data_1G3B
# 
_entry.id   1G3B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1G3B         
RCSB  RCSB012180   
WWPDB D_1000012180 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1BTY 
_pdbx_database_related.details        'the same protein complexed with benzamidine' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1G3B 
_pdbx_database_status.recvd_initial_deposition_date   2000-10-23 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Toyota, E.'    1 
'Ng, K.K.S.'    2 
'Sekizaki, H.'  3 
'Itoh, K.'      4 
'Tanizawa, K.'  5 
'James, M.N.G.' 6 
# 
_citation.id                        primary 
_citation.title                     
'X-ray crystallographic analyses of complexes between bovine beta-trypsin and Schiff base copper(II) or iron(III) chelates.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            305 
_citation.page_first                471 
_citation.page_last                 479 
_citation.year                      2001 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11152605 
_citation.pdbx_database_id_DOI      10.1006/jmbi.2000.4303 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Toyota, E.'   1 
primary 'Ng, K.K.'     2 
primary 'Sekizaki, H.' 3 
primary 'Itoh, K.'     4 
primary 'Tanizawa, K.' 5 
primary 'James, M.N.'  6 
# 
_cell.entry_id           1G3B 
_cell.length_a           63.770 
_cell.length_b           63.250 
_cell.length_c           69.330 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1G3B 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat BETA-TRYPSIN                                               23913.820 1   3.4.21.4 ? 'MATURE ENZYME' ? 
2 non-polymer syn 'MAGNESIUM ION'                                            24.305    1   ?        ? ?               ? 
3 non-polymer syn 'CALCIUM ION'                                              40.078    1   ?        ? ?               ? 
4 non-polymer syn 'SULFATE ION'                                              96.063    1   ?        ? ?               ? 
5 non-polymer syn '2-(5-CARBAMIMIDOYL-2-HYDROXY-BENZYLAMINO)-PROPIONIC ACID' 237.255   1   ?        ? ?               ? 
6 water       nat water                                                      18.015    170 ?        ? ?               ? 
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        E.C.3.4.21.4 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPS
YNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQ
ITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPS
YNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQ
ITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   ASP n 
1 4   ASP n 
1 5   LYS n 
1 6   ILE n 
1 7   VAL n 
1 8   GLY n 
1 9   GLY n 
1 10  TYR n 
1 11  THR n 
1 12  CYS n 
1 13  GLY n 
1 14  ALA n 
1 15  ASN n 
1 16  THR n 
1 17  VAL n 
1 18  PRO n 
1 19  TYR n 
1 20  GLN n 
1 21  VAL n 
1 22  SER n 
1 23  LEU n 
1 24  ASN n 
1 25  SER n 
1 26  GLY n 
1 27  TYR n 
1 28  HIS n 
1 29  PHE n 
1 30  CYS n 
1 31  GLY n 
1 32  GLY n 
1 33  SER n 
1 34  LEU n 
1 35  ILE n 
1 36  ASN n 
1 37  SER n 
1 38  GLN n 
1 39  TRP n 
1 40  VAL n 
1 41  VAL n 
1 42  SER n 
1 43  ALA n 
1 44  ALA n 
1 45  HIS n 
1 46  CYS n 
1 47  TYR n 
1 48  LYS n 
1 49  SER n 
1 50  GLY n 
1 51  ILE n 
1 52  GLN n 
1 53  VAL n 
1 54  ARG n 
1 55  LEU n 
1 56  GLY n 
1 57  GLU n 
1 58  ASP n 
1 59  ASN n 
1 60  ILE n 
1 61  ASN n 
1 62  VAL n 
1 63  VAL n 
1 64  GLU n 
1 65  GLY n 
1 66  ASN n 
1 67  GLU n 
1 68  GLN n 
1 69  PHE n 
1 70  ILE n 
1 71  SER n 
1 72  ALA n 
1 73  SER n 
1 74  LYS n 
1 75  SER n 
1 76  ILE n 
1 77  VAL n 
1 78  HIS n 
1 79  PRO n 
1 80  SER n 
1 81  TYR n 
1 82  ASN n 
1 83  SER n 
1 84  ASN n 
1 85  THR n 
1 86  LEU n 
1 87  ASN n 
1 88  ASN n 
1 89  ASP n 
1 90  ILE n 
1 91  MET n 
1 92  LEU n 
1 93  ILE n 
1 94  LYS n 
1 95  LEU n 
1 96  LYS n 
1 97  SER n 
1 98  ALA n 
1 99  ALA n 
1 100 SER n 
1 101 LEU n 
1 102 ASN n 
1 103 SER n 
1 104 ARG n 
1 105 VAL n 
1 106 ALA n 
1 107 SER n 
1 108 ILE n 
1 109 SER n 
1 110 LEU n 
1 111 PRO n 
1 112 THR n 
1 113 SER n 
1 114 CYS n 
1 115 ALA n 
1 116 SER n 
1 117 ALA n 
1 118 GLY n 
1 119 THR n 
1 120 GLN n 
1 121 CYS n 
1 122 LEU n 
1 123 ILE n 
1 124 SER n 
1 125 GLY n 
1 126 TRP n 
1 127 GLY n 
1 128 ASN n 
1 129 THR n 
1 130 LYS n 
1 131 SER n 
1 132 SER n 
1 133 GLY n 
1 134 THR n 
1 135 SER n 
1 136 TYR n 
1 137 PRO n 
1 138 ASP n 
1 139 VAL n 
1 140 LEU n 
1 141 LYS n 
1 142 CYS n 
1 143 LEU n 
1 144 LYS n 
1 145 ALA n 
1 146 PRO n 
1 147 ILE n 
1 148 LEU n 
1 149 SER n 
1 150 ASP n 
1 151 SER n 
1 152 SER n 
1 153 CYS n 
1 154 LYS n 
1 155 SER n 
1 156 ALA n 
1 157 TYR n 
1 158 PRO n 
1 159 GLY n 
1 160 GLN n 
1 161 ILE n 
1 162 THR n 
1 163 SER n 
1 164 ASN n 
1 165 MET n 
1 166 PHE n 
1 167 CYS n 
1 168 ALA n 
1 169 GLY n 
1 170 TYR n 
1 171 LEU n 
1 172 GLU n 
1 173 GLY n 
1 174 GLY n 
1 175 LYS n 
1 176 ASP n 
1 177 SER n 
1 178 CYS n 
1 179 GLN n 
1 180 GLY n 
1 181 ASP n 
1 182 SER n 
1 183 GLY n 
1 184 GLY n 
1 185 PRO n 
1 186 VAL n 
1 187 VAL n 
1 188 CYS n 
1 189 SER n 
1 190 GLY n 
1 191 LYS n 
1 192 LEU n 
1 193 GLN n 
1 194 GLY n 
1 195 ILE n 
1 196 VAL n 
1 197 SER n 
1 198 TRP n 
1 199 GLY n 
1 200 SER n 
1 201 GLY n 
1 202 CYS n 
1 203 ALA n 
1 204 GLN n 
1 205 LYS n 
1 206 ASN n 
1 207 LYS n 
1 208 PRO n 
1 209 GLY n 
1 210 VAL n 
1 211 TYR n 
1 212 THR n 
1 213 LYS n 
1 214 VAL n 
1 215 CYS n 
1 216 ASN n 
1 217 TYR n 
1 218 VAL n 
1 219 SER n 
1 220 TRP n 
1 221 ILE n 
1 222 LYS n 
1 223 GLN n 
1 224 THR n 
1 225 ILE n 
1 226 ALA n 
1 227 SER n 
1 228 ASN n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                cattle 
_entity_src_nat.pdbx_organism_scientific   'Bos taurus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9913 
_entity_src_nat.genus                      Bos 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             PANCREAS 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TRY1_BOVIN 
_struct_ref.pdbx_db_accession          P00760 
_struct_ref.pdbx_align_begin           11 
_struct_ref.pdbx_seq_one_letter_code   
;DDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPS
YNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQ
ITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1G3B 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 221 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00760 
_struct_ref_seq.db_align_beg                  11 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  238 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       11 
_struct_ref_seq.pdbx_auth_seq_align_end       238 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
108 non-polymer         . '2-(5-CARBAMIMIDOYL-2-HYDROXY-BENZYLAMINO)-PROPIONIC ACID' ? 'C11 H15 N3 O3'  237.255 
ALA 'L-peptide linking' y ALANINE                                                    ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                   ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                 ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                            ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'                                              ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE                                                   ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                  ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                            ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                    ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                  ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                      ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                 ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                    ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                     ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                 ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                            ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                              ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                    ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                     ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'                                              ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE                                                  ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                 ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                   ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                     ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1G3B 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.92 
_exptl_crystal.density_percent_sol   57.91 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.3 
_exptl_crystal_grow.pdbx_details    
'magnesium sulfate, Tris-Cl, calcium chloride, pH 8.3, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           106 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MACSCIENCE DIP100' 
_diffrn_detector.pdbx_collection_date   1999-08-19 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Yale mirrors' 
_diffrn_radiation.pdbx_diffrn_protocol             MONOCHROMATIC 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1G3B 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            1.80 
_reflns.number_obs                   26364 
_reflns.number_all                   26364 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            0.086 
_reflns.pdbx_Rsym_value              0.086 
_reflns.pdbx_netI_over_sigmaI        7.6 
_reflns.B_iso_Wilson_estimate        13.5 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   0.978 
_reflns_shell.Rmerge_I_obs           0.353 
_reflns_shell.pdbx_Rsym_value        0.353 
_reflns_shell.meanI_over_sigI_obs    3.4 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2540 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1G3B 
_refine.ls_number_reflns_obs                     25810 
_refine.ls_number_reflns_all                     25810 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               233278.91 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             19.35 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    96.9 
_refine.ls_R_factor_obs                          0.173 
_refine.ls_R_factor_all                          0.173 
_refine.ls_R_factor_R_work                       0.173 
_refine.ls_R_factor_R_free                       0.193 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.8 
_refine.ls_number_reflns_R_free                  2542 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               19.0 
_refine.aniso_B[1][1]                            -0.51 
_refine.aniso_B[2][2]                            1.15 
_refine.aniso_B[3][3]                            -0.64 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.395 
_refine.solvent_model_param_bsol                 49.95 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1BTY 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1G3B 
_refine_analyze.Luzzati_coordinate_error_obs    0.18 
_refine_analyze.Luzzati_sigma_a_obs             0.14 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.20 
_refine_analyze.Luzzati_sigma_a_free            0.15 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1629 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         24 
_refine_hist.number_atoms_solvent             170 
_refine_hist.number_atoms_total               1823 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        19.35 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.004 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 25.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.71  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.18  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.85  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.22  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.31  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.91 
_refine_ls_shell.number_reflns_R_work             3695 
_refine_ls_shell.R_factor_R_work                  0.231 
_refine_ls_shell.percent_reflns_obs               94 
_refine_ls_shell.R_factor_R_free                  0.253 
_refine_ls_shell.R_factor_R_free_error            0.013 
_refine_ls_shell.percent_reflns_R_free            9.5 
_refine_ls_shell.number_reflns_R_free             386 
_refine_ls_shell.number_reflns_obs                3695 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PA PROTEIN_SEP.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARA WATER.TOP       'X-RAY DIFFRACTION' 
3 ION_NEW2.PARAM ION_NEW.TOP     'X-RAY DIFFRACTION' 
4 BEN.PARAM      BEN.TOP         'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1G3B 
_struct.title                     'BOVINE BETA-TRYPSIN BOUND TO META-AMIDINO SCHIFF BASE MAGNESIUM(II) CHELATE' 
_struct.pdbx_descriptor           'BETA-TRYPSIN (E.C.3.4.21.4)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1G3B 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'enzyme-inhibitor complex, coordination metal based inhibitor, hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 43  ? TYR A 47  ? ALA A 55  TYR A 59  5 ? 5  
HELX_P HELX_P2 2 SER A 149 ? TYR A 157 ? SER A 164 TYR A 172 1 ? 9  
HELX_P HELX_P3 3 TYR A 217 ? SER A 227 ? TYR A 234 SER A 244 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 12  SG ? ? ? 1_555 A CYS 142 SG  ? ? A CYS 22  A CYS 157 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf2  disulf ? ? A CYS 30  SG ? ? ? 1_555 A CYS 46  SG  ? ? A CYS 42  A CYS 58  1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf3  disulf ? ? A CYS 114 SG ? ? ? 1_555 A CYS 215 SG  ? ? A CYS 128 A CYS 232 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf4  disulf ? ? A CYS 121 SG ? ? ? 1_555 A CYS 188 SG  ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf5  disulf ? ? A CYS 153 SG ? ? ? 1_555 A CYS 167 SG  ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.026 ? 
disulf6  disulf ? ? A CYS 178 SG ? ? ? 1_555 A CYS 202 SG  ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc1  metalc ? ? B MG  .   MG ? ? ? 1_555 E 108 .   N   ? ? A MG  501 A 108 601 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc2  metalc ? ? B MG  .   MG ? ? ? 1_555 E 108 .   OXT ? ? A MG  501 A 108 601 1_555 ? ? ? ? ? ? ? 2.121 ? 
metalc3  metalc ? ? B MG  .   MG ? ? ? 1_555 F HOH .   O   ? ? A MG  501 A HOH 724 1_555 ? ? ? ? ? ? ? 2.263 ? 
metalc4  metalc ? ? B MG  .   MG ? ? ? 1_555 F HOH .   O   ? ? A MG  501 A HOH 725 1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc5  metalc ? ? B MG  .   MG ? ? ? 1_555 A GLN 179 OE1 ? ? A MG  501 A GLN 192 1_555 ? ? ? ? ? ? ? 2.605 ? 
metalc6  metalc ? ? B MG  .   MG ? ? ? 1_555 E 108 .   O1  ? ? A MG  501 A 108 601 1_555 ? ? ? ? ? ? ? 1.961 ? 
metalc7  metalc ? ? C CA  .   CA ? ? ? 1_555 F HOH .   O   ? ? A CA  502 A HOH 739 1_555 ? ? ? ? ? ? ? 2.252 ? 
metalc8  metalc ? ? C CA  .   CA ? ? ? 1_555 A VAL 62  O   ? ? A CA  502 A VAL 75  1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc9  metalc ? ? C CA  .   CA ? ? ? 1_555 F HOH .   O   ? ? A CA  502 A HOH 737 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc10 metalc ? ? C CA  .   CA ? ? ? 1_555 A GLU 67  OE2 ? ? A CA  502 A GLU 80  1_555 ? ? ? ? ? ? ? 2.240 ? 
metalc11 metalc ? ? C CA  .   CA ? ? ? 1_555 A ASN 59  O   ? ? A CA  502 A ASN 72  1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc12 metalc ? ? C CA  .   CA ? ? ? 1_555 A GLU 57  OE1 ? ? A CA  502 A GLU 70  1_555 ? ? ? ? ? ? ? 2.205 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 10  ? THR A 11  ? TYR A 20  THR A 21  
A 2 LYS A 141 ? PRO A 146 ? LYS A 156 PRO A 161 
A 3 GLN A 120 ? GLY A 125 ? GLN A 135 GLY A 140 
A 4 PRO A 185 ? CYS A 188 ? PRO A 198 CYS A 201 
A 5 LYS A 191 ? TRP A 198 ? LYS A 204 TRP A 215 
A 6 GLY A 209 ? LYS A 213 ? GLY A 226 LYS A 230 
A 7 MET A 165 ? ALA A 168 ? MET A 180 ALA A 183 
B 1 GLN A 20  ? ASN A 24  ? GLN A 30  ASN A 34  
B 2 HIS A 28  ? ASN A 36  ? HIS A 40  ASN A 48  
B 3 TRP A 39  ? SER A 42  ? TRP A 51  SER A 54  
B 4 MET A 91  ? LEU A 95  ? MET A 104 LEU A 108 
B 5 GLN A 68  ? VAL A 77  ? GLN A 81  VAL A 90  
B 6 GLN A 52  ? LEU A 55  ? GLN A 64  LEU A 66  
B 7 GLN A 20  ? ASN A 24  ? GLN A 30  ASN A 34  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 10  ? O TYR A 20  N CYS A 142 ? N CYS A 157 
A 2 3 O ALA A 145 ? O ALA A 160 N CYS A 121 ? N CYS A 136 
A 3 4 N SER A 124 ? N SER A 139 O PRO A 185 ? O PRO A 198 
A 4 5 N CYS A 188 ? N CYS A 201 O LYS A 191 ? O LYS A 204 
A 5 6 O TRP A 198 ? O TRP A 215 N VAL A 210 ? N VAL A 227 
A 6 7 N TYR A 211 ? N TYR A 228 O PHE A 166 ? O PHE A 181 
B 1 2 O LEU A 23  ? O LEU A 33  N PHE A 29  ? N PHE A 41  
B 2 3 N ILE A 35  ? N ILE A 47  O TRP A 39  ? O TRP A 51  
B 3 4 N SER A 42  ? N SER A 54  O MET A 91  ? O MET A 104 
B 4 5 O LYS A 94  ? O LYS A 107 N SER A 73  ? N SER A 86  
B 5 6 O ILE A 70  ? O ILE A 83  N VAL A 53  ? N VAL A 65  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 501'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 502'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 701' 
AC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE 108 A 601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  GLN A 179 ? GLN A 192 . ? 1_555 ? 
2  AC1 4  108 E .   ? 108 A 601 . ? 1_555 ? 
3  AC1 4  HOH F .   ? HOH A 724 . ? 1_555 ? 
4  AC1 4  HOH F .   ? HOH A 725 . ? 1_555 ? 
5  AC2 6  GLU A 57  ? GLU A 70  . ? 1_555 ? 
6  AC2 6  ASN A 59  ? ASN A 72  . ? 1_555 ? 
7  AC2 6  VAL A 62  ? VAL A 75  . ? 1_555 ? 
8  AC2 6  GLU A 67  ? GLU A 80  . ? 1_555 ? 
9  AC2 6  HOH F .   ? HOH A 737 . ? 1_555 ? 
10 AC2 6  HOH F .   ? HOH A 739 . ? 1_555 ? 
11 AC3 5  PRO A 158 ? PRO A 173 . ? 1_555 ? 
12 AC3 5  GLY A 159 ? GLY A 174 . ? 1_555 ? 
13 AC3 5  GLN A 223 ? GLN A 240 . ? 3_645 ? 
14 AC3 5  HOH F .   ? HOH A 713 . ? 1_555 ? 
15 AC3 5  HOH F .   ? HOH A 871 . ? 3_645 ? 
16 AC4 12 ASP A 176 ? ASP A 189 . ? 1_555 ? 
17 AC4 12 SER A 177 ? SER A 190 . ? 1_555 ? 
18 AC4 12 CYS A 178 ? CYS A 191 . ? 1_555 ? 
19 AC4 12 GLN A 179 ? GLN A 192 . ? 1_555 ? 
20 AC4 12 SER A 182 ? SER A 195 . ? 1_555 ? 
21 AC4 12 TRP A 198 ? TRP A 215 . ? 1_555 ? 
22 AC4 12 GLY A 199 ? GLY A 216 . ? 1_555 ? 
23 AC4 12 GLY A 201 ? GLY A 219 . ? 1_555 ? 
24 AC4 12 GLY A 209 ? GLY A 226 . ? 1_555 ? 
25 AC4 12 MG  B .   ? MG  A 501 . ? 1_555 ? 
26 AC4 12 HOH F .   ? HOH A 723 . ? 1_555 ? 
27 AC4 12 HOH F .   ? HOH A 724 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1G3B 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1G3B 
_atom_sites.fract_transf_matrix[1][1]   0.015681 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015810 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014424 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ILE A 1 6   ? 52.858 -3.227  26.746 1.00 12.87 ? 16  ILE A N   1 
ATOM   2    C  CA  . ILE A 1 6   ? 52.925 -3.595  25.301 1.00 13.62 ? 16  ILE A CA  1 
ATOM   3    C  C   . ILE A 1 6   ? 53.303 -5.068  25.169 1.00 14.82 ? 16  ILE A C   1 
ATOM   4    O  O   . ILE A 1 6   ? 54.306 -5.506  25.729 1.00 14.11 ? 16  ILE A O   1 
ATOM   5    C  CB  . ILE A 1 6   ? 53.994 -2.760  24.558 1.00 13.73 ? 16  ILE A CB  1 
ATOM   6    C  CG1 . ILE A 1 6   ? 53.675 -1.263  24.676 1.00 14.03 ? 16  ILE A CG1 1 
ATOM   7    C  CG2 . ILE A 1 6   ? 54.061 -3.185  23.087 1.00 14.02 ? 16  ILE A CG2 1 
ATOM   8    C  CD1 . ILE A 1 6   ? 52.419 -0.825  23.937 1.00 12.76 ? 16  ILE A CD1 1 
ATOM   9    N  N   . VAL A 1 7   ? 52.495 -5.824  24.430 1.00 15.89 ? 17  VAL A N   1 
ATOM   10   C  CA  . VAL A 1 7   ? 52.757 -7.245  24.216 1.00 15.18 ? 17  VAL A CA  1 
ATOM   11   C  C   . VAL A 1 7   ? 53.287 -7.448  22.799 1.00 15.47 ? 17  VAL A C   1 
ATOM   12   O  O   . VAL A 1 7   ? 52.714 -6.934  21.839 1.00 15.74 ? 17  VAL A O   1 
ATOM   13   C  CB  . VAL A 1 7   ? 51.468 -8.088  24.392 1.00 15.96 ? 17  VAL A CB  1 
ATOM   14   C  CG1 . VAL A 1 7   ? 51.762 -9.568  24.139 1.00 15.77 ? 17  VAL A CG1 1 
ATOM   15   C  CG2 . VAL A 1 7   ? 50.910 -7.894  25.796 1.00 15.96 ? 17  VAL A CG2 1 
ATOM   16   N  N   . GLY A 1 8   ? 54.389 -8.183  22.677 1.00 16.14 ? 18  GLY A N   1 
ATOM   17   C  CA  . GLY A 1 8   ? 54.968 -8.447  21.371 1.00 15.83 ? 18  GLY A CA  1 
ATOM   18   C  C   . GLY A 1 8   ? 55.648 -7.257  20.721 1.00 17.13 ? 18  GLY A C   1 
ATOM   19   O  O   . GLY A 1 8   ? 55.800 -7.215  19.499 1.00 18.06 ? 18  GLY A O   1 
ATOM   20   N  N   . GLY A 1 9   ? 56.062 -6.288  21.531 1.00 16.89 ? 19  GLY A N   1 
ATOM   21   C  CA  . GLY A 1 9   ? 56.724 -5.110  20.996 1.00 15.52 ? 19  GLY A CA  1 
ATOM   22   C  C   . GLY A 1 9   ? 58.234 -5.171  21.136 1.00 16.75 ? 19  GLY A C   1 
ATOM   23   O  O   . GLY A 1 9   ? 58.810 -6.251  21.281 1.00 16.83 ? 19  GLY A O   1 
ATOM   24   N  N   . TYR A 1 10  ? 58.882 -4.011  21.093 1.00 15.78 ? 20  TYR A N   1 
ATOM   25   C  CA  . TYR A 1 10  ? 60.334 -3.944  21.213 1.00 16.06 ? 20  TYR A CA  1 
ATOM   26   C  C   . TYR A 1 10  ? 60.752 -2.769  22.090 1.00 16.80 ? 20  TYR A C   1 
ATOM   27   O  O   . TYR A 1 10  ? 59.965 -1.859  22.338 1.00 16.26 ? 20  TYR A O   1 
ATOM   28   C  CB  . TYR A 1 10  ? 60.974 -3.790  19.830 1.00 16.70 ? 20  TYR A CB  1 
ATOM   29   C  CG  . TYR A 1 10  ? 60.505 -2.571  19.063 1.00 17.55 ? 20  TYR A CG  1 
ATOM   30   C  CD1 . TYR A 1 10  ? 59.317 -2.594  18.332 1.00 18.73 ? 20  TYR A CD1 1 
ATOM   31   C  CD2 . TYR A 1 10  ? 61.241 -1.387  19.083 1.00 18.81 ? 20  TYR A CD2 1 
ATOM   32   C  CE1 . TYR A 1 10  ? 58.873 -1.463  17.641 1.00 18.63 ? 20  TYR A CE1 1 
ATOM   33   C  CE2 . TYR A 1 10  ? 60.806 -0.254  18.399 1.00 19.61 ? 20  TYR A CE2 1 
ATOM   34   C  CZ  . TYR A 1 10  ? 59.622 -0.298  17.682 1.00 19.06 ? 20  TYR A CZ  1 
ATOM   35   O  OH  . TYR A 1 10  ? 59.186 0.830   17.020 1.00 20.94 ? 20  TYR A OH  1 
ATOM   36   N  N   . THR A 1 11  ? 61.992 -2.794  22.564 1.00 16.41 ? 21  THR A N   1 
ATOM   37   C  CA  . THR A 1 11  ? 62.497 -1.704  23.388 1.00 16.00 ? 21  THR A CA  1 
ATOM   38   C  C   . THR A 1 11  ? 62.684 -0.491  22.485 1.00 15.70 ? 21  THR A C   1 
ATOM   39   O  O   . THR A 1 11  ? 63.448 -0.533  21.524 1.00 16.56 ? 21  THR A O   1 
ATOM   40   C  CB  . THR A 1 11  ? 63.841 -2.077  24.040 1.00 16.72 ? 21  THR A CB  1 
ATOM   41   O  OG1 . THR A 1 11  ? 63.656 -3.223  24.879 1.00 18.83 ? 21  THR A OG1 1 
ATOM   42   C  CG2 . THR A 1 11  ? 64.372 -0.921  24.877 1.00 15.73 ? 21  THR A CG2 1 
ATOM   43   N  N   . CYS A 1 12  ? 61.979 0.592   22.794 1.00 14.14 ? 22  CYS A N   1 
ATOM   44   C  CA  . CYS A 1 12  ? 62.051 1.805   21.988 1.00 13.96 ? 22  CYS A CA  1 
ATOM   45   C  C   . CYS A 1 12  ? 63.443 2.397   21.852 1.00 14.50 ? 22  CYS A C   1 
ATOM   46   O  O   . CYS A 1 12  ? 63.870 2.768   20.759 1.00 17.11 ? 22  CYS A O   1 
ATOM   47   C  CB  . CYS A 1 12  ? 61.178 2.896   22.582 1.00 13.95 ? 22  CYS A CB  1 
ATOM   48   S  SG  . CYS A 1 12  ? 59.433 2.524   22.905 1.00 11.75 ? 22  CYS A SG  1 
ATOM   49   N  N   . GLY A 1 13  ? 64.128 2.502   22.982 1.00 15.40 ? 23  GLY A N   1 
ATOM   50   C  CA  . GLY A 1 13  ? 65.443 3.109   23.016 1.00 16.44 ? 23  GLY A CA  1 
ATOM   51   C  C   . GLY A 1 13  ? 65.254 4.366   23.850 1.00 17.42 ? 23  GLY A C   1 
ATOM   52   O  O   . GLY A 1 13  ? 64.236 5.049   23.714 1.00 16.58 ? 23  GLY A O   1 
ATOM   53   N  N   . ALA A 1 14  ? 66.218 4.676   24.711 1.00 16.87 ? 24  ALA A N   1 
ATOM   54   C  CA  . ALA A 1 14  ? 66.118 5.844   25.579 1.00 18.07 ? 24  ALA A CA  1 
ATOM   55   C  C   . ALA A 1 14  ? 65.768 7.153   24.878 1.00 18.60 ? 24  ALA A C   1 
ATOM   56   O  O   . ALA A 1 14  ? 66.459 7.586   23.958 1.00 18.34 ? 24  ALA A O   1 
ATOM   57   C  CB  . ALA A 1 14  ? 67.415 6.016   26.373 1.00 19.33 ? 24  ALA A CB  1 
ATOM   58   N  N   . ASN A 1 15  ? 64.677 7.764   25.333 1.00 18.44 ? 25  ASN A N   1 
ATOM   59   C  CA  . ASN A 1 15  ? 64.189 9.046   24.830 1.00 19.14 ? 25  ASN A CA  1 
ATOM   60   C  C   . ASN A 1 15  ? 63.907 9.155   23.332 1.00 18.86 ? 25  ASN A C   1 
ATOM   61   O  O   . ASN A 1 15  ? 64.026 10.234  22.750 1.00 19.00 ? 25  ASN A O   1 
ATOM   62   C  CB  . ASN A 1 15  ? 65.159 10.148  25.254 1.00 20.35 ? 25  ASN A CB  1 
ATOM   63   C  CG  . ASN A 1 15  ? 65.422 10.138  26.745 1.00 22.20 ? 25  ASN A CG  1 
ATOM   64   O  OD1 . ASN A 1 15  ? 64.519 10.385  27.548 1.00 25.28 ? 25  ASN A OD1 1 
ATOM   65   N  ND2 . ASN A 1 15  ? 66.656 9.836   27.126 1.00 22.82 ? 25  ASN A ND2 1 
ATOM   66   N  N   . THR A 1 16  ? 63.519 8.049   22.711 1.00 16.46 ? 26  THR A N   1 
ATOM   67   C  CA  . THR A 1 16  ? 63.206 8.059   21.288 1.00 15.78 ? 26  THR A CA  1 
ATOM   68   C  C   . THR A 1 16  ? 61.737 8.425   21.072 1.00 14.71 ? 26  THR A C   1 
ATOM   69   O  O   . THR A 1 16  ? 61.292 8.625   19.943 1.00 13.59 ? 26  THR A O   1 
ATOM   70   C  CB  . THR A 1 16  ? 63.492 6.692   20.652 1.00 17.13 ? 26  THR A CB  1 
ATOM   71   O  OG1 . THR A 1 16  ? 62.799 5.671   21.380 1.00 17.30 ? 26  THR A OG1 1 
ATOM   72   C  CG2 . THR A 1 16  ? 64.989 6.403   20.675 1.00 18.75 ? 26  THR A CG2 1 
ATOM   73   N  N   . VAL A 1 17  ? 60.991 8.506   22.171 1.00 13.03 ? 27  VAL A N   1 
ATOM   74   C  CA  . VAL A 1 17  ? 59.573 8.867   22.143 1.00 12.08 ? 27  VAL A CA  1 
ATOM   75   C  C   . VAL A 1 17  ? 59.464 9.985   23.178 1.00 12.57 ? 27  VAL A C   1 
ATOM   76   O  O   . VAL A 1 17  ? 58.906 9.796   24.262 1.00 11.34 ? 27  VAL A O   1 
ATOM   77   C  CB  . VAL A 1 17  ? 58.685 7.674   22.571 1.00 12.71 ? 27  VAL A CB  1 
ATOM   78   C  CG1 . VAL A 1 17  ? 57.215 8.009   22.337 1.00 10.73 ? 27  VAL A CG1 1 
ATOM   79   C  CG2 . VAL A 1 17  ? 59.082 6.420   21.796 1.00 11.93 ? 27  VAL A CG2 1 
ATOM   80   N  N   . PRO A 1 18  ? 59.998 11.171  22.844 1.00 12.64 ? 28  PRO A N   1 
ATOM   81   C  CA  . PRO A 1 18  ? 60.025 12.369  23.691 1.00 12.47 ? 28  PRO A CA  1 
ATOM   82   C  C   . PRO A 1 18  ? 58.721 12.909  24.259 1.00 11.24 ? 28  PRO A C   1 
ATOM   83   O  O   . PRO A 1 18  ? 58.736 13.604  25.273 1.00 11.16 ? 28  PRO A O   1 
ATOM   84   C  CB  . PRO A 1 18  ? 60.747 13.392  22.812 1.00 13.86 ? 28  PRO A CB  1 
ATOM   85   C  CG  . PRO A 1 18  ? 60.335 12.998  21.438 1.00 15.86 ? 28  PRO A CG  1 
ATOM   86   C  CD  . PRO A 1 18  ? 60.468 11.493  21.482 1.00 14.13 ? 28  PRO A CD  1 
ATOM   87   N  N   . TYR A 1 19  ? 57.600 12.596  23.619 1.00 9.13  ? 29  TYR A N   1 
ATOM   88   C  CA  . TYR A 1 19  ? 56.302 13.081  24.082 1.00 8.83  ? 29  TYR A CA  1 
ATOM   89   C  C   . TYR A 1 19  ? 55.620 12.129  25.060 1.00 9.25  ? 29  TYR A C   1 
ATOM   90   O  O   . TYR A 1 19  ? 54.574 12.457  25.621 1.00 9.95  ? 29  TYR A O   1 
ATOM   91   C  CB  . TYR A 1 19  ? 55.390 13.319  22.876 1.00 8.81  ? 29  TYR A CB  1 
ATOM   92   C  CG  . TYR A 1 19  ? 55.324 12.125  21.953 1.00 8.11  ? 29  TYR A CG  1 
ATOM   93   C  CD1 . TYR A 1 19  ? 54.498 11.039  22.243 1.00 9.15  ? 29  TYR A CD1 1 
ATOM   94   C  CD2 . TYR A 1 19  ? 56.127 12.059  20.814 1.00 10.10 ? 29  TYR A CD2 1 
ATOM   95   C  CE1 . TYR A 1 19  ? 54.476 9.913   21.424 1.00 9.89  ? 29  TYR A CE1 1 
ATOM   96   C  CE2 . TYR A 1 19  ? 56.114 10.941  19.989 1.00 11.25 ? 29  TYR A CE2 1 
ATOM   97   C  CZ  . TYR A 1 19  ? 55.289 9.873   20.298 1.00 11.49 ? 29  TYR A CZ  1 
ATOM   98   O  OH  . TYR A 1 19  ? 55.281 8.765   19.485 1.00 12.07 ? 29  TYR A OH  1 
ATOM   99   N  N   . GLN A 1 20  ? 56.207 10.953  25.265 1.00 9.14  ? 30  GLN A N   1 
ATOM   100  C  CA  . GLN A 1 20  ? 55.623 9.971   26.174 1.00 8.50  ? 30  GLN A CA  1 
ATOM   101  C  C   . GLN A 1 20  ? 55.811 10.366  27.634 1.00 10.24 ? 30  GLN A C   1 
ATOM   102  O  O   . GLN A 1 20  ? 56.913 10.726  28.054 1.00 10.71 ? 30  GLN A O   1 
ATOM   103  C  CB  . GLN A 1 20  ? 56.252 8.588   25.947 1.00 9.34  ? 30  GLN A CB  1 
ATOM   104  C  CG  . GLN A 1 20  ? 55.855 7.536   26.989 1.00 9.89  ? 30  GLN A CG  1 
ATOM   105  C  CD  . GLN A 1 20  ? 54.533 6.848   26.680 1.00 10.29 ? 30  GLN A CD  1 
ATOM   106  O  OE1 . GLN A 1 20  ? 53.660 6.718   27.546 1.00 13.61 ? 30  GLN A OE1 1 
ATOM   107  N  NE2 . GLN A 1 20  ? 54.385 6.389   25.449 1.00 9.67  ? 30  GLN A NE2 1 
ATOM   108  N  N   . VAL A 1 21  ? 54.733 10.304  28.407 1.00 9.14  ? 31  VAL A N   1 
ATOM   109  C  CA  . VAL A 1 21  ? 54.826 10.626  29.824 1.00 11.16 ? 31  VAL A CA  1 
ATOM   110  C  C   . VAL A 1 21  ? 54.288 9.470   30.650 1.00 10.37 ? 31  VAL A C   1 
ATOM   111  O  O   . VAL A 1 21  ? 53.519 8.639   30.161 1.00 9.48  ? 31  VAL A O   1 
ATOM   112  C  CB  . VAL A 1 21  ? 54.031 11.908  30.194 1.00 14.68 ? 31  VAL A CB  1 
ATOM   113  C  CG1 . VAL A 1 21  ? 54.332 13.013  29.193 1.00 16.62 ? 31  VAL A CG1 1 
ATOM   114  C  CG2 . VAL A 1 21  ? 52.545 11.619  30.244 1.00 14.33 ? 31  VAL A CG2 1 
ATOM   115  N  N   . SER A 1 22  ? 54.717 9.413   31.903 1.00 9.41  ? 32  SER A N   1 
ATOM   116  C  CA  . SER A 1 22  ? 54.262 8.386   32.824 1.00 9.70  ? 32  SER A CA  1 
ATOM   117  C  C   . SER A 1 22  ? 53.508 9.096   33.937 1.00 9.59  ? 32  SER A C   1 
ATOM   118  O  O   . SER A 1 22  ? 54.025 10.053  34.514 1.00 10.10 ? 32  SER A O   1 
ATOM   119  C  CB  . SER A 1 22  ? 55.456 7.633   33.420 1.00 10.15 ? 32  SER A CB  1 
ATOM   120  O  OG  . SER A 1 22  ? 55.061 6.867   34.550 1.00 12.59 ? 32  SER A OG  1 
ATOM   121  N  N   . LEU A 1 23  ? 52.282 8.654   34.215 1.00 8.72  ? 33  LEU A N   1 
ATOM   122  C  CA  . LEU A 1 23  ? 51.499 9.241   35.295 1.00 8.78  ? 33  LEU A CA  1 
ATOM   123  C  C   . LEU A 1 23  ? 51.868 8.388   36.499 1.00 9.15  ? 33  LEU A C   1 
ATOM   124  O  O   . LEU A 1 23  ? 51.752 7.162   36.461 1.00 9.99  ? 33  LEU A O   1 
ATOM   125  C  CB  . LEU A 1 23  ? 49.998 9.168   34.992 1.00 7.47  ? 33  LEU A CB  1 
ATOM   126  C  CG  . LEU A 1 23  ? 49.570 9.895   33.708 1.00 8.66  ? 33  LEU A CG  1 
ATOM   127  C  CD1 . LEU A 1 23  ? 48.052 9.917   33.624 1.00 9.91  ? 33  LEU A CD1 1 
ATOM   128  C  CD2 . LEU A 1 23  ? 50.119 11.321  33.688 1.00 10.52 ? 33  LEU A CD2 1 
ATOM   129  N  N   . ASN A 1 24  ? 52.306 9.045   37.565 1.00 9.25  ? 34  ASN A N   1 
ATOM   130  C  CA  . ASN A 1 24  ? 52.791 8.352   38.752 1.00 9.57  ? 34  ASN A CA  1 
ATOM   131  C  C   . ASN A 1 24  ? 52.116 8.776   40.056 1.00 10.79 ? 34  ASN A C   1 
ATOM   132  O  O   . ASN A 1 24  ? 51.903 9.963   40.298 1.00 12.58 ? 34  ASN A O   1 
ATOM   133  C  CB  . ASN A 1 24  ? 54.303 8.609   38.840 1.00 9.93  ? 34  ASN A CB  1 
ATOM   134  C  CG  . ASN A 1 24  ? 54.983 7.826   39.944 1.00 11.20 ? 34  ASN A CG  1 
ATOM   135  O  OD1 . ASN A 1 24  ? 55.661 6.824   39.687 1.00 14.01 ? 34  ASN A OD1 1 
ATOM   136  N  ND2 . ASN A 1 24  ? 54.815 8.279   41.177 1.00 10.00 ? 34  ASN A ND2 1 
ATOM   137  N  N   . SER A 1 25  ? 51.789 7.794   40.890 1.00 12.62 ? 37  SER A N   1 
ATOM   138  C  CA  . SER A 1 25  ? 51.183 8.048   42.199 1.00 12.95 ? 37  SER A CA  1 
ATOM   139  C  C   . SER A 1 25  ? 51.857 7.097   43.187 1.00 14.16 ? 37  SER A C   1 
ATOM   140  O  O   . SER A 1 25  ? 51.197 6.428   43.983 1.00 15.56 ? 37  SER A O   1 
ATOM   141  C  CB  . SER A 1 25  ? 49.667 7.797   42.159 1.00 14.04 ? 37  SER A CB  1 
ATOM   142  O  OG  . SER A 1 25  ? 49.366 6.449   41.837 1.00 15.82 ? 37  SER A OG  1 
ATOM   143  N  N   . GLY A 1 26  ? 53.185 7.051   43.129 1.00 14.03 ? 38  GLY A N   1 
ATOM   144  C  CA  . GLY A 1 26  ? 53.940 6.158   43.989 1.00 14.46 ? 38  GLY A CA  1 
ATOM   145  C  C   . GLY A 1 26  ? 54.295 4.918   43.189 1.00 13.54 ? 38  GLY A C   1 
ATOM   146  O  O   . GLY A 1 26  ? 54.973 4.008   43.665 1.00 13.63 ? 38  GLY A O   1 
ATOM   147  N  N   . TYR A 1 27  ? 53.814 4.899   41.950 1.00 12.85 ? 39  TYR A N   1 
ATOM   148  C  CA  . TYR A 1 27  ? 54.049 3.813   41.008 1.00 11.86 ? 39  TYR A CA  1 
ATOM   149  C  C   . TYR A 1 27  ? 53.450 4.254   39.677 1.00 11.67 ? 39  TYR A C   1 
ATOM   150  O  O   . TYR A 1 27  ? 52.590 5.133   39.644 1.00 11.24 ? 39  TYR A O   1 
ATOM   151  C  CB  . TYR A 1 27  ? 53.365 2.517   41.464 1.00 13.41 ? 39  TYR A CB  1 
ATOM   152  C  CG  . TYR A 1 27  ? 51.868 2.649   41.660 1.00 13.59 ? 39  TYR A CG  1 
ATOM   153  C  CD1 . TYR A 1 27  ? 51.346 3.212   42.823 1.00 13.47 ? 39  TYR A CD1 1 
ATOM   154  C  CD2 . TYR A 1 27  ? 50.977 2.245   40.665 1.00 14.35 ? 39  TYR A CD2 1 
ATOM   155  C  CE1 . TYR A 1 27  ? 49.973 3.372   42.991 1.00 14.83 ? 39  TYR A CE1 1 
ATOM   156  C  CE2 . TYR A 1 27  ? 49.603 2.402   40.823 1.00 15.99 ? 39  TYR A CE2 1 
ATOM   157  C  CZ  . TYR A 1 27  ? 49.110 2.966   41.987 1.00 17.85 ? 39  TYR A CZ  1 
ATOM   158  O  OH  . TYR A 1 27  ? 47.750 3.121   42.149 1.00 20.44 ? 39  TYR A OH  1 
ATOM   159  N  N   . HIS A 1 28  ? 53.910 3.654   38.586 1.00 10.08 ? 40  HIS A N   1 
ATOM   160  C  CA  . HIS A 1 28  ? 53.388 3.985   37.261 1.00 11.12 ? 40  HIS A CA  1 
ATOM   161  C  C   . HIS A 1 28  ? 52.001 3.363   37.100 1.00 11.05 ? 40  HIS A C   1 
ATOM   162  O  O   . HIS A 1 28  ? 51.843 2.160   37.298 1.00 10.90 ? 40  HIS A O   1 
ATOM   163  C  CB  . HIS A 1 28  ? 54.308 3.425   36.178 1.00 10.58 ? 40  HIS A CB  1 
ATOM   164  C  CG  . HIS A 1 28  ? 53.709 3.453   34.807 1.00 11.74 ? 40  HIS A CG  1 
ATOM   165  N  ND1 . HIS A 1 28  ? 53.725 4.575   34.008 1.00 9.83  ? 40  HIS A ND1 1 
ATOM   166  C  CD2 . HIS A 1 28  ? 53.036 2.505   34.112 1.00 11.95 ? 40  HIS A CD2 1 
ATOM   167  C  CE1 . HIS A 1 28  ? 53.089 4.317   32.878 1.00 12.32 ? 40  HIS A CE1 1 
ATOM   168  N  NE2 . HIS A 1 28  ? 52.660 3.068   32.917 1.00 11.22 ? 40  HIS A NE2 1 
ATOM   169  N  N   . PHE A 1 29  ? 51.002 4.162   36.734 1.00 10.76 ? 41  PHE A N   1 
ATOM   170  C  CA  . PHE A 1 29  ? 49.654 3.615   36.563 1.00 12.23 ? 41  PHE A CA  1 
ATOM   171  C  C   . PHE A 1 29  ? 49.009 3.899   35.203 1.00 12.21 ? 41  PHE A C   1 
ATOM   172  O  O   . PHE A 1 29  ? 48.035 3.251   34.835 1.00 12.28 ? 41  PHE A O   1 
ATOM   173  C  CB  . PHE A 1 29  ? 48.732 4.093   37.696 1.00 12.45 ? 41  PHE A CB  1 
ATOM   174  C  CG  . PHE A 1 29  ? 48.364 5.550   37.623 1.00 12.49 ? 41  PHE A CG  1 
ATOM   175  C  CD1 . PHE A 1 29  ? 47.277 5.970   36.860 1.00 11.62 ? 41  PHE A CD1 1 
ATOM   176  C  CD2 . PHE A 1 29  ? 49.097 6.502   38.326 1.00 12.83 ? 41  PHE A CD2 1 
ATOM   177  C  CE1 . PHE A 1 29  ? 46.926 7.316   36.801 1.00 12.58 ? 41  PHE A CE1 1 
ATOM   178  C  CE2 . PHE A 1 29  ? 48.755 7.851   38.274 1.00 13.54 ? 41  PHE A CE2 1 
ATOM   179  C  CZ  . PHE A 1 29  ? 47.664 8.259   37.508 1.00 14.13 ? 41  PHE A CZ  1 
ATOM   180  N  N   . CYS A 1 30  ? 49.545 4.865   34.462 1.00 10.94 ? 42  CYS A N   1 
ATOM   181  C  CA  . CYS A 1 30  ? 49.006 5.195   33.137 1.00 10.81 ? 42  CYS A CA  1 
ATOM   182  C  C   . CYS A 1 30  ? 50.010 5.987   32.324 1.00 9.95  ? 42  CYS A C   1 
ATOM   183  O  O   . CYS A 1 30  ? 50.943 6.565   32.871 1.00 10.66 ? 42  CYS A O   1 
ATOM   184  C  CB  . CYS A 1 30  ? 47.728 6.033   33.245 1.00 11.39 ? 42  CYS A CB  1 
ATOM   185  S  SG  . CYS A 1 30  ? 46.148 5.139   33.434 1.00 10.85 ? 42  CYS A SG  1 
ATOM   186  N  N   . GLY A 1 31  ? 49.807 6.004   31.010 1.00 9.20  ? 43  GLY A N   1 
ATOM   187  C  CA  . GLY A 1 31  ? 50.675 6.763   30.136 1.00 8.28  ? 43  GLY A CA  1 
ATOM   188  C  C   . GLY A 1 31  ? 49.973 8.060   29.776 1.00 8.92  ? 43  GLY A C   1 
ATOM   189  O  O   . GLY A 1 31  ? 48.849 8.317   30.219 1.00 8.05  ? 43  GLY A O   1 
ATOM   190  N  N   . GLY A 1 32  ? 50.636 8.882   28.973 1.00 8.31  ? 44  GLY A N   1 
ATOM   191  C  CA  . GLY A 1 32  ? 50.056 10.144  28.556 1.00 8.49  ? 44  GLY A CA  1 
ATOM   192  C  C   . GLY A 1 32  ? 50.923 10.738  27.466 1.00 8.61  ? 44  GLY A C   1 
ATOM   193  O  O   . GLY A 1 32  ? 52.003 10.217  27.190 1.00 8.42  ? 44  GLY A O   1 
ATOM   194  N  N   . SER A 1 33  ? 50.459 11.821  26.848 1.00 8.47  ? 45  SER A N   1 
ATOM   195  C  CA  . SER A 1 33  ? 51.212 12.473  25.784 1.00 9.36  ? 45  SER A CA  1 
ATOM   196  C  C   . SER A 1 33  ? 51.317 13.966  26.049 1.00 9.33  ? 45  SER A C   1 
ATOM   197  O  O   . SER A 1 33  ? 50.337 14.605  26.409 1.00 8.94  ? 45  SER A O   1 
ATOM   198  C  CB  . SER A 1 33  ? 50.524 12.255  24.431 1.00 11.03 ? 45  SER A CB  1 
ATOM   199  O  OG  . SER A 1 33  ? 50.392 10.879  24.143 1.00 15.77 ? 45  SER A OG  1 
ATOM   200  N  N   . LEU A 1 34  ? 52.512 14.516  25.865 1.00 8.11  ? 46  LEU A N   1 
ATOM   201  C  CA  . LEU A 1 34  ? 52.740 15.944  26.071 1.00 9.73  ? 46  LEU A CA  1 
ATOM   202  C  C   . LEU A 1 34  ? 52.336 16.675  24.790 1.00 9.77  ? 46  LEU A C   1 
ATOM   203  O  O   . LEU A 1 34  ? 52.905 16.416  23.731 1.00 12.96 ? 46  LEU A O   1 
ATOM   204  C  CB  . LEU A 1 34  ? 54.225 16.192  26.362 1.00 8.77  ? 46  LEU A CB  1 
ATOM   205  C  CG  . LEU A 1 34  ? 54.628 17.613  26.755 1.00 10.78 ? 46  LEU A CG  1 
ATOM   206  C  CD1 . LEU A 1 34  ? 54.016 17.946  28.105 1.00 10.26 ? 46  LEU A CD1 1 
ATOM   207  C  CD2 . LEU A 1 34  ? 56.150 17.724  26.829 1.00 13.19 ? 46  LEU A CD2 1 
ATOM   208  N  N   . ILE A 1 35  ? 51.369 17.586  24.873 1.00 10.94 ? 47  ILE A N   1 
ATOM   209  C  CA  . ILE A 1 35  ? 50.936 18.304  23.674 1.00 12.19 ? 47  ILE A CA  1 
ATOM   210  C  C   . ILE A 1 35  ? 51.443 19.744  23.595 1.00 13.04 ? 47  ILE A C   1 
ATOM   211  O  O   . ILE A 1 35  ? 51.351 20.381  22.552 1.00 12.85 ? 47  ILE A O   1 
ATOM   212  C  CB  . ILE A 1 35  ? 49.398 18.263  23.501 1.00 12.34 ? 47  ILE A CB  1 
ATOM   213  C  CG1 . ILE A 1 35  ? 48.696 18.859  24.716 1.00 13.67 ? 47  ILE A CG1 1 
ATOM   214  C  CG2 . ILE A 1 35  ? 48.957 16.821  23.269 1.00 13.22 ? 47  ILE A CG2 1 
ATOM   215  C  CD1 . ILE A 1 35  ? 47.182 18.909  24.562 1.00 17.92 ? 47  ILE A CD1 1 
ATOM   216  N  N   . ASN A 1 36  ? 51.956 20.248  24.711 1.00 14.23 ? 48  ASN A N   1 
ATOM   217  C  CA  . ASN A 1 36  ? 52.585 21.570  24.781 1.00 15.25 ? 48  ASN A CA  1 
ATOM   218  C  C   . ASN A 1 36  ? 53.323 21.633  26.113 1.00 14.98 ? 48  ASN A C   1 
ATOM   219  O  O   . ASN A 1 36  ? 53.260 20.681  26.891 1.00 14.95 ? 48  ASN A O   1 
ATOM   220  C  CB  . ASN A 1 36  ? 51.590 22.740  24.599 1.00 17.31 ? 48  ASN A CB  1 
ATOM   221  C  CG  . ASN A 1 36  ? 50.548 22.831  25.691 1.00 19.26 ? 48  ASN A CG  1 
ATOM   222  O  OD1 . ASN A 1 36  ? 50.865 22.873  26.876 1.00 20.12 ? 48  ASN A OD1 1 
ATOM   223  N  ND2 . ASN A 1 36  ? 49.282 22.896  25.285 1.00 22.05 ? 48  ASN A ND2 1 
ATOM   224  N  N   . SER A 1 37  ? 54.028 22.726  26.384 1.00 14.97 ? 49  SER A N   1 
ATOM   225  C  CA  . SER A 1 37  ? 54.811 22.818  27.613 1.00 16.81 ? 49  SER A CA  1 
ATOM   226  C  C   . SER A 1 37  ? 54.055 22.675  28.928 1.00 16.02 ? 49  SER A C   1 
ATOM   227  O  O   . SER A 1 37  ? 54.661 22.366  29.954 1.00 16.60 ? 49  SER A O   1 
ATOM   228  C  CB  . SER A 1 37  ? 55.608 24.128  27.640 1.00 17.36 ? 49  SER A CB  1 
ATOM   229  O  OG  . SER A 1 37  ? 54.745 25.238  27.778 1.00 21.00 ? 49  SER A OG  1 
ATOM   230  N  N   . GLN A 1 38  ? 52.743 22.885  28.914 1.00 16.50 ? 50  GLN A N   1 
ATOM   231  C  CA  . GLN A 1 38  ? 51.980 22.787  30.154 1.00 16.31 ? 50  GLN A CA  1 
ATOM   232  C  C   . GLN A 1 38  ? 50.820 21.805  30.164 1.00 13.65 ? 50  GLN A C   1 
ATOM   233  O  O   . GLN A 1 38  ? 50.160 21.667  31.188 1.00 12.79 ? 50  GLN A O   1 
ATOM   234  C  CB  . GLN A 1 38  ? 51.426 24.157  30.555 1.00 20.64 ? 50  GLN A CB  1 
ATOM   235  C  CG  . GLN A 1 38  ? 52.459 25.163  31.016 1.00 28.92 ? 50  GLN A CG  1 
ATOM   236  C  CD  . GLN A 1 38  ? 51.827 26.328  31.759 1.00 32.19 ? 50  GLN A CD  1 
ATOM   237  O  OE1 . GLN A 1 38  ? 51.288 26.162  32.856 1.00 34.88 ? 50  GLN A OE1 1 
ATOM   238  N  NE2 . GLN A 1 38  ? 51.883 27.511  31.162 1.00 35.16 ? 50  GLN A NE2 1 
ATOM   239  N  N   . TRP A 1 39  ? 50.563 21.128  29.047 1.00 12.26 ? 51  TRP A N   1 
ATOM   240  C  CA  . TRP A 1 39  ? 49.438 20.200  28.999 1.00 12.00 ? 51  TRP A CA  1 
ATOM   241  C  C   . TRP A 1 39  ? 49.741 18.791  28.508 1.00 11.13 ? 51  TRP A C   1 
ATOM   242  O  O   . TRP A 1 39  ? 50.509 18.588  27.569 1.00 11.63 ? 51  TRP A O   1 
ATOM   243  C  CB  . TRP A 1 39  ? 48.308 20.783  28.145 1.00 11.55 ? 51  TRP A CB  1 
ATOM   244  C  CG  . TRP A 1 39  ? 47.672 22.016  28.720 1.00 13.26 ? 51  TRP A CG  1 
ATOM   245  C  CD1 . TRP A 1 39  ? 48.116 23.305  28.602 1.00 13.58 ? 51  TRP A CD1 1 
ATOM   246  C  CD2 . TRP A 1 39  ? 46.461 22.077  29.482 1.00 13.04 ? 51  TRP A CD2 1 
ATOM   247  N  NE1 . TRP A 1 39  ? 47.250 24.165  29.239 1.00 13.58 ? 51  TRP A NE1 1 
ATOM   248  C  CE2 . TRP A 1 39  ? 46.225 23.439  29.787 1.00 14.72 ? 51  TRP A CE2 1 
ATOM   249  C  CE3 . TRP A 1 39  ? 45.549 21.114  29.935 1.00 14.40 ? 51  TRP A CE3 1 
ATOM   250  C  CZ2 . TRP A 1 39  ? 45.110 23.861  30.525 1.00 14.61 ? 51  TRP A CZ2 1 
ATOM   251  C  CZ3 . TRP A 1 39  ? 44.440 21.534  30.670 1.00 14.34 ? 51  TRP A CZ3 1 
ATOM   252  C  CH2 . TRP A 1 39  ? 44.232 22.897  30.956 1.00 15.97 ? 51  TRP A CH2 1 
ATOM   253  N  N   . VAL A 1 40  ? 49.093 17.826  29.151 1.00 10.84 ? 52  VAL A N   1 
ATOM   254  C  CA  . VAL A 1 40  ? 49.232 16.414  28.826 1.00 10.32 ? 52  VAL A CA  1 
ATOM   255  C  C   . VAL A 1 40  ? 47.848 15.846  28.539 1.00 11.49 ? 52  VAL A C   1 
ATOM   256  O  O   . VAL A 1 40  ? 46.876 16.211  29.198 1.00 11.54 ? 52  VAL A O   1 
ATOM   257  C  CB  . VAL A 1 40  ? 49.839 15.630  30.017 1.00 11.35 ? 52  VAL A CB  1 
ATOM   258  C  CG1 . VAL A 1 40  ? 49.693 14.126  29.793 1.00 11.15 ? 52  VAL A CG1 1 
ATOM   259  C  CG2 . VAL A 1 40  ? 51.300 15.999  30.186 1.00 11.07 ? 52  VAL A CG2 1 
ATOM   260  N  N   . VAL A 1 41  ? 47.756 14.968  27.546 1.00 11.26 ? 53  VAL A N   1 
ATOM   261  C  CA  . VAL A 1 41  ? 46.485 14.336  27.231 1.00 11.59 ? 53  VAL A CA  1 
ATOM   262  C  C   . VAL A 1 41  ? 46.598 12.865  27.628 1.00 10.48 ? 53  VAL A C   1 
ATOM   263  O  O   . VAL A 1 41  ? 47.614 12.219  27.369 1.00 9.29  ? 53  VAL A O   1 
ATOM   264  C  CB  . VAL A 1 41  ? 46.147 14.435  25.724 1.00 14.14 ? 53  VAL A CB  1 
ATOM   265  C  CG1 . VAL A 1 41  ? 47.229 13.773  24.902 1.00 18.79 ? 53  VAL A CG1 1 
ATOM   266  C  CG2 . VAL A 1 41  ? 44.805 13.775  25.454 1.00 17.41 ? 53  VAL A CG2 1 
ATOM   267  N  N   . SER A 1 42  ? 45.564 12.345  28.275 1.00 8.14  ? 54  SER A N   1 
ATOM   268  C  CA  . SER A 1 42  ? 45.566 10.945  28.696 1.00 7.70  ? 54  SER A CA  1 
ATOM   269  C  C   . SER A 1 42  ? 44.133 10.429  28.606 1.00 7.73  ? 54  SER A C   1 
ATOM   270  O  O   . SER A 1 42  ? 43.284 11.064  27.977 1.00 7.93  ? 54  SER A O   1 
ATOM   271  C  CB  . SER A 1 42  ? 46.106 10.829  30.130 1.00 7.17  ? 54  SER A CB  1 
ATOM   272  O  OG  . SER A 1 42  ? 46.230 9.479   30.541 1.00 9.52  ? 54  SER A OG  1 
ATOM   273  N  N   . ALA A 1 43  ? 43.870 9.277   29.213 1.00 7.64  ? 55  ALA A N   1 
ATOM   274  C  CA  . ALA A 1 43  ? 42.533 8.694   29.195 1.00 7.84  ? 55  ALA A CA  1 
ATOM   275  C  C   . ALA A 1 43  ? 41.757 9.118   30.438 1.00 8.33  ? 55  ALA A C   1 
ATOM   276  O  O   . ALA A 1 43  ? 42.330 9.270   31.517 1.00 8.72  ? 55  ALA A O   1 
ATOM   277  C  CB  . ALA A 1 43  ? 42.630 7.177   29.142 1.00 8.24  ? 55  ALA A CB  1 
ATOM   278  N  N   . ALA A 1 44  ? 40.451 9.302   30.285 1.00 8.57  ? 56  ALA A N   1 
ATOM   279  C  CA  . ALA A 1 44  ? 39.613 9.695   31.408 1.00 9.13  ? 56  ALA A CA  1 
ATOM   280  C  C   . ALA A 1 44  ? 39.596 8.625   32.498 1.00 10.00 ? 56  ALA A C   1 
ATOM   281  O  O   . ALA A 1 44  ? 39.476 8.948   33.680 1.00 9.97  ? 56  ALA A O   1 
ATOM   282  C  CB  . ALA A 1 44  ? 38.191 9.975   30.927 1.00 8.13  ? 56  ALA A CB  1 
ATOM   283  N  N   . HIS A 1 45  ? 39.718 7.353   32.122 1.00 11.63 ? 57  HIS A N   1 
ATOM   284  C  CA  . HIS A 1 45  ? 39.688 6.309   33.142 1.00 11.47 ? 57  HIS A CA  1 
ATOM   285  C  C   . HIS A 1 45  ? 40.959 6.274   33.986 1.00 12.75 ? 57  HIS A C   1 
ATOM   286  O  O   . HIS A 1 45  ? 41.054 5.514   34.946 1.00 13.09 ? 57  HIS A O   1 
ATOM   287  C  CB  . HIS A 1 45  ? 39.400 4.920   32.530 1.00 13.01 ? 57  HIS A CB  1 
ATOM   288  C  CG  . HIS A 1 45  ? 40.545 4.319   31.771 1.00 14.16 ? 57  HIS A CG  1 
ATOM   289  N  ND1 . HIS A 1 45  ? 40.693 4.456   30.407 1.00 14.59 ? 57  HIS A ND1 1 
ATOM   290  C  CD2 . HIS A 1 45  ? 41.575 3.540   32.183 1.00 15.75 ? 57  HIS A CD2 1 
ATOM   291  C  CE1 . HIS A 1 45  ? 41.761 3.786   30.010 1.00 13.90 ? 57  HIS A CE1 1 
ATOM   292  N  NE2 . HIS A 1 45  ? 42.314 3.221   31.069 1.00 16.37 ? 57  HIS A NE2 1 
ATOM   293  N  N   . CYS A 1 46  ? 41.925 7.116   33.634 1.00 10.51 ? 58  CYS A N   1 
ATOM   294  C  CA  . CYS A 1 46  ? 43.182 7.197   34.373 1.00 12.33 ? 58  CYS A CA  1 
ATOM   295  C  C   . CYS A 1 46  ? 43.101 8.259   35.461 1.00 12.90 ? 58  CYS A C   1 
ATOM   296  O  O   . CYS A 1 46  ? 44.057 8.475   36.197 1.00 14.29 ? 58  CYS A O   1 
ATOM   297  C  CB  . CYS A 1 46  ? 44.331 7.557   33.436 1.00 10.58 ? 58  CYS A CB  1 
ATOM   298  S  SG  . CYS A 1 46  ? 44.855 6.231   32.313 1.00 12.68 ? 58  CYS A SG  1 
ATOM   299  N  N   . TYR A 1 47  ? 41.963 8.931   35.555 1.00 13.26 ? 59  TYR A N   1 
ATOM   300  C  CA  . TYR A 1 47  ? 41.813 9.977   36.553 1.00 15.24 ? 59  TYR A CA  1 
ATOM   301  C  C   . TYR A 1 47  ? 41.956 9.501   37.994 1.00 15.43 ? 59  TYR A C   1 
ATOM   302  O  O   . TYR A 1 47  ? 41.485 8.429   38.364 1.00 15.09 ? 59  TYR A O   1 
ATOM   303  C  CB  . TYR A 1 47  ? 40.459 10.674  36.417 1.00 16.65 ? 59  TYR A CB  1 
ATOM   304  C  CG  . TYR A 1 47  ? 40.226 11.673  37.525 1.00 18.27 ? 59  TYR A CG  1 
ATOM   305  C  CD1 . TYR A 1 47  ? 40.844 12.923  37.505 1.00 19.59 ? 59  TYR A CD1 1 
ATOM   306  C  CD2 . TYR A 1 47  ? 39.457 11.335  38.638 1.00 20.86 ? 59  TYR A CD2 1 
ATOM   307  C  CE1 . TYR A 1 47  ? 40.704 13.810  38.572 1.00 22.30 ? 59  TYR A CE1 1 
ATOM   308  C  CE2 . TYR A 1 47  ? 39.315 12.211  39.706 1.00 21.93 ? 59  TYR A CE2 1 
ATOM   309  C  CZ  . TYR A 1 47  ? 39.941 13.443  39.668 1.00 22.93 ? 59  TYR A CZ  1 
ATOM   310  O  OH  . TYR A 1 47  ? 39.813 14.300  40.734 1.00 26.87 ? 59  TYR A OH  1 
ATOM   311  N  N   . LYS A 1 48  ? 42.613 10.330  38.795 1.00 17.22 ? 60  LYS A N   1 
ATOM   312  C  CA  . LYS A 1 48  ? 42.798 10.086  40.220 1.00 19.20 ? 60  LYS A CA  1 
ATOM   313  C  C   . LYS A 1 48  ? 43.488 11.319  40.782 1.00 19.73 ? 60  LYS A C   1 
ATOM   314  O  O   . LYS A 1 48  ? 44.098 12.088  40.038 1.00 19.14 ? 60  LYS A O   1 
ATOM   315  C  CB  . LYS A 1 48  ? 43.643 8.831   40.467 1.00 21.51 ? 60  LYS A CB  1 
ATOM   316  C  CG  . LYS A 1 48  ? 45.100 8.960   40.088 1.00 23.50 ? 60  LYS A CG  1 
ATOM   317  C  CD  . LYS A 1 48  ? 45.790 7.599   40.070 1.00 27.20 ? 60  LYS A CD  1 
ATOM   318  C  CE  . LYS A 1 48  ? 45.732 6.894   41.406 1.00 28.21 ? 60  LYS A CE  1 
ATOM   319  N  NZ  . LYS A 1 48  ? 46.433 5.576   41.332 1.00 28.66 ? 60  LYS A NZ  1 
ATOM   320  N  N   . SER A 1 49  ? 43.374 11.532  42.086 1.00 20.99 ? 61  SER A N   1 
ATOM   321  C  CA  . SER A 1 49  ? 44.015 12.688  42.693 1.00 22.80 ? 61  SER A CA  1 
ATOM   322  C  C   . SER A 1 49  ? 45.468 12.346  43.013 1.00 22.30 ? 61  SER A C   1 
ATOM   323  O  O   . SER A 1 49  ? 45.846 11.175  43.033 1.00 23.80 ? 61  SER A O   1 
ATOM   324  C  CB  . SER A 1 49  ? 43.271 13.094  43.969 1.00 25.24 ? 61  SER A CB  1 
ATOM   325  O  OG  . SER A 1 49  ? 43.213 12.020  44.891 1.00 28.83 ? 61  SER A OG  1 
ATOM   326  N  N   . GLY A 1 50  ? 46.281 13.372  43.241 1.00 21.99 ? 62  GLY A N   1 
ATOM   327  C  CA  . GLY A 1 50  ? 47.679 13.160  43.576 1.00 21.53 ? 62  GLY A CA  1 
ATOM   328  C  C   . GLY A 1 50  ? 48.533 12.622  42.445 1.00 21.12 ? 62  GLY A C   1 
ATOM   329  O  O   . GLY A 1 50  ? 49.374 11.746  42.657 1.00 23.35 ? 62  GLY A O   1 
ATOM   330  N  N   . ILE A 1 51  ? 48.327 13.149  41.245 1.00 18.26 ? 63  ILE A N   1 
ATOM   331  C  CA  . ILE A 1 51  ? 49.087 12.709  40.081 1.00 16.32 ? 63  ILE A CA  1 
ATOM   332  C  C   . ILE A 1 51  ? 50.374 13.497  39.881 1.00 14.41 ? 63  ILE A C   1 
ATOM   333  O  O   . ILE A 1 51  ? 50.374 14.728  39.920 1.00 13.43 ? 63  ILE A O   1 
ATOM   334  C  CB  . ILE A 1 51  ? 48.260 12.848  38.777 1.00 17.48 ? 63  ILE A CB  1 
ATOM   335  C  CG1 . ILE A 1 51  ? 47.084 11.871  38.788 1.00 17.39 ? 63  ILE A CG1 1 
ATOM   336  C  CG2 . ILE A 1 51  ? 49.150 12.595  37.559 1.00 16.77 ? 63  ILE A CG2 1 
ATOM   337  C  CD1 . ILE A 1 51  ? 46.201 11.976  37.556 1.00 20.99 ? 63  ILE A CD1 1 
ATOM   338  N  N   . GLN A 1 52  ? 51.474 12.781  39.681 1.00 13.13 ? 64  GLN A N   1 
ATOM   339  C  CA  . GLN A 1 52  ? 52.748 13.426  39.395 1.00 12.07 ? 64  GLN A CA  1 
ATOM   340  C  C   . GLN A 1 52  ? 53.098 13.001  37.970 1.00 11.73 ? 64  GLN A C   1 
ATOM   341  O  O   . GLN A 1 52  ? 53.126 11.808  37.657 1.00 11.98 ? 64  GLN A O   1 
ATOM   342  C  CB  . GLN A 1 52  ? 53.848 12.974  40.357 1.00 11.13 ? 64  GLN A CB  1 
ATOM   343  C  CG  . GLN A 1 52  ? 55.217 13.565  40.005 1.00 14.30 ? 64  GLN A CG  1 
ATOM   344  C  CD  . GLN A 1 52  ? 56.311 13.150  40.966 1.00 16.36 ? 64  GLN A CD  1 
ATOM   345  O  OE1 . GLN A 1 52  ? 56.720 13.922  41.837 1.00 19.30 ? 64  GLN A OE1 1 
ATOM   346  N  NE2 . GLN A 1 52  ? 56.785 11.923  40.821 1.00 15.35 ? 64  GLN A NE2 1 
ATOM   347  N  N   . VAL A 1 53  ? 53.338 13.975  37.103 1.00 8.79  ? 65  VAL A N   1 
ATOM   348  C  CA  . VAL A 1 53  ? 53.674 13.677  35.715 1.00 9.44  ? 65  VAL A CA  1 
ATOM   349  C  C   . VAL A 1 53  ? 55.183 13.531  35.589 1.00 9.68  ? 65  VAL A C   1 
ATOM   350  O  O   . VAL A 1 53  ? 55.937 14.408  36.021 1.00 11.02 ? 65  VAL A O   1 
ATOM   351  C  CB  . VAL A 1 53  ? 53.184 14.798  34.771 1.00 9.78  ? 65  VAL A CB  1 
ATOM   352  C  CG1 . VAL A 1 53  ? 53.545 14.470  33.334 1.00 12.84 ? 65  VAL A CG1 1 
ATOM   353  C  CG2 . VAL A 1 53  ? 51.679 14.967  34.908 1.00 11.52 ? 65  VAL A CG2 1 
ATOM   354  N  N   . ARG A 1 54  A 55.624 12.417  35.011 1.00 8.42  ? 65  ARG A N   1 
ATOM   355  C  CA  . ARG A 1 54  A 57.048 12.174  34.838 1.00 9.62  ? 65  ARG A CA  1 
ATOM   356  C  C   . ARG A 1 54  A 57.413 12.156  33.362 1.00 9.96  ? 65  ARG A C   1 
ATOM   357  O  O   . ARG A 1 54  A 56.991 11.270  32.606 1.00 10.11 ? 65  ARG A O   1 
ATOM   358  C  CB  . ARG A 1 54  A 57.445 10.866  35.523 1.00 9.02  ? 65  ARG A CB  1 
ATOM   359  C  CG  . ARG A 1 54  A 57.184 10.914  37.026 1.00 9.64  ? 65  ARG A CG  1 
ATOM   360  C  CD  . ARG A 1 54  A 57.761 9.726   37.770 1.00 10.93 ? 65  ARG A CD  1 
ATOM   361  N  NE  . ARG A 1 54  A 57.723 9.972   39.212 1.00 10.15 ? 65  ARG A NE  1 
ATOM   362  C  CZ  . ARG A 1 54  A 58.352 9.236   40.122 1.00 12.89 ? 65  ARG A CZ  1 
ATOM   363  N  NH1 . ARG A 1 54  A 59.074 8.187   39.753 1.00 11.64 ? 65  ARG A NH1 1 
ATOM   364  N  NH2 . ARG A 1 54  A 58.269 9.563   41.406 1.00 13.68 ? 65  ARG A NH2 1 
ATOM   365  N  N   . LEU A 1 55  ? 58.196 13.157  32.970 1.00 9.44  ? 66  LEU A N   1 
ATOM   366  C  CA  . LEU A 1 55  ? 58.641 13.335  31.589 1.00 10.35 ? 66  LEU A CA  1 
ATOM   367  C  C   . LEU A 1 55  ? 60.103 12.933  31.428 1.00 10.35 ? 66  LEU A C   1 
ATOM   368  O  O   . LEU A 1 55  ? 60.853 12.905  32.403 1.00 9.83  ? 66  LEU A O   1 
ATOM   369  C  CB  . LEU A 1 55  ? 58.508 14.809  31.183 1.00 11.75 ? 66  LEU A CB  1 
ATOM   370  C  CG  . LEU A 1 55  ? 57.262 15.589  31.607 1.00 15.62 ? 66  LEU A CG  1 
ATOM   371  C  CD1 . LEU A 1 55  ? 57.381 17.032  31.143 1.00 18.00 ? 66  LEU A CD1 1 
ATOM   372  C  CD2 . LEU A 1 55  ? 56.034 14.955  31.010 1.00 19.53 ? 66  LEU A CD2 1 
ATOM   373  N  N   . GLY A 1 56  ? 60.496 12.638  30.189 1.00 9.53  ? 69  GLY A N   1 
ATOM   374  C  CA  . GLY A 1 56  ? 61.874 12.276  29.894 1.00 10.46 ? 69  GLY A CA  1 
ATOM   375  C  C   . GLY A 1 56  ? 62.330 10.951  30.465 1.00 11.95 ? 69  GLY A C   1 
ATOM   376  O  O   . GLY A 1 56  ? 63.522 10.720  30.654 1.00 12.76 ? 69  GLY A O   1 
ATOM   377  N  N   . GLU A 1 57  ? 61.374 10.067  30.711 1.00 11.08 ? 70  GLU A N   1 
ATOM   378  C  CA  . GLU A 1 57  ? 61.654 8.762   31.284 1.00 11.16 ? 70  GLU A CA  1 
ATOM   379  C  C   . GLU A 1 57  ? 61.956 7.652   30.287 1.00 12.75 ? 70  GLU A C   1 
ATOM   380  O  O   . GLU A 1 57  ? 61.518 7.684   29.136 1.00 12.41 ? 70  GLU A O   1 
ATOM   381  C  CB  . GLU A 1 57  ? 60.449 8.305   32.119 1.00 11.25 ? 70  GLU A CB  1 
ATOM   382  C  CG  . GLU A 1 57  ? 60.265 9.031   33.435 1.00 10.72 ? 70  GLU A CG  1 
ATOM   383  C  CD  . GLU A 1 57  ? 61.118 8.437   34.534 1.00 12.67 ? 70  GLU A CD  1 
ATOM   384  O  OE1 . GLU A 1 57  ? 62.175 7.860   34.206 1.00 11.40 ? 70  GLU A OE1 1 
ATOM   385  O  OE2 . GLU A 1 57  ? 60.738 8.553   35.719 1.00 11.96 ? 70  GLU A OE2 1 
ATOM   386  N  N   . ASP A 1 58  ? 62.740 6.684   30.747 1.00 12.31 ? 71  ASP A N   1 
ATOM   387  C  CA  . ASP A 1 58  ? 62.998 5.473   29.985 1.00 12.90 ? 71  ASP A CA  1 
ATOM   388  C  C   . ASP A 1 58  ? 62.827 4.405   31.053 1.00 13.10 ? 71  ASP A C   1 
ATOM   389  O  O   . ASP A 1 58  ? 61.777 3.774   31.132 1.00 15.07 ? 71  ASP A O   1 
ATOM   390  C  CB  . ASP A 1 58  ? 64.394 5.399   29.378 1.00 14.34 ? 71  ASP A CB  1 
ATOM   391  C  CG  . ASP A 1 58  ? 64.526 4.209   28.448 1.00 16.41 ? 71  ASP A CG  1 
ATOM   392  O  OD1 . ASP A 1 58  ? 63.551 3.959   27.702 1.00 15.19 ? 71  ASP A OD1 1 
ATOM   393  O  OD2 . ASP A 1 58  ? 65.571 3.526   28.459 1.00 16.22 ? 71  ASP A OD2 1 
ATOM   394  N  N   . ASN A 1 59  ? 63.841 4.220   31.898 1.00 11.68 ? 72  ASN A N   1 
ATOM   395  C  CA  . ASN A 1 59  ? 63.723 3.258   32.990 1.00 12.02 ? 72  ASN A CA  1 
ATOM   396  C  C   . ASN A 1 59  ? 62.966 3.998   34.095 1.00 11.74 ? 72  ASN A C   1 
ATOM   397  O  O   . ASN A 1 59  ? 63.504 4.914   34.714 1.00 11.53 ? 72  ASN A O   1 
ATOM   398  C  CB  . ASN A 1 59  ? 65.111 2.825   33.479 1.00 14.06 ? 72  ASN A CB  1 
ATOM   399  C  CG  . ASN A 1 59  ? 65.048 1.730   34.533 1.00 15.39 ? 72  ASN A CG  1 
ATOM   400  O  OD1 . ASN A 1 59  ? 65.954 0.901   34.633 1.00 18.95 ? 72  ASN A OD1 1 
ATOM   401  N  ND2 . ASN A 1 59  ? 63.990 1.728   35.330 1.00 13.32 ? 72  ASN A ND2 1 
ATOM   402  N  N   . ILE A 1 60  ? 61.717 3.610   34.338 1.00 11.41 ? 73  ILE A N   1 
ATOM   403  C  CA  . ILE A 1 60  ? 60.901 4.284   35.342 1.00 12.46 ? 73  ILE A CA  1 
ATOM   404  C  C   . ILE A 1 60  ? 61.247 3.965   36.791 1.00 12.56 ? 73  ILE A C   1 
ATOM   405  O  O   . ILE A 1 60  ? 60.678 4.560   37.707 1.00 11.95 ? 73  ILE A O   1 
ATOM   406  C  CB  . ILE A 1 60  ? 59.394 3.993   35.132 1.00 13.86 ? 73  ILE A CB  1 
ATOM   407  C  CG1 . ILE A 1 60  ? 59.151 2.482   35.102 1.00 14.32 ? 73  ILE A CG1 1 
ATOM   408  C  CG2 . ILE A 1 60  ? 58.916 4.653   33.853 1.00 14.50 ? 73  ILE A CG2 1 
ATOM   409  C  CD1 . ILE A 1 60  ? 57.682 2.101   35.028 1.00 19.72 ? 73  ILE A CD1 1 
ATOM   410  N  N   . ASN A 1 61  ? 62.182 3.043   36.999 1.00 13.67 ? 74  ASN A N   1 
ATOM   411  C  CA  . ASN A 1 61  ? 62.582 2.660   38.350 1.00 15.04 ? 74  ASN A CA  1 
ATOM   412  C  C   . ASN A 1 61  ? 63.945 3.211   38.744 1.00 15.22 ? 74  ASN A C   1 
ATOM   413  O  O   . ASN A 1 61  ? 64.384 3.036   39.883 1.00 15.44 ? 74  ASN A O   1 
ATOM   414  C  CB  . ASN A 1 61  ? 62.593 1.135   38.476 1.00 18.02 ? 74  ASN A CB  1 
ATOM   415  C  CG  . ASN A 1 61  ? 61.203 0.537   38.383 1.00 22.26 ? 74  ASN A CG  1 
ATOM   416  O  OD1 . ASN A 1 61  ? 60.961 -0.392  37.609 1.00 27.22 ? 74  ASN A OD1 1 
ATOM   417  N  ND2 . ASN A 1 61  ? 60.281 1.065   39.177 1.00 22.33 ? 74  ASN A ND2 1 
ATOM   418  N  N   . VAL A 1 62  ? 64.608 3.875   37.803 1.00 13.73 ? 75  VAL A N   1 
ATOM   419  C  CA  . VAL A 1 62  ? 65.929 4.445   38.045 1.00 14.34 ? 75  VAL A CA  1 
ATOM   420  C  C   . VAL A 1 62  ? 66.030 5.867   37.516 1.00 13.26 ? 75  VAL A C   1 
ATOM   421  O  O   . VAL A 1 62  ? 65.588 6.151   36.406 1.00 13.45 ? 75  VAL A O   1 
ATOM   422  C  CB  . VAL A 1 62  ? 67.030 3.609   37.343 1.00 15.27 ? 75  VAL A CB  1 
ATOM   423  C  CG1 . VAL A 1 62  ? 68.392 4.290   37.489 1.00 16.20 ? 75  VAL A CG1 1 
ATOM   424  C  CG2 . VAL A 1 62  ? 67.064 2.204   37.924 1.00 16.59 ? 75  VAL A CG2 1 
ATOM   425  N  N   . VAL A 1 63  ? 66.603 6.763   38.310 1.00 11.79 ? 76  VAL A N   1 
ATOM   426  C  CA  . VAL A 1 63  ? 66.802 8.134   37.850 1.00 13.26 ? 76  VAL A CA  1 
ATOM   427  C  C   . VAL A 1 63  ? 68.080 8.083   37.008 1.00 13.68 ? 76  VAL A C   1 
ATOM   428  O  O   . VAL A 1 63  ? 69.184 7.948   37.540 1.00 15.09 ? 76  VAL A O   1 
ATOM   429  C  CB  . VAL A 1 63  ? 66.988 9.106   39.031 1.00 12.72 ? 76  VAL A CB  1 
ATOM   430  C  CG1 . VAL A 1 63  ? 67.305 10.503  38.509 1.00 14.56 ? 76  VAL A CG1 1 
ATOM   431  C  CG2 . VAL A 1 63  ? 65.723 9.133   39.875 1.00 15.39 ? 76  VAL A CG2 1 
ATOM   432  N  N   . GLU A 1 64  ? 67.921 8.188   35.693 1.00 13.59 ? 77  GLU A N   1 
ATOM   433  C  CA  . GLU A 1 64  ? 69.042 8.107   34.760 1.00 13.97 ? 77  GLU A CA  1 
ATOM   434  C  C   . GLU A 1 64  ? 69.513 9.454   34.243 1.00 12.91 ? 77  GLU A C   1 
ATOM   435  O  O   . GLU A 1 64  ? 70.601 9.560   33.674 1.00 14.75 ? 77  GLU A O   1 
ATOM   436  C  CB  . GLU A 1 64  ? 68.647 7.253   33.552 1.00 14.31 ? 77  GLU A CB  1 
ATOM   437  C  CG  . GLU A 1 64  ? 68.228 5.839   33.875 1.00 15.88 ? 77  GLU A CG  1 
ATOM   438  C  CD  . GLU A 1 64  ? 67.757 5.093   32.640 1.00 17.14 ? 77  GLU A CD  1 
ATOM   439  O  OE1 . GLU A 1 64  ? 66.645 5.383   32.150 1.00 14.36 ? 77  GLU A OE1 1 
ATOM   440  O  OE2 . GLU A 1 64  ? 68.506 4.223   32.150 1.00 18.27 ? 77  GLU A OE2 1 
ATOM   441  N  N   . GLY A 1 65  ? 68.681 10.470  34.437 1.00 14.65 ? 78  GLY A N   1 
ATOM   442  C  CA  . GLY A 1 65  ? 68.981 11.801  33.955 1.00 14.75 ? 78  GLY A CA  1 
ATOM   443  C  C   . GLY A 1 65  ? 67.964 12.099  32.867 1.00 15.70 ? 78  GLY A C   1 
ATOM   444  O  O   . GLY A 1 65  ? 67.459 11.175  32.232 1.00 15.49 ? 78  GLY A O   1 
ATOM   445  N  N   . ASN A 1 66  ? 67.663 13.379  32.668 1.00 14.82 ? 79  ASN A N   1 
ATOM   446  C  CA  . ASN A 1 66  ? 66.701 13.839  31.667 1.00 15.49 ? 79  ASN A CA  1 
ATOM   447  C  C   . ASN A 1 66  ? 65.267 13.819  32.177 1.00 13.25 ? 79  ASN A C   1 
ATOM   448  O  O   . ASN A 1 66  ? 64.369 14.332  31.511 1.00 12.95 ? 79  ASN A O   1 
ATOM   449  C  CB  . ASN A 1 66  ? 66.793 13.012  30.378 1.00 17.33 ? 79  ASN A CB  1 
ATOM   450  C  CG  . ASN A 1 66  ? 68.146 13.129  29.708 1.00 21.83 ? 79  ASN A CG  1 
ATOM   451  O  OD1 . ASN A 1 66  ? 68.629 14.232  29.445 1.00 24.21 ? 79  ASN A OD1 1 
ATOM   452  N  ND2 . ASN A 1 66  ? 68.765 11.989  29.424 1.00 24.02 ? 79  ASN A ND2 1 
ATOM   453  N  N   . GLU A 1 67  ? 65.043 13.228  33.347 1.00 12.42 ? 80  GLU A N   1 
ATOM   454  C  CA  . GLU A 1 67  ? 63.694 13.194  33.899 1.00 12.38 ? 80  GLU A CA  1 
ATOM   455  C  C   . GLU A 1 67  ? 63.283 14.552  34.445 1.00 11.70 ? 80  GLU A C   1 
ATOM   456  O  O   . GLU A 1 67  ? 64.111 15.333  34.906 1.00 12.29 ? 80  GLU A O   1 
ATOM   457  C  CB  . GLU A 1 67  ? 63.565 12.181  35.046 1.00 11.24 ? 80  GLU A CB  1 
ATOM   458  C  CG  . GLU A 1 67  ? 63.748 10.729  34.646 1.00 11.70 ? 80  GLU A CG  1 
ATOM   459  C  CD  . GLU A 1 67  ? 65.118 10.206  35.007 1.00 10.91 ? 80  GLU A CD  1 
ATOM   460  O  OE1 . GLU A 1 67  ? 66.062 11.015  35.080 1.00 11.98 ? 80  GLU A OE1 1 
ATOM   461  O  OE2 . GLU A 1 67  ? 65.253 8.986   35.210 1.00 11.30 ? 80  GLU A OE2 1 
ATOM   462  N  N   . GLN A 1 68  ? 61.985 14.814  34.379 1.00 11.28 ? 81  GLN A N   1 
ATOM   463  C  CA  . GLN A 1 68  ? 61.396 16.027  34.916 1.00 11.63 ? 81  GLN A CA  1 
ATOM   464  C  C   . GLN A 1 68  ? 60.124 15.548  35.599 1.00 11.59 ? 81  GLN A C   1 
ATOM   465  O  O   . GLN A 1 68  ? 59.259 14.949  34.953 1.00 11.34 ? 81  GLN A O   1 
ATOM   466  C  CB  . GLN A 1 68  ? 61.046 17.021  33.807 1.00 12.17 ? 81  GLN A CB  1 
ATOM   467  C  CG  . GLN A 1 68  ? 62.237 17.736  33.186 1.00 12.44 ? 81  GLN A CG  1 
ATOM   468  C  CD  . GLN A 1 68  ? 61.808 18.714  32.104 1.00 14.64 ? 81  GLN A CD  1 
ATOM   469  O  OE1 . GLN A 1 68  ? 61.001 19.609  32.349 1.00 14.74 ? 81  GLN A OE1 1 
ATOM   470  N  NE2 . GLN A 1 68  ? 62.344 18.542  30.899 1.00 13.33 ? 81  GLN A NE2 1 
ATOM   471  N  N   . PHE A 1 69  ? 60.036 15.773  36.907 1.00 11.35 ? 82  PHE A N   1 
ATOM   472  C  CA  . PHE A 1 69  ? 58.863 15.381  37.680 1.00 9.77  ? 82  PHE A CA  1 
ATOM   473  C  C   . PHE A 1 69  ? 58.073 16.652  37.957 1.00 12.53 ? 82  PHE A C   1 
ATOM   474  O  O   . PHE A 1 69  ? 58.585 17.586  38.579 1.00 11.68 ? 82  PHE A O   1 
ATOM   475  C  CB  . PHE A 1 69  ? 59.270 14.734  39.015 1.00 10.17 ? 82  PHE A CB  1 
ATOM   476  C  CG  . PHE A 1 69  ? 59.961 13.398  38.874 1.00 11.68 ? 82  PHE A CG  1 
ATOM   477  C  CD1 . PHE A 1 69  ? 60.138 12.804  37.623 1.00 10.91 ? 82  PHE A CD1 1 
ATOM   478  C  CD2 . PHE A 1 69  ? 60.440 12.735  40.002 1.00 11.21 ? 82  PHE A CD2 1 
ATOM   479  C  CE1 . PHE A 1 69  ? 60.785 11.565  37.498 1.00 13.31 ? 82  PHE A CE1 1 
ATOM   480  C  CE2 . PHE A 1 69  ? 61.086 11.500  39.889 1.00 12.88 ? 82  PHE A CE2 1 
ATOM   481  C  CZ  . PHE A 1 69  ? 61.259 10.915  38.635 1.00 11.66 ? 82  PHE A CZ  1 
ATOM   482  N  N   . ILE A 1 70  ? 56.826 16.687  37.499 1.00 11.87 ? 83  ILE A N   1 
ATOM   483  C  CA  . ILE A 1 70  ? 55.991 17.862  37.689 1.00 12.50 ? 83  ILE A CA  1 
ATOM   484  C  C   . ILE A 1 70  ? 54.601 17.453  38.147 1.00 13.80 ? 83  ILE A C   1 
ATOM   485  O  O   . ILE A 1 70  ? 53.977 16.569  37.556 1.00 13.33 ? 83  ILE A O   1 
ATOM   486  C  CB  . ILE A 1 70  ? 55.881 18.670  36.374 1.00 13.01 ? 83  ILE A CB  1 
ATOM   487  C  CG1 . ILE A 1 70  ? 57.284 19.054  35.885 1.00 13.78 ? 83  ILE A CG1 1 
ATOM   488  C  CG2 . ILE A 1 70  ? 55.036 19.919  36.593 1.00 14.59 ? 83  ILE A CG2 1 
ATOM   489  C  CD1 . ILE A 1 70  ? 57.305 19.736  34.523 1.00 14.65 ? 83  ILE A CD1 1 
ATOM   490  N  N   . SER A 1 71  ? 54.124 18.093  39.209 1.00 12.47 ? 84  SER A N   1 
ATOM   491  C  CA  . SER A 1 71  ? 52.799 17.797  39.741 1.00 14.84 ? 84  SER A CA  1 
ATOM   492  C  C   . SER A 1 71  ? 51.694 18.313  38.828 1.00 14.36 ? 84  SER A C   1 
ATOM   493  O  O   . SER A 1 71  ? 51.852 19.322  38.142 1.00 13.11 ? 84  SER A O   1 
ATOM   494  C  CB  . SER A 1 71  ? 52.622 18.432  41.126 1.00 17.40 ? 84  SER A CB  1 
ATOM   495  O  OG  . SER A 1 71  ? 53.486 17.846  42.081 1.00 20.76 ? 84  SER A OG  1 
ATOM   496  N  N   . ALA A 1 72  ? 50.570 17.608  38.827 1.00 15.13 ? 85  ALA A N   1 
ATOM   497  C  CA  . ALA A 1 72  ? 49.422 18.014  38.034 1.00 15.37 ? 85  ALA A CA  1 
ATOM   498  C  C   . ALA A 1 72  ? 48.692 19.080  38.851 1.00 17.46 ? 85  ALA A C   1 
ATOM   499  O  O   . ALA A 1 72  ? 48.430 18.872  40.037 1.00 17.22 ? 85  ALA A O   1 
ATOM   500  C  CB  . ALA A 1 72  ? 48.507 16.820  37.798 1.00 15.99 ? 85  ALA A CB  1 
ATOM   501  N  N   . SER A 1 73  ? 48.385 20.219  38.235 1.00 16.95 ? 86  SER A N   1 
ATOM   502  C  CA  . SER A 1 73  ? 47.673 21.284  38.939 1.00 18.61 ? 86  SER A CA  1 
ATOM   503  C  C   . SER A 1 73  ? 46.167 21.041  38.854 1.00 18.71 ? 86  SER A C   1 
ATOM   504  O  O   . SER A 1 73  ? 45.417 21.409  39.752 1.00 19.54 ? 86  SER A O   1 
ATOM   505  C  CB  . SER A 1 73  ? 48.018 22.655  38.350 1.00 19.05 ? 86  SER A CB  1 
ATOM   506  O  OG  . SER A 1 73  ? 47.627 22.748  36.995 1.00 26.61 ? 86  SER A OG  1 
ATOM   507  N  N   . LYS A 1 74  ? 45.730 20.426  37.763 1.00 18.31 ? 87  LYS A N   1 
ATOM   508  C  CA  . LYS A 1 74  ? 44.319 20.104  37.589 1.00 20.04 ? 87  LYS A CA  1 
ATOM   509  C  C   . LYS A 1 74  ? 44.147 19.082  36.478 1.00 18.50 ? 87  LYS A C   1 
ATOM   510  O  O   . LYS A 1 74  ? 44.897 19.077  35.504 1.00 16.23 ? 87  LYS A O   1 
ATOM   511  C  CB  . LYS A 1 74  ? 43.498 21.353  37.258 1.00 23.27 ? 87  LYS A CB  1 
ATOM   512  C  CG  . LYS A 1 74  ? 43.802 21.976  35.908 1.00 27.36 ? 87  LYS A CG  1 
ATOM   513  C  CD  . LYS A 1 74  ? 42.614 22.793  35.397 1.00 31.51 ? 87  LYS A CD  1 
ATOM   514  C  CE  . LYS A 1 74  ? 42.240 23.924  36.345 1.00 34.61 ? 87  LYS A CE  1 
ATOM   515  N  NZ  . LYS A 1 74  ? 43.322 24.941  36.458 1.00 37.78 ? 87  LYS A NZ  1 
ATOM   516  N  N   . SER A 1 75  ? 43.166 18.205  36.641 1.00 16.36 ? 88  SER A N   1 
ATOM   517  C  CA  . SER A 1 75  ? 42.884 17.190  35.641 1.00 16.00 ? 88  SER A CA  1 
ATOM   518  C  C   . SER A 1 75  ? 41.463 17.434  35.167 1.00 15.14 ? 88  SER A C   1 
ATOM   519  O  O   . SER A 1 75  ? 40.551 17.604  35.975 1.00 15.58 ? 88  SER A O   1 
ATOM   520  C  CB  . SER A 1 75  ? 43.017 15.792  36.245 1.00 17.84 ? 88  SER A CB  1 
ATOM   521  O  OG  . SER A 1 75  ? 44.344 15.568  36.691 1.00 20.44 ? 88  SER A OG  1 
ATOM   522  N  N   . ILE A 1 76  ? 41.284 17.464  33.854 1.00 12.00 ? 89  ILE A N   1 
ATOM   523  C  CA  . ILE A 1 76  ? 39.978 17.717  33.272 1.00 11.71 ? 89  ILE A CA  1 
ATOM   524  C  C   . ILE A 1 76  ? 39.475 16.525  32.474 1.00 11.71 ? 89  ILE A C   1 
ATOM   525  O  O   . ILE A 1 76  ? 39.903 16.294  31.341 1.00 10.82 ? 89  ILE A O   1 
ATOM   526  C  CB  . ILE A 1 76  ? 40.022 18.965  32.358 1.00 10.81 ? 89  ILE A CB  1 
ATOM   527  C  CG1 . ILE A 1 76  ? 40.538 20.166  33.159 1.00 12.34 ? 89  ILE A CG1 1 
ATOM   528  C  CG2 . ILE A 1 76  ? 38.628 19.259  31.788 1.00 13.25 ? 89  ILE A CG2 1 
ATOM   529  C  CD1 . ILE A 1 76  ? 40.721 21.435  32.337 1.00 10.89 ? 89  ILE A CD1 1 
ATOM   530  N  N   . VAL A 1 77  ? 38.574 15.764  33.088 1.00 12.11 ? 90  VAL A N   1 
ATOM   531  C  CA  . VAL A 1 77  ? 37.972 14.601  32.448 1.00 12.59 ? 90  VAL A CA  1 
ATOM   532  C  C   . VAL A 1 77  ? 36.864 15.135  31.544 1.00 11.99 ? 90  VAL A C   1 
ATOM   533  O  O   . VAL A 1 77  ? 36.146 16.057  31.924 1.00 12.55 ? 90  VAL A O   1 
ATOM   534  C  CB  . VAL A 1 77  ? 37.361 13.646  33.500 1.00 15.61 ? 90  VAL A CB  1 
ATOM   535  C  CG1 . VAL A 1 77  ? 36.525 12.567  32.816 1.00 16.04 ? 90  VAL A CG1 1 
ATOM   536  C  CG2 . VAL A 1 77  ? 38.475 13.008  34.324 1.00 16.11 ? 90  VAL A CG2 1 
ATOM   537  N  N   . HIS A 1 78  ? 36.734 14.578  30.345 1.00 10.54 ? 91  HIS A N   1 
ATOM   538  C  CA  . HIS A 1 78  ? 35.696 15.033  29.426 1.00 10.14 ? 91  HIS A CA  1 
ATOM   539  C  C   . HIS A 1 78  ? 34.343 14.950  30.136 1.00 9.83  ? 91  HIS A C   1 
ATOM   540  O  O   . HIS A 1 78  ? 34.012 13.930  30.742 1.00 9.76  ? 91  HIS A O   1 
ATOM   541  C  CB  . HIS A 1 78  ? 35.695 14.174  28.160 1.00 11.08 ? 91  HIS A CB  1 
ATOM   542  C  CG  . HIS A 1 78  ? 34.899 14.759  27.037 1.00 11.79 ? 91  HIS A CG  1 
ATOM   543  N  ND1 . HIS A 1 78  ? 33.520 14.769  27.026 1.00 11.37 ? 91  HIS A ND1 1 
ATOM   544  C  CD2 . HIS A 1 78  ? 35.289 15.384  25.900 1.00 12.58 ? 91  HIS A CD2 1 
ATOM   545  C  CE1 . HIS A 1 78  ? 33.096 15.374  25.930 1.00 12.12 ? 91  HIS A CE1 1 
ATOM   546  N  NE2 . HIS A 1 78  ? 34.150 15.758  25.231 1.00 12.67 ? 91  HIS A NE2 1 
ATOM   547  N  N   . PRO A 1 79  ? 33.547 16.030  30.074 1.00 11.06 ? 92  PRO A N   1 
ATOM   548  C  CA  . PRO A 1 79  ? 32.228 16.096  30.715 1.00 11.39 ? 92  PRO A CA  1 
ATOM   549  C  C   . PRO A 1 79  ? 31.259 14.976  30.338 1.00 12.50 ? 92  PRO A C   1 
ATOM   550  O  O   . PRO A 1 79  ? 30.383 14.622  31.125 1.00 11.38 ? 92  PRO A O   1 
ATOM   551  C  CB  . PRO A 1 79  ? 31.706 17.471  30.289 1.00 12.97 ? 92  PRO A CB  1 
ATOM   552  C  CG  . PRO A 1 79  ? 32.954 18.274  30.130 1.00 14.01 ? 92  PRO A CG  1 
ATOM   553  C  CD  . PRO A 1 79  ? 33.871 17.309  29.417 1.00 10.70 ? 92  PRO A CD  1 
ATOM   554  N  N   . SER A 1 80  ? 31.413 14.424  29.138 1.00 11.87 ? 93  SER A N   1 
ATOM   555  C  CA  . SER A 1 80  ? 30.523 13.361  28.682 1.00 12.53 ? 93  SER A CA  1 
ATOM   556  C  C   . SER A 1 80  ? 31.123 11.965  28.766 1.00 13.06 ? 93  SER A C   1 
ATOM   557  O  O   . SER A 1 80  ? 30.604 11.020  28.174 1.00 11.83 ? 93  SER A O   1 
ATOM   558  C  CB  . SER A 1 80  ? 30.062 13.642  27.252 1.00 14.01 ? 93  SER A CB  1 
ATOM   559  O  OG  . SER A 1 80  ? 29.283 14.823  27.213 1.00 17.16 ? 93  SER A OG  1 
ATOM   560  N  N   . TYR A 1 81  ? 32.220 11.838  29.501 1.00 12.92 ? 94  TYR A N   1 
ATOM   561  C  CA  . TYR A 1 81  ? 32.861 10.543  29.675 1.00 13.34 ? 94  TYR A CA  1 
ATOM   562  C  C   . TYR A 1 81  ? 31.874 9.594   30.354 1.00 15.31 ? 94  TYR A C   1 
ATOM   563  O  O   . TYR A 1 81  ? 31.232 9.960   31.337 1.00 14.41 ? 94  TYR A O   1 
ATOM   564  C  CB  . TYR A 1 81  ? 34.116 10.700  30.542 1.00 13.35 ? 94  TYR A CB  1 
ATOM   565  C  CG  . TYR A 1 81  ? 34.671 9.402   31.082 1.00 12.80 ? 94  TYR A CG  1 
ATOM   566  C  CD1 . TYR A 1 81  ? 35.127 8.402   30.224 1.00 14.09 ? 94  TYR A CD1 1 
ATOM   567  C  CD2 . TYR A 1 81  ? 34.746 9.176   32.456 1.00 13.66 ? 94  TYR A CD2 1 
ATOM   568  C  CE1 . TYR A 1 81  ? 35.650 7.207   30.721 1.00 14.79 ? 94  TYR A CE1 1 
ATOM   569  C  CE2 . TYR A 1 81  ? 35.264 7.988   32.963 1.00 15.53 ? 94  TYR A CE2 1 
ATOM   570  C  CZ  . TYR A 1 81  ? 35.715 7.009   32.091 1.00 15.98 ? 94  TYR A CZ  1 
ATOM   571  O  OH  . TYR A 1 81  ? 36.238 5.836   32.592 1.00 18.23 ? 94  TYR A OH  1 
ATOM   572  N  N   . ASN A 1 82  ? 31.749 8.384   29.817 1.00 14.79 ? 95  ASN A N   1 
ATOM   573  C  CA  . ASN A 1 82  ? 30.853 7.371   30.371 1.00 17.53 ? 95  ASN A CA  1 
ATOM   574  C  C   . ASN A 1 82  ? 31.735 6.202   30.802 1.00 17.63 ? 95  ASN A C   1 
ATOM   575  O  O   . ASN A 1 82  ? 32.322 5.527   29.956 1.00 17.35 ? 95  ASN A O   1 
ATOM   576  C  CB  . ASN A 1 82  ? 29.855 6.910   29.300 1.00 18.73 ? 95  ASN A CB  1 
ATOM   577  C  CG  . ASN A 1 82  ? 28.854 5.895   29.828 1.00 20.52 ? 95  ASN A CG  1 
ATOM   578  O  OD1 . ASN A 1 82  ? 29.226 4.919   30.478 1.00 22.03 ? 95  ASN A OD1 1 
ATOM   579  N  ND2 . ASN A 1 82  ? 27.576 6.119   29.538 1.00 23.04 ? 95  ASN A ND2 1 
ATOM   580  N  N   . SER A 1 83  ? 31.835 5.964   32.108 1.00 17.58 ? 96  SER A N   1 
ATOM   581  C  CA  . SER A 1 83  ? 32.688 4.890   32.617 1.00 20.06 ? 96  SER A CA  1 
ATOM   582  C  C   . SER A 1 83  ? 32.201 3.475   32.314 1.00 20.91 ? 96  SER A C   1 
ATOM   583  O  O   . SER A 1 83  ? 32.949 2.511   32.477 1.00 23.21 ? 96  SER A O   1 
ATOM   584  C  CB  . SER A 1 83  ? 32.896 5.042   34.128 1.00 20.89 ? 96  SER A CB  1 
ATOM   585  O  OG  . SER A 1 83  ? 31.665 5.004   34.825 1.00 24.68 ? 96  SER A OG  1 
ATOM   586  N  N   . ASN A 1 84  ? 30.956 3.346   31.870 1.00 21.97 ? 97  ASN A N   1 
ATOM   587  C  CA  . ASN A 1 84  ? 30.406 2.033   31.551 1.00 23.42 ? 97  ASN A CA  1 
ATOM   588  C  C   . ASN A 1 84  ? 30.765 1.623   30.127 1.00 22.45 ? 97  ASN A C   1 
ATOM   589  O  O   . ASN A 1 84  ? 31.078 0.462   29.862 1.00 23.55 ? 97  ASN A O   1 
ATOM   590  C  CB  . ASN A 1 84  ? 28.881 2.044   31.685 1.00 26.78 ? 97  ASN A CB  1 
ATOM   591  C  CG  . ASN A 1 84  ? 28.416 2.522   33.045 1.00 30.88 ? 97  ASN A CG  1 
ATOM   592  O  OD1 . ASN A 1 84  ? 28.722 1.912   34.069 1.00 33.66 ? 97  ASN A OD1 1 
ATOM   593  N  ND2 . ASN A 1 84  ? 27.670 3.625   33.062 1.00 34.05 ? 97  ASN A ND2 1 
ATOM   594  N  N   . THR A 1 85  ? 30.721 2.587   29.215 1.00 20.02 ? 98  THR A N   1 
ATOM   595  C  CA  . THR A 1 85  ? 31.002 2.337   27.807 1.00 18.81 ? 98  THR A CA  1 
ATOM   596  C  C   . THR A 1 85  ? 32.384 2.815   27.367 1.00 19.67 ? 98  THR A C   1 
ATOM   597  O  O   . THR A 1 85  ? 32.891 2.395   26.326 1.00 20.30 ? 98  THR A O   1 
ATOM   598  C  CB  . THR A 1 85  ? 29.956 3.039   26.924 1.00 17.57 ? 98  THR A CB  1 
ATOM   599  O  OG1 . THR A 1 85  ? 30.068 4.458   27.092 1.00 16.68 ? 98  THR A OG1 1 
ATOM   600  C  CG2 . THR A 1 85  ? 28.548 2.609   27.321 1.00 19.82 ? 98  THR A CG2 1 
ATOM   601  N  N   . LEU A 1 86  ? 32.980 3.692   28.169 1.00 18.26 ? 99  LEU A N   1 
ATOM   602  C  CA  . LEU A 1 86  ? 34.285 4.272   27.879 1.00 17.47 ? 99  LEU A CA  1 
ATOM   603  C  C   . LEU A 1 86  ? 34.203 5.218   26.683 1.00 15.97 ? 99  LEU A C   1 
ATOM   604  O  O   . LEU A 1 86  ? 35.196 5.496   26.014 1.00 13.44 ? 99  LEU A O   1 
ATOM   605  C  CB  . LEU A 1 86  ? 35.335 3.177   27.642 1.00 19.48 ? 99  LEU A CB  1 
ATOM   606  C  CG  . LEU A 1 86  ? 35.687 2.368   28.895 1.00 22.74 ? 99  LEU A CG  1 
ATOM   607  C  CD1 . LEU A 1 86  ? 36.707 1.295   28.557 1.00 26.10 ? 99  LEU A CD1 1 
ATOM   608  C  CD2 . LEU A 1 86  ? 36.238 3.299   29.969 1.00 23.64 ? 99  LEU A CD2 1 
ATOM   609  N  N   . ASN A 1 87  ? 33.003 5.712   26.408 1.00 13.85 ? 100 ASN A N   1 
ATOM   610  C  CA  . ASN A 1 87  ? 32.842 6.660   25.318 1.00 13.34 ? 100 ASN A CA  1 
ATOM   611  C  C   . ASN A 1 87  ? 33.402 7.980   25.854 1.00 11.41 ? 100 ASN A C   1 
ATOM   612  O  O   . ASN A 1 87  ? 33.199 8.308   27.024 1.00 12.18 ? 100 ASN A O   1 
ATOM   613  C  CB  . ASN A 1 87  ? 31.364 6.807   24.947 1.00 13.79 ? 100 ASN A CB  1 
ATOM   614  C  CG  . ASN A 1 87  ? 31.162 7.618   23.688 1.00 15.65 ? 100 ASN A CG  1 
ATOM   615  O  OD1 . ASN A 1 87  ? 31.952 7.531   22.743 1.00 15.99 ? 100 ASN A OD1 1 
ATOM   616  N  ND2 . ASN A 1 87  ? 30.093 8.403   23.656 1.00 18.75 ? 100 ASN A ND2 1 
ATOM   617  N  N   . ASN A 1 88  ? 34.110 8.717   25.003 1.00 11.02 ? 101 ASN A N   1 
ATOM   618  C  CA  . ASN A 1 88  ? 34.729 9.990   25.382 1.00 11.42 ? 101 ASN A CA  1 
ATOM   619  C  C   . ASN A 1 88  ? 35.808 9.772   26.445 1.00 11.00 ? 101 ASN A C   1 
ATOM   620  O  O   . ASN A 1 88  ? 35.921 10.540  27.405 1.00 10.66 ? 101 ASN A O   1 
ATOM   621  C  CB  . ASN A 1 88  ? 33.678 10.980  25.905 1.00 11.92 ? 101 ASN A CB  1 
ATOM   622  C  CG  . ASN A 1 88  ? 32.623 11.313  24.868 1.00 13.03 ? 101 ASN A CG  1 
ATOM   623  O  OD1 . ASN A 1 88  ? 32.942 11.674  23.736 1.00 13.42 ? 101 ASN A OD1 1 
ATOM   624  N  ND2 . ASN A 1 88  ? 31.357 11.199  25.253 1.00 14.51 ? 101 ASN A ND2 1 
ATOM   625  N  N   . ASP A 1 89  ? 36.604 8.722   26.265 1.00 9.56  ? 102 ASP A N   1 
ATOM   626  C  CA  . ASP A 1 89  ? 37.669 8.403   27.210 1.00 10.72 ? 102 ASP A CA  1 
ATOM   627  C  C   . ASP A 1 89  ? 38.894 9.274   26.947 1.00 10.79 ? 102 ASP A C   1 
ATOM   628  O  O   . ASP A 1 89  ? 39.887 8.828   26.367 1.00 10.21 ? 102 ASP A O   1 
ATOM   629  C  CB  . ASP A 1 89  ? 38.036 6.919   27.102 1.00 10.60 ? 102 ASP A CB  1 
ATOM   630  C  CG  . ASP A 1 89  ? 38.939 6.453   28.232 1.00 11.48 ? 102 ASP A CG  1 
ATOM   631  O  OD1 . ASP A 1 89  ? 39.059 7.173   29.244 1.00 10.29 ? 102 ASP A OD1 1 
ATOM   632  O  OD2 . ASP A 1 89  ? 39.519 5.354   28.113 1.00 13.16 ? 102 ASP A OD2 1 
ATOM   633  N  N   . ILE A 1 90  ? 38.812 10.529  27.375 1.00 9.05  ? 103 ILE A N   1 
ATOM   634  C  CA  . ILE A 1 90  ? 39.907 11.464  27.181 1.00 9.39  ? 103 ILE A CA  1 
ATOM   635  C  C   . ILE A 1 90  ? 39.947 12.439  28.355 1.00 9.62  ? 103 ILE A C   1 
ATOM   636  O  O   . ILE A 1 90  ? 38.910 12.831  28.892 1.00 9.83  ? 103 ILE A O   1 
ATOM   637  C  CB  . ILE A 1 90  ? 39.744 12.218  25.836 1.00 10.64 ? 103 ILE A CB  1 
ATOM   638  C  CG1 . ILE A 1 90  ? 40.911 13.184  25.622 1.00 11.49 ? 103 ILE A CG1 1 
ATOM   639  C  CG2 . ILE A 1 90  ? 38.407 12.945  25.806 1.00 10.55 ? 103 ILE A CG2 1 
ATOM   640  C  CD1 . ILE A 1 90  ? 40.964 13.761  24.212 1.00 11.47 ? 103 ILE A CD1 1 
ATOM   641  N  N   . MET A 1 91  ? 41.154 12.805  28.761 1.00 9.25  ? 104 MET A N   1 
ATOM   642  C  CA  . MET A 1 91  ? 41.346 13.710  29.884 1.00 9.86  ? 104 MET A CA  1 
ATOM   643  C  C   . MET A 1 91  ? 42.536 14.626  29.631 1.00 10.56 ? 104 MET A C   1 
ATOM   644  O  O   . MET A 1 91  ? 43.528 14.213  29.032 1.00 10.15 ? 104 MET A O   1 
ATOM   645  C  CB  . MET A 1 91  ? 41.580 12.884  31.156 1.00 11.54 ? 104 MET A CB  1 
ATOM   646  C  CG  . MET A 1 91  ? 42.160 13.639  32.336 1.00 15.87 ? 104 MET A CG  1 
ATOM   647  S  SD  . MET A 1 91  ? 42.366 12.560  33.783 1.00 14.37 ? 104 MET A SD  1 
ATOM   648  C  CE  . MET A 1 91  ? 43.873 11.679  33.382 1.00 15.12 ? 104 MET A CE  1 
ATOM   649  N  N   . LEU A 1 92  ? 42.426 15.874  30.073 1.00 9.30  ? 105 LEU A N   1 
ATOM   650  C  CA  . LEU A 1 92  ? 43.515 16.829  29.922 1.00 10.03 ? 105 LEU A CA  1 
ATOM   651  C  C   . LEU A 1 92  ? 44.112 17.092  31.297 1.00 9.89  ? 105 LEU A C   1 
ATOM   652  O  O   . LEU A 1 92  ? 43.382 17.222  32.277 1.00 12.61 ? 105 LEU A O   1 
ATOM   653  C  CB  . LEU A 1 92  ? 43.006 18.150  29.341 1.00 11.27 ? 105 LEU A CB  1 
ATOM   654  C  CG  . LEU A 1 92  ? 42.530 18.132  27.891 1.00 14.50 ? 105 LEU A CG  1 
ATOM   655  C  CD1 . LEU A 1 92  ? 42.022 19.519  27.509 1.00 16.44 ? 105 LEU A CD1 1 
ATOM   656  C  CD2 . LEU A 1 92  ? 43.676 17.709  26.981 1.00 17.57 ? 105 LEU A CD2 1 
ATOM   657  N  N   . ILE A 1 93  ? 45.436 17.166  31.368 1.00 9.06  ? 106 ILE A N   1 
ATOM   658  C  CA  . ILE A 1 93  ? 46.115 17.436  32.633 1.00 10.74 ? 106 ILE A CA  1 
ATOM   659  C  C   . ILE A 1 93  ? 46.980 18.679  32.458 1.00 10.63 ? 106 ILE A C   1 
ATOM   660  O  O   . ILE A 1 93  ? 47.784 18.750  31.533 1.00 10.90 ? 106 ILE A O   1 
ATOM   661  C  CB  . ILE A 1 93  ? 47.031 16.268  33.051 1.00 11.07 ? 106 ILE A CB  1 
ATOM   662  C  CG1 . ILE A 1 93  ? 46.217 14.981  33.181 1.00 12.65 ? 106 ILE A CG1 1 
ATOM   663  C  CG2 . ILE A 1 93  ? 47.709 16.588  34.382 1.00 13.92 ? 106 ILE A CG2 1 
ATOM   664  C  CD1 . ILE A 1 93  ? 47.069 13.750  33.461 1.00 15.17 ? 106 ILE A CD1 1 
ATOM   665  N  N   . LYS A 1 94  ? 46.797 19.660  33.337 1.00 10.34 ? 107 LYS A N   1 
ATOM   666  C  CA  . LYS A 1 94  ? 47.583 20.882  33.282 1.00 11.31 ? 107 LYS A CA  1 
ATOM   667  C  C   . LYS A 1 94  ? 48.711 20.735  34.296 1.00 10.77 ? 107 LYS A C   1 
ATOM   668  O  O   . LYS A 1 94  ? 48.480 20.343  35.444 1.00 12.93 ? 107 LYS A O   1 
ATOM   669  C  CB  . LYS A 1 94  ? 46.712 22.094  33.633 1.00 13.61 ? 107 LYS A CB  1 
ATOM   670  C  CG  . LYS A 1 94  ? 47.408 23.438  33.473 1.00 16.54 ? 107 LYS A CG  1 
ATOM   671  C  CD  . LYS A 1 94  ? 46.500 24.566  33.949 1.00 20.75 ? 107 LYS A CD  1 
ATOM   672  C  CE  . LYS A 1 94  ? 47.191 25.920  33.898 1.00 25.57 ? 107 LYS A CE  1 
ATOM   673  N  NZ  . LYS A 1 94  ? 47.520 26.333  32.510 1.00 29.84 ? 107 LYS A NZ  1 
ATOM   674  N  N   . LEU A 1 95  ? 49.933 21.030  33.868 1.00 11.61 ? 108 LEU A N   1 
ATOM   675  C  CA  . LEU A 1 95  ? 51.088 20.920  34.748 1.00 12.70 ? 108 LEU A CA  1 
ATOM   676  C  C   . LEU A 1 95  ? 51.214 22.142  35.645 1.00 14.65 ? 108 LEU A C   1 
ATOM   677  O  O   . LEU A 1 95  ? 50.925 23.263  35.226 1.00 14.53 ? 108 LEU A O   1 
ATOM   678  C  CB  . LEU A 1 95  ? 52.370 20.758  33.925 1.00 13.14 ? 108 LEU A CB  1 
ATOM   679  C  CG  . LEU A 1 95  ? 52.432 19.548  32.987 1.00 15.44 ? 108 LEU A CG  1 
ATOM   680  C  CD1 . LEU A 1 95  ? 53.784 19.511  32.300 1.00 14.30 ? 108 LEU A CD1 1 
ATOM   681  C  CD2 . LEU A 1 95  ? 52.194 18.265  33.770 1.00 16.73 ? 108 LEU A CD2 1 
ATOM   682  N  N   . LYS A 1 96  ? 51.650 21.911  36.881 1.00 14.82 ? 109 LYS A N   1 
ATOM   683  C  CA  . LYS A 1 96  ? 51.830 22.975  37.862 1.00 18.71 ? 109 LYS A CA  1 
ATOM   684  C  C   . LYS A 1 96  ? 52.822 24.008  37.335 1.00 19.68 ? 109 LYS A C   1 
ATOM   685  O  O   . LYS A 1 96  ? 52.662 25.211  37.554 1.00 20.27 ? 109 LYS A O   1 
ATOM   686  C  CB  . LYS A 1 96  ? 52.339 22.365  39.167 1.00 21.34 ? 109 LYS A CB  1 
ATOM   687  C  CG  . LYS A 1 96  ? 52.755 23.349  40.243 1.00 27.51 ? 109 LYS A CG  1 
ATOM   688  C  CD  . LYS A 1 96  ? 53.521 22.601  41.330 1.00 32.92 ? 109 LYS A CD  1 
ATOM   689  C  CE  . LYS A 1 96  ? 54.725 21.861  40.725 1.00 36.98 ? 109 LYS A CE  1 
ATOM   690  N  NZ  . LYS A 1 96  ? 55.368 20.872  41.642 1.00 39.80 ? 109 LYS A NZ  1 
ATOM   691  N  N   . SER A 1 97  ? 53.846 23.522  36.641 1.00 18.71 ? 110 SER A N   1 
ATOM   692  C  CA  . SER A 1 97  ? 54.879 24.367  36.053 1.00 21.11 ? 110 SER A CA  1 
ATOM   693  C  C   . SER A 1 97  ? 55.121 23.878  34.630 1.00 19.87 ? 110 SER A C   1 
ATOM   694  O  O   . SER A 1 97  ? 54.948 22.694  34.342 1.00 18.66 ? 110 SER A O   1 
ATOM   695  C  CB  . SER A 1 97  ? 56.181 24.255  36.851 1.00 22.29 ? 110 SER A CB  1 
ATOM   696  O  OG  . SER A 1 97  ? 55.975 24.575  38.215 1.00 30.94 ? 110 SER A OG  1 
ATOM   697  N  N   . ALA A 1 98  ? 55.520 24.782  33.742 1.00 19.28 ? 111 ALA A N   1 
ATOM   698  C  CA  . ALA A 1 98  ? 55.787 24.407  32.361 1.00 19.28 ? 111 ALA A CA  1 
ATOM   699  C  C   . ALA A 1 98  ? 57.023 23.517  32.302 1.00 19.21 ? 111 ALA A C   1 
ATOM   700  O  O   . ALA A 1 98  ? 57.992 23.733  33.029 1.00 19.48 ? 111 ALA A O   1 
ATOM   701  C  CB  . ALA A 1 98  ? 56.000 25.652  31.510 1.00 20.45 ? 111 ALA A CB  1 
ATOM   702  N  N   . ALA A 1 99  ? 56.983 22.507  31.443 1.00 17.85 ? 112 ALA A N   1 
ATOM   703  C  CA  . ALA A 1 99  ? 58.113 21.603  31.294 1.00 17.36 ? 112 ALA A CA  1 
ATOM   704  C  C   . ALA A 1 99  ? 59.190 22.293  30.467 1.00 17.49 ? 112 ALA A C   1 
ATOM   705  O  O   . ALA A 1 99  ? 58.899 23.212  29.701 1.00 15.83 ? 112 ALA A O   1 
ATOM   706  C  CB  . ALA A 1 99  ? 57.670 20.321  30.602 1.00 17.82 ? 112 ALA A CB  1 
ATOM   707  N  N   . SER A 1 100 ? 60.434 21.862  30.638 1.00 17.18 ? 113 SER A N   1 
ATOM   708  C  CA  . SER A 1 100 ? 61.533 22.430  29.870 1.00 18.95 ? 113 SER A CA  1 
ATOM   709  C  C   . SER A 1 100 ? 61.664 21.558  28.638 1.00 18.71 ? 113 SER A C   1 
ATOM   710  O  O   . SER A 1 100 ? 62.064 20.397  28.729 1.00 20.00 ? 113 SER A O   1 
ATOM   711  C  CB  . SER A 1 100 ? 62.833 22.404  30.676 1.00 20.55 ? 113 SER A CB  1 
ATOM   712  O  OG  . SER A 1 100 ? 62.727 23.229  31.823 1.00 26.58 ? 113 SER A OG  1 
ATOM   713  N  N   . LEU A 1 101 ? 61.310 22.108  27.485 1.00 19.15 ? 114 LEU A N   1 
ATOM   714  C  CA  . LEU A 1 101 ? 61.373 21.343  26.250 1.00 21.02 ? 114 LEU A CA  1 
ATOM   715  C  C   . LEU A 1 101 ? 62.781 21.273  25.677 1.00 22.36 ? 114 LEU A C   1 
ATOM   716  O  O   . LEU A 1 101 ? 63.504 22.268  25.645 1.00 22.38 ? 114 LEU A O   1 
ATOM   717  C  CB  . LEU A 1 101 ? 60.411 21.937  25.217 1.00 21.04 ? 114 LEU A CB  1 
ATOM   718  C  CG  . LEU A 1 101 ? 58.952 22.022  25.676 1.00 22.24 ? 114 LEU A CG  1 
ATOM   719  C  CD1 . LEU A 1 101 ? 58.090 22.574  24.555 1.00 25.21 ? 114 LEU A CD1 1 
ATOM   720  C  CD2 . LEU A 1 101 ? 58.462 20.646  26.094 1.00 24.03 ? 114 LEU A CD2 1 
ATOM   721  N  N   . ASN A 1 102 ? 63.162 20.079  25.240 1.00 21.88 ? 115 ASN A N   1 
ATOM   722  C  CA  . ASN A 1 102 ? 64.471 19.841  24.648 1.00 24.28 ? 115 ASN A CA  1 
ATOM   723  C  C   . ASN A 1 102 ? 64.366 18.642  23.711 1.00 24.98 ? 115 ASN A C   1 
ATOM   724  O  O   . ASN A 1 102 ? 63.265 18.257  23.316 1.00 25.93 ? 115 ASN A O   1 
ATOM   725  C  CB  . ASN A 1 102 ? 65.522 19.592  25.740 1.00 24.06 ? 115 ASN A CB  1 
ATOM   726  C  CG  . ASN A 1 102 ? 65.118 18.497  26.710 1.00 25.18 ? 115 ASN A CG  1 
ATOM   727  O  OD1 . ASN A 1 102 ? 64.851 17.367  26.310 1.00 25.26 ? 115 ASN A OD1 1 
ATOM   728  N  ND2 . ASN A 1 102 ? 65.077 18.830  27.996 1.00 25.92 ? 115 ASN A ND2 1 
ATOM   729  N  N   . SER A 1 103 ? 65.498 18.050  23.350 1.00 25.88 ? 116 SER A N   1 
ATOM   730  C  CA  . SER A 1 103 ? 65.478 16.908  22.444 1.00 27.03 ? 116 SER A CA  1 
ATOM   731  C  C   . SER A 1 103 ? 64.918 15.648  23.100 1.00 26.41 ? 116 SER A C   1 
ATOM   732  O  O   . SER A 1 103 ? 64.418 14.758  22.415 1.00 27.96 ? 116 SER A O   1 
ATOM   733  C  CB  . SER A 1 103 ? 66.887 16.631  21.910 1.00 28.02 ? 116 SER A CB  1 
ATOM   734  O  OG  . SER A 1 103 ? 67.778 16.302  22.960 1.00 31.92 ? 116 SER A OG  1 
ATOM   735  N  N   . ARG A 1 104 ? 64.992 15.585  24.426 1.00 25.47 ? 117 ARG A N   1 
ATOM   736  C  CA  . ARG A 1 104 ? 64.512 14.423  25.173 1.00 24.61 ? 117 ARG A CA  1 
ATOM   737  C  C   . ARG A 1 104 ? 63.063 14.574  25.627 1.00 21.84 ? 117 ARG A C   1 
ATOM   738  O  O   . ARG A 1 104 ? 62.376 13.584  25.886 1.00 20.69 ? 117 ARG A O   1 
ATOM   739  C  CB  . ARG A 1 104 ? 65.405 14.187  26.395 1.00 28.08 ? 117 ARG A CB  1 
ATOM   740  C  CG  . ARG A 1 104 ? 66.893 14.125  26.079 1.00 33.25 ? 117 ARG A CG  1 
ATOM   741  C  CD  . ARG A 1 104 ? 67.226 12.949  25.179 1.00 37.93 ? 117 ARG A CD  1 
ATOM   742  N  NE  . ARG A 1 104 ? 68.619 12.968  24.736 1.00 42.59 ? 117 ARG A NE  1 
ATOM   743  C  CZ  . ARG A 1 104 ? 69.670 12.907  25.549 1.00 44.60 ? 117 ARG A CZ  1 
ATOM   744  N  NH1 . ARG A 1 104 ? 69.496 12.822  26.861 1.00 46.70 ? 117 ARG A NH1 1 
ATOM   745  N  NH2 . ARG A 1 104 ? 70.899 12.929  25.047 1.00 45.84 ? 117 ARG A NH2 1 
ATOM   746  N  N   . VAL A 1 105 ? 62.608 15.816  25.739 1.00 18.94 ? 118 VAL A N   1 
ATOM   747  C  CA  . VAL A 1 105 ? 61.240 16.096  26.158 1.00 17.47 ? 118 VAL A CA  1 
ATOM   748  C  C   . VAL A 1 105 ? 60.627 17.070  25.163 1.00 17.17 ? 118 VAL A C   1 
ATOM   749  O  O   . VAL A 1 105 ? 60.955 18.259  25.157 1.00 17.14 ? 118 VAL A O   1 
ATOM   750  C  CB  . VAL A 1 105 ? 61.201 16.710  27.572 1.00 16.05 ? 118 VAL A CB  1 
ATOM   751  C  CG1 . VAL A 1 105 ? 59.762 17.043  27.960 1.00 16.78 ? 118 VAL A CG1 1 
ATOM   752  C  CG2 . VAL A 1 105 ? 61.801 15.731  28.575 1.00 16.16 ? 118 VAL A CG2 1 
ATOM   753  N  N   . ALA A 1 106 ? 59.737 16.557  24.321 1.00 16.14 ? 119 ALA A N   1 
ATOM   754  C  CA  . ALA A 1 106 ? 59.097 17.374  23.301 1.00 16.04 ? 119 ALA A CA  1 
ATOM   755  C  C   . ALA A 1 106 ? 57.619 17.044  23.181 1.00 15.54 ? 119 ALA A C   1 
ATOM   756  O  O   . ALA A 1 106 ? 57.174 15.966  23.577 1.00 14.15 ? 119 ALA A O   1 
ATOM   757  C  CB  . ALA A 1 106 ? 59.792 17.160  21.959 1.00 17.26 ? 119 ALA A CB  1 
ATOM   758  N  N   . SER A 1 107 ? 56.857 17.976  22.626 1.00 14.55 ? 120 SER A N   1 
ATOM   759  C  CA  . SER A 1 107 ? 55.428 17.772  22.465 1.00 13.93 ? 120 SER A CA  1 
ATOM   760  C  C   . SER A 1 107 ? 55.108 17.113  21.128 1.00 14.26 ? 120 SER A C   1 
ATOM   761  O  O   . SER A 1 107 ? 55.922 17.123  20.200 1.00 13.19 ? 120 SER A O   1 
ATOM   762  C  CB  . SER A 1 107 ? 54.694 19.108  22.582 1.00 15.87 ? 120 SER A CB  1 
ATOM   763  O  OG  . SER A 1 107 ? 55.186 20.038  21.642 1.00 19.07 ? 120 SER A OG  1 
ATOM   764  N  N   . ILE A 1 108 ? 53.922 16.522  21.045 1.00 13.13 ? 121 ILE A N   1 
ATOM   765  C  CA  . ILE A 1 108 ? 53.475 15.861  19.827 1.00 13.00 ? 121 ILE A CA  1 
ATOM   766  C  C   . ILE A 1 108 ? 52.319 16.691  19.273 1.00 14.61 ? 121 ILE A C   1 
ATOM   767  O  O   . ILE A 1 108 ? 51.532 17.250  20.035 1.00 14.86 ? 121 ILE A O   1 
ATOM   768  C  CB  . ILE A 1 108 ? 53.015 14.406  20.122 1.00 13.38 ? 121 ILE A CB  1 
ATOM   769  C  CG1 . ILE A 1 108 ? 52.688 13.685  18.814 1.00 14.49 ? 121 ILE A CG1 1 
ATOM   770  C  CG2 . ILE A 1 108 ? 51.821 14.408  21.061 1.00 14.28 ? 121 ILE A CG2 1 
ATOM   771  C  CD1 . ILE A 1 108 ? 53.896 13.498  17.916 1.00 15.11 ? 121 ILE A CD1 1 
ATOM   772  N  N   . SER A 1 109 ? 52.223 16.780  17.949 1.00 14.04 ? 122 SER A N   1 
ATOM   773  C  CA  . SER A 1 109 ? 51.173 17.570  17.317 1.00 16.34 ? 122 SER A CA  1 
ATOM   774  C  C   . SER A 1 109 ? 49.802 16.910  17.303 1.00 15.56 ? 122 SER A C   1 
ATOM   775  O  O   . SER A 1 109 ? 49.687 15.686  17.237 1.00 14.62 ? 122 SER A O   1 
ATOM   776  C  CB  . SER A 1 109 ? 51.562 17.904  15.872 1.00 18.16 ? 122 SER A CB  1 
ATOM   777  O  OG  . SER A 1 109 ? 52.728 18.705  15.826 1.00 24.18 ? 122 SER A OG  1 
ATOM   778  N  N   . LEU A 1 110 ? 48.762 17.735  17.374 1.00 15.42 ? 123 LEU A N   1 
ATOM   779  C  CA  . LEU A 1 110 ? 47.396 17.236  17.314 1.00 16.31 ? 123 LEU A CA  1 
ATOM   780  C  C   . LEU A 1 110 ? 47.062 17.112  15.826 1.00 18.61 ? 123 LEU A C   1 
ATOM   781  O  O   . LEU A 1 110 ? 47.574 17.872  15.001 1.00 18.71 ? 123 LEU A O   1 
ATOM   782  C  CB  . LEU A 1 110 ? 46.436 18.211  18.003 1.00 17.32 ? 123 LEU A CB  1 
ATOM   783  C  CG  . LEU A 1 110 ? 46.560 18.290  19.531 1.00 16.61 ? 123 LEU A CG  1 
ATOM   784  C  CD1 . LEU A 1 110 ? 45.631 19.361  20.084 1.00 19.17 ? 123 LEU A CD1 1 
ATOM   785  C  CD2 . LEU A 1 110 ? 46.218 16.933  20.126 1.00 17.92 ? 123 LEU A CD2 1 
ATOM   786  N  N   . PRO A 1 111 ? 46.209 16.147  15.462 1.00 18.03 ? 124 PRO A N   1 
ATOM   787  C  CA  . PRO A 1 111 ? 45.840 15.955  14.056 1.00 19.93 ? 124 PRO A CA  1 
ATOM   788  C  C   . PRO A 1 111 ? 44.943 17.044  13.477 1.00 20.75 ? 124 PRO A C   1 
ATOM   789  O  O   . PRO A 1 111 ? 44.194 17.697  14.200 1.00 20.43 ? 124 PRO A O   1 
ATOM   790  C  CB  . PRO A 1 111 ? 45.157 14.592  14.069 1.00 18.24 ? 124 PRO A CB  1 
ATOM   791  C  CG  . PRO A 1 111 ? 44.482 14.585  15.408 1.00 19.39 ? 124 PRO A CG  1 
ATOM   792  C  CD  . PRO A 1 111 ? 45.556 15.144  16.321 1.00 18.29 ? 124 PRO A CD  1 
ATOM   793  N  N   . THR A 1 112 ? 45.036 17.236  12.164 1.00 24.15 ? 125 THR A N   1 
ATOM   794  C  CA  . THR A 1 112 ? 44.220 18.224  11.466 1.00 26.53 ? 125 THR A CA  1 
ATOM   795  C  C   . THR A 1 112 ? 43.092 17.477  10.764 1.00 26.47 ? 125 THR A C   1 
ATOM   796  O  O   . THR A 1 112 ? 42.089 18.065  10.359 1.00 28.41 ? 125 THR A O   1 
ATOM   797  C  CB  . THR A 1 112 ? 45.043 18.994  10.413 1.00 27.91 ? 125 THR A CB  1 
ATOM   798  O  OG1 . THR A 1 112 ? 45.673 18.062  9.524  1.00 30.53 ? 125 THR A OG1 1 
ATOM   799  C  CG2 . THR A 1 112 ? 46.109 19.844  11.087 1.00 29.36 ? 125 THR A CG2 1 
ATOM   800  N  N   . SER A 1 113 ? 43.277 16.169  10.624 1.00 25.03 ? 127 SER A N   1 
ATOM   801  C  CA  . SER A 1 113 ? 42.293 15.303  9.991  1.00 24.16 ? 127 SER A CA  1 
ATOM   802  C  C   . SER A 1 113 ? 42.440 13.899  10.568 1.00 22.57 ? 127 SER A C   1 
ATOM   803  O  O   . SER A 1 113 ? 43.488 13.550  11.112 1.00 21.16 ? 127 SER A O   1 
ATOM   804  C  CB  . SER A 1 113 ? 42.509 15.267  8.476  1.00 26.49 ? 127 SER A CB  1 
ATOM   805  O  OG  . SER A 1 113 ? 43.794 14.759  8.161  1.00 30.13 ? 127 SER A OG  1 
ATOM   806  N  N   . CYS A 1 114 ? 41.388 13.099  10.454 1.00 21.21 ? 128 CYS A N   1 
ATOM   807  C  CA  . CYS A 1 114 ? 41.411 11.738  10.971 1.00 20.68 ? 128 CYS A CA  1 
ATOM   808  C  C   . CYS A 1 114 ? 42.233 10.814  10.080 1.00 22.26 ? 128 CYS A C   1 
ATOM   809  O  O   . CYS A 1 114 ? 42.342 11.035  8.874  1.00 21.70 ? 128 CYS A O   1 
ATOM   810  C  CB  . CYS A 1 114 ? 39.989 11.200  11.085 1.00 19.72 ? 128 CYS A CB  1 
ATOM   811  S  SG  . CYS A 1 114 ? 38.899 12.160  12.180 1.00 19.05 ? 128 CYS A SG  1 
ATOM   812  N  N   . ALA A 1 115 ? 42.805 9.776   10.682 1.00 21.24 ? 129 ALA A N   1 
ATOM   813  C  CA  . ALA A 1 115 ? 43.616 8.813   9.948  1.00 22.06 ? 129 ALA A CA  1 
ATOM   814  C  C   . ALA A 1 115 ? 42.721 7.758   9.299  1.00 22.91 ? 129 ALA A C   1 
ATOM   815  O  O   . ALA A 1 115 ? 41.638 7.457   9.798  1.00 25.08 ? 129 ALA A O   1 
ATOM   816  C  CB  . ALA A 1 115 ? 44.613 8.150   10.888 1.00 21.85 ? 129 ALA A CB  1 
ATOM   817  N  N   . SER A 1 116 ? 43.176 7.200   8.183  1.00 22.40 ? 130 SER A N   1 
ATOM   818  C  CA  . SER A 1 116 ? 42.399 6.189   7.480  1.00 22.17 ? 130 SER A CA  1 
ATOM   819  C  C   . SER A 1 116 ? 42.855 4.785   7.858  1.00 20.54 ? 130 SER A C   1 
ATOM   820  O  O   . SER A 1 116 ? 43.952 4.600   8.385  1.00 20.51 ? 130 SER A O   1 
ATOM   821  C  CB  . SER A 1 116 ? 42.536 6.382   5.965  1.00 24.48 ? 130 SER A CB  1 
ATOM   822  O  OG  . SER A 1 116 ? 43.885 6.237   5.551  1.00 28.92 ? 130 SER A OG  1 
ATOM   823  N  N   . ALA A 1 117 ? 42.006 3.797   7.591  1.00 19.34 ? 132 ALA A N   1 
ATOM   824  C  CA  . ALA A 1 117 ? 42.346 2.412   7.890  1.00 18.39 ? 132 ALA A CA  1 
ATOM   825  C  C   . ALA A 1 117 ? 43.623 2.062   7.138  1.00 17.78 ? 132 ALA A C   1 
ATOM   826  O  O   . ALA A 1 117 ? 43.840 2.534   6.020  1.00 18.10 ? 132 ALA A O   1 
ATOM   827  C  CB  . ALA A 1 117 ? 41.211 1.485   7.458  1.00 19.24 ? 132 ALA A CB  1 
ATOM   828  N  N   . GLY A 1 118 ? 44.470 1.242   7.750  1.00 16.48 ? 133 GLY A N   1 
ATOM   829  C  CA  . GLY A 1 118 ? 45.708 0.851   7.102  1.00 16.88 ? 133 GLY A CA  1 
ATOM   830  C  C   . GLY A 1 118 ? 46.892 1.727   7.462  1.00 18.12 ? 133 GLY A C   1 
ATOM   831  O  O   . GLY A 1 118 ? 48.038 1.366   7.195  1.00 18.75 ? 133 GLY A O   1 
ATOM   832  N  N   . THR A 1 119 ? 46.619 2.884   8.056  1.00 16.65 ? 134 THR A N   1 
ATOM   833  C  CA  . THR A 1 119 ? 47.678 3.803   8.463  1.00 17.58 ? 134 THR A CA  1 
ATOM   834  C  C   . THR A 1 119 ? 48.511 3.144   9.560  1.00 16.80 ? 134 THR A C   1 
ATOM   835  O  O   . THR A 1 119 ? 47.963 2.607   10.524 1.00 15.38 ? 134 THR A O   1 
ATOM   836  C  CB  . THR A 1 119 ? 47.091 5.121   9.009  1.00 18.82 ? 134 THR A CB  1 
ATOM   837  O  OG1 . THR A 1 119 ? 46.293 5.744   7.995  1.00 21.14 ? 134 THR A OG1 1 
ATOM   838  C  CG2 . THR A 1 119 ? 48.208 6.072   9.431  1.00 20.29 ? 134 THR A CG2 1 
ATOM   839  N  N   . GLN A 1 120 ? 49.831 3.184   9.411  1.00 16.05 ? 135 GLN A N   1 
ATOM   840  C  CA  . GLN A 1 120 ? 50.722 2.580   10.395 1.00 18.72 ? 135 GLN A CA  1 
ATOM   841  C  C   . GLN A 1 120 ? 51.006 3.585   11.506 1.00 16.49 ? 135 GLN A C   1 
ATOM   842  O  O   . GLN A 1 120 ? 51.312 4.747   11.234 1.00 16.42 ? 135 GLN A O   1 
ATOM   843  C  CB  . GLN A 1 120 ? 52.036 2.159   9.732  1.00 23.07 ? 135 GLN A CB  1 
ATOM   844  C  CG  . GLN A 1 120 ? 52.736 1.021   10.455 1.00 29.71 ? 135 GLN A CG  1 
ATOM   845  C  CD  . GLN A 1 120 ? 52.000 -0.302  10.303 1.00 33.10 ? 135 GLN A CD  1 
ATOM   846  O  OE1 . GLN A 1 120 ? 52.164 -1.214  11.114 1.00 35.96 ? 135 GLN A OE1 1 
ATOM   847  N  NE2 . GLN A 1 120 ? 51.196 -0.416  9.249  1.00 34.08 ? 135 GLN A NE2 1 
ATOM   848  N  N   . CYS A 1 121 ? 50.916 3.134   12.753 1.00 15.31 ? 136 CYS A N   1 
ATOM   849  C  CA  . CYS A 1 121 ? 51.143 4.015   13.896 1.00 13.94 ? 136 CYS A CA  1 
ATOM   850  C  C   . CYS A 1 121 ? 52.094 3.417   14.921 1.00 13.57 ? 136 CYS A C   1 
ATOM   851  O  O   . CYS A 1 121 ? 52.352 2.214   14.923 1.00 13.63 ? 136 CYS A O   1 
ATOM   852  C  CB  . CYS A 1 121 ? 49.821 4.315   14.595 1.00 13.85 ? 136 CYS A CB  1 
ATOM   853  S  SG  . CYS A 1 121 ? 48.464 4.838   13.502 1.00 14.70 ? 136 CYS A SG  1 
ATOM   854  N  N   . LEU A 1 122 ? 52.597 4.271   15.804 1.00 12.56 ? 137 LEU A N   1 
ATOM   855  C  CA  . LEU A 1 122 ? 53.502 3.833   16.856 1.00 11.33 ? 137 LEU A CA  1 
ATOM   856  C  C   . LEU A 1 122 ? 52.782 3.956   18.193 1.00 10.84 ? 137 LEU A C   1 
ATOM   857  O  O   . LEU A 1 122 ? 52.275 5.024   18.540 1.00 11.05 ? 137 LEU A O   1 
ATOM   858  C  CB  . LEU A 1 122 ? 54.776 4.690   16.877 1.00 12.60 ? 137 LEU A CB  1 
ATOM   859  C  CG  . LEU A 1 122 ? 55.768 4.345   17.997 1.00 14.34 ? 137 LEU A CG  1 
ATOM   860  C  CD1 . LEU A 1 122 ? 56.321 2.949   17.773 1.00 15.64 ? 137 LEU A CD1 1 
ATOM   861  C  CD2 . LEU A 1 122 ? 56.900 5.360   18.030 1.00 17.47 ? 137 LEU A CD2 1 
ATOM   862  N  N   . ILE A 1 123 ? 52.730 2.850   18.926 1.00 10.60 ? 138 ILE A N   1 
ATOM   863  C  CA  . ILE A 1 123 ? 52.090 2.805   20.236 1.00 10.89 ? 138 ILE A CA  1 
ATOM   864  C  C   . ILE A 1 123 ? 53.203 2.498   21.235 1.00 10.98 ? 138 ILE A C   1 
ATOM   865  O  O   . ILE A 1 123 ? 54.067 1.666   20.966 1.00 10.96 ? 138 ILE A O   1 
ATOM   866  C  CB  . ILE A 1 123 ? 51.024 1.693   20.283 1.00 12.20 ? 138 ILE A CB  1 
ATOM   867  C  CG1 . ILE A 1 123 ? 50.043 1.881   19.121 1.00 14.06 ? 138 ILE A CG1 1 
ATOM   868  C  CG2 . ILE A 1 123 ? 50.283 1.729   21.617 1.00 12.00 ? 138 ILE A CG2 1 
ATOM   869  C  CD1 . ILE A 1 123 ? 49.030 0.768   18.978 1.00 16.30 ? 138 ILE A CD1 1 
ATOM   870  N  N   . SER A 1 124 ? 53.185 3.160   22.387 1.00 10.74 ? 139 SER A N   1 
ATOM   871  C  CA  . SER A 1 124 ? 54.236 2.948   23.374 1.00 9.62  ? 139 SER A CA  1 
ATOM   872  C  C   . SER A 1 124 ? 53.721 3.016   24.806 1.00 9.83  ? 139 SER A C   1 
ATOM   873  O  O   . SER A 1 124 ? 52.660 3.586   25.067 1.00 10.57 ? 139 SER A O   1 
ATOM   874  C  CB  . SER A 1 124 ? 55.339 3.993   23.168 1.00 9.65  ? 139 SER A CB  1 
ATOM   875  O  OG  . SER A 1 124 ? 54.788 5.304   23.130 1.00 11.18 ? 139 SER A OG  1 
ATOM   876  N  N   . GLY A 1 125 ? 54.477 2.427   25.729 1.00 9.69  ? 140 GLY A N   1 
ATOM   877  C  CA  . GLY A 1 125 ? 54.084 2.439   27.126 1.00 11.02 ? 140 GLY A CA  1 
ATOM   878  C  C   . GLY A 1 125 ? 54.854 1.473   28.009 1.00 12.49 ? 140 GLY A C   1 
ATOM   879  O  O   . GLY A 1 125 ? 55.647 0.660   27.528 1.00 11.76 ? 140 GLY A O   1 
ATOM   880  N  N   . TRP A 1 126 ? 54.610 1.571   29.313 1.00 11.04 ? 141 TRP A N   1 
ATOM   881  C  CA  . TRP A 1 126 ? 55.255 0.719   30.306 1.00 11.89 ? 141 TRP A CA  1 
ATOM   882  C  C   . TRP A 1 126 ? 54.254 -0.307  30.843 1.00 12.54 ? 141 TRP A C   1 
ATOM   883  O  O   . TRP A 1 126 ? 54.398 -0.794  31.966 1.00 13.66 ? 141 TRP A O   1 
ATOM   884  C  CB  . TRP A 1 126 ? 55.776 1.575   31.466 1.00 10.49 ? 141 TRP A CB  1 
ATOM   885  C  CG  . TRP A 1 126 ? 56.958 2.431   31.120 1.00 10.49 ? 141 TRP A CG  1 
ATOM   886  C  CD1 . TRP A 1 126 ? 58.272 2.056   31.124 1.00 10.45 ? 141 TRP A CD1 1 
ATOM   887  C  CD2 . TRP A 1 126 ? 56.935 3.813   30.742 1.00 9.97  ? 141 TRP A CD2 1 
ATOM   888  N  NE1 . TRP A 1 126 ? 59.070 3.122   30.779 1.00 10.14 ? 141 TRP A NE1 1 
ATOM   889  C  CE2 . TRP A 1 126 ? 58.275 4.213   30.538 1.00 10.45 ? 141 TRP A CE2 1 
ATOM   890  C  CE3 . TRP A 1 126 ? 55.912 4.755   30.559 1.00 9.41  ? 141 TRP A CE3 1 
ATOM   891  C  CZ2 . TRP A 1 126 ? 58.621 5.519   30.159 1.00 10.90 ? 141 TRP A CZ2 1 
ATOM   892  C  CZ3 . TRP A 1 126 ? 56.255 6.052   30.185 1.00 9.64  ? 141 TRP A CZ3 1 
ATOM   893  C  CH2 . TRP A 1 126 ? 57.599 6.420   29.990 1.00 10.65 ? 141 TRP A CH2 1 
ATOM   894  N  N   . GLY A 1 127 ? 53.242 -0.622  30.038 1.00 12.56 ? 142 GLY A N   1 
ATOM   895  C  CA  . GLY A 1 127 ? 52.231 -1.582  30.444 1.00 13.66 ? 142 GLY A CA  1 
ATOM   896  C  C   . GLY A 1 127 ? 52.696 -3.030  30.414 1.00 14.77 ? 142 GLY A C   1 
ATOM   897  O  O   . GLY A 1 127 ? 53.829 -3.329  30.035 1.00 14.66 ? 142 GLY A O   1 
ATOM   898  N  N   . ASN A 1 128 ? 51.807 -3.931  30.813 1.00 15.74 ? 143 ASN A N   1 
ATOM   899  C  CA  . ASN A 1 128 ? 52.104 -5.359  30.855 1.00 17.06 ? 143 ASN A CA  1 
ATOM   900  C  C   . ASN A 1 128 ? 52.569 -5.884  29.499 1.00 17.30 ? 143 ASN A C   1 
ATOM   901  O  O   . ASN A 1 128 ? 52.025 -5.514  28.457 1.00 13.92 ? 143 ASN A O   1 
ATOM   902  C  CB  . ASN A 1 128 ? 50.864 -6.118  31.333 1.00 19.67 ? 143 ASN A CB  1 
ATOM   903  C  CG  . ASN A 1 128 ? 51.122 -7.597  31.536 1.00 24.14 ? 143 ASN A CG  1 
ATOM   904  O  OD1 . ASN A 1 128 ? 52.206 -7.999  31.957 1.00 26.31 ? 143 ASN A OD1 1 
ATOM   905  N  ND2 . ASN A 1 128 ? 50.116 -8.415  31.254 1.00 27.86 ? 143 ASN A ND2 1 
ATOM   906  N  N   . THR A 1 129 ? 53.582 -6.748  29.521 1.00 18.15 ? 144 THR A N   1 
ATOM   907  C  CA  . THR A 1 129 ? 54.138 -7.318  28.297 1.00 21.11 ? 144 THR A CA  1 
ATOM   908  C  C   . THR A 1 129 ? 53.709 -8.765  28.056 1.00 23.85 ? 144 THR A C   1 
ATOM   909  O  O   . THR A 1 129 ? 54.118 -9.378  27.071 1.00 23.79 ? 144 THR A O   1 
ATOM   910  C  CB  . THR A 1 129 ? 55.682 -7.284  28.317 1.00 21.75 ? 144 THR A CB  1 
ATOM   911  O  OG1 . THR A 1 129 ? 56.160 -8.038  29.438 1.00 21.91 ? 144 THR A OG1 1 
ATOM   912  C  CG2 . THR A 1 129 ? 56.188 -5.849  28.427 1.00 22.89 ? 144 THR A CG2 1 
ATOM   913  N  N   . LYS A 1 130 ? 52.893 -9.312  28.949 1.00 27.01 ? 145 LYS A N   1 
ATOM   914  C  CA  . LYS A 1 130 ? 52.436 -10.691 28.802 1.00 32.97 ? 145 LYS A CA  1 
ATOM   915  C  C   . LYS A 1 130 ? 50.939 -10.819 28.564 1.00 35.57 ? 145 LYS A C   1 
ATOM   916  O  O   . LYS A 1 130 ? 50.130 -10.197 29.252 1.00 35.10 ? 145 LYS A O   1 
ATOM   917  C  CB  . LYS A 1 130 ? 52.837 -11.518 30.030 1.00 34.21 ? 145 LYS A CB  1 
ATOM   918  C  CG  . LYS A 1 130 ? 54.194 -12.203 29.901 1.00 37.37 ? 145 LYS A CG  1 
ATOM   919  C  CD  . LYS A 1 130 ? 55.288 -11.223 29.497 1.00 40.10 ? 145 LYS A CD  1 
ATOM   920  C  CE  . LYS A 1 130 ? 56.616 -11.929 29.238 1.00 41.80 ? 145 LYS A CE  1 
ATOM   921  N  NZ  . LYS A 1 130 ? 57.667 -10.984 28.752 1.00 41.79 ? 145 LYS A NZ  1 
ATOM   922  N  N   . SER A 1 131 ? 50.583 -11.634 27.577 1.00 39.34 ? 146 SER A N   1 
ATOM   923  C  CA  . SER A 1 131 ? 49.188 -11.870 27.228 1.00 42.83 ? 146 SER A CA  1 
ATOM   924  C  C   . SER A 1 131 ? 48.529 -12.737 28.294 1.00 44.89 ? 146 SER A C   1 
ATOM   925  O  O   . SER A 1 131 ? 47.324 -12.643 28.535 1.00 45.24 ? 146 SER A O   1 
ATOM   926  C  CB  . SER A 1 131 ? 49.101 -12.566 25.870 1.00 43.07 ? 146 SER A CB  1 
ATOM   927  O  OG  . SER A 1 131 ? 47.754 -12.826 25.521 1.00 46.62 ? 146 SER A OG  1 
ATOM   928  N  N   . SER A 1 132 ? 49.332 -13.586 28.927 1.00 46.99 ? 147 SER A N   1 
ATOM   929  C  CA  . SER A 1 132 ? 48.847 -14.472 29.977 1.00 49.00 ? 147 SER A CA  1 
ATOM   930  C  C   . SER A 1 132 ? 49.744 -14.331 31.203 1.00 49.56 ? 147 SER A C   1 
ATOM   931  O  O   . SER A 1 132 ? 50.758 -15.021 31.328 1.00 50.67 ? 147 SER A O   1 
ATOM   932  C  CB  . SER A 1 132 ? 48.852 -15.924 29.489 1.00 49.62 ? 147 SER A CB  1 
ATOM   933  O  OG  . SER A 1 132 ? 48.400 -16.804 30.503 1.00 51.45 ? 147 SER A OG  1 
ATOM   934  N  N   . GLY A 1 133 ? 49.365 -13.430 32.103 1.00 49.32 ? 148 GLY A N   1 
ATOM   935  C  CA  . GLY A 1 133 ? 50.149 -13.205 33.303 1.00 48.56 ? 148 GLY A CA  1 
ATOM   936  C  C   . GLY A 1 133 ? 50.489 -11.735 33.461 1.00 47.88 ? 148 GLY A C   1 
ATOM   937  O  O   . GLY A 1 133 ? 50.045 -10.904 32.668 1.00 47.59 ? 148 GLY A O   1 
ATOM   938  N  N   . THR A 1 134 ? 51.279 -11.412 34.480 1.00 46.74 ? 149 THR A N   1 
ATOM   939  C  CA  . THR A 1 134 ? 51.668 -10.030 34.737 1.00 45.27 ? 149 THR A CA  1 
ATOM   940  C  C   . THR A 1 134 ? 53.183 -9.851  34.738 1.00 43.75 ? 149 THR A C   1 
ATOM   941  O  O   . THR A 1 134 ? 53.897 -10.521 35.484 1.00 44.44 ? 149 THR A O   1 
ATOM   942  C  CB  . THR A 1 134 ? 51.112 -9.544  36.089 1.00 45.93 ? 149 THR A CB  1 
ATOM   943  O  OG1 . THR A 1 134 ? 49.680 -9.591  36.058 1.00 46.95 ? 149 THR A OG1 1 
ATOM   944  C  CG2 . THR A 1 134 ? 51.560 -8.120  36.371 1.00 45.89 ? 149 THR A CG2 1 
ATOM   945  N  N   . SER A 1 135 ? 53.662 -8.939  33.899 1.00 40.82 ? 150 SER A N   1 
ATOM   946  C  CA  . SER A 1 135 ? 55.088 -8.654  33.790 1.00 37.96 ? 150 SER A CA  1 
ATOM   947  C  C   . SER A 1 135 ? 55.292 -7.224  33.289 1.00 35.78 ? 150 SER A C   1 
ATOM   948  O  O   . SER A 1 135 ? 55.155 -6.949  32.097 1.00 34.99 ? 150 SER A O   1 
ATOM   949  C  CB  . SER A 1 135 ? 55.750 -9.641  32.826 1.00 37.98 ? 150 SER A CB  1 
ATOM   950  O  OG  . SER A 1 135 ? 57.141 -9.395  32.717 1.00 37.99 ? 150 SER A OG  1 
ATOM   951  N  N   . TYR A 1 136 ? 55.617 -6.320  34.208 1.00 33.36 ? 151 TYR A N   1 
ATOM   952  C  CA  . TYR A 1 136 ? 55.833 -4.918  33.863 1.00 30.30 ? 151 TYR A CA  1 
ATOM   953  C  C   . TYR A 1 136 ? 57.303 -4.639  33.592 1.00 27.19 ? 151 TYR A C   1 
ATOM   954  O  O   . TYR A 1 136 ? 58.173 -5.026  34.372 1.00 28.25 ? 151 TYR A O   1 
ATOM   955  C  CB  . TYR A 1 136 ? 55.327 -4.023  34.991 1.00 32.51 ? 151 TYR A CB  1 
ATOM   956  C  CG  . TYR A 1 136 ? 53.833 -4.100  35.188 1.00 35.47 ? 151 TYR A CG  1 
ATOM   957  C  CD1 . TYR A 1 136 ? 52.958 -3.584  34.233 1.00 36.02 ? 151 TYR A CD1 1 
ATOM   958  C  CD2 . TYR A 1 136 ? 53.290 -4.708  36.321 1.00 37.28 ? 151 TYR A CD2 1 
ATOM   959  C  CE1 . TYR A 1 136 ? 51.579 -3.672  34.396 1.00 37.91 ? 151 TYR A CE1 1 
ATOM   960  C  CE2 . TYR A 1 136 ? 51.910 -4.802  36.496 1.00 39.00 ? 151 TYR A CE2 1 
ATOM   961  C  CZ  . TYR A 1 136 ? 51.062 -4.282  35.529 1.00 39.63 ? 151 TYR A CZ  1 
ATOM   962  O  OH  . TYR A 1 136 ? 49.700 -4.378  35.691 1.00 41.83 ? 151 TYR A OH  1 
ATOM   963  N  N   . PRO A 1 137 ? 57.600 -3.957  32.476 1.00 23.32 ? 152 PRO A N   1 
ATOM   964  C  CA  . PRO A 1 137 ? 58.973 -3.626  32.093 1.00 20.98 ? 152 PRO A CA  1 
ATOM   965  C  C   . PRO A 1 137 ? 59.518 -2.397  32.809 1.00 19.94 ? 152 PRO A C   1 
ATOM   966  O  O   . PRO A 1 137 ? 58.754 -1.580  33.326 1.00 18.67 ? 152 PRO A O   1 
ATOM   967  C  CB  . PRO A 1 137 ? 58.852 -3.393  30.598 1.00 21.56 ? 152 PRO A CB  1 
ATOM   968  C  CG  . PRO A 1 137 ? 57.530 -2.688  30.511 1.00 20.45 ? 152 PRO A CG  1 
ATOM   969  C  CD  . PRO A 1 137 ? 56.648 -3.502  31.444 1.00 20.98 ? 152 PRO A CD  1 
ATOM   970  N  N   . ASP A 1 138 ? 60.841 -2.279  32.838 1.00 19.21 ? 153 ASP A N   1 
ATOM   971  C  CA  . ASP A 1 138 ? 61.494 -1.132  33.455 1.00 19.98 ? 153 ASP A CA  1 
ATOM   972  C  C   . ASP A 1 138 ? 61.603 -0.018  32.416 1.00 17.31 ? 153 ASP A C   1 
ATOM   973  O  O   . ASP A 1 138 ? 61.409 1.159   32.729 1.00 17.19 ? 153 ASP A O   1 
ATOM   974  C  CB  . ASP A 1 138 ? 62.907 -1.489  33.939 1.00 23.61 ? 153 ASP A CB  1 
ATOM   975  C  CG  . ASP A 1 138 ? 62.906 -2.396  35.156 1.00 26.32 ? 153 ASP A CG  1 
ATOM   976  O  OD1 . ASP A 1 138 ? 62.144 -2.124  36.106 1.00 28.14 ? 153 ASP A OD1 1 
ATOM   977  O  OD2 . ASP A 1 138 ? 63.681 -3.375  35.168 1.00 31.66 ? 153 ASP A OD2 1 
ATOM   978  N  N   . VAL A 1 139 ? 61.914 -0.397  31.179 1.00 15.07 ? 154 VAL A N   1 
ATOM   979  C  CA  . VAL A 1 139 ? 62.067 0.575   30.104 1.00 15.72 ? 154 VAL A CA  1 
ATOM   980  C  C   . VAL A 1 139 ? 60.862 0.635   29.172 1.00 14.35 ? 154 VAL A C   1 
ATOM   981  O  O   . VAL A 1 139 ? 60.040 -0.282  29.130 1.00 13.61 ? 154 VAL A O   1 
ATOM   982  C  CB  . VAL A 1 139 ? 63.339 0.300   29.270 1.00 17.19 ? 154 VAL A CB  1 
ATOM   983  C  CG1 . VAL A 1 139 ? 64.567 0.389   30.169 1.00 19.74 ? 154 VAL A CG1 1 
ATOM   984  C  CG2 . VAL A 1 139 ? 63.255 -1.075  28.607 1.00 18.63 ? 154 VAL A CG2 1 
ATOM   985  N  N   . LEU A 1 140 ? 60.775 1.727   28.423 1.00 12.91 ? 155 LEU A N   1 
ATOM   986  C  CA  . LEU A 1 140 ? 59.666 1.962   27.503 1.00 12.25 ? 155 LEU A CA  1 
ATOM   987  C  C   . LEU A 1 140 ? 59.640 0.984   26.332 1.00 12.68 ? 155 LEU A C   1 
ATOM   988  O  O   . LEU A 1 140 ? 60.659 0.748   25.683 1.00 11.69 ? 155 LEU A O   1 
ATOM   989  C  CB  . LEU A 1 140 ? 59.740 3.396   26.973 1.00 10.77 ? 155 LEU A CB  1 
ATOM   990  C  CG  . LEU A 1 140 ? 58.583 3.915   26.116 1.00 11.32 ? 155 LEU A CG  1 
ATOM   991  C  CD1 . LEU A 1 140 ? 57.296 3.941   26.928 1.00 10.82 ? 155 LEU A CD1 1 
ATOM   992  C  CD2 . LEU A 1 140 ? 58.924 5.319   25.617 1.00 12.59 ? 155 LEU A CD2 1 
ATOM   993  N  N   . LYS A 1 141 ? 58.461 0.426   26.065 1.00 12.43 ? 156 LYS A N   1 
ATOM   994  C  CA  . LYS A 1 141 ? 58.285 -0.519  24.971 1.00 12.23 ? 156 LYS A CA  1 
ATOM   995  C  C   . LYS A 1 141 ? 57.524 0.133   23.823 1.00 13.24 ? 156 LYS A C   1 
ATOM   996  O  O   . LYS A 1 141 ? 56.698 1.031   24.033 1.00 11.84 ? 156 LYS A O   1 
ATOM   997  C  CB  . LYS A 1 141 ? 57.540 -1.763  25.456 1.00 13.10 ? 156 LYS A CB  1 
ATOM   998  C  CG  . LYS A 1 141 ? 58.289 -2.556  26.516 1.00 15.09 ? 156 LYS A CG  1 
ATOM   999  C  CD  . LYS A 1 141 ? 59.559 -3.176  25.945 1.00 18.21 ? 156 LYS A CD  1 
ATOM   1000 C  CE  . LYS A 1 141 ? 60.304 -3.982  26.995 1.00 21.61 ? 156 LYS A CE  1 
ATOM   1001 N  NZ  . LYS A 1 141 ? 61.503 -4.656  26.421 1.00 23.56 ? 156 LYS A NZ  1 
ATOM   1002 N  N   . CYS A 1 142 ? 57.810 -0.337  22.612 1.00 12.24 ? 157 CYS A N   1 
ATOM   1003 C  CA  . CYS A 1 142 ? 57.212 0.191   21.393 1.00 12.78 ? 157 CYS A CA  1 
ATOM   1004 C  C   . CYS A 1 142 ? 56.538 -0.879  20.538 1.00 12.60 ? 157 CYS A C   1 
ATOM   1005 O  O   . CYS A 1 142 ? 56.903 -2.054  20.591 1.00 14.02 ? 157 CYS A O   1 
ATOM   1006 C  CB  . CYS A 1 142 ? 58.297 0.905   20.574 1.00 12.01 ? 157 CYS A CB  1 
ATOM   1007 S  SG  . CYS A 1 142 ? 58.524 2.634   21.090 1.00 13.08 ? 157 CYS A SG  1 
ATOM   1008 N  N   . LEU A 1 143 ? 55.546 -0.460  19.757 1.00 13.07 ? 158 LEU A N   1 
ATOM   1009 C  CA  . LEU A 1 143 ? 54.819 -1.364  18.875 1.00 12.62 ? 158 LEU A CA  1 
ATOM   1010 C  C   . LEU A 1 143 ? 54.274 -0.628  17.657 1.00 13.43 ? 158 LEU A C   1 
ATOM   1011 O  O   . LEU A 1 143 ? 53.609 0.400   17.787 1.00 12.18 ? 158 LEU A O   1 
ATOM   1012 C  CB  . LEU A 1 143 ? 53.647 -2.020  19.613 1.00 13.74 ? 158 LEU A CB  1 
ATOM   1013 C  CG  . LEU A 1 143 ? 52.748 -2.919  18.750 1.00 15.03 ? 158 LEU A CG  1 
ATOM   1014 C  CD1 . LEU A 1 143 ? 53.541 -4.131  18.306 1.00 16.04 ? 158 LEU A CD1 1 
ATOM   1015 C  CD2 . LEU A 1 143 ? 51.517 -3.356  19.535 1.00 15.62 ? 158 LEU A CD2 1 
ATOM   1016 N  N   . LYS A 1 144 ? 54.563 -1.159  16.474 1.00 13.57 ? 159 LYS A N   1 
ATOM   1017 C  CA  . LYS A 1 144 ? 54.064 -0.576  15.234 1.00 15.31 ? 159 LYS A CA  1 
ATOM   1018 C  C   . LYS A 1 144 ? 52.768 -1.327  14.939 1.00 15.51 ? 159 LYS A C   1 
ATOM   1019 O  O   . LYS A 1 144 ? 52.765 -2.557  14.872 1.00 15.04 ? 159 LYS A O   1 
ATOM   1020 C  CB  . LYS A 1 144 ? 55.065 -0.798  14.096 1.00 19.83 ? 159 LYS A CB  1 
ATOM   1021 C  CG  . LYS A 1 144 ? 56.470 -0.289  14.384 1.00 26.22 ? 159 LYS A CG  1 
ATOM   1022 C  CD  . LYS A 1 144 ? 56.789 0.985   13.618 1.00 31.93 ? 159 LYS A CD  1 
ATOM   1023 C  CE  . LYS A 1 144 ? 55.892 2.141   14.036 1.00 34.76 ? 159 LYS A CE  1 
ATOM   1024 N  NZ  . LYS A 1 144 ? 56.226 3.386   13.285 1.00 38.49 ? 159 LYS A NZ  1 
ATOM   1025 N  N   . ALA A 1 145 ? 51.669 -0.599  14.780 1.00 14.50 ? 160 ALA A N   1 
ATOM   1026 C  CA  . ALA A 1 145 ? 50.383 -1.236  14.513 1.00 14.17 ? 160 ALA A CA  1 
ATOM   1027 C  C   . ALA A 1 145 ? 49.543 -0.421  13.546 1.00 14.32 ? 160 ALA A C   1 
ATOM   1028 O  O   . ALA A 1 145 ? 49.590 0.804   13.549 1.00 15.09 ? 160 ALA A O   1 
ATOM   1029 C  CB  . ALA A 1 145 ? 49.621 -1.443  15.817 1.00 15.53 ? 160 ALA A CB  1 
ATOM   1030 N  N   . PRO A 1 146 ? 48.759 -1.098  12.700 1.00 13.99 ? 161 PRO A N   1 
ATOM   1031 C  CA  . PRO A 1 146 ? 47.921 -0.387  11.739 1.00 13.11 ? 161 PRO A CA  1 
ATOM   1032 C  C   . PRO A 1 146 ? 46.509 -0.164  12.266 1.00 12.82 ? 161 PRO A C   1 
ATOM   1033 O  O   . PRO A 1 146 ? 46.013 -0.929  13.089 1.00 13.23 ? 161 PRO A O   1 
ATOM   1034 C  CB  . PRO A 1 146 ? 47.930 -1.322  10.541 1.00 14.22 ? 161 PRO A CB  1 
ATOM   1035 C  CG  . PRO A 1 146 ? 47.833 -2.666  11.218 1.00 13.44 ? 161 PRO A CG  1 
ATOM   1036 C  CD  . PRO A 1 146 ? 48.806 -2.541  12.390 1.00 14.11 ? 161 PRO A CD  1 
ATOM   1037 N  N   . ILE A 1 147 ? 45.877 0.902   11.792 1.00 13.32 ? 162 ILE A N   1 
ATOM   1038 C  CA  . ILE A 1 147 ? 44.507 1.211   12.164 1.00 13.08 ? 162 ILE A CA  1 
ATOM   1039 C  C   . ILE A 1 147 ? 43.656 0.256   11.334 1.00 13.10 ? 162 ILE A C   1 
ATOM   1040 O  O   . ILE A 1 147 ? 43.902 0.083   10.139 1.00 13.09 ? 162 ILE A O   1 
ATOM   1041 C  CB  . ILE A 1 147 ? 44.153 2.672   11.805 1.00 13.20 ? 162 ILE A CB  1 
ATOM   1042 C  CG1 . ILE A 1 147 ? 44.957 3.627   12.695 1.00 14.17 ? 162 ILE A CG1 1 
ATOM   1043 C  CG2 . ILE A 1 147 ? 42.657 2.908   11.967 1.00 12.13 ? 162 ILE A CG2 1 
ATOM   1044 C  CD1 . ILE A 1 147 ? 44.741 5.097   12.383 1.00 15.56 ? 162 ILE A CD1 1 
ATOM   1045 N  N   . LEU A 1 148 ? 42.673 -0.377  11.962 1.00 13.63 ? 163 LEU A N   1 
ATOM   1046 C  CA  . LEU A 1 148 ? 41.821 -1.319  11.248 1.00 14.02 ? 163 LEU A CA  1 
ATOM   1047 C  C   . LEU A 1 148 ? 40.572 -0.648  10.693 1.00 14.21 ? 163 LEU A C   1 
ATOM   1048 O  O   . LEU A 1 148 ? 40.189 0.435   11.132 1.00 13.70 ? 163 LEU A O   1 
ATOM   1049 C  CB  . LEU A 1 148 ? 41.425 -2.471  12.176 1.00 14.25 ? 163 LEU A CB  1 
ATOM   1050 C  CG  . LEU A 1 148 ? 42.601 -3.187  12.850 1.00 16.85 ? 163 LEU A CG  1 
ATOM   1051 C  CD1 . LEU A 1 148 ? 42.079 -4.323  13.712 1.00 17.26 ? 163 LEU A CD1 1 
ATOM   1052 C  CD2 . LEU A 1 148 ? 43.562 -3.710  11.791 1.00 15.80 ? 163 LEU A CD2 1 
ATOM   1053 N  N   . SER A 1 149 ? 39.940 -1.292  9.717  1.00 14.06 ? 164 SER A N   1 
ATOM   1054 C  CA  . SER A 1 149 ? 38.726 -0.751  9.122  1.00 14.12 ? 164 SER A CA  1 
ATOM   1055 C  C   . SER A 1 149 ? 37.625 -0.738  10.175 1.00 14.88 ? 164 SER A C   1 
ATOM   1056 O  O   . SER A 1 149 ? 37.628 -1.546  11.102 1.00 13.29 ? 164 SER A O   1 
ATOM   1057 C  CB  . SER A 1 149 ? 38.277 -1.613  7.942  1.00 16.29 ? 164 SER A CB  1 
ATOM   1058 O  OG  . SER A 1 149 ? 37.921 -2.908  8.386  1.00 18.66 ? 164 SER A OG  1 
ATOM   1059 N  N   . ASP A 1 150 ? 36.678 0.177   10.024 1.00 16.34 ? 165 ASP A N   1 
ATOM   1060 C  CA  . ASP A 1 150 ? 35.577 0.279   10.968 1.00 20.20 ? 165 ASP A CA  1 
ATOM   1061 C  C   . ASP A 1 150 ? 34.749 -1.008  10.979 1.00 19.72 ? 165 ASP A C   1 
ATOM   1062 O  O   . ASP A 1 150 ? 34.255 -1.429  12.025 1.00 17.67 ? 165 ASP A O   1 
ATOM   1063 C  CB  . ASP A 1 150 ? 34.696 1.478   10.604 1.00 24.57 ? 165 ASP A CB  1 
ATOM   1064 C  CG  . ASP A 1 150 ? 33.594 1.722   11.617 1.00 30.87 ? 165 ASP A CG  1 
ATOM   1065 O  OD1 . ASP A 1 150 ? 33.905 1.850   12.821 1.00 33.15 ? 165 ASP A OD1 1 
ATOM   1066 O  OD2 . ASP A 1 150 ? 32.414 1.793   11.207 1.00 34.30 ? 165 ASP A OD2 1 
ATOM   1067 N  N   . SER A 1 151 ? 34.613 -1.642  9.818  1.00 19.61 ? 166 SER A N   1 
ATOM   1068 C  CA  . SER A 1 151 ? 33.833 -2.872  9.724  1.00 19.40 ? 166 SER A CA  1 
ATOM   1069 C  C   . SER A 1 151 ? 34.450 -4.023  10.512 1.00 18.08 ? 166 SER A C   1 
ATOM   1070 O  O   . SER A 1 151 ? 33.734 -4.803  11.138 1.00 17.29 ? 166 SER A O   1 
ATOM   1071 C  CB  . SER A 1 151 ? 33.646 -3.280  8.255  1.00 21.85 ? 166 SER A CB  1 
ATOM   1072 O  OG  . SER A 1 151 ? 34.886 -3.543  7.624  1.00 27.07 ? 166 SER A OG  1 
ATOM   1073 N  N   . SER A 1 152 ? 35.775 -4.134  10.487 1.00 16.43 ? 167 SER A N   1 
ATOM   1074 C  CA  . SER A 1 152 ? 36.443 -5.203  11.220 1.00 15.66 ? 167 SER A CA  1 
ATOM   1075 C  C   . SER A 1 152 ? 36.387 -4.946  12.721 1.00 15.12 ? 167 SER A C   1 
ATOM   1076 O  O   . SER A 1 152 ? 36.314 -5.878  13.521 1.00 15.14 ? 167 SER A O   1 
ATOM   1077 C  CB  . SER A 1 152 ? 37.903 -5.326  10.777 1.00 17.18 ? 167 SER A CB  1 
ATOM   1078 O  OG  . SER A 1 152 ? 37.987 -5.751  9.428  1.00 20.71 ? 167 SER A OG  1 
ATOM   1079 N  N   . CYS A 1 153 ? 36.425 -3.671  13.091 1.00 14.24 ? 168 CYS A N   1 
ATOM   1080 C  CA  . CYS A 1 153 ? 36.387 -3.253  14.488 1.00 14.14 ? 168 CYS A CA  1 
ATOM   1081 C  C   . CYS A 1 153 ? 35.033 -3.577  15.110 1.00 14.59 ? 168 CYS A C   1 
ATOM   1082 O  O   . CYS A 1 153 ? 34.956 -4.159  16.195 1.00 14.58 ? 168 CYS A O   1 
ATOM   1083 C  CB  . CYS A 1 153 ? 36.640 -1.749  14.559 1.00 14.67 ? 168 CYS A CB  1 
ATOM   1084 S  SG  . CYS A 1 153 ? 36.988 -1.021  16.193 1.00 15.53 ? 168 CYS A SG  1 
ATOM   1085 N  N   . LYS A 1 154 ? 33.968 -3.197  14.412 1.00 15.52 ? 169 LYS A N   1 
ATOM   1086 C  CA  . LYS A 1 154 ? 32.613 -3.443  14.894 1.00 18.18 ? 169 LYS A CA  1 
ATOM   1087 C  C   . LYS A 1 154 ? 32.244 -4.920  14.872 1.00 18.54 ? 169 LYS A C   1 
ATOM   1088 O  O   . LYS A 1 154 ? 31.408 -5.365  15.659 1.00 19.03 ? 169 LYS A O   1 
ATOM   1089 C  CB  . LYS A 1 154 ? 31.608 -2.634  14.073 1.00 19.01 ? 169 LYS A CB  1 
ATOM   1090 C  CG  . LYS A 1 154 ? 31.736 -1.141  14.303 1.00 22.67 ? 169 LYS A CG  1 
ATOM   1091 C  CD  . LYS A 1 154 ? 30.747 -0.342  13.480 1.00 25.79 ? 169 LYS A CD  1 
ATOM   1092 C  CE  . LYS A 1 154 ? 30.908 1.142   13.761 1.00 27.53 ? 169 LYS A CE  1 
ATOM   1093 N  NZ  . LYS A 1 154 ? 29.951 1.966   12.973 1.00 31.07 ? 169 LYS A NZ  1 
ATOM   1094 N  N   . SER A 1 155 ? 32.857 -5.686  13.976 1.00 18.81 ? 170 SER A N   1 
ATOM   1095 C  CA  . SER A 1 155 ? 32.562 -7.112  13.924 1.00 21.36 ? 170 SER A CA  1 
ATOM   1096 C  C   . SER A 1 155 ? 33.244 -7.784  15.112 1.00 19.73 ? 170 SER A C   1 
ATOM   1097 O  O   . SER A 1 155 ? 32.750 -8.776  15.645 1.00 20.72 ? 170 SER A O   1 
ATOM   1098 C  CB  . SER A 1 155 ? 33.045 -7.724  12.602 1.00 23.43 ? 170 SER A CB  1 
ATOM   1099 O  OG  . SER A 1 155 ? 34.442 -7.566  12.433 1.00 31.55 ? 170 SER A OG  1 
ATOM   1100 N  N   . ALA A 1 156 ? 34.372 -7.221  15.540 1.00 19.35 ? 171 ALA A N   1 
ATOM   1101 C  CA  . ALA A 1 156 ? 35.115 -7.761  16.672 1.00 17.60 ? 171 ALA A CA  1 
ATOM   1102 C  C   . ALA A 1 156 ? 34.452 -7.412  18.006 1.00 17.78 ? 171 ALA A C   1 
ATOM   1103 O  O   . ALA A 1 156 ? 34.477 -8.211  18.942 1.00 18.14 ? 171 ALA A O   1 
ATOM   1104 C  CB  . ALA A 1 156 ? 36.554 -7.240  16.654 1.00 18.07 ? 171 ALA A CB  1 
ATOM   1105 N  N   . TYR A 1 157 ? 33.859 -6.223  18.081 1.00 16.35 ? 172 TYR A N   1 
ATOM   1106 C  CA  . TYR A 1 157 ? 33.199 -5.754  19.301 1.00 16.26 ? 172 TYR A CA  1 
ATOM   1107 C  C   . TYR A 1 157 ? 31.783 -5.263  19.009 1.00 17.72 ? 172 TYR A C   1 
ATOM   1108 O  O   . TYR A 1 157 ? 31.491 -4.067  19.106 1.00 16.07 ? 172 TYR A O   1 
ATOM   1109 C  CB  . TYR A 1 157 ? 34.007 -4.614  19.926 1.00 16.30 ? 172 TYR A CB  1 
ATOM   1110 C  CG  . TYR A 1 157 ? 35.377 -5.027  20.415 1.00 15.85 ? 172 TYR A CG  1 
ATOM   1111 C  CD1 . TYR A 1 157 ? 35.523 -5.813  21.556 1.00 15.31 ? 172 TYR A CD1 1 
ATOM   1112 C  CD2 . TYR A 1 157 ? 36.527 -4.623  19.741 1.00 16.75 ? 172 TYR A CD2 1 
ATOM   1113 C  CE1 . TYR A 1 157 ? 36.785 -6.184  22.020 1.00 16.61 ? 172 TYR A CE1 1 
ATOM   1114 C  CE2 . TYR A 1 157 ? 37.792 -4.989  20.194 1.00 16.34 ? 172 TYR A CE2 1 
ATOM   1115 C  CZ  . TYR A 1 157 ? 37.912 -5.767  21.336 1.00 15.00 ? 172 TYR A CZ  1 
ATOM   1116 O  OH  . TYR A 1 157 ? 39.157 -6.113  21.798 1.00 16.51 ? 172 TYR A OH  1 
ATOM   1117 N  N   . PRO A 1 158 ? 30.877 -6.185  18.660 1.00 18.38 ? 173 PRO A N   1 
ATOM   1118 C  CA  . PRO A 1 158 ? 29.487 -5.842  18.350 1.00 19.68 ? 173 PRO A CA  1 
ATOM   1119 C  C   . PRO A 1 158 ? 28.818 -4.912  19.365 1.00 19.53 ? 173 PRO A C   1 
ATOM   1120 O  O   . PRO A 1 158 ? 28.776 -5.205  20.559 1.00 20.73 ? 173 PRO A O   1 
ATOM   1121 C  CB  . PRO A 1 158 ? 28.808 -7.208  18.285 1.00 19.09 ? 173 PRO A CB  1 
ATOM   1122 C  CG  . PRO A 1 158 ? 29.891 -8.088  17.773 1.00 20.51 ? 173 PRO A CG  1 
ATOM   1123 C  CD  . PRO A 1 158 ? 31.079 -7.643  18.594 1.00 19.00 ? 173 PRO A CD  1 
ATOM   1124 N  N   . GLY A 1 159 ? 28.305 -3.790  18.869 1.00 20.68 ? 174 GLY A N   1 
ATOM   1125 C  CA  . GLY A 1 159 ? 27.610 -2.823  19.705 1.00 22.78 ? 174 GLY A CA  1 
ATOM   1126 C  C   . GLY A 1 159 ? 28.374 -2.143  20.829 1.00 22.66 ? 174 GLY A C   1 
ATOM   1127 O  O   . GLY A 1 159 ? 27.758 -1.601  21.749 1.00 23.40 ? 174 GLY A O   1 
ATOM   1128 N  N   . GLN A 1 160 ? 29.700 -2.152  20.768 1.00 22.05 ? 175 GLN A N   1 
ATOM   1129 C  CA  . GLN A 1 160 ? 30.502 -1.522  21.818 1.00 22.32 ? 175 GLN A CA  1 
ATOM   1130 C  C   . GLN A 1 160 ? 31.395 -0.415  21.271 1.00 21.18 ? 175 GLN A C   1 
ATOM   1131 O  O   . GLN A 1 160 ? 32.025 0.316   22.033 1.00 21.49 ? 175 GLN A O   1 
ATOM   1132 C  CB  . GLN A 1 160 ? 31.384 -2.560  22.508 1.00 23.69 ? 175 GLN A CB  1 
ATOM   1133 C  CG  . GLN A 1 160 ? 30.650 -3.780  23.016 1.00 28.30 ? 175 GLN A CG  1 
ATOM   1134 C  CD  . GLN A 1 160 ? 31.600 -4.826  23.560 1.00 30.05 ? 175 GLN A CD  1 
ATOM   1135 O  OE1 . GLN A 1 160 ? 32.236 -4.625  24.593 1.00 34.23 ? 175 GLN A OE1 1 
ATOM   1136 N  NE2 . GLN A 1 160 ? 31.709 -5.949  22.858 1.00 33.95 ? 175 GLN A NE2 1 
ATOM   1137 N  N   . ILE A 1 161 ? 31.453 -0.301  19.950 1.00 19.33 ? 176 ILE A N   1 
ATOM   1138 C  CA  . ILE A 1 161 ? 32.286 0.705   19.311 1.00 18.68 ? 176 ILE A CA  1 
ATOM   1139 C  C   . ILE A 1 161 ? 31.471 1.936   18.925 1.00 19.18 ? 176 ILE A C   1 
ATOM   1140 O  O   . ILE A 1 161 ? 30.492 1.835   18.186 1.00 18.87 ? 176 ILE A O   1 
ATOM   1141 C  CB  . ILE A 1 161 ? 32.960 0.132   18.039 1.00 17.93 ? 176 ILE A CB  1 
ATOM   1142 C  CG1 . ILE A 1 161 ? 33.746 -1.137  18.388 1.00 17.59 ? 176 ILE A CG1 1 
ATOM   1143 C  CG2 . ILE A 1 161 ? 33.867 1.178   17.410 1.00 17.87 ? 176 ILE A CG2 1 
ATOM   1144 C  CD1 . ILE A 1 161 ? 34.857 -0.929  19.410 1.00 16.47 ? 176 ILE A CD1 1 
ATOM   1145 N  N   . THR A 1 162 ? 31.875 3.097   19.434 1.00 16.70 ? 177 THR A N   1 
ATOM   1146 C  CA  . THR A 1 162 ? 31.186 4.343   19.121 1.00 16.01 ? 177 THR A CA  1 
ATOM   1147 C  C   . THR A 1 162 ? 31.979 5.095   18.058 1.00 16.14 ? 177 THR A C   1 
ATOM   1148 O  O   . THR A 1 162 ? 33.069 4.673   17.673 1.00 15.18 ? 177 THR A O   1 
ATOM   1149 C  CB  . THR A 1 162 ? 31.046 5.245   20.373 1.00 16.86 ? 177 THR A CB  1 
ATOM   1150 O  OG1 . THR A 1 162 ? 32.338 5.720   20.774 1.00 15.10 ? 177 THR A OG1 1 
ATOM   1151 C  CG2 . THR A 1 162 ? 30.427 4.463   21.523 1.00 16.15 ? 177 THR A CG2 1 
ATOM   1152 N  N   . SER A 1 163 ? 31.433 6.209   17.584 1.00 15.38 ? 178 SER A N   1 
ATOM   1153 C  CA  . SER A 1 163 ? 32.110 7.004   16.568 1.00 16.86 ? 178 SER A CA  1 
ATOM   1154 C  C   . SER A 1 163 ? 33.401 7.623   17.107 1.00 14.83 ? 178 SER A C   1 
ATOM   1155 O  O   . SER A 1 163 ? 34.223 8.115   16.340 1.00 13.96 ? 178 SER A O   1 
ATOM   1156 C  CB  . SER A 1 163 ? 31.186 8.116   16.070 1.00 19.40 ? 178 SER A CB  1 
ATOM   1157 O  OG  . SER A 1 163 ? 30.860 9.005   17.125 1.00 24.34 ? 178 SER A OG  1 
ATOM   1158 N  N   . ASN A 1 164 ? 33.577 7.584   18.425 1.00 13.40 ? 179 ASN A N   1 
ATOM   1159 C  CA  . ASN A 1 164 ? 34.759 8.164   19.062 1.00 12.61 ? 179 ASN A CA  1 
ATOM   1160 C  C   . ASN A 1 164 ? 35.843 7.149   19.393 1.00 12.30 ? 179 ASN A C   1 
ATOM   1161 O  O   . ASN A 1 164 ? 36.714 7.405   20.231 1.00 11.16 ? 179 ASN A O   1 
ATOM   1162 C  CB  . ASN A 1 164 ? 34.348 8.895   20.338 1.00 14.17 ? 179 ASN A CB  1 
ATOM   1163 C  CG  . ASN A 1 164 ? 33.372 10.017  20.066 1.00 15.50 ? 179 ASN A CG  1 
ATOM   1164 O  OD1 . ASN A 1 164 ? 33.618 10.866  19.214 1.00 15.86 ? 179 ASN A OD1 1 
ATOM   1165 N  ND2 . ASN A 1 164 ? 32.257 10.025  20.788 1.00 17.23 ? 179 ASN A ND2 1 
ATOM   1166 N  N   . MET A 1 165 ? 35.786 5.999   18.732 1.00 12.83 ? 180 MET A N   1 
ATOM   1167 C  CA  . MET A 1 165 ? 36.756 4.934   18.947 1.00 13.13 ? 180 MET A CA  1 
ATOM   1168 C  C   . MET A 1 165 ? 37.202 4.345   17.617 1.00 13.50 ? 180 MET A C   1 
ATOM   1169 O  O   . MET A 1 165 ? 36.519 4.483   16.604 1.00 14.34 ? 180 MET A O   1 
ATOM   1170 C  CB  . MET A 1 165 ? 36.131 3.804   19.763 1.00 12.56 ? 180 MET A CB  1 
ATOM   1171 C  CG  . MET A 1 165 ? 35.526 4.214   21.090 1.00 10.63 ? 180 MET A CG  1 
ATOM   1172 S  SD  . MET A 1 165 ? 34.622 2.829   21.811 1.00 14.52 ? 180 MET A SD  1 
ATOM   1173 C  CE  . MET A 1 165 ? 33.850 3.641   23.242 1.00 13.23 ? 180 MET A CE  1 
ATOM   1174 N  N   . PHE A 1 166 ? 38.358 3.694   17.631 1.00 13.01 ? 181 PHE A N   1 
ATOM   1175 C  CA  . PHE A 1 166 ? 38.870 3.012   16.453 1.00 12.84 ? 181 PHE A CA  1 
ATOM   1176 C  C   . PHE A 1 166 ? 39.730 1.858   16.948 1.00 13.17 ? 181 PHE A C   1 
ATOM   1177 O  O   . PHE A 1 166 ? 40.255 1.899   18.064 1.00 13.12 ? 181 PHE A O   1 
ATOM   1178 C  CB  . PHE A 1 166 ? 39.658 3.968   15.533 1.00 12.54 ? 181 PHE A CB  1 
ATOM   1179 C  CG  . PHE A 1 166 ? 41.015 4.384   16.054 1.00 13.38 ? 181 PHE A CG  1 
ATOM   1180 C  CD1 . PHE A 1 166 ? 42.108 3.522   15.980 1.00 12.71 ? 181 PHE A CD1 1 
ATOM   1181 C  CD2 . PHE A 1 166 ? 41.213 5.668   16.554 1.00 14.07 ? 181 PHE A CD2 1 
ATOM   1182 C  CE1 . PHE A 1 166 ? 43.382 3.935   16.393 1.00 13.18 ? 181 PHE A CE1 1 
ATOM   1183 C  CE2 . PHE A 1 166 ? 42.485 6.091   16.970 1.00 14.42 ? 181 PHE A CE2 1 
ATOM   1184 C  CZ  . PHE A 1 166 ? 43.569 5.220   16.887 1.00 13.01 ? 181 PHE A CZ  1 
ATOM   1185 N  N   . CYS A 1 167 ? 39.830 0.806   16.146 1.00 12.03 ? 182 CYS A N   1 
ATOM   1186 C  CA  . CYS A 1 167 ? 40.636 -0.343  16.525 1.00 11.25 ? 182 CYS A CA  1 
ATOM   1187 C  C   . CYS A 1 167 ? 41.964 -0.265  15.796 1.00 10.61 ? 182 CYS A C   1 
ATOM   1188 O  O   . CYS A 1 167 ? 42.043 0.262   14.690 1.00 11.18 ? 182 CYS A O   1 
ATOM   1189 C  CB  . CYS A 1 167 ? 39.963 -1.655  16.120 1.00 12.23 ? 182 CYS A CB  1 
ATOM   1190 S  SG  . CYS A 1 167 ? 38.446 -2.189  16.978 1.00 14.36 ? 182 CYS A SG  1 
ATOM   1191 N  N   . ALA A 1 168 ? 43.005 -0.793  16.422 1.00 10.72 ? 183 ALA A N   1 
ATOM   1192 C  CA  . ALA A 1 168 ? 44.327 -0.828  15.813 1.00 11.60 ? 183 ALA A CA  1 
ATOM   1193 C  C   . ALA A 1 168 ? 45.005 -2.079  16.343 1.00 12.63 ? 183 ALA A C   1 
ATOM   1194 O  O   . ALA A 1 168 ? 44.786 -2.473  17.489 1.00 12.64 ? 183 ALA A O   1 
ATOM   1195 C  CB  . ALA A 1 168 ? 45.130 0.413   16.187 1.00 11.76 ? 183 ALA A CB  1 
ATOM   1196 N  N   . GLY A 1 169 ? 45.816 -2.720  15.513 1.00 13.32 ? 184 GLY A N   1 
ATOM   1197 C  CA  . GLY A 1 169 ? 46.485 -3.913  15.981 1.00 13.38 ? 184 GLY A CA  1 
ATOM   1198 C  C   . GLY A 1 169 ? 46.488 -5.066  15.005 1.00 13.91 ? 184 GLY A C   1 
ATOM   1199 O  O   . GLY A 1 169 ? 46.452 -4.867  13.789 1.00 13.53 ? 184 GLY A O   1 
ATOM   1200 N  N   . TYR A 1 170 A 46.517 -6.277  15.550 1.00 15.07 ? 184 TYR A N   1 
ATOM   1201 C  CA  . TYR A 1 170 A 46.573 -7.486  14.743 1.00 17.36 ? 184 TYR A CA  1 
ATOM   1202 C  C   . TYR A 1 170 A 45.532 -8.519  15.150 1.00 18.54 ? 184 TYR A C   1 
ATOM   1203 O  O   . TYR A 1 170 A 45.482 -8.947  16.303 1.00 19.65 ? 184 TYR A O   1 
ATOM   1204 C  CB  . TYR A 1 170 A 47.970 -8.099  14.855 1.00 18.45 ? 184 TYR A CB  1 
ATOM   1205 C  CG  . TYR A 1 170 A 49.079 -7.144  14.486 1.00 17.95 ? 184 TYR A CG  1 
ATOM   1206 C  CD1 . TYR A 1 170 A 49.509 -6.156  15.377 1.00 18.37 ? 184 TYR A CD1 1 
ATOM   1207 C  CD2 . TYR A 1 170 A 49.676 -7.205  13.231 1.00 19.14 ? 184 TYR A CD2 1 
ATOM   1208 C  CE1 . TYR A 1 170 A 50.508 -5.251  15.017 1.00 17.06 ? 184 TYR A CE1 1 
ATOM   1209 C  CE2 . TYR A 1 170 A 50.668 -6.312  12.864 1.00 19.81 ? 184 TYR A CE2 1 
ATOM   1210 C  CZ  . TYR A 1 170 A 51.080 -5.338  13.756 1.00 18.11 ? 184 TYR A CZ  1 
ATOM   1211 O  OH  . TYR A 1 170 A 52.057 -4.455  13.365 1.00 17.57 ? 184 TYR A OH  1 
ATOM   1212 N  N   . LEU A 1 171 ? 44.713 -8.934  14.191 1.00 17.68 ? 185 LEU A N   1 
ATOM   1213 C  CA  . LEU A 1 171 ? 43.674 -9.913  14.465 1.00 19.31 ? 185 LEU A CA  1 
ATOM   1214 C  C   . LEU A 1 171 ? 44.225 -11.302 14.782 1.00 19.91 ? 185 LEU A C   1 
ATOM   1215 O  O   . LEU A 1 171 ? 43.537 -12.114 15.396 1.00 19.32 ? 185 LEU A O   1 
ATOM   1216 C  CB  . LEU A 1 171 ? 42.701 -9.981  13.283 1.00 19.76 ? 185 LEU A CB  1 
ATOM   1217 C  CG  . LEU A 1 171 ? 41.926 -8.683  13.025 1.00 19.82 ? 185 LEU A CG  1 
ATOM   1218 C  CD1 . LEU A 1 171 ? 41.000 -8.853  11.826 1.00 21.09 ? 185 LEU A CD1 1 
ATOM   1219 C  CD2 . LEU A 1 171 ? 41.121 -8.321  14.268 1.00 20.97 ? 185 LEU A CD2 1 
ATOM   1220 N  N   . GLU A 1 172 ? 45.464 -11.573 14.378 1.00 22.62 ? 186 GLU A N   1 
ATOM   1221 C  CA  . GLU A 1 172 ? 46.071 -12.877 14.643 1.00 25.59 ? 186 GLU A CA  1 
ATOM   1222 C  C   . GLU A 1 172 ? 46.505 -12.984 16.101 1.00 25.57 ? 186 GLU A C   1 
ATOM   1223 O  O   . GLU A 1 172 ? 46.768 -14.079 16.596 1.00 26.05 ? 186 GLU A O   1 
ATOM   1224 C  CB  . GLU A 1 172 ? 47.301 -13.112 13.759 1.00 28.59 ? 186 GLU A CB  1 
ATOM   1225 C  CG  . GLU A 1 172 ? 47.296 -12.421 12.409 1.00 34.17 ? 186 GLU A CG  1 
ATOM   1226 C  CD  . GLU A 1 172 ? 47.815 -10.997 12.485 1.00 35.50 ? 186 GLU A CD  1 
ATOM   1227 O  OE1 . GLU A 1 172 ? 47.071 -10.115 12.957 1.00 38.02 ? 186 GLU A OE1 1 
ATOM   1228 O  OE2 . GLU A 1 172 ? 48.976 -10.763 12.084 1.00 37.01 ? 186 GLU A OE2 1 
ATOM   1229 N  N   . GLY A 1 173 ? 46.590 -11.843 16.779 1.00 24.98 ? 187 GLY A N   1 
ATOM   1230 C  CA  . GLY A 1 173 ? 47.002 -11.834 18.173 1.00 23.63 ? 187 GLY A CA  1 
ATOM   1231 C  C   . GLY A 1 173 ? 48.513 -11.800 18.318 1.00 23.19 ? 187 GLY A C   1 
ATOM   1232 O  O   . GLY A 1 173 ? 49.233 -11.817 17.320 1.00 24.03 ? 187 GLY A O   1 
ATOM   1233 N  N   . GLY A 1 174 ? 48.994 -11.740 19.557 1.00 21.83 ? 188 GLY A N   1 
ATOM   1234 C  CA  . GLY A 1 174 ? 50.427 -11.718 19.799 1.00 20.87 ? 188 GLY A CA  1 
ATOM   1235 C  C   . GLY A 1 174 ? 51.071 -10.345 19.902 1.00 19.72 ? 188 GLY A C   1 
ATOM   1236 O  O   . GLY A 1 174 ? 52.176 -10.220 20.428 1.00 19.37 ? 188 GLY A O   1 
ATOM   1237 N  N   . LYS A 1 175 A 50.395 -9.319  19.396 1.00 18.56 ? 188 LYS A N   1 
ATOM   1238 C  CA  . LYS A 1 175 A 50.915 -7.951  19.438 1.00 17.58 ? 188 LYS A CA  1 
ATOM   1239 C  C   . LYS A 1 175 A 49.765 -7.014  19.795 1.00 16.95 ? 188 LYS A C   1 
ATOM   1240 O  O   . LYS A 1 175 A 48.763 -6.952  19.082 1.00 14.58 ? 188 LYS A O   1 
ATOM   1241 C  CB  . LYS A 1 175 A 51.505 -7.568  18.078 1.00 20.20 ? 188 LYS A CB  1 
ATOM   1242 C  CG  . LYS A 1 175 A 52.618 -8.493  17.604 1.00 23.25 ? 188 LYS A CG  1 
ATOM   1243 C  CD  . LYS A 1 175 A 53.143 -8.098  16.231 1.00 28.70 ? 188 LYS A CD  1 
ATOM   1244 C  CE  . LYS A 1 175 A 53.858 -6.758  16.274 1.00 33.28 ? 188 LYS A CE  1 
ATOM   1245 N  NZ  . LYS A 1 175 A 54.348 -6.332  14.930 1.00 36.89 ? 188 LYS A NZ  1 
ATOM   1246 N  N   . ASP A 1 176 ? 49.910 -6.275  20.892 1.00 15.49 ? 189 ASP A N   1 
ATOM   1247 C  CA  . ASP A 1 176 ? 48.837 -5.388  21.327 1.00 14.73 ? 189 ASP A CA  1 
ATOM   1248 C  C   . ASP A 1 176 ? 49.305 -4.511  22.487 1.00 14.30 ? 189 ASP A C   1 
ATOM   1249 O  O   . ASP A 1 176 ? 50.383 -4.732  23.044 1.00 13.51 ? 189 ASP A O   1 
ATOM   1250 C  CB  . ASP A 1 176 ? 47.660 -6.271  21.764 1.00 14.46 ? 189 ASP A CB  1 
ATOM   1251 C  CG  . ASP A 1 176 ? 46.391 -5.496  22.049 1.00 15.43 ? 189 ASP A CG  1 
ATOM   1252 O  OD1 . ASP A 1 176 ? 46.267 -4.325  21.634 1.00 14.65 ? 189 ASP A OD1 1 
ATOM   1253 O  OD2 . ASP A 1 176 ? 45.495 -6.088  22.684 1.00 16.78 ? 189 ASP A OD2 1 
ATOM   1254 N  N   . SER A 1 177 ? 48.519 -3.492  22.825 1.00 13.88 ? 190 SER A N   1 
ATOM   1255 C  CA  . SER A 1 177 ? 48.853 -2.654  23.970 1.00 12.76 ? 190 SER A CA  1 
ATOM   1256 C  C   . SER A 1 177 ? 48.174 -3.405  25.109 1.00 13.36 ? 190 SER A C   1 
ATOM   1257 O  O   . SER A 1 177 ? 47.407 -4.335  24.857 1.00 13.57 ? 190 SER A O   1 
ATOM   1258 C  CB  . SER A 1 177 ? 48.288 -1.233  23.815 1.00 12.25 ? 190 SER A CB  1 
ATOM   1259 O  OG  . SER A 1 177 ? 46.894 -1.237  23.570 1.00 13.25 ? 190 SER A OG  1 
ATOM   1260 N  N   . CYS A 1 178 ? 48.441 -3.032  26.355 1.00 13.46 ? 191 CYS A N   1 
ATOM   1261 C  CA  . CYS A 1 178 ? 47.831 -3.755  27.465 1.00 13.72 ? 191 CYS A CA  1 
ATOM   1262 C  C   . CYS A 1 178 ? 47.668 -2.875  28.701 1.00 15.28 ? 191 CYS A C   1 
ATOM   1263 O  O   . CYS A 1 178 ? 47.971 -1.678  28.667 1.00 14.08 ? 191 CYS A O   1 
ATOM   1264 C  CB  . CYS A 1 178 ? 48.691 -4.986  27.784 1.00 15.57 ? 191 CYS A CB  1 
ATOM   1265 S  SG  . CYS A 1 178 ? 47.906 -6.289  28.790 1.00 16.46 ? 191 CYS A SG  1 
ATOM   1266 N  N   . GLN A 1 179 ? 47.173 -3.466  29.783 1.00 15.17 ? 192 GLN A N   1 
ATOM   1267 C  CA  . GLN A 1 179 ? 46.974 -2.734  31.030 1.00 17.63 ? 192 GLN A CA  1 
ATOM   1268 C  C   . GLN A 1 179 ? 48.271 -2.024  31.408 1.00 16.38 ? 192 GLN A C   1 
ATOM   1269 O  O   . GLN A 1 179 ? 49.335 -2.639  31.430 1.00 15.85 ? 192 GLN A O   1 
ATOM   1270 C  CB  . GLN A 1 179 ? 46.572 -3.698  32.147 1.00 21.74 ? 192 GLN A CB  1 
ATOM   1271 C  CG  . GLN A 1 179 ? 46.265 -3.018  33.472 1.00 29.24 ? 192 GLN A CG  1 
ATOM   1272 C  CD  . GLN A 1 179 ? 45.006 -2.174  33.418 1.00 33.79 ? 192 GLN A CD  1 
ATOM   1273 O  OE1 . GLN A 1 179 ? 44.864 -1.304  32.559 1.00 37.22 ? 192 GLN A OE1 1 
ATOM   1274 N  NE2 . GLN A 1 179 ? 44.083 -2.425  34.343 1.00 36.94 ? 192 GLN A NE2 1 
ATOM   1275 N  N   . GLY A 1 180 ? 48.182 -0.730  31.705 1.00 14.87 ? 193 GLY A N   1 
ATOM   1276 C  CA  . GLY A 1 180 ? 49.376 0.016   32.062 1.00 13.95 ? 193 GLY A CA  1 
ATOM   1277 C  C   . GLY A 1 180 ? 49.787 0.947   30.937 1.00 13.36 ? 193 GLY A C   1 
ATOM   1278 O  O   . GLY A 1 180 ? 50.438 1.968   31.172 1.00 13.03 ? 193 GLY A O   1 
ATOM   1279 N  N   . ASP A 1 181 ? 49.423 0.585   29.707 1.00 10.60 ? 194 ASP A N   1 
ATOM   1280 C  CA  . ASP A 1 181 ? 49.718 1.410   28.540 1.00 10.37 ? 194 ASP A CA  1 
ATOM   1281 C  C   . ASP A 1 181 ? 48.605 2.439   28.414 1.00 9.09  ? 194 ASP A C   1 
ATOM   1282 O  O   . ASP A 1 181 ? 48.743 3.444   27.719 1.00 9.19  ? 194 ASP A O   1 
ATOM   1283 C  CB  . ASP A 1 181 ? 49.753 0.567   27.258 1.00 10.18 ? 194 ASP A CB  1 
ATOM   1284 C  CG  . ASP A 1 181 ? 50.924 -0.389  27.220 1.00 12.84 ? 194 ASP A CG  1 
ATOM   1285 O  OD1 . ASP A 1 181 ? 52.039 0.043   27.566 1.00 11.61 ? 194 ASP A OD1 1 
ATOM   1286 O  OD2 . ASP A 1 181 ? 50.732 -1.565  26.833 1.00 12.98 ? 194 ASP A OD2 1 
ATOM   1287 N  N   . SER A 1 182 ? 47.499 2.148   29.092 1.00 10.43 ? 195 SER A N   1 
ATOM   1288 C  CA  . SER A 1 182 ? 46.302 2.981   29.115 1.00 11.54 ? 195 SER A CA  1 
ATOM   1289 C  C   . SER A 1 182 ? 46.618 4.465   29.242 1.00 10.81 ? 195 SER A C   1 
ATOM   1290 O  O   . SER A 1 182 ? 47.434 4.862   30.074 1.00 11.57 ? 195 SER A O   1 
ATOM   1291 C  CB  . SER A 1 182 ? 45.420 2.557   30.290 1.00 15.46 ? 195 SER A CB  1 
ATOM   1292 O  OG  . SER A 1 182 ? 45.440 1.146   30.431 1.00 21.80 ? 195 SER A OG  1 
ATOM   1293 N  N   . GLY A 1 183 ? 45.945 5.275   28.428 1.00 9.75  ? 196 GLY A N   1 
ATOM   1294 C  CA  . GLY A 1 183 ? 46.155 6.711   28.454 1.00 8.85  ? 196 GLY A CA  1 
ATOM   1295 C  C   . GLY A 1 183 ? 47.300 7.163   27.567 1.00 7.99  ? 196 GLY A C   1 
ATOM   1296 O  O   . GLY A 1 183 ? 47.451 8.360   27.304 1.00 9.03  ? 196 GLY A O   1 
ATOM   1297 N  N   . GLY A 1 184 ? 48.093 6.203   27.097 1.00 7.72  ? 197 GLY A N   1 
ATOM   1298 C  CA  . GLY A 1 184 ? 49.241 6.498   26.255 1.00 7.94  ? 197 GLY A CA  1 
ATOM   1299 C  C   . GLY A 1 184 ? 48.946 6.866   24.811 1.00 7.99  ? 197 GLY A C   1 
ATOM   1300 O  O   . GLY A 1 184 ? 47.809 6.777   24.353 1.00 8.54  ? 197 GLY A O   1 
ATOM   1301 N  N   . PRO A 1 185 ? 49.983 7.250   24.055 1.00 8.59  ? 198 PRO A N   1 
ATOM   1302 C  CA  . PRO A 1 185 ? 49.874 7.654   22.652 1.00 9.63  ? 198 PRO A CA  1 
ATOM   1303 C  C   . PRO A 1 185 ? 49.826 6.609   21.551 1.00 10.78 ? 198 PRO A C   1 
ATOM   1304 O  O   . PRO A 1 185 ? 50.381 5.517   21.667 1.00 11.90 ? 198 PRO A O   1 
ATOM   1305 C  CB  . PRO A 1 185 ? 51.091 8.547   22.471 1.00 9.36  ? 198 PRO A CB  1 
ATOM   1306 C  CG  . PRO A 1 185 ? 52.126 7.806   23.267 1.00 9.07  ? 198 PRO A CG  1 
ATOM   1307 C  CD  . PRO A 1 185 ? 51.368 7.422   24.538 1.00 9.41  ? 198 PRO A CD  1 
ATOM   1308 N  N   . VAL A 1 186 ? 49.134 6.987   20.481 1.00 10.74 ? 199 VAL A N   1 
ATOM   1309 C  CA  . VAL A 1 186 ? 49.049 6.206   19.256 1.00 9.58  ? 199 VAL A CA  1 
ATOM   1310 C  C   . VAL A 1 186 ? 49.367 7.330   18.283 1.00 10.13 ? 199 VAL A C   1 
ATOM   1311 O  O   . VAL A 1 186 ? 48.540 8.211   18.043 1.00 9.23  ? 199 VAL A O   1 
ATOM   1312 C  CB  . VAL A 1 186 ? 47.640 5.668   18.968 1.00 10.53 ? 199 VAL A CB  1 
ATOM   1313 C  CG1 . VAL A 1 186 ? 47.641 4.937   17.624 1.00 11.49 ? 199 VAL A CG1 1 
ATOM   1314 C  CG2 . VAL A 1 186 ? 47.215 4.719   20.064 1.00 10.06 ? 199 VAL A CG2 1 
ATOM   1315 N  N   . VAL A 1 187 ? 50.589 7.325   17.766 1.00 9.81  ? 200 VAL A N   1 
ATOM   1316 C  CA  . VAL A 1 187 ? 51.036 8.375   16.860 1.00 10.71 ? 200 VAL A CA  1 
ATOM   1317 C  C   . VAL A 1 187 ? 51.194 7.860   15.442 1.00 11.36 ? 200 VAL A C   1 
ATOM   1318 O  O   . VAL A 1 187 ? 51.854 6.852   15.207 1.00 11.69 ? 200 VAL A O   1 
ATOM   1319 C  CB  . VAL A 1 187 ? 52.371 8.979   17.366 1.00 12.03 ? 200 VAL A CB  1 
ATOM   1320 C  CG1 . VAL A 1 187 ? 52.956 9.938   16.335 1.00 12.05 ? 200 VAL A CG1 1 
ATOM   1321 C  CG2 . VAL A 1 187 ? 52.125 9.710   18.683 1.00 10.79 ? 200 VAL A CG2 1 
ATOM   1322 N  N   . CYS A 1 188 ? 50.570 8.554   14.498 1.00 13.25 ? 201 CYS A N   1 
ATOM   1323 C  CA  . CYS A 1 188 ? 50.639 8.155   13.099 1.00 15.64 ? 201 CYS A CA  1 
ATOM   1324 C  C   . CYS A 1 188 ? 51.079 9.353   12.268 1.00 18.23 ? 201 CYS A C   1 
ATOM   1325 O  O   . CYS A 1 188 ? 50.441 10.410  12.291 1.00 17.79 ? 201 CYS A O   1 
ATOM   1326 C  CB  . CYS A 1 188 ? 49.271 7.663   12.621 1.00 15.24 ? 201 CYS A CB  1 
ATOM   1327 S  SG  . CYS A 1 188 ? 48.257 6.820   13.881 1.00 14.31 ? 201 CYS A SG  1 
ATOM   1328 N  N   . SER A 1 189 ? 52.178 9.178   11.540 1.00 21.39 ? 202 SER A N   1 
ATOM   1329 C  CA  . SER A 1 189 ? 52.746 10.228  10.703 1.00 23.48 ? 202 SER A CA  1 
ATOM   1330 C  C   . SER A 1 189 ? 52.933 11.546  11.458 1.00 22.69 ? 202 SER A C   1 
ATOM   1331 O  O   . SER A 1 189 ? 52.539 12.610  10.984 1.00 23.04 ? 202 SER A O   1 
ATOM   1332 C  CB  . SER A 1 189 ? 51.884 10.441  9.450  1.00 26.72 ? 202 SER A CB  1 
ATOM   1333 O  OG  . SER A 1 189 ? 50.535 10.727  9.776  1.00 31.90 ? 202 SER A OG  1 
ATOM   1334 N  N   . GLY A 1 190 ? 53.534 11.456  12.642 1.00 21.24 ? 203 GLY A N   1 
ATOM   1335 C  CA  . GLY A 1 190 ? 53.796 12.639  13.446 1.00 20.10 ? 203 GLY A CA  1 
ATOM   1336 C  C   . GLY A 1 190 ? 52.615 13.295  14.141 1.00 18.55 ? 203 GLY A C   1 
ATOM   1337 O  O   . GLY A 1 190 ? 52.767 14.371  14.717 1.00 19.50 ? 203 GLY A O   1 
ATOM   1338 N  N   . LYS A 1 191 ? 51.445 12.666  14.099 1.00 17.51 ? 204 LYS A N   1 
ATOM   1339 C  CA  . LYS A 1 191 ? 50.261 13.235  14.743 1.00 16.74 ? 204 LYS A CA  1 
ATOM   1340 C  C   . LYS A 1 191 ? 49.673 12.274  15.768 1.00 14.75 ? 204 LYS A C   1 
ATOM   1341 O  O   . LYS A 1 191 ? 49.660 11.060  15.556 1.00 13.79 ? 204 LYS A O   1 
ATOM   1342 C  CB  . LYS A 1 191 ? 49.179 13.547  13.702 1.00 19.78 ? 204 LYS A CB  1 
ATOM   1343 C  CG  . LYS A 1 191 ? 49.649 14.333  12.490 1.00 23.63 ? 204 LYS A CG  1 
ATOM   1344 C  CD  . LYS A 1 191 ? 50.040 15.757  12.842 1.00 26.99 ? 204 LYS A CD  1 
ATOM   1345 C  CE  . LYS A 1 191 ? 50.446 16.522  11.589 1.00 28.77 ? 204 LYS A CE  1 
ATOM   1346 N  NZ  . LYS A 1 191 ? 50.854 17.918  11.902 1.00 32.76 ? 204 LYS A NZ  1 
ATOM   1347 N  N   . LEU A 1 192 ? 49.176 12.821  16.873 1.00 13.79 ? 209 LEU A N   1 
ATOM   1348 C  CA  . LEU A 1 192 ? 48.553 12.005  17.913 1.00 12.57 ? 209 LEU A CA  1 
ATOM   1349 C  C   . LEU A 1 192 ? 47.133 11.681  17.453 1.00 13.17 ? 209 LEU A C   1 
ATOM   1350 O  O   . LEU A 1 192 ? 46.253 12.536  17.512 1.00 14.71 ? 209 LEU A O   1 
ATOM   1351 C  CB  . LEU A 1 192 ? 48.498 12.776  19.234 1.00 12.17 ? 209 LEU A CB  1 
ATOM   1352 C  CG  . LEU A 1 192 ? 47.820 12.049  20.400 1.00 13.00 ? 209 LEU A CG  1 
ATOM   1353 C  CD1 . LEU A 1 192 ? 48.640 10.825  20.780 1.00 12.50 ? 209 LEU A CD1 1 
ATOM   1354 C  CD2 . LEU A 1 192 ? 47.689 12.988  21.586 1.00 13.78 ? 209 LEU A CD2 1 
ATOM   1355 N  N   . GLN A 1 193 ? 46.906 10.454  16.991 1.00 11.54 ? 210 GLN A N   1 
ATOM   1356 C  CA  . GLN A 1 193 ? 45.579 10.071  16.522 1.00 11.49 ? 210 GLN A CA  1 
ATOM   1357 C  C   . GLN A 1 193 ? 44.777 9.270   17.541 1.00 9.80  ? 210 GLN A C   1 
ATOM   1358 O  O   . GLN A 1 193 ? 43.552 9.220   17.468 1.00 10.50 ? 210 GLN A O   1 
ATOM   1359 C  CB  . GLN A 1 193 ? 45.685 9.269   15.220 1.00 13.59 ? 210 GLN A CB  1 
ATOM   1360 C  CG  . GLN A 1 193 ? 46.226 10.056  14.027 1.00 16.38 ? 210 GLN A CG  1 
ATOM   1361 C  CD  . GLN A 1 193 ? 45.213 11.027  13.436 1.00 18.31 ? 210 GLN A CD  1 
ATOM   1362 O  OE1 . GLN A 1 193 ? 45.478 11.682  12.424 1.00 21.68 ? 210 GLN A OE1 1 
ATOM   1363 N  NE2 . GLN A 1 193 ? 44.052 11.124  14.061 1.00 17.79 ? 210 GLN A NE2 1 
ATOM   1364 N  N   . GLY A 1 194 ? 45.454 8.645   18.495 1.00 9.80  ? 211 GLY A N   1 
ATOM   1365 C  CA  . GLY A 1 194 ? 44.719 7.862   19.467 1.00 7.91  ? 211 GLY A CA  1 
ATOM   1366 C  C   . GLY A 1 194 ? 45.273 7.839   20.874 1.00 7.96  ? 211 GLY A C   1 
ATOM   1367 O  O   . GLY A 1 194 ? 46.414 8.232   21.126 1.00 8.49  ? 211 GLY A O   1 
ATOM   1368 N  N   . ILE A 1 195 ? 44.431 7.386   21.794 1.00 8.10  ? 212 ILE A N   1 
ATOM   1369 C  CA  . ILE A 1 195 ? 44.789 7.250   23.196 1.00 7.88  ? 212 ILE A CA  1 
ATOM   1370 C  C   . ILE A 1 195 ? 44.469 5.803   23.565 1.00 8.13  ? 212 ILE A C   1 
ATOM   1371 O  O   . ILE A 1 195 ? 43.376 5.317   23.272 1.00 7.29  ? 212 ILE A O   1 
ATOM   1372 C  CB  . ILE A 1 195 ? 43.946 8.188   24.084 1.00 8.94  ? 212 ILE A CB  1 
ATOM   1373 C  CG1 . ILE A 1 195 ? 44.228 9.647   23.713 1.00 10.69 ? 212 ILE A CG1 1 
ATOM   1374 C  CG2 . ILE A 1 195 ? 44.263 7.941   25.560 1.00 9.53  ? 212 ILE A CG2 1 
ATOM   1375 C  CD1 . ILE A 1 195 ? 43.348 10.647  24.452 1.00 14.46 ? 212 ILE A CD1 1 
ATOM   1376 N  N   . VAL A 1 196 ? 45.414 5.109   24.190 1.00 7.89  ? 213 VAL A N   1 
ATOM   1377 C  CA  . VAL A 1 196 ? 45.168 3.723   24.590 1.00 9.59  ? 213 VAL A CA  1 
ATOM   1378 C  C   . VAL A 1 196 ? 43.976 3.709   25.549 1.00 10.22 ? 213 VAL A C   1 
ATOM   1379 O  O   . VAL A 1 196 ? 44.030 4.294   26.634 1.00 10.46 ? 213 VAL A O   1 
ATOM   1380 C  CB  . VAL A 1 196 ? 46.395 3.119   25.291 1.00 8.42  ? 213 VAL A CB  1 
ATOM   1381 C  CG1 . VAL A 1 196 ? 46.100 1.690   25.710 1.00 10.93 ? 213 VAL A CG1 1 
ATOM   1382 C  CG2 . VAL A 1 196 ? 47.598 3.166   24.354 1.00 8.60  ? 213 VAL A CG2 1 
ATOM   1383 N  N   . SER A 1 197 ? 42.902 3.035   25.151 1.00 10.25 ? 214 SER A N   1 
ATOM   1384 C  CA  . SER A 1 197 ? 41.698 3.002   25.968 1.00 10.21 ? 214 SER A CA  1 
ATOM   1385 C  C   . SER A 1 197 ? 41.330 1.639   26.546 1.00 12.22 ? 214 SER A C   1 
ATOM   1386 O  O   . SER A 1 197 ? 41.429 1.431   27.755 1.00 12.24 ? 214 SER A O   1 
ATOM   1387 C  CB  . SER A 1 197 ? 40.521 3.562   25.158 1.00 10.79 ? 214 SER A CB  1 
ATOM   1388 O  OG  . SER A 1 197 ? 39.374 3.738   25.974 1.00 11.95 ? 214 SER A OG  1 
ATOM   1389 N  N   . TRP A 1 198 ? 40.898 0.708   25.701 1.00 11.49 ? 215 TRP A N   1 
ATOM   1390 C  CA  . TRP A 1 198 ? 40.522 -0.606  26.212 1.00 11.03 ? 215 TRP A CA  1 
ATOM   1391 C  C   . TRP A 1 198 ? 40.657 -1.733  25.204 1.00 12.47 ? 215 TRP A C   1 
ATOM   1392 O  O   . TRP A 1 198 ? 41.161 -1.543  24.104 1.00 11.93 ? 215 TRP A O   1 
ATOM   1393 C  CB  . TRP A 1 198 ? 39.082 -0.582  26.741 1.00 12.37 ? 215 TRP A CB  1 
ATOM   1394 C  CG  . TRP A 1 198 ? 38.038 -0.229  25.705 1.00 14.04 ? 215 TRP A CG  1 
ATOM   1395 C  CD1 . TRP A 1 198 ? 37.743 1.017   25.229 1.00 14.26 ? 215 TRP A CD1 1 
ATOM   1396 C  CD2 . TRP A 1 198 ? 37.158 -1.137  25.023 1.00 14.04 ? 215 TRP A CD2 1 
ATOM   1397 N  NE1 . TRP A 1 198 ? 36.733 0.943   24.295 1.00 15.32 ? 215 TRP A NE1 1 
ATOM   1398 C  CE2 . TRP A 1 198 ? 36.358 -0.367  24.150 1.00 15.18 ? 215 TRP A CE2 1 
ATOM   1399 C  CE3 . TRP A 1 198 ? 36.971 -2.526  25.065 1.00 16.75 ? 215 TRP A CE3 1 
ATOM   1400 C  CZ2 . TRP A 1 198 ? 35.381 -0.941  23.322 1.00 15.58 ? 215 TRP A CZ2 1 
ATOM   1401 C  CZ3 . TRP A 1 198 ? 35.997 -3.097  24.239 1.00 16.20 ? 215 TRP A CZ3 1 
ATOM   1402 C  CH2 . TRP A 1 198 ? 35.218 -2.303  23.382 1.00 14.47 ? 215 TRP A CH2 1 
ATOM   1403 N  N   . GLY A 1 199 ? 40.200 -2.912  25.614 1.00 13.74 ? 216 GLY A N   1 
ATOM   1404 C  CA  . GLY A 1 199 ? 40.248 -4.092  24.772 1.00 16.03 ? 216 GLY A CA  1 
ATOM   1405 C  C   . GLY A 1 199 ? 39.872 -5.299  25.609 1.00 18.12 ? 216 GLY A C   1 
ATOM   1406 O  O   . GLY A 1 199 ? 39.827 -5.211  26.837 1.00 19.15 ? 216 GLY A O   1 
ATOM   1407 N  N   . SER A 1 200 ? 39.592 -6.423  24.959 1.00 19.11 ? 217 SER A N   1 
ATOM   1408 C  CA  . SER A 1 200 ? 39.234 -7.640  25.679 1.00 20.24 ? 217 SER A CA  1 
ATOM   1409 C  C   . SER A 1 200 ? 40.527 -8.416  25.894 1.00 20.33 ? 217 SER A C   1 
ATOM   1410 O  O   . SER A 1 200 ? 41.066 -9.007  24.959 1.00 21.31 ? 217 SER A O   1 
ATOM   1411 C  CB  . SER A 1 200 ? 38.241 -8.467  24.857 1.00 22.19 ? 217 SER A CB  1 
ATOM   1412 O  OG  . SER A 1 200 ? 37.809 -9.605  25.580 1.00 25.17 ? 217 SER A OG  1 
ATOM   1413 N  N   . GLY A 1 201 ? 41.025 -8.410  27.127 1.00 20.08 ? 219 GLY A N   1 
ATOM   1414 C  CA  . GLY A 1 201 ? 42.276 -9.086  27.411 1.00 19.70 ? 219 GLY A CA  1 
ATOM   1415 C  C   . GLY A 1 201 ? 43.386 -8.350  26.677 1.00 19.41 ? 219 GLY A C   1 
ATOM   1416 O  O   . GLY A 1 201 ? 43.248 -7.159  26.390 1.00 19.06 ? 219 GLY A O   1 
ATOM   1417 N  N   . CYS A 1 202 ? 44.478 -9.043  26.372 1.00 18.15 ? 220 CYS A N   1 
ATOM   1418 C  CA  . CYS A 1 202 ? 45.594 -8.440  25.646 1.00 18.16 ? 220 CYS A CA  1 
ATOM   1419 C  C   . CYS A 1 202 ? 46.199 -9.406  24.630 1.00 18.18 ? 220 CYS A C   1 
ATOM   1420 O  O   . CYS A 1 202 ? 46.510 -10.552 24.958 1.00 18.47 ? 220 CYS A O   1 
ATOM   1421 C  CB  . CYS A 1 202 ? 46.689 -7.994  26.614 1.00 19.07 ? 220 CYS A CB  1 
ATOM   1422 S  SG  . CYS A 1 202 ? 46.185 -6.705  27.796 1.00 18.80 ? 220 CYS A SG  1 
ATOM   1423 N  N   . ALA A 1 203 ? 46.359 -8.933  23.398 1.00 18.35 ? 221 ALA A N   1 
ATOM   1424 C  CA  . ALA A 1 203 ? 46.947 -9.722  22.320 1.00 18.83 ? 221 ALA A CA  1 
ATOM   1425 C  C   . ALA A 1 203 ? 46.191 -11.002 21.977 1.00 20.02 ? 221 ALA A C   1 
ATOM   1426 O  O   . ALA A 1 203 ? 46.780 -11.950 21.456 1.00 20.27 ? 221 ALA A O   1 
ATOM   1427 C  CB  . ALA A 1 203 ? 48.402 -10.053 22.651 1.00 18.36 ? 221 ALA A CB  1 
ATOM   1428 N  N   . GLN A 1 204 A 44.893 -11.029 22.266 1.00 20.95 ? 221 GLN A N   1 
ATOM   1429 C  CA  . GLN A 1 204 A 44.071 -12.196 21.953 1.00 22.71 ? 221 GLN A CA  1 
ATOM   1430 C  C   . GLN A 1 204 A 43.637 -12.100 20.493 1.00 22.74 ? 221 GLN A C   1 
ATOM   1431 O  O   . GLN A 1 204 A 43.423 -11.006 19.977 1.00 19.87 ? 221 GLN A O   1 
ATOM   1432 C  CB  . GLN A 1 204 A 42.839 -12.242 22.862 1.00 24.99 ? 221 GLN A CB  1 
ATOM   1433 C  CG  . GLN A 1 204 A 43.171 -12.458 24.328 1.00 28.94 ? 221 GLN A CG  1 
ATOM   1434 C  CD  . GLN A 1 204 A 43.959 -13.734 24.557 1.00 32.99 ? 221 GLN A CD  1 
ATOM   1435 O  OE1 . GLN A 1 204 A 43.475 -14.835 24.283 1.00 34.89 ? 221 GLN A OE1 1 
ATOM   1436 N  NE2 . GLN A 1 204 A 45.184 -13.593 25.055 1.00 33.67 ? 221 GLN A NE2 1 
ATOM   1437 N  N   . LYS A 1 205 ? 43.509 -13.236 19.817 1.00 23.40 ? 222 LYS A N   1 
ATOM   1438 C  CA  . LYS A 1 205 ? 43.109 -13.196 18.417 1.00 24.11 ? 222 LYS A CA  1 
ATOM   1439 C  C   . LYS A 1 205 ? 41.675 -12.696 18.274 1.00 22.67 ? 222 LYS A C   1 
ATOM   1440 O  O   . LYS A 1 205 ? 40.823 -12.969 19.121 1.00 22.46 ? 222 LYS A O   1 
ATOM   1441 C  CB  . LYS A 1 205 ? 43.252 -14.576 17.766 1.00 29.33 ? 222 LYS A CB  1 
ATOM   1442 C  CG  . LYS A 1 205 ? 42.155 -15.563 18.107 1.00 33.55 ? 222 LYS A CG  1 
ATOM   1443 C  CD  . LYS A 1 205 ? 42.254 -16.791 17.210 1.00 38.19 ? 222 LYS A CD  1 
ATOM   1444 C  CE  . LYS A 1 205 ? 41.098 -17.753 17.444 1.00 41.65 ? 222 LYS A CE  1 
ATOM   1445 N  NZ  . LYS A 1 205 ? 41.180 -18.946 16.550 1.00 43.47 ? 222 LYS A NZ  1 
ATOM   1446 N  N   . ASN A 1 206 ? 41.424 -11.947 17.204 1.00 22.17 ? 223 ASN A N   1 
ATOM   1447 C  CA  . ASN A 1 206 ? 40.098 -11.404 16.928 1.00 23.07 ? 223 ASN A CA  1 
ATOM   1448 C  C   . ASN A 1 206 ? 39.651 -10.375 17.965 1.00 21.39 ? 223 ASN A C   1 
ATOM   1449 O  O   . ASN A 1 206 ? 38.478 -10.010 18.017 1.00 20.37 ? 223 ASN A O   1 
ATOM   1450 C  CB  . ASN A 1 206 ? 39.079 -12.547 16.858 1.00 26.29 ? 223 ASN A CB  1 
ATOM   1451 C  CG  . ASN A 1 206 ? 39.378 -13.521 15.735 1.00 29.78 ? 223 ASN A CG  1 
ATOM   1452 O  OD1 . ASN A 1 206 ? 39.021 -14.700 15.805 1.00 33.35 ? 223 ASN A OD1 1 
ATOM   1453 N  ND2 . ASN A 1 206 ? 40.029 -13.031 14.687 1.00 30.64 ? 223 ASN A ND2 1 
ATOM   1454 N  N   . LYS A 1 207 ? 40.588 -9.909  18.786 1.00 19.30 ? 224 LYS A N   1 
ATOM   1455 C  CA  . LYS A 1 207 ? 40.277 -8.922  19.818 1.00 19.55 ? 224 LYS A CA  1 
ATOM   1456 C  C   . LYS A 1 207 ? 41.349 -7.833  19.848 1.00 17.95 ? 224 LYS A C   1 
ATOM   1457 O  O   . LYS A 1 207 ? 42.174 -7.782  20.758 1.00 18.33 ? 224 LYS A O   1 
ATOM   1458 C  CB  . LYS A 1 207 ? 40.193 -9.598  21.189 1.00 22.62 ? 224 LYS A CB  1 
ATOM   1459 C  CG  . LYS A 1 207 ? 39.071 -10.613 21.322 1.00 26.35 ? 224 LYS A CG  1 
ATOM   1460 C  CD  . LYS A 1 207 ? 37.707 -9.952  21.195 1.00 30.26 ? 224 LYS A CD  1 
ATOM   1461 C  CE  . LYS A 1 207 ? 36.588 -10.968 21.362 1.00 32.83 ? 224 LYS A CE  1 
ATOM   1462 N  NZ  . LYS A 1 207 ? 35.244 -10.334 21.236 1.00 35.75 ? 224 LYS A NZ  1 
ATOM   1463 N  N   . PRO A 1 208 ? 41.341 -6.943  18.849 1.00 15.84 ? 225 PRO A N   1 
ATOM   1464 C  CA  . PRO A 1 208 ? 42.324 -5.858  18.775 1.00 14.37 ? 225 PRO A CA  1 
ATOM   1465 C  C   . PRO A 1 208 ? 42.116 -4.791  19.846 1.00 13.54 ? 225 PRO A C   1 
ATOM   1466 O  O   . PRO A 1 208 ? 41.086 -4.760  20.519 1.00 14.13 ? 225 PRO A O   1 
ATOM   1467 C  CB  . PRO A 1 208 ? 42.117 -5.310  17.368 1.00 14.49 ? 225 PRO A CB  1 
ATOM   1468 C  CG  . PRO A 1 208 ? 40.632 -5.467  17.185 1.00 14.86 ? 225 PRO A CG  1 
ATOM   1469 C  CD  . PRO A 1 208 ? 40.379 -6.860  17.734 1.00 15.19 ? 225 PRO A CD  1 
ATOM   1470 N  N   . GLY A 1 209 ? 43.101 -3.914  19.999 1.00 12.62 ? 226 GLY A N   1 
ATOM   1471 C  CA  . GLY A 1 209 ? 42.978 -2.855  20.979 1.00 10.49 ? 226 GLY A CA  1 
ATOM   1472 C  C   . GLY A 1 209 ? 42.027 -1.785  20.480 1.00 9.99  ? 226 GLY A C   1 
ATOM   1473 O  O   . GLY A 1 209 ? 41.892 -1.580  19.273 1.00 9.82  ? 226 GLY A O   1 
ATOM   1474 N  N   . VAL A 1 210 ? 41.352 -1.109  21.404 1.00 9.42  ? 227 VAL A N   1 
ATOM   1475 C  CA  . VAL A 1 210 ? 40.422 -0.050  21.042 1.00 8.40  ? 227 VAL A CA  1 
ATOM   1476 C  C   . VAL A 1 210 ? 41.006 1.262   21.547 1.00 8.53  ? 227 VAL A C   1 
ATOM   1477 O  O   . VAL A 1 210 ? 41.518 1.330   22.666 1.00 8.92  ? 227 VAL A O   1 
ATOM   1478 C  CB  . VAL A 1 210 ? 39.036 -0.283  21.664 1.00 9.29  ? 227 VAL A CB  1 
ATOM   1479 C  CG1 . VAL A 1 210 ? 38.082 0.820   21.230 1.00 9.54  ? 227 VAL A CG1 1 
ATOM   1480 C  CG2 . VAL A 1 210 ? 38.503 -1.645  21.229 1.00 11.98 ? 227 VAL A CG2 1 
ATOM   1481 N  N   . TYR A 1 211 ? 40.922 2.301   20.726 1.00 9.54  ? 228 TYR A N   1 
ATOM   1482 C  CA  . TYR A 1 211 ? 41.508 3.586   21.079 1.00 9.72  ? 228 TYR A CA  1 
ATOM   1483 C  C   . TYR A 1 211 ? 40.581 4.770   20.905 1.00 10.52 ? 228 TYR A C   1 
ATOM   1484 O  O   . TYR A 1 211 ? 39.689 4.760   20.060 1.00 11.02 ? 228 TYR A O   1 
ATOM   1485 C  CB  . TYR A 1 211 ? 42.771 3.815   20.237 1.00 10.26 ? 228 TYR A CB  1 
ATOM   1486 C  CG  . TYR A 1 211 ? 43.772 2.688   20.340 1.00 10.98 ? 228 TYR A CG  1 
ATOM   1487 C  CD1 . TYR A 1 211 ? 43.595 1.496   19.631 1.00 11.38 ? 228 TYR A CD1 1 
ATOM   1488 C  CD2 . TYR A 1 211 ? 44.860 2.785   21.203 1.00 11.02 ? 228 TYR A CD2 1 
ATOM   1489 C  CE1 . TYR A 1 211 ? 44.478 0.427   19.788 1.00 11.47 ? 228 TYR A CE1 1 
ATOM   1490 C  CE2 . TYR A 1 211 ? 45.746 1.727   21.367 1.00 11.39 ? 228 TYR A CE2 1 
ATOM   1491 C  CZ  . TYR A 1 211 ? 45.550 0.552   20.661 1.00 12.95 ? 228 TYR A CZ  1 
ATOM   1492 O  OH  . TYR A 1 211 ? 46.422 -0.493  20.856 1.00 12.24 ? 228 TYR A OH  1 
ATOM   1493 N  N   . THR A 1 212 ? 40.812 5.796   21.715 1.00 10.00 ? 229 THR A N   1 
ATOM   1494 C  CA  . THR A 1 212 ? 40.023 7.014   21.647 1.00 10.28 ? 229 THR A CA  1 
ATOM   1495 C  C   . THR A 1 212 ? 40.448 7.755   20.383 1.00 9.62  ? 229 THR A C   1 
ATOM   1496 O  O   . THR A 1 212 ? 41.639 7.988   20.162 1.00 9.71  ? 229 THR A O   1 
ATOM   1497 C  CB  . THR A 1 212 ? 40.275 7.894   22.885 1.00 9.98  ? 229 THR A CB  1 
ATOM   1498 O  OG1 . THR A 1 212 ? 39.950 7.146   24.065 1.00 10.61 ? 229 THR A OG1 1 
ATOM   1499 C  CG2 . THR A 1 212 ? 39.415 9.151   22.835 1.00 9.88  ? 229 THR A CG2 1 
ATOM   1500 N  N   . LYS A 1 213 ? 39.469 8.108   19.555 1.00 10.31 ? 230 LYS A N   1 
ATOM   1501 C  CA  . LYS A 1 213 ? 39.717 8.803   18.291 1.00 11.17 ? 230 LYS A CA  1 
ATOM   1502 C  C   . LYS A 1 213 ? 39.944 10.297  18.532 1.00 10.84 ? 230 LYS A C   1 
ATOM   1503 O  O   . LYS A 1 213 ? 39.010 11.092  18.514 1.00 10.85 ? 230 LYS A O   1 
ATOM   1504 C  CB  . LYS A 1 213 ? 38.519 8.584   17.366 1.00 12.63 ? 230 LYS A CB  1 
ATOM   1505 C  CG  . LYS A 1 213 ? 38.755 8.921   15.909 1.00 17.94 ? 230 LYS A CG  1 
ATOM   1506 C  CD  . LYS A 1 213 ? 37.544 8.498   15.082 1.00 19.72 ? 230 LYS A CD  1 
ATOM   1507 C  CE  . LYS A 1 213 ? 37.745 8.774   13.604 1.00 25.59 ? 230 LYS A CE  1 
ATOM   1508 N  NZ  . LYS A 1 213 ? 38.893 8.012   13.045 1.00 31.70 ? 230 LYS A NZ  1 
ATOM   1509 N  N   . VAL A 1 214 ? 41.201 10.673  18.734 1.00 10.86 ? 231 VAL A N   1 
ATOM   1510 C  CA  . VAL A 1 214 ? 41.561 12.056  19.024 1.00 10.90 ? 231 VAL A CA  1 
ATOM   1511 C  C   . VAL A 1 214 ? 41.111 13.125  18.028 1.00 12.22 ? 231 VAL A C   1 
ATOM   1512 O  O   . VAL A 1 214 ? 40.790 14.243  18.430 1.00 11.02 ? 231 VAL A O   1 
ATOM   1513 C  CB  . VAL A 1 214 ? 43.089 12.179  19.229 1.00 10.41 ? 231 VAL A CB  1 
ATOM   1514 C  CG1 . VAL A 1 214 ? 43.479 13.637  19.453 1.00 10.15 ? 231 VAL A CG1 1 
ATOM   1515 C  CG2 . VAL A 1 214 ? 43.510 11.327  20.423 1.00 10.59 ? 231 VAL A CG2 1 
ATOM   1516 N  N   . CYS A 1 215 ? 41.082 12.798  16.740 1.00 12.58 ? 232 CYS A N   1 
ATOM   1517 C  CA  . CYS A 1 215 ? 40.679 13.789  15.747 1.00 14.07 ? 232 CYS A CA  1 
ATOM   1518 C  C   . CYS A 1 215 ? 39.277 14.358  16.005 1.00 14.87 ? 232 CYS A C   1 
ATOM   1519 O  O   . CYS A 1 215 ? 38.967 15.463  15.555 1.00 16.58 ? 232 CYS A O   1 
ATOM   1520 C  CB  . CYS A 1 215 ? 40.779 13.194  14.332 1.00 15.48 ? 232 CYS A CB  1 
ATOM   1521 S  SG  . CYS A 1 215 ? 39.661 11.798  14.029 1.00 17.26 ? 232 CYS A SG  1 
ATOM   1522 N  N   . ASN A 1 216 ? 38.437 13.624  16.734 1.00 13.87 ? 233 ASN A N   1 
ATOM   1523 C  CA  . ASN A 1 216 ? 37.084 14.103  17.043 1.00 15.10 ? 233 ASN A CA  1 
ATOM   1524 C  C   . ASN A 1 216 ? 37.073 15.110  18.192 1.00 14.87 ? 233 ASN A C   1 
ATOM   1525 O  O   . ASN A 1 216 ? 36.057 15.762  18.437 1.00 15.14 ? 233 ASN A O   1 
ATOM   1526 C  CB  . ASN A 1 216 ? 36.155 12.947  17.445 1.00 16.19 ? 233 ASN A CB  1 
ATOM   1527 C  CG  . ASN A 1 216 ? 35.807 12.029  16.287 1.00 17.11 ? 233 ASN A CG  1 
ATOM   1528 O  OD1 . ASN A 1 216 ? 36.107 12.319  15.131 1.00 18.30 ? 233 ASN A OD1 1 
ATOM   1529 N  ND2 . ASN A 1 216 ? 35.157 10.911  16.600 1.00 17.65 ? 233 ASN A ND2 1 
ATOM   1530 N  N   . TYR A 1 217 ? 38.199 15.238  18.890 1.00 11.95 ? 234 TYR A N   1 
ATOM   1531 C  CA  . TYR A 1 217 ? 38.287 16.126  20.047 1.00 13.02 ? 234 TYR A CA  1 
ATOM   1532 C  C   . TYR A 1 217 ? 39.221 17.325  19.925 1.00 13.15 ? 234 TYR A C   1 
ATOM   1533 O  O   . TYR A 1 217 ? 39.419 18.047  20.900 1.00 13.56 ? 234 TYR A O   1 
ATOM   1534 C  CB  . TYR A 1 217 ? 38.711 15.307  21.270 1.00 13.03 ? 234 TYR A CB  1 
ATOM   1535 C  CG  . TYR A 1 217 ? 37.766 14.177  21.601 1.00 11.86 ? 234 TYR A CG  1 
ATOM   1536 C  CD1 . TYR A 1 217 ? 36.595 14.412  22.322 1.00 12.56 ? 234 TYR A CD1 1 
ATOM   1537 C  CD2 . TYR A 1 217 ? 38.024 12.876  21.170 1.00 12.83 ? 234 TYR A CD2 1 
ATOM   1538 C  CE1 . TYR A 1 217 ? 35.705 13.381  22.605 1.00 12.61 ? 234 TYR A CE1 1 
ATOM   1539 C  CE2 . TYR A 1 217 ? 37.136 11.835  21.445 1.00 13.30 ? 234 TYR A CE2 1 
ATOM   1540 C  CZ  . TYR A 1 217 ? 35.981 12.096  22.163 1.00 12.84 ? 234 TYR A CZ  1 
ATOM   1541 O  OH  . TYR A 1 217 ? 35.102 11.076  22.445 1.00 11.45 ? 234 TYR A OH  1 
ATOM   1542 N  N   . VAL A 1 218 ? 39.800 17.545  18.749 1.00 13.17 ? 235 VAL A N   1 
ATOM   1543 C  CA  . VAL A 1 218 ? 40.723 18.664  18.584 1.00 14.18 ? 235 VAL A CA  1 
ATOM   1544 C  C   . VAL A 1 218 ? 40.125 20.012  18.994 1.00 14.26 ? 235 VAL A C   1 
ATOM   1545 O  O   . VAL A 1 218 ? 40.762 20.783  19.713 1.00 14.73 ? 235 VAL A O   1 
ATOM   1546 C  CB  . VAL A 1 218 ? 41.244 18.739  17.132 1.00 15.39 ? 235 VAL A CB  1 
ATOM   1547 C  CG1 . VAL A 1 218 ? 42.139 19.960  16.955 1.00 15.63 ? 235 VAL A CG1 1 
ATOM   1548 C  CG2 . VAL A 1 218 ? 42.029 17.468  16.807 1.00 16.87 ? 235 VAL A CG2 1 
ATOM   1549 N  N   . SER A 1 219 ? 38.902 20.298  18.554 1.00 14.80 ? 236 SER A N   1 
ATOM   1550 C  CA  . SER A 1 219 ? 38.261 21.566  18.905 1.00 15.32 ? 236 SER A CA  1 
ATOM   1551 C  C   . SER A 1 219 ? 38.016 21.681  20.406 1.00 14.22 ? 236 SER A C   1 
ATOM   1552 O  O   . SER A 1 219 ? 38.218 22.745  20.997 1.00 13.96 ? 236 SER A O   1 
ATOM   1553 C  CB  . SER A 1 219 ? 36.934 21.720  18.161 1.00 17.75 ? 236 SER A CB  1 
ATOM   1554 O  OG  . SER A 1 219 ? 37.166 21.886  16.776 1.00 23.79 ? 236 SER A OG  1 
ATOM   1555 N  N   . TRP A 1 220 ? 37.581 20.584  21.019 1.00 13.73 ? 237 TRP A N   1 
ATOM   1556 C  CA  . TRP A 1 220 ? 37.312 20.566  22.452 1.00 13.59 ? 237 TRP A CA  1 
ATOM   1557 C  C   . TRP A 1 220 ? 38.592 20.796  23.249 1.00 13.71 ? 237 TRP A C   1 
ATOM   1558 O  O   . TRP A 1 220 ? 38.600 21.537  24.233 1.00 15.75 ? 237 TRP A O   1 
ATOM   1559 C  CB  . TRP A 1 220 ? 36.695 19.226  22.866 1.00 15.18 ? 237 TRP A CB  1 
ATOM   1560 C  CG  . TRP A 1 220 ? 36.436 19.141  24.343 1.00 15.27 ? 237 TRP A CG  1 
ATOM   1561 C  CD1 . TRP A 1 220 ? 35.427 19.745  25.032 1.00 16.05 ? 237 TRP A CD1 1 
ATOM   1562 C  CD2 . TRP A 1 220 ? 37.242 18.467  25.318 1.00 16.04 ? 237 TRP A CD2 1 
ATOM   1563 N  NE1 . TRP A 1 220 ? 35.554 19.495  26.378 1.00 17.34 ? 237 TRP A NE1 1 
ATOM   1564 C  CE2 . TRP A 1 220 ? 36.660 18.713  26.583 1.00 16.64 ? 237 TRP A CE2 1 
ATOM   1565 C  CE3 . TRP A 1 220 ? 38.403 17.682  25.248 1.00 16.28 ? 237 TRP A CE3 1 
ATOM   1566 C  CZ2 . TRP A 1 220 ? 37.198 18.203  27.770 1.00 14.85 ? 237 TRP A CZ2 1 
ATOM   1567 C  CZ3 . TRP A 1 220 ? 38.941 17.173  26.432 1.00 15.83 ? 237 TRP A CZ3 1 
ATOM   1568 C  CH2 . TRP A 1 220 ? 38.336 17.438  27.675 1.00 15.59 ? 237 TRP A CH2 1 
ATOM   1569 N  N   . ILE A 1 221 ? 39.673 20.154  22.824 1.00 14.09 ? 238 ILE A N   1 
ATOM   1570 C  CA  . ILE A 1 221 ? 40.956 20.292  23.503 1.00 12.68 ? 238 ILE A CA  1 
ATOM   1571 C  C   . ILE A 1 221 ? 41.441 21.737  23.454 1.00 13.37 ? 238 ILE A C   1 
ATOM   1572 O  O   . ILE A 1 221 ? 41.809 22.315  24.476 1.00 13.10 ? 238 ILE A O   1 
ATOM   1573 C  CB  . ILE A 1 221 ? 42.022 19.378  22.860 1.00 11.71 ? 238 ILE A CB  1 
ATOM   1574 C  CG1 . ILE A 1 221 ? 41.687 17.913  23.153 1.00 11.00 ? 238 ILE A CG1 1 
ATOM   1575 C  CG2 . ILE A 1 221 ? 43.407 19.729  23.386 1.00 11.88 ? 238 ILE A CG2 1 
ATOM   1576 C  CD1 . ILE A 1 221 ? 42.565 16.928  22.411 1.00 12.65 ? 238 ILE A CD1 1 
ATOM   1577 N  N   . LYS A 1 222 ? 41.431 22.320  22.261 1.00 13.67 ? 239 LYS A N   1 
ATOM   1578 C  CA  . LYS A 1 222 ? 41.883 23.691  22.089 1.00 14.55 ? 239 LYS A CA  1 
ATOM   1579 C  C   . LYS A 1 222 ? 41.046 24.695  22.872 1.00 13.96 ? 239 LYS A C   1 
ATOM   1580 O  O   . LYS A 1 222 ? 41.587 25.592  23.517 1.00 14.30 ? 239 LYS A O   1 
ATOM   1581 C  CB  . LYS A 1 222 ? 41.894 24.049  20.601 1.00 17.35 ? 239 LYS A CB  1 
ATOM   1582 C  CG  . LYS A 1 222 ? 42.983 23.324  19.827 1.00 21.66 ? 239 LYS A CG  1 
ATOM   1583 C  CD  . LYS A 1 222 ? 42.988 23.711  18.359 1.00 27.47 ? 239 LYS A CD  1 
ATOM   1584 C  CE  . LYS A 1 222 ? 44.190 23.109  17.648 1.00 31.03 ? 239 LYS A CE  1 
ATOM   1585 N  NZ  . LYS A 1 222 ? 44.239 23.489  16.208 1.00 34.82 ? 239 LYS A NZ  1 
ATOM   1586 N  N   . GLN A 1 223 ? 39.728 24.540  22.829 1.00 13.69 ? 240 GLN A N   1 
ATOM   1587 C  CA  . GLN A 1 223 ? 38.848 25.453  23.546 1.00 15.46 ? 240 GLN A CA  1 
ATOM   1588 C  C   . GLN A 1 223 ? 39.014 25.329  25.056 1.00 14.58 ? 240 GLN A C   1 
ATOM   1589 O  O   . GLN A 1 223 ? 38.961 26.326  25.777 1.00 15.81 ? 240 GLN A O   1 
ATOM   1590 C  CB  . GLN A 1 223 ? 37.388 25.207  23.146 1.00 16.95 ? 240 GLN A CB  1 
ATOM   1591 C  CG  . GLN A 1 223 ? 37.062 25.687  21.734 1.00 21.64 ? 240 GLN A CG  1 
ATOM   1592 C  CD  . GLN A 1 223 ? 35.614 25.446  21.340 1.00 25.46 ? 240 GLN A CD  1 
ATOM   1593 O  OE1 . GLN A 1 223 ? 35.146 25.947  20.316 1.00 27.63 ? 240 GLN A OE1 1 
ATOM   1594 N  NE2 . GLN A 1 223 ? 34.900 24.672  22.148 1.00 27.11 ? 240 GLN A NE2 1 
ATOM   1595 N  N   . THR A 1 224 ? 39.234 24.108  25.534 1.00 13.61 ? 241 THR A N   1 
ATOM   1596 C  CA  . THR A 1 224 ? 39.408 23.870  26.963 1.00 13.45 ? 241 THR A CA  1 
ATOM   1597 C  C   . THR A 1 224 ? 40.737 24.435  27.456 1.00 13.82 ? 241 THR A C   1 
ATOM   1598 O  O   . THR A 1 224 ? 40.805 25.056  28.518 1.00 13.88 ? 241 THR A O   1 
ATOM   1599 C  CB  . THR A 1 224 ? 39.338 22.361  27.278 1.00 13.88 ? 241 THR A CB  1 
ATOM   1600 O  OG1 . THR A 1 224 ? 38.074 21.849  26.837 1.00 13.79 ? 241 THR A OG1 1 
ATOM   1601 C  CG2 . THR A 1 224 ? 39.484 22.115  28.774 1.00 13.72 ? 241 THR A CG2 1 
ATOM   1602 N  N   . ILE A 1 225 ? 41.795 24.222  26.681 1.00 14.01 ? 242 ILE A N   1 
ATOM   1603 C  CA  . ILE A 1 225 ? 43.111 24.729  27.045 1.00 16.32 ? 242 ILE A CA  1 
ATOM   1604 C  C   . ILE A 1 225 ? 43.115 26.259  27.041 1.00 16.26 ? 242 ILE A C   1 
ATOM   1605 O  O   . ILE A 1 225 ? 43.735 26.888  27.895 1.00 17.17 ? 242 ILE A O   1 
ATOM   1606 C  CB  . ILE A 1 225 ? 44.200 24.225  26.061 1.00 16.79 ? 242 ILE A CB  1 
ATOM   1607 C  CG1 . ILE A 1 225 ? 44.478 22.741  26.310 1.00 17.41 ? 242 ILE A CG1 1 
ATOM   1608 C  CG2 . ILE A 1 225 ? 45.473 25.048  26.216 1.00 19.06 ? 242 ILE A CG2 1 
ATOM   1609 C  CD1 . ILE A 1 225 ? 45.499 22.142  25.356 1.00 20.18 ? 242 ILE A CD1 1 
ATOM   1610 N  N   . ALA A 1 226 ? 42.414 26.850  26.081 1.00 16.77 ? 243 ALA A N   1 
ATOM   1611 C  CA  . ALA A 1 226 ? 42.364 28.304  25.966 1.00 18.65 ? 243 ALA A CA  1 
ATOM   1612 C  C   . ALA A 1 226 ? 41.658 28.990  27.131 1.00 19.63 ? 243 ALA A C   1 
ATOM   1613 O  O   . ALA A 1 226 ? 41.955 30.142  27.445 1.00 20.85 ? 243 ALA A O   1 
ATOM   1614 C  CB  . ALA A 1 226 ? 41.697 28.696  24.656 1.00 20.09 ? 243 ALA A CB  1 
ATOM   1615 N  N   . SER A 1 227 ? 40.733 28.286  27.775 1.00 19.54 ? 244 SER A N   1 
ATOM   1616 C  CA  . SER A 1 227 ? 39.984 28.858  28.890 1.00 19.61 ? 244 SER A CA  1 
ATOM   1617 C  C   . SER A 1 227 ? 40.467 28.422  30.273 1.00 19.68 ? 244 SER A C   1 
ATOM   1618 O  O   . SER A 1 227 ? 39.814 28.705  31.277 1.00 19.97 ? 244 SER A O   1 
ATOM   1619 C  CB  . SER A 1 227 ? 38.495 28.526  28.738 1.00 21.06 ? 244 SER A CB  1 
ATOM   1620 O  OG  . SER A 1 227 ? 38.290 27.128  28.608 1.00 22.96 ? 244 SER A OG  1 
ATOM   1621 N  N   . ASN A 1 228 ? 41.608 27.742  30.330 1.00 18.13 ? 245 ASN A N   1 
ATOM   1622 C  CA  . ASN A 1 228 ? 42.151 27.285  31.607 1.00 19.02 ? 245 ASN A CA  1 
ATOM   1623 C  C   . ASN A 1 228 ? 43.624 27.640  31.749 1.00 20.70 ? 245 ASN A C   1 
ATOM   1624 O  O   . ASN A 1 228 ? 44.310 26.967  32.544 1.00 22.01 ? 245 ASN A O   1 
ATOM   1625 C  CB  . ASN A 1 228 ? 41.974 25.767  31.745 1.00 17.29 ? 245 ASN A CB  1 
ATOM   1626 C  CG  . ASN A 1 228 ? 40.558 25.377  32.117 1.00 17.54 ? 245 ASN A CG  1 
ATOM   1627 O  OD1 . ASN A 1 228 ? 40.167 25.449  33.282 1.00 16.61 ? 245 ASN A OD1 1 
ATOM   1628 N  ND2 . ASN A 1 228 ? 39.777 24.973  31.124 1.00 15.30 ? 245 ASN A ND2 1 
ATOM   1629 O  OXT . ASN A 1 228 ? 44.066 28.600  31.083 1.00 22.71 ? 245 ASN A OXT 1 
HETATM 1630 MG MG  . MG  B 2 .   ? 42.580 -1.177  31.312 1.00 41.03 ? 501 MG  A MG  1 
HETATM 1631 CA CA  . CA  C 3 .   ? 64.044 7.104   35.099 1.00 16.48 ? 502 CA  A CA  1 
HETATM 1632 S  S   . SO4 D 4 .   ? 27.204 -2.303  15.722 1.00 70.25 ? 701 SO4 A S   1 
HETATM 1633 O  O1  . SO4 D 4 .   ? 25.888 -2.560  16.339 1.00 70.50 ? 701 SO4 A O1  1 
HETATM 1634 O  O2  . SO4 D 4 .   ? 28.164 -3.331  16.164 1.00 69.94 ? 701 SO4 A O2  1 
HETATM 1635 O  O3  . SO4 D 4 .   ? 27.079 -2.350  14.253 1.00 70.81 ? 701 SO4 A O3  1 
HETATM 1636 O  O4  . SO4 D 4 .   ? 27.684 -0.969  16.130 1.00 70.90 ? 701 SO4 A O4  1 
HETATM 1637 C  C1  . 108 E 5 .   ? 44.109 -2.993  26.076 1.00 24.51 ? 601 108 A C1  1 
HETATM 1638 C  C2  . 108 E 5 .   ? 43.266 -3.542  27.031 1.00 28.07 ? 601 108 A C2  1 
HETATM 1639 C  C3  . 108 E 5 .   ? 43.060 -2.909  28.260 1.00 31.11 ? 601 108 A C3  1 
HETATM 1640 C  C4  . 108 E 5 .   ? 43.719 -1.702  28.517 1.00 29.37 ? 601 108 A C4  1 
HETATM 1641 C  C5  . 108 E 5 .   ? 44.559 -1.166  27.549 1.00 28.22 ? 601 108 A C5  1 
HETATM 1642 C  C6  . 108 E 5 .   ? 44.750 -1.800  26.349 1.00 25.58 ? 601 108 A C6  1 
HETATM 1643 C  C7  . 108 E 5 .   ? 42.162 -3.528  29.217 1.00 35.22 ? 601 108 A C7  1 
HETATM 1644 C  C8  . 108 E 5 .   ? 44.343 -3.671  24.826 1.00 22.69 ? 601 108 A C8  1 
HETATM 1645 O  O1  . 108 E 5 .   ? 43.611 -0.989  29.654 1.00 30.76 ? 601 108 A O1  1 
HETATM 1646 N  N1  . 108 E 5 .   ? 44.800 -2.990  23.784 1.00 19.50 ? 601 108 A N1  1 
HETATM 1647 N  N2  . 108 E 5 .   ? 44.102 -4.970  24.720 1.00 21.39 ? 601 108 A N2  1 
HETATM 1648 N  N   . 108 E 5 .   ? 41.878 -3.052  30.393 1.00 39.86 ? 601 108 A N   1 
HETATM 1649 C  CA  . 108 E 5 .   ? 40.948 -3.809  31.219 1.00 42.12 ? 601 108 A CA  1 
HETATM 1650 C  CB  . 108 E 5 .   ? 41.645 -5.031  31.812 1.00 42.68 ? 601 108 A CB  1 
HETATM 1651 C  C   . 108 E 5 .   ? 40.398 -2.930  32.331 1.00 43.86 ? 601 108 A C   1 
HETATM 1652 O  O   . 108 E 5 .   ? 39.327 -3.239  32.858 1.00 46.15 ? 601 108 A O   1 
HETATM 1653 O  OXT . 108 E 5 .   ? 41.105 -1.902  32.652 1.00 43.83 ? 601 108 A OXT 1 
HETATM 1654 O  O   . HOH F 6 .   ? 37.079 -8.490  12.996 1.00 27.36 ? 702 HOH A O   1 
HETATM 1655 O  O   . HOH F 6 .   ? 37.747 -8.736  9.941  1.00 34.82 ? 703 HOH A O   1 
HETATM 1656 O  O   . HOH F 6 .   ? 38.133 -5.176  6.783  1.00 16.94 ? 704 HOH A O   1 
HETATM 1657 O  O   . HOH F 6 .   ? 37.917 0.691   5.366  1.00 44.63 ? 705 HOH A O   1 
HETATM 1658 O  O   . HOH F 6 .   ? 37.078 2.332   7.897  1.00 27.60 ? 706 HOH A O   1 
HETATM 1659 O  O   . HOH F 6 .   ? 39.181 3.071   10.520 1.00 31.27 ? 707 HOH A O   1 
HETATM 1660 O  O   . HOH F 6 .   ? 38.658 0.906   13.547 1.00 11.82 ? 708 HOH A O   1 
HETATM 1661 O  O   . HOH F 6 .   ? 36.340 2.298   13.483 1.00 41.94 ? 709 HOH A O   1 
HETATM 1662 O  O   . HOH F 6 .   ? 36.384 4.930   13.677 1.00 36.94 ? 710 HOH A O   1 
HETATM 1663 O  O   . HOH F 6 .   ? 33.679 4.087   14.917 1.00 36.99 ? 711 HOH A O   1 
HETATM 1664 O  O   . HOH F 6 .   ? 29.359 3.677   15.608 1.00 49.74 ? 712 HOH A O   1 
HETATM 1665 O  O   . HOH F 6 .   ? 30.338 -1.922  17.652 1.00 28.63 ? 713 HOH A O   1 
HETATM 1666 O  O   . HOH F 6 .   ? 25.379 -5.896  17.228 1.00 52.08 ? 714 HOH A O   1 
HETATM 1667 O  O   . HOH F 6 .   ? 29.886 -9.551  14.648 1.00 47.48 ? 715 HOH A O   1 
HETATM 1668 O  O   . HOH F 6 .   ? 30.811 -5.240  10.734 1.00 34.52 ? 716 HOH A O   1 
HETATM 1669 O  O   . HOH F 6 .   ? 28.979 -2.859  11.207 1.00 50.56 ? 717 HOH A O   1 
HETATM 1670 O  O   . HOH F 6 .   ? 28.616 1.639   23.446 1.00 44.26 ? 718 HOH A O   1 
HETATM 1671 O  O   . HOH F 6 .   ? 31.619 0.531   24.582 1.00 29.35 ? 719 HOH A O   1 
HETATM 1672 O  O   . HOH F 6 .   ? 30.835 -1.550  26.212 1.00 40.71 ? 720 HOH A O   1 
HETATM 1673 O  O   . HOH F 6 .   ? 33.946 -0.864  26.830 1.00 44.40 ? 721 HOH A O   1 
HETATM 1674 O  O   . HOH F 6 .   ? 33.535 -0.589  31.702 1.00 54.67 ? 722 HOH A O   1 
HETATM 1675 O  O   . HOH F 6 .   ? 38.621 -2.511  29.719 1.00 55.61 ? 723 HOH A O   1 
HETATM 1676 O  O   . HOH F 6 .   ? 40.943 -0.176  30.113 1.00 25.14 ? 724 HOH A O   1 
HETATM 1677 O  O   . HOH F 6 .   ? 43.085 0.699   32.219 1.00 24.24 ? 725 HOH A O   1 
HETATM 1678 O  O   . HOH F 6 .   ? 46.134 1.051   33.626 1.00 47.36 ? 726 HOH A O   1 
HETATM 1679 O  O   . HOH F 6 .   ? 47.797 0.269   35.507 1.00 51.27 ? 727 HOH A O   1 
HETATM 1680 O  O   . HOH F 6 .   ? 50.203 -0.948  35.466 1.00 53.12 ? 728 HOH A O   1 
HETATM 1681 O  O   . HOH F 6 .   ? 49.695 -0.452  38.087 1.00 53.14 ? 729 HOH A O   1 
HETATM 1682 O  O   . HOH F 6 .   ? 53.539 -2.621  38.443 1.00 56.06 ? 730 HOH A O   1 
HETATM 1683 O  O   . HOH F 6 .   ? 55.676 -0.533  37.005 1.00 38.14 ? 731 HOH A O   1 
HETATM 1684 O  O   . HOH F 6 .   ? 55.986 -0.981  34.207 1.00 27.69 ? 732 HOH A O   1 
HETATM 1685 O  O   . HOH F 6 .   ? 55.982 1.734   39.016 1.00 30.98 ? 733 HOH A O   1 
HETATM 1686 O  O   . HOH F 6 .   ? 58.072 3.481   39.116 1.00 34.59 ? 734 HOH A O   1 
HETATM 1687 O  O   . HOH F 6 .   ? 56.405 6.342   36.905 1.00 12.22 ? 735 HOH A O   1 
HETATM 1688 O  O   . HOH F 6 .   ? 59.218 6.880   37.147 1.00 13.48 ? 736 HOH A O   1 
HETATM 1689 O  O   . HOH F 6 .   ? 62.926 7.492   37.038 1.00 11.56 ? 737 HOH A O   1 
HETATM 1690 O  O   . HOH F 6 .   ? 62.720 6.704   39.576 1.00 18.26 ? 738 HOH A O   1 
HETATM 1691 O  O   . HOH F 6 .   ? 64.925 7.053   33.027 1.00 11.19 ? 739 HOH A O   1 
HETATM 1692 O  O   . HOH F 6 .   ? 65.580 9.307   31.693 1.00 14.55 ? 740 HOH A O   1 
HETATM 1693 O  O   . HOH F 6 .   ? 67.348 8.744   29.586 1.00 39.00 ? 741 HOH A O   1 
HETATM 1694 O  O   . HOH F 6 .   ? 71.412 5.478   31.276 1.00 38.30 ? 742 HOH A O   1 
HETATM 1695 O  O   . HOH F 6 .   ? 69.939 3.579   27.623 1.00 51.87 ? 743 HOH A O   1 
HETATM 1696 O  O   . HOH F 6 .   ? 68.661 2.896   24.873 1.00 48.80 ? 744 HOH A O   1 
HETATM 1697 O  O   . HOH F 6 .   ? 65.944 1.408   26.656 1.00 20.02 ? 745 HOH A O   1 
HETATM 1698 O  O   . HOH F 6 .   ? 63.136 2.013   25.720 1.00 13.28 ? 746 HOH A O   1 
HETATM 1699 O  O   . HOH F 6 .   ? 62.454 6.396   26.858 1.00 15.96 ? 747 HOH A O   1 
HETATM 1700 O  O   . HOH F 6 .   ? 61.206 7.955   24.980 1.00 13.58 ? 748 HOH A O   1 
HETATM 1701 O  O   . HOH F 6 .   ? 59.807 9.329   27.465 1.00 16.27 ? 749 HOH A O   1 
HETATM 1702 O  O   . HOH F 6 .   ? 62.145 11.110  26.598 1.00 19.72 ? 750 HOH A O   1 
HETATM 1703 O  O   . HOH F 6 .   ? 58.771 12.747  27.898 1.00 17.15 ? 751 HOH A O   1 
HETATM 1704 O  O   . HOH F 6 .   ? 58.355 10.148  30.424 1.00 10.68 ? 752 HOH A O   1 
HETATM 1705 O  O   . HOH F 6 .   ? 52.461 3.565   29.784 1.00 11.77 ? 753 HOH A O   1 
HETATM 1706 O  O   . HOH F 6 .   ? 51.459 4.362   27.329 1.00 9.96  ? 754 HOH A O   1 
HETATM 1707 O  O   . HOH F 6 .   ? 47.904 10.112  25.032 1.00 13.95 ? 755 HOH A O   1 
HETATM 1708 O  O   . HOH F 6 .   ? 53.897 6.652   20.550 1.00 11.78 ? 756 HOH A O   1 
HETATM 1709 O  O   . HOH F 6 .   ? 56.627 8.873   16.919 1.00 28.44 ? 757 HOH A O   1 
HETATM 1710 O  O   . HOH F 6 .   ? 56.828 11.286  15.891 1.00 57.26 ? 758 HOH A O   1 
HETATM 1711 O  O   . HOH F 6 .   ? 59.491 11.441  18.052 1.00 59.20 ? 759 HOH A O   1 
HETATM 1712 O  O   . HOH F 6 .   ? 57.914 14.954  18.919 1.00 42.31 ? 760 HOH A O   1 
HETATM 1713 O  O   . HOH F 6 .   ? 57.694 18.908  19.193 1.00 31.26 ? 761 HOH A O   1 
HETATM 1714 O  O   . HOH F 6 .   ? 58.555 20.404  21.385 1.00 24.34 ? 762 HOH A O   1 
HETATM 1715 O  O   . HOH F 6 .   ? 61.585 20.117  22.183 1.00 31.20 ? 763 HOH A O   1 
HETATM 1716 O  O   . HOH F 6 .   ? 63.150 15.689  20.153 1.00 50.05 ? 764 HOH A O   1 
HETATM 1717 O  O   . HOH F 6 .   ? 54.546 16.560  16.317 1.00 69.70 ? 765 HOH A O   1 
HETATM 1718 O  O   . HOH F 6 .   ? 53.636 20.050  19.479 1.00 37.63 ? 766 HOH A O   1 
HETATM 1719 O  O   . HOH F 6 .   ? 52.670 22.390  20.655 1.00 38.72 ? 767 HOH A O   1 
HETATM 1720 O  O   . HOH F 6 .   ? 55.094 22.915  22.303 1.00 38.47 ? 768 HOH A O   1 
HETATM 1721 O  O   . HOH F 6 .   ? 54.581 25.024  24.326 1.00 30.65 ? 769 HOH A O   1 
HETATM 1722 O  O   . HOH F 6 .   ? 60.212 25.214  27.568 1.00 40.36 ? 770 HOH A O   1 
HETATM 1723 O  O   . HOH F 6 .   ? 60.337 25.549  32.029 1.00 59.82 ? 771 HOH A O   1 
HETATM 1724 O  O   . HOH F 6 .   ? 59.098 23.069  35.490 1.00 45.01 ? 772 HOH A O   1 
HETATM 1725 O  O   . HOH F 6 .   ? 60.871 20.911  34.680 1.00 27.13 ? 773 HOH A O   1 
HETATM 1726 O  O   . HOH F 6 .   ? 64.687 18.057  35.943 1.00 23.64 ? 774 HOH A O   1 
HETATM 1727 O  O   . HOH F 6 .   ? 66.394 17.620  32.936 1.00 29.25 ? 775 HOH A O   1 
HETATM 1728 O  O   . HOH F 6 .   ? 66.862 15.425  34.742 1.00 29.95 ? 776 HOH A O   1 
HETATM 1729 O  O   . HOH F 6 .   ? 64.739 16.882  30.679 1.00 19.79 ? 777 HOH A O   1 
HETATM 1730 O  O   . HOH F 6 .   ? 65.630 21.650  28.941 1.00 49.38 ? 778 HOH A O   1 
HETATM 1731 O  O   . HOH F 6 .   ? 55.873 27.745  34.661 1.00 43.72 ? 779 HOH A O   1 
HETATM 1732 O  O   . HOH F 6 .   ? 54.281 27.541  38.399 1.00 48.29 ? 780 HOH A O   1 
HETATM 1733 O  O   . HOH F 6 .   ? 58.590 17.508  41.429 1.00 37.28 ? 781 HOH A O   1 
HETATM 1734 O  O   . HOH F 6 .   ? 56.058 16.754  42.014 1.00 31.20 ? 782 HOH A O   1 
HETATM 1735 O  O   . HOH F 6 .   ? 59.423 12.781  43.423 1.00 41.22 ? 783 HOH A O   1 
HETATM 1736 O  O   . HOH F 6 .   ? 52.571 10.844  43.656 1.00 51.13 ? 784 HOH A O   1 
HETATM 1737 O  O   . HOH F 6 .   ? 49.165 6.163   45.804 1.00 26.10 ? 785 HOH A O   1 
HETATM 1738 O  O   . HOH F 6 .   ? 46.874 6.268   44.241 1.00 28.63 ? 786 HOH A O   1 
HETATM 1739 O  O   . HOH F 6 .   ? 45.996 8.881   44.563 1.00 37.54 ? 787 HOH A O   1 
HETATM 1740 O  O   . HOH F 6 .   ? 41.501 9.582   43.293 1.00 33.52 ? 788 HOH A O   1 
HETATM 1741 O  O   . HOH F 6 .   ? 39.220 7.076   37.281 1.00 46.79 ? 789 HOH A O   1 
HETATM 1742 O  O   . HOH F 6 .   ? 37.575 8.670   35.632 1.00 24.72 ? 790 HOH A O   1 
HETATM 1743 O  O   . HOH F 6 .   ? 36.068 11.106  36.723 1.00 47.78 ? 791 HOH A O   1 
HETATM 1744 O  O   . HOH F 6 .   ? 37.051 14.219  37.553 1.00 25.82 ? 792 HOH A O   1 
HETATM 1745 O  O   . HOH F 6 .   ? 37.958 16.305  35.918 1.00 17.37 ? 793 HOH A O   1 
HETATM 1746 O  O   . HOH F 6 .   ? 35.895 14.828  40.203 1.00 54.68 ? 794 HOH A O   1 
HETATM 1747 O  O   . HOH F 6 .   ? 64.043 21.435  34.323 1.00 55.85 ? 795 HOH A O   1 
HETATM 1748 O  O   . HOH F 6 .   ? 65.674 24.156  32.711 1.00 55.98 ? 796 HOH A O   1 
HETATM 1749 O  O   . HOH F 6 .   ? 36.542 5.679   35.341 1.00 32.99 ? 797 HOH A O   1 
HETATM 1750 O  O   . HOH F 6 .   ? 30.103 7.468   33.873 1.00 49.74 ? 798 HOH A O   1 
HETATM 1751 O  O   . HOH F 6 .   ? 29.907 12.098  32.427 1.00 40.64 ? 799 HOH A O   1 
HETATM 1752 O  O   . HOH F 6 .   ? 28.510 9.393   27.078 1.00 52.95 ? 800 HOH A O   1 
HETATM 1753 O  O   . HOH F 6 .   ? 27.900 6.263   26.084 1.00 40.19 ? 801 HOH A O   1 
HETATM 1754 O  O   . HOH F 6 .   ? 25.597 3.912   31.088 1.00 44.75 ? 802 HOH A O   1 
HETATM 1755 O  O   . HOH F 6 .   ? 28.953 11.923  23.785 1.00 34.83 ? 803 HOH A O   1 
HETATM 1756 O  O   . HOH F 6 .   ? 31.782 13.632  22.363 1.00 37.41 ? 804 HOH A O   1 
HETATM 1757 O  O   . HOH F 6 .   ? 33.468 15.022  20.213 1.00 58.32 ? 805 HOH A O   1 
HETATM 1758 O  O   . HOH F 6 .   ? 33.648 16.876  22.600 1.00 30.35 ? 806 HOH A O   1 
HETATM 1759 O  O   . HOH F 6 .   ? 36.081 18.518  19.204 1.00 23.74 ? 807 HOH A O   1 
HETATM 1760 O  O   . HOH F 6 .   ? 37.636 18.499  16.572 1.00 39.31 ? 808 HOH A O   1 
HETATM 1761 O  O   . HOH F 6 .   ? 33.276 16.537  17.201 1.00 52.48 ? 809 HOH A O   1 
HETATM 1762 O  O   . HOH F 6 .   ? 35.483 10.803  13.045 1.00 40.65 ? 810 HOH A O   1 
HETATM 1763 O  O   . HOH F 6 .   ? 39.135 13.840  8.996  1.00 38.25 ? 811 HOH A O   1 
HETATM 1764 O  O   . HOH F 6 .   ? 41.830 8.921   13.073 1.00 25.37 ? 812 HOH A O   1 
HETATM 1765 O  O   . HOH F 6 .   ? 42.104 10.338  15.511 1.00 12.38 ? 813 HOH A O   1 
HETATM 1766 O  O   . HOH F 6 .   ? 41.024 6.245   12.693 1.00 58.16 ? 814 HOH A O   1 
HETATM 1767 O  O   . HOH F 6 .   ? 39.712 4.580   5.725  1.00 49.79 ? 815 HOH A O   1 
HETATM 1768 O  O   . HOH F 6 .   ? 45.995 8.509   7.283  1.00 39.50 ? 816 HOH A O   1 
HETATM 1769 O  O   . HOH F 6 .   ? 48.212 11.231  11.098 1.00 29.69 ? 817 HOH A O   1 
HETATM 1770 O  O   . HOH F 6 .   ? 46.537 15.471  10.323 1.00 40.60 ? 818 HOH A O   1 
HETATM 1771 O  O   . HOH F 6 .   ? 45.625 20.643  15.114 1.00 47.67 ? 819 HOH A O   1 
HETATM 1772 O  O   . HOH F 6 .   ? 49.163 20.606  17.768 1.00 25.32 ? 820 HOH A O   1 
HETATM 1773 O  O   . HOH F 6 .   ? 50.112 19.753  20.147 1.00 33.75 ? 821 HOH A O   1 
HETATM 1774 O  O   . HOH F 6 .   ? 51.035 21.393  15.965 1.00 54.79 ? 822 HOH A O   1 
HETATM 1775 O  O   . HOH F 6 .   ? 43.978 26.639  22.592 1.00 25.04 ? 823 HOH A O   1 
HETATM 1776 O  O   . HOH F 6 .   ? 45.884 28.217  24.390 1.00 39.56 ? 824 HOH A O   1 
HETATM 1777 O  O   . HOH F 6 .   ? 46.730 27.070  29.443 1.00 37.32 ? 825 HOH A O   1 
HETATM 1778 O  O   . HOH F 6 .   ? 39.681 28.095  34.568 1.00 50.14 ? 826 HOH A O   1 
HETATM 1779 O  O   . HOH F 6 .   ? 35.746 25.720  28.476 1.00 17.08 ? 827 HOH A O   1 
HETATM 1780 O  O   . HOH F 6 .   ? 35.904 23.560  26.672 1.00 22.97 ? 828 HOH A O   1 
HETATM 1781 O  O   . HOH F 6 .   ? 34.363 23.372  24.456 1.00 37.15 ? 829 HOH A O   1 
HETATM 1782 O  O   . HOH F 6 .   ? 32.449 19.652  26.812 1.00 41.29 ? 830 HOH A O   1 
HETATM 1783 O  O   . HOH F 6 .   ? 29.796 17.208  25.899 1.00 38.97 ? 831 HOH A O   1 
HETATM 1784 O  O   . HOH F 6 .   ? 36.136 7.273   23.244 1.00 13.73 ? 832 HOH A O   1 
HETATM 1785 O  O   . HOH F 6 .   ? 37.278 4.794   24.181 1.00 22.78 ? 833 HOH A O   1 
HETATM 1786 O  O   . HOH F 6 .   ? 43.873 -0.013  23.763 1.00 16.99 ? 834 HOH A O   1 
HETATM 1787 O  O   . HOH F 6 .   ? 46.480 -2.779  19.628 1.00 15.86 ? 835 HOH A O   1 
HETATM 1788 O  O   . HOH F 6 .   ? 46.173 -6.098  18.443 1.00 15.15 ? 836 HOH A O   1 
HETATM 1789 O  O   . HOH F 6 .   ? 45.027 -8.098  20.037 1.00 22.78 ? 837 HOH A O   1 
HETATM 1790 O  O   . HOH F 6 .   ? 43.238 -8.775  23.184 1.00 19.68 ? 838 HOH A O   1 
HETATM 1791 O  O   . HOH F 6 .   ? 44.841 -11.422 27.841 1.00 32.33 ? 839 HOH A O   1 
HETATM 1792 O  O   . HOH F 6 .   ? 38.549 -12.075 25.894 1.00 62.93 ? 840 HOH A O   1 
HETATM 1793 O  O   . HOH F 6 .   ? 34.693 -9.107  24.096 1.00 39.09 ? 841 HOH A O   1 
HETATM 1794 O  O   . HOH F 6 .   ? 40.088 -6.873  29.625 1.00 40.22 ? 842 HOH A O   1 
HETATM 1795 O  O   . HOH F 6 .   ? 40.233 -14.851 21.167 1.00 41.71 ? 843 HOH A O   1 
HETATM 1796 O  O   . HOH F 6 .   ? 45.627 -8.704  11.461 1.00 30.36 ? 844 HOH A O   1 
HETATM 1797 O  O   . HOH F 6 .   ? 56.342 -3.448  16.155 1.00 22.34 ? 845 HOH A O   1 
HETATM 1798 O  O   . HOH F 6 .   ? 57.190 -5.883  17.512 1.00 29.67 ? 846 HOH A O   1 
HETATM 1799 O  O   . HOH F 6 .   ? 58.479 -8.794  22.589 1.00 44.44 ? 847 HOH A O   1 
HETATM 1800 O  O   . HOH F 6 .   ? 59.280 -7.304  25.181 1.00 48.86 ? 848 HOH A O   1 
HETATM 1801 O  O   . HOH F 6 .   ? 56.774 -5.817  24.334 1.00 23.39 ? 849 HOH A O   1 
HETATM 1802 O  O   . HOH F 6 .   ? 55.840 -9.294  24.961 1.00 29.91 ? 850 HOH A O   1 
HETATM 1803 O  O   . HOH F 6 .   ? 53.409 -12.328 21.650 1.00 36.36 ? 851 HOH A O   1 
HETATM 1804 O  O   . HOH F 6 .   ? 52.037 -13.757 26.501 1.00 50.00 ? 852 HOH A O   1 
HETATM 1805 O  O   . HOH F 6 .   ? 55.207 -2.151  27.941 1.00 13.22 ? 853 HOH A O   1 
HETATM 1806 O  O   . HOH F 6 .   ? 63.511 -5.348  22.110 1.00 31.49 ? 854 HOH A O   1 
HETATM 1807 O  O   . HOH F 6 .   ? 60.706 2.987   17.009 1.00 42.78 ? 855 HOH A O   1 
HETATM 1808 O  O   . HOH F 6 .   ? 62.035 4.247   18.862 1.00 63.51 ? 856 HOH A O   1 
HETATM 1809 O  O   . HOH F 6 .   ? 59.590 4.585   15.030 1.00 47.59 ? 857 HOH A O   1 
HETATM 1810 O  O   . HOH F 6 .   ? 55.133 9.177   13.512 1.00 40.71 ? 858 HOH A O   1 
HETATM 1811 O  O   . HOH F 6 .   ? 53.521 6.617   11.450 1.00 38.90 ? 859 HOH A O   1 
HETATM 1812 O  O   . HOH F 6 .   ? 51.179 4.417   7.268  1.00 45.55 ? 860 HOH A O   1 
HETATM 1813 O  O   . HOH F 6 .   ? 68.696 6.469   22.648 1.00 40.40 ? 861 HOH A O   1 
HETATM 1814 O  O   . HOH F 6 .   ? 67.645 2.883   29.972 1.00 26.37 ? 862 HOH A O   1 
HETATM 1815 O  O   . HOH F 6 .   ? 67.852 0.663   32.135 1.00 34.58 ? 863 HOH A O   1 
HETATM 1816 O  O   . HOH F 6 .   ? 65.548 -1.159  37.224 1.00 39.30 ? 864 HOH A O   1 
HETATM 1817 O  O   . HOH F 6 .   ? 45.685 3.203   39.455 1.00 55.38 ? 865 HOH A O   1 
HETATM 1818 O  O   . HOH F 6 .   ? 43.502 5.480   37.819 1.00 40.46 ? 866 HOH A O   1 
HETATM 1819 O  O   . HOH F 6 .   ? 43.415 3.144   35.874 1.00 46.12 ? 867 HOH A O   1 
HETATM 1820 O  O   . HOH F 6 .   ? 44.294 14.875  39.523 1.00 33.43 ? 868 HOH A O   1 
HETATM 1821 O  O   . HOH F 6 .   ? 46.512 15.209  40.812 1.00 46.57 ? 869 HOH A O   1 
HETATM 1822 O  O   . HOH F 6 .   ? 37.945 28.604  24.328 1.00 45.02 ? 870 HOH A O   1 
HETATM 1823 O  O   . HOH F 6 .   ? 39.161 29.276  21.637 1.00 40.89 ? 871 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   11  ?   ?   ?   A . n 
A 1 2   ASP 2   12  ?   ?   ?   A . n 
A 1 3   ASP 3   13  ?   ?   ?   A . n 
A 1 4   ASP 4   14  ?   ?   ?   A . n 
A 1 5   LYS 5   15  ?   ?   ?   A . n 
A 1 6   ILE 6   16  16  ILE ILE A . n 
A 1 7   VAL 7   17  17  VAL VAL A . n 
A 1 8   GLY 8   18  18  GLY GLY A . n 
A 1 9   GLY 9   19  19  GLY GLY A . n 
A 1 10  TYR 10  20  20  TYR TYR A . n 
A 1 11  THR 11  21  21  THR THR A . n 
A 1 12  CYS 12  22  22  CYS CYS A . n 
A 1 13  GLY 13  23  23  GLY GLY A . n 
A 1 14  ALA 14  24  24  ALA ALA A . n 
A 1 15  ASN 15  25  25  ASN ASN A . n 
A 1 16  THR 16  26  26  THR THR A . n 
A 1 17  VAL 17  27  27  VAL VAL A . n 
A 1 18  PRO 18  28  28  PRO PRO A . n 
A 1 19  TYR 19  29  29  TYR TYR A . n 
A 1 20  GLN 20  30  30  GLN GLN A . n 
A 1 21  VAL 21  31  31  VAL VAL A . n 
A 1 22  SER 22  32  32  SER SER A . n 
A 1 23  LEU 23  33  33  LEU LEU A . n 
A 1 24  ASN 24  34  34  ASN ASN A . n 
A 1 25  SER 25  37  37  SER SER A . n 
A 1 26  GLY 26  38  38  GLY GLY A . n 
A 1 27  TYR 27  39  39  TYR TYR A . n 
A 1 28  HIS 28  40  40  HIS HIS A . n 
A 1 29  PHE 29  41  41  PHE PHE A . n 
A 1 30  CYS 30  42  42  CYS CYS A . n 
A 1 31  GLY 31  43  43  GLY GLY A . n 
A 1 32  GLY 32  44  44  GLY GLY A . n 
A 1 33  SER 33  45  45  SER SER A . n 
A 1 34  LEU 34  46  46  LEU LEU A . n 
A 1 35  ILE 35  47  47  ILE ILE A . n 
A 1 36  ASN 36  48  48  ASN ASN A . n 
A 1 37  SER 37  49  49  SER SER A . n 
A 1 38  GLN 38  50  50  GLN GLN A . n 
A 1 39  TRP 39  51  51  TRP TRP A . n 
A 1 40  VAL 40  52  52  VAL VAL A . n 
A 1 41  VAL 41  53  53  VAL VAL A . n 
A 1 42  SER 42  54  54  SER SER A . n 
A 1 43  ALA 43  55  55  ALA ALA A . n 
A 1 44  ALA 44  56  56  ALA ALA A . n 
A 1 45  HIS 45  57  57  HIS HIS A . n 
A 1 46  CYS 46  58  58  CYS CYS A . n 
A 1 47  TYR 47  59  59  TYR TYR A . n 
A 1 48  LYS 48  60  60  LYS LYS A . n 
A 1 49  SER 49  61  61  SER SER A . n 
A 1 50  GLY 50  62  62  GLY GLY A . n 
A 1 51  ILE 51  63  63  ILE ILE A . n 
A 1 52  GLN 52  64  64  GLN GLN A . n 
A 1 53  VAL 53  65  65  VAL VAL A . n 
A 1 54  ARG 54  65  65  ARG ARG A A n 
A 1 55  LEU 55  66  66  LEU LEU A . n 
A 1 56  GLY 56  69  69  GLY GLY A . n 
A 1 57  GLU 57  70  70  GLU GLU A . n 
A 1 58  ASP 58  71  71  ASP ASP A . n 
A 1 59  ASN 59  72  72  ASN ASN A . n 
A 1 60  ILE 60  73  73  ILE ILE A . n 
A 1 61  ASN 61  74  74  ASN ASN A . n 
A 1 62  VAL 62  75  75  VAL VAL A . n 
A 1 63  VAL 63  76  76  VAL VAL A . n 
A 1 64  GLU 64  77  77  GLU GLU A . n 
A 1 65  GLY 65  78  78  GLY GLY A . n 
A 1 66  ASN 66  79  79  ASN ASN A . n 
A 1 67  GLU 67  80  80  GLU GLU A . n 
A 1 68  GLN 68  81  81  GLN GLN A . n 
A 1 69  PHE 69  82  82  PHE PHE A . n 
A 1 70  ILE 70  83  83  ILE ILE A . n 
A 1 71  SER 71  84  84  SER SER A . n 
A 1 72  ALA 72  85  85  ALA ALA A . n 
A 1 73  SER 73  86  86  SER SER A . n 
A 1 74  LYS 74  87  87  LYS LYS A . n 
A 1 75  SER 75  88  88  SER SER A . n 
A 1 76  ILE 76  89  89  ILE ILE A . n 
A 1 77  VAL 77  90  90  VAL VAL A . n 
A 1 78  HIS 78  91  91  HIS HIS A . n 
A 1 79  PRO 79  92  92  PRO PRO A . n 
A 1 80  SER 80  93  93  SER SER A . n 
A 1 81  TYR 81  94  94  TYR TYR A . n 
A 1 82  ASN 82  95  95  ASN ASN A . n 
A 1 83  SER 83  96  96  SER SER A . n 
A 1 84  ASN 84  97  97  ASN ASN A . n 
A 1 85  THR 85  98  98  THR THR A . n 
A 1 86  LEU 86  99  99  LEU LEU A . n 
A 1 87  ASN 87  100 100 ASN ASN A . n 
A 1 88  ASN 88  101 101 ASN ASN A . n 
A 1 89  ASP 89  102 102 ASP ASP A . n 
A 1 90  ILE 90  103 103 ILE ILE A . n 
A 1 91  MET 91  104 104 MET MET A . n 
A 1 92  LEU 92  105 105 LEU LEU A . n 
A 1 93  ILE 93  106 106 ILE ILE A . n 
A 1 94  LYS 94  107 107 LYS LYS A . n 
A 1 95  LEU 95  108 108 LEU LEU A . n 
A 1 96  LYS 96  109 109 LYS LYS A . n 
A 1 97  SER 97  110 110 SER SER A . n 
A 1 98  ALA 98  111 111 ALA ALA A . n 
A 1 99  ALA 99  112 112 ALA ALA A . n 
A 1 100 SER 100 113 113 SER SER A . n 
A 1 101 LEU 101 114 114 LEU LEU A . n 
A 1 102 ASN 102 115 115 ASN ASN A . n 
A 1 103 SER 103 116 116 SER SER A . n 
A 1 104 ARG 104 117 117 ARG ARG A . n 
A 1 105 VAL 105 118 118 VAL VAL A . n 
A 1 106 ALA 106 119 119 ALA ALA A . n 
A 1 107 SER 107 120 120 SER SER A . n 
A 1 108 ILE 108 121 121 ILE ILE A . n 
A 1 109 SER 109 122 122 SER SER A . n 
A 1 110 LEU 110 123 123 LEU LEU A . n 
A 1 111 PRO 111 124 124 PRO PRO A . n 
A 1 112 THR 112 125 125 THR THR A . n 
A 1 113 SER 113 127 127 SER SER A . n 
A 1 114 CYS 114 128 128 CYS CYS A . n 
A 1 115 ALA 115 129 129 ALA ALA A . n 
A 1 116 SER 116 130 130 SER SER A . n 
A 1 117 ALA 117 132 132 ALA ALA A . n 
A 1 118 GLY 118 133 133 GLY GLY A . n 
A 1 119 THR 119 134 134 THR THR A . n 
A 1 120 GLN 120 135 135 GLN GLN A . n 
A 1 121 CYS 121 136 136 CYS CYS A . n 
A 1 122 LEU 122 137 137 LEU LEU A . n 
A 1 123 ILE 123 138 138 ILE ILE A . n 
A 1 124 SER 124 139 139 SER SER A . n 
A 1 125 GLY 125 140 140 GLY GLY A . n 
A 1 126 TRP 126 141 141 TRP TRP A . n 
A 1 127 GLY 127 142 142 GLY GLY A . n 
A 1 128 ASN 128 143 143 ASN ASN A . n 
A 1 129 THR 129 144 144 THR THR A . n 
A 1 130 LYS 130 145 145 LYS LYS A . n 
A 1 131 SER 131 146 146 SER SER A . n 
A 1 132 SER 132 147 147 SER SER A . n 
A 1 133 GLY 133 148 148 GLY GLY A . n 
A 1 134 THR 134 149 149 THR THR A . n 
A 1 135 SER 135 150 150 SER SER A . n 
A 1 136 TYR 136 151 151 TYR TYR A . n 
A 1 137 PRO 137 152 152 PRO PRO A . n 
A 1 138 ASP 138 153 153 ASP ASP A . n 
A 1 139 VAL 139 154 154 VAL VAL A . n 
A 1 140 LEU 140 155 155 LEU LEU A . n 
A 1 141 LYS 141 156 156 LYS LYS A . n 
A 1 142 CYS 142 157 157 CYS CYS A . n 
A 1 143 LEU 143 158 158 LEU LEU A . n 
A 1 144 LYS 144 159 159 LYS LYS A . n 
A 1 145 ALA 145 160 160 ALA ALA A . n 
A 1 146 PRO 146 161 161 PRO PRO A . n 
A 1 147 ILE 147 162 162 ILE ILE A . n 
A 1 148 LEU 148 163 163 LEU LEU A . n 
A 1 149 SER 149 164 164 SER SER A . n 
A 1 150 ASP 150 165 165 ASP ASP A . n 
A 1 151 SER 151 166 166 SER SER A . n 
A 1 152 SER 152 167 167 SER SER A . n 
A 1 153 CYS 153 168 168 CYS CYS A . n 
A 1 154 LYS 154 169 169 LYS LYS A . n 
A 1 155 SER 155 170 170 SER SER A . n 
A 1 156 ALA 156 171 171 ALA ALA A . n 
A 1 157 TYR 157 172 172 TYR TYR A . n 
A 1 158 PRO 158 173 173 PRO PRO A . n 
A 1 159 GLY 159 174 174 GLY GLY A . n 
A 1 160 GLN 160 175 175 GLN GLN A . n 
A 1 161 ILE 161 176 176 ILE ILE A . n 
A 1 162 THR 162 177 177 THR THR A . n 
A 1 163 SER 163 178 178 SER SER A . n 
A 1 164 ASN 164 179 179 ASN ASN A . n 
A 1 165 MET 165 180 180 MET MET A . n 
A 1 166 PHE 166 181 181 PHE PHE A . n 
A 1 167 CYS 167 182 182 CYS CYS A . n 
A 1 168 ALA 168 183 183 ALA ALA A . n 
A 1 169 GLY 169 184 184 GLY GLY A . n 
A 1 170 TYR 170 184 184 TYR TYR A A n 
A 1 171 LEU 171 185 185 LEU LEU A . n 
A 1 172 GLU 172 186 186 GLU GLU A . n 
A 1 173 GLY 173 187 187 GLY GLY A . n 
A 1 174 GLY 174 188 188 GLY GLY A . n 
A 1 175 LYS 175 188 188 LYS LYS A A n 
A 1 176 ASP 176 189 189 ASP ASP A . n 
A 1 177 SER 177 190 190 SER SER A . n 
A 1 178 CYS 178 191 191 CYS CYS A . n 
A 1 179 GLN 179 192 192 GLN GLN A . n 
A 1 180 GLY 180 193 193 GLY GLY A . n 
A 1 181 ASP 181 194 194 ASP ASP A . n 
A 1 182 SER 182 195 195 SER SER A . n 
A 1 183 GLY 183 196 196 GLY GLY A . n 
A 1 184 GLY 184 197 197 GLY GLY A . n 
A 1 185 PRO 185 198 198 PRO PRO A . n 
A 1 186 VAL 186 199 199 VAL VAL A . n 
A 1 187 VAL 187 200 200 VAL VAL A . n 
A 1 188 CYS 188 201 201 CYS CYS A . n 
A 1 189 SER 189 202 202 SER SER A . n 
A 1 190 GLY 190 203 203 GLY GLY A . n 
A 1 191 LYS 191 204 204 LYS LYS A . n 
A 1 192 LEU 192 209 209 LEU LEU A . n 
A 1 193 GLN 193 210 210 GLN GLN A . n 
A 1 194 GLY 194 211 211 GLY GLY A . n 
A 1 195 ILE 195 212 212 ILE ILE A . n 
A 1 196 VAL 196 213 213 VAL VAL A . n 
A 1 197 SER 197 214 214 SER SER A . n 
A 1 198 TRP 198 215 215 TRP TRP A . n 
A 1 199 GLY 199 216 216 GLY GLY A . n 
A 1 200 SER 200 217 217 SER SER A . n 
A 1 201 GLY 201 219 219 GLY GLY A . n 
A 1 202 CYS 202 220 220 CYS CYS A . n 
A 1 203 ALA 203 221 221 ALA ALA A . n 
A 1 204 GLN 204 221 221 GLN GLN A A n 
A 1 205 LYS 205 222 222 LYS LYS A . n 
A 1 206 ASN 206 223 223 ASN ASN A . n 
A 1 207 LYS 207 224 224 LYS LYS A . n 
A 1 208 PRO 208 225 225 PRO PRO A . n 
A 1 209 GLY 209 226 226 GLY GLY A . n 
A 1 210 VAL 210 227 227 VAL VAL A . n 
A 1 211 TYR 211 228 228 TYR TYR A . n 
A 1 212 THR 212 229 229 THR THR A . n 
A 1 213 LYS 213 230 230 LYS LYS A . n 
A 1 214 VAL 214 231 231 VAL VAL A . n 
A 1 215 CYS 215 232 232 CYS CYS A . n 
A 1 216 ASN 216 233 233 ASN ASN A . n 
A 1 217 TYR 217 234 234 TYR TYR A . n 
A 1 218 VAL 218 235 235 VAL VAL A . n 
A 1 219 SER 219 236 236 SER SER A . n 
A 1 220 TRP 220 237 237 TRP TRP A . n 
A 1 221 ILE 221 238 238 ILE ILE A . n 
A 1 222 LYS 222 239 239 LYS LYS A . n 
A 1 223 GLN 223 240 240 GLN GLN A . n 
A 1 224 THR 224 241 241 THR THR A . n 
A 1 225 ILE 225 242 242 ILE ILE A . n 
A 1 226 ALA 226 243 243 ALA ALA A . n 
A 1 227 SER 227 244 244 SER SER A . n 
A 1 228 ASN 228 245 245 ASN ASN A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   501 501 MG  MG  A . 
C 3 CA  1   502 502 CA  CA  A . 
D 4 SO4 1   701 701 SO4 SO4 A . 
E 5 108 1   601 601 108 108 A . 
F 6 HOH 1   702 1   HOH HOH A . 
F 6 HOH 2   703 2   HOH HOH A . 
F 6 HOH 3   704 3   HOH HOH A . 
F 6 HOH 4   705 4   HOH HOH A . 
F 6 HOH 5   706 5   HOH HOH A . 
F 6 HOH 6   707 6   HOH HOH A . 
F 6 HOH 7   708 7   HOH HOH A . 
F 6 HOH 8   709 8   HOH HOH A . 
F 6 HOH 9   710 9   HOH HOH A . 
F 6 HOH 10  711 10  HOH HOH A . 
F 6 HOH 11  712 11  HOH HOH A . 
F 6 HOH 12  713 12  HOH HOH A . 
F 6 HOH 13  714 13  HOH HOH A . 
F 6 HOH 14  715 14  HOH HOH A . 
F 6 HOH 15  716 15  HOH HOH A . 
F 6 HOH 16  717 16  HOH HOH A . 
F 6 HOH 17  718 17  HOH HOH A . 
F 6 HOH 18  719 18  HOH HOH A . 
F 6 HOH 19  720 19  HOH HOH A . 
F 6 HOH 20  721 20  HOH HOH A . 
F 6 HOH 21  722 21  HOH HOH A . 
F 6 HOH 22  723 22  HOH HOH A . 
F 6 HOH 23  724 23  HOH HOH A . 
F 6 HOH 24  725 24  HOH HOH A . 
F 6 HOH 25  726 25  HOH HOH A . 
F 6 HOH 26  727 26  HOH HOH A . 
F 6 HOH 27  728 27  HOH HOH A . 
F 6 HOH 28  729 28  HOH HOH A . 
F 6 HOH 29  730 29  HOH HOH A . 
F 6 HOH 30  731 30  HOH HOH A . 
F 6 HOH 31  732 31  HOH HOH A . 
F 6 HOH 32  733 32  HOH HOH A . 
F 6 HOH 33  734 33  HOH HOH A . 
F 6 HOH 34  735 34  HOH HOH A . 
F 6 HOH 35  736 35  HOH HOH A . 
F 6 HOH 36  737 36  HOH HOH A . 
F 6 HOH 37  738 37  HOH HOH A . 
F 6 HOH 38  739 38  HOH HOH A . 
F 6 HOH 39  740 39  HOH HOH A . 
F 6 HOH 40  741 40  HOH HOH A . 
F 6 HOH 41  742 41  HOH HOH A . 
F 6 HOH 42  743 42  HOH HOH A . 
F 6 HOH 43  744 43  HOH HOH A . 
F 6 HOH 44  745 44  HOH HOH A . 
F 6 HOH 45  746 45  HOH HOH A . 
F 6 HOH 46  747 46  HOH HOH A . 
F 6 HOH 47  748 47  HOH HOH A . 
F 6 HOH 48  749 48  HOH HOH A . 
F 6 HOH 49  750 49  HOH HOH A . 
F 6 HOH 50  751 50  HOH HOH A . 
F 6 HOH 51  752 51  HOH HOH A . 
F 6 HOH 52  753 52  HOH HOH A . 
F 6 HOH 53  754 53  HOH HOH A . 
F 6 HOH 54  755 54  HOH HOH A . 
F 6 HOH 55  756 55  HOH HOH A . 
F 6 HOH 56  757 56  HOH HOH A . 
F 6 HOH 57  758 57  HOH HOH A . 
F 6 HOH 58  759 58  HOH HOH A . 
F 6 HOH 59  760 59  HOH HOH A . 
F 6 HOH 60  761 60  HOH HOH A . 
F 6 HOH 61  762 61  HOH HOH A . 
F 6 HOH 62  763 62  HOH HOH A . 
F 6 HOH 63  764 63  HOH HOH A . 
F 6 HOH 64  765 64  HOH HOH A . 
F 6 HOH 65  766 65  HOH HOH A . 
F 6 HOH 66  767 66  HOH HOH A . 
F 6 HOH 67  768 67  HOH HOH A . 
F 6 HOH 68  769 68  HOH HOH A . 
F 6 HOH 69  770 69  HOH HOH A . 
F 6 HOH 70  771 70  HOH HOH A . 
F 6 HOH 71  772 71  HOH HOH A . 
F 6 HOH 72  773 72  HOH HOH A . 
F 6 HOH 73  774 73  HOH HOH A . 
F 6 HOH 74  775 74  HOH HOH A . 
F 6 HOH 75  776 75  HOH HOH A . 
F 6 HOH 76  777 76  HOH HOH A . 
F 6 HOH 77  778 77  HOH HOH A . 
F 6 HOH 78  779 78  HOH HOH A . 
F 6 HOH 79  780 79  HOH HOH A . 
F 6 HOH 80  781 80  HOH HOH A . 
F 6 HOH 81  782 81  HOH HOH A . 
F 6 HOH 82  783 82  HOH HOH A . 
F 6 HOH 83  784 83  HOH HOH A . 
F 6 HOH 84  785 84  HOH HOH A . 
F 6 HOH 85  786 85  HOH HOH A . 
F 6 HOH 86  787 86  HOH HOH A . 
F 6 HOH 87  788 87  HOH HOH A . 
F 6 HOH 88  789 88  HOH HOH A . 
F 6 HOH 89  790 89  HOH HOH A . 
F 6 HOH 90  791 90  HOH HOH A . 
F 6 HOH 91  792 91  HOH HOH A . 
F 6 HOH 92  793 92  HOH HOH A . 
F 6 HOH 93  794 93  HOH HOH A . 
F 6 HOH 94  795 94  HOH HOH A . 
F 6 HOH 95  796 95  HOH HOH A . 
F 6 HOH 96  797 96  HOH HOH A . 
F 6 HOH 97  798 97  HOH HOH A . 
F 6 HOH 98  799 98  HOH HOH A . 
F 6 HOH 99  800 99  HOH HOH A . 
F 6 HOH 100 801 100 HOH HOH A . 
F 6 HOH 101 802 101 HOH HOH A . 
F 6 HOH 102 803 102 HOH HOH A . 
F 6 HOH 103 804 103 HOH HOH A . 
F 6 HOH 104 805 104 HOH HOH A . 
F 6 HOH 105 806 105 HOH HOH A . 
F 6 HOH 106 807 106 HOH HOH A . 
F 6 HOH 107 808 107 HOH HOH A . 
F 6 HOH 108 809 108 HOH HOH A . 
F 6 HOH 109 810 109 HOH HOH A . 
F 6 HOH 110 811 110 HOH HOH A . 
F 6 HOH 111 812 111 HOH HOH A . 
F 6 HOH 112 813 112 HOH HOH A . 
F 6 HOH 113 814 113 HOH HOH A . 
F 6 HOH 114 815 114 HOH HOH A . 
F 6 HOH 115 816 115 HOH HOH A . 
F 6 HOH 116 817 116 HOH HOH A . 
F 6 HOH 117 818 117 HOH HOH A . 
F 6 HOH 118 819 118 HOH HOH A . 
F 6 HOH 119 820 119 HOH HOH A . 
F 6 HOH 120 821 120 HOH HOH A . 
F 6 HOH 121 822 121 HOH HOH A . 
F 6 HOH 122 823 122 HOH HOH A . 
F 6 HOH 123 824 123 HOH HOH A . 
F 6 HOH 124 825 124 HOH HOH A . 
F 6 HOH 125 826 125 HOH HOH A . 
F 6 HOH 126 827 126 HOH HOH A . 
F 6 HOH 127 828 127 HOH HOH A . 
F 6 HOH 128 829 128 HOH HOH A . 
F 6 HOH 129 830 129 HOH HOH A . 
F 6 HOH 130 831 130 HOH HOH A . 
F 6 HOH 131 832 131 HOH HOH A . 
F 6 HOH 132 833 132 HOH HOH A . 
F 6 HOH 133 834 133 HOH HOH A . 
F 6 HOH 134 835 134 HOH HOH A . 
F 6 HOH 135 836 135 HOH HOH A . 
F 6 HOH 136 837 136 HOH HOH A . 
F 6 HOH 137 838 137 HOH HOH A . 
F 6 HOH 138 839 138 HOH HOH A . 
F 6 HOH 139 840 139 HOH HOH A . 
F 6 HOH 140 841 140 HOH HOH A . 
F 6 HOH 141 842 141 HOH HOH A . 
F 6 HOH 142 843 142 HOH HOH A . 
F 6 HOH 143 844 143 HOH HOH A . 
F 6 HOH 144 845 144 HOH HOH A . 
F 6 HOH 145 846 145 HOH HOH A . 
F 6 HOH 146 847 146 HOH HOH A . 
F 6 HOH 147 848 147 HOH HOH A . 
F 6 HOH 148 849 148 HOH HOH A . 
F 6 HOH 149 850 149 HOH HOH A . 
F 6 HOH 150 851 150 HOH HOH A . 
F 6 HOH 151 852 151 HOH HOH A . 
F 6 HOH 152 853 152 HOH HOH A . 
F 6 HOH 153 854 153 HOH HOH A . 
F 6 HOH 154 855 154 HOH HOH A . 
F 6 HOH 155 856 155 HOH HOH A . 
F 6 HOH 156 857 156 HOH HOH A . 
F 6 HOH 157 858 157 HOH HOH A . 
F 6 HOH 158 859 158 HOH HOH A . 
F 6 HOH 159 860 159 HOH HOH A . 
F 6 HOH 160 861 160 HOH HOH A . 
F 6 HOH 161 862 161 HOH HOH A . 
F 6 HOH 162 863 162 HOH HOH A . 
F 6 HOH 163 864 163 HOH HOH A . 
F 6 HOH 164 865 164 HOH HOH A . 
F 6 HOH 165 866 165 HOH HOH A . 
F 6 HOH 166 867 166 HOH HOH A . 
F 6 HOH 167 868 167 HOH HOH A . 
F 6 HOH 168 869 168 HOH HOH A . 
F 6 HOH 169 870 169 HOH HOH A . 
F 6 HOH 170 871 170 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  N   ? E 108 .   ? A 108 601 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 OXT ? E 108 .   ? A 108 601 ? 1_555 75.6  ? 
2  N   ? E 108 .   ? A 108 601 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O   ? F HOH .   ? A HOH 724 ? 1_555 85.7  ? 
3  OXT ? E 108 .   ? A 108 601 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O   ? F HOH .   ? A HOH 724 ? 1_555 89.0  ? 
4  N   ? E 108 .   ? A 108 601 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O   ? F HOH .   ? A HOH 725 ? 1_555 175.0 ? 
5  OXT ? E 108 .   ? A 108 601 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O   ? F HOH .   ? A HOH 725 ? 1_555 101.3 ? 
6  O   ? F HOH .   ? A HOH 724 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O   ? F HOH .   ? A HOH 725 ? 1_555 90.4  ? 
7  N   ? E 108 .   ? A 108 601 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 OE1 ? A GLN 179 ? A GLN 192 ? 1_555 115.9 ? 
8  OXT ? E 108 .   ? A 108 601 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 OE1 ? A GLN 179 ? A GLN 192 ? 1_555 106.9 ? 
9  O   ? F HOH .   ? A HOH 724 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 OE1 ? A GLN 179 ? A GLN 192 ? 1_555 155.4 ? 
10 O   ? F HOH .   ? A HOH 725 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 OE1 ? A GLN 179 ? A GLN 192 ? 1_555 68.5  ? 
11 N   ? E 108 .   ? A 108 601 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O1  ? E 108 .   ? A 108 601 ? 1_555 84.1  ? 
12 OXT ? E 108 .   ? A 108 601 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O1  ? E 108 .   ? A 108 601 ? 1_555 158.8 ? 
13 O   ? F HOH .   ? A HOH 724 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O1  ? E 108 .   ? A 108 601 ? 1_555 83.7  ? 
14 O   ? F HOH .   ? A HOH 725 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O1  ? E 108 .   ? A 108 601 ? 1_555 98.6  ? 
15 OE1 ? A GLN 179 ? A GLN 192 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O1  ? E 108 .   ? A 108 601 ? 1_555 87.0  ? 
16 O   ? F HOH .   ? A HOH 739 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O   ? A VAL 62  ? A VAL 75  ? 1_555 105.0 ? 
17 O   ? F HOH .   ? A HOH 739 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O   ? F HOH .   ? A HOH 737 ? 1_555 169.0 ? 
18 O   ? A VAL 62  ? A VAL 75  ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O   ? F HOH .   ? A HOH 737 ? 1_555 85.0  ? 
19 O   ? F HOH .   ? A HOH 739 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OE2 ? A GLU 67  ? A GLU 80  ? 1_555 81.6  ? 
20 O   ? A VAL 62  ? A VAL 75  ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OE2 ? A GLU 67  ? A GLU 80  ? 1_555 87.5  ? 
21 O   ? F HOH .   ? A HOH 737 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OE2 ? A GLU 67  ? A GLU 80  ? 1_555 94.6  ? 
22 O   ? F HOH .   ? A HOH 739 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O   ? A ASN 59  ? A ASN 72  ? 1_555 85.2  ? 
23 O   ? A VAL 62  ? A VAL 75  ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O   ? A ASN 59  ? A ASN 72  ? 1_555 81.6  ? 
24 O   ? F HOH .   ? A HOH 737 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O   ? A ASN 59  ? A ASN 72  ? 1_555 101.0 ? 
25 OE2 ? A GLU 67  ? A GLU 80  ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O   ? A ASN 59  ? A ASN 72  ? 1_555 160.0 ? 
26 O   ? F HOH .   ? A HOH 739 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OE1 ? A GLU 57  ? A GLU 70  ? 1_555 88.1  ? 
27 O   ? A VAL 62  ? A VAL 75  ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OE1 ? A GLU 57  ? A GLU 70  ? 1_555 165.5 ? 
28 O   ? F HOH .   ? A HOH 737 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OE1 ? A GLU 57  ? A GLU 70  ? 1_555 82.5  ? 
29 OE2 ? A GLU 67  ? A GLU 80  ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OE1 ? A GLU 57  ? A GLU 70  ? 1_555 100.9 ? 
30 O   ? A ASN 59  ? A ASN 72  ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OE1 ? A GLU 57  ? A GLU 70  ? 1_555 93.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-01-17 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-04-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_source 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_source.type' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 71  ? ? -134.71 -78.64 
2 1 ASN A 79  ? ? 85.25   -9.30  
3 1 SER A 214 ? ? -113.85 -70.06 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 11 ? A ASP 1 
2 1 Y 1 A ASP 12 ? A ASP 2 
3 1 Y 1 A ASP 13 ? A ASP 3 
4 1 Y 1 A ASP 14 ? A ASP 4 
5 1 Y 1 A LYS 15 ? A LYS 5 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                                            MG  
3 'CALCIUM ION'                                              CA  
4 'SULFATE ION'                                              SO4 
5 '2-(5-CARBAMIMIDOYL-2-HYDROXY-BENZYLAMINO)-PROPIONIC ACID' 108 
6 water                                                      HOH 
#