM 9778  H HB2  . PRO B 2 57 ? -6.182  11.203  8.641   1.00 0.00 ? 351 PRO B HB2  6  
ATOM 9779  H HB3  . PRO B 2 57 ? -7.516  11.348  7.496   1.00 0.00 ? 351 PRO B HB3  6  
ATOM 9780  H HG2  . PRO B 2 57 ? -5.669  13.276  7.724   1.00 0.00 ? 351 PRO B HG2  6  
ATOM 9781  H HG3  . PRO B 2 57 ? -7.375  13.647  7.396   1.00 0.00 ? 351 PRO B HG3  6  
ATOM 9782  H HD2  . PRO B 2 57 ? -5.884  13.775  10.005  1.00 0.00 ? 351 PRO B HD2  6  
ATOM 9783  H HD3  . PRO B 2 57 ? -7.014  14.952  9.297   1.00 0.00 ? 351 PRO B HD3  6  
ATOM 9784  N N    . ALA B 2 58 ? -8.475  9.707   10.611  1.00 0.00 ? 352 ALA B N    6  
ATOM 9785  C CA   . ALA B 2 58 ? -8.239  8.629   11.566  1.00 0.00 ? 352 ALA B CA   6  
ATOM 9786  C C    . ALA B 2 58 ? -6.953  7.872   11.241  1.00 0.00 ? 352 ALA B C    6  
ATOM 9787  O O    . ALA B 2 58 ? -6.091  7.707   12.105  1.00 0.00 ? 352 ALA B O    6  
ATOM 9788  C CB   . ALA B 2 58 ? -9.427  7.677   11.607  1.00 0.00 ? 352 ALA B CB   6  
ATOM 9789  H H    . ALA B 2 58 ? -9.228  9.638   9.987   1.00 0.00 ? 352 ALA B H    6  
ATOM 9790  H HA   . ALA B 2 58 ? -8.138  9.075   12.546  1.00 0.00 ? 352 ALA B HA   6  
ATOM 9791  H HB1  . ALA B 2 58 ? -9.103  6.680   11.343  1.00 0.00 ? 352 ALA B HB1  6  
ATOM 9792  H HB2  . ALA B 2 58 ? -10.180 8.007   10.906  1.00 0.00 ? 352 ALA B HB2  6  
ATOM 9793  H HB3  . ALA B 2 58 ? -9.846  7.666   12.602  1.00 0.00 ? 352 ALA B HB3  6  
ATOM 9794  N N    . LEU B 2 59 ? -6.824  7.417   9.990   1.00 0.00 ? 353 LEU B N    6  
ATOM 9795  C CA   . LEU B 2 59 ? -5.628  6.684   9.569   1.00 0.00 ? 353 LEU B CA   6  
ATOM 9796  C C    . LEU B 2 59 ? -4.484  7.604   9.199   1.00 0.00 ? 353 LEU B C    6  
ATOM 9797  O O    . LEU B 2 59 ? -4.674  8.758   8.807   1.00 0.00 ? 353 LEU B O    6  
ATOM 9798  C CB   . LEU B 2 59 ? -5.876  5.766   8.372   1.00 0.00 ? 353 LEU B CB   6  
ATOM 9799  C CG   . LEU B 2 59 ? -5.969  4.282   8.688   1.00 0.00 ? 353 LEU B CG   6  
ATOM 9800  C CD1  . LEU B 2 59 ? -7.284  3.947   9.377   1.00 0.00 ? 353 LEU B CD1  6  
ATOM 9801  C CD2  . LEU B 2 59 ? -5.762  3.462   7.425   1.00 0.00 ? 353 LEU B CD2  6  
ATOM 9802  H H    . LEU B 2 59 ? -7.538  7.587   9.344   1.00 0.00 ? 353 LEU B H    6  
ATOM 9803  H HA   . LEU B 2 59 ? -5.316  6.075   10.405  1.00 0.00 ? 353 LEU B HA   6  
ATOM 9804  H HB2  . LEU B 2 59 ? -6.784  6.065   7.883   1.00 0.00 ? 353 LEU B HB2  6  
ATOM 9805  H HB3  . LEU B 2 59 ? -5.049  5.899   7.686   1.00 0.00 ? 353 LEU B HB3  6  
ATOM 9806  H HG   . LEU B 2 59 ? -5.177  4.036   9.362   1.00 0.00 ? 353 LEU B HG   6  
ATOM 9807  H HD11 . LEU B 2 59 ? -7.475  2.887   9.292   1.00 0.00 ? 353 LEU B HD11 6  
ATOM 9808  H HD12 . LEU B 2 59 ? -8.087  4.497   8.910   1.00 0.00 ? 353 LEU B HD12 6  
ATOM 9809  H HD13 . LEU B 2 59 ? -7.221  4.217   10.422  1.00 0.00 ? 353 LEU B HD13 6  
ATOM 9810  H HD21 . LEU B 2 59 ? -6.126  2.456   7.583   1.00 0.00 ? 353 LEU B HD21 6  
ATOM 9811  H HD22 . LEU B 2 59 ? -4.709  3.430   7.186   1.00 0.00 ? 353 LEU B HD22 6  
ATOM 9812  H HD23 . LEU B 2 59 ? -6.301  3.916   6.608   1.00 0.00 ? 353 LEU B HD23 6  
ATOM 9813  N N    . THR B 2 60 ? -3.298  7.031   9.285   1.00 0.00 ? 354 THR B N    6  
ATOM 9814  C CA   . THR B 2 60 ? -2.055  7.693   8.931   1.00 0.00 ? 354 THR B CA   6  
ATOM 9815  C C    . THR B 2 60 ? -1.051  6.613   8.547   1.00 0.00 ? 354 THR B C    6  
ATOM 9816  O O    . THR B 2 60 ? -1.397  5.428   8.536   1.00 0.00 ? 354 THR B O    6  
ATOM 9817  C CB   . THR B 2 60 ? -1.523  8.531   10.102  1.00 0.00 ? 354 THR B CB   6  
ATOM 9818  O OG1  . THR B 2 60 ? -1.348  7.731   11.260  1.00 0.00 ? 354 THR B OG1  6  
ATOM 9819  C CG2  . THR B 2 60 ? -2.419  9.695   10.475  1.00 0.00 ? 354 THR B CG2  6  
ATOM 9820  H H    . THR B 2 60 ? -3.257  6.091   9.572   1.00 0.00 ? 354 THR B H    6  
ATOM 9821  H HA   . THR B 2 60 ? -2.239  8.330   8.077   1.00 0.00 ? 354 THR B HA   6  
ATOM 9822  H HB   . THR B 2 60 ? -0.559  8.937   9.826   1.00 0.00 ? 354 THR B HB   6  
ATOM 9823  H HG1  . THR B 2 60 ? -2.197  7.379   11.541  1.00 0.00 ? 354 THR B HG1  6  
ATOM 9824  H HG21 . THR B 2 60 ? -2.034  10.175  11.362  1.00 0.00 ? 354 THR B HG21 6  
ATOM 9825  H HG22 . THR B 2 60 ? -3.418  9.334   10.667  1.00 0.00 ? 354 THR B HG22 6  
ATOM 9826  H HG23 . THR B 2 60 ? -2.442  10.407  9.663   1.00 0.00 ? 354 THR B HG23 6  
ATOM 9827  N N    . GLU B 2 61 ? 0.190   6.993   8.271   1.00 0.00 ? 355 GLU B N    6  
ATOM 9828  C CA   . GLU B 2 61 ? 1.210   6.001   7.944   1.00 0.00 ? 355 GLU B CA   6  
ATOM 9829  C C    . GLU B 2 61 ? 1.279   4.968   9.077   1.00 0.00 ? 355 GLU B C    6  
ATOM 9830  O O    . GLU B 2 61 ? 1.679   3.822   8.871   1.00 0.00 ? 355 GLU B O    6  
ATOM 9831  C CB   . GLU B 2 61 ? 2.583   6.659   7.755   1.00 0.00 ? 355 GLU B CB   6  
ATOM 9832  C CG   . GLU B 2 61 ? 2.614   7.764   6.708   1.00 0.00 ? 355 GLU B CG   6  
ATOM 9833  C CD   . GLU B 2 61 ? 2.219   9.120   7.268   1.00 0.00 ? 355 GLU B CD   6  
ATOM 9834  O OE1  . GLU B 2 61 ? 2.935   9.623   8.159   1.00 0.00 ? 355 GLU B OE1  6  
ATOM 9835  O OE2  . GLU B 2 61 ? 1.195   9.675   6.820   1.00 0.00 ? 355 GLU B OE2  6  
ATOM 9836  H H    . GLU B 2 61 ? 0.428   7.941   8.321   1.00 0.00 ? 355 GLU B H    6  
ATOM 9837  H HA   . GLU B 2 61 ? 0.918   5.499   7.027   1.00 0.00 ? 355 GLU B HA   6  
ATOM 9838  H HB2  . GLU B 2 61 ? 2.889   7.086   8.696   1.00 0.00 ? 355 GLU B HB2  6  
ATOM 9839  H HB3  . GLU B 2 61 ? 3.293   5.901   7.466   1.00 0.00 ? 355 GLU B HB3  6  
ATOM 9840  H HG2  . GLU B 2 61 ? 3.614   7.834   6.309   1.00 0.00 ? 355 GLU B HG2  6  
ATOM 9841  H HG3  . GLU B 2 61 ? 1.928   7.506   5.912   1.00 0.00 ? 355 GLU B HG3  6  
ATOM 9842  N N    . GLN B 2 62 ? 0.864   5.402   10.278  1.00 0.00 ? 356 GLN B N    6  
ATOM 9843  C CA   . GLN B 2 62 ? 0.848   4.564   11.469  1.00 0.00 ? 356 GLN B CA   6  
ATOM 9844  C C    . GLN B 2 62 ? -0.093  3.372   11.309  1.00 0.00 ? 356 GLN B C    6  
ATOM 9845  O O    . GLN B 2 62 ? 0.290   2.245   11.614  1.00 0.00 ? 356 GLN B O    6  
ATOM 9846  C CB   . GLN B 2 62 ? 0.431   5.380   12.698  1.00 0.00 ? 356 GLN B CB   6  
ATOM 9847  C CG   . GLN B 2 62 ? 1.477   6.379   13.187  1.00 0.00 ? 356 GLN B CG   6  
ATOM 9848  C CD   . GLN B 2 62 ? 1.764   7.499   12.197  1.00 0.00 ? 356 GLN B CD   6  
ATOM 9849  O OE1  . GLN B 2 62 ? 2.416   7.291   11.173  1.00 0.00 ? 356 GLN B OE1  6  
ATOM 9850  N NE2  . GLN B 2 62 ? 1.272   8.697   12.497  1.00 0.00 ? 356 GLN B NE2  6  
ATOM 9851  H H    . GLN B 2 62 ? 0.551   6.323   10.357  1.00 0.00 ? 356 GLN B H    6  
ATOM 9852  H HA   . GLN B 2 62 ? 1.851   4.193   11.623  1.00 0.00 ? 356 GLN B HA   6  
ATOM 9853  H HB2  . GLN B 2 62 ? -0.467  5.928   12.460  1.00 0.00 ? 356 GLN B HB2  6  
ATOM 9854  H HB3  . GLN B 2 62 ? 0.216   4.698   13.508  1.00 0.00 ? 356 GLN B HB3  6  
ATOM 9855  H HG2  . GLN B 2 62 ? 1.126   6.819   14.107  1.00 0.00 ? 356 GLN B HG2  6  
ATOM 9856  H HG3  . GLN B 2 62 ? 2.396   5.845   13.377  1.00 0.00 ? 356 GLN B HG3  6  
ATOM 9857  H HE21 . GLN B 2 62 ? 0.760   8.794   13.328  1.00 0.00 ? 356 GLN B HE21 6  
ATOM 9858  H HE22 . GLN B 2 62 ? 1.443   9.436   11.877  1.00 0.00 ? 356 GLN B HE22 6  
ATOM 9859  N N    . GLU B 2 63 ? -1.322  3.609   10.826  1.00 0.00 ? 357 GLU B N    6  
ATOM 9860  C CA   . GLU B 2 63 ? -2.277  2.516   10.641  1.00 0.00 ? 357 GLU B CA   6  
ATOM 9861  C C    . GLU B 2 63 ? -1.853  1.621   9.489   1.00 0.00 ? 357 GLU B C    6  
ATOM 9862  O O    . GLU B 2 63 ? -2.046  0.407   9.523   1.00 0.00 ? 357 GLU B O    6  
ATOM 9863  C CB   . GLU B 2 63 ? -3.672  3.044   10.306  1.00 0.00 ? 357 GLU B CB   6  
ATOM 9864  C CG   . GLU B 2 63 ? -4.410  3.758   11.428  1.00 0.00 ? 357 GLU B CG   6  
ATOM 9865  C CD   . GLU B 2 63 ? -4.636  2.898   12.667  1.00 0.00 ? 357 GLU B CD   6  
ATOM 9866  O OE1  . GLU B 2 63 ? -4.330  1.685   12.630  1.00 0.00 ? 357 GLU B OE1  6  
ATOM 9867  O OE2  . GLU B 2 63 ? -5.137  3.441   13.673  1.00 0.00 ? 357 GLU B OE2  6  
ATOM 9868  H H    . GLU B 2 63 ? -1.589  4.528   10.584  1.00 0.00 ? 357 GLU B H    6  
ATOM 9869  H HA   . GLU B 2 63 ? -2.318  1.937   11.549  1.00 0.00 ? 357 GLU B HA   6  
ATOM 9870  H HB2  . GLU B 2 63 ? -3.576  3.739   9.486   1.00 0.00 ? 357 GLU B HB2  6  
ATOM 9871  H HB3  . GLU B 2 63 ? -4.281  2.216   9.979   1.00 0.00 ? 357 GLU B HB3  6  
ATOM 9872  H HG2  . GLU B 2 63 ? -3.849  4.633   11.714  1.00 0.00 ? 357 GLU B HG2  6  
ATOM 9873  H HG3  . GLU B 2 63 ? -5.382  4.063   11.042  1.00 0.00 ? 357 GLU B HG3  6  
ATOM 9874  N N    . VAL B 2 64 ? -1.310  2.244   8.451   1.00 0.00 ? 358 VAL B N    6  
ATOM 9875  C CA   . VAL B 2 64 ? -0.896  1.527   7.257   1.00 0.00 ? 358 VAL B CA   6  
ATOM 9876  C C    . VAL B 2 64 ? 0.211   0.521   7.547   1.00 0.00 ? 358 VAL B C    6  
ATOM 9877  O O    . VAL B 2 64 ? 0.010   -0.682  7.406   1.00 0.00 ? 358 VAL B O    6  
ATOM 9878  C CB   . VAL B 2 64 ? -0.419  2.532   6.195   1.00 0.00 ? 358 VAL B CB   6  
ATOM 9879  C CG1  . VAL B 2 64 ? -0.094  1.846   4.883   1.00 0.00 ? 358 VAL B CG1  6  
ATOM 9880  C CG2  . VAL B 2 64 ? -1.467  3.611   5.996   1.00 0.00 ? 358 VAL B CG2  6  
ATOM 9881  H H    . VAL B 2 64 ? -1.208  3.221   8.481   1.00 0.00 ? 358 VAL B H    6  
ATOM 9882  H HA   . VAL B 2 64 ? -1.756  1.004   6.866   1.00 0.00 ? 358 VAL B HA   6  
ATOM 9883  H HB   . VAL B 2 64 ? 0.482   3.004   6.556   1.00 0.00 ? 358 VAL B HB   6  
ATOM 9884  H HG11 . VAL B 2 64 ? -0.982  1.801   4.271   1.00 0.00 ? 358 VAL B HG11 6  
ATOM 9885  H HG12 . VAL B 2 64 ? 0.262   0.845   5.080   1.00 0.00 ? 358 VAL B HG12 6  
ATOM 9886  H HG13 . VAL B 2 64 ? 0.672   2.408   4.371   1.00 0.00 ? 358 VAL B HG13 6  
ATOM 9887  H HG21 . VAL B 2 64 ? -2.153  3.606   6.836   1.00 0.00 ? 358 VAL B HG21 6  
ATOM 9888  H HG22 . VAL B 2 64 ? -2.011  3.420   5.085   1.00 0.00 ? 358 VAL B HG22 6  
ATOM 9889  H HG23 . VAL B 2 64 ? -0.980  4.570   5.935   1.00 0.00 ? 358 VAL B HG23 6  
ATOM 9890  N N    . TYR B 2 65 ? 1.367   1.013   7.977   1.00 0.00 ? 359 TYR B N    6  
ATOM 9891  C CA   . TYR B 2 65 ? 2.492   0.145   8.306   1.00 0.00 ? 359 TYR B CA   6  
ATOM 9892  C C    . TYR B 2 65 ? 2.135   -0.817  9.444   1.00 0.00 ? 359 TYR B C    6  
ATOM 9893  O O    . TYR B 2 65 ? 2.576   -1.966  9.453   1.00 0.00 ? 359 TYR B O    6  
ATOM 9894  C CB   . TYR B 2 65 ? 3.718   0.996   8.657   1.00 0.00 ? 359 TYR B CB   6  
ATOM 9895  C CG   . TYR B 2 65 ? 4.990   0.208   8.898   1.00 0.00 ? 359 TYR B CG   6  
ATOM 9896  C CD1  . TYR B 2 65 ? 5.122   -0.639  9.992   1.00 0.00 ? 359 TYR B CD1  6  
ATOM 9897  C CD2  . TYR B 2 65 ? 6.064   0.319   8.024   1.00 0.00 ? 359 TYR B CD2  6  
ATOM 9898  C CE1  . TYR B 2 65 ? 6.286   -1.351  10.207  1.00 0.00 ? 359 TYR B CE1  6  
ATOM 9899  C CE2  . TYR B 2 65 ? 7.230   -0.391  8.231   1.00 0.00 ? 359 TYR B CE2  6  
ATOM 9900  C CZ   . TYR B 2 65 ? 7.337   -1.225  9.324   1.00 0.00 ? 359 TYR B CZ   6  
ATOM 9901  O OH   . TYR B 2 65 ? 8.498   -1.933  9.534   1.00 0.00 ? 359 TYR B OH   6  
ATOM 9902  H H    . TYR B 2 65 ? 1.461   1.983   8.089   1.00 0.00 ? 359 TYR B H    6  
ATOM 9903  H HA   . TYR B 2 65 ? 2.718   -0.439  7.425   1.00 0.00 ? 359 TYR B HA   6  
ATOM 9904  H HB2  . TYR B 2 65 ? 3.908   1.674   7.841   1.00 0.00 ? 359 TYR B HB2  6  
ATOM 9905  H HB3  . TYR B 2 65 ? 3.504   1.570   9.545   1.00 0.00 ? 359 TYR B HB3  6  
ATOM 9906  H HD1  . TYR B 2 65 ? 4.297   -0.737  10.684  1.00 0.00 ? 359 TYR B HD1  6  
ATOM 9907  H HD2  . TYR B 2 65 ? 5.979   0.972   7.168   1.00 0.00 ? 359 TYR B HD2  6  
ATOM 9908  H HE1  . TYR B 2 65 ? 6.368   -2.005  11.064  1.00 0.00 ? 359 TYR B HE1  6  
ATOM 9909  H HE2  . TYR B 2 65 ? 8.052   -0.291  7.538   1.00 0.00 ? 359 TYR B HE2  6  
ATOM 9910  H HH   . TYR B 2 65 ? 8.670   -2.501  8.780   1.00 0.00 ? 359 TYR B HH   6  
ATOM 9911  N N    . ALA B 2 66 ? 1.336   -0.333  10.403  1.00 0.00 ? 360 ALA B N    6  
ATOM 9912  C CA   . ALA B 2 66 ? 0.925   -1.145  11.556  1.00 0.00 ? 360 ALA B CA   6  
ATOM 9913  C C    . ALA B 2 66 ? 0.107   -2.373  11.150  1.00 0.00 ? 360 ALA B C    6  
ATOM 9914  O O    . ALA B 2 66 ? 0.411   -3.491  11.575  1.00 0.00 ? 360 ALA B O    6  
ATOM 9915  C CB   . ALA B 2 66 ? 0.143   -0.305  12.554  1.00 0.00 ? 360 ALA B CB   6  
ATOM 9916  H H    . ALA B 2 66 ? 1.017   0.596   10.335  1.00 0.00 ? 360 ALA B H    6  
ATOM 9917  H HA   . ALA B 2 66 ? 1.824   -1.483  12.049  1.00 0.00 ? 360 ALA B HA   6  
ATOM 9918  H HB1  . ALA B 2 66 ? -0.756  0.066   12.086  1.00 0.00 ? 360 ALA B HB1  6  
ATOM 9919  H HB2  . ALA B 2 66 ? 0.750   0.524   12.880  1.00 0.00 ? 360 ALA B HB2  6  
ATOM 9920  H HB3  . ALA B 2 66 ? -0.121  -0.913  13.407  1.00 0.00 ? 360 ALA B HB3  6  
ATOM 9921  N N    . GLN B 2 67 ? -0.932  -2.163  10.338  1.00 0.00 ? 361 GLN B N    6  
ATOM 9922  C CA   . GLN B 2 67 ? -1.797  -3.262  9.898   1.00 0.00 ? 361 GLN B CA   6  
ATOM 9923  C C    . GLN B 2 67 ? -1.024  -4.251  9.024   1.00 0.00 ? 361 GLN B C    6  
ATOM 9924  O O    . GLN B 2 67 ? -1.178  -5.465  9.170   1.00 0.00 ? 361 GLN B O    6  
ATOM 9925  C CB   . GLN B 2 67 ? -3.005  -2.723  9.119   1.00 0.00 ? 361 GLN B CB   6  
ATOM 9926  C CG   . GLN B 2 67 ? -3.944  -1.837  9.930   1.00 0.00 ? 361 GLN B CG   6  
ATOM 9927  C CD   . GLN B 2 67 ? -4.658  -2.579  11.047  1.00 0.00 ? 361 GLN B CD   6  
ATOM 9928  O OE1  . GLN B 2 67 ? -5.248  -3.637  10.828  1.00 0.00 ? 361 GLN B OE1  6  
ATOM 9929  N NE2  . GLN B 2 67 ? -4.630  -2.012  12.250  1.00 0.00 ? 361 GLN B NE2  6  
ATOM 9930  H H    . GLN B 2 67 ? -1.130  -1.249  10.040  1.00 0.00 ? 361 GLN B H    6  
ATOM 9931  H HA   . GLN B 2 67 ? -2.149  -3.777  10.778  1.00 0.00 ? 361 GLN B HA   6  
ATOM 9932  H HB2  . GLN B 2 67 ? -2.645  -2.145  8.282   1.00 0.00 ? 361 GLN B HB2  6  
ATOM 9933  H HB3  . GLN B 2 67 ? -3.575  -3.560  8.746   1.00 0.00 ? 361 GLN B HB3  6  
ATOM 9934  H HG2  . GLN B 2 67 ? -3.370  -1.035  10.369  1.00 0.00 ? 361 GLN B HG2  6  
ATOM 9935  H HG3  . GLN B 2 67 ? -4.687  -1.420  9.264   1.00 0.00 ? 361 GLN B HG3  6  
ATOM 9936  H HE21 . GLN B 2 67 ? -4.157  -1.158  12.351  1.00 0.00 ? 361 GLN B HE21 6  
ATOM 9937  H HE22 . GLN B 2 67 ? -5.082  -2.472  12.988  1.00 0.00 ? 361 GLN B HE22 6  
ATOM 9938  N N    . VAL B 2 68 ? -0.187  -3.726  8.126   1.00 0.00 ? 362 VAL B N    6  
ATOM 9939  C CA   . VAL B 2 68 ? 0.620   -4.564  7.238   1.00 0.00 ? 362 VAL B CA   6  
ATOM 9940  C C    . VAL B 2 68 ? 1.646   -5.369  8.035   1.00 0.00 ? 362 VAL B C    6  
ATOM 9941  O O    . VAL B 2 68 ? 1.905   -6.533  7.727   1.00 0.00 ? 362 VAL B O    6  
ATOM 9942  C CB   . VAL B 2 68 ? 1.360   -3.714  6.182   1.00 0.00 ? 362 VAL B CB   6  
ATOM 9943  C CG1  . VAL B 2 68 ? 2.163   -4.596  5.230   1.00 0.00 ? 362 VAL B CG1  6  
ATOM 9944  C CG2  . VAL B 2 68 ? 0.380   -2.847  5.407   1.00 0.00 ? 362 VAL B CG2  6  
ATOM 9945  H H    . VAL B 2 68 ? -0.103  -2.751  8.067   1.00 0.00 ? 362 VAL B H    6  
ATOM 9946  H HA   . VAL B 2 68 ? -0.043  -5.246  6.726   1.00 0.00 ? 362 VAL B HA   6  
ATOM 9947  H HB   . VAL B 2 68 ? 2.050   -3.066  6.704   1.00 0.00 ? 362 VAL B HB   6  
ATOM 9948  H HG11 . VAL B 2 68 ? 2.604   -5.413  5.778   1.00 0.00 ? 362 VAL B HG11 6  
ATOM 9949  H HG12 . VAL B 2 68 ? 2.942   -4.008  4.766   1.00 0.00 ? 362 VAL B HG12 6  
ATOM 9950  H HG13 . VAL B 2 68 ? 1.507   -4.988  4.467   1.00 0.00 ? 362 VAL B HG13 6  
ATOM 9951  H HG21 . VAL B 2 68 ? -0.100  -2.158  6.079   1.00 0.00 ? 362 VAL B HG21 6  
ATOM 9952  H HG22 . VAL B 2 68 ? -0.368  -3.473  4.947   1.00 0.00 ? 362 VAL B HG22 6  
ATOM 9953  H HG23 . VAL B 2 68 ? 0.910   -2.297  4.644   1.00 0.00 ? 362 VAL B HG23 6  
ATOM 9954  N N    . ALA B 2 69 ? 2.224   -4.739  9.063   1.00 0.00 ? 363 ALA B N    6  
ATOM 9955  C CA   . ALA B 2 69 ? 3.219   -5.392  9.912   1.00 0.00 ? 363 ALA B CA   6  
ATOM 9956  C C    . ALA B 2 69 ? 2.681   -6.695  10.498  1.00 0.00 ? 363 ALA B C    6  
ATOM 9957  O O    . ALA B 2 69 ? 3.412   -7.681  10.611  1.00 0.00 ? 363 ALA B O    6  
ATOM 9958  C CB   . ALA B 2 69 ? 3.668   -4.456  11.028  1.00 0.00 ? 363 ALA B CB   6  
ATOM 9959  H H    . ALA B 2 69 ? 1.972   -3.811  9.255   1.00 0.00 ? 363 ALA B H    6  
ATOM 9960  H HA   . ALA B 2 69 ? 4.077   -5.616  9.298   1.00 0.00 ? 363 ALA B HA   6  
ATOM 9961  H HB1  . ALA B 2 69 ? 4.675   -4.119  10.830  1.00 0.00 ? 363 ALA B HB1  6  
ATOM 9962  H HB2  . ALA B 2 69 ? 3.642   -4.980  11.971  1.00 0.00 ? 363 ALA B HB2  6  
ATOM 9963  H HB3  . ALA B 2 69 ? 3.006   -3.604  11.072  1.00 0.00 ? 363 ALA B HB3  6  
ATOM 9964  N N    . ARG B 2 70 ? 1.393   -6.699  10.856  1.00 0.00 ? 364 ARG B N    6  
ATOM 9965  C CA   . ARG B 2 70 ? 0.758   -7.893  11.413  1.00 0.00 ? 364 ARG B CA   6  
ATOM 9966  C C    . ARG B 2 70 ? 0.566   -8.961  10.344  1.00 0.00 ? 364 ARG B C    6  
ATOM 9967  O O    . ARG B 2 70 ? 0.681   -10.151 10.623  1.00 0.00 ? 364 ARG B O    6  
ATOM 9968  C CB   . ARG B 2 70 ? -0.575  -7.545  12.075  1.00 0.00 ? 364 ARG B CB   6  
ATOM 9969  C CG   . ARG B 2 70 ? -0.432  -7.171  13.543  1.00 0.00 ? 364 ARG B CG   6  
ATOM 9970  C CD   . ARG B 2 70 ? -1.752  -6.705  14.137  1.00 0.00 ? 364 ARG B CD   6  
ATOM 9971  N NE   . ARG B 2 70 ? -2.143  -5.388  13.636  1.00 0.00 ? 364 ARG B NE   6  
ATOM 9972  C CZ   . ARG B 2 70 ? -1.490  -4.257  13.917  1.00 0.00 ? 364 ARG B CZ   6  
ATOM 9973  N NH1  . ARG B 2 70 ? -0.437  -4.263  14.731  1.00 0.00 ? 364 ARG B NH1  6  
ATOM 9974  N NH2  . ARG B 2 70 ? -1.898  -3.114  13.385  1.00 0.00 ? 364 ARG B NH2  6  
ATOM 9975  H H    . ARG B 2 70 ? 0.856   -5.887  10.722  1.00 0.00 ? 364 ARG B H    6  
ATOM 9976  H HA   . ARG B 2 70 ? 1.425   -8.288  12.166  1.00 0.00 ? 364 ARG B HA   6  
ATOM 9977  H HB2  . ARG B 2 70 ? -1.020  -6.712  11.552  1.00 0.00 ? 364 ARG B HB2  6  
ATOM 9978  H HB3  . ARG B 2 70 ? -1.233  -8.398  12.006  1.00 0.00 ? 364 ARG B HB3  6  
ATOM 9979  H HG2  . ARG B 2 70 ? -0.088  -8.034  14.092  1.00 0.00 ? 364 ARG B HG2  6  
ATOM 9980  H HG3  . ARG B 2 70 ? 0.293   -6.376  13.630  1.00 0.00 ? 364 ARG B HG3  6  
ATOM 9981  H HD2  . ARG B 2 70 ? -2.520  -7.419  13.881  1.00 0.00 ? 364 ARG B HD2  6  
ATOM 9982  H HD3  . ARG B 2 70 ? -1.651  -6.655  15.211  1.00 0.00 ? 364 ARG B HD3  6  
ATOM 9983  H HE   . ARG B 2 70 ? -2.926  -5.346  13.047  1.00 0.00 ? 364 ARG B HE   6  
ATOM 9984  H HH11 . ARG B 2 70 ? -0.123  -5.116  15.143  1.00 0.00 ? 364 ARG B HH11 6  
ATOM 9985  H HH12 . ARG B 2 70 ? 0.044   -3.408  14.930  1.00 0.00 ? 364 ARG B HH12 6  
ATOM 9986  H HH21 . ARG B 2 70 ? -2.687  -3.102  12.775  1.00 0.00 ? 364 ARG B HH21 6  
ATOM 9987  H HH22 . ARG B 2 70 ? -1.418  -2.264  13.596  1.00 0.00 ? 364 ARG B HH22 6  
ATOM 9988  N N    . LEU B 2 71 ? 0.288   -8.534  9.116   1.00 0.00 ? 365 LEU B N    6  
ATOM 9989  C CA   . LEU B 2 71 ? 0.107   -9.470  8.012   1.00 0.00 ? 365 LEU B CA   6  
ATOM 9990  C C    . LEU B 2 71 ? 1.416   -10.204 7.708   1.00 0.00 ? 365 LEU B C    6  
ATOM 9991  O O    . LEU B 2 71 ? 1.421   -11.412 7.467   1.00 0.00 ? 365 LEU B O    6  
ATOM 9992  C CB   . LEU B 2 71 ? -0.362  -8.738  6.744   1.00 0.00 ? 365 LEU B CB   6  
ATOM 9993  C CG   . LEU B 2 71 ? -1.638  -7.902  6.881   1.00 0.00 ? 365 LEU B CG   6  
ATOM 9994  C CD1  . LEU B 2 71 ? -1.999  -7.248  5.551   1.00 0.00 ? 365 LEU B CD1  6  
ATOM 9995  C CD2  . LEU B 2 71 ? -2.792  -8.755  7.392   1.00 0.00 ? 365 LEU B CD2  6  
ATOM 9996  H H    . LEU B 2 71 ? 0.216   -7.571  8.945   1.00 0.00 ? 365 LEU B H    6  
ATOM 9997  H HA   . LEU B 2 71 ? -0.642  -10.191 8.302   1.00 0.00 ? 365 LEU B HA   6  
ATOM 9998  H HB2  . LEU B 2 71 ? 0.434   -8.084  6.420   1.00 0.00 ? 365 LEU B HB2  6  
ATOM 9999  H HB3  . LEU B 2 71 ? -0.526  -9.477  5.977   1.00 0.00 ? 365 LEU B HB3  6  
ATOM 10000 H HG   . LEU B 2 71 ? -1.463  -7.116  7.595   1.00 0.00 ? 365 LEU B HG   6  
ATOM 10001 H HD11 . LEU B 2 71 ? -2.338  -6.239  5.728   1.00 0.00 ? 365 LEU B HD11 6  
ATOM 10002 H HD12 . LEU B 2 71 ? -2.784  -7.812  5.070   1.00 0.00 ? 365 LEU B HD12 6  
ATOM 10003 H HD13 . LEU B 2 71 ? -1.129  -7.226  4.912   1.00 0.00 ? 365 LEU B HD13 6  
ATOM 10004 H HD21 . LEU B 2 71 ? -3.331  -8.209  8.153   1.00 0.00 ? 365 LEU B HD21 6  
ATOM 10005 H HD22 . LEU B 2 71 ? -2.406  -9.670  7.813   1.00 0.00 ? 365 LEU B HD22 6  
ATOM 10006 H HD23 . LEU B 2 71 ? -3.459  -8.986  6.575   1.00 0.00 ? 365 LEU B HD23 6  
ATOM 10007 N N    . PHE B 2 72 ? 2.517   -9.443  7.674   1.00 0.00 ? 366 PHE B N    6  
ATOM 10008 C CA   . PHE B 2 72 ? 3.836   -9.982  7.343   1.00 0.00 ? 366 PHE B CA   6  
ATOM 10009 C C    . PHE B 2 72 ? 4.627   -10.470 8.571   1.00 0.00 ? 366 PHE B C    6  
ATOM 10010 O O    . PHE B 2 72 ? 5.839   -10.247 8.647   1.00 0.00 ? 366 PHE B O    6  
ATOM 10011 C CB   . PHE B 2 72 ? 4.648   -8.911  6.604   1.00 0.00 ? 366 PHE B CB   6  
ATOM 10012 C CG   . PHE B 2 72 ? 4.003   -8.372  5.344   1.00 0.00 ? 366 PHE B CG   6  
ATOM 10013 C CD1  . PHE B 2 72 ? 2.672   -8.636  5.039   1.00 0.00 ? 366 PHE B CD1  6  
ATOM 10014 C CD2  . PHE B 2 72 ? 4.731   -7.580  4.471   1.00 0.00 ? 366 PHE B CD2  6  
ATOM 10015 C CE1  . PHE B 2 72 ? 2.092   -8.128  3.899   1.00 0.00 ? 366 PHE B CE1  6  
ATOM 10016 C CE2  . PHE B 2 72 ? 4.151   -7.071  3.325   1.00 0.00 ? 366 PHE B CE2  6  
ATOM 10017 C CZ   . PHE B 2 72 ? 2.828   -7.347  3.042   1.00 0.00 ? 366 PHE B CZ   6  
ATOM 10018 H H    . PHE B 2 72 ? 2.433   -8.479  7.839   1.00 0.00 ? 366 PHE B H    6  
ATOM 10019 H HA   . PHE B 2 72 ? 3.688   -10.817 6.675   1.00 0.00 ? 366 PHE B HA   6  
ATOM 10020 H HB2  . PHE B 2 72 ? 4.794   -8.082  7.272   1.00 0.00 ? 366 PHE B HB2  6  
ATOM 10021 H HB3  . PHE B 2 72 ? 5.612   -9.320  6.335   1.00 0.00 ? 366 PHE B HB3  6  
ATOM 10022 H HD1  . PHE B 2 72 ? 2.088   -9.249  5.701   1.00 0.00 ? 366 PHE B HD1  6  
ATOM 10023 H HD2  . PHE B 2 72 ? 5.767   -7.364  4.690   1.00 0.00 ? 366 PHE B HD2  6  
ATOM 10024 H HE1  . PHE B 2 72 ? 1.057   -8.344  3.679   1.00 0.00 ? 366 PHE B HE1  6  
ATOM 10025 H HE2  . PHE B 2 72 ? 4.731   -6.458  2.655   1.00 0.00 ? 366 PHE B HE2  6  
ATOM 10026 H HZ   . PHE B 2 72 ? 2.370   -6.956  2.148   1.00 0.00 ? 366 PHE B HZ   6  
ATOM 10027 N N    . LYS B 2 73 ? 3.965   -11.140 9.520   1.00 0.00 ? 367 LYS B N    6  
ATOM 10028 C CA   . LYS B 2 73 ? 4.658   -11.652 10.715  1.00 0.00 ? 367 LYS B CA   6  
ATOM 10029 C C    . LYS B 2 73 ? 5.901   -12.464 10.345  1.00 0.00 ? 367 LYS B C    6  
ATOM 10030 O O    . LYS B 2 73 ? 7.017   -12.119 10.741  1.00 0.00 ? 367 LYS B O    6  
ATOM 10031 C CB   . LYS B 2 73 ? 3.731   -12.513 11.582  1.00 0.00 ? 367 LYS B CB   6  
ATOM 10032 C CG   . LYS B 2 73 ? 2.581   -11.748 12.215  1.00 0.00 ? 367 LYS B CG   6  
ATOM 10033 C CD   . LYS B 2 73 ? 3.057   -10.508 12.964  1.00 0.00 ? 367 LYS B CD   6  
ATOM 10034 C CE   . LYS B 2 73 ? 3.994   -10.863 14.110  1.00 0.00 ? 367 LYS B CE   6  
ATOM 10035 N NZ   . LYS B 2 73 ? 4.458   -9.654  14.847  1.00 0.00 ? 367 LYS B NZ   6  
ATOM 10036 H H    . LYS B 2 73 ? 3.005   -11.304 9.414   1.00 0.00 ? 367 LYS B H    6  
ATOM 10037 H HA   . LYS B 2 73 ? 4.974   -10.796 11.293  1.00 0.00 ? 367 LYS B HA   6  
ATOM 10038 H HB2  . LYS B 2 73 ? 3.315   -13.299 10.970  1.00 0.00 ? 367 LYS B HB2  6  
ATOM 10039 H HB3  . LYS B 2 73 ? 4.314   -12.960 12.374  1.00 0.00 ? 367 LYS B HB3  6  
ATOM 10040 H HG2  . LYS B 2 73 ? 1.900   -11.447 11.440  1.00 0.00 ? 367 LYS B HG2  6  
ATOM 10041 H HG3  . LYS B 2 73 ? 2.069   -12.400 12.909  1.00 0.00 ? 367 LYS B HG3  6  
ATOM 10042 H HD2  . LYS B 2 73 ? 3.581   -9.863  12.275  1.00 0.00 ? 367 LYS B HD2  6  
ATOM 10043 H HD3  . LYS B 2 73 ? 2.198   -9.989  13.363  1.00 0.00 ? 367 LYS B HD3  6  
ATOM 10044 H HE2  . LYS B 2 73 ? 3.473   -11.513 14.797  1.00 0.00 ? 367 LYS B HE2  6  
ATOM 10045 H HE3  . LYS B 2 73 ? 4.853   -11.381 13.710  1.00 0.00 ? 367 LYS B HE3  6  
ATOM 10046 H HZ1  . LYS B 2 73 ? 4.542   -8.847  14.197  1.00 0.00 ? 367 LYS B HZ1  6  
ATOM 10047 H HZ2  . LYS B 2 73 ? 5.386   -9.833  15.281  1.00 0.00 ? 367 LYS B HZ2  6  
ATOM 10048 H HZ3  . LYS B 2 73 ? 3.779   -9.410  15.599  1.00 0.00 ? 367 LYS B HZ3  6  
ATOM 10049 N N    . ASN B 2 74 ? 5.696   -13.555 9.600   1.00 0.00 ? 368 ASN B N    6  
ATOM 10050 C CA   . ASN B 2 74 ? 6.797   -14.438 9.191   1.00 0.00 ? 368 ASN B CA   6  
ATOM 10051 C C    . ASN B 2 74 ? 7.509   -13.967 7.911   1.00 0.00 ? 368 ASN B C    6  
ATOM 10052 O O    . ASN B 2 74 ? 8.247   -14.738 7.295   1.00 0.00 ? 368 ASN B O    6  
ATOM 10053 C CB   . ASN B 2 74 ? 6.291   -15.877 9.014   1.00 0.00 ? 368 ASN B CB   6  
ATOM 10054 C CG   . ASN B 2 74 ? 5.094   -15.977 8.083   1.00 0.00 ? 368 ASN B CG   6  
ATOM 10055 O OD1  . ASN B 2 74 ? 3.998   -15.528 8.414   1.00 0.00 ? 368 ASN B OD1  6  
ATOM 10056 N ND2  . ASN B 2 74 ? 5.301   -16.561 6.908   1.00 0.00 ? 368 ASN B ND2  6  
ATOM 10057 H H    . ASN B 2 74 ? 4.781   -13.781 9.329   1.00 0.00 ? 368 ASN B H    6  
ATOM 10058 H HA   . ASN B 2 74 ? 7.519   -14.434 9.993   1.00 0.00 ? 368 ASN B HA   6  
ATOM 10059 H HB2  . ASN B 2 74 ? 7.087   -16.484 8.609   1.00 0.00 ? 368 ASN B HB2  6  
ATOM 10060 H HB3  . ASN B 2 74 ? 6.004   -16.270 9.979   1.00 0.00 ? 368 ASN B HB3  6  
ATOM 10061 H HD21 . ASN B 2 74 ? 6.201   -16.892 6.704   1.00 0.00 ? 368 ASN B HD21 6  
ATOM 10062 H HD22 . ASN B 2 74 ? 4.544   -16.636 6.291   1.00 0.00 ? 368 ASN B HD22 6  
ATOM 10063 N N    . GLN B 2 75 ? 7.309   -12.705 7.523   1.00 0.00 ? 369 GLN B N    6  
ATOM 10064 C CA   . GLN B 2 75 ? 7.962   -12.157 6.333   1.00 0.00 ? 369 GLN B CA   6  
ATOM 10065 C C    . GLN B 2 75 ? 8.366   -10.696 6.551   1.00 0.00 ? 369 GLN B C    6  
ATOM 10066 O O    . GLN B 2 75 ? 8.027   -9.815  5.758   1.00 0.00 ? 369 GLN B O    6  
ATOM 10067 C CB   . GLN B 2 75 ? 7.074   -12.296 5.087   1.00 0.00 ? 369 GLN B CB   6  
ATOM 10068 C CG   . GLN B 2 75 ? 5.600   -12.007 5.326   1.00 0.00 ? 369 GLN B CG   6  
ATOM 10069 C CD   . GLN B 2 75 ? 4.796   -13.263 5.611   1.00 0.00 ? 369 GLN B CD   6  
ATOM 10070 O OE1  . GLN B 2 75 ? 4.768   -14.191 4.801   1.00 0.00 ? 369 GLN B OE1  6  
ATOM 10071 N NE2  . GLN B 2 75 ? 4.129   -13.303 6.757   1.00 0.00 ? 369 GLN B NE2  6  
ATOM 10072 H H    . GLN B 2 75 ? 6.727   -12.125 8.054   1.00 0.00 ? 369 GLN B H    6  
ATOM 10073 H HA   . GLN B 2 75 ? 8.866   -12.730 6.175   1.00 0.00 ? 369 GLN B HA   6  
ATOM 10074 H HB2  . GLN B 2 75 ? 7.429   -11.613 4.331   1.00 0.00 ? 369 GLN B HB2  6  
ATOM 10075 H HB3  . GLN B 2 75 ? 7.161   -13.304 4.709   1.00 0.00 ? 369 GLN B HB3  6  
ATOM 10076 H HG2  . GLN B 2 75 ? 5.512   -11.343 6.173   1.00 0.00 ? 369 GLN B HG2  6  
ATOM 10077 H HG3  . GLN B 2 75 ? 5.196   -11.525 4.451   1.00 0.00 ? 369 GLN B HG3  6  
ATOM 10078 H HE21 . GLN B 2 75 ? 4.192   -12.536 7.358   1.00 0.00 ? 369 GLN B HE21 6  
ATOM 10079 H HE22 . GLN B 2 75 ? 3.598   -14.101 6.955   1.00 0.00 ? 369 GLN B HE22 6  
ATOM 10080 N N    . GLU B 2 76 ? 9.108   -10.459 7.640   1.00 0.00 ? 370 GLU B N    6  
ATOM 10081 C CA   . GLU B 2 76 ? 9.595   -9.120  7.994   1.00 0.00 ? 370 GLU B CA   6  
ATOM 10082 C C    . GLU B 2 76 ? 10.320  -8.430  6.829   1.00 0.00 ? 370 GLU B C    6  
ATOM 10083 O O    . GLU B 2 76 ? 10.433  -7.202  6.810   1.00 0.00 ? 370 GLU B O    6  
ATOM 10084 C CB   . GLU B 2 76 ? 10.530  -9.201  9.207   1.00 0.00 ? 370 GLU B CB   6  
ATOM 10085 C CG   . GLU B 2 76 ? 9.861   -9.743  10.461  1.00 0.00 ? 370 GLU B CG   6  
ATOM 10086 C CD   . GLU B 2 76 ? 10.806  -9.810  11.648  1.00 0.00 ? 370 GLU B CD   6  
ATOM 10087 O OE1  . GLU B 2 76 ? 11.815  -10.542 11.565  1.00 0.00 ? 370 GLU B OE1  6  
ATOM 10088 O OE2  . GLU B 2 76 ? 10.537  -9.130  12.660  1.00 0.00 ? 370 GLU B OE2  6  
ATOM 10089 H H    . GLU B 2 76 ? 9.345   -11.214 8.219   1.00 0.00 ? 370 GLU B H    6  
ATOM 10090 H HA   . GLU B 2 76 ? 8.736   -8.524  8.264   1.00 0.00 ? 370 GLU B HA   6  
ATOM 10091 H HB2  . GLU B 2 76 ? 11.362  -9.844  8.961   1.00 0.00 ? 370 GLU B HB2  6  
ATOM 10092 H HB3  . GLU B 2 76 ? 10.904  -8.211  9.423   1.00 0.00 ? 370 GLU B HB3  6  
ATOM 10093 H HG2  . GLU B 2 76 ? 9.031   -9.102  10.718  1.00 0.00 ? 370 GLU B HG2  6  
ATOM 10094 H HG3  . GLU B 2 76 ? 9.494   -10.738 10.256  1.00 0.00 ? 370 GLU B HG3  6  
ATOM 10095 N N    . ASP B 2 77 ? 10.819  -9.218  5.868   1.00 0.00 ? 371 ASP B N    6  
ATOM 10096 C CA   . ASP B 2 77 ? 11.541  -8.669  4.718   1.00 0.00 ? 371 ASP B CA   6  
ATOM 10097 C C    . ASP B 2 77 ? 10.624  -7.809  3.852   1.00 0.00 ? 371 ASP B C    6  
ATOM 10098 O O    . ASP B 2 77 ? 10.930  -6.643  3.592   1.00 0.00 ? 371 ASP B O    6  
ATOM 10099 C CB   . ASP B 2 77 ? 12.146  -9.799  3.878   1.00 0.00 ? 371 ASP B CB   6  
ATOM 10100 C CG   . ASP B 2 77 ? 13.132  -10.648 4.663   1.00 0.00 ? 371 ASP B CG   6  
ATOM 10101 O OD1  . ASP B 2 77 ? 14.158  -10.101 5.120   1.00 0.00 ? 371 ASP B OD1  6  
ATOM 10102 O OD2  . ASP B 2 77 ? 12.875  -11.860 4.822   1.00 0.00 ? 371 ASP B OD2  6  
ATOM 10103 H H    . ASP B 2 77 ? 10.710  -10.188 5.940   1.00 0.00 ? 371 ASP B H    6  
ATOM 10104 H HA   . ASP B 2 77 ? 12.341  -8.050  5.097   1.00 0.00 ? 371 ASP B HA   6  
ATOM 10105 H HB2  . ASP B 2 77 ? 11.353  -10.438 3.523   1.00 0.00 ? 371 ASP B HB2  6  
ATOM 10106 H HB3  . ASP B 2 77 ? 12.663  -9.371  3.032   1.00 0.00 ? 371 ASP B HB3  6  
ATOM 10107 N N    . LEU B 2 78 ? 9.497   -8.380  3.417   1.00 0.00 ? 372 LEU B N    6  
ATOM 10108 C CA   . LEU B 2 78 ? 8.534   -7.644  2.594   1.00 0.00 ? 372 LEU B CA   6  
ATOM 10109 C C    . LEU B 2 78 ? 8.120   -6.333  3.273   1.00 0.00 ? 372 LEU B C    6  
ATOM 10110 O O    . LEU B 2 78 ? 7.894   -5.326  2.601   1.00 0.00 ? 372 LEU B O    6  
ATOM 10111 C CB   . LEU B 2 78 ? 7.302   -8.510  2.296   1.00 0.00 ? 372 LEU B CB   6  
ATOM 10112 C CG   . LEU B 2 78 ? 7.548   -9.678  1.329   1.00 0.00 ? 372 LEU B CG   6  
ATOM 10113 C CD1  . LEU B 2 78 ? 6.311   -10.559 1.223   1.00 0.00 ? 372 LEU B CD1  6  
ATOM 10114 C CD2  . LEU B 2 78 ? 7.951   -9.156  -0.048  1.00 0.00 ? 372 LEU B CD2  6  
ATOM 10115 H H    . LEU B 2 78 ? 9.304   -9.308  3.665   1.00 0.00 ? 372 LEU B H    6  
ATOM 10116 H HA   . LEU B 2 78 ? 9.023   -7.405  1.661   1.00 0.00 ? 372 LEU B HA   6  
ATOM 10117 H HB2  . LEU B 2 78 ? 6.938   -8.915  3.229   1.00 0.00 ? 372 LEU B HB2  6  
ATOM 10118 H HB3  . LEU B 2 78 ? 6.537   -7.879  1.873   1.00 0.00 ? 372 LEU B HB3  6  
ATOM 10119 H HG   . LEU B 2 78 ? 8.357   -10.286 1.706   1.00 0.00 ? 372 LEU B HG   6  
ATOM 10120 H HD11 . LEU B 2 78 ? 5.440   -9.996  1.530   1.00 0.00 ? 372 LEU B HD11 6  
ATOM 10121 H HD12 . LEU B 2 78 ? 6.426   -11.422 1.864   1.00 0.00 ? 372 LEU B HD12 6  
ATOM 10122 H HD13 . LEU B 2 78 ? 6.186   -10.885 0.200   1.00 0.00 ? 372 LEU B HD13 6  
ATOM 10123 H HD21 . LEU B 2 78 ? 7.151   -8.556  -0.456  1.00 0.00 ? 372 LEU B HD21 6  
ATOM 10124 H HD22 . LEU B 2 78 ? 8.146   -9.989  -0.711  1.00 0.00 ? 372 LEU B HD22 6  
ATOM 10125 H HD23 . LEU B 2 78 ? 8.842   -8.555  0.039   1.00 0.00 ? 372 LEU B HD23 6  
ATOM 10126 N N    . LEU B 2 79 ? 8.045   -6.345  4.609   1.00 0.00 ? 373 LEU B N    6  
ATOM 10127 C CA   . LEU B 2 79 ? 7.680   -5.149  5.372   1.00 0.00 ? 373 LEU B CA   6  
ATOM 10128 C C    . LEU B 2 79 ? 8.713   -4.041  5.194   1.00 0.00 ? 373 LEU B C    6  
ATOM 10129 O O    . LEU B 2 79 ? 8.352   -2.882  4.991   1.00 0.00 ? 373 LEU B O    6  
ATOM 10130 C CB   . LEU B 2 79 ? 7.526   -5.481  6.857   1.00 0.00 ? 373 LEU B CB   6  
ATOM 10131 C CG   . LEU B 2 79 ? 6.167   -6.048  7.251   1.00 0.00 ? 373 LEU B CG   6  
ATOM 10132 C CD1  . LEU B 2 79 ? 6.159   -6.434  8.722   1.00 0.00 ? 373 LEU B CD1  6  
ATOM 10133 C CD2  . LEU B 2 79 ? 5.063   -5.041  6.948   1.00 0.00 ? 373 LEU B CD2  6  
ATOM 10134 H H    . LEU B 2 79 ? 8.250   -7.172  5.091   1.00 0.00 ? 373 LEU B H    6  
ATOM 10135 H HA   . LEU B 2 79 ? 6.732   -4.798  4.994   1.00 0.00 ? 373 LEU B HA   6  
ATOM 10136 H HB2  . LEU B 2 79 ? 8.282   -6.204  7.123   1.00 0.00 ? 373 LEU B HB2  6  
ATOM 10137 H HB3  . LEU B 2 79 ? 7.694   -4.580  7.428   1.00 0.00 ? 373 LEU B HB3  6  
ATOM 10138 H HG   . LEU B 2 79 ? 5.977   -6.935  6.670   1.00 0.00 ? 373 LEU B HG   6  
ATOM 10139 H HD11 . LEU B 2 79 ? 5.344   -7.119  8.910   1.00 0.00 ? 373 LEU B HD11 6  
ATOM 10140 H HD12 . LEU B 2 79 ? 6.031   -5.548  9.326   1.00 0.00 ? 373 LEU B HD12 6  
ATOM 10141 H HD13 . LEU B 2 79 ? 7.094   -6.911  8.974   1.00 0.00 ? 373 LEU B HD13 6  
ATOM 10142 H HD21 . LEU B 2 79 ? 5.437   -4.288  6.265   1.00 0.00 ? 373 LEU B HD21 6  
ATOM 10143 H HD22 . LEU B 2 79 ? 4.745   -4.567  7.864   1.00 0.00 ? 373 LEU B HD22 6  
ATOM 10144 H HD23 . LEU B 2 79 ? 4.227   -5.550  6.496   1.00 0.00 ? 373 LEU B HD23 6  
ATOM 10145 N N    . SER B 2 80 ? 9.996   -4.404  5.257   1.00 0.00 ? 374 SER B N    6  
ATOM 10146 C CA   . SER B 2 80 ? 11.074  -3.433  5.081   1.00 0.00 ? 374 SER B CA   6  
ATOM 10147 C C    . SER B 2 80 ? 10.884  -2.676  3.768   1.00 0.00 ? 374 SER B C    6  
ATOM 10148 O O    . SER B 2 80 ? 11.035  -1.455  3.714   1.00 0.00 ? 374 SER B O    6  
ATOM 10149 C CB   . SER B 2 80 ? 12.436  -4.133  5.092   1.00 0.00 ? 374 SER B CB   6  
ATOM 10150 O OG   . SER B 2 80 ? 13.495  -3.203  4.938   1.00 0.00 ? 374 SER B OG   6  
ATOM 10151 H H    . SER B 2 80 ? 10.221  -5.347  5.410   1.00 0.00 ? 374 SER B H    6  
ATOM 10152 H HA   . SER B 2 80 ? 11.028  -2.730  5.901   1.00 0.00 ? 374 SER B HA   6  
ATOM 10153 H HB2  . SER B 2 80 ? 12.565  -4.651  6.031   1.00 0.00 ? 374 SER B HB2  6  
ATOM 10154 H HB3  . SER B 2 80 ? 12.478  -4.846  4.283   1.00 0.00 ? 374 SER B HB3  6  
ATOM 10155 H HG   . SER B 2 80 ? 13.611  -2.710  5.753   1.00 0.00 ? 374 SER B HG   6  
ATOM 10156 N N    . GLU B 2 81 ? 10.535  -3.421  2.716   1.00 0.00 ? 375 GLU B N    6  
ATOM 10157 C CA   . GLU B 2 81 ? 10.299  -2.844  1.396   1.00 0.00 ? 375 GLU B CA   6  
ATOM 10158 C C    . GLU B 2 81 ? 9.094   -1.896  1.418   1.00 0.00 ? 375 GLU B C    6  
ATOM 10159 O O    . GLU B 2 81 ? 9.112   -0.846  0.775   1.00 0.00 ? 375 GLU B O    6  
ATOM 10160 C CB   . GLU B 2 81 ? 10.065  -3.962  0.372   1.00 0.00 ? 375 GLU B CB   6  
ATOM 10161 C CG   . GLU B 2 81 ? 10.057  -3.490  -1.075  1.00 0.00 ? 375 GLU B CG   6  
ATOM 10162 C CD   . GLU B 2 81 ? 11.422  -3.022  -1.549  1.00 0.00 ? 375 GLU B CD   6  
ATOM 10163 O OE1  . GLU B 2 81 ? 11.918  -1.998  -1.030  1.00 0.00 ? 375 GLU B OE1  6  
ATOM 10164 O OE2  . GLU B 2 81 ? 11.997  -3.683  -2.439  1.00 0.00 ? 375 GLU B OE2  6  
ATOM 10165 H H    . GLU B 2 81 ? 10.421  -4.387  2.836   1.00 0.00 ? 375 GLU B H    6  
ATOM 10166 H HA   . GLU B 2 81 ? 11.178  -2.286  1.116   1.00 0.00 ? 375 GLU B HA   6  
ATOM 10167 H HB2  . GLU B 2 81 ? 10.847  -4.699  0.480   1.00 0.00 ? 375 GLU B HB2  6  
ATOM 10168 H HB3  . GLU B 2 81 ? 9.114   -4.429  0.580   1.00 0.00 ? 375 GLU B HB3  6  
ATOM 10169 H HG2  . GLU B 2 81 ? 9.736   -4.307  -1.703  1.00 0.00 ? 375 GLU B HG2  6  
ATOM 10170 H HG3  . GLU B 2 81 ? 9.360   -2.670  -1.169  1.00 0.00 ? 375 GLU B HG3  6  
ATOM 10171 N N    . PHE B 2 82 ? 8.049   -2.285  2.158   1.00 0.00 ? 376 PHE B N    6  
ATOM 10172 C CA   . PHE B 2 82 ? 6.825   -1.485  2.264   1.00 0.00 ? 376 PHE B CA   6  
ATOM 10173 C C    . PHE B 2 82 ? 7.112   -0.049  2.703   1.00 0.00 ? 376 PHE B C    6  
ATOM 10174 O O    . PHE B 2 82 ? 6.734   0.902   2.018   1.00 0.00 ? 376 PHE B O    6  
ATOM 10175 C CB   . PHE B 2 82 ? 5.844   -2.128  3.249   1.00 0.00 ? 376 PHE B CB   6  
ATOM 10176 C CG   . PHE B 2 82 ? 4.545   -1.385  3.345   1.00 0.00 ? 376 PHE B CG   6  
ATOM 10177 C CD1  . PHE B 2 82 ? 3.763   -1.190  2.217   1.00 0.00 ? 376 PHE B CD1  6  
ATOM 10178 C CD2  . PHE B 2 82 ? 4.109   -0.869  4.556   1.00 0.00 ? 376 PHE B CD2  6  
ATOM 10179 C CE1  . PHE B 2 82 ? 2.576   -0.495  2.294   1.00 0.00 ? 376 PHE B CE1  6  
ATOM 10180 C CE2  . PHE B 2 82 ? 2.919   -0.176  4.639   1.00 0.00 ? 376 PHE B CE2  6  
ATOM 10181 C CZ   . PHE B 2 82 ? 2.153   0.012   3.506   1.00 0.00 ? 376 PHE B CZ   6  
ATOM 10182 H H    . PHE B 2 82 ? 8.098   -3.138  2.639   1.00 0.00 ? 376 PHE B H    6  
ATOM 10183 H HA   . PHE B 2 82 ? 6.367   -1.460  1.288   1.00 0.00 ? 376 PHE B HA   6  
ATOM 10184 H HB2  . PHE B 2 82 ? 5.631   -3.137  2.938   1.00 0.00 ? 376 PHE B HB2  6  
ATOM 10185 H HB3  . PHE B 2 82 ? 6.291   -2.146  4.232   1.00 0.00 ? 376 PHE B HB3  6  
ATOM 10186 H HD1  . PHE B 2 82 ? 4.094   -1.588  1.269   1.00 0.00 ? 376 PHE B HD1  6  
ATOM 10187 H HD2  . PHE B 2 82 ? 4.710   -1.018  5.441   1.00 0.00 ? 376 PHE B HD2  6  
ATOM 10188 H HE1  . PHE B 2 82 ? 1.977   -0.348  1.408   1.00 0.00 ? 376 PHE B HE1  6  
ATOM 10189 H HE2  . PHE B 2 82 ? 2.589   0.221   5.587   1.00 0.00 ? 376 PHE B HE2  6  
ATOM 10190 H HZ   . PHE B 2 82 ? 1.225   0.555   3.566   1.00 0.00 ? 376 PHE B HZ   6  
ATOM 10191 N N    . GLY B 2 83 ? 7.767   0.100   3.858   1.00 0.00 ? 377 GLY B N    6  
ATOM 10192 C CA   . GLY B 2 83 ? 8.082   1.422   4.385   1.00 0.00 ? 377 GLY B CA   6  
ATOM 10193 C C    . GLY B 2 83 ? 8.811   2.323   3.392   1.00 0.00 ? 377 GLY B C    6  
ATOM 10194 O O    . GLY B 2 83 ? 8.773   3.547   3.527   1.00 0.00 ? 377 GLY B O    6  
ATOM 10195 H H    . GLY B 2 83 ? 8.028   -0.699  4.367   1.00 0.00 ? 377 GLY B H    6  
ATOM 10196 H HA2  . GLY B 2 83 ? 7.162   1.906   4.675   1.00 0.00 ? 377 GLY B HA2  6  
ATOM 10197 H HA3  . GLY B 2 83 ? 8.700   1.305   5.262   1.00 0.00 ? 377 GLY B HA3  6  
ATOM 10198 N N    . GLN B 2 84 ? 9.481   1.722   2.404   1.00 0.00 ? 378 GLN B N    6  
ATOM 10199 C CA   . GLN B 2 84 ? 10.227  2.485   1.400   1.00 0.00 ? 378 GLN B CA   6  
ATOM 10200 C C    . GLN B 2 84 ? 9.308   3.236   0.428   1.00 0.00 ? 378 GLN B C    6  
ATOM 10201 O O    . GLN B 2 84 ? 9.770   4.112   -0.306  1.00 0.00 ? 378 GLN B O    6  
ATOM 10202 C CB   . GLN B 2 84 ? 11.156  1.555   0.607   1.00 0.00 ? 378 GLN B CB   6  
ATOM 10203 C CG   . GLN B 2 84 ? 12.063  0.692   1.478   1.00 0.00 ? 378 GLN B CG   6  
ATOM 10204 C CD   . GLN B 2 84 ? 13.000  1.507   2.353   1.00 0.00 ? 378 GLN B CD   6  
ATOM 10205 O OE1  . GLN B 2 84 ? 12.560  2.284   3.200   1.00 0.00 ? 378 GLN B OE1  6  
ATOM 10206 N NE2  . GLN B 2 84 ? 14.302  1.329   2.155   1.00 0.00 ? 378 GLN B NE2  6  
ATOM 10207 H H    . GLN B 2 84 ? 9.482   0.744   2.354   1.00 0.00 ? 378 GLN B H    6  
ATOM 10208 H HA   . GLN B 2 84 ? 10.830  3.208   1.924   1.00 0.00 ? 378 GLN B HA   6  
ATOM 10209 H HB2  . GLN B 2 84 ? 10.553  0.900   -0.003  1.00 0.00 ? 378 GLN B HB2  6  
ATOM 10210 H HB3  . GLN B 2 84 ? 11.780  2.157   -0.037  1.00 0.00 ? 378 GLN B HB3  6  
ATOM 10211 H HG2  . GLN B 2 84 ? 11.445  0.078   2.115   1.00 0.00 ? 378 GLN B HG2  6  
ATOM 10212 H HG3  . GLN B 2 84 ? 12.654  0.058   0.833   1.00 0.00 ? 378 GLN B HG3  6  
ATOM 10213 H HE21 . GLN B 2 84 ? 14.585  0.691   1.465   1.00 0.00 ? 378 GLN B HE21 6  
ATOM 10214 H HE22 . GLN B 2 84 ? 14.929  1.842   2.707   1.00 0.00 ? 378 GLN B HE22 6  
ATOM 10215 N N    . PHE B 2 85 ? 8.015   2.895   0.410   1.00 0.00 ? 379 PHE B N    6  
ATOM 10216 C CA   . PHE B 2 85 ? 7.063   3.543   -0.489  1.00 0.00 ? 379 PHE B CA   6  
ATOM 10217 C C    . PHE B 2 85 ? 6.426   4.768   0.158   1.00 0.00 ? 379 PHE B C    6  
ATOM 10218 O O    . PHE B 2 85 ? 6.471   5.863   -0.400  1.00 0.00 ? 379 PHE B O    6  
ATOM 10219 C CB   . PHE B 2 85 ? 5.974   2.555   -0.906  1.00 0.00 ? 379 PHE B CB   6  
ATOM 10220 C CG   . PHE B 2 85 ? 6.518   1.337   -1.589  1.00 0.00 ? 379 PHE B CG   6  
ATOM 10221 C CD1  . PHE B 2 85 ? 7.060   1.425   -2.860  1.00 0.00 ? 379 PHE B CD1  6  
ATOM 10222 C CD2  . PHE B 2 85 ? 6.506   0.111   -0.951  1.00 0.00 ? 379 PHE B CD2  6  
ATOM 10223 C CE1  . PHE B 2 85 ? 7.578   0.308   -3.482  1.00 0.00 ? 379 PHE B CE1  6  
ATOM 10224 C CE2  . PHE B 2 85 ? 7.020   -1.009  -1.567  1.00 0.00 ? 379 PHE B CE2  6  
ATOM 10225 C CZ   . PHE B 2 85 ? 7.558   -0.912  -2.834  1.00 0.00 ? 379 PHE B CZ   6  
ATOM 10226 H H    . PHE B 2 85 ? 7.696   2.183   1.005   1.00 0.00 ? 379 PHE B H    6  
ATOM 10227 H HA   . PHE B 2 85 ? 7.602   3.859   -1.370  1.00 0.00 ? 379 PHE B HA   6  
ATOM 10228 H HB2  . PHE B 2 85 ? 5.433   2.231   -0.028  1.00 0.00 ? 379 PHE B HB2  6  
ATOM 10229 H HB3  . PHE B 2 85 ? 5.292   3.043   -1.586  1.00 0.00 ? 379 PHE B HB3  6  
ATOM 10230 H HD1  . PHE B 2 85 ? 7.075   2.378   -3.366  1.00 0.00 ? 379 PHE B HD1  6  
ATOM 10231 H HD2  . PHE B 2 85 ? 6.084   0.034   0.039   1.00 0.00 ? 379 PHE B HD2  6  
ATOM 10232 H HE1  . PHE B 2 85 ? 7.996   0.389   -4.473  1.00 0.00 ? 379 PHE B HE1  6  
ATOM 10233 H HE2  . PHE B 2 85 ? 7.005   -1.957  -1.055  1.00 0.00 ? 379 PHE B HE2  6  
ATOM 10234 H HZ   . PHE B 2 85 ? 7.963   -1.789  -3.319  1.00 0.00 ? 379 PHE B HZ   6  
ATOM 10235 N N    . LEU B 2 86 ? 5.833   4.578   1.334   1.00 0.00 ? 380 LEU B N    6  
ATOM 10236 C CA   . LEU B 2 86 ? 5.182   5.678   2.045   1.00 0.00 ? 380 LEU B CA   6  
ATOM 10237 C C    . LEU B 2 86 ? 6.156   6.349   3.021   1.00 0.00 ? 380 LEU B C    6  
ATOM 10238 O O    . LEU B 2 86 ? 7.316   5.941   3.117   1.00 0.00 ? 380 LEU B O    6  
ATOM 10239 C CB   . LEU B 2 86 ? 3.903   5.184   2.746   1.00 0.00 ? 380 LEU B CB   6  
ATOM 10240 C CG   . LEU B 2 86 ? 4.076   4.420   4.065   1.00 0.00 ? 380 LEU B CG   6  
ATOM 10241 C CD1  . LEU B 2 86 ? 2.709   4.043   4.622   1.00 0.00 ? 380 LEU B CD1  6  
ATOM 10242 C CD2  . LEU B 2 86 ? 4.928   3.173   3.877   1.00 0.00 ? 380 LEU B CD2  6  
ATOM 10243 H H    . LEU B 2 86 ? 5.830   3.682   1.727   1.00 0.00 ? 380 LEU B H    6  
ATOM 10244 H HA   . LEU B 2 86 ? 4.900   6.410   1.301   1.00 0.00 ? 380 LEU B HA   6  
ATOM 10245 H HB2  . LEU B 2 86 ? 3.275   6.039   2.938   1.00 0.00 ? 380 LEU B HB2  6  
ATOM 10246 H HB3  . LEU B 2 86 ? 3.384   4.535   2.056   1.00 0.00 ? 380 LEU B HB3  6  
ATOM 10247 H HG   . LEU B 2 86 ? 4.565   5.060   4.787   1.00 0.00 ? 380 LEU B HG   6  
ATOM 10248 H HD11 . LEU B 2 86 ? 2.800   3.156   5.235   1.00 0.00 ? 380 LEU B HD11 6  
ATOM 10249 H HD12 . LEU B 2 86 ? 2.026   3.850   3.800   1.00 0.00 ? 380 LEU B HD12 6  
ATOM 10250 H HD13 . LEU B 2 86 ? 2.328   4.856   5.222   1.00 0.00 ? 380 LEU B HD13 6  
ATOM 10251 H HD21 . LEU B 2 86 ? 4.846   2.547   4.753   1.00 0.00 ? 380 LEU B HD21 6  
ATOM 10252 H HD22 . LEU B 2 86 ? 5.959   3.461   3.734   1.00 0.00 ? 380 LEU B HD22 6  
ATOM 10253 H HD23 . LEU B 2 86 ? 4.581   2.629   3.011   1.00 0.00 ? 380 LEU B HD23 6  
ATOM 10254 N N    . PRO B 2 87 ? 5.713   7.405   3.742   1.00 0.00 ? 381 PRO B N    6  
ATOM 10255 C CA   . PRO B 2 87 ? 6.570   8.140   4.689   1.00 0.00 ? 381 PRO B CA   6  
ATOM 10256 C C    . PRO B 2 87 ? 7.070   7.274   5.848   1.00 0.00 ? 381 PRO B C    6  
ATOM 10257 O O    . PRO B 2 87 ? 7.136   6.048   5.741   1.00 0.00 ? 381 PRO B O    6  
ATOM 10258 C CB   . PRO B 2 87 ? 5.654   9.263   5.207   1.00 0.00 ? 381 PRO B CB   6  
ATOM 10259 C CG   . PRO B 2 87 ? 4.568   9.373   4.196   1.00 0.00 ? 381 PRO B CG   6  
ATOM 10260 C CD   . PRO B 2 87 ? 4.362   7.982   3.679   1.00 0.00 ? 381 PRO B CD   6  
ATOM 10261 H HA   . PRO B 2 87 ? 7.419   8.577   4.186   1.00 0.00 ? 381 PRO B HA   6  
ATOM 10262 H HB2  . PRO B 2 87 ? 5.264   8.996   6.177   1.00 0.00 ? 381 PRO B HB2  6  
ATOM 10263 H HB3  . PRO B 2 87 ? 6.217   10.183  5.281   1.00 0.00 ? 381 PRO B HB3  6  
ATOM 10264 H HG2  . PRO B 2 87 ? 3.665   9.738   4.663   1.00 0.00 ? 381 PRO B HG2  6  
ATOM 10265 H HG3  . PRO B 2 87 ? 4.872   10.031  3.396   1.00 0.00 ? 381 PRO B HG3  6  
ATOM 10266 H HD2  . PRO B 2 87 ? 3.684   7.441   4.320   1.00 0.00 ? 381 PRO B HD2  6  
ATOM 10267 H HD3  . PRO B 2 87 ? 3.997   8.003   2.664   1.00 0.00 ? 381 PRO B HD3  6  
ATOM 10268 N N    . ASP B 2 88 ? 7.425   7.925   6.955   1.00 0.00 ? 382 ASP B N    6  
ATOM 10269 C CA   . ASP B 2 88 ? 7.927   7.222   8.134   1.00 0.00 ? 382 ASP B CA   6  
ATOM 10270 C C    . ASP B 2 88 ? 6.769   6.667   8.956   1.00 0.00 ? 382 ASP B C    6  
ATOM 10271 O O    . ASP B 2 88 ? 6.301   7.295   9.908   1.00 0.00 ? 382 ASP B O    6  
ATOM 10272 C CB   . ASP B 2 88 ? 8.792   8.153   8.994   1.00 0.00 ? 382 ASP B CB   6  
ATOM 10273 C CG   . ASP B 2 88 ? 10.051  8.613   8.279   1.00 0.00 ? 382 ASP B CG   6  
ATOM 10274 O OD1  . ASP B 2 88 ? 9.932   9.316   7.251   1.00 0.00 ? 382 ASP B OD1  6  
ATOM 10275 O OD2  . ASP B 2 88 ? 11.156  8.269   8.745   1.00 0.00 ? 382 ASP B OD2  6  
ATOM 10276 H H    . ASP B 2 88 ? 7.349   8.900   6.978   1.00 0.00 ? 382 ASP B H    6  
ATOM 10277 H HA   . ASP B 2 88 ? 8.535   6.397   7.791   1.00 0.00 ? 382 ASP B HA   6  
ATOM 10278 H HB2  . ASP B 2 88 ? 8.215   9.027   9.258   1.00 0.00 ? 382 ASP B HB2  6  
ATOM 10279 H HB3  . ASP B 2 88 ? 9.082   7.635   9.895   1.00 0.00 ? 382 ASP B HB3  6  
ATOM 10280 N N    . ALA B 2 89 ? 6.308   5.481   8.564   1.00 0.00 ? 383 ALA B N    6  
ATOM 10281 C CA   . ALA B 2 89 ? 5.197   4.818   9.236   1.00 0.00 ? 383 ALA B CA   6  
ATOM 10282 C C    . ALA B 2 89 ? 5.649   4.114   10.516  1.00 0.00 ? 383 ALA B C    6  
ATOM 10283 O O    . ALA B 2 89 ? 4.815   3.980   11.438  1.00 0.00 ? 383 ALA B O    6  
ATOM 10284 C CB   . ALA B 2 89 ? 4.543   3.828   8.290   1.00 0.00 ? 383 ALA B CB   6  
ATOM 10285 O OXT  . ALA B 2 89 ? 6.824   3.696   10.587  1.00 0.00 ? 383 ALA B OXT  6  
ATOM 10286 H H    . ALA B 2 89 ? 6.724   5.042   7.791   1.00 0.00 ? 383 ALA B H    6  
ATOM 10287 H HA   . ALA B 2 89 ? 4.464   5.570   9.491   1.00 0.00 ? 383 ALA B HA   6  
ATOM 10288 H HB1  . ALA B 2 89 ? 4.147   4.353   7.434   1.00 0.00 ? 383 ALA B HB1  6  
ATOM 10289 H HB2  . ALA B 2 89 ? 3.742   3.321   8.802   1.00 0.00 ? 383 ALA B HB2  6  
ATOM 10290 H HB3  . ALA B 2 89 ? 5.275   3.107   7.962   1.00 0.00 ? 383 ALA B HB3  6  
ATOM 10291 N N    . ARG A 1 1  ? 0.108   12.693  -5.351  1.00 0.00 ? 6   ARG A N    7  
ATOM 10292 C CA   . ARG A 1 1  ? 0.084   12.204  -6.760  1.00 0.00 ? 6   ARG A CA   7  
ATOM 10293 C C    . ARG A 1 1  ? 0.498   10.735  -6.846  1.00 0.00 ? 6   ARG A C    7  
ATOM 10294 O O    . ARG A 1 1  ? -0.207  9.920   -7.443  1.00 0.00 ? 6   ARG A O    7  
ATOM 10295 C CB   . ARG A 1 1  ? 1.023   13.075  -7.604  1.00 0.00 ? 6   ARG A CB   7  
ATOM 10296 C CG   . ARG A 1 1  ? 0.641   14.547  -7.615  1.00 0.00 ? 6   ARG A CG   7  
ATOM 10297 C CD   . ARG A 1 1  ? 1.625   15.378  -8.422  1.00 0.00 ? 6   ARG A CD   7  
ATOM 10298 N NE   . ARG A 1 1  ? 1.316   16.807  -8.366  1.00 0.00 ? 6   ARG A NE   7  
ATOM 10299 C CZ   . ARG A 1 1  ? 1.404   17.554  -7.259  1.00 0.00 ? 6   ARG A CZ   7  
ATOM 10300 N NH1  . ARG A 1 1  ? 1.840   17.027  -6.116  1.00 0.00 ? 6   ARG A NH1  7  
ATOM 10301 N NH2  . ARG A 1 1  ? 1.066   18.839  -7.299  1.00 0.00 ? 6   ARG A NH2  7  
ATOM 10302 H H1   . ARG A 1 1  ? -0.243  11.928  -4.743  1.00 0.00 ? 6   ARG A H1   7  
ATOM 10303 H H2   . ARG A 1 1  ? -0.509  13.528  -5.297  1.00 0.00 ? 6   ARG A H2   7  
ATOM 10304 H H3   . ARG A 1 1  ? 1.092   12.936  -5.114  1.00 0.00 ? 6   ARG A H3   7  
ATOM 10305 H HA   . ARG A 1 1  ? -0.923  12.304  -7.138  1.00 0.00 ? 6   ARG A HA   7  
ATOM 10306 H HB2  . ARG A 1 1  ? 2.025   12.987  -7.211  1.00 0.00 ? 6   ARG A HB2  7  
ATOM 10307 H HB3  . ARG A 1 1  ? 1.012   12.714  -8.622  1.00 0.00 ? 6   ARG A HB3  7  
ATOM 10308 H HG2  . ARG A 1 1  ? -0.342  14.649  -8.049  1.00 0.00 ? 6   ARG A HG2  7  
ATOM 10309 H HG3  . ARG A 1 1  ? 0.625   14.910  -6.598  1.00 0.00 ? 6   ARG A HG3  7  
ATOM 10310 H HD2  . ARG A 1 1  ? 2.620   15.219  -8.029  1.00 0.00 ? 6   ARG A HD2  7  
ATOM 10311 H HD3  . ARG A 1 1  ? 1.591   15.052  -9.452  1.00 0.00 ? 6   ARG A HD3  7  
ATOM 10312 H HE   . ARG A 1 1  ? 1.013   17.234  -9.194  1.00 0.00 ? 6   ARG A HE   7  
ATOM 10313 H HH11 . ARG A 1 1  ? 2.109   16.066  -6.076  1.00 0.00 ? 6   ARG A HH11 7  
ATOM 10314 H HH12 . ARG A 1 1  ? 1.900   17.595  -5.294  1.00 0.00 ? 6   ARG A HH12 7  
ATOM 10315 H HH21 . ARG A 1 1  ? 0.747   19.246  -8.154  1.00 0.00 ? 6   ARG A HH21 7  
ATOM 10316 H HH22 . ARG A 1 1  ? 1.130   19.399  -6.473  1.00 0.00 ? 6   ARG A HH22 7  
ATOM 10317 N N    . MET A 1 2  ? 1.641   10.404  -6.242  1.00 0.00 ? 7   MET A N    7  
ATOM 10318 C CA   . MET A 1 2  ? 2.143   9.031   -6.244  1.00 0.00 ? 7   MET A CA   7  
ATOM 10319 C C    . MET A 1 2  ? 2.507   8.582   -4.829  1.00 0.00 ? 7   MET A C    7  
ATOM 10320 O O    . MET A 1 2  ? 3.243   9.268   -4.117  1.00 0.00 ? 7   MET A O    7  
ATOM 10321 C CB   . MET A 1 2  ? 3.356   8.898   -7.173  1.00 0.00 ? 7   MET A CB   7  
ATOM 10322 C CG   . MET A 1 2  ? 4.538   9.770   -6.780  1.00 0.00 ? 7   MET A CG   7  
ATOM 10323 S SD   . MET A 1 2  ? 5.960   9.536   -7.864  1.00 0.00 ? 7   MET A SD   7  
ATOM 10324 C CE   . MET A 1 2  ? 6.300   7.796   -7.609  1.00 0.00 ? 7   MET A CE   7  
ATOM 10325 H H    . MET A 1 2  ? 2.156   11.097  -5.779  1.00 0.00 ? 7   MET A H    7  
ATOM 10326 H HA   . MET A 1 2  ? 1.352   8.395   -6.612  1.00 0.00 ? 7   MET A HA   7  
ATOM 10327 H HB2  . MET A 1 2  ? 3.680   7.868   -7.170  1.00 0.00 ? 7   MET A HB2  7  
ATOM 10328 H HB3  . MET A 1 2  ? 3.056   9.166   -8.174  1.00 0.00 ? 7   MET A HB3  7  
ATOM 10329 H HG2  . MET A 1 2  ? 4.236   10.806  -6.825  1.00 0.00 ? 7   MET A HG2  7  
ATOM 10330 H HG3  . MET A 1 2  ? 4.830   9.525   -5.769  1.00 0.00 ? 7   MET A HG3  7  
ATOM 10331 H HE1  . MET A 1 2  ? 6.884   7.418   -8.434  1.00 0.00 ? 7   MET A HE1  7  
ATOM 10332 H HE2  . MET A 1 2  ? 5.368   7.252   -7.553  1.00 0.00 ? 7   MET A HE2  7  
ATOM 10333 H HE3  . MET A 1 2  ? 6.848   7.666   -6.689  1.00 0.00 ? 7   MET A HE3  7  
ATOM 10334 N N    . ASN A 1 3  ? 1.977   7.425   -4.433  1.00 0.00 ? 8   ASN A N    7  
ATOM 10335 C CA   . ASN A 1 3  ? 2.230   6.866   -3.104  1.00 0.00 ? 8   ASN A CA   7  
ATOM 10336 C C    . ASN A 1 3  ? 1.649   5.446   -2.991  1.00 0.00 ? 8   ASN A C    7  
ATOM 10337 O O    . ASN A 1 3  ? 1.902   4.611   -3.862  1.00 0.00 ? 8   ASN A O    7  
ATOM 10338 C CB   . ASN A 1 3  ? 1.684   7.806   -2.006  1.00 0.00 ? 8   ASN A CB   7  
ATOM 10339 C CG   . ASN A 1 3  ? 0.199   8.170   -2.130  1.00 0.00 ? 8   ASN A CG   7  
ATOM 10340 O OD1  . ASN A 1 3  ? -0.303  8.975   -1.345  1.00 0.00 ? 8   ASN A OD1  7  
ATOM 10341 N ND2  . ASN A 1 3  ? -0.523  7.586   -3.088  1.00 0.00 ? 8   ASN A ND2  7  
ATOM 10342 H H    . ASN A 1 3  ? 1.398   6.932   -5.051  1.00 0.00 ? 8   ASN A H    7  
ATOM 10343 H HA   . ASN A 1 3  ? 3.303   6.795   -2.990  1.00 0.00 ? 8   ASN A HA   7  
ATOM 10344 H HB2  . ASN A 1 3  ? 1.828   7.337   -1.046  1.00 0.00 ? 8   ASN A HB2  7  
ATOM 10345 H HB3  . ASN A 1 3  ? 2.256   8.725   -2.026  1.00 0.00 ? 8   ASN A HB3  7  
ATOM 10346 H HD21 . ASN A 1 3  ? -0.090  6.945   -3.679  1.00 0.00 ? 8   ASN A HD21 7  
ATOM 10347 H HD22 . ASN A 1 3  ? -1.470  7.827   -3.158  1.00 0.00 ? 8   ASN A HD22 7  
ATOM 10348 N N    . ILE A 1 4  ? 0.875   5.167   -1.933  1.00 0.00 ? 9   ILE A N    7  
ATOM 10349 C CA   . ILE A 1 4  ? 0.280   3.841   -1.753  1.00 0.00 ? 9   ILE A CA   7  
ATOM 10350 C C    . ILE A 1 4  ? -0.560  3.425   -2.935  1.00 0.00 ? 9   ILE A C    7  
ATOM 10351 O O    . ILE A 1 4  ? -0.525  2.267   -3.344  1.00 0.00 ? 9   ILE A O    7  
ATOM 10352 C CB   . ILE A 1 4  ? -0.625  3.749   -0.512  1.00 0.00 ? 9   ILE A CB   7  
ATOM 10353 C CG1  . ILE A 1 4  ? -1.549  4.962   -0.388  1.00 0.00 ? 9   ILE A CG1  7  
ATOM 10354 C CG2  . ILE A 1 4  ? 0.204   3.578   0.724   1.00 0.00 ? 9   ILE A CG2  7  
ATOM 10355 C CD1  . ILE A 1 4  ? -2.484  4.881   0.796   1.00 0.00 ? 9   ILE A CD1  7  
ATOM 10356 H H    . ILE A 1 4  ? 0.701   5.857   -1.265  1.00 0.00 ? 9   ILE A H    7  
ATOM 10357 H HA   . ILE A 1 4  ? 1.084   3.132   -1.632  1.00 0.00 ? 9   ILE A HA   7  
ATOM 10358 H HB   . ILE A 1 4  ? -1.233  2.862   -0.617  1.00 0.00 ? 9   ILE A HB   7  
ATOM 10359 H HG12 . ILE A 1 4  ? -0.952  5.855   -0.278  1.00 0.00 ? 9   ILE A HG12 7  
ATOM 10360 H HG13 . ILE A 1 4  ? -2.149  5.044   -1.281  1.00 0.00 ? 9   ILE A HG13 7  
ATOM 10361 H HG21 . ILE A 1 4  ? -0.257  2.838   1.352   1.00 0.00 ? 9   ILE A HG21 7  
ATOM 10362 H HG22 . ILE A 1 4  ? 0.263   4.519   1.250   1.00 0.00 ? 9   ILE A HG22 7  
ATOM 10363 H HG23 . ILE A 1 4  ? 1.190   3.252   0.440   1.00 0.00 ? 9   ILE A HG23 7  
ATOM 10364 H HD11 . ILE A 1 4  ? -3.396  4.386   0.500   1.00 0.00 ? 9   ILE A HD11 7  
ATOM 10365 H HD12 . ILE A 1 4  ? -2.712  5.877   1.142   1.00 0.00 ? 9   ILE A HD12 7  
ATOM 10366 H HD13 . ILE A 1 4  ? -2.013  4.323   1.592   1.00 0.00 ? 9   ILE A HD13 7  
ATOM 10367 N N    . GLN A 1 5  ? -1.350  4.358   -3.455  1.00 0.00 ? 10  GLN A N    7  
ATOM 10368 C CA   . GLN A 1 5  ? -2.227  4.050   -4.561  1.00 0.00 ? 10  GLN A CA   7  
ATOM 10369 C C    . GLN A 1 5  ? -1.457  3.430   -5.724  1.00 0.00 ? 10  GLN A C    7  
ATOM 10370 O O    . GLN A 1 5  ? -1.867  2.404   -6.264  1.00 0.00 ? 10  GLN A O    7  
ATOM 10371 C CB   . GLN A 1 5  ? -2.986  5.296   -5.029  1.00 0.00 ? 10  GLN A CB   7  
ATOM 10372 C CG   . GLN A 1 5  ? -3.821  5.080   -6.280  1.00 0.00 ? 10  GLN A CG   7  
ATOM 10373 C CD   . GLN A 1 5  ? -4.550  6.337   -6.718  1.00 0.00 ? 10  GLN A CD   7  
ATOM 10374 O OE1  . GLN A 1 5  ? -5.392  6.864   -5.989  1.00 0.00 ? 10  GLN A OE1  7  
ATOM 10375 N NE2  . GLN A 1 5  ? -4.227  6.829   -7.910  1.00 0.00 ? 10  GLN A NE2  7  
ATOM 10376 H H    . GLN A 1 5  ? -1.360  5.257   -3.066  1.00 0.00 ? 10  GLN A H    7  
ATOM 10377 H HA   . GLN A 1 5  ? -2.928  3.329   -4.176  1.00 0.00 ? 10  GLN A HA   7  
ATOM 10378 H HB2  . GLN A 1 5  ? -3.647  5.610   -4.240  1.00 0.00 ? 10  GLN A HB2  7  
ATOM 10379 H HB3  . GLN A 1 5  ? -2.275  6.085   -5.227  1.00 0.00 ? 10  GLN A HB3  7  
ATOM 10380 H HG2  . GLN A 1 5  ? -3.171  4.761   -7.082  1.00 0.00 ? 10  GLN A HG2  7  
ATOM 10381 H HG3  . GLN A 1 5  ? -4.552  4.309   -6.083  1.00 0.00 ? 10  GLN A HG3  7  
ATOM 10382 H HE21 . GLN A 1 5  ? -3.546  6.363   -8.437  1.00 0.00 ? 10  GLN A HE21 7  
ATOM 10383 H HE22 . GLN A 1 5  ? -4.684  7.641   -8.214  1.00 0.00 ? 10  GLN A HE22 7  
ATOM 10384 N N    . MET A 1 6  ? -0.334  4.050   -6.095  1.00 0.00 ? 11  MET A N    7  
ATOM 10385 C CA   . MET A 1 6  ? 0.504   3.543   -7.182  1.00 0.00 ? 11  MET A CA   7  
ATOM 10386 C C    . MET A 1 6  ? 0.816   2.060   -6.965  1.00 0.00 ? 11  MET A C    7  
ATOM 10387 O O    . MET A 1 6  ? 0.823   1.269   -7.908  1.00 0.00 ? 11  MET A O    7  
ATOM 10388 C CB   . MET A 1 6  ? 1.803   4.353   -7.265  1.00 0.00 ? 11  MET A CB   7  
ATOM 10389 C CG   . MET A 1 6  ? 2.728   3.924   -8.394  1.00 0.00 ? 11  MET A CG   7  
ATOM 10390 S SD   . MET A 1 6  ? 4.239   4.907   -8.462  1.00 0.00 ? 11  MET A SD   7  
ATOM 10391 C CE   . MET A 1 6  ? 4.958   4.544   -6.861  1.00 0.00 ? 11  MET A CE   7  
ATOM 10392 H H    . MET A 1 6  ? -0.055  4.859   -5.616  1.00 0.00 ? 11  MET A H    7  
ATOM 10393 H HA   . MET A 1 6  ? -0.044  3.655   -8.107  1.00 0.00 ? 11  MET A HA   7  
ATOM 10394 H HB2  . MET A 1 6  ? 1.555   5.394   -7.410  1.00 0.00 ? 11  MET A HB2  7  
ATOM 10395 H HB3  . MET A 1 6  ? 2.338   4.246   -6.333  1.00 0.00 ? 11  MET A HB3  7  
ATOM 10396 H HG2  . MET A 1 6  ? 2.998   2.889   -8.248  1.00 0.00 ? 11  MET A HG2  7  
ATOM 10397 H HG3  . MET A 1 6  ? 2.203   4.030   -9.332  1.00 0.00 ? 11  MET A HG3  7  
ATOM 10398 H HE1  . MET A 1 6  ? 4.812   5.387   -6.202  1.00 0.00 ? 11  MET A HE1  7  
ATOM 10399 H HE2  . MET A 1 6  ? 6.014   4.354   -6.975  1.00 0.00 ? 11  MET A HE2  7  
ATOM 10400 H HE3  . MET A 1 6  ? 4.479   3.671   -6.442  1.00 0.00 ? 11  MET A HE3  7  
ATOM 10401 N N    . LEU A 1 7  ? 1.051   1.697   -5.704  1.00 0.00 ? 12  LEU A N    7  
ATOM 10402 C CA   . LEU A 1 7  ? 1.342   0.320   -5.325  1.00 0.00 ? 12  LEU A CA   7  
ATOM 10403 C C    . LEU A 1 7  ? 0.056   -0.512  -5.266  1.00 0.00 ? 12  LEU A C    7  
ATOM 10404 O O    . LEU A 1 7  ? 0.028   -1.643  -5.749  1.00 0.00 ? 12  LEU A O    7  
ATOM 10405 C CB   . LEU A 1 7  ? 2.091   0.328   -3.991  1.00 0.00 ? 12  LEU A CB   7  
ATOM 10406 C CG   . LEU A 1 7  ? 1.913   -0.894  -3.093  1.00 0.00 ? 12  LEU A CG   7  
ATOM 10407 C CD1  . LEU A 1 7  ? 2.689   -2.075  -3.642  1.00 0.00 ? 12  LEU A CD1  7  
ATOM 10408 C CD2  . LEU A 1 7  ? 2.354   -0.580  -1.671  1.00 0.00 ? 12  LEU A CD2  7  
ATOM 10409 H H    . LEU A 1 7  ? 1.013   2.376   -5.000  1.00 0.00 ? 12  LEU A H    7  
ATOM 10410 H HA   . LEU A 1 7  ? 1.986   -0.097  -6.083  1.00 0.00 ? 12  LEU A HA   7  
ATOM 10411 H HB2  . LEU A 1 7  ? 3.142   0.414   -4.223  1.00 0.00 ? 12  LEU A HB2  7  
ATOM 10412 H HB3  . LEU A 1 7  ? 1.790   1.202   -3.439  1.00 0.00 ? 12  LEU A HB3  7  
ATOM 10413 H HG   . LEU A 1 7  ? 0.868   -1.161  -3.069  1.00 0.00 ? 12  LEU A HG   7  
ATOM 10414 H HD11 . LEU A 1 7  ? 3.744   -1.852  -3.626  1.00 0.00 ? 12  LEU A HD11 7  
ATOM 10415 H HD12 . LEU A 1 7  ? 2.375   -2.270  -4.657  1.00 0.00 ? 12  LEU A HD12 7  
ATOM 10416 H HD13 . LEU A 1 7  ? 2.495   -2.943  -3.031  1.00 0.00 ? 12  LEU A HD13 7  
ATOM 10417 H HD21 . LEU A 1 7  ? 3.300   -0.058  -1.694  1.00 0.00 ? 12  LEU A HD21 7  
ATOM 10418 H HD22 . LEU A 1 7  ? 2.465   -1.501  -1.117  1.00 0.00 ? 12  LEU A HD22 7  
ATOM 10419 H HD23 . LEU A 1 7  ? 1.612   0.040   -1.193  1.00 0.00 ? 12  LEU A HD23 7  
ATOM 10420 N N    . LEU A 1 8  ? -1.014  0.064   -4.705  1.00 0.00 ? 13  LEU A N    7  
ATOM 10421 C CA   . LEU A 1 8  ? -2.310  -0.624  -4.633  1.00 0.00 ? 13  LEU A CA   7  
ATOM 10422 C C    . LEU A 1 8  ? -2.764  -1.038  -6.029  1.00 0.00 ? 13  LEU A C    7  
ATOM 10423 O O    . LEU A 1 8  ? -3.101  -2.201  -6.259  1.00 0.00 ? 13  LEU A O    7  
ATOM 10424 C CB   . LEU A 1 8  ? -3.376  0.294   -4.020  1.00 0.00 ? 13  LEU A CB   7  
ATOM 10425 C CG   . LEU A 1 8  ? -3.332  0.450   -2.504  1.00 0.00 ? 13  LEU A CG   7  
ATOM 10426 C CD1  . LEU A 1 8  ? -4.161  1.649   -2.067  1.00 0.00 ? 13  LEU A CD1  7  
ATOM 10427 C CD2  . LEU A 1 8  ? -3.844  -0.817  -1.838  1.00 0.00 ? 13  LEU A CD2  7  
ATOM 10428 H H    . LEU A 1 8  ? -0.937  0.979   -4.350  1.00 0.00 ? 13  LEU A H    7  
ATOM 10429 H HA   . LEU A 1 8  ? -2.190  -1.515  -4.023  1.00 0.00 ? 13  LEU A HA   7  
ATOM 10430 H HB2  . LEU A 1 8  ? -3.269  1.273   -4.461  1.00 0.00 ? 13  LEU A HB2  7  
ATOM 10431 H HB3  . LEU A 1 8  ? -4.348  -0.094  -4.289  1.00 0.00 ? 13  LEU A HB3  7  
ATOM 10432 H HG   . LEU A 1 8  ? -2.312  0.610   -2.190  1.00 0.00 ? 13  LEU A HG   7  
ATOM 10433 H HD11 . LEU A 1 8  ? -4.833  1.932   -2.864  1.00 0.00 ? 13  LEU A HD11 7  
ATOM 10434 H HD12 . LEU A 1 8  ? -3.506  2.475   -1.838  1.00 0.00 ? 13  LEU A HD12 7  
ATOM 10435 H HD13 . LEU A 1 8  ? -4.735  1.390   -1.189  1.00 0.00 ? 13  LEU A HD13 7  
ATOM 10436 H HD21 . LEU A 1 8  ? -3.714  -0.743  -0.771  1.00 0.00 ? 13  LEU A HD21 7  
ATOM 10437 H HD22 . LEU A 1 8  ? -3.290  -1.666  -2.211  1.00 0.00 ? 13  LEU A HD22 7  
ATOM 10438 H HD23 . LEU A 1 8  ? -4.892  -0.946  -2.067  1.00 0.00 ? 13  LEU A HD23 7  
ATOM 10439 N N    . GLU A 1 9  ? -2.753  -0.073  -6.960  1.00 0.00 ? 14  GLU A N    7  
ATOM 10440 C CA   . GLU A 1 9  ? -3.143  -0.323  -8.349  1.00 0.00 ? 14  GLU A CA   7  
ATOM 10441 C C    . GLU A 1 9  ? -2.462  -1.583  -8.868  1.00 0.00 ? 14  GLU A C    7  
ATOM 10442 O O    . GLU A 1 9  ? -3.054  -2.352  -9.628  1.00 0.00 ? 14  GLU A O    7  
ATOM 10443 C CB   . GLU A 1 9  ? -2.771  0.868   -9.235  1.00 0.00 ? 14  GLU A CB   7  
ATOM 10444 C CG   . GLU A 1 9  ? -3.546  2.141   -8.920  1.00 0.00 ? 14  GLU A CG   7  
ATOM 10445 C CD   . GLU A 1 9  ? -3.081  3.344   -9.731  1.00 0.00 ? 14  GLU A CD   7  
ATOM 10446 O OE1  . GLU A 1 9  ? -2.108  3.211   -10.507 1.00 0.00 ? 14  GLU A OE1  7  
ATOM 10447 O OE2  . GLU A 1 9  ? -3.689  4.424   -9.582  1.00 0.00 ? 14  GLU A OE2  7  
ATOM 10448 H H    . GLU A 1 9  ? -2.462  0.828   -6.704  1.00 0.00 ? 14  GLU A H    7  
ATOM 10449 H HA   . GLU A 1 9  ? -4.214  -0.467  -8.374  1.00 0.00 ? 14  GLU A HA   7  
ATOM 10450 H HB2  . GLU A 1 9  ? -1.718  1.076   -9.114  1.00 0.00 ? 14  GLU A HB2  7  
ATOM 10451 H HB3  . GLU A 1 9  ? -2.959  0.605   -10.266 1.00 0.00 ? 14  GLU A HB3  7  
ATOM 10452 H HG2  . GLU A 1 9  ? -4.590  1.970   -9.134  1.00 0.00 ? 14  GLU A HG2  7  
ATOM 10453 H HG3  . GLU A 1 9  ? -3.430  2.368   -7.872  1.00 0.00 ? 14  GLU A HG3  7  
ATOM 10454 N N    . ALA A 1 10 ? -1.214  -1.791  -8.434  1.00 0.00 ? 15  ALA A N    7  
ATOM 10455 C CA   . ALA A 1 10 ? -0.445  -2.962  -8.827  1.00 0.00 ? 15  ALA A CA   7  
ATOM 10456 C C    . ALA A 1 10 ? -1.244  -4.228  -8.593  1.00 0.00 ? 15  ALA A C    7  
ATOM 10457 O O    . ALA A 1 10 ? -1.585  -4.929  -9.540  1.00 0.00 ? 15  ALA A O    7  
ATOM 10458 C CB   . ALA A 1 10 ? 0.856   -3.036  -8.047  1.00 0.00 ? 15  ALA A CB   7  
ATOM 10459 H H    . ALA A 1 10 ? -0.808  -1.143  -7.820  1.00 0.00 ? 15  ALA A H    7  
ATOM 10460 H HA   . ALA A 1 10 ? -0.210  -2.877  -9.877  1.00 0.00 ? 15  ALA A HA   7  
ATOM 10461 H HB1  . ALA A 1 10 ? 0.706   -3.614  -7.147  1.00 0.00 ? 15  ALA A HB1  7  
ATOM 10462 H HB2  . ALA A 1 10 ? 1.178   -2.040  -7.784  1.00 0.00 ? 15  ALA A HB2  7  
ATOM 10463 H HB3  . ALA A 1 10 ? 1.612   -3.511  -8.655  1.00 0.00 ? 15  ALA A HB3  7  
ATOM 10464 N N    . ALA A 1 11 ? -1.534  -4.514  -7.319  1.00 0.00 ? 16  ALA A N    7  
ATOM 10465 C CA   . ALA A 1 11 ? -2.284  -5.706  -6.947  1.00 0.00 ? 16  ALA A CA   7  
ATOM 10466 C C    . ALA A 1 11 ? -3.449  -5.968  -7.898  1.00 0.00 ? 16  ALA A C    7  
ATOM 10467 O O    . ALA A 1 11 ? -3.583  -7.069  -8.423  1.00 0.00 ? 16  ALA A O    7  
ATOM 10468 C CB   . ALA A 1 11 ? -2.806  -5.606  -5.528  1.00 0.00 ? 16  ALA A CB   7  
ATOM 10469 H H    . ALA A 1 11 ? -1.224  -3.908  -6.614  1.00 0.00 ? 16  ALA A H    7  
ATOM 10470 H HA   . ALA A 1 11 ? -1.596  -6.536  -6.989  1.00 0.00 ? 16  ALA A HA   7  
ATOM 10471 H HB1  . ALA A 1 11 ? -3.608  -6.317  -5.400  1.00 0.00 ? 16  ALA A HB1  7  
ATOM 10472 H HB2  . ALA A 1 11 ? -3.173  -4.607  -5.348  1.00 0.00 ? 16  ALA A HB2  7  
ATOM 10473 H HB3  . ALA A 1 11 ? -2.011  -5.831  -4.836  1.00 0.00 ? 16  ALA A HB3  7  
ATOM 10474 N N    . ASP A 1 12 ? -4.287  -4.947  -8.114  1.00 0.00 ? 17  ASP A N    7  
ATOM 10475 C CA   . ASP A 1 12 ? -5.441  -5.072  -9.008  1.00 0.00 ? 17  ASP A CA   7  
ATOM 10476 C C    . ASP A 1 12 ? -5.023  -5.671  -10.352 1.00 0.00 ? 17  ASP A C    7  
ATOM 10477 O O    . ASP A 1 12 ? -5.713  -6.535  -10.897 1.00 0.00 ? 17  ASP A O    7  
ATOM 10478 C CB   . ASP A 1 12 ? -6.101  -3.704  -9.233  1.00 0.00 ? 17  ASP A CB   7  
ATOM 10479 C CG   . ASP A 1 12 ? -6.644  -3.091  -7.954  1.00 0.00 ? 17  ASP A CG   7  
ATOM 10480 O OD1  . ASP A 1 12 ? -5.838  -2.781  -7.051  1.00 0.00 ? 17  ASP A OD1  7  
ATOM 10481 O OD2  . ASP A 1 12 ? -7.877  -2.920  -7.855  1.00 0.00 ? 17  ASP A OD2  7  
ATOM 10482 H H    . ASP A 1 12 ? -4.121  -4.092  -7.663  1.00 0.00 ? 17  ASP A H    7  
ATOM 10483 H HA   . ASP A 1 12 ? -6.154  -5.733  -8.539  1.00 0.00 ? 17  ASP A HA   7  
ATOM 10484 H HB2  . ASP A 1 12 ? -5.374  -3.026  -9.652  1.00 0.00 ? 17  ASP A HB2  7  
ATOM 10485 H HB3  . ASP A 1 12 ? -6.919  -3.819  -9.930  1.00 0.00 ? 17  ASP A HB3  7  
ATOM 10486 N N    . TYR A 1 13 ? -3.881  -5.215  -10.867 1.00 0.00 ? 18  TYR A N    7  
ATOM 10487 C CA   . TYR A 1 13 ? -3.348  -5.703  -12.136 1.00 0.00 ? 18  TYR A CA   7  
ATOM 10488 C C    . TYR A 1 13 ? -2.667  -7.058  -11.954 1.00 0.00 ? 18  TYR A C    7  
ATOM 10489 O O    . TYR A 1 13 ? -2.885  -7.978  -12.744 1.00 0.00 ? 18  TYR A O    7  
ATOM 10490 C CB   . TYR A 1 13 ? -2.371  -4.673  -12.723 1.00 0.00 ? 18  TYR A CB   7  
ATOM 10491 C CG   . TYR A 1 13 ? -1.740  -5.074  -14.043 1.00 0.00 ? 18  TYR A CG   7  
ATOM 10492 C CD1  . TYR A 1 13 ? -0.849  -6.139  -14.120 1.00 0.00 ? 18  TYR A CD1  7  
ATOM 10493 C CD2  . TYR A 1 13 ? -2.033  -4.381  -15.211 1.00 0.00 ? 18  TYR A CD2  7  
ATOM 10494 C CE1  . TYR A 1 13 ? -0.269  -6.499  -15.321 1.00 0.00 ? 18  TYR A CE1  7  
ATOM 10495 C CE2  . TYR A 1 13 ? -1.458  -4.737  -16.416 1.00 0.00 ? 18  TYR A CE2  7  
ATOM 10496 C CZ   . TYR A 1 13 ? -0.577  -5.796  -16.464 1.00 0.00 ? 18  TYR A CZ   7  
ATOM 10497 O OH   . TYR A 1 13 ? -0.001  -6.152  -17.664 1.00 0.00 ? 18  TYR A OH   7  
ATOM 10498 H H    . TYR A 1 13 ? -3.377  -4.534  -10.374 1.00 0.00 ? 18  TYR A H    7  
ATOM 10499 H HA   . TYR A 1 13 ? -4.177  -5.833  -12.807 1.00 0.00 ? 18  TYR A HA   7  
ATOM 10500 H HB2  . TYR A 1 13 ? -2.898  -3.744  -12.883 1.00 0.00 ? 18  TYR A HB2  7  
ATOM 10501 H HB3  . TYR A 1 13 ? -1.574  -4.504  -12.013 1.00 0.00 ? 18  TYR A HB3  7  
ATOM 10502 H HD1  . TYR A 1 13 ? -0.608  -6.689  -13.221 1.00 0.00 ? 18  TYR A HD1  7  
ATOM 10503 H HD2  . TYR A 1 13 ? -2.723  -3.550  -15.169 1.00 0.00 ? 18  TYR A HD2  7  
ATOM 10504 H HE1  . TYR A 1 13 ? 0.421   -7.330  -15.359 1.00 0.00 ? 18  TYR A HE1  7  
ATOM 10505 H HE2  . TYR A 1 13 ? -1.699  -4.186  -17.312 1.00 0.00 ? 18  TYR A HE2  7  
ATOM 10506 H HH   . TYR A 1 13 ? 0.855   -5.727  -17.747 1.00 0.00 ? 18  TYR A HH   7  
ATOM 10507 N N    . LEU A 1 14 ? -1.856  -7.176  -10.904 1.00 0.00 ? 19  LEU A N    7  
ATOM 10508 C CA   . LEU A 1 14 ? -1.157  -8.425  -10.609 1.00 0.00 ? 19  LEU A CA   7  
ATOM 10509 C C    . LEU A 1 14 ? -2.165  -9.553  -10.414 1.00 0.00 ? 19  LEU A C    7  
ATOM 10510 O O    . LEU A 1 14 ? -1.906  -10.700 -10.783 1.00 0.00 ? 19  LEU A O    7  
ATOM 10511 C CB   . LEU A 1 14 ? -0.293  -8.273  -9.353  1.00 0.00 ? 19  LEU A CB   7  
ATOM 10512 C CG   . LEU A 1 14 ? 0.595   -7.030  -9.323  1.00 0.00 ? 19  LEU A CG   7  
ATOM 10513 C CD1  . LEU A 1 14 ? 1.314   -6.915  -7.995  1.00 0.00 ? 19  LEU A CD1  7  
ATOM 10514 C CD2  . LEU A 1 14 ? 1.595   -7.041  -10.471 1.00 0.00 ? 19  LEU A CD2  7  
ATOM 10515 H H    . LEU A 1 14 ? -1.733  -6.407  -10.306 1.00 0.00 ? 19  LEU A H    7  
ATOM 10516 H HA   . LEU A 1 14 ? -0.523  -8.662  -11.450 1.00 0.00 ? 19  LEU A HA   7  
ATOM 10517 H HB2  . LEU A 1 14 ? -0.948  -8.244  -8.493  1.00 0.00 ? 19  LEU A HB2  7  
ATOM 10518 H HB3  . LEU A 1 14 ? 0.341   -9.142  -9.271  1.00 0.00 ? 19  LEU A HB3  7  
ATOM 10519 H HG   . LEU A 1 14 ? -0.027  -6.161  -9.436  1.00 0.00 ? 19  LEU A HG   7  
ATOM 10520 H HD11 . LEU A 1 14 ? 0.649   -7.217  -7.194  1.00 0.00 ? 19  LEU A HD11 7  
ATOM 10521 H HD12 . LEU A 1 14 ? 1.621   -5.886  -7.841  1.00 0.00 ? 19  LEU A HD12 7  
ATOM 10522 H HD13 . LEU A 1 14 ? 2.185   -7.553  -7.999  1.00 0.00 ? 19  LEU A HD13 7  
ATOM 10523 H HD21 . LEU A 1 14 ? 2.082   -6.076  -10.530 1.00 0.00 ? 19  LEU A HD21 7  
ATOM 10524 H HD22 . LEU A 1 14 ? 1.079   -7.242  -11.397 1.00 0.00 ? 19  LEU A HD22 7  
ATOM 10525 H HD23 . LEU A 1 14 ? 2.336   -7.807  -10.295 1.00 0.00 ? 19  LEU A HD23 7  
ATOM 10526 N N    . GLU A 1 15 ? -3.329  -9.211  -9.846  1.00 0.00 ? 20  GLU A N    7  
ATOM 10527 C CA   . GLU A 1 15 ? -4.394  -10.192 -9.620  1.00 0.00 ? 20  GLU A CA   7  
ATOM 10528 C C    . GLU A 1 15 ? -4.884  -10.782 -10.941 1.00 0.00 ? 20  GLU A C    7  
ATOM 10529 O O    . GLU A 1 15 ? -5.173  -11.977 -11.025 1.00 0.00 ? 20  GLU A O    7  
ATOM 10530 C CB   . GLU A 1 15 ? -5.571  -9.559  -8.868  1.00 0.00 ? 20  GLU A CB   7  
ATOM 10531 C CG   . GLU A 1 15 ? -5.311  -9.323  -7.387  1.00 0.00 ? 20  GLU A CG   7  
ATOM 10532 C CD   . GLU A 1 15 ? -5.230  -10.611 -6.585  1.00 0.00 ? 20  GLU A CD   7  
ATOM 10533 O OE1  . GLU A 1 15 ? -4.292  -11.403 -6.814  1.00 0.00 ? 20  GLU A OE1  7  
ATOM 10534 O OE2  . GLU A 1 15 ? -6.107  -10.826 -5.721  1.00 0.00 ? 20  GLU A OE2  7  
ATOM 10535 H H    . GLU A 1 15 ? -3.477  -8.266  -9.584  1.00 0.00 ? 20  GLU A H    7  
ATOM 10536 H HA   . GLU A 1 15 ? -3.982  -10.989 -9.020  1.00 0.00 ? 20  GLU A HA   7  
ATOM 10537 H HB2  . GLU A 1 15 ? -5.802  -8.608  -9.324  1.00 0.00 ? 20  GLU A HB2  7  
ATOM 10538 H HB3  . GLU A 1 15 ? -6.430  -10.208 -8.960  1.00 0.00 ? 20  GLU A HB3  7  
ATOM 10539 H HG2  . GLU A 1 15 ? -4.376  -8.795  -7.281  1.00 0.00 ? 20  GLU A HG2  7  
ATOM 10540 H HG3  . GLU A 1 15 ? -6.111  -8.716  -6.988  1.00 0.00 ? 20  GLU A HG3  7  
ATOM 10541 N N    . ARG A 1 16 ? -4.969  -9.938  -11.972 1.00 0.00 ? 21  ARG A N    7  
ATOM 10542 C CA   . ARG A 1 16 ? -5.419  -10.372 -13.295 1.00 0.00 ? 21  ARG A CA   7  
ATOM 10543 C C    . ARG A 1 16 ? -4.492  -11.450 -13.861 1.00 0.00 ? 21  ARG A C    7  
ATOM 10544 O O    . ARG A 1 16 ? -3.257  -11.251 -13.826 1.00 0.00 ? 21  ARG A O    7  
ATOM 10545 C CB   . ARG A 1 16 ? -5.481  -9.183  -14.257 1.00 0.00 ? 21  ARG A CB   7  
ATOM 10546 C CG   . ARG A 1 16 ? -6.457  -8.098  -13.828 1.00 0.00 ? 21  ARG A CG   7  
ATOM 10547 C CD   . ARG A 1 16 ? -6.478  -6.940  -14.817 1.00 0.00 ? 21  ARG A CD   7  
ATOM 10548 N NE   . ARG A 1 16 ? -6.835  -7.371  -16.172 1.00 0.00 ? 21  ARG A NE   7  
ATOM 10549 C CZ   . ARG A 1 16 ? -8.033  -7.856  -16.519 1.00 0.00 ? 21  ARG A CZ   7  
ATOM 10550 N NH1  . ARG A 1 16 ? -9.023  -7.924  -15.630 1.00 0.00 ? 21  ARG A NH1  7  
ATOM 10551 N NH2  . ARG A 1 16 ? -8.246  -8.257  -17.766 1.00 0.00 ? 21  ARG A NH2  7  
ATOM 10552 O OXT  . ARG A 1 16 ? -5.010  -12.484 -14.332 1.00 0.00 ? 21  ARG A OXT  7  
ATOM 10553 H H    . ARG A 1 16 ? -4.721  -8.997  -11.841 1.00 0.00 ? 21  ARG A H    7  
ATOM 10554 H HA   . ARG A 1 16 ? -6.408  -10.788 -13.186 1.00 0.00 ? 21  ARG A HA   7  
ATOM 10555 H HB2  . ARG A 1 16 ? -4.498  -8.744  -14.333 1.00 0.00 ? 21  ARG A HB2  7  
ATOM 10556 H HB3  . ARG A 1 16 ? -5.781  -9.541  -15.232 1.00 0.00 ? 21  ARG A HB3  7  
ATOM 10557 H HG2  . ARG A 1 16 ? -7.447  -8.523  -13.765 1.00 0.00 ? 21  ARG A HG2  7  
ATOM 10558 H HG3  . ARG A 1 16 ? -6.161  -7.725  -12.859 1.00 0.00 ? 21  ARG A HG3  7  
ATOM 10559 H HD2  . ARG A 1 16 ? -7.200  -6.210  -14.481 1.00 0.00 ? 21  ARG A HD2  7  
ATOM 10560 H HD3  . ARG A 1 16 ? -5.497  -6.488  -14.842 1.00 0.00 ? 21  ARG A HD3  7  
ATOM 10561 H HE   . ARG A 1 16 ? -6.140  -7.311  -16.860 1.00 0.00 ? 21  ARG A HE   7  
ATOM 10562 H HH11 . ARG A 1 16 ? -8.880  -7.611  -14.692 1.00 0.00 ? 21  ARG A HH11 7  
ATOM 10563 H HH12 . ARG A 1 16 ? -9.912  -8.289  -15.902 1.00 0.00 ? 21  ARG A HH12 7  
ATOM 10564 H HH21 . ARG A 1 16 ? -7.512  -8.199  -18.443 1.00 0.00 ? 21  ARG A HH21 7  
ATOM 10565 H HH22 . ARG A 1 16 ? -9.141  -8.621  -18.030 1.00 0.00 ? 21  ARG A HH22 7  
ATOM 10566 N N    . SER B 2 1  ? 14.170  8.738   -12.831 1.00 0.00 ? 295 SER B N    7  
ATOM 10567 C CA   . SER B 2 1  ? 14.623  9.831   -11.923 1.00 0.00 ? 295 SER B CA   7  
ATOM 10568 C C    . SER B 2 1  ? 13.544  10.905  -11.757 1.00 0.00 ? 295 SER B C    7  
ATOM 10569 O O    . SER B 2 1  ? 12.971  11.052  -10.677 1.00 0.00 ? 295 SER B O    7  
ATOM 10570 C CB   . SER B 2 1  ? 15.913  10.441  -12.490 1.00 0.00 ? 295 SER B CB   7  
ATOM 10571 O OG   . SER B 2 1  ? 15.735  10.886  -13.826 1.00 0.00 ? 295 SER B OG   7  
ATOM 10572 H H1   . SER B 2 1  ? 13.578  8.089   -12.273 1.00 0.00 ? 295 SER B H1   7  
ATOM 10573 H H2   . SER B 2 1  ? 15.015  8.252   -13.195 1.00 0.00 ? 295 SER B H2   7  
ATOM 10574 H H3   . SER B 2 1  ? 13.623  9.168   -13.603 1.00 0.00 ? 295 SER B H3   7  
ATOM 10575 H HA   . SER B 2 1  ? 14.834  9.401   -10.957 1.00 0.00 ? 295 SER B HA   7  
ATOM 10576 H HB2  . SER B 2 1  ? 16.208  11.282  -11.882 1.00 0.00 ? 295 SER B HB2  7  
ATOM 10577 H HB3  . SER B 2 1  ? 16.697  9.696   -12.475 1.00 0.00 ? 295 SER B HB3  7  
ATOM 10578 H HG   . SER B 2 1  ? 15.873  10.154  -14.430 1.00 0.00 ? 295 SER B HG   7  
ATOM 10579 N N    . LEU B 2 2  ? 13.269  11.646  -12.834 1.00 0.00 ? 296 LEU B N    7  
ATOM 10580 C CA   . LEU B 2 2  ? 12.256  12.700  -12.810 1.00 0.00 ? 296 LEU B CA   7  
ATOM 10581 C C    . LEU B 2 2  ? 11.667  12.909  -14.205 1.00 0.00 ? 296 LEU B C    7  
ATOM 10582 O O    . LEU B 2 2  ? 12.402  12.961  -15.194 1.00 0.00 ? 296 LEU B O    7  
ATOM 10583 C CB   . LEU B 2 2  ? 12.842  14.016  -12.276 1.00 0.00 ? 296 LEU B CB   7  
ATOM 10584 C CG   . LEU B 2 2  ? 13.932  14.667  -13.140 1.00 0.00 ? 296 LEU B CG   7  
ATOM 10585 C CD1  . LEU B 2 2  ? 14.277  16.050  -12.604 1.00 0.00 ? 296 LEU B CD1  7  
ATOM 10586 C CD2  . LEU B 2 2  ? 15.179  13.794  -13.190 1.00 0.00 ? 296 LEU B CD2  7  
ATOM 10587 H H    . LEU B 2 2  ? 13.758  11.476  -13.667 1.00 0.00 ? 296 LEU B H    7  
ATOM 10588 H HA   . LEU B 2 2  ? 11.464  12.377  -12.149 1.00 0.00 ? 296 LEU B HA   7  
ATOM 10589 H HB2  . LEU B 2 2  ? 12.033  14.723  -12.166 1.00 0.00 ? 296 LEU B HB2  7  
ATOM 10590 H HB3  . LEU B 2 2  ? 13.260  13.824  -11.298 1.00 0.00 ? 296 LEU B HB3  7  
ATOM 10591 H HG   . LEU B 2 2  ? 13.562  14.784  -14.148 1.00 0.00 ? 296 LEU B HG   7  
ATOM 10592 H HD11 . LEU B 2 2  ? 14.375  16.740  -13.428 1.00 0.00 ? 296 LEU B HD11 7  
ATOM 10593 H HD12 . LEU B 2 2  ? 15.210  16.005  -12.061 1.00 0.00 ? 296 LEU B HD12 7  
ATOM 10594 H HD13 . LEU B 2 2  ? 13.492  16.388  -11.943 1.00 0.00 ? 296 LEU B HD13 7  
ATOM 10595 H HD21 . LEU B 2 2  ? 15.168  13.102  -12.363 1.00 0.00 ? 296 LEU B HD21 7  
ATOM 10596 H HD22 . LEU B 2 2  ? 16.058  14.418  -13.125 1.00 0.00 ? 296 LEU B HD22 7  
ATOM 10597 H HD23 . LEU B 2 2  ? 15.195  13.246  -14.120 1.00 0.00 ? 296 LEU B HD23 7  
ATOM 10598 N N    . GLN B 2 3  ? 10.337  13.021  -14.275 1.00 0.00 ? 297 GLN B N    7  
ATOM 10599 C CA   . GLN B 2 3  ? 9.634   13.212  -15.544 1.00 0.00 ? 297 GLN B CA   7  
ATOM 10600 C C    . GLN B 2 3  ? 10.014  12.125  -16.558 1.00 0.00 ? 297 GLN B C    7  
ATOM 10601 O O    . GLN B 2 3  ? 10.674  11.143  -16.208 1.00 0.00 ? 297 GLN B O    7  
ATOM 10602 C CB   . GLN B 2 3  ? 9.930   14.605  -16.119 1.00 0.00 ? 297 GLN B CB   7  
ATOM 10603 C CG   . GLN B 2 3  ? 9.408   15.754  -15.267 1.00 0.00 ? 297 GLN B CG   7  
ATOM 10604 C CD   . GLN B 2 3  ? 10.150  15.903  -13.951 1.00 0.00 ? 297 GLN B CD   7  
ATOM 10605 O OE1  . GLN B 2 3  ? 11.350  16.175  -13.931 1.00 0.00 ? 297 GLN B OE1  7  
ATOM 10606 N NE2  . GLN B 2 3  ? 9.440   15.722  -12.842 1.00 0.00 ? 297 GLN B NE2  7  
ATOM 10607 H H    . GLN B 2 3  ? 9.811   12.966  -13.453 1.00 0.00 ? 297 GLN B H    7  
ATOM 10608 H HA   . GLN B 2 3  ? 8.575   13.137  -15.344 1.00 0.00 ? 297 GLN B HA   7  
ATOM 10609 H HB2  . GLN B 2 3  ? 10.998  14.718  -16.221 1.00 0.00 ? 297 GLN B HB2  7  
ATOM 10610 H HB3  . GLN B 2 3  ? 9.477   14.677  -17.093 1.00 0.00 ? 297 GLN B HB3  7  
ATOM 10611 H HG2  . GLN B 2 3  ? 9.514   16.672  -15.825 1.00 0.00 ? 297 GLN B HG2  7  
ATOM 10612 H HG3  . GLN B 2 3  ? 8.362   15.582  -15.056 1.00 0.00 ? 297 GLN B HG3  7  
ATOM 10613 H HE21 . GLN B 2 3  ? 8.486   15.506  -12.930 1.00 0.00 ? 297 GLN B HE21 7  
ATOM 10614 H HE22 . GLN B 2 3  ? 9.896   15.812  -11.980 1.00 0.00 ? 297 GLN B HE22 7  
ATOM 10615 N N    . ASN B 2 4  ? 9.588   12.302  -17.814 1.00 0.00 ? 298 ASN B N    7  
ATOM 10616 C CA   . ASN B 2 4  ? 9.879   11.336  -18.878 1.00 0.00 ? 298 ASN B CA   7  
ATOM 10617 C C    . ASN B 2 4  ? 9.228   9.978   -18.595 1.00 0.00 ? 298 ASN B C    7  
ATOM 10618 O O    . ASN B 2 4  ? 8.556   9.798   -17.577 1.00 0.00 ? 298 ASN B O    7  
ATOM 10619 C CB   . ASN B 2 4  ? 11.396  11.163  -19.048 1.00 0.00 ? 298 ASN B CB   7  
ATOM 10620 C CG   . ASN B 2 4  ? 12.099  12.456  -19.431 1.00 0.00 ? 298 ASN B CG   7  
ATOM 10621 O OD1  . ASN B 2 4  ? 12.062  13.439  -18.692 1.00 0.00 ? 298 ASN B OD1  7  
ATOM 10622 N ND2  . ASN B 2 4  ? 12.746  12.457  -20.593 1.00 0.00 ? 298 ASN B ND2  7  
ATOM 10623 H H    . ASN B 2 4  ? 9.061   13.098  -18.031 1.00 0.00 ? 298 ASN B H    7  
ATOM 10624 H HA   . ASN B 2 4  ? 9.470   11.730  -19.797 1.00 0.00 ? 298 ASN B HA   7  
ATOM 10625 H HB2  . ASN B 2 4  ? 11.819  10.810  -18.121 1.00 0.00 ? 298 ASN B HB2  7  
ATOM 10626 H HB3  . ASN B 2 4  ? 11.582  10.431  -19.821 1.00 0.00 ? 298 ASN B HB3  7  
ATOM 10627 H HD21 . ASN B 2 4  ? 12.736  11.639  -21.133 1.00 0.00 ? 298 ASN B HD21 7  
ATOM 10628 H HD22 . ASN B 2 4  ? 13.207  13.280  -20.863 1.00 0.00 ? 298 ASN B HD22 7  
ATOM 10629 N N    . ASN B 2 5  ? 9.433   9.028   -19.508 1.00 0.00 ? 299 ASN B N    7  
ATOM 10630 C CA   . ASN B 2 5  ? 8.870   7.684   -19.366 1.00 0.00 ? 299 ASN B CA   7  
ATOM 10631 C C    . ASN B 2 5  ? 9.674   6.840   -18.363 1.00 0.00 ? 299 ASN B C    7  
ATOM 10632 O O    . ASN B 2 5  ? 10.491  7.376   -17.610 1.00 0.00 ? 299 ASN B O    7  
ATOM 10633 C CB   . ASN B 2 5  ? 8.798   6.983   -20.738 1.00 0.00 ? 299 ASN B CB   7  
ATOM 10634 C CG   . ASN B 2 5  ? 10.150  6.745   -21.425 1.00 0.00 ? 299 ASN B CG   7  
ATOM 10635 O OD1  . ASN B 2 5  ? 10.188  6.177   -22.516 1.00 0.00 ? 299 ASN B OD1  7  
ATOM 10636 N ND2  . ASN B 2 5  ? 11.262  7.166   -20.818 1.00 0.00 ? 299 ASN B ND2  7  
ATOM 10637 H H    . ASN B 2 5  ? 9.974   9.238   -20.299 1.00 0.00 ? 299 ASN B H    7  
ATOM 10638 H HA   . ASN B 2 5  ? 7.866   7.795   -18.984 1.00 0.00 ? 299 ASN B HA   7  
ATOM 10639 H HB2  . ASN B 2 5  ? 8.321   6.025   -20.611 1.00 0.00 ? 299 ASN B HB2  7  
ATOM 10640 H HB3  . ASN B 2 5  ? 8.190   7.587   -21.397 1.00 0.00 ? 299 ASN B HB3  7  
ATOM 10641 H HD21 . ASN B 2 5  ? 11.188  7.613   -19.955 1.00 0.00 ? 299 ASN B HD21 7  
ATOM 10642 H HD22 . ASN B 2 5  ? 12.118  7.006   -21.268 1.00 0.00 ? 299 ASN B HD22 7  
ATOM 10643 N N    . GLN B 2 6  ? 9.431   5.524   -18.361 1.00 0.00 ? 300 GLN B N    7  
ATOM 10644 C CA   . GLN B 2 6  ? 10.124  4.596   -17.462 1.00 0.00 ? 300 GLN B CA   7  
ATOM 10645 C C    . GLN B 2 6  ? 9.671   4.784   -16.012 1.00 0.00 ? 300 GLN B C    7  
ATOM 10646 O O    . GLN B 2 6  ? 10.335  5.465   -15.226 1.00 0.00 ? 300 GLN B O    7  
ATOM 10647 C CB   . GLN B 2 6  ? 11.646  4.768   -17.566 1.00 0.00 ? 300 GLN B CB   7  
ATOM 10648 C CG   . GLN B 2 6  ? 12.196  4.523   -18.961 1.00 0.00 ? 300 GLN B CG   7  
ATOM 10649 C CD   . GLN B 2 6  ? 13.684  4.804   -19.061 1.00 0.00 ? 300 GLN B CD   7  
ATOM 10650 O OE1  . GLN B 2 6  ? 14.131  5.928   -18.827 1.00 0.00 ? 300 GLN B OE1  7  
ATOM 10651 N NE2  . GLN B 2 6  ? 14.462  3.784   -19.408 1.00 0.00 ? 300 GLN B NE2  7  
ATOM 10652 H H    . GLN B 2 6  ? 8.767   5.164   -18.985 1.00 0.00 ? 300 GLN B H    7  
ATOM 10653 H HA   . GLN B 2 6  ? 9.867   3.593   -17.771 1.00 0.00 ? 300 GLN B HA   7  
ATOM 10654 H HB2  . GLN B 2 6  ? 11.906  5.772   -17.271 1.00 0.00 ? 300 GLN B HB2  7  
ATOM 10655 H HB3  . GLN B 2 6  ? 12.119  4.072   -16.890 1.00 0.00 ? 300 GLN B HB3  7  
ATOM 10656 H HG2  . GLN B 2 6  ? 12.021  3.490   -19.228 1.00 0.00 ? 300 GLN B HG2  7  
ATOM 10657 H HG3  . GLN B 2 6  ? 11.676  5.164   -19.657 1.00 0.00 ? 300 GLN B HG3  7  
ATOM 10658 H HE21 . GLN B 2 6  ? 14.040  2.916   -19.579 1.00 0.00 ? 300 GLN B HE21 7  
ATOM 10659 H HE22 . GLN B 2 6  ? 15.427  3.941   -19.478 1.00 0.00 ? 300 GLN B HE22 7  
ATOM 10660 N N    . PRO B 2 7  ? 8.529   4.173   -15.636 1.00 0.00 ? 301 PRO B N    7  
ATOM 10661 C CA   . PRO B 2 7  ? 7.989   4.267   -14.280 1.00 0.00 ? 301 PRO B CA   7  
ATOM 10662 C C    . PRO B 2 7  ? 8.643   3.258   -13.331 1.00 0.00 ? 301 PRO B C    7  
ATOM 10663 O O    . PRO B 2 7  ? 8.032   2.257   -12.950 1.00 0.00 ? 301 PRO B O    7  
ATOM 10664 C CB   . PRO B 2 7  ? 6.509   3.950   -14.490 1.00 0.00 ? 301 PRO B CB   7  
ATOM 10665 C CG   . PRO B 2 7  ? 6.485   3.001   -15.641 1.00 0.00 ? 301 PRO B CG   7  
ATOM 10666 C CD   . PRO B 2 7  ? 7.674   3.342   -16.508 1.00 0.00 ? 301 PRO B CD   7  
ATOM 10667 H HA   . PRO B 2 7  ? 8.096   5.263   -13.877 1.00 0.00 ? 301 PRO B HA   7  
ATOM 10668 H HB2  . PRO B 2 7  ? 6.103   3.501   -13.595 1.00 0.00 ? 301 PRO B HB2  7  
ATOM 10669 H HB3  . PRO B 2 7  ? 5.973   4.859   -14.718 1.00 0.00 ? 301 PRO B HB3  7  
ATOM 10670 H HG2  . PRO B 2 7  ? 6.568   1.987   -15.279 1.00 0.00 ? 301 PRO B HG2  7  
ATOM 10671 H HG3  . PRO B 2 7  ? 5.569   3.126   -16.198 1.00 0.00 ? 301 PRO B HG3  7  
ATOM 10672 H HD2  . PRO B 2 7  ? 8.192   2.442   -16.805 1.00 0.00 ? 301 PRO B HD2  7  
ATOM 10673 H HD3  . PRO B 2 7  ? 7.356   3.898   -17.378 1.00 0.00 ? 301 PRO B HD3  7  
ATOM 10674 N N    . VAL B 2 8  ? 9.896   3.532   -12.959 1.00 0.00 ? 302 VAL B N    7  
ATOM 10675 C CA   . VAL B 2 8  ? 10.646  2.653   -12.060 1.00 0.00 ? 302 VAL B CA   7  
ATOM 10676 C C    . VAL B 2 8  ? 9.995   2.587   -10.678 1.00 0.00 ? 302 VAL B C    7  
ATOM 10677 O O    . VAL B 2 8  ? 9.880   1.512   -10.094 1.00 0.00 ? 302 VAL B O    7  
ATOM 10678 C CB   . VAL B 2 8  ? 12.114  3.112   -11.911 1.00 0.00 ? 302 VAL B CB   7  
ATOM 10679 C CG1  . VAL B 2 8  ? 12.890  2.153   -11.016 1.00 0.00 ? 302 VAL B CG1  7  
ATOM 10680 C CG2  . VAL B 2 8  ? 12.781  3.236   -13.273 1.00 0.00 ? 302 VAL B CG2  7  
ATOM 10681 H H    . VAL B 2 8  ? 10.327  4.344   -13.301 1.00 0.00 ? 302 VAL B H    7  
ATOM 10682 H HA   . VAL B 2 8  ? 10.645  1.662   -12.491 1.00 0.00 ? 302 VAL B HA   7  
ATOM 10683 H HB   . VAL B 2 8  ? 12.119  4.085   -11.442 1.00 0.00 ? 302 VAL B HB   7  
ATOM 10684 H HG11 . VAL B 2 8  ? 12.461  2.158   -10.025 1.00 0.00 ? 302 VAL B HG11 7  
ATOM 10685 H HG12 . VAL B 2 8  ? 13.922  2.467   -10.962 1.00 0.00 ? 302 VAL B HG12 7  
ATOM 10686 H HG13 . VAL B 2 8  ? 12.839  1.155   -11.426 1.00 0.00 ? 302 VAL B HG13 7  
ATOM 10687 H HG21 . VAL B 2 8  ? 13.813  2.924   -13.200 1.00 0.00 ? 302 VAL B HG21 7  
ATOM 10688 H HG22 . VAL B 2 8  ? 12.738  4.262   -13.603 1.00 0.00 ? 302 VAL B HG22 7  
ATOM 10689 H HG23 . VAL B 2 8  ? 12.267  2.607   -13.986 1.00 0.00 ? 302 VAL B HG23 7  
ATOM 10690 N N    . GLU B 2 9  ? 9.566   3.745   -10.168 1.00 0.00 ? 303 GLU B N    7  
ATOM 10691 C CA   . GLU B 2 9  ? 8.918   3.818   -8.857  1.00 0.00 ? 303 GLU B CA   7  
ATOM 10692 C C    . GLU B 2 9  ? 7.621   3.009   -8.843  1.00 0.00 ? 303 GLU B C    7  
ATOM 10693 O O    . GLU B 2 9  ? 7.319   2.324   -7.865  1.00 0.00 ? 303 GLU B O    7  
ATOM 10694 C CB   . GLU B 2 9  ? 8.639   5.277   -8.486  1.00 0.00 ? 303 GLU B CB   7  
ATOM 10695 C CG   . GLU B 2 9  ? 9.904   6.100   -8.293  1.00 0.00 ? 303 GLU B CG   7  
ATOM 10696 C CD   . GLU B 2 9  ? 9.621   7.573   -8.055  1.00 0.00 ? 303 GLU B CD   7  
ATOM 10697 O OE1  . GLU B 2 9  ? 9.108   8.236   -8.980  1.00 0.00 ? 303 GLU B OE1  7  
ATOM 10698 O OE2  . GLU B 2 9  ? 9.911   8.062   -6.942  1.00 0.00 ? 303 GLU B OE2  7  
ATOM 10699 H H    . GLU B 2 9  ? 9.682   4.568   -10.688 1.00 0.00 ? 303 GLU B H    7  
ATOM 10700 H HA   . GLU B 2 9  ? 9.597   3.397   -8.132  1.00 0.00 ? 303 GLU B HA   7  
ATOM 10701 H HB2  . GLU B 2 9  ? 8.053   5.733   -9.272  1.00 0.00 ? 303 GLU B HB2  7  
ATOM 10702 H HB3  . GLU B 2 9  ? 8.075   5.301   -7.566  1.00 0.00 ? 303 GLU B HB3  7  
ATOM 10703 H HG2  . GLU B 2 9  ? 10.440  5.712   -7.440  1.00 0.00 ? 303 GLU B HG2  7  
ATOM 10704 H HG3  . GLU B 2 9  ? 10.517  6.006   -9.176  1.00 0.00 ? 303 GLU B HG3  7  
ATOM 10705 N N    . PHE B 2 10 ? 6.867   3.080   -9.944  1.00 0.00 ? 304 PHE B N    7  
ATOM 10706 C CA   . PHE B 2 10 ? 5.614   2.343   -10.073 1.00 0.00 ? 304 PHE B CA   7  
ATOM 10707 C C    . PHE B 2 10 ? 5.889   0.837   -10.057 1.00 0.00 ? 304 PHE B C    7  
ATOM 10708 O O    . PHE B 2 10 ? 5.395   0.117   -9.189  1.00 0.00 ? 304 PHE B O    7  
ATOM 10709 C CB   . PHE B 2 10 ? 4.901   2.746   -11.376 1.00 0.00 ? 304 PHE B CB   7  
ATOM 10710 C CG   . PHE B 2 10 ? 3.515   2.171   -11.557 1.00 0.00 ? 304 PHE B CG   7  
ATOM 10711 C CD1  . PHE B 2 10 ? 2.893   1.448   -10.549 1.00 0.00 ? 304 PHE B CD1  7  
ATOM 10712 C CD2  . PHE B 2 10 ? 2.833   2.368   -12.749 1.00 0.00 ? 304 PHE B CD2  7  
ATOM 10713 C CE1  . PHE B 2 10 ? 1.623   0.931   -10.730 1.00 0.00 ? 304 PHE B CE1  7  
ATOM 10714 C CE2  . PHE B 2 10 ? 1.563   1.852   -12.932 1.00 0.00 ? 304 PHE B CE2  7  
ATOM 10715 C CZ   . PHE B 2 10 ? 0.957   1.133   -11.923 1.00 0.00 ? 304 PHE B CZ   7  
ATOM 10716 H H    . PHE B 2 10 ? 7.171   3.635   -10.694 1.00 0.00 ? 304 PHE B H    7  
ATOM 10717 H HA   . PHE B 2 10 ? 4.987   2.596   -9.231  1.00 0.00 ? 304 PHE B HA   7  
ATOM 10718 H HB2  . PHE B 2 10 ? 4.812   3.821   -11.404 1.00 0.00 ? 304 PHE B HB2  7  
ATOM 10719 H HB3  . PHE B 2 10 ? 5.502   2.424   -12.213 1.00 0.00 ? 304 PHE B HB3  7  
ATOM 10720 H HD1  . PHE B 2 10 ? 3.409   1.289   -9.614  1.00 0.00 ? 304 PHE B HD1  7  
ATOM 10721 H HD2  . PHE B 2 10 ? 3.305   2.929   -13.542 1.00 0.00 ? 304 PHE B HD2  7  
ATOM 10722 H HE1  . PHE B 2 10 ? 1.151   0.369   -9.939  1.00 0.00 ? 304 PHE B HE1  7  
ATOM 10723 H HE2  . PHE B 2 10 ? 1.045   2.013   -13.866 1.00 0.00 ? 304 PHE B HE2  7  
ATOM 10724 H HZ   . PHE B 2 10 ? -0.034  0.729   -12.064 1.00 0.00 ? 304 PHE B HZ   7  
ATOM 10725 N N    . ASN B 2 11 ? 6.694   0.378   -11.017 1.00 0.00 ? 305 ASN B N    7  
ATOM 10726 C CA   . ASN B 2 11 ? 7.056   -1.037  -11.126 1.00 0.00 ? 305 ASN B CA   7  
ATOM 10727 C C    . ASN B 2 11 ? 7.713   -1.560  -9.842  1.00 0.00 ? 305 ASN B C    7  
ATOM 10728 O O    . ASN B 2 11 ? 7.584   -2.742  -9.515  1.00 0.00 ? 305 ASN B O    7  
ATOM 10729 C CB   . ASN B 2 11 ? 7.994   -1.248  -12.320 1.00 0.00 ? 305 ASN B CB   7  
ATOM 10730 C CG   . ASN B 2 11 ? 8.374   -2.704  -12.517 1.00 0.00 ? 305 ASN B CG   7  
ATOM 10731 O OD1  . ASN B 2 11 ? 7.513   -3.564  -12.706 1.00 0.00 ? 305 ASN B OD1  7  
ATOM 10732 N ND2  . ASN B 2 11 ? 9.672   -2.991  -12.479 1.00 0.00 ? 305 ASN B ND2  7  
ATOM 10733 H H    . ASN B 2 11 ? 7.060   1.010   -11.671 1.00 0.00 ? 305 ASN B H    7  
ATOM 10734 H HA   . ASN B 2 11 ? 6.147   -1.594  -11.298 1.00 0.00 ? 305 ASN B HA   7  
ATOM 10735 H HB2  . ASN B 2 11 ? 7.504   -0.900  -13.217 1.00 0.00 ? 305 ASN B HB2  7  
ATOM 10736 H HB3  . ASN B 2 11 ? 8.897   -0.677  -12.164 1.00 0.00 ? 305 ASN B HB3  7  
ATOM 10737 H HD21 . ASN B 2 11 ? 10.305  -2.257  -12.327 1.00 0.00 ? 305 ASN B HD21 7  
ATOM 10738 H HD22 . ASN B 2 11 ? 9.945   -3.922  -12.608 1.00 0.00 ? 305 ASN B HD22 7  
ATOM 10739 N N    . HIS B 2 12 ? 8.418   -0.683  -9.121  1.00 0.00 ? 306 HIS B N    7  
ATOM 10740 C CA   . HIS B 2 12 ? 9.091   -1.066  -7.878  1.00 0.00 ? 306 HIS B CA   7  
ATOM 10741 C C    . HIS B 2 12 ? 8.094   -1.661  -6.882  1.00 0.00 ? 306 HIS B C    7  
ATOM 10742 O O    . HIS B 2 12 ? 8.299   -2.764  -6.372  1.00 0.00 ? 306 HIS B O    7  
ATOM 10743 C CB   . HIS B 2 12 ? 9.802   0.140   -7.261  1.00 0.00 ? 306 HIS B CB   7  
ATOM 10744 C CG   . HIS B 2 12 ? 10.759  -0.226  -6.173  1.00 0.00 ? 306 HIS B CG   7  
ATOM 10745 N ND1  . HIS B 2 12 ? 11.871  -1.015  -6.380  1.00 0.00 ? 306 HIS B ND1  7  
ATOM 10746 C CD2  . HIS B 2 12 ? 10.769  0.096   -4.862  1.00 0.00 ? 306 HIS B CD2  7  
ATOM 10747 C CE1  . HIS B 2 12 ? 12.524  -1.161  -5.240  1.00 0.00 ? 306 HIS B CE1  7  
ATOM 10748 N NE2  . HIS B 2 12 ? 11.875  -0.496  -4.304  1.00 0.00 ? 306 HIS B NE2  7  
ATOM 10749 H H    . HIS B 2 12 ? 8.489   0.244   -9.432  1.00 0.00 ? 306 HIS B H    7  
ATOM 10750 H HA   . HIS B 2 12 ? 9.825   -1.819  -8.118  1.00 0.00 ? 306 HIS B HA   7  
ATOM 10751 H HB2  . HIS B 2 12 ? 10.357  0.653   -8.031  1.00 0.00 ? 306 HIS B HB2  7  
ATOM 10752 H HB3  . HIS B 2 12 ? 9.065   0.812   -6.847  1.00 0.00 ? 306 HIS B HB3  7  
ATOM 10753 H HD1  . HIS B 2 12 ? 12.142  -1.411  -7.235  1.00 0.00 ? 306 HIS B HD1  7  
ATOM 10754 H HD2  . HIS B 2 12 ? 10.037  0.699   -4.349  1.00 0.00 ? 306 HIS B HD2  7  
ATOM 10755 H HE1  . HIS B 2 12 ? 13.432  -1.728  -5.099  1.00 0.00 ? 306 HIS B HE1  7  
ATOM 10756 H HE2  . HIS B 2 12 ? 12.090  -0.513  -3.347  1.00 0.00 ? 306 HIS B HE2  7  
ATOM 10757 N N    . ALA B 2 13 ? 7.000   -0.936  -6.629  1.00 0.00 ? 307 ALA B N    7  
ATOM 10758 C CA   . ALA B 2 13 ? 5.958   -1.408  -5.715  1.00 0.00 ? 307 ALA B CA   7  
ATOM 10759 C C    . ALA B 2 13 ? 5.243   -2.622  -6.300  1.00 0.00 ? 307 ALA B C    7  
ATOM 10760 O O    . ALA B 2 13 ? 4.835   -3.525  -5.575  1.00 0.00 ? 307 ALA B O    7  
ATOM 10761 C CB   . ALA B 2 13 ? 4.954   -0.303  -5.431  1.00 0.00 ? 307 ALA B CB   7  
ATOM 10762 H H    . ALA B 2 13 ? 6.884   -0.073  -7.079  1.00 0.00 ? 307 ALA B H    7  
ATOM 10763 H HA   . ALA B 2 13 ? 6.428   -1.689  -4.784  1.00 0.00 ? 307 ALA B HA   7  
ATOM 10764 H HB1  . ALA B 2 13 ? 3.955   -0.719  -5.441  1.00 0.00 ? 307 ALA B HB1  7  
ATOM 10765 H HB2  . ALA B 2 13 ? 5.033   0.461   -6.190  1.00 0.00 ? 307 ALA B HB2  7  
ATOM 10766 H HB3  . ALA B 2 13 ? 5.155   0.127   -4.461  1.00 0.00 ? 307 ALA B HB3  7  
ATOM 10767 N N    . ILE B 2 14 ? 5.107   -2.628  -7.624  1.00 0.00 ? 308 ILE B N    7  
ATOM 10768 C CA   . ILE B 2 14 ? 4.462   -3.714  -8.347  1.00 0.00 ? 308 ILE B CA   7  
ATOM 10769 C C    . ILE B 2 14 ? 5.103   -5.057  -8.029  1.00 0.00 ? 308 ILE B C    7  
ATOM 10770 O O    . ILE B 2 14 ? 4.449   -5.951  -7.487  1.00 0.00 ? 308 ILE B O    7  
ATOM 10771 C CB   . ILE B 2 14 ? 4.531   -3.428  -9.861  1.00 0.00 ? 308 ILE B CB   7  
ATOM 10772 C CG1  . ILE B 2 14 ? 3.297   -2.651  -10.301 1.00 0.00 ? 308 ILE B CG1  7  
ATOM 10773 C CG2  . ILE B 2 14 ? 4.688   -4.705  -10.655 1.00 0.00 ? 308 ILE B CG2  7  
ATOM 10774 C CD1  . ILE B 2 14 ? 2.884   -1.590  -9.311  1.00 0.00 ? 308 ILE B CD1  7  
ATOM 10775 H H    . ILE B 2 14 ? 5.460   -1.874  -8.141  1.00 0.00 ? 308 ILE B H    7  
ATOM 10776 H HA   . ILE B 2 14 ? 3.423   -3.743  -8.052  1.00 0.00 ? 308 ILE B HA   7  
ATOM 10777 H HB   . ILE B 2 14 ? 5.403   -2.822  -10.043 1.00 0.00 ? 308 ILE B HB   7  
ATOM 10778 H HG12 . ILE B 2 14 ? 3.503   -2.163  -11.240 1.00 0.00 ? 308 ILE B HG12 7  
ATOM 10779 H HG13 . ILE B 2 14 ? 2.470   -3.332  -10.422 1.00 0.00 ? 308 ILE B HG13 7  
ATOM 10780 H HG21 . ILE B 2 14 ? 3.927   -5.404  -10.350 1.00 0.00 ? 308 ILE B HG21 7  
ATOM 10781 H HG22 . ILE B 2 14 ? 5.672   -5.123  -10.462 1.00 0.00 ? 308 ILE B HG22 7  
ATOM 10782 H HG23 . ILE B 2 14 ? 4.582   -4.485  -11.704 1.00 0.00 ? 308 ILE B HG23 7  
ATOM 10783 H HD11 . ILE B 2 14 ? 3.517   -0.728  -9.419  1.00 0.00 ? 308 ILE B HD11 7  
ATOM 10784 H HD12 . ILE B 2 14 ? 2.979   -1.983  -8.305  1.00 0.00 ? 308 ILE B HD12 7  
ATOM 10785 H HD13 . ILE B 2 14 ? 1.859   -1.312  -9.490  1.00 0.00 ? 308 ILE B HD13 7  
ATOM 10786 N N    . ASN B 2 15 ? 6.383   -5.184  -8.357  1.00 0.00 ? 309 ASN B N    7  
ATOM 10787 C CA   . ASN B 2 15 ? 7.120   -6.409  -8.092  1.00 0.00 ? 309 ASN B CA   7  
ATOM 10788 C C    . ASN B 2 15 ? 7.095   -6.734  -6.598  1.00 0.00 ? 309 ASN B C    7  
ATOM 10789 O O    . ASN B 2 15 ? 7.131   -7.901  -6.207  1.00 0.00 ? 309 ASN B O    7  
ATOM 10790 C CB   . ASN B 2 15 ? 8.544   -6.271  -8.617  1.00 0.00 ? 309 ASN B CB   7  
ATOM 10791 C CG   . ASN B 2 15 ? 8.665   -6.676  -10.074 1.00 0.00 ? 309 ASN B CG   7  
ATOM 10792 O OD1  . ASN B 2 15 ? 8.402   -7.824  -10.435 1.00 0.00 ? 309 ASN B OD1  7  
ATOM 10793 N ND2  . ASN B 2 15 ? 9.061   -5.733  -10.922 1.00 0.00 ? 309 ASN B ND2  7  
ATOM 10794 H H    . ASN B 2 15 ? 6.848   -4.429  -8.777  1.00 0.00 ? 309 ASN B H    7  
ATOM 10795 H HA   . ASN B 2 15 ? 6.626   -7.210  -8.626  1.00 0.00 ? 309 ASN B HA   7  
ATOM 10796 H HB2  . ASN B 2 15 ? 8.834   -5.235  -8.536  1.00 0.00 ? 309 ASN B HB2  7  
ATOM 10797 H HB3  . ASN B 2 15 ? 9.208   -6.882  -8.028  1.00 0.00 ? 309 ASN B HB3  7  
ATOM 10798 H HD21 . ASN B 2 15 ? 9.252   -4.839  -10.567 1.00 0.00 ? 309 ASN B HD21 7  
ATOM 10799 H HD22 . ASN B 2 15 ? 9.146   -5.969  -11.869 1.00 0.00 ? 309 ASN B HD22 7  
ATOM 10800 N N    . TYR B 2 16 ? 6.974   -5.689  -5.768  1.00 0.00 ? 310 TYR B N    7  
ATOM 10801 C CA   . TYR B 2 16 ? 6.874   -5.861  -4.323  1.00 0.00 ? 310 TYR B CA   7  
ATOM 10802 C C    . TYR B 2 16 ? 5.569   -6.583  -3.991  1.00 0.00 ? 310 TYR B C    7  
ATOM 10803 O O    . TYR B 2 16 ? 5.562   -7.558  -3.237  1.00 0.00 ? 310 TYR B O    7  
ATOM 10804 C CB   . TYR B 2 16 ? 6.921   -4.500  -3.619  1.00 0.00 ? 310 TYR B CB   7  
ATOM 10805 C CG   . TYR B 2 16 ? 6.548   -4.551  -2.155  1.00 0.00 ? 310 TYR B CG   7  
ATOM 10806 C CD1  . TYR B 2 16 ? 6.961   -5.601  -1.343  1.00 0.00 ? 310 TYR B CD1  7  
ATOM 10807 C CD2  . TYR B 2 16 ? 5.785   -3.542  -1.584  1.00 0.00 ? 310 TYR B CD2  7  
ATOM 10808 C CE1  . TYR B 2 16 ? 6.622   -5.642  -0.008  1.00 0.00 ? 310 TYR B CE1  7  
ATOM 10809 C CE2  . TYR B 2 16 ? 5.441   -3.577  -0.249  1.00 0.00 ? 310 TYR B CE2  7  
ATOM 10810 C CZ   . TYR B 2 16 ? 5.861   -4.629  0.534   1.00 0.00 ? 310 TYR B CZ   7  
ATOM 10811 O OH   . TYR B 2 16 ? 5.519   -4.668  1.866   1.00 0.00 ? 310 TYR B OH   7  
ATOM 10812 H H    . TYR B 2 16 ? 6.911   -4.786  -6.142  1.00 0.00 ? 310 TYR B H    7  
ATOM 10813 H HA   . TYR B 2 16 ? 7.707   -6.467  -3.994  1.00 0.00 ? 310 TYR B HA   7  
ATOM 10814 H HB2  . TYR B 2 16 ? 7.922   -4.102  -3.689  1.00 0.00 ? 310 TYR B HB2  7  
ATOM 10815 H HB3  . TYR B 2 16 ? 6.240   -3.825  -4.110  1.00 0.00 ? 310 TYR B HB3  7  
ATOM 10816 H HD1  . TYR B 2 16 ? 7.559   -6.393  -1.771  1.00 0.00 ? 310 TYR B HD1  7  
ATOM 10817 H HD2  . TYR B 2 16 ? 5.456   -2.719  -2.202  1.00 0.00 ? 310 TYR B HD2  7  
ATOM 10818 H HE1  . TYR B 2 16 ? 6.956   -6.464  0.607   1.00 0.00 ? 310 TYR B HE1  7  
ATOM 10819 H HE2  . TYR B 2 16 ? 4.845   -2.783  0.176   1.00 0.00 ? 310 TYR B HE2  7  
ATOM 10820 H HH   . TYR B 2 16 ? 4.612   -4.368  1.974   1.00 0.00 ? 310 TYR B HH   7  
ATOM 10821 N N    . VAL B 2 17 ? 4.467   -6.111  -4.590  1.00 0.00 ? 311 VAL B N    7  
ATOM 10822 C CA   . VAL B 2 17 ? 3.157   -6.730  -4.389  1.00 0.00 ? 311 VAL B CA   7  
ATOM 10823 C C    . VAL B 2 17 ? 3.210   -8.188  -4.841  1.00 0.00 ? 311 VAL B C    7  
ATOM 10824 O O    . VAL B 2 17 ? 2.605   -9.060  -4.219  1.00 0.00 ? 311 VAL B O    7  
ATOM 10825 C CB   . VAL B 2 17 ? 2.036   -6.018  -5.183  1.00 0.00 ? 311 VAL B CB   7  
ATOM 10826 C CG1  . VAL B 2 17 ? 0.669   -6.539  -4.778  1.00 0.00 ? 311 VAL B CG1  7  
ATOM 10827 C CG2  . VAL B 2 17 ? 2.077   -4.518  -5.012  1.00 0.00 ? 311 VAL B CG2  7  
ATOM 10828 H H    . VAL B 2 17 ? 4.543   -5.345  -5.196  1.00 0.00 ? 311 VAL B H    7  
ATOM 10829 H HA   . VAL B 2 17 ? 2.918   -6.689  -3.336  1.00 0.00 ? 311 VAL B HA   7  
ATOM 10830 H HB   . VAL B 2 17 ? 2.183   -6.238  -6.225  1.00 0.00 ? 311 VAL B HB   7  
ATOM 10831 H HG11 . VAL B 2 17 ? 0.501   -7.501  -5.245  1.00 0.00 ? 311 VAL B HG11 7  
ATOM 10832 H HG12 . VAL B 2 17 ? -0.094  -5.836  -5.099  1.00 0.00 ? 311 VAL B HG12 7  
ATOM 10833 H HG13 . VAL B 2 17 ? 0.627   -6.645  -3.705  1.00 0.00 ? 311 VAL B HG13 7  
ATOM 10834 H HG21 . VAL B 2 17 ? 2.755   -4.087  -5.735  1.00 0.00 ? 311 VAL B HG21 7  
ATOM 10835 H HG22 . VAL B 2 17 ? 2.409   -4.281  -4.017  1.00 0.00 ? 311 VAL B HG22 7  
ATOM 10836 H HG23 . VAL B 2 17 ? 1.083   -4.119  -5.170  1.00 0.00 ? 311 VAL B HG23 7  
ATOM 10837 N N    . ASN B 2 18 ? 3.952   -8.437  -5.930  1.00 0.00 ? 312 ASN B N    7  
ATOM 10838 C CA   . ASN B 2 18 ? 4.112   -9.783  -6.474  1.00 0.00 ? 312 ASN B CA   7  
ATOM 10839 C C    . ASN B 2 18 ? 4.606   -10.734 -5.386  1.00 0.00 ? 312 ASN B C    7  
ATOM 10840 O O    . ASN B 2 18 ? 4.054   -11.815 -5.208  1.00 0.00 ? 312 ASN B O    7  
ATOM 10841 C CB   . ASN B 2 18 ? 5.094   -9.770  -7.652  1.00 0.00 ? 312 ASN B CB   7  
ATOM 10842 C CG   . ASN B 2 18 ? 5.190   -11.113 -8.354  1.00 0.00 ? 312 ASN B CG   7  
ATOM 10843 O OD1  . ASN B 2 18 ? 4.226   -11.575 -8.964  1.00 0.00 ? 312 ASN B OD1  7  
ATOM 10844 N ND2  . ASN B 2 18 ? 6.355   -11.749 -8.270  1.00 0.00 ? 312 ASN B ND2  7  
ATOM 10845 H H    . ASN B 2 18 ? 4.414   -7.692  -6.372  1.00 0.00 ? 312 ASN B H    7  
ATOM 10846 H HA   . ASN B 2 18 ? 3.145   -10.119 -6.819  1.00 0.00 ? 312 ASN B HA   7  
ATOM 10847 H HB2  . ASN B 2 18 ? 4.772   -9.033  -8.372  1.00 0.00 ? 312 ASN B HB2  7  
ATOM 10848 H HB3  . ASN B 2 18 ? 6.076   -9.505  -7.289  1.00 0.00 ? 312 ASN B HB3  7  
ATOM 10849 H HD21 . ASN B 2 18 ? 7.080   -11.323 -7.765  1.00 0.00 ? 312 ASN B HD21 7  
ATOM 10850 H HD22 . ASN B 2 18 ? 6.441   -12.617 -8.716  1.00 0.00 ? 312 ASN B HD22 7  
ATOM 10851 N N    . LYS B 2 19 ? 5.629   -10.303 -4.639  1.00 0.00 ? 313 LYS B N    7  
ATOM 10852 C CA   . LYS B 2 19 ? 6.170   -11.105 -3.540  1.00 0.00 ? 313 LYS B CA   7  
ATOM 10853 C C    . LYS B 2 19 ? 5.054   -11.514 -2.589  1.00 0.00 ? 313 LYS B C    7  
ATOM 10854 O O    . LYS B 2 19 ? 4.892   -12.687 -2.271  1.00 0.00 ? 313 LYS B O    7  
ATOM 10855 C CB   . LYS B 2 19 ? 7.206   -10.305 -2.745  1.00 0.00 ? 313 LYS B CB   7  
ATOM 10856 C CG   . LYS B 2 19 ? 8.579   -10.218 -3.383  1.00 0.00 ? 313 LYS B CG   7  
ATOM 10857 C CD   . LYS B 2 19 ? 9.503   -9.361  -2.533  1.00 0.00 ? 313 LYS B CD   7  
ATOM 10858 C CE   . LYS B 2 19 ? 10.959  -9.536  -2.919  1.00 0.00 ? 313 LYS B CE   7  
ATOM 10859 N NZ   . LYS B 2 19 ? 11.239  -9.064  -4.304  1.00 0.00 ? 313 LYS B NZ   7  
ATOM 10860 H H    . LYS B 2 19 ? 6.011   -9.418  -4.817  1.00 0.00 ? 313 LYS B H    7  
ATOM 10861 H HA   . LYS B 2 19 ? 6.633   -11.990 -3.954  1.00 0.00 ? 313 LYS B HA   7  
ATOM 10862 H HB2  . LYS B 2 19 ? 6.836   -9.297  -2.615  1.00 0.00 ? 313 LYS B HB2  7  
ATOM 10863 H HB3  . LYS B 2 19 ? 7.316   -10.759 -1.772  1.00 0.00 ? 313 LYS B HB3  7  
ATOM 10864 H HG2  . LYS B 2 19 ? 8.993   -11.212 -3.464  1.00 0.00 ? 313 LYS B HG2  7  
ATOM 10865 H HG3  . LYS B 2 19 ? 8.486   -9.776  -4.364  1.00 0.00 ? 313 LYS B HG3  7  
ATOM 10866 H HD2  . LYS B 2 19 ? 9.232   -8.324  -2.660  1.00 0.00 ? 313 LYS B HD2  7  
ATOM 10867 H HD3  . LYS B 2 19 ? 9.382   -9.640  -1.499  1.00 0.00 ? 313 LYS B HD3  7  
ATOM 10868 H HE2  . LYS B 2 19 ? 11.564  -8.973  -2.224  1.00 0.00 ? 313 LYS B HE2  7  
ATOM 10869 H HE3  . LYS B 2 19 ? 11.210  -10.582 -2.844  1.00 0.00 ? 313 LYS B HE3  7  
ATOM 10870 H HZ1  . LYS B 2 19 ? 10.678  -9.610  -4.990  1.00 0.00 ? 313 LYS B HZ1  7  
ATOM 10871 H HZ2  . LYS B 2 19 ? 12.247  -9.184  -4.525  1.00 0.00 ? 313 LYS B HZ2  7  
ATOM 10872 H HZ3  . LYS B 2 19 ? 10.994  -8.056  -4.395  1.00 0.00 ? 313 LYS B HZ3  7  
ATOM 10873 N N    . ILE B 2 20 ? 4.296   -10.518 -2.146  1.00 0.00 ? 314 ILE B N    7  
ATOM 10874 C CA   . ILE B 2 20 ? 3.183   -10.720 -1.230  1.00 0.00 ? 314 ILE B CA   7  
ATOM 10875 C C    . ILE B 2 20 ? 2.124   -11.634 -1.844  1.00 0.00 ? 314 ILE B C    7  
ATOM 10876 O O    . ILE B 2 20 ? 1.773   -12.664 -1.268  1.00 0.00 ? 314 ILE B O    7  
ATOM 10877 C CB   . ILE B 2 20 ? 2.564   -9.356  -0.860  1.00 0.00 ? 314 ILE B CB   7  
ATOM 10878 C CG1  . ILE B 2 20 ? 3.625   -8.491  -0.173  1.00 0.00 ? 314 ILE B CG1  7  
ATOM 10879 C CG2  . ILE B 2 20 ? 1.339   -9.523  0.028   1.00 0.00 ? 314 ILE B CG2  7  
ATOM 10880 C CD1  . ILE B 2 20 ? 3.252   -7.035  -0.070  1.00 0.00 ? 314 ILE B CD1  7  
ATOM 10881 H H    . ILE B 2 20 ? 4.494   -9.606  -2.449  1.00 0.00 ? 314 ILE B H    7  
ATOM 10882 H HA   . ILE B 2 20 ? 3.566   -11.178 -0.329  1.00 0.00 ? 314 ILE B HA   7  
ATOM 10883 H HB   . ILE B 2 20 ? 2.252   -8.869  -1.771  1.00 0.00 ? 314 ILE B HB   7  
ATOM 10884 H HG12 . ILE B 2 20 ? 3.785   -8.860  0.830   1.00 0.00 ? 314 ILE B HG12 7  
ATOM 10885 H HG13 . ILE B 2 20 ? 4.550   -8.560  -0.726  1.00 0.00 ? 314 ILE B HG13 7  
ATOM 10886 H HG21 . ILE B 2 20 ? 0.611   -10.143 -0.474  1.00 0.00 ? 314 ILE B HG21 7  
ATOM 10887 H HG22 . ILE B 2 20 ? 0.908   -8.555  0.234   1.00 0.00 ? 314 ILE B HG22 7  
ATOM 10888 H HG23 . ILE B 2 20 ? 1.629   -9.989  0.954   1.00 0.00 ? 314 ILE B HG23 7  
ATOM 10889 H HD11 . ILE B 2 20 ? 3.735   -6.604  0.791   1.00 0.00 ? 314 ILE B HD11 7  
ATOM 10890 H HD12 . ILE B 2 20 ? 2.181   -6.944  0.032   1.00 0.00 ? 314 ILE B HD12 7  
ATOM 10891 H HD13 . ILE B 2 20 ? 3.577   -6.519  -0.962  1.00 0.00 ? 314 ILE B HD13 7  
ATOM 10892 N N    . LYS B 2 21 ? 1.631   -11.249 -3.018  1.00 0.00 ? 315 LYS B N    7  
ATOM 10893 C CA   . LYS B 2 21 ? 0.625   -12.022 -3.737  1.00 0.00 ? 315 LYS B CA   7  
ATOM 10894 C C    . LYS B 2 21 ? 1.074   -13.472 -3.953  1.00 0.00 ? 315 LYS B C    7  
ATOM 10895 O O    . LYS B 2 21 ? 0.345   -14.411 -3.633  1.00 0.00 ? 315 LYS B O    7  
ATOM 10896 C CB   . LYS B 2 21 ? 0.347   -11.344 -5.077  1.00 0.00 ? 315 LYS B CB   7  
ATOM 10897 C CG   . LYS B 2 21 ? -0.772  -11.983 -5.875  1.00 0.00 ? 315 LYS B CG   7  
ATOM 10898 C CD   . LYS B 2 21 ? -1.005  -11.229 -7.171  1.00 0.00 ? 315 LYS B CD   7  
ATOM 10899 C CE   . LYS B 2 21 ? 0.168   -11.382 -8.134  1.00 0.00 ? 315 LYS B CE   7  
ATOM 10900 N NZ   . LYS B 2 21 ? 0.412   -12.803 -8.518  1.00 0.00 ? 315 LYS B NZ   7  
ATOM 10901 H H    . LYS B 2 21 ? 1.960   -10.420 -3.424  1.00 0.00 ? 315 LYS B H    7  
ATOM 10902 H HA   . LYS B 2 21 ? -0.279  -12.021 -3.148  1.00 0.00 ? 315 LYS B HA   7  
ATOM 10903 H HB2  . LYS B 2 21 ? 0.084   -10.314 -4.895  1.00 0.00 ? 315 LYS B HB2  7  
ATOM 10904 H HB3  . LYS B 2 21 ? 1.244   -11.367 -5.674  1.00 0.00 ? 315 LYS B HB3  7  
ATOM 10905 H HG2  . LYS B 2 21 ? -0.506  -13.004 -6.100  1.00 0.00 ? 315 LYS B HG2  7  
ATOM 10906 H HG3  . LYS B 2 21 ? -1.679  -11.962 -5.288  1.00 0.00 ? 315 LYS B HG3  7  
ATOM 10907 H HD2  . LYS B 2 21 ? -1.900  -11.606 -7.640  1.00 0.00 ? 315 LYS B HD2  7  
ATOM 10908 H HD3  . LYS B 2 21 ? -1.130  -10.181 -6.936  1.00 0.00 ? 315 LYS B HD3  7  
ATOM 10909 H HE2  . LYS B 2 21 ? -0.046  -10.815 -9.027  1.00 0.00 ? 315 LYS B HE2  7  
ATOM 10910 H HE3  . LYS B 2 21 ? 1.056   -10.988 -7.663  1.00 0.00 ? 315 LYS B HE3  7  
ATOM 10911 H HZ1  . LYS B 2 21 ? -0.168  -13.441 -7.938  1.00 0.00 ? 315 LYS B HZ1  7  
ATOM 10912 H HZ2  . LYS B 2 21 ? 1.415   -13.042 -8.379  1.00 0.00 ? 315 LYS B HZ2  7  
ATOM 10913 H HZ3  . LYS B 2 21 ? 0.170   -12.948 -9.519  1.00 0.00 ? 315 LYS B HZ3  7  
ATOM 10914 N N    . ASN B 2 22 ? 2.279   -13.636 -4.504  1.00 0.00 ? 316 ASN B N    7  
ATOM 10915 C CA   . ASN B 2 22 ? 2.848   -14.957 -4.779  1.00 0.00 ? 316 ASN B CA   7  
ATOM 10916 C C    . ASN B 2 22 ? 3.144   -15.725 -3.493  1.00 0.00 ? 316 ASN B C    7  
ATOM 10917 O O    . ASN B 2 22 ? 2.736   -16.877 -3.343  1.00 0.00 ? 316 ASN B O    7  
ATOM 10918 C CB   . ASN B 2 22 ? 4.128   -14.810 -5.608  1.00 0.00 ? 316 ASN B CB   7  
ATOM 10919 C CG   . ASN B 2 22 ? 3.842   -14.428 -7.049  1.00 0.00 ? 316 ASN B CG   7  
ATOM 10920 O OD1  . ASN B 2 22 ? 3.187   -13.422 -7.317  1.00 0.00 ? 316 ASN B OD1  7  
ATOM 10921 N ND2  . ASN B 2 22 ? 4.331   -15.232 -7.988  1.00 0.00 ? 316 ASN B ND2  7  
ATOM 10922 H H    . ASN B 2 22 ? 2.803   -12.839 -4.736  1.00 0.00 ? 316 ASN B H    7  
ATOM 10923 H HA   . ASN B 2 22 ? 2.123   -15.514 -5.354  1.00 0.00 ? 316 ASN B HA   7  
ATOM 10924 H HB2  . ASN B 2 22 ? 4.744   -14.038 -5.170  1.00 0.00 ? 316 ASN B HB2  7  
ATOM 10925 H HB3  . ASN B 2 22 ? 4.672   -15.741 -5.598  1.00 0.00 ? 316 ASN B HB3  7  
ATOM 10926 H HD21 . ASN B 2 22 ? 4.845   -16.017 -7.706  1.00 0.00 ? 316 ASN B HD21 7  
ATOM 10927 H HD22 . ASN B 2 22 ? 4.158   -15.006 -8.927  1.00 0.00 ? 316 ASN B HD22 7  
ATOM 10928 N N    . ARG B 2 23 ? 3.854   -15.085 -2.568  1.00 0.00 ? 317 ARG B N    7  
ATOM 10929 C CA   . ARG B 2 23 ? 4.195   -15.714 -1.297  1.00 0.00 ? 317 ARG B CA   7  
ATOM 10930 C C    . ARG B 2 23 ? 2.938   -16.179 -0.563  1.00 0.00 ? 317 ARG B C    7  
ATOM 10931 O O    . ARG B 2 23 ? 2.883   -17.308 -0.075  1.00 0.00 ? 317 ARG B O    7  
ATOM 10932 C CB   . ARG B 2 23 ? 4.996   -14.749 -0.414  1.00 0.00 ? 317 ARG B CB   7  
ATOM 10933 C CG   . ARG B 2 23 ? 5.407   -15.335 0.929   1.00 0.00 ? 317 ARG B CG   7  
ATOM 10934 C CD   . ARG B 2 23 ? 6.340   -16.526 0.766   1.00 0.00 ? 317 ARG B CD   7  
ATOM 10935 N NE   . ARG B 2 23 ? 6.736   -17.091 2.057   1.00 0.00 ? 317 ARG B NE   7  
ATOM 10936 C CZ   . ARG B 2 23 ? 7.492   -16.453 2.958   1.00 0.00 ? 317 ARG B CZ   7  
ATOM 10937 N NH1  . ARG B 2 23 ? 7.993   -15.247 2.696   1.00 0.00 ? 317 ARG B NH1  7  
ATOM 10938 N NH2  . ARG B 2 23 ? 7.760   -17.034 4.123   1.00 0.00 ? 317 ARG B NH2  7  
ATOM 10939 H H    . ARG B 2 23 ? 4.152   -14.168 -2.744  1.00 0.00 ? 317 ARG B H    7  
ATOM 10940 H HA   . ARG B 2 23 ? 4.808   -16.578 -1.513  1.00 0.00 ? 317 ARG B HA   7  
ATOM 10941 H HB2  . ARG B 2 23 ? 5.891   -14.459 -0.942  1.00 0.00 ? 317 ARG B HB2  7  
ATOM 10942 H HB3  . ARG B 2 23 ? 4.397   -13.869 -0.230  1.00 0.00 ? 317 ARG B HB3  7  
ATOM 10943 H HG2  . ARG B 2 23 ? 5.909   -14.572 1.503   1.00 0.00 ? 317 ARG B HG2  7  
ATOM 10944 H HG3  . ARG B 2 23 ? 4.520   -15.656 1.456   1.00 0.00 ? 317 ARG B HG3  7  
ATOM 10945 H HD2  . ARG B 2 23 ? 5.836   -17.286 0.190   1.00 0.00 ? 317 ARG B HD2  7  
ATOM 10946 H HD3  . ARG B 2 23 ? 7.225   -16.203 0.238   1.00 0.00 ? 317 ARG B HD3  7  
ATOM 10947 H HE   . ARG B 2 23 ? 6.406   -17.988 2.273   1.00 0.00 ? 317 ARG B HE   7  
ATOM 10948 H HH11 . ARG B 2 23 ? 7.808   -14.807 1.819   1.00 0.00 ? 317 ARG B HH11 7  
ATOM 10949 H HH12 . ARG B 2 23 ? 8.555   -14.781 3.379   1.00 0.00 ? 317 ARG B HH12 7  
ATOM 10950 H HH21 . ARG B 2 23 ? 7.397   -17.943 4.325   1.00 0.00 ? 317 ARG B HH21 7  
ATOM 10951 H HH22 . ARG B 2 23 ? 8.326   -16.560 4.800   1.00 0.00 ? 317 ARG B HH22 7  
ATOM 10952 N N    . PHE B 2 24 ? 1.931   -15.302 -0.483  1.00 0.00 ? 318 PHE B N    7  
ATOM 10953 C CA   . PHE B 2 24 ? 0.683   -15.638 0.200   1.00 0.00 ? 318 PHE B CA   7  
ATOM 10954 C C    . PHE B 2 24 ? -0.413  -15.988 -0.814  1.00 0.00 ? 318 PHE B C    7  
ATOM 10955 O O    . PHE B 2 24 ? -1.559  -15.561 -0.662  1.00 0.00 ? 318 PHE B O    7  
ATOM 10956 C CB   . PHE B 2 24 ? 0.187   -14.484 1.096   1.00 0.00 ? 318 PHE B CB   7  
ATOM 10957 C CG   . PHE B 2 24 ? 1.247   -13.573 1.664   1.00 0.00 ? 318 PHE B CG   7  
ATOM 10958 C CD1  . PHE B 2 24 ? 2.578   -13.954 1.777   1.00 0.00 ? 318 PHE B CD1  7  
ATOM 10959 C CD2  . PHE B 2 24 ? 0.887   -12.312 2.088   1.00 0.00 ? 318 PHE B CD2  7  
ATOM 10960 C CE1  . PHE B 2 24 ? 3.520   -13.085 2.298   1.00 0.00 ? 318 PHE B CE1  7  
ATOM 10961 C CE2  . PHE B 2 24 ? 1.821   -11.442 2.604   1.00 0.00 ? 318 PHE B CE2  7  
ATOM 10962 C CZ   . PHE B 2 24 ? 3.138   -11.824 2.709   1.00 0.00 ? 318 PHE B CZ   7  
ATOM 10963 H H    . PHE B 2 24 ? 2.031   -14.413 -0.890  1.00 0.00 ? 318 PHE B H    7  
ATOM 10964 H HA   . PHE B 2 24 ? 0.871   -16.505 0.818   1.00 0.00 ? 318 PHE B HA   7  
ATOM 10965 H HB2  . PHE B 2 24 ? -0.504  -13.870 0.537   1.00 0.00 ? 318 PHE B HB2  7  
ATOM 10966 H HB3  . PHE B 2 24 ? -0.340  -14.917 1.931   1.00 0.00 ? 318 PHE B HB3  7  
ATOM 10967 H HD1  . PHE B 2 24 ? 2.876   -14.940 1.460   1.00 0.00 ? 318 PHE B HD1  7  
ATOM 10968 H HD2  . PHE B 2 24 ? -0.146  -12.005 2.006   1.00 0.00 ? 318 PHE B HD2  7  
ATOM 10969 H HE1  . PHE B 2 24 ? 4.552   -13.391 2.378   1.00 0.00 ? 318 PHE B HE1  7  
ATOM 10970 H HE2  . PHE B 2 24 ? 1.517   -10.463 2.928   1.00 0.00 ? 318 PHE B HE2  7  
ATOM 10971 H HZ   . PHE B 2 24 ? 3.870   -11.135 3.109   1.00 0.00 ? 318 PHE B HZ   7  
ATOM 10972 N N    . GLN B 2 25 ? -0.063  -16.760 -1.851  1.00 0.00 ? 319 GLN B N    7  
ATOM 10973 C CA   . GLN B 2 25 ? -1.036  -17.157 -2.877  1.00 0.00 ? 319 GLN B CA   7  
ATOM 10974 C C    . GLN B 2 25 ? -2.321  -17.719 -2.260  1.00 0.00 ? 319 GLN B C    7  
ATOM 10975 O O    . GLN B 2 25 ? -3.407  -17.538 -2.813  1.00 0.00 ? 319 GLN B O    7  
ATOM 10976 C CB   . GLN B 2 25 ? -0.421  -18.174 -3.844  1.00 0.00 ? 319 GLN B CB   7  
ATOM 10977 C CG   . GLN B 2 25 ? 0.364   -17.533 -4.976  1.00 0.00 ? 319 GLN B CG   7  
ATOM 10978 C CD   . GLN B 2 25 ? 1.130   -18.545 -5.810  1.00 0.00 ? 319 GLN B CD   7  
ATOM 10979 O OE1  . GLN B 2 25 ? 1.982   -19.270 -5.295  1.00 0.00 ? 319 GLN B OE1  7  
ATOM 10980 N NE2  . GLN B 2 25 ? 0.834   -18.597 -7.105  1.00 0.00 ? 319 GLN B NE2  7  
ATOM 10981 H H    . GLN B 2 25 ? 0.863   -17.069 -1.926  1.00 0.00 ? 319 GLN B H    7  
ATOM 10982 H HA   . GLN B 2 25 ? -1.293  -16.268 -3.435  1.00 0.00 ? 319 GLN B HA   7  
ATOM 10983 H HB2  . GLN B 2 25 ? 0.247   -18.819 -3.292  1.00 0.00 ? 319 GLN B HB2  7  
ATOM 10984 H HB3  . GLN B 2 25 ? -1.211  -18.770 -4.274  1.00 0.00 ? 319 GLN B HB3  7  
ATOM 10985 H HG2  . GLN B 2 25 ? -0.325  -17.011 -5.622  1.00 0.00 ? 319 GLN B HG2  7  
ATOM 10986 H HG3  . GLN B 2 25 ? 1.063   -16.828 -4.560  1.00 0.00 ? 319 GLN B HG3  7  
ATOM 10987 H HE21 . GLN B 2 25 ? 0.147   -17.988 -7.450  1.00 0.00 ? 319 GLN B HE21 7  
ATOM 10988 H HE22 . GLN B 2 25 ? 1.316   -19.243 -7.663  1.00 0.00 ? 319 GLN B HE22 7  
ATOM 10989 N N    . GLY B 2 26 ? -2.192  -18.392 -1.111  1.00 0.00 ? 320 GLY B N    7  
ATOM 10990 C CA   . GLY B 2 26 ? -3.353  -18.957 -0.443  1.00 0.00 ? 320 GLY B CA   7  
ATOM 10991 C C    . GLY B 2 26 ? -3.914  -18.059 0.653   1.00 0.00 ? 320 GLY B C    7  
ATOM 10992 O O    . GLY B 2 26 ? -4.854  -18.446 1.348   1.00 0.00 ? 320 GLY B O    7  
ATOM 10993 H H    . GLY B 2 26 ? -1.303  -18.501 -0.712  1.00 0.00 ? 320 GLY B H    7  
ATOM 10994 H HA2  . GLY B 2 26 ? -4.126  -19.131 -1.177  1.00 0.00 ? 320 GLY B HA2  7  
ATOM 10995 H HA3  . GLY B 2 26 ? -3.073  -19.904 -0.005  1.00 0.00 ? 320 GLY B HA3  7  
ATOM 10996 N N    . GLN B 2 27 ? -3.337  -16.861 0.811   1.00 0.00 ? 321 GLN B N    7  
ATOM 10997 C CA   . GLN B 2 27 ? -3.784  -15.910 1.828   1.00 0.00 ? 321 GLN B CA   7  
ATOM 10998 C C    . GLN B 2 27 ? -4.536  -14.735 1.208   1.00 0.00 ? 321 GLN B C    7  
ATOM 10999 O O    . GLN B 2 27 ? -3.981  -13.641 1.077   1.00 0.00 ? 321 GLN B O    7  
ATOM 11000 C CB   . GLN B 2 27 ? -2.600  -15.361 2.623   1.00 0.00 ? 321 GLN B CB   7  
ATOM 11001 C CG   . GLN B 2 27 ? -1.787  -16.408 3.360   1.00 0.00 ? 321 GLN B CG   7  
ATOM 11002 C CD   . GLN B 2 27 ? -2.610  -17.215 4.350   1.00 0.00 ? 321 GLN B CD   7  
ATOM 11003 O OE1  . GLN B 2 27 ? -3.539  -17.927 3.970   1.00 0.00 ? 321 GLN B OE1  7  
ATOM 11004 N NE2  . GLN B 2 27 ? -2.271  -17.108 5.632   1.00 0.00 ? 321 GLN B NE2  7  
ATOM 11005 H H    . GLN B 2 27 ? -2.593  -16.609 0.230   1.00 0.00 ? 321 GLN B H    7  
ATOM 11006 H HA   . GLN B 2 27 ? -4.447  -16.431 2.502   1.00 0.00 ? 321 GLN B HA   7  
ATOM 11007 H HB2  . GLN B 2 27 ? -1.945  -14.849 1.940   1.00 0.00 ? 321 GLN B HB2  7  
ATOM 11008 H HB3  . GLN B 2 27 ? -2.968  -14.649 3.345   1.00 0.00 ? 321 GLN B HB3  7  
ATOM 11009 H HG2  . GLN B 2 27 ? -1.352  -17.084 2.638   1.00 0.00 ? 321 GLN B HG2  7  
ATOM 11010 H HG3  . GLN B 2 27 ? -1.000  -15.901 3.900   1.00 0.00 ? 321 GLN B HG3  7  
ATOM 11011 H HE21 . GLN B 2 27 ? -1.520  -16.524 5.866   1.00 0.00 ? 321 GLN B HE21 7  
ATOM 11012 H HE22 . GLN B 2 27 ? -2.787  -17.619 6.289   1.00 0.00 ? 321 GLN B HE22 7  
ATOM 11013 N N    . PRO B 2 28 ? -5.816  -14.918 0.847   1.00 0.00 ? 322 PRO B N    7  
ATOM 11014 C CA   . PRO B 2 28 ? -6.614  -13.831 0.284   1.00 0.00 ? 322 PRO B CA   7  
ATOM 11015 C C    . PRO B 2 28 ? -6.888  -12.751 1.331   1.00 0.00 ? 322 PRO B C    7  
ATOM 11016 O O    . PRO B 2 28 ? -7.156  -11.599 0.992   1.00 0.00 ? 322 PRO B O    7  
ATOM 11017 C CB   . PRO B 2 28 ? -7.914  -14.522 -0.140  1.00 0.00 ? 322 PRO B CB   7  
ATOM 11018 C CG   . PRO B 2 28 ? -8.005  -15.728 0.730   1.00 0.00 ? 322 PRO B CG   7  
ATOM 11019 C CD   . PRO B 2 28 ? -6.589  -16.164 0.988   1.00 0.00 ? 322 PRO B CD   7  
ATOM 11020 H HA   . PRO B 2 28 ? -6.134  -13.388 -0.578  1.00 0.00 ? 322 PRO B HA   7  
ATOM 11021 H HB2  . PRO B 2 28 ? -8.748  -13.854 0.018   1.00 0.00 ? 322 PRO B HB2  7  
ATOM 11022 H HB3  . PRO B 2 28 ? -7.856  -14.793 -1.184  1.00 0.00 ? 322 PRO B HB3  7  
ATOM 11023 H HG2  . PRO B 2 28 ? -8.496  -15.474 1.658   1.00 0.00 ? 322 PRO B HG2  7  
ATOM 11024 H HG3  . PRO B 2 28 ? -8.549  -16.508 0.219   1.00 0.00 ? 322 PRO B HG3  7  
ATOM 11025 H HD2  . PRO B 2 28 ? -6.495  -16.566 1.988   1.00 0.00 ? 322 PRO B HD2  7  
ATOM 11026 H HD3  . PRO B 2 28 ? -6.280  -16.895 0.256   1.00 0.00 ? 322 PRO B HD3  7  
ATOM 11027 N N    . ASP B 2 29 ? -6.798  -13.136 2.611   1.00 0.00 ? 323 ASP B N    7  
ATOM 11028 C CA   . ASP B 2 29 ? -7.016  -12.214 3.719   1.00 0.00 ? 323 ASP B CA   7  
ATOM 11029 C C    . ASP B 2 29 ? -5.890  -11.192 3.821   1.00 0.00 ? 323 ASP B C    7  
ATOM 11030 O O    . ASP B 2 29 ? -6.135  -10.025 4.111   1.00 0.00 ? 323 ASP B O    7  
ATOM 11031 C CB   . ASP B 2 29 ? -7.141  -12.985 5.037   1.00 0.00 ? 323 ASP B CB   7  
ATOM 11032 C CG   . ASP B 2 29 ? -8.287  -13.980 5.025   1.00 0.00 ? 323 ASP B CG   7  
ATOM 11033 O OD1  . ASP B 2 29 ? -9.451  -13.548 4.888   1.00 0.00 ? 323 ASP B OD1  7  
ATOM 11034 O OD2  . ASP B 2 29 ? -8.020  -15.195 5.146   1.00 0.00 ? 323 ASP B OD2  7  
ATOM 11035 H H    . ASP B 2 29 ? -6.559  -14.064 2.818   1.00 0.00 ? 323 ASP B H    7  
ATOM 11036 H HA   . ASP B 2 29 ? -7.943  -11.690 3.534   1.00 0.00 ? 323 ASP B HA   7  
ATOM 11037 H HB2  . ASP B 2 29 ? -6.223  -13.524 5.220   1.00 0.00 ? 323 ASP B HB2  7  
ATOM 11038 H HB3  . ASP B 2 29 ? -7.307  -12.284 5.843   1.00 0.00 ? 323 ASP B HB3  7  
ATOM 11039 N N    . ILE B 2 30 ? -4.652  -11.641 3.585   1.00 0.00 ? 324 ILE B N    7  
ATOM 11040 C CA   . ILE B 2 30 ? -3.491  -10.762 3.661   1.00 0.00 ? 324 ILE B CA   7  
ATOM 11041 C C    . ILE B 2 30 ? -3.471  -9.768  2.517   1.00 0.00 ? 324 ILE B C    7  
ATOM 11042 O O    . ILE B 2 30 ? -3.308  -8.565  2.721   1.00 0.00 ? 324 ILE B O    7  
ATOM 11043 C CB   . ILE B 2 30 ? -2.182  -11.548 3.602   1.00 0.00 ? 324 ILE B CB   7  
ATOM 11044 C CG1  . ILE B 2 30 ? -2.161  -12.619 4.689   1.00 0.00 ? 324 ILE B CG1  7  
ATOM 11045 C CG2  . ILE B 2 30 ? -1.003  -10.586 3.732   1.00 0.00 ? 324 ILE B CG2  7  
ATOM 11046 C CD1  . ILE B 2 30 ? -0.906  -13.444 4.662   1.00 0.00 ? 324 ILE B CD1  7  
ATOM 11047 H H    . ILE B 2 30 ? -4.516  -12.588 3.356   1.00 0.00 ? 324 ILE B H    7  
ATOM 11048 H HA   . ILE B 2 30 ? -3.523  -10.232 4.600   1.00 0.00 ? 324 ILE B HA   7  
ATOM 11049 H HB   . ILE B 2 30 ? -2.118  -12.028 2.636   1.00 0.00 ? 324 ILE B HB   7  
ATOM 11050 H HG12 . ILE B 2 30 ? -2.236  -12.151 5.658   1.00 0.00 ? 324 ILE B HG12 7  
ATOM 11051 H HG13 . ILE B 2 30 ? -3.003  -13.289 4.543   1.00 0.00 ? 324 ILE B HG13 7  
ATOM 11052 H HG21 . ILE B 2 30 ? -0.759  -10.182 2.752   1.00 0.00 ? 324 ILE B HG21 7  
ATOM 11053 H HG22 . ILE B 2 30 ? -0.148  -11.111 4.128   1.00 0.00 ? 324 ILE B HG22 7  
ATOM 11054 H HG23 . ILE B 2 30 ? -1.269  -9.775  4.398   1.00 0.00 ? 324 ILE B HG23 7  
ATOM 11055 H HD11 . ILE B 2 30 ? -1.055  -14.347 5.232   1.00 0.00 ? 324 ILE B HD11 7  
ATOM 11056 H HD12 . ILE B 2 30 ? -0.096  -12.874 5.089   1.00 0.00 ? 324 ILE B HD12 7  
ATOM 11057 H HD13 . ILE B 2 30 ? -0.674  -13.694 3.638   1.00 0.00 ? 324 ILE B HD13 7  
ATOM 11058 N N    . TYR B 2 31 ? -3.604  -10.299 1.309   1.00 0.00 ? 325 TYR B N    7  
ATOM 11059 C CA   . TYR B 2 31 ? -3.571  -9.483  0.106   1.00 0.00 ? 325 TYR B CA   7  
ATOM 11060 C C    . TYR B 2 31 ? -4.704  -8.457  0.118   1.00 0.00 ? 325 TYR B C    7  
ATOM 11061 O O    . TYR B 2 31 ? -4.462  -7.264  -0.056  1.00 0.00 ? 325 TYR B O    7  
ATOM 11062 C CB   . TYR B 2 31 ? -3.677  -10.384 -1.125  1.00 0.00 ? 325 TYR B CB   7  
ATOM 11063 C CG   . TYR B 2 31 ? -3.048  -9.800  -2.365  1.00 0.00 ? 325 TYR B CG   7  
ATOM 11064 C CD1  . TYR B 2 31 ? -1.715  -9.399  -2.369  1.00 0.00 ? 325 TYR B CD1  7  
ATOM 11065 C CD2  . TYR B 2 31 ? -3.778  -9.663  -3.536  1.00 0.00 ? 325 TYR B CD2  7  
ATOM 11066 C CE1  . TYR B 2 31 ? -1.136  -8.877  -3.514  1.00 0.00 ? 325 TYR B CE1  7  
ATOM 11067 C CE2  . TYR B 2 31 ? -3.207  -9.141  -4.675  1.00 0.00 ? 325 TYR B CE2  7  
ATOM 11068 C CZ   . TYR B 2 31 ? -1.892  -8.752  -4.662  1.00 0.00 ? 325 TYR B CZ   7  
ATOM 11069 O OH   . TYR B 2 31 ? -1.329  -8.244  -5.806  1.00 0.00 ? 325 TYR B OH   7  
ATOM 11070 H H    . TYR B 2 31 ? -3.698  -11.274 1.228   1.00 0.00 ? 325 TYR B H    7  
ATOM 11071 H HA   . TYR B 2 31 ? -2.627  -8.961  0.082   1.00 0.00 ? 325 TYR B HA   7  
ATOM 11072 H HB2  . TYR B 2 31 ? -3.188  -11.324 -0.917  1.00 0.00 ? 325 TYR B HB2  7  
ATOM 11073 H HB3  . TYR B 2 31 ? -4.721  -10.568 -1.337  1.00 0.00 ? 325 TYR B HB3  7  
ATOM 11074 H HD1  . TYR B 2 31 ? -1.132  -9.500  -1.457  1.00 0.00 ? 325 TYR B HD1  7  
ATOM 11075 H HD2  . TYR B 2 31 ? -4.814  -9.970  -3.547  1.00 0.00 ? 325 TYR B HD2  7  
ATOM 11076 H HE1  . TYR B 2 31 ? -0.100  -8.568  -3.512  1.00 0.00 ? 325 TYR B HE1  7  
ATOM 11077 H HE2  . TYR B 2 31 ? -3.793  -9.041  -5.575  1.00 0.00 ? 325 TYR B HE2  7  
ATOM 11078 H HH   . TYR B 2 31 ? -0.550  -8.754  -6.037  1.00 0.00 ? 325 TYR B HH   7  
ATOM 11079 N N    . LYS B 2 32 ? -5.934  -8.920  0.349   1.00 0.00 ? 326 LYS B N    7  
ATOM 11080 C CA   . LYS B 2 32 ? -7.090  -8.026  0.408   1.00 0.00 ? 326 LYS B CA   7  
ATOM 11081 C C    . LYS B 2 32 ? -6.945  -7.020  1.552   1.00 0.00 ? 326 LYS B C    7  
ATOM 11082 O O    . LYS B 2 32 ? -7.185  -5.826  1.369   1.00 0.00 ? 326 LYS B O    7  
ATOM 11083 C CB   . LYS B 2 32 ? -8.387  -8.826  0.573   1.00 0.00 ? 326 LYS B CB   7  
ATOM 11084 C CG   . LYS B 2 32 ? -8.717  -9.713  -0.619  1.00 0.00 ? 326 LYS B CG   7  
ATOM 11085 C CD   . LYS B 2 32 ? -9.000  -8.895  -1.870  1.00 0.00 ? 326 LYS B CD   7  
ATOM 11086 C CE   . LYS B 2 32 ? -9.292  -9.784  -3.071  1.00 0.00 ? 326 LYS B CE   7  
ATOM 11087 N NZ   . LYS B 2 32 ? -10.477 -10.662 -2.849  1.00 0.00 ? 326 LYS B NZ   7  
ATOM 11088 H H    . LYS B 2 32 ? -6.064  -9.881  0.501   1.00 0.00 ? 326 LYS B H    7  
ATOM 11089 H HA   . LYS B 2 32 ? -7.131  -7.482  -0.525  1.00 0.00 ? 326 LYS B HA   7  
ATOM 11090 H HB2  . LYS B 2 32 ? -8.301  -9.453  1.448   1.00 0.00 ? 326 LYS B HB2  7  
ATOM 11091 H HB3  . LYS B 2 32 ? -9.206  -8.135  0.717   1.00 0.00 ? 326 LYS B HB3  7  
ATOM 11092 H HG2  . LYS B 2 32 ? -7.879  -10.365 -0.811  1.00 0.00 ? 326 LYS B HG2  7  
ATOM 11093 H HG3  . LYS B 2 32 ? -9.589  -10.306 -0.383  1.00 0.00 ? 326 LYS B HG3  7  
ATOM 11094 H HD2  . LYS B 2 32 ? -9.856  -8.261  -1.689  1.00 0.00 ? 326 LYS B HD2  7  
ATOM 11095 H HD3  . LYS B 2 32 ? -8.137  -8.281  -2.089  1.00 0.00 ? 326 LYS B HD3  7  
ATOM 11096 H HE2  . LYS B 2 32 ? -9.476  -9.157  -3.929  1.00 0.00 ? 326 LYS B HE2  7  
ATOM 11097 H HE3  . LYS B 2 32 ? -8.427  -10.404 -3.260  1.00 0.00 ? 326 LYS B HE3  7  
ATOM 11098 H HZ1  . LYS B 2 32 ? -10.175 -11.576 -2.455  1.00 0.00 ? 326 LYS B HZ1  7  
ATOM 11099 H HZ2  . LYS B 2 32 ? -10.969 -10.831 -3.749  1.00 0.00 ? 326 LYS B HZ2  7  
ATOM 11100 H HZ3  . LYS B 2 32 ? -11.138 -10.210 -2.186  1.00 0.00 ? 326 LYS B HZ3  7  
ATOM 11101 N N    . ALA B 2 33 ? -6.543  -7.511  2.732   1.00 0.00 ? 327 ALA B N    7  
ATOM 11102 C CA   . ALA B 2 33 ? -6.359  -6.655  3.907   1.00 0.00 ? 327 ALA B CA   7  
ATOM 11103 C C    . ALA B 2 33 ? -5.343  -5.550  3.640   1.00 0.00 ? 327 ALA B C    7  
ATOM 11104 O O    . ALA B 2 33 ? -5.631  -4.377  3.860   1.00 0.00 ? 327 ALA B O    7  
ATOM 11105 C CB   . ALA B 2 33 ? -5.927  -7.480  5.112   1.00 0.00 ? 327 ALA B CB   7  
ATOM 11106 H H    . ALA B 2 33 ? -6.365  -8.473  2.811   1.00 0.00 ? 327 ALA B H    7  
ATOM 11107 H HA   . ALA B 2 33 ? -7.313  -6.202  4.137   1.00 0.00 ? 327 ALA B HA   7  
ATOM 11108 H HB1  . ALA B 2 33 ? -6.725  -8.154  5.391   1.00 0.00 ? 327 ALA B HB1  7  
ATOM 11109 H HB2  . ALA B 2 33 ? -5.708  -6.823  5.939   1.00 0.00 ? 327 ALA B HB2  7  
ATOM 11110 H HB3  . ALA B 2 33 ? -5.044  -8.052  4.862   1.00 0.00 ? 327 ALA B HB3  7  
ATOM 11111 N N    . PHE B 2 34 ? -4.156  -5.934  3.158   1.00 0.00 ? 328 PHE B N    7  
ATOM 11112 C CA   . PHE B 2 34 ? -3.089  -4.976  2.854   1.00 0.00 ? 328 PHE B CA   7  
ATOM 11113 C C    . PHE B 2 34 ? -3.618  -3.836  1.992   1.00 0.00 ? 328 PHE B C    7  
ATOM 11114 O O    . PHE B 2 34 ? -3.390  -2.664  2.293   1.00 0.00 ? 328 PHE B O    7  
ATOM 11115 C CB   . PHE B 2 34 ? -1.939  -5.689  2.124   1.00 0.00 ? 328 PHE B CB   7  
ATOM 11116 C CG   . PHE B 2 34 ? -0.784  -4.798  1.736   1.00 0.00 ? 328 PHE B CG   7  
ATOM 11117 C CD1  . PHE B 2 34 ? -0.625  -3.537  2.294   1.00 0.00 ? 328 PHE B CD1  7  
ATOM 11118 C CD2  . PHE B 2 34 ? 0.154   -5.235  0.813   1.00 0.00 ? 328 PHE B CD2  7  
ATOM 11119 C CE1  . PHE B 2 34 ? 0.440   -2.734  1.936   1.00 0.00 ? 328 PHE B CE1  7  
ATOM 11120 C CE2  . PHE B 2 34 ? 1.221   -4.433  0.452   1.00 0.00 ? 328 PHE B CE2  7  
ATOM 11121 C CZ   . PHE B 2 34 ? 1.363   -3.182  1.013   1.00 0.00 ? 328 PHE B CZ   7  
ATOM 11122 H H    . PHE B 2 34 ? -3.996  -6.889  3.002   1.00 0.00 ? 328 PHE B H    7  
ATOM 11123 H HA   . PHE B 2 34 ? -2.722  -4.571  3.788   1.00 0.00 ? 328 PHE B HA   7  
ATOM 11124 H HB2  . PHE B 2 34 ? -1.550  -6.467  2.764   1.00 0.00 ? 328 PHE B HB2  7  
ATOM 11125 H HB3  . PHE B 2 34 ? -2.328  -6.139  1.222   1.00 0.00 ? 328 PHE B HB3  7  
ATOM 11126 H HD1  . PHE B 2 34 ? -1.344  -3.184  3.016   1.00 0.00 ? 328 PHE B HD1  7  
ATOM 11127 H HD2  . PHE B 2 34 ? 0.042   -6.212  0.367   1.00 0.00 ? 328 PHE B HD2  7  
ATOM 11128 H HE1  . PHE B 2 34 ? 0.548   -1.754  2.377   1.00 0.00 ? 328 PHE B HE1  7  
ATOM 11129 H HE2  . PHE B 2 34 ? 1.943   -4.788  -0.269  1.00 0.00 ? 328 PHE B HE2  7  
ATOM 11130 H HZ   . PHE B 2 34 ? 2.197   -2.554  0.733   1.00 0.00 ? 328 PHE B HZ   7  
ATOM 11131 N N    . LEU B 2 35 ? -4.333  -4.182  0.927   1.00 0.00 ? 329 LEU B N    7  
ATOM 11132 C CA   . LEU B 2 35 ? -4.896  -3.173  0.035   1.00 0.00 ? 329 LEU B CA   7  
ATOM 11133 C C    . LEU B 2 35 ? -5.851  -2.254  0.796   1.00 0.00 ? 329 LEU B C    7  
ATOM 11134 O O    . LEU B 2 35 ? -5.722  -1.030  0.730   1.00 0.00 ? 329 LEU B O    7  
ATOM 11135 C CB   . LEU B 2 35 ? -5.607  -3.828  -1.154  1.00 0.00 ? 329 LEU B CB   7  
ATOM 11136 C CG   . LEU B 2 35 ? -4.739  -4.779  -1.988  1.00 0.00 ? 329 LEU B CG   7  
ATOM 11137 C CD1  . LEU B 2 35 ? -5.490  -5.233  -3.230  1.00 0.00 ? 329 LEU B CD1  7  
ATOM 11138 C CD2  . LEU B 2 35 ? -3.412  -4.125  -2.362  1.00 0.00 ? 329 LEU B CD2  7  
ATOM 11139 H H    . LEU B 2 35 ? -4.489  -5.133  0.742   1.00 0.00 ? 329 LEU B H    7  
ATOM 11140 H HA   . LEU B 2 35 ? -4.074  -2.578  -0.334  1.00 0.00 ? 329 LEU B HA   7  
ATOM 11141 H HB2  . LEU B 2 35 ? -6.453  -4.383  -0.777  1.00 0.00 ? 329 LEU B HB2  7  
ATOM 11142 H HB3  . LEU B 2 35 ? -5.970  -3.045  -1.803  1.00 0.00 ? 329 LEU B HB3  7  
ATOM 11143 H HG   . LEU B 2 35 ? -4.521  -5.656  -1.399  1.00 0.00 ? 329 LEU B HG   7  
ATOM 11144 H HD11 . LEU B 2 35 ? -5.813  -6.256  -3.102  1.00 0.00 ? 329 LEU B HD11 7  
ATOM 11145 H HD12 . LEU B 2 35 ? -4.838  -5.169  -4.089  1.00 0.00 ? 329 LEU B HD12 7  
ATOM 11146 H HD13 . LEU B 2 35 ? -6.352  -4.600  -3.384  1.00 0.00 ? 329 LEU B HD13 7  
ATOM 11147 H HD21 . LEU B 2 35 ? -3.148  -3.384  -1.621  1.00 0.00 ? 329 LEU B HD21 7  
ATOM 11148 H HD22 . LEU B 2 35 ? -3.504  -3.651  -3.329  1.00 0.00 ? 329 LEU B HD22 7  
ATOM 11149 H HD23 . LEU B 2 35 ? -2.640  -4.879  -2.405  1.00 0.00 ? 329 LEU B HD23 7  
ATOM 11150 N N    . GLU B 2 36 ? -6.792  -2.849  1.536   1.00 0.00 ? 330 GLU B N    7  
ATOM 11151 C CA   . GLU B 2 36 ? -7.754  -2.078  2.331   1.00 0.00 ? 330 GLU B CA   7  
ATOM 11152 C C    . GLU B 2 36 ? -7.038  -1.181  3.342   1.00 0.00 ? 330 GLU B C    7  
ATOM 11153 O O    . GLU B 2 36 ? -7.499  -0.080  3.635   1.00 0.00 ? 330 GLU B O    7  
ATOM 11154 C CB   . GLU B 2 36 ? -8.720  -3.017  3.061   1.00 0.00 ? 330 GLU B CB   7  
ATOM 11155 C CG   . GLU B 2 36 ? -9.603  -3.837  2.129   1.00 0.00 ? 330 GLU B CG   7  
ATOM 11156 C CD   . GLU B 2 36 ? -10.511 -4.814  2.862   1.00 0.00 ? 330 GLU B CD   7  
ATOM 11157 O OE1  . GLU B 2 36 ? -10.464 -4.866  4.111   1.00 0.00 ? 330 GLU B OE1  7  
ATOM 11158 O OE2  . GLU B 2 36 ? -11.273 -5.532  2.181   1.00 0.00 ? 330 GLU B OE2  7  
ATOM 11159 H H    . GLU B 2 36 ? -6.830  -3.828  1.560   1.00 0.00 ? 330 GLU B H    7  
ATOM 11160 H HA   . GLU B 2 36 ? -8.318  -1.452  1.651   1.00 0.00 ? 330 GLU B HA   7  
ATOM 11161 H HB2  . GLU B 2 36 ? -8.147  -3.698  3.672   1.00 0.00 ? 330 GLU B HB2  7  
ATOM 11162 H HB3  . GLU B 2 36 ? -9.359  -2.426  3.700   1.00 0.00 ? 330 GLU B HB3  7  
ATOM 11163 H HG2  . GLU B 2 36 ? -10.220 -3.162  1.556   1.00 0.00 ? 330 GLU B HG2  7  
ATOM 11164 H HG3  . GLU B 2 36 ? -8.969  -4.396  1.457   1.00 0.00 ? 330 GLU B HG3  7  
ATOM 11165 N N    . ILE B 2 37 ? -5.897  -1.654  3.855   1.00 0.00 ? 331 ILE B N    7  
ATOM 11166 C CA   . ILE B 2 37 ? -5.098  -0.893  4.813   1.00 0.00 ? 331 ILE B CA   7  
ATOM 11167 C C    . ILE B 2 37 ? -4.681  0.438   4.197   1.00 0.00 ? 331 ILE B C    7  
ATOM 11168 O O    . ILE B 2 37 ? -4.918  1.507   4.763   1.00 0.00 ? 331 ILE B O    7  
ATOM 11169 C CB   . ILE B 2 37 ? -3.850  -1.694  5.236   1.00 0.00 ? 331 ILE B CB   7  
ATOM 11170 C CG1  . ILE B 2 37 ? -4.265  -2.902  6.073   1.00 0.00 ? 331 ILE B CG1  7  
ATOM 11171 C CG2  . ILE B 2 37 ? -2.868  -0.825  6.006   1.00 0.00 ? 331 ILE B CG2  7  
ATOM 11172 C CD1  . ILE B 2 37 ? -3.152  -3.892  6.287   1.00 0.00 ? 331 ILE B CD1  7  
ATOM 11173 H H    . ILE B 2 37 ? -5.573  -2.532  3.565   1.00 0.00 ? 331 ILE B H    7  
ATOM 11174 H HA   . ILE B 2 37 ? -5.699  -0.714  5.692   1.00 0.00 ? 331 ILE B HA   7  
ATOM 11175 H HB   . ILE B 2 37 ? -3.357  -2.042  4.344   1.00 0.00 ? 331 ILE B HB   7  
ATOM 11176 H HG12 . ILE B 2 37 ? -4.595  -2.561  7.042   1.00 0.00 ? 331 ILE B HG12 7  
ATOM 11177 H HG13 . ILE B 2 37 ? -5.078  -3.412  5.582   1.00 0.00 ? 331 ILE B HG13 7  
ATOM 11178 H HG21 . ILE B 2 37 ? -2.511  -0.033  5.365   1.00 0.00 ? 331 ILE B HG21 7  
ATOM 11179 H HG22 . ILE B 2 37 ? -2.034  -1.431  6.327   1.00 0.00 ? 331 ILE B HG22 7  
ATOM 11180 H HG23 . ILE B 2 37 ? -3.360  -0.400  6.868   1.00 0.00 ? 331 ILE B HG23 7  
ATOM 11181 H HD11 . ILE B 2 37 ? -2.610  -4.027  5.365   1.00 0.00 ? 331 ILE B HD11 7  
ATOM 11182 H HD12 . ILE B 2 37 ? -3.565  -4.836  6.605   1.00 0.00 ? 331 ILE B HD12 7  
ATOM 11183 H HD13 . ILE B 2 37 ? -2.482  -3.518  7.042   1.00 0.00 ? 331 ILE B HD13 7  
ATOM 11184 N N    . LEU B 2 38 ? -4.079  0.347   3.014   1.00 0.00 ? 332 LEU B N    7  
ATOM 11185 C CA   . LEU B 2 38 ? -3.636  1.516   2.261   1.00 0.00 ? 332 LEU B CA   7  
ATOM 11186 C C    . LEU B 2 38 ? -4.833  2.379   1.882   1.00 0.00 ? 332 LEU B C    7  
ATOM 11187 O O    . LEU B 2 38 ? -4.842  3.589   2.103   1.00 0.00 ? 332 LEU B O    7  
ATOM 11188 C CB   . LEU B 2 38 ? -2.912  1.062   0.995   1.00 0.00 ? 332 LEU B CB   7  
ATOM 11189 C CG   . LEU B 2 38 ? -1.877  -0.037  1.216   1.00 0.00 ? 332 LEU B CG   7  
ATOM 11190 C CD1  . LEU B 2 38 ? -1.334  -0.532  -0.109  1.00 0.00 ? 332 LEU B CD1  7  
ATOM 11191 C CD2  . LEU B 2 38 ? -0.762  0.465   2.114   1.00 0.00 ? 332 LEU B CD2  7  
ATOM 11192 H H    . LEU B 2 38 ? -3.947  -0.541  2.623   1.00 0.00 ? 332 LEU B H    7  
ATOM 11193 H HA   . LEU B 2 38 ? -2.961  2.088   2.878   1.00 0.00 ? 332 LEU B HA   7  
ATOM 11194 H HB2  . LEU B 2 38 ? -3.649  0.701   0.293   1.00 0.00 ? 332 LEU B HB2  7  
ATOM 11195 H HB3  . LEU B 2 38 ? -2.413  1.917   0.562   1.00 0.00 ? 332 LEU B HB3  7  
ATOM 11196 H HG   . LEU B 2 38 ? -2.350  -0.871  1.709   1.00 0.00 ? 332 LEU B HG   7  
ATOM 11197 H HD11 . LEU B 2 38 ? -0.334  -0.914  0.029   1.00 0.00 ? 332 LEU B HD11 7  
ATOM 11198 H HD12 . LEU B 2 38 ? -1.318  0.284   -0.815  1.00 0.00 ? 332 LEU B HD12 7  
ATOM 11199 H HD13 . LEU B 2 38 ? -1.975  -1.321  -0.482  1.00 0.00 ? 332 LEU B HD13 7  
ATOM 11200 H HD21 . LEU B 2 38 ? -1.019  1.448   2.481   1.00 0.00 ? 332 LEU B HD21 7  
ATOM 11201 H HD22 . LEU B 2 38 ? 0.159   0.516   1.555   1.00 0.00 ? 332 LEU B HD22 7  
ATOM 11202 H HD23 . LEU B 2 38 ? -0.644  -0.210  2.948   1.00 0.00 ? 332 LEU B HD23 7  
ATOM 11203 N N    . HIS B 2 39 ? -5.844  1.722   1.312   1.00 0.00 ? 333 HIS B N    7  
ATOM 11204 C CA   . HIS B 2 39 ? -7.075  2.395   0.886   1.00 0.00 ? 333 HIS B CA   7  
ATOM 11205 C C    . HIS B 2 39 ? -7.689  3.220   2.022   1.00 0.00 ? 333 HIS B C    7  
ATOM 11206 O O    . HIS B 2 39 ? -8.180  4.324   1.791   1.00 0.00 ? 333 HIS B O    7  
ATOM 11207 C CB   . HIS B 2 39 ? -8.096  1.373   0.376   1.00 0.00 ? 333 HIS B CB   7  
ATOM 11208 C CG   . HIS B 2 39 ? -7.777  0.833   -0.984  1.00 0.00 ? 333 HIS B CG   7  
ATOM 11209 N ND1  . HIS B 2 39 ? -7.643  1.630   -2.101  1.00 0.00 ? 333 HIS B ND1  7  
ATOM 11210 C CD2  . HIS B 2 39 ? -7.572  -0.436  -1.403  1.00 0.00 ? 333 HIS B CD2  7  
ATOM 11211 C CE1  . HIS B 2 39 ? -7.370  0.873   -3.149  1.00 0.00 ? 333 HIS B CE1  7  
ATOM 11212 N NE2  . HIS B 2 39 ? -7.319  -0.385  -2.751  1.00 0.00 ? 333 HIS B NE2  7  
ATOM 11213 H H    . HIS B 2 39 ? -5.749  0.753   1.167   1.00 0.00 ? 333 HIS B H    7  
ATOM 11214 H HA   . HIS B 2 39 ? -6.819  3.059   0.077   1.00 0.00 ? 333 HIS B HA   7  
ATOM 11215 H HB2  . HIS B 2 39 ? -8.134  0.541   1.063   1.00 0.00 ? 333 HIS B HB2  7  
ATOM 11216 H HB3  . HIS B 2 39 ? -9.071  1.838   0.331   1.00 0.00 ? 333 HIS B HB3  7  
ATOM 11217 H HD1  . HIS B 2 39 ? -7.736  2.605   -2.124  1.00 0.00 ? 333 HIS B HD1  7  
ATOM 11218 H HD2  . HIS B 2 39 ? -7.598  -1.322  -0.789  1.00 0.00 ? 333 HIS B HD2  7  
ATOM 11219 H HE1  . HIS B 2 39 ? -7.212  1.223   -4.159  1.00 0.00 ? 333 HIS B HE1  7  
ATOM 11220 H HE2  . HIS B 2 39 ? -7.037  -1.141  -3.306  1.00 0.00 ? 333 HIS B HE2  7  
ATOM 11221 N N    . THR B 2 40 ? -7.641  2.689   3.249   1.00 0.00 ? 334 THR B N    7  
ATOM 11222 C CA   . THR B 2 40 ? -8.179  3.393   4.418   1.00 0.00 ? 334 THR B CA   7  
ATOM 11223 C C    . THR B 2 40 ? -7.450  4.723   4.613   1.00 0.00 ? 334 THR B C    7  
ATOM 11224 O O    . THR B 2 40 ? -8.076  5.760   4.842   1.00 0.00 ? 334 THR B O    7  
ATOM 11225 C CB   . THR B 2 40 ? -8.035  2.518   5.678   1.00 0.00 ? 334 THR B CB   7  
ATOM 11226 O OG1  . THR B 2 40 ? -8.795  1.328   5.547   1.00 0.00 ? 334 THR B OG1  7  
ATOM 11227 C CG2  . THR B 2 40 ? -8.476  3.196   6.966   1.00 0.00 ? 334 THR B CG2  7  
ATOM 11228 H H    . THR B 2 40 ? -7.223  1.809   3.373   1.00 0.00 ? 334 THR B H    7  
ATOM 11229 H HA   . THR B 2 40 ? -9.224  3.588   4.238   1.00 0.00 ? 334 THR B HA   7  
ATOM 11230 H HB   . THR B 2 40 ? -6.996  2.240   5.790   1.00 0.00 ? 334 THR B HB   7  
ATOM 11231 H HG1  . THR B 2 40 ? -8.258  0.574   5.804   1.00 0.00 ? 334 THR B HG1  7  
ATOM 11232 H HG21 . THR B 2 40 ? -8.743  4.221   6.760   1.00 0.00 ? 334 THR B HG21 7  
ATOM 11233 H HG22 . THR B 2 40 ? -7.665  3.174   7.690   1.00 0.00 ? 334 THR B HG22 7  
ATOM 11234 H HG23 . THR B 2 40 ? -9.330  2.677   7.375   1.00 0.00 ? 334 THR B HG23 7  
ATOM 11235 N N    . TYR B 2 41 ? -6.123  4.671   4.515   1.00 0.00 ? 335 TYR B N    7  
ATOM 11236 C CA   . TYR B 2 41 ? -5.265  5.844   4.680   1.00 0.00 ? 335 TYR B CA   7  
ATOM 11237 C C    . TYR B 2 41 ? -5.596  6.959   3.679   1.00 0.00 ? 335 TYR B C    7  
ATOM 11238 O O    . TYR B 2 41 ? -5.928  8.070   4.083   1.00 0.00 ? 335 TYR B O    7  
ATOM 11239 C CB   . TYR B 2 41 ? -3.806  5.412   4.539   1.00 0.00 ? 335 TYR B CB   7  
ATOM 11240 C CG   . TYR B 2 41 ? -2.803  6.531   4.658   1.00 0.00 ? 335 TYR B CG   7  
ATOM 11241 C CD1  . TYR B 2 41 ? -2.485  7.096   5.888   1.00 0.00 ? 335 TYR B CD1  7  
ATOM 11242 C CD2  . TYR B 2 41 ? -2.169  7.018   3.526   1.00 0.00 ? 335 TYR B CD2  7  
ATOM 11243 C CE1  . TYR B 2 41 ? -1.555  8.123   5.974   1.00 0.00 ? 335 TYR B CE1  7  
ATOM 11244 C CE2  . TYR B 2 41 ? -1.246  8.034   3.604   1.00 0.00 ? 335 TYR B CE2  7  
ATOM 11245 C CZ   . TYR B 2 41 ? -0.941  8.586   4.827   1.00 0.00 ? 335 TYR B CZ   7  
ATOM 11246 O OH   . TYR B 2 41 ? -0.021  9.607   4.906   1.00 0.00 ? 335 TYR B OH   7  
ATOM 11247 H H    . TYR B 2 41 ? -5.701  3.805   4.329   1.00 0.00 ? 335 TYR B H    7  
ATOM 11248 H HA   . TYR B 2 41 ? -5.420  6.223   5.680   1.00 0.00 ? 335 TYR B HA   7  
ATOM 11249 H HB2  . TYR B 2 41 ? -3.585  4.690   5.309   1.00 0.00 ? 335 TYR B HB2  7  
ATOM 11250 H HB3  . TYR B 2 41 ? -3.672  4.946   3.573   1.00 0.00 ? 335 TYR B HB3  7  
ATOM 11251 H HD1  . TYR B 2 41 ? -2.975  6.723   6.790   1.00 0.00 ? 335 TYR B HD1  7  
ATOM 11252 H HD2  . TYR B 2 41 ? -2.408  6.587   2.569   1.00 0.00 ? 335 TYR B HD2  7  
ATOM 11253 H HE1  . TYR B 2 41 ? -1.303  8.551   6.934   1.00 0.00 ? 335 TYR B HE1  7  
ATOM 11254 H HE2  . TYR B 2 41 ? -0.765  8.391   2.705   1.00 0.00 ? 335 TYR B HE2  7  
ATOM 11255 H HH   . TYR B 2 41 ? -0.376  10.322  5.439   1.00 0.00 ? 335 TYR B HH   7  
ATOM 11256 N N    . GLN B 2 42 ? -5.499  6.681   2.380   1.00 0.00 ? 336 GLN B N    7  
ATOM 11257 C CA   . GLN B 2 42 ? -5.794  7.707   1.371   1.00 0.00 ? 336 GLN B CA   7  
ATOM 11258 C C    . GLN B 2 42 ? -7.157  8.358   1.599   1.00 0.00 ? 336 GLN B C    7  
ATOM 11259 O O    . GLN B 2 42 ? -7.319  9.557   1.365   1.00 0.00 ? 336 GLN B O    7  
ATOM 11260 C CB   . GLN B 2 42 ? -5.725  7.138   -0.044  1.00 0.00 ? 336 GLN B CB   7  
ATOM 11261 C CG   . GLN B 2 42 ? -4.327  7.170   -0.631  1.00 0.00 ? 336 GLN B CG   7  
ATOM 11262 C CD   . GLN B 2 42 ? -4.267  6.802   -2.105  1.00 0.00 ? 336 GLN B CD   7  
ATOM 11263 O OE1  . GLN B 2 42 ? -3.216  6.929   -2.727  1.00 0.00 ? 336 GLN B OE1  7  
ATOM 11264 N NE2  . GLN B 2 42 ? -5.382  6.338   -2.675  1.00 0.00 ? 336 GLN B NE2  7  
ATOM 11265 H H    . GLN B 2 42 ? -5.219  5.784   2.094   1.00 0.00 ? 336 GLN B H    7  
ATOM 11266 H HA   . GLN B 2 42 ? -5.039  8.472   1.467   1.00 0.00 ? 336 GLN B HA   7  
ATOM 11267 H HB2  . GLN B 2 42 ? -6.065  6.112   -0.026  1.00 0.00 ? 336 GLN B HB2  7  
ATOM 11268 H HB3  . GLN B 2 42 ? -6.375  7.715   -0.685  1.00 0.00 ? 336 GLN B HB3  7  
ATOM 11269 H HG2  . GLN B 2 42 ? -3.927  8.165   -0.514  1.00 0.00 ? 336 GLN B HG2  7  
ATOM 11270 H HG3  . GLN B 2 42 ? -3.712  6.478   -0.081  1.00 0.00 ? 336 GLN B HG3  7  
ATOM 11271 H HE21 . GLN B 2 42 ? -6.188  6.252   -2.128  1.00 0.00 ? 336 GLN B HE21 7  
ATOM 11272 H HE22 . GLN B 2 42 ? -5.349  6.104   -3.625  1.00 0.00 ? 336 GLN B HE22 7  
ATOM 11273 N N    . LYS B 2 43 ? -8.131  7.572   2.061   1.00 0.00 ? 337 LYS B N    7  
ATOM 11274 C CA   . LYS B 2 43 ? -9.468  8.094   2.319   1.00 0.00 ? 337 LYS B CA   7  
ATOM 11275 C C    . LYS B 2 43 ? -9.446  9.165   3.408   1.00 0.00 ? 337 LYS B C    7  
ATOM 11276 O O    . LYS B 2 43 ? -9.948  10.268  3.198   1.00 0.00 ? 337 LYS B O    7  
ATOM 11277 C CB   . LYS B 2 43 ? -10.431 6.968   2.709   1.00 0.00 ? 337 LYS B CB   7  
ATOM 11278 C CG   . LYS B 2 43 ? -10.781 6.039   1.554   1.00 0.00 ? 337 LYS B CG   7  
ATOM 11279 C CD   . LYS B 2 43 ? -11.763 4.954   1.978   1.00 0.00 ? 337 LYS B CD   7  
ATOM 11280 C CE   . LYS B 2 43 ? -11.159 4.025   3.020   1.00 0.00 ? 337 LYS B CE   7  
ATOM 11281 N NZ   . LYS B 2 43 ? -12.115 2.965   3.446   1.00 0.00 ? 337 LYS B NZ   7  
ATOM 11282 H H    . LYS B 2 43 ? -7.944  6.625   2.234   1.00 0.00 ? 337 LYS B H    7  
ATOM 11283 H HA   . LYS B 2 43 ? -9.821  8.547   1.403   1.00 0.00 ? 337 LYS B HA   7  
ATOM 11284 H HB2  . LYS B 2 43 ? -9.977  6.378   3.491   1.00 0.00 ? 337 LYS B HB2  7  
ATOM 11285 H HB3  . LYS B 2 43 ? -11.345 7.404   3.082   1.00 0.00 ? 337 LYS B HB3  7  
ATOM 11286 H HG2  . LYS B 2 43 ? -11.229 6.622   0.763   1.00 0.00 ? 337 LYS B HG2  7  
ATOM 11287 H HG3  . LYS B 2 43 ? -9.878  5.574   1.191   1.00 0.00 ? 337 LYS B HG3  7  
ATOM 11288 H HD2  . LYS B 2 43 ? -12.641 5.421   2.396   1.00 0.00 ? 337 LYS B HD2  7  
ATOM 11289 H HD3  . LYS B 2 43 ? -12.039 4.376   1.109   1.00 0.00 ? 337 LYS B HD3  7  
ATOM 11290 H HE2  . LYS B 2 43 ? -10.283 3.555   2.598   1.00 0.00 ? 337 LYS B HE2  7  
ATOM 11291 H HE3  . LYS B 2 43 ? -10.874 4.607   3.883   1.00 0.00 ? 337 LYS B HE3  7  
ATOM 11292 H HZ1  . LYS B 2 43 ? -12.531 2.501   2.612   1.00 0.00 ? 337 LYS B HZ1  7  
ATOM 11293 H HZ2  . LYS B 2 43 ? -12.880 3.380   4.015   1.00 0.00 ? 337 LYS B HZ2  7  
ATOM 11294 H HZ3  . LYS B 2 43 ? -11.622 2.249   4.018   1.00 0.00 ? 337 LYS B HZ3  7  
ATOM 11295 N N    . GLU B 2 44 ? -8.866  8.841   4.569   1.00 0.00 ? 338 GLU B N    7  
ATOM 11296 C CA   . GLU B 2 44 ? -8.798  9.792   5.685   1.00 0.00 ? 338 GLU B CA   7  
ATOM 11297 C C    . GLU B 2 44 ? -8.082  11.089  5.295   1.00 0.00 ? 338 GLU B C    7  
ATOM 11298 O O    . GLU B 2 44 ? -8.436  12.160  5.792   1.00 0.00 ? 338 GLU B O    7  
ATOM 11299 C CB   . GLU B 2 44 ? -8.147  9.149   6.928   1.00 0.00 ? 338 GLU B CB   7  
ATOM 11300 C CG   . GLU B 2 44 ? -6.742  8.586   6.728   1.00 0.00 ? 338 GLU B CG   7  
ATOM 11301 C CD   . GLU B 2 44 ? -5.633  9.628   6.606   1.00 0.00 ? 338 GLU B CD   7  
ATOM 11302 O OE1  . GLU B 2 44 ? -5.859  10.807  6.937   1.00 0.00 ? 338 GLU B OE1  7  
ATOM 11303 O OE2  . GLU B 2 44 ? -4.513  9.244   6.215   1.00 0.00 ? 338 GLU B OE2  7  
ATOM 11304 H H    . GLU B 2 44 ? -8.484  7.946   4.680   1.00 0.00 ? 338 GLU B H    7  
ATOM 11305 H HA   . GLU B 2 44 ? -9.822  10.050  5.936   1.00 0.00 ? 338 GLU B HA   7  
ATOM 11306 H HB2  . GLU B 2 44 ? -8.101  9.884   7.711   1.00 0.00 ? 338 GLU B HB2  7  
ATOM 11307 H HB3  . GLU B 2 44 ? -8.782  8.338   7.257   1.00 0.00 ? 338 GLU B HB3  7  
ATOM 11308 H HG2  . GLU B 2 44 ? -6.509  7.961   7.575   1.00 0.00 ? 338 GLU B HG2  7  
ATOM 11309 H HG3  . GLU B 2 44 ? -6.745  7.978   5.841   1.00 0.00 ? 338 GLU B HG3  7  
ATOM 11310 N N    . GLN B 2 45 ? -7.089  10.999  4.402   1.00 0.00 ? 339 GLN B N    7  
ATOM 11311 C CA   . GLN B 2 45 ? -6.357  12.189  3.958   1.00 0.00 ? 339 GLN B CA   7  
ATOM 11312 C C    . GLN B 2 45 ? -7.299  13.128  3.226   1.00 0.00 ? 339 GLN B C    7  
ATOM 11313 O O    . GLN B 2 45 ? -7.470  14.289  3.604   1.00 0.00 ? 339 GLN B O    7  
ATOM 11314 C CB   . GLN B 2 45 ? -5.207  11.820  3.014   1.00 0.00 ? 339 GLN B CB   7  
ATOM 11315 C CG   . GLN B 2 45 ? -4.273  10.759  3.552   1.00 0.00 ? 339 GLN B CG   7  
ATOM 11316 C CD   . GLN B 2 45 ? -3.091  10.513  2.634   1.00 0.00 ? 339 GLN B CD   7  
ATOM 11317 O OE1  . GLN B 2 45 ? -3.245  9.985   1.533   1.00 0.00 ? 339 GLN B OE1  7  
ATOM 11318 N NE2  . GLN B 2 45 ? -1.902  10.906  3.078   1.00 0.00 ? 339 GLN B NE2  7  
ATOM 11319 H H    . GLN B 2 45 ? -6.854  10.124  4.030   1.00 0.00 ? 339 GLN B H    7  
ATOM 11320 H HA   . GLN B 2 45 ? -5.959  12.688  4.830   1.00 0.00 ? 339 GLN B HA   7  
ATOM 11321 H HB2  . GLN B 2 45 ? -5.625  11.458  2.087   1.00 0.00 ? 339 GLN B HB2  7  
ATOM 11322 H HB3  . GLN B 2 45 ? -4.629  12.708  2.812   1.00 0.00 ? 339 GLN B HB3  7  
ATOM 11323 H HG2  . GLN B 2 45 ? -3.908  11.070  4.518   1.00 0.00 ? 339 GLN B HG2  7  
ATOM 11324 H HG3  . GLN B 2 45 ? -4.829  9.842   3.653   1.00 0.00 ? 339 GLN B HG3  7  
ATOM 11325 H HE21 . GLN B 2 45 ? -1.852  11.331  3.961   1.00 0.00 ? 339 GLN B HE21 7  
ATOM 11326 H HE22 . GLN B 2 45 ? -1.122  10.758  2.504   1.00 0.00 ? 339 GLN B HE22 7  
ATOM 11327 N N    . ARG B 2 46 ? -7.899  12.597  2.166   1.00 0.00 ? 340 ARG B N    7  
ATOM 11328 C CA   . ARG B 2 46 ? -8.833  13.351  1.336   1.00 0.00 ? 340 ARG B CA   7  
ATOM 11329 C C    . ARG B 2 46 ? -10.079 13.769  2.121   1.00 0.00 ? 340 ARG B C    7  
ATOM 11330 O O    . ARG B 2 46 ? -10.579 14.879  1.948   1.00 0.00 ? 340 ARG B O    7  
ATOM 11331 C CB   . ARG B 2 46 ? -9.221  12.533  0.117   1.00 0.00 ? 340 ARG B CB   7  
ATOM 11332 C CG   . ARG B 2 46 ? -8.028  12.218  -0.765  1.00 0.00 ? 340 ARG B CG   7  
ATOM 11333 C CD   . ARG B 2 46 ? -8.444  11.484  -2.015  1.00 0.00 ? 340 ARG B CD   7  
ATOM 11334 N NE   . ARG B 2 46 ? -9.143  12.349  -2.966  1.00 0.00 ? 340 ARG B NE   7  
ATOM 11335 C CZ   . ARG B 2 46 ? -9.593  11.942  -4.156  1.00 0.00 ? 340 ARG B CZ   7  
ATOM 11336 N NH1  . ARG B 2 46 ? -9.436  10.677  -4.540  1.00 0.00 ? 340 ARG B NH1  7  
ATOM 11337 N NH2  . ARG B 2 46 ? -10.200 12.803  -4.964  1.00 0.00 ? 340 ARG B NH2  7  
ATOM 11338 H H    . ARG B 2 46 ? -7.698  11.661  1.934   1.00 0.00 ? 340 ARG B H    7  
ATOM 11339 H HA   . ARG B 2 46 ? -8.322  14.233  0.994   1.00 0.00 ? 340 ARG B HA   7  
ATOM 11340 H HB2  . ARG B 2 46 ? -9.665  11.602  0.441   1.00 0.00 ? 340 ARG B HB2  7  
ATOM 11341 H HB3  . ARG B 2 46 ? -9.940  13.088  -0.468  1.00 0.00 ? 340 ARG B HB3  7  
ATOM 11342 H HG2  . ARG B 2 46 ? -7.546  13.142  -1.045  1.00 0.00 ? 340 ARG B HG2  7  
ATOM 11343 H HG3  . ARG B 2 46 ? -7.336  11.602  -0.209  1.00 0.00 ? 340 ARG B HG3  7  
ATOM 11344 H HD2  . ARG B 2 46 ? -7.562  11.084  -2.484  1.00 0.00 ? 340 ARG B HD2  7  
ATOM 11345 H HD3  . ARG B 2 46 ? -9.099  10.680  -1.729  1.00 0.00 ? 340 ARG B HD3  7  
ATOM 11346 H HE   . ARG B 2 46 ? -9.278  13.287  -2.709  1.00 0.00 ? 340 ARG B HE   7  
ATOM 11347 H HH11 . ARG B 2 46 ? -8.979  10.021  -3.940  1.00 0.00 ? 340 ARG B HH11 7  
ATOM 11348 H HH12 . ARG B 2 46 ? -9.776  10.382  -5.434  1.00 0.00 ? 340 ARG B HH12 7  
ATOM 11349 H HH21 . ARG B 2 46 ? -10.322 13.755  -4.682  1.00 0.00 ? 340 ARG B HH21 7  
ATOM 11350 H HH22 . ARG B 2 46 ? -10.538 12.501  -5.857  1.00 0.00 ? 340 ARG B HH22 7  
ATOM 11351 N N    . ASN B 2 47 ? -10.572 12.875  2.984   1.00 0.00 ? 341 ASN B N    7  
ATOM 11352 C CA   . ASN B 2 47 ? -11.759 13.149  3.798   1.00 0.00 ? 341 ASN B CA   7  
ATOM 11353 C C    . ASN B 2 47 ? -11.599 14.424  4.629   1.00 0.00 ? 341 ASN B C    7  
ATOM 11354 O O    . ASN B 2 47 ? -12.437 15.324  4.550   1.00 0.00 ? 341 ASN B O    7  
ATOM 11355 C CB   . ASN B 2 47 ? -12.071 11.960  4.714   1.00 0.00 ? 341 ASN B CB   7  
ATOM 11356 C CG   . ASN B 2 47 ? -12.822 10.850  4.002   1.00 0.00 ? 341 ASN B CG   7  
ATOM 11357 O OD1  . ASN B 2 47 ? -13.805 11.100  3.302   1.00 0.00 ? 341 ASN B OD1  7  
ATOM 11358 N ND2  . ASN B 2 47 ? -12.385 9.609   4.198   1.00 0.00 ? 341 ASN B ND2  7  
ATOM 11359 H H    . ASN B 2 47 ? -10.123 12.008  3.077   1.00 0.00 ? 341 ASN B H    7  
ATOM 11360 H HA   . ASN B 2 47 ? -12.588 13.287  3.121   1.00 0.00 ? 341 ASN B HA   7  
ATOM 11361 H HB2  . ASN B 2 47 ? -11.143 11.554  5.090   1.00 0.00 ? 341 ASN B HB2  7  
ATOM 11362 H HB3  . ASN B 2 47 ? -12.666 12.300  5.544   1.00 0.00 ? 341 ASN B HB3  7  
ATOM 11363 H HD21 . ASN B 2 47 ? -11.613 9.477   4.786   1.00 0.00 ? 341 ASN B HD21 7  
ATOM 11364 H HD22 . ASN B 2 47 ? -12.854 8.877   3.746   1.00 0.00 ? 341 ASN B HD22 7  
ATOM 11365 N N    . ALA B 2 48 ? -10.523 14.499  5.416   1.00 0.00 ? 342 ALA B N    7  
ATOM 11366 C CA   . ALA B 2 48 ? -10.259 15.673  6.251   1.00 0.00 ? 342 ALA B CA   7  
ATOM 11367 C C    . ALA B 2 48 ? -10.239 16.954  5.413   1.00 0.00 ? 342 ALA B C    7  
ATOM 11368 O O    . ALA B 2 48 ? -10.734 17.996  5.847   1.00 0.00 ? 342 ALA B O    7  
ATOM 11369 C CB   . ALA B 2 48 ? -8.941  15.507  6.996   1.00 0.00 ? 342 ALA B CB   7  
ATOM 11370 H H    . ALA B 2 48 ? -9.889  13.750  5.432   1.00 0.00 ? 342 ALA B H    7  
ATOM 11371 H HA   . ALA B 2 48 ? -11.053 15.749  6.986   1.00 0.00 ? 342 ALA B HA   7  
ATOM 11372 H HB1  . ALA B 2 48 ? -8.138  15.385  6.285   1.00 0.00 ? 342 ALA B HB1  7  
ATOM 11373 H HB2  . ALA B 2 48 ? -8.995  14.636  7.630   1.00 0.00 ? 342 ALA B HB2  7  
ATOM 11374 H HB3  . ALA B 2 48 ? -8.757  16.382  7.602   1.00 0.00 ? 342 ALA B HB3  7  
ATOM 11375 N N    . LYS B 2 49 ? -9.671  16.863  4.206   1.00 0.00 ? 343 LYS B N    7  
ATOM 11376 C CA   . LYS B 2 49 ? -9.591  18.005  3.295   1.00 0.00 ? 343 LYS B CA   7  
ATOM 11377 C C    . LYS B 2 49 ? -10.980 18.407  2.791   1.00 0.00 ? 343 LYS B C    7  
ATOM 11378 O O    . LYS B 2 49 ? -11.306 19.594  2.734   1.00 0.00 ? 343 LYS B O    7  
ATOM 11379 C CB   . LYS B 2 49 ? -8.680  17.673  2.107   1.00 0.00 ? 343 LYS B CB   7  
ATOM 11380 C CG   . LYS B 2 49 ? -8.519  18.815  1.113   1.00 0.00 ? 343 LYS B CG   7  
ATOM 11381 C CD   . LYS B 2 49 ? -7.841  20.025  1.742   1.00 0.00 ? 343 LYS B CD   7  
ATOM 11382 C CE   . LYS B 2 49 ? -6.420  19.710  2.194   1.00 0.00 ? 343 LYS B CE   7  
ATOM 11383 N NZ   . LYS B 2 49 ? -5.540  19.321  1.055   1.00 0.00 ? 343 LYS B NZ   7  
ATOM 11384 H H    . LYS B 2 49 ? -9.300  16.002  3.918   1.00 0.00 ? 343 LYS B H    7  
ATOM 11385 H HA   . LYS B 2 49 ? -9.165  18.835  3.841   1.00 0.00 ? 343 LYS B HA   7  
ATOM 11386 H HB2  . LYS B 2 49 ? -7.702  17.411  2.481   1.00 0.00 ? 343 LYS B HB2  7  
ATOM 11387 H HB3  . LYS B 2 49 ? -9.092  16.823  1.582   1.00 0.00 ? 343 LYS B HB3  7  
ATOM 11388 H HG2  . LYS B 2 49 ? -7.921  18.474  0.282   1.00 0.00 ? 343 LYS B HG2  7  
ATOM 11389 H HG3  . LYS B 2 49 ? -9.496  19.106  0.758   1.00 0.00 ? 343 LYS B HG3  7  
ATOM 11390 H HD2  . LYS B 2 49 ? -7.807  20.824  1.016   1.00 0.00 ? 343 LYS B HD2  7  
ATOM 11391 H HD3  . LYS B 2 49 ? -8.419  20.343  2.599   1.00 0.00 ? 343 LYS B HD3  7  
ATOM 11392 H HE2  . LYS B 2 49 ? -6.007  20.586  2.671   1.00 0.00 ? 343 LYS B HE2  7  
ATOM 11393 H HE3  . LYS B 2 49 ? -6.455  18.898  2.905   1.00 0.00 ? 343 LYS B HE3  7  
ATOM 11394 H HZ1  . LYS B 2 49 ? -5.865  18.423  0.641   1.00 0.00 ? 343 LYS B HZ1  7  
ATOM 11395 H HZ2  . LYS B 2 49 ? -4.561  19.203  1.384   1.00 0.00 ? 343 LYS B HZ2  7  
ATOM 11396 H HZ3  . LYS B 2 49 ? -5.560  20.056  0.319   1.00 0.00 ? 343 LYS B HZ3  7  
ATOM 11397 N N    . GLU B 2 50 ? -11.790 17.408  2.427   1.00 0.00 ? 344 GLU B N    7  
ATOM 11398 C CA   . GLU B 2 50 ? -13.146 17.643  1.924   1.00 0.00 ? 344 GLU B CA   7  
ATOM 11399 C C    . GLU B 2 50 ? -13.953 18.528  2.876   1.00 0.00 ? 344 GLU B C    7  
ATOM 11400 O O    . GLU B 2 50 ? -14.548 19.520  2.453   1.00 0.00 ? 344 GLU B O    7  
ATOM 11401 C CB   . GLU B 2 50 ? -13.877 16.313  1.713   1.00 0.00 ? 344 GLU B CB   7  
ATOM 11402 C CG   . GLU B 2 50 ? -13.301 15.467  0.589   1.00 0.00 ? 344 GLU B CG   7  
ATOM 11403 C CD   . GLU B 2 50 ? -13.911 14.079  0.526   1.00 0.00 ? 344 GLU B CD   7  
ATOM 11404 O OE1  . GLU B 2 50 ? -15.137 13.976  0.304   1.00 0.00 ? 344 GLU B OE1  7  
ATOM 11405 O OE2  . GLU B 2 50 ? -13.164 13.094  0.704   1.00 0.00 ? 344 GLU B OE2  7  
ATOM 11406 H H    . GLU B 2 50 ? -11.465 16.486  2.496   1.00 0.00 ? 344 GLU B H    7  
ATOM 11407 H HA   . GLU B 2 50 ? -13.061 18.148  0.974   1.00 0.00 ? 344 GLU B HA   7  
ATOM 11408 H HB2  . GLU B 2 50 ? -13.826 15.740  2.628   1.00 0.00 ? 344 GLU B HB2  7  
ATOM 11409 H HB3  . GLU B 2 50 ? -14.913 16.517  1.486   1.00 0.00 ? 344 GLU B HB3  7  
ATOM 11410 H HG2  . GLU B 2 50 ? -13.489 15.966  -0.351  1.00 0.00 ? 344 GLU B HG2  7  
ATOM 11411 H HG3  . GLU B 2 50 ? -12.237 15.371  0.735   1.00 0.00 ? 344 GLU B HG3  7  
ATOM 11412 N N    . ALA B 2 51 ? -13.966 18.164  4.159   1.00 0.00 ? 345 ALA B N    7  
ATOM 11413 C CA   . ALA B 2 51 ? -14.702 18.930  5.164   1.00 0.00 ? 345 ALA B CA   7  
ATOM 11414 C C    . ALA B 2 51 ? -14.056 20.293  5.409   1.00 0.00 ? 345 ALA B C    7  
ATOM 11415 O O    . ALA B 2 51 ? -14.751 21.307  5.492   1.00 0.00 ? 345 ALA B O    7  
ATOM 11416 C CB   . ALA B 2 51 ? -14.796 18.145  6.467   1.00 0.00 ? 345 ALA B CB   7  
ATOM 11417 H H    . ALA B 2 51 ? -13.472 17.364  4.436   1.00 0.00 ? 345 ALA B H    7  
ATOM 11418 H HA   . ALA B 2 51 ? -15.706 19.084  4.794   1.00 0.00 ? 345 ALA B HA   7  
ATOM 11419 H HB1  . ALA B 2 51 ? -14.244 17.221  6.371   1.00 0.00 ? 345 ALA B HB1  7  
ATOM 11420 H HB2  . ALA B 2 51 ? -15.831 17.926  6.682   1.00 0.00 ? 345 ALA B HB2  7  
ATOM 11421 H HB3  . ALA B 2 51 ? -14.378 18.732  7.273   1.00 0.00 ? 345 ALA B HB3  7  
ATOM 11422 N N    . GLY B 2 52 ? -12.723 20.307  5.520   1.00 0.00 ? 346 GLY B N    7  
ATOM 11423 C CA   . GLY B 2 52 ? -11.995 21.549  5.752   1.00 0.00 ? 346 GLY B CA   7  
ATOM 11424 C C    . GLY B 2 52 ? -12.584 22.385  6.876   1.00 0.00 ? 346 GLY B C    7  
ATOM 11425 O O    . GLY B 2 52 ? -12.677 23.608  6.759   1.00 0.00 ? 346 GLY B O    7  
ATOM 11426 H H    . GLY B 2 52 ? -12.227 19.465  5.442   1.00 0.00 ? 346 GLY B H    7  
ATOM 11427 H HA2  . GLY B 2 52 ? -10.971 21.309  5.998   1.00 0.00 ? 346 GLY B HA2  7  
ATOM 11428 H HA3  . GLY B 2 52 ? -12.005 22.132  4.842   1.00 0.00 ? 346 GLY B HA3  7  
ATOM 11429 N N    . GLY B 2 53 ? -12.986 21.724  7.964   1.00 0.00 ? 347 GLY B N    7  
ATOM 11430 C CA   . GLY B 2 53 ? -13.568 22.430  9.093   1.00 0.00 ? 347 GLY B CA   7  
ATOM 11431 C C    . GLY B 2 53 ? -13.594 21.592  10.357  1.00 0.00 ? 347 GLY B C    7  
ATOM 11432 O O    . GLY B 2 53 ? -12.974 21.956  11.357  1.00 0.00 ? 347 GLY B O    7  
ATOM 11433 H H    . GLY B 2 53 ? -12.889 20.749  7.997   1.00 0.00 ? 347 GLY B H    7  
ATOM 11434 H HA2  . GLY B 2 53 ? -12.992 23.324  9.280   1.00 0.00 ? 347 GLY B HA2  7  
ATOM 11435 H HA3  . GLY B 2 53 ? -14.580 22.713  8.842   1.00 0.00 ? 347 GLY B HA3  7  
ATOM 11436 N N    . ASN B 2 54 ? -14.312 20.465  10.310  1.00 0.00 ? 348 ASN B N    7  
ATOM 11437 C CA   . ASN B 2 54 ? -14.425 19.568  11.460  1.00 0.00 ? 348 ASN B CA   7  
ATOM 11438 C C    . ASN B 2 54 ? -14.780 18.147  11.018  1.00 0.00 ? 348 ASN B C    7  
ATOM 11439 O O    . ASN B 2 54 ? -15.931 17.859  10.680  1.00 0.00 ? 348 ASN B O    7  
ATOM 11440 C CB   . ASN B 2 54 ? -15.487 20.077  12.445  1.00 0.00 ? 348 ASN B CB   7  
ATOM 11441 C CG   . ASN B 2 54 ? -15.086 21.370  13.132  1.00 0.00 ? 348 ASN B CG   7  
ATOM 11442 O OD1  . ASN B 2 54 ? -14.100 21.416  13.867  1.00 0.00 ? 348 ASN B OD1  7  
ATOM 11443 N ND2  . ASN B 2 54 ? -15.851 22.432  12.897  1.00 0.00 ? 348 ASN B ND2  7  
ATOM 11444 H H    . ASN B 2 54 ? -14.781 20.235  9.479   1.00 0.00 ? 348 ASN B H    7  
ATOM 11445 H HA   . ASN B 2 54 ? -13.467 19.547  11.958  1.00 0.00 ? 348 ASN B HA   7  
ATOM 11446 H HB2  . ASN B 2 54 ? -16.409 20.249  11.910  1.00 0.00 ? 348 ASN B HB2  7  
ATOM 11447 H HB3  . ASN B 2 54 ? -15.652 19.325  13.203  1.00 0.00 ? 348 ASN B HB3  7  
ATOM 11448 H HD21 . ASN B 2 54 ? -16.624 22.326  12.302  1.00 0.00 ? 348 ASN B HD21 7  
ATOM 11449 H HD22 . ASN B 2 54 ? -15.614 23.278  13.330  1.00 0.00 ? 348 ASN B HD22 7  
ATOM 11450 N N    . TYR B 2 55 ? -13.780 17.266  11.031  1.00 0.00 ? 349 TYR B N    7  
ATOM 11451 C CA   . TYR B 2 55 ? -13.968 15.870  10.641  1.00 0.00 ? 349 TYR B CA   7  
ATOM 11452 C C    . TYR B 2 55 ? -12.883 14.978  11.249  1.00 0.00 ? 349 TYR B C    7  
ATOM 11453 O O    . TYR B 2 55 ? -13.193 13.959  11.863  1.00 0.00 ? 349 TYR B O    7  
ATOM 11454 C CB   . TYR B 2 55 ? -13.978 15.739  9.107   1.00 0.00 ? 349 TYR B CB   7  
ATOM 11455 C CG   . TYR B 2 55 ? -13.672 14.341  8.605   1.00 0.00 ? 349 TYR B CG   7  
ATOM 11456 C CD1  . TYR B 2 55 ? -12.359 13.900  8.492   1.00 0.00 ? 349 TYR B CD1  7  
ATOM 11457 C CD2  . TYR B 2 55 ? -14.690 13.458  8.271   1.00 0.00 ? 349 TYR B CD2  7  
ATOM 11458 C CE1  . TYR B 2 55 ? -12.067 12.624  8.060   1.00 0.00 ? 349 TYR B CE1  7  
ATOM 11459 C CE2  . TYR B 2 55 ? -14.408 12.178  7.834   1.00 0.00 ? 349 TYR B CE2  7  
ATOM 11460 C CZ   . TYR B 2 55 ? -13.096 11.763  7.732   1.00 0.00 ? 349 TYR B CZ   7  
ATOM 11461 O OH   . TYR B 2 55 ? -12.816 10.482  7.303   1.00 0.00 ? 349 TYR B OH   7  
ATOM 11462 H H    . TYR B 2 55 ? -12.889 17.563  11.309  1.00 0.00 ? 349 TYR B H    7  
ATOM 11463 H HA   . TYR B 2 55 ? -14.927 15.552  11.022  1.00 0.00 ? 349 TYR B HA   7  
ATOM 11464 H HB2  . TYR B 2 55 ? -14.954 16.016  8.737   1.00 0.00 ? 349 TYR B HB2  7  
ATOM 11465 H HB3  . TYR B 2 55 ? -13.241 16.411  8.692   1.00 0.00 ? 349 TYR B HB3  7  
ATOM 11466 H HD1  . TYR B 2 55 ? -11.556 14.576  8.747   1.00 0.00 ? 349 TYR B HD1  7  
ATOM 11467 H HD2  . TYR B 2 55 ? -15.718 13.785  8.352   1.00 0.00 ? 349 TYR B HD2  7  
ATOM 11468 H HE1  . TYR B 2 55 ? -11.035 12.304  7.978   1.00 0.00 ? 349 TYR B HE1  7  
ATOM 11469 H HE2  . TYR B 2 55 ? -15.214 11.506  7.578   1.00 0.00 ? 349 TYR B HE2  7  
ATOM 11470 H HH   . TYR B 2 55 ? -11.918 10.442  6.963   1.00 0.00 ? 349 TYR B HH   7  
ATOM 11471 N N    . THR B 2 56 ? -11.621 15.377  11.056  1.00 0.00 ? 350 THR B N    7  
ATOM 11472 C CA   . THR B 2 56 ? -10.451 14.642  11.553  1.00 0.00 ? 350 THR B CA   7  
ATOM 11473 C C    . THR B 2 56 ? -10.377 13.242  10.930  1.00 0.00 ? 350 THR B C    7  
ATOM 11474 O O    . THR B 2 56 ? -11.363 12.503  10.893  1.00 0.00 ? 350 THR B O    7  
ATOM 11475 C CB   . THR B 2 56 ? -10.427 14.567  13.086  1.00 0.00 ? 350 THR B CB   7  
ATOM 11476 O OG1  . THR B 2 56 ? -9.089  14.573  13.557  1.00 0.00 ? 350 THR B OG1  7  
ATOM 11477 C CG2  . THR B 2 56 ? -11.057 13.318  13.631  1.00 0.00 ? 350 THR B CG2  7  
ATOM 11478 H H    . THR B 2 56 ? -11.467 16.199  10.546  1.00 0.00 ? 350 THR B H    7  
ATOM 11479 H HA   . THR B 2 56 ? -9.585  15.185  11.238  1.00 0.00 ? 350 THR B HA   7  
ATOM 11480 H HB   . THR B 2 56 ? -10.947 15.419  13.498  1.00 0.00 ? 350 THR B HB   7  
ATOM 11481 H HG1  . THR B 2 56 ? -8.606  13.837  13.171  1.00 0.00 ? 350 THR B HG1  7  
ATOM 11482 H HG21 . THR B 2 56 ? -10.701 12.478  13.057  1.00 0.00 ? 350 THR B HG21 7  
ATOM 11483 H HG22 . THR B 2 56 ? -12.127 13.389  13.550  1.00 0.00 ? 350 THR B HG22 7  
ATOM 11484 H HG23 . THR B 2 56 ? -10.774 13.194  14.663  1.00 0.00 ? 350 THR B HG23 7  
ATOM 11485 N N    . PRO B 2 57 ? -9.196  12.867  10.415  1.00 0.00 ? 351 PRO B N    7  
ATOM 11486 C CA   . PRO B 2 57 ? -8.972  11.564  9.767   1.00 0.00 ? 351 PRO B CA   7  
ATOM 11487 C C    . PRO B 2 57 ? -9.096  10.379  10.722  1.00 0.00 ? 351 PRO B C    7  
ATOM 11488 O O    . PRO B 2 57 ? -9.030  10.537  11.942  1.00 0.00 ? 351 PRO B O    7  
ATOM 11489 C CB   . PRO B 2 57 ? -7.538  11.676  9.235   1.00 0.00 ? 351 PRO B CB   7  
ATOM 11490 C CG   . PRO B 2 57 ? -7.239  13.131  9.233   1.00 0.00 ? 351 PRO B CG   7  
ATOM 11491 C CD   . PRO B 2 57 ? -7.983  13.687  10.405  1.00 0.00 ? 351 PRO B CD   7  
ATOM 11492 H HA   . PRO B 2 57 ? -9.650  11.421  8.937   1.00 0.00 ? 351 PRO B HA   7  
ATOM 11493 H HB2  . PRO B 2 57 ? -6.866  11.132  9.883   1.00 0.00 ? 351 PRO B HB2  7  
ATOM 11494 H HB3  . PRO B 2 57 ? -7.493  11.267  8.240   1.00 0.00 ? 351 PRO B HB3  7  
ATOM 11495 H HG2  . PRO B 2 57 ? -6.177  13.293  9.344   1.00 0.00 ? 351 PRO B HG2  7  
ATOM 11496 H HG3  . PRO B 2 57 ? -7.599  13.576  8.316   1.00 0.00 ? 351 PRO B HG3  7  
ATOM 11497 H HD2  . PRO B 2 57 ? -7.419  13.553  11.318  1.00 0.00 ? 351 PRO B HD2  7  
ATOM 11498 H HD3  . PRO B 2 57 ? -8.221  14.728  10.250  1.00 0.00 ? 351 PRO B HD3  7  
ATOM 11499 N N    . ALA B 2 58 ? -9.273  9.187   10.145  1.00 0.00 ? 352 ALA B N    7  
ATOM 11500 C CA   . ALA B 2 58 ? -9.407  7.957   10.922  1.00 0.00 ? 352 ALA B CA   7  
ATOM 11501 C C    . ALA B 2 58 ? -8.065  7.234   11.095  1.00 0.00 ? 352 ALA B C    7  
ATOM 11502 O O    . ALA B 2 58 ? -7.937  6.370   11.964  1.00 0.00 ? 352 ALA B O    7  
ATOM 11503 C CB   . ALA B 2 58 ? -10.423 7.032   10.267  1.00 0.00 ? 352 ALA B CB   7  
ATOM 11504 H H    . ALA B 2 58 ? -9.315  9.136   9.168   1.00 0.00 ? 352 ALA B H    7  
ATOM 11505 H HA   . ALA B 2 58 ? -9.784  8.224   11.899  1.00 0.00 ? 352 ALA B HA   7  
ATOM 11506 H HB1  . ALA B 2 58 ? -11.410 7.462   10.353  1.00 0.00 ? 352 ALA B HB1  7  
ATOM 11507 H HB2  . ALA B 2 58 ? -10.405 6.071   10.759  1.00 0.00 ? 352 ALA B HB2  7  
ATOM 11508 H HB3  . ALA B 2 58 ? -10.175 6.907   9.223   1.00 0.00 ? 352 ALA B HB3  7  
ATOM 11509 N N    . LEU B 2 59 ? -7.068  7.586   10.273  1.00 0.00 ? 353 LEU B N    7  
ATOM 11510 C CA   . LEU B 2 59 ? -5.752  6.959   10.356  1.00 0.00 ? 353 LEU B CA   7  
ATOM 11511 C C    . LEU B 2 59 ? -4.660  7.829   9.758   1.00 0.00 ? 353 LEU B C    7  
ATOM 11512 O O    . LEU B 2 59 ? -4.901  8.945   9.293   1.00 0.00 ? 353 LEU B O    7  
ATOM 11513 C CB   . LEU B 2 59 ? -5.719  5.601   9.639   1.00 0.00 ? 353 LEU B CB   7  
ATOM 11514 C CG   . LEU B 2 59 ? -6.041  5.605   8.148   1.00 0.00 ? 353 LEU B CG   7  
ATOM 11515 C CD1  . LEU B 2 59 ? -5.663  4.264   7.537   1.00 0.00 ? 353 LEU B CD1  7  
ATOM 11516 C CD2  . LEU B 2 59 ? -7.516  5.905   7.920   1.00 0.00 ? 353 LEU B CD2  7  
ATOM 11517 H H    . LEU B 2 59 ? -7.220  8.275   9.602   1.00 0.00 ? 353 LEU B H    7  
ATOM 11518 H HA   . LEU B 2 59 ? -5.531  6.801   11.402  1.00 0.00 ? 353 LEU B HA   7  
ATOM 11519 H HB2  . LEU B 2 59 ? -4.720  5.205   9.741   1.00 0.00 ? 353 LEU B HB2  7  
ATOM 11520 H HB3  . LEU B 2 59 ? -6.408  4.935   10.134  1.00 0.00 ? 353 LEU B HB3  7  
ATOM 11521 H HG   . LEU B 2 59 ? -5.452  6.367   7.656   1.00 0.00 ? 353 LEU B HG   7  
ATOM 11522 H HD11 . LEU B 2 59 ? -6.283  4.073   6.677   1.00 0.00 ? 353 LEU B HD11 7  
ATOM 11523 H HD12 . LEU B 2 59 ? -5.808  3.482   8.267   1.00 0.00 ? 353 LEU B HD12 7  
ATOM 11524 H HD13 . LEU B 2 59 ? -4.626  4.287   7.234   1.00 0.00 ? 353 LEU B HD13 7  
ATOM 11525 H HD21 . LEU B 2 59 ? -7.749  6.885   8.304   1.00 0.00 ? 353 LEU B HD21 7  
ATOM 11526 H HD22 . LEU B 2 59 ? -8.117  5.167   8.429   1.00 0.00 ? 353 LEU B HD22 7  
ATOM 11527 H HD23 . LEU B 2 59 ? -7.728  5.875   6.865   1.00 0.00 ? 353 LEU B HD23 7  
ATOM 11528 N N    . THR B 2 60 ? -3.457  7.270   9.766   1.00 0.00 ? 354 THR B N    7  
ATOM 11529 C CA   . THR B 2 60 ? -2.275  7.909   9.222   1.00 0.00 ? 354 THR B CA   7  
ATOM 11530 C C    . THR B 2 60 ? -1.322  6.825   8.729   1.00 0.00 ? 354 THR B C    7  
ATOM 11531 O O    . THR B 2 60 ? -1.663  5.639   8.763   1.00 0.00 ? 354 THR B O    7  
ATOM 11532 C CB   . THR B 2 60 ? -1.592  8.785   10.285  1.00 0.00 ? 354 THR B CB   7  
ATOM 11533 O OG1  . THR B 2 60 ? -1.318  8.047   11.468  1.00 0.00 ? 354 THR B OG1  7  
ATOM 11534 C CG2  . THR B 2 60 ? -2.411  9.996   10.684  1.00 0.00 ? 354 THR B CG2  7  
ATOM 11535 H H    . THR B 2 60 ? -3.363  6.369   10.145  1.00 0.00 ? 354 THR B H    7  
ATOM 11536 H HA   . THR B 2 60 ? -2.575  8.524   8.385   1.00 0.00 ? 354 THR B HA   7  
ATOM 11537 H HB   . THR B 2 60 ? -0.653  9.143   9.888   1.00 0.00 ? 354 THR B HB   7  
ATOM 11538 H HG1  . THR B 2 60 ? -1.257  7.111   11.261  1.00 0.00 ? 354 THR B HG1  7  
ATOM 11539 H HG21 . THR B 2 60 ? -3.006  10.321  9.844   1.00 0.00 ? 354 THR B HG21 7  
ATOM 11540 H HG22 . THR B 2 60 ? -1.749  10.794  10.986  1.00 0.00 ? 354 THR B HG22 7  
ATOM 11541 H HG23 . THR B 2 60 ? -3.060  9.735   11.507  1.00 0.00 ? 354 THR B HG23 7  
ATOM 11542 N N    . GLU B 2 61 ? -0.130  7.213   8.291   1.00 0.00 ? 355 GLU B N    7  
ATOM 11543 C CA   . GLU B 2 61 ? 0.854   6.242   7.825   1.00 0.00 ? 355 GLU B CA   7  
ATOM 11544 C C    . GLU B 2 61 ? 1.111   5.190   8.912   1.00 0.00 ? 355 GLU B C    7  
ATOM 11545 O O    . GLU B 2 61 ? 1.502   4.061   8.615   1.00 0.00 ? 355 GLU B O    7  
ATOM 11546 C CB   . GLU B 2 61 ? 2.146   6.958   7.434   1.00 0.00 ? 355 GLU B CB   7  
ATOM 11547 C CG   . GLU B 2 61 ? 1.990   7.908   6.256   1.00 0.00 ? 355 GLU B CG   7  
ATOM 11548 C CD   . GLU B 2 61 ? 1.816   7.203   4.920   1.00 0.00 ? 355 GLU B CD   7  
ATOM 11549 O OE1  . GLU B 2 61 ? 0.986   6.272   4.830   1.00 0.00 ? 355 GLU B OE1  7  
ATOM 11550 O OE2  . GLU B 2 61 ? 2.491   7.607   3.951   1.00 0.00 ? 355 GLU B OE2  7  
ATOM 11551 H H    . GLU B 2 61 ? 0.097   8.166   8.296   1.00 0.00 ? 355 GLU B H    7  
ATOM 11552 H HA   . GLU B 2 61 ? 0.447   5.745   6.955   1.00 0.00 ? 355 GLU B HA   7  
ATOM 11553 H HB2  . GLU B 2 61 ? 2.476   7.537   8.279   1.00 0.00 ? 355 GLU B HB2  7  
ATOM 11554 H HB3  . GLU B 2 61 ? 2.899   6.225   7.188   1.00 0.00 ? 355 GLU B HB3  7  
ATOM 11555 H HG2  . GLU B 2 61 ? 1.124   8.526   6.428   1.00 0.00 ? 355 GLU B HG2  7  
ATOM 11556 H HG3  . GLU B 2 61 ? 2.867   8.534   6.201   1.00 0.00 ? 355 GLU B HG3  7  
ATOM 11557 N N    . GLN B 2 62 ? 0.855   5.572   10.175  1.00 0.00 ? 356 GLN B N    7  
ATOM 11558 C CA   . GLN B 2 62 ? 1.019   4.674   11.317  1.00 0.00 ? 356 GLN B CA   7  
ATOM 11559 C C    . GLN B 2 62 ? 0.068   3.483   11.208  1.00 0.00 ? 356 GLN B C    7  
ATOM 11560 O O    . GLN B 2 62 ? 0.463   2.350   11.466  1.00 0.00 ? 356 GLN B O    7  
ATOM 11561 C CB   . GLN B 2 62 ? 0.763   5.423   12.628  1.00 0.00 ? 356 GLN B CB   7  
ATOM 11562 C CG   . GLN B 2 62 ? 1.705   6.595   12.860  1.00 0.00 ? 356 GLN B CG   7  
ATOM 11563 C CD   . GLN B 2 62 ? 1.400   7.340   14.148  1.00 0.00 ? 356 GLN B CD   7  
ATOM 11564 O OE1  . GLN B 2 62 ? 0.307   7.880   14.320  1.00 0.00 ? 356 GLN B OE1  7  
ATOM 11565 N NE2  . GLN B 2 62 ? 2.367   7.372   15.060  1.00 0.00 ? 356 GLN B NE2  7  
ATOM 11566 H H    . GLN B 2 62 ? 0.529   6.481   10.338  1.00 0.00 ? 356 GLN B H    7  
ATOM 11567 H HA   . GLN B 2 62 ? 2.036   4.312   11.310  1.00 0.00 ? 356 GLN B HA   7  
ATOM 11568 H HB2  . GLN B 2 62 ? -0.249  5.800   12.621  1.00 0.00 ? 356 GLN B HB2  7  
ATOM 11569 H HB3  . GLN B 2 62 ? 0.875   4.732   13.450  1.00 0.00 ? 356 GLN B HB3  7  
ATOM 11570 H HG2  . GLN B 2 62 ? 2.717   6.223   12.908  1.00 0.00 ? 356 GLN B HG2  7  
ATOM 11571 H HG3  . GLN B 2 62 ? 1.613   7.284   12.033  1.00 0.00 ? 356 GLN B HG3  7  
ATOM 11572 H HE21 . GLN B 2 62 ? 3.212   6.921   14.858  1.00 0.00 ? 356 GLN B HE21 7  
ATOM 11573 H HE22 . GLN B 2 62 ? 2.192   7.845   15.900  1.00 0.00 ? 356 GLN B HE22 7  
ATOM 11574 N N    . GLU B 2 63 ? -1.185  3.745   10.804  1.00 0.00 ? 357 GLU B N    7  
ATOM 11575 C CA   . GLU B 2 63 ? -2.180  2.680   10.642  1.00 0.00 ? 357 GLU B CA   7  
ATOM 11576 C C    . GLU B 2 63 ? -1.824  1.810   9.446   1.00 0.00 ? 357 GLU B C    7  
ATOM 11577 O O    . GLU B 2 63 ? -1.999  0.592   9.472   1.00 0.00 ? 357 GLU B O    7  
ATOM 11578 C CB   . GLU B 2 63 ? -3.585  3.251   10.396  1.00 0.00 ? 357 GLU B CB   7  
ATOM 11579 C CG   . GLU B 2 63 ? -4.213  3.978   11.573  1.00 0.00 ? 357 GLU B CG   7  
ATOM 11580 C CD   . GLU B 2 63 ? -4.193  3.163   12.854  1.00 0.00 ? 357 GLU B CD   7  
ATOM 11581 O OE1  . GLU B 2 63 ? -4.816  2.081   12.882  1.00 0.00 ? 357 GLU B OE1  7  
ATOM 11582 O OE2  . GLU B 2 63 ? -3.548  3.607   13.827  1.00 0.00 ? 357 GLU B OE2  7  
ATOM 11583 H H    . GLU B 2 63 ? -1.437  4.670   10.597  1.00 0.00 ? 357 GLU B H    7  
ATOM 11584 H HA   . GLU B 2 63 ? -2.187  2.076   11.537  1.00 0.00 ? 357 GLU B HA   7  
ATOM 11585 H HB2  . GLU B 2 63 ? -3.528  3.947   9.574   1.00 0.00 ? 357 GLU B HB2  7  
ATOM 11586 H HB3  . GLU B 2 63 ? -4.239  2.443   10.115  1.00 0.00 ? 357 GLU B HB3  7  
ATOM 11587 H HG2  . GLU B 2 63 ? -3.686  4.904   11.737  1.00 0.00 ? 357 GLU B HG2  7  
ATOM 11588 H HG3  . GLU B 2 63 ? -5.250  4.195   11.316  1.00 0.00 ? 357 GLU B HG3  7  
ATOM 11589 N N    . VAL B 2 64 ? -1.343  2.461   8.391   1.00 0.00 ? 358 VAL B N    7  
ATOM 11590 C CA   . VAL B 2 64 ? -0.976  1.780   7.160   1.00 0.00 ? 358 VAL B CA   7  
ATOM 11591 C C    . VAL B 2 64 ? 0.135   0.760   7.406   1.00 0.00 ? 358 VAL B C    7  
ATOM 11592 O O    . VAL B 2 64 ? -0.062  -0.440  7.215   1.00 0.00 ? 358 VAL B O    7  
ATOM 11593 C CB   . VAL B 2 64 ? -0.512  2.809   6.108   1.00 0.00 ? 358 VAL B CB   7  
ATOM 11594 C CG1  . VAL B 2 64 ? -0.312  2.164   4.750   1.00 0.00 ? 358 VAL B CG1  7  
ATOM 11595 C CG2  . VAL B 2 64 ? -1.504  3.961   6.021   1.00 0.00 ? 358 VAL B CG2  7  
ATOM 11596 H H    . VAL B 2 64 ? -1.245  3.435   8.440   1.00 0.00 ? 358 VAL B H    7  
ATOM 11597 H HA   . VAL B 2 64 ? -1.849  1.272   6.780   1.00 0.00 ? 358 VAL B HA   7  
ATOM 11598 H HB   . VAL B 2 64 ? 0.438   3.212   6.427   1.00 0.00 ? 358 VAL B HB   7  
ATOM 11599 H HG11 . VAL B 2 64 ? -0.091  1.115   4.877   1.00 0.00 ? 358 VAL B HG11 7  
ATOM 11600 H HG12 . VAL B 2 64 ? 0.511   2.649   4.242   1.00 0.00 ? 358 VAL B HG12 7  
ATOM 11601 H HG13 . VAL B 2 64 ? -1.212  2.275   4.164   1.00 0.00 ? 358 VAL B HG13 7  
ATOM 11602 H HG21 . VAL B 2 64 ? -2.315  3.795   6.717   1.00 0.00 ? 358 VAL B HG21 7  
ATOM 11603 H HG22 . VAL B 2 64 ? -1.895  4.020   5.018   1.00 0.00 ? 358 VAL B HG22 7  
ATOM 11604 H HG23 . VAL B 2 64 ? -1.003  4.883   6.267   1.00 0.00 ? 358 VAL B HG23 7  
ATOM 11605 N N    . TYR B 2 65 ? 1.295   1.241   7.851   1.00 0.00 ? 359 TYR B N    7  
ATOM 11606 C CA   . TYR B 2 65 ? 2.430   0.371   8.148   1.00 0.00 ? 359 TYR B CA   7  
ATOM 11607 C C    . TYR B 2 65 ? 2.102   -0.624  9.267   1.00 0.00 ? 359 TYR B C    7  
ATOM 11608 O O    . TYR B 2 65 ? 2.573   -1.762  9.249   1.00 0.00 ? 359 TYR B O    7  
ATOM 11609 C CB   . TYR B 2 65 ? 3.662   1.207   8.518   1.00 0.00 ? 359 TYR B CB   7  
ATOM 11610 C CG   . TYR B 2 65 ? 4.933   0.396   8.670   1.00 0.00 ? 359 TYR B CG   7  
ATOM 11611 C CD1  . TYR B 2 65 ? 5.101   -0.485  9.734   1.00 0.00 ? 359 TYR B CD1  7  
ATOM 11612 C CD2  . TYR B 2 65 ? 5.961   0.502   7.741   1.00 0.00 ? 359 TYR B CD2  7  
ATOM 11613 C CE1  . TYR B 2 65 ? 6.256   -1.233  9.866   1.00 0.00 ? 359 TYR B CE1  7  
ATOM 11614 C CE2  . TYR B 2 65 ? 7.119   -0.241  7.867   1.00 0.00 ? 359 TYR B CE2  7  
ATOM 11615 C CZ   . TYR B 2 65 ? 7.261   -1.107  8.931   1.00 0.00 ? 359 TYR B CZ   7  
ATOM 11616 O OH   . TYR B 2 65 ? 8.411   -1.852  9.058   1.00 0.00 ? 359 TYR B OH   7  
ATOM 11617 H H    . TYR B 2 65 ? 1.383   2.207   8.000   1.00 0.00 ? 359 TYR B H    7  
ATOM 11618 H HA   . TYR B 2 65 ? 2.651   -0.189  7.253   1.00 0.00 ? 359 TYR B HA   7  
ATOM 11619 H HB2  . TYR B 2 65 ? 3.832   1.943   7.746   1.00 0.00 ? 359 TYR B HB2  7  
ATOM 11620 H HB3  . TYR B 2 65 ? 3.476   1.714   9.452   1.00 0.00 ? 359 TYR B HB3  7  
ATOM 11621 H HD1  . TYR B 2 65 ? 4.313   -0.579  10.467  1.00 0.00 ? 359 TYR B HD1  7  
ATOM 11622 H HD2  . TYR B 2 65 ? 5.848   1.181   6.909   1.00 0.00 ? 359 TYR B HD2  7  
ATOM 11623 H HE1  . TYR B 2 65 ? 6.366   -1.911  10.700  1.00 0.00 ? 359 TYR B HE1  7  
ATOM 11624 H HE2  . TYR B 2 65 ? 7.906   -0.144  7.135   1.00 0.00 ? 359 TYR B HE2  7  
ATOM 11625 H HH   . TYR B 2 65 ? 8.293   -2.702  8.625   1.00 0.00 ? 359 TYR B HH   7  
ATOM 11626 N N    . ALA B 2 66 ? 1.314   -0.175  10.249  1.00 0.00 ? 360 ALA B N    7  
ATOM 11627 C CA   . ALA B 2 66 ? 0.949   -1.015  11.397  1.00 0.00 ? 360 ALA B CA   7  
ATOM 11628 C C    . ALA B 2 66 ? 0.166   -2.263  10.996  1.00 0.00 ? 360 ALA B C    7  
ATOM 11629 O O    . ALA B 2 66 ? 0.526   -3.374  11.388  1.00 0.00 ? 360 ALA B O    7  
ATOM 11630 C CB   . ALA B 2 66 ? 0.155   -0.211  12.414  1.00 0.00 ? 360 ALA B CB   7  
ATOM 11631 H H    . ALA B 2 66 ? 0.982   0.751   10.207  1.00 0.00 ? 360 ALA B H    7  
ATOM 11632 H HA   . ALA B 2 66 ? 1.867   -1.327  11.873  1.00 0.00 ? 360 ALA B HA   7  
ATOM 11633 H HB1  . ALA B 2 66 ? 0.799   0.521   12.876  1.00 0.00 ? 360 ALA B HB1  7  
ATOM 11634 H HB2  . ALA B 2 66 ? -0.236  -0.876  13.172  1.00 0.00 ? 360 ALA B HB2  7  
ATOM 11635 H HB3  . ALA B 2 66 ? -0.663  0.290   11.919  1.00 0.00 ? 360 ALA B HB3  7  
ATOM 11636 N N    . GLN B 2 67 ? -0.910  -2.080  10.234  1.00 0.00 ? 361 GLN B N    7  
ATOM 11637 C CA   . GLN B 2 67 ? -1.748  -3.204  9.810   1.00 0.00 ? 361 GLN B CA   7  
ATOM 11638 C C    . GLN B 2 67 ? -0.988  -4.149  8.878   1.00 0.00 ? 361 GLN B C    7  
ATOM 11639 O O    . GLN B 2 67 ? -1.117  -5.368  8.991   1.00 0.00 ? 361 GLN B O    7  
ATOM 11640 C CB   . GLN B 2 67 ? -3.020  -2.696  9.128   1.00 0.00 ? 361 GLN B CB   7  
ATOM 11641 C CG   . GLN B 2 67 ? -3.915  -1.868  10.037  1.00 0.00 ? 361 GLN B CG   7  
ATOM 11642 C CD   . GLN B 2 67 ? -5.162  -1.368  9.331   1.00 0.00 ? 361 GLN B CD   7  
ATOM 11643 O OE1  . GLN B 2 67 ? -5.998  -2.158  8.892   1.00 0.00 ? 361 GLN B OE1  7  
ATOM 11644 N NE2  . GLN B 2 67 ? -5.291  -0.051  9.209   1.00 0.00 ? 361 GLN B NE2  7  
ATOM 11645 H H    . GLN B 2 67 ? -1.157  -1.171  9.963   1.00 0.00 ? 361 GLN B H    7  
ATOM 11646 H HA   . GLN B 2 67 ? -2.026  -3.753  10.697  1.00 0.00 ? 361 GLN B HA   7  
ATOM 11647 H HB2  . GLN B 2 67 ? -2.741  -2.085  8.282   1.00 0.00 ? 361 GLN B HB2  7  
ATOM 11648 H HB3  . GLN B 2 67 ? -3.589  -3.544  8.777   1.00 0.00 ? 361 GLN B HB3  7  
ATOM 11649 H HG2  . GLN B 2 67 ? -4.216  -2.477  10.876  1.00 0.00 ? 361 GLN B HG2  7  
ATOM 11650 H HG3  . GLN B 2 67 ? -3.356  -1.017  10.396  1.00 0.00 ? 361 GLN B HG3  7  
ATOM 11651 H HE21 . GLN B 2 67 ? -4.584  0.521   9.577   1.00 0.00 ? 361 GLN B HE21 7  
ATOM 11652 H HE22 . GLN B 2 67 ? -6.086  0.296   8.756   1.00 0.00 ? 361 GLN B HE22 7  
ATOM 11653 N N    . VAL B 2 68 ? -0.182  -3.588  7.973   1.00 0.00 ? 362 VAL B N    7  
ATOM 11654 C CA   . VAL B 2 68 ? 0.607   -4.400  7.047   1.00 0.00 ? 362 VAL B CA   7  
ATOM 11655 C C    . VAL B 2 68 ? 1.650   -5.211  7.817   1.00 0.00 ? 362 VAL B C    7  
ATOM 11656 O O    . VAL B 2 68 ? 1.864   -6.391  7.532   1.00 0.00 ? 362 VAL B O    7  
ATOM 11657 C CB   . VAL B 2 68 ? 1.309   -3.533  5.978   1.00 0.00 ? 362 VAL B CB   7  
ATOM 11658 C CG1  . VAL B 2 68 ? 2.139   -4.394  5.032   1.00 0.00 ? 362 VAL B CG1  7  
ATOM 11659 C CG2  . VAL B 2 68 ? 0.285   -2.720  5.199   1.00 0.00 ? 362 VAL B CG2  7  
ATOM 11660 H H    . VAL B 2 68 ? -0.108  -2.611  7.937   1.00 0.00 ? 362 VAL B H    7  
ATOM 11661 H HA   . VAL B 2 68 ? -0.067  -5.084  6.547   1.00 0.00 ? 362 VAL B HA   7  
ATOM 11662 H HB   . VAL B 2 68 ? 1.974   -2.845  6.480   1.00 0.00 ? 362 VAL B HB   7  
ATOM 11663 H HG11 . VAL B 2 68 ? 2.224   -5.393  5.434   1.00 0.00 ? 362 VAL B HG11 7  
ATOM 11664 H HG12 . VAL B 2 68 ? 3.124   -3.964  4.927   1.00 0.00 ? 362 VAL B HG12 7  
ATOM 11665 H HG13 . VAL B 2 68 ? 1.658   -4.434  4.066   1.00 0.00 ? 362 VAL B HG13 7  
ATOM 11666 H HG21 . VAL B 2 68 ? 0.792   -2.103  4.472   1.00 0.00 ? 362 VAL B HG21 7  
ATOM 11667 H HG22 . VAL B 2 68 ? -0.271  -2.095  5.878   1.00 0.00 ? 362 VAL B HG22 7  
ATOM 11668 H HG23 . VAL B 2 68 ? -0.393  -3.390  4.692   1.00 0.00 ? 362 VAL B HG23 7  
ATOM 11669 N N    . ALA B 2 69 ? 2.277   -4.571  8.810   1.00 0.00 ? 363 ALA B N    7  
ATOM 11670 C CA   . ALA B 2 69 ? 3.281   -5.228  9.646   1.00 0.00 ? 363 ALA B CA   7  
ATOM 11671 C C    . ALA B 2 69 ? 2.722   -6.499  10.287  1.00 0.00 ? 363 ALA B C    7  
ATOM 11672 O O    . ALA B 2 69 ? 3.442   -7.486  10.452  1.00 0.00 ? 363 ALA B O    7  
ATOM 11673 C CB   . ALA B 2 69 ? 3.791   -4.271  10.715  1.00 0.00 ? 363 ALA B CB   7  
ATOM 11674 H H    . ALA B 2 69 ? 2.048   -3.635  8.991   1.00 0.00 ? 363 ALA B H    7  
ATOM 11675 H HA   . ALA B 2 69 ? 4.114   -5.497  9.012   1.00 0.00 ? 363 ALA B HA   7  
ATOM 11676 H HB1  . ALA B 2 69 ? 3.061   -3.494  10.883  1.00 0.00 ? 363 ALA B HB1  7  
ATOM 11677 H HB2  . ALA B 2 69 ? 4.720   -3.827  10.387  1.00 0.00 ? 363 ALA B HB2  7  
ATOM 11678 H HB3  . ALA B 2 69 ? 3.957   -4.814  11.635  1.00 0.00 ? 363 ALA B HB3  7  
ATOM 11679 N N    . ARG B 2 70 ? 1.430   -6.471  10.634  1.00 0.00 ? 364 ARG B N    7  
ATOM 11680 C CA   . ARG B 2 70 ? 0.770   -7.624  11.244  1.00 0.00 ? 364 ARG B CA   7  
ATOM 11681 C C    . ARG B 2 70 ? 0.677   -8.772  10.243  1.00 0.00 ? 364 ARG B C    7  
ATOM 11682 O O    . ARG B 2 70 ? 0.881   -9.934  10.591  1.00 0.00 ? 364 ARG B O    7  
ATOM 11683 C CB   . ARG B 2 70 ? -0.629  -7.241  11.740  1.00 0.00 ? 364 ARG B CB   7  
ATOM 11684 C CG   . ARG B 2 70 ? -0.629  -6.120  12.770  1.00 0.00 ? 364 ARG B CG   7  
ATOM 11685 C CD   . ARG B 2 70 ? 0.151   -6.506  14.018  1.00 0.00 ? 364 ARG B CD   7  
ATOM 11686 N NE   . ARG B 2 70 ? 0.220   -5.412  14.990  1.00 0.00 ? 364 ARG B NE   7  
ATOM 11687 C CZ   . ARG B 2 70 ? -0.833  -4.925  15.654  1.00 0.00 ? 364 ARG B CZ   7  
ATOM 11688 N NH1  . ARG B 2 70 ? -2.042  -5.461  15.499  1.00 0.00 ? 364 ARG B NH1  7  
ATOM 11689 N NH2  . ARG B 2 70 ? -0.671  -3.905  16.491  1.00 0.00 ? 364 ARG B NH2  7  
ATOM 11690 H H    . ARG B 2 70 ? 0.906   -5.659  10.466  1.00 0.00 ? 364 ARG B H    7  
ATOM 11691 H HA   . ARG B 2 70 ? 1.367   -7.942  12.085  1.00 0.00 ? 364 ARG B HA   7  
ATOM 11692 H HB2  . ARG B 2 70 ? -1.224  -6.921  10.896  1.00 0.00 ? 364 ARG B HB2  7  
ATOM 11693 H HB3  . ARG B 2 70 ? -1.092  -8.109  12.187  1.00 0.00 ? 364 ARG B HB3  7  
ATOM 11694 H HG2  . ARG B 2 70 ? -0.175  -5.245  12.333  1.00 0.00 ? 364 ARG B HG2  7  
ATOM 11695 H HG3  . ARG B 2 70 ? -1.648  -5.899  13.047  1.00 0.00 ? 364 ARG B HG3  7  
ATOM 11696 H HD2  . ARG B 2 70 ? -0.330  -7.354  14.481  1.00 0.00 ? 364 ARG B HD2  7  
ATOM 11697 H HD3  . ARG B 2 70 ? 1.155   -6.779  13.728  1.00 0.00 ? 364 ARG B HD3  7  
ATOM 11698 H HE   . ARG B 2 70 ? 1.100   -5.008  15.148  1.00 0.00 ? 364 ARG B HE   7  
ATOM 11699 H HH11 . ARG B 2 70 ? -2.174  -6.237  14.883  1.00 0.00 ? 364 ARG B HH11 7  
ATOM 11700 H HH12 . ARG B 2 70 ? -2.822  -5.085  16.000  1.00 0.00 ? 364 ARG B HH12 7  
ATOM 11701 H HH21 . ARG B 2 70 ? 0.235   -3.504  16.622  1.00 0.00 ? 364 ARG B HH21 7  
ATOM 11702 H HH22 . ARG B 2 70 ? -1.457  -3.536  16.989  1.00 0.00 ? 364 ARG B HH22 7  
ATOM 11703 N N    . LEU B 2 71 ? 0.381   -8.429  8.990   1.00 0.00 ? 365 LEU B N    7  
ATOM 11704 C CA   . LE