data_1G3I
# 
_entry.id   1G3I 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1G3I         
RCSB  RCSB012187   
WWPDB D_1000012187 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1G3K 
_pdbx_database_related.details        HSLV 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1G3I 
_pdbx_database_status.recvd_initial_deposition_date   2000-10-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sousa, M.C.'    1 
'Trame, C.B.'    2 
'Tsuruta, H.'    3 
'Wilbanks, S.M.' 4 
'Reddy, V.S.'    5 
'McKay, D.B.'    6 
# 
_citation.id                        primary 
_citation.title                     'Crystal and solution structures of an HslUV protease-chaperone complex.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            103 
_citation.page_first                633 
_citation.page_last                 643 
_citation.year                      2000 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11106733 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(00)00166-5' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sousa, M.C.'    1 
primary 'Trame, C.B.'    2 
primary 'Tsuruta, H.'    3 
primary 'Wilbanks, S.M.' 4 
primary 'Reddy, V.S.'    5 
primary 'McKay, D.B.'    6 
# 
_cell.entry_id           1G3I 
_cell.length_a           209.223 
_cell.length_b           220.579 
_cell.length_c           241.070 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              48 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1G3I 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT HSLU' 49441.504 12 ?        ? ? ? 
2 polymer     man 'ATP-DEPENDENT PROTEASE HSLV'                          18903.549 12 3.4.99.- ? ? ? 
3 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"                            507.181   12 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 HSLU 
2 HSLV 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MSEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIK
VEATKFTEVGYVGKEVDSIIRDLTDSAMKLVRQQEIAKNRARAEDVAEERILDALLPPAKNQWGEVENHDSHSSTRQAFR
KKLREGQLDDKEIEIDVSAGVSMGVEIMAPPGMEEMTNQLQSLFQNLGSDKTKKRKMKIKDALKALIDDEAAKLINPEEL
KQKAIDAVEQNGIVFIDEIDKICKKGEYSGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLI
PELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVM
ERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
;
;MSEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIK
VEATKFTEVGYVGKEVDSIIRDLTDSAMKLVRQQEIAKNRARAEDVAEERILDALLPPAKNQWGEVENHDSHSSTRQAFR
KKLREGQLDDKEIEIDVSAGVSMGVEIMAPPGMEEMTNQLQSLFQNLGSDKTKKRKMKIKDALKALIDDEAAKLINPEEL
KQKAIDAVEQNGIVFIDEIDKICKKGEYSGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLI
PELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVM
ERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
;
A,B,C,D,E,F,S,T,U,V,W,X ? 
2 'polypeptide(L)' no no 
;TTIVSVRRNGQVVVGGDGQVSLGNTVMKGNARKVRRLYNGKVLAGFAGGTADAFTLFELFERKLEMHQGHLLKSAVELAK
DWRTDRALRKLEAMLIVADEKESLIITGIGDVVQPEEDQILAIGSGGNYALSAARALVENTELSAHEIVEKSLRIAGDIC
VFTNTNFTIEELPN
;
;TTIVSVRRNGQVVVGGDGQVSLGNTVMKGNARKVRRLYNGKVLAGFAGGTADAFTLFELFERKLEMHQGHLLKSAVELAK
DWRTDRALRKLEAMLIVADEKESLIITGIGDVVQPEEDQILAIGSGGNYALSAARALVENTELSAHEIVEKSLRIAGDIC
VFTNTNFTIEELPN
;
G,H,I,J,K,L,M,N,O,P,Q,R ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLU n 
1 4   MET n 
1 5   THR n 
1 6   PRO n 
1 7   ARG n 
1 8   GLU n 
1 9   ILE n 
1 10  VAL n 
1 11  SER n 
1 12  GLU n 
1 13  LEU n 
1 14  ASP n 
1 15  GLN n 
1 16  HIS n 
1 17  ILE n 
1 18  ILE n 
1 19  GLY n 
1 20  GLN n 
1 21  ALA n 
1 22  ASP n 
1 23  ALA n 
1 24  LYS n 
1 25  ARG n 
1 26  ALA n 
1 27  VAL n 
1 28  ALA n 
1 29  ILE n 
1 30  ALA n 
1 31  LEU n 
1 32  ARG n 
1 33  ASN n 
1 34  ARG n 
1 35  TRP n 
1 36  ARG n 
1 37  ARG n 
1 38  MET n 
1 39  GLN n 
1 40  LEU n 
1 41  GLN n 
1 42  GLU n 
1 43  PRO n 
1 44  LEU n 
1 45  ARG n 
1 46  HIS n 
1 47  GLU n 
1 48  VAL n 
1 49  THR n 
1 50  PRO n 
1 51  LYS n 
1 52  ASN n 
1 53  ILE n 
1 54  LEU n 
1 55  MET n 
1 56  ILE n 
1 57  GLY n 
1 58  PRO n 
1 59  THR n 
1 60  GLY n 
1 61  VAL n 
1 62  GLY n 
1 63  LYS n 
1 64  THR n 
1 65  GLU n 
1 66  ILE n 
1 67  ALA n 
1 68  ARG n 
1 69  ARG n 
1 70  LEU n 
1 71  ALA n 
1 72  LYS n 
1 73  LEU n 
1 74  ALA n 
1 75  ASN n 
1 76  ALA n 
1 77  PRO n 
1 78  PHE n 
1 79  ILE n 
1 80  LYS n 
1 81  VAL n 
1 82  GLU n 
1 83  ALA n 
1 84  THR n 
1 85  LYS n 
1 86  PHE n 
1 87  THR n 
1 88  GLU n 
1 89  VAL n 
1 90  GLY n 
1 91  TYR n 
1 92  VAL n 
1 93  GLY n 
1 94  LYS n 
1 95  GLU n 
1 96  VAL n 
1 97  ASP n 
1 98  SER n 
1 99  ILE n 
1 100 ILE n 
1 101 ARG n 
1 102 ASP n 
1 103 LEU n 
1 104 THR n 
1 105 ASP n 
1 106 SER n 
1 107 ALA n 
1 108 MET n 
1 109 LYS n 
1 110 LEU n 
1 111 VAL n 
1 112 ARG n 
1 113 GLN n 
1 114 GLN n 
1 115 GLU n 
1 116 ILE n 
1 117 ALA n 
1 118 LYS n 
1 119 ASN n 
1 120 ARG n 
1 121 ALA n 
1 122 ARG n 
1 123 ALA n 
1 124 GLU n 
1 125 ASP n 
1 126 VAL n 
1 127 ALA n 
1 128 GLU n 
1 129 GLU n 
1 130 ARG n 
1 131 ILE n 
1 132 LEU n 
1 133 ASP n 
1 134 ALA n 
1 135 LEU n 
1 136 LEU n 
1 137 PRO n 
1 138 PRO n 
1 139 ALA n 
1 140 LYS n 
1 141 ASN n 
1 142 GLN n 
1 143 TRP n 
1 144 GLY n 
1 145 GLU n 
1 146 VAL n 
1 147 GLU n 
1 148 ASN n 
1 149 HIS n 
1 150 ASP n 
1 151 SER n 
1 152 HIS n 
1 153 SER n 
1 154 SER n 
1 155 THR n 
1 156 ARG n 
1 157 GLN n 
1 158 ALA n 
1 159 PHE n 
1 160 ARG n 
1 161 LYS n 
1 162 LYS n 
1 163 LEU n 
1 164 ARG n 
1 165 GLU n 
1 166 GLY n 
1 167 GLN n 
1 168 LEU n 
1 169 ASP n 
1 170 ASP n 
1 171 LYS n 
1 172 GLU n 
1 173 ILE n 
1 174 GLU n 
1 175 ILE n 
1 176 ASP n 
1 177 VAL n 
1 178 SER n 
1 179 ALA n 
1 180 GLY n 
1 181 VAL n 
1 182 SER n 
1 183 MET n 
1 184 GLY n 
1 185 VAL n 
1 186 GLU n 
1 187 ILE n 
1 188 MET n 
1 189 ALA n 
1 190 PRO n 
1 191 PRO n 
1 192 GLY n 
1 193 MET n 
1 194 GLU n 
1 195 GLU n 
1 196 MET n 
1 197 THR n 
1 198 ASN n 
1 199 GLN n 
1 200 LEU n 
1 201 GLN n 
1 202 SER n 
1 203 LEU n 
1 204 PHE n 
1 205 GLN n 
1 206 ASN n 
1 207 LEU n 
1 208 GLY n 
1 209 SER n 
1 210 ASP n 
1 211 LYS n 
1 212 THR n 
1 213 LYS n 
1 214 LYS n 
1 215 ARG n 
1 216 LYS n 
1 217 MET n 
1 218 LYS n 
1 219 ILE n 
1 220 LYS n 
1 221 ASP n 
1 222 ALA n 
1 223 LEU n 
1 224 LYS n 
1 225 ALA n 
1 226 LEU n 
1 227 ILE n 
1 228 ASP n 
1 229 ASP n 
1 230 GLU n 
1 231 ALA n 
1 232 ALA n 
1 233 LYS n 
1 234 LEU n 
1 235 ILE n 
1 236 ASN n 
1 237 PRO n 
1 238 GLU n 
1 239 GLU n 
1 240 LEU n 
1 241 LYS n 
1 242 GLN n 
1 243 LYS n 
1 244 ALA n 
1 245 ILE n 
1 246 ASP n 
1 247 ALA n 
1 248 VAL n 
1 249 GLU n 
1 250 GLN n 
1 251 ASN n 
1 252 GLY n 
1 253 ILE n 
1 254 VAL n 
1 255 PHE n 
1 256 ILE n 
1 257 ASP n 
1 258 GLU n 
1 259 ILE n 
1 260 ASP n 
1 261 LYS n 
1 262 ILE n 
1 263 CYS n 
1 264 LYS n 
1 265 LYS n 
1 266 GLY n 
1 267 GLU n 
1 268 TYR n 
1 269 SER n 
1 270 GLY n 
1 271 ALA n 
1 272 ASP n 
1 273 VAL n 
1 274 SER n 
1 275 ARG n 
1 276 GLU n 
1 277 GLY n 
1 278 VAL n 
1 279 GLN n 
1 280 ARG n 
1 281 ASP n 
1 282 LEU n 
1 283 LEU n 
1 284 PRO n 
1 285 LEU n 
1 286 VAL n 
1 287 GLU n 
1 288 GLY n 
1 289 SER n 
1 290 THR n 
1 291 VAL n 
1 292 SER n 
1 293 THR n 
1 294 LYS n 
1 295 HIS n 
1 296 GLY n 
1 297 MET n 
1 298 VAL n 
1 299 LYS n 
1 300 THR n 
1 301 ASP n 
1 302 HIS n 
1 303 ILE n 
1 304 LEU n 
1 305 PHE n 
1 306 ILE n 
1 307 ALA n 
1 308 SER n 
1 309 GLY n 
1 310 ALA n 
1 311 PHE n 
1 312 GLN n 
1 313 VAL n 
1 314 ALA n 
1 315 ARG n 
1 316 PRO n 
1 317 SER n 
1 318 ASP n 
1 319 LEU n 
1 320 ILE n 
1 321 PRO n 
1 322 GLU n 
1 323 LEU n 
1 324 GLN n 
1 325 GLY n 
1 326 ARG n 
1 327 LEU n 
1 328 PRO n 
1 329 ILE n 
1 330 ARG n 
1 331 VAL n 
1 332 GLU n 
1 333 LEU n 
1 334 THR n 
1 335 ALA n 
1 336 LEU n 
1 337 SER n 
1 338 ALA n 
1 339 ALA n 
1 340 ASP n 
1 341 PHE n 
1 342 GLU n 
1 343 ARG n 
1 344 ILE n 
1 345 LEU n 
1 346 THR n 
1 347 GLU n 
1 348 PRO n 
1 349 HIS n 
1 350 ALA n 
1 351 SER n 
1 352 LEU n 
1 353 THR n 
1 354 GLU n 
1 355 GLN n 
1 356 TYR n 
1 357 LYS n 
1 358 ALA n 
1 359 LEU n 
1 360 MET n 
1 361 ALA n 
1 362 THR n 
1 363 GLU n 
1 364 GLY n 
1 365 VAL n 
1 366 ASN n 
1 367 ILE n 
1 368 ALA n 
1 369 PHE n 
1 370 THR n 
1 371 THR n 
1 372 ASP n 
1 373 ALA n 
1 374 VAL n 
1 375 LYS n 
1 376 LYS n 
1 377 ILE n 
1 378 ALA n 
1 379 GLU n 
1 380 ALA n 
1 381 ALA n 
1 382 PHE n 
1 383 ARG n 
1 384 VAL n 
1 385 ASN n 
1 386 GLU n 
1 387 LYS n 
1 388 THR n 
1 389 GLU n 
1 390 ASN n 
1 391 ILE n 
1 392 GLY n 
1 393 ALA n 
1 394 ARG n 
1 395 ARG n 
1 396 LEU n 
1 397 HIS n 
1 398 THR n 
1 399 VAL n 
1 400 MET n 
1 401 GLU n 
1 402 ARG n 
1 403 LEU n 
1 404 MET n 
1 405 ASP n 
1 406 LYS n 
1 407 ILE n 
1 408 SER n 
1 409 PHE n 
1 410 SER n 
1 411 ALA n 
1 412 SER n 
1 413 ASP n 
1 414 MET n 
1 415 ASN n 
1 416 GLY n 
1 417 GLN n 
1 418 THR n 
1 419 VAL n 
1 420 ASN n 
1 421 ILE n 
1 422 ASP n 
1 423 ALA n 
1 424 ALA n 
1 425 TYR n 
1 426 VAL n 
1 427 ALA n 
1 428 ASP n 
1 429 ALA n 
1 430 LEU n 
1 431 GLY n 
1 432 GLU n 
1 433 VAL n 
1 434 VAL n 
1 435 GLU n 
1 436 ASN n 
1 437 GLU n 
1 438 ASP n 
1 439 LEU n 
1 440 SER n 
1 441 ARG n 
1 442 PHE n 
1 443 ILE n 
1 444 LEU n 
2 1   THR n 
2 2   THR n 
2 3   ILE n 
2 4   VAL n 
2 5   SER n 
2 6   VAL n 
2 7   ARG n 
2 8   ARG n 
2 9   ASN n 
2 10  GLY n 
2 11  GLN n 
2 12  VAL n 
2 13  VAL n 
2 14  VAL n 
2 15  GLY n 
2 16  GLY n 
2 17  ASP n 
2 18  GLY n 
2 19  GLN n 
2 20  VAL n 
2 21  SER n 
2 22  LEU n 
2 23  GLY n 
2 24  ASN n 
2 25  THR n 
2 26  VAL n 
2 27  MET n 
2 28  LYS n 
2 29  GLY n 
2 30  ASN n 
2 31  ALA n 
2 32  ARG n 
2 33  LYS n 
2 34  VAL n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  TYR n 
2 39  ASN n 
2 40  GLY n 
2 41  LYS n 
2 42  VAL n 
2 43  LEU n 
2 44  ALA n 
2 45  GLY n 
2 46  PHE n 
2 47  ALA n 
2 48  GLY n 
2 49  GLY n 
2 50  THR n 
2 51  ALA n 
2 52  ASP n 
2 53  ALA n 
2 54  PHE n 
2 55  THR n 
2 56  LEU n 
2 57  PHE n 
2 58  GLU n 
2 59  LEU n 
2 60  PHE n 
2 61  GLU n 
2 62  ARG n 
2 63  LYS n 
2 64  LEU n 
2 65  GLU n 
2 66  MET n 
2 67  HIS n 
2 68  GLN n 
2 69  GLY n 
2 70  HIS n 
2 71  LEU n 
2 72  LEU n 
2 73  LYS n 
2 74  SER n 
2 75  ALA n 
2 76  VAL n 
2 77  GLU n 
2 78  LEU n 
2 79  ALA n 
2 80  LYS n 
2 81  ASP n 
2 82  TRP n 
2 83  ARG n 
2 84  THR n 
2 85  ASP n 
2 86  ARG n 
2 87  ALA n 
2 88  LEU n 
2 89  ARG n 
2 90  LYS n 
2 91  LEU n 
2 92  GLU n 
2 93  ALA n 
2 94  MET n 
2 95  LEU n 
2 96  ILE n 
2 97  VAL n 
2 98  ALA n 
2 99  ASP n 
2 100 GLU n 
2 101 LYS n 
2 102 GLU n 
2 103 SER n 
2 104 LEU n 
2 105 ILE n 
2 106 ILE n 
2 107 THR n 
2 108 GLY n 
2 109 ILE n 
2 110 GLY n 
2 111 ASP n 
2 112 VAL n 
2 113 VAL n 
2 114 GLN n 
2 115 PRO n 
2 116 GLU n 
2 117 GLU n 
2 118 ASP n 
2 119 GLN n 
2 120 ILE n 
2 121 LEU n 
2 122 ALA n 
2 123 ILE n 
2 124 GLY n 
2 125 SER n 
2 126 GLY n 
2 127 GLY n 
2 128 ASN n 
2 129 TYR n 
2 130 ALA n 
2 131 LEU n 
2 132 SER n 
2 133 ALA n 
2 134 ALA n 
2 135 ARG n 
2 136 ALA n 
2 137 LEU n 
2 138 VAL n 
2 139 GLU n 
2 140 ASN n 
2 141 THR n 
2 142 GLU n 
2 143 LEU n 
2 144 SER n 
2 145 ALA n 
2 146 HIS n 
2 147 GLU n 
2 148 ILE n 
2 149 VAL n 
2 150 GLU n 
2 151 LYS n 
2 152 SER n 
2 153 LEU n 
2 154 ARG n 
2 155 ILE n 
2 156 ALA n 
2 157 GLY n 
2 158 ASP n 
2 159 ILE n 
2 160 CYS n 
2 161 VAL n 
2 162 PHE n 
2 163 THR n 
2 164 ASN n 
2 165 THR n 
2 166 ASN n 
2 167 PHE n 
2 168 THR n 
2 169 ILE n 
2 170 GLU n 
2 171 GLU n 
2 172 LEU n 
2 173 PRO n 
2 174 ASN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? Haemophilus ? ? ? ? ? ? ? 'Haemophilus influenzae' 727 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PET ? ? ? ? ? ? 
2 1 sample ? ? ? ? Haemophilus ? ? ? ? ? ? ? 'Haemophilus influenzae' 727 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PET ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP HSLU_HAEIN 1 
;MSEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIK
VEATKFTEVGYVGKEVDSIIRDLTDSAMKLVRQQEIAKNRARAEDVAEERILDALLPPAKNQWGEVENHDSHSSTRQAFR
KKLREGQLDDKEIEIDVSAGVSMGVEIMAPPGMEEMTNQLQSLFQNLGSDKTKKRKMKIKDALKALIDDEAAKLINPEEL
KQKAIDAVEQNGIVFIDEIDKICKKGEYSGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLI
PELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVM
ERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
;
1 P43773 ? 
2 UNP HSLV_HAEIN 2 
;TTIVSVRRNGQVVVGGDGQVSLGNTVMKGNARKVRRLYNGKVLAGFAGGTADAFTLFELFERKLEMHQGHLLKSAVELAK
DWRTDRALRKLEAMLIVADEKESLIITGIGDVVQPEEDQILAIGSGGNYALSAARALVENTELSAHEIVEKSLRIAGDIC
VFTNTNFTIEELPN
;
1 P43772 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1G3I A 1 ? 444 ? P43773 1 ? 444 ? 1 444 
2  1 1G3I B 1 ? 444 ? P43773 1 ? 444 ? 1 444 
3  1 1G3I C 1 ? 444 ? P43773 1 ? 444 ? 1 444 
4  1 1G3I D 1 ? 444 ? P43773 1 ? 444 ? 1 444 
5  1 1G3I E 1 ? 444 ? P43773 1 ? 444 ? 1 444 
6  1 1G3I F 1 ? 444 ? P43773 1 ? 444 ? 1 444 
7  1 1G3I S 1 ? 444 ? P43773 1 ? 444 ? 1 444 
8  1 1G3I T 1 ? 444 ? P43773 1 ? 444 ? 1 444 
9  1 1G3I U 1 ? 444 ? P43773 1 ? 444 ? 1 444 
10 1 1G3I V 1 ? 444 ? P43773 1 ? 444 ? 1 444 
11 1 1G3I W 1 ? 444 ? P43773 1 ? 444 ? 1 444 
12 1 1G3I X 1 ? 444 ? P43773 1 ? 444 ? 1 444 
13 2 1G3I G 1 ? 174 ? P43772 1 ? 174 ? 1 174 
14 2 1G3I H 1 ? 174 ? P43772 1 ? 174 ? 1 174 
15 2 1G3I I 1 ? 174 ? P43772 1 ? 174 ? 1 174 
16 2 1G3I J 1 ? 174 ? P43772 1 ? 174 ? 1 174 
17 2 1G3I K 1 ? 174 ? P43772 1 ? 174 ? 1 174 
18 2 1G3I L 1 ? 174 ? P43772 1 ? 174 ? 1 174 
19 2 1G3I M 1 ? 174 ? P43772 1 ? 174 ? 1 174 
20 2 1G3I N 1 ? 174 ? P43772 1 ? 174 ? 1 174 
21 2 1G3I O 1 ? 174 ? P43772 1 ? 174 ? 1 174 
22 2 1G3I P 1 ? 174 ? P43772 1 ? 174 ? 1 174 
23 2 1G3I Q 1 ? 174 ? P43772 1 ? 174 ? 1 174 
24 2 1G3I R 1 ? 174 ? P43772 1 ? 174 ? 1 174 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                  ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1G3I 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.39 
_exptl_crystal.density_percent_sol   63.72 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'PEG monomethyl ether 2000, potassium Chloride, magnesium acetate, citrate, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2000-06-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     1G3I 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            3.4 
_reflns.number_obs                   134912 
_reflns.number_all                   134912 
_reflns.percent_possible_obs         89.1 
_reflns.pdbx_Rmerge_I_obs            0.0640000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.4 
_reflns_shell.d_res_low              3.52 
_reflns_shell.percent_possible_all   80.6 
_reflns_shell.Rmerge_I_obs           0.2850000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3 
_reflns_shell.pdbx_redundancy        1.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1G3I 
_refine.ls_number_reflns_obs                     126814 
_refine.ls_number_reflns_all                     134912 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               9712778.95 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             30.08 
_refine.ls_d_res_high                            3.41 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2400000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2400000 
_refine.ls_R_factor_R_free                       0.2840000 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  6383 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               102.9 
_refine.aniso_B[1][1]                            -28.95 
_refine.aniso_B[2][2]                            -7.75 
_refine.aniso_B[3][3]                            36.70 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.238 
_refine.solvent_model_param_bsol                 63.96 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'H. influenzae HslU at 2.3A H. influenzae HslV at 1.9A' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             GROUP 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1G3I 
_refine_analyze.Luzzati_coordinate_error_obs    0.40 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.49 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        45156 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         372 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               45528 
_refine_hist.d_res_high                       3.41 
_refine_hist.d_res_low                        30.08 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg        1.3  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.8 ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.79 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.40 
_refine_ls_shell.d_res_low                        3.61 
_refine_ls_shell.number_reflns_R_work             15794 
_refine_ls_shell.R_factor_R_work                  0.3440000 
_refine_ls_shell.percent_reflns_obs               65.9 
_refine_ls_shell.R_factor_R_free                  0.3670000 
_refine_ls_shell.R_factor_R_free_error            0.013 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             852 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM          PROTEIN.TOP   'X-RAY DIFFRACTION' 
2 BILL_DNA-RNA-ATP_REP.PARAM BILL_ATP.TOP2 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1G3I 
_struct.title                     'CRYSTAL STRUCTURE OF THE HSLUV PROTEASE-CHAPERONE COMPLEX' 
_struct.pdbx_descriptor           'ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT HSLU/ATP-DEPENDENT PROTEASE HSLV (E.C.3.4.99.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1G3I 
_struct_keywords.pdbx_keywords   CHAPERONE/HYDROLASE 
_struct_keywords.text            'CHAPERONE/HYDROLASE, CHAPERONE-HYDROLASE complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 1 ? 
V  N N 1 ? 
W  N N 1 ? 
X  N N 1 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 3 ? 
GA N N 3 ? 
HA N N 3 ? 
IA N N 3 ? 
JA N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological assembly is the complex HslU12-HslV12 seen in the asymmetric unit.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   THR A 5   ? GLN A 15  ? THR A 5   GLN A 15  1 ? 11 
HELX_P HELX_P2   2   GLN A 20  ? ARG A 37  ? GLN A 20  ARG A 37  1 ? 18 
HELX_P HELX_P3   3   GLN A 41  ? VAL A 48  ? GLN A 41  VAL A 48  1 ? 8  
HELX_P HELX_P4   4   GLY A 62  ? ALA A 74  ? GLY A 62  ALA A 74  1 ? 13 
HELX_P HELX_P5   5   THR A 84  ? THR A 87  ? THR A 84  THR A 87  5 ? 4  
HELX_P HELX_P6   6   GLU A 95  ? VAL A 96  ? GLU A 95  VAL A 96  5 ? 2  
HELX_P HELX_P7   7   ASP A 97  ? GLN A 113 ? ASP A 97  GLN A 113 1 ? 17 
HELX_P HELX_P8   8   ASN A 236 ? GLY A 252 ? ASN A 236 GLY A 252 1 ? 17 
HELX_P HELX_P9   9   GLU A 258 ? CYS A 263 ? GLU A 258 CYS A 263 5 ? 6  
HELX_P HELX_P10  10  ARG A 275 ? GLY A 288 ? ARG A 275 GLY A 288 1 ? 14 
HELX_P HELX_P11  11  ARG A 315 ? LEU A 319 ? ARG A 315 LEU A 319 5 ? 5  
HELX_P HELX_P12  12  ILE A 320 ? GLY A 325 ? ILE A 320 GLY A 325 1 ? 6  
HELX_P HELX_P13  13  SER A 337 ? LEU A 345 ? SER A 337 LEU A 345 1 ? 9  
HELX_P HELX_P14  14  SER A 351 ? GLU A 363 ? SER A 351 GLU A 363 1 ? 13 
HELX_P HELX_P15  15  THR A 370 ? THR A 388 ? THR A 370 THR A 388 1 ? 19 
HELX_P HELX_P16  16  ALA A 393 ? MET A 404 ? ALA A 393 MET A 404 1 ? 12 
HELX_P HELX_P17  17  MET A 404 ? ALA A 411 ? MET A 404 ALA A 411 1 ? 8  
HELX_P HELX_P18  18  SER A 412 ? MET A 414 ? SER A 412 MET A 414 5 ? 3  
HELX_P HELX_P19  19  ASP A 422 ? GLY A 431 ? ASP A 422 GLY A 431 1 ? 10 
HELX_P HELX_P20  20  LEU A 439 ? ILE A 443 ? LEU A 439 ILE A 443 5 ? 5  
HELX_P HELX_P21  21  THR B 5   ? ILE B 17  ? THR B 5   ILE B 17  1 ? 13 
HELX_P HELX_P22  22  GLN B 20  ? ARG B 37  ? GLN B 20  ARG B 37  1 ? 18 
HELX_P HELX_P23  23  GLN B 41  ? HIS B 46  ? GLN B 41  HIS B 46  1 ? 6  
HELX_P HELX_P24  24  GLY B 62  ? ALA B 74  ? GLY B 62  ALA B 74  1 ? 13 
HELX_P HELX_P25  25  THR B 84  ? THR B 87  ? THR B 84  THR B 87  5 ? 4  
HELX_P HELX_P26  26  GLU B 95  ? VAL B 96  ? GLU B 95  VAL B 96  5 ? 2  
HELX_P HELX_P27  27  ASP B 97  ? ALA B 117 ? ASP B 97  ALA B 117 1 ? 21 
HELX_P HELX_P28  28  GLU B 238 ? GLY B 252 ? GLU B 238 GLY B 252 1 ? 15 
HELX_P HELX_P29  29  GLU B 258 ? CYS B 263 ? GLU B 258 CYS B 263 5 ? 6  
HELX_P HELX_P30  30  SER B 274 ? GLY B 288 ? SER B 274 GLY B 288 1 ? 15 
HELX_P HELX_P31  31  ASP B 301 ? ILE B 303 ? ASP B 301 ILE B 303 5 ? 3  
HELX_P HELX_P32  32  ARG B 315 ? LEU B 319 ? ARG B 315 LEU B 319 5 ? 5  
HELX_P HELX_P33  33  ILE B 320 ? GLY B 325 ? ILE B 320 GLY B 325 1 ? 6  
HELX_P HELX_P34  34  SER B 337 ? GLU B 347 ? SER B 337 GLU B 347 1 ? 11 
HELX_P HELX_P35  35  SER B 351 ? GLU B 363 ? SER B 351 GLU B 363 1 ? 13 
HELX_P HELX_P36  36  THR B 370 ? THR B 388 ? THR B 370 THR B 388 1 ? 19 
HELX_P HELX_P37  37  ALA B 393 ? MET B 404 ? ALA B 393 MET B 404 1 ? 12 
HELX_P HELX_P38  38  MET B 404 ? ALA B 411 ? MET B 404 ALA B 411 1 ? 8  
HELX_P HELX_P39  39  ASP B 422 ? LEU B 430 ? ASP B 422 LEU B 430 1 ? 9  
HELX_P HELX_P40  40  ASP B 438 ? ILE B 443 ? ASP B 438 ILE B 443 5 ? 6  
HELX_P HELX_P41  41  THR C 5   ? GLN C 15  ? THR C 5   GLN C 15  1 ? 11 
HELX_P HELX_P42  42  GLN C 20  ? ARG C 37  ? GLN C 20  ARG C 37  1 ? 18 
HELX_P HELX_P43  43  GLN C 41  ? VAL C 48  ? GLN C 41  VAL C 48  1 ? 8  
HELX_P HELX_P44  44  GLY C 62  ? ALA C 74  ? GLY C 62  ALA C 74  1 ? 13 
HELX_P HELX_P45  45  THR C 84  ? THR C 87  ? THR C 84  THR C 87  5 ? 4  
HELX_P HELX_P46  46  GLU C 95  ? VAL C 96  ? GLU C 95  VAL C 96  5 ? 2  
HELX_P HELX_P47  47  ASP C 97  ? GLN C 114 ? ASP C 97  GLN C 114 1 ? 18 
HELX_P HELX_P48  48  ASN C 236 ? GLY C 252 ? ASN C 236 GLY C 252 1 ? 17 
HELX_P HELX_P49  49  GLU C 258 ? CYS C 263 ? GLU C 258 CYS C 263 5 ? 6  
HELX_P HELX_P50  50  SER C 274 ? GLU C 287 ? SER C 274 GLU C 287 1 ? 14 
HELX_P HELX_P51  51  ASP C 301 ? ILE C 303 ? ASP C 301 ILE C 303 5 ? 3  
HELX_P HELX_P52  52  ARG C 315 ? LEU C 319 ? ARG C 315 LEU C 319 5 ? 5  
HELX_P HELX_P53  53  ILE C 320 ? GLY C 325 ? ILE C 320 GLY C 325 1 ? 6  
HELX_P HELX_P54  54  SER C 337 ? LEU C 345 ? SER C 337 LEU C 345 1 ? 9  
HELX_P HELX_P55  55  SER C 351 ? GLU C 363 ? SER C 351 GLU C 363 1 ? 13 
HELX_P HELX_P56  56  THR C 370 ? THR C 388 ? THR C 370 THR C 388 1 ? 19 
HELX_P HELX_P57  57  ALA C 393 ? MET C 404 ? ALA C 393 MET C 404 1 ? 12 
HELX_P HELX_P58  58  MET C 404 ? ALA C 411 ? MET C 404 ALA C 411 1 ? 8  
HELX_P HELX_P59  59  ASP C 422 ? GLY C 431 ? ASP C 422 GLY C 431 1 ? 10 
HELX_P HELX_P60  60  LEU C 439 ? ILE C 443 ? LEU C 439 ILE C 443 5 ? 5  
HELX_P HELX_P61  61  THR D 5   ? GLN D 15  ? THR D 5   GLN D 15  1 ? 11 
HELX_P HELX_P62  62  GLN D 20  ? ARG D 37  ? GLN D 20  ARG D 37  1 ? 18 
HELX_P HELX_P63  63  GLN D 41  ? VAL D 48  ? GLN D 41  VAL D 48  1 ? 8  
HELX_P HELX_P64  64  GLY D 62  ? ALA D 74  ? GLY D 62  ALA D 74  1 ? 13 
HELX_P HELX_P65  65  THR D 84  ? THR D 87  ? THR D 84  THR D 87  5 ? 4  
HELX_P HELX_P66  66  GLU D 95  ? VAL D 96  ? GLU D 95  VAL D 96  5 ? 2  
HELX_P HELX_P67  67  ASP D 97  ? ILE D 116 ? ASP D 97  ILE D 116 1 ? 20 
HELX_P HELX_P68  68  ASN D 236 ? GLY D 252 ? ASN D 236 GLY D 252 1 ? 17 
HELX_P HELX_P69  69  ARG D 275 ? GLU D 287 ? ARG D 275 GLU D 287 1 ? 13 
HELX_P HELX_P70  70  ASP D 301 ? ILE D 303 ? ASP D 301 ILE D 303 5 ? 3  
HELX_P HELX_P71  71  ARG D 315 ? LEU D 319 ? ARG D 315 LEU D 319 5 ? 5  
HELX_P HELX_P72  72  ILE D 320 ? GLY D 325 ? ILE D 320 GLY D 325 1 ? 6  
HELX_P HELX_P73  73  SER D 337 ? LEU D 345 ? SER D 337 LEU D 345 1 ? 9  
HELX_P HELX_P74  74  SER D 351 ? GLU D 363 ? SER D 351 GLU D 363 1 ? 13 
HELX_P HELX_P75  75  THR D 370 ? THR D 388 ? THR D 370 THR D 388 1 ? 19 
HELX_P HELX_P76  76  ALA D 393 ? MET D 404 ? ALA D 393 MET D 404 1 ? 12 
HELX_P HELX_P77  77  MET D 404 ? ALA D 411 ? MET D 404 ALA D 411 1 ? 8  
HELX_P HELX_P78  78  SER D 412 ? MET D 414 ? SER D 412 MET D 414 5 ? 3  
HELX_P HELX_P79  79  ASP D 422 ? GLY D 431 ? ASP D 422 GLY D 431 1 ? 10 
HELX_P HELX_P80  80  ASN D 436 ? SER D 440 ? ASN D 436 SER D 440 5 ? 5  
HELX_P HELX_P81  81  THR E 5   ? GLN E 15  ? THR E 5   GLN E 15  1 ? 11 
HELX_P HELX_P82  82  GLN E 20  ? ARG E 37  ? GLN E 20  ARG E 37  1 ? 18 
HELX_P HELX_P83  83  GLN E 41  ? VAL E 48  ? GLN E 41  VAL E 48  1 ? 8  
HELX_P HELX_P84  84  GLY E 62  ? ALA E 74  ? GLY E 62  ALA E 74  1 ? 13 
HELX_P HELX_P85  85  THR E 84  ? THR E 87  ? THR E 84  THR E 87  5 ? 4  
HELX_P HELX_P86  86  GLU E 95  ? VAL E 96  ? GLU E 95  VAL E 96  5 ? 2  
HELX_P HELX_P87  87  ASP E 97  ? ILE E 116 ? ASP E 97  ILE E 116 1 ? 20 
HELX_P HELX_P88  88  ASN E 236 ? GLY E 252 ? ASN E 236 GLY E 252 1 ? 17 
HELX_P HELX_P89  89  GLU E 258 ? CYS E 263 ? GLU E 258 CYS E 263 5 ? 6  
HELX_P HELX_P90  90  ARG E 275 ? GLY E 288 ? ARG E 275 GLY E 288 1 ? 14 
HELX_P HELX_P91  91  ASP E 301 ? ILE E 303 ? ASP E 301 ILE E 303 5 ? 3  
HELX_P HELX_P92  92  ARG E 315 ? LEU E 319 ? ARG E 315 LEU E 319 5 ? 5  
HELX_P HELX_P93  93  ILE E 320 ? GLY E 325 ? ILE E 320 GLY E 325 1 ? 6  
HELX_P HELX_P94  94  SER E 337 ? LEU E 345 ? SER E 337 LEU E 345 1 ? 9  
HELX_P HELX_P95  95  SER E 351 ? GLU E 363 ? SER E 351 GLU E 363 1 ? 13 
HELX_P HELX_P96  96  THR E 370 ? THR E 388 ? THR E 370 THR E 388 1 ? 19 
HELX_P HELX_P97  97  ALA E 393 ? MET E 404 ? ALA E 393 MET E 404 1 ? 12 
HELX_P HELX_P98  98  MET E 404 ? ALA E 411 ? MET E 404 ALA E 411 1 ? 8  
HELX_P HELX_P99  99  ASP E 422 ? GLY E 431 ? ASP E 422 GLY E 431 1 ? 10 
HELX_P HELX_P100 101 THR F 5   ? GLN F 15  ? THR F 5   GLN F 15  1 ? 11 
HELX_P HELX_P101 102 GLN F 20  ? ARG F 37  ? GLN F 20  ARG F 37  1 ? 18 
HELX_P HELX_P102 103 GLN F 41  ? VAL F 48  ? GLN F 41  VAL F 48  1 ? 8  
HELX_P HELX_P103 104 GLY F 62  ? ALA F 74  ? GLY F 62  ALA F 74  1 ? 13 
HELX_P HELX_P104 105 THR F 84  ? THR F 87  ? THR F 84  THR F 87  5 ? 4  
HELX_P HELX_P105 106 GLU F 95  ? VAL F 96  ? GLU F 95  VAL F 96  5 ? 2  
HELX_P HELX_P106 107 ASP F 97  ? ARG F 112 ? ASP F 97  ARG F 112 1 ? 16 
HELX_P HELX_P107 108 GLN F 113 ? ILE F 116 ? GLN F 113 ILE F 116 5 ? 4  
HELX_P HELX_P108 109 ALA F 117 ? ALA F 121 ? ALA F 117 ALA F 121 5 ? 5  
HELX_P HELX_P109 110 ASN F 236 ? GLY F 252 ? ASN F 236 GLY F 252 1 ? 17 
HELX_P HELX_P110 111 ARG F 275 ? GLY F 288 ? ARG F 275 GLY F 288 1 ? 14 
HELX_P HELX_P111 112 ASP F 301 ? ILE F 303 ? ASP F 301 ILE F 303 5 ? 3  
HELX_P HELX_P112 113 ARG F 315 ? LEU F 319 ? ARG F 315 LEU F 319 5 ? 5  
HELX_P HELX_P113 114 ILE F 320 ? GLY F 325 ? ILE F 320 GLY F 325 1 ? 6  
HELX_P HELX_P114 115 SER F 337 ? LEU F 345 ? SER F 337 LEU F 345 1 ? 9  
HELX_P HELX_P115 116 SER F 351 ? GLU F 363 ? SER F 351 GLU F 363 1 ? 13 
HELX_P HELX_P116 117 THR F 370 ? THR F 388 ? THR F 370 THR F 388 1 ? 19 
HELX_P HELX_P117 118 ALA F 393 ? MET F 404 ? ALA F 393 MET F 404 1 ? 12 
HELX_P HELX_P118 119 MET F 404 ? ALA F 411 ? MET F 404 ALA F 411 1 ? 8  
HELX_P HELX_P119 120 ASP F 422 ? GLY F 431 ? ASP F 422 GLY F 431 1 ? 10 
HELX_P HELX_P120 121 LEU F 439 ? ILE F 443 ? LEU F 439 ILE F 443 5 ? 5  
HELX_P HELX_P121 122 GLY G 49  ? HIS G 67  ? GLY G 49  HIS G 67  1 ? 19 
HELX_P HELX_P122 123 HIS G 70  ? LYS G 80  ? HIS G 70  LYS G 80  1 ? 11 
HELX_P HELX_P123 124 GLY G 126 ? ASN G 140 ? GLY G 126 ASN G 140 1 ? 15 
HELX_P HELX_P124 125 SER G 144 ? ASP G 158 ? SER G 144 ASP G 158 1 ? 15 
HELX_P HELX_P125 126 GLY H 49  ? HIS H 67  ? GLY H 49  HIS H 67  1 ? 19 
HELX_P HELX_P126 127 HIS H 70  ? ARG H 83  ? HIS H 70  ARG H 83  1 ? 14 
HELX_P HELX_P127 128 GLY H 126 ? ASN H 140 ? GLY H 126 ASN H 140 1 ? 15 
HELX_P HELX_P128 129 SER H 144 ? ASP H 158 ? SER H 144 ASP H 158 1 ? 15 
HELX_P HELX_P129 130 GLY I 49  ? HIS I 67  ? GLY I 49  HIS I 67  1 ? 19 
HELX_P HELX_P130 131 HIS I 70  ? ASP I 81  ? HIS I 70  ASP I 81  1 ? 12 
HELX_P HELX_P131 132 GLY I 126 ? ASN I 140 ? GLY I 126 ASN I 140 1 ? 15 
HELX_P HELX_P132 133 SER I 144 ? CYS I 160 ? SER I 144 CYS I 160 1 ? 17 
HELX_P HELX_P133 134 GLY J 49  ? HIS J 67  ? GLY J 49  HIS J 67  1 ? 19 
HELX_P HELX_P134 135 HIS J 70  ? THR J 84  ? HIS J 70  THR J 84  1 ? 15 
HELX_P HELX_P135 136 GLY J 126 ? ASN J 140 ? GLY J 126 ASN J 140 1 ? 15 
HELX_P HELX_P136 137 SER J 144 ? ASP J 158 ? SER J 144 ASP J 158 1 ? 15 
HELX_P HELX_P137 138 GLY K 49  ? HIS K 67  ? GLY K 49  HIS K 67  1 ? 19 
HELX_P HELX_P138 139 HIS K 70  ? ASP K 81  ? HIS K 70  ASP K 81  1 ? 12 
HELX_P HELX_P139 140 GLY K 126 ? ASN K 140 ? GLY K 126 ASN K 140 1 ? 15 
HELX_P HELX_P140 141 SER K 144 ? ASP K 158 ? SER K 144 ASP K 158 1 ? 15 
HELX_P HELX_P141 142 GLY L 49  ? HIS L 67  ? GLY L 49  HIS L 67  1 ? 19 
HELX_P HELX_P142 143 HIS L 70  ? ASP L 81  ? HIS L 70  ASP L 81  1 ? 12 
HELX_P HELX_P143 144 GLY L 126 ? ASN L 140 ? GLY L 126 ASN L 140 1 ? 15 
HELX_P HELX_P144 145 SER L 144 ? CYS L 160 ? SER L 144 CYS L 160 1 ? 17 
HELX_P HELX_P145 147 HIS M 70  ? ASP M 81  ? HIS M 70  ASP M 81  1 ? 12 
HELX_P HELX_P146 148 GLY M 126 ? THR M 141 ? GLY M 126 THR M 141 1 ? 16 
HELX_P HELX_P147 149 SER M 144 ? ASP M 158 ? SER M 144 ASP M 158 1 ? 15 
HELX_P HELX_P148 151 HIS N 70  ? ASP N 81  ? HIS N 70  ASP N 81  1 ? 12 
HELX_P HELX_P149 152 GLY N 126 ? THR N 141 ? GLY N 126 THR N 141 1 ? 16 
HELX_P HELX_P150 153 SER N 144 ? ASP N 158 ? SER N 144 ASP N 158 1 ? 15 
HELX_P HELX_P151 155 HIS O 70  ? ASP O 81  ? HIS O 70  ASP O 81  1 ? 12 
HELX_P HELX_P152 156 GLY O 126 ? THR O 141 ? GLY O 126 THR O 141 1 ? 16 
HELX_P HELX_P153 157 SER O 144 ? ASP O 158 ? SER O 144 ASP O 158 1 ? 15 
HELX_P HELX_P154 159 HIS P 70  ? ASP P 81  ? HIS P 70  ASP P 81  1 ? 12 
HELX_P HELX_P155 160 GLY P 126 ? THR P 141 ? GLY P 126 THR P 141 1 ? 16 
HELX_P HELX_P156 161 SER P 144 ? ASP P 158 ? SER P 144 ASP P 158 1 ? 15 
HELX_P HELX_P157 163 HIS Q 70  ? ASP Q 81  ? HIS Q 70  ASP Q 81  1 ? 12 
HELX_P HELX_P158 164 GLY Q 126 ? THR Q 141 ? GLY Q 126 THR Q 141 1 ? 16 
HELX_P HELX_P159 165 SER Q 144 ? ASP Q 158 ? SER Q 144 ASP Q 158 1 ? 15 
HELX_P HELX_P160 167 HIS R 70  ? ASP R 81  ? HIS R 70  ASP R 81  1 ? 12 
HELX_P HELX_P161 168 GLY R 126 ? THR R 141 ? GLY R 126 THR R 141 1 ? 16 
HELX_P HELX_P162 169 SER R 144 ? ASP R 158 ? SER R 144 ASP R 158 1 ? 15 
HELX_P HELX_P163 170 THR S 5   ? ASP S 14  ? THR S 5   ASP S 14  1 ? 10 
HELX_P HELX_P164 171 ALA S 21  ? ASN S 33  ? ALA S 21  ASN S 33  1 ? 13 
HELX_P HELX_P165 172 GLU S 42  ? GLU S 47  ? GLU S 42  GLU S 47  1 ? 6  
HELX_P HELX_P166 173 THR S 64  ? ARG S 69  ? THR S 64  ARG S 69  1 ? 6  
HELX_P HELX_P167 174 ASP S 97  ? ASP S 105 ? ASP S 97  ASP S 105 1 ? 9  
HELX_P HELX_P168 175 ASN S 236 ? LYS S 241 ? ASN S 236 LYS S 241 1 ? 6  
HELX_P HELX_P169 176 ALA S 244 ? GLU S 249 ? ALA S 244 GLU S 249 1 ? 6  
HELX_P HELX_P170 177 ILE S 259 ? CYS S 263 ? ILE S 259 CYS S 263 5 ? 5  
HELX_P HELX_P171 178 SER S 274 ? LEU S 282 ? SER S 274 LEU S 282 1 ? 9  
HELX_P HELX_P172 179 LEU S 282 ? GLY S 288 ? LEU S 282 GLY S 288 1 ? 7  
HELX_P HELX_P173 180 ARG S 315 ? LEU S 319 ? ARG S 315 LEU S 319 5 ? 5  
HELX_P HELX_P174 181 ILE S 320 ? ARG S 326 ? ILE S 320 ARG S 326 1 ? 7  
HELX_P HELX_P175 182 SER S 337 ? ILE S 344 ? SER S 337 ILE S 344 1 ? 8  
HELX_P HELX_P176 183 SER S 351 ? MET S 360 ? SER S 351 MET S 360 1 ? 10 
HELX_P HELX_P177 184 THR S 371 ? ALA S 373 ? THR S 371 ALA S 373 5 ? 3  
HELX_P HELX_P178 185 VAL S 374 ? GLU S 379 ? VAL S 374 GLU S 379 1 ? 6  
HELX_P HELX_P179 186 ALA S 381 ? GLU S 386 ? ALA S 381 GLU S 386 1 ? 6  
HELX_P HELX_P180 187 ALA S 393 ? MET S 404 ? ALA S 393 MET S 404 1 ? 12 
HELX_P HELX_P181 188 ASP S 422 ? ASP S 428 ? ASP S 422 ASP S 428 1 ? 7  
HELX_P HELX_P182 189 ASP S 438 ? ILE S 443 ? ASP S 438 ILE S 443 1 ? 6  
HELX_P HELX_P183 190 THR T 5   ? ASP T 14  ? THR T 5   ASP T 14  1 ? 10 
HELX_P HELX_P184 191 ALA T 21  ? ASN T 33  ? ALA T 21  ASN T 33  1 ? 13 
HELX_P HELX_P185 192 GLU T 42  ? GLU T 47  ? GLU T 42  GLU T 47  1 ? 6  
HELX_P HELX_P186 193 THR T 64  ? ARG T 69  ? THR T 64  ARG T 69  1 ? 6  
HELX_P HELX_P187 194 ASP T 97  ? ASP T 105 ? ASP T 97  ASP T 105 1 ? 9  
HELX_P HELX_P188 195 GLN T 114 ? ASN T 119 ? GLN T 114 ASN T 119 1 ? 6  
HELX_P HELX_P189 196 ILE T 227 ? LYS T 233 ? ILE T 227 LYS T 233 1 ? 7  
HELX_P HELX_P190 197 GLU T 239 ? ALA T 244 ? GLU T 239 ALA T 244 1 ? 6  
HELX_P HELX_P191 198 ILE T 259 ? CYS T 263 ? ILE T 259 CYS T 263 5 ? 5  
HELX_P HELX_P192 199 SER T 274 ? LEU T 282 ? SER T 274 LEU T 282 1 ? 9  
HELX_P HELX_P193 200 LEU T 282 ? GLY T 288 ? LEU T 282 GLY T 288 1 ? 7  
HELX_P HELX_P194 201 ARG T 315 ? LEU T 319 ? ARG T 315 LEU T 319 5 ? 5  
HELX_P HELX_P195 202 ILE T 320 ? ARG T 326 ? ILE T 320 ARG T 326 1 ? 7  
HELX_P HELX_P196 203 SER T 337 ? ILE T 344 ? SER T 337 ILE T 344 1 ? 8  
HELX_P HELX_P197 204 SER T 351 ? MET T 360 ? SER T 351 MET T 360 1 ? 10 
HELX_P HELX_P198 205 THR T 371 ? ALA T 373 ? THR T 371 ALA T 373 5 ? 3  
HELX_P HELX_P199 206 VAL T 374 ? GLU T 379 ? VAL T 374 GLU T 379 1 ? 6  
HELX_P HELX_P200 207 VAL T 384 ? THR T 388 ? VAL T 384 THR T 388 5 ? 5  
HELX_P HELX_P201 208 ALA T 393 ? MET T 404 ? ALA T 393 MET T 404 1 ? 12 
HELX_P HELX_P202 209 ASP T 422 ? ASP T 428 ? ASP T 422 ASP T 428 1 ? 7  
HELX_P HELX_P203 210 GLU T 437 ? ARG T 441 ? GLU T 437 ARG T 441 5 ? 5  
HELX_P HELX_P204 211 THR U 5   ? ASP U 14  ? THR U 5   ASP U 14  1 ? 10 
HELX_P HELX_P205 212 ALA U 21  ? ASN U 33  ? ALA U 21  ASN U 33  1 ? 13 
HELX_P HELX_P206 213 GLU U 42  ? GLU U 47  ? GLU U 42  GLU U 47  1 ? 6  
HELX_P HELX_P207 214 THR U 64  ? ARG U 69  ? THR U 64  ARG U 69  1 ? 6  
HELX_P HELX_P208 215 ASP U 97  ? ASP U 105 ? ASP U 97  ASP U 105 1 ? 9  
HELX_P HELX_P209 216 GLN U 114 ? ASN U 119 ? GLN U 114 ASN U 119 1 ? 6  
HELX_P HELX_P210 217 GLU U 230 ? LEU U 234 ? GLU U 230 LEU U 234 5 ? 5  
HELX_P HELX_P211 218 ASN U 236 ? LYS U 241 ? ASN U 236 LYS U 241 1 ? 6  
HELX_P HELX_P212 219 ILE U 245 ? GLN U 250 ? ILE U 245 GLN U 250 1 ? 6  
HELX_P HELX_P213 220 ILE U 259 ? CYS U 263 ? ILE U 259 CYS U 263 5 ? 5  
HELX_P HELX_P214 221 SER U 274 ? LEU U 282 ? SER U 274 LEU U 282 1 ? 9  
HELX_P HELX_P215 222 LEU U 282 ? GLY U 288 ? LEU U 282 GLY U 288 1 ? 7  
HELX_P HELX_P216 223 ARG U 315 ? LEU U 319 ? ARG U 315 LEU U 319 5 ? 5  
HELX_P HELX_P217 224 ILE U 320 ? ARG U 326 ? ILE U 320 ARG U 326 1 ? 7  
HELX_P HELX_P218 225 SER U 337 ? LEU U 345 ? SER U 337 LEU U 345 1 ? 9  
HELX_P HELX_P219 226 SER U 351 ? MET U 360 ? SER U 351 MET U 360 1 ? 10 
HELX_P HELX_P220 227 THR U 371 ? ALA U 373 ? THR U 371 ALA U 373 5 ? 3  
HELX_P HELX_P221 228 VAL U 374 ? GLU U 379 ? VAL U 374 GLU U 379 1 ? 6  
HELX_P HELX_P222 229 VAL U 384 ? THR U 388 ? VAL U 384 THR U 388 5 ? 5  
HELX_P HELX_P223 230 ALA U 393 ? MET U 404 ? ALA U 393 MET U 404 1 ? 12 
HELX_P HELX_P224 231 ASP U 422 ? ASP U 428 ? ASP U 422 ASP U 428 1 ? 7  
HELX_P HELX_P225 232 THR V 5   ? ASP V 14  ? THR V 5   ASP V 14  1 ? 10 
HELX_P HELX_P226 233 ALA V 21  ? ASN V 33  ? ALA V 21  ASN V 33  1 ? 13 
HELX_P HELX_P227 234 GLU V 42  ? GLU V 47  ? GLU V 42  GLU V 47  1 ? 6  
HELX_P HELX_P228 235 THR V 64  ? ARG V 69  ? THR V 64  ARG V 69  1 ? 6  
HELX_P HELX_P229 236 ASP V 97  ? ASP V 105 ? ASP V 97  ASP V 105 1 ? 9  
HELX_P HELX_P230 237 ALA V 107 ? GLN V 113 ? ALA V 107 GLN V 113 1 ? 7  
HELX_P HELX_P231 238 ASN V 236 ? LYS V 241 ? ASN V 236 LYS V 241 1 ? 6  
HELX_P HELX_P232 239 ILE V 259 ? CYS V 263 ? ILE V 259 CYS V 263 5 ? 5  
HELX_P HELX_P233 240 SER V 274 ? LEU V 282 ? SER V 274 LEU V 282 1 ? 9  
HELX_P HELX_P234 241 LEU V 282 ? GLY V 288 ? LEU V 282 GLY V 288 1 ? 7  
HELX_P HELX_P235 242 ARG V 315 ? LEU V 319 ? ARG V 315 LEU V 319 5 ? 5  
HELX_P HELX_P236 243 ILE V 320 ? ARG V 326 ? ILE V 320 ARG V 326 1 ? 7  
HELX_P HELX_P237 244 SER V 337 ? LEU V 345 ? SER V 337 LEU V 345 1 ? 9  
HELX_P HELX_P238 245 SER V 351 ? MET V 360 ? SER V 351 MET V 360 1 ? 10 
HELX_P HELX_P239 246 THR V 371 ? ALA V 373 ? THR V 371 ALA V 373 5 ? 3  
HELX_P HELX_P240 247 VAL V 374 ? GLU V 379 ? VAL V 374 GLU V 379 1 ? 6  
HELX_P HELX_P241 248 ALA V 381 ? GLU V 386 ? ALA V 381 GLU V 386 1 ? 6  
HELX_P HELX_P242 249 ALA V 393 ? MET V 404 ? ALA V 393 MET V 404 1 ? 12 
HELX_P HELX_P243 250 ASP V 422 ? ASP V 428 ? ASP V 422 ASP V 428 1 ? 7  
HELX_P HELX_P244 251 THR W 5   ? ASP W 14  ? THR W 5   ASP W 14  1 ? 10 
HELX_P HELX_P245 252 ALA W 21  ? ASN W 33  ? ALA W 21  ASN W 33  1 ? 13 
HELX_P HELX_P246 253 GLU W 42  ? GLU W 47  ? GLU W 42  GLU W 47  1 ? 6  
HELX_P HELX_P247 254 THR W 64  ? ARG W 69  ? THR W 64  ARG W 69  1 ? 6  
HELX_P HELX_P248 255 ASP W 97  ? ASP W 105 ? ASP W 97  ASP W 105 1 ? 9  
HELX_P HELX_P249 256 ALA W 244 ? GLU W 249 ? ALA W 244 GLU W 249 1 ? 6  
HELX_P HELX_P250 257 ILE W 259 ? CYS W 263 ? ILE W 259 CYS W 263 5 ? 5  
HELX_P HELX_P251 258 SER W 274 ? LEU W 282 ? SER W 274 LEU W 282 1 ? 9  
HELX_P HELX_P252 259 LEU W 282 ? GLY W 288 ? LEU W 282 GLY W 288 1 ? 7  
HELX_P HELX_P253 260 ARG W 315 ? LEU W 319 ? ARG W 315 LEU W 319 5 ? 5  
HELX_P HELX_P254 261 ILE W 320 ? ARG W 326 ? ILE W 320 ARG W 326 1 ? 7  
HELX_P HELX_P255 262 SER W 337 ? LEU W 345 ? SER W 337 LEU W 345 1 ? 9  
HELX_P HELX_P256 263 SER W 351 ? MET W 360 ? SER W 351 MET W 360 1 ? 10 
HELX_P HELX_P257 264 THR W 371 ? ALA W 373 ? THR W 371 ALA W 373 5 ? 3  
HELX_P HELX_P258 265 VAL W 374 ? GLU W 379 ? VAL W 374 GLU W 379 1 ? 6  
HELX_P HELX_P259 266 ALA W 381 ? GLU W 386 ? ALA W 381 GLU W 386 1 ? 6  
HELX_P HELX_P260 267 ALA W 393 ? MET W 404 ? ALA W 393 MET W 404 1 ? 12 
HELX_P HELX_P261 268 ASP W 422 ? ASP W 428 ? ASP W 422 ASP W 428 1 ? 7  
HELX_P HELX_P262 269 THR X 5   ? ASP X 14  ? THR X 5   ASP X 14  1 ? 10 
HELX_P HELX_P263 270 ALA X 21  ? ASN X 33  ? ALA X 21  ASN X 33  1 ? 13 
HELX_P HELX_P264 271 GLU X 42  ? GLU X 47  ? GLU X 42  GLU X 47  1 ? 6  
HELX_P HELX_P265 272 THR X 64  ? ARG X 69  ? THR X 64  ARG X 69  1 ? 6  
HELX_P HELX_P266 273 ASP X 97  ? ASP X 105 ? ASP X 97  ASP X 105 1 ? 9  
HELX_P HELX_P267 274 ILE X 227 ? LEU X 234 ? ILE X 227 LEU X 234 1 ? 8  
HELX_P HELX_P268 275 ILE X 259 ? CYS X 263 ? ILE X 259 CYS X 263 5 ? 5  
HELX_P HELX_P269 276 SER X 274 ? LEU X 282 ? SER X 274 LEU X 282 1 ? 9  
HELX_P HELX_P270 277 LEU X 282 ? GLY X 288 ? LEU X 282 GLY X 288 1 ? 7  
HELX_P HELX_P271 278 ARG X 315 ? LEU X 319 ? ARG X 315 LEU X 319 5 ? 5  
HELX_P HELX_P272 279 ILE X 320 ? ARG X 326 ? ILE X 320 ARG X 326 1 ? 7  
HELX_P HELX_P273 280 SER X 337 ? LEU X 345 ? SER X 337 LEU X 345 1 ? 9  
HELX_P HELX_P274 281 SER X 351 ? MET X 360 ? SER X 351 MET X 360 1 ? 10 
HELX_P HELX_P275 282 THR X 371 ? ALA X 373 ? THR X 371 ALA X 373 5 ? 3  
HELX_P HELX_P276 283 VAL X 374 ? GLU X 379 ? VAL X 374 GLU X 379 1 ? 6  
HELX_P HELX_P277 284 VAL X 384 ? THR X 388 ? VAL X 384 THR X 388 5 ? 5  
HELX_P HELX_P278 285 ALA X 393 ? MET X 404 ? ALA X 393 MET X 404 1 ? 12 
HELX_P HELX_P279 286 ASP X 422 ? ASP X 428 ? ASP X 422 ASP X 428 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 172 M . ? LEU 172 M PRO 173 M ? PRO 173 M 1 -0.29 
2 LEU 172 N . ? LEU 172 N PRO 173 N ? PRO 173 N 1 0.10  
3 LEU 172 O . ? LEU 172 O PRO 173 O ? PRO 173 O 1 -0.06 
4 LEU 172 P . ? LEU 172 P PRO 173 P ? PRO 173 P 1 -0.17 
5 LEU 172 Q . ? LEU 172 Q PRO 173 Q ? PRO 173 Q 1 0.05  
6 LEU 172 R . ? LEU 172 R PRO 173 R ? PRO 173 R 1 0.01  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 5 ? 
B  ? 2 ? 
C  ? 2 ? 
D  ? 5 ? 
E  ? 2 ? 
F  ? 2 ? 
G  ? 5 ? 
H  ? 2 ? 
I  ? 2 ? 
J  ? 5 ? 
K  ? 2 ? 
L  ? 2 ? 
M  ? 5 ? 
N  ? 2 ? 
O  ? 2 ? 
P  ? 5 ? 
Q  ? 2 ? 
R  ? 2 ? 
S  ? 5 ? 
T  ? 2 ? 
U  ? 2 ? 
V  ? 5 ? 
W  ? 2 ? 
X  ? 2 ? 
Y  ? 5 ? 
Z  ? 2 ? 
AA ? 2 ? 
AB ? 5 ? 
AC ? 2 ? 
AD ? 2 ? 
AE ? 5 ? 
AF ? 2 ? 
AG ? 2 ? 
AH ? 5 ? 
AI ? 2 ? 
AJ ? 2 ? 
AK ? 4 ? 
AL ? 2 ? 
AM ? 5 ? 
AN ? 4 ? 
AO ? 2 ? 
AP ? 5 ? 
AQ ? 4 ? 
AR ? 2 ? 
AS ? 5 ? 
AT ? 4 ? 
AU ? 2 ? 
AV ? 5 ? 
AW ? 4 ? 
AX ? 2 ? 
AY ? 5 ? 
AZ ? 4 ? 
BA ? 2 ? 
BB ? 5 ? 
BC ? 4 ? 
BD ? 2 ? 
BE ? 5 ? 
BF ? 4 ? 
BG ? 2 ? 
BH ? 5 ? 
BI ? 4 ? 
BJ ? 2 ? 
BK ? 5 ? 
BL ? 4 ? 
BM ? 2 ? 
BN ? 5 ? 
BO ? 4 ? 
BP ? 2 ? 
BQ ? 5 ? 
BR ? 4 ? 
BS ? 2 ? 
BT ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? parallel      
A  2 3 ? parallel      
A  3 4 ? parallel      
A  4 5 ? parallel      
B  1 2 ? anti-parallel 
C  1 2 ? parallel      
D  1 2 ? parallel      
D  2 3 ? parallel      
D  3 4 ? parallel      
D  4 5 ? parallel      
E  1 2 ? anti-parallel 
F  1 2 ? parallel      
G  1 2 ? parallel      
G  2 3 ? parallel      
G  3 4 ? parallel      
G  4 5 ? parallel      
H  1 2 ? anti-parallel 
I  1 2 ? parallel      
J  1 2 ? parallel      
J  2 3 ? parallel      
J  3 4 ? parallel      
J  4 5 ? parallel      
K  1 2 ? anti-parallel 
L  1 2 ? parallel      
M  1 2 ? parallel      
M  2 3 ? parallel      
M  3 4 ? parallel      
M  4 5 ? parallel      
N  1 2 ? anti-parallel 
O  1 2 ? parallel      
P  1 2 ? parallel      
P  2 3 ? parallel      
P  3 4 ? parallel      
P  4 5 ? parallel      
Q  1 2 ? anti-parallel 
R  1 2 ? parallel      
S  1 2 ? parallel      
S  2 3 ? parallel      
S  3 4 ? parallel      
S  4 5 ? parallel      
T  1 2 ? anti-parallel 
U  1 2 ? parallel      
V  1 2 ? parallel      
V  2 3 ? parallel      
V  3 4 ? parallel      
V  4 5 ? parallel      
W  1 2 ? anti-parallel 
X  1 2 ? parallel      
Y  1 2 ? parallel      
Y  2 3 ? parallel      
Y  3 4 ? parallel      
Y  4 5 ? parallel      
Z  1 2 ? anti-parallel 
AA 1 2 ? parallel      
AB 1 2 ? parallel      
AB 2 3 ? parallel      
AB 3 4 ? parallel      
AB 4 5 ? parallel      
AC 1 2 ? anti-parallel 
AD 1 2 ? parallel      
AE 1 2 ? parallel      
AE 2 3 ? parallel      
AE 3 4 ? parallel      
AE 4 5 ? parallel      
AF 1 2 ? anti-parallel 
AG 1 2 ? parallel      
AH 1 2 ? parallel      
AH 2 3 ? parallel      
AH 3 4 ? parallel      
AH 4 5 ? parallel      
AI 1 2 ? anti-parallel 
AJ 1 2 ? parallel      
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AM 4 5 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AO 1 2 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AP 4 5 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AR 1 2 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AS 3 4 ? anti-parallel 
AS 4 5 ? anti-parallel 
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AT 3 4 ? anti-parallel 
AU 1 2 ? anti-parallel 
AV 1 2 ? anti-parallel 
AV 2 3 ? anti-parallel 
AV 3 4 ? anti-parallel 
AV 4 5 ? anti-parallel 
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AW 3 4 ? anti-parallel 
AX 1 2 ? anti-parallel 
AY 1 2 ? anti-parallel 
AY 2 3 ? anti-parallel 
AY 3 4 ? anti-parallel 
AY 4 5 ? anti-parallel 
AZ 1 2 ? anti-parallel 
AZ 2 3 ? anti-parallel 
AZ 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BB 4 5 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BD 1 2 ? anti-parallel 
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BE 3 4 ? anti-parallel 
BE 4 5 ? anti-parallel 
BF 1 2 ? anti-parallel 
BF 2 3 ? anti-parallel 
BF 3 4 ? anti-parallel 
BG 1 2 ? anti-parallel 
BH 1 2 ? anti-parallel 
BH 2 3 ? anti-parallel 
BH 3 4 ? anti-parallel 
BH 4 5 ? anti-parallel 
BI 1 2 ? anti-parallel 
BI 2 3 ? anti-parallel 
BI 3 4 ? anti-parallel 
BJ 1 2 ? anti-parallel 
BK 1 2 ? anti-parallel 
BK 2 3 ? anti-parallel 
BK 3 4 ? anti-parallel 
BK 4 5 ? anti-parallel 
BL 1 2 ? anti-parallel 
BL 2 3 ? anti-parallel 
BL 3 4 ? anti-parallel 
BM 1 2 ? anti-parallel 
BN 1 2 ? anti-parallel 
BN 2 3 ? anti-parallel 
BN 3 4 ? anti-parallel 
BN 4 5 ? anti-parallel 
BO 1 2 ? anti-parallel 
BO 2 3 ? anti-parallel 
BO 3 4 ? anti-parallel 
BP 1 2 ? anti-parallel 
BQ 1 2 ? anti-parallel 
BQ 2 3 ? anti-parallel 
BQ 3 4 ? anti-parallel 
BQ 4 5 ? anti-parallel 
BR 1 2 ? anti-parallel 
BR 2 3 ? anti-parallel 
BR 3 4 ? anti-parallel 
BS 1 2 ? anti-parallel 
BT 1 2 ? anti-parallel 
BT 2 3 ? anti-parallel 
BT 3 4 ? anti-parallel 
BT 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 PHE A 78  ? GLU A 82  ? PHE A 78  GLU A 82  
A  2 ILE A 253 ? ASP A 257 ? ILE A 253 ASP A 257 
A  3 LEU A 304 ? GLY A 309 ? LEU A 304 GLY A 309 
A  4 ILE A 53  ? ILE A 56  ? ILE A 53  ILE A 56  
A  5 ILE A 329 ? GLU A 332 ? ILE A 329 GLU A 332 
B  1 THR A 290 ? THR A 293 ? THR A 290 THR A 293 
B  2 GLY A 296 ? LYS A 299 ? GLY A 296 LYS A 299 
C  1 ASN A 366 ? PHE A 369 ? ASN A 366 PHE A 369 
C  2 THR A 418 ? ILE A 421 ? THR A 418 ILE A 421 
D  1 PHE B 78  ? GLU B 82  ? PHE B 78  GLU B 82  
D  2 ILE B 253 ? ASP B 257 ? ILE B 253 ASP B 257 
D  3 LEU B 304 ? GLY B 309 ? LEU B 304 GLY B 309 
D  4 ILE B 53  ? ILE B 56  ? ILE B 53  ILE B 56  
D  5 ILE B 329 ? GLU B 332 ? ILE B 329 GLU B 332 
E  1 THR B 290 ? THR B 293 ? THR B 290 THR B 293 
E  2 GLY B 296 ? LYS B 299 ? GLY B 296 LYS B 299 
F  1 ASN B 366 ? PHE B 369 ? ASN B 366 PHE B 369 
F  2 THR B 418 ? ILE B 421 ? THR B 418 ILE B 421 
G  1 PHE C 78  ? GLU C 82  ? PHE C 78  GLU C 82  
G  2 ILE C 253 ? ASP C 257 ? ILE C 253 ASP C 257 
G  3 LEU C 304 ? GLY C 309 ? LEU C 304 GLY C 309 
G  4 ILE C 53  ? ILE C 56  ? ILE C 53  ILE C 56  
G  5 ILE C 329 ? GLU C 332 ? ILE C 329 GLU C 332 
H  1 THR C 290 ? THR C 293 ? THR C 290 THR C 293 
H  2 GLY C 296 ? LYS C 299 ? GLY C 296 LYS C 299 
I  1 ASN C 366 ? PHE C 369 ? ASN C 366 PHE C 369 
I  2 THR C 418 ? ILE C 421 ? THR C 418 ILE C 421 
J  1 PHE D 78  ? GLU D 82  ? PHE D 78  GLU D 82  
J  2 ILE D 253 ? ASP D 257 ? ILE D 253 ASP D 257 
J  3 LEU D 304 ? GLY D 309 ? LEU D 304 GLY D 309 
J  4 ILE D 53  ? ILE D 56  ? ILE D 53  ILE D 56  
J  5 ILE D 329 ? GLU D 332 ? ILE D 329 GLU D 332 
K  1 THR D 290 ? THR D 293 ? THR D 290 THR D 293 
K  2 GLY D 296 ? LYS D 299 ? GLY D 296 LYS D 299 
L  1 ASN D 366 ? PHE D 369 ? ASN D 366 PHE D 369 
L  2 THR D 418 ? ILE D 421 ? THR D 418 ILE D 421 
M  1 PHE E 78  ? GLU E 82  ? PHE E 78  GLU E 82  
M  2 ILE E 253 ? ASP E 257 ? ILE E 253 ASP E 257 
M  3 LEU E 304 ? GLY E 309 ? LEU E 304 GLY E 309 
M  4 ILE E 53  ? ILE E 56  ? ILE E 53  ILE E 56  
M  5 ILE E 329 ? GLU E 332 ? ILE E 329 GLU E 332 
N  1 THR E 290 ? THR E 293 ? THR E 290 THR E 293 
N  2 GLY E 296 ? LYS E 299 ? GLY E 296 LYS E 299 
O  1 ASN E 366 ? PHE E 369 ? ASN E 366 PHE E 369 
O  2 THR E 418 ? ILE E 421 ? THR E 418 ILE E 421 
P  1 PHE F 78  ? GLU F 82  ? PHE F 78  GLU F 82  
P  2 ILE F 253 ? ASP F 257 ? ILE F 253 ASP F 257 
P  3 LEU F 304 ? GLY F 309 ? LEU F 304 GLY F 309 
P  4 ILE F 53  ? ILE F 56  ? ILE F 53  ILE F 56  
P  5 ILE F 329 ? GLU F 332 ? ILE F 329 GLU F 332 
Q  1 THR F 290 ? THR F 293 ? THR F 290 THR F 293 
Q  2 GLY F 296 ? LYS F 299 ? GLY F 296 LYS F 299 
R  1 ASN F 366 ? PHE F 369 ? ASN F 366 PHE F 369 
R  2 THR F 418 ? ILE F 421 ? THR F 418 ILE F 421 
S  1 PHE S 78  ? GLU S 82  ? PHE S 78  GLU S 82  
S  2 ILE S 253 ? ASP S 257 ? ILE S 253 ASP S 257 
S  3 LEU S 304 ? GLY S 309 ? LEU S 304 GLY S 309 
S  4 ILE S 53  ? ILE S 56  ? ILE S 53  ILE S 56  
S  5 ILE S 329 ? GLU S 332 ? ILE S 329 GLU S 332 
T  1 THR S 290 ? THR S 293 ? THR S 290 THR S 293 
T  2 GLY S 296 ? LYS S 299 ? GLY S 296 LYS S 299 
U  1 ASN S 366 ? PHE S 369 ? ASN S 366 PHE S 369 
U  2 THR S 418 ? ILE S 421 ? THR S 418 ILE S 421 
V  1 PHE T 78  ? GLU T 82  ? PHE T 78  GLU T 82  
V  2 ILE T 253 ? ASP T 257 ? ILE T 253 ASP T 257 
V  3 LEU T 304 ? GLY T 309 ? LEU T 304 GLY T 309 
V  4 ILE T 53  ? ILE T 56  ? ILE T 53  ILE T 56  
V  5 ILE T 329 ? GLU T 332 ? ILE T 329 GLU T 332 
W  1 THR T 290 ? THR T 293 ? THR T 290 THR T 293 
W  2 GLY T 296 ? LYS T 299 ? GLY T 296 LYS T 299 
X  1 ASN T 366 ? PHE T 369 ? ASN T 366 PHE T 369 
X  2 THR T 418 ? ILE T 421 ? THR T 418 ILE T 421 
Y  1 PHE U 78  ? GLU U 82  ? PHE U 78  GLU U 82  
Y  2 ILE U 253 ? ASP U 257 ? ILE U 253 ASP U 257 
Y  3 LEU U 304 ? GLY U 309 ? LEU U 304 GLY U 309 
Y  4 ILE U 53  ? ILE U 56  ? ILE U 53  ILE U 56  
Y  5 ILE U 329 ? GLU U 332 ? ILE U 329 GLU U 332 
Z  1 THR U 290 ? THR U 293 ? THR U 290 THR U 293 
Z  2 GLY U 296 ? LYS U 299 ? GLY U 296 LYS U 299 
AA 1 ASN U 366 ? PHE U 369 ? ASN U 366 PHE U 369 
AA 2 THR U 418 ? ILE U 421 ? THR U 418 ILE U 421 
AB 1 PHE V 78  ? GLU V 82  ? PHE V 78  GLU V 82  
AB 2 ILE V 253 ? ASP V 257 ? ILE V 253 ASP V 257 
AB 3 LEU V 304 ? GLY V 309 ? LEU V 304 GLY V 309 
AB 4 ILE V 53  ? ILE V 56  ? ILE V 53  ILE V 56  
AB 5 ILE V 329 ? GLU V 332 ? ILE V 329 GLU V 332 
AC 1 THR V 290 ? THR V 293 ? THR V 290 THR V 293 
AC 2 GLY V 296 ? LYS V 299 ? GLY V 296 LYS V 299 
AD 1 ASN V 366 ? PHE V 369 ? ASN V 366 PHE V 369 
AD 2 THR V 418 ? ILE V 421 ? THR V 418 ILE V 421 
AE 1 PHE W 78  ? GLU W 82  ? PHE W 78  GLU W 82  
AE 2 ILE W 253 ? ASP W 257 ? ILE W 253 ASP W 257 
AE 3 LEU W 304 ? GLY W 309 ? LEU W 304 GLY W 309 
AE 4 ILE W 53  ? ILE W 56  ? ILE W 53  ILE W 56  
AE 5 ILE W 329 ? GLU W 332 ? ILE W 329 GLU W 332 
AF 1 THR W 290 ? THR W 293 ? THR W 290 THR W 293 
AF 2 GLY W 296 ? LYS W 299 ? GLY W 296 LYS W 299 
AG 1 ASN W 366 ? PHE W 369 ? ASN W 366 PHE W 369 
AG 2 THR W 418 ? ILE W 421 ? THR W 418 ILE W 421 
AH 1 PHE X 78  ? GLU X 82  ? PHE X 78  GLU X 82  
AH 2 ILE X 253 ? ASP X 257 ? ILE X 253 ASP X 257 
AH 3 LEU X 304 ? GLY X 309 ? LEU X 304 GLY X 309 
AH 4 ILE X 53  ? ILE X 56  ? ILE X 53  ILE X 56  
AH 5 ILE X 329 ? GLU X 332 ? ILE X 329 GLU X 332 
AI 1 THR X 290 ? THR X 293 ? THR X 290 THR X 293 
AI 2 GLY X 296 ? LYS X 299 ? GLY X 296 LYS X 299 
AJ 1 ASN X 366 ? PHE X 369 ? ASN X 366 PHE X 369 
AJ 2 THR X 418 ? ILE X 421 ? THR X 418 ILE X 421 
AK 1 ILE G 120 ? GLY G 124 ? ILE G 120 GLY G 124 
AK 2 THR G 2   ? ARG G 7   ? THR G 2   ARG G 7   
AK 3 VAL G 12  ? GLY G 16  ? VAL G 12  GLY G 16  
AK 4 THR G 168 ? LEU G 172 ? THR G 168 LEU G 172 
AL 1 VAL G 20  ? LEU G 22  ? VAL G 20  LEU G 22  
AL 2 THR G 25  ? LYS G 28  ? THR G 25  LYS G 28  
AM 1 VAL G 34  ? LEU G 37  ? VAL G 34  LEU G 37  
AM 2 VAL G 42  ? GLY G 48  ? VAL G 42  GLY G 48  
AM 3 ALA G 93  ? ASP G 99  ? ALA G 93  ASP G 99  
AM 4 SER G 103 ? THR G 107 ? SER G 103 THR G 107 
AM 5 ASP G 111 ? VAL G 113 ? ASP G 111 VAL G 113 
AN 1 ILE H 120 ? GLY H 124 ? ILE H 120 GLY H 124 
AN 2 THR H 2   ? ARG H 7   ? THR H 2   ARG H 7   
AN 3 VAL H 12  ? GLY H 16  ? VAL H 12  GLY H 16  
AN 4 THR H 168 ? LEU H 172 ? THR H 168 LEU H 172 
AO 1 VAL H 20  ? LEU H 22  ? VAL H 20  LEU H 22  
AO 2 THR H 25  ? LYS H 28  ? THR H 25  LYS H 28  
AP 1 VAL H 34  ? LEU H 37  ? VAL H 34  LEU H 37  
AP 2 VAL H 42  ? GLY H 48  ? VAL H 42  GLY H 48  
AP 3 ALA H 93  ? ASP H 99  ? ALA H 93  ASP H 99  
AP 4 SER H 103 ? THR H 107 ? SER H 103 THR H 107 
AP 5 ASP H 111 ? VAL H 113 ? ASP H 111 VAL H 113 
AQ 1 ILE I 120 ? GLY I 124 ? ILE I 120 GLY I 124 
AQ 2 THR I 2   ? ARG I 7   ? THR I 2   ARG I 7   
AQ 3 VAL I 12  ? GLY I 16  ? VAL I 12  GLY I 16  
AQ 4 THR I 168 ? LEU I 172 ? THR I 168 LEU I 172 
AR 1 VAL I 20  ? LEU I 22  ? VAL I 20  LEU I 22  
AR 2 THR I 25  ? LYS I 28  ? THR I 25  LYS I 28  
AS 1 VAL I 34  ? LEU I 37  ? VAL I 34  LEU I 37  
AS 2 VAL I 42  ? GLY I 48  ? VAL I 42  GLY I 48  
AS 3 ALA I 93  ? ASP I 99  ? ALA I 93  ASP I 99  
AS 4 SER I 103 ? THR I 107 ? SER I 103 THR I 107 
AS 5 VAL I 112 ? VAL I 113 ? VAL I 112 VAL I 113 
AT 1 ILE J 120 ? GLY J 124 ? ILE J 120 GLY J 124 
AT 2 THR J 2   ? ARG J 7   ? THR J 2   ARG J 7   
AT 3 VAL J 12  ? GLY J 16  ? VAL J 12  GLY J 16  
AT 4 THR J 168 ? LEU J 172 ? THR J 168 LEU J 172 
AU 1 VAL J 20  ? LEU J 22  ? VAL J 20  LEU J 22  
AU 2 THR J 25  ? LYS J 28  ? THR J 25  LYS J 28  
AV 1 VAL J 34  ? LEU J 37  ? VAL J 34  LEU J 37  
AV 2 VAL J 42  ? GLY J 48  ? VAL J 42  GLY J 48  
AV 3 ALA J 93  ? ASP J 99  ? ALA J 93  ASP J 99  
AV 4 SER J 103 ? THR J 107 ? SER J 103 THR J 107 
AV 5 VAL J 112 ? VAL J 113 ? VAL J 112 VAL J 113 
AW 1 ILE K 120 ? GLY K 124 ? ILE K 120 GLY K 124 
AW 2 THR K 2   ? ARG K 7   ? THR K 2   ARG K 7   
AW 3 VAL K 12  ? GLY K 16  ? VAL K 12  GLY K 16  
AW 4 THR K 168 ? GLU K 171 ? THR K 168 GLU K 171 
AX 1 VAL K 20  ? LEU K 22  ? VAL K 20  LEU K 22  
AX 2 THR K 25  ? LYS K 28  ? THR K 25  LYS K 28  
AY 1 VAL K 34  ? LEU K 37  ? VAL K 34  LEU K 37  
AY 2 VAL K 42  ? GLY K 48  ? VAL K 42  GLY K 48  
AY 3 ALA K 93  ? ASP K 99  ? ALA K 93  ASP K 99  
AY 4 SER K 103 ? THR K 107 ? SER K 103 THR K 107 
AY 5 ASP K 111 ? VAL K 113 ? ASP K 111 VAL K 113 
AZ 1 ILE L 120 ? GLY L 124 ? ILE L 120 GLY L 124 
AZ 2 THR L 2   ? ARG L 7   ? THR L 2   ARG L 7   
AZ 3 VAL L 12  ? GLY L 16  ? VAL L 12  GLY L 16  
AZ 4 THR L 168 ? GLU L 171 ? THR L 168 GLU L 171 
BA 1 VAL L 20  ? LEU L 22  ? VAL L 20  LEU L 22  
BA 2 THR L 25  ? LYS L 28  ? THR L 25  LYS L 28  
BB 1 VAL L 34  ? LEU L 37  ? VAL L 34  LEU L 37  
BB 2 VAL L 42  ? GLY L 48  ? VAL L 42  GLY L 48  
BB 3 ALA L 93  ? ASP L 99  ? ALA L 93  ASP L 99  
BB 4 SER L 103 ? THR L 107 ? SER L 103 THR L 107 
BB 5 VAL L 112 ? VAL L 113 ? VAL L 112 VAL L 113 
BC 1 LEU M 121 ? ILE M 123 ? LEU M 121 ILE M 123 
BC 2 ILE M 3   ? ARG M 7   ? ILE M 3   ARG M 7   
BC 3 VAL M 12  ? GLY M 16  ? VAL M 12  GLY M 16  
BC 4 THR M 168 ? LEU M 172 ? THR M 168 LEU M 172 
BD 1 VAL M 20  ? LEU M 22  ? VAL M 20  LEU M 22  
BD 2 THR M 25  ? LYS M 28  ? THR M 25  LYS M 28  
BE 1 VAL M 34  ? LEU M 37  ? VAL M 34  LEU M 37  
BE 2 VAL M 42  ? GLY M 48  ? VAL M 42  GLY M 48  
BE 3 LEU M 91  ? ASP M 99  ? LEU M 91  ASP M 99  
BE 4 SER M 103 ? GLY M 108 ? SER M 103 GLY M 108 
BE 5 ASP M 111 ? VAL M 113 ? ASP M 111 VAL M 113 
BF 1 ILE N 120 ? ILE N 123 ? ILE N 120 ILE N 123 
BF 2 ILE N 3   ? VAL N 6   ? ILE N 3   VAL N 6   
BF 3 VAL N 12  ? GLY N 16  ? VAL N 12  GLY N 16  
BF 4 THR N 168 ? LEU N 172 ? THR N 168 LEU N 172 
BG 1 VAL N 20  ? LEU N 22  ? VAL N 20  LEU N 22  
BG 2 THR N 25  ? LYS N 28  ? THR N 25  LYS N 28  
BH 1 VAL N 34  ? LEU N 37  ? VAL N 34  LEU N 37  
BH 2 VAL N 42  ? GLY N 48  ? VAL N 42  GLY N 48  
BH 3 LEU N 91  ? ASP N 99  ? LEU N 91  ASP N 99  
BH 4 SER N 103 ? GLY N 108 ? SER N 103 GLY N 108 
BH 5 ASP N 111 ? VAL N 113 ? ASP N 111 VAL N 113 
BI 1 ILE O 120 ? ILE O 123 ? ILE O 120 ILE O 123 
BI 2 ILE O 3   ? VAL O 6   ? ILE O 3   VAL O 6   
BI 3 VAL O 12  ? GLY O 16  ? VAL O 12  GLY O 16  
BI 4 THR O 168 ? LEU O 172 ? THR O 168 LEU O 172 
BJ 1 VAL O 20  ? LEU O 22  ? VAL O 20  LEU O 22  
BJ 2 THR O 25  ? LYS O 28  ? THR O 25  LYS O 28  
BK 1 VAL O 34  ? LEU O 37  ? VAL O 34  LEU O 37  
BK 2 VAL O 42  ? GLY O 48  ? VAL O 42  GLY O 48  
BK 3 LEU O 91  ? ASP O 99  ? LEU O 91  ASP O 99  
BK 4 SER O 103 ? GLY O 108 ? SER O 103 GLY O 108 
BK 5 ASP O 111 ? VAL O 113 ? ASP O 111 VAL O 113 
BL 1 ILE P 120 ? ILE P 123 ? ILE P 120 ILE P 123 
BL 2 ILE P 3   ? ARG P 7   ? ILE P 3   ARG P 7   
BL 3 VAL P 12  ? GLY P 16  ? VAL P 12  GLY P 16  
BL 4 THR P 168 ? LEU P 172 ? THR P 168 LEU P 172 
BM 1 VAL P 20  ? LEU P 22  ? VAL P 20  LEU P 22  
BM 2 THR P 25  ? LYS P 28  ? THR P 25  LYS P 28  
BN 1 VAL P 34  ? LEU P 37  ? VAL P 34  LEU P 37  
BN 2 VAL P 42  ? GLY P 48  ? VAL P 42  GLY P 48  
BN 3 LEU P 91  ? ASP P 99  ? LEU P 91  ASP P 99  
BN 4 SER P 103 ? GLY P 108 ? SER P 103 GLY P 108 
BN 5 ASP P 111 ? VAL P 113 ? ASP P 111 VAL P 113 
BO 1 ILE Q 120 ? ILE Q 123 ? ILE Q 120 ILE Q 123 
BO 2 ILE Q 3   ? ARG Q 7   ? ILE Q 3   ARG Q 7   
BO 3 VAL Q 12  ? GLY Q 16  ? VAL Q 12  GLY Q 16  
BO 4 THR Q 168 ? LEU Q 172 ? THR Q 168 LEU Q 172 
BP 1 VAL Q 20  ? LEU Q 22  ? VAL Q 20  LEU Q 22  
BP 2 THR Q 25  ? LYS Q 28  ? THR Q 25  LYS Q 28  
BQ 1 VAL Q 34  ? LEU Q 37  ? VAL Q 34  LEU Q 37  
BQ 2 VAL Q 42  ? GLY Q 48  ? VAL Q 42  GLY Q 48  
BQ 3 LEU Q 91  ? ASP Q 99  ? LEU Q 91  ASP Q 99  
BQ 4 SER Q 103 ? GLY Q 108 ? SER Q 103 GLY Q 108 
BQ 5 ASP Q 111 ? VAL Q 113 ? ASP Q 111 VAL Q 113 
BR 1 ILE R 120 ? ILE R 123 ? ILE R 120 ILE R 123 
BR 2 ILE R 3   ? ARG R 7   ? ILE R 3   ARG R 7   
BR 3 VAL R 12  ? GLY R 16  ? VAL R 12  GLY R 16  
BR 4 THR R 168 ? LEU R 172 ? THR R 168 LEU R 172 
BS 1 VAL R 20  ? LEU R 22  ? VAL R 20  LEU R 22  
BS 2 THR R 25  ? LYS R 28  ? THR R 25  LYS R 28  
BT 1 VAL R 34  ? LEU R 37  ? VAL R 34  LEU R 37  
BT 2 VAL R 42  ? GLY R 48  ? VAL R 42  GLY R 48  
BT 3 LEU R 91  ? ASP R 99  ? LEU R 91  ASP R 99  
BT 4 SER R 103 ? GLY R 108 ? SER R 103 GLY R 108 
BT 5 ASP R 111 ? VAL R 113 ? ASP R 111 VAL R 113 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N ILE A 79  ? N ILE A 79  O ILE A 253 ? O ILE A 253 
A  2 3 N VAL A 254 ? N VAL A 254 O LEU A 304 ? O LEU A 304 
A  3 4 N ALA A 307 ? N ALA A 307 O ILE A 53  ? O ILE A 53  
A  4 5 N LEU A 54  ? N LEU A 54  O ILE A 329 ? O ILE A 329 
B  1 2 N THR A 293 ? N THR A 293 O GLY A 296 ? O GLY A 296 
C  1 2 O ASN A 366 ? O ASN A 366 N VAL A 419 ? N VAL A 419 
D  1 2 N ILE B 79  ? N ILE B 79  O ILE B 253 ? O ILE B 253 
D  2 3 N VAL B 254 ? N VAL B 254 O LEU B 304 ? O LEU B 304 
D  3 4 N ALA B 307 ? N ALA B 307 O ILE B 53  ? O ILE B 53  
D  4 5 N LEU B 54  ? N LEU B 54  O ILE B 329 ? O ILE B 329 
E  1 2 N THR B 293 ? N THR B 293 O GLY B 296 ? O GLY B 296 
F  1 2 O ASN B 366 ? O ASN B 366 N VAL B 419 ? N VAL B 419 
G  1 2 N ILE C 79  ? N ILE C 79  O ILE C 253 ? O ILE C 253 
G  2 3 N VAL C 254 ? N VAL C 254 O LEU C 304 ? O LEU C 304 
G  3 4 N ALA C 307 ? N ALA C 307 O ILE C 53  ? O ILE C 53  
G  4 5 N LEU C 54  ? N LEU C 54  O ILE C 329 ? O ILE C 329 
H  1 2 N THR C 293 ? N THR C 293 O GLY C 296 ? O GLY C 296 
I  1 2 O ASN C 366 ? O ASN C 366 N VAL C 419 ? N VAL C 419 
J  1 2 N ILE D 79  ? N ILE D 79  O ILE D 253 ? O ILE D 253 
J  2 3 N VAL D 254 ? N VAL D 254 O LEU D 304 ? O LEU D 304 
J  3 4 N ALA D 307 ? N ALA D 307 O ILE D 53  ? O ILE D 53  
J  4 5 N LEU D 54  ? N LEU D 54  O ILE D 329 ? O ILE D 329 
K  1 2 N THR D 293 ? N THR D 293 O GLY D 296 ? O GLY D 296 
L  1 2 N ALA D 368 ? N ALA D 368 O VAL D 419 ? O VAL D 419 
M  1 2 N ILE E 79  ? N ILE E 79  O ILE E 253 ? O ILE E 253 
M  2 3 N VAL E 254 ? N VAL E 254 O LEU E 304 ? O LEU E 304 
M  3 4 N ALA E 307 ? N ALA E 307 O ILE E 53  ? O ILE E 53  
M  4 5 N LEU E 54  ? N LEU E 54  O ILE E 329 ? O ILE E 329 
N  1 2 N THR E 293 ? N THR E 293 O GLY E 296 ? O GLY E 296 
O  1 2 O ASN E 366 ? O ASN E 366 N VAL E 419 ? N VAL E 419 
P  1 2 N ILE F 79  ? N ILE F 79  O ILE F 253 ? O ILE F 253 
P  2 3 N VAL F 254 ? N VAL F 254 O LEU F 304 ? O LEU F 304 
P  3 4 N ALA F 307 ? N ALA F 307 O ILE F 53  ? O ILE F 53  
P  4 5 N LEU F 54  ? N LEU F 54  O ILE F 329 ? O ILE F 329 
Q  1 2 N THR F 293 ? N THR F 293 O GLY F 296 ? O GLY F 296 
R  1 2 O ASN F 366 ? O ASN F 366 N VAL F 419 ? N VAL F 419 
S  1 2 N ILE S 79  ? N ILE S 79  O ILE S 253 ? O ILE S 253 
S  2 3 N VAL S 254 ? N VAL S 254 O LEU S 304 ? O LEU S 304 
S  3 4 O PHE S 305 ? O PHE S 305 N ILE S 53  ? N ILE S 53  
S  4 5 N LEU S 54  ? N LEU S 54  O ILE S 329 ? O ILE S 329 
T  1 2 N THR S 293 ? N THR S 293 O GLY S 296 ? O GLY S 296 
U  1 2 N ALA S 368 ? N ALA S 368 O VAL S 419 ? O VAL S 419 
V  1 2 N ILE T 79  ? N ILE T 79  O ILE T 253 ? O ILE T 253 
V  2 3 N VAL T 254 ? N VAL T 254 O LEU T 304 ? O LEU T 304 
V  3 4 O PHE T 305 ? O PHE T 305 N ILE T 53  ? N ILE T 53  
V  4 5 N LEU T 54  ? N LEU T 54  O ILE T 329 ? O ILE T 329 
W  1 2 N THR T 293 ? N THR T 293 O GLY T 296 ? O GLY T 296 
X  1 2 N ALA T 368 ? N ALA T 368 O VAL T 419 ? O VAL T 419 
Y  1 2 N ILE U 79  ? N ILE U 79  O ILE U 253 ? O ILE U 253 
Y  2 3 N VAL U 254 ? N VAL U 254 O LEU U 304 ? O LEU U 304 
Y  3 4 O PHE U 305 ? O PHE U 305 N ILE U 53  ? N ILE U 53  
Y  4 5 N LEU U 54  ? N LEU U 54  O ILE U 329 ? O ILE U 329 
Z  1 2 N THR U 293 ? N THR U 293 O GLY U 296 ? O GLY U 296 
AA 1 2 N ALA U 368 ? N ALA U 368 O VAL U 419 ? O VAL U 419 
AB 1 2 N ILE V 79  ? N ILE V 79  O ILE V 253 ? O ILE V 253 
AB 2 3 N VAL V 254 ? N VAL V 254 O LEU V 304 ? O LEU V 304 
AB 3 4 O PHE V 305 ? O PHE V 305 N ILE V 53  ? N ILE V 53  
AB 4 5 N LEU V 54  ? N LEU V 54  O ILE V 329 ? O ILE V 329 
AC 1 2 N THR V 293 ? N THR V 293 O GLY V 296 ? O GLY V 296 
AD 1 2 N ALA V 368 ? N ALA V 368 O VAL V 419 ? O VAL V 419 
AE 1 2 N ILE W 79  ? N ILE W 79  O ILE W 253 ? O ILE W 253 
AE 2 3 N VAL W 254 ? N VAL W 254 O LEU W 304 ? O LEU W 304 
AE 3 4 O PHE W 305 ? O PHE W 305 N ILE W 53  ? N ILE W 53  
AE 4 5 N LEU W 54  ? N LEU W 54  O ILE W 329 ? O ILE W 329 
AF 1 2 N THR W 293 ? N THR W 293 O GLY W 296 ? O GLY W 296 
AG 1 2 N ALA W 368 ? N ALA W 368 O VAL W 419 ? O VAL W 419 
AH 1 2 N ILE X 79  ? N ILE X 79  O ILE X 253 ? O ILE X 253 
AH 2 3 N VAL X 254 ? N VAL X 254 O LEU X 304 ? O LEU X 304 
AH 3 4 O PHE X 305 ? O PHE X 305 N ILE X 53  ? N ILE X 53  
AH 4 5 N LEU X 54  ? N LEU X 54  O ILE X 329 ? O ILE X 329 
AI 1 2 N THR X 293 ? N THR X 293 O GLY X 296 ? O GLY X 296 
AJ 1 2 N ALA X 368 ? N ALA X 368 O VAL X 419 ? O VAL X 419 
AK 1 2 O ILE G 123 ? O ILE G 123 N ILE G 3   ? N ILE G 3   
AK 2 3 O VAL G 6   ? O VAL G 6   N VAL G 13  ? N VAL G 13  
AK 3 4 O GLY G 16  ? O GLY G 16  N THR G 168 ? N THR G 168 
AL 1 2 N LEU G 22  ? N LEU G 22  O THR G 25  ? O THR G 25  
AM 1 2 N LEU G 37  ? N LEU G 37  O VAL G 42  ? O VAL G 42  
AM 2 3 O ALA G 47  ? O ALA G 47  N MET G 94  ? N MET G 94  
AM 3 4 O VAL G 97  ? O VAL G 97  N LEU G 104 ? N LEU G 104 
AM 4 5 N THR G 107 ? N THR G 107 O ASP G 111 ? O ASP G 111 
AN 1 2 O ILE H 123 ? O ILE H 123 N ILE H 3   ? N ILE H 3   
AN 2 3 O VAL H 6   ? O VAL H 6   N VAL H 13  ? N VAL H 13  
AN 3 4 O GLY H 16  ? O GLY H 16  N THR H 168 ? N THR H 168 
AO 1 2 N LEU H 22  ? N LEU H 22  O THR H 25  ? O THR H 25  
AP 1 2 N LEU H 37  ? N LEU H 37  O VAL H 42  ? O VAL H 42  
AP 2 3 O ALA H 47  ? O ALA H 47  N MET H 94  ? N MET H 94  
AP 3 4 O VAL H 97  ? O VAL H 97  N LEU H 104 ? N LEU H 104 
AP 4 5 N THR H 107 ? N THR H 107 O ASP H 111 ? O ASP H 111 
AQ 1 2 O ILE I 123 ? O ILE I 123 N ILE I 3   ? N ILE I 3   
AQ 2 3 O VAL I 6   ? O VAL I 6   N VAL I 13  ? N VAL I 13  
AQ 3 4 O GLY I 16  ? O GLY I 16  N THR I 168 ? N THR I 168 
AR 1 2 N LEU I 22  ? N LEU I 22  O THR I 25  ? O THR I 25  
AS 1 2 N LEU I 37  ? N LEU I 37  O VAL I 42  ? O VAL I 42  
AS 2 3 N ALA I 47  ? N ALA I 47  O MET I 94  ? O MET I 94  
AS 3 4 O VAL I 97  ? O VAL I 97  N LEU I 104 ? N LEU I 104 
AS 4 5 O ILE I 105 ? O ILE I 105 N VAL I 113 ? N VAL I 113 
AT 1 2 N ILE J 123 ? N ILE J 123 O ILE J 3   ? O ILE J 3   
AT 2 3 O VAL J 6   ? O VAL J 6   N VAL J 13  ? N VAL J 13  
AT 3 4 O GLY J 16  ? O GLY J 16  N THR J 168 ? N THR J 168 
AU 1 2 N LEU J 22  ? N LEU J 22  O THR J 25  ? O THR J 25  
AV 1 2 N LEU J 37  ? N LEU J 37  O VAL J 42  ? O VAL J 42  
AV 2 3 O ALA J 47  ? O ALA J 47  N MET J 94  ? N MET J 94  
AV 3 4 O VAL J 97  ? O VAL J 97  N LEU J 104 ? N LEU J 104 
AV 4 5 O ILE J 105 ? O ILE J 105 N VAL J 113 ? N VAL J 113 
AW 1 2 N ILE K 123 ? N ILE K 123 O ILE K 3   ? O ILE K 3   
AW 2 3 O VAL K 6   ? O VAL K 6   N VAL K 13  ? N VAL K 13  
AW 3 4 N GLY K 16  ? N GLY K 16  O THR K 168 ? O THR K 168 
AX 1 2 N LEU K 22  ? N LEU K 22  O THR K 25  ? O THR K 25  
AY 1 2 N LEU K 37  ? N LEU K 37  O VAL K 42  ? O VAL K 42  
AY 2 3 N ALA K 47  ? N ALA K 47  O MET K 94  ? O MET K 94  
AY 3 4 O VAL K 97  ? O VAL K 97  N LEU K 104 ? N LEU K 104 
AY 4 5 N THR K 107 ? N THR K 107 O ASP K 111 ? O ASP K 111 
AZ 1 2 N ILE L 123 ? N ILE L 123 O ILE L 3   ? O ILE L 3   
AZ 2 3 O VAL L 6   ? O VAL L 6   N VAL L 13  ? N VAL L 13  
AZ 3 4 N GLY L 16  ? N GLY L 16  O THR L 168 ? O THR L 168 
BA 1 2 N LEU L 22  ? N LEU L 22  O THR L 25  ? O THR L 25  
BB 1 2 N LEU L 37  ? N LEU L 37  O VAL L 42  ? O VAL L 42  
BB 2 3 O ALA L 47  ? O ALA L 47  N MET L 94  ? N MET L 94  
BB 3 4 O VAL L 97  ? O VAL L 97  N LEU L 104 ? N LEU L 104 
BB 4 5 N ILE L 105 ? N ILE L 105 O VAL L 113 ? O VAL L 113 
BC 1 2 O ILE M 123 ? O ILE M 123 N ILE M 3   ? N ILE M 3   
BC 2 3 O VAL M 6   ? O VAL M 6   N VAL M 13  ? N VAL M 13  
BC 3 4 O GLY M 16  ? O GLY M 16  N THR M 168 ? N THR M 168 
BD 1 2 O LEU M 22  ? O LEU M 22  N THR M 25  ? N THR M 25  
BE 1 2 N LEU M 37  ? N LEU M 37  O VAL M 42  ? O VAL M 42  
BE 2 3 O ALA M 47  ? O ALA M 47  N MET M 94  ? N MET M 94  
BE 3 4 O VAL M 97  ? O VAL M 97  N LEU M 104 ? N LEU M 104 
BE 4 5 N THR M 107 ? N THR M 107 O ASP M 111 ? O ASP M 111 
BF 1 2 O ILE N 123 ? O ILE N 123 N ILE N 3   ? N ILE N 3   
BF 2 3 O VAL N 6   ? O VAL N 6   N VAL N 13  ? N VAL N 13  
BF 3 4 O GLY N 16  ? O GLY N 16  N THR N 168 ? N THR N 168 
BG 1 2 O LEU N 22  ? O LEU N 22  N THR N 25  ? N THR N 25  
BH 1 2 N LEU N 37  ? N LEU N 37  O VAL N 42  ? O VAL N 42  
BH 2 3 O ALA N 47  ? O ALA N 47  N MET N 94  ? N MET N 94  
BH 3 4 O VAL N 97  ? O VAL N 97  N LEU N 104 ? N LEU N 104 
BH 4 5 N THR N 107 ? N THR N 107 O ASP N 111 ? O ASP N 111 
BI 1 2 O ILE O 123 ? O ILE O 123 N ILE O 3   ? N ILE O 3   
BI 2 3 O VAL O 6   ? O VAL O 6   N VAL O 13  ? N VAL O 13  
BI 3 4 O GLY O 16  ? O GLY O 16  N THR O 168 ? N THR O 168 
BJ 1 2 O LEU O 22  ? O LEU O 22  N THR O 25  ? N THR O 25  
BK 1 2 N LEU O 37  ? N LEU O 37  O VAL O 42  ? O VAL O 42  
BK 2 3 O ALA O 47  ? O ALA O 47  N MET O 94  ? N MET O 94  
BK 3 4 O VAL O 97  ? O VAL O 97  N LEU O 104 ? N LEU O 104 
BK 4 5 N THR O 107 ? N THR O 107 O ASP O 111 ? O ASP O 111 
BL 1 2 O ILE P 123 ? O ILE P 123 N ILE P 3   ? N ILE P 3   
BL 2 3 O VAL P 6   ? O VAL P 6   N VAL P 13  ? N VAL P 13  
BL 3 4 O GLY P 16  ? O GLY P 16  N THR P 168 ? N THR P 168 
BM 1 2 O LEU P 22  ? O LEU P 22  N THR P 25  ? N THR P 25  
BN 1 2 N LEU P 37  ? N LEU P 37  O VAL P 42  ? O VAL P 42  
BN 2 3 O ALA P 47  ? O ALA P 47  N MET P 94  ? N MET P 94  
BN 3 4 O VAL P 97  ? O VAL P 97  N LEU P 104 ? N LEU P 104 
BN 4 5 N THR P 107 ? N THR P 107 O ASP P 111 ? O ASP P 111 
BO 1 2 O ILE Q 123 ? O ILE Q 123 N ILE Q 3   ? N ILE Q 3   
BO 2 3 O VAL Q 6   ? O VAL Q 6   N VAL Q 13  ? N VAL Q 13  
BO 3 4 O GLY Q 16  ? O GLY Q 16  N THR Q 168 ? N THR Q 168 
BP 1 2 O LEU Q 22  ? O LEU Q 22  N THR Q 25  ? N THR Q 25  
BQ 1 2 N LEU Q 37  ? N LEU Q 37  O VAL Q 42  ? O VAL Q 42  
BQ 2 3 O ALA Q 47  ? O ALA Q 47  N MET Q 94  ? N MET Q 94  
BQ 3 4 O VAL Q 97  ? O VAL Q 97  N LEU Q 104 ? N LEU Q 104 
BQ 4 5 N THR Q 107 ? N THR Q 107 O ASP Q 111 ? O ASP Q 111 
BR 1 2 O ILE R 123 ? O ILE R 123 N ILE R 3   ? N ILE R 3   
BR 2 3 O VAL R 6   ? O VAL R 6   N VAL R 13  ? N VAL R 13  
BR 3 4 O GLY R 16  ? O GLY R 16  N THR R 168 ? N THR R 168 
BS 1 2 O LEU R 22  ? O LEU R 22  N THR R 25  ? N THR R 25  
BT 1 2 N LEU R 37  ? N LEU R 37  O VAL R 42  ? O VAL R 42  
BT 2 3 O ALA R 47  ? O ALA R 47  N MET R 94  ? N MET R 94  
BT 3 4 O VAL R 97  ? O VAL R 97  N LEU R 104 ? N LEU R 104 
BT 4 5 N THR R 107 ? N THR R 107 O ASP R 111 ? O ASP R 111 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ATP A 450' 
AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ATP B 451' 
AC3 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE ATP C 452' 
AC4 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ATP D 453' 
AC5 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ATP E 454' 
AC6 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE ATP F 455' 
AC7 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE ATP S 456' 
AC8 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ATP T 457' 
AC9 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE ATP U 458' 
BC1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE ATP V 459' 
BC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ATP W 460' 
BC3 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ATP X 461' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 15 HIS A 16  ? HIS A 16  . ? 1_555 ? 
2   AC1 15 ILE A 17  ? ILE A 17  . ? 1_555 ? 
3   AC1 15 ILE A 18  ? ILE A 18  . ? 1_555 ? 
4   AC1 15 THR A 59  ? THR A 59  . ? 1_555 ? 
5   AC1 15 GLY A 60  ? GLY A 60  . ? 1_555 ? 
6   AC1 15 VAL A 61  ? VAL A 61  . ? 1_555 ? 
7   AC1 15 GLY A 62  ? GLY A 62  . ? 1_555 ? 
8   AC1 15 LYS A 63  ? LYS A 63  . ? 1_555 ? 
9   AC1 15 THR A 64  ? THR A 64  . ? 1_555 ? 
10  AC1 15 GLU A 65  ? GLU A 65  . ? 1_555 ? 
11  AC1 15 ASP A 257 ? ASP A 257 . ? 1_555 ? 
12  AC1 15 LEU A 336 ? LEU A 336 . ? 1_555 ? 
13  AC1 15 ILE A 344 ? ILE A 344 . ? 1_555 ? 
14  AC1 15 ALA A 393 ? ALA A 393 . ? 1_555 ? 
15  AC1 15 GLU B 322 ? GLU B 322 . ? 1_555 ? 
16  AC2 15 HIS B 16  ? HIS B 16  . ? 1_555 ? 
17  AC2 15 ILE B 17  ? ILE B 17  . ? 1_555 ? 
18  AC2 15 ILE B 18  ? ILE B 18  . ? 1_555 ? 
19  AC2 15 PRO B 58  ? PRO B 58  . ? 1_555 ? 
20  AC2 15 THR B 59  ? THR B 59  . ? 1_555 ? 
21  AC2 15 GLY B 60  ? GLY B 60  . ? 1_555 ? 
22  AC2 15 VAL B 61  ? VAL B 61  . ? 1_555 ? 
23  AC2 15 GLY B 62  ? GLY B 62  . ? 1_555 ? 
24  AC2 15 LYS B 63  ? LYS B 63  . ? 1_555 ? 
25  AC2 15 THR B 64  ? THR B 64  . ? 1_555 ? 
26  AC2 15 GLU B 65  ? GLU B 65  . ? 1_555 ? 
27  AC2 15 ASP B 257 ? ASP B 257 . ? 1_555 ? 
28  AC2 15 LEU B 336 ? LEU B 336 . ? 1_555 ? 
29  AC2 15 ILE B 344 ? ILE B 344 . ? 1_555 ? 
30  AC2 15 ALA B 393 ? ALA B 393 . ? 1_555 ? 
31  AC3 17 HIS C 16  ? HIS C 16  . ? 1_555 ? 
32  AC3 17 ILE C 17  ? ILE C 17  . ? 1_555 ? 
33  AC3 17 ILE C 18  ? ILE C 18  . ? 1_555 ? 
34  AC3 17 PRO C 58  ? PRO C 58  . ? 1_555 ? 
35  AC3 17 THR C 59  ? THR C 59  . ? 1_555 ? 
36  AC3 17 GLY C 60  ? GLY C 60  . ? 1_555 ? 
37  AC3 17 VAL C 61  ? VAL C 61  . ? 1_555 ? 
38  AC3 17 GLY C 62  ? GLY C 62  . ? 1_555 ? 
39  AC3 17 LYS C 63  ? LYS C 63  . ? 1_555 ? 
40  AC3 17 THR C 64  ? THR C 64  . ? 1_555 ? 
41  AC3 17 GLU C 65  ? GLU C 65  . ? 1_555 ? 
42  AC3 17 ASP C 257 ? ASP C 257 . ? 1_555 ? 
43  AC3 17 SER C 308 ? SER C 308 . ? 1_555 ? 
44  AC3 17 LEU C 336 ? LEU C 336 . ? 1_555 ? 
45  AC3 17 ILE C 344 ? ILE C 344 . ? 1_555 ? 
46  AC3 17 ALA C 393 ? ALA C 393 . ? 1_555 ? 
47  AC3 17 GLU D 322 ? GLU D 322 . ? 1_555 ? 
48  AC4 15 HIS D 16  ? HIS D 16  . ? 1_555 ? 
49  AC4 15 ILE D 17  ? ILE D 17  . ? 1_555 ? 
50  AC4 15 ILE D 18  ? ILE D 18  . ? 1_555 ? 
51  AC4 15 THR D 59  ? THR D 59  . ? 1_555 ? 
52  AC4 15 GLY D 60  ? GLY D 60  . ? 1_555 ? 
53  AC4 15 VAL D 61  ? VAL D 61  . ? 1_555 ? 
54  AC4 15 GLY D 62  ? GLY D 62  . ? 1_555 ? 
55  AC4 15 LYS D 63  ? LYS D 63  . ? 1_555 ? 
56  AC4 15 THR D 64  ? THR D 64  . ? 1_555 ? 
57  AC4 15 GLU D 65  ? GLU D 65  . ? 1_555 ? 
58  AC4 15 ASP D 257 ? ASP D 257 . ? 1_555 ? 
59  AC4 15 LEU D 336 ? LEU D 336 . ? 1_555 ? 
60  AC4 15 ILE D 344 ? ILE D 344 . ? 1_555 ? 
61  AC4 15 ALA D 393 ? ALA D 393 . ? 1_555 ? 
62  AC4 15 GLU E 322 ? GLU E 322 . ? 1_555 ? 
63  AC5 15 HIS E 16  ? HIS E 16  . ? 1_555 ? 
64  AC5 15 ILE E 17  ? ILE E 17  . ? 1_555 ? 
65  AC5 15 ILE E 18  ? ILE E 18  . ? 1_555 ? 
66  AC5 15 GLY E 60  ? GLY E 60  . ? 1_555 ? 
67  AC5 15 VAL E 61  ? VAL E 61  . ? 1_555 ? 
68  AC5 15 GLY E 62  ? GLY E 62  . ? 1_555 ? 
69  AC5 15 LYS E 63  ? LYS E 63  . ? 1_555 ? 
70  AC5 15 THR E 64  ? THR E 64  . ? 1_555 ? 
71  AC5 15 GLU E 65  ? GLU E 65  . ? 1_555 ? 
72  AC5 15 ASP E 257 ? ASP E 257 . ? 1_555 ? 
73  AC5 15 SER E 308 ? SER E 308 . ? 1_555 ? 
74  AC5 15 LEU E 336 ? LEU E 336 . ? 1_555 ? 
75  AC5 15 ILE E 344 ? ILE E 344 . ? 1_555 ? 
76  AC5 15 ALA E 393 ? ALA E 393 . ? 1_555 ? 
77  AC5 15 GLU F 322 ? GLU F 322 . ? 1_555 ? 
78  AC6 16 GLU A 322 ? GLU A 322 . ? 1_555 ? 
79  AC6 16 HIS F 16  ? HIS F 16  . ? 1_555 ? 
80  AC6 16 ILE F 17  ? ILE F 17  . ? 1_555 ? 
81  AC6 16 ILE F 18  ? ILE F 18  . ? 1_555 ? 
82  AC6 16 THR F 59  ? THR F 59  . ? 1_555 ? 
83  AC6 16 GLY F 60  ? GLY F 60  . ? 1_555 ? 
84  AC6 16 VAL F 61  ? VAL F 61  . ? 1_555 ? 
85  AC6 16 GLY F 62  ? GLY F 62  . ? 1_555 ? 
86  AC6 16 LYS F 63  ? LYS F 63  . ? 1_555 ? 
87  AC6 16 THR F 64  ? THR F 64  . ? 1_555 ? 
88  AC6 16 GLU F 65  ? GLU F 65  . ? 1_555 ? 
89  AC6 16 ASP F 257 ? ASP F 257 . ? 1_555 ? 
90  AC6 16 SER F 308 ? SER F 308 . ? 1_555 ? 
91  AC6 16 LEU F 336 ? LEU F 336 . ? 1_555 ? 
92  AC6 16 ILE F 344 ? ILE F 344 . ? 1_555 ? 
93  AC6 16 ALA F 393 ? ALA F 393 . ? 1_555 ? 
94  AC7 16 HIS S 16  ? HIS S 16  . ? 1_555 ? 
95  AC7 16 ILE S 17  ? ILE S 17  . ? 1_555 ? 
96  AC7 16 ILE S 18  ? ILE S 18  . ? 1_555 ? 
97  AC7 16 PRO S 58  ? PRO S 58  . ? 1_555 ? 
98  AC7 16 THR S 59  ? THR S 59  . ? 1_555 ? 
99  AC7 16 GLY S 60  ? GLY S 60  . ? 1_555 ? 
100 AC7 16 VAL S 61  ? VAL S 61  . ? 1_555 ? 
101 AC7 16 GLY S 62  ? GLY S 62  . ? 1_555 ? 
102 AC7 16 LYS S 63  ? LYS S 63  . ? 1_555 ? 
103 AC7 16 THR S 64  ? THR S 64  . ? 1_555 ? 
104 AC7 16 GLU S 65  ? GLU S 65  . ? 1_555 ? 
105 AC7 16 ASP S 257 ? ASP S 257 . ? 1_555 ? 
106 AC7 16 ILE S 344 ? ILE S 344 . ? 1_555 ? 
107 AC7 16 ALA S 393 ? ALA S 393 . ? 1_555 ? 
108 AC7 16 ARG S 394 ? ARG S 394 . ? 1_555 ? 
109 AC7 16 HIS S 397 ? HIS S 397 . ? 1_555 ? 
110 AC8 14 HIS T 16  ? HIS T 16  . ? 1_555 ? 
111 AC8 14 ILE T 17  ? ILE T 17  . ? 1_555 ? 
112 AC8 14 ILE T 18  ? ILE T 18  . ? 1_555 ? 
113 AC8 14 GLY T 60  ? GLY T 60  . ? 1_555 ? 
114 AC8 14 VAL T 61  ? VAL T 61  . ? 1_555 ? 
115 AC8 14 GLY T 62  ? GLY T 62  . ? 1_555 ? 
116 AC8 14 LYS T 63  ? LYS T 63  . ? 1_555 ? 
117 AC8 14 THR T 64  ? THR T 64  . ? 1_555 ? 
118 AC8 14 GLU T 65  ? GLU T 65  . ? 1_555 ? 
119 AC8 14 ASP T 257 ? ASP T 257 . ? 1_555 ? 
120 AC8 14 ILE T 344 ? ILE T 344 . ? 1_555 ? 
121 AC8 14 ALA T 393 ? ALA T 393 . ? 1_555 ? 
122 AC8 14 ARG T 394 ? ARG T 394 . ? 1_555 ? 
123 AC8 14 HIS T 397 ? HIS T 397 . ? 1_555 ? 
124 AC9 12 ILE U 17  ? ILE U 17  . ? 1_555 ? 
125 AC9 12 ILE U 18  ? ILE U 18  . ? 1_555 ? 
126 AC9 12 THR U 59  ? THR U 59  . ? 1_555 ? 
127 AC9 12 GLY U 60  ? GLY U 60  . ? 1_555 ? 
128 AC9 12 VAL U 61  ? VAL U 61  . ? 1_555 ? 
129 AC9 12 GLY U 62  ? GLY U 62  . ? 1_555 ? 
130 AC9 12 LYS U 63  ? LYS U 63  . ? 1_555 ? 
131 AC9 12 THR U 64  ? THR U 64  . ? 1_555 ? 
132 AC9 12 GLU U 65  ? GLU U 65  . ? 1_555 ? 
133 AC9 12 ASP U 257 ? ASP U 257 . ? 1_555 ? 
134 AC9 12 ILE U 344 ? ILE U 344 . ? 1_555 ? 
135 AC9 12 ARG U 394 ? ARG U 394 . ? 1_555 ? 
136 BC1 16 HIS V 16  ? HIS V 16  . ? 1_555 ? 
137 BC1 16 ILE V 17  ? ILE V 17  . ? 1_555 ? 
138 BC1 16 ILE V 18  ? ILE V 18  . ? 1_555 ? 
139 BC1 16 PRO V 58  ? PRO V 58  . ? 1_555 ? 
140 BC1 16 THR V 59  ? THR V 59  . ? 1_555 ? 
141 BC1 16 GLY V 60  ? GLY V 60  . ? 1_555 ? 
142 BC1 16 VAL V 61  ? VAL V 61  . ? 1_555 ? 
143 BC1 16 GLY V 62  ? GLY V 62  . ? 1_555 ? 
144 BC1 16 LYS V 63  ? LYS V 63  . ? 1_555 ? 
145 BC1 16 THR V 64  ? THR V 64  . ? 1_555 ? 
146 BC1 16 GLU V 65  ? GLU V 65  . ? 1_555 ? 
147 BC1 16 ASP V 257 ? ASP V 257 . ? 1_555 ? 
148 BC1 16 ILE V 344 ? ILE V 344 . ? 1_555 ? 
149 BC1 16 ALA V 393 ? ALA V 393 . ? 1_555 ? 
150 BC1 16 ARG V 394 ? ARG V 394 . ? 1_555 ? 
151 BC1 16 HIS V 397 ? HIS V 397 . ? 1_555 ? 
152 BC2 14 HIS W 16  ? HIS W 16  . ? 1_555 ? 
153 BC2 14 ILE W 17  ? ILE W 17  . ? 1_555 ? 
154 BC2 14 ILE W 18  ? ILE W 18  . ? 1_555 ? 
155 BC2 14 GLY W 60  ? GLY W 60  . ? 1_555 ? 
156 BC2 14 VAL W 61  ? VAL W 61  . ? 1_555 ? 
157 BC2 14 GLY W 62  ? GLY W 62  . ? 1_555 ? 
158 BC2 14 LYS W 63  ? LYS W 63  . ? 1_555 ? 
159 BC2 14 THR W 64  ? THR W 64  . ? 1_555 ? 
160 BC2 14 GLU W 65  ? GLU W 65  . ? 1_555 ? 
161 BC2 14 ASP W 257 ? ASP W 257 . ? 1_555 ? 
162 BC2 14 ILE W 344 ? ILE W 344 . ? 1_555 ? 
163 BC2 14 ALA W 393 ? ALA W 393 . ? 1_555 ? 
164 BC2 14 ARG W 394 ? ARG W 394 . ? 1_555 ? 
165 BC2 14 HIS W 397 ? HIS W 397 . ? 1_555 ? 
166 BC3 15 ILE X 17  ? ILE X 17  . ? 1_555 ? 
167 BC3 15 ILE X 18  ? ILE X 18  . ? 1_555 ? 
168 BC3 15 PRO X 58  ? PRO X 58  . ? 1_555 ? 
169 BC3 15 THR X 59  ? THR X 59  . ? 1_555 ? 
170 BC3 15 GLY X 60  ? GLY X 60  . ? 1_555 ? 
171 BC3 15 VAL X 61  ? VAL X 61  . ? 1_555 ? 
172 BC3 15 GLY X 62  ? GLY X 62  . ? 1_555 ? 
173 BC3 15 LYS X 63  ? LYS X 63  . ? 1_555 ? 
174 BC3 15 THR X 64  ? THR X 64  . ? 1_555 ? 
175 BC3 15 GLU X 65  ? GLU X 65  . ? 1_555 ? 
176 BC3 15 ASP X 257 ? ASP X 257 . ? 1_555 ? 
177 BC3 15 ILE X 344 ? ILE X 344 . ? 1_555 ? 
178 BC3 15 ALA X 393 ? ALA X 393 . ? 1_555 ? 
179 BC3 15 ARG X 394 ? ARG X 394 . ? 1_555 ? 
180 BC3 15 HIS X 397 ? HIS X 397 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1G3I 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1G3I 
_atom_sites.fract_transf_matrix[1][1]   0.004780 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004534 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004148 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . SER A  1 2   ? 183.364 103.187 147.386 1.00 181.46 ? 2   SER A N     1 
ATOM   2     C CA    . SER A  1 2   ? 181.901 102.997 147.141 1.00 182.06 ? 2   SER A CA    1 
ATOM   3     C C     . SER A  1 2   ? 181.652 101.981 146.025 1.00 180.23 ? 2   SER A C     1 
ATOM   4     O O     . SER A  1 2   ? 180.608 101.324 145.986 1.00 181.04 ? 2   SER A O     1 
ATOM   5     C CB    . SER A  1 2   ? 181.251 104.334 146.765 1.00 187.90 ? 2   SER A CB    1 
ATOM   6     O OG    . SER A  1 2   ? 181.411 105.295 147.795 1.00 190.70 ? 2   SER A OG    1 
ATOM   7     N N     . GLU A  1 3   ? 182.624 101.855 145.128 1.00 56.72  ? 3   GLU A N     1 
ATOM   8     C CA    . GLU A  1 3   ? 182.528 100.943 143.995 1.00 51.83  ? 3   GLU A CA    1 
ATOM   9     C C     . GLU A  1 3   ? 183.809 101.036 143.173 1.00 48.10  ? 3   GLU A C     1 
ATOM   10    O O     . GLU A  1 3   ? 184.587 101.993 143.283 1.00 46.51  ? 3   GLU A O     1 
ATOM   11    C CB    . GLU A  1 3   ? 181.335 101.322 143.117 1.00 80.09  ? 3   GLU A CB    1 
ATOM   12    C CG    . GLU A  1 3   ? 181.057 100.363 141.987 1.00 81.62  ? 3   GLU A CG    1 
ATOM   13    C CD    . GLU A  1 3   ? 180.834 98.973  142.495 1.00 82.56  ? 3   GLU A CD    1 
ATOM   14    O OE1   . GLU A  1 3   ? 181.824 98.225  142.637 1.00 82.96  ? 3   GLU A OE1   1 
ATOM   15    O OE2   . GLU A  1 3   ? 179.666 98.636  142.773 1.00 82.07  ? 3   GLU A OE2   1 
ATOM   16    N N     . MET A  1 4   ? 184.015 100.043 142.326 1.00 55.97  ? 4   MET A N     1 
ATOM   17    C CA    . MET A  1 4   ? 185.203 100.011 141.502 1.00 52.64  ? 4   MET A CA    1 
ATOM   18    C C     . MET A  1 4   ? 185.202 101.095 140.436 1.00 49.82  ? 4   MET A C     1 
ATOM   19    O O     . MET A  1 4   ? 184.279 101.896 140.358 1.00 49.15  ? 4   MET A O     1 
ATOM   20    C CB    . MET A  1 4   ? 185.330 98.630  140.880 1.00 64.99  ? 4   MET A CB    1 
ATOM   21    C CG    . MET A  1 4   ? 185.370 97.540  141.931 1.00 64.89  ? 4   MET A CG    1 
ATOM   22    S SD    . MET A  1 4   ? 185.914 96.001  141.260 1.00 67.39  ? 4   MET A SD    1 
ATOM   23    C CE    . MET A  1 4   ? 187.123 96.534  140.092 1.00 63.45  ? 4   MET A CE    1 
ATOM   24    N N     . THR A  1 5   ? 186.235 101.107 139.604 1.00 35.91  ? 5   THR A N     1 
ATOM   25    C CA    . THR A  1 5   ? 186.368 102.115 138.561 1.00 33.67  ? 5   THR A CA    1 
ATOM   26    C C     . THR A  1 5   ? 186.712 101.547 137.203 1.00 32.09  ? 5   THR A C     1 
ATOM   27    O O     . THR A  1 5   ? 187.223 100.449 137.100 1.00 31.55  ? 5   THR A O     1 
ATOM   28    C CB    . THR A  1 5   ? 187.462 103.074 138.911 1.00 28.02  ? 5   THR A CB    1 
ATOM   29    O OG1   . THR A  1 5   ? 188.629 102.774 138.139 1.00 27.75  ? 5   THR A OG1   1 
ATOM   30    C CG2   . THR A  1 5   ? 187.785 102.935 140.370 1.00 28.68  ? 5   THR A CG2   1 
ATOM   31    N N     . PRO A  1 6   ? 186.469 102.317 136.140 1.00 31.93  ? 6   PRO A N     1 
ATOM   32    C CA    . PRO A  1 6   ? 186.749 101.895 134.774 1.00 31.33  ? 6   PRO A CA    1 
ATOM   33    C C     . PRO A  1 6   ? 187.968 101.010 134.691 1.00 31.56  ? 6   PRO A C     1 
ATOM   34    O O     . PRO A  1 6   ? 187.865 99.803  134.496 1.00 32.59  ? 6   PRO A O     1 
ATOM   35    C CB    . PRO A  1 6   ? 186.956 103.210 134.072 1.00 33.22  ? 6   PRO A CB    1 
ATOM   36    C CG    . PRO A  1 6   ? 185.930 104.039 134.696 1.00 33.92  ? 6   PRO A CG    1 
ATOM   37    C CD    . PRO A  1 6   ? 186.095 103.738 136.161 1.00 33.62  ? 6   PRO A CD    1 
ATOM   38    N N     . ARG A  1 7   ? 189.129 101.620 134.871 1.00 44.56  ? 7   ARG A N     1 
ATOM   39    C CA    . ARG A  1 7   ? 190.406 100.913 134.805 1.00 45.02  ? 7   ARG A CA    1 
ATOM   40    C C     . ARG A  1 7   ? 190.526 99.854  135.889 1.00 43.20  ? 7   ARG A C     1 
ATOM   41    O O     . ARG A  1 7   ? 191.199 98.846  135.711 1.00 42.84  ? 7   ARG A O     1 
ATOM   42    C CB    . ARG A  1 7   ? 191.541 101.930 134.931 1.00 141.99 ? 7   ARG A CB    1 
ATOM   43    C CG    . ARG A  1 7   ? 192.898 101.489 134.397 1.00 148.08 ? 7   ARG A CG    1 
ATOM   44    C CD    . ARG A  1 7   ? 193.814 102.705 134.291 1.00 152.81 ? 7   ARG A CD    1 
ATOM   45    N NE    . ARG A  1 7   ? 193.606 103.585 135.436 1.00 158.11 ? 7   ARG A NE    1 
ATOM   46    C CZ    . ARG A  1 7   ? 193.883 103.253 136.694 1.00 161.44 ? 7   ARG A CZ    1 
ATOM   47    N NH1   . ARG A  1 7   ? 194.396 102.062 136.975 1.00 162.86 ? 7   ARG A NH1   1 
ATOM   48    N NH2   . ARG A  1 7   ? 193.612 104.099 137.679 1.00 162.92 ? 7   ARG A NH2   1 
ATOM   49    N N     . GLU A  1 8   ? 189.853 100.097 137.003 1.00 25.08  ? 8   GLU A N     1 
ATOM   50    C CA    . GLU A  1 8   ? 189.864 99.212  138.155 1.00 24.15  ? 8   GLU A CA    1 
ATOM   51    C C     . GLU A  1 8   ? 189.105 97.890  137.894 1.00 22.96  ? 8   GLU A C     1 
ATOM   52    O O     . GLU A  1 8   ? 189.494 96.804  138.387 1.00 22.71  ? 8   GLU A O     1 
ATOM   53    C CB    . GLU A  1 8   ? 189.249 99.976  139.326 1.00 53.04  ? 8   GLU A CB    1 
ATOM   54    C CG    . GLU A  1 8   ? 189.557 99.428  140.695 1.00 56.94  ? 8   GLU A CG    1 
ATOM   55    C CD    . GLU A  1 8   ? 189.614 100.523 141.746 1.00 59.02  ? 8   GLU A CD    1 
ATOM   56    O OE1   . GLU A  1 8   ? 190.653 101.232 141.826 1.00 58.64  ? 8   GLU A OE1   1 
ATOM   57    O OE2   . GLU A  1 8   ? 188.613 100.675 142.482 1.00 60.95  ? 8   GLU A OE2   1 
ATOM   58    N N     . ILE A  1 9   ? 188.018 97.989  137.124 1.00 51.04  ? 9   ILE A N     1 
ATOM   59    C CA    . ILE A  1 9   ? 187.208 96.830  136.782 1.00 46.55  ? 9   ILE A CA    1 
ATOM   60    C C     . ILE A  1 9   ? 187.939 96.064  135.712 1.00 44.97  ? 9   ILE A C     1 
ATOM   61    O O     . ILE A  1 9   ? 188.083 94.854  135.803 1.00 45.49  ? 9   ILE A O     1 
ATOM   62    C CB    . ILE A  1 9   ? 185.844 97.211  136.209 1.00 22.65  ? 9   ILE A CB    1 
ATOM   63    C CG1   . ILE A  1 9   ? 185.090 98.090  137.177 1.00 20.97  ? 9   ILE A CG1   1 
ATOM   64    C CG2   . ILE A  1 9   ? 184.993 95.985  136.038 1.00 22.12  ? 9   ILE A CG2   1 
ATOM   65    C CD1   . ILE A  1 9   ? 183.734 98.459  136.653 1.00 21.03  ? 9   ILE A CD1   1 
ATOM   66    N N     . VAL A  1 10  ? 188.397 96.762  134.688 1.00 17.97  ? 10  VAL A N     1 
ATOM   67    C CA    . VAL A  1 10  ? 189.111 96.073  133.641 1.00 19.05  ? 10  VAL A CA    1 
ATOM   68    C C     . VAL A  1 10  ? 190.106 95.123  134.292 1.00 22.01  ? 10  VAL A C     1 
ATOM   69    O O     . VAL A  1 10  ? 190.147 93.935  133.955 1.00 22.80  ? 10  VAL A O     1 
ATOM   70    C CB    . VAL A  1 10  ? 189.836 97.063  132.737 1.00 12.28  ? 10  VAL A CB    1 
ATOM   71    C CG1   . VAL A  1 10  ? 190.629 96.361  131.635 1.00 9.25   ? 10  VAL A CG1   1 
ATOM   72    C CG2   . VAL A  1 10  ? 188.817 97.936  132.115 1.00 11.86  ? 10  VAL A CG2   1 
ATOM   73    N N     . SER A  1 11  ? 190.900 95.627  135.233 1.00 50.50  ? 11  SER A N     1 
ATOM   74    C CA    . SER A  1 11  ? 191.877 94.786  135.926 1.00 53.42  ? 11  SER A CA    1 
ATOM   75    C C     . SER A  1 11  ? 191.239 93.467  136.367 1.00 52.82  ? 11  SER A C     1 
ATOM   76    O O     . SER A  1 11  ? 191.696 92.391  135.975 1.00 53.19  ? 11  SER A O     1 
ATOM   77    C CB    . SER A  1 11  ? 192.427 95.532  137.134 1.00 120.32 ? 11  SER A CB    1 
ATOM   78    O OG    . SER A  1 11  ? 192.970 96.776  136.725 1.00 123.59 ? 11  SER A OG    1 
ATOM   79    N N     . GLU A  1 12  ? 190.181 93.565  137.170 1.00 27.87  ? 12  GLU A N     1 
ATOM   80    C CA    . GLU A  1 12  ? 189.454 92.396  137.652 1.00 27.40  ? 12  GLU A CA    1 
ATOM   81    C C     . GLU A  1 12  ? 189.076 91.434  136.507 1.00 24.68  ? 12  GLU A C     1 
ATOM   82    O O     . GLU A  1 12  ? 189.175 90.220  136.648 1.00 22.20  ? 12  GLU A O     1 
ATOM   83    C CB    . GLU A  1 12  ? 188.199 92.855  138.376 1.00 93.38  ? 12  GLU A CB    1 
ATOM   84    C CG    . GLU A  1 12  ? 187.408 91.751  139.030 1.00 100.58 ? 12  GLU A CG    1 
ATOM   85    C CD    . GLU A  1 12  ? 188.155 91.101  140.174 1.00 105.60 ? 12  GLU A CD    1 
ATOM   86    O OE1   . GLU A  1 12  ? 188.805 91.824  140.963 1.00 106.72 ? 12  GLU A OE1   1 
ATOM   87    O OE2   . GLU A  1 12  ? 188.078 89.860  140.293 1.00 109.14 ? 12  GLU A OE2   1 
ATOM   88    N N     . LEU A  1 13  ? 188.636 91.978  135.373 1.00 16.13  ? 13  LEU A N     1 
ATOM   89    C CA    . LEU A  1 13  ? 188.264 91.176  134.193 1.00 14.68  ? 13  LEU A CA    1 
ATOM   90    C C     . LEU A  1 13  ? 189.466 90.521  133.569 1.00 14.99  ? 13  LEU A C     1 
ATOM   91    O O     . LEU A  1 13  ? 189.399 89.406  133.091 1.00 14.94  ? 13  LEU A O     1 
ATOM   92    C CB    . LEU A  1 13  ? 187.647 92.052  133.122 1.00 13.08  ? 13  LEU A CB    1 
ATOM   93    C CG    . LEU A  1 13  ? 186.357 92.750  133.481 1.00 10.99  ? 13  LEU A CG    1 
ATOM   94    C CD1   . LEU A  1 13  ? 186.031 93.607  132.301 1.00 11.52  ? 13  LEU A CD1   1 
ATOM   95    C CD2   . LEU A  1 13  ? 185.225 91.775  133.761 1.00 9.40   ? 13  LEU A CD2   1 
ATOM   96    N N     . ASP A  1 14  ? 190.563 91.255  133.538 1.00 13.79  ? 14  ASP A N     1 
ATOM   97    C CA    . ASP A  1 14  ? 191.772 90.728  132.966 1.00 16.09  ? 14  ASP A CA    1 
ATOM   98    C C     . ASP A  1 14  ? 192.150 89.451  133.705 1.00 16.54  ? 14  ASP A C     1 
ATOM   99    O O     . ASP A  1 14  ? 192.873 88.594  133.184 1.00 15.68  ? 14  ASP A O     1 
ATOM   100   C CB    . ASP A  1 14  ? 192.903 91.745  133.077 1.00 55.06  ? 14  ASP A CB    1 
ATOM   101   C CG    . ASP A  1 14  ? 192.828 92.822  132.023 1.00 57.83  ? 14  ASP A CG    1 
ATOM   102   O OD1   . ASP A  1 14  ? 192.658 92.500  130.823 1.00 59.26  ? 14  ASP A OD1   1 
ATOM   103   O OD2   . ASP A  1 14  ? 192.962 94.001  132.397 1.00 60.47  ? 14  ASP A OD2   1 
ATOM   104   N N     . GLN A  1 15  ? 191.668 89.322  134.929 1.00 50.81  ? 15  GLN A N     1 
ATOM   105   C CA    . GLN A  1 15  ? 192.003 88.150  135.683 1.00 52.40  ? 15  GLN A CA    1 
ATOM   106   C C     . GLN A  1 15  ? 191.394 86.887  135.102 1.00 50.82  ? 15  GLN A C     1 
ATOM   107   O O     . GLN A  1 15  ? 191.962 85.818  135.239 1.00 52.03  ? 15  GLN A O     1 
ATOM   108   C CB    . GLN A  1 15  ? 191.605 88.335  137.133 1.00 75.51  ? 15  GLN A CB    1 
ATOM   109   C CG    . GLN A  1 15  ? 192.693 88.973  137.947 1.00 81.62  ? 15  GLN A CG    1 
ATOM   110   C CD    . GLN A  1 15  ? 192.229 89.317  139.339 1.00 86.74  ? 15  GLN A CD    1 
ATOM   111   O OE1   . GLN A  1 15  ? 191.524 88.536  139.986 1.00 89.11  ? 15  GLN A OE1   1 
ATOM   112   N NE2   . GLN A  1 15  ? 192.627 90.491  139.820 1.00 88.67  ? 15  GLN A NE2   1 
ATOM   113   N N     . HIS A  1 16  ? 190.260 86.977  134.429 1.00 31.77  ? 16  HIS A N     1 
ATOM   114   C CA    . HIS A  1 16  ? 189.708 85.757  133.883 1.00 29.23  ? 16  HIS A CA    1 
ATOM   115   C C     . HIS A  1 16  ? 189.633 85.718  132.389 1.00 26.42  ? 16  HIS A C     1 
ATOM   116   O O     . HIS A  1 16  ? 189.504 84.658  131.829 1.00 28.32  ? 16  HIS A O     1 
ATOM   117   C CB    . HIS A  1 16  ? 188.319 85.495  134.409 1.00 45.14  ? 16  HIS A CB    1 
ATOM   118   C CG    . HIS A  1 16  ? 188.212 85.575  135.888 1.00 49.40  ? 16  HIS A CG    1 
ATOM   119   N ND1   . HIS A  1 16  ? 188.188 86.773  136.565 1.00 51.88  ? 16  HIS A ND1   1 
ATOM   120   C CD2   . HIS A  1 16  ? 188.075 84.608  136.823 1.00 51.96  ? 16  HIS A CD2   1 
ATOM   121   C CE1   . HIS A  1 16  ? 188.032 86.542  137.855 1.00 54.31  ? 16  HIS A CE1   1 
ATOM   122   N NE2   . HIS A  1 16  ? 187.961 85.236  138.038 1.00 55.55  ? 16  HIS A NE2   1 
ATOM   123   N N     . ILE A  1 17  ? 189.678 86.853  131.727 1.00 2.58   ? 17  ILE A N     1 
ATOM   124   C CA    . ILE A  1 17  ? 189.596 86.814  130.293 1.00 1.58   ? 17  ILE A CA    1 
ATOM   125   C C     . ILE A  1 17  ? 190.905 87.211  129.666 1.00 1.58   ? 17  ILE A C     1 
ATOM   126   O O     . ILE A  1 17  ? 191.570 88.115  130.122 1.00 2.83   ? 17  ILE A O     1 
ATOM   127   C CB    . ILE A  1 17  ? 188.544 87.778  129.735 1.00 2.67   ? 17  ILE A CB    1 
ATOM   128   C CG1   . ILE A  1 17  ? 187.128 87.357  130.107 1.00 2.67   ? 17  ILE A CG1   1 
ATOM   129   C CG2   . ILE A  1 17  ? 188.644 87.773  128.232 1.00 3.62   ? 17  ILE A CG2   1 
ATOM   130   C CD1   . ILE A  1 17  ? 186.812 87.589  131.470 1.00 4.84   ? 17  ILE A CD1   1 
ATOM   131   N N     . ILE A  1 18  ? 191.282 86.561  128.591 1.00 9.28   ? 18  ILE A N     1 
ATOM   132   C CA    . ILE A  1 18  ? 192.512 86.955  127.946 1.00 10.79  ? 18  ILE A CA    1 
ATOM   133   C C     . ILE A  1 18  ? 192.157 87.780  126.724 1.00 12.26  ? 18  ILE A C     1 
ATOM   134   O O     . ILE A  1 18  ? 191.301 87.379  125.966 1.00 12.55  ? 18  ILE A O     1 
ATOM   135   C CB    . ILE A  1 18  ? 193.310 85.725  127.519 1.00 21.89  ? 18  ILE A CB    1 
ATOM   136   C CG1   . ILE A  1 18  ? 193.719 84.966  128.764 1.00 21.60  ? 18  ILE A CG1   1 
ATOM   137   C CG2   . ILE A  1 18  ? 194.538 86.112  126.730 1.00 21.78  ? 18  ILE A CG2   1 
ATOM   138   C CD1   . ILE A  1 18  ? 194.387 85.835  129.771 1.00 24.05  ? 18  ILE A CD1   1 
ATOM   139   N N     . GLY A  1 19  ? 192.798 88.931  126.536 1.00 36.42  ? 19  GLY A N     1 
ATOM   140   C CA    . GLY A  1 19  ? 192.518 89.739  125.359 1.00 37.03  ? 19  GLY A CA    1 
ATOM   141   C C     . GLY A  1 19  ? 191.130 90.319  125.426 1.00 38.57  ? 19  GLY A C     1 
ATOM   142   O O     . GLY A  1 19  ? 190.572 90.495  126.510 1.00 39.21  ? 19  GLY A O     1 
ATOM   143   N N     . GLN A  1 20  ? 190.558 90.610  124.267 1.00 36.67  ? 20  GLN A N     1 
ATOM   144   C CA    . GLN A  1 20  ? 189.220 91.194  124.230 1.00 37.33  ? 20  GLN A CA    1 
ATOM   145   C C     . GLN A  1 20  ? 189.214 92.411  125.163 1.00 38.86  ? 20  GLN A C     1 
ATOM   146   O O     . GLN A  1 20  ? 188.586 92.408  126.208 1.00 37.26  ? 20  GLN A O     1 
ATOM   147   C CB    . GLN A  1 20  ? 188.194 90.152  124.682 1.00 17.55  ? 20  GLN A CB    1 
ATOM   148   C CG    . GLN A  1 20  ? 188.196 88.836  123.889 1.00 14.87  ? 20  GLN A CG    1 
ATOM   149   C CD    . GLN A  1 20  ? 188.360 89.015  122.368 1.00 15.74  ? 20  GLN A CD    1 
ATOM   150   O OE1   . GLN A  1 20  ? 187.521 88.585  121.588 1.00 15.25  ? 20  GLN A OE1   1 
ATOM   151   N NE2   . GLN A  1 20  ? 189.464 89.632  121.954 1.00 15.55  ? 20  GLN A NE2   1 
ATOM   152   N N     . ALA A  1 21  ? 189.934 93.453  124.773 1.00 52.65  ? 21  ALA A N     1 
ATOM   153   C CA    . ALA A  1 21  ? 190.046 94.638  125.604 1.00 55.23  ? 21  ALA A CA    1 
ATOM   154   C C     . ALA A  1 21  ? 188.894 95.605  125.460 1.00 56.91  ? 21  ALA A C     1 
ATOM   155   O O     . ALA A  1 21  ? 188.191 95.903  126.435 1.00 57.35  ? 21  ALA A O     1 
ATOM   156   C CB    . ALA A  1 21  ? 191.336 95.345  125.295 1.00 84.19  ? 21  ALA A CB    1 
ATOM   157   N N     . ASP A  1 22  ? 188.721 96.111  124.243 1.00 36.28  ? 22  ASP A N     1 
ATOM   158   C CA    . ASP A  1 22  ? 187.665 97.059  123.970 1.00 34.14  ? 22  ASP A CA    1 
ATOM   159   C C     . ASP A  1 22  ? 186.435 96.581  124.685 1.00 31.95  ? 22  ASP A C     1 
ATOM   160   O O     . ASP A  1 22  ? 185.739 97.358  125.333 1.00 31.86  ? 22  ASP A O     1 
ATOM   161   C CB    . ASP A  1 22  ? 187.387 97.141  122.481 1.00 52.29  ? 22  ASP A CB    1 
ATOM   162   C CG    . ASP A  1 22  ? 188.643 97.318  121.676 1.00 56.01  ? 22  ASP A CG    1 
ATOM   163   O OD1   . ASP A  1 22  ? 189.499 98.150  122.057 1.00 57.49  ? 22  ASP A OD1   1 
ATOM   164   O OD2   . ASP A  1 22  ? 188.777 96.625  120.649 1.00 59.26  ? 22  ASP A OD2   1 
ATOM   165   N N     . ALA A  1 23  ? 186.182 95.286  124.592 1.00 10.26  ? 23  ALA A N     1 
ATOM   166   C CA    . ALA A  1 23  ? 185.016 94.735  125.234 1.00 8.89   ? 23  ALA A CA    1 
ATOM   167   C C     . ALA A  1 23  ? 185.036 94.987  126.735 1.00 7.30   ? 23  ALA A C     1 
ATOM   168   O O     . ALA A  1 23  ? 184.060 95.481  127.311 1.00 6.14   ? 23  ALA A O     1 
ATOM   169   C CB    . ALA A  1 23  ? 184.930 93.259  124.951 1.00 59.70  ? 23  ALA A CB    1 
ATOM   170   N N     . LYS A  1 24  ? 186.146 94.640  127.369 1.00 26.14  ? 24  LYS A N     1 
ATOM   171   C CA    . LYS A  1 24  ? 186.269 94.823  128.802 1.00 26.71  ? 24  LYS A CA    1 
ATOM   172   C C     . LYS A  1 24  ? 185.992 96.271  129.154 1.00 27.26  ? 24  LYS A C     1 
ATOM   173   O O     . LYS A  1 24  ? 185.202 96.570  130.062 1.00 27.10  ? 24  LYS A O     1 
ATOM   174   C CB    . LYS A  1 24  ? 187.671 94.425  129.263 1.00 30.20  ? 24  LYS A CB    1 
ATOM   175   C CG    . LYS A  1 24  ? 187.845 92.941  129.557 1.00 29.29  ? 24  LYS A CG    1 
ATOM   176   C CD    . LYS A  1 24  ? 189.297 92.515  129.378 1.00 29.83  ? 24  LYS A CD    1 
ATOM   177   C CE    . LYS A  1 24  ? 189.528 91.046  129.730 1.00 29.46  ? 24  LYS A CE    1 
ATOM   178   N NZ    . LYS A  1 24  ? 190.869 90.581  129.255 1.00 30.77  ? 24  LYS A NZ    1 
ATOM   179   N N     . ARG A  1 25  ? 186.651 97.173  128.438 1.00 26.99  ? 25  ARG A N     1 
ATOM   180   C CA    . ARG A  1 25  ? 186.446 98.601  128.667 1.00 27.73  ? 25  ARG A CA    1 
ATOM   181   C C     . ARG A  1 25  ? 184.926 98.898  128.626 1.00 25.34  ? 25  ARG A C     1 
ATOM   182   O O     . ARG A  1 25  ? 184.305 99.309  129.620 1.00 23.18  ? 25  ARG A O     1 
ATOM   183   C CB    . ARG A  1 25  ? 187.166 99.387  127.569 1.00 54.26  ? 25  ARG A CB    1 
ATOM   184   C CG    . ARG A  1 25  ? 187.940 100.604 128.036 1.00 58.56  ? 25  ARG A CG    1 
ATOM   185   C CD    . ARG A  1 25  ? 189.118 100.803 127.100 1.00 63.63  ? 25  ARG A CD    1 
ATOM   186   N NE    . ARG A  1 25  ? 189.901 102.001 127.384 1.00 68.47  ? 25  ARG A NE    1 
ATOM   187   C CZ    . ARG A  1 25  ? 189.498 103.230 127.097 1.00 69.98  ? 25  ARG A CZ    1 
ATOM   188   N NH1   . ARG A  1 25  ? 188.312 103.406 126.520 1.00 69.28  ? 25  ARG A NH1   1 
ATOM   189   N NH2   . ARG A  1 25  ? 190.285 104.268 127.374 1.00 69.50  ? 25  ARG A NH2   1 
ATOM   190   N N     . ALA A  1 26  ? 184.346 98.681  127.452 1.00 18.77  ? 26  ALA A N     1 
ATOM   191   C CA    . ALA A  1 26  ? 182.938 98.888  127.243 1.00 17.86  ? 26  ALA A CA    1 
ATOM   192   C C     . ALA A  1 26  ? 182.110 98.490  128.462 1.00 15.74  ? 26  ALA A C     1 
ATOM   193   O O     . ALA A  1 26  ? 181.363 99.299  128.996 1.00 14.71  ? 26  ALA A O     1 
ATOM   194   C CB    . ALA A  1 26  ? 182.497 98.105  126.033 1.00 75.36  ? 26  ALA A CB    1 
ATOM   195   N N     . VAL A  1 27  ? 182.217 97.254  128.911 1.00 16.91  ? 27  VAL A N     1 
ATOM   196   C CA    . VAL A  1 27  ? 181.416 96.885  130.060 1.00 16.74  ? 27  VAL A CA    1 
ATOM   197   C C     . VAL A  1 27  ? 181.888 97.595  131.314 1.00 17.05  ? 27  VAL A C     1 
ATOM   198   O O     . VAL A  1 27  ? 181.152 97.696  132.301 1.00 16.84  ? 27  VAL A O     1 
ATOM   199   C CB    . VAL A  1 27  ? 181.437 95.385  130.286 1.00 5.78   ? 27  VAL A CB    1 
ATOM   200   C CG1   . VAL A  1 27  ? 180.663 94.721  129.181 1.00 6.95   ? 27  VAL A CG1   1 
ATOM   201   C CG2   . VAL A  1 27  ? 182.866 94.878  130.316 1.00 4.64   ? 27  VAL A CG2   1 
ATOM   202   N N     . ALA A  1 28  ? 183.118 98.090  131.283 1.00 18.56  ? 28  ALA A N     1 
ATOM   203   C CA    . ALA A  1 28  ? 183.645 98.786  132.439 1.00 19.22  ? 28  ALA A CA    1 
ATOM   204   C C     . ALA A  1 28  ? 182.964 100.149 132.566 1.00 19.63  ? 28  ALA A C     1 
ATOM   205   O O     . ALA A  1 28  ? 182.179 100.380 133.503 1.00 19.68  ? 28  ALA A O     1 
ATOM   206   C CB    . ALA A  1 28  ? 185.134 98.947  132.304 1.00 62.04  ? 28  ALA A CB    1 
ATOM   207   N N     . ILE A  1 29  ? 183.249 101.043 131.617 1.00 6.22   ? 29  ILE A N     1 
ATOM   208   C CA    . ILE A  1 29  ? 182.652 102.370 131.641 1.00 6.15   ? 29  ILE A CA    1 
ATOM   209   C C     . ILE A  1 29  ? 181.169 102.199 131.923 1.00 6.26   ? 29  ILE A C     1 
ATOM   210   O O     . ILE A  1 29  ? 180.560 102.985 132.642 1.00 6.18   ? 29  ILE A O     1 
ATOM   211   C CB    . ILE A  1 29  ? 182.819 103.108 130.299 1.00 21.92  ? 29  ILE A CB    1 
ATOM   212   C CG1   . ILE A  1 29  ? 181.950 102.473 129.221 1.00 28.38  ? 29  ILE A CG1   1 
ATOM   213   C CG2   . ILE A  1 29  ? 184.222 103.016 129.844 1.00 19.27  ? 29  ILE A CG2   1 
ATOM   214   C CD1   . ILE A  1 29  ? 182.212 102.994 127.779 1.00 33.68  ? 29  ILE A CD1   1 
ATOM   215   N N     . ALA A  1 30  ? 180.601 101.140 131.366 1.00 6.72   ? 30  ALA A N     1 
ATOM   216   C CA    . ALA A  1 30  ? 179.204 100.871 131.525 1.00 8.36   ? 30  ALA A CA    1 
ATOM   217   C C     . ALA A  1 30  ? 178.910 100.617 132.972 1.00 9.04   ? 30  ALA A C     1 
ATOM   218   O O     . ALA A  1 30  ? 178.016 101.232 133.516 1.00 8.26   ? 30  ALA A O     1 
ATOM   219   C CB    . ALA A  1 30  ? 178.805 99.674  130.690 1.00 107.95 ? 30  ALA A CB    1 
ATOM   220   N N     . LEU A  1 31  ? 179.660 99.720  133.603 1.00 22.50  ? 31  LEU A N     1 
ATOM   221   C CA    . LEU A  1 31  ? 179.375 99.411  134.987 1.00 24.22  ? 31  LEU A CA    1 
ATOM   222   C C     . LEU A  1 31  ? 179.618 100.624 135.815 1.00 25.82  ? 31  LEU A C     1 
ATOM   223   O O     . LEU A  1 31  ? 178.958 100.852 136.836 1.00 27.65  ? 31  LEU A O     1 
ATOM   224   C CB    . LEU A  1 31  ? 180.242 98.279  135.502 1.00 15.54  ? 31  LEU A CB    1 
ATOM   225   C CG    . LEU A  1 31  ? 179.960 97.997  136.983 1.00 15.23  ? 31  LEU A CG    1 
ATOM   226   C CD1   . LEU A  1 31  ? 178.448 97.948  137.243 1.00 15.46  ? 31  LEU A CD1   1 
ATOM   227   C CD2   . LEU A  1 31  ? 180.603 96.667  137.381 1.00 15.53  ? 31  LEU A CD2   1 
ATOM   228   N N     . ARG A  1 32  ? 180.559 101.435 135.367 1.00 19.48  ? 32  ARG A N     1 
ATOM   229   C CA    . ARG A  1 32  ? 180.870 102.623 136.139 1.00 21.56  ? 32  ARG A CA    1 
ATOM   230   C C     . ARG A  1 32  ? 179.707 103.601 136.146 1.00 22.45  ? 32  ARG A C     1 
ATOM   231   O O     . ARG A  1 32  ? 179.253 104.013 137.220 1.00 22.40  ? 32  ARG A O     1 
ATOM   232   C CB    . ARG A  1 32  ? 182.147 103.286 135.617 1.00 29.90  ? 32  ARG A CB    1 
ATOM   233   C CG    . ARG A  1 32  ? 182.650 104.471 136.438 1.00 32.04  ? 32  ARG A CG    1 
ATOM   234   C CD    . ARG A  1 32  ? 182.829 104.136 137.900 1.00 35.69  ? 32  ARG A CD    1 
ATOM   235   N NE    . ARG A  1 32  ? 183.653 105.138 138.588 1.00 38.54  ? 32  ARG A NE    1 
ATOM   236   C CZ    . ARG A  1 32  ? 183.735 105.265 139.916 1.00 38.84  ? 32  ARG A CZ    1 
ATOM   237   N NH1   . ARG A  1 32  ? 183.035 104.449 140.699 1.00 41.10  ? 32  ARG A NH1   1 
ATOM   238   N NH2   . ARG A  1 32  ? 184.502 106.202 140.468 1.00 34.97  ? 32  ARG A NH2   1 
ATOM   239   N N     . ASN A  1 33  ? 179.205 103.960 134.962 1.00 22.46  ? 33  ASN A N     1 
ATOM   240   C CA    . ASN A  1 33  ? 178.098 104.903 134.892 1.00 22.42  ? 33  ASN A CA    1 
ATOM   241   C C     . ASN A  1 33  ? 177.047 104.541 135.926 1.00 23.01  ? 33  ASN A C     1 
ATOM   242   O O     . ASN A  1 33  ? 176.330 105.395 136.413 1.00 22.50  ? 33  ASN A O     1 
ATOM   243   C CB    . ASN A  1 33  ? 177.471 104.931 133.497 1.00 22.08  ? 33  ASN A CB    1 
ATOM   244   C CG    . ASN A  1 33  ? 178.291 105.726 132.511 1.00 24.80  ? 33  ASN A CG    1 
ATOM   245   O OD1   . ASN A  1 33  ? 178.877 106.746 132.855 1.00 27.65  ? 33  ASN A OD1   1 
ATOM   246   N ND2   . ASN A  1 33  ? 178.321 105.280 131.269 1.00 28.42  ? 33  ASN A ND2   1 
ATOM   247   N N     . ARG A  1 34  ? 176.971 103.277 136.305 1.00 22.12  ? 34  ARG A N     1 
ATOM   248   C CA    . ARG A  1 34  ? 175.957 102.917 137.258 1.00 25.76  ? 34  ARG A CA    1 
ATOM   249   C C     . ARG A  1 34  ? 176.184 103.679 138.551 1.00 26.89  ? 34  ARG A C     1 
ATOM   250   O O     . ARG A  1 34  ? 175.272 104.280 139.110 1.00 26.66  ? 34  ARG A O     1 
ATOM   251   C CB    . ARG A  1 34  ? 175.966 101.414 137.506 1.00 47.84  ? 34  ARG A CB    1 
ATOM   252   C CG    . ARG A  1 34  ? 174.622 100.905 137.997 1.00 50.26  ? 34  ARG A CG    1 
ATOM   253   C CD    . ARG A  1 34  ? 173.805 100.240 136.908 1.00 50.36  ? 34  ARG A CD    1 
ATOM   254   N NE    . ARG A  1 34  ? 174.003 98.799  136.971 1.00 52.81  ? 34  ARG A NE    1 
ATOM   255   C CZ    . ARG A  1 34  ? 173.223 97.917  136.368 1.00 54.30  ? 34  ARG A CZ    1 
ATOM   256   N NH1   . ARG A  1 34  ? 172.185 98.334  135.652 1.00 53.94  ? 34  ARG A NH1   1 
ATOM   257   N NH2   . ARG A  1 34  ? 173.484 96.623  136.488 1.00 53.84  ? 34  ARG A NH2   1 
ATOM   258   N N     . TRP A  1 35  ? 177.415 103.660 139.022 1.00 82.51  ? 35  TRP A N     1 
ATOM   259   C CA    . TRP A  1 35  ? 177.741 104.354 140.249 1.00 84.08  ? 35  TRP A CA    1 
ATOM   260   C C     . TRP A  1 35  ? 177.575 105.852 140.060 1.00 84.17  ? 35  TRP A C     1 
ATOM   261   O O     . TRP A  1 35  ? 177.150 106.553 140.971 1.00 85.02  ? 35  TRP A O     1 
ATOM   262   C CB    . TRP A  1 35  ? 179.178 104.028 140.649 1.00 54.72  ? 35  TRP A CB    1 
ATOM   263   C CG    . TRP A  1 35  ? 179.741 104.921 141.704 1.00 55.08  ? 35  TRP A CG    1 
ATOM   264   C CD1   . TRP A  1 35  ? 179.617 104.801 143.064 1.00 55.34  ? 35  TRP A CD1   1 
ATOM   265   C CD2   . TRP A  1 35  ? 180.552 106.059 141.475 1.00 55.26  ? 35  TRP A CD2   1 
ATOM   266   N NE1   . TRP A  1 35  ? 180.317 105.799 143.687 1.00 55.30  ? 35  TRP A NE1   1 
ATOM   267   C CE2   . TRP A  1 35  ? 180.898 106.584 142.727 1.00 55.15  ? 35  TRP A CE2   1 
ATOM   268   C CE3   . TRP A  1 35  ? 181.025 106.690 140.321 1.00 57.11  ? 35  TRP A CE3   1 
ATOM   269   C CZ2   . TRP A  1 35  ? 181.691 107.702 142.856 1.00 56.91  ? 35  TRP A CZ2   1 
ATOM   270   C CZ3   . TRP A  1 35  ? 181.813 107.799 140.450 1.00 57.41  ? 35  TRP A CZ3   1 
ATOM   271   C CH2   . TRP A  1 35  ? 182.141 108.296 141.705 1.00 57.75  ? 35  TRP A CH2   1 
ATOM   272   N N     . ARG A  1 36  ? 177.911 106.338 138.872 1.00 27.12  ? 36  ARG A N     1 
ATOM   273   C CA    . ARG A  1 36  ? 177.803 107.764 138.582 1.00 26.48  ? 36  ARG A CA    1 
ATOM   274   C C     . ARG A  1 36  ? 176.375 108.308 138.760 1.00 28.02  ? 36  ARG A C     1 
ATOM   275   O O     . ARG A  1 36  ? 176.157 109.270 139.498 1.00 28.55  ? 36  ARG A O     1 
ATOM   276   C CB    . ARG A  1 36  ? 178.325 108.032 137.177 1.00 34.17  ? 36  ARG A CB    1 
ATOM   277   C CG    . ARG A  1 36  ? 179.780 107.741 137.059 1.00 30.80  ? 36  ARG A CG    1 
ATOM   278   C CD    . ARG A  1 36  ? 180.216 107.985 135.681 1.00 30.02  ? 36  ARG A CD    1 
ATOM   279   N NE    . ARG A  1 36  ? 181.645 107.775 135.563 1.00 31.40  ? 36  ARG A NE    1 
ATOM   280   C CZ    . ARG A  1 36  ? 182.298 107.758 134.403 1.00 32.55  ? 36  ARG A CZ    1 
ATOM   281   N NH1   . ARG A  1 36  ? 181.643 107.935 133.248 1.00 32.36  ? 36  ARG A NH1   1 
ATOM   282   N NH2   . ARG A  1 36  ? 183.614 107.568 134.399 1.00 32.34  ? 36  ARG A NH2   1 
ATOM   283   N N     . ARG A  1 37  ? 175.411 107.717 138.059 1.00 14.06  ? 37  ARG A N     1 
ATOM   284   C CA    . ARG A  1 37  ? 174.018 108.101 138.215 1.00 15.81  ? 37  ARG A CA    1 
ATOM   285   C C     . ARG A  1 37  ? 173.775 107.473 139.571 1.00 18.44  ? 37  ARG A C     1 
ATOM   286   O O     . ARG A  1 37  ? 174.659 106.822 140.106 1.00 17.91  ? 37  ARG A O     1 
ATOM   287   C CB    . ARG A  1 37  ? 173.157 107.422 137.148 1.00 39.36  ? 37  ARG A CB    1 
ATOM   288   C CG    . ARG A  1 37  ? 171.891 106.786 137.704 1.00 40.03  ? 37  ARG A CG    1 
ATOM   289   C CD    . ARG A  1 37  ? 171.035 106.048 136.670 1.00 39.38  ? 37  ARG A CD    1 
ATOM   290   N NE    . ARG A  1 37  ? 169.812 105.602 137.318 1.00 38.02  ? 37  ARG A NE    1 
ATOM   291   C CZ    . ARG A  1 37  ? 169.745 104.547 138.116 1.00 37.66  ? 37  ARG A CZ    1 
ATOM   292   N NH1   . ARG A  1 37  ? 170.832 103.819 138.336 1.00 36.20  ? 37  ARG A NH1   1 
ATOM   293   N NH2   . ARG A  1 37  ? 168.610 104.253 138.742 1.00 38.13  ? 37  ARG A NH2   1 
ATOM   294   N N     . MET A  1 38  ? 172.607 107.641 140.151 1.00 40.01  ? 38  MET A N     1 
ATOM   295   C CA    . MET A  1 38  ? 172.397 107.023 141.451 1.00 45.93  ? 38  MET A CA    1 
ATOM   296   C C     . MET A  1 38  ? 173.417 107.630 142.391 1.00 47.63  ? 38  MET A C     1 
ATOM   297   O O     . MET A  1 38  ? 173.779 107.050 143.408 1.00 48.88  ? 38  MET A O     1 
ATOM   298   C CB    . MET A  1 38  ? 172.611 105.509 141.377 1.00 85.66  ? 38  MET A CB    1 
ATOM   299   C CG    . MET A  1 38  ? 172.024 104.721 142.549 1.00 90.99  ? 38  MET A CG    1 
ATOM   300   S SD    . MET A  1 38  ? 172.422 102.948 142.483 1.00 95.66  ? 38  MET A SD    1 
ATOM   301   C CE    . MET A  1 38  ? 172.500 102.654 140.722 1.00 94.92  ? 38  MET A CE    1 
ATOM   302   N N     . GLN A  1 39  ? 173.876 108.812 142.016 1.00 68.07  ? 39  GLN A N     1 
ATOM   303   C CA    . GLN A  1 39  ? 174.834 109.566 142.788 1.00 69.25  ? 39  GLN A CA    1 
ATOM   304   C C     . GLN A  1 39  ? 174.414 110.972 142.427 1.00 69.93  ? 39  GLN A C     1 
ATOM   305   O O     . GLN A  1 39  ? 174.893 111.951 142.992 1.00 70.76  ? 39  GLN A O     1 
ATOM   306   C CB    . GLN A  1 39  ? 176.243 109.301 142.281 1.00 71.71  ? 39  GLN A CB    1 
ATOM   307   C CG    . GLN A  1 39  ? 177.326 109.794 143.194 1.00 73.82  ? 39  GLN A CG    1 
ATOM   308   C CD    . GLN A  1 39  ? 177.789 108.731 144.157 1.00 74.96  ? 39  GLN A CD    1 
ATOM   309   O OE1   . GLN A  1 39  ? 178.634 108.981 145.010 1.00 77.20  ? 39  GLN A OE1   1 
ATOM   310   N NE2   . GLN A  1 39  ? 177.244 107.534 144.024 1.00 74.48  ? 39  GLN A NE2   1 
ATOM   311   N N     . LEU A  1 40  ? 173.510 111.048 141.456 1.00 39.52  ? 40  LEU A N     1 
ATOM   312   C CA    . LEU A  1 40  ? 172.984 112.313 140.978 1.00 40.96  ? 40  LEU A CA    1 
ATOM   313   C C     . LEU A  1 40  ? 171.720 112.650 141.781 1.00 43.72  ? 40  LEU A C     1 
ATOM   314   O O     . LEU A  1 40  ? 171.242 111.821 142.562 1.00 43.08  ? 40  LEU A O     1 
ATOM   315   C CB    . LEU A  1 40  ? 172.651 112.187 139.501 1.00 49.92  ? 40  LEU A CB    1 
ATOM   316   C CG    . LEU A  1 40  ? 173.795 111.732 138.611 1.00 47.90  ? 40  LEU A CG    1 
ATOM   317   C CD1   . LEU A  1 40  ? 173.207 111.070 137.404 1.00 48.49  ? 40  LEU A CD1   1 
ATOM   318   C CD2   . LEU A  1 40  ? 174.664 112.905 138.207 1.00 47.21  ? 40  LEU A CD2   1 
ATOM   319   N N     . GLN A  1 41  ? 171.179 113.858 141.601 1.00 104.37 ? 41  GLN A N     1 
ATOM   320   C CA    . GLN A  1 41  ? 169.981 114.252 142.342 1.00 107.92 ? 41  GLN A CA    1 
ATOM   321   C C     . GLN A  1 41  ? 168.700 113.838 141.651 1.00 108.40 ? 41  GLN A C     1 
ATOM   322   O O     . GLN A  1 41  ? 168.571 113.989 140.436 1.00 108.33 ? 41  GLN A O     1 
ATOM   323   C CB    . GLN A  1 41  ? 169.973 115.757 142.602 1.00 132.31 ? 41  GLN A CB    1 
ATOM   324   C CG    . GLN A  1 41  ? 170.783 116.156 143.822 1.00 135.47 ? 41  GLN A CG    1 
ATOM   325   C CD    . GLN A  1 41  ? 170.333 115.443 145.089 1.00 137.90 ? 41  GLN A CD    1 
ATOM   326   O OE1   . GLN A  1 41  ? 170.907 115.648 146.154 1.00 139.80 ? 41  GLN A OE1   1 
ATOM   327   N NE2   . GLN A  1 41  ? 169.306 114.602 144.979 1.00 137.79 ? 41  GLN A NE2   1 
ATOM   328   N N     . GLU A  1 42  ? 167.753 113.348 142.453 1.00 78.68  ? 42  GLU A N     1 
ATOM   329   C CA    . GLU A  1 42  ? 166.458 112.828 141.987 1.00 79.55  ? 42  GLU A CA    1 
ATOM   330   C C     . GLU A  1 42  ? 165.944 113.073 140.550 1.00 78.30  ? 42  GLU A C     1 
ATOM   331   O O     . GLU A  1 42  ? 165.525 112.119 139.873 1.00 77.63  ? 42  GLU A O     1 
ATOM   332   C CB    . GLU A  1 42  ? 165.352 113.184 142.983 1.00 154.94 ? 42  GLU A CB    1 
ATOM   333   C CG    . GLU A  1 42  ? 164.149 112.269 142.808 1.00 159.06 ? 42  GLU A CG    1 
ATOM   334   C CD    . GLU A  1 42  ? 164.564 110.808 142.631 1.00 160.70 ? 42  GLU A CD    1 
ATOM   335   O OE1   . GLU A  1 42  ? 165.016 110.194 143.621 1.00 160.87 ? 42  GLU A OE1   1 
ATOM   336   O OE2   . GLU A  1 42  ? 164.453 110.279 141.501 1.00 161.42 ? 42  GLU A OE2   1 
ATOM   337   N N     . PRO A  1 43  ? 165.930 114.332 140.074 1.00 101.19 ? 43  PRO A N     1 
ATOM   338   C CA    . PRO A  1 43  ? 165.451 114.563 138.706 1.00 100.00 ? 43  PRO A CA    1 
ATOM   339   C C     . PRO A  1 43  ? 166.228 113.701 137.696 1.00 98.46  ? 43  PRO A C     1 
ATOM   340   O O     . PRO A  1 43  ? 165.642 112.940 136.931 1.00 98.78  ? 43  PRO A O     1 
ATOM   341   C CB    . PRO A  1 43  ? 165.700 116.051 138.509 1.00 104.82 ? 43  PRO A CB    1 
ATOM   342   C CG    . PRO A  1 43  ? 165.437 116.594 139.870 1.00 105.89 ? 43  PRO A CG    1 
ATOM   343   C CD    . PRO A  1 43  ? 166.154 115.611 140.770 1.00 105.69 ? 43  PRO A CD    1 
ATOM   344   N N     . LEU A  1 44  ? 167.553 113.814 137.714 1.00 43.03  ? 44  LEU A N     1 
ATOM   345   C CA    . LEU A  1 44  ? 168.411 113.054 136.819 1.00 39.33  ? 44  LEU A CA    1 
ATOM   346   C C     . LEU A  1 44  ? 168.678 111.638 137.285 1.00 39.13  ? 44  LEU A C     1 
ATOM   347   O O     . LEU A  1 44  ? 168.904 110.747 136.483 1.00 38.31  ? 44  LEU A O     1 
ATOM   348   C CB    . LEU A  1 44  ? 169.750 113.753 136.677 1.00 17.04  ? 44  LEU A CB    1 
ATOM   349   C CG    . LEU A  1 44  ? 169.706 115.095 135.969 1.00 14.97  ? 44  LEU A CG    1 
ATOM   350   C CD1   . LEU A  1 44  ? 171.122 115.603 135.714 1.00 15.15  ? 44  LEU A CD1   1 
ATOM   351   C CD2   . LEU A  1 44  ? 168.983 114.927 134.670 1.00 14.87  ? 44  LEU A CD2   1 
ATOM   352   N N     . ARG A  1 45  ? 168.673 111.430 138.590 1.00 49.25  ? 45  ARG A N     1 
ATOM   353   C CA    . ARG A  1 45  ? 168.960 110.113 139.124 1.00 51.25  ? 45  ARG A CA    1 
ATOM   354   C C     . ARG A  1 45  ? 168.065 109.119 138.465 1.00 52.08  ? 45  ARG A C     1 
ATOM   355   O O     . ARG A  1 45  ? 168.388 107.938 138.449 1.00 52.81  ? 45  ARG A O     1 
ATOM   356   C CB    . ARG A  1 45  ? 168.745 110.056 140.635 1.00 100.83 ? 45  ARG A CB    1 
ATOM   357   C CG    . ARG A  1 45  ? 169.625 109.040 141.339 1.00 103.49 ? 45  ARG A CG    1 
ATOM   358   C CD    . ARG A  1 45  ? 169.440 109.109 142.845 1.00 106.74 ? 45  ARG A CD    1 
ATOM   359   N NE    . ARG A  1 45  ? 168.335 108.269 143.283 1.00 110.62 ? 45  ARG A NE    1 
ATOM   360   C CZ    . ARG A  1 45  ? 168.426 106.955 143.471 1.00 113.76 ? 45  ARG A CZ    1 
ATOM   361   N NH1   . ARG A  1 45  ? 169.579 106.333 143.266 1.00 114.19 ? 45  ARG A NH1   1 
ATOM   362   N NH2   . ARG A  1 45  ? 167.362 106.256 143.855 1.00 115.07 ? 45  ARG A NH2   1 
ATOM   363   N N     . HIS A  1 46  ? 166.941 109.592 137.921 1.00 39.84  ? 46  HIS A N     1 
ATOM   364   C CA    . HIS A  1 46  ? 165.991 108.695 137.249 1.00 40.31  ? 46  HIS A CA    1 
ATOM   365   C C     . HIS A  1 46  ? 165.832 108.926 135.741 1.00 37.72  ? 46  HIS A C     1 
ATOM   366   O O     . HIS A  1 46  ? 165.336 108.075 135.007 1.00 36.36  ? 46  HIS A O     1 
ATOM   367   C CB    . HIS A  1 46  ? 164.624 108.755 137.929 1.00 105.36 ? 46  HIS A CB    1 
ATOM   368   C CG    . HIS A  1 46  ? 164.080 107.403 138.271 1.00 111.35 ? 46  HIS A CG    1 
ATOM   369   N ND1   . HIS A  1 46  ? 164.663 106.587 139.218 1.00 112.90 ? 46  HIS A ND1   1 
ATOM   370   C CD2   . HIS A  1 46  ? 163.050 106.695 137.747 1.00 113.81 ? 46  HIS A CD2   1 
ATOM   371   C CE1   . HIS A  1 46  ? 164.017 105.434 139.260 1.00 114.64 ? 46  HIS A CE1   1 
ATOM   372   N NE2   . HIS A  1 46  ? 163.035 105.473 138.376 1.00 114.91 ? 46  HIS A NE2   1 
ATOM   373   N N     . GLU A  1 47  ? 166.272 110.085 135.285 1.00 54.21  ? 47  GLU A N     1 
ATOM   374   C CA    . GLU A  1 47  ? 166.188 110.423 133.883 1.00 51.91  ? 47  GLU A CA    1 
ATOM   375   C C     . GLU A  1 47  ? 167.268 109.734 133.065 1.00 49.63  ? 47  GLU A C     1 
ATOM   376   O O     . GLU A  1 47  ? 167.010 109.299 131.957 1.00 49.18  ? 47  GLU A O     1 
ATOM   377   C CB    . GLU A  1 47  ? 166.306 111.935 133.715 1.00 94.82  ? 47  GLU A CB    1 
ATOM   378   C CG    . GLU A  1 47  ? 165.032 112.679 133.994 1.00 97.92  ? 47  GLU A CG    1 
ATOM   379   C CD    . GLU A  1 47  ? 164.067 112.617 132.831 1.00 100.16 ? 47  GLU A CD    1 
ATOM   380   O OE1   . GLU A  1 47  ? 162.948 113.156 132.966 1.00 101.38 ? 47  GLU A OE1   1 
ATOM   381   O OE2   . GLU A  1 47  ? 164.428 112.039 131.781 1.00 100.51 ? 47  GLU A OE2   1 
ATOM   382   N N     . VAL A  1 48  ? 168.477 109.637 133.607 1.00 46.95  ? 48  VAL A N     1 
ATOM   383   C CA    . VAL A  1 48  ? 169.585 109.026 132.889 1.00 45.22  ? 48  VAL A CA    1 
ATOM   384   C C     . VAL A  1 48  ? 169.443 107.509 132.807 1.00 44.28  ? 48  VAL A C     1 
ATOM   385   O O     . VAL A  1 48  ? 169.196 106.840 133.813 1.00 43.45  ? 48  VAL A O     1 
ATOM   386   C CB    . VAL A  1 48  ? 170.913 109.399 133.546 1.00 53.76  ? 48  VAL A CB    1 
ATOM   387   C CG1   . VAL A  1 48  ? 170.918 108.981 134.972 1.00 53.20  ? 48  VAL A CG1   1 
ATOM   388   C CG2   . VAL A  1 48  ? 172.041 108.747 132.819 1.00 54.57  ? 48  VAL A CG2   1 
ATOM   389   N N     . THR A  1 49  ? 169.608 106.971 131.600 1.00 79.10  ? 49  THR A N     1 
ATOM   390   C CA    . THR A  1 49  ? 169.445 105.540 131.361 1.00 77.15  ? 49  THR A CA    1 
ATOM   391   C C     . THR A  1 49  ? 170.685 104.837 130.851 1.00 75.46  ? 49  THR A C     1 
ATOM   392   O O     . THR A  1 49  ? 171.504 105.439 130.166 1.00 77.42  ? 49  THR A O     1 
ATOM   393   C CB    . THR A  1 49  ? 168.354 105.293 130.324 1.00 101.26 ? 49  THR A CB    1 
ATOM   394   O OG1   . THR A  1 49  ? 168.747 105.886 129.079 1.00 102.38 ? 49  THR A OG1   1 
ATOM   395   C CG2   . THR A  1 49  ? 167.043 105.898 130.782 1.00 102.68 ? 49  THR A CG2   1 
ATOM   396   N N     . PRO A  1 50  ? 170.811 103.535 131.147 1.00 26.22  ? 50  PRO A N     1 
ATOM   397   C CA    . PRO A  1 50  ? 171.905 102.639 130.772 1.00 24.01  ? 50  PRO A CA    1 
ATOM   398   C C     . PRO A  1 50  ? 172.345 102.809 129.311 1.00 22.01  ? 50  PRO A C     1 
ATOM   399   O O     . PRO A  1 50  ? 171.530 103.144 128.451 1.00 21.51  ? 50  PRO A O     1 
ATOM   400   C CB    . PRO A  1 50  ? 171.297 101.264 131.012 1.00 76.37  ? 50  PRO A CB    1 
ATOM   401   C CG    . PRO A  1 50  ? 170.442 101.490 132.181 1.00 77.23  ? 50  PRO A CG    1 
ATOM   402   C CD    . PRO A  1 50  ? 169.751 102.781 131.834 1.00 76.88  ? 50  PRO A CD    1 
ATOM   403   N N     . LYS A  1 51  ? 173.616 102.561 129.010 1.00 55.73  ? 51  LYS A N     1 
ATOM   404   C CA    . LYS A  1 51  ? 174.053 102.709 127.634 1.00 54.74  ? 51  LYS A CA    1 
ATOM   405   C C     . LYS A  1 51  ? 174.299 101.370 126.969 1.00 52.70  ? 51  LYS A C     1 
ATOM   406   O O     . LYS A  1 51  ? 175.310 101.193 126.308 1.00 54.76  ? 51  LYS A O     1 
ATOM   407   C CB    . LYS A  1 51  ? 175.316 103.549 127.583 1.00 95.19  ? 51  LYS A CB    1 
ATOM   408   C CG    . LYS A  1 51  ? 175.124 104.943 128.131 1.00 99.22  ? 51  LYS A CG    1 
ATOM   409   C CD    . LYS A  1 51  ? 174.056 105.683 127.348 1.00 102.46 ? 51  LYS A CD    1 
ATOM   410   C CE    . LYS A  1 51  ? 173.773 107.062 127.929 1.00 103.33 ? 51  LYS A CE    1 
ATOM   411   N NZ    . LYS A  1 51  ? 172.650 107.709 127.197 1.00 102.99 ? 51  LYS A NZ    1 
ATOM   412   N N     . ASN A  1 52  ? 173.363 100.441 127.140 1.00 34.68  ? 52  ASN A N     1 
ATOM   413   C CA    . ASN A  1 52  ? 173.416 99.086  126.591 1.00 30.64  ? 52  ASN A CA    1 
ATOM   414   C C     . ASN A  1 52  ? 174.452 98.761  125.525 1.00 28.62  ? 52  ASN A C     1 
ATOM   415   O O     . ASN A  1 52  ? 174.654 99.519  124.587 1.00 29.78  ? 52  ASN A O     1 
ATOM   416   C CB    . ASN A  1 52  ? 172.035 98.713  126.088 1.00 33.17  ? 52  ASN A CB    1 
ATOM   417   C CG    . ASN A  1 52  ? 171.025 98.644  127.212 1.00 34.21  ? 52  ASN A CG    1 
ATOM   418   O OD1   . ASN A  1 52  ? 171.342 98.221  128.314 1.00 33.33  ? 52  ASN A OD1   1 
ATOM   419   N ND2   . ASN A  1 52  ? 169.808 99.053  126.942 1.00 33.44  ? 52  ASN A ND2   1 
ATOM   420   N N     . ILE A  1 53  ? 175.081 97.599  125.657 1.00 25.45  ? 53  ILE A N     1 
ATOM   421   C CA    . ILE A  1 53  ? 176.123 97.179  124.732 1.00 20.37  ? 53  ILE A CA    1 
ATOM   422   C C     . ILE A  1 53  ? 175.787 96.026  123.809 1.00 18.21  ? 53  ILE A C     1 
ATOM   423   O O     . ILE A  1 53  ? 175.014 95.124  124.172 1.00 17.78  ? 53  ILE A O     1 
ATOM   424   C CB    . ILE A  1 53  ? 177.311 96.707  125.488 1.00 21.88  ? 53  ILE A CB    1 
ATOM   425   C CG1   . ILE A  1 53  ? 177.703 97.738  126.495 1.00 20.97  ? 53  ILE A CG1   1 
ATOM   426   C CG2   . ILE A  1 53  ? 178.429 96.404  124.560 1.00 20.35  ? 53  ILE A CG2   1 
ATOM   427   C CD1   . ILE A  1 53  ? 178.393 97.087  127.627 1.00 23.36  ? 53  ILE A CD1   1 
ATOM   428   N N     . LEU A  1 54  ? 176.411 96.056  122.630 1.00 6.85   ? 54  LEU A N     1 
ATOM   429   C CA    . LEU A  1 54  ? 176.274 95.000  121.636 1.00 5.96   ? 54  LEU A CA    1 
ATOM   430   C C     . LEU A  1 54  ? 177.697 94.565  121.325 1.00 5.51   ? 54  LEU A C     1 
ATOM   431   O O     . LEU A  1 54  ? 178.472 95.365  120.793 1.00 5.88   ? 54  LEU A O     1 
ATOM   432   C CB    . LEU A  1 54  ? 175.611 95.489  120.340 1.00 2.25   ? 54  LEU A CB    1 
ATOM   433   C CG    . LEU A  1 54  ? 175.598 94.422  119.239 1.00 1.00   ? 54  LEU A CG    1 
ATOM   434   C CD1   . LEU A  1 54  ? 174.740 93.299  119.770 1.00 1.00   ? 54  LEU A CD1   1 
ATOM   435   C CD2   . LEU A  1 54  ? 175.057 94.911  117.895 1.00 1.00   ? 54  LEU A CD2   1 
ATOM   436   N N     . MET A  1 55  ? 178.032 93.314  121.688 1.00 9.44   ? 55  MET A N     1 
ATOM   437   C CA    . MET A  1 55  ? 179.345 92.705  121.456 1.00 5.30   ? 55  MET A CA    1 
ATOM   438   C C     . MET A  1 55  ? 179.189 91.890  120.239 1.00 5.85   ? 55  MET A C     1 
ATOM   439   O O     . MET A  1 55  ? 178.303 91.067  120.181 1.00 5.83   ? 55  MET A O     1 
ATOM   440   C CB    . MET A  1 55  ? 179.699 91.767  122.550 1.00 1.52   ? 55  MET A CB    1 
ATOM   441   C CG    . MET A  1 55  ? 179.548 92.407  123.849 1.00 1.52   ? 55  MET A CG    1 
ATOM   442   S SD    . MET A  1 55  ? 180.327 91.377  125.008 1.00 1.52   ? 55  MET A SD    1 
ATOM   443   C CE    . MET A  1 55  ? 179.767 91.962  126.558 1.00 1.52   ? 55  MET A CE    1 
ATOM   444   N N     . ILE A  1 56  ? 180.028 92.153  119.256 1.00 22.37  ? 56  ILE A N     1 
ATOM   445   C CA    . ILE A  1 56  ? 180.004 91.443  117.999 1.00 23.43  ? 56  ILE A CA    1 
ATOM   446   C C     . ILE A  1 56  ? 181.280 90.639  117.981 1.00 26.87  ? 56  ILE A C     1 
ATOM   447   O O     . ILE A  1 56  ? 182.381 91.196  118.064 1.00 29.72  ? 56  ILE A O     1 
ATOM   448   C CB    . ILE A  1 56  ? 180.084 92.374  116.819 1.00 10.47  ? 56  ILE A CB    1 
ATOM   449   C CG1   . ILE A  1 56  ? 178.789 93.137  116.633 1.00 10.64  ? 56  ILE A CG1   1 
ATOM   450   C CG2   . ILE A  1 56  ? 180.339 91.586  115.608 1.00 10.55  ? 56  ILE A CG2   1 
ATOM   451   C CD1   . ILE A  1 56  ? 178.488 94.179  117.695 1.00 10.25  ? 56  ILE A CD1   1 
ATOM   452   N N     . GLY A  1 57  ? 181.158 89.327  117.865 1.00 28.75  ? 57  GLY A N     1 
ATOM   453   C CA    . GLY A  1 57  ? 182.361 88.532  117.852 1.00 29.40  ? 57  GLY A CA    1 
ATOM   454   C C     . GLY A  1 57  ? 182.141 87.157  117.281 1.00 29.83  ? 57  GLY A C     1 
ATOM   455   O O     . GLY A  1 57  ? 181.018 86.821  116.904 1.00 28.99  ? 57  GLY A O     1 
ATOM   456   N N     . PRO A  1 58  ? 183.217 86.347  117.214 1.00 10.04  ? 58  PRO A N     1 
ATOM   457   C CA    . PRO A  1 58  ? 183.258 84.994  116.704 1.00 10.57  ? 58  PRO A CA    1 
ATOM   458   C C     . PRO A  1 58  ? 182.772 84.127  117.818 1.00 11.51  ? 58  PRO A C     1 
ATOM   459   O O     . PRO A  1 58  ? 182.344 84.655  118.842 1.00 11.42  ? 58  PRO A O     1 
ATOM   460   C CB    . PRO A  1 58  ? 184.734 84.781  116.457 1.00 29.53  ? 58  PRO A CB    1 
ATOM   461   C CG    . PRO A  1 58  ? 185.317 86.146  116.430 1.00 28.74  ? 58  PRO A CG    1 
ATOM   462   C CD    . PRO A  1 58  ? 184.585 86.771  117.524 1.00 27.49  ? 58  PRO A CD    1 
ATOM   463   N N     . THR A  1 59  ? 182.870 82.807  117.641 1.00 31.10  ? 59  THR A N     1 
ATOM   464   C CA    . THR A  1 59  ? 182.401 81.881  118.667 1.00 31.23  ? 59  THR A CA    1 
ATOM   465   C C     . THR A  1 59  ? 183.340 81.656  119.854 1.00 29.69  ? 59  THR A C     1 
ATOM   466   O O     . THR A  1 59  ? 184.547 81.481  119.673 1.00 29.45  ? 59  THR A O     1 
ATOM   467   C CB    . THR A  1 59  ? 182.073 80.536  118.061 1.00 25.42  ? 59  THR A CB    1 
ATOM   468   O OG1   . THR A  1 59  ? 181.191 80.721  116.944 1.00 27.51  ? 59  THR A OG1   1 
ATOM   469   C CG2   . THR A  1 59  ? 181.428 79.650  119.119 1.00 25.52  ? 59  THR A CG2   1 
ATOM   470   N N     . GLY A  1 60  ? 182.757 81.657  121.058 1.00 19.12  ? 60  GLY A N     1 
ATOM   471   C CA    . GLY A  1 60  ? 183.511 81.472  122.281 1.00 20.09  ? 60  GLY A CA    1 
ATOM   472   C C     . GLY A  1 60  ? 184.841 82.222  122.379 1.00 22.24  ? 60  GLY A C     1 
ATOM   473   O O     . GLY A  1 60  ? 185.920 81.610  122.443 1.00 22.09  ? 60  GLY A O     1 
ATOM   474   N N     . VAL A  1 61  ? 184.786 83.555  122.398 1.00 39.38  ? 61  VAL A N     1 
ATOM   475   C CA    . VAL A  1 61  ? 186.000 84.353  122.512 1.00 37.93  ? 61  VAL A CA    1 
ATOM   476   C C     . VAL A  1 61  ? 185.920 85.285  123.692 1.00 38.92  ? 61  VAL A C     1 
ATOM   477   O O     . VAL A  1 61  ? 186.772 86.150  123.882 1.00 39.53  ? 61  VAL A O     1 
ATOM   478   C CB    . VAL A  1 61  ? 186.262 85.135  121.254 1.00 1.30   ? 61  VAL A CB    1 
ATOM   479   C CG1   . VAL A  1 61  ? 186.951 84.249  120.276 1.00 1.30   ? 61  VAL A CG1   1 
ATOM   480   C CG2   . VAL A  1 61  ? 184.999 85.580  120.664 1.00 1.30   ? 61  VAL A CG2   1 
ATOM   481   N N     . GLY A  1 62  ? 184.874 85.100  124.483 1.00 1.66   ? 62  GLY A N     1 
ATOM   482   C CA    . GLY A  1 62  ? 184.713 85.889  125.687 1.00 2.57   ? 62  GLY A CA    1 
ATOM   483   C C     . GLY A  1 62  ? 183.425 86.650  125.933 1.00 2.60   ? 62  GLY A C     1 
ATOM   484   O O     . GLY A  1 62  ? 183.088 86.973  127.085 1.00 1.71   ? 62  GLY A O     1 
ATOM   485   N N     . LYS A  1 63  ? 182.708 86.941  124.859 1.00 27.07  ? 63  LYS A N     1 
ATOM   486   C CA    . LYS A  1 63  ? 181.483 87.685  124.984 1.00 27.96  ? 63  LYS A CA    1 
ATOM   487   C C     . LYS A  1 63  ? 180.716 87.390  126.270 1.00 29.27  ? 63  LYS A C     1 
ATOM   488   O O     . LYS A  1 63  ? 180.369 88.303  126.999 1.00 30.90  ? 63  LYS A O     1 
ATOM   489   C CB    . LYS A  1 63  ? 180.612 87.434  123.776 1.00 3.42   ? 63  LYS A CB    1 
ATOM   490   C CG    . LYS A  1 63  ? 181.243 87.858  122.504 1.00 1.92   ? 63  LYS A CG    1 
ATOM   491   C CD    . LYS A  1 63  ? 180.186 87.840  121.455 1.00 2.36   ? 63  LYS A CD    1 
ATOM   492   C CE    . LYS A  1 63  ? 180.660 87.358  120.086 1.00 1.65   ? 63  LYS A CE    1 
ATOM   493   N NZ    . LYS A  1 63  ? 180.649 85.866  119.976 1.00 1.89   ? 63  LYS A NZ    1 
ATOM   494   N N     . THR A  1 64  ? 180.475 86.127  126.583 1.00 10.76  ? 64  THR A N     1 
ATOM   495   C CA    . THR A  1 64  ? 179.714 85.809  127.790 1.00 11.69  ? 64  THR A CA    1 
ATOM   496   C C     . THR A  1 64  ? 180.501 85.869  129.084 1.00 12.35  ? 64  THR A C     1 
ATOM   497   O O     . THR A  1 64  ? 179.983 86.332  130.087 1.00 12.42  ? 64  THR A O     1 
ATOM   498   C CB    . THR A  1 64  ? 179.037 84.425  127.687 1.00 25.73  ? 64  THR A CB    1 
ATOM   499   O OG1   . THR A  1 64  ? 178.161 84.410  126.553 1.00 28.01  ? 64  THR A OG1   1 
ATOM   500   C CG2   . THR A  1 64  ? 178.230 84.107  128.936 1.00 23.49  ? 64  THR A CG2   1 
ATOM   501   N N     . GLU A  1 65  ? 181.744 85.404  129.095 1.00 34.66  ? 65  GLU A N     1 
ATOM   502   C CA    . GLU A  1 65  ? 182.502 85.463  130.345 1.00 35.92  ? 65  GLU A CA    1 
ATOM   503   C C     . GLU A  1 65  ? 182.554 86.880  130.795 1.00 34.41  ? 65  GLU A C     1 
ATOM   504   O O     . GLU A  1 65  ? 182.155 87.216  131.907 1.00 34.61  ? 65  GLU A O     1 
ATOM   505   C CB    . GLU A  1 65  ? 183.912 84.947  130.169 1.00 35.46  ? 65  GLU A CB    1 
ATOM   506   C CG    . GLU A  1 65  ? 183.974 83.454  130.360 1.00 40.86  ? 65  GLU A CG    1 
ATOM   507   C CD    . GLU A  1 65  ? 183.679 83.032  131.784 1.00 42.56  ? 65  GLU A CD    1 
ATOM   508   O OE1   . GLU A  1 65  ? 182.704 82.271  131.983 1.00 44.35  ? 65  GLU A OE1   1 
ATOM   509   O OE2   . GLU A  1 65  ? 184.429 83.461  132.692 1.00 43.42  ? 65  GLU A OE2   1 
ATOM   510   N N     . ILE A  1 66  ? 183.041 87.716  129.902 1.00 28.67  ? 66  ILE A N     1 
ATOM   511   C CA    . ILE A  1 66  ? 183.126 89.120  130.191 1.00 25.77  ? 66  ILE A CA    1 
ATOM   512   C C     . ILE A  1 66  ? 181.844 89.595  130.865 1.00 25.37  ? 66  ILE A C     1 
ATOM   513   O O     . ILE A  1 66  ? 181.906 90.259  131.890 1.00 25.66  ? 66  ILE A O     1 
ATOM   514   C CB    . ILE A  1 66  ? 183.389 89.886  128.913 1.00 12.51  ? 66  ILE A CB    1 
ATOM   515   C CG1   . ILE A  1 66  ? 184.743 89.444  128.334 1.00 9.40   ? 66  ILE A CG1   1 
ATOM   516   C CG2   . ILE A  1 66  ? 183.379 91.358  129.195 1.00 13.16  ? 66  ILE A CG2   1 
ATOM   517   C CD1   . ILE A  1 66  ? 185.058 90.045  127.006 1.00 4.52   ? 66  ILE A CD1   1 
ATOM   518   N N     . ALA A  1 67  ? 180.689 89.238  130.315 1.00 3.81   ? 67  ALA A N     1 
ATOM   519   C CA    . ALA A  1 67  ? 179.397 89.626  130.926 1.00 5.34   ? 67  ALA A CA    1 
ATOM   520   C C     . ALA A  1 67  ? 179.128 88.926  132.241 1.00 5.63   ? 67  ALA A C     1 
ATOM   521   O O     . ALA A  1 67  ? 178.773 89.537  133.239 1.00 3.70   ? 67  ALA A O     1 
ATOM   522   C CB    . ALA A  1 67  ? 178.219 89.323  129.996 1.00 11.69  ? 67  ALA A CB    1 
ATOM   523   N N     . ARG A  1 68  ? 179.284 87.621  132.238 1.00 19.91  ? 68  ARG A N     1 
ATOM   524   C CA    . ARG A  1 68  ? 179.003 86.894  133.445 1.00 23.10  ? 68  ARG A CA    1 
ATOM   525   C C     . ARG A  1 68  ? 179.921 87.378  134.544 1.00 22.60  ? 68  ARG A C     1 
ATOM   526   O O     . ARG A  1 68  ? 179.511 87.478  135.708 1.00 21.59  ? 68  ARG A O     1 
ATOM   527   C CB    . ARG A  1 68  ? 179.163 85.390  133.214 1.00 55.92  ? 68  ARG A CB    1 
ATOM   528   C CG    . ARG A  1 68  ? 178.236 84.537  134.071 1.00 60.24  ? 68  ARG A CG    1 
ATOM   529   C CD    . ARG A  1 68  ? 178.487 83.073  133.823 1.00 66.08  ? 68  ARG A CD    1 
ATOM   530   N NE    . ARG A  1 68  ? 178.061 82.597  132.500 1.00 70.75  ? 68  ARG A NE    1 
ATOM   531   C CZ    . ARG A  1 68  ? 176.856 82.097  132.222 1.00 71.77  ? 68  ARG A CZ    1 
ATOM   532   N NH1   . ARG A  1 68  ? 175.926 82.011  133.170 1.00 69.93  ? 68  ARG A NH1   1 
ATOM   533   N NH2   . ARG A  1 68  ? 176.600 81.634  131.004 1.00 72.16  ? 68  ARG A NH2   1 
ATOM   534   N N     . ARG A  1 69  ? 181.156 87.697  134.170 1.00 31.67  ? 69  ARG A N     1 
ATOM   535   C CA    . ARG A  1 69  ? 182.137 88.167  135.142 1.00 34.02  ? 69  ARG A CA    1 
ATOM   536   C C     . ARG A  1 69  ? 181.838 89.566  135.591 1.00 34.25  ? 69  ARG A C     1 
ATOM   537   O O     . ARG A  1 69  ? 181.964 89.875  136.767 1.00 35.64  ? 69  ARG A O     1 
ATOM   538   C CB    . ARG A  1 69  ? 183.539 88.159  134.564 1.00 44.82  ? 69  ARG A CB    1 
ATOM   539   C CG    . ARG A  1 69  ? 184.092 86.797  134.345 1.00 47.96  ? 69  ARG A CG    1 
ATOM   540   C CD    . ARG A  1 69  ? 184.368 86.121  135.666 1.00 50.17  ? 69  ARG A CD    1 
ATOM   541   N NE    . ARG A  1 69  ? 184.661 84.707  135.463 1.00 51.20  ? 69  ARG A NE    1 
ATOM   542   C CZ    . ARG A  1 69  ? 184.791 83.820  136.440 1.00 51.12  ? 69  ARG A CZ    1 
ATOM   543   N NH1   . ARG A  1 69  ? 184.653 84.189  137.706 1.00 50.82  ? 69  ARG A NH1   1 
ATOM   544   N NH2   . ARG A  1 69  ? 185.063 82.561  136.147 1.00 53.00  ? 69  ARG A NH2   1 
ATOM   545   N N     . LEU A  1 70  ? 181.463 90.421  134.650 1.00 28.33  ? 70  LEU A N     1 
ATOM   546   C CA    . LEU A  1 70  ? 181.176 91.789  135.008 1.00 27.31  ? 70  LEU A CA    1 
ATOM   547   C C     . LEU A  1 70  ? 180.185 91.732  136.122 1.00 28.17  ? 70  LEU A C     1 
ATOM   548   O O     . LEU A  1 70  ? 180.382 92.348  137.173 1.00 28.71  ? 70  LEU A O     1 
ATOM   549   C CB    . LEU A  1 70  ? 180.554 92.533  133.853 1.00 14.16  ? 70  LEU A CB    1 
ATOM   550   C CG    . LEU A  1 70  ? 180.203 93.975  134.183 1.00 10.96  ? 70  LEU A CG    1 
ATOM   551   C CD1   . LEU A  1 70  ? 181.443 94.823  134.237 1.00 9.01   ? 70  LEU A CD1   1 
ATOM   552   C CD2   . LEU A  1 70  ? 179.300 94.465  133.112 1.00 12.05  ? 70  LEU A CD2   1 
ATOM   553   N N     . ALA A  1 71  ? 179.122 90.970  135.867 1.00 28.91  ? 71  ALA A N     1 
ATOM   554   C CA    . ALA A  1 71  ? 178.032 90.779  136.814 1.00 31.02  ? 71  ALA A CA    1 
ATOM   555   C C     . ALA A  1 71  ? 178.544 90.283  138.164 1.00 31.67  ? 71  ALA A C     1 
ATOM   556   O O     . ALA A  1 71  ? 178.198 90.813  139.224 1.00 30.95  ? 71  ALA A O     1 
ATOM   557   C CB    . ALA A  1 71  ? 177.035 89.786  136.242 1.00 105.30 ? 71  ALA A CB    1 
ATOM   558   N N     . LYS A  1 72  ? 179.377 89.256  138.107 1.00 46.38  ? 72  LYS A N     1 
ATOM   559   C CA    . LYS A  1 72  ? 179.929 88.662  139.302 1.00 48.48  ? 72  LYS A CA    1 
ATOM   560   C C     . LYS A  1 72  ? 180.725 89.660  140.146 1.00 47.02  ? 72  LYS A C     1 
ATOM   561   O O     . LYS A  1 72  ? 180.545 89.736  141.353 1.00 47.81  ? 72  LYS A O     1 
ATOM   562   C CB    . LYS A  1 72  ? 180.812 87.475  138.909 1.00 113.90 ? 72  LYS A CB    1 
ATOM   563   C CG    . LYS A  1 72  ? 181.165 86.550  140.054 1.00 121.58 ? 72  LYS A CG    1 
ATOM   564   C CD    . LYS A  1 72  ? 179.918 85.942  140.686 1.00 126.89 ? 72  LYS A CD    1 
ATOM   565   C CE    . LYS A  1 72  ? 180.278 84.885  141.722 1.00 130.70 ? 72  LYS A CE    1 
ATOM   566   N NZ    . LYS A  1 72  ? 181.019 83.743  141.107 1.00 131.89 ? 72  LYS A NZ    1 
ATOM   567   N N     . LEU A  1 73  ? 181.584 90.450  139.517 1.00 30.16  ? 73  LEU A N     1 
ATOM   568   C CA    . LEU A  1 73  ? 182.423 91.370  140.273 1.00 29.23  ? 73  LEU A CA    1 
ATOM   569   C C     . LEU A  1 73  ? 181.656 92.540  140.751 1.00 29.34  ? 73  LEU A C     1 
ATOM   570   O O     . LEU A  1 73  ? 182.187 93.378  141.479 1.00 29.48  ? 73  LEU A O     1 
ATOM   571   C CB    . LEU A  1 73  ? 183.610 91.869  139.444 1.00 37.06  ? 73  LEU A CB    1 
ATOM   572   C CG    . LEU A  1 73  ? 183.351 92.895  138.341 1.00 36.76  ? 73  LEU A CG    1 
ATOM   573   C CD1   . LEU A  1 73  ? 183.391 94.283  138.900 1.00 35.16  ? 73  LEU A CD1   1 
ATOM   574   C CD2   . LEU A  1 73  ? 184.426 92.767  137.292 1.00 36.15  ? 73  LEU A CD2   1 
ATOM   575   N N     . ALA A  1 74  ? 180.407 92.615  140.332 1.00 36.07  ? 74  ALA A N     1 
ATOM   576   C CA    . ALA A  1 74  ? 179.580 93.729  140.740 1.00 38.26  ? 74  ALA A CA    1 
ATOM   577   C C     . ALA A  1 74  ? 178.474 93.201  141.633 1.00 39.28  ? 74  ALA A C     1 
ATOM   578   O O     . ALA A  1 74  ? 177.553 93.937  142.031 1.00 39.60  ? 74  ALA A O     1 
ATOM   579   C CB    . ALA A  1 74  ? 179.000 94.422  139.515 1.00 55.37  ? 74  ALA A CB    1 
ATOM   580   N N     . ASN A  1 75  ? 178.568 91.916  141.951 1.00 47.40  ? 75  ASN A N     1 
ATOM   581   C CA    . ASN A  1 75  ? 177.563 91.300  142.791 1.00 49.51  ? 75  ASN A CA    1 
ATOM   582   C C     . ASN A  1 75  ? 176.208 91.806  142.284 1.00 48.31  ? 75  ASN A C     1 
ATOM   583   O O     . ASN A  1 75  ? 175.457 92.438  143.015 1.00 47.98  ? 75  ASN A O     1 
ATOM   584   C CB    . ASN A  1 75  ? 177.797 91.724  144.236 1.00 115.19 ? 75  ASN A CB    1 
ATOM   585   C CG    . ASN A  1 75  ? 176.880 91.026  145.199 1.00 120.09 ? 75  ASN A CG    1 
ATOM   586   O OD1   . ASN A  1 75  ? 176.908 89.802  145.329 1.00 121.84 ? 75  ASN A OD1   1 
ATOM   587   N ND2   . ASN A  1 75  ? 176.053 91.801  145.887 1.00 121.16 ? 75  ASN A ND2   1 
ATOM   588   N N     . ALA A  1 76  ? 175.917 91.538  141.014 1.00 43.90  ? 76  ALA A N     1 
ATOM   589   C CA    . ALA A  1 76  ? 174.674 91.980  140.401 1.00 41.66  ? 76  ALA A CA    1 
ATOM   590   C C     . ALA A  1 76  ? 173.854 90.814  139.891 1.00 39.64  ? 76  ALA A C     1 
ATOM   591   O O     . ALA A  1 76  ? 174.409 89.813  139.456 1.00 40.66  ? 76  ALA A O     1 
ATOM   592   C CB    . ALA A  1 76  ? 174.984 92.904  139.264 1.00 47.95  ? 76  ALA A CB    1 
ATOM   593   N N     . PRO A  1 77  ? 172.519 90.920  139.946 1.00 27.71  ? 77  PRO A N     1 
ATOM   594   C CA    . PRO A  1 77  ? 171.644 89.845  139.468 1.00 26.60  ? 77  PRO A CA    1 
ATOM   595   C C     . PRO A  1 77  ? 171.927 89.699  137.983 1.00 25.34  ? 77  PRO A C     1 
ATOM   596   O O     . PRO A  1 77  ? 171.809 90.676  137.245 1.00 26.28  ? 77  PRO A O     1 
ATOM   597   C CB    . PRO A  1 77  ? 170.251 90.399  139.725 1.00 76.13  ? 77  PRO A CB    1 
ATOM   598   C CG    . PRO A  1 77  ? 170.452 91.301  140.896 1.00 77.10  ? 77  PRO A CG    1 
ATOM   599   C CD    . PRO A  1 77  ? 171.728 92.005  140.543 1.00 76.67  ? 77  PRO A CD    1 
ATOM   600   N N     . PHE A  1 78  ? 172.297 88.504  137.538 1.00 12.84  ? 78  PHE A N     1 
ATOM   601   C CA    . PHE A  1 78  ? 172.635 88.321  136.136 1.00 11.59  ? 78  PHE A CA    1 
ATOM   602   C C     . PHE A  1 78  ? 171.803 87.238  135.525 1.00 12.09  ? 78  PHE A C     1 
ATOM   603   O O     . PHE A  1 78  ? 171.293 86.381  136.228 1.00 12.09  ? 78  PHE A O     1 
ATOM   604   C CB    . PHE A  1 78  ? 174.105 87.939  136.007 1.00 28.50  ? 78  PHE A CB    1 
ATOM   605   C CG    . PHE A  1 78  ? 174.553 87.686  134.597 1.00 27.79  ? 78  PHE A CG    1 
ATOM   606   C CD1   . PHE A  1 78  ? 175.003 88.718  133.790 1.00 29.17  ? 78  PHE A CD1   1 
ATOM   607   C CD2   . PHE A  1 78  ? 174.533 86.422  134.080 1.00 27.04  ? 78  PHE A CD2   1 
ATOM   608   C CE1   . PHE A  1 78  ? 175.432 88.487  132.481 1.00 28.95  ? 78  PHE A CE1   1 
ATOM   609   C CE2   . PHE A  1 78  ? 174.952 86.189  132.785 1.00 28.30  ? 78  PHE A CE2   1 
ATOM   610   C CZ    . PHE A  1 78  ? 175.404 87.230  131.983 1.00 28.55  ? 78  PHE A CZ    1 
ATOM   611   N N     . ILE A  1 79  ? 171.680 87.259  134.204 1.00 35.06  ? 79  ILE A N     1 
ATOM   612   C CA    . ILE A  1 79  ? 170.906 86.239  133.512 1.00 34.63  ? 79  ILE A CA    1 
ATOM   613   C C     . ILE A  1 79  ? 171.203 86.272  132.014 1.00 33.11  ? 79  ILE A C     1 
ATOM   614   O O     . ILE A  1 79  ? 171.374 87.329  131.410 1.00 31.29  ? 79  ILE A O     1 
ATOM   615   C CB    . ILE A  1 79  ? 169.397 86.418  133.789 1.00 63.08  ? 79  ILE A CB    1 
ATOM   616   C CG1   . ILE A  1 79  ? 168.600 85.368  133.039 1.00 63.57  ? 79  ILE A CG1   1 
ATOM   617   C CG2   . ILE A  1 79  ? 168.951 87.796  133.386 1.00 66.27  ? 79  ILE A CG2   1 
ATOM   618   C CD1   . ILE A  1 79  ? 168.921 83.990  133.486 1.00 66.03  ? 79  ILE A CD1   1 
ATOM   619   N N     . LYS A  1 80  ? 171.305 85.090  131.432 1.00 30.16  ? 80  LYS A N     1 
ATOM   620   C CA    . LYS A  1 80  ? 171.602 84.970  130.025 1.00 31.01  ? 80  LYS A CA    1 
ATOM   621   C C     . LYS A  1 80  ? 170.458 84.304  129.316 1.00 32.14  ? 80  LYS A C     1 
ATOM   622   O O     . LYS A  1 80  ? 169.845 83.413  129.878 1.00 34.64  ? 80  LYS A O     1 
ATOM   623   C CB    . LYS A  1 80  ? 172.857 84.130  129.823 1.00 7.77   ? 80  LYS A CB    1 
ATOM   624   C CG    . LYS A  1 80  ? 173.137 83.795  128.366 1.00 7.73   ? 80  LYS A CG    1 
ATOM   625   C CD    . LYS A  1 80  ? 174.552 83.290  128.124 1.00 8.98   ? 80  LYS A CD    1 
ATOM   626   C CE    . LYS A  1 80  ? 174.639 82.519  126.810 1.00 9.90   ? 80  LYS A CE    1 
ATOM   627   N NZ    . LYS A  1 80  ? 175.976 81.905  126.556 1.00 12.81  ? 80  LYS A NZ    1 
ATOM   628   N N     . VAL A  1 81  ? 170.165 84.715  128.082 1.00 11.41  ? 81  VAL A N     1 
ATOM   629   C CA    . VAL A  1 81  ? 169.084 84.079  127.323 1.00 11.46  ? 81  VAL A CA    1 
ATOM   630   C C     . VAL A  1 81  ? 169.349 84.063  125.807 1.00 11.37  ? 81  VAL A C     1 
ATOM   631   O O     . VAL A  1 81  ? 169.903 85.035  125.275 1.00 8.63   ? 81  VAL A O     1 
ATOM   632   C CB    . VAL A  1 81  ? 167.780 84.792  127.589 1.00 30.11  ? 81  VAL A CB    1 
ATOM   633   C CG1   . VAL A  1 81  ? 167.541 84.863  129.081 1.00 31.28  ? 81  VAL A CG1   1 
ATOM   634   C CG2   . VAL A  1 81  ? 167.850 86.173  127.034 1.00 30.68  ? 81  VAL A CG2   1 
ATOM   635   N N     . GLU A  1 82  ? 169.026 82.948  125.127 1.00 21.96  ? 82  GLU A N     1 
ATOM   636   C CA    . GLU A  1 82  ? 169.213 82.914  123.668 1.00 24.50  ? 82  GLU A CA    1 
ATOM   637   C C     . GLU A  1 82  ? 168.115 83.838  123.191 1.00 22.98  ? 82  GLU A C     1 
ATOM   638   O O     . GLU A  1 82  ? 167.025 83.875  123.774 1.00 22.36  ? 82  GLU A O     1 
ATOM   639   C CB    . GLU A  1 82  ? 168.883 81.581  122.977 1.00 82.98  ? 82  GLU A CB    1 
ATOM   640   C CG    . GLU A  1 82  ? 169.795 80.352  123.016 1.00 90.73  ? 82  GLU A CG    1 
ATOM   641   C CD    . GLU A  1 82  ? 171.208 80.456  122.486 1.00 95.93  ? 82  GLU A CD    1 
ATOM   642   O OE1   . GLU A  1 82  ? 172.079 80.803  123.306 1.00 97.38  ? 82  GLU A OE1   1 
ATOM   643   O OE2   . GLU A  1 82  ? 171.460 80.157  121.290 1.00 98.67  ? 82  GLU A OE2   1 
ATOM   644   N N     . ALA A  1 83  ? 168.371 84.545  122.103 1.00 11.84  ? 83  ALA A N     1 
ATOM   645   C CA    . ALA A  1 83  ? 167.366 85.444  121.574 1.00 10.14  ? 83  ALA A CA    1 
ATOM   646   C C     . ALA A  1 83  ? 166.348 84.575  120.903 1.00 9.14   ? 83  ALA A C     1 
ATOM   647   O O     . ALA A  1 83  ? 165.167 84.842  120.938 1.00 8.98   ? 83  ALA A O     1 
ATOM   648   C CB    . ALA A  1 83  ? 167.981 86.386  120.568 1.00 64.49  ? 83  ALA A CB    1 
ATOM   649   N N     . THR A  1 84  ? 166.829 83.503  120.305 1.00 10.80  ? 84  THR A N     1 
ATOM   650   C CA    . THR A  1 84  ? 165.967 82.599  119.586 1.00 13.09  ? 84  THR A CA    1 
ATOM   651   C C     . THR A  1 84  ? 165.090 81.811  120.477 1.00 14.22  ? 84  THR A C     1 
ATOM   652   O O     . THR A  1 84  ? 164.230 81.099  119.986 1.00 15.44  ? 84  THR A O     1 
ATOM   653   C CB    . THR A  1 84  ? 166.754 81.600  118.749 1.00 52.24  ? 84  THR A CB    1 
ATOM   654   O OG1   . THR A  1 84  ? 167.884 81.127  119.497 1.00 54.61  ? 84  THR A OG1   1 
ATOM   655   C CG2   . THR A  1 84  ? 167.204 82.252  117.452 1.00 54.04  ? 84  THR A CG2   1 
ATOM   656   N N     . LYS A  1 85  ? 165.302 81.912  121.784 1.00 32.46  ? 85  LYS A N     1 
ATOM   657   C CA    . LYS A  1 85  ? 164.477 81.153  122.714 1.00 33.45  ? 85  LYS A CA    1 
ATOM   658   C C     . LYS A  1 85  ? 163.055 81.566  122.555 1.00 33.30  ? 85  LYS A C     1 
ATOM   659   O O     . LYS A  1 85  ? 162.178 80.877  123.018 1.00 34.07  ? 85  LYS A O     1 
ATOM   660   C CB    . LYS A  1 85  ? 164.865 81.400  124.163 1.00 47.48  ? 85  LYS A CB    1 
ATOM   661   C CG    . LYS A  1 85  ? 163.925 80.741  125.174 1.00 50.31  ? 85  LYS A CG    1 
ATOM   662   C CD    . LYS A  1 85  ? 164.271 81.188  126.587 1.00 53.34  ? 85  LYS A CD    1 
ATOM   663   C CE    . LYS A  1 85  ? 163.395 80.520  127.645 1.00 55.09  ? 85  LYS A CE    1 
ATOM   664   N NZ    . LYS A  1 85  ? 163.625 81.063  129.036 1.00 57.56  ? 85  LYS A NZ    1 
ATOM   665   N N     . PHE A  1 86  ? 162.821 82.687  121.891 1.00 25.95  ? 86  PHE A N     1 
ATOM   666   C CA    . PHE A  1 86  ? 161.468 83.144  121.729 1.00 27.51  ? 86  PHE A CA    1 
ATOM   667   C C     . PHE A  1 86  ? 160.923 83.157  120.303 1.00 30.40  ? 86  PHE A C     1 
ATOM   668   O O     . PHE A  1 86  ? 159.997 83.904  120.009 1.00 31.56  ? 86  PHE A O     1 
ATOM   669   C CB    . PHE A  1 86  ? 161.332 84.535  122.324 1.00 18.12  ? 86  PHE A CB    1 
ATOM   670   C CG    . PHE A  1 86  ? 161.979 84.687  123.638 1.00 15.37  ? 86  PHE A CG    1 
ATOM   671   C CD1   . PHE A  1 86  ? 163.297 85.062  123.717 1.00 16.03  ? 86  PHE A CD1   1 
ATOM   672   C CD2   . PHE A  1 86  ? 161.274 84.452  124.804 1.00 15.83  ? 86  PHE A CD2   1 
ATOM   673   C CE1   . PHE A  1 86  ? 163.925 85.206  124.958 1.00 18.23  ? 86  PHE A CE1   1 
ATOM   674   C CE2   . PHE A  1 86  ? 161.872 84.587  126.059 1.00 16.57  ? 86  PHE A CE2   1 
ATOM   675   C CZ    . PHE A  1 86  ? 163.205 84.967  126.146 1.00 17.93  ? 86  PHE A CZ    1 
ATOM   676   N N     . THR A  1 87  ? 161.448 82.340  119.407 1.00 48.63  ? 87  THR A N     1 
ATOM   677   C CA    . THR A  1 87  ? 160.922 82.377  118.046 1.00 51.97  ? 87  THR A CA    1 
ATOM   678   C C     . THR A  1 87  ? 159.537 81.720  117.890 1.00 53.61  ? 87  THR A C     1 
ATOM   679   O O     . THR A  1 87  ? 158.947 81.194  118.848 1.00 54.95  ? 87  THR A O     1 
ATOM   680   C CB    . THR A  1 87  ? 161.892 81.716  117.070 1.00 92.61  ? 87  THR A CB    1 
ATOM   681   O OG1   . THR A  1 87  ? 163.229 82.114  117.387 1.00 95.43  ? 87  THR A OG1   1 
ATOM   682   C CG2   . THR A  1 87  ? 161.584 82.148  115.656 1.00 93.93  ? 87  THR A CG2   1 
ATOM   683   N N     . GLU A  1 95  ? 157.525 83.316  126.203 1.00 64.29  ? 95  GLU A N     1 
ATOM   684   C CA    . GLU A  1 95  ? 157.216 84.538  126.962 1.00 63.60  ? 95  GLU A CA    1 
ATOM   685   C C     . GLU A  1 95  ? 158.467 85.385  127.305 1.00 60.84  ? 95  GLU A C     1 
ATOM   686   O O     . GLU A  1 95  ? 159.249 85.023  128.192 1.00 60.01  ? 95  GLU A O     1 
ATOM   687   C CB    . GLU A  1 95  ? 156.487 84.164  128.257 1.00 150.50 ? 95  GLU A CB    1 
ATOM   688   C CG    . GLU A  1 95  ? 156.158 85.352  129.156 1.00 157.03 ? 95  GLU A CG    1 
ATOM   689   C CD    . GLU A  1 95  ? 155.174 86.326  128.522 1.00 160.61 ? 95  GLU A CD    1 
ATOM   690   O OE1   . GLU A  1 95  ? 155.420 86.773  127.377 1.00 162.61 ? 95  GLU A OE1   1 
ATOM   691   O OE2   . GLU A  1 95  ? 154.156 86.651  129.176 1.00 162.28 ? 95  GLU A OE2   1 
ATOM   692   N N     . VAL A  1 96  ? 158.641 86.521  126.622 1.00 19.69  ? 96  VAL A N     1 
ATOM   693   C CA    . VAL A  1 96  ? 159.803 87.398  126.848 1.00 16.18  ? 96  VAL A CA    1 
ATOM   694   C C     . VAL A  1 96  ? 159.889 88.077  128.248 1.00 14.15  ? 96  VAL A C     1 
ATOM   695   O O     . VAL A  1 96  ? 160.977 88.392  128.753 1.00 12.69  ? 96  VAL A O     1 
ATOM   696   C CB    . VAL A  1 96  ? 159.881 88.467  125.716 1.00 16.03  ? 96  VAL A CB    1 
ATOM   697   C CG1   . VAL A  1 96  ? 159.699 89.855  126.292 1.00 16.58  ? 96  VAL A CG1   1 
ATOM   698   C CG2   . VAL A  1 96  ? 161.207 88.365  124.985 1.00 15.71  ? 96  VAL A CG2   1 
ATOM   699   N N     . ASP A  1 97  ? 158.746 88.305  128.873 1.00 29.38  ? 97  ASP A N     1 
ATOM   700   C CA    . ASP A  1 97  ? 158.766 88.922  130.175 1.00 29.28  ? 97  ASP A CA    1 
ATOM   701   C C     . ASP A  1 97  ? 159.466 87.974  131.115 1.00 26.81  ? 97  ASP A C     1 
ATOM   702   O O     . ASP A  1 97  ? 159.938 88.363  132.171 1.00 27.88  ? 97  ASP A O     1 
ATOM   703   C CB    . ASP A  1 97  ? 157.355 89.214  130.684 1.00 105.30 ? 97  ASP A CB    1 
ATOM   704   C CG    . ASP A  1 97  ? 156.705 90.378  129.969 1.00 109.41 ? 97  ASP A CG    1 
ATOM   705   O OD1   . ASP A  1 97  ? 157.419 91.345  129.624 1.00 109.74 ? 97  ASP A OD1   1 
ATOM   706   O OD2   . ASP A  1 97  ? 155.473 90.324  129.768 1.00 110.52 ? 97  ASP A OD2   1 
ATOM   707   N N     . SER A  1 98  ? 159.548 86.715  130.744 1.00 22.38  ? 98  SER A N     1 
ATOM   708   C CA    . SER A  1 98  ? 160.226 85.773  131.620 1.00 19.64  ? 98  SER A CA    1 
ATOM   709   C C     . SER A  1 98  ? 161.684 86.212  131.936 1.00 16.97  ? 98  SER A C     1 
ATOM   710   O O     . SER A  1 98  ? 162.234 85.918  133.005 1.00 15.56  ? 98  SER A O     1 
ATOM   711   C CB    . SER A  1 98  ? 160.249 84.410  130.959 1.00 33.24  ? 98  SER A CB    1 
ATOM   712   O OG    . SER A  1 98  ? 161.109 84.441  129.828 1.00 35.01  ? 98  SER A OG    1 
ATOM   713   N N     . ILE A  1 99  ? 162.312 86.915  131.005 1.00 23.86  ? 99  ILE A N     1 
ATOM   714   C CA    . ILE A  1 99  ? 163.677 87.310  131.227 1.00 21.94  ? 99  ILE A CA    1 
ATOM   715   C C     . ILE A  1 99  ? 163.756 88.075  132.502 1.00 23.33  ? 99  ILE A C     1 
ATOM   716   O O     . ILE A  1 99  ? 164.537 87.740  133.391 1.00 23.91  ? 99  ILE A O     1 
ATOM   717   C CB    . ILE A  1 99  ? 164.209 88.167  130.088 1.00 21.34  ? 99  ILE A CB    1 
ATOM   718   C CG1   . ILE A  1 99  ? 164.277 87.316  128.814 1.00 20.38  ? 99  ILE A CG1   1 
ATOM   719   C CG2   . ILE A  1 99  ? 165.614 88.674  130.431 1.00 17.40  ? 99  ILE A CG2   1 
ATOM   720   C CD1   . ILE A  1 99  ? 164.595 88.089  127.543 1.00 19.21  ? 99  ILE A CD1   1 
ATOM   721   N N     . ILE A  1 100 ? 162.931 89.104  132.604 1.00 20.12  ? 100 ILE A N     1 
ATOM   722   C CA    . ILE A  1 100 ? 162.946 89.913  133.807 1.00 20.47  ? 100 ILE A CA    1 
ATOM   723   C C     . ILE A  1 100 ? 162.512 89.110  135.010 1.00 23.59  ? 100 ILE A C     1 
ATOM   724   O O     . ILE A  1 100 ? 163.059 89.258  136.096 1.00 23.34  ? 100 ILE A O     1 
ATOM   725   C CB    . ILE A  1 100 ? 162.033 91.085  133.675 1.00 12.66  ? 100 ILE A CB    1 
ATOM   726   C CG1   . ILE A  1 100 ? 162.401 91.876  132.427 1.00 11.69  ? 100 ILE A CG1   1 
ATOM   727   C CG2   . ILE A  1 100 ? 162.159 91.935  134.885 1.00 12.28  ? 100 ILE A CG2   1 
ATOM   728   C CD1   . ILE A  1 100 ? 163.843 92.307  132.418 1.00 11.86  ? 100 ILE A CD1   1 
ATOM   729   N N     . ARG A  1 101 ? 161.518 88.255  134.810 1.00 21.47  ? 101 ARG A N     1 
ATOM   730   C CA    . ARG A  1 101 ? 161.016 87.426  135.883 1.00 26.06  ? 101 ARG A CA    1 
ATOM   731   C C     . ARG A  1 101 ? 162.185 86.633  136.455 1.00 27.67  ? 101 ARG A C     1 
ATOM   732   O O     . ARG A  1 101 ? 162.570 86.829  137.600 1.00 28.26  ? 101 ARG A O     1 
ATOM   733   C CB    . ARG A  1 101 ? 159.938 86.509  135.342 1.00 62.43  ? 101 ARG A CB    1 
ATOM   734   C CG    . ARG A  1 101 ? 158.901 86.119  136.351 1.00 67.32  ? 101 ARG A CG    1 
ATOM   735   C CD    . ARG A  1 101 ? 157.645 85.694  135.615 1.00 71.72  ? 101 ARG A CD    1 
ATOM   736   N NE    . ARG A  1 101 ? 156.982 86.811  134.936 1.00 74.05  ? 101 ARG A NE    1 
ATOM   737   C CZ    . ARG A  1 101 ? 156.300 86.702  133.796 1.00 75.84  ? 101 ARG A CZ    1 
ATOM   738   N NH1   . ARG A  1 101 ? 156.193 85.525  133.185 1.00 76.97  ? 101 ARG A NH1   1 
ATOM   739   N NH2   . ARG A  1 101 ? 155.698 87.767  133.280 1.00 75.89  ? 101 ARG A NH2   1 
ATOM   740   N N     . ASP A  1 102 ? 162.772 85.761  135.646 1.00 49.87  ? 102 ASP A N     1 
ATOM   741   C CA    . ASP A  1 102 ? 163.908 84.952  136.085 1.00 52.81  ? 102 ASP A CA    1 
ATOM   742   C C     . ASP A  1 102 ? 164.993 85.828  136.740 1.00 52.28  ? 102 ASP A C     1 
ATOM   743   O O     . ASP A  1 102 ? 165.683 85.406  137.674 1.00 51.97  ? 102 ASP A O     1 
ATOM   744   C CB    . ASP A  1 102 ? 164.528 84.211  134.884 1.00 69.97  ? 102 ASP A CB    1 
ATOM   745   C CG    . ASP A  1 102 ? 163.576 83.222  134.235 1.00 72.64  ? 102 ASP A CG    1 
ATOM   746   O OD1   . ASP A  1 102 ? 163.836 82.836  133.076 1.00 74.06  ? 102 ASP A OD1   1 
ATOM   747   O OD2   . ASP A  1 102 ? 162.586 82.820  134.878 1.00 74.58  ? 102 ASP A OD2   1 
ATOM   748   N N     . LEU A  1 103 ? 165.150 87.046  136.240 1.00 31.94  ? 103 LEU A N     1 
ATOM   749   C CA    . LEU A  1 103 ? 166.176 87.920  136.774 1.00 32.05  ? 103 LEU A CA    1 
ATOM   750   C C     . LEU A  1 103 ? 165.857 88.200  138.228 1.00 33.86  ? 103 LEU A C     1 
ATOM   751   O O     . LEU A  1 103 ? 166.683 88.028  139.125 1.00 34.55  ? 103 LEU A O     1 
ATOM   752   C CB    . LEU A  1 103 ? 166.223 89.220  135.971 1.00 19.75  ? 103 LEU A CB    1 
ATOM   753   C CG    . LEU A  1 103 ? 167.320 90.204  136.377 1.00 17.46  ? 103 LEU A CG    1 
ATOM   754   C CD1   . LEU A  1 103 ? 168.696 89.632  136.134 1.00 18.00  ? 103 LEU A CD1   1 
ATOM   755   C CD2   . LEU A  1 103 ? 167.156 91.451  135.571 1.00 17.30  ? 103 LEU A CD2   1 
ATOM   756   N N     . THR A  1 104 ? 164.627 88.623  138.441 1.00 30.75  ? 104 THR A N     1 
ATOM   757   C CA    . THR A  1 104 ? 164.125 88.924  139.757 1.00 31.83  ? 104 THR A CA    1 
ATOM   758   C C     . THR A  1 104 ? 164.306 87.755  140.713 1.00 34.26  ? 104 THR A C     1 
ATOM   759   O O     . THR A  1 104 ? 164.620 87.934  141.887 1.00 34.28  ? 104 THR A O     1 
ATOM   760   C CB    . THR A  1 104 ? 162.667 89.207  139.672 1.00 16.91  ? 104 THR A CB    1 
ATOM   761   O OG1   . THR A  1 104 ? 162.444 90.313  138.791 1.00 15.11  ? 104 THR A OG1   1 
ATOM   762   C CG2   . THR A  1 104 ? 162.138 89.497  141.041 1.00 18.39  ? 104 THR A CG2   1 
ATOM   763   N N     . ASP A  1 105 ? 164.062 86.559  140.195 1.00 65.89  ? 105 ASP A N     1 
ATOM   764   C CA    . ASP A  1 105 ? 164.200 85.316  140.949 1.00 68.97  ? 105 ASP A CA    1 
ATOM   765   C C     . ASP A  1 105 ? 165.635 85.129  141.425 1.00 70.65  ? 105 ASP A C     1 
ATOM   766   O O     . ASP A  1 105 ? 165.868 84.693  142.557 1.00 70.82  ? 105 ASP A O     1 
ATOM   767   C CB    . ASP A  1 105 ? 163.814 84.138  140.062 1.00 108.00 ? 105 ASP A CB    1 
ATOM   768   C CG    . ASP A  1 105 ? 162.579 83.454  140.534 1.00 110.89 ? 105 ASP A CG    1 
ATOM   769   O OD1   . ASP A  1 105 ? 161.836 84.081  141.320 1.00 112.17 ? 105 ASP A OD1   1 
ATOM   770   O OD2   . ASP A  1 105 ? 162.350 82.301  140.112 1.00 112.87 ? 105 ASP A OD2   1 
ATOM   771   N N     . SER A  1 106 ? 166.588 85.444  140.544 1.00 59.14  ? 106 SER A N     1 
ATOM   772   C CA    . SER A  1 106 ? 167.997 85.317  140.862 1.00 60.76  ? 106 SER A CA    1 
ATOM   773   C C     . SER A  1 106 ? 168.346 86.316  141.945 1.00 62.31  ? 106 SER A C     1 
ATOM   774   O O     . SER A  1 106 ? 169.118 86.008  142.848 1.00 62.62  ? 106 SER A O     1 
ATOM   775   C CB    . SER A  1 106 ? 168.846 85.575  139.631 1.00 67.90  ? 106 SER A CB    1 
ATOM   776   O OG    . SER A  1 106 ? 170.215 85.588  139.986 1.00 69.52  ? 106 SER A OG    1 
ATOM   777   N N     . ALA A  1 107 ? 167.762 87.510  141.861 1.00 71.27  ? 107 ALA A N     1 
ATOM   778   C CA    . ALA A  1 107 ? 167.996 88.557  142.856 1.00 73.28  ? 107 ALA A CA    1 
ATOM   779   C C     . ALA A  1 107 ? 167.630 88.066  144.251 1.00 74.92  ? 107 ALA A C     1 
ATOM   780   O O     . ALA A  1 107 ? 168.110 88.595  145.248 1.00 75.09  ? 107 ALA A O     1 
ATOM   781   C CB    . ALA A  1 107 ? 167.188 89.790  142.522 1.00 40.92  ? 107 ALA A CB    1 
ATOM   782   N N     . MET A  1 108 ? 166.765 87.063  144.327 1.00 73.38  ? 108 MET A N     1 
ATOM   783   C CA    . MET A  1 108 ? 166.409 86.521  145.621 1.00 76.09  ? 108 MET A CA    1 
ATOM   784   C C     . MET A  1 108 ? 167.601 85.748  146.142 1.00 77.54  ? 108 MET A C     1 
ATOM   785   O O     . MET A  1 108 ? 168.295 86.225  147.030 1.00 78.44  ? 108 MET A O     1 
ATOM   786   C CB    . MET A  1 108 ? 165.193 85.601  145.532 1.00 104.86 ? 108 MET A CB    1 
ATOM   787   C CG    . MET A  1 108 ? 163.877 86.352  145.487 1.00 106.17 ? 108 MET A CG    1 
ATOM   788   S SD    . MET A  1 108 ? 163.694 87.513  146.861 1.00 108.11 ? 108 MET A SD    1 
ATOM   789   C CE    . MET A  1 108 ? 162.568 86.642  147.898 1.00 108.36 ? 108 MET A CE    1 
ATOM   790   N N     . LYS A  1 109 ? 167.864 84.573  145.576 1.00 97.28  ? 109 LYS A N     1 
ATOM   791   C CA    . LYS A  1 109 ? 168.988 83.761  146.039 1.00 99.11  ? 109 LYS A CA    1 
ATOM   792   C C     . LYS A  1 109 ? 170.209 84.616  146.345 1.00 100.07 ? 109 LYS A C     1 
ATOM   793   O O     . LYS A  1 109 ? 171.005 84.299  147.236 1.00 100.48 ? 109 LYS A O     1 
ATOM   794   C CB    . LYS A  1 109 ? 169.373 82.695  145.012 1.00 118.14 ? 109 LYS A CB    1 
ATOM   795   C CG    . LYS A  1 109 ? 170.502 81.780  145.498 1.00 119.12 ? 109 LYS A CG    1 
ATOM   796   C CD    . LYS A  1 109 ? 170.887 80.736  144.460 1.00 120.09 ? 109 LYS A CD    1 
ATOM   797   C CE    . LYS A  1 109 ? 171.437 81.378  143.188 1.00 120.35 ? 109 LYS A CE    1 
ATOM   798   N NZ    . LYS A  1 109 ? 171.766 80.375  142.127 1.00 119.83 ? 109 LYS A NZ    1 
ATOM   799   N N     . LEU A  1 110 ? 170.357 85.708  145.610 1.00 67.33  ? 110 LEU A N     1 
ATOM   800   C CA    . LEU A  1 110 ? 171.493 86.578  145.832 1.00 69.32  ? 110 LEU A CA    1 
ATOM   801   C C     . LEU A  1 110 ? 171.334 87.297  147.172 1.00 70.89  ? 110 LEU A C     1 
ATOM   802   O O     . LEU A  1 110 ? 172.188 87.164  148.053 1.00 71.16  ? 110 LEU A O     1 
ATOM   803   C CB    . LEU A  1 110 ? 171.618 87.574  144.676 1.00 109.69 ? 110 LEU A CB    1 
ATOM   804   C CG    . LEU A  1 110 ? 172.906 88.397  144.597 1.00 110.30 ? 110 LEU A CG    1 
ATOM   805   C CD1   . LEU A  1 110 ? 174.131 87.504  144.740 1.00 110.46 ? 110 LEU A CD1   1 
ATOM   806   C CD2   . LEU A  1 110 ? 172.924 89.128  143.273 1.00 110.17 ? 110 LEU A CD2   1 
ATOM   807   N N     . VAL A  1 111 ? 170.227 88.031  147.315 1.00 75.29  ? 111 VAL A N     1 
ATOM   808   C CA    . VAL A  1 111 ? 169.899 88.794  148.528 1.00 77.62  ? 111 VAL A CA    1 
ATOM   809   C C     . VAL A  1 111 ? 169.601 87.897  149.741 1.00 80.23  ? 111 VAL A C     1 
ATOM   810   O O     . VAL A  1 111 ? 169.976 88.205  150.881 1.00 80.56  ? 111 VAL A O     1 
ATOM   811   C CB    . VAL A  1 111 ? 168.671 89.694  148.284 1.00 77.11  ? 111 VAL A CB    1 
ATOM   812   C CG1   . VAL A  1 111 ? 168.299 90.425  149.546 1.00 77.26  ? 111 VAL A CG1   1 
ATOM   813   C CG2   . VAL A  1 111 ? 168.964 90.682  147.195 1.00 77.14  ? 111 VAL A CG2   1 
ATOM   814   N N     . ARG A  1 112 ? 168.892 86.804  149.484 1.00 82.38  ? 112 ARG A N     1 
ATOM   815   C CA    . ARG A  1 112 ? 168.558 85.832  150.512 1.00 85.42  ? 112 ARG A CA    1 
ATOM   816   C C     . ARG A  1 112 ? 169.904 85.463  151.124 1.00 86.98  ? 112 ARG A C     1 
ATOM   817   O O     . ARG A  1 112 ? 170.298 85.992  152.165 1.00 87.00  ? 112 ARG A O     1 
ATOM   818   C CB    . ARG A  1 112 ? 167.920 84.598  149.859 1.00 172.49 ? 112 ARG A CB    1 
ATOM   819   C CG    . ARG A  1 112 ? 167.595 83.448  150.799 1.00 174.95 ? 112 ARG A CG    1 
ATOM   820   C CD    . ARG A  1 112 ? 166.216 83.602  151.412 1.00 177.05 ? 112 ARG A CD    1 
ATOM   821   N NE    . ARG A  1 112 ? 165.912 82.512  152.335 1.00 178.44 ? 112 ARG A NE    1 
ATOM   822   C CZ    . ARG A  1 112 ? 164.733 82.337  152.925 1.00 178.81 ? 112 ARG A CZ    1 
ATOM   823   N NH1   . ARG A  1 112 ? 163.739 83.182  152.687 1.00 178.92 ? 112 ARG A NH1   1 
ATOM   824   N NH2   . ARG A  1 112 ? 164.550 81.316  153.752 1.00 178.34 ? 112 ARG A NH2   1 
ATOM   825   N N     . GLN A  1 113 ? 170.619 84.576  150.440 1.00 111.00 ? 113 GLN A N     1 
ATOM   826   C CA    . GLN A  1 113 ? 171.919 84.127  150.891 1.00 113.81 ? 113 GLN A CA    1 
ATOM   827   C C     . GLN A  1 113 ? 172.891 85.300  150.963 1.00 115.21 ? 113 GLN A C     1 
ATOM   828   O O     . GLN A  1 113 ? 174.056 85.176  150.577 1.00 115.72 ? 113 GLN A O     1 
ATOM   829   C CB    . GLN A  1 113 ? 172.456 83.058  149.941 1.00 200.00 ? 113 GLN A CB    1 
ATOM   830   C CG    . GLN A  1 113 ? 173.352 82.045  150.621 1.00 200.00 ? 113 GLN A CG    1 
ATOM   831   C CD    . GLN A  1 113 ? 172.607 81.221  151.661 1.00 200.00 ? 113 GLN A CD    1 
ATOM   832   O OE1   . GLN A  1 113 ? 171.929 81.763  152.535 1.00 200.00 ? 113 GLN A OE1   1 
ATOM   833   N NE2   . GLN A  1 113 ? 172.738 79.902  151.573 1.00 200.00 ? 113 GLN A NE2   1 
ATOM   834   N N     . GLN A  1 114 ? 172.397 86.440  151.446 1.00 70.92  ? 114 GLN A N     1 
ATOM   835   C CA    . GLN A  1 114 ? 173.196 87.657  151.602 1.00 72.24  ? 114 GLN A CA    1 
ATOM   836   C C     . GLN A  1 114 ? 172.778 88.347  152.888 1.00 72.76  ? 114 GLN A C     1 
ATOM   837   O O     . GLN A  1 114 ? 173.413 89.302  153.345 1.00 72.29  ? 114 GLN A O     1 
ATOM   838   C CB    . GLN A  1 114 ? 173.003 88.609  150.426 1.00 164.02 ? 114 GLN A CB    1 
ATOM   839   C CG    . GLN A  1 114 ? 174.210 88.687  149.515 1.00 165.25 ? 114 GLN A CG    1 
ATOM   840   C CD    . GLN A  1 114 ? 174.460 90.091  149.007 1.00 166.75 ? 114 GLN A CD    1 
ATOM   841   O OE1   . GLN A  1 114 ? 175.403 90.331  148.253 1.00 167.15 ? 114 GLN A OE1   1 
ATOM   842   N NE2   . GLN A  1 114 ? 173.616 91.033  149.423 1.00 167.62 ? 114 GLN A NE2   1 
ATOM   843   N N     . GLU A  1 115 ? 171.681 87.856  153.446 1.00 131.19 ? 115 GLU A N     1 
ATOM   844   C CA    . GLU A  1 115 ? 171.158 88.348  154.706 1.00 131.63 ? 115 GLU A CA    1 
ATOM   845   C C     . GLU A  1 115 ? 170.872 87.105  155.531 1.00 130.94 ? 115 GLU A C     1 
ATOM   846   O O     . GLU A  1 115 ? 169.834 86.974  156.185 1.00 130.00 ? 115 GLU A O     1 
ATOM   847   C CB    . GLU A  1 115 ? 169.898 89.190  154.499 1.00 200.00 ? 115 GLU A CB    1 
ATOM   848   C CG    . GLU A  1 115 ? 170.216 90.627  154.103 1.00 200.00 ? 115 GLU A CG    1 
ATOM   849   C CD    . GLU A  1 115 ? 169.141 91.611  154.526 1.00 200.00 ? 115 GLU A CD    1 
ATOM   850   O OE1   . GLU A  1 115 ? 168.707 91.559  155.697 1.00 200.00 ? 115 GLU A OE1   1 
ATOM   851   O OE2   . GLU A  1 115 ? 168.737 92.447  153.693 1.00 200.00 ? 115 GLU A OE2   1 
ATOM   852   N N     . ILE A  1 116 ? 171.831 86.189  155.455 1.00 183.66 ? 116 ILE A N     1 
ATOM   853   C CA    . ILE A  1 116 ? 171.812 84.918  156.160 1.00 183.66 ? 116 ILE A CA    1 
ATOM   854   C C     . ILE A  1 116 ? 173.268 84.545  156.416 1.00 183.66 ? 116 ILE A C     1 
ATOM   855   O O     . ILE A  1 116 ? 173.595 83.906  157.417 1.00 183.66 ? 116 ILE A O     1 
ATOM   856   C CB    . ILE A  1 116 ? 171.124 83.815  155.320 1.00 118.81 ? 116 ILE A CB    1 
ATOM   857   C CG1   . ILE A  1 116 ? 169.604 83.899  155.512 1.00 118.81 ? 116 ILE A CG1   1 
ATOM   858   C CG2   . ILE A  1 116 ? 171.659 82.435  155.704 1.00 118.81 ? 116 ILE A CG2   1 
ATOM   859   C CD1   . ILE A  1 116 ? 168.815 82.844  154.741 1.00 118.81 ? 116 ILE A CD1   1 
ATOM   860   N N     . ALA A  1 117 ? 174.139 84.957  155.500 1.00 180.26 ? 117 ALA A N     1 
ATOM   861   C CA    . ALA A  1 117 ? 175.569 84.695  155.627 1.00 180.26 ? 117 ALA A CA    1 
ATOM   862   C C     . ALA A  1 117 ? 176.268 86.003  156.002 1.00 180.26 ? 117 ALA A C     1 
ATOM   863   O O     . ALA A  1 117 ? 177.500 86.071  156.071 1.00 180.26 ? 117 ALA A O     1 
ATOM   864   C CB    . ALA A  1 117 ? 176.129 84.139  154.314 1.00 127.42 ? 117 ALA A CB    1 
ATOM   865   N N     . LYS A  1 118 ? 175.461 87.037  156.236 1.00 177.96 ? 118 LYS A N     1 
ATOM   866   C CA    . LYS A  1 118 ? 175.956 88.354  156.629 1.00 177.96 ? 118 LYS A CA    1 
ATOM   867   C C     . LYS A  1 118 ? 175.163 88.741  157.873 1.00 177.96 ? 118 LYS A C     1 
ATOM   868   O O     . LYS A  1 118 ? 175.639 88.598  159.000 1.00 177.96 ? 118 LYS A O     1 
ATOM   869   C CB    . LYS A  1 118 ? 175.715 89.384  155.513 1.00 175.03 ? 118 LYS A CB    1 
ATOM   870   C CG    . LYS A  1 118 ? 176.653 90.602  155.547 1.00 175.03 ? 118 LYS A CG    1 
ATOM   871   C CD    . LYS A  1 118 ? 176.599 91.355  156.880 1.00 175.03 ? 118 LYS A CD    1 
ATOM   872   C CE    . LYS A  1 118 ? 177.581 92.526  156.915 1.00 175.03 ? 118 LYS A CE    1 
ATOM   873   N NZ    . LYS A  1 118 ? 177.537 93.275  158.209 1.00 175.03 ? 118 LYS A NZ    1 
ATOM   874   N N     . ASN A  1 119 ? 173.945 89.224  157.656 1.00 128.19 ? 119 ASN A N     1 
ATOM   875   C CA    . ASN A  1 119 ? 173.069 89.609  158.753 1.00 128.19 ? 119 ASN A CA    1 
ATOM   876   C C     . ASN A  1 119 ? 172.507 88.327  159.376 1.00 128.19 ? 119 ASN A C     1 
ATOM   877   O O     . ASN A  1 119 ? 171.379 88.299  159.876 1.00 128.19 ? 119 ASN A O     1 
ATOM   878   C CB    . ASN A  1 119 ? 171.937 90.515  158.235 1.00 152.47 ? 119 ASN A CB    1 
ATOM   879   C CG    . ASN A  1 119 ? 172.304 92.006  158.262 1.00 152.47 ? 119 ASN A CG    1 
ATOM   880   O OD1   . ASN A  1 119 ? 173.481 92.372  158.230 1.00 152.47 ? 119 ASN A OD1   1 
ATOM   881   N ND2   . ASN A  1 119 ? 171.286 92.869  158.307 1.00 152.47 ? 119 ASN A ND2   1 
ATOM   882   N N     . ARG A  1 120 ? 173.320 87.272  159.330 1.00 172.03 ? 120 ARG A N     1 
ATOM   883   C CA    . ARG A  1 120 ? 172.983 85.956  159.877 1.00 172.03 ? 120 ARG A CA    1 
ATOM   884   C C     . ARG A  1 120 ? 171.574 85.477  159.544 1.00 172.03 ? 120 ARG A C     1 
ATOM   885   O O     . ARG A  1 120 ? 171.108 84.471  160.088 1.00 172.03 ? 120 ARG A O     1 
ATOM   886   C CB    . ARG A  1 120 ? 173.156 85.959  161.391 1.00 149.71 ? 120 ARG A CB    1 
ATOM   887   C CG    . ARG A  1 120 ? 174.528 86.356  161.864 1.00 149.71 ? 120 ARG A CG    1 
ATOM   888   C CD    . ARG A  1 120 ? 174.501 86.446  163.360 1.00 149.71 ? 120 ARG A CD    1 
ATOM   889   N NE    . ARG A  1 120 ? 175.737 86.980  163.906 1.00 149.71 ? 120 ARG A NE    1 
ATOM   890   C CZ    . ARG A  1 120 ? 175.924 87.214  165.198 1.00 149.71 ? 120 ARG A CZ    1 
ATOM   891   N NH1   . ARG A  1 120 ? 174.946 86.957  166.060 1.00 149.71 ? 120 ARG A NH1   1 
ATOM   892   N NH2   . ARG A  1 120 ? 177.085 87.696  165.627 1.00 149.71 ? 120 ARG A NH2   1 
ATOM   893   N N     . ILE A  1 227 ? 169.434 75.112  165.644 1.00 185.86 ? 227 ILE A N     1 
ATOM   894   C CA    . ILE A  1 227 ? 170.378 76.056  165.063 1.00 185.86 ? 227 ILE A CA    1 
ATOM   895   C C     . ILE A  1 227 ? 169.711 76.956  164.022 1.00 185.86 ? 227 ILE A C     1 
ATOM   896   O O     . ILE A  1 227 ? 169.746 78.183  164.147 1.00 185.86 ? 227 ILE A O     1 
ATOM   897   C CB    . ILE A  1 227 ? 171.574 75.314  164.410 1.00 186.24 ? 227 ILE A CB    1 
ATOM   898   C CG1   . ILE A  1 227 ? 172.447 76.305  163.628 1.00 186.24 ? 227 ILE A CG1   1 
ATOM   899   C CG2   . ILE A  1 227 ? 171.063 74.188  163.520 1.00 186.24 ? 227 ILE A CG2   1 
ATOM   900   C CD1   . ILE A  1 227 ? 173.621 75.665  162.902 1.00 186.24 ? 227 ILE A CD1   1 
ATOM   901   N N     . ASP A  1 228 ? 169.101 76.349  163.002 1.00 200.00 ? 228 ASP A N     1 
ATOM   902   C CA    . ASP A  1 228 ? 168.437 77.117  161.948 1.00 200.00 ? 228 ASP A CA    1 
ATOM   903   C C     . ASP A  1 228 ? 167.109 77.707  162.415 1.00 200.00 ? 228 ASP A C     1 
ATOM   904   O O     . ASP A  1 228 ? 166.170 77.864  161.627 1.00 200.00 ? 228 ASP A O     1 
ATOM   905   C CB    . ASP A  1 228 ? 168.231 76.257  160.676 1.00 177.58 ? 228 ASP A CB    1 
ATOM   906   C CG    . ASP A  1 228 ? 167.322 75.048  160.897 1.00 177.58 ? 228 ASP A CG    1 
ATOM   907   O OD1   . ASP A  1 228 ? 166.162 75.223  161.328 1.00 177.58 ? 228 ASP A OD1   1 
ATOM   908   O OD2   . ASP A  1 228 ? 167.769 73.915  160.616 1.00 177.58 ? 228 ASP A OD2   1 
ATOM   909   N N     . ASP A  1 229 ? 167.048 78.049  163.701 1.00 200.00 ? 229 ASP A N     1 
ATOM   910   C CA    . ASP A  1 229 ? 165.845 78.622  164.297 1.00 200.00 ? 229 ASP A CA    1 
ATOM   911   C C     . ASP A  1 229 ? 166.027 80.116  164.571 1.00 200.00 ? 229 ASP A C     1 
ATOM   912   O O     . ASP A  1 229 ? 165.061 80.884  164.585 1.00 200.00 ? 229 ASP A O     1 
ATOM   913   C CB    . ASP A  1 229 ? 165.505 77.886  165.596 1.00 200.00 ? 229 ASP A CB    1 
ATOM   914   C CG    . ASP A  1 229 ? 164.078 78.130  166.046 1.00 200.00 ? 229 ASP A CG    1 
ATOM   915   O OD1   . ASP A  1 229 ? 163.756 79.283  166.412 1.00 200.00 ? 229 ASP A OD1   1 
ATOM   916   O OD2   . ASP A  1 229 ? 163.280 77.165  166.025 1.00 200.00 ? 229 ASP A OD2   1 
ATOM   917   N N     . GLU A  1 230 ? 167.273 80.521  164.791 1.00 200.00 ? 230 GLU A N     1 
ATOM   918   C CA    . GLU A  1 230 ? 167.584 81.921  165.041 1.00 200.00 ? 230 GLU A CA    1 
ATOM   919   C C     . GLU A  1 230 ? 167.717 82.646  163.702 1.00 200.00 ? 230 GLU A C     1 
ATOM   920   O O     . GLU A  1 230 ? 168.263 83.748  163.630 1.00 200.00 ? 230 GLU A O     1 
ATOM   921   C CB    . GLU A  1 230 ? 168.888 82.035  165.849 1.00 200.00 ? 230 GLU A CB    1 
ATOM   922   C CG    . GLU A  1 230 ? 170.039 81.152  165.351 1.00 200.00 ? 230 GLU A CG    1 
ATOM   923   C CD    . GLU A  1 230 ? 171.306 81.285  166.196 1.00 200.00 ? 230 GLU A CD    1 
ATOM   924   O OE1   . GLU A  1 230 ? 171.254 81.004  167.415 1.00 200.00 ? 230 GLU A OE1   1 
ATOM   925   O OE2   . GLU A  1 230 ? 172.357 81.671  165.637 1.00 200.00 ? 230 GLU A OE2   1 
ATOM   926   N N     . ALA A  1 231 ? 167.198 82.016  162.649 1.00 193.95 ? 231 ALA A N     1 
ATOM   927   C CA    . ALA A  1 231 ? 167.255 82.561  161.293 1.00 193.95 ? 231 ALA A CA    1 
ATOM   928   C C     . ALA A  1 231 ? 165.995 83.334  160.909 1.00 193.95 ? 231 ALA A C     1 
ATOM   929   O O     . ALA A  1 231 ? 166.051 84.253  160.090 1.00 193.95 ? 231 ALA A O     1 
ATOM   930   C CB    . ALA A  1 231 ? 167.500 81.428  160.290 1.00 117.34 ? 231 ALA A CB    1 
ATOM   931   N N     . ALA A  1 232 ? 164.863 82.955  161.497 1.00 200.00 ? 232 ALA A N     1 
ATOM   932   C CA    . ALA A  1 232 ? 163.593 83.618  161.213 1.00 200.00 ? 232 ALA A CA    1 
ATOM   933   C C     . ALA A  1 232 ? 163.610 85.048  161.747 1.00 200.00 ? 232 ALA A C     1 
ATOM   934   O O     . ALA A  1 232 ? 162.682 85.825  161.513 1.00 200.00 ? 232 ALA A O     1 
ATOM   935   C CB    . ALA A  1 232 ? 162.440 82.833  161.838 1.00 102.19 ? 232 ALA A CB    1 
ATOM   936   N N     . LYS A  1 233 ? 164.674 85.384  162.469 1.00 127.64 ? 233 LYS A N     1 
ATOM   937   C CA    . LYS A  1 233 ? 164.840 86.716  163.031 1.00 127.64 ? 233 LYS A CA    1 
ATOM   938   C C     . LYS A  1 233 ? 165.351 87.639  161.928 1.00 127.64 ? 233 LYS A C     1 
ATOM   939   O O     . LYS A  1 233 ? 166.091 87.204  161.041 1.00 127.64 ? 233 LYS A O     1 
ATOM   940   C CB    . LYS A  1 233 ? 165.840 86.660  164.195 1.00 200.00 ? 233 LYS A CB    1 
ATOM   941   C CG    . LYS A  1 233 ? 166.201 88.003  164.839 1.00 200.00 ? 233 LYS A CG    1 
ATOM   942   C CD    . LYS A  1 233 ? 167.085 88.874  163.941 1.00 200.00 ? 233 LYS A CD    1 
ATOM   943   C CE    . LYS A  1 233 ? 168.334 88.131  163.464 1.00 200.00 ? 233 LYS A CE    1 
ATOM   944   N NZ    . LYS A  1 233 ? 169.104 88.897  162.439 1.00 200.00 ? 233 LYS A NZ    1 
ATOM   945   N N     . LEU A  1 234 ? 164.951 88.909  161.995 1.00 200.00 ? 234 LEU A N     1 
ATOM   946   C CA    . LEU A  1 234 ? 165.345 89.931  161.021 1.00 200.00 ? 234 LEU A CA    1 
ATOM   947   C C     . LEU A  1 234 ? 164.512 89.790  159.752 1.00 200.00 ? 234 LEU A C     1 
ATOM   948   O O     . LEU A  1 234 ? 163.597 90.578  159.509 1.00 200.00 ? 234 LEU A O     1 
ATOM   949   C CB    . LEU A  1 234 ? 166.832 89.804  160.659 1.00 109.68 ? 234 LEU A CB    1 
ATOM   950   C CG    . LEU A  1 234 ? 167.632 91.062  160.297 1.00 109.68 ? 234 LEU A CG    1 
ATOM   951   C CD1   . LEU A  1 234 ? 168.927 90.603  159.648 1.00 109.68 ? 234 LEU A CD1   1 
ATOM   952   C CD2   . LEU A  1 234 ? 166.856 91.989  159.359 1.00 109.68 ? 234 LEU A CD2   1 
ATOM   953   N N     . ILE A  1 235 ? 164.848 88.778  158.955 1.00 164.76 ? 235 ILE A N     1 
ATOM   954   C CA    . ILE A  1 235 ? 164.171 88.478  157.695 1.00 164.76 ? 235 ILE A CA    1 
ATOM   955   C C     . ILE A  1 235 ? 163.082 89.462  157.289 1.00 164.76 ? 235 ILE A C     1 
ATOM   956   O O     . ILE A  1 235 ? 163.311 90.330  156.452 1.00 164.76 ? 235 ILE A O     1 
ATOM   957   C CB    . ILE A  1 235 ? 163.558 87.057  157.713 1.00 103.59 ? 235 ILE A CB    1 
ATOM   958   C CG1   . ILE A  1 235 ? 164.676 86.002  157.690 1.00 103.59 ? 235 ILE A CG1   1 
ATOM   959   C CG2   . ILE A  1 235 ? 162.624 86.878  156.531 1.00 103.59 ? 235 ILE A CG2   1 
ATOM   960   C CD1   . ILE A  1 235 ? 164.181 84.555  157.802 1.00 103.59 ? 235 ILE A CD1   1 
ATOM   961   N N     . ASN A  1 236 ? 161.901 89.338  157.885 1.00 149.92 ? 236 ASN A N     1 
ATOM   962   C CA    . ASN A  1 236 ? 160.801 90.221  157.524 1.00 149.92 ? 236 ASN A CA    1 
ATOM   963   C C     . ASN A  1 236 ? 160.576 90.010  156.034 1.00 149.92 ? 236 ASN A C     1 
ATOM   964   O O     . ASN A  1 236 ? 160.783 90.915  155.228 1.00 149.92 ? 236 ASN A O     1 
ATOM   965   C CB    . ASN A  1 236 ? 161.163 91.687  157.807 1.00 152.44 ? 236 ASN A CB    1 
ATOM   966   C CG    . ASN A  1 236 ? 160.138 92.668  157.246 1.00 152.44 ? 236 ASN A CG    1 
ATOM   967   O OD1   . ASN A  1 236 ? 158.930 92.418  157.278 1.00 152.44 ? 236 ASN A OD1   1 
ATOM   968   N ND2   . ASN A  1 236 ? 160.619 93.799  156.748 1.00 152.44 ? 236 ASN A ND2   1 
ATOM   969   N N     . PRO A  1 237 ? 160.148 88.795  155.654 1.00 145.69 ? 237 PRO A N     1 
ATOM   970   C CA    . PRO A  1 237 ? 159.883 88.403  154.268 1.00 145.99 ? 237 PRO A CA    1 
ATOM   971   C C     . PRO A  1 237 ? 159.374 89.506  153.335 1.00 146.30 ? 237 PRO A C     1 
ATOM   972   O O     . PRO A  1 237 ? 159.841 89.614  152.200 1.00 145.96 ? 237 PRO A O     1 
ATOM   973   C CB    . PRO A  1 237 ? 158.885 87.262  154.429 1.00 157.18 ? 237 PRO A CB    1 
ATOM   974   C CG    . PRO A  1 237 ? 159.385 86.585  155.662 1.00 157.02 ? 237 PRO A CG    1 
ATOM   975   C CD    . PRO A  1 237 ? 159.662 87.758  156.586 1.00 156.74 ? 237 PRO A CD    1 
ATOM   976   N N     . GLU A  1 238 ? 158.433 90.325  153.808 1.00 143.88 ? 238 GLU A N     1 
ATOM   977   C CA    . GLU A  1 238 ? 157.876 91.395  152.980 1.00 144.13 ? 238 GLU A CA    1 
ATOM   978   C C     . GLU A  1 238 ? 158.912 92.466  152.634 1.00 143.71 ? 238 GLU A C     1 
ATOM   979   O O     . GLU A  1 238 ? 158.646 93.358  151.823 1.00 143.90 ? 238 GLU A O     1 
ATOM   980   C CB    . GLU A  1 238 ? 156.664 92.047  153.671 1.00 170.50 ? 238 GLU A CB    1 
ATOM   981   C CG    . GLU A  1 238 ? 155.854 92.986  152.757 1.00 172.31 ? 238 GLU A CG    1 
ATOM   982   C CD    . GLU A  1 238 ? 154.659 93.641  153.447 1.00 173.85 ? 238 GLU A CD    1 
ATOM   983   O OE1   . GLU A  1 238 ? 154.865 94.416  154.405 1.00 174.80 ? 238 GLU A OE1   1 
ATOM   984   O OE2   . GLU A  1 238 ? 153.510 93.385  153.029 1.00 174.45 ? 238 GLU A OE2   1 
ATOM   985   N N     . GLU A  1 239 ? 160.093 92.375  153.242 1.00 140.71 ? 239 GLU A N     1 
ATOM   986   C CA    . GLU A  1 239 ? 161.163 93.336  152.983 1.00 139.54 ? 239 GLU A CA    1 
ATOM   987   C C     . GLU A  1 239 ? 162.229 92.724  152.078 1.00 137.85 ? 239 GLU A C     1 
ATOM   988   O O     . GLU A  1 239 ? 162.729 93.378  151.159 1.00 137.79 ? 239 GLU A O     1 
ATOM   989   C CB    . GLU A  1 239 ? 161.805 93.783  154.292 1.00 184.48 ? 239 GLU A CB    1 
ATOM   990   C CG    . GLU A  1 239 ? 162.866 94.848  154.123 1.00 186.62 ? 239 GLU A CG    1 
ATOM   991   C CD    . GLU A  1 239 ? 163.479 95.266  155.439 1.00 187.69 ? 239 GLU A CD    1 
ATOM   992   O OE1   . GLU A  1 239 ? 162.720 95.686  156.337 1.00 188.28 ? 239 GLU A OE1   1 
ATOM   993   O OE2   . GLU A  1 239 ? 164.717 95.175  155.574 1.00 188.16 ? 239 GLU A OE2   1 
ATOM   994   N N     . LEU A  1 240 ? 162.583 91.472  152.352 1.00 89.49  ? 240 LEU A N     1 
ATOM   995   C CA    . LEU A  1 240 ? 163.573 90.772  151.551 1.00 86.84  ? 240 LEU A CA    1 
ATOM   996   C C     . LEU A  1 240 ? 163.200 91.037  150.103 1.00 84.93  ? 240 LEU A C     1 
ATOM   997   O O     . LEU A  1 240 ? 164.003 91.537  149.316 1.00 84.41  ? 240 LEU A O     1 
ATOM   998   C CB    . LEU A  1 240 ? 163.512 89.272  151.835 1.00 130.85 ? 240 LEU A CB    1 
ATOM   999   C CG    . LEU A  1 240 ? 164.455 88.359  151.046 1.00 131.48 ? 240 LEU A CG    1 
ATOM   1000  C CD1   . LEU A  1 240 ? 165.903 88.766  151.284 1.00 131.20 ? 240 LEU A CD1   1 
ATOM   1001  C CD2   . LEU A  1 240 ? 164.224 86.912  151.472 1.00 131.49 ? 240 LEU A CD2   1 
ATOM   1002  N N     . LYS A  1 241 ? 161.954 90.714  149.775 1.00 78.00  ? 241 LYS A N     1 
ATOM   1003  C CA    . LYS A  1 241 ? 161.422 90.911  148.432 1.00 76.29  ? 241 LYS A CA    1 
ATOM   1004  C C     . LYS A  1 241 ? 161.696 92.333  147.969 1.00 74.47  ? 241 LYS A C     1 
ATOM   1005  O O     . LYS A  1 241 ? 162.369 92.550  146.959 1.00 73.86  ? 241 LYS A O     1 
ATOM   1006  C CB    . LYS A  1 241 ? 159.907 90.650  148.425 1.00 116.62 ? 241 LYS A CB    1 
ATOM   1007  C CG    . LYS A  1 241 ? 159.505 89.249  148.896 1.00 117.51 ? 241 LYS A CG    1 
ATOM   1008  C CD    . LYS A  1 241 ? 157.997 89.022  148.812 1.00 117.77 ? 241 LYS A CD    1 
ATOM   1009  C CE    . LYS A  1 241 ? 157.640 87.554  149.047 1.00 117.94 ? 241 LYS A CE    1 
ATOM   1010  N NZ    . LYS A  1 241 ? 156.186 87.270  148.833 1.00 117.73 ? 241 LYS A NZ    1 
ATOM   1011  N N     . GLN A  1 242 ? 161.172 93.290  148.731 1.00 124.38 ? 242 GLN A N     1 
ATOM   1012  C CA    . GLN A  1 242 ? 161.312 94.713  148.442 1.00 122.76 ? 242 GLN A CA    1 
ATOM   1013  C C     . GLN A  1 242 ? 162.761 95.170  148.316 1.00 120.95 ? 242 GLN A C     1 
ATOM   1014  O O     . GLN A  1 242 ? 163.027 96.327  147.982 1.00 121.22 ? 242 GLN A O     1 
ATOM   1015  C CB    . GLN A  1 242 ? 160.595 95.528  149.523 1.00 137.50 ? 242 GLN A CB    1 
ATOM   1016  C CG    . GLN A  1 242 ? 160.652 97.050  149.354 1.00 138.93 ? 242 GLN A CG    1 
ATOM   1017  C CD    . GLN A  1 242 ? 160.076 97.532  148.037 1.00 139.72 ? 242 GLN A CD    1 
ATOM   1018  O OE1   . GLN A  1 242 ? 160.784 97.628  147.033 1.00 139.96 ? 242 GLN A OE1   1 
ATOM   1019  N NE2   . GLN A  1 242 ? 158.780 97.831  148.034 1.00 139.97 ? 242 GLN A NE2   1 
ATOM   1020  N N     . LYS A  1 243 ? 163.700 94.274  148.591 1.00 113.76 ? 243 LYS A N     1 
ATOM   1021  C CA    . LYS A  1 243 ? 165.097 94.639  148.454 1.00 111.03 ? 243 LYS A CA    1 
ATOM   1022  C C     . LYS A  1 243 ? 165.656 94.015  147.171 1.00 108.28 ? 243 LYS A C     1 
ATOM   1023  O O     . LYS A  1 243 ? 166.515 94.606  146.516 1.00 107.99 ? 243 LYS A O     1 
ATOM   1024  C CB    . LYS A  1 243 ? 165.908 94.189  149.675 1.00 135.58 ? 243 LYS A CB    1 
ATOM   1025  C CG    . LYS A  1 243 ? 167.211 94.967  149.820 1.00 137.20 ? 243 LYS A CG    1 
ATOM   1026  C CD    . LYS A  1 243 ? 168.045 94.542  151.022 1.00 138.60 ? 243 LYS A CD    1 
ATOM   1027  C CE    . LYS A  1 243 ? 169.364 95.331  151.074 1.00 139.52 ? 243 LYS A CE    1 
ATOM   1028  N NZ    . LYS A  1 243 ? 170.361 94.824  152.078 1.00 140.09 ? 243 LYS A NZ    1 
ATOM   1029  N N     . ALA A  1 244 ? 165.151 92.833  146.810 1.00 66.76  ? 244 ALA A N     1 
ATOM   1030  C CA    . ALA A  1 244 ? 165.591 92.125  145.601 1.00 62.41  ? 244 ALA A CA    1 
ATOM   1031  C C     . ALA A  1 244 ? 165.083 92.866  144.387 1.00 59.14  ? 244 ALA A C     1 
ATOM   1032  O O     . ALA A  1 244 ? 165.750 92.936  143.353 1.00 57.79  ? 244 ALA A O     1 
ATOM   1033  C CB    . ALA A  1 244 ? 165.053 90.701  145.591 1.00 83.88  ? 244 ALA A CB    1 
ATOM   1034  N N     . ILE A  1 245 ? 163.883 93.413  144.520 1.00 63.67  ? 245 ILE A N     1 
ATOM   1035  C CA    . ILE A  1 245 ? 163.301 94.156  143.435 1.00 61.14  ? 245 ILE A CA    1 
ATOM   1036  C C     . ILE A  1 245 ? 164.226 95.305  143.117 1.00 59.76  ? 245 ILE A C     1 
ATOM   1037  O O     . ILE A  1 245 ? 164.464 95.611  141.952 1.00 59.99  ? 245 ILE A O     1 
ATOM   1038  C CB    . ILE A  1 245 ? 161.939 94.669  143.808 1.00 65.63  ? 245 ILE A CB    1 
ATOM   1039  C CG1   . ILE A  1 245 ? 161.002 93.483  143.982 1.00 65.85  ? 245 ILE A CG1   1 
ATOM   1040  C CG2   . ILE A  1 245 ? 161.417 95.590  142.729 1.00 65.61  ? 245 ILE A CG2   1 
ATOM   1041  C CD1   . ILE A  1 245 ? 159.567 93.886  144.184 1.00 67.53  ? 245 ILE A CD1   1 
ATOM   1042  N N     . ASP A  1 246 ? 164.759 95.948  144.148 1.00 52.90  ? 246 ASP A N     1 
ATOM   1043  C CA    . ASP A  1 246 ? 165.701 97.038  143.915 1.00 52.08  ? 246 ASP A CA    1 
ATOM   1044  C C     . ASP A  1 246 ? 166.906 96.469  143.129 1.00 49.60  ? 246 ASP A C     1 
ATOM   1045  O O     . ASP A  1 246 ? 167.253 96.938  142.036 1.00 49.04  ? 246 ASP A O     1 
ATOM   1046  C CB    . ASP A  1 246 ? 166.198 97.609  145.249 1.00 132.65 ? 246 ASP A CB    1 
ATOM   1047  C CG    . ASP A  1 246 ? 165.099 98.255  146.061 1.00 136.18 ? 246 ASP A CG    1 
ATOM   1048  O OD1   . ASP A  1 246 ? 164.472 99.207  145.553 1.00 137.72 ? 246 ASP A OD1   1 
ATOM   1049  O OD2   . ASP A  1 246 ? 164.870 97.815  147.207 1.00 138.19 ? 246 ASP A OD2   1 
ATOM   1050  N N     . ALA A  1 247 ? 167.531 95.448  143.715 1.00 69.18  ? 247 ALA A N     1 
ATOM   1051  C CA    . ALA A  1 247 ? 168.689 94.778  143.136 1.00 65.38  ? 247 ALA A CA    1 
ATOM   1052  C C     . ALA A  1 247 ? 168.509 94.590  141.649 1.00 62.17  ? 247 ALA A C     1 
ATOM   1053  O O     . ALA A  1 247 ? 169.398 94.900  140.853 1.00 61.02  ? 247 ALA A O     1 
ATOM   1054  C CB    . ALA A  1 247 ? 168.881 93.437  143.799 1.00 101.67 ? 247 ALA A CB    1 
ATOM   1055  N N     . VAL A  1 248 ? 167.352 94.062  141.278 1.00 27.95  ? 248 VAL A N     1 
ATOM   1056  C CA    . VAL A  1 248 ? 167.077 93.861  139.872 1.00 24.87  ? 248 VAL A CA    1 
ATOM   1057  C C     . VAL A  1 248 ? 167.000 95.200  139.200 1.00 23.77  ? 248 VAL A C     1 
ATOM   1058  O O     . VAL A  1 248 ? 167.798 95.515  138.313 1.00 23.48  ? 248 VAL A O     1 
ATOM   1059  C CB    . VAL A  1 248 ? 165.727 93.214  139.604 1.00 17.55  ? 248 VAL A CB    1 
ATOM   1060  C CG1   . VAL A  1 248 ? 165.434 93.318  138.111 1.00 17.18  ? 248 VAL A CG1   1 
ATOM   1061  C CG2   . VAL A  1 248 ? 165.733 91.763  140.025 1.00 17.62  ? 248 VAL A CG2   1 
ATOM   1062  N N     . GLU A  1 249 ? 166.004 95.967  139.639 1.00 31.08  ? 249 GLU A N     1 
ATOM   1063  C CA    . GLU A  1 249 ? 165.718 97.287  139.114 1.00 30.15  ? 249 GLU A CA    1 
ATOM   1064  C C     . GLU A  1 249 ? 166.943 98.164  139.001 1.00 29.79  ? 249 GLU A C     1 
ATOM   1065  O O     . GLU A  1 249 ? 167.109 98.877  137.993 1.00 29.80  ? 249 GLU A O     1 
ATOM   1066  C CB    . GLU A  1 249 ? 164.676 97.982  139.984 1.00 68.74  ? 249 GLU A CB    1 
ATOM   1067  C CG    . GLU A  1 249 ? 163.273 97.476  139.770 1.00 71.01  ? 249 GLU A CG    1 
ATOM   1068  C CD    . GLU A  1 249 ? 162.239 98.436  140.306 1.00 72.95  ? 249 GLU A CD    1 
ATOM   1069  O OE1   . GLU A  1 249 ? 161.023 98.160  140.175 1.00 72.92  ? 249 GLU A OE1   1 
ATOM   1070  O OE2   . GLU A  1 249 ? 162.655 99.476  140.860 1.00 75.30  ? 249 GLU A OE2   1 
ATOM   1071  N N     . GLN A  1 250 ? 167.796 98.095  140.026 1.00 45.27  ? 250 GLN A N     1 
ATOM   1072  C CA    . GLN A  1 250 ? 169.000 98.907  140.090 1.00 44.97  ? 250 GLN A CA    1 
ATOM   1073  C C     . GLN A  1 250 ? 170.221 98.375  139.349 1.00 42.87  ? 250 GLN A C     1 
ATOM   1074  O O     . GLN A  1 250 ? 170.752 99.074  138.480 1.00 42.48  ? 250 GLN A O     1 
ATOM   1075  C CB    . GLN A  1 250 ? 169.365 99.210  141.552 1.00 108.06 ? 250 GLN A CB    1 
ATOM   1076  C CG    . GLN A  1 250 ? 168.433 100.213 142.237 1.00 114.18 ? 250 GLN A CG    1 
ATOM   1077  C CD    . GLN A  1 250 ? 168.347 101.557 141.510 1.00 117.46 ? 250 GLN A CD    1 
ATOM   1078  O OE1   . GLN A  1 250 ? 167.553 102.423 141.878 1.00 118.23 ? 250 GLN A OE1   1 
ATOM   1079  N NE2   . GLN A  1 250 ? 169.166 101.733 140.480 1.00 118.86 ? 250 GLN A NE2   1 
ATOM   1080  N N     . ASN A  1 251 ? 170.684 97.166  139.667 1.00 64.75  ? 251 ASN A N     1 
ATOM   1081  C CA    . ASN A  1 251 ? 171.860 96.655  138.968 1.00 62.69  ? 251 ASN A CA    1 
ATOM   1082  C C     . ASN A  1 251 ? 171.708 95.315  138.260 1.00 59.23  ? 251 ASN A C     1 
ATOM   1083  O O     . ASN A  1 251 ? 172.535 94.430  138.417 1.00 59.86  ? 251 ASN A O     1 
ATOM   1084  C CB    . ASN A  1 251 ? 173.078 96.576  139.903 1.00 78.64  ? 251 ASN A CB    1 
ATOM   1085  C CG    . ASN A  1 251 ? 172.784 97.064  141.304 1.00 81.58  ? 251 ASN A CG    1 
ATOM   1086  O OD1   . ASN A  1 251 ? 172.574 98.253  141.531 1.00 83.48  ? 251 ASN A OD1   1 
ATOM   1087  N ND2   . ASN A  1 251 ? 172.773 96.143  142.258 1.00 83.06  ? 251 ASN A ND2   1 
ATOM   1088  N N     . GLY A  1 252 ? 170.670 95.153  137.462 1.00 46.59  ? 252 GLY A N     1 
ATOM   1089  C CA    . GLY A  1 252 ? 170.542 93.893  136.761 1.00 41.27  ? 252 GLY A CA    1 
ATOM   1090  C C     . GLY A  1 252 ? 171.276 93.912  135.429 1.00 37.78  ? 252 GLY A C     1 
ATOM   1091  O O     . GLY A  1 252 ? 171.299 94.927  134.726 1.00 37.92  ? 252 GLY A O     1 
ATOM   1092  N N     . ILE A  1 253 ? 171.899 92.800  135.073 1.00 22.02  ? 253 ILE A N     1 
ATOM   1093  C CA    . ILE A  1 253 ? 172.594 92.722  133.795 1.00 18.93  ? 253 ILE A CA    1 
ATOM   1094  C C     . ILE A  1 253 ? 171.879 91.595  133.072 1.00 16.73  ? 253 ILE A C     1 
ATOM   1095  O O     . ILE A  1 253 ? 171.676 90.529  133.630 1.00 16.96  ? 253 ILE A O     1 
ATOM   1096  C CB    . ILE A  1 253 ? 174.110 92.332  133.929 1.00 29.45  ? 253 ILE A CB    1 
ATOM   1097  C CG1   . ILE A  1 253 ? 174.719 92.860  135.225 1.00 30.03  ? 253 ILE A CG1   1 
ATOM   1098  C CG2   . ILE A  1 253 ? 174.907 92.945  132.795 1.00 29.88  ? 253 ILE A CG2   1 
ATOM   1099  C CD1   . ILE A  1 253 ? 174.825 94.343  135.291 1.00 30.56  ? 253 ILE A CD1   1 
ATOM   1100  N N     . VAL A  1 254 ? 171.470 91.837  131.841 1.00 29.35  ? 254 VAL A N     1 
ATOM   1101  C CA    . VAL A  1 254 ? 170.798 90.814  131.065 1.00 26.12  ? 254 VAL A CA    1 
ATOM   1102  C C     . VAL A  1 254 ? 171.572 90.595  129.788 1.00 27.05  ? 254 VAL A C     1 
ATOM   1103  O O     . VAL A  1 254 ? 171.827 91.526  129.020 1.00 27.66  ? 254 VAL A O     1 
ATOM   1104  C CB    . VAL A  1 254 ? 169.388 91.223  130.742 1.00 1.00   ? 254 VAL A CB    1 
ATOM   1105  C CG1   . VAL A  1 254 ? 168.842 90.399  129.594 1.00 1.00   ? 254 VAL A CG1   1 
ATOM   1106  C CG2   . VAL A  1 254 ? 168.560 91.062  131.969 1.00 1.00   ? 254 VAL A CG2   1 
ATOM   1107  N N     . PHE A  1 255 ? 171.955 89.350  129.563 1.00 18.38  ? 255 PHE A N     1 
ATOM   1108  C CA    . PHE A  1 255 ? 172.738 89.036  128.395 1.00 17.44  ? 255 PHE A CA    1 
ATOM   1109  C C     . PHE A  1 255 ? 171.861 88.367  127.340 1.00 18.92  ? 255 PHE A C     1 
ATOM   1110  O O     . PHE A  1 255 ? 171.319 87.287  127.555 1.00 20.00  ? 255 PHE A O     1 
ATOM   1111  C CB    . PHE A  1 255 ? 173.891 88.136  128.832 1.00 8.07   ? 255 PHE A CB    1 
ATOM   1112  C CG    . PHE A  1 255 ? 174.904 87.899  127.776 1.00 7.01   ? 255 PHE A CG    1 
ATOM   1113  C CD1   . PHE A  1 255 ? 175.814 88.865  127.435 1.00 6.11   ? 255 PHE A CD1   1 
ATOM   1114  C CD2   . PHE A  1 255 ? 174.936 86.706  127.103 1.00 8.06   ? 255 PHE A CD2   1 
ATOM   1115  C CE1   . PHE A  1 255 ? 176.745 88.636  126.432 1.00 3.87   ? 255 PHE A CE1   1 
ATOM   1116  C CE2   . PHE A  1 255 ? 175.854 86.478  126.106 1.00 6.79   ? 255 PHE A CE2   1 
ATOM   1117  C CZ    . PHE A  1 255 ? 176.757 87.440  125.772 1.00 3.35   ? 255 PHE A CZ    1 
ATOM   1118  N N     . ILE A  1 256 ? 171.687 89.022  126.201 1.00 22.94  ? 256 ILE A N     1 
ATOM   1119  C CA    . ILE A  1 256 ? 170.879 88.430  125.149 1.00 23.01  ? 256 ILE A CA    1 
ATOM   1120  C C     . ILE A  1 256 ? 171.795 87.828  124.097 1.00 25.70  ? 256 ILE A C     1 
ATOM   1121  O O     . ILE A  1 256 ? 172.318 88.543  123.236 1.00 25.58  ? 256 ILE A O     1 
ATOM   1122  C CB    . ILE A  1 256 ? 170.003 89.460  124.492 1.00 7.66   ? 256 ILE A CB    1 
ATOM   1123  C CG1   . ILE A  1 256 ? 168.992 90.003  125.514 1.00 6.73   ? 256 ILE A CG1   1 
ATOM   1124  C CG2   . ILE A  1 256 ? 169.348 88.839  123.270 1.00 7.20   ? 256 ILE A CG2   1 
ATOM   1125  C CD1   . ILE A  1 256 ? 167.947 90.931  124.929 1.00 4.62   ? 256 ILE A CD1   1 
ATOM   1126  N N     . ASP A  1 257 ? 171.977 86.506  124.156 1.00 16.18  ? 257 ASP A N     1 
ATOM   1127  C CA    . ASP A  1 257 ? 172.887 85.842  123.234 1.00 16.75  ? 257 ASP A CA    1 
ATOM   1128  C C     . ASP A  1 257 ? 172.324 85.605  121.866 1.00 15.64  ? 257 ASP A C     1 
ATOM   1129  O O     . ASP A  1 257 ? 171.131 85.435  121.694 1.00 14.79  ? 257 ASP A O     1 
ATOM   1130  C CB    . ASP A  1 257 ? 173.366 84.524  123.817 1.00 28.10  ? 257 ASP A CB    1 
ATOM   1131  C CG    . ASP A  1 257 ? 174.693 84.099  123.245 1.00 31.96  ? 257 ASP A CG    1 
ATOM   1132  O OD1   . ASP A  1 257 ? 175.430 85.037  122.887 1.00 33.63  ? 257 ASP A OD1   1 
ATOM   1133  O OD2   . ASP A  1 257 ? 175.014 82.873  123.167 1.00 34.10  ? 257 ASP A OD2   1 
ATOM   1134  N N     . GLU A  1 258 ? 173.222 85.575  120.899 1.00 5.55   ? 258 GLU A N     1 
ATOM   1135  C CA    . GLU A  1 258 ? 172.909 85.378  119.487 1.00 7.74   ? 258 GLU A CA    1 
ATOM   1136  C C     . GLU A  1 258 ? 171.685 86.168  118.998 1.00 5.99   ? 258 GLU A C     1 
ATOM   1137  O O     . GLU A  1 258 ? 170.762 85.641  118.397 1.00 4.34   ? 258 GLU A O     1 
ATOM   1138  C CB    . GLU A  1 258 ? 172.855 83.861  119.136 1.00 69.67  ? 258 GLU A CB    1 
ATOM   1139  C CG    . GLU A  1 258 ? 174.291 83.261  118.886 1.00 77.54  ? 258 GLU A CG    1 
ATOM   1140  C CD    . GLU A  1 258 ? 174.348 81.763  118.528 1.00 81.89  ? 258 GLU A CD    1 
ATOM   1141  O OE1   . GLU A  1 258 ? 175.465 81.257  118.199 1.00 82.67  ? 258 GLU A OE1   1 
ATOM   1142  O OE2   . GLU A  1 258 ? 173.287 81.102  118.580 1.00 83.13  ? 258 GLU A OE2   1 
ATOM   1143  N N     . ILE A  1 259 ? 171.716 87.473  119.249 1.00 9.52   ? 259 ILE A N     1 
ATOM   1144  C CA    . ILE A  1 259 ? 170.646 88.349  118.816 1.00 7.57   ? 259 ILE A CA    1 
ATOM   1145  C C     . ILE A  1 259 ? 170.765 88.464  117.315 1.00 8.45   ? 259 ILE A C     1 
ATOM   1146  O O     . ILE A  1 259 ? 169.793 88.733  116.620 1.00 9.56   ? 259 ILE A O     1 
ATOM   1147  C CB    . ILE A  1 259 ? 170.764 89.766  119.449 1.00 3.18   ? 259 ILE A CB    1 
ATOM   1148  C CG1   . ILE A  1 259 ? 169.390 90.432  119.479 1.00 3.18   ? 259 ILE A CG1   1 
ATOM   1149  C CG2   . ILE A  1 259 ? 171.755 90.642  118.650 1.00 3.18   ? 259 ILE A CG2   1 
ATOM   1150  C CD1   . ILE A  1 259 ? 169.274 91.468  120.535 1.00 3.18   ? 259 ILE A CD1   1 
ATOM   1151  N N     . ASP A  1 260 ? 171.966 88.263  116.809 1.00 17.11  ? 260 ASP A N     1 
ATOM   1152  C CA    . ASP A  1 260 ? 172.150 88.350  115.391 1.00 20.40  ? 260 ASP A CA    1 
ATOM   1153  C C     . ASP A  1 260 ? 171.283 87.297  114.714 1.00 22.02  ? 260 ASP A C     1 
ATOM   1154  O O     . ASP A  1 260 ? 170.958 87.416  113.535 1.00 22.92  ? 260 ASP A O     1 
ATOM   1155  C CB    . ASP A  1 260 ? 173.634 88.204  115.018 1.00 51.41  ? 260 ASP A CB    1 
ATOM   1156  C CG    . ASP A  1 260 ? 174.227 86.854  115.393 1.00 55.52  ? 260 ASP A CG    1 
ATOM   1157  O OD1   . ASP A  1 260 ? 173.869 86.312  116.453 1.00 58.48  ? 260 ASP A OD1   1 
ATOM   1158  O OD2   . ASP A  1 260 ? 175.080 86.342  114.632 1.00 57.85  ? 260 ASP A OD2   1 
ATOM   1159  N N     . LYS A  1 261 ? 170.861 86.277  115.451 1.00 28.22  ? 261 LYS A N     1 
ATOM   1160  C CA    . LYS A  1 261 ? 170.021 85.244  114.834 1.00 30.72  ? 261 LYS A CA    1 
ATOM   1161  C C     . LYS A  1 261 ? 168.565 85.694  114.634 1.00 30.28  ? 261 LYS A C     1 
ATOM   1162  O O     . LYS A  1 261 ? 167.892 85.231  113.714 1.00 30.00  ? 261 LYS A O     1 
ATOM   1163  C CB    . LYS A  1 261 ? 170.023 83.959  115.673 1.00 69.52  ? 261 LYS A CB    1 
ATOM   1164  C CG    . LYS A  1 261 ? 171.348 83.228  115.778 1.00 71.68  ? 261 LYS A CG    1 
ATOM   1165  C CD    . LYS A  1 261 ? 171.680 82.461  114.527 1.00 74.05  ? 261 LYS A CD    1 
ATOM   1166  C CE    . LYS A  1 261 ? 172.971 81.675  114.732 1.00 75.22  ? 261 LYS A CE    1 
ATOM   1167  N NZ    . LYS A  1 261 ? 173.396 80.929  113.512 1.00 78.63  ? 261 LYS A NZ    1 
ATOM   1168  N N     . ILE A  1 262 ? 168.072 86.580  115.494 1.00 7.45   ? 262 ILE A N     1 
ATOM   1169  C CA    . ILE A  1 262 ? 166.700 87.016  115.357 1.00 7.12   ? 262 ILE A CA    1 
ATOM   1170  C C     . ILE A  1 262 ? 166.681 88.266  114.562 1.00 8.44   ? 262 ILE A C     1 
ATOM   1171  O O     . ILE A  1 262 ? 165.778 89.054  114.680 1.00 7.40   ? 262 ILE A O     1 
ATOM   1172  C CB    . ILE A  1 262 ? 165.976 87.246  116.720 1.00 22.88  ? 262 ILE A CB    1 
ATOM   1173  C CG1   . ILE A  1 262 ? 166.497 88.481  117.414 1.00 20.88  ? 262 ILE A CG1   1 
ATOM   1174  C CG2   . ILE A  1 262 ? 166.197 86.053  117.648 1.00 24.37  ? 262 ILE A CG2   1 
ATOM   1175  C CD1   . ILE A  1 262 ? 165.910 88.598  118.775 1.00 18.51  ? 262 ILE A CD1   1 
ATOM   1176  N N     . CYS A  1 263 ? 167.703 88.432  113.741 1.00 18.60  ? 263 CYS A N     1 
ATOM   1177  C CA    . CYS A  1 263 ? 167.801 89.572  112.858 1.00 24.78  ? 263 CYS A CA    1 
ATOM   1178  C C     . CYS A  1 263 ? 166.990 89.207  111.628 1.00 29.70  ? 263 CYS A C     1 
ATOM   1179  O O     . CYS A  1 263 ? 166.113 88.366  111.735 1.00 31.81  ? 263 CYS A O     1 
ATOM   1180  C CB    . CYS A  1 263 ? 169.221 89.737  112.480 1.00 43.31  ? 263 CYS A CB    1 
ATOM   1181  S SG    . CYS A  1 263 ? 169.470 91.381  112.275 1.00 47.71  ? 263 CYS A SG    1 
ATOM   1182  N N     . LYS A  1 264 ? 167.203 89.827  110.473 1.00 48.10  ? 264 LYS A N     1 
ATOM   1183  C CA    . LYS A  1 264 ? 166.447 89.357  109.300 1.00 54.64  ? 264 LYS A CA    1 
ATOM   1184  C C     . LYS A  1 264 ? 167.378 88.998  108.161 1.00 59.04  ? 264 LYS A C     1 
ATOM   1185  O O     . LYS A  1 264 ? 168.516 89.470  108.109 1.00 60.31  ? 264 LYS A O     1 
ATOM   1186  C CB    . LYS A  1 264 ? 165.338 90.324  108.808 1.00 64.27  ? 264 LYS A CB    1 
ATOM   1187  C CG    . LYS A  1 264 ? 165.481 91.832  108.978 1.00 65.74  ? 264 LYS A CG    1 
ATOM   1188  C CD    . LYS A  1 264 ? 164.889 92.415  110.263 1.00 66.03  ? 264 LYS A CD    1 
ATOM   1189  C CE    . LYS A  1 264 ? 165.643 91.958  111.504 1.00 66.46  ? 264 LYS A CE    1 
ATOM   1190  N NZ    . LYS A  1 264 ? 165.976 93.074  112.444 1.00 64.85  ? 264 LYS A NZ    1 
ATOM   1191  N N     . LYS A  1 265 ? 166.903 88.136  107.266 1.00 175.67 ? 265 LYS A N     1 
ATOM   1192  C CA    . LYS A  1 265 ? 167.698 87.681  106.129 1.00 179.92 ? 265 LYS A CA    1 
ATOM   1193  C C     . LYS A  1 265 ? 166.886 86.696  105.289 1.00 180.88 ? 265 LYS A C     1 
ATOM   1194  O O     . LYS A  1 265 ? 166.831 86.799  104.063 1.00 182.01 ? 265 LYS A O     1 
ATOM   1195  C CB    . LYS A  1 265 ? 168.983 87.003  106.625 1.00 153.84 ? 265 LYS A CB    1 
ATOM   1196  C CG    . LYS A  1 265 ? 168.730 85.846  107.586 1.00 156.57 ? 265 LYS A CG    1 
ATOM   1197  C CD    . LYS A  1 265 ? 170.019 85.171  108.036 1.00 158.66 ? 265 LYS A CD    1 
ATOM   1198  C CE    . LYS A  1 265 ? 169.721 83.929  108.877 1.00 160.61 ? 265 LYS A CE    1 
ATOM   1199  N NZ    . LYS A  1 265 ? 170.949 83.197  109.314 1.00 161.33 ? 265 LYS A NZ    1 
ATOM   1200  N N     . GLY A  1 270 ? 158.702 85.502  104.507 1.00 155.10 ? 270 GLY A N     1 
ATOM   1201  C CA    . GLY A  1 270 ? 157.911 84.677  105.400 1.00 155.35 ? 270 GLY A CA    1 
ATOM   1202  C C     . GLY A  1 270 ? 158.778 83.901  106.369 1.00 155.41 ? 270 GLY A C     1 
ATOM   1203  O O     . GLY A  1 270 ? 159.920 83.556  106.055 1.00 155.96 ? 270 GLY A O     1 
ATOM   1204  N N     . ALA A  1 271 ? 158.231 83.630  107.550 1.00 197.21 ? 271 ALA A N     1 
ATOM   1205  C CA    . ALA A  1 271 ? 158.940 82.895  108.589 1.00 196.01 ? 271 ALA A CA    1 
ATOM   1206  C C     . ALA A  1 271 ? 160.108 83.710  109.154 1.00 195.27 ? 271 ALA A C     1 
ATOM   1207  O O     . ALA A  1 271 ? 160.748 83.303  110.125 1.00 195.79 ? 271 ALA A O     1 
ATOM   1208  C CB    . ALA A  1 271 ? 159.431 81.565  108.036 1.00 79.79  ? 271 ALA A CB    1 
ATOM   1209  N N     . ASP A  1 272 ? 160.373 84.861  108.537 1.00 79.55  ? 272 ASP A N     1 
ATOM   1210  C CA    . ASP A  1 272 ? 161.442 85.770  108.961 1.00 77.13  ? 272 ASP A CA    1 
ATOM   1211  C C     . ASP A  1 272 ? 160.832 86.810  109.904 1.00 74.68  ? 272 ASP A C     1 
ATOM   1212  O O     . ASP A  1 272 ? 161.490 87.306  110.816 1.00 74.40  ? 272 ASP A O     1 
ATOM   1213  C CB    . ASP A  1 272 ? 162.063 86.456  107.734 1.00 147.23 ? 272 ASP A CB    1 
ATOM   1214  C CG    . ASP A  1 272 ? 163.136 87.475  108.100 1.00 148.77 ? 272 ASP A CG    1 
ATOM   1215  O OD1   . ASP A  1 272 ? 162.799 88.479  108.761 1.00 150.20 ? 272 ASP A OD1   1 
ATOM   1216  O OD2   . ASP A  1 272 ? 164.314 87.278  107.721 1.00 148.34 ? 272 ASP A OD2   1 
ATOM   1217  N N     . VAL A  1 273 ? 159.562 87.128  109.677 1.00 107.21 ? 273 VAL A N     1 
ATOM   1218  C CA    . VAL A  1 273 ? 158.848 88.090  110.511 1.00 105.08 ? 273 VAL A CA    1 
ATOM   1219  C C     . VAL A  1 273 ? 158.620 87.468  111.882 1.00 102.18 ? 273 VAL A C     1 
ATOM   1220  O O     . VAL A  1 273 ? 158.283 88.153  112.845 1.00 101.54 ? 273 VAL A O     1 
ATOM   1221  C CB    . VAL A  1 273 ? 157.483 88.467  109.887 1.00 185.78 ? 273 VAL A CB    1 
ATOM   1222  C CG1   . VAL A  1 273 ? 157.701 89.265  108.603 1.00 186.48 ? 273 VAL A CG1   1 
ATOM   1223  C CG2   . VAL A  1 273 ? 156.675 87.205  109.597 1.00 185.81 ? 273 VAL A CG2   1 
ATOM   1224  N N     . SER A  1 274 ? 158.804 86.155  111.952 1.00 90.70  ? 274 SER A N     1 
ATOM   1225  C CA    . SER A  1 274 ? 158.647 85.420  113.196 1.00 87.28  ? 274 SER A CA    1 
ATOM   1226  C C     . SER A  1 274 ? 159.816 85.826  114.095 1.00 84.28  ? 274 SER A C     1 
ATOM   1227  O O     . SER A  1 274 ? 159.683 85.914  115.319 1.00 84.00  ? 274 SER A O     1 
ATOM   1228  C CB    . SER A  1 274 ? 158.699 83.910  112.920 1.00 173.95 ? 274 SER A CB    1 
ATOM   1229  O OG    . SER A  1 274 ? 157.803 83.535  111.884 1.00 174.46 ? 274 SER A OG    1 
ATOM   1230  N N     . ARG A  1 275 ? 160.961 86.074  113.463 1.00 74.16  ? 275 ARG A N     1 
ATOM   1231  C CA    . ARG A  1 275 ? 162.172 86.465  114.163 1.00 69.62  ? 275 ARG A CA    1 
ATOM   1232  C C     . ARG A  1 275 ? 162.201 87.969  114.371 1.00 65.81  ? 275 ARG A C     1 
ATOM   1233  O O     . ARG A  1 275 ? 162.322 88.434  115.508 1.00 65.94  ? 275 ARG A O     1 
ATOM   1234  C CB    . ARG A  1 275 ? 163.399 85.990  113.383 1.00 95.83  ? 275 ARG A CB    1 
ATOM   1235  C CG    . ARG A  1 275 ? 163.525 84.464  113.375 1.00 98.27  ? 275 ARG A CG    1 
ATOM   1236  C CD    . ARG A  1 275 ? 164.738 83.963  112.612 1.00 100.15 ? 275 ARG A CD    1 
ATOM   1237  N NE    . ARG A  1 275 ? 164.677 84.345  111.205 1.00 102.12 ? 275 ARG A NE    1 
ATOM   1238  C CZ    . ARG A  1 275 ? 165.536 83.931  110.284 1.00 103.16 ? 275 ARG A CZ    1 
ATOM   1239  N NH1   . ARG A  1 275 ? 166.525 83.117  110.620 1.00 104.22 ? 275 ARG A NH1   1 
ATOM   1240  N NH2   . ARG A  1 275 ? 165.408 84.337  109.029 1.00 103.70 ? 275 ARG A NH2   1 
ATOM   1241  N N     . GLU A  1 276 ? 162.063 88.726  113.278 1.00 58.94  ? 276 GLU A N     1 
ATOM   1242  C CA    . GLU A  1 276 ? 162.049 90.200  113.325 1.00 52.88  ? 276 GLU A CA    1 
ATOM   1243  C C     . GLU A  1 276 ? 160.931 90.649  114.239 1.00 47.76  ? 276 GLU A C     1 
ATOM   1244  O O     . GLU A  1 276 ? 160.579 91.822  114.286 1.00 45.97  ? 276 GLU A O     1 
ATOM   1245  C CB    . GLU A  1 276 ? 161.817 90.784  111.931 1.00 106.27 ? 276 GLU A CB    1 
ATOM   1246  C CG    . GLU A  1 276 ? 161.784 92.300  111.905 1.00 108.16 ? 276 GLU A CG    1 
ATOM   1247  C CD    . GLU A  1 276 ? 161.773 92.861  110.500 1.00 109.90 ? 276 GLU A CD    1 
ATOM   1248  O OE1   . GLU A  1 276 ? 161.784 94.101  110.349 1.00 111.34 ? 276 GLU A OE1   1 
ATOM   1249  O OE2   . GLU A  1 276 ? 161.756 92.062  109.542 1.00 111.00 ? 276 GLU A OE2   1 
ATOM   1250  N N     . GLY A  1 277 ? 160.377 89.674  114.949 1.00 34.76  ? 277 GLY A N     1 
ATOM   1251  C CA    . GLY A  1 277 ? 159.293 89.918  115.869 1.00 29.85  ? 277 GLY A CA    1 
ATOM   1252  C C     . GLY A  1 277 ? 159.808 89.836  117.280 1.00 25.75  ? 277 GLY A C     1 
ATOM   1253  O O     . GLY A  1 277 ? 159.416 90.600  118.151 1.00 24.81  ? 277 GLY A O     1 
ATOM   1254  N N     . VAL A  1 278 ? 160.702 88.903  117.524 1.00 43.83  ? 278 VAL A N     1 
ATOM   1255  C CA    . VAL A  1 278 ? 161.214 88.799  118.864 1.00 41.35  ? 278 VAL A CA    1 
ATOM   1256  C C     . VAL A  1 278 ? 161.814 90.141  119.226 1.00 39.85  ? 278 VAL A C     1 
ATOM   1257  O O     . VAL A  1 278 ? 161.887 90.502  120.405 1.00 40.64  ? 278 VAL A O     1 
ATOM   1258  C CB    . VAL A  1 278 ? 162.278 87.746  118.952 1.00 52.79  ? 278 VAL A CB    1 
ATOM   1259  C CG1   . VAL A  1 278 ? 162.606 87.476  120.393 1.00 51.95  ? 278 VAL A CG1   1 
ATOM   1260  C CG2   . VAL A  1 278 ? 161.793 86.509  118.265 1.00 54.13  ? 278 VAL A CG2   1 
ATOM   1261  N N     . GLN A  1 279 ? 162.241 90.888  118.211 1.00 18.77  ? 279 GLN A N     1 
ATOM   1262  C CA    . GLN A  1 279 ? 162.839 92.181  118.477 1.00 16.50  ? 279 GLN A CA    1 
ATOM   1263  C C     . GLN A  1 279 ? 161.770 93.065  119.053 1.00 16.99  ? 279 GLN A C     1 
ATOM   1264  O O     . GLN A  1 279 ? 161.895 93.545  120.168 1.00 17.43  ? 279 GLN A O     1 
ATOM   1265  C CB    . GLN A  1 279 ? 163.398 92.796  117.208 1.00 19.40  ? 279 GLN A CB    1 
ATOM   1266  C CG    . GLN A  1 279 ? 164.537 92.031  116.651 1.00 15.56  ? 279 GLN A CG    1 
ATOM   1267  C CD    . GLN A  1 279 ? 165.158 92.713  115.466 1.00 13.39  ? 279 GLN A CD    1 
ATOM   1268  O OE1   . GLN A  1 279 ? 165.727 93.795  115.577 1.00 13.08  ? 279 GLN A OE1   1 
ATOM   1269  N NE2   . GLN A  1 279 ? 165.056 92.081  114.317 1.00 11.85  ? 279 GLN A NE2   1 
ATOM   1270  N N     . ARG A  1 280 ? 160.700 93.267  118.302 1.00 38.14  ? 280 ARG A N     1 
ATOM   1271  C CA    . ARG A  1 280 ? 159.618 94.104  118.789 1.00 39.45  ? 280 ARG A CA    1 
ATOM   1272  C C     . ARG A  1 280 ? 159.196 93.610  120.167 1.00 39.16  ? 280 ARG A C     1 
ATOM   1273  O O     . ARG A  1 280 ? 158.753 94.395  120.998 1.00 40.32  ? 280 ARG A O     1 
ATOM   1274  C CB    . ARG A  1 280 ? 158.422 94.067  117.831 1.00 41.92  ? 280 ARG A CB    1 
ATOM   1275  C CG    . ARG A  1 280 ? 158.763 94.458  116.399 1.00 47.04  ? 280 ARG A CG    1 
ATOM   1276  C CD    . ARG A  1 280 ? 158.287 95.866  116.012 1.00 52.27  ? 280 ARG A CD    1 
ATOM   1277  N NE    . ARG A  1 280 ? 158.814 96.278  114.706 1.00 57.53  ? 280 ARG A NE    1 
ATOM   1278  C CZ    . ARG A  1 280 ? 158.591 95.648  113.548 1.00 59.90  ? 280 ARG A CZ    1 
ATOM   1279  N NH1   . ARG A  1 280 ? 157.826 94.557  113.496 1.00 60.17  ? 280 ARG A NH1   1 
ATOM   1280  N NH2   . ARG A  1 280 ? 159.168 96.094  112.433 1.00 59.33  ? 280 ARG A NH2   1 
ATOM   1281  N N     . ASP A  1 281 ? 159.354 92.312  120.419 1.00 31.22  ? 281 ASP A N     1 
ATOM   1282  C CA    . ASP A  1 281 ? 158.964 91.737  121.697 1.00 29.65  ? 281 ASP A CA    1 
ATOM   1283  C C     . ASP A  1 281 ? 159.931 92.093  122.816 1.00 26.93  ? 281 ASP A C     1 
ATOM   1284  O O     . ASP A  1 281 ? 159.545 92.133  123.979 1.00 26.79  ? 281 ASP A O     1 
ATOM   1285  C CB    . ASP A  1 281 ? 158.857 90.228  121.563 1.00 76.25  ? 281 ASP A CB    1 
ATOM   1286  C CG    . ASP A  1 281 ? 157.603 89.797  120.829 1.00 81.51  ? 281 ASP A CG    1 
ATOM   1287  O OD1   . ASP A  1 281 ? 156.517 89.904  121.428 1.00 84.12  ? 281 ASP A OD1   1 
ATOM   1288  O OD2   . ASP A  1 281 ? 157.692 89.355  119.660 1.00 84.44  ? 281 ASP A OD2   1 
ATOM   1289  N N     . LEU A  1 282 ? 161.187 92.357  122.467 1.00 29.42  ? 282 LEU A N     1 
ATOM   1290  C CA    . LEU A  1 282 ? 162.207 92.703  123.449 1.00 26.12  ? 282 LEU A CA    1 
ATOM   1291  C C     . LEU A  1 282 ? 162.257 94.173  123.767 1.00 25.24  ? 282 LEU A C     1 
ATOM   1292  O O     . LEU A  1 282 ? 162.798 94.550  124.794 1.00 26.31  ? 282 LEU A O     1 
ATOM   1293  C CB    . LEU A  1 282 ? 163.575 92.311  122.937 1.00 23.47  ? 282 LEU A CB    1 
ATOM   1294  C CG    . LEU A  1 282 ? 163.944 90.844  122.984 1.00 23.11  ? 282 LEU A CG    1 
ATOM   1295  C CD1   . LEU A  1 282 ? 165.343 90.713  122.434 1.00 21.85  ? 282 LEU A CD1   1 
ATOM   1296  C CD2   . LEU A  1 282 ? 163.875 90.323  124.438 1.00 24.58  ? 282 LEU A CD2   1 
ATOM   1297  N N     . LEU A  1 283 ? 161.711 95.002  122.876 1.00 20.10  ? 283 LEU A N     1 
ATOM   1298  C CA    . LEU A  1 283 ? 161.739 96.448  123.042 1.00 18.19  ? 283 LEU A CA    1 
ATOM   1299  C C     . LEU A  1 283 ? 161.328 96.906  124.403 1.00 17.71  ? 283 LEU A C     1 
ATOM   1300  O O     . LEU A  1 283 ? 162.129 97.451  125.157 1.00 17.15  ? 283 LEU A O     1 
ATOM   1301  C CB    . LEU A  1 283 ? 160.893 97.097  121.976 1.00 16.97  ? 283 LEU A CB    1 
ATOM   1302  C CG    . LEU A  1 283 ? 161.816 97.166  120.759 1.00 17.89  ? 283 LEU A CG    1 
ATOM   1303  C CD1   . LEU A  1 283 ? 161.086 97.585  119.540 1.00 20.44  ? 283 LEU A CD1   1 
ATOM   1304  C CD2   . LEU A  1 283 ? 162.923 98.157  121.028 1.00 17.40  ? 283 LEU A CD2   1 
ATOM   1305  N N     . PRO A  1 284 ? 160.081 96.656  124.766 1.00 29.51  ? 284 PRO A N     1 
ATOM   1306  C CA    . PRO A  1 284 ? 159.578 97.057  126.083 1.00 29.76  ? 284 PRO A CA    1 
ATOM   1307  C C     . PRO A  1 284 ? 160.557 96.818  127.247 1.00 28.41  ? 284 PRO A C     1 
ATOM   1308  O O     . PRO A  1 284 ? 160.575 97.575  128.201 1.00 30.27  ? 284 PRO A O     1 
ATOM   1309  C CB    . PRO A  1 284 ? 158.311 96.232  126.228 1.00 58.30  ? 284 PRO A CB    1 
ATOM   1310  C CG    . PRO A  1 284 ? 157.855 96.085  124.801 1.00 59.12  ? 284 PRO A CG    1 
ATOM   1311  C CD    . PRO A  1 284 ? 159.121 95.799  124.058 1.00 57.27  ? 284 PRO A CD    1 
ATOM   1312  N N     . LEU A  1 285 ? 161.355 95.762  127.178 1.00 2.16   ? 285 LEU A N     1 
ATOM   1313  C CA    . LEU A  1 285 ? 162.309 95.467  128.232 1.00 1.81   ? 285 LEU A CA    1 
ATOM   1314  C C     . LEU A  1 285 ? 163.404 96.453  128.118 1.00 3.40   ? 285 LEU A C     1 
ATOM   1315  O O     . LEU A  1 285 ? 163.659 97.230  129.024 1.00 4.85   ? 285 LEU A O     1 
ATOM   1316  C CB    . LEU A  1 285 ? 162.919 94.094  128.061 1.00 9.10   ? 285 LEU A CB    1 
ATOM   1317  C CG    . LEU A  1 285 ? 162.209 92.948  128.755 1.00 7.21   ? 285 LEU A CG    1 
ATOM   1318  C CD1   . LEU A  1 285 ? 160.727 92.957  128.447 1.00 9.67   ? 285 LEU A CD1   1 
ATOM   1319  C CD2   . LEU A  1 285 ? 162.850 91.652  128.293 1.00 7.01   ? 285 LEU A CD2   1 
ATOM   1320  N N     . VAL A  1 286 ? 164.064 96.398  126.976 1.00 25.49  ? 286 VAL A N     1 
ATOM   1321  C CA    . VAL A  1 286 ? 165.171 97.272  126.658 1.00 28.25  ? 286 VAL A CA    1 
ATOM   1322  C C     . VAL A  1 286 ? 164.781 98.724  126.842 1.00 31.41  ? 286 VAL A C     1 
ATOM   1323  O O     . VAL A  1 286 ? 165.447 99.450  127.587 1.00 30.98  ? 286 VAL A O     1 
ATOM   1324  C CB    . VAL A  1 286 ? 165.602 97.024  125.222 1.00 20.22  ? 286 VAL A CB    1 
ATOM   1325  C CG1   . VAL A  1 286 ? 166.192 98.257  124.646 1.00 20.57  ? 286 VAL A CG1   1 
ATOM   1326  C CG2   . VAL A  1 286 ? 166.608 95.880  125.193 1.00 18.41  ? 286 VAL A CG2   1 
ATOM   1327  N N     . GLU A  1 287 ? 163.681 99.102  126.177 1.00 31.17  ? 287 GLU A N     1 
ATOM   1328  C CA    . GLU A  1 287 ? 163.104 100.449 126.168 1.00 33.82  ? 287 GLU A CA    1 
ATOM   1329  C C     . GLU A  1 287 ? 162.577 100.912 127.504 1.00 34.75  ? 287 GLU A C     1 
ATOM   1330  O O     . GLU A  1 287 ? 162.428 102.113 127.719 1.00 36.73  ? 287 GLU A O     1 
ATOM   1331  C CB    . GLU A  1 287 ? 161.969 100.533 125.158 1.00 61.09  ? 287 GLU A CB    1 
ATOM   1332  C CG    . GLU A  1 287 ? 162.198 101.542 124.040 1.00 69.31  ? 287 GLU A CG    1 
ATOM   1333  C CD    . GLU A  1 287 ? 161.005 101.635 123.064 1.00 74.49  ? 287 GLU A CD    1 
ATOM   1334  O OE1   . GLU A  1 287 ? 159.887 102.030 123.501 1.00 76.80  ? 287 GLU A OE1   1 
ATOM   1335  O OE2   . GLU A  1 287 ? 161.187 101.316 121.859 1.00 76.38  ? 287 GLU A OE2   1 
ATOM   1336  N N     . GLY A  1 288 ? 162.273 99.970  128.395 1.00 16.18  ? 288 GLY A N     1 
ATOM   1337  C CA    . GLY A  1 288 ? 161.783 100.329 129.721 1.00 15.55  ? 288 GLY A CA    1 
ATOM   1338  C C     . GLY A  1 288 ? 160.300 100.140 129.955 1.00 16.11  ? 288 GLY A C     1 
ATOM   1339  O O     . GLY A  1 288 ? 159.451 100.824 129.381 1.00 14.89  ? 288 GLY A O     1 
ATOM   1340  N N     . SER A  1 289 ? 159.971 99.199  130.817 1.00 32.55  ? 289 SER A N     1 
ATOM   1341  C CA    . SER A  1 289 ? 158.580 98.955  131.103 1.00 35.73  ? 289 SER A CA    1 
ATOM   1342  C C     . SER A  1 289 ? 158.576 98.222  132.411 1.00 37.59  ? 289 SER A C     1 
ATOM   1343  O O     . SER A  1 289 ? 159.607 98.145  133.078 1.00 38.50  ? 289 SER A O     1 
ATOM   1344  C CB    . SER A  1 289 ? 157.989 98.079  130.013 1.00 57.42  ? 289 SER A CB    1 
ATOM   1345  O OG    . SER A  1 289 ? 158.728 96.877  129.915 1.00 56.95  ? 289 SER A OG    1 
ATOM   1346  N N     . THR A  1 290 ? 157.424 97.669  132.763 1.00 50.81  ? 290 THR A N     1 
ATOM   1347  C CA    . THR A  1 290 ? 157.281 96.909  133.994 1.00 52.73  ? 290 THR A CA    1 
ATOM   1348  C C     . THR A  1 290 ? 156.760 95.494  133.745 1.00 54.30  ? 290 THR A C     1 
ATOM   1349  O O     . THR A  1 290 ? 155.939 95.272  132.859 1.00 54.81  ? 290 THR A O     1 
ATOM   1350  C CB    . THR A  1 290 ? 156.319 97.593  134.892 1.00 55.01  ? 290 THR A CB    1 
ATOM   1351  O OG1   . THR A  1 290 ? 156.520 99.003  134.776 1.00 54.82  ? 290 THR A OG1   1 
ATOM   1352  C CG2   . THR A  1 290 ? 156.529 97.128  136.318 1.00 55.13  ? 290 THR A CG2   1 
ATOM   1353  N N     . VAL A  1 291 ? 157.247 94.530  134.514 1.00 49.26  ? 291 VAL A N     1 
ATOM   1354  C CA    . VAL A  1 291 ? 156.783 93.155  134.357 1.00 51.33  ? 291 VAL A CA    1 
ATOM   1355  C C     . VAL A  1 291 ? 156.583 92.589  135.751 1.00 52.73  ? 291 VAL A C     1 
ATOM   1356  O O     . VAL A  1 291 ? 157.394 92.843  136.664 1.00 51.18  ? 291 VAL A O     1 
ATOM   1357  C CB    . VAL A  1 291 ? 157.780 92.250  133.588 1.00 77.92  ? 291 VAL A CB    1 
ATOM   1358  C CG1   . VAL A  1 291 ? 158.328 92.978  132.364 1.00 78.06  ? 291 VAL A CG1   1 
ATOM   1359  C CG2   . VAL A  1 291 ? 158.889 91.785  134.517 1.00 77.21  ? 291 VAL A CG2   1 
ATOM   1360  N N     . SER A  1 292 ? 155.501 91.825  135.904 1.00 54.22  ? 292 SER A N     1 
ATOM   1361  C CA    . SER A  1 292 ? 155.148 91.263  137.196 1.00 56.04  ? 292 SER A CA    1 
ATOM   1362  C C     . SER A  1 292 ? 155.870 89.994  137.523 1.00 57.05  ? 292 SER A C     1 
ATOM   1363  O O     . SER A  1 292 ? 155.828 89.043  136.752 1.00 57.31  ? 292 SER A O     1 
ATOM   1364  C CB    . SER A  1 292 ? 153.649 91.006  137.287 1.00 95.77  ? 292 SER A CB    1 
ATOM   1365  O OG    . SER A  1 292 ? 153.342 90.355  138.508 1.00 97.43  ? 292 SER A OG    1 
ATOM   1366  N N     . THR A  1 293 ? 156.516 89.992  138.686 1.00 38.38  ? 293 THR A N     1 
ATOM   1367  C CA    . THR A  1 293 ? 157.274 88.849  139.180 1.00 38.57  ? 293 THR A CA    1 
ATOM   1368  C C     . THR A  1 293 ? 156.581 88.347  140.419 1.00 39.01  ? 293 THR A C     1 
ATOM   1369  O O     . THR A  1 293 ? 155.786 89.057  141.026 1.00 39.01  ? 293 THR A O     1 
ATOM   1370  C CB    . THR A  1 293 ? 158.689 89.261  139.594 1.00 34.83  ? 293 THR A CB    1 
ATOM   1371  O OG1   . THR A  1 293 ? 158.594 90.332  140.536 1.00 35.23  ? 293 THR A OG1   1 
ATOM   1372  C CG2   . THR A  1 293 ? 159.497 89.743  138.404 1.00 35.50  ? 293 THR A CG2   1 
ATOM   1373  N N     . LYS A  1 294 ? 156.896 87.129  140.817 1.00 83.75  ? 294 LYS A N     1 
ATOM   1374  C CA    . LYS A  1 294 ? 156.281 86.590  142.011 1.00 84.75  ? 294 LYS A CA    1 
ATOM   1375  C C     . LYS A  1 294 ? 156.863 87.248  143.257 1.00 84.82  ? 294 LYS A C     1 
ATOM   1376  O O     . LYS A  1 294 ? 156.736 86.732  144.360 1.00 85.16  ? 294 LYS A O     1 
ATOM   1377  C CB    . LYS A  1 294 ? 156.491 85.084  142.084 1.00 93.41  ? 294 LYS A CB    1 
ATOM   1378  C CG    . LYS A  1 294 ? 157.920 84.641  142.327 1.00 94.67  ? 294 LYS A CG    1 
ATOM   1379  C CD    . LYS A  1 294 ? 157.943 83.125  142.444 1.00 96.10  ? 294 LYS A CD    1 
ATOM   1380  C CE    . LYS A  1 294 ? 159.328 82.572  142.731 1.00 97.93  ? 294 LYS A CE    1 
ATOM   1381  N NZ    . LYS A  1 294 ? 159.301 81.077  142.836 1.00 99.16  ? 294 LYS A NZ    1 
ATOM   1382  N N     . HIS A  1 295 ? 157.513 88.387  143.079 1.00 57.62  ? 295 HIS A N     1 
ATOM   1383  C CA    . HIS A  1 295 ? 158.085 89.100  144.206 1.00 58.02  ? 295 HIS A CA    1 
ATOM   1384  C C     . HIS A  1 295 ? 157.599 90.534  144.171 1.00 58.11  ? 295 HIS A C     1 
ATOM   1385  O O     . HIS A  1 295 ? 157.851 91.313  145.097 1.00 57.88  ? 295 HIS A O     1 
ATOM   1386  C CB    . HIS A  1 295 ? 159.595 89.063  144.123 1.00 90.05  ? 295 HIS A CB    1 
ATOM   1387  C CG    . HIS A  1 295 ? 160.152 87.682  144.197 1.00 92.20  ? 295 HIS A CG    1 
ATOM   1388  N ND1   . HIS A  1 295 ? 160.112 86.932  145.350 1.00 93.58  ? 295 HIS A ND1   1 
ATOM   1389  C CD2   . HIS A  1 295 ? 160.746 86.907  143.260 1.00 93.29  ? 295 HIS A CD2   1 
ATOM   1390  C CE1   . HIS A  1 295 ? 160.663 85.753  145.122 1.00 94.16  ? 295 HIS A CE1   1 
ATOM   1391  N NE2   . HIS A  1 295 ? 161.055 85.711  143.861 1.00 94.19  ? 295 HIS A NE2   1 
ATOM   1392  N N     . GLY A  1 296 ? 156.893 90.870  143.093 1.00 55.72  ? 296 GLY A N     1 
ATOM   1393  C CA    . GLY A  1 296 ? 156.373 92.215  142.930 1.00 54.99  ? 296 GLY A CA    1 
ATOM   1394  C C     . GLY A  1 296 ? 156.616 92.778  141.544 1.00 53.83  ? 296 GLY A C     1 
ATOM   1395  O O     . GLY A  1 296 ? 156.943 92.052  140.609 1.00 53.04  ? 296 GLY A O     1 
ATOM   1396  N N     . MET A  1 297 ? 156.460 94.086  141.415 1.00 80.35  ? 297 MET A N     1 
ATOM   1397  C CA    . MET A  1 297 ? 156.655 94.737  140.136 1.00 79.78  ? 297 MET A CA    1 
ATOM   1398  C C     . MET A  1 297 ? 158.086 95.223  139.994 1.00 78.44  ? 297 MET A C     1 
ATOM   1399  O O     . MET A  1 297 ? 158.596 95.910  140.884 1.00 79.36  ? 297 MET A O     1 
ATOM   1400  C CB    . MET A  1 297 ? 155.710 95.929  140.018 1.00 82.62  ? 297 MET A CB    1 
ATOM   1401  C CG    . MET A  1 297 ? 154.255 95.586  140.190 1.00 85.90  ? 297 MET A CG    1 
ATOM   1402  S SD    . MET A  1 297 ? 153.674 94.443  138.932 1.00 90.00  ? 297 MET A SD    1 
ATOM   1403  C CE    . MET A  1 297 ? 153.455 95.540  137.546 1.00 89.42  ? 297 MET A CE    1 
ATOM   1404  N N     . VAL A  1 298 ? 158.742 94.866  138.889 1.00 67.25  ? 298 VAL A N     1 
ATOM   1405  C CA    . VAL A  1 298 ? 160.112 95.333  138.654 1.00 63.76  ? 298 VAL A CA    1 
ATOM   1406  C C     . VAL A  1 298 ? 160.119 96.154  137.380 1.00 62.01  ? 298 VAL A C     1 
ATOM   1407  O O     . VAL A  1 298 ? 159.263 95.958  136.520 1.00 61.97  ? 298 VAL A O     1 
ATOM   1408  C CB    . VAL A  1 298 ? 161.121 94.181  138.506 1.00 37.52  ? 298 VAL A CB    1 
ATOM   1409  C CG1   . VAL A  1 298 ? 161.079 93.286  139.744 1.00 36.74  ? 298 VAL A CG1   1 
ATOM   1410  C CG2   . VAL A  1 298 ? 160.828 93.404  137.262 1.00 37.24  ? 298 VAL A CG2   1 
ATOM   1411  N N     . LYS A  1 299 ? 161.074 97.073  137.265 1.00 33.37  ? 299 LYS A N     1 
ATOM   1412  C CA    . LYS A  1 299 ? 161.155 97.939  136.103 1.00 31.94  ? 299 LYS A CA    1 
ATOM   1413  C C     . LYS A  1 299 ? 162.459 97.751  135.338 1.00 30.46  ? 299 LYS A C     1 
ATOM   1414  O O     . LYS A  1 299 ? 163.563 97.876  135.879 1.00 30.69  ? 299 LYS A O     1 
ATOM   1415  C CB    . LYS A  1 299 ? 161.001 99.405  136.518 1.00 84.02  ? 299 LYS A CB    1 
ATOM   1416  C CG    . LYS A  1 299 ? 159.941 99.646  137.587 1.00 87.75  ? 299 LYS A CG    1 
ATOM   1417  C CD    . LYS A  1 299 ? 159.483 101.105 137.638 1.00 92.36  ? 299 LYS A CD    1 
ATOM   1418  C CE    . LYS A  1 299 ? 160.612 102.089 137.963 1.00 94.34  ? 299 LYS A CE    1 
ATOM   1419  N NZ    . LYS A  1 299 ? 160.154 103.519 137.870 1.00 97.02  ? 299 LYS A NZ    1 
ATOM   1420  N N     . THR A  1 300 ? 162.296 97.460  134.055 1.00 27.13  ? 300 THR A N     1 
ATOM   1421  C CA    . THR A  1 300 ? 163.378 97.220  133.108 1.00 24.78  ? 300 THR A CA    1 
ATOM   1422  C C     . THR A  1 300 ? 164.035 98.531  132.717 1.00 25.35  ? 300 THR A C     1 
ATOM   1423  O O     . THR A  1 300 ? 165.024 98.556  131.992 1.00 24.28  ? 300 THR A O     1 
ATOM   1424  C CB    . THR A  1 300 ? 162.797 96.655  131.851 1.00 12.80  ? 300 THR A CB    1 
ATOM   1425  O OG1   . THR A  1 300 ? 161.815 97.595  131.376 1.00 11.42  ? 300 THR A OG1   1 
ATOM   1426  C CG2   . THR A  1 300 ? 162.123 95.275  132.114 1.00 11.80  ? 300 THR A CG2   1 
ATOM   1427  N N     . ASP A  1 301 ? 163.449 99.630  133.170 1.00 54.63  ? 301 ASP A N     1 
ATOM   1428  C CA    . ASP A  1 301 ? 163.975 100.955 132.848 1.00 54.24  ? 301 ASP A CA    1 
ATOM   1429  C C     . ASP A  1 301 ? 165.479 101.074 132.996 1.00 51.46  ? 301 ASP A C     1 
ATOM   1430  O O     . ASP A  1 301 ? 166.141 101.648 132.140 1.00 49.40  ? 301 ASP A O     1 
ATOM   1431  C CB    . ASP A  1 301 ? 163.324 102.033 133.723 1.00 142.62 ? 301 ASP A CB    1 
ATOM   1432  C CG    . ASP A  1 301 ? 162.013 102.540 133.158 1.00 146.64 ? 301 ASP A CG    1 
ATOM   1433  O OD1   . ASP A  1 301 ? 161.011 101.794 133.214 1.00 148.16 ? 301 ASP A OD1   1 
ATOM   1434  O OD2   . ASP A  1 301 ? 161.991 103.686 132.654 1.00 147.90 ? 301 ASP A OD2   1 
ATOM   1435  N N     . HIS A  1 302 ? 166.010 100.512 134.078 1.00 64.08  ? 302 HIS A N     1 
ATOM   1436  C CA    . HIS A  1 302 ? 167.428 100.622 134.355 1.00 61.85  ? 302 HIS A CA    1 
ATOM   1437  C C     . HIS A  1 302 ? 168.341 99.407  134.216 1.00 59.59  ? 302 HIS A C     1 
ATOM   1438  O O     . HIS A  1 302 ? 169.556 99.521  134.384 1.00 59.22  ? 302 HIS A O     1 
ATOM   1439  C CB    . HIS A  1 302 ? 167.594 101.241 135.731 1.00 57.88  ? 302 HIS A CB    1 
ATOM   1440  C CG    . HIS A  1 302 ? 167.247 102.695 135.767 1.00 60.07  ? 302 HIS A CG    1 
ATOM   1441  N ND1   . HIS A  1 302 ? 167.782 103.606 134.878 1.00 60.14  ? 302 HIS A ND1   1 
ATOM   1442  C CD2   . HIS A  1 302 ? 166.438 103.401 136.591 1.00 60.34  ? 302 HIS A CD2   1 
ATOM   1443  C CE1   . HIS A  1 302 ? 167.319 104.810 135.154 1.00 60.81  ? 302 HIS A CE1   1 
ATOM   1444  N NE2   . HIS A  1 302 ? 166.501 104.713 136.188 1.00 61.91  ? 302 HIS A NE2   1 
ATOM   1445  N N     . ILE A  1 303 ? 167.769 98.250  133.910 1.00 32.08  ? 303 ILE A N     1 
ATOM   1446  C CA    . ILE A  1 303 ? 168.540 97.019  133.715 1.00 26.42  ? 303 ILE A CA    1 
ATOM   1447  C C     . ILE A  1 303 ? 169.630 97.293  132.695 1.00 23.38  ? 303 ILE A C     1 
ATOM   1448  O O     . ILE A  1 303 ? 169.405 98.039  131.767 1.00 24.13  ? 303 ILE A O     1 
ATOM   1449  C CB    . ILE A  1 303 ? 167.629 95.937  133.130 1.00 39.22  ? 303 ILE A CB    1 
ATOM   1450  C CG1   . ILE A  1 303 ? 166.494 95.619  134.114 1.00 40.12  ? 303 ILE A CG1   1 
ATOM   1451  C CG2   . ILE A  1 303 ? 168.441 94.761  132.681 1.00 37.75  ? 303 ILE A CG2   1 
ATOM   1452  C CD1   . ILE A  1 303 ? 166.945 95.297  135.527 1.00 40.97  ? 303 ILE A CD1   1 
ATOM   1453  N N     . LEU A  1 304 ? 170.815 96.732  132.845 1.00 23.96  ? 304 LEU A N     1 
ATOM   1454  C CA    . LEU A  1 304 ? 171.813 96.969  131.811 1.00 21.61  ? 304 LEU A CA    1 
ATOM   1455  C C     . LEU A  1 304 ? 171.718 95.818  130.823 1.00 22.05  ? 304 LEU A C     1 
ATOM   1456  O O     . LEU A  1 304 ? 171.797 94.667  131.242 1.00 22.40  ? 304 LEU A O     1 
ATOM   1457  C CB    . LEU A  1 304 ? 173.216 96.987  132.388 1.00 1.00   ? 304 LEU A CB    1 
ATOM   1458  C CG    . LEU A  1 304 ? 174.297 96.846  131.302 1.00 1.00   ? 304 LEU A CG    1 
ATOM   1459  C CD1   . LEU A  1 304 ? 174.032 97.852  130.159 1.00 1.00   ? 304 LEU A CD1   1 
ATOM   1460  C CD2   . LEU A  1 304 ? 175.684 97.025  131.911 1.00 1.00   ? 304 LEU A CD2   1 
ATOM   1461  N N     . PHE A  1 305 ? 171.561 96.102  129.529 1.00 5.70   ? 305 PHE A N     1 
ATOM   1462  C CA    . PHE A  1 305 ? 171.470 95.030  128.549 1.00 2.75   ? 305 PHE A CA    1 
ATOM   1463  C C     . PHE A  1 305 ? 172.727 94.803  127.718 1.00 2.52   ? 305 PHE A C     1 
ATOM   1464  O O     . PHE A  1 305 ? 173.306 95.735  127.176 1.00 3.75   ? 305 PHE A O     1 
ATOM   1465  C CB    . PHE A  1 305 ? 170.318 95.279  127.611 1.00 15.24  ? 305 PHE A CB    1 
ATOM   1466  C CG    . PHE A  1 305 ? 169.013 95.096  128.242 1.00 16.99  ? 305 PHE A CG    1 
ATOM   1467  C CD1   . PHE A  1 305 ? 168.406 96.132  128.897 1.00 18.62  ? 305 PHE A CD1   1 
ATOM   1468  C CD2   . PHE A  1 305 ? 168.406 93.863  128.241 1.00 19.68  ? 305 PHE A CD2   1 
ATOM   1469  C CE1   . PHE A  1 305 ? 167.213 95.944  129.546 1.00 20.00  ? 305 PHE A CE1   1 
ATOM   1470  C CE2   . PHE A  1 305 ? 167.204 93.662  128.893 1.00 19.80  ? 305 PHE A CE2   1 
ATOM   1471  C CZ    . PHE A  1 305 ? 166.608 94.703  129.547 1.00 19.61  ? 305 PHE A CZ    1 
ATOM   1472  N N     . ILE A  1 306 ? 173.174 93.559  127.620 1.00 3.86   ? 306 ILE A N     1 
ATOM   1473  C CA    . ILE A  1 306 ? 174.328 93.276  126.795 1.00 2.70   ? 306 ILE A CA    1 
ATOM   1474  C C     . ILE A  1 306 ? 173.868 92.228  125.799 1.00 2.81   ? 306 ILE A C     1 
ATOM   1475  O O     . ILE A  1 306 ? 173.437 91.144  126.193 1.00 3.18   ? 306 ILE A O     1 
ATOM   1476  C CB    . ILE A  1 306 ? 175.479 92.720  127.612 1.00 1.00   ? 306 ILE A CB    1 
ATOM   1477  C CG1   . ILE A  1 306 ? 176.014 93.782  128.553 1.00 1.00   ? 306 ILE A CG1   1 
ATOM   1478  C CG2   . ILE A  1 306 ? 176.602 92.328  126.706 1.00 1.00   ? 306 ILE A CG2   1 
ATOM   1479  C CD1   . ILE A  1 306 ? 177.026 93.248  129.524 1.00 1.00   ? 306 ILE A CD1   1 
ATOM   1480  N N     . ALA A  1 307 ? 173.914 92.569  124.517 1.00 7.63   ? 307 ALA A N     1 
ATOM   1481  C CA    . ALA A  1 307 ? 173.516 91.637  123.470 1.00 6.92   ? 307 ALA A CA    1 
ATOM   1482  C C     . ALA A  1 307 ? 174.762 91.215  122.689 1.00 7.77   ? 307 ALA A C     1 
ATOM   1483  O O     . ALA A  1 307 ? 175.649 92.021  122.437 1.00 7.26   ? 307 ALA A O     1 
ATOM   1484  C CB    . ALA A  1 307 ? 172.524 92.284  122.538 1.00 2.36   ? 307 ALA A CB    1 
ATOM   1485  N N     . SER A  1 308 ? 174.837 89.947  122.302 1.00 19.19  ? 308 SER A N     1 
ATOM   1486  C CA    . SER A  1 308 ? 176.001 89.476  121.564 1.00 19.73  ? 308 SER A CA    1 
ATOM   1487  C C     . SER A  1 308 ? 175.569 88.793  120.295 1.00 20.80  ? 308 SER A C     1 
ATOM   1488  O O     . SER A  1 308 ? 174.437 88.340  120.188 1.00 21.37  ? 308 SER A O     1 
ATOM   1489  C CB    . SER A  1 308 ? 176.782 88.464  122.383 1.00 14.83  ? 308 SER A CB    1 
ATOM   1490  O OG    . SER A  1 308 ? 176.209 87.181  122.261 1.00 14.80  ? 308 SER A OG    1 
ATOM   1491  N N     . GLY A  1 309 ? 176.484 88.701  119.346 1.00 20.58  ? 309 GLY A N     1 
ATOM   1492  C CA    . GLY A  1 309 ? 176.177 88.043  118.105 1.00 21.66  ? 309 GLY A CA    1 
ATOM   1493  C C     . GLY A  1 309 ? 177.387 88.057  117.213 1.00 24.23  ? 309 GLY A C     1 
ATOM   1494  O O     . GLY A  1 309 ? 178.196 88.987  117.310 1.00 25.67  ? 309 GLY A O     1 
ATOM   1495  N N     . ALA A  1 310 ? 177.501 87.038  116.352 1.00 2.09   ? 310 ALA A N     1 
ATOM   1496  C CA    . ALA A  1 310 ? 178.610 86.893  115.404 1.00 1.80   ? 310 ALA A CA    1 
ATOM   1497  C C     . ALA A  1 310 ? 178.387 87.817  114.247 1.00 2.72   ? 310 ALA A C     1 
ATOM   1498  O O     . ALA A  1 310 ? 179.289 88.464  113.774 1.00 1.02   ? 310 ALA A O     1 
ATOM   1499  C CB    . ALA A  1 310 ? 178.670 85.492  114.907 1.00 131.91 ? 310 ALA A CB    1 
ATOM   1500  N N     . PHE A  1 311 ? 177.163 87.883  113.781 1.00 29.21  ? 311 PHE A N     1 
ATOM   1501  C CA    . PHE A  1 311 ? 176.891 88.777  112.686 1.00 33.51  ? 311 PHE A CA    1 
ATOM   1502  C C     . PHE A  1 311 ? 177.755 88.476  111.494 1.00 38.42  ? 311 PHE A C     1 
ATOM   1503  O O     . PHE A  1 311 ? 178.452 89.365  111.016 1.00 40.04  ? 311 PHE A O     1 
ATOM   1504  C CB    . PHE A  1 311 ? 177.136 90.208  113.131 1.00 14.06  ? 311 PHE A CB    1 
ATOM   1505  C CG    . PHE A  1 311 ? 176.051 90.745  114.006 1.00 12.14  ? 311 PHE A CG    1 
ATOM   1506  C CD1   . PHE A  1 311 ? 174.844 91.203  113.456 1.00 10.36  ? 311 PHE A CD1   1 
ATOM   1507  C CD2   . PHE A  1 311 ? 176.194 90.742  115.391 1.00 11.62  ? 311 PHE A CD2   1 
ATOM   1508  C CE1   . PHE A  1 311 ? 173.809 91.638  114.270 1.00 8.47   ? 311 PHE A CE1   1 
ATOM   1509  C CE2   . PHE A  1 311 ? 175.139 91.187  116.221 1.00 11.95  ? 311 PHE A CE2   1 
ATOM   1510  C CZ    . PHE A  1 311 ? 173.955 91.630  115.659 1.00 9.15   ? 311 PHE A CZ    1 
ATOM   1511  N N     . GLN A  1 312 ? 177.731 87.232  111.016 1.00 39.24  ? 312 GLN A N     1 
ATOM   1512  C CA    . GLN A  1 312 ? 178.530 86.903  109.845 1.00 42.85  ? 312 GLN A CA    1 
ATOM   1513  C C     . GLN A  1 312 ? 177.695 87.157  108.609 1.00 44.36  ? 312 GLN A C     1 
ATOM   1514  O O     . GLN A  1 312 ? 178.224 87.493  107.560 1.00 44.72  ? 312 GLN A O     1 
ATOM   1515  C CB    . GLN A  1 312 ? 179.034 85.451  109.884 1.00 105.52 ? 312 GLN A CB    1 
ATOM   1516  C CG    . GLN A  1 312 ? 178.217 84.480  110.721 1.00 108.04 ? 312 GLN A CG    1 
ATOM   1517  C CD    . GLN A  1 312 ? 178.911 83.125  110.872 1.00 110.02 ? 312 GLN A CD    1 
ATOM   1518  O OE1   . GLN A  1 312 ? 180.086 83.053  111.246 1.00 110.20 ? 312 GLN A OE1   1 
ATOM   1519  N NE2   . GLN A  1 312 ? 178.183 82.046  110.588 1.00 111.06 ? 312 GLN A NE2   1 
ATOM   1520  N N     . VAL A  1 313 ? 176.384 87.025  108.747 1.00 44.97  ? 313 VAL A N     1 
ATOM   1521  C CA    . VAL A  1 313 ? 175.472 87.261  107.641 1.00 47.53  ? 313 VAL A CA    1 
ATOM   1522  C C     . VAL A  1 313 ? 174.775 88.598  107.749 1.00 48.91  ? 313 VAL A C     1 
ATOM   1523  O O     . VAL A  1 313 ? 174.758 89.360  106.792 1.00 50.37  ? 313 VAL A O     1 
ATOM   1524  C CB    . VAL A  1 313 ? 174.428 86.222  107.601 1.00 66.92  ? 313 VAL A CB    1 
ATOM   1525  C CG1   . VAL A  1 313 ? 174.971 85.038  106.849 1.00 69.18  ? 313 VAL A CG1   1 
ATOM   1526  C CG2   . VAL A  1 313 ? 174.015 85.857  109.047 1.00 68.69  ? 313 VAL A CG2   1 
ATOM   1527  N N     . ALA A  1 314 ? 174.191 88.890  108.905 1.00 44.16  ? 314 ALA A N     1 
ATOM   1528  C CA    . ALA A  1 314 ? 173.517 90.162  109.084 1.00 44.82  ? 314 ALA A CA    1 
ATOM   1529  C C     . ALA A  1 314 ? 174.430 91.185  109.745 1.00 45.46  ? 314 ALA A C     1 
ATOM   1530  O O     . ALA A  1 314 ? 175.368 90.823  110.458 1.00 45.58  ? 314 ALA A O     1 
ATOM   1531  C CB    . ALA A  1 314 ? 172.289 89.974  109.911 1.00 59.06  ? 314 ALA A CB    1 
ATOM   1532  N N     . ARG A  1 315 ? 174.160 92.462  109.479 1.00 27.56  ? 315 ARG A N     1 
ATOM   1533  C CA    . ARG A  1 315 ? 174.917 93.564  110.064 1.00 28.35  ? 315 ARG A CA    1 
ATOM   1534  C C     . ARG A  1 315 ? 174.074 93.945  111.281 1.00 24.76  ? 315 ARG A C     1 
ATOM   1535  O O     . ARG A  1 315 ? 172.907 93.579  111.359 1.00 24.15  ? 315 ARG A O     1 
ATOM   1536  C CB    . ARG A  1 315 ? 175.004 94.731  109.069 1.00 174.62 ? 315 ARG A CB    1 
ATOM   1537  C CG    . ARG A  1 315 ? 175.781 94.410  107.785 1.00 183.52 ? 315 ARG A CG    1 
ATOM   1538  C CD    . ARG A  1 315 ? 174.998 94.749  106.498 1.00 191.73 ? 315 ARG A CD    1 
ATOM   1539  N NE    . ARG A  1 315 ? 173.928 93.788  106.205 1.00 197.89 ? 315 ARG A NE    1 
ATOM   1540  C CZ    . ARG A  1 315 ? 173.195 93.785  105.092 1.00 199.33 ? 315 ARG A CZ    1 
ATOM   1541  N NH1   . ARG A  1 315 ? 173.405 94.693  104.148 1.00 200.00 ? 315 ARG A NH1   1 
ATOM   1542  N NH2   . ARG A  1 315 ? 172.249 92.868  104.920 1.00 198.46 ? 315 ARG A NH2   1 
ATOM   1543  N N     . PRO A  1 316 ? 174.655 94.638  112.263 1.00 17.01  ? 316 PRO A N     1 
ATOM   1544  C CA    . PRO A  1 316 ? 173.818 94.988  113.408 1.00 16.46  ? 316 PRO A CA    1 
ATOM   1545  C C     . PRO A  1 316 ? 172.769 95.985  112.963 1.00 16.16  ? 316 PRO A C     1 
ATOM   1546  O O     . PRO A  1 316 ? 171.642 96.044  113.488 1.00 15.87  ? 316 PRO A O     1 
ATOM   1547  C CB    . PRO A  1 316 ? 174.815 95.580  114.380 1.00 17.93  ? 316 PRO A CB    1 
ATOM   1548  C CG    . PRO A  1 316 ? 176.010 94.788  114.103 1.00 17.86  ? 316 PRO A CG    1 
ATOM   1549  C CD    . PRO A  1 316 ? 176.065 94.836  112.600 1.00 18.04  ? 316 PRO A CD    1 
ATOM   1550  N N     . SER A  1 317 ? 173.177 96.750  111.961 1.00 37.62  ? 317 SER A N     1 
ATOM   1551  C CA    . SER A  1 317 ? 172.368 97.758  111.312 1.00 36.40  ? 317 SER A CA    1 
ATOM   1552  C C     . SER A  1 317 ? 171.242 97.074  110.543 1.00 36.14  ? 317 SER A C     1 
ATOM   1553  O O     . SER A  1 317 ? 170.745 97.608  109.551 1.00 37.15  ? 317 SER A O     1 
ATOM   1554  C CB    . SER A  1 317 ? 173.245 98.474  110.329 1.00 26.17  ? 317 SER A CB    1 
ATOM   1555  O OG    . SER A  1 317 ? 173.812 97.515  109.451 1.00 25.60  ? 317 SER A OG    1 
ATOM   1556  N N     . ASP A  1 318 ? 170.872 95.873  110.984 1.00 30.14  ? 318 ASP A N     1 
ATOM   1557  C CA    . ASP A  1 318 ? 169.820 95.100  110.344 1.00 27.60  ? 318 ASP A CA    1 
ATOM   1558  C C     . ASP A  1 318 ? 168.778 94.852  111.376 1.00 24.30  ? 318 ASP A C     1 
ATOM   1559  O O     . ASP A  1 318 ? 167.772 94.250  111.099 1.00 24.66  ? 318 ASP A O     1 
ATOM   1560  C CB    . ASP A  1 318 ? 170.353 93.764  109.810 1.00 68.33  ? 318 ASP A CB    1 
ATOM   1561  C CG    . ASP A  1 318 ? 170.594 93.785  108.308 1.00 71.58  ? 318 ASP A CG    1 
ATOM   1562  O OD1   . ASP A  1 318 ? 170.749 94.894  107.745 1.00 71.93  ? 318 ASP A OD1   1 
ATOM   1563  O OD2   . ASP A  1 318 ? 170.642 92.694  107.696 1.00 71.61  ? 318 ASP A OD2   1 
ATOM   1564  N N     . LEU A  1 319 ? 169.023 95.295  112.588 1.00 38.85  ? 319 LEU A N     1 
ATOM   1565  C CA    . LEU A  1 319 ? 168.018 95.116  113.608 1.00 36.66  ? 319 LEU A CA    1 
ATOM   1566  C C     . LEU A  1 319 ? 166.989 96.225  113.388 1.00 36.26  ? 319 LEU A C     1 
ATOM   1567  O O     . LEU A  1 319 ? 167.210 97.132  112.566 1.00 37.29  ? 319 LEU A O     1 
ATOM   1568  C CB    . LEU A  1 319 ? 168.652 95.289  114.963 1.00 12.70  ? 319 LEU A CB    1 
ATOM   1569  C CG    . LEU A  1 319 ? 169.809 94.360  115.255 1.00 9.81   ? 319 LEU A CG    1 
ATOM   1570  C CD1   . LEU A  1 319 ? 170.833 95.049  116.150 1.00 8.12   ? 319 LEU A CD1   1 
ATOM   1571  C CD2   . LEU A  1 319 ? 169.233 93.101  115.907 1.00 8.23   ? 319 LEU A CD2   1 
ATOM   1572  N N     . ILE A  1 320 ? 165.870 96.156  114.107 1.00 17.64  ? 320 ILE A N     1 
ATOM   1573  C CA    . ILE A  1 320 ? 164.840 97.183  113.995 1.00 15.82  ? 320 ILE A CA    1 
ATOM   1574  C C     . ILE A  1 320 ? 165.413 98.452  114.619 1.00 17.05  ? 320 ILE A C     1 
ATOM   1575  O O     . ILE A  1 320 ? 166.046 98.408  115.699 1.00 17.76  ? 320 ILE A O     1 
ATOM   1576  C CB    . ILE A  1 320 ? 163.584 96.784  114.738 1.00 13.94  ? 320 ILE A CB    1 
ATOM   1577  C CG1   . ILE A  1 320 ? 163.915 96.486  116.205 1.00 13.57  ? 320 ILE A CG1   1 
ATOM   1578  C CG2   . ILE A  1 320 ? 162.987 95.588  114.075 1.00 14.46  ? 320 ILE A CG2   1 
ATOM   1579  C CD1   . ILE A  1 320 ? 162.739 96.070  117.064 1.00 12.49  ? 320 ILE A CD1   1 
ATOM   1580  N N     . PRO A  1 321 ? 165.207 99.603  113.941 1.00 6.25   ? 321 PRO A N     1 
ATOM   1581  C CA    . PRO A  1 321 ? 165.699 100.906 114.389 1.00 4.07   ? 321 PRO A CA    1 
ATOM   1582  C C     . PRO A  1 321 ? 165.405 101.143 115.827 1.00 2.89   ? 321 PRO A C     1 
ATOM   1583  O O     . PRO A  1 321 ? 166.250 101.641 116.538 1.00 2.89   ? 321 PRO A O     1 
ATOM   1584  C CB    . PRO A  1 321 ? 164.984 101.871 113.466 1.00 28.94  ? 321 PRO A CB    1 
ATOM   1585  C CG    . PRO A  1 321 ? 164.949 101.119 112.182 1.00 29.24  ? 321 PRO A CG    1 
ATOM   1586  C CD    . PRO A  1 321 ? 164.504 99.736  112.648 1.00 30.29  ? 321 PRO A CD    1 
ATOM   1587  N N     . GLU A  1 322 ? 164.212 100.755 116.258 1.00 5.70   ? 322 GLU A N     1 
ATOM   1588  C CA    . GLU A  1 322 ? 163.829 100.961 117.648 1.00 9.95   ? 322 GLU A CA    1 
ATOM   1589  C C     . GLU A  1 322 ? 164.925 100.403 118.558 1.00 9.55   ? 322 GLU A C     1 
ATOM   1590  O O     . GLU A  1 322 ? 165.393 101.074 119.483 1.00 9.65   ? 322 GLU A O     1 
ATOM   1591  C CB    . GLU A  1 322 ? 162.462 100.318 117.944 1.00 33.02  ? 322 GLU A CB    1 
ATOM   1592  C CG    . GLU A  1 322 ? 161.234 101.079 117.355 1.00 42.29  ? 322 GLU A CG    1 
ATOM   1593  C CD    . GLU A  1 322 ? 161.166 101.103 115.795 1.00 48.21  ? 322 GLU A CD    1 
ATOM   1594  O OE1   . GLU A  1 322 ? 160.163 101.619 115.189 1.00 49.64  ? 322 GLU A OE1   1 
ATOM   1595  O OE2   . GLU A  1 322 ? 162.131 100.600 115.175 1.00 50.19  ? 322 GLU A OE2   1 
ATOM   1596  N N     . LEU A  1 323 ? 165.385 99.203  118.233 1.00 6.61   ? 323 LEU A N     1 
ATOM   1597  C CA    . LEU A  1 323 ? 166.406 98.505  119.012 1.00 6.61   ? 323 LEU A CA    1 
ATOM   1598  C C     . LEU A  1 323 ? 167.825 98.942  118.637 1.00 7.15   ? 323 LEU A C     1 
ATOM   1599  O O     . LEU A  1 323 ? 168.754 99.067  119.468 1.00 6.51   ? 323 LEU A O     1 
ATOM   1600  C CB    . LEU A  1 323 ? 166.238 97.007  118.776 1.00 23.51  ? 323 LEU A CB    1 
ATOM   1601  C CG    . LEU A  1 323 ? 166.955 96.012  119.672 1.00 22.98  ? 323 LEU A CG    1 
ATOM   1602  C CD1   . LEU A  1 323 ? 166.626 96.263  121.132 1.00 21.11  ? 323 LEU A CD1   1 
ATOM   1603  C CD2   . LEU A  1 323 ? 166.506 94.639  119.234 1.00 21.74  ? 323 LEU A CD2   1 
ATOM   1604  N N     . GLN A  1 324 ? 167.983 99.166  117.351 1.00 32.82  ? 324 GLN A N     1 
ATOM   1605  C CA    . GLN A  1 324 ? 169.249 99.591  116.838 1.00 34.20  ? 324 GLN A CA    1 
ATOM   1606  C C     . GLN A  1 324 ? 169.765 100.799 117.593 1.00 33.92  ? 324 GLN A C     1 
ATOM   1607  O O     . GLN A  1 324 ? 170.957 101.014 117.641 1.00 33.97  ? 324 GLN A O     1 
ATOM   1608  C CB    . GLN A  1 324 ? 169.083 99.913  115.377 1.00 36.65  ? 324 GLN A CB    1 
ATOM   1609  C CG    . GLN A  1 324 ? 170.303 100.422 114.750 1.00 40.12  ? 324 GLN A CG    1 
ATOM   1610  C CD    . GLN A  1 324 ? 170.226 100.266 113.271 1.00 42.59  ? 324 GLN A CD    1 
ATOM   1611  O OE1   . GLN A  1 324 ? 171.039 100.825 112.525 1.00 45.76  ? 324 GLN A OE1   1 
ATOM   1612  N NE2   . GLN A  1 324 ? 169.243 99.490  112.818 1.00 41.57  ? 324 GLN A NE2   1 
ATOM   1613  N N     . GLY A  1 325 ? 168.866 101.574 118.194 1.00 29.26  ? 325 GLY A N     1 
ATOM   1614  C CA    . GLY A  1 325 ? 169.274 102.768 118.909 1.00 29.93  ? 325 GLY A CA    1 
ATOM   1615  C C     . GLY A  1 325 ? 169.353 102.615 120.411 1.00 30.85  ? 325 GLY A C     1 
ATOM   1616  O O     . GLY A  1 325 ? 169.914 103.451 121.129 1.00 31.34  ? 325 GLY A O     1 
ATOM   1617  N N     . ARG A  1 326 ? 168.777 101.543 120.909 1.00 19.68  ? 326 ARG A N     1 
ATOM   1618  C CA    . ARG A  1 326 ? 168.832 101.310 122.332 1.00 20.44  ? 326 ARG A CA    1 
ATOM   1619  C C     . ARG A  1 326 ? 170.053 100.431 122.634 1.00 18.11  ? 326 ARG A C     1 
ATOM   1620  O O     . ARG A  1 326 ? 170.276 100.000 123.773 1.00 17.03  ? 326 ARG A O     1 
ATOM   1621  C CB    . ARG A  1 326 ? 167.521 100.679 122.776 1.00 68.88  ? 326 ARG A CB    1 
ATOM   1622  C CG    . ARG A  1 326 ? 166.342 101.656 122.699 1.00 75.30  ? 326 ARG A CG    1 
ATOM   1623  C CD    . ARG A  1 326 ? 165.993 102.175 124.085 1.00 81.70  ? 326 ARG A CD    1 
ATOM   1624  N NE    . ARG A  1 326 ? 167.182 102.191 124.941 1.00 88.12  ? 326 ARG A NE    1 
ATOM   1625  C CZ    . ARG A  1 326 ? 167.182 102.472 126.243 1.00 91.00  ? 326 ARG A CZ    1 
ATOM   1626  N NH1   . ARG A  1 326 ? 166.048 102.772 126.872 1.00 92.23  ? 326 ARG A NH1   1 
ATOM   1627  N NH2   . ARG A  1 326 ? 168.324 102.439 126.918 1.00 91.43  ? 326 ARG A NH2   1 
ATOM   1628  N N     . LEU A  1 327 ? 170.838 100.186 121.584 1.00 25.03  ? 327 LEU A N     1 
ATOM   1629  C CA    . LEU A  1 327 ? 172.087 99.422  121.653 1.00 24.68  ? 327 LEU A CA    1 
ATOM   1630  C C     . LEU A  1 327 ? 173.151 100.375 121.088 1.00 24.77  ? 327 LEU A C     1 
ATOM   1631  O O     . LEU A  1 327 ? 173.710 100.169 120.001 1.00 25.03  ? 327 LEU A O     1 
ATOM   1632  C CB    . LEU A  1 327 ? 172.007 98.147  120.800 1.00 16.25  ? 327 LEU A CB    1 
ATOM   1633  C CG    . LEU A  1 327 ? 171.111 97.013  121.288 1.00 14.04  ? 327 LEU A CG    1 
ATOM   1634  C CD1   . LEU A  1 327 ? 171.393 95.817  120.451 1.00 12.51  ? 327 LEU A CD1   1 
ATOM   1635  C CD2   . LEU A  1 327 ? 171.389 96.681  122.732 1.00 11.33  ? 327 LEU A CD2   1 
ATOM   1636  N N     . PRO A  1 328 ? 173.447 101.428 121.843 1.00 24.18  ? 328 PRO A N     1 
ATOM   1637  C CA    . PRO A  1 328 ? 174.382 102.513 121.588 1.00 25.51  ? 328 PRO A CA    1 
ATOM   1638  C C     . PRO A  1 328 ? 175.810 102.103 121.391 1.00 27.32  ? 328 PRO A C     1 
ATOM   1639  O O     . PRO A  1 328 ? 176.437 102.452 120.387 1.00 29.86  ? 328 PRO A O     1 
ATOM   1640  C CB    . PRO A  1 328 ? 174.249 103.380 122.826 1.00 15.22  ? 328 PRO A CB    1 
ATOM   1641  C CG    . PRO A  1 328 ? 173.056 102.882 123.507 1.00 15.21  ? 328 PRO A CG    1 
ATOM   1642  C CD    . PRO A  1 328 ? 173.076 101.438 123.253 1.00 14.69  ? 328 PRO A CD    1 
ATOM   1643  N N     . ILE A  1 329 ? 176.331 101.398 122.387 1.00 25.79  ? 329 ILE A N     1 
ATOM   1644  C CA    . ILE A  1 329 ? 177.704 100.930 122.381 1.00 24.43  ? 329 ILE A CA    1 
ATOM   1645  C C     . ILE A  1 329 ? 177.953 99.663  121.548 1.00 23.18  ? 329 ILE A C     1 
ATOM   1646  O O     . ILE A  1 329 ? 177.475 98.585  121.890 1.00 22.63  ? 329 ILE A O     1 
ATOM   1647  C CB    . ILE A  1 329 ? 178.151 100.629 123.815 1.00 28.16  ? 329 ILE A CB    1 
ATOM   1648  C CG1   . ILE A  1 329 ? 178.066 101.890 124.682 1.00 29.15  ? 329 ILE A CG1   1 
ATOM   1649  C CG2   . ILE A  1 329 ? 179.554 100.048 123.795 1.00 28.79  ? 329 ILE A CG2   1 
ATOM   1650  C CD1   . ILE A  1 329 ? 178.683 101.713 126.099 1.00 31.46  ? 329 ILE A CD1   1 
ATOM   1651  N N     . ARG A  1 330 ? 178.672 99.776  120.447 1.00 29.25  ? 330 ARG A N     1 
ATOM   1652  C CA    . ARG A  1 330 ? 178.980 98.571  119.700 1.00 30.38  ? 330 ARG A CA    1 
ATOM   1653  C C     . ARG A  1 330 ? 180.452 98.345  120.054 1.00 29.92  ? 330 ARG A C     1 
ATOM   1654  O O     . ARG A  1 330 ? 181.237 99.300  120.094 1.00 31.59  ? 330 ARG A O     1 
ATOM   1655  C CB    . ARG A  1 330 ? 178.857 98.760  118.183 1.00 35.51  ? 330 ARG A CB    1 
ATOM   1656  C CG    . ARG A  1 330 ? 177.581 99.348  117.682 1.00 37.91  ? 330 ARG A CG    1 
ATOM   1657  C CD    . ARG A  1 330 ? 176.355 98.606  118.132 1.00 41.28  ? 330 ARG A CD    1 
ATOM   1658  N NE    . ARG A  1 330 ? 175.144 99.263  117.627 1.00 45.09  ? 330 ARG A NE    1 
ATOM   1659  C CZ    . ARG A  1 330 ? 174.824 99.367  116.333 1.00 47.20  ? 330 ARG A CZ    1 
ATOM   1660  N NH1   . ARG A  1 330 ? 175.624 98.840  115.391 1.00 46.65  ? 330 ARG A NH1   1 
ATOM   1661  N NH2   . ARG A  1 330 ? 173.719 100.029 115.978 1.00 46.19  ? 330 ARG A NH2   1 
ATOM   1662  N N     . VAL A  1 331 ? 180.835 97.102  120.318 1.00 8.47   ? 331 VAL A N     1 
ATOM   1663  C CA    . VAL A  1 331 ? 182.216 96.807  120.673 1.00 6.37   ? 331 VAL A CA    1 
ATOM   1664  C C     . VAL A  1 331 ? 182.545 95.477  120.016 1.00 7.82   ? 331 VAL A C     1 
ATOM   1665  O O     . VAL A  1 331 ? 181.740 94.557  120.057 1.00 8.92   ? 331 VAL A O     1 
ATOM   1666  C CB    . VAL A  1 331 ? 182.340 96.695  122.173 1.00 2.00   ? 331 VAL A CB    1 
ATOM   1667  C CG1   . VAL A  1 331 ? 181.380 95.671  122.657 1.00 2.00   ? 331 VAL A CG1   1 
ATOM   1668  C CG2   . VAL A  1 331 ? 183.718 96.317  122.560 1.00 2.00   ? 331 VAL A CG2   1 
ATOM   1669  N N     . GLU A  1 332 ? 183.728 95.357  119.429 1.00 18.48  ? 332 GLU A N     1 
ATOM   1670  C CA    . GLU A  1 332 ? 184.077 94.148  118.699 1.00 18.76  ? 332 GLU A CA    1 
ATOM   1671  C C     . GLU A  1 332 ? 185.039 93.205  119.417 1.00 17.60  ? 332 GLU A C     1 
ATOM   1672  O O     . GLU A  1 332 ? 186.006 93.648  120.034 1.00 18.17  ? 332 GLU A O     1 
ATOM   1673  C CB    . GLU A  1 332 ? 184.670 94.595  117.382 1.00 67.14  ? 332 GLU A CB    1 
ATOM   1674  C CG    . GLU A  1 332 ? 184.508 93.649  116.258 1.00 75.03  ? 332 GLU A CG    1 
ATOM   1675  C CD    . GLU A  1 332 ? 184.848 94.311  114.932 1.00 81.14  ? 332 GLU A CD    1 
ATOM   1676  O OE1   . GLU A  1 332 ? 184.162 95.287  114.569 1.00 83.32  ? 332 GLU A OE1   1 
ATOM   1677  O OE2   . GLU A  1 332 ? 185.800 93.869  114.249 1.00 84.96  ? 332 GLU A OE2   1 
ATOM   1678  N N     . LEU A  1 333 ? 184.786 91.897  119.365 1.00 18.43  ? 333 LEU A N     1 
ATOM   1679  C CA    . LEU A  1 333 ? 185.716 90.953  119.988 1.00 15.79  ? 333 LEU A CA    1 
ATOM   1680  C C     . LEU A  1 333 ? 186.380 90.210  118.857 1.00 15.88  ? 333 LEU A C     1 
ATOM   1681  O O     . LEU A  1 333 ? 185.769 90.005  117.787 1.00 15.97  ? 333 LEU A O     1 
ATOM   1682  C CB    . LEU A  1 333 ? 185.027 89.980  120.923 1.00 11.25  ? 333 LEU A CB    1 
ATOM   1683  C CG    . LEU A  1 333 ? 184.574 90.565  122.251 1.00 11.14  ? 333 LEU A CG    1 
ATOM   1684  C CD1   . LEU A  1 333 ? 183.297 91.312  122.015 1.00 12.84  ? 333 LEU A CD1   1 
ATOM   1685  C CD2   . LEU A  1 333 ? 184.324 89.488  123.270 1.00 9.58   ? 333 LEU A CD2   1 
ATOM   1686  N N     . THR A  1 334 ? 187.634 89.826  119.109 1.00 1.00   ? 334 THR A N     1 
ATOM   1687  C CA    . THR A  1 334 ? 188.506 89.161  118.137 1.00 1.00   ? 334 THR A CA    1 
ATOM   1688  C C     . THR A  1 334 ? 188.558 87.671  118.250 1.00 1.00   ? 334 THR A C     1 
ATOM   1689  O O     . THR A  1 334 ? 188.358 87.118  119.334 1.00 1.00   ? 334 THR A O     1 
ATOM   1690  C CB    . THR A  1 334 ? 189.970 89.578  118.293 1.00 11.30  ? 334 THR A CB    1 
ATOM   1691  O OG1   . THR A  1 334 ? 190.368 89.409  119.669 1.00 10.76  ? 334 THR A OG1   1 
ATOM   1692  C CG2   . THR A  1 334 ? 190.193 91.012  117.833 1.00 11.95  ? 334 THR A CG2   1 
ATOM   1693  N N     . ALA A  1 335 ? 188.878 87.039  117.120 1.00 18.45  ? 335 ALA A N     1 
ATOM   1694  C CA    . ALA A  1 335 ? 189.025 85.596  117.049 1.00 20.47  ? 335 ALA A CA    1 
ATOM   1695  C C     . ALA A  1 335 ? 190.189 85.218  117.983 1.00 22.25  ? 335 ALA A C     1 
ATOM   1696  O O     . ALA A  1 335 ? 191.159 85.984  118.167 1.00 20.69  ? 335 ALA A O     1 
ATOM   1697  C CB    . ALA A  1 335 ? 189.334 85.187  115.625 1.00 103.99 ? 335 ALA A CB    1 
ATOM   1698  N N     . LEU A  1 336 ? 190.099 84.034  118.575 1.00 32.67  ? 336 LEU A N     1 
ATOM   1699  C CA    . LEU A  1 336 ? 191.138 83.615  119.485 1.00 33.33  ? 336 LEU A CA    1 
ATOM   1700  C C     . LEU A  1 336 ? 192.253 82.899  118.748 1.00 36.76  ? 336 LEU A C     1 
ATOM   1701  O O     . LEU A  1 336 ? 192.008 81.994  117.956 1.00 39.87  ? 336 LEU A O     1 
ATOM   1702  C CB    . LEU A  1 336 ? 190.521 82.754  120.573 1.00 2.02   ? 336 LEU A CB    1 
ATOM   1703  C CG    . LEU A  1 336 ? 190.484 83.447  121.955 1.00 1.69   ? 336 LEU A CG    1 
ATOM   1704  C CD1   . LEU A  1 336 ? 190.377 84.960  121.783 1.00 1.10   ? 336 LEU A CD1   1 
ATOM   1705  C CD2   . LEU A  1 336 ? 189.319 82.868  122.829 1.00 1.00   ? 336 LEU A CD2   1 
ATOM   1706  N N     . SER A  1 337 ? 193.488 83.324  118.990 1.00 46.24  ? 337 SER A N     1 
ATOM   1707  C CA    . SER A  1 337 ? 194.640 82.729  118.323 1.00 47.94  ? 337 SER A CA    1 
ATOM   1708  C C     . SER A  1 337 ? 195.388 81.649  119.073 1.00 48.45  ? 337 SER A C     1 
ATOM   1709  O O     . SER A  1 337 ? 195.252 81.479  120.290 1.00 49.93  ? 337 SER A O     1 
ATOM   1710  C CB    . SER A  1 337 ? 195.656 83.793  117.958 1.00 82.05  ? 337 SER A CB    1 
ATOM   1711  O OG    . SER A  1 337 ? 196.958 83.228  117.986 1.00 85.68  ? 337 SER A OG    1 
ATOM   1712  N N     . ALA A  1 338 ? 196.213 80.938  118.312 1.00 20.43  ? 338 ALA A N     1 
ATOM   1713  C CA    . ALA A  1 338 ? 197.030 79.863  118.838 1.00 19.08  ? 338 ALA A CA    1 
ATOM   1714  C C     . ALA A  1 338 ? 197.654 80.435  120.082 1.00 18.80  ? 338 ALA A C     1 
ATOM   1715  O O     . ALA A  1 338 ? 197.427 79.953  121.214 1.00 16.75  ? 338 ALA A O     1 
ATOM   1716  C CB    . ALA A  1 338 ? 198.096 79.519  117.829 1.00 68.27  ? 338 ALA A CB    1 
ATOM   1717  N N     . ALA A  1 339 ? 198.413 81.504  119.823 1.00 22.99  ? 339 ALA A N     1 
ATOM   1718  C CA    . ALA A  1 339 ? 199.145 82.269  120.831 1.00 23.36  ? 339 ALA A CA    1 
ATOM   1719  C C     . ALA A  1 339 ? 198.266 82.664  121.987 1.00 22.98  ? 339 ALA A C     1 
ATOM   1720  O O     . ALA A  1 339 ? 198.728 82.736  123.133 1.00 22.44  ? 339 ALA A O     1 
ATOM   1721  C CB    . ALA A  1 339 ? 199.729 83.510  120.206 1.00 99.98  ? 339 ALA A CB    1 
ATOM   1722  N N     . ASP A  1 340 ? 196.999 82.934  121.657 1.00 19.92  ? 340 ASP A N     1 
ATOM   1723  C CA    . ASP A  1 340 ? 196.019 83.339  122.644 1.00 19.65  ? 340 ASP A CA    1 
ATOM   1724  C C     . ASP A  1 340 ? 195.702 82.157  123.513 1.00 17.57  ? 340 ASP A C     1 
ATOM   1725  O O     . ASP A  1 340 ? 195.766 82.253  124.747 1.00 15.90  ? 340 ASP A O     1 
ATOM   1726  C CB    . ASP A  1 340 ? 194.771 83.883  121.959 1.00 61.46  ? 340 ASP A CB    1 
ATOM   1727  C CG    . ASP A  1 340 ? 195.001 85.253  121.365 1.00 65.94  ? 340 ASP A CG    1 
ATOM   1728  O OD1   . ASP A  1 340 ? 195.202 86.211  122.142 1.00 69.02  ? 340 ASP A OD1   1 
ATOM   1729  O OD2   . ASP A  1 340 ? 194.998 85.377  120.123 1.00 68.77  ? 340 ASP A OD2   1 
ATOM   1730  N N     . PHE A  1 341 ? 195.408 81.034  122.862 1.00 22.24  ? 341 PHE A N     1 
ATOM   1731  C CA    . PHE A  1 341 ? 195.082 79.820  123.580 1.00 21.55  ? 341 PHE A CA    1 
ATOM   1732  C C     . PHE A  1 341 ? 196.154 79.513  124.598 1.00 21.89  ? 341 PHE A C     1 
ATOM   1733  O O     . PHE A  1 341 ? 195.846 79.160  125.745 1.00 21.16  ? 341 PHE A O     1 
ATOM   1734  C CB    . PHE A  1 341 ? 194.960 78.658  122.622 1.00 47.40  ? 341 PHE A CB    1 
ATOM   1735  C CG    . PHE A  1 341 ? 193.676 78.630  121.871 1.00 46.45  ? 341 PHE A CG    1 
ATOM   1736  C CD1   . PHE A  1 341 ? 192.558 79.274  122.361 1.00 46.55  ? 341 PHE A CD1   1 
ATOM   1737  C CD2   . PHE A  1 341 ? 193.569 77.918  120.689 1.00 46.80  ? 341 PHE A CD2   1 
ATOM   1738  C CE1   . PHE A  1 341 ? 191.337 79.212  121.681 1.00 46.62  ? 341 PHE A CE1   1 
ATOM   1739  C CE2   . PHE A  1 341 ? 192.366 77.847  120.004 1.00 46.99  ? 341 PHE A CE2   1 
ATOM   1740  C CZ    . PHE A  1 341 ? 191.243 78.498  120.501 1.00 46.74  ? 341 PHE A CZ    1 
ATOM   1741  N N     . GLU A  1 342 ? 197.412 79.651  124.173 1.00 22.90  ? 342 GLU A N     1 
ATOM   1742  C CA    . GLU A  1 342 ? 198.540 79.388  125.053 1.00 23.96  ? 342 GLU A CA    1 
ATOM   1743  C C     . GLU A  1 342 ? 198.368 80.042  126.417 1.00 24.00  ? 342 GLU A C     1 
ATOM   1744  O O     . GLU A  1 342 ? 198.787 79.491  127.437 1.00 23.57  ? 342 GLU A O     1 
ATOM   1745  C CB    . GLU A  1 342 ? 199.831 79.895  124.423 1.00 46.63  ? 342 GLU A CB    1 
ATOM   1746  C CG    . GLU A  1 342 ? 200.264 79.113  123.222 1.00 51.36  ? 342 GLU A CG    1 
ATOM   1747  C CD    . GLU A  1 342 ? 201.564 79.628  122.629 1.00 56.21  ? 342 GLU A CD    1 
ATOM   1748  O OE1   . GLU A  1 342 ? 202.411 80.130  123.428 1.00 58.30  ? 342 GLU A OE1   1 
ATOM   1749  O OE2   . GLU A  1 342 ? 201.735 79.518  121.375 1.00 56.66  ? 342 GLU A OE2   1 
ATOM   1750  N N     . ARG A  1 343 ? 197.732 81.215  126.421 1.00 17.79  ? 343 ARG A N     1 
ATOM   1751  C CA    . ARG A  1 343 ? 197.538 82.017  127.625 1.00 16.45  ? 343 ARG A CA    1 
ATOM   1752  C C     . ARG A  1 343 ? 196.296 81.684  128.421 1.00 16.65  ? 343 ARG A C     1 
ATOM   1753  O O     . ARG A  1 343 ? 196.344 81.624  129.651 1.00 15.46  ? 343 ARG A O     1 
ATOM   1754  C CB    . ARG A  1 343 ? 197.530 83.483  127.230 1.00 25.81  ? 343 ARG A CB    1 
ATOM   1755  C CG    . ARG A  1 343 ? 198.692 83.856  126.362 1.00 26.62  ? 343 ARG A CG    1 
ATOM   1756  C CD    . ARG A  1 343 ? 198.642 85.300  126.017 1.00 30.21  ? 343 ARG A CD    1 
ATOM   1757  N NE    . ARG A  1 343 ? 198.494 86.105  127.218 1.00 33.30  ? 343 ARG A NE    1 
ATOM   1758  C CZ    . ARG A  1 343 ? 198.009 87.343  127.236 1.00 36.15  ? 343 ARG A CZ    1 
ATOM   1759  N NH1   . ARG A  1 343 ? 197.619 87.943  126.105 1.00 38.17  ? 343 ARG A NH1   1 
ATOM   1760  N NH2   . ARG A  1 343 ? 197.886 87.976  128.399 1.00 37.66  ? 343 ARG A NH2   1 
ATOM   1761  N N     . ILE A  1 344 ? 195.180 81.495  127.719 1.00 27.78  ? 344 ILE A N     1 
ATOM   1762  C CA    . ILE A  1 344 ? 193.919 81.155  128.371 1.00 28.25  ? 344 ILE A CA    1 
ATOM   1763  C C     . ILE A  1 344 ? 194.192 79.824  129.019 1.00 27.55  ? 344 ILE A C     1 
ATOM   1764  O O     . ILE A  1 344 ? 193.491 79.405  129.934 1.00 27.22  ? 344 ILE A O     1 
ATOM   1765  C CB    . ILE A  1 344 ? 192.780 80.909  127.369 1.00 29.85  ? 344 ILE A CB    1 
ATOM   1766  C CG1   . ILE A  1 344 ? 193.256 81.188  125.964 1.00 31.59  ? 344 ILE A CG1   1 
ATOM   1767  C CG2   . ILE A  1 344 ? 191.629 81.836  127.633 1.00 28.15  ? 344 ILE A CG2   1 
ATOM   1768  C CD1   . ILE A  1 344 ? 193.253 82.663  125.652 1.00 35.99  ? 344 ILE A CD1   1 
ATOM   1769  N N     . LEU A  1 345 ? 195.226 79.157  128.517 1.00 24.39  ? 345 LEU A N     1 
ATOM   1770  C CA    . LEU A  1 345 ? 195.599 77.833  128.992 1.00 23.56  ? 345 LEU A CA    1 
ATOM   1771  C C     . LEU A  1 345 ? 196.289 77.821  130.348 1.00 25.23  ? 345 LEU A C     1 
ATOM   1772  O O     . LEU A  1 345 ? 196.234 76.828  131.057 1.00 25.51  ? 345 LEU A O     1 
ATOM   1773  C CB    . LEU A  1 345 ? 196.476 77.158  127.935 1.00 6.08   ? 345 LEU A CB    1 
ATOM   1774  C CG    . LEU A  1 345 ? 196.291 75.651  127.774 1.00 3.89   ? 345 LEU A CG    1 
ATOM   1775  C CD1   . LEU A  1 345 ? 194.911 75.236  128.271 1.00 1.59   ? 345 LEU A CD1   1 
ATOM   1776  C CD2   . LEU A  1 345 ? 196.488 75.265  126.297 1.00 2.05   ? 345 LEU A CD2   1 
ATOM   1777  N N     . THR A  1 346 ? 196.909 78.938  130.723 1.00 47.52  ? 346 THR A N     1 
ATOM   1778  C CA    . THR A  1 346 ? 197.629 79.006  131.992 1.00 48.96  ? 346 THR A CA    1 
ATOM   1779  C C     . THR A  1 346 ? 197.509 80.271  132.845 1.00 51.31  ? 346 THR A C     1 
ATOM   1780  O O     . THR A  1 346 ? 197.611 80.190  134.077 1.00 53.25  ? 346 THR A O     1 
ATOM   1781  C CB    . THR A  1 346 ? 199.119 78.749  131.755 1.00 23.98  ? 346 THR A CB    1 
ATOM   1782  O OG1   . THR A  1 346 ? 199.685 79.793  130.962 1.00 20.96  ? 346 THR A OG1   1 
ATOM   1783  C CG2   . THR A  1 346 ? 199.296 77.452  130.994 1.00 25.91  ? 346 THR A CG2   1 
ATOM   1784  N N     . GLU A  1 347 ? 197.293 81.426  132.209 1.00 29.63  ? 347 GLU A N     1 
ATOM   1785  C CA    . GLU A  1 347 ? 197.205 82.683  132.938 1.00 29.73  ? 347 GLU A CA    1 
ATOM   1786  C C     . GLU A  1 347 ? 195.964 82.825  133.827 1.00 29.10  ? 347 GLU A C     1 
ATOM   1787  O O     . GLU A  1 347 ? 196.051 82.870  135.050 1.00 30.57  ? 347 GLU A O     1 
ATOM   1788  C CB    . GLU A  1 347 ? 197.275 83.877  131.967 1.00 36.24  ? 347 GLU A CB    1 
ATOM   1789  C CG    . GLU A  1 347 ? 198.382 83.797  130.909 1.00 39.63  ? 347 GLU A CG    1 
ATOM   1790  C CD    . GLU A  1 347 ? 198.801 85.161  130.321 1.00 41.96  ? 347 GLU A CD    1 
ATOM   1791  O OE1   . GLU A  1 347 ? 199.501 85.150  129.283 1.00 43.18  ? 347 GLU A OE1   1 
ATOM   1792  O OE2   . GLU A  1 347 ? 198.453 86.231  130.886 1.00 42.26  ? 347 GLU A OE2   1 
ATOM   1793  N N     . PRO A  1 348 ? 194.784 82.838  133.218 1.00 1.55   ? 348 PRO A N     1 
ATOM   1794  C CA    . PRO A  1 348 ? 193.491 82.987  133.909 1.00 2.30   ? 348 PRO A CA    1 
ATOM   1795  C C     . PRO A  1 348 ? 193.319 82.318  135.270 1.00 3.99   ? 348 PRO A C     1 
ATOM   1796  O O     . PRO A  1 348 ? 193.579 81.138  135.400 1.00 4.72   ? 348 PRO A O     1 
ATOM   1797  C CB    . PRO A  1 348 ? 192.487 82.419  132.899 1.00 3.31   ? 348 PRO A CB    1 
ATOM   1798  C CG    . PRO A  1 348 ? 193.186 82.562  131.559 1.00 1.53   ? 348 PRO A CG    1 
ATOM   1799  C CD    . PRO A  1 348 ? 194.609 82.216  131.890 1.00 1.53   ? 348 PRO A CD    1 
ATOM   1800  N N     . HIS A  1 349 ? 192.858 83.059  136.275 1.00 35.84  ? 349 HIS A N     1 
ATOM   1801  C CA    . HIS A  1 349 ? 192.615 82.450  137.586 1.00 39.64  ? 349 HIS A CA    1 
ATOM   1802  C C     . HIS A  1 349 ? 191.808 81.183  137.355 1.00 38.68  ? 349 HIS A C     1 
ATOM   1803  O O     . HIS A  1 349 ? 190.726 81.220  136.767 1.00 38.65  ? 349 HIS A O     1 
ATOM   1804  C CB    . HIS A  1 349 ? 191.808 83.357  138.526 1.00 134.21 ? 349 HIS A CB    1 
ATOM   1805  C CG    . HIS A  1 349 ? 192.624 84.406  139.216 1.00 141.98 ? 349 HIS A CG    1 
ATOM   1806  N ND1   . HIS A  1 349 ? 192.204 85.035  140.369 1.00 143.76 ? 349 HIS A ND1   1 
ATOM   1807  C CD2   . HIS A  1 349 ? 193.821 84.958  138.903 1.00 144.31 ? 349 HIS A CD2   1 
ATOM   1808  C CE1   . HIS A  1 349 ? 193.106 85.929  140.735 1.00 144.88 ? 349 HIS A CE1   1 
ATOM   1809  N NE2   . HIS A  1 349 ? 194.097 85.903  139.862 1.00 144.97 ? 349 HIS A NE2   1 
ATOM   1810  N N     . ALA A  1 350 ? 192.357 80.062  137.816 1.00 29.33  ? 350 ALA A N     1 
ATOM   1811  C CA    . ALA A  1 350 ? 191.725 78.755  137.686 1.00 27.34  ? 350 ALA A CA    1 
ATOM   1812  C C     . ALA A  1 350 ? 191.677 78.318  136.247 1.00 25.91  ? 350 ALA A C     1 
ATOM   1813  O O     . ALA A  1 350 ? 190.624 77.905  135.782 1.00 23.99  ? 350 ALA A O     1 
ATOM   1814  C CB    . ALA A  1 350 ? 190.326 78.801  138.246 1.00 113.65 ? 350 ALA A CB    1 
ATOM   1815  N N     . SER A  1 351 ? 192.812 78.417  135.552 1.00 44.36  ? 351 SER A N     1 
ATOM   1816  C CA    . SER A  1 351 ? 192.906 78.018  134.148 1.00 43.61  ? 351 SER A CA    1 
ATOM   1817  C C     . SER A  1 351 ? 192.740 76.525  134.041 1.00 44.07  ? 351 SER A C     1 
ATOM   1818  O O     . SER A  1 351 ? 192.597 75.840  135.048 1.00 45.27  ? 351 SER A O     1 
ATOM   1819  C CB    . SER A  1 351 ? 194.259 78.407  133.554 1.00 36.30  ? 351 SER A CB    1 
ATOM   1820  O OG    . SER A  1 351 ? 195.322 77.664  134.114 1.00 33.67  ? 351 SER A OG    1 
ATOM   1821  N N     . LEU A  1 352 ? 192.758 76.008  132.824 1.00 28.03  ? 352 LEU A N     1 
ATOM   1822  C CA    . LEU A  1 352 ? 192.610 74.572  132.664 1.00 27.97  ? 352 LEU A CA    1 
ATOM   1823  C C     . LEU A  1 352 ? 193.709 73.787  133.380 1.00 27.91  ? 352 LEU A C     1 
ATOM   1824  O O     . LEU A  1 352 ? 193.435 72.954  134.251 1.00 27.84  ? 352 LEU A O     1 
ATOM   1825  C CB    . LEU A  1 352 ? 192.612 74.209  131.187 1.00 19.77  ? 352 LEU A CB    1 
ATOM   1826  C CG    . LEU A  1 352 ? 191.295 74.401  130.455 1.00 18.46  ? 352 LEU A CG    1 
ATOM   1827  C CD1   . LEU A  1 352 ? 191.424 74.022  128.962 1.00 18.51  ? 352 LEU A CD1   1 
ATOM   1828  C CD2   . LEU A  1 352 ? 190.265 73.564  131.168 1.00 17.86  ? 352 LEU A CD2   1 
ATOM   1829  N N     . THR A  1 353 ? 194.955 74.037  133.004 1.00 36.54  ? 353 THR A N     1 
ATOM   1830  C CA    . THR A  1 353 ? 196.042 73.330  133.635 1.00 36.24  ? 353 THR A CA    1 
ATOM   1831  C C     . THR A  1 353 ? 195.951 73.541  135.127 1.00 37.78  ? 353 THR A C     1 
ATOM   1832  O O     . THR A  1 353 ? 195.991 72.589  135.888 1.00 40.67  ? 353 THR A O     1 
ATOM   1833  C CB    . THR A  1 353 ? 197.379 73.822  133.160 1.00 31.20  ? 353 THR A CB    1 
ATOM   1834  O OG1   . THR A  1 353 ? 197.473 75.223  133.405 1.00 32.26  ? 353 THR A OG1   1 
ATOM   1835  C CG2   . THR A  1 353 ? 197.538 73.548  131.692 1.00 29.77  ? 353 THR A CG2   1 
ATOM   1836  N N     . GLU A  1 354 ? 195.815 74.780  135.565 1.00 34.90  ? 354 GLU A N     1 
ATOM   1837  C CA    . GLU A  1 354 ? 195.720 75.011  136.996 1.00 38.18  ? 354 GLU A CA    1 
ATOM   1838  C C     . GLU A  1 354 ? 194.693 74.052  137.577 1.00 37.99  ? 354 GLU A C     1 
ATOM   1839  O O     . GLU A  1 354 ? 194.855 73.557  138.685 1.00 38.69  ? 354 GLU A O     1 
ATOM   1840  C CB    . GLU A  1 354 ? 195.300 76.450  137.298 1.00 99.41  ? 354 GLU A CB    1 
ATOM   1841  C CG    . GLU A  1 354 ? 196.419 77.330  137.823 1.00 105.76 ? 354 GLU A CG    1 
ATOM   1842  C CD    . GLU A  1 354 ? 195.930 78.714  138.207 1.00 109.98 ? 354 GLU A CD    1 
ATOM   1843  O OE1   . GLU A  1 354 ? 195.029 78.784  139.077 1.00 110.65 ? 354 GLU A OE1   1 
ATOM   1844  O OE2   . GLU A  1 354 ? 196.442 79.718  137.645 1.00 111.21 ? 354 GLU A OE2   1 
ATOM   1845  N N     . GLN A  1 355 ? 193.643 73.765  136.819 1.00 22.23  ? 355 GLN A N     1 
ATOM   1846  C CA    . GLN A  1 355 ? 192.601 72.876  137.313 1.00 21.59  ? 355 GLN A CA    1 
ATOM   1847  C C     . GLN A  1 355 ? 193.000 71.422  137.353 1.00 20.54  ? 355 GLN A C     1 
ATOM   1848  O O     . GLN A  1 355 ? 192.879 70.799  138.394 1.00 20.29  ? 355 GLN A O     1 
ATOM   1849  C CB    . GLN A  1 355 ? 191.350 72.999  136.472 1.00 41.59  ? 355 GLN A CB    1 
ATOM   1850  C CG    . GLN A  1 355 ? 190.560 74.238  136.678 1.00 41.45  ? 355 GLN A CG    1 
ATOM   1851  C CD    . GLN A  1 355 ? 189.218 74.103  136.024 1.00 42.52  ? 355 GLN A CD    1 
ATOM   1852  O OE1   . GLN A  1 355 ? 188.270 73.563  136.608 1.00 42.43  ? 355 GLN A OE1   1 
ATOM   1853  N NE2   . GLN A  1 355 ? 189.128 74.561  134.782 1.00 44.37  ? 355 GLN A NE2   1 
ATOM   1854  N N     . TYR A  1 356 ? 193.434 70.871  136.221 1.00 15.75  ? 356 TYR A N     1 
ATOM   1855  C CA    . TYR A  1 356 ? 193.857 69.485  136.200 1.00 17.57  ? 356 TYR A CA    1 
ATOM   1856  C C     . TYR A  1 356 ? 194.877 69.232  137.286 1.00 18.31  ? 356 TYR A C     1 
ATOM   1857  O O     . TYR A  1 356 ? 194.692 68.304  138.083 1.00 18.28  ? 356 TYR A O     1 
ATOM   1858  C CB    . TYR A  1 356 ? 194.425 69.118  134.846 1.00 52.30  ? 356 TYR A CB    1 
ATOM   1859  C CG    . TYR A  1 356 ? 193.330 68.758  133.898 1.00 54.22  ? 356 TYR A CG    1 
ATOM   1860  C CD1   . TYR A  1 356 ? 193.066 69.536  132.777 1.00 54.81  ? 356 TYR A CD1   1 
ATOM   1861  C CD2   . TYR A  1 356 ? 192.505 67.662  134.158 1.00 54.10  ? 356 TYR A CD2   1 
ATOM   1862  C CE1   . TYR A  1 356 ? 191.997 69.228  131.933 1.00 56.12  ? 356 TYR A CE1   1 
ATOM   1863  C CE2   . TYR A  1 356 ? 191.437 67.351  133.328 1.00 54.79  ? 356 TYR A CE2   1 
ATOM   1864  C CZ    . TYR A  1 356 ? 191.185 68.132  132.222 1.00 55.32  ? 356 TYR A CZ    1 
ATOM   1865  O OH    . TYR A  1 356 ? 190.111 67.819  131.424 1.00 53.74  ? 356 TYR A OH    1 
ATOM   1866  N N     . LYS A  1 357 ? 195.936 70.055  137.328 1.00 37.52  ? 357 LYS A N     1 
ATOM   1867  C CA    . LYS A  1 357 ? 196.959 69.937  138.364 1.00 38.47  ? 357 LYS A CA    1 
ATOM   1868  C C     . LYS A  1 357 ? 196.210 69.750  139.676 1.00 36.75  ? 357 LYS A C     1 
ATOM   1869  O O     . LYS A  1 357 ? 196.337 68.731  140.346 1.00 37.41  ? 357 LYS A O     1 
ATOM   1870  C CB    . LYS A  1 357 ? 197.825 71.200  138.449 1.00 108.71 ? 357 LYS A CB    1 
ATOM   1871  C CG    . LYS A  1 357 ? 199.212 71.068  137.818 1.00 114.19 ? 357 LYS A CG    1 
ATOM   1872  C CD    . LYS A  1 357 ? 200.132 72.230  138.224 1.00 119.39 ? 357 LYS A CD    1 
ATOM   1873  C CE    . LYS A  1 357 ? 201.565 72.086  137.668 1.00 123.17 ? 357 LYS A CE    1 
ATOM   1874  N NZ    . LYS A  1 357 ? 201.721 72.297  136.182 1.00 123.93 ? 357 LYS A NZ    1 
ATOM   1875  N N     . ALA A  1 358 ? 195.399 70.729  140.025 1.00 21.33  ? 358 ALA A N     1 
ATOM   1876  C CA    . ALA A  1 358 ? 194.620 70.652  141.249 1.00 19.73  ? 358 ALA A CA    1 
ATOM   1877  C C     . ALA A  1 358 ? 193.759 69.396  141.396 1.00 18.13  ? 358 ALA A C     1 
ATOM   1878  O O     . ALA A  1 358 ? 193.488 68.988  142.523 1.00 18.11  ? 358 ALA A O     1 
ATOM   1879  C CB    . ALA A  1 358 ? 193.740 71.881  141.372 1.00 129.77 ? 358 ALA A CB    1 
ATOM   1880  N N     . LEU A  1 359 ? 193.322 68.805  140.278 1.00 48.06  ? 359 LEU A N     1 
ATOM   1881  C CA    . LEU A  1 359 ? 192.475 67.599  140.296 1.00 47.97  ? 359 LEU A CA    1 
ATOM   1882  C C     . LEU A  1 359 ? 193.257 66.292  140.507 1.00 49.22  ? 359 LEU A C     1 
ATOM   1883  O O     . LEU A  1 359 ? 192.875 65.450  141.332 1.00 50.26  ? 359 LEU A O     1 
ATOM   1884  C CB    . LEU A  1 359 ? 191.641 67.494  139.007 1.00 29.96  ? 359 LEU A CB    1 
ATOM   1885  C CG    . LEU A  1 359 ? 190.214 68.072  138.899 1.00 27.76  ? 359 LEU A CG    1 
ATOM   1886  C CD1   . LEU A  1 359 ? 189.302 67.524  139.965 1.00 25.16  ? 359 LEU A CD1   1 
ATOM   1887  C CD2   . LEU A  1 359 ? 190.280 69.562  139.033 1.00 29.05  ? 359 LEU A CD2   1 
ATOM   1888  N N     . MET A  1 360 ? 194.333 66.106  139.749 1.00 28.88  ? 360 MET A N     1 
ATOM   1889  C CA    . MET A  1 360 ? 195.176 64.918  139.905 1.00 28.53  ? 360 MET A CA    1 
ATOM   1890  C C     . MET A  1 360 ? 195.807 64.957  141.290 1.00 28.86  ? 360 MET A C     1 
ATOM   1891  O O     . MET A  1 360 ? 196.100 63.929  141.875 1.00 28.89  ? 360 MET A O     1 
ATOM   1892  C CB    . MET A  1 360 ? 196.267 64.908  138.841 1.00 12.86  ? 360 MET A CB    1 
ATOM   1893  C CG    . MET A  1 360 ? 195.710 64.955  137.470 1.00 12.99  ? 360 MET A CG    1 
ATOM   1894  S SD    . MET A  1 360 ? 194.586 63.599  137.317 1.00 17.22  ? 360 MET A SD    1 
ATOM   1895  C CE    . MET A  1 360 ? 193.061 64.190  137.999 1.00 12.25  ? 360 MET A CE    1 
ATOM   1896  N N     . ALA A  1 361 ? 196.029 66.167  141.791 1.00 46.25  ? 361 ALA A N     1 
ATOM   1897  C CA    . ALA A  1 361 ? 196.586 66.367  143.110 1.00 47.75  ? 361 ALA A CA    1 
ATOM   1898  C C     . ALA A  1 361 ? 195.849 65.427  144.017 1.00 49.21  ? 361 ALA A C     1 
ATOM   1899  O O     . ALA A  1 361 ? 196.455 64.568  144.643 1.00 51.19  ? 361 ALA A O     1 
ATOM   1900  C CB    . ALA A  1 361 ? 196.339 67.777  143.571 1.00 38.85  ? 361 ALA A CB    1 
ATOM   1901  N N     . THR A  1 362 ? 194.529 65.601  144.064 1.00 21.30  ? 362 THR A N     1 
ATOM   1902  C CA    . THR A  1 362 ? 193.629 64.793  144.898 1.00 23.31  ? 362 THR A CA    1 
ATOM   1903  C C     . THR A  1 362 ? 193.887 63.284  144.884 1.00 23.86  ? 362 THR A C     1 
ATOM   1904  O O     . THR A  1 362 ? 193.805 62.613  145.913 1.00 23.62  ? 362 THR A O     1 
ATOM   1905  C CB    . THR A  1 362 ? 192.156 64.977  144.499 1.00 60.66  ? 362 THR A CB    1 
ATOM   1906  O OG1   . THR A  1 362 ? 191.988 66.178  143.744 1.00 61.95  ? 362 THR A OG1   1 
ATOM   1907  C CG2   . THR A  1 362 ? 191.310 65.066  145.741 1.00 63.55  ? 362 THR A CG2   1 
ATOM   1908  N N     . GLU A  1 363 ? 194.164 62.741  143.713 1.00 68.48  ? 363 GLU A N     1 
ATOM   1909  C CA    . GLU A  1 363 ? 194.419 61.320  143.632 1.00 70.53  ? 363 GLU A CA    1 
ATOM   1910  C C     . GLU A  1 363 ? 195.833 61.086  144.092 1.00 70.35  ? 363 GLU A C     1 
ATOM   1911  O O     . GLU A  1 363 ? 196.293 59.952  144.140 1.00 72.86  ? 363 GLU A O     1 
ATOM   1912  C CB    . GLU A  1 363 ? 194.239 60.816  142.200 1.00 50.30  ? 363 GLU A CB    1 
ATOM   1913  C CG    . GLU A  1 363 ? 192.806 60.927  141.692 1.00 52.02  ? 363 GLU A CG    1 
ATOM   1914  C CD    . GLU A  1 363 ? 191.874 59.863  142.253 1.00 52.49  ? 363 GLU A CD    1 
ATOM   1915  O OE1   . GLU A  1 363 ? 192.194 59.282  143.307 1.00 53.55  ? 363 GLU A OE1   1 
ATOM   1916  O OE2   . GLU A  1 363 ? 190.811 59.615  141.644 1.00 52.42  ? 363 GLU A OE2   1 
ATOM   1917  N N     . GLY A  1 364 ? 196.517 62.169  144.436 1.00 40.95  ? 364 GLY A N     1 
ATOM   1918  C CA    . GLY A  1 364 ? 197.884 62.057  144.890 1.00 40.72  ? 364 GLY A CA    1 
ATOM   1919  C C     . GLY A  1 364 ? 198.940 62.162  143.802 1.00 41.48  ? 364 GLY A C     1 
ATOM   1920  O O     . GLY A  1 364 ? 200.128 62.110  144.113 1.00 43.26  ? 364 GLY A O     1 
ATOM   1921  N N     . VAL A  1 365 ? 198.555 62.279  142.535 1.00 21.09  ? 365 VAL A N     1 
ATOM   1922  C CA    . VAL A  1 365 ? 199.565 62.424  141.500 1.00 20.24  ? 365 VAL A CA    1 
ATOM   1923  C C     . VAL A  1 365 ? 199.953 63.875  141.340 1.00 21.86  ? 365 VAL A C     1 
ATOM   1924  O O     . VAL A  1 365 ? 199.092 64.783  141.397 1.00 22.33  ? 365 VAL A O     1 
ATOM   1925  C CB    . VAL A  1 365 ? 199.072 61.961  140.176 1.00 43.34  ? 365 VAL A CB    1 
ATOM   1926  C CG1   . VAL A  1 365 ? 200.118 62.273  139.072 1.00 41.76  ? 365 VAL A CG1   1 
ATOM   1927  C CG2   . VAL A  1 365 ? 198.779 60.504  140.277 1.00 44.13  ? 365 VAL A CG2   1 
ATOM   1928  N N     . ASN A  1 366 ? 201.251 64.101  141.155 1.00 64.52  ? 366 ASN A N     1 
ATOM   1929  C CA    . ASN A  1 366 ? 201.764 65.448  140.956 1.00 66.84  ? 366 ASN A CA    1 
ATOM   1930  C C     . ASN A  1 366 ? 202.066 65.556  139.471 1.00 65.92  ? 366 ASN A C     1 
ATOM   1931  O O     . ASN A  1 366 ? 202.848 64.789  138.906 1.00 64.74  ? 366 ASN A O     1 
ATOM   1932  C CB    . ASN A  1 366 ? 203.023 65.689  141.792 1.00 104.18 ? 366 ASN A CB    1 
ATOM   1933  C CG    . ASN A  1 366 ? 203.494 67.132  141.733 1.00 106.60 ? 366 ASN A CG    1 
ATOM   1934  O OD1   . ASN A  1 366 ? 204.157 67.545  140.782 1.00 107.68 ? 366 ASN A OD1   1 
ATOM   1935  N ND2   . ASN A  1 366 ? 203.141 67.909  142.748 1.00 107.16 ? 366 ASN A ND2   1 
ATOM   1936  N N     . ILE A  1 367 ? 201.424 66.522  138.842 1.00 44.55  ? 367 ILE A N     1 
ATOM   1937  C CA    . ILE A  1 367 ? 201.569 66.700  137.422 1.00 42.72  ? 367 ILE A CA    1 
ATOM   1938  C C     . ILE A  1 367 ? 202.179 68.052  137.098 1.00 40.38  ? 367 ILE A C     1 
ATOM   1939  O O     . ILE A  1 367 ? 202.106 68.982  137.898 1.00 39.00  ? 367 ILE A O     1 
ATOM   1940  C CB    . ILE A  1 367 ? 200.178 66.528  136.785 1.00 61.07  ? 367 ILE A CB    1 
ATOM   1941  C CG1   . ILE A  1 367 ? 200.195 66.940  135.320 1.00 61.71  ? 367 ILE A CG1   1 
ATOM   1942  C CG2   . ILE A  1 367 ? 199.141 67.285  137.610 1.00 60.99  ? 367 ILE A CG2   1 
ATOM   1943  C CD1   . ILE A  1 367 ? 198.887 66.655  134.640 1.00 63.18  ? 367 ILE A CD1   1 
ATOM   1944  N N     . ALA A  1 368 ? 202.805 68.155  135.932 1.00 32.55  ? 368 ALA A N     1 
ATOM   1945  C CA    . ALA A  1 368 ? 203.415 69.416  135.522 1.00 30.90  ? 368 ALA A CA    1 
ATOM   1946  C C     . ALA A  1 368 ? 203.431 69.509  134.004 1.00 29.79  ? 368 ALA A C     1 
ATOM   1947  O O     . ALA A  1 368 ? 203.822 68.558  133.308 1.00 28.70  ? 368 ALA A O     1 
ATOM   1948  C CB    . ALA A  1 368 ? 204.826 69.518  136.067 1.00 101.25 ? 368 ALA A CB    1 
ATOM   1949  N N     . PHE A  1 369 ? 202.980 70.653  133.496 1.00 36.29  ? 369 PHE A N     1 
ATOM   1950  C CA    . PHE A  1 369 ? 202.945 70.868  132.056 1.00 35.86  ? 369 PHE A CA    1 
ATOM   1951  C C     . PHE A  1 369 ? 204.142 71.721  131.666 1.00 37.84  ? 369 PHE A C     1 
ATOM   1952  O O     . PHE A  1 369 ? 204.386 72.778  132.246 1.00 38.08  ? 369 PHE A O     1 
ATOM   1953  C CB    . PHE A  1 369 ? 201.663 71.604  131.603 1.00 16.14  ? 369 PHE A CB    1 
ATOM   1954  C CG    . PHE A  1 369 ? 200.367 70.881  131.907 1.00 12.70  ? 369 PHE A CG    1 
ATOM   1955  C CD1   . PHE A  1 369 ? 199.720 71.049  133.137 1.00 11.09  ? 369 PHE A CD1   1 
ATOM   1956  C CD2   . PHE A  1 369 ? 199.779 70.060  130.951 1.00 12.33  ? 369 PHE A CD2   1 
ATOM   1957  C CE1   . PHE A  1 369 ? 198.520 70.423  133.410 1.00 9.92   ? 369 PHE A CE1   1 
ATOM   1958  C CE2   . PHE A  1 369 ? 198.562 69.416  131.212 1.00 12.19  ? 369 PHE A CE2   1 
ATOM   1959  C CZ    . PHE A  1 369 ? 197.936 69.605  132.450 1.00 11.40  ? 369 PHE A CZ    1 
ATOM   1960  N N     . THR A  1 370 ? 204.894 71.261  130.681 1.00 37.00  ? 370 THR A N     1 
ATOM   1961  C CA    . THR A  1 370 ? 206.037 72.018  130.214 1.00 39.11  ? 370 THR A CA    1 
ATOM   1962  C C     . THR A  1 370 ? 205.509 73.071  129.264 1.00 40.47  ? 370 THR A C     1 
ATOM   1963  O O     . THR A  1 370 ? 204.421 72.933  128.702 1.00 39.82  ? 370 THR A O     1 
ATOM   1964  C CB    . THR A  1 370 ? 207.049 71.114  129.454 1.00 39.64  ? 370 THR A CB    1 
ATOM   1965  O OG1   . THR A  1 370 ? 206.772 71.074  128.039 1.00 37.55  ? 370 THR A OG1   1 
ATOM   1966  C CG2   . THR A  1 370 ? 206.950 69.727  129.994 1.00 41.77  ? 370 THR A CG2   1 
ATOM   1967  N N     . THR A  1 371 ? 206.281 74.130  129.095 1.00 69.40  ? 371 THR A N     1 
ATOM   1968  C CA    . THR A  1 371 ? 205.910 75.192  128.179 1.00 71.63  ? 371 THR A CA    1 
ATOM   1969  C C     . THR A  1 371 ? 205.535 74.609  126.815 1.00 71.50  ? 371 THR A C     1 
ATOM   1970  O O     . THR A  1 371 ? 204.413 74.782  126.334 1.00 71.79  ? 371 THR A O     1 
ATOM   1971  C CB    . THR A  1 371 ? 207.073 76.111  127.971 1.00 47.12  ? 371 THR A CB    1 
ATOM   1972  O OG1   . THR A  1 371 ? 207.838 76.159  129.180 1.00 47.69  ? 371 THR A OG1   1 
ATOM   1973  C CG2   . THR A  1 371 ? 206.574 77.494  127.594 1.00 48.20  ? 371 THR A CG2   1 
ATOM   1974  N N     . ASP A  1 372 ? 206.497 73.923  126.200 1.00 33.32  ? 372 ASP A N     1 
ATOM   1975  C CA    . ASP A  1 372 ? 206.308 73.300  124.906 1.00 32.78  ? 372 ASP A CA    1 
ATOM   1976  C C     . ASP A  1 372 ? 205.054 72.466  124.922 1.00 29.83  ? 372 ASP A C     1 
ATOM   1977  O O     . ASP A  1 372 ? 204.389 72.330  123.909 1.00 29.02  ? 372 ASP A O     1 
ATOM   1978  C CB    . ASP A  1 372 ? 207.527 72.464  124.553 1.00 187.32 ? 372 ASP A CB    1 
ATOM   1979  C CG    . ASP A  1 372 ? 208.746 73.323  124.300 1.00 195.51 ? 372 ASP A CG    1 
ATOM   1980  O OD1   . ASP A  1 372 ? 208.686 74.191  123.403 1.00 197.12 ? 372 ASP A OD1   1 
ATOM   1981  O OD2   . ASP A  1 372 ? 209.761 73.145  125.000 1.00 199.93 ? 372 ASP A OD2   1 
ATOM   1982  N N     . ALA A  1 373 ? 204.702 71.931  126.084 1.00 45.30  ? 373 ALA A N     1 
ATOM   1983  C CA    . ALA A  1 373 ? 203.490 71.124  126.192 1.00 42.31  ? 373 ALA A CA    1 
ATOM   1984  C C     . ALA A  1 373 ? 202.279 71.997  125.943 1.00 40.24  ? 373 ALA A C     1 
ATOM   1985  O O     . ALA A  1 373 ? 201.402 71.649  125.160 1.00 40.86  ? 373 ALA A O     1 
ATOM   1986  C CB    . ALA A  1 373 ? 203.395 70.493  127.559 1.00 23.63  ? 373 ALA A CB    1 
ATOM   1987  N N     . VAL A  1 374 ? 202.231 73.143  126.609 1.00 23.32  ? 374 VAL A N     1 
ATOM   1988  C CA    . VAL A  1 374 ? 201.105 74.059  126.433 1.00 20.18  ? 374 VAL A CA    1 
ATOM   1989  C C     . VAL A  1 374 ? 201.084 74.570  124.990 1.00 19.75  ? 374 VAL A C     1 
ATOM   1990  O O     . VAL A  1 374 ? 200.057 74.561  124.308 1.00 18.17  ? 374 VAL A O     1 
ATOM   1991  C CB    . VAL A  1 374 ? 201.193 75.278  127.402 1.00 1.00   ? 374 VAL A CB    1 
ATOM   1992  C CG1   . VAL A  1 374 ? 200.047 76.188  127.153 1.00 1.00   ? 374 VAL A CG1   1 
ATOM   1993  C CG2   . VAL A  1 374 ? 201.090 74.839  128.858 1.00 1.00   ? 374 VAL A CG2   1 
ATOM   1994  N N     . LYS A  1 375 ? 202.243 75.012  124.531 1.00 26.59  ? 375 LYS A N     1 
ATOM   1995  C CA    . LYS A  1 375 ? 202.382 75.522  123.178 1.00 28.38  ? 375 LYS A CA    1 
ATOM   1996  C C     . LYS A  1 375 ? 201.797 74.512  122.213 1.00 26.63  ? 375 LYS A C     1 
ATOM   1997  O O     . LYS A  1 375 ? 201.178 74.890  121.237 1.00 23.42  ? 375 LYS A O     1 
ATOM   1998  C CB    . LYS A  1 375 ? 203.862 75.774  122.878 1.00 52.80  ? 375 LYS A CB    1 
ATOM   1999  C CG    . LYS A  1 375 ? 204.125 76.892  121.891 1.00 56.53  ? 375 LYS A CG    1 
ATOM   2000  C CD    . LYS A  1 375 ? 205.462 77.605  122.178 1.00 59.71  ? 375 LYS A CD    1 
ATOM   2001  C CE    . LYS A  1 375 ? 205.717 78.763  121.194 1.00 64.58  ? 375 LYS A CE    1 
ATOM   2002  N NZ    . LYS A  1 375 ? 205.697 78.397  119.716 1.00 66.24  ? 375 LYS A NZ    1 
ATOM   2003  N N     . LYS A  1 376 ? 201.989 73.227  122.515 1.00 1.72   ? 376 LYS A N     1 
ATOM   2004  C CA    . LYS A  1 376 ? 201.478 72.116  121.710 1.00 3.08   ? 376 LYS A CA    1 
ATOM   2005  C C     . LYS A  1 376 ? 199.956 71.929  121.898 1.00 2.04   ? 376 LYS A C     1 
ATOM   2006  O O     . LYS A  1 376 ? 199.212 71.922  120.923 1.00 1.24   ? 376 LYS A O     1 
ATOM   2007  C CB    . LYS A  1 376 ? 202.206 70.821  122.089 1.00 19.77  ? 376 LYS A CB    1 
ATOM   2008  C CG    . LYS A  1 376 ? 201.854 69.607  121.222 1.00 23.77  ? 376 LYS A CG    1 
ATOM   2009  C CD    . LYS A  1 376 ? 202.392 69.774  119.811 1.00 27.73  ? 376 LYS A CD    1 
ATOM   2010  C CE    . LYS A  1 376 ? 201.889 68.686  118.884 1.00 28.62  ? 376 LYS A CE    1 
ATOM   2011  N NZ    . LYS A  1 376 ? 202.440 68.827  117.504 1.00 31.72  ? 376 LYS A NZ    1 
ATOM   2012  N N     . ILE A  1 377 ? 199.502 71.767  123.146 1.00 5.88   ? 377 ILE A N     1 
ATOM   2013  C CA    . ILE A  1 377 ? 198.063 71.602  123.464 1.00 4.56   ? 377 ILE A CA    1 
ATOM   2014  C C     . ILE A  1 377 ? 197.250 72.630  122.699 1.00 5.54   ? 377 ILE A C     1 
ATOM   2015  O O     . ILE A  1 377 ? 196.289 72.285  122.020 1.00 5.32   ? 377 ILE A O     1 
ATOM   2016  C CB    . ILE A  1 377 ? 197.773 71.828  124.976 1.00 7.50   ? 377 ILE A CB    1 
ATOM   2017  C CG1   . ILE A  1 377 ? 198.434 70.718  125.792 1.00 7.98   ? 377 ILE A CG1   1 
ATOM   2018  C CG2   . ILE A  1 377 ? 196.284 71.929  125.221 1.00 3.17   ? 377 ILE A CG2   1 
ATOM   2019  C CD1   . ILE A  1 377 ? 198.062 70.693  127.267 1.00 8.32   ? 377 ILE A CD1   1 
ATOM   2020  N N     . ALA A  1 378 ? 197.671 73.896  122.841 1.00 9.09   ? 378 ALA A N     1 
ATOM   2021  C CA    . ALA A  1 378 ? 197.071 75.059  122.197 1.00 7.25   ? 378 ALA A CA    1 
ATOM   2022  C C     . ALA A  1 378 ? 197.157 75.002  120.668 1.00 6.80   ? 378 ALA A C     1 
ATOM   2023  O O     . ALA A  1 378 ? 196.140 75.054  119.973 1.00 5.95   ? 378 ALA A O     1 
ATOM   2024  C CB    . ALA A  1 378 ? 197.745 76.312  122.708 1.00 85.37  ? 378 ALA A CB    1 
ATOM   2025  N N     . GLU A  1 379 ? 198.372 74.898  120.142 1.00 24.66  ? 379 GLU A N     1 
ATOM   2026  C CA    . GLU A  1 379 ? 198.534 74.823  118.698 1.00 29.05  ? 379 GLU A CA    1 
ATOM   2027  C C     . GLU A  1 379 ? 197.591 73.726  118.219 1.00 27.73  ? 379 GLU A C     1 
ATOM   2028  O O     . GLU A  1 379 ? 197.088 73.754  117.100 1.00 27.69  ? 379 GLU A O     1 
ATOM   2029  C CB    . GLU A  1 379 ? 199.975 74.480  118.322 1.00 129.29 ? 379 GLU A CB    1 
ATOM   2030  C CG    . GLU A  1 379 ? 200.631 75.494  117.393 1.00 137.36 ? 379 GLU A CG    1 
ATOM   2031  C CD    . GLU A  1 379 ? 201.772 76.243  118.066 1.00 144.75 ? 379 GLU A CD    1 
ATOM   2032  O OE1   . GLU A  1 379 ? 202.768 75.585  118.449 1.00 147.88 ? 379 GLU A OE1   1 
ATOM   2033  O OE2   . GLU A  1 379 ? 201.674 77.483  118.216 1.00 145.35 ? 379 GLU A OE2   1 
ATOM   2034  N N     . ALA A  1 380 ? 197.327 72.765  119.092 1.00 4.86   ? 380 ALA A N     1 
ATOM   2035  C CA    . ALA A  1 380 ? 196.441 71.662  118.752 1.00 3.89   ? 380 ALA A CA    1 
ATOM   2036  C C     . ALA A  1 380 ? 195.002 72.091  118.673 1.00 3.60   ? 380 ALA A C     1 
ATOM   2037  O O     . ALA A  1 380 ? 194.347 71.843  117.680 1.00 2.12   ? 380 ALA A O     1 
ATOM   2038  C CB    . ALA A  1 380 ? 196.572 70.570  119.762 1.00 1.55   ? 380 ALA A CB    1 
ATOM   2039  N N     . ALA A  1 381 ? 194.508 72.720  119.735 1.00 19.89  ? 381 ALA A N     1 
ATOM   2040  C CA    . ALA A  1 381 ? 193.122 73.171  119.765 1.00 20.73  ? 381 ALA A CA    1 
ATOM   2041  C C     . ALA A  1 381 ? 192.906 74.014  118.537 1.00 21.62  ? 381 ALA A C     1 
ATOM   2042  O O     . ALA A  1 381 ? 192.049 73.716  117.712 1.00 20.70  ? 381 ALA A O     1 
ATOM   2043  C CB    . ALA A  1 381 ? 192.850 73.992  121.008 1.00 49.29  ? 381 ALA A CB    1 
ATOM   2044  N N     . PHE A  1 382 ? 193.699 75.068  118.410 1.00 15.68  ? 382 PHE A N     1 
ATOM   2045  C CA    . PHE A  1 382 ? 193.566 75.932  117.257 1.00 18.40  ? 382 PHE A CA    1 
ATOM   2046  C C     . PHE A  1 382 ? 193.524 75.067  116.010 1.00 19.27  ? 382 PHE A C     1 
ATOM   2047  O O     . PHE A  1 382 ? 192.576 75.117  115.228 1.00 19.67  ? 382 PHE A O     1 
ATOM   2048  C CB    . PHE A  1 382 ? 194.733 76.903  117.208 1.00 42.23  ? 382 PHE A CB    1 
ATOM   2049  C CG    . PHE A  1 382 ? 194.663 77.886  116.084 1.00 44.90  ? 382 PHE A CG    1 
ATOM   2050  C CD1   . PHE A  1 382 ? 195.087 79.189  116.280 1.00 46.96  ? 382 PHE A CD1   1 
ATOM   2051  C CD2   . PHE A  1 382 ? 194.279 77.494  114.810 1.00 44.38  ? 382 PHE A CD2   1 
ATOM   2052  C CE1   . PHE A  1 382 ? 195.145 80.083  115.229 1.00 49.14  ? 382 PHE A CE1   1 
ATOM   2053  C CE2   . PHE A  1 382 ? 194.330 78.376  113.749 1.00 45.43  ? 382 PHE A CE2   1 
ATOM   2054  C CZ    . PHE A  1 382 ? 194.767 79.675  113.954 1.00 48.43  ? 382 PHE A CZ    1 
ATOM   2055  N N     . ARG A  1 383 ? 194.548 74.247  115.839 1.00 22.05  ? 383 ARG A N     1 
ATOM   2056  C CA    . ARG A  1 383 ? 194.624 73.372  114.677 1.00 24.58  ? 383 ARG A CA    1 
ATOM   2057  C C     . ARG A  1 383 ? 193.234 72.872  114.225 1.00 22.08  ? 383 ARG A C     1 
ATOM   2058  O O     . ARG A  1 383 ? 192.745 73.212  113.153 1.00 20.86  ? 383 ARG A O     1 
ATOM   2059  C CB    . ARG A  1 383 ? 195.531 72.187  114.999 1.00 126.65 ? 383 ARG A CB    1 
ATOM   2060  C CG    . ARG A  1 383 ? 195.810 71.281  113.824 1.00 136.19 ? 383 ARG A CG    1 
ATOM   2061  C CD    . ARG A  1 383 ? 196.677 71.964  112.778 1.00 143.60 ? 383 ARG A CD    1 
ATOM   2062  N NE    . ARG A  1 383 ? 196.911 71.084  111.636 1.00 151.69 ? 383 ARG A NE    1 
ATOM   2063  C CZ    . ARG A  1 383 ? 197.764 71.340  110.649 1.00 154.83 ? 383 ARG A CZ    1 
ATOM   2064  N NH1   . ARG A  1 383 ? 198.477 72.458  110.657 1.00 155.37 ? 383 ARG A NH1   1 
ATOM   2065  N NH2   . ARG A  1 383 ? 197.902 70.477  109.650 1.00 156.43 ? 383 ARG A NH2   1 
ATOM   2066  N N     . VAL A  1 384 ? 192.594 72.070  115.052 1.00 33.59  ? 384 VAL A N     1 
ATOM   2067  C CA    . VAL A  1 384 ? 191.305 71.540  114.678 1.00 32.91  ? 384 VAL A CA    1 
ATOM   2068  C C     . VAL A  1 384 ? 190.263 72.617  114.460 1.00 35.06  ? 384 VAL A C     1 
ATOM   2069  O O     . VAL A  1 384 ? 189.519 72.557  113.484 1.00 36.26  ? 384 VAL A O     1 
ATOM   2070  C CB    . VAL A  1 384 ? 190.793 70.543  115.725 1.00 1.00   ? 384 VAL A CB    1 
ATOM   2071  C CG1   . VAL A  1 384 ? 191.358 70.918  117.069 1.00 1.00   ? 384 VAL A CG1   1 
ATOM   2072  C CG2   . VAL A  1 384 ? 189.249 70.551  115.771 1.00 1.00   ? 384 VAL A CG2   1 
ATOM   2073  N N     . ASN A  1 385 ? 190.178 73.586  115.365 1.00 38.15  ? 385 ASN A N     1 
ATOM   2074  C CA    . ASN A  1 385 ? 189.192 74.634  115.196 1.00 38.05  ? 385 ASN A CA    1 
ATOM   2075  C C     . ASN A  1 385 ? 189.257 75.107  113.760 1.00 39.40  ? 385 ASN A C     1 
ATOM   2076  O O     . ASN A  1 385 ? 188.210 75.263  113.138 1.00 39.51  ? 385 ASN A O     1 
ATOM   2077  C CB    . ASN A  1 385 ? 189.460 75.778  116.154 1.00 41.55  ? 385 ASN A CB    1 
ATOM   2078  C CG    . ASN A  1 385 ? 188.555 75.741  117.337 1.00 39.52  ? 385 ASN A CG    1 
ATOM   2079  O OD1   . ASN A  1 385 ? 188.012 74.694  117.664 1.00 36.64  ? 385 ASN A OD1   1 
ATOM   2080  N ND2   . ASN A  1 385 ? 188.383 76.884  117.997 1.00 39.45  ? 385 ASN A ND2   1 
ATOM   2081  N N     . GLU A  1 386 ? 190.474 75.312  113.226 1.00 14.36  ? 386 GLU A N     1 
ATOM   2082  C CA    . GLU A  1 386 ? 190.621 75.734  111.829 1.00 17.01  ? 386 GLU A CA    1 
ATOM   2083  C C     . GLU A  1 386 ? 190.156 74.630  110.879 1.00 16.41  ? 386 GLU A C     1 
ATOM   2084  O O     . GLU A  1 386 ? 189.371 74.845  109.967 1.00 16.01  ? 386 GLU A O     1 
ATOM   2085  C CB    . GLU A  1 386 ? 192.062 76.106  111.481 1.00 105.05 ? 386 GLU A CB    1 
ATOM   2086  C CG    . GLU A  1 386 ? 192.249 76.262  109.966 1.00 111.81 ? 386 GLU A CG    1 
ATOM   2087  C CD    . GLU A  1 386 ? 193.584 76.864  109.563 1.00 117.43 ? 386 GLU A CD    1 
ATOM   2088  O OE1   . GLU A  1 386 ? 193.802 78.063  109.828 1.00 120.12 ? 386 GLU A OE1   1 
ATOM   2089  O OE2   . GLU A  1 386 ? 194.421 76.146  108.976 1.00 119.98 ? 386 GLU A OE2   1 
ATOM   2090  N N     . LYS A  1 387 ? 190.611 73.421  111.115 1.00 39.87  ? 387 LYS A N     1 
ATOM   2091  C CA    . LYS A  1 387 ? 190.220 72.339  110.240 1.00 41.66  ? 387 LYS A CA    1 
ATOM   2092  C C     . LYS A  1 387 ? 188.738 71.954  110.296 1.00 40.36  ? 387 LYS A C     1 
ATOM   2093  O O     . LYS A  1 387 ? 188.205 71.406  109.340 1.00 40.58  ? 387 LYS A O     1 
ATOM   2094  C CB    . LYS A  1 387 ? 191.107 71.125  110.523 1.00 142.18 ? 387 LYS A CB    1 
ATOM   2095  C CG    . LYS A  1 387 ? 192.612 71.431  110.454 1.00 147.28 ? 387 LYS A CG    1 
ATOM   2096  C CD    . LYS A  1 387 ? 193.038 71.947  109.075 1.00 150.76 ? 387 LYS A CD    1 
ATOM   2097  C CE    . LYS A  1 387 ? 194.533 72.271  109.024 1.00 151.21 ? 387 LYS A CE    1 
ATOM   2098  N NZ    . LYS A  1 387 ? 194.965 72.797  107.690 1.00 152.84 ? 387 LYS A NZ    1 
ATOM   2099  N N     . THR A  1 388 ? 188.051 72.239  111.389 1.00 51.64  ? 388 THR A N     1 
ATOM   2100  C CA    . THR A  1 388 ? 186.650 71.857  111.442 1.00 51.88  ? 388 THR A CA    1 
ATOM   2101  C C     . THR A  1 388 ? 185.705 72.945  111.968 1.00 52.66  ? 388 THR A C     1 
ATOM   2102  O O     . THR A  1 388 ? 185.816 74.112  111.593 1.00 54.34  ? 388 THR A O     1 
ATOM   2103  C CB    . THR A  1 388 ? 186.484 70.546  112.258 1.00 36.74  ? 388 THR A CB    1 
ATOM   2104  O OG1   . THR A  1 388 ? 187.197 70.637  113.496 1.00 36.82  ? 388 THR A OG1   1 
ATOM   2105  C CG2   . THR A  1 388 ? 187.043 69.382  111.487 1.00 36.99  ? 388 THR A CG2   1 
ATOM   2106  N N     . GLU A  1 389 ? 184.754 72.557  112.806 1.00 40.99  ? 389 GLU A N     1 
ATOM   2107  C CA    . GLU A  1 389 ? 183.808 73.495  113.390 1.00 39.38  ? 389 GLU A CA    1 
ATOM   2108  C C     . GLU A  1 389 ? 184.537 74.340  114.450 1.00 36.35  ? 389 GLU A C     1 
ATOM   2109  O O     . GLU A  1 389 ? 184.700 73.902  115.592 1.00 36.86  ? 389 GLU A O     1 
ATOM   2110  C CB    . GLU A  1 389 ? 182.669 72.697  114.036 1.00 145.92 ? 389 GLU A CB    1 
ATOM   2111  C CG    . GLU A  1 389 ? 181.519 73.527  114.558 1.00 152.79 ? 389 GLU A CG    1 
ATOM   2112  C CD    . GLU A  1 389 ? 180.614 74.015  113.454 1.00 157.08 ? 389 GLU A CD    1 
ATOM   2113  O OE1   . GLU A  1 389 ? 179.950 73.169  112.815 1.00 159.87 ? 389 GLU A OE1   1 
ATOM   2114  O OE2   . GLU A  1 389 ? 180.570 75.243  113.226 1.00 157.78 ? 389 GLU A OE2   1 
ATOM   2115  N N     . ASN A  1 390 ? 184.989 75.539  114.094 1.00 27.99  ? 390 ASN A N     1 
ATOM   2116  C CA    . ASN A  1 390 ? 185.687 76.386  115.073 1.00 24.98  ? 390 ASN A CA    1 
ATOM   2117  C C     . ASN A  1 390 ? 184.776 76.756  116.220 1.00 21.98  ? 390 ASN A C     1 
ATOM   2118  O O     . ASN A  1 390 ? 183.904 77.589  116.053 1.00 21.56  ? 390 ASN A O     1 
ATOM   2119  C CB    . ASN A  1 390 ? 186.161 77.682  114.446 1.00 46.28  ? 390 ASN A CB    1 
ATOM   2120  C CG    . ASN A  1 390 ? 186.832 78.589  115.447 1.00 47.86  ? 390 ASN A CG    1 
ATOM   2121  O OD1   . ASN A  1 390 ? 186.304 78.827  116.532 1.00 49.19  ? 390 ASN A OD1   1 
ATOM   2122  N ND2   . ASN A  1 390 ? 188.010 79.103  115.090 1.00 48.30  ? 390 ASN A ND2   1 
ATOM   2123  N N     . ILE A  1 391 ? 184.979 76.145  117.377 1.00 7.46   ? 391 ILE A N     1 
ATOM   2124  C CA    . ILE A  1 391 ? 184.147 76.441  118.514 1.00 3.18   ? 391 ILE A CA    1 
ATOM   2125  C C     . ILE A  1 391 ? 184.917 77.282  119.476 1.00 1.43   ? 391 ILE A C     1 
ATOM   2126  O O     . ILE A  1 391 ? 184.741 77.186  120.675 1.00 1.01   ? 391 ILE A O     1 
ATOM   2127  C CB    . ILE A  1 391 ? 183.704 75.198  119.234 1.00 4.94   ? 391 ILE A CB    1 
ATOM   2128  C CG1   . ILE A  1 391 ? 184.914 74.394  119.673 1.00 6.59   ? 391 ILE A CG1   1 
ATOM   2129  C CG2   . ILE A  1 391 ? 182.850 74.407  118.336 1.00 4.78   ? 391 ILE A CG2   1 
ATOM   2130  C CD1   . ILE A  1 391 ? 184.554 73.198  120.430 1.00 8.03   ? 391 ILE A CD1   1 
ATOM   2131  N N     . GLY A  1 392 ? 185.803 78.097  118.954 1.00 18.69  ? 392 GLY A N     1 
ATOM   2132  C CA    . GLY A  1 392 ? 186.519 78.968  119.844 1.00 21.28  ? 392 GLY A CA    1 
ATOM   2133  C C     . GLY A  1 392 ? 187.322 78.297  120.935 1.00 22.88  ? 392 GLY A C     1 
ATOM   2134  O O     . GLY A  1 392 ? 187.924 77.265  120.701 1.00 25.17  ? 392 GLY A O     1 
ATOM   2135  N N     . ALA A  1 393 ? 187.319 78.869  122.134 1.00 5.63   ? 393 ALA A N     1 
ATOM   2136  C CA    . ALA A  1 393 ? 188.118 78.343  123.207 1.00 4.00   ? 393 ALA A CA    1 
ATOM   2137  C C     . ALA A  1 393 ? 187.558 77.111  123.815 1.00 5.24   ? 393 ALA A C     1 
ATOM   2138  O O     . ALA A  1 393 ? 188.260 76.452  124.556 1.00 5.72   ? 393 ALA A O     1 
ATOM   2139  C CB    . ALA A  1 393 ? 188.307 79.372  124.243 1.00 6.53   ? 393 ALA A CB    1 
ATOM   2140  N N     . ARG A  1 394 ? 186.304 76.784  123.539 1.00 29.95  ? 394 ARG A N     1 
ATOM   2141  C CA    . ARG A  1 394 ? 185.790 75.556  124.109 1.00 33.28  ? 394 ARG A CA    1 
ATOM   2142  C C     . ARG A  1 394 ? 186.777 74.486  123.703 1.00 32.88  ? 394 ARG A C     1 
ATOM   2143  O O     . ARG A  1 394 ? 187.157 73.630  124.513 1.00 36.00  ? 394 ARG A O     1 
ATOM   2144  C CB    . ARG A  1 394 ? 184.405 75.208  123.568 1.00 64.73  ? 394 ARG A CB    1 
ATOM   2145  C CG    . ARG A  1 394 ? 183.296 75.712  124.452 1.00 72.10  ? 394 ARG A CG    1 
ATOM   2146  C CD    . ARG A  1 394 ? 183.512 75.304  125.912 1.00 78.43  ? 394 ARG A CD    1 
ATOM   2147  N NE    . ARG A  1 394 ? 182.471 75.861  126.773 1.00 84.91  ? 394 ARG A NE    1 
ATOM   2148  C CZ    . ARG A  1 394 ? 182.371 75.632  128.078 1.00 88.30  ? 394 ARG A CZ    1 
ATOM   2149  N NH1   . ARG A  1 394 ? 183.263 74.848  128.687 1.00 88.55  ? 394 ARG A NH1   1 
ATOM   2150  N NH2   . ARG A  1 394 ? 181.365 76.178  128.765 1.00 89.10  ? 394 ARG A NH2   1 
ATOM   2151  N N     . ARG A  1 395 ? 187.232 74.560  122.456 1.00 8.00   ? 395 ARG A N     1 
ATOM   2152  C CA    . ARG A  1 395 ? 188.163 73.571  121.964 1.00 6.11   ? 395 ARG A CA    1 
ATOM   2153  C C     . ARG A  1 395 ? 189.286 73.229  122.959 1.00 5.31   ? 395 ARG A C     1 
ATOM   2154  O O     . ARG A  1 395 ? 189.825 72.144  122.909 1.00 5.35   ? 395 ARG A O     1 
ATOM   2155  C CB    . ARG A  1 395 ? 188.728 74.016  120.635 1.00 35.35  ? 395 ARG A CB    1 
ATOM   2156  C CG    . ARG A  1 395 ? 189.412 72.901  119.912 1.00 38.79  ? 395 ARG A CG    1 
ATOM   2157  C CD    . ARG A  1 395 ? 188.433 71.811  119.576 1.00 38.82  ? 395 ARG A CD    1 
ATOM   2158  N NE    . ARG A  1 395 ? 187.594 72.208  118.470 1.00 40.74  ? 395 ARG A NE    1 
ATOM   2159  C CZ    . ARG A  1 395 ? 186.569 71.492  118.044 1.00 42.27  ? 395 ARG A CZ    1 
ATOM   2160  N NH1   . ARG A  1 395 ? 186.274 70.354  118.639 1.00 43.94  ? 395 ARG A NH1   1 
ATOM   2161  N NH2   . ARG A  1 395 ? 185.828 71.911  117.034 1.00 43.79  ? 395 ARG A NH2   1 
ATOM   2162  N N     . LEU A  1 396 ? 189.650 74.129  123.868 1.00 6.23   ? 396 LEU A N     1 
ATOM   2163  C CA    . LEU A  1 396 ? 190.671 73.770  124.836 1.00 4.46   ? 396 LEU A CA    1 
ATOM   2164  C C     . LEU A  1 396 ? 190.102 72.793  125.817 1.00 6.32   ? 396 LEU A C     1 
ATOM   2165  O O     . LEU A  1 396 ? 190.734 71.802  126.091 1.00 6.64   ? 396 LEU A O     1 
ATOM   2166  C CB    . LEU A  1 396 ? 191.196 74.964  125.590 1.00 11.13  ? 396 LEU A CB    1 
ATOM   2167  C CG    . LEU A  1 396 ? 191.845 75.852  124.541 1.00 11.27  ? 396 LEU A CG    1 
ATOM   2168  C CD1   . LEU A  1 396 ? 192.336 77.126  125.143 1.00 12.67  ? 396 LEU A CD1   1 
ATOM   2169  C CD2   . LEU A  1 396 ? 192.997 75.164  123.944 1.00 9.96   ? 396 LEU A CD2   1 
ATOM   2170  N N     . HIS A  1 397 ? 188.909 73.040  126.344 1.00 31.08  ? 397 HIS A N     1 
ATOM   2171  C CA    . HIS A  1 397 ? 188.329 72.102  127.308 1.00 34.90  ? 397 HIS A CA    1 
ATOM   2172  C C     . HIS A  1 397 ? 188.282 70.743  126.677 1.00 34.44  ? 397 HIS A C     1 
ATOM   2173  O O     . HIS A  1 397 ? 188.443 69.738  127.372 1.00 35.59  ? 397 HIS A O     1 
ATOM   2174  C CB    . HIS A  1 397 ? 186.909 72.507  127.713 1.00 74.02  ? 397 HIS A CB    1 
ATOM   2175  C CG    . HIS A  1 397 ? 186.847 73.784  128.486 1.00 79.55  ? 397 HIS A CG    1 
ATOM   2176  N ND1   . HIS A  1 397 ? 186.443 73.838  129.801 1.00 82.65  ? 397 HIS A ND1   1 
ATOM   2177  C CD2   . HIS A  1 397 ? 187.195 75.047  128.147 1.00 81.56  ? 397 HIS A CD2   1 
ATOM   2178  C CE1   . HIS A  1 397 ? 186.551 75.080  130.240 1.00 83.63  ? 397 HIS A CE1   1 
ATOM   2179  N NE2   . HIS A  1 397 ? 187.006 75.833  129.256 1.00 83.45  ? 397 HIS A NE2   1 
ATOM   2180  N N     . THR A  1 398 ? 188.063 70.726  125.360 1.00 28.76  ? 398 THR A N     1 
ATOM   2181  C CA    . THR A  1 398 ? 187.993 69.486  124.597 1.00 29.21  ? 398 THR A CA    1 
ATOM   2182  C C     . THR A  1 398 ? 189.317 68.734  124.574 1.00 29.44  ? 398 THR A C     1 
ATOM   2183  O O     . THR A  1 398 ? 189.462 67.639  125.145 1.00 30.03  ? 398 THR A O     1 
ATOM   2184  C CB    . THR A  1 398 ? 187.579 69.769  123.160 1.00 36.64  ? 398 THR A CB    1 
ATOM   2185  O OG1   . THR A  1 398 ? 186.158 69.860  123.128 1.00 37.66  ? 398 THR A OG1   1 
ATOM   2186  C CG2   . THR A  1 398 ? 188.081 68.651  122.181 1.00 38.32  ? 398 THR A CG2   1 
ATOM   2187  N N     . VAL A  1 399 ? 190.287 69.341  123.909 1.00 24.63  ? 399 VAL A N     1 
ATOM   2188  C CA    . VAL A  1 399 ? 191.566 68.734  123.789 1.00 20.71  ? 399 VAL A CA    1 
ATOM   2189  C C     . VAL A  1 399 ? 192.130 68.405  125.121 1.00 20.02  ? 399 VAL A C     1 
ATOM   2190  O O     . VAL A  1 399 ? 192.700 67.358  125.271 1.00 22.70  ? 399 VAL A O     1 
ATOM   2191  C CB    . VAL A  1 399 ? 192.518 69.602  123.082 1.00 9.88   ? 399 VAL A CB    1 
ATOM   2192  C CG1   . VAL A  1 399 ? 193.844 68.916  123.061 1.00 11.87  ? 399 VAL A CG1   1 
ATOM   2193  C CG2   . VAL A  1 399 ? 192.055 69.828  121.670 1.00 9.23   ? 399 VAL A CG2   1 
ATOM   2194  N N     . MET A  1 400 ? 192.005 69.276  126.102 1.00 5.23   ? 400 MET A N     1 
ATOM   2195  C CA    . MET A  1 400 ? 192.545 68.919  127.415 1.00 6.52   ? 400 MET A CA    1 
ATOM   2196  C C     . MET A  1 400 ? 192.003 67.590  127.867 1.00 7.98   ? 400 MET A C     1 
ATOM   2197  O O     . MET A  1 400 ? 192.791 66.709  128.219 1.00 8.62   ? 400 MET A O     1 
ATOM   2198  C CB    . MET A  1 400 ? 192.186 69.925  128.506 1.00 20.12  ? 400 MET A CB    1 
ATOM   2199  C CG    . MET A  1 400 ? 193.052 71.112  128.537 1.00 20.97  ? 400 MET A CG    1 
ATOM   2200  S SD    . MET A  1 400 ? 194.730 70.669  128.758 1.00 21.55  ? 400 MET A SD    1 
ATOM   2201  C CE    . MET A  1 400 ? 194.853 70.888  130.490 1.00 21.54  ? 400 MET A CE    1 
ATOM   2202  N N     . GLU A  1 401 ? 190.672 67.434  127.857 1.00 8.55   ? 401 GLU A N     1 
ATOM   2203  C CA    . GLU A  1 401 ? 190.101 66.187  128.332 1.00 12.55  ? 401 GLU A CA    1 
ATOM   2204  C C     . GLU A  1 401 ? 190.626 65.024  127.484 1.00 12.80  ? 401 GLU A C     1 
ATOM   2205  O O     . GLU A  1 401 ? 190.937 63.939  128.006 1.00 12.11  ? 401 GLU A O     1 
ATOM   2206  C CB    . GLU A  1 401 ? 188.572 66.239  128.350 1.00 59.14  ? 401 GLU A CB    1 
ATOM   2207  C CG    . GLU A  1 401 ? 187.930 65.097  129.170 1.00 66.37  ? 401 GLU A CG    1 
ATOM   2208  C CD    . GLU A  1 401 ? 188.392 65.026  130.638 1.00 70.17  ? 401 GLU A CD    1 
ATOM   2209  O OE1   . GLU A  1 401 ? 188.347 66.077  131.325 1.00 71.32  ? 401 GLU A OE1   1 
ATOM   2210  O OE2   . GLU A  1 401 ? 188.777 63.914  131.100 1.00 69.39  ? 401 GLU A OE2   1 
ATOM   2211  N N     . ARG A  1 402 ? 190.781 65.267  126.187 1.00 32.79  ? 402 ARG A N     1 
ATOM   2212  C CA    . ARG A  1 402 ? 191.283 64.241  125.291 1.00 32.16  ? 402 ARG A CA    1 
ATOM   2213  C C     . ARG A  1 402 ? 192.708 63.850  125.667 1.00 32.48  ? 402 ARG A C     1 
ATOM   2214  O O     . ARG A  1 402 ? 193.125 62.733  125.416 1.00 33.98  ? 402 ARG A O     1 
ATOM   2215  C CB    . ARG A  1 402 ? 191.227 64.746  123.858 1.00 24.98  ? 402 ARG A CB    1 
ATOM   2216  C CG    . ARG A  1 402 ? 191.449 63.683  122.838 1.00 26.35  ? 402 ARG A CG    1 
ATOM   2217  C CD    . ARG A  1 402 ? 190.813 64.055  121.511 1.00 29.42  ? 402 ARG A CD    1 
ATOM   2218  N NE    . ARG A  1 402 ? 191.786 64.277  120.443 1.00 34.45  ? 402 ARG A NE    1 
ATOM   2219  C CZ    . ARG A  1 402 ? 191.833 65.372  119.665 1.00 38.00  ? 402 ARG A CZ    1 
ATOM   2220  N NH1   . ARG A  1 402 ? 190.940 66.382  119.827 1.00 40.12  ? 402 ARG A NH1   1 
ATOM   2221  N NH2   . ARG A  1 402 ? 192.787 65.474  118.721 1.00 38.19  ? 402 ARG A NH2   1 
ATOM   2222  N N     . LEU A  1 403 ? 193.441 64.766  126.289 1.00 19.68  ? 403 LEU A N     1 
ATOM   2223  C CA    . LEU A  1 403 ? 194.823 64.541  126.698 1.00 19.44  ? 403 LEU A CA    1 
ATOM   2224  C C     . LEU A  1 403 ? 194.923 63.935  128.092 1.00 21.11  ? 403 LEU A C     1 
ATOM   2225  O O     . LEU A  1 403 ? 195.571 62.908  128.320 1.00 23.19  ? 403 LEU A O     1 
ATOM   2226  C CB    . LEU A  1 403 ? 195.582 65.864  126.665 1.00 20.27  ? 403 LEU A CB    1 
ATOM   2227  C CG    . LEU A  1 403 ? 196.884 66.037  127.457 1.00 19.90  ? 403 LEU A CG    1 
ATOM   2228  C CD1   . LEU A  1 403 ? 197.593 67.324  127.048 1.00 19.26  ? 403 LEU A CD1   1 
ATOM   2229  C CD2   . LEU A  1 403 ? 196.583 66.101  128.924 1.00 18.49  ? 403 LEU A CD2   1 
ATOM   2230  N N     . MET A  1 404 ? 194.293 64.583  129.045 1.00 25.07  ? 404 MET A N     1 
ATOM   2231  C CA    . MET A  1 404 ? 194.337 64.089  130.406 1.00 28.21  ? 404 MET A CA    1 
ATOM   2232  C C     . MET A  1 404 ? 193.583 62.767  130.573 1.00 31.43  ? 404 MET A C     1 
ATOM   2233  O O     . MET A  1 404 ? 193.329 62.308  131.703 1.00 31.68  ? 404 MET A O     1 
ATOM   2234  C CB    . MET A  1 404 ? 193.743 65.140  131.323 1.00 30.18  ? 404 MET A CB    1 
ATOM   2235  C CG    . MET A  1 404 ? 194.504 66.397  131.280 1.00 28.98  ? 404 MET A CG    1 
ATOM   2236  S SD    . MET A  1 404 ? 196.115 65.966  131.804 1.00 25.74  ? 404 MET A SD    1 
ATOM   2237  C CE    . MET A  1 404 ? 195.705 65.637  133.535 1.00 26.33  ? 404 MET A CE    1 
ATOM   2238  N N     . ASP A  1 405 ? 193.222 62.163  129.442 1.00 43.45  ? 405 ASP A N     1 
ATOM   2239  C CA    . ASP A  1 405 ? 192.475 60.891  129.403 1.00 45.17  ? 405 ASP A CA    1 
ATOM   2240  C C     . ASP A  1 405 ? 193.006 59.811  130.368 1.00 43.36  ? 405 ASP A C     1 
ATOM   2241  O O     . ASP A  1 405 ? 192.479 59.577  131.454 1.00 40.73  ? 405 ASP A O     1 
ATOM   2242  C CB    . ASP A  1 405 ? 192.501 60.347  127.962 1.00 102.59 ? 405 ASP A CB    1 
ATOM   2243  C CG    . ASP A  1 405 ? 191.380 59.374  127.678 1.00 105.85 ? 405 ASP A CG    1 
ATOM   2244  O OD1   . ASP A  1 405 ? 191.211 58.402  128.449 1.00 107.48 ? 405 ASP A OD1   1 
ATOM   2245  O OD2   . ASP A  1 405 ? 190.672 59.587  126.672 1.00 107.98 ? 405 ASP A OD2   1 
ATOM   2246  N N     . LYS A  1 406 ? 194.074 59.166  129.931 1.00 50.00  ? 406 LYS A N     1 
ATOM   2247  C CA    . LYS A  1 406 ? 194.721 58.101  130.667 1.00 51.00  ? 406 LYS A CA    1 
ATOM   2248  C C     . LYS A  1 406 ? 194.913 58.472  132.128 1.00 49.22  ? 406 LYS A C     1 
ATOM   2249  O O     . LYS A  1 406 ? 194.248 57.931  133.003 1.00 49.55  ? 406 LYS A O     1 
ATOM   2250  C CB    . LYS A  1 406 ? 196.065 57.766  130.001 1.00 121.21 ? 406 LYS A CB    1 
ATOM   2251  C CG    . LYS A  1 406 ? 195.972 57.403  128.499 1.00 126.12 ? 406 LYS A CG    1 
ATOM   2252  C CD    . LYS A  1 406 ? 195.546 58.606  127.618 1.00 130.19 ? 406 LYS A CD    1 
ATOM   2253  C CE    . LYS A  1 406 ? 195.215 58.206  126.164 1.00 130.83 ? 406 LYS A CE    1 
ATOM   2254  N NZ    . LYS A  1 406 ? 194.518 59.283  125.376 1.00 128.29 ? 406 LYS A NZ    1 
ATOM   2255  N N     . ILE A  1 407 ? 195.807 59.409  132.393 1.00 52.66  ? 407 ILE A N     1 
ATOM   2256  C CA    . ILE A  1 407 ? 196.065 59.823  133.772 1.00 49.79  ? 407 ILE A CA    1 
ATOM   2257  C C     . ILE A  1 407 ? 194.804 59.965  134.617 1.00 49.52  ? 407 ILE A C     1 
ATOM   2258  O O     . ILE A  1 407 ? 194.780 59.513  135.753 1.00 48.49  ? 407 ILE A O     1 
ATOM   2259  C CB    . ILE A  1 407 ? 196.831 61.171  133.830 1.00 15.06  ? 407 ILE A CB    1 
ATOM   2260  C CG1   . ILE A  1 407 ? 198.143 61.021  133.062 1.00 14.24  ? 407 ILE A CG1   1 
ATOM   2261  C CG2   . ILE A  1 407 ? 197.038 61.623  135.300 1.00 10.18  ? 407 ILE A CG2   1 
ATOM   2262  C CD1   . ILE A  1 407 ? 198.945 62.290  132.932 1.00 14.64  ? 407 ILE A CD1   1 
ATOM   2263  N N     . SER A  1 408 ? 193.763 60.590  134.066 1.00 25.98  ? 408 SER A N     1 
ATOM   2264  C CA    . SER A  1 408 ? 192.533 60.801  134.803 1.00 23.94  ? 408 SER A CA    1 
ATOM   2265  C C     . SER A  1 408 ? 191.999 59.459  135.358 1.00 22.46  ? 408 SER A C     1 
ATOM   2266  O O     . SER A  1 408 ? 191.457 59.401  136.463 1.00 21.73  ? 408 SER A O     1 
ATOM   2267  C CB    . SER A  1 408 ? 191.517 61.504  133.888 1.00 44.10  ? 408 SER A CB    1 
ATOM   2268  O OG    . SER A  1 408 ? 190.570 62.288  134.612 1.00 48.18  ? 408 SER A OG    1 
ATOM   2269  N N     . PHE A  1 409 ? 192.185 58.373  134.615 1.00 34.03  ? 409 PHE A N     1 
ATOM   2270  C CA    . PHE A  1 409 ? 191.709 57.068  135.063 1.00 34.10  ? 409 PHE A CA    1 
ATOM   2271  C C     . PHE A  1 409 ? 192.592 56.507  136.152 1.00 36.36  ? 409 PHE A C     1 
ATOM   2272  O O     . PHE A  1 409 ? 192.196 56.359  137.312 1.00 36.87  ? 409 PHE A O     1 
ATOM   2273  C CB    . PHE A  1 409 ? 191.725 56.085  133.916 1.00 15.22  ? 409 PHE A CB    1 
ATOM   2274  C CG    . PHE A  1 409 ? 191.025 54.812  134.215 1.00 13.04  ? 409 PHE A CG    1 
ATOM   2275  C CD1   . PHE A  1 409 ? 189.694 54.814  134.600 1.00 14.59  ? 409 PHE A CD1   1 
ATOM   2276  C CD2   . PHE A  1 409 ? 191.635 53.614  134.019 1.00 12.56  ? 409 PHE A CD2   1 
ATOM   2277  C CE1   . PHE A  1 409 ? 188.961 53.630  134.777 1.00 13.45  ? 409 PHE A CE1   1 
ATOM   2278  C CE2   . PHE A  1 409 ? 190.911 52.417  134.192 1.00 14.01  ? 409 PHE A CE2   1 
ATOM   2279  C CZ    . PHE A  1 409 ? 189.571 52.435  134.568 1.00 12.62  ? 409 PHE A CZ    1 
ATOM   2280  N N     . SER A  1 410 ? 193.810 56.197  135.730 1.00 29.26  ? 410 SER A N     1 
ATOM   2281  C CA    . SER A  1 410 ? 194.864 55.631  136.564 1.00 30.40  ? 410 SER A CA    1 
ATOM   2282  C C     . SER A  1 410 ? 195.391 56.548  137.684 1.00 30.56  ? 410 SER A C     1 
ATOM   2283  O O     . SER A  1 410 ? 195.930 56.096  138.682 1.00 29.20  ? 410 SER A O     1 
ATOM   2284  C CB    . SER A  1 410 ? 196.006 55.222  135.639 1.00 58.80  ? 410 SER A CB    1 
ATOM   2285  O OG    . SER A  1 410 ? 195.476 54.837  134.375 1.00 58.51  ? 410 SER A OG    1 
ATOM   2286  N N     . ALA A  1 411 ? 195.245 57.845  137.524 1.00 32.42  ? 411 ALA A N     1 
ATOM   2287  C CA    . ALA A  1 411 ? 195.731 58.736  138.554 1.00 35.11  ? 411 ALA A CA    1 
ATOM   2288  C C     . ALA A  1 411 ? 195.317 58.216  139.929 1.00 36.51  ? 411 ALA A C     1 
ATOM   2289  O O     . ALA A  1 411 ? 195.968 58.478  140.931 1.00 35.54  ? 411 ALA A O     1 
ATOM   2290  C CB    . ALA A  1 411 ? 195.172 60.135  138.337 1.00 57.93  ? 411 ALA A CB    1 
ATOM   2291  N N     . SER A  1 412 ? 194.243 57.449  139.980 1.00 37.22  ? 412 SER A N     1 
ATOM   2292  C CA    . SER A  1 412 ? 193.772 56.989  141.267 1.00 39.11  ? 412 SER A CA    1 
ATOM   2293  C C     . SER A  1 412 ? 194.743 56.086  142.001 1.00 39.43  ? 412 SER A C     1 
ATOM   2294  O O     . SER A  1 412 ? 195.117 56.351  143.137 1.00 39.67  ? 412 SER A O     1 
ATOM   2295  C CB    . SER A  1 412 ? 192.426 56.294  141.105 1.00 110.12 ? 412 SER A CB    1 
ATOM   2296  O OG    . SER A  1 412 ? 191.777 56.211  142.357 1.00 111.18 ? 412 SER A OG    1 
ATOM   2297  N N     . ASP A  1 413 ? 195.147 55.013  141.348 1.00 61.33  ? 413 ASP A N     1 
ATOM   2298  C CA    . ASP A  1 413 ? 196.060 54.057  141.947 1.00 63.17  ? 413 ASP A CA    1 
ATOM   2299  C C     . ASP A  1 413 ? 197.477 54.350  141.475 1.00 63.68  ? 413 ASP A C     1 
ATOM   2300  O O     . ASP A  1 413 ? 198.369 53.507  141.527 1.00 63.66  ? 413 ASP A O     1 
ATOM   2301  C CB    . ASP A  1 413 ? 195.630 52.637  141.552 1.00 94.14  ? 413 ASP A CB    1 
ATOM   2302  C CG    . ASP A  1 413 ? 195.609 52.417  140.032 1.00 95.00  ? 413 ASP A CG    1 
ATOM   2303  O OD1   . ASP A  1 413 ? 194.722 51.686  139.540 1.00 94.89  ? 413 ASP A OD1   1 
ATOM   2304  O OD2   . ASP A  1 413 ? 196.483 52.954  139.324 1.00 94.30  ? 413 ASP A OD2   1 
ATOM   2305  N N     . MET A  1 414 ? 197.682 55.570  141.016 1.00 90.96  ? 414 MET A N     1 
ATOM   2306  C CA    . MET A  1 414 ? 198.979 55.970  140.510 1.00 90.50  ? 414 MET A CA    1 
ATOM   2307  C C     . MET A  1 414 ? 199.630 56.951  141.485 1.00 90.80  ? 414 MET A C     1 
ATOM   2308  O O     . MET A  1 414 ? 200.524 57.709  141.127 1.00 90.61  ? 414 MET A O     1 
ATOM   2309  C CB    . MET A  1 414 ? 198.760 56.607  139.150 1.00 41.58  ? 414 MET A CB    1 
ATOM   2310  C CG    . MET A  1 414 ? 199.980 57.087  138.489 1.00 40.36  ? 414 MET A CG    1 
ATOM   2311  S SD    . MET A  1 414 ? 199.494 57.896  136.997 1.00 41.21  ? 414 MET A SD    1 
ATOM   2312  C CE    . MET A  1 414 ? 199.179 56.473  135.937 1.00 39.64  ? 414 MET A CE    1 
ATOM   2313  N N     . ASN A  1 415 ? 199.170 56.907  142.730 1.00 49.38  ? 415 ASN A N     1 
ATOM   2314  C CA    . ASN A  1 415 ? 199.645 57.778  143.792 1.00 49.28  ? 415 ASN A CA    1 
ATOM   2315  C C     . ASN A  1 415 ? 201.134 58.066  143.775 1.00 50.04  ? 415 ASN A C     1 
ATOM   2316  O O     . ASN A  1 415 ? 201.930 57.333  143.175 1.00 50.97  ? 415 ASN A O     1 
ATOM   2317  C CB    . ASN A  1 415 ? 199.281 57.172  145.149 1.00 55.93  ? 415 ASN A CB    1 
ATOM   2318  C CG    . ASN A  1 415 ? 199.630 58.086  146.328 1.00 55.66  ? 415 ASN A CG    1 
ATOM   2319  O OD1   . ASN A  1 415 ? 200.773 58.515  146.495 1.00 53.87  ? 415 ASN A OD1   1 
ATOM   2320  N ND2   . ASN A  1 415 ? 198.634 58.371  147.163 1.00 55.56  ? 415 ASN A ND2   1 
ATOM   2321  N N     . GLY A  1 416 ? 201.500 59.153  144.448 1.00 55.22  ? 416 GLY A N     1 
ATOM   2322  C CA    . GLY A  1 416 ? 202.893 59.535  144.566 1.00 55.61  ? 416 GLY A CA    1 
ATOM   2323  C C     . GLY A  1 416 ? 203.620 59.960  143.310 1.00 56.23  ? 416 GLY A C     1 
ATOM   2324  O O     . GLY A  1 416 ? 204.228 61.032  143.296 1.00 56.02  ? 416 GLY A O     1 
ATOM   2325  N N     . GLN A  1 417 ? 203.575 59.135  142.265 1.00 81.67  ? 417 GLN A N     1 
ATOM   2326  C CA    . GLN A  1 417 ? 204.256 59.456  141.012 1.00 82.97  ? 417 GLN A CA    1 
ATOM   2327  C C     . GLN A  1 417 ? 204.082 60.918  140.587 1.00 83.13  ? 417 GLN A C     1 
ATOM   2328  O O     . GLN A  1 417 ? 203.281 61.663  141.153 1.00 84.16  ? 417 GLN A O     1 
ATOM   2329  C CB    . GLN A  1 417 ? 203.729 58.584  139.874 1.00 83.13  ? 417 GLN A CB    1 
ATOM   2330  C CG    . GLN A  1 417 ? 203.565 57.120  140.185 1.00 85.90  ? 417 GLN A CG    1 
ATOM   2331  C CD    . GLN A  1 417 ? 203.361 56.299  138.919 1.00 89.12  ? 417 GLN A CD    1 
ATOM   2332  O OE1   . GLN A  1 417 ? 203.030 55.114  138.980 1.00 90.24  ? 417 GLN A OE1   1 
ATOM   2333  N NE2   . GLN A  1 417 ? 203.569 56.929  137.762 1.00 89.49  ? 417 GLN A NE2   1 
ATOM   2334  N N     . THR A  1 418 ? 204.845 61.330  139.586 1.00 62.67  ? 418 THR A N     1 
ATOM   2335  C CA    . THR A  1 418 ? 204.706 62.676  139.058 1.00 62.51  ? 418 THR A CA    1 
ATOM   2336  C C     . THR A  1 418 ? 204.795 62.525  137.535 1.00 62.57  ? 418 THR A C     1 
ATOM   2337  O O     . THR A  1 418 ? 205.762 61.947  137.009 1.00 62.37  ? 418 THR A O     1 
ATOM   2338  C CB    . THR A  1 418 ? 205.809 63.606  139.553 1.00 53.36  ? 418 THR A CB    1 
ATOM   2339  O OG1   . THR A  1 418 ? 207.072 63.067  139.161 1.00 55.76  ? 418 THR A OG1   1 
ATOM   2340  C CG2   . THR A  1 418 ? 205.759 63.757  141.060 1.00 52.20  ? 418 THR A CG2   1 
ATOM   2341  N N     . VAL A  1 419 ? 203.770 63.012  136.833 1.00 59.18  ? 419 VAL A N     1 
ATOM   2342  C CA    . VAL A  1 419 ? 203.730 62.910  135.376 1.00 57.94  ? 419 VAL A CA    1 
ATOM   2343  C C     . VAL A  1 419 ? 204.275 64.189  134.806 1.00 57.11  ? 419 VAL A C     1 
ATOM   2344  O O     . VAL A  1 419 ? 203.934 65.287  135.252 1.00 57.56  ? 419 VAL A O     1 
ATOM   2345  C CB    . VAL A  1 419 ? 202.302 62.734  134.846 1.00 112.84 ? 419 VAL A CB    1 
ATOM   2346  C CG1   . VAL A  1 419 ? 202.345 62.117  133.455 1.00 111.61 ? 419 VAL A CG1   1 
ATOM   2347  C CG2   . VAL A  1 419 ? 201.478 61.892  135.810 1.00 114.30 ? 419 VAL A CG2   1 
ATOM   2348  N N     . ASN A  1 420 ? 205.122 64.055  133.808 1.00 49.31  ? 420 ASN A N     1 
ATOM   2349  C CA    . ASN A  1 420 ? 205.707 65.238  133.228 1.00 48.98  ? 420 ASN A CA    1 
ATOM   2350  C C     . ASN A  1 420 ? 205.198 65.405  131.820 1.00 46.06  ? 420 ASN A C     1 
ATOM   2351  O O     . ASN A  1 420 ? 205.789 64.892  130.869 1.00 46.02  ? 420 ASN A O     1 
ATOM   2352  C CB    . ASN A  1 420 ? 207.228 65.124  133.227 1.00 79.01  ? 420 ASN A CB    1 
ATOM   2353  C CG    . ASN A  1 420 ? 207.898 66.445  132.962 1.00 80.37  ? 420 ASN A CG    1 
ATOM   2354  O OD1   . ASN A  1 420 ? 208.644 66.597  131.986 1.00 80.36  ? 420 ASN A OD1   1 
ATOM   2355  N ND2   . ASN A  1 420 ? 207.632 67.421  133.829 1.00 80.63  ? 420 ASN A ND2   1 
ATOM   2356  N N     . ILE A  1 421 ? 204.105 66.145  131.690 1.00 23.16  ? 421 ILE A N     1 
ATOM   2357  C CA    . ILE A  1 421 ? 203.494 66.370  130.393 1.00 19.74  ? 421 ILE A CA    1 
ATOM   2358  C C     . ILE A  1 421 ? 204.249 67.341  129.526 1.00 19.24  ? 421 ILE A C     1 
ATOM   2359  O O     . ILE A  1 421 ? 204.195 68.545  129.743 1.00 18.81  ? 421 ILE A O     1 
ATOM   2360  C CB    . ILE A  1 421 ? 202.097 66.886  130.543 1.00 22.11  ? 421 ILE A CB    1 
ATOM   2361  C CG1   . ILE A  1 421 ? 201.446 66.217  131.763 1.00 21.02  ? 421 ILE A CG1   1 
ATOM   2362  C CG2   . ILE A  1 421 ? 201.364 66.637  129.257 1.00 20.82  ? 421 ILE A CG2   1 
ATOM   2363  C CD1   . ILE A  1 421 ? 199.943 66.284  131.842 1.00 19.03  ? 421 ILE A CD1   1 
ATOM   2364  N N     . ASP A  1 422 ? 204.944 66.807  128.531 1.00 21.78  ? 422 ASP A N     1 
ATOM   2365  C CA    . ASP A  1 422 ? 205.739 67.609  127.612 1.00 22.72  ? 422 ASP A CA    1 
ATOM   2366  C C     . ASP A  1 422 ? 205.175 67.479  126.215 1.00 21.13  ? 422 ASP A C     1 
ATOM   2367  O O     . ASP A  1 422 ? 204.199 66.769  126.004 1.00 20.61  ? 422 ASP A O     1 
ATOM   2368  C CB    . ASP A  1 422 ? 207.201 67.136  127.640 1.00 79.90  ? 422 ASP A CB    1 
ATOM   2369  C CG    . ASP A  1 422 ? 207.353 65.656  127.336 1.00 84.51  ? 422 ASP A CG    1 
ATOM   2370  O OD1   . ASP A  1 422 ? 208.475 65.143  127.514 1.00 85.79  ? 422 ASP A OD1   1 
ATOM   2371  O OD2   . ASP A  1 422 ? 206.366 65.012  126.918 1.00 87.44  ? 422 ASP A OD2   1 
ATOM   2372  N N     . ALA A  1 423 ? 205.792 68.162  125.261 1.00 17.16  ? 423 ALA A N     1 
ATOM   2373  C CA    . ALA A  1 423 ? 205.332 68.115  123.874 1.00 16.63  ? 423 ALA A CA    1 
ATOM   2374  C C     . ALA A  1 423 ? 205.206 66.684  123.405 1.00 16.54  ? 423 ALA A C     1 
ATOM   2375  O O     . ALA A  1 423 ? 204.299 66.348  122.670 1.00 13.74  ? 423 ALA A O     1 
ATOM   2376  C CB    . ALA A  1 423 ? 206.293 68.857  122.977 1.00 29.17  ? 423 ALA A CB    1 
ATOM   2377  N N     . ALA A  1 424 ? 206.138 65.838  123.831 1.00 39.90  ? 424 ALA A N     1 
ATOM   2378  C CA    . ALA A  1 424 ? 206.118 64.440  123.442 1.00 40.31  ? 424 ALA A CA    1 
ATOM   2379  C C     . ALA A  1 424 ? 204.788 63.930  123.880 1.00 39.66  ? 424 ALA A C     1 
ATOM   2380  O O     . ALA A  1 424 ? 203.973 63.547  123.064 1.00 39.96  ? 424 ALA A O     1 
ATOM   2381  C CB    . ALA A  1 424 ? 207.221 63.678  124.148 1.00 77.53  ? 424 ALA A CB    1 
ATOM   2382  N N     . TYR A  1 425 ? 204.570 63.977  125.186 1.00 25.11  ? 425 TYR A N     1 
ATOM   2383  C CA    . TYR A  1 425 ? 203.338 63.495  125.790 1.00 24.59  ? 425 TYR A CA    1 
ATOM   2384  C C     . TYR A  1 425 ? 202.098 63.843  125.021 1.00 23.89  ? 425 TYR A C     1 
ATOM   2385  O O     . TYR A  1 425 ? 201.428 62.989  124.451 1.00 24.43  ? 425 TYR A O     1 
ATOM   2386  C CB    . TYR A  1 425 ? 203.173 64.052  127.190 1.00 30.74  ? 425 TYR A CB    1 
ATOM   2387  C CG    . TYR A  1 425 ? 202.262 63.214  128.038 1.00 31.18  ? 425 TYR A CG    1 
ATOM   2388  C CD1   . TYR A  1 425 ? 202.025 63.562  129.352 1.00 31.08  ? 425 TYR A CD1   1 
ATOM   2389  C CD2   . TYR A  1 425 ? 201.692 62.031  127.544 1.00 31.60  ? 425 TYR A CD2   1 
ATOM   2390  C CE1   . TYR A  1 425 ? 201.263 62.777  130.170 1.00 32.04  ? 425 TYR A CE1   1 
ATOM   2391  C CE2   . TYR A  1 425 ? 200.916 61.229  128.357 1.00 32.95  ? 425 TYR A CE2   1 
ATOM   2392  C CZ    . TYR A  1 425 ? 200.711 61.622  129.683 1.00 33.11  ? 425 TYR A CZ    1 
ATOM   2393  O OH    . TYR A  1 425 ? 199.949 60.891  130.557 1.00 36.44  ? 425 TYR A OH    1 
ATOM   2394  N N     . VAL A  1 426 ? 201.781 65.122  125.054 1.00 17.64  ? 426 VAL A N     1 
ATOM   2395  C CA    . VAL A  1 426 ? 200.609 65.651  124.377 1.00 17.35  ? 426 VAL A CA    1 
ATOM   2396  C C     . VAL A  1 426 ? 200.555 65.131  122.943 1.00 18.07  ? 426 VAL A C     1 
ATOM   2397  O O     . VAL A  1 426 ? 199.587 64.538  122.540 1.00 15.41  ? 426 VAL A O     1 
ATOM   2398  C CB    . VAL A  1 426 ? 200.653 67.217  124.361 1.00 27.52  ? 426 VAL A CB    1 
ATOM   2399  C CG1   . VAL A  1 426 ? 199.470 67.786  123.646 1.00 26.30  ? 426 VAL A CG1   1 
ATOM   2400  C CG2   . VAL A  1 426 ? 200.699 67.739  125.756 1.00 27.20  ? 426 VAL A CG2   1 
ATOM   2401  N N     . ALA A  1 427 ? 201.612 65.353  122.180 1.00 31.48  ? 427 ALA A N     1 
ATOM   2402  C CA    . ALA A  1 427 ? 201.632 64.939  120.790 1.00 33.36  ? 427 ALA A CA    1 
ATOM   2403  C C     . ALA A  1 427 ? 201.148 63.527  120.644 1.00 33.33  ? 427 ALA A C     1 
ATOM   2404  O O     . ALA A  1 427 ? 200.522 63.187  119.644 1.00 30.88  ? 427 ALA A O     1 
ATOM   2405  C CB    . ALA A  1 427 ? 203.034 65.064  120.235 1.00 165.77 ? 427 ALA A CB    1 
ATOM   2406  N N     . ASP A  1 428 ? 201.456 62.711  121.647 1.00 39.92  ? 428 ASP A N     1 
ATOM   2407  C CA    . ASP A  1 428 ? 201.070 61.312  121.659 1.00 44.00  ? 428 ASP A CA    1 
ATOM   2408  C C     . ASP A  1 428 ? 199.598 61.190  122.039 1.00 46.74  ? 428 ASP A C     1 
ATOM   2409  O O     . ASP A  1 428 ? 198.740 60.874  121.198 1.00 46.86  ? 428 ASP A O     1 
ATOM   2410  C CB    . ASP A  1 428 ? 201.947 60.550  122.653 1.00 53.64  ? 428 ASP A CB    1 
ATOM   2411  C CG    . ASP A  1 428 ? 201.291 59.289  123.158 1.00 54.60  ? 428 ASP A CG    1 
ATOM   2412  O OD1   . ASP A  1 428 ? 200.426 59.388  124.056 1.00 55.07  ? 428 ASP A OD1   1 
ATOM   2413  O OD2   . ASP A  1 428 ? 201.629 58.197  122.652 1.00 53.54  ? 428 ASP A OD2   1 
ATOM   2414  N N     . ALA A  1 429 ? 199.307 61.458  123.307 1.00 41.31  ? 429 ALA A N     1 
ATOM   2415  C CA    . ALA A  1 429 ? 197.946 61.392  123.818 1.00 43.69  ? 429 ALA A CA    1 
ATOM   2416  C C     . ALA A  1 429 ? 196.863 61.890  122.861 1.00 45.88  ? 429 ALA A C     1 
ATOM   2417  O O     . ALA A  1 429 ? 195.712 61.530  123.018 1.00 46.19  ? 429 ALA A O     1 
ATOM   2418  C CB    . ALA A  1 429 ? 197.856 62.164  125.121 1.00 72.56  ? 429 ALA A CB    1 
ATOM   2419  N N     . LEU A  1 430 ? 197.207 62.714  121.882 1.00 40.53  ? 430 LEU A N     1 
ATOM   2420  C CA    . LEU A  1 430 ? 196.188 63.211  120.986 1.00 43.64  ? 430 LEU A CA    1 
ATOM   2421  C C     . LEU A  1 430 ? 196.038 62.401  119.733 1.00 49.70  ? 430 LEU A C     1 
ATOM   2422  O O     . LEU A  1 430 ? 194.931 62.091  119.352 1.00 51.25  ? 430 LEU A O     1 
ATOM   2423  C CB    . LEU A  1 430 ? 196.424 64.684  120.615 1.00 9.20   ? 430 LEU A CB    1 
ATOM   2424  C CG    . LEU A  1 430 ? 196.421 65.672  121.790 1.00 4.74   ? 430 LEU A CG    1 
ATOM   2425  C CD1   . LEU A  1 430 ? 196.531 67.082  121.305 1.00 2.82   ? 430 LEU A CD1   1 
ATOM   2426  C CD2   . LEU A  1 430 ? 195.154 65.531  122.582 1.00 2.15   ? 430 LEU A CD2   1 
ATOM   2427  N N     . GLY A  1 431 ? 197.122 62.029  119.080 1.00 68.60  ? 431 GLY A N     1 
ATOM   2428  C CA    . GLY A  1 431 ? 196.946 61.291  117.840 1.00 77.24  ? 431 GLY A CA    1 
ATOM   2429  C C     . GLY A  1 431 ? 196.915 62.259  116.658 1.00 83.35  ? 431 GLY A C     1 
ATOM   2430  O O     . GLY A  1 431 ? 197.322 63.419  116.784 1.00 83.75  ? 431 GLY A O     1 
ATOM   2431  N N     . GLU A  1 432 ? 196.410 61.808  115.516 1.00 141.09 ? 432 GLU A N     1 
ATOM   2432  C CA    . GLU A  1 432 ? 196.389 62.645  114.319 1.00 148.40 ? 432 GLU A CA    1 
ATOM   2433  C C     . GLU A  1 432 ? 195.056 63.354  114.084 1.00 152.92 ? 432 GLU A C     1 
ATOM   2434  O O     . GLU A  1 432 ? 194.064 63.018  114.723 1.00 154.00 ? 432 GLU A O     1 
ATOM   2435  C CB    . GLU A  1 432 ? 196.764 61.760  113.132 1.00 190.16 ? 432 GLU A CB    1 
ATOM   2436  C CG    . GLU A  1 432 ? 197.987 60.893  113.451 1.00 192.71 ? 432 GLU A CG    1 
ATOM   2437  C CD    . GLU A  1 432 ? 198.225 59.777  112.456 1.00 193.89 ? 432 GLU A CD    1 
ATOM   2438  O OE1   . GLU A  1 432 ? 198.486 60.077  111.272 1.00 194.39 ? 432 GLU A OE1   1 
ATOM   2439  O OE2   . GLU A  1 432 ? 198.161 58.596  112.862 1.00 193.89 ? 432 GLU A OE2   1 
ATOM   2440  N N     . VAL A  1 433 ? 195.032 64.339  113.185 1.00 148.93 ? 433 VAL A N     1 
ATOM   2441  C CA    . VAL A  1 433 ? 193.796 65.076  112.886 1.00 153.93 ? 433 VAL A CA    1 
ATOM   2442  C C     . VAL A  1 433 ? 193.171 64.647  111.554 1.00 157.23 ? 433 VAL A C     1 
ATOM   2443  O O     . VAL A  1 433 ? 193.883 64.360  110.593 1.00 157.88 ? 433 VAL A O     1 
ATOM   2444  C CB    . VAL A  1 433 ? 194.030 66.612  112.805 1.00 92.87  ? 433 VAL A CB    1 
ATOM   2445  C CG1   . VAL A  1 433 ? 192.695 67.318  112.577 1.00 93.01  ? 433 VAL A CG1   1 
ATOM   2446  C CG2   . VAL A  1 433 ? 194.704 67.126  114.072 1.00 92.77  ? 433 VAL A CG2   1 
ATOM   2447  N N     . VAL A  1 434 ? 191.840 64.605  111.508 1.00 196.36 ? 434 VAL A N     1 
ATOM   2448  C CA    . VAL A  1 434 ? 191.105 64.239  110.292 1.00 199.69 ? 434 VAL A CA    1 
ATOM   2449  C C     . VAL A  1 434 ? 190.600 65.556  109.686 1.00 199.71 ? 434 VAL A C     1 
ATOM   2450  O O     . VAL A  1 434 ? 190.398 66.526  110.419 1.00 199.71 ? 434 VAL A O     1 
ATOM   2451  C CB    . VAL A  1 434 ? 189.898 63.293  110.618 1.00 155.76 ? 434 VAL A CB    1 
ATOM   2452  C CG1   . VAL A  1 434 ? 189.057 63.032  109.356 1.00 71.59  ? 434 VAL A CG1   1 
ATOM   2453  C CG2   . VAL A  1 434 ? 190.413 61.963  111.199 1.00 71.59  ? 434 VAL A CG2   1 
ATOM   2454  N N     . GLU A  1 435 ? 190.411 65.605  108.365 1.00 136.31 ? 435 GLU A N     1 
ATOM   2455  C CA    . GLU A  1 435 ? 189.951 66.840  107.721 1.00 136.31 ? 435 GLU A CA    1 
ATOM   2456  C C     . GLU A  1 435 ? 189.240 66.714  106.370 1.00 136.31 ? 435 GLU A C     1 
ATOM   2457  O O     . GLU A  1 435 ? 188.022 66.869  106.294 1.00 136.31 ? 435 GLU A O     1 
ATOM   2458  C CB    . GLU A  1 435 ? 191.125 67.819  107.569 1.00 162.66 ? 435 GLU A CB    1 
ATOM   2459  C CG    . GLU A  1 435 ? 192.326 67.262  106.812 1.00 164.05 ? 435 GLU A CG    1 
ATOM   2460  C CD    . GLU A  1 435 ? 193.329 68.331  106.426 1.00 164.72 ? 435 GLU A CD    1 
ATOM   2461  O OE1   . GLU A  1 435 ? 194.373 67.980  105.835 1.00 165.33 ? 435 GLU A OE1   1 
ATOM   2462  O OE2   . GLU A  1 435 ? 193.073 69.521  106.707 1.00 164.27 ? 435 GLU A OE2   1 
ATOM   2463  N N     . ASN A  1 436 ? 190.009 66.460  105.310 1.00 133.55 ? 436 ASN A N     1 
ATOM   2464  C CA    . ASN A  1 436 ? 189.480 66.334  103.949 1.00 133.04 ? 436 ASN A CA    1 
ATOM   2465  C C     . ASN A  1 436 ? 188.377 65.291  103.796 1.00 132.42 ? 436 ASN A C     1 
ATOM   2466  O O     . ASN A  1 436 ? 188.274 64.605  102.770 1.00 132.41 ? 436 ASN A O     1 
ATOM   2467  C CB    . ASN A  1 436 ? 190.614 66.036  102.959 1.00 200.00 ? 436 ASN A CB    1 
ATOM   2468  C CG    . ASN A  1 436 ? 191.540 67.220  102.758 1.00 186.19 ? 436 ASN A CG    1 
ATOM   2469  O OD1   . ASN A  1 436 ? 191.114 68.288  102.318 1.00 186.19 ? 436 ASN A OD1   1 
ATOM   2470  N ND2   . ASN A  1 436 ? 192.816 67.036  103.078 1.00 186.19 ? 436 ASN A ND2   1 
ATOM   2471  N N     . GLU A  1 437 ? 187.563 65.174  104.838 1.00 200.00 ? 437 GLU A N     1 
ATOM   2472  C CA    . GLU A  1 437 ? 186.428 64.270  104.852 1.00 200.00 ? 437 GLU A CA    1 
ATOM   2473  C C     . GLU A  1 437 ? 185.660 64.601  103.578 1.00 200.00 ? 437 GLU A C     1 
ATOM   2474  O O     . GLU A  1 437 ? 185.244 63.710  102.834 1.00 200.00 ? 437 GLU A O     1 
ATOM   2475  C CB    . GLU A  1 437 ? 185.565 64.571  106.081 1.00 184.20 ? 437 GLU A CB    1 
ATOM   2476  C CG    . GLU A  1 437 ? 184.198 63.916  106.100 1.00 185.68 ? 437 GLU A CG    1 
ATOM   2477  C CD    . GLU A  1 437 ? 183.240 64.619  107.050 1.00 186.82 ? 437 GLU A CD    1 
ATOM   2478  O OE1   . GLU A  1 437 ? 182.818 65.755  106.742 1.00 187.33 ? 437 GLU A OE1   1 
ATOM   2479  O OE2   . GLU A  1 437 ? 182.919 64.041  108.108 1.00 187.63 ? 437 GLU A OE2   1 
ATOM   2480  N N     . ASP A  1 438 ? 185.504 65.904  103.340 1.00 162.46 ? 438 ASP A N     1 
ATOM   2481  C CA    . ASP A  1 438 ? 184.801 66.435  102.175 1.00 159.02 ? 438 ASP A CA    1 
ATOM   2482  C C     . ASP A  1 438 ? 185.459 65.970  100.901 1.00 156.98 ? 438 ASP A C     1 
ATOM   2483  O O     . ASP A  1 438 ? 185.895 64.824  100.793 1.00 157.40 ? 438 ASP A O     1 
ATOM   2484  C CB    . ASP A  1 438 ? 184.813 67.964  102.192 1.00 200.00 ? 438 ASP A CB    1 
ATOM   2485  C CG    . ASP A  1 438 ? 184.153 68.539  103.431 1.00 200.00 ? 438 ASP A CG    1 
ATOM   2486  O OD1   . ASP A  1 438 ? 182.951 68.275  103.644 1.00 200.00 ? 438 ASP A OD1   1 
ATOM   2487  O OD2   . ASP A  1 438 ? 184.838 69.255  104.191 1.00 200.00 ? 438 ASP A OD2   1 
ATOM   2488  N N     . LEU A  1 439 ? 185.540 66.877  99.937  1.00 114.98 ? 439 LEU A N     1 
ATOM   2489  C CA    . LEU A  1 439 ? 186.149 66.544  98.665  1.00 112.67 ? 439 LEU A CA    1 
ATOM   2490  C C     . LEU A  1 439 ? 185.541 65.230  98.187  1.00 110.78 ? 439 LEU A C     1 
ATOM   2491  O O     . LEU A  1 439 ? 184.435 64.866  98.596  1.00 110.61 ? 439 LEU A O     1 
ATOM   2492  C CB    . LEU A  1 439 ? 187.666 66.385  98.826  1.00 200.00 ? 439 LEU A CB    1 
ATOM   2493  C CG    . LEU A  1 439 ? 188.503 67.629  99.134  1.00 177.83 ? 439 LEU A CG    1 
ATOM   2494  C CD1   . LEU A  1 439 ? 189.916 67.217  99.515  1.00 177.83 ? 439 LEU A CD1   1 
ATOM   2495  C CD2   . LEU A  1 439 ? 188.523 68.542  97.921  1.00 177.83 ? 439 LEU A CD2   1 
ATOM   2496  N N     . SER A  1 440 ? 186.278 64.521  97.334  1.00 46.52  ? 440 SER A N     1 
ATOM   2497  C CA    . SER A  1 440 ? 185.831 63.251  96.794  1.00 44.78  ? 440 SER A CA    1 
ATOM   2498  C C     . SER A  1 440 ? 184.318 63.201  96.635  1.00 42.30  ? 440 SER A C     1 
ATOM   2499  O O     . SER A  1 440 ? 183.753 63.947  95.844  1.00 40.94  ? 440 SER A O     1 
ATOM   2500  C CB    . SER A  1 440 ? 186.296 62.109  97.703  1.00 200.00 ? 440 SER A CB    1 
ATOM   2501  O OG    . SER A  1 440 ? 185.808 62.279  99.024  1.00 200.00 ? 440 SER A OG    1 
ATOM   2502  N N     . ARG A  1 441 ? 183.691 62.310  97.401  1.00 127.04 ? 441 ARG A N     1 
ATOM   2503  C CA    . ARG A  1 441 ? 182.248 62.084  97.404  1.00 125.29 ? 441 ARG A CA    1 
ATOM   2504  C C     . ARG A  1 441 ? 181.363 63.121  96.705  1.00 122.49 ? 441 ARG A C     1 
ATOM   2505  O O     . ARG A  1 441 ? 180.454 62.766  95.947  1.00 122.24 ? 441 ARG A O     1 
ATOM   2506  C CB    . ARG A  1 441 ? 181.766 61.915  98.849  1.00 175.92 ? 441 ARG A CB    1 
ATOM   2507  C CG    . ARG A  1 441 ? 182.276 60.667  99.536  1.00 178.91 ? 441 ARG A CG    1 
ATOM   2508  C CD    . ARG A  1 441 ? 181.803 59.421  98.807  1.00 181.82 ? 441 ARG A CD    1 
ATOM   2509  N NE    . ARG A  1 441 ? 182.134 58.203  99.536  1.00 183.95 ? 441 ARG A NE    1 
ATOM   2510  C CZ    . ARG A  1 441 ? 181.659 57.907  100.741 1.00 184.90 ? 441 ARG A CZ    1 
ATOM   2511  N NH1   . ARG A  1 441 ? 180.830 58.744  101.352 1.00 185.07 ? 441 ARG A NH1   1 
ATOM   2512  N NH2   . ARG A  1 441 ? 182.013 56.774  101.336 1.00 185.50 ? 441 ARG A NH2   1 
ATOM   2513  N N     . PHE A  1 442 ? 181.623 64.397  96.974  1.00 91.82  ? 442 PHE A N     1 
ATOM   2514  C CA    . PHE A  1 442 ? 180.841 65.477  96.401  1.00 87.23  ? 442 PHE A CA    1 
ATOM   2515  C C     . PHE A  1 442 ? 181.717 66.307  95.488  1.00 84.80  ? 442 PHE A C     1 
ATOM   2516  O O     . PHE A  1 442 ? 181.601 67.520  95.454  1.00 84.69  ? 442 PHE A O     1 
ATOM   2517  C CB    . PHE A  1 442 ? 180.300 66.371  97.517  1.00 120.00 ? 442 PHE A CB    1 
ATOM   2518  C CG    . PHE A  1 442 ? 179.957 65.627  98.779  1.00 119.29 ? 442 PHE A CG    1 
ATOM   2519  C CD1   . PHE A  1 442 ? 178.957 64.653  98.787  1.00 118.85 ? 442 PHE A CD1   1 
ATOM   2520  C CD2   . PHE A  1 442 ? 180.643 65.894  99.964  1.00 118.26 ? 442 PHE A CD2   1 
ATOM   2521  C CE1   . PHE A  1 442 ? 178.645 63.954  99.955  1.00 118.88 ? 442 PHE A CE1   1 
ATOM   2522  C CE2   . PHE A  1 442 ? 180.338 65.199  101.140 1.00 118.16 ? 442 PHE A CE2   1 
ATOM   2523  C CZ    . PHE A  1 442 ? 179.338 64.229  101.135 1.00 118.24 ? 442 PHE A CZ    1 
ATOM   2524  N N     . ILE A  1 443 ? 182.604 65.667  94.749  1.00 56.02  ? 443 ILE A N     1 
ATOM   2525  C CA    . ILE A  1 443 ? 183.466 66.418  93.866  1.00 53.41  ? 443 ILE A CA    1 
ATOM   2526  C C     . ILE A  1 443 ? 183.808 65.663  92.602  1.00 53.66  ? 443 ILE A C     1 
ATOM   2527  O O     . ILE A  1 443 ? 184.232 64.509  92.654  1.00 54.85  ? 443 ILE A O     1 
ATOM   2528  C CB    . ILE A  1 443 ? 184.783 66.832  94.581  1.00 30.96  ? 443 ILE A CB    1 
ATOM   2529  C CG1   . ILE A  1 443 ? 184.526 68.041  95.493  1.00 30.07  ? 443 ILE A CG1   1 
ATOM   2530  C CG2   . ILE A  1 443 ? 185.872 67.157  93.556  1.00 30.02  ? 443 ILE A CG2   1 
ATOM   2531  C CD1   . ILE A  1 443 ? 185.781 68.807  95.929  1.00 28.12  ? 443 ILE A CD1   1 
ATOM   2532  N N     . LEU A  1 444 ? 183.626 66.330  91.465  1.00 87.46  ? 444 LEU A N     1 
ATOM   2533  C CA    . LEU A  1 444 ? 183.937 65.751  90.157  1.00 86.44  ? 444 LEU A CA    1 
ATOM   2534  C C     . LEU A  1 444 ? 184.782 66.697  89.306  1.00 86.33  ? 444 LEU A C     1 
ATOM   2535  O O     . LEU A  1 444 ? 185.849 66.262  88.828  1.00 86.40  ? 444 LEU A O     1 
ATOM   2536  C CB    . LEU A  1 444 ? 182.650 65.399  89.415  1.00 42.73  ? 444 LEU A CB    1 
ATOM   2537  C CG    . LEU A  1 444 ? 182.705 65.265  87.899  1.00 40.92  ? 444 LEU A CG    1 
ATOM   2538  C CD1   . LEU A  1 444 ? 181.665 64.275  87.460  1.00 40.69  ? 444 LEU A CD1   1 
ATOM   2539  C CD2   . LEU A  1 444 ? 182.470 66.615  87.258  1.00 40.77  ? 444 LEU A CD2   1 
ATOM   2540  N N     . SER B  1 2   ? 185.784 56.741  150.732 1.00 141.86 ? 2   SER B N     1 
ATOM   2541  C CA    . SER B  1 2   ? 184.926 57.939  150.517 1.00 142.32 ? 2   SER B CA    1 
ATOM   2542  C C     . SER B  1 2   ? 184.077 57.771  149.261 1.00 140.99 ? 2   SER B C     1 
ATOM   2543  O O     . SER B  1 2   ? 182.948 58.263  149.186 1.00 142.16 ? 2   SER B O     1 
ATOM   2544  C CB    . SER B  1 2   ? 185.797 59.191  150.374 1.00 143.22 ? 2   SER B CB    1 
ATOM   2545  O OG    . SER B  1 2   ? 186.618 59.381  151.512 1.00 145.05 ? 2   SER B OG    1 
ATOM   2546  N N     . GLU B  1 3   ? 184.632 57.074  148.277 1.00 66.72  ? 3   GLU B N     1 
ATOM   2547  C CA    . GLU B  1 3   ? 183.943 56.844  147.017 1.00 62.56  ? 3   GLU B CA    1 
ATOM   2548  C C     . GLU B  1 3   ? 184.779 55.873  146.203 1.00 59.16  ? 3   GLU B C     1 
ATOM   2549  O O     . GLU B  1 3   ? 185.980 55.718  146.440 1.00 59.07  ? 3   GLU B O     1 
ATOM   2550  C CB    . GLU B  1 3   ? 183.778 58.156  146.250 1.00 88.59  ? 3   GLU B CB    1 
ATOM   2551  C CG    . GLU B  1 3   ? 182.864 58.059  145.039 1.00 91.01  ? 3   GLU B CG    1 
ATOM   2552  C CD    . GLU B  1 3   ? 181.505 57.483  145.394 1.00 92.91  ? 3   GLU B CD    1 
ATOM   2553  O OE1   . GLU B  1 3   ? 181.364 56.238  145.405 1.00 93.75  ? 3   GLU B OE1   1 
ATOM   2554  O OE2   . GLU B  1 3   ? 180.582 58.277  145.681 1.00 92.90  ? 3   GLU B OE2   1 
ATOM   2555  N N     . MET B  1 4   ? 184.152 55.224  145.233 1.00 42.66  ? 4   MET B N     1 
ATOM   2556  C CA    . MET B  1 4   ? 184.851 54.246  144.418 1.00 38.35  ? 4   MET B CA    1 
ATOM   2557  C C     . MET B  1 4   ? 185.881 54.883  143.538 1.00 35.65  ? 4   MET B C     1 
ATOM   2558  O O     . MET B  1 4   ? 186.110 56.079  143.611 1.00 35.61  ? 4   MET B O     1 
ATOM   2559  C CB    . MET B  1 4   ? 183.840 53.486  143.593 1.00 54.21  ? 4   MET B CB    1 
ATOM   2560  C CG    . MET B  1 4   ? 182.686 53.029  144.450 1.00 53.31  ? 4   MET B CG    1 
ATOM   2561  S SD    . MET B  1 4   ? 181.722 51.888  143.578 1.00 55.95  ? 4   MET B SD    1 
ATOM   2562  C CE    . MET B  1 4   ? 182.975 51.234  142.368 1.00 53.88  ? 4   MET B CE    1 
ATOM   2563  N N     . THR B  1 5   ? 186.490 54.090  142.678 1.00 25.25  ? 5   THR B N     1 
ATOM   2564  C CA    . THR B  1 5   ? 187.523 54.628  141.808 1.00 23.10  ? 5   THR B CA    1 
ATOM   2565  C C     . THR B  1 5   ? 187.361 54.291  140.339 1.00 21.59  ? 5   THR B C     1 
ATOM   2566  O O     . THR B  1 5   ? 186.562 53.440  139.964 1.00 20.87  ? 5   THR B O     1 
ATOM   2567  C CB    . THR B  1 5   ? 188.845 54.111  142.243 1.00 27.00  ? 5   THR B CB    1 
ATOM   2568  O OG1   . THR B  1 5   ? 189.251 53.055  141.363 1.00 26.62  ? 5   THR B OG1   1 
ATOM   2569  C CG2   . THR B  1 5   ? 188.715 53.579  143.662 1.00 27.42  ? 5   THR B CG2   1 
ATOM   2570  N N     . PRO B  1 6   ? 188.137 54.956  139.482 1.00 37.73  ? 6   PRO B N     1 
ATOM   2571  C CA    . PRO B  1 6   ? 188.036 54.686  138.056 1.00 37.47  ? 6   PRO B CA    1 
ATOM   2572  C C     . PRO B  1 6   ? 187.902 53.208  137.813 1.00 37.78  ? 6   PRO B C     1 
ATOM   2573  O O     . PRO B  1 6   ? 186.822 52.740  137.480 1.00 38.66  ? 6   PRO B O     1 
ATOM   2574  C CB    . PRO B  1 6   ? 189.333 55.249  137.521 1.00 47.38  ? 6   PRO B CB    1 
ATOM   2575  C CG    . PRO B  1 6   ? 189.498 56.461  138.333 1.00 49.08  ? 6   PRO B CG    1 
ATOM   2576  C CD    . PRO B  1 6   ? 189.160 55.981  139.742 1.00 48.84  ? 6   PRO B CD    1 
ATOM   2577  N N     . ARG B  1 7   ? 188.985 52.466  138.034 1.00 36.76  ? 7   ARG B N     1 
ATOM   2578  C CA    . ARG B  1 7   ? 188.997 51.015  137.783 1.00 37.56  ? 7   ARG B CA    1 
ATOM   2579  C C     . ARG B  1 7   ? 187.964 50.284  138.618 1.00 35.12  ? 7   ARG B C     1 
ATOM   2580  O O     . ARG B  1 7   ? 187.330 49.333  138.166 1.00 35.06  ? 7   ARG B O     1 
ATOM   2581  C CB    . ARG B  1 7   ? 190.407 50.454  138.050 1.00 91.14  ? 7   ARG B CB    1 
ATOM   2582  C CG    . ARG B  1 7   ? 190.781 49.129  137.340 1.00 96.25  ? 7   ARG B CG    1 
ATOM   2583  C CD    . ARG B  1 7   ? 192.305 48.912  137.403 1.00 100.90 ? 7   ARG B CD    1 
ATOM   2584  N NE    . ARG B  1 7   ? 192.843 49.422  138.664 1.00 105.21 ? 7   ARG B NE    1 
ATOM   2585  C CZ    . ARG B  1 7   ? 192.570 48.902  139.857 1.00 107.08 ? 7   ARG B CZ    1 
ATOM   2586  N NH1   . ARG B  1 7   ? 191.778 47.841  139.946 1.00 106.45 ? 7   ARG B NH1   1 
ATOM   2587  N NH2   . ARG B  1 7   ? 193.044 49.469  140.964 1.00 107.72 ? 7   ARG B NH2   1 
ATOM   2588  N N     . GLU B  1 8   ? 187.794 50.772  139.833 1.00 23.92  ? 8   GLU B N     1 
ATOM   2589  C CA    . GLU B  1 8   ? 186.866 50.216  140.797 1.00 22.61  ? 8   GLU B CA    1 
ATOM   2590  C C     . GLU B  1 8   ? 185.438 50.228  140.233 1.00 20.27  ? 8   GLU B C     1 
ATOM   2591  O O     . GLU B  1 8   ? 184.718 49.219  140.280 1.00 20.11  ? 8   GLU B O     1 
ATOM   2592  C CB    . GLU B  1 8   ? 186.966 51.054  142.082 1.00 69.72  ? 8   GLU B CB    1 
ATOM   2593  C CG    . GLU B  1 8   ? 186.506 50.386  143.359 1.00 74.35  ? 8   GLU B CG    1 
ATOM   2594  C CD    . GLU B  1 8   ? 187.351 50.789  144.564 1.00 77.23  ? 8   GLU B CD    1 
ATOM   2595  O OE1   . GLU B  1 8   ? 188.421 50.174  144.792 1.00 77.60  ? 8   GLU B OE1   1 
ATOM   2596  O OE2   . GLU B  1 8   ? 186.945 51.732  145.277 1.00 79.14  ? 8   GLU B OE2   1 
ATOM   2597  N N     . ILE B  1 9   ? 185.038 51.377  139.695 1.00 39.85  ? 9   ILE B N     1 
ATOM   2598  C CA    . ILE B  1 9   ? 183.708 51.524  139.139 1.00 35.97  ? 9   ILE B CA    1 
ATOM   2599  C C     . ILE B  1 9   ? 183.522 50.665  137.915 1.00 34.64  ? 9   ILE B C     1 
ATOM   2600  O O     . ILE B  1 9   ? 182.472 50.072  137.718 1.00 33.89  ? 9   ILE B O     1 
ATOM   2601  C CB    . ILE B  1 9   ? 183.417 52.936  138.658 1.00 15.23  ? 9   ILE B CB    1 
ATOM   2602  C CG1   . ILE B  1 9   ? 183.619 53.953  139.754 1.00 13.74  ? 9   ILE B CG1   1 
ATOM   2603  C CG2   . ILE B  1 9   ? 181.986 53.009  138.209 1.00 15.81  ? 9   ILE B CG2   1 
ATOM   2604  C CD1   . ILE B  1 9   ? 183.248 55.354  139.281 1.00 12.49  ? 9   ILE B CD1   1 
ATOM   2605  N N     . VAL B  1 10  ? 184.535 50.628  137.069 1.00 13.87  ? 10  VAL B N     1 
ATOM   2606  C CA    . VAL B  1 10  ? 184.388 49.877  135.871 1.00 13.01  ? 10  VAL B CA    1 
ATOM   2607  C C     . VAL B  1 10  ? 184.044 48.501  136.285 1.00 15.59  ? 10  VAL B C     1 
ATOM   2608  O O     . VAL B  1 10  ? 183.127 47.922  135.712 1.00 18.52  ? 10  VAL B O     1 
ATOM   2609  C CB    . VAL B  1 10  ? 185.636 49.853  135.058 1.00 6.63   ? 10  VAL B CB    1 
ATOM   2610  C CG1   . VAL B  1 10  ? 185.389 49.117  133.787 1.00 7.75   ? 10  VAL B CG1   1 
ATOM   2611  C CG2   . VAL B  1 10  ? 186.049 51.251  134.711 1.00 5.99   ? 10  VAL B CG2   1 
ATOM   2612  N N     . SER B  1 11  ? 184.746 47.971  137.288 1.00 27.12  ? 11  SER B N     1 
ATOM   2613  C CA    . SER B  1 11  ? 184.465 46.610  137.769 1.00 29.77  ? 11  SER B CA    1 
ATOM   2614  C C     . SER B  1 11  ? 182.956 46.458  137.973 1.00 29.46  ? 11  SER B C     1 
ATOM   2615  O O     . SER B  1 11  ? 182.290 45.686  137.278 1.00 29.75  ? 11  SER B O     1 
ATOM   2616  C CB    . SER B  1 11  ? 185.199 46.356  139.079 1.00 94.37  ? 11  SER B CB    1 
ATOM   2617  O OG    . SER B  1 11  ? 186.596 46.451  138.875 1.00 99.77  ? 11  SER B OG    1 
ATOM   2618  N N     . GLU B  1 12  ? 182.422 47.217  138.919 1.00 16.39  ? 12  GLU B N     1 
ATOM   2619  C CA    . GLU B  1 12  ? 180.998 47.204  139.187 1.00 17.03  ? 12  GLU B CA    1 
ATOM   2620  C C     . GLU B  1 12  ? 180.172 47.228  137.885 1.00 14.42  ? 12  GLU B C     1 
ATOM   2621  O O     . GLU B  1 12  ? 179.143 46.604  137.800 1.00 13.63  ? 12  GLU B O     1 
ATOM   2622  C CB    . GLU B  1 12  ? 180.648 48.419  140.036 1.00 90.39  ? 12  GLU B CB    1 
ATOM   2623  C CG    . GLU B  1 12  ? 179.203 48.512  140.434 1.00 97.03  ? 12  GLU B CG    1 
ATOM   2624  C CD    . GLU B  1 12  ? 178.828 47.417  141.377 1.00 102.12 ? 12  GLU B CD    1 
ATOM   2625  O OE1   . GLU B  1 12  ? 179.654 47.126  142.267 1.00 104.56 ? 12  GLU B OE1   1 
ATOM   2626  O OE2   . GLU B  1 12  ? 177.718 46.857  141.235 1.00 105.62 ? 12  GLU B OE2   1 
ATOM   2627  N N     . LEU B  1 13  ? 180.610 47.946  136.862 1.00 15.34  ? 13  LEU B N     1 
ATOM   2628  C CA    . LEU B  1 13  ? 179.830 48.009  135.633 1.00 13.74  ? 13  LEU B CA    1 
ATOM   2629  C C     . LEU B  1 13  ? 179.931 46.736  134.902 1.00 15.32  ? 13  LEU B C     1 
ATOM   2630  O O     . LEU B  1 13  ? 178.967 46.294  134.317 1.00 17.23  ? 13  LEU B O     1 
ATOM   2631  C CB    . LEU B  1 13  ? 180.327 49.090  134.701 1.00 1.00   ? 13  LEU B CB    1 
ATOM   2632  C CG    . LEU B  1 13  ? 180.196 50.507  135.191 1.00 1.00   ? 13  LEU B CG    1 
ATOM   2633  C CD1   . LEU B  1 13  ? 180.862 51.331  134.160 1.00 1.00   ? 13  LEU B CD1   1 
ATOM   2634  C CD2   . LEU B  1 13  ? 178.760 50.917  135.394 1.00 1.00   ? 13  LEU B CD2   1 
ATOM   2635  N N     . ASP B  1 14  ? 181.117 46.155  134.903 1.00 30.74  ? 14  ASP B N     1 
ATOM   2636  C CA    . ASP B  1 14  ? 181.313 44.907  134.199 1.00 32.73  ? 14  ASP B CA    1 
ATOM   2637  C C     . ASP B  1 14  ? 180.344 43.867  134.709 1.00 33.67  ? 14  ASP B C     1 
ATOM   2638  O O     . ASP B  1 14  ? 180.041 42.896  134.010 1.00 34.28  ? 14  ASP B O     1 
ATOM   2639  C CB    . ASP B  1 14  ? 182.735 44.397  134.380 1.00 41.48  ? 14  ASP B CB    1 
ATOM   2640  C CG    . ASP B  1 14  ? 183.740 45.215  133.624 1.00 43.09  ? 14  ASP B CG    1 
ATOM   2641  O OD1   . ASP B  1 14  ? 183.500 45.493  132.429 1.00 43.93  ? 14  ASP B OD1   1 
ATOM   2642  O OD2   . ASP B  1 14  ? 184.775 45.568  134.225 1.00 44.64  ? 14  ASP B OD2   1 
ATOM   2643  N N     . GLN B  1 15  ? 179.852 44.059  135.924 1.00 28.94  ? 15  GLN B N     1 
ATOM   2644  C CA    . GLN B  1 15  ? 178.931 43.092  136.458 1.00 30.80  ? 15  GLN B CA    1 
ATOM   2645  C C     . GLN B  1 15  ? 177.643 43.038  135.650 1.00 30.05  ? 15  GLN B C     1 
ATOM   2646  O O     . GLN B  1 15  ? 177.086 41.951  135.459 1.00 33.60  ? 15  GLN B O     1 
ATOM   2647  C CB    . GLN B  1 15  ? 178.658 43.361  137.933 1.00 78.10  ? 15  GLN B CB    1 
ATOM   2648  C CG    . GLN B  1 15  ? 179.584 42.584  138.862 1.00 84.06  ? 15  GLN B CG    1 
ATOM   2649  C CD    . GLN B  1 15  ? 179.490 43.050  140.306 1.00 89.33  ? 15  GLN B CD    1 
ATOM   2650  O OE1   . GLN B  1 15  ? 178.396 43.253  140.835 1.00 90.92  ? 15  GLN B OE1   1 
ATOM   2651  N NE2   . GLN B  1 15  ? 180.641 43.216  140.955 1.00 91.96  ? 15  GLN B NE2   1 
ATOM   2652  N N     . HIS B  1 16  ? 177.170 44.168  135.135 1.00 31.46  ? 16  HIS B N     1 
ATOM   2653  C CA    . HIS B  1 16  ? 175.943 44.119  134.347 1.00 29.22  ? 16  HIS B CA    1 
ATOM   2654  C C     . HIS B  1 16  ? 176.009 44.371  132.851 1.00 25.78  ? 16  HIS B C     1 
ATOM   2655  O O     . HIS B  1 16  ? 175.048 44.086  132.159 1.00 26.69  ? 16  HIS B O     1 
ATOM   2656  C CB    . HIS B  1 16  ? 174.924 45.066  134.894 1.00 35.60  ? 16  HIS B CB    1 
ATOM   2657  C CG    . HIS B  1 16  ? 174.803 45.022  136.366 1.00 39.09  ? 16  HIS B CG    1 
ATOM   2658  N ND1   . HIS B  1 16  ? 175.823 45.407  137.201 1.00 41.85  ? 16  HIS B ND1   1 
ATOM   2659  C CD2   . HIS B  1 16  ? 173.741 44.770  137.156 1.00 41.09  ? 16  HIS B CD2   1 
ATOM   2660  C CE1   . HIS B  1 16  ? 175.392 45.413  138.448 1.00 42.87  ? 16  HIS B CE1   1 
ATOM   2661  N NE2   . HIS B  1 16  ? 174.130 45.033  138.446 1.00 45.58  ? 16  HIS B NE2   1 
ATOM   2662  N N     . ILE B  1 17  ? 177.093 44.932  132.343 1.00 7.92   ? 17  ILE B N     1 
ATOM   2663  C CA    . ILE B  1 17  ? 177.172 45.173  130.919 1.00 5.55   ? 17  ILE B CA    1 
ATOM   2664  C C     . ILE B  1 17  ? 178.319 44.388  130.381 1.00 5.81   ? 17  ILE B C     1 
ATOM   2665  O O     . ILE B  1 17  ? 179.390 44.380  130.975 1.00 6.91   ? 17  ILE B O     1 
ATOM   2666  C CB    . ILE B  1 17  ? 177.443 46.654  130.563 1.00 20.27  ? 17  ILE B CB    1 
ATOM   2667  C CG1   . ILE B  1 17  ? 176.305 47.537  131.030 1.00 20.20  ? 17  ILE B CG1   1 
ATOM   2668  C CG2   . ILE B  1 17  ? 177.549 46.816  129.085 1.00 20.11  ? 17  ILE B CG2   1 
ATOM   2669  C CD1   . ILE B  1 17  ? 176.273 47.685  132.515 1.00 19.60  ? 17  ILE B CD1   1 
ATOM   2670  N N     . ILE B  1 18  ? 178.101 43.747  129.240 1.00 14.07  ? 18  ILE B N     1 
ATOM   2671  C CA    . ILE B  1 18  ? 179.138 42.957  128.577 1.00 13.69  ? 18  ILE B CA    1 
ATOM   2672  C C     . ILE B  1 18  ? 179.787 43.782  127.487 1.00 13.40  ? 18  ILE B C     1 
ATOM   2673  O O     . ILE B  1 18  ? 179.113 44.271  126.604 1.00 12.37  ? 18  ILE B O     1 
ATOM   2674  C CB    . ILE B  1 18  ? 178.538 41.724  127.903 1.00 24.35  ? 18  ILE B CB    1 
ATOM   2675  C CG1   . ILE B  1 18  ? 177.908 40.827  128.956 1.00 21.62  ? 18  ILE B CG1   1 
ATOM   2676  C CG2   . ILE B  1 18  ? 179.586 41.030  127.077 1.00 23.74  ? 18  ILE B CG2   1 
ATOM   2677  C CD1   . ILE B  1 18  ? 178.868 40.493  130.035 1.00 24.49  ? 18  ILE B CD1   1 
ATOM   2678  N N     . GLY B  1 19  ? 181.098 43.929  127.530 1.00 24.16  ? 19  GLY B N     1 
ATOM   2679  C CA    . GLY B  1 19  ? 181.754 44.706  126.494 1.00 25.60  ? 19  GLY B CA    1 
ATOM   2680  C C     . GLY B  1 19  ? 181.609 46.195  126.712 1.00 26.26  ? 19  GLY B C     1 
ATOM   2681  O O     . GLY B  1 19  ? 181.473 46.659  127.850 1.00 25.48  ? 19  GLY B O     1 
ATOM   2682  N N     . GLN B  1 20  ? 181.622 46.952  125.618 1.00 28.25  ? 20  GLN B N     1 
ATOM   2683  C CA    . GLN B  1 20  ? 181.513 48.418  125.699 1.00 28.85  ? 20  GLN B CA    1 
ATOM   2684  C C     . GLN B  1 20  ? 182.433 48.913  126.812 1.00 30.54  ? 20  GLN B C     1 
ATOM   2685  O O     . GLN B  1 20  ? 181.981 49.399  127.838 1.00 30.04  ? 20  GLN B O     1 
ATOM   2686  C CB    . GLN B  1 20  ? 180.066 48.863  125.973 1.00 5.67   ? 20  GLN B CB    1 
ATOM   2687  C CG    . GLN B  1 20  ? 178.993 48.300  125.040 1.00 3.06   ? 20  GLN B CG    1 
ATOM   2688  C CD    . GLN B  1 20  ? 179.387 48.182  123.553 1.00 3.50   ? 20  GLN B CD    1 
ATOM   2689  O OE1   . GLN B  1 20  ? 178.515 48.264  122.685 1.00 5.12   ? 20  GLN B OE1   1 
ATOM   2690  N NE2   . GLN B  1 20  ? 180.674 47.947  123.257 1.00 2.44   ? 20  GLN B NE2   1 
ATOM   2691  N N     . ALA B  1 21  ? 183.734 48.784  126.587 1.00 42.04  ? 21  ALA B N     1 
ATOM   2692  C CA    . ALA B  1 21  ? 184.707 49.159  127.584 1.00 45.00  ? 21  ALA B CA    1 
ATOM   2693  C C     . ALA B  1 21  ? 184.929 50.640  127.657 1.00 46.78  ? 21  ALA B C     1 
ATOM   2694  O O     . ALA B  1 21  ? 184.674 51.268  128.693 1.00 47.89  ? 21  ALA B O     1 
ATOM   2695  C CB    . ALA B  1 21  ? 186.015 48.457  127.309 1.00 117.23 ? 21  ALA B CB    1 
ATOM   2696  N N     . ASP B  1 22  ? 185.410 51.195  126.549 1.00 36.79  ? 22  ASP B N     1 
ATOM   2697  C CA    . ASP B  1 22  ? 185.717 52.623  126.480 1.00 35.46  ? 22  ASP B CA    1 
ATOM   2698  C C     . ASP B  1 22  ? 184.626 53.388  127.174 1.00 31.87  ? 22  ASP B C     1 
ATOM   2699  O O     . ASP B  1 22  ? 184.897 54.269  127.971 1.00 31.23  ? 22  ASP B O     1 
ATOM   2700  C CB    . ASP B  1 22  ? 185.821 53.083  125.029 1.00 60.18  ? 22  ASP B CB    1 
ATOM   2701  C CG    . ASP B  1 22  ? 186.728 52.204  124.202 1.00 63.19  ? 22  ASP B CG    1 
ATOM   2702  O OD1   . ASP B  1 22  ? 187.853 51.926  124.664 1.00 63.63  ? 22  ASP B OD1   1 
ATOM   2703  O OD2   . ASP B  1 22  ? 186.311 51.803  123.091 1.00 65.21  ? 22  ASP B OD2   1 
ATOM   2704  N N     . ALA B  1 23  ? 183.390 53.018  126.872 1.00 13.75  ? 23  ALA B N     1 
ATOM   2705  C CA    . ALA B  1 23  ? 182.245 53.671  127.470 1.00 12.15  ? 23  ALA B CA    1 
ATOM   2706  C C     . ALA B  1 23  ? 182.286 53.602  128.997 1.00 10.65  ? 23  ALA B C     1 
ATOM   2707  O O     . ALA B  1 23  ? 182.201 54.635  129.688 1.00 9.33   ? 23  ALA B O     1 
ATOM   2708  C CB    . ALA B  1 23  ? 180.976 53.051  126.945 1.00 21.31  ? 23  ALA B CB    1 
ATOM   2709  N N     . LYS B  1 24  ? 182.413 52.389  129.525 1.00 17.48  ? 24  LYS B N     1 
ATOM   2710  C CA    . LYS B  1 24  ? 182.476 52.211  130.968 1.00 16.61  ? 24  LYS B CA    1 
ATOM   2711  C C     . LYS B  1 24  ? 183.512 53.155  131.577 1.00 17.34  ? 24  LYS B C     1 
ATOM   2712  O O     . LYS B  1 24  ? 183.224 53.893  132.525 1.00 16.94  ? 24  LYS B O     1 
ATOM   2713  C CB    . LYS B  1 24  ? 182.831 50.765  131.313 1.00 12.53  ? 24  LYS B CB    1 
ATOM   2714  C CG    . LYS B  1 24  ? 181.660 49.856  131.385 1.00 12.58  ? 24  LYS B CG    1 
ATOM   2715  C CD    . LYS B  1 24  ? 182.103 48.416  131.226 1.00 14.20  ? 24  LYS B CD    1 
ATOM   2716  C CE    . LYS B  1 24  ? 180.921 47.434  131.235 1.00 14.20  ? 24  LYS B CE    1 
ATOM   2717  N NZ    . LYS B  1 24  ? 181.266 46.103  130.660 1.00 15.48  ? 24  LYS B NZ    1 
ATOM   2718  N N     . ARG B  1 25  ? 184.718 53.127  131.024 1.00 8.83   ? 25  ARG B N     1 
ATOM   2719  C CA    . ARG B  1 25  ? 185.794 53.966  131.521 1.00 9.68   ? 25  ARG B CA    1 
ATOM   2720  C C     . ARG B  1 25  ? 185.334 55.445  131.564 1.00 9.73   ? 25  ARG B C     1 
ATOM   2721  O O     . ARG B  1 25  ? 185.430 56.148  132.590 1.00 8.05   ? 25  ARG B O     1 
ATOM   2722  C CB    . ARG B  1 25  ? 186.991 53.794  130.591 1.00 30.00  ? 25  ARG B CB    1 
ATOM   2723  C CG    . ARG B  1 25  ? 188.352 53.620  131.248 1.00 33.55  ? 25  ARG B CG    1 
ATOM   2724  C CD    . ARG B  1 25  ? 189.218 52.896  130.244 1.00 38.71  ? 25  ARG B CD    1 
ATOM   2725  N NE    . ARG B  1 25  ? 190.614 52.761  130.622 1.00 45.34  ? 25  ARG B NE    1 
ATOM   2726  C CZ    . ARG B  1 25  ? 191.481 53.768  130.669 1.00 49.44  ? 25  ARG B CZ    1 
ATOM   2727  N NH1   . ARG B  1 25  ? 191.084 55.008  130.362 1.00 49.16  ? 25  ARG B NH1   1 
ATOM   2728  N NH2   . ARG B  1 25  ? 192.756 53.531  131.005 1.00 50.97  ? 25  ARG B NH2   1 
ATOM   2729  N N     . ALA B  1 26  ? 184.828 55.902  130.423 1.00 25.87  ? 26  ALA B N     1 
ATOM   2730  C CA    . ALA B  1 26  ? 184.358 57.260  130.252 1.00 23.47  ? 26  ALA B CA    1 
ATOM   2731  C C     . ALA B  1 26  ? 183.522 57.663  131.435 1.00 22.29  ? 26  ALA B C     1 
ATOM   2732  O O     . ALA B  1 26  ? 183.867 58.555  132.188 1.00 21.23  ? 26  ALA B O     1 
ATOM   2733  C CB    . ALA B  1 26  ? 183.549 57.339  128.998 1.00 1.75   ? 26  ALA B CB    1 
ATOM   2734  N N     . VAL B  1 27  ? 182.403 56.996  131.605 1.00 11.18  ? 27  VAL B N     1 
ATOM   2735  C CA    . VAL B  1 27  ? 181.565 57.348  132.729 1.00 10.90  ? 27  VAL B CA    1 
ATOM   2736  C C     . VAL B  1 27  ? 182.286 57.117  134.073 1.00 10.57  ? 27  VAL B C     1 
ATOM   2737  O O     . VAL B  1 27  ? 181.865 57.633  135.111 1.00 8.96   ? 27  VAL B O     1 
ATOM   2738  C CB    . VAL B  1 27  ? 180.237 56.531  132.724 1.00 10.00  ? 27  VAL B CB    1 
ATOM   2739  C CG1   . VAL B  1 27  ? 179.300 57.063  131.692 1.00 9.15   ? 27  VAL B CG1   1 
ATOM   2740  C CG2   . VAL B  1 27  ? 180.524 55.067  132.444 1.00 9.07   ? 27  VAL B CG2   1 
ATOM   2741  N N     . ALA B  1 28  ? 183.357 56.333  134.060 1.00 9.79   ? 28  ALA B N     1 
ATOM   2742  C CA    . ALA B  1 28  ? 184.048 56.036  135.298 1.00 10.07  ? 28  ALA B CA    1 
ATOM   2743  C C     . ALA B  1 28  ? 184.894 57.211  135.673 1.00 10.20  ? 28  ALA B C     1 
ATOM   2744  O O     . ALA B  1 28  ? 184.776 57.729  136.792 1.00 9.66   ? 28  ALA B O     1 
ATOM   2745  C CB    . ALA B  1 28  ? 184.899 54.804  135.142 1.00 22.25  ? 28  ALA B CB    1 
ATOM   2746  N N     . ILE B  1 29  ? 185.745 57.642  134.740 1.00 5.63   ? 29  ILE B N     1 
ATOM   2747  C CA    . ILE B  1 29  ? 186.622 58.793  135.006 1.00 6.58   ? 29  ILE B CA    1 
ATOM   2748  C C     . ILE B  1 29  ? 185.686 59.925  135.393 1.00 5.21   ? 29  ILE B C     1 
ATOM   2749  O O     . ILE B  1 29  ? 185.933 60.670  136.334 1.00 3.25   ? 29  ILE B O     1 
ATOM   2750  C CB    . ILE B  1 29  ? 187.480 59.214  133.767 1.00 44.31  ? 29  ILE B CB    1 
ATOM   2751  C CG1   . ILE B  1 29  ? 186.582 59.481  132.566 1.00 50.25  ? 29  ILE B CG1   1 
ATOM   2752  C CG2   . ILE B  1 29  ? 188.408 58.116  133.366 1.00 44.36  ? 29  ILE B CG2   1 
ATOM   2753  C CD1   . ILE B  1 29  ? 187.325 59.950  131.296 1.00 55.08  ? 29  ILE B CD1   1 
ATOM   2754  N N     . ALA B  1 30  ? 184.566 59.994  134.684 1.00 7.97   ? 30  ALA B N     1 
ATOM   2755  C CA    . ALA B  1 30  ? 183.592 61.035  134.917 1.00 9.39   ? 30  ALA B CA    1 
ATOM   2756  C C     . ALA B  1 30  ? 183.093 61.020  136.366 1.00 9.38   ? 30  ALA B C     1 
ATOM   2757  O O     . ALA B  1 30  ? 183.305 61.966  137.114 1.00 7.86   ? 30  ALA B O     1 
ATOM   2758  C CB    . ALA B  1 30  ? 182.432 60.892  133.910 1.00 19.33  ? 30  ALA B CB    1 
ATOM   2759  N N     . LEU B  1 31  ? 182.445 59.940  136.771 1.00 19.92  ? 31  LEU B N     1 
ATOM   2760  C CA    . LEU B  1 31  ? 181.939 59.855  138.127 1.00 20.43  ? 31  LEU B CA    1 
ATOM   2761  C C     . LEU B  1 31  ? 183.073 60.025  139.118 1.00 21.90  ? 31  LEU B C     1 
ATOM   2762  O O     . LEU B  1 31  ? 182.862 60.410  140.276 1.00 21.73  ? 31  LEU B O     1 
ATOM   2763  C CB    . LEU B  1 31  ? 181.260 58.513  138.358 1.00 8.98   ? 31  LEU B CB    1 
ATOM   2764  C CG    . LEU B  1 31  ? 180.876 58.285  139.815 1.00 8.19   ? 31  LEU B CG    1 
ATOM   2765  C CD1   . LEU B  1 31  ? 180.053 59.447  140.296 1.00 8.39   ? 31  LEU B CD1   1 
ATOM   2766  C CD2   . LEU B  1 31  ? 180.107 56.977  139.953 1.00 9.19   ? 31  LEU B CD2   1 
ATOM   2767  N N     . ARG B  1 32  ? 184.289 59.742  138.681 1.00 21.95  ? 32  ARG B N     1 
ATOM   2768  C CA    . ARG B  1 32  ? 185.367 59.891  139.624 1.00 24.31  ? 32  ARG B CA    1 
ATOM   2769  C C     . ARG B  1 32  ? 185.703 61.353  139.851 1.00 25.66  ? 32  ARG B C     1 
ATOM   2770  O O     . ARG B  1 32  ? 185.921 61.762  140.998 1.00 25.36  ? 32  ARG B O     1 
ATOM   2771  C CB    . ARG B  1 32  ? 186.608 59.136  139.171 1.00 37.17  ? 32  ARG B CB    1 
ATOM   2772  C CG    . ARG B  1 32  ? 187.787 59.205  140.168 1.00 39.06  ? 32  ARG B CG    1 
ATOM   2773  C CD    . ARG B  1 32  ? 187.431 58.673  141.548 1.00 40.90  ? 32  ARG B CD    1 
ATOM   2774  N NE    . ARG B  1 32  ? 188.616 58.401  142.360 1.00 42.10  ? 32  ARG B NE    1 
ATOM   2775  C CZ    . ARG B  1 32  ? 188.603 58.307  143.689 1.00 43.36  ? 32  ARG B CZ    1 
ATOM   2776  N NH1   . ARG B  1 32  ? 187.473 58.462  144.364 1.00 44.10  ? 32  ARG B NH1   1 
ATOM   2777  N NH2   . ARG B  1 32  ? 189.716 58.066  144.357 1.00 43.39  ? 32  ARG B NH2   1 
ATOM   2778  N N     . ASN B  1 33  ? 185.744 62.137  138.764 1.00 24.49  ? 33  ASN B N     1 
ATOM   2779  C CA    . ASN B  1 33  ? 186.074 63.557  138.856 1.00 24.06  ? 33  ASN B CA    1 
ATOM   2780  C C     . ASN B  1 33  ? 185.141 64.218  139.832 1.00 24.39  ? 33  ASN B C     1 
ATOM   2781  O O     . ASN B  1 33  ? 185.482 65.209  140.438 1.00 23.50  ? 33  ASN B O     1 
ATOM   2782  C CB    . ASN B  1 33  ? 185.994 64.231  137.486 1.00 31.50  ? 33  ASN B CB    1 
ATOM   2783  C CG    . ASN B  1 33  ? 187.253 64.007  136.665 1.00 32.40  ? 33  ASN B CG    1 
ATOM   2784  O OD1   . ASN B  1 33  ? 188.339 63.950  137.219 1.00 32.88  ? 33  ASN B OD1   1 
ATOM   2785  N ND2   . ASN B  1 33  ? 187.120 63.895  135.348 1.00 34.72  ? 33  ASN B ND2   1 
ATOM   2786  N N     . ARG B  1 34  ? 183.962 63.648  140.016 1.00 24.53  ? 34  ARG B N     1 
ATOM   2787  C CA    . ARG B  1 34  ? 183.025 64.234  140.951 1.00 26.96  ? 34  ARG B CA    1 
ATOM   2788  C C     . ARG B  1 34  ? 183.633 64.245  142.350 1.00 28.41  ? 34  ARG B C     1 
ATOM   2789  O O     . ARG B  1 34  ? 183.611 65.248  143.046 1.00 28.87  ? 34  ARG B O     1 
ATOM   2790  C CB    . ARG B  1 34  ? 181.715 63.455  140.963 1.00 40.43  ? 34  ARG B CB    1 
ATOM   2791  C CG    . ARG B  1 34  ? 180.539 64.292  141.440 1.00 42.36  ? 34  ARG B CG    1 
ATOM   2792  C CD    . ARG B  1 34  ? 179.700 64.822  140.283 1.00 43.01  ? 34  ARG B CD    1 
ATOM   2793  N NE    . ARG B  1 34  ? 178.607 63.901  139.998 1.00 44.29  ? 34  ARG B NE    1 
ATOM   2794  C CZ    . ARG B  1 34  ? 177.565 64.186  139.224 1.00 46.45  ? 34  ARG B CZ    1 
ATOM   2795  N NH1   . ARG B  1 34  ? 177.457 65.374  138.636 1.00 45.69  ? 34  ARG B NH1   1 
ATOM   2796  N NH2   . ARG B  1 34  ? 176.612 63.280  139.060 1.00 47.59  ? 34  ARG B NH2   1 
ATOM   2797  N N     . TRP B  1 35  ? 184.184 63.118  142.765 1.00 41.20  ? 35  TRP B N     1 
ATOM   2798  C CA    . TRP B  1 35  ? 184.793 63.024  144.086 1.00 41.78  ? 35  TRP B CA    1 
ATOM   2799  C C     . TRP B  1 35  ? 186.018 63.914  144.175 1.00 40.86  ? 35  TRP B C     1 
ATOM   2800  O O     . TRP B  1 35  ? 186.273 64.499  145.203 1.00 40.47  ? 35  TRP B O     1 
ATOM   2801  C CB    . TRP B  1 35  ? 185.185 61.572  144.369 1.00 66.60  ? 35  TRP B CB    1 
ATOM   2802  C CG    . TRP B  1 35  ? 186.118 61.421  145.520 1.00 67.83  ? 35  TRP B CG    1 
ATOM   2803  C CD1   . TRP B  1 35  ? 185.798 61.385  146.845 1.00 68.23  ? 35  TRP B CD1   1 
ATOM   2804  C CD2   . TRP B  1 35  ? 187.537 61.342  145.446 1.00 67.43  ? 35  TRP B CD2   1 
ATOM   2805  N NE1   . TRP B  1 35  ? 186.937 61.291  147.599 1.00 68.23  ? 35  TRP B NE1   1 
ATOM   2806  C CE2   . TRP B  1 35  ? 188.018 61.264  146.759 1.00 66.97  ? 35  TRP B CE2   1 
ATOM   2807  C CE3   . TRP B  1 35  ? 188.450 61.334  144.390 1.00 68.50  ? 35  TRP B CE3   1 
ATOM   2808  C CZ2   . TRP B  1 35  ? 189.372 61.178  147.046 1.00 67.78  ? 35  TRP B CZ2   1 
ATOM   2809  C CZ3   . TRP B  1 35  ? 189.793 61.245  144.675 1.00 68.28  ? 35  TRP B CZ3   1 
ATOM   2810  C CH2   . TRP B  1 35  ? 190.244 61.169  145.993 1.00 68.31  ? 35  TRP B CH2   1 
ATOM   2811  N N     . ARG B  1 36  ? 186.779 63.995  143.096 1.00 14.16  ? 36  ARG B N     1 
ATOM   2812  C CA    . ARG B  1 36  ? 187.969 64.825  143.069 1.00 15.71  ? 36  ARG B CA    1 
ATOM   2813  C C     . ARG B  1 36  ? 187.653 66.332  143.319 1.00 17.87  ? 36  ARG B C     1 
ATOM   2814  O O     . ARG B  1 36  ? 188.254 66.966  144.194 1.00 18.75  ? 36  ARG B O     1 
ATOM   2815  C CB    . ARG B  1 36  ? 188.685 64.647  141.727 1.00 32.43  ? 36  ARG B CB    1 
ATOM   2816  C CG    . ARG B  1 36  ? 189.103 63.242  141.427 1.00 29.35  ? 36  ARG B CG    1 
ATOM   2817  C CD    . ARG B  1 36  ? 189.620 63.136  140.022 1.00 28.15  ? 36  ARG B CD    1 
ATOM   2818  N NE    . ARG B  1 36  ? 190.110 61.792  139.771 1.00 27.91  ? 36  ARG B NE    1 
ATOM   2819  C CZ    . ARG B  1 36  ? 190.716 61.413  138.654 1.00 27.48  ? 36  ARG B CZ    1 
ATOM   2820  N NH1   . ARG B  1 36  ? 190.902 62.285  137.678 1.00 27.09  ? 36  ARG B NH1   1 
ATOM   2821  N NH2   . ARG B  1 36  ? 191.151 60.167  138.525 1.00 25.67  ? 36  ARG B NH2   1 
ATOM   2822  N N     . ARG B  1 37  ? 186.754 66.927  142.536 1.00 15.11  ? 37  ARG B N     1 
ATOM   2823  C CA    . ARG B  1 37  ? 186.374 68.315  142.768 1.00 16.79  ? 37  ARG B CA    1 
ATOM   2824  C C     . ARG B  1 37  ? 185.567 68.082  144.020 1.00 19.97  ? 37  ARG B C     1 
ATOM   2825  O O     . ARG B  1 37  ? 185.381 66.941  144.390 1.00 20.52  ? 37  ARG B O     1 
ATOM   2826  C CB    . ARG B  1 37  ? 185.463 68.814  141.642 1.00 42.27  ? 37  ARG B CB    1 
ATOM   2827  C CG    . ARG B  1 37  ? 184.209 69.502  142.152 1.00 41.16  ? 37  ARG B CG    1 
ATOM   2828  C CD    . ARG B  1 37  ? 183.306 70.073  141.085 1.00 39.80  ? 37  ARG B CD    1 
ATOM   2829  N NE    . ARG B  1 37  ? 182.282 70.860  141.760 1.00 38.72  ? 37  ARG B NE    1 
ATOM   2830  C CZ    . ARG B  1 37  ? 181.230 70.327  142.365 1.00 40.08  ? 37  ARG B CZ    1 
ATOM   2831  N NH1   . ARG B  1 37  ? 181.084 69.008  142.337 1.00 41.27  ? 37  ARG B NH1   1 
ATOM   2832  N NH2   . ARG B  1 37  ? 180.360 71.093  143.037 1.00 39.63  ? 37  ARG B NH2   1 
ATOM   2833  N N     . MET B  1 38  ? 185.073 69.109  144.685 1.00 63.20  ? 38  MET B N     1 
ATOM   2834  C CA    . MET B  1 38  ? 184.275 68.839  145.879 1.00 68.83  ? 38  MET B CA    1 
ATOM   2835  C C     . MET B  1 38  ? 185.210 68.144  146.846 1.00 70.14  ? 38  MET B C     1 
ATOM   2836  O O     . MET B  1 38  ? 184.794 67.395  147.731 1.00 71.19  ? 38  MET B O     1 
ATOM   2837  C CB    . MET B  1 38  ? 183.102 67.915  145.537 1.00 96.06  ? 38  MET B CB    1 
ATOM   2838  C CG    . MET B  1 38  ? 181.989 67.869  146.564 1.00 101.06 ? 38  MET B CG    1 
ATOM   2839  S SD    . MET B  1 38  ? 180.836 66.513  146.227 1.00 109.40 ? 38  MET B SD    1 
ATOM   2840  C CE    . MET B  1 38  ? 180.639 66.601  144.444 1.00 107.43 ? 38  MET B CE    1 
ATOM   2841  N N     . GLN B  1 39  ? 186.491 68.389  146.618 1.00 79.29  ? 39  GLN B N     1 
ATOM   2842  C CA    . GLN B  1 39  ? 187.568 67.860  147.428 1.00 80.71  ? 39  GLN B CA    1 
ATOM   2843  C C     . GLN B  1 39  ? 188.621 68.935  147.280 1.00 82.02  ? 39  GLN B C     1 
ATOM   2844  O O     . GLN B  1 39  ? 189.685 68.879  147.888 1.00 82.47  ? 39  GLN B O     1 
ATOM   2845  C CB    . GLN B  1 39  ? 188.094 66.558  146.853 1.00 63.00  ? 39  GLN B CB    1 
ATOM   2846  C CG    . GLN B  1 39  ? 189.020 65.808  147.771 1.00 65.34  ? 39  GLN B CG    1 
ATOM   2847  C CD    . GLN B  1 39  ? 188.331 64.650  148.449 1.00 67.82  ? 39  GLN B CD    1 
ATOM   2848  O OE1   . GLN B  1 39  ? 188.958 63.898  149.185 1.00 68.63  ? 39  GLN B OE1   1 
ATOM   2849  N NE2   . GLN B  1 39  ? 187.028 64.496  148.200 1.00 69.17  ? 39  GLN B NE2   1 
ATOM   2850  N N     . LEU B  1 40  ? 188.301 69.911  146.437 1.00 86.50  ? 40  LEU B N     1 
ATOM   2851  C CA    . LEU B  1 40  ? 189.169 71.045  146.171 1.00 86.59  ? 40  LEU B CA    1 
ATOM   2852  C C     . LEU B  1 40  ? 188.713 72.174  147.082 1.00 89.37  ? 40  LEU B C     1 
ATOM   2853  O O     . LEU B  1 40  ? 187.684 72.035  147.754 1.00 90.18  ? 40  LEU B O     1 
ATOM   2854  C CB    . LEU B  1 40  ? 189.002 71.460  144.731 1.00 37.93  ? 40  LEU B CB    1 
ATOM   2855  C CG    . LEU B  1 40  ? 189.237 70.316  143.756 1.00 35.86  ? 40  LEU B CG    1 
ATOM   2856  C CD1   . LEU B  1 40  ? 188.574 70.629  142.437 1.00 35.88  ? 40  LEU B CD1   1 
ATOM   2857  C CD2   . LEU B  1 40  ? 190.735 70.105  143.576 1.00 35.79  ? 40  LEU B CD2   1 
ATOM   2858  N N     . GLN B  1 41  ? 189.455 73.286  147.111 1.00 75.94  ? 41  GLN B N     1 
ATOM   2859  C CA    . GLN B  1 41  ? 189.078 74.416  147.977 1.00 79.28  ? 41  GLN B CA    1 
ATOM   2860  C C     . GLN B  1 41  ? 188.142 75.394  147.291 1.00 79.35  ? 41  GLN B C     1 
ATOM   2861  O O     . GLN B  1 41  ? 188.360 75.742  146.137 1.00 79.36  ? 41  GLN B O     1 
ATOM   2862  C CB    . GLN B  1 41  ? 190.316 75.149  148.500 1.00 130.14 ? 41  GLN B CB    1 
ATOM   2863  C CG    . GLN B  1 41  ? 190.921 74.512  149.754 1.00 133.86 ? 41  GLN B CG    1 
ATOM   2864  C CD    . GLN B  1 41  ? 189.934 74.413  150.921 1.00 136.37 ? 41  GLN B CD    1 
ATOM   2865  O OE1   . GLN B  1 41  ? 190.269 73.892  151.986 1.00 138.31 ? 41  GLN B OE1   1 
ATOM   2866  N NE2   . GLN B  1 41  ? 188.717 74.912  150.722 1.00 135.90 ? 41  GLN B NE2   1 
ATOM   2867  N N     . GLU B  1 42  ? 187.130 75.849  148.032 1.00 100.32 ? 42  GLU B N     1 
ATOM   2868  C CA    . GLU B  1 42  ? 186.070 76.728  147.527 1.00 101.94 ? 42  GLU B CA    1 
ATOM   2869  C C     . GLU B  1 42  ? 186.203 77.465  146.188 1.00 101.25 ? 42  GLU B C     1 
ATOM   2870  O O     . GLU B  1 42  ? 185.250 77.475  145.394 1.00 101.35 ? 42  GLU B O     1 
ATOM   2871  C CB    . GLU B  1 42  ? 185.633 77.726  148.597 1.00 167.77 ? 42  GLU B CB    1 
ATOM   2872  C CG    . GLU B  1 42  ? 184.263 78.332  148.271 1.00 171.47 ? 42  GLU B CG    1 
ATOM   2873  C CD    . GLU B  1 42  ? 183.234 77.275  147.852 1.00 173.72 ? 42  GLU B CD    1 
ATOM   2874  O OE1   . GLU B  1 42  ? 182.811 76.472  148.712 1.00 174.44 ? 42  GLU B OE1   1 
ATOM   2875  O OE2   . GLU B  1 42  ? 182.855 77.240  146.659 1.00 174.32 ? 42  GLU B OE2   1 
ATOM   2876  N N     . PRO B  1 43  ? 187.353 78.111  145.918 1.00 100.73 ? 43  PRO B N     1 
ATOM   2877  C CA    . PRO B  1 43  ? 187.499 78.817  144.636 1.00 98.80  ? 43  PRO B CA    1 
ATOM   2878  C C     . PRO B  1 43  ? 187.286 77.871  143.457 1.00 97.33  ? 43  PRO B C     1 
ATOM   2879  O O     . PRO B  1 43  ? 186.478 78.142  142.569 1.00 97.50  ? 43  PRO B O     1 
ATOM   2880  C CB    . PRO B  1 43  ? 188.922 79.317  144.685 1.00 51.48  ? 43  PRO B CB    1 
ATOM   2881  C CG    . PRO B  1 43  ? 189.108 79.573  146.128 1.00 53.33  ? 43  PRO B CG    1 
ATOM   2882  C CD    . PRO B  1 43  ? 188.505 78.374  146.792 1.00 52.41  ? 43  PRO B CD    1 
ATOM   2883  N N     . LEU B  1 44  ? 188.020 76.759  143.467 1.00 49.98  ? 44  LEU B N     1 
ATOM   2884  C CA    . LEU B  1 44  ? 187.929 75.745  142.429 1.00 46.40  ? 44  LEU B CA    1 
ATOM   2885  C C     . LEU B  1 44  ? 186.785 74.757  142.619 1.00 46.61  ? 44  LEU B C     1 
ATOM   2886  O O     . LEU B  1 44  ? 186.160 74.323  141.653 1.00 46.51  ? 44  LEU B O     1 
ATOM   2887  C CB    . LEU B  1 44  ? 189.222 74.975  142.376 1.00 23.80  ? 44  LEU B CB    1 
ATOM   2888  C CG    . LEU B  1 44  ? 190.410 75.758  141.879 1.00 22.11  ? 44  LEU B CG    1 
ATOM   2889  C CD1   . LEU B  1 44  ? 191.628 74.885  141.892 1.00 22.89  ? 44  LEU B CD1   1 
ATOM   2890  C CD2   . LEU B  1 44  ? 190.148 76.191  140.482 1.00 22.75  ? 44  LEU B CD2   1 
ATOM   2891  N N     . ARG B  1 45  ? 186.518 74.385  143.862 1.00 56.64  ? 45  ARG B N     1 
ATOM   2892  C CA    . ARG B  1 45  ? 185.450 73.443  144.140 1.00 58.71  ? 45  ARG B CA    1 
ATOM   2893  C C     . ARG B  1 45  ? 184.221 73.786  143.303 1.00 60.05  ? 45  ARG B C     1 
ATOM   2894  O O     . ARG B  1 45  ? 183.433 72.899  142.978 1.00 60.63  ? 45  ARG B O     1 
ATOM   2895  C CB    . ARG B  1 45  ? 185.083 73.471  145.629 1.00 81.52  ? 45  ARG B CB    1 
ATOM   2896  C CG    . ARG B  1 45  ? 184.642 72.132  146.194 1.00 83.52  ? 45  ARG B CG    1 
ATOM   2897  C CD    . ARG B  1 45  ? 184.346 72.216  147.679 1.00 86.51  ? 45  ARG B CD    1 
ATOM   2898  N NE    . ARG B  1 45  ? 183.002 72.725  147.947 1.00 91.91  ? 45  ARG B NE    1 
ATOM   2899  C CZ    . ARG B  1 45  ? 181.885 71.995  147.871 1.00 95.02  ? 45  ARG B CZ    1 
ATOM   2900  N NH1   . ARG B  1 45  ? 181.938 70.709  147.534 1.00 95.74  ? 45  ARG B NH1   1 
ATOM   2901  N NH2   . ARG B  1 45  ? 180.702 72.548  148.131 1.00 95.58  ? 45  ARG B NH2   1 
ATOM   2902  N N     . HIS B  1 46  ? 184.060 75.065  142.946 1.00 72.51  ? 46  HIS B N     1 
ATOM   2903  C CA    . HIS B  1 46  ? 182.904 75.511  142.156 1.00 72.76  ? 46  HIS B CA    1 
ATOM   2904  C C     . HIS B  1 46  ? 183.260 75.966  140.745 1.00 69.51  ? 46  HIS B C     1 
ATOM   2905  O O     . HIS B  1 46  ? 182.393 76.131  139.904 1.00 69.80  ? 46  HIS B O     1 
ATOM   2906  C CB    . HIS B  1 46  ? 182.176 76.652  142.878 1.00 190.98 ? 46  HIS B CB    1 
ATOM   2907  C CG    . HIS B  1 46  ? 180.701 76.430  143.009 1.00 197.41 ? 46  HIS B CG    1 
ATOM   2908  N ND1   . HIS B  1 46  ? 180.168 75.433  143.797 1.00 199.90 ? 46  HIS B ND1   1 
ATOM   2909  C CD2   . HIS B  1 46  ? 179.647 77.051  142.426 1.00 199.97 ? 46  HIS B CD2   1 
ATOM   2910  C CE1   . HIS B  1 46  ? 178.851 75.447  143.693 1.00 200.00 ? 46  HIS B CE1   1 
ATOM   2911  N NE2   . HIS B  1 46  ? 178.509 76.419  142.867 1.00 200.00 ? 46  HIS B NE2   1 
ATOM   2912  N N     . GLU B  1 47  ? 184.542 76.157  140.492 1.00 21.04  ? 47  GLU B N     1 
ATOM   2913  C CA    . GLU B  1 47  ? 185.010 76.623  139.195 1.00 18.66  ? 47  GLU B CA    1 
ATOM   2914  C C     . GLU B  1 47  ? 185.150 75.524  138.182 1.00 16.24  ? 47  GLU B C     1 
ATOM   2915  O O     . GLU B  1 47  ? 185.078 75.776  136.981 1.00 15.09  ? 47  GLU B O     1 
ATOM   2916  C CB    . GLU B  1 47  ? 186.363 77.316  139.324 1.00 74.48  ? 47  GLU B CB    1 
ATOM   2917  C CG    . GLU B  1 47  ? 186.308 78.776  139.708 1.00 78.24  ? 47  GLU B CG    1 
ATOM   2918  C CD    . GLU B  1 47  ? 185.913 79.671  138.550 1.00 81.05  ? 47  GLU B CD    1 
ATOM   2919  O OE1   . GLU B  1 47  ? 185.896 80.914  138.734 1.00 82.63  ? 47  GLU B OE1   1 
ATOM   2920  O OE2   . GLU B  1 47  ? 185.625 79.133  137.458 1.00 81.36  ? 47  GLU B OE2   1 
ATOM   2921  N N     . VAL B  1 48  ? 185.383 74.307  138.655 1.00 42.75  ? 48  VAL B N     1 
ATOM   2922  C CA    . VAL B  1 48  ? 185.540 73.186  137.743 1.00 41.88  ? 48  VAL B CA    1 
ATOM   2923  C C     . VAL B  1 48  ? 184.174 72.553  137.426 1.00 40.47  ? 48  VAL B C     1 
ATOM   2924  O O     . VAL B  1 48  ? 183.319 72.382  138.311 1.00 39.35  ? 48  VAL B O     1 
ATOM   2925  C CB    . VAL B  1 48  ? 186.516 72.165  138.316 1.00 43.71  ? 48  VAL B CB    1 
ATOM   2926  C CG1   . VAL B  1 48  ? 186.039 71.678  139.657 1.00 44.20  ? 48  VAL B CG1   1 
ATOM   2927  C CG2   . VAL B  1 48  ? 186.675 71.047  137.354 1.00 43.86  ? 48  VAL B CG2   1 
ATOM   2928  N N     . THR B  1 49  ? 183.976 72.227  136.149 1.00 46.40  ? 49  THR B N     1 
ATOM   2929  C CA    . THR B  1 49  ? 182.705 71.687  135.672 1.00 45.59  ? 49  THR B CA    1 
ATOM   2930  C C     . THR B  1 49  ? 182.750 70.307  135.027 1.00 43.51  ? 49  THR B C     1 
ATOM   2931  O O     . THR B  1 49  ? 183.729 69.963  134.374 1.00 44.94  ? 49  THR B O     1 
ATOM   2932  C CB    . THR B  1 49  ? 182.085 72.637  134.641 1.00 93.28  ? 49  THR B CB    1 
ATOM   2933  O OG1   . THR B  1 49  ? 182.953 72.742  133.504 1.00 94.47  ? 49  THR B OG1   1 
ATOM   2934  C CG2   . THR B  1 49  ? 181.892 74.011  135.245 1.00 94.97  ? 49  THR B CG2   1 
ATOM   2935  N N     . PRO B  1 50  ? 181.664 69.518  135.173 1.00 19.60  ? 50  PRO B N     1 
ATOM   2936  C CA    . PRO B  1 50  ? 181.479 68.167  134.647 1.00 17.44  ? 50  PRO B CA    1 
ATOM   2937  C C     . PRO B  1 50  ? 182.034 68.083  133.244 1.00 15.91  ? 50  PRO B C     1 
ATOM   2938  O O     . PRO B  1 50  ? 182.075 69.109  132.550 1.00 15.38  ? 50  PRO B O     1 
ATOM   2939  C CB    . PRO B  1 50  ? 179.970 68.013  134.656 1.00 86.50  ? 50  PRO B CB    1 
ATOM   2940  C CG    . PRO B  1 50  ? 179.593 68.743  135.865 1.00 88.19  ? 50  PRO B CG    1 
ATOM   2941  C CD    . PRO B  1 50  ? 180.405 70.001  135.762 1.00 87.74  ? 50  PRO B CD    1 
ATOM   2942  N N     . LYS B  1 51  ? 182.444 66.881  132.813 1.00 20.27  ? 51  LYS B N     1 
ATOM   2943  C CA    . LYS B  1 51  ? 183.005 66.705  131.465 1.00 18.50  ? 51  LYS B CA    1 
ATOM   2944  C C     . LYS B  1 51  ? 182.085 65.870  130.598 1.00 14.46  ? 51  LYS B C     1 
ATOM   2945  O O     . LYS B  1 51  ? 182.513 64.939  129.973 1.00 15.51  ? 51  LYS B O     1 
ATOM   2946  C CB    . LYS B  1 51  ? 184.390 66.047  131.562 1.00 83.53  ? 51  LYS B CB    1 
ATOM   2947  C CG    . LYS B  1 51  ? 185.453 66.880  132.315 1.00 87.17  ? 51  LYS B CG    1 
ATOM   2948  C CD    . LYS B  1 51  ? 185.693 68.232  131.641 1.00 89.20  ? 51  LYS B CD    1 
ATOM   2949  C CE    . LYS B  1 51  ? 186.606 69.136  132.454 1.00 90.94  ? 51  LYS B CE    1 
ATOM   2950  N NZ    . LYS B  1 51  ? 186.676 70.483  131.814 1.00 89.51  ? 51  LYS B NZ    1 
ATOM   2951  N N     . ASN B  1 52  ? 180.816 66.234  130.556 1.00 18.80  ? 52  ASN B N     1 
ATOM   2952  C CA    . ASN B  1 52  ? 179.779 65.525  129.817 1.00 14.45  ? 52  ASN B CA    1 
ATOM   2953  C C     . ASN B  1 52  ? 180.203 64.550  128.738 1.00 11.22  ? 52  ASN B C     1 
ATOM   2954  O O     . ASN B  1 52  ? 181.239 64.689  128.116 1.00 10.80  ? 52  ASN B O     1 
ATOM   2955  C CB    . ASN B  1 52  ? 178.792 66.546  129.290 1.00 41.18  ? 52  ASN B CB    1 
ATOM   2956  C CG    . ASN B  1 52  ? 178.213 67.394  130.417 1.00 42.96  ? 52  ASN B CG    1 
ATOM   2957  O OD1   . ASN B  1 52  ? 177.859 66.893  131.480 1.00 41.50  ? 52  ASN B OD1   1 
ATOM   2958  N ND2   . ASN B  1 52  ? 178.123 68.675  130.193 1.00 43.15  ? 52  ASN B ND2   1 
ATOM   2959  N N     . ILE B  1 53  ? 179.388 63.541  128.512 1.00 21.16  ? 53  ILE B N     1 
ATOM   2960  C CA    . ILE B  1 53  ? 179.737 62.521  127.542 1.00 17.94  ? 53  ILE B CA    1 
ATOM   2961  C C     . ILE B  1 53  ? 178.711 62.329  126.461 1.00 16.14  ? 53  ILE B C     1 
ATOM   2962  O O     . ILE B  1 53  ? 177.523 62.441  126.698 1.00 15.46  ? 53  ILE B O     1 
ATOM   2963  C CB    . ILE B  1 53  ? 179.915 61.168  128.239 1.00 18.07  ? 53  ILE B CB    1 
ATOM   2964  C CG1   . ILE B  1 53  ? 180.941 61.309  129.349 1.00 17.69  ? 53  ILE B CG1   1 
ATOM   2965  C CG2   . ILE B  1 53  ? 180.385 60.138  127.269 1.00 14.57  ? 53  ILE B CG2   1 
ATOM   2966  C CD1   . ILE B  1 53  ? 180.663 60.446  130.540 1.00 19.49  ? 53  ILE B CD1   1 
ATOM   2967  N N     . LEU B  1 54  ? 179.181 62.043  125.261 1.00 11.35  ? 54  LEU B N     1 
ATOM   2968  C CA    . LEU B  1 54  ? 178.287 61.762  124.159 1.00 10.25  ? 54  LEU B CA    1 
ATOM   2969  C C     . LEU B  1 54  ? 178.686 60.349  123.746 1.00 11.26  ? 54  LEU B C     1 
ATOM   2970  O O     . LEU B  1 54  ? 179.800 60.153  123.294 1.00 13.75  ? 54  LEU B O     1 
ATOM   2971  C CB    . LEU B  1 54  ? 178.501 62.738  122.989 1.00 1.00   ? 54  LEU B CB    1 
ATOM   2972  C CG    . LEU B  1 54  ? 177.800 62.297  121.698 1.00 1.00   ? 54  LEU B CG    1 
ATOM   2973  C CD1   . LEU B  1 54  ? 176.313 62.301  121.937 1.00 1.00   ? 54  LEU B CD1   1 
ATOM   2974  C CD2   . LEU B  1 54  ? 178.143 63.166  120.529 1.00 1.00   ? 54  LEU B CD2   1 
ATOM   2975  N N     . MET B  1 55  ? 177.817 59.357  123.940 1.00 3.63   ? 55  MET B N     1 
ATOM   2976  C CA    . MET B  1 55  ? 178.134 57.984  123.544 1.00 1.84   ? 55  MET B CA    1 
ATOM   2977  C C     . MET B  1 55  ? 177.560 57.779  122.176 1.00 1.18   ? 55  MET B C     1 
ATOM   2978  O O     . MET B  1 55  ? 176.382 58.029  121.963 1.00 1.83   ? 55  MET B O     1 
ATOM   2979  C CB    . MET B  1 55  ? 177.480 56.980  124.464 1.00 13.23  ? 55  MET B CB    1 
ATOM   2980  C CG    . MET B  1 55  ? 177.725 57.217  125.909 1.00 15.76  ? 55  MET B CG    1 
ATOM   2981  S SD    . MET B  1 55  ? 176.781 56.044  126.824 1.00 19.42  ? 55  MET B SD    1 
ATOM   2982  C CE    . MET B  1 55  ? 177.180 56.437  128.447 1.00 18.63  ? 55  MET B CE    1 
ATOM   2983  N N     . ILE B  1 56  ? 178.376 57.342  121.236 1.00 4.33   ? 56  ILE B N     1 
ATOM   2984  C CA    . ILE B  1 56  ? 177.860 57.122  119.903 1.00 4.33   ? 56  ILE B CA    1 
ATOM   2985  C C     . ILE B  1 56  ? 177.785 55.640  119.722 1.00 4.80   ? 56  ILE B C     1 
ATOM   2986  O O     . ILE B  1 56  ? 178.772 54.978  119.992 1.00 6.95   ? 56  ILE B O     1 
ATOM   2987  C CB    . ILE B  1 56  ? 178.807 57.561  118.824 1.00 4.79   ? 56  ILE B CB    1 
ATOM   2988  C CG1   . ILE B  1 56  ? 178.972 59.063  118.789 1.00 4.47   ? 56  ILE B CG1   1 
ATOM   2989  C CG2   . ILE B  1 56  ? 178.239 57.113  117.513 1.00 6.18   ? 56  ILE B CG2   1 
ATOM   2990  C CD1   . ILE B  1 56  ? 179.363 59.637  120.058 1.00 6.23   ? 56  ILE B CD1   1 
ATOM   2991  N N     . GLY B  1 57  ? 176.667 55.101  119.242 1.00 14.31  ? 57  GLY B N     1 
ATOM   2992  C CA    . GLY B  1 57  ? 176.616 53.661  119.051 1.00 15.42  ? 57  GLY B CA    1 
ATOM   2993  C C     . GLY B  1 57  ? 175.406 53.170  118.311 1.00 16.12  ? 57  GLY B C     1 
ATOM   2994  O O     . GLY B  1 57  ? 174.622 53.973  117.890 1.00 18.15  ? 57  GLY B O     1 
ATOM   2995  N N     . PRO B  1 58  ? 175.245 51.859  118.110 1.00 10.40  ? 58  PRO B N     1 
ATOM   2996  C CA    . PRO B  1 58  ? 174.122 51.227  117.419 1.00 11.36  ? 58  PRO B CA    1 
ATOM   2997  C C     . PRO B  1 58  ? 172.991 51.077  118.420 1.00 12.94  ? 58  PRO B C     1 
ATOM   2998  O O     . PRO B  1 58  ? 173.110 51.565  119.537 1.00 13.79  ? 58  PRO B O     1 
ATOM   2999  C CB    . PRO B  1 58  ? 174.685 49.866  117.035 1.00 55.47  ? 58  PRO B CB    1 
ATOM   3000  C CG    . PRO B  1 58  ? 176.155 50.085  117.000 1.00 54.99  ? 58  PRO B CG    1 
ATOM   3001  C CD    . PRO B  1 58  ? 176.351 50.904  118.225 1.00 55.40  ? 58  PRO B CD    1 
ATOM   3002  N N     . THR B  1 59  ? 171.921 50.368  118.057 1.00 26.94  ? 59  THR B N     1 
ATOM   3003  C CA    . THR B  1 59  ? 170.795 50.190  118.974 1.00 27.29  ? 59  THR B CA    1 
ATOM   3004  C C     . THR B  1 59  ? 170.986 49.163  120.067 1.00 26.94  ? 59  THR B C     1 
ATOM   3005  O O     . THR B  1 59  ? 171.508 48.080  119.818 1.00 26.01  ? 59  THR B O     1 
ATOM   3006  C CB    . THR B  1 59  ? 169.556 49.750  118.266 1.00 15.71  ? 59  THR B CB    1 
ATOM   3007  O OG1   . THR B  1 59  ? 169.440 50.452  117.025 1.00 18.78  ? 59  THR B OG1   1 
ATOM   3008  C CG2   . THR B  1 59  ? 168.347 50.023  119.165 1.00 15.03  ? 59  THR B CG2   1 
ATOM   3009  N N     . GLY B  1 60  ? 170.512 49.516  121.265 1.00 32.70  ? 60  GLY B N     1 
ATOM   3010  C CA    . GLY B  1 60  ? 170.573 48.639  122.430 1.00 32.81  ? 60  GLY B CA    1 
ATOM   3011  C C     . GLY B  1 60  ? 171.792 47.756  122.591 1.00 32.03  ? 60  GLY B C     1 
ATOM   3012  O O     . GLY B  1 60  ? 171.697 46.530  122.567 1.00 31.15  ? 60  GLY B O     1 
ATOM   3013  N N     . VAL B  1 61  ? 172.935 48.405  122.775 1.00 23.71  ? 61  VAL B N     1 
ATOM   3014  C CA    . VAL B  1 61  ? 174.207 47.737  122.946 1.00 22.56  ? 61  VAL B CA    1 
ATOM   3015  C C     . VAL B  1 61  ? 174.802 48.168  124.258 1.00 23.63  ? 61  VAL B C     1 
ATOM   3016  O O     . VAL B  1 61  ? 175.976 47.894  124.491 1.00 24.22  ? 61  VAL B O     1 
ATOM   3017  C CB    . VAL B  1 61  ? 175.207 48.111  121.832 1.00 3.05   ? 61  VAL B CB    1 
ATOM   3018  C CG1   . VAL B  1 61  ? 174.893 47.402  120.576 1.00 3.05   ? 61  VAL B CG1   1 
ATOM   3019  C CG2   . VAL B  1 61  ? 175.104 49.542  121.531 1.00 3.69   ? 61  VAL B CG2   1 
ATOM   3020  N N     . GLY B  1 62  ? 174.012 48.863  125.084 1.00 21.99  ? 62  GLY B N     1 
ATOM   3021  C CA    . GLY B  1 62  ? 174.498 49.298  126.386 1.00 24.82  ? 62  GLY B CA    1 
ATOM   3022  C C     . GLY B  1 62  ? 174.496 50.767  126.813 1.00 26.48  ? 62  GLY B C     1 
ATOM   3023  O O     . GLY B  1 62  ? 174.513 51.054  128.019 1.00 26.99  ? 62  GLY B O     1 
ATOM   3024  N N     . LYS B  1 63  ? 174.477 51.690  125.851 1.00 43.12  ? 63  LYS B N     1 
ATOM   3025  C CA    . LYS B  1 63  ? 174.474 53.129  126.128 1.00 42.82  ? 63  LYS B CA    1 
ATOM   3026  C C     . LYS B  1 63  ? 173.685 53.512  127.351 1.00 42.92  ? 63  LYS B C     1 
ATOM   3027  O O     . LYS B  1 63  ? 174.173 54.204  128.232 1.00 43.65  ? 63  LYS B O     1 
ATOM   3028  C CB    . LYS B  1 63  ? 173.884 53.891  124.961 1.00 21.81  ? 63  LYS B CB    1 
ATOM   3029  C CG    . LYS B  1 63  ? 174.579 53.647  123.671 1.00 22.24  ? 63  LYS B CG    1 
ATOM   3030  C CD    . LYS B  1 63  ? 174.266 54.733  122.678 1.00 21.47  ? 63  LYS B CD    1 
ATOM   3031  C CE    . LYS B  1 63  ? 174.438 54.215  121.293 1.00 18.52  ? 63  LYS B CE    1 
ATOM   3032  N NZ    . LYS B  1 63  ? 173.398 53.192  121.159 1.00 18.42  ? 63  LYS B NZ    1 
ATOM   3033  N N     . THR B  1 64  ? 172.445 53.067  127.392 1.00 27.25  ? 64  THR B N     1 
ATOM   3034  C CA    . THR B  1 64  ? 171.595 53.389  128.504 1.00 27.59  ? 64  THR B CA    1 
ATOM   3035  C C     . THR B  1 64  ? 171.881 52.599  129.791 1.00 29.29  ? 64  THR B C     1 
ATOM   3036  O O     . THR B  1 64  ? 171.899 53.185  130.884 1.00 31.21  ? 64  THR B O     1 
ATOM   3037  C CB    . THR B  1 64  ? 170.130 53.212  128.109 1.00 7.81   ? 64  THR B CB    1 
ATOM   3038  O OG1   . THR B  1 64  ? 169.823 54.035  126.968 1.00 4.71   ? 64  THR B OG1   1 
ATOM   3039  C CG2   . THR B  1 64  ? 169.223 53.569  129.282 1.00 8.20   ? 64  THR B CG2   1 
ATOM   3040  N N     . GLU B  1 65  ? 172.097 51.289  129.695 1.00 30.51  ? 65  GLU B N     1 
ATOM   3041  C CA    . GLU B  1 65  ? 172.373 50.531  130.910 1.00 31.68  ? 65  GLU B CA    1 
ATOM   3042  C C     . GLU B  1 65  ? 173.562 51.120  131.640 1.00 30.48  ? 65  GLU B C     1 
ATOM   3043  O O     . GLU B  1 65  ? 173.507 51.400  132.848 1.00 30.79  ? 65  GLU B O     1 
ATOM   3044  C CB    . GLU B  1 65  ? 172.646 49.069  130.603 1.00 54.95  ? 65  GLU B CB    1 
ATOM   3045  C CG    . GLU B  1 65  ? 171.381 48.238  130.589 1.00 62.56  ? 65  GLU B CG    1 
ATOM   3046  C CD    . GLU B  1 65  ? 170.770 48.026  131.973 1.00 67.03  ? 65  GLU B CD    1 
ATOM   3047  O OE1   . GLU B  1 65  ? 169.526 48.152  132.073 1.00 70.52  ? 65  GLU B OE1   1 
ATOM   3048  O OE2   . GLU B  1 65  ? 171.515 47.719  132.944 1.00 65.96  ? 65  GLU B OE2   1 
ATOM   3049  N N     . ILE B  1 66  ? 174.636 51.329  130.897 1.00 6.84   ? 66  ILE B N     1 
ATOM   3050  C CA    . ILE B  1 66  ? 175.823 51.872  131.487 1.00 3.13   ? 66  ILE B CA    1 
ATOM   3051  C C     . ILE B  1 66  ? 175.464 53.125  132.263 1.00 2.93   ? 66  ILE B C     1 
ATOM   3052  O O     . ILE B  1 66  ? 175.885 53.298  133.414 1.00 3.00   ? 66  ILE B O     1 
ATOM   3053  C CB    . ILE B  1 66  ? 176.815 52.157  130.422 1.00 3.98   ? 66  ILE B CB    1 
ATOM   3054  C CG1   . ILE B  1 66  ? 177.256 50.863  129.809 1.00 2.98   ? 66  ILE B CG1   1 
ATOM   3055  C CG2   . ILE B  1 66  ? 178.035 52.710  130.983 1.00 5.25   ? 66  ILE B CG2   1 
ATOM   3056  C CD1   . ILE B  1 66  ? 177.857 51.097  128.486 1.00 3.77   ? 66  ILE B CD1   1 
ATOM   3057  N N     . ALA B  1 67  ? 174.648 53.990  131.676 1.00 7.22   ? 67  ALA B N     1 
ATOM   3058  C CA    . ALA B  1 67  ? 174.292 55.221  132.379 1.00 10.01  ? 67  ALA B CA    1 
ATOM   3059  C C     . ALA B  1 67  ? 173.418 54.961  133.580 1.00 11.83  ? 67  ALA B C     1 
ATOM   3060  O O     . ALA B  1 67  ? 173.674 55.457  134.687 1.00 11.43  ? 67  ALA B O     1 
ATOM   3061  C CB    . ALA B  1 67  ? 173.588 56.182  131.452 1.00 3.13   ? 67  ALA B CB    1 
ATOM   3062  N N     . ARG B  1 68  ? 172.374 54.184  133.354 1.00 25.48  ? 68  ARG B N     1 
ATOM   3063  C CA    . ARG B  1 68  ? 171.452 53.902  134.419 1.00 29.21  ? 68  ARG B CA    1 
ATOM   3064  C C     . ARG B  1 68  ? 172.187 53.273  135.591 1.00 29.42  ? 68  ARG B C     1 
ATOM   3065  O O     . ARG B  1 68  ? 171.943 53.621  136.748 1.00 29.54  ? 68  ARG B O     1 
ATOM   3066  C CB    . ARG B  1 68  ? 170.330 52.999  133.911 1.00 59.23  ? 68  ARG B CB    1 
ATOM   3067  C CG    . ARG B  1 68  ? 169.011 53.267  134.616 1.00 64.45  ? 68  ARG B CG    1 
ATOM   3068  C CD    . ARG B  1 68  ? 167.951 52.303  134.175 1.00 69.36  ? 68  ARG B CD    1 
ATOM   3069  N NE    . ARG B  1 68  ? 167.429 52.597  132.844 1.00 74.00  ? 68  ARG B NE    1 
ATOM   3070  C CZ    . ARG B  1 68  ? 166.448 53.462  132.595 1.00 75.45  ? 68  ARG B CZ    1 
ATOM   3071  N NH1   . ARG B  1 68  ? 165.881 54.133  133.594 1.00 75.74  ? 68  ARG B NH1   1 
ATOM   3072  N NH2   . ARG B  1 68  ? 166.005 53.620  131.348 1.00 74.99  ? 68  ARG B NH2   1 
ATOM   3073  N N     . ARG B  1 69  ? 173.101 52.361  135.282 1.00 18.71  ? 69  ARG B N     1 
ATOM   3074  C CA    . ARG B  1 69  ? 173.887 51.682  136.303 1.00 19.11  ? 69  ARG B CA    1 
ATOM   3075  C C     . ARG B  1 69  ? 174.813 52.645  137.015 1.00 19.01  ? 69  ARG B C     1 
ATOM   3076  O O     . ARG B  1 69  ? 174.865 52.675  138.248 1.00 18.77  ? 69  ARG B O     1 
ATOM   3077  C CB    . ARG B  1 69  ? 174.718 50.593  135.662 1.00 43.44  ? 69  ARG B CB    1 
ATOM   3078  C CG    . ARG B  1 69  ? 173.902 49.474  135.119 1.00 46.88  ? 69  ARG B CG    1 
ATOM   3079  C CD    . ARG B  1 69  ? 173.394 48.641  136.260 1.00 48.79  ? 69  ARG B CD    1 
ATOM   3080  N NE    . ARG B  1 69  ? 172.356 47.744  135.788 1.00 50.46  ? 69  ARG B NE    1 
ATOM   3081  C CZ    . ARG B  1 69  ? 171.593 47.032  136.597 1.00 51.14  ? 69  ARG B CZ    1 
ATOM   3082  N NH1   . ARG B  1 69  ? 171.774 47.124  137.918 1.00 50.74  ? 69  ARG B NH1   1 
ATOM   3083  N NH2   . ARG B  1 69  ? 170.652 46.250  136.079 1.00 51.15  ? 69  ARG B NH2   1 
ATOM   3084  N N     . LEU B  1 70  ? 175.560 53.427  136.234 1.00 22.97  ? 70  LEU B N     1 
ATOM   3085  C CA    . LEU B  1 70  ? 176.480 54.394  136.819 1.00 22.19  ? 70  LEU B CA    1 
ATOM   3086  C C     . LEU B  1 70  ? 175.706 55.091  137.927 1.00 22.66  ? 70  LEU B C     1 
ATOM   3087  O O     . LEU B  1 70  ? 176.074 55.081  139.101 1.00 21.08  ? 70  LEU B O     1 
ATOM   3088  C CB    . LEU B  1 70  ? 176.926 55.426  135.776 1.00 1.00   ? 70  LEU B CB    1 
ATOM   3089  C CG    . LEU B  1 70  ? 177.924 56.465  136.307 1.00 1.00   ? 70  LEU B CG    1 
ATOM   3090  C CD1   . LEU B  1 70  ? 179.345 55.937  136.312 1.00 1.00   ? 70  LEU B CD1   1 
ATOM   3091  C CD2   . LEU B  1 70  ? 177.881 57.651  135.428 1.00 1.00   ? 70  LEU B CD2   1 
ATOM   3092  N N     . ALA B  1 71  ? 174.592 55.674  137.526 1.00 33.26  ? 71  ALA B N     1 
ATOM   3093  C CA    . ALA B  1 71  ? 173.747 56.384  138.453 1.00 35.95  ? 71  ALA B CA    1 
ATOM   3094  C C     . ALA B  1 71  ? 173.479 55.531  139.669 1.00 37.04  ? 71  ALA B C     1 
ATOM   3095  O O     . ALA B  1 71  ? 173.651 55.964  140.804 1.00 36.65  ? 71  ALA B O     1 
ATOM   3096  C CB    . ALA B  1 71  ? 172.445 56.742  137.771 1.00 83.82  ? 71  ALA B CB    1 
ATOM   3097  N N     . LYS B  1 72  ? 173.072 54.298  139.406 1.00 39.66  ? 72  LYS B N     1 
ATOM   3098  C CA    . LYS B  1 72  ? 172.710 53.371  140.456 1.00 41.27  ? 72  LYS B CA    1 
ATOM   3099  C C     . LYS B  1 72  ? 173.823 53.094  141.437 1.00 39.89  ? 72  LYS B C     1 
ATOM   3100  O O     . LYS B  1 72  ? 173.618 53.202  142.636 1.00 39.97  ? 72  LYS B O     1 
ATOM   3101  C CB    . LYS B  1 72  ? 172.221 52.061  139.842 1.00 182.54 ? 72  LYS B CB    1 
ATOM   3102  C CG    . LYS B  1 72  ? 171.523 51.140  140.828 1.00 189.59 ? 72  LYS B CG    1 
ATOM   3103  C CD    . LYS B  1 72  ? 170.296 51.805  141.434 1.00 195.15 ? 72  LYS B CD    1 
ATOM   3104  C CE    . LYS B  1 72  ? 169.490 50.822  142.272 1.00 199.59 ? 72  LYS B CE    1 
ATOM   3105  N NZ    . LYS B  1 72  ? 168.981 49.684  141.454 1.00 200.00 ? 72  LYS B NZ    1 
ATOM   3106  N N     . LEU B  1 73  ? 175.006 52.758  140.936 1.00 35.31  ? 73  LEU B N     1 
ATOM   3107  C CA    . LEU B  1 73  ? 176.121 52.414  141.817 1.00 34.14  ? 73  LEU B CA    1 
ATOM   3108  C C     . LEU B  1 73  ? 176.684 53.625  142.518 1.00 34.45  ? 73  LEU B C     1 
ATOM   3109  O O     . LEU B  1 73  ? 177.575 53.515  143.361 1.00 35.09  ? 73  LEU B O     1 
ATOM   3110  C CB    . LEU B  1 73  ? 177.234 51.716  141.032 1.00 21.57  ? 73  LEU B CB    1 
ATOM   3111  C CG    . LEU B  1 73  ? 178.069 52.611  140.112 1.00 20.75  ? 73  LEU B CG    1 
ATOM   3112  C CD1   . LEU B  1 73  ? 179.226 53.174  140.930 1.00 18.83  ? 73  LEU B CD1   1 
ATOM   3113  C CD2   . LEU B  1 73  ? 178.602 51.844  138.886 1.00 19.85  ? 73  LEU B CD2   1 
ATOM   3114  N N     . ALA B  1 74  ? 176.162 54.788  142.167 1.00 23.09  ? 74  ALA B N     1 
ATOM   3115  C CA    . ALA B  1 74  ? 176.646 56.012  142.767 1.00 24.26  ? 74  ALA B CA    1 
ATOM   3116  C C     . ALA B  1 74  ? 175.521 56.581  143.583 1.00 24.57  ? 74  ALA B C     1 
ATOM   3117  O O     . ALA B  1 74  ? 175.635 57.670  144.139 1.00 24.45  ? 74  ALA B O     1 
ATOM   3118  C CB    . ALA B  1 74  ? 177.073 56.994  141.682 1.00 116.90 ? 74  ALA B CB    1 
ATOM   3119  N N     . ASN B  1 75  ? 174.418 55.848  143.644 1.00 44.44  ? 75  ASN B N     1 
ATOM   3120  C CA    . ASN B  1 75  ? 173.288 56.315  144.425 1.00 46.95  ? 75  ASN B CA    1 
ATOM   3121  C C     . ASN B  1 75  ? 173.043 57.788  144.040 1.00 46.10  ? 75  ASN B C     1 
ATOM   3122  O O     . ASN B  1 75  ? 173.032 58.701  144.879 1.00 46.27  ? 75  ASN B O     1 
ATOM   3123  C CB    . ASN B  1 75  ? 173.644 56.178  145.909 1.00 75.87  ? 75  ASN B CB    1 
ATOM   3124  C CG    . ASN B  1 75  ? 172.497 56.513  146.816 1.00 79.86  ? 75  ASN B CG    1 
ATOM   3125  O OD1   . ASN B  1 75  ? 171.453 55.859  146.779 1.00 81.84  ? 75  ASN B OD1   1 
ATOM   3126  N ND2   . ASN B  1 75  ? 172.679 57.539  147.646 1.00 80.74  ? 75  ASN B ND2   1 
ATOM   3127  N N     . ALA B  1 76  ? 172.845 58.010  142.749 1.00 45.75  ? 76  ALA B N     1 
ATOM   3128  C CA    . ALA B  1 76  ? 172.639 59.354  142.261 1.00 43.16  ? 76  ALA B CA    1 
ATOM   3129  C C     . ALA B  1 76  ? 171.323 59.564  141.568 1.00 40.86  ? 76  ALA B C     1 
ATOM   3130  O O     . ALA B  1 76  ? 170.782 58.651  140.950 1.00 41.57  ? 76  ALA B O     1 
ATOM   3131  C CB    . ALA B  1 76  ? 173.756 59.717  141.303 1.00 74.96  ? 76  ALA B CB    1 
ATOM   3132  N N     . PRO B  1 77  ? 170.781 60.779  141.674 1.00 29.32  ? 77  PRO B N     1 
ATOM   3133  C CA    . PRO B  1 77  ? 169.519 61.132  141.034 1.00 28.95  ? 77  PRO B CA    1 
ATOM   3134  C C     . PRO B  1 77  ? 169.744 61.018  139.511 1.00 28.20  ? 77  PRO B C     1 
ATOM   3135  O O     . PRO B  1 77  ? 170.548 61.743  138.940 1.00 28.52  ? 77  PRO B O     1 
ATOM   3136  C CB    . PRO B  1 77  ? 169.313 62.581  141.467 1.00 22.39  ? 77  PRO B CB    1 
ATOM   3137  C CG    . PRO B  1 77  ? 169.954 62.643  142.780 1.00 22.37  ? 77  PRO B CG    1 
ATOM   3138  C CD    . PRO B  1 77  ? 171.216 61.851  142.578 1.00 22.66  ? 77  PRO B CD    1 
ATOM   3139  N N     . PHE B  1 78  ? 169.042 60.101  138.863 1.00 31.33  ? 78  PHE B N     1 
ATOM   3140  C CA    . PHE B  1 78  ? 169.202 59.883  137.440 1.00 29.73  ? 78  PHE B CA    1 
ATOM   3141  C C     . PHE B  1 78  ? 167.894 60.141  136.748 1.00 30.88  ? 78  PHE B C     1 
ATOM   3142  O O     . PHE B  1 78  ? 166.844 60.113  137.370 1.00 32.19  ? 78  PHE B O     1 
ATOM   3143  C CB    . PHE B  1 78  ? 169.604 58.438  137.203 1.00 24.49  ? 78  PHE B CB    1 
ATOM   3144  C CG    . PHE B  1 78  ? 169.745 58.075  135.766 1.00 22.73  ? 78  PHE B CG    1 
ATOM   3145  C CD1   . PHE B  1 78  ? 170.869 58.431  135.053 1.00 23.12  ? 78  PHE B CD1   1 
ATOM   3146  C CD2   . PHE B  1 78  ? 168.743 57.399  135.111 1.00 23.44  ? 78  PHE B CD2   1 
ATOM   3147  C CE1   . PHE B  1 78  ? 170.996 58.120  133.689 1.00 22.80  ? 78  PHE B CE1   1 
ATOM   3148  C CE2   . PHE B  1 78  ? 168.859 57.086  133.755 1.00 22.51  ? 78  PHE B CE2   1 
ATOM   3149  C CZ    . PHE B  1 78  ? 169.995 57.452  133.044 1.00 21.40  ? 78  PHE B CZ    1 
ATOM   3150  N N     . ILE B  1 79  ? 167.946 60.385  135.449 1.00 21.92  ? 79  ILE B N     1 
ATOM   3151  C CA    . ILE B  1 79  ? 166.727 60.615  134.673 1.00 21.07  ? 79  ILE B CA    1 
ATOM   3152  C C     . ILE B  1 79  ? 167.070 60.543  133.193 1.00 19.47  ? 79  ILE B C     1 
ATOM   3153  O O     . ILE B  1 79  ? 168.098 61.070  132.756 1.00 17.73  ? 79  ILE B O     1 
ATOM   3154  C CB    . ILE B  1 79  ? 166.059 61.984  135.040 1.00 30.38  ? 79  ILE B CB    1 
ATOM   3155  C CG1   . ILE B  1 79  ? 164.945 62.304  134.071 1.00 30.10  ? 79  ILE B CG1   1 
ATOM   3156  C CG2   . ILE B  1 79  ? 167.042 63.107  134.964 1.00 32.47  ? 79  ILE B CG2   1 
ATOM   3157  C CD1   . ILE B  1 79  ? 163.941 61.242  133.998 1.00 32.44  ? 79  ILE B CD1   1 
ATOM   3158  N N     . LYS B  1 80  ? 166.242 59.834  132.438 1.00 27.65  ? 80  LYS B N     1 
ATOM   3159  C CA    . LYS B  1 80  ? 166.467 59.704  131.009 1.00 28.12  ? 80  LYS B CA    1 
ATOM   3160  C C     . LYS B  1 80  ? 165.368 60.435  130.281 1.00 28.55  ? 80  LYS B C     1 
ATOM   3161  O O     . LYS B  1 80  ? 164.240 60.474  130.749 1.00 29.67  ? 80  LYS B O     1 
ATOM   3162  C CB    . LYS B  1 80  ? 166.460 58.230  130.591 1.00 29.60  ? 80  LYS B CB    1 
ATOM   3163  C CG    . LYS B  1 80  ? 166.508 58.008  129.079 1.00 30.10  ? 80  LYS B CG    1 
ATOM   3164  C CD    . LYS B  1 80  ? 166.748 56.549  128.770 1.00 33.43  ? 80  LYS B CD    1 
ATOM   3165  C CE    . LYS B  1 80  ? 166.598 56.179  127.278 1.00 35.39  ? 80  LYS B CE    1 
ATOM   3166  N NZ    . LYS B  1 80  ? 166.627 54.660  126.962 1.00 37.68  ? 80  LYS B NZ    1 
ATOM   3167  N N     . VAL B  1 81  ? 165.677 61.026  129.140 1.00 14.04  ? 81  VAL B N     1 
ATOM   3168  C CA    . VAL B  1 81  ? 164.638 61.714  128.390 1.00 15.39  ? 81  VAL B CA    1 
ATOM   3169  C C     . VAL B  1 81  ? 164.913 61.627  126.897 1.00 16.50  ? 81  VAL B C     1 
ATOM   3170  O O     . VAL B  1 81  ? 166.083 61.700  126.495 1.00 17.08  ? 81  VAL B O     1 
ATOM   3171  C CB    . VAL B  1 81  ? 164.562 63.200  128.771 1.00 33.98  ? 81  VAL B CB    1 
ATOM   3172  C CG1   . VAL B  1 81  ? 164.439 63.353  130.251 1.00 33.40  ? 81  VAL B CG1   1 
ATOM   3173  C CG2   . VAL B  1 81  ? 165.791 63.912  128.294 1.00 34.57  ? 81  VAL B CG2   1 
ATOM   3174  N N     . GLU B  1 82  ? 163.868 61.442  126.077 1.00 11.77  ? 82  GLU B N     1 
ATOM   3175  C CA    . GLU B  1 82  ? 164.086 61.418  124.627 1.00 14.03  ? 82  GLU B CA    1 
ATOM   3176  C C     . GLU B  1 82  ? 164.419 62.878  124.216 1.00 12.82  ? 82  GLU B C     1 
ATOM   3177  O O     . GLU B  1 82  ? 163.900 63.843  124.777 1.00 11.75  ? 82  GLU B O     1 
ATOM   3178  C CB    . GLU B  1 82  ? 162.852 60.910  123.885 1.00 102.24 ? 82  GLU B CB    1 
ATOM   3179  C CG    . GLU B  1 82  ? 163.186 60.256  122.553 1.00 111.87 ? 82  GLU B CG    1 
ATOM   3180  C CD    . GLU B  1 82  ? 163.282 58.734  122.626 1.00 118.67 ? 82  GLU B CD    1 
ATOM   3181  O OE1   . GLU B  1 82  ? 163.592 58.187  123.715 1.00 121.87 ? 82  GLU B OE1   1 
ATOM   3182  O OE2   . GLU B  1 82  ? 163.054 58.087  121.575 1.00 120.50 ? 82  GLU B OE2   1 
ATOM   3183  N N     . ALA B  1 83  ? 165.324 63.051  123.266 1.00 19.19  ? 83  ALA B N     1 
ATOM   3184  C CA    . ALA B  1 83  ? 165.697 64.398  122.856 1.00 17.57  ? 83  ALA B CA    1 
ATOM   3185  C C     . ALA B  1 83  ? 164.541 65.001  122.094 1.00 17.05  ? 83  ALA B C     1 
ATOM   3186  O O     . ALA B  1 83  ? 164.250 66.177  122.219 1.00 16.76  ? 83  ALA B O     1 
ATOM   3187  C CB    . ALA B  1 83  ? 166.953 64.352  121.982 1.00 2.97   ? 83  ALA B CB    1 
ATOM   3188  N N     . THR B  1 84  ? 163.881 64.150  121.320 1.00 19.14  ? 84  THR B N     1 
ATOM   3189  C CA    . THR B  1 84  ? 162.748 64.518  120.502 1.00 20.46  ? 84  THR B CA    1 
ATOM   3190  C C     . THR B  1 84  ? 161.532 64.783  121.331 1.00 21.40  ? 84  THR B C     1 
ATOM   3191  O O     . THR B  1 84  ? 160.545 65.308  120.831 1.00 22.18  ? 84  THR B O     1 
ATOM   3192  C CB    . THR B  1 84  ? 162.392 63.418  119.529 1.00 52.09  ? 84  THR B CB    1 
ATOM   3193  O OG1   . THR B  1 84  ? 162.493 62.153  120.193 1.00 52.89  ? 84  THR B OG1   1 
ATOM   3194  C CG2   . THR B  1 84  ? 163.317 63.462  118.337 1.00 55.48  ? 84  THR B CG2   1 
ATOM   3195  N N     . LYS B  1 85  ? 161.576 64.422  122.599 1.00 36.82  ? 85  LYS B N     1 
ATOM   3196  C CA    . LYS B  1 85  ? 160.421 64.685  123.428 1.00 37.90  ? 85  LYS B CA    1 
ATOM   3197  C C     . LYS B  1 85  ? 160.061 66.159  123.330 1.00 38.70  ? 85  LYS B C     1 
ATOM   3198  O O     . LYS B  1 85  ? 158.926 66.538  123.572 1.00 39.99  ? 85  LYS B O     1 
ATOM   3199  C CB    . LYS B  1 85  ? 160.704 64.348  124.886 1.00 68.31  ? 85  LYS B CB    1 
ATOM   3200  C CG    . LYS B  1 85  ? 159.520 64.557  125.827 1.00 71.00  ? 85  LYS B CG    1 
ATOM   3201  C CD    . LYS B  1 85  ? 159.935 64.328  127.276 1.00 73.98  ? 85  LYS B CD    1 
ATOM   3202  C CE    . LYS B  1 85  ? 158.781 64.520  128.257 1.00 76.78  ? 85  LYS B CE    1 
ATOM   3203  N NZ    . LYS B  1 85  ? 159.229 64.432  129.690 1.00 79.94  ? 85  LYS B NZ    1 
ATOM   3204  N N     . PHE B  1 86  ? 161.017 66.995  122.948 1.00 32.40  ? 86  PHE B N     1 
ATOM   3205  C CA    . PHE B  1 86  ? 160.759 68.424  122.869 1.00 32.28  ? 86  PHE B CA    1 
ATOM   3206  C C     . PHE B  1 86  ? 160.703 69.070  121.496 1.00 34.49  ? 86  PHE B C     1 
ATOM   3207  O O     . PHE B  1 86  ? 161.046 70.245  121.376 1.00 34.59  ? 86  PHE B O     1 
ATOM   3208  C CB    . PHE B  1 86  ? 161.799 69.150  123.683 1.00 11.28  ? 86  PHE B CB    1 
ATOM   3209  C CG    . PHE B  1 86  ? 162.103 68.483  124.967 1.00 9.14   ? 86  PHE B CG    1 
ATOM   3210  C CD1   . PHE B  1 86  ? 163.066 67.496  125.030 1.00 9.75   ? 86  PHE B CD1   1 
ATOM   3211  C CD2   . PHE B  1 86  ? 161.426 68.835  126.119 1.00 8.75   ? 86  PHE B CD2   1 
ATOM   3212  C CE1   . PHE B  1 86  ? 163.349 66.872  126.234 1.00 10.97  ? 86  PHE B CE1   1 
ATOM   3213  C CE2   . PHE B  1 86  ? 161.697 68.219  127.323 1.00 9.40   ? 86  PHE B CE2   1 
ATOM   3214  C CZ    . PHE B  1 86  ? 162.655 67.238  127.389 1.00 10.55  ? 86  PHE B CZ    1 
ATOM   3215  N N     . THR B  1 87  ? 160.262 68.341  120.472 1.00 48.02  ? 87  THR B N     1 
ATOM   3216  C CA    . THR B  1 87  ? 160.195 68.915  119.129 1.00 52.00  ? 87  THR B CA    1 
ATOM   3217  C C     . THR B  1 87  ? 158.908 69.704  118.823 1.00 53.44  ? 87  THR B C     1 
ATOM   3218  O O     . THR B  1 87  ? 158.128 70.071  119.707 1.00 54.20  ? 87  THR B O     1 
ATOM   3219  C CB    . THR B  1 87  ? 160.346 67.828  118.065 1.00 50.83  ? 87  THR B CB    1 
ATOM   3220  O OG1   . THR B  1 87  ? 161.382 66.939  118.461 1.00 52.37  ? 87  THR B OG1   1 
ATOM   3221  C CG2   . THR B  1 87  ? 160.734 68.425  116.729 1.00 51.48  ? 87  THR B CG2   1 
ATOM   3222  N N     . GLU B  1 95  ? 158.352 71.372  127.431 1.00 73.93  ? 95  GLU B N     1 
ATOM   3223  C CA    . GLU B  1 95  ? 159.126 72.176  128.389 1.00 75.43  ? 95  GLU B CA    1 
ATOM   3224  C C     . GLU B  1 95  ? 160.446 71.526  128.879 1.00 73.30  ? 95  GLU B C     1 
ATOM   3225  O O     . GLU B  1 95  ? 160.452 70.724  129.817 1.00 73.11  ? 95  GLU B O     1 
ATOM   3226  C CB    . GLU B  1 95  ? 158.253 72.511  129.604 1.00 184.01 ? 95  GLU B CB    1 
ATOM   3227  C CG    . GLU B  1 95  ? 158.968 73.309  130.700 1.00 190.02 ? 95  GLU B CG    1 
ATOM   3228  C CD    . GLU B  1 95  ? 159.349 74.719  130.265 1.00 193.48 ? 95  GLU B CD    1 
ATOM   3229  O OE1   . GLU B  1 95  ? 159.986 74.869  129.198 1.00 195.37 ? 95  GLU B OE1   1 
ATOM   3230  O OE2   . GLU B  1 95  ? 159.018 75.679  130.998 1.00 194.25 ? 95  GLU B OE2   1 
ATOM   3231  N N     . VAL B  1 96  ? 161.570 71.903  128.275 1.00 35.77  ? 96  VAL B N     1 
ATOM   3232  C CA    . VAL B  1 96  ? 162.867 71.334  128.637 1.00 32.35  ? 96  VAL B CA    1 
ATOM   3233  C C     . VAL B  1 96  ? 163.290 71.466  130.110 1.00 30.09  ? 96  VAL B C     1 
ATOM   3234  O O     . VAL B  1 96  ? 164.003 70.622  130.624 1.00 29.40  ? 96  VAL B O     1 
ATOM   3235  C CB    . VAL B  1 96  ? 163.967 71.927  127.728 1.00 38.60  ? 96  VAL B CB    1 
ATOM   3236  C CG1   . VAL B  1 96  ? 164.978 72.701  128.558 1.00 38.09  ? 96  VAL B CG1   1 
ATOM   3237  C CG2   . VAL B  1 96  ? 164.637 70.822  126.947 1.00 37.52  ? 96  VAL B CG2   1 
ATOM   3238  N N     . ASP B  1 97  ? 162.879 72.526  130.788 1.00 50.25  ? 97  ASP B N     1 
ATOM   3239  C CA    . ASP B  1 97  ? 163.271 72.674  132.179 1.00 49.25  ? 97  ASP B CA    1 
ATOM   3240  C C     . ASP B  1 97  ? 162.756 71.494  132.956 1.00 46.42  ? 97  ASP B C     1 
ATOM   3241  O O     . ASP B  1 97  ? 163.246 71.206  134.045 1.00 47.03  ? 97  ASP B O     1 
ATOM   3242  C CB    . ASP B  1 97  ? 162.698 73.945  132.810 1.00 121.65 ? 97  ASP B CB    1 
ATOM   3243  C CG    . ASP B  1 97  ? 163.360 75.196  132.303 1.00 124.99 ? 97  ASP B CG    1 
ATOM   3244  O OD1   . ASP B  1 97  ? 164.583 75.158  132.080 1.00 126.34 ? 97  ASP B OD1   1 
ATOM   3245  O OD2   . ASP B  1 97  ? 162.664 76.221  132.145 1.00 126.94 ? 97  ASP B OD2   1 
ATOM   3246  N N     . SER B  1 98  ? 161.769 70.805  132.402 1.00 27.09  ? 98  SER B N     1 
ATOM   3247  C CA    . SER B  1 98  ? 161.201 69.677  133.119 1.00 23.53  ? 98  SER B CA    1 
ATOM   3248  C C     . SER B  1 98  ? 162.274 68.663  133.509 1.00 20.58  ? 98  SER B C     1 
ATOM   3249  O O     . SER B  1 98  ? 162.264 68.124  134.617 1.00 20.14  ? 98  SER B O     1 
ATOM   3250  C CB    . SER B  1 98  ? 160.143 68.977  132.280 1.00 23.28  ? 98  SER B CB    1 
ATOM   3251  O OG    . SER B  1 98  ? 160.743 68.065  131.369 1.00 23.42  ? 98  SER B OG    1 
ATOM   3252  N N     . ILE B  1 99  ? 163.200 68.402  132.600 1.00 23.14  ? 99  ILE B N     1 
ATOM   3253  C CA    . ILE B  1 99  ? 164.246 67.441  132.866 1.00 21.65  ? 99  ILE B CA    1 
ATOM   3254  C C     . ILE B  1 99  ? 164.820 67.651  134.247 1.00 24.11  ? 99  ILE B C     1 
ATOM   3255  O O     . ILE B  1 99  ? 164.974 66.710  135.033 1.00 26.06  ? 99  ILE B O     1 
ATOM   3256  C CB    . ILE B  1 99  ? 165.374 67.573  131.878 1.00 5.55   ? 99  ILE B CB    1 
ATOM   3257  C CG1   . ILE B  1 99  ? 164.898 67.184  130.499 1.00 3.78   ? 99  ILE B CG1   1 
ATOM   3258  C CG2   . ILE B  1 99  ? 166.475 66.639  132.248 1.00 4.62   ? 99  ILE B CG2   1 
ATOM   3259  C CD1   . ILE B  1 99  ? 165.823 67.646  129.405 1.00 2.09   ? 99  ILE B CD1   1 
ATOM   3260  N N     . ILE B  1 100 ? 165.148 68.896  134.551 1.00 9.53   ? 100 ILE B N     1 
ATOM   3261  C CA    . ILE B  1 100 ? 165.719 69.190  135.850 1.00 8.67   ? 100 ILE B CA    1 
ATOM   3262  C C     . ILE B  1 100 ? 164.656 69.048  136.918 1.00 10.60  ? 100 ILE B C     1 
ATOM   3263  O O     . ILE B  1 100 ? 164.920 68.634  138.025 1.00 9.63   ? 100 ILE B O     1 
ATOM   3264  C CB    . ILE B  1 100 ? 166.261 70.599  135.873 1.00 5.28   ? 100 ILE B CB    1 
ATOM   3265  C CG1   . ILE B  1 100 ? 167.137 70.817  134.640 1.00 5.28   ? 100 ILE B CG1   1 
ATOM   3266  C CG2   . ILE B  1 100 ? 167.006 70.833  137.171 1.00 5.28   ? 100 ILE B CG2   1 
ATOM   3267  C CD1   . ILE B  1 100 ? 168.220 69.802  134.467 1.00 5.28   ? 100 ILE B CD1   1 
ATOM   3268  N N     . ARG B  1 101 ? 163.438 69.403  136.568 1.00 16.93  ? 101 ARG B N     1 
ATOM   3269  C CA    . ARG B  1 101 ? 162.366 69.307  137.511 1.00 22.60  ? 101 ARG B CA    1 
ATOM   3270  C C     . ARG B  1 101 ? 162.215 67.833  137.876 1.00 24.82  ? 101 ARG B C     1 
ATOM   3271  O O     . ARG B  1 101 ? 162.359 67.446  139.038 1.00 26.42  ? 101 ARG B O     1 
ATOM   3272  C CB    . ARG B  1 101 ? 161.095 69.863  136.888 1.00 71.15  ? 101 ARG B CB    1 
ATOM   3273  C CG    . ARG B  1 101 ? 160.121 70.468  137.874 1.00 76.12  ? 101 ARG B CG    1 
ATOM   3274  C CD    . ARG B  1 101 ? 159.161 71.367  137.131 1.00 79.83  ? 101 ARG B CD    1 
ATOM   3275  N NE    . ARG B  1 101 ? 159.833 72.577  136.668 1.00 83.34  ? 101 ARG B NE    1 
ATOM   3276  C CZ    . ARG B  1 101 ? 159.535 73.221  135.543 1.00 84.32  ? 101 ARG B CZ    1 
ATOM   3277  N NH1   . ARG B  1 101 ? 158.568 72.764  134.744 1.00 84.60  ? 101 ARG B NH1   1 
ATOM   3278  N NH2   . ARG B  1 101 ? 160.204 74.328  135.226 1.00 84.39  ? 101 ARG B NH2   1 
ATOM   3279  N N     . ASP B  1 102 ? 161.938 67.000  136.888 1.00 41.02  ? 102 ASP B N     1 
ATOM   3280  C CA    . ASP B  1 102 ? 161.793 65.579  137.149 1.00 44.36  ? 102 ASP B CA    1 
ATOM   3281  C C     . ASP B  1 102 ? 162.990 65.042  137.948 1.00 44.52  ? 102 ASP B C     1 
ATOM   3282  O O     . ASP B  1 102 ? 162.833 64.280  138.903 1.00 44.50  ? 102 ASP B O     1 
ATOM   3283  C CB    . ASP B  1 102 ? 161.668 64.831  135.826 1.00 108.61 ? 102 ASP B CB    1 
ATOM   3284  C CG    . ASP B  1 102 ? 160.385 65.156  135.097 1.00 113.78 ? 102 ASP B CG    1 
ATOM   3285  O OD1   . ASP B  1 102 ? 160.316 64.882  133.879 1.00 115.86 ? 102 ASP B OD1   1 
ATOM   3286  O OD2   . ASP B  1 102 ? 159.446 65.673  135.744 1.00 116.81 ? 102 ASP B OD2   1 
ATOM   3287  N N     . LEU B  1 103 ? 164.188 65.446  137.555 1.00 39.58  ? 103 LEU B N     1 
ATOM   3288  C CA    . LEU B  1 103 ? 165.382 64.997  138.246 1.00 39.99  ? 103 LEU B CA    1 
ATOM   3289  C C     . LEU B  1 103 ? 165.259 65.260  139.747 1.00 40.69  ? 103 LEU B C     1 
ATOM   3290  O O     . LEU B  1 103 ? 165.356 64.360  140.561 1.00 41.28  ? 103 LEU B O     1 
ATOM   3291  C CB    . LEU B  1 103 ? 166.599 65.723  137.680 1.00 43.01  ? 103 LEU B CB    1 
ATOM   3292  C CG    . LEU B  1 103 ? 167.936 65.283  138.267 1.00 40.83  ? 103 LEU B CG    1 
ATOM   3293  C CD1   . LEU B  1 103 ? 168.135 63.777  138.070 1.00 38.97  ? 103 LEU B CD1   1 
ATOM   3294  C CD2   . LEU B  1 103 ? 169.040 66.083  137.597 1.00 39.26  ? 103 LEU B CD2   1 
ATOM   3295  N N     . THR B  1 104 ? 165.037 66.510  140.105 1.00 29.85  ? 104 THR B N     1 
ATOM   3296  C CA    . THR B  1 104 ? 164.892 66.875  141.487 1.00 30.82  ? 104 THR B CA    1 
ATOM   3297  C C     . THR B  1 104 ? 163.834 66.024  142.149 1.00 33.83  ? 104 THR B C     1 
ATOM   3298  O O     . THR B  1 104 ? 164.003 65.577  143.279 1.00 35.09  ? 104 THR B O     1 
ATOM   3299  C CB    . THR B  1 104 ? 164.472 68.295  141.601 1.00 29.66  ? 104 THR B CB    1 
ATOM   3300  O OG1   . THR B  1 104 ? 165.410 69.113  140.902 1.00 29.84  ? 104 THR B OG1   1 
ATOM   3301  C CG2   . THR B  1 104 ? 164.431 68.696  143.045 1.00 31.16  ? 104 THR B CG2   1 
ATOM   3302  N N     . ASP B  1 105 ? 162.729 65.812  141.449 1.00 61.80  ? 105 ASP B N     1 
ATOM   3303  C CA    . ASP B  1 105 ? 161.643 65.002  141.987 1.00 65.42  ? 105 ASP B CA    1 
ATOM   3304  C C     . ASP B  1 105 ? 162.169 63.623  142.376 1.00 66.57  ? 105 ASP B C     1 
ATOM   3305  O O     . ASP B  1 105 ? 161.804 63.061  143.408 1.00 67.52  ? 105 ASP B O     1 
ATOM   3306  C CB    . ASP B  1 105 ? 160.524 64.867  140.949 1.00 101.63 ? 105 ASP B CB    1 
ATOM   3307  C CG    . ASP B  1 105 ? 159.197 65.396  141.455 1.00 103.50 ? 105 ASP B CG    1 
ATOM   3308  O OD1   . ASP B  1 105 ? 159.219 66.285  142.334 1.00 104.41 ? 105 ASP B OD1   1 
ATOM   3309  O OD2   . ASP B  1 105 ? 158.141 64.934  140.972 1.00 103.97 ? 105 ASP B OD2   1 
ATOM   3310  N N     . SER B  1 106 ? 163.044 63.087  141.541 1.00 39.45  ? 106 SER B N     1 
ATOM   3311  C CA    . SER B  1 106 ? 163.624 61.781  141.797 1.00 41.07  ? 106 SER B CA    1 
ATOM   3312  C C     . SER B  1 106 ? 164.604 61.854  142.958 1.00 41.61  ? 106 SER B C     1 
ATOM   3313  O O     . SER B  1 106 ? 164.668 60.945  143.773 1.00 42.25  ? 106 SER B O     1 
ATOM   3314  C CB    . SER B  1 106 ? 164.337 61.267  140.550 1.00 87.90  ? 106 SER B CB    1 
ATOM   3315  O OG    . SER B  1 106 ? 164.873 59.979  140.784 1.00 89.95  ? 106 SER B OG    1 
ATOM   3316  N N     . ALA B  1 107 ? 165.380 62.929  143.028 1.00 43.89  ? 107 ALA B N     1 
ATOM   3317  C CA    . ALA B  1 107 ? 166.324 63.073  144.123 1.00 46.40  ? 107 ALA B CA    1 
ATOM   3318  C C     . ALA B  1 107 ? 165.527 63.027  145.419 1.00 48.59  ? 107 ALA B C     1 
ATOM   3319  O O     . ALA B  1 107 ? 166.017 62.520  146.434 1.00 49.33  ? 107 ALA B O     1 
ATOM   3320  C CB    . ALA B  1 107 ? 167.077 64.386  144.018 1.00 37.09  ? 107 ALA B CB    1 
ATOM   3321  N N     . MET B  1 108 ? 164.298 63.553  145.386 1.00 39.58  ? 108 MET B N     1 
ATOM   3322  C CA    . MET B  1 108 ? 163.451 63.535  146.576 1.00 41.47  ? 108 MET B CA    1 
ATOM   3323  C C     . MET B  1 108 ? 163.357 62.101  147.012 1.00 42.53  ? 108 MET B C     1 
ATOM   3324  O O     . MET B  1 108 ? 163.909 61.733  148.034 1.00 43.33  ? 108 MET B O     1 
ATOM   3325  C CB    . MET B  1 108 ? 162.048 64.075  146.300 1.00 75.53  ? 108 MET B CB    1 
ATOM   3326  C CG    . MET B  1 108 ? 161.800 65.443  146.917 1.00 77.29  ? 108 MET B CG    1 
ATOM   3327  S SD    . MET B  1 108 ? 162.378 65.589  148.629 1.00 78.74  ? 108 MET B SD    1 
ATOM   3328  C CE    . MET B  1 108 ? 161.097 64.654  149.480 1.00 79.30  ? 108 MET B CE    1 
ATOM   3329  N N     . LYS B  1 109 ? 162.679 61.285  146.221 1.00 47.65  ? 109 LYS B N     1 
ATOM   3330  C CA    . LYS B  1 109 ? 162.552 59.871  146.544 1.00 50.33  ? 109 LYS B CA    1 
ATOM   3331  C C     . LYS B  1 109 ? 163.848 59.348  147.155 1.00 51.71  ? 109 LYS B C     1 
ATOM   3332  O O     . LYS B  1 109 ? 163.859 58.783  148.249 1.00 52.45  ? 109 LYS B O     1 
ATOM   3333  C CB    . LYS B  1 109 ? 162.227 59.057  145.291 1.00 83.10  ? 109 LYS B CB    1 
ATOM   3334  C CG    . LYS B  1 109 ? 162.087 57.581  145.552 1.00 84.31  ? 109 LYS B CG    1 
ATOM   3335  C CD    . LYS B  1 109 ? 161.912 56.831  144.275 1.00 85.28  ? 109 LYS B CD    1 
ATOM   3336  C CE    . LYS B  1 109 ? 162.123 55.361  144.520 1.00 86.72  ? 109 LYS B CE    1 
ATOM   3337  N NZ    . LYS B  1 109 ? 162.141 54.583  143.252 1.00 88.00  ? 109 LYS B NZ    1 
ATOM   3338  N N     . LEU B  1 110 ? 164.947 59.552  146.451 1.00 48.67  ? 110 LEU B N     1 
ATOM   3339  C CA    . LEU B  1 110 ? 166.226 59.086  146.936 1.00 50.42  ? 110 LEU B CA    1 
ATOM   3340  C C     . LEU B  1 110 ? 166.525 59.650  148.323 1.00 51.76  ? 110 LEU B C     1 
ATOM   3341  O O     . LEU B  1 110 ? 166.637 58.907  149.290 1.00 52.03  ? 110 LEU B O     1 
ATOM   3342  C CB    . LEU B  1 110 ? 167.313 59.481  145.949 1.00 66.31  ? 110 LEU B CB    1 
ATOM   3343  C CG    . LEU B  1 110 ? 168.450 58.473  145.883 1.00 66.71  ? 110 LEU B CG    1 
ATOM   3344  C CD1   . LEU B  1 110 ? 167.867 57.106  145.581 1.00 66.74  ? 110 LEU B CD1   1 
ATOM   3345  C CD2   . LEU B  1 110 ? 169.472 58.906  144.827 1.00 67.15  ? 110 LEU B CD2   1 
ATOM   3346  N N     . VAL B  1 111 ? 166.639 60.964  148.426 1.00 60.04  ? 111 VAL B N     1 
ATOM   3347  C CA    . VAL B  1 111 ? 166.932 61.575  149.713 1.00 62.78  ? 111 VAL B CA    1 
ATOM   3348  C C     . VAL B  1 111 ? 165.878 61.260  150.776 1.00 65.52  ? 111 VAL B C     1 
ATOM   3349  O O     . VAL B  1 111 ? 166.200 61.158  151.955 1.00 66.48  ? 111 VAL B O     1 
ATOM   3350  C CB    . VAL B  1 111 ? 167.083 63.106  149.580 1.00 70.66  ? 111 VAL B CB    1 
ATOM   3351  C CG1   . VAL B  1 111 ? 167.415 63.725  150.924 1.00 70.37  ? 111 VAL B CG1   1 
ATOM   3352  C CG2   . VAL B  1 111 ? 168.179 63.423  148.595 1.00 70.27  ? 111 VAL B CG2   1 
ATOM   3353  N N     . ARG B  1 112 ? 164.621 61.103  150.378 1.00 74.61  ? 112 ARG B N     1 
ATOM   3354  C CA    . ARG B  1 112 ? 163.578 60.796  151.351 1.00 77.69  ? 112 ARG B CA    1 
ATOM   3355  C C     . ARG B  1 112 ? 163.813 59.379  151.833 1.00 79.68  ? 112 ARG B C     1 
ATOM   3356  O O     . ARG B  1 112 ? 164.225 59.171  152.967 1.00 80.32  ? 112 ARG B O     1 
ATOM   3357  C CB    . ARG B  1 112 ? 162.194 60.905  150.721 1.00 138.47 ? 112 ARG B CB    1 
ATOM   3358  C CG    . ARG B  1 112 ? 161.070 60.921  151.735 1.00 140.38 ? 112 ARG B CG    1 
ATOM   3359  C CD    . ARG B  1 112 ? 159.728 61.021  151.044 1.00 142.11 ? 112 ARG B CD    1 
ATOM   3360  N NE    . ARG B  1 112 ? 158.637 61.256  151.981 1.00 143.52 ? 112 ARG B NE    1 
ATOM   3361  C CZ    . ARG B  1 112 ? 157.357 61.303  151.628 1.00 144.59 ? 112 ARG B CZ    1 
ATOM   3362  N NH1   . ARG B  1 112 ? 157.011 61.128  150.360 1.00 144.74 ? 112 ARG B NH1   1 
ATOM   3363  N NH2   . ARG B  1 112 ? 156.422 61.534  152.539 1.00 145.55 ? 112 ARG B NH2   1 
ATOM   3364  N N     . GLN B  1 113 ? 163.565 58.409  150.961 1.00 71.05  ? 113 GLN B N     1 
ATOM   3365  C CA    . GLN B  1 113 ? 163.773 56.998  151.285 1.00 73.41  ? 113 GLN B CA    1 
ATOM   3366  C C     . GLN B  1 113 ? 165.109 56.724  152.007 1.00 74.30  ? 113 GLN B C     1 
ATOM   3367  O O     . GLN B  1 113 ? 165.265 55.702  152.681 1.00 73.77  ? 113 GLN B O     1 
ATOM   3368  C CB    . GLN B  1 113 ? 163.707 56.166  150.002 1.00 147.81 ? 113 GLN B CB    1 
ATOM   3369  C CG    . GLN B  1 113 ? 164.414 54.827  150.090 1.00 149.38 ? 113 GLN B CG    1 
ATOM   3370  C CD    . GLN B  1 113 ? 165.147 54.491  148.810 1.00 150.14 ? 113 GLN B CD    1 
ATOM   3371  O OE1   . GLN B  1 113 ? 164.528 54.205  147.783 1.00 150.85 ? 113 GLN B OE1   1 
ATOM   3372  N NE2   . GLN B  1 113 ? 166.477 54.539  148.859 1.00 150.26 ? 113 GLN B NE2   1 
ATOM   3373  N N     . GLN B  1 114 ? 166.069 57.632  151.850 1.00 96.25  ? 114 GLN B N     1 
ATOM   3374  C CA    . GLN B  1 114 ? 167.377 57.494  152.486 1.00 97.69  ? 114 GLN B CA    1 
ATOM   3375  C C     . GLN B  1 114 ? 167.300 57.815  153.971 1.00 98.17  ? 114 GLN B C     1 
ATOM   3376  O O     . GLN B  1 114 ? 168.230 57.534  154.725 1.00 98.12  ? 114 GLN B O     1 
ATOM   3377  C CB    . GLN B  1 114 ? 168.389 58.438  151.842 1.00 125.59 ? 114 GLN B CB    1 
ATOM   3378  C CG    . GLN B  1 114 ? 169.379 57.783  150.904 1.00 127.03 ? 114 GLN B CG    1 
ATOM   3379  C CD    . GLN B  1 114 ? 170.537 58.712  150.580 1.00 127.78 ? 114 GLN B CD    1 
ATOM   3380  O OE1   . GLN B  1 114 ? 171.451 58.353  149.834 1.00 128.13 ? 114 GLN B OE1   1 
ATOM   3381  N NE2   . GLN B  1 114 ? 170.505 59.919  151.146 1.00 127.87 ? 114 GLN B NE2   1 
ATOM   3382  N N     . GLU B  1 115 ? 166.192 58.416  154.384 1.00 94.24  ? 115 GLU B N     1 
ATOM   3383  C CA    . GLU B  1 115 ? 166.005 58.781  155.779 1.00 94.64  ? 115 GLU B CA    1 
ATOM   3384  C C     . GLU B  1 115 ? 164.784 58.138  156.418 1.00 94.10  ? 115 GLU B C     1 
ATOM   3385  O O     . GLU B  1 115 ? 164.469 58.404  157.577 1.00 93.46  ? 115 GLU B O     1 
ATOM   3386  C CB    . GLU B  1 115 ? 165.901 60.302  155.930 1.00 155.38 ? 115 GLU B CB    1 
ATOM   3387  C CG    . GLU B  1 115 ? 167.234 61.013  156.061 1.00 157.46 ? 115 GLU B CG    1 
ATOM   3388  C CD    . GLU B  1 115 ? 167.097 62.365  156.730 1.00 158.26 ? 115 GLU B CD    1 
ATOM   3389  O OE1   . GLU B  1 115 ? 166.501 62.425  157.827 1.00 158.84 ? 115 GLU B OE1   1 
ATOM   3390  O OE2   . GLU B  1 115 ? 167.587 63.365  156.169 1.00 158.65 ? 115 GLU B OE2   1 
ATOM   3391  N N     . ILE B  1 116 ? 164.089 57.296  155.672 1.00 172.94 ? 116 ILE B N     1 
ATOM   3392  C CA    . ILE B  1 116 ? 162.913 56.661  156.232 1.00 172.94 ? 116 ILE B CA    1 
ATOM   3393  C C     . ILE B  1 116 ? 163.315 55.301  156.777 1.00 172.94 ? 116 ILE B C     1 
ATOM   3394  O O     . ILE B  1 116 ? 162.549 54.661  157.495 1.00 172.94 ? 116 ILE B O     1 
ATOM   3395  C CB    . ILE B  1 116 ? 161.786 56.516  155.161 1.00 154.67 ? 116 ILE B CB    1 
ATOM   3396  C CG1   . ILE B  1 116 ? 160.415 56.775  155.807 1.00 154.67 ? 116 ILE B CG1   1 
ATOM   3397  C CG2   . ILE B  1 116 ? 161.837 55.124  154.515 1.00 154.67 ? 116 ILE B CG2   1 
ATOM   3398  C CD1   . ILE B  1 116 ? 159.258 56.914  154.812 1.00 154.67 ? 116 ILE B CD1   1 
ATOM   3399  N N     . ALA B  1 117 ? 164.530 54.871  156.455 1.00 160.72 ? 117 ALA B N     1 
ATOM   3400  C CA    . ALA B  1 117 ? 164.992 53.571  156.919 1.00 160.72 ? 117 ALA B CA    1 
ATOM   3401  C C     . ALA B  1 117 ? 166.439 53.549  157.393 1.00 160.72 ? 117 ALA B C     1 
ATOM   3402  O O     . ALA B  1 117 ? 166.706 53.289  158.568 1.00 160.72 ? 117 ALA B O     1 
ATOM   3403  C CB    . ALA B  1 117 ? 164.789 52.530  155.818 1.00 121.59 ? 117 ALA B CB    1 
ATOM   3404  N N     . LYS B  1 118 ? 167.366 53.814  156.475 1.00 200.00 ? 118 LYS B N     1 
ATOM   3405  C CA    . LYS B  1 118 ? 168.794 53.803  156.786 1.00 200.00 ? 118 LYS B CA    1 
ATOM   3406  C C     . LYS B  1 118 ? 169.129 54.761  157.934 1.00 200.00 ? 118 LYS B C     1 
ATOM   3407  O O     . LYS B  1 118 ? 170.164 54.619  158.590 1.00 200.00 ? 118 LYS B O     1 
ATOM   3408  C CB    . LYS B  1 118 ? 169.606 54.160  155.531 1.00 125.30 ? 118 LYS B CB    1 
ATOM   3409  C CG    . LYS B  1 118 ? 170.897 53.357  155.361 1.00 125.30 ? 118 LYS B CG    1 
ATOM   3410  C CD    . LYS B  1 118 ? 171.910 53.650  156.466 1.00 125.30 ? 118 LYS B CD    1 
ATOM   3411  C CE    . LYS B  1 118 ? 173.236 52.941  156.217 1.00 125.30 ? 118 LYS B CE    1 
ATOM   3412  N NZ    . LYS B  1 118 ? 174.296 53.402  157.150 1.00 125.30 ? 118 LYS B NZ    1 
ATOM   3413  N N     . ASN B  1 119 ? 168.246 55.728  158.174 1.00 200.00 ? 119 ASN B N     1 
ATOM   3414  C CA    . ASN B  1 119 ? 168.433 56.703  159.248 1.00 200.00 ? 119 ASN B CA    1 
ATOM   3415  C C     . ASN B  1 119 ? 167.242 56.711  160.214 1.00 200.00 ? 119 ASN B C     1 
ATOM   3416  O O     . ASN B  1 119 ? 167.210 57.504  161.158 1.00 200.00 ? 119 ASN B O     1 
ATOM   3417  C CB    . ASN B  1 119 ? 168.632 58.112  158.666 1.00 191.27 ? 119 ASN B CB    1 
ATOM   3418  C CG    . ASN B  1 119 ? 170.101 58.498  158.531 1.00 191.27 ? 119 ASN B CG    1 
ATOM   3419  O OD1   . ASN B  1 119 ? 170.820 58.610  159.526 1.00 191.27 ? 119 ASN B OD1   1 
ATOM   3420  N ND2   . ASN B  1 119 ? 170.549 58.711  157.297 1.00 191.27 ? 119 ASN B ND2   1 
ATOM   3421  N N     . ARG B  1 120 ? 166.276 55.824  159.970 1.00 152.59 ? 120 ARG B N     1 
ATOM   3422  C CA    . ARG B  1 120 ? 165.065 55.701  160.793 1.00 152.59 ? 120 ARG B CA    1 
ATOM   3423  C C     . ARG B  1 120 ? 164.778 56.921  161.680 1.00 152.59 ? 120 ARG B C     1 
ATOM   3424  O O     . ARG B  1 120 ? 164.428 58.002  161.195 1.00 152.59 ? 120 ARG B O     1 
ATOM   3425  C CB    . ARG B  1 120 ? 165.139 54.422  161.657 1.00 165.47 ? 120 ARG B CB    1 
ATOM   3426  C CG    . ARG B  1 120 ? 165.124 54.662  163.170 1.00 165.47 ? 120 ARG B CG    1 
ATOM   3427  C CD    . ARG B  1 120 ? 164.219 53.675  163.898 1.00 165.47 ? 120 ARG B CD    1 
ATOM   3428  N NE    . ARG B  1 120 ? 163.708 54.252  165.140 1.00 165.47 ? 120 ARG B NE    1 
ATOM   3429  C CZ    . ARG B  1 120 ? 162.643 53.802  165.798 1.00 165.47 ? 120 ARG B CZ    1 
ATOM   3430  N NH1   . ARG B  1 120 ? 161.963 52.758  165.341 1.00 165.47 ? 120 ARG B NH1   1 
ATOM   3431  N NH2   . ARG B  1 120 ? 162.243 54.410  166.907 1.00 165.47 ? 120 ARG B NH2   1 
ATOM   3432  N N     . ILE B  1 227 ? 152.715 50.025  163.278 1.00 144.18 ? 227 ILE B N     1 
ATOM   3433  C CA    . ILE B  1 227 ? 153.827 50.952  163.502 1.00 144.18 ? 227 ILE B CA    1 
ATOM   3434  C C     . ILE B  1 227 ? 154.013 51.936  162.336 1.00 144.18 ? 227 ILE B C     1 
ATOM   3435  O O     . ILE B  1 227 ? 154.874 52.825  162.388 1.00 144.18 ? 227 ILE B O     1 
ATOM   3436  C CB    . ILE B  1 227 ? 155.165 50.175  163.741 1.00 184.05 ? 227 ILE B CB    1 
ATOM   3437  C CG1   . ILE B  1 227 ? 156.354 51.151  163.798 1.00 184.05 ? 227 ILE B CG1   1 
ATOM   3438  C CG2   . ILE B  1 227 ? 155.352 49.117  162.659 1.00 184.05 ? 227 ILE B CG2   1 
ATOM   3439  C CD1   . ILE B  1 227 ? 157.713 50.498  164.013 1.00 184.05 ? 227 ILE B CD1   1 
ATOM   3440  N N     . ASP B  1 228 ? 153.194 51.781  161.296 1.00 200.00 ? 228 ASP B N     1 
ATOM   3441  C CA    . ASP B  1 228 ? 153.270 52.638  160.111 1.00 200.00 ? 228 ASP B CA    1 
ATOM   3442  C C     . ASP B  1 228 ? 153.023 54.122  160.398 1.00 200.00 ? 228 ASP B C     1 
ATOM   3443  O O     . ASP B  1 228 ? 153.392 54.979  159.590 1.00 200.00 ? 228 ASP B O     1 
ATOM   3444  C CB    . ASP B  1 228 ? 152.291 52.144  159.033 1.00 200.00 ? 228 ASP B CB    1 
ATOM   3445  C CG    . ASP B  1 228 ? 152.726 50.826  158.392 1.00 200.00 ? 228 ASP B CG    1 
ATOM   3446  O OD1   . ASP B  1 228 ? 151.973 50.305  157.539 1.00 200.00 ? 228 ASP B OD1   1 
ATOM   3447  O OD2   . ASP B  1 228 ? 153.817 50.314  158.732 1.00 200.00 ? 228 ASP B OD2   1 
ATOM   3448  N N     . ASP B  1 229 ? 152.399 54.424  161.536 1.00 165.43 ? 229 ASP B N     1 
ATOM   3449  C CA    . ASP B  1 229 ? 152.138 55.813  161.905 1.00 165.43 ? 229 ASP B CA    1 
ATOM   3450  C C     . ASP B  1 229 ? 153.414 56.392  162.513 1.00 165.43 ? 229 ASP B C     1 
ATOM   3451  O O     . ASP B  1 229 ? 153.503 57.592  162.782 1.00 165.43 ? 229 ASP B O     1 
ATOM   3452  C CB    . ASP B  1 229 ? 150.977 55.905  162.907 1.00 200.00 ? 229 ASP B CB    1 
ATOM   3453  C CG    . ASP B  1 229 ? 150.457 57.333  163.078 1.00 200.00 ? 229 ASP B CG    1 
ATOM   3454  O OD1   . ASP B  1 229 ? 151.161 58.170  163.685 1.00 200.00 ? 229 ASP B OD1   1 
ATOM   3455  O OD2   . ASP B  1 229 ? 149.339 57.622  162.599 1.00 200.00 ? 229 ASP B OD2   1 
ATOM   3456  N N     . GLU B  1 230 ? 154.405 55.527  162.724 1.00 158.44 ? 230 GLU B N     1 
ATOM   3457  C CA    . GLU B  1 230 ? 155.687 55.953  163.275 1.00 158.44 ? 230 GLU B CA    1 
ATOM   3458  C C     . GLU B  1 230 ? 156.579 56.502  162.161 1.00 158.44 ? 230 GLU B C     1 
ATOM   3459  O O     . GLU B  1 230 ? 156.927 55.777  161.220 1.00 158.44 ? 230 GLU B O     1 
ATOM   3460  C CB    . GLU B  1 230 ? 156.386 54.785  163.982 1.00 200.00 ? 230 GLU B CB    1 
ATOM   3461  C CG    . GLU B  1 230 ? 157.825 55.075  164.422 1.00 200.00 ? 230 GLU B CG    1 
ATOM   3462  C CD    . GLU B  1 230 ? 157.959 56.351  165.245 1.00 200.00 ? 230 GLU B CD    1 
ATOM   3463  O OE1   . GLU B  1 230 ? 157.265 56.473  166.277 1.00 200.00 ? 230 GLU B OE1   1 
ATOM   3464  O OE2   . GLU B  1 230 ? 158.765 57.231  164.863 1.00 200.00 ? 230 GLU B OE2   1 
ATOM   3465  N N     . ALA B  1 231 ? 156.923 57.787  162.292 1.00 178.43 ? 231 ALA B N     1 
ATOM   3466  C CA    . ALA B  1 231 ? 157.767 58.546  161.360 1.00 178.43 ? 231 ALA B CA    1 
ATOM   3467  C C     . ALA B  1 231 ? 157.013 59.783  160.882 1.00 178.43 ? 231 ALA B C     1 
ATOM   3468  O O     . ALA B  1 231 ? 156.199 59.693  159.965 1.00 178.43 ? 231 ALA B O     1 
ATOM   3469  C CB    . ALA B  1 231 ? 158.167 57.691  160.164 1.00 88.20  ? 231 ALA B CB    1 
ATOM   3470  N N     . ALA B  1 232 ? 157.283 60.938  161.491 1.00 200.00 ? 232 ALA B N     1 
ATOM   3471  C CA    . ALA B  1 232 ? 156.588 62.165  161.099 1.00 200.00 ? 232 ALA B CA    1 
ATOM   3472  C C     . ALA B  1 232 ? 157.290 63.496  161.397 1.00 200.00 ? 232 ALA B C     1 
ATOM   3473  O O     . ALA B  1 232 ? 157.724 64.187  160.472 1.00 200.00 ? 232 ALA B O     1 
ATOM   3474  C CB    . ALA B  1 232 ? 155.191 62.175  161.711 1.00 164.89 ? 232 ALA B CB    1 
ATOM   3475  N N     . LYS B  1 233 ? 157.382 63.869  162.673 1.00 176.92 ? 233 LYS B N     1 
ATOM   3476  C CA    . LYS B  1 233 ? 158.025 65.132  163.048 1.00 176.92 ? 233 LYS B CA    1 
ATOM   3477  C C     . LYS B  1 233 ? 159.530 64.961  163.293 1.00 176.92 ? 233 LYS B C     1 
ATOM   3478  O O     . LYS B  1 233 ? 160.214 65.902  163.711 1.00 176.92 ? 233 LYS B O     1 
ATOM   3479  C CB    . LYS B  1 233 ? 157.353 65.726  164.296 1.00 155.22 ? 233 LYS B CB    1 
ATOM   3480  C CG    . LYS B  1 233 ? 157.803 67.152  164.634 1.00 155.22 ? 233 LYS B CG    1 
ATOM   3481  C CD    . LYS B  1 233 ? 157.186 67.669  165.940 1.00 155.22 ? 233 LYS B CD    1 
ATOM   3482  C CE    . LYS B  1 233 ? 157.722 69.061  166.304 1.00 155.22 ? 233 LYS B CE    1 
ATOM   3483  N NZ    . LYS B  1 233 ? 157.221 69.573  167.618 1.00 155.22 ? 233 LYS B NZ    1 
ATOM   3484  N N     . LEU B  1 234 ? 160.033 63.756  163.026 1.00 200.00 ? 234 LEU B N     1 
ATOM   3485  C CA    . LEU B  1 234 ? 161.455 63.435  163.190 1.00 200.00 ? 234 LEU B CA    1 
ATOM   3486  C C     . LEU B  1 234 ? 162.189 63.598  161.852 1.00 200.00 ? 234 LEU B C     1 
ATOM   3487  O O     . LEU B  1 234 ? 163.386 63.312  161.738 1.00 200.00 ? 234 LEU B O     1 
ATOM   3488  C CB    . LEU B  1 234 ? 161.630 61.987  163.692 1.00 139.51 ? 234 LEU B CB    1 
ATOM   3489  C CG    . LEU B  1 234 ? 161.085 60.828  162.834 1.00 139.51 ? 234 LEU B CG    1 
ATOM   3490  C CD1   . LEU B  1 234 ? 161.846 59.541  163.147 1.00 139.51 ? 234 LEU B CD1   1 
ATOM   3491  C CD2   . LEU B  1 234 ? 159.588 60.658  163.077 1.00 139.51 ? 234 LEU B CD2   1 
ATOM   3492  N N     . ILE B  1 235 ? 161.453 64.068  160.849 1.00 186.23 ? 235 ILE B N     1 
ATOM   3493  C CA    . ILE B  1 235 ? 161.980 64.263  159.503 1.00 186.23 ? 235 ILE B CA    1 
ATOM   3494  C C     . ILE B  1 235 ? 162.397 65.712  159.231 1.00 186.23 ? 235 ILE B C     1 
ATOM   3495  O O     . ILE B  1 235 ? 163.567 65.984  158.951 1.00 186.23 ? 235 ILE B O     1 
ATOM   3496  C CB    . ILE B  1 235 ? 160.922 63.803  158.450 1.00 114.76 ? 235 ILE B CB    1 
ATOM   3497  C CG1   . ILE B  1 235 ? 160.816 62.269  158.462 1.00 114.76 ? 235 ILE B CG1   1 
ATOM   3498  C CG2   . ILE B  1 235 ? 161.282 64.326  157.070 1.00 114.76 ? 235 ILE B CG2   1 
ATOM   3499  C CD1   . ILE B  1 235 ? 159.668 61.700  157.640 1.00 114.76 ? 235 ILE B CD1   1 
ATOM   3500  N N     . ASN B  1 236 ? 161.435 66.628  159.328 1.00 158.52 ? 236 ASN B N     1 
ATOM   3501  C CA    . ASN B  1 236 ? 161.648 68.057  159.086 1.00 158.52 ? 236 ASN B CA    1 
ATOM   3502  C C     . ASN B  1 236 ? 161.598 68.362  157.589 1.00 158.52 ? 236 ASN B C     1 
ATOM   3503  O O     . ASN B  1 236 ? 162.596 68.763  156.992 1.00 158.52 ? 236 ASN B O     1 
ATOM   3504  C CB    . ASN B  1 236 ? 162.991 68.528  159.676 1.00 155.94 ? 236 ASN B CB    1 
ATOM   3505  C CG    . ASN B  1 236 ? 163.267 70.008  159.410 1.00 155.94 ? 236 ASN B CG    1 
ATOM   3506  O OD1   . ASN B  1 236 ? 162.366 70.839  159.489 1.00 155.94 ? 236 ASN B OD1   1 
ATOM   3507  N ND2   . ASN B  1 236 ? 164.520 70.338  159.108 1.00 155.94 ? 236 ASN B ND2   1 
ATOM   3508  N N     . PRO B  1 237 ? 160.423 68.167  156.962 1.00 156.61 ? 237 PRO B N     1 
ATOM   3509  C CA    . PRO B  1 237 ? 160.206 68.409  155.531 1.00 156.71 ? 237 PRO B CA    1 
ATOM   3510  C C     . PRO B  1 237 ? 160.660 69.766  154.981 1.00 156.74 ? 237 PRO B C     1 
ATOM   3511  O O     . PRO B  1 237 ? 160.236 70.173  153.901 1.00 156.33 ? 237 PRO B O     1 
ATOM   3512  C CB    . PRO B  1 237 ? 158.704 68.186  155.375 1.00 164.20 ? 237 PRO B CB    1 
ATOM   3513  C CG    . PRO B  1 237 ? 158.455 67.069  156.344 1.00 163.96 ? 237 PRO B CG    1 
ATOM   3514  C CD    . PRO B  1 237 ? 159.234 67.533  157.564 1.00 164.03 ? 237 PRO B CD    1 
ATOM   3515  N N     . GLU B  1 238 ? 161.511 70.465  155.724 1.00 131.40 ? 238 GLU B N     1 
ATOM   3516  C CA    . GLU B  1 238 ? 162.034 71.752  155.279 1.00 131.97 ? 238 GLU B CA    1 
ATOM   3517  C C     . GLU B  1 238 ? 163.502 71.524  154.933 1.00 131.70 ? 238 GLU B C     1 
ATOM   3518  O O     . GLU B  1 238 ? 164.124 72.296  154.194 1.00 131.88 ? 238 GLU B O     1 
ATOM   3519  C CB    . GLU B  1 238 ? 161.934 72.791  156.395 1.00 200.00 ? 238 GLU B CB    1 
ATOM   3520  C CG    . GLU B  1 238 ? 162.380 74.184  155.974 1.00 200.00 ? 238 GLU B CG    1 
ATOM   3521  C CD    . GLU B  1 238 ? 162.618 75.106  157.155 1.00 200.00 ? 238 GLU B CD    1 
ATOM   3522  O OE1   . GLU B  1 238 ? 163.568 74.843  157.925 1.00 200.00 ? 238 GLU B OE1   1 
ATOM   3523  O OE2   . GLU B  1 238 ? 161.857 76.089  157.316 1.00 200.00 ? 238 GLU B OE2   1 
ATOM   3524  N N     . GLU B  1 239 ? 164.034 70.439  155.487 1.00 103.91 ? 239 GLU B N     1 
ATOM   3525  C CA    . GLU B  1 239 ? 165.423 70.034  155.307 1.00 102.81 ? 239 GLU B CA    1 
ATOM   3526  C C     . GLU B  1 239 ? 165.563 69.087  154.129 1.00 100.70 ? 239 GLU B C     1 
ATOM   3527  O O     . GLU B  1 239 ? 166.368 69.318  153.225 1.00 100.26 ? 239 GLU B O     1 
ATOM   3528  C CB    . GLU B  1 239 ? 165.919 69.336  156.584 1.00 181.28 ? 239 GLU B CB    1 
ATOM   3529  C CG    . GLU B  1 239 ? 167.204 68.518  156.439 1.00 181.28 ? 239 GLU B CG    1 
ATOM   3530  C CD    . GLU B  1 239 ? 167.425 67.550  157.601 1.00 181.28 ? 239 GLU B CD    1 
ATOM   3531  O OE1   . GLU B  1 239 ? 166.562 66.671  157.820 1.00 181.28 ? 239 GLU B OE1   1 
ATOM   3532  O OE2   . GLU B  1 239 ? 168.460 67.664  158.294 1.00 181.28 ? 239 GLU B OE2   1 
ATOM   3533  N N     . LEU B  1 240 ? 164.768 68.020  154.151 1.00 106.83 ? 240 LEU B N     1 
ATOM   3534  C CA    . LEU B  1 240 ? 164.822 67.012  153.108 1.00 104.52 ? 240 LEU B CA    1 
ATOM   3535  C C     . LEU B  1 240 ? 165.028 67.656  151.751 1.00 102.78 ? 240 LEU B C     1 
ATOM   3536  O O     . LEU B  1 240 ? 166.091 67.502  151.155 1.00 102.82 ? 240 LEU B O     1 
ATOM   3537  C CB    . LEU B  1 240 ? 163.552 66.164  153.103 1.00 98.12  ? 240 LEU B CB    1 
ATOM   3538  C CG    . LEU B  1 240 ? 163.856 64.689  152.826 1.00 98.06  ? 240 LEU B CG    1 
ATOM   3539  C CD1   . LEU B  1 240 ? 164.459 64.066  154.074 1.00 97.67  ? 240 LEU B CD1   1 
ATOM   3540  C CD2   . LEU B  1 240 ? 162.593 63.953  152.432 1.00 98.46  ? 240 LEU B CD2   1 
ATOM   3541  N N     . LYS B  1 241 ? 164.023 68.381  151.271 1.00 73.45  ? 241 LYS B N     1 
ATOM   3542  C CA    . LYS B  1 241 ? 164.119 69.061  149.985 1.00 71.82  ? 241 LYS B CA    1 
ATOM   3543  C C     . LYS B  1 241 ? 165.518 69.647  149.780 1.00 70.68  ? 241 LYS B C     1 
ATOM   3544  O O     . LYS B  1 241 ? 166.237 69.255  148.855 1.00 70.54  ? 241 LYS B O     1 
ATOM   3545  C CB    . LYS B  1 241 ? 163.090 70.192  149.891 1.00 100.69 ? 241 LYS B CB    1 
ATOM   3546  C CG    . LYS B  1 241 ? 161.664 69.765  149.562 1.00 101.14 ? 241 LYS B CG    1 
ATOM   3547  C CD    . LYS B  1 241 ? 160.750 70.988  149.543 1.00 101.22 ? 241 LYS B CD    1 
ATOM   3548  C CE    . LYS B  1 241 ? 159.301 70.618  149.294 1.00 101.60 ? 241 LYS B CE    1 
ATOM   3549  N NZ    . LYS B  1 241 ? 158.408 71.815  149.357 1.00 101.98 ? 241 LYS B NZ    1 
ATOM   3550  N N     . GLN B  1 242 ? 165.901 70.595  150.634 1.00 107.70 ? 242 GLN B N     1 
ATOM   3551  C CA    . GLN B  1 242 ? 167.220 71.210  150.529 1.00 105.37 ? 242 GLN B CA    1 
ATOM   3552  C C     . GLN B  1 242 ? 168.229 70.102  150.230 1.00 103.09 ? 242 GLN B C     1 
ATOM   3553  O O     . GLN B  1 242 ? 168.969 70.162  149.246 1.00 102.84 ? 242 GLN B O     1 
ATOM   3554  C CB    . GLN B  1 242 ? 167.574 71.919  151.843 1.00 110.24 ? 242 GLN B CB    1 
ATOM   3555  C CG    . GLN B  1 242 ? 169.001 72.474  151.926 1.00 111.19 ? 242 GLN B CG    1 
ATOM   3556  C CD    . GLN B  1 242 ? 169.212 73.746  151.120 1.00 111.42 ? 242 GLN B CD    1 
ATOM   3557  O OE1   . GLN B  1 242 ? 169.091 73.746  149.898 1.00 111.63 ? 242 GLN B OE1   1 
ATOM   3558  N NE2   . GLN B  1 242 ? 169.535 74.838  151.808 1.00 111.87 ? 242 GLN B NE2   1 
ATOM   3559  N N     . LYS B  1 243 ? 168.226 69.072  151.069 1.00 70.01  ? 243 LYS B N     1 
ATOM   3560  C CA    . LYS B  1 243 ? 169.134 67.955  150.889 1.00 66.74  ? 243 LYS B CA    1 
ATOM   3561  C C     . LYS B  1 243 ? 168.902 67.270  149.534 1.00 63.76  ? 243 LYS B C     1 
ATOM   3562  O O     . LYS B  1 243 ? 169.847 66.833  148.873 1.00 63.36  ? 243 LYS B O     1 
ATOM   3563  C CB    . LYS B  1 243 ? 168.959 66.959  152.035 1.00 129.98 ? 243 LYS B CB    1 
ATOM   3564  C CG    . LYS B  1 243 ? 170.138 66.037  152.173 1.00 131.93 ? 243 LYS B CG    1 
ATOM   3565  C CD    . LYS B  1 243 ? 170.024 65.106  153.357 1.00 133.49 ? 243 LYS B CD    1 
ATOM   3566  C CE    . LYS B  1 243 ? 171.255 64.207  153.417 1.00 134.54 ? 243 LYS B CE    1 
ATOM   3567  N NZ    . LYS B  1 243 ? 171.175 63.167  154.474 1.00 135.25 ? 243 LYS B NZ    1 
ATOM   3568  N N     . ALA B  1 244 ? 167.642 67.189  149.120 1.00 70.00  ? 244 ALA B N     1 
ATOM   3569  C CA    . ALA B  1 244 ? 167.286 66.574  147.844 1.00 66.09  ? 244 ALA B CA    1 
ATOM   3570  C C     . ALA B  1 244 ? 167.797 67.435  146.714 1.00 63.60  ? 244 ALA B C     1 
ATOM   3571  O O     . ALA B  1 244 ? 168.094 66.936  145.634 1.00 63.11  ? 244 ALA B O     1 
ATOM   3572  C CB    . ALA B  1 244 ? 165.786 66.426  147.726 1.00 46.37  ? 244 ALA B CB    1 
ATOM   3573  N N     . ILE B  1 245 ? 167.872 68.738  146.962 1.00 53.28  ? 245 ILE B N     1 
ATOM   3574  C CA    . ILE B  1 245 ? 168.375 69.660  145.961 1.00 51.14  ? 245 ILE B CA    1 
ATOM   3575  C C     . ILE B  1 245 ? 169.861 69.366  145.840 1.00 49.99  ? 245 ILE B C     1 
ATOM   3576  O O     . ILE B  1 245 ? 170.367 69.088  144.755 1.00 50.18  ? 245 ILE B O     1 
ATOM   3577  C CB    . ILE B  1 245 ? 168.187 71.122  146.386 1.00 61.24  ? 245 ILE B CB    1 
ATOM   3578  C CG1   . ILE B  1 245 ? 166.706 71.449  146.456 1.00 61.35  ? 245 ILE B CG1   1 
ATOM   3579  C CG2   . ILE B  1 245 ? 168.853 72.061  145.387 1.00 60.47  ? 245 ILE B CG2   1 
ATOM   3580  C CD1   . ILE B  1 245 ? 166.446 72.885  146.878 1.00 62.18  ? 245 ILE B CD1   1 
ATOM   3581  N N     . ASP B  1 246 ? 170.562 69.420  146.964 1.00 49.57  ? 246 ASP B N     1 
ATOM   3582  C CA    . ASP B  1 246 ? 171.984 69.132  146.941 1.00 48.12  ? 246 ASP B CA    1 
ATOM   3583  C C     . ASP B  1 246 ? 172.184 67.872  146.104 1.00 45.41  ? 246 ASP B C     1 
ATOM   3584  O O     . ASP B  1 246 ? 173.007 67.838  145.182 1.00 45.00  ? 246 ASP B O     1 
ATOM   3585  C CB    . ASP B  1 246 ? 172.502 68.916  148.365 1.00 100.23 ? 246 ASP B CB    1 
ATOM   3586  C CG    . ASP B  1 246 ? 172.552 70.202  149.167 1.00 101.96 ? 246 ASP B CG    1 
ATOM   3587  O OD1   . ASP B  1 246 ? 172.890 70.135  150.366 1.00 103.36 ? 246 ASP B OD1   1 
ATOM   3588  O OD2   . ASP B  1 246 ? 172.261 71.278  148.601 1.00 102.89 ? 246 ASP B OD2   1 
ATOM   3589  N N     . ALA B  1 247 ? 171.404 66.847  146.424 1.00 55.34  ? 247 ALA B N     1 
ATOM   3590  C CA    . ALA B  1 247 ? 171.465 65.587  145.703 1.00 51.86  ? 247 ALA B CA    1 
ATOM   3591  C C     . ALA B  1 247 ? 171.543 65.869  144.210 1.00 48.74  ? 247 ALA B C     1 
ATOM   3592  O O     . ALA B  1 247 ? 172.481 65.461  143.525 1.00 48.08  ? 247 ALA B O     1 
ATOM   3593  C CB    . ALA B  1 247 ? 170.232 64.768  146.008 1.00 95.63  ? 247 ALA B CB    1 
ATOM   3594  N N     . VAL B  1 248 ? 170.547 66.583  143.711 1.00 25.56  ? 248 VAL B N     1 
ATOM   3595  C CA    . VAL B  1 248 ? 170.517 66.915  142.301 1.00 21.60  ? 248 VAL B CA    1 
ATOM   3596  C C     . VAL B  1 248 ? 171.697 67.768  141.946 1.00 19.75  ? 248 VAL B C     1 
ATOM   3597  O O     . VAL B  1 248 ? 172.518 67.374  141.139 1.00 19.52  ? 248 VAL B O     1 
ATOM   3598  C CB    . VAL B  1 248 ? 169.291 67.735  141.899 1.00 21.13  ? 248 VAL B CB    1 
ATOM   3599  C CG1   . VAL B  1 248 ? 169.426 68.113  140.462 1.00 20.93  ? 248 VAL B CG1   1 
ATOM   3600  C CG2   . VAL B  1 248 ? 168.011 66.953  142.095 1.00 22.09  ? 248 VAL B CG2   1 
ATOM   3601  N N     . GLU B  1 249 ? 171.757 68.946  142.558 1.00 21.76  ? 249 GLU B N     1 
ATOM   3602  C CA    . GLU B  1 249 ? 172.804 69.913  142.289 1.00 21.68  ? 249 GLU B CA    1 
ATOM   3603  C C     . GLU B  1 249 ? 174.184 69.345  142.282 1.00 21.28  ? 249 GLU B C     1 
ATOM   3604  O O     . GLU B  1 249 ? 174.986 69.733  141.435 1.00 20.77  ? 249 GLU B O     1 
ATOM   3605  C CB    . GLU B  1 249 ? 172.751 71.071  143.279 1.00 81.60  ? 249 GLU B CB    1 
ATOM   3606  C CG    . GLU B  1 249 ? 171.623 72.047  143.014 1.00 85.51  ? 249 GLU B CG    1 
ATOM   3607  C CD    . GLU B  1 249 ? 171.827 73.388  143.701 1.00 87.92  ? 249 GLU B CD    1 
ATOM   3608  O OE1   . GLU B  1 249 ? 170.988 74.299  143.520 1.00 88.48  ? 249 GLU B OE1   1 
ATOM   3609  O OE2   . GLU B  1 249 ? 172.832 73.536  144.424 1.00 89.77  ? 249 GLU B OE2   1 
ATOM   3610  N N     . GLN B  1 250 ? 174.453 68.417  143.203 1.00 61.03  ? 250 GLN B N     1 
ATOM   3611  C CA    . GLN B  1 250 ? 175.779 67.800  143.344 1.00 60.71  ? 250 GLN B CA    1 
ATOM   3612  C C     . GLN B  1 250 ? 176.116 66.547  142.523 1.00 58.03  ? 250 GLN B C     1 
ATOM   3613  O O     . GLN B  1 250 ? 177.198 66.484  141.932 1.00 57.20  ? 250 GLN B O     1 
ATOM   3614  C CB    . GLN B  1 250 ? 176.067 67.523  144.825 1.00 100.68 ? 250 GLN B CB    1 
ATOM   3615  C CG    . GLN B  1 250 ? 176.344 68.775  145.645 1.00 105.97 ? 250 GLN B CG    1 
ATOM   3616  C CD    . GLN B  1 250 ? 177.507 69.602  145.086 1.00 109.64 ? 250 GLN B CD    1 
ATOM   3617  O OE1   . GLN B  1 250 ? 177.828 70.680  145.596 1.00 111.20 ? 250 GLN B OE1   1 
ATOM   3618  N NE2   . GLN B  1 250 ? 178.142 69.096  144.036 1.00 111.04 ? 250 GLN B NE2   1 
ATOM   3619  N N     . ASN B  1 251 ? 175.229 65.547  142.509 1.00 47.64  ? 251 ASN B N     1 
ATOM   3620  C CA    . ASN B  1 251 ? 175.477 64.334  141.727 1.00 45.04  ? 251 ASN B CA    1 
ATOM   3621  C C     . ASN B  1 251 ? 174.304 63.894  140.854 1.00 40.84  ? 251 ASN B C     1 
ATOM   3622  O O     . ASN B  1 251 ? 173.830 62.769  140.959 1.00 40.51  ? 251 ASN B O     1 
ATOM   3623  C CB    . ASN B  1 251 ? 175.889 63.155  142.618 1.00 109.71 ? 251 ASN B CB    1 
ATOM   3624  C CG    . ASN B  1 251 ? 175.961 63.521  144.077 1.00 113.92 ? 251 ASN B CG    1 
ATOM   3625  O OD1   . ASN B  1 251 ? 176.763 64.363  144.471 1.00 116.94 ? 251 ASN B OD1   1 
ATOM   3626  N ND2   . ASN B  1 251 ? 175.122 62.888  144.895 1.00 114.25 ? 251 ASN B ND2   1 
ATOM   3627  N N     . GLY B  1 252 ? 173.834 64.772  139.979 1.00 34.87  ? 252 GLY B N     1 
ATOM   3628  C CA    . GLY B  1 252 ? 172.751 64.379  139.109 1.00 29.98  ? 252 GLY B CA    1 
ATOM   3629  C C     . GLY B  1 252 ? 173.324 63.898  137.789 1.00 26.96  ? 252 GLY B C     1 
ATOM   3630  O O     . GLY B  1 252 ? 174.308 64.455  137.293 1.00 27.20  ? 252 GLY B O     1 
ATOM   3631  N N     . ILE B  1 253 ? 172.737 62.845  137.232 1.00 16.08  ? 253 ILE B N     1 
ATOM   3632  C CA    . ILE B  1 253 ? 173.177 62.326  135.950 1.00 13.28  ? 253 ILE B CA    1 
ATOM   3633  C C     . ILE B  1 253 ? 171.975 62.462  135.058 1.00 10.94  ? 253 ILE B C     1 
ATOM   3634  O O     . ILE B  1 253 ? 170.906 62.018  135.414 1.00 13.04  ? 253 ILE B O     1 
ATOM   3635  C CB    . ILE B  1 253 ? 173.501 60.824  135.984 1.00 22.16  ? 253 ILE B CB    1 
ATOM   3636  C CG1   . ILE B  1 253 ? 174.145 60.419  137.317 1.00 22.19  ? 253 ILE B CG1   1 
ATOM   3637  C CG2   . ILE B  1 253 ? 174.396 60.488  134.793 1.00 22.86  ? 253 ILE B CG2   1 
ATOM   3638  C CD1   . ILE B  1 253 ? 175.542 60.919  137.514 1.00 22.01  ? 253 ILE B CD1   1 
ATOM   3639  N N     . VAL B  1 254 ? 172.117 63.072  133.904 1.00 16.25  ? 254 VAL B N     1 
ATOM   3640  C CA    . VAL B  1 254 ? 170.973 63.190  133.026 1.00 13.74  ? 254 VAL B CA    1 
ATOM   3641  C C     . VAL B  1 254 ? 171.349 62.485  131.754 1.00 14.25  ? 254 VAL B C     1 
ATOM   3642  O O     . VAL B  1 254 ? 172.424 62.716  131.212 1.00 15.54  ? 254 VAL B O     1 
ATOM   3643  C CB    . VAL B  1 254 ? 170.666 64.637  132.757 1.00 2.50   ? 254 VAL B CB    1 
ATOM   3644  C CG1   . VAL B  1 254 ? 169.803 64.766  131.505 1.00 1.00   ? 254 VAL B CG1   1 
ATOM   3645  C CG2   . VAL B  1 254 ? 170.002 65.229  133.994 1.00 1.00   ? 254 VAL B CG2   1 
ATOM   3646  N N     . PHE B  1 255 ? 170.488 61.602  131.280 1.00 2.20   ? 255 PHE B N     1 
ATOM   3647  C CA    . PHE B  1 255 ? 170.815 60.856  130.079 1.00 1.61   ? 255 PHE B CA    1 
ATOM   3648  C C     . PHE B  1 255 ? 169.897 61.274  128.940 1.00 2.56   ? 255 PHE B C     1 
ATOM   3649  O O     . PHE B  1 255 ? 168.737 60.903  128.905 1.00 4.35   ? 255 PHE B O     1 
ATOM   3650  C CB    . PHE B  1 255 ? 170.677 59.365  130.374 1.00 3.49   ? 255 PHE B CB    1 
ATOM   3651  C CG    . PHE B  1 255 ? 171.012 58.500  129.223 1.00 3.02   ? 255 PHE B CG    1 
ATOM   3652  C CD1   . PHE B  1 255 ? 172.319 58.282  128.874 1.00 4.19   ? 255 PHE B CD1   1 
ATOM   3653  C CD2   . PHE B  1 255 ? 170.025 57.956  128.427 1.00 3.22   ? 255 PHE B CD2   1 
ATOM   3654  C CE1   . PHE B  1 255 ? 172.634 57.530  127.727 1.00 2.12   ? 255 PHE B CE1   1 
ATOM   3655  C CE2   . PHE B  1 255 ? 170.342 57.225  127.309 1.00 1.24   ? 255 PHE B CE2   1 
ATOM   3656  C CZ    . PHE B  1 255 ? 171.640 57.018  126.964 1.00 1.00   ? 255 PHE B CZ    1 
ATOM   3657  N N     . ILE B  1 256 ? 170.410 62.068  128.014 1.00 8.00   ? 256 ILE B N     1 
ATOM   3658  C CA    . ILE B  1 256 ? 169.625 62.542  126.879 1.00 9.75   ? 256 ILE B CA    1 
ATOM   3659  C C     . ILE B  1 256 ? 169.720 61.544  125.732 1.00 11.28  ? 256 ILE B C     1 
ATOM   3660  O O     . ILE B  1 256 ? 170.746 61.464  125.087 1.00 12.96  ? 256 ILE B O     1 
ATOM   3661  C CB    . ILE B  1 256 ? 170.163 63.919  126.445 1.00 6.17   ? 256 ILE B CB    1 
ATOM   3662  C CG1   . ILE B  1 256 ? 169.858 64.930  127.559 1.00 3.82   ? 256 ILE B CG1   1 
ATOM   3663  C CG2   . ILE B  1 256 ? 169.638 64.296  125.046 1.00 4.70   ? 256 ILE B CG2   1 
ATOM   3664  C CD1   . ILE B  1 256 ? 170.457 66.267  127.335 1.00 4.56   ? 256 ILE B CD1   1 
ATOM   3665  N N     . ASP B  1 257 ? 168.657 60.794  125.464 1.00 21.21  ? 257 ASP B N     1 
ATOM   3666  C CA    . ASP B  1 257 ? 168.704 59.790  124.400 1.00 24.05  ? 257 ASP B CA    1 
ATOM   3667  C C     . ASP B  1 257 ? 168.475 60.296  122.977 1.00 23.45  ? 257 ASP B C     1 
ATOM   3668  O O     . ASP B  1 257 ? 167.887 61.349  122.762 1.00 22.76  ? 257 ASP B O     1 
ATOM   3669  C CB    . ASP B  1 257 ? 167.720 58.656  124.702 1.00 65.52  ? 257 ASP B CB    1 
ATOM   3670  C CG    . ASP B  1 257 ? 168.082 57.364  123.981 1.00 70.59  ? 257 ASP B CG    1 
ATOM   3671  O OD1   . ASP B  1 257 ? 169.278 57.199  123.665 1.00 71.92  ? 257 ASP B OD1   1 
ATOM   3672  O OD2   . ASP B  1 257 ? 167.194 56.508  123.746 1.00 73.34  ? 257 ASP B OD2   1 
ATOM   3673  N N     . GLU B  1 258 ? 168.952 59.529  122.007 1.00 21.10  ? 258 GLU B N     1 
ATOM   3674  C CA    . GLU B  1 258 ? 168.819 59.881  120.604 1.00 24.10  ? 258 GLU B CA    1 
ATOM   3675  C C     . GLU B  1 258 ? 168.872 61.389  120.346 1.00 23.35  ? 258 GLU B C     1 
ATOM   3676  O O     . GLU B  1 258 ? 167.970 61.970  119.756 1.00 23.27  ? 258 GLU B O     1 
ATOM   3677  C CB    . GLU B  1 258 ? 167.545 59.240  119.999 1.00 60.75  ? 258 GLU B CB    1 
ATOM   3678  C CG    . GLU B  1 258 ? 167.815 57.803  119.437 1.00 69.17  ? 258 GLU B CG    1 
ATOM   3679  C CD    . GLU B  1 258 ? 166.574 56.989  118.971 1.00 73.82  ? 258 GLU B CD    1 
ATOM   3680  O OE1   . GLU B  1 258 ? 166.745 55.815  118.534 1.00 74.32  ? 258 GLU B OE1   1 
ATOM   3681  O OE2   . GLU B  1 258 ? 165.438 57.506  119.038 1.00 76.68  ? 258 GLU B OE2   1 
ATOM   3682  N N     . ILE B  1 259 ? 169.948 62.021  120.802 1.00 13.76  ? 259 ILE B N     1 
ATOM   3683  C CA    . ILE B  1 259 ? 170.153 63.443  120.589 1.00 11.95  ? 259 ILE B CA    1 
ATOM   3684  C C     . ILE B  1 259 ? 170.464 63.603  119.119 1.00 12.83  ? 259 ILE B C     1 
ATOM   3685  O O     . ILE B  1 259 ? 170.300 64.665  118.548 1.00 14.98  ? 259 ILE B O     1 
ATOM   3686  C CB    . ILE B  1 259 ? 171.375 63.968  121.377 1.00 8.89   ? 259 ILE B CB    1 
ATOM   3687  C CG1   . ILE B  1 259 ? 171.321 65.478  121.500 1.00 6.76   ? 259 ILE B CG1   1 
ATOM   3688  C CG2   . ILE B  1 259 ? 172.663 63.671  120.638 1.00 5.44   ? 259 ILE B CG2   1 
ATOM   3689  C CD1   . ILE B  1 259 ? 171.756 65.944  122.861 1.00 7.83   ? 259 ILE B CD1   1 
ATOM   3690  N N     . ASP B  1 260 ? 170.944 62.534  118.511 1.00 18.87  ? 260 ASP B N     1 
ATOM   3691  C CA    . ASP B  1 260 ? 171.305 62.570  117.112 1.00 21.16  ? 260 ASP B CA    1 
ATOM   3692  C C     . ASP B  1 260 ? 170.040 62.827  116.316 1.00 21.31  ? 260 ASP B C     1 
ATOM   3693  O O     . ASP B  1 260 ? 170.092 63.195  115.151 1.00 21.10  ? 260 ASP B O     1 
ATOM   3694  C CB    . ASP B  1 260 ? 171.984 61.251  116.708 1.00 42.37  ? 260 ASP B CB    1 
ATOM   3695  C CG    . ASP B  1 260 ? 171.043 60.049  116.768 1.00 45.82  ? 260 ASP B CG    1 
ATOM   3696  O OD1   . ASP B  1 260 ? 170.296 59.880  117.759 1.00 46.60  ? 260 ASP B OD1   1 
ATOM   3697  O OD2   . ASP B  1 260 ? 171.067 59.254  115.808 1.00 47.56  ? 260 ASP B OD2   1 
ATOM   3698  N N     . LYS B  1 261 ? 168.891 62.660  116.951 1.00 24.53  ? 261 LYS B N     1 
ATOM   3699  C CA    . LYS B  1 261 ? 167.631 62.909  116.253 1.00 28.96  ? 261 LYS B CA    1 
ATOM   3700  C C     . LYS B  1 261 ? 167.256 64.397  116.180 1.00 30.10  ? 261 LYS B C     1 
ATOM   3701  O O     . LYS B  1 261 ? 166.527 64.813  115.288 1.00 30.77  ? 261 LYS B O     1 
ATOM   3702  C CB    . LYS B  1 261 ? 166.484 62.145  116.911 1.00 39.22  ? 261 LYS B CB    1 
ATOM   3703  C CG    . LYS B  1 261 ? 166.538 60.642  116.724 1.00 42.52  ? 261 LYS B CG    1 
ATOM   3704  C CD    . LYS B  1 261 ? 166.211 60.211  115.315 1.00 43.15  ? 261 LYS B CD    1 
ATOM   3705  C CE    . LYS B  1 261 ? 166.203 58.704  115.242 1.00 44.61  ? 261 LYS B CE    1 
ATOM   3706  N NZ    . LYS B  1 261 ? 165.822 58.215  113.890 1.00 48.24  ? 261 LYS B NZ    1 
ATOM   3707  N N     . ILE B  1 262 ? 167.730 65.196  117.129 1.00 10.23  ? 262 ILE B N     1 
ATOM   3708  C CA    . ILE B  1 262 ? 167.462 66.619  117.116 1.00 7.73   ? 262 ILE B CA    1 
ATOM   3709  C C     . ILE B  1 262 ? 168.672 67.366  116.538 1.00 10.94  ? 262 ILE B C     1 
ATOM   3710  O O     . ILE B  1 262 ? 169.020 68.463  116.961 1.00 10.21  ? 262 ILE B O     1 
ATOM   3711  C CB    . ILE B  1 262 ? 167.165 67.093  118.511 1.00 2.36   ? 262 ILE B CB    1 
ATOM   3712  C CG1   . ILE B  1 262 ? 168.425 67.049  119.370 1.00 1.50   ? 262 ILE B CG1   1 
ATOM   3713  C CG2   . ILE B  1 262 ? 166.134 66.171  119.133 1.00 1.50   ? 262 ILE B CG2   1 
ATOM   3714  C CD1   . ILE B  1 262 ? 168.190 67.511  120.818 1.00 1.50   ? 262 ILE B CD1   1 
ATOM   3715  N N     . CYS B  1 263 ? 169.307 66.729  115.557 1.00 21.64  ? 263 CYS B N     1 
ATOM   3716  C CA    . CYS B  1 263 ? 170.450 67.262  114.843 1.00 26.96  ? 263 CYS B CA    1 
ATOM   3717  C C     . CYS B  1 263 ? 169.896 67.740  113.516 1.00 31.10  ? 263 CYS B C     1 
ATOM   3718  O O     . CYS B  1 263 ? 168.707 67.674  113.292 1.00 32.08  ? 263 CYS B O     1 
ATOM   3719  C CB    . CYS B  1 263 ? 171.465 66.167  114.609 1.00 45.54  ? 263 CYS B CB    1 
ATOM   3720  S SG    . CYS B  1 263 ? 173.109 66.654  115.088 1.00 50.28  ? 263 CYS B SG    1 
ATOM   3721  N N     . LYS B  1 264 ? 170.745 68.206  112.622 1.00 50.94  ? 264 LYS B N     1 
ATOM   3722  C CA    . LYS B  1 264 ? 170.271 68.706  111.336 1.00 57.04  ? 264 LYS B CA    1 
ATOM   3723  C C     . LYS B  1 264 ? 170.429 67.685  110.230 1.00 60.76  ? 264 LYS B C     1 
ATOM   3724  O O     . LYS B  1 264 ? 171.215 66.750  110.342 1.00 60.87  ? 264 LYS B O     1 
ATOM   3725  C CB    . LYS B  1 264 ? 171.054 69.950  110.899 1.00 81.52  ? 264 LYS B CB    1 
ATOM   3726  C CG    . LYS B  1 264 ? 170.931 71.183  111.754 1.00 83.18  ? 264 LYS B CG    1 
ATOM   3727  C CD    . LYS B  1 264 ? 171.991 71.287  112.836 1.00 84.35  ? 264 LYS B CD    1 
ATOM   3728  C CE    . LYS B  1 264 ? 171.679 70.424  114.057 1.00 83.94  ? 264 LYS B CE    1 
ATOM   3729  N NZ    . LYS B  1 264 ? 172.699 70.627  115.133 1.00 84.15  ? 264 LYS B NZ    1 
ATOM   3730  N N     . LYS B  1 265 ? 169.698 67.899  109.143 1.00 109.69 ? 265 LYS B N     1 
ATOM   3731  C CA    . LYS B  1 265 ? 169.772 67.031  107.975 1.00 114.04 ? 265 LYS B CA    1 
ATOM   3732  C C     . LYS B  1 265 ? 168.651 67.343  106.983 1.00 115.50 ? 265 LYS B C     1 
ATOM   3733  O O     . LYS B  1 265 ? 168.895 67.540  105.787 1.00 116.10 ? 265 LYS B O     1 
ATOM   3734  C CB    . LYS B  1 265 ? 169.715 65.551  108.391 1.00 155.75 ? 265 LYS B CB    1 
ATOM   3735  C CG    . LYS B  1 265 ? 168.440 65.128  109.110 1.00 158.27 ? 265 LYS B CG    1 
ATOM   3736  C CD    . LYS B  1 265 ? 168.435 63.629  109.396 1.00 160.09 ? 265 LYS B CD    1 
ATOM   3737  C CE    . LYS B  1 265 ? 167.098 63.176  109.977 1.00 161.92 ? 265 LYS B CE    1 
ATOM   3738  N NZ    . LYS B  1 265 ? 167.054 61.712  110.271 1.00 162.80 ? 265 LYS B NZ    1 
ATOM   3739  N N     . GLY B  1 270 ? 163.358 73.824  106.226 1.00 140.77 ? 270 GLY B N     1 
ATOM   3740  C CA    . GLY B  1 270 ? 162.222 74.031  107.106 1.00 141.14 ? 270 GLY B CA    1 
ATOM   3741  C C     . GLY B  1 270 ? 161.911 72.792  107.922 1.00 141.41 ? 270 GLY B C     1 
ATOM   3742  O O     . GLY B  1 270 ? 162.266 71.681  107.518 1.00 142.37 ? 270 GLY B O     1 
ATOM   3743  N N     . ALA B  1 271 ? 161.251 72.984  109.066 1.00 194.75 ? 271 ALA B N     1 
ATOM   3744  C CA    . ALA B  1 271 ? 160.872 71.895  109.976 1.00 193.65 ? 271 ALA B CA    1 
ATOM   3745  C C     . ALA B  1 271 ? 162.088 71.252  110.649 1.00 192.43 ? 271 ALA B C     1 
ATOM   3746  O O     . ALA B  1 271 ? 161.950 70.406  111.535 1.00 192.13 ? 271 ALA B O     1 
ATOM   3747  C CB    . ALA B  1 271 ? 160.058 70.831  109.226 1.00 143.96 ? 271 ALA B CB    1 
ATOM   3748  N N     . ASP B  1 272 ? 163.275 71.669  110.215 1.00 99.20  ? 272 ASP B N     1 
ATOM   3749  C CA    . ASP B  1 272 ? 164.548 71.176  110.738 1.00 97.03  ? 272 ASP B CA    1 
ATOM   3750  C C     . ASP B  1 272 ? 164.978 72.120  111.857 1.00 94.82  ? 272 ASP B C     1 
ATOM   3751  O O     . ASP B  1 272 ? 165.607 71.713  112.832 1.00 94.68  ? 272 ASP B O     1 
ATOM   3752  C CB    . ASP B  1 272 ? 165.592 71.151  109.604 1.00 148.68 ? 272 ASP B CB    1 
ATOM   3753  C CG    . ASP B  1 272 ? 166.962 70.684  110.065 1.00 149.73 ? 272 ASP B CG    1 
ATOM   3754  O OD1   . ASP B  1 272 ? 167.590 71.403  110.870 1.00 150.59 ? 272 ASP B OD1   1 
ATOM   3755  O OD2   . ASP B  1 272 ? 167.412 69.603  109.619 1.00 149.54 ? 272 ASP B OD2   1 
ATOM   3756  N N     . VAL B  1 273 ? 164.615 73.389  111.706 1.00 125.03 ? 273 VAL B N     1 
ATOM   3757  C CA    . VAL B  1 273 ? 164.931 74.405  112.699 1.00 122.34 ? 273 VAL B CA    1 
ATOM   3758  C C     . VAL B  1 273 ? 164.093 74.120  113.944 1.00 119.32 ? 273 VAL B C     1 
ATOM   3759  O O     . VAL B  1 273 ? 164.325 74.675  115.019 1.00 119.09 ? 273 VAL B O     1 
ATOM   3760  C CB    . VAL B  1 273 ? 164.617 75.825  112.155 1.00 114.12 ? 273 VAL B CB    1 
ATOM   3761  C CG1   . VAL B  1 273 ? 165.562 76.159  110.999 1.00 114.12 ? 273 VAL B CG1   1 
ATOM   3762  C CG2   . VAL B  1 273 ? 163.167 75.899  111.686 1.00 114.30 ? 273 VAL B CG2   1 
ATOM   3763  N N     . SER B  1 274 ? 163.115 73.239  113.779 1.00 91.24  ? 274 SER B N     1 
ATOM   3764  C CA    . SER B  1 274 ? 162.242 72.844  114.869 1.00 87.94  ? 274 SER B CA    1 
ATOM   3765  C C     . SER B  1 274 ? 163.045 71.938  115.783 1.00 85.00  ? 274 SER B C     1 
ATOM   3766  O O     . SER B  1 274 ? 162.805 71.901  116.987 1.00 84.99  ? 274 SER B O     1 
ATOM   3767  C CB    . SER B  1 274 ? 161.037 72.077  114.327 1.00 133.86 ? 274 SER B CB    1 
ATOM   3768  O OG    . SER B  1 274 ? 160.380 72.814  113.311 1.00 134.86 ? 274 SER B OG    1 
ATOM   3769  N N     . ARG B  1 275 ? 163.997 71.214  115.187 1.00 72.99  ? 275 ARG B N     1 
ATOM   3770  C CA    . ARG B  1 275 ? 164.875 70.284  115.897 1.00 67.64  ? 275 ARG B CA    1 
ATOM   3771  C C     . ARG B  1 275 ? 166.158 70.974  116.313 1.00 62.93  ? 275 ARG B C     1 
ATOM   3772  O O     . ARG B  1 275 ? 166.582 70.876  117.469 1.00 62.64  ? 275 ARG B O     1 
ATOM   3773  C CB    . ARG B  1 275 ? 165.192 69.084  115.010 1.00 143.20 ? 275 ARG B CB    1 
ATOM   3774  C CG    . ARG B  1 275 ? 163.965 68.257  114.719 1.00 147.56 ? 275 ARG B CG    1 
ATOM   3775  C CD    . ARG B  1 275 ? 164.271 67.055  113.870 1.00 150.91 ? 275 ARG B CD    1 
ATOM   3776  N NE    . ARG B  1 275 ? 164.762 67.438  112.554 1.00 154.05 ? 275 ARG B NE    1 
ATOM   3777  C CZ    . ARG B  1 275 ? 164.923 66.584  111.549 1.00 156.01 ? 275 ARG B CZ    1 
ATOM   3778  N NH1   . ARG B  1 275 ? 164.626 65.300  111.715 1.00 156.28 ? 275 ARG B NH1   1 
ATOM   3779  N NH2   . ARG B  1 275 ? 165.386 67.008  110.379 1.00 156.40 ? 275 ARG B NH2   1 
ATOM   3780  N N     . GLU B  1 276 ? 166.767 71.690  115.370 1.00 38.65  ? 276 GLU B N     1 
ATOM   3781  C CA    . GLU B  1 276 ? 168.006 72.412  115.650 1.00 33.45  ? 276 GLU B CA    1 
ATOM   3782  C C     . GLU B  1 276 ? 167.685 73.440  116.696 1.00 28.75  ? 276 GLU B C     1 
ATOM   3783  O O     . GLU B  1 276 ? 168.498 74.297  117.014 1.00 27.54  ? 276 GLU B O     1 
ATOM   3784  C CB    . GLU B  1 276 ? 168.557 73.109  114.403 1.00 79.36  ? 276 GLU B CB    1 
ATOM   3785  C CG    . GLU B  1 276 ? 169.846 73.891  114.672 1.00 82.10  ? 276 GLU B CG    1 
ATOM   3786  C CD    . GLU B  1 276 ? 170.604 74.242  113.409 1.00 83.77  ? 276 GLU B CD    1 
ATOM   3787  O OE1   . GLU B  1 276 ? 171.722 74.806  113.511 1.00 84.24  ? 276 GLU B OE1   1 
ATOM   3788  O OE2   . GLU B  1 276 ? 170.079 73.946  112.314 1.00 84.67  ? 276 GLU B OE2   1 
ATOM   3789  N N     . GLY B  1 277 ? 166.473 73.331  117.221 1.00 36.68  ? 277 GLY B N     1 
ATOM   3790  C CA    . GLY B  1 277 ? 166.007 74.239  118.240 1.00 31.86  ? 277 GLY B CA    1 
ATOM   3791  C C     . GLY B  1 277 ? 166.144 73.598  119.589 1.00 27.36  ? 277 GLY B C     1 
ATOM   3792  O O     . GLY B  1 277 ? 166.653 74.191  120.517 1.00 25.93  ? 277 GLY B O     1 
ATOM   3793  N N     . VAL B  1 278 ? 165.704 72.364  119.698 1.00 39.27  ? 278 VAL B N     1 
ATOM   3794  C CA    . VAL B  1 278 ? 165.807 71.702  120.970 1.00 36.51  ? 278 VAL B CA    1 
ATOM   3795  C C     . VAL B  1 278 ? 167.222 71.812  121.490 1.00 36.11  ? 278 VAL B C     1 
ATOM   3796  O O     . VAL B  1 278 ? 167.445 71.789  122.701 1.00 37.28  ? 278 VAL B O     1 
ATOM   3797  C CB    . VAL B  1 278 ? 165.447 70.241  120.868 1.00 3.83   ? 278 VAL B CB    1 
ATOM   3798  C CG1   . VAL B  1 278 ? 165.394 69.622  122.222 1.00 1.77   ? 278 VAL B CG1   1 
ATOM   3799  C CG2   . VAL B  1 278 ? 164.114 70.113  120.228 1.00 5.32   ? 278 VAL B CG2   1 
ATOM   3800  N N     . GLN B  1 279 ? 168.189 71.944  120.592 1.00 37.90  ? 279 GLN B N     1 
ATOM   3801  C CA    . GLN B  1 279 ? 169.560 72.051  121.055 1.00 35.15  ? 279 GLN B CA    1 
ATOM   3802  C C     . GLN B  1 279 ? 169.751 73.335  121.807 1.00 35.77  ? 279 GLN B C     1 
ATOM   3803  O O     . GLN B  1 279 ? 170.251 73.323  122.939 1.00 35.25  ? 279 GLN B O     1 
ATOM   3804  C CB    . GLN B  1 279 ? 170.508 72.005  119.896 1.00 29.77  ? 279 GLN B CB    1 
ATOM   3805  C CG    . GLN B  1 279 ? 170.442 70.719  119.221 1.00 24.82  ? 279 GLN B CG    1 
ATOM   3806  C CD    . GLN B  1 279 ? 171.524 70.578  118.231 1.00 24.04  ? 279 GLN B CD    1 
ATOM   3807  O OE1   . GLN B  1 279 ? 172.718 70.658  118.567 1.00 22.89  ? 279 GLN B OE1   1 
ATOM   3808  N NE2   . GLN B  1 279 ? 171.134 70.358  116.980 1.00 24.63  ? 279 GLN B NE2   1 
ATOM   3809  N N     . ARG B  1 280 ? 169.346 74.441  121.177 1.00 35.79  ? 280 ARG B N     1 
ATOM   3810  C CA    . ARG B  1 280 ? 169.462 75.759  121.798 1.00 37.52  ? 280 ARG B CA    1 
ATOM   3811  C C     . ARG B  1 280 ? 168.670 75.769  123.116 1.00 37.53  ? 280 ARG B C     1 
ATOM   3812  O O     . ARG B  1 280 ? 169.012 76.479  124.064 1.00 37.54  ? 280 ARG B O     1 
ATOM   3813  C CB    . ARG B  1 280 ? 168.932 76.835  120.852 1.00 50.01  ? 280 ARG B CB    1 
ATOM   3814  C CG    . ARG B  1 280 ? 169.665 76.901  119.520 1.00 54.60  ? 280 ARG B CG    1 
ATOM   3815  C CD    . ARG B  1 280 ? 170.734 78.006  119.453 1.00 60.91  ? 280 ARG B CD    1 
ATOM   3816  N NE    . ARG B  1 280 ? 171.487 77.972  118.192 1.00 65.55  ? 280 ARG B NE    1 
ATOM   3817  C CZ    . ARG B  1 280 ? 170.943 78.042  116.971 1.00 68.42  ? 280 ARG B CZ    1 
ATOM   3818  N NH1   . ARG B  1 280 ? 169.622 78.159  116.812 1.00 69.62  ? 280 ARG B NH1   1 
ATOM   3819  N NH2   . ARG B  1 280 ? 171.725 77.971  115.895 1.00 67.98  ? 280 ARG B NH2   1 
ATOM   3820  N N     . ASP B  1 281 ? 167.621 74.952  123.179 1.00 58.44  ? 281 ASP B N     1 
ATOM   3821  C CA    . ASP B  1 281 ? 166.786 74.870  124.370 1.00 57.50  ? 281 ASP B CA    1 
ATOM   3822  C C     . ASP B  1 281 ? 167.499 74.129  125.494 1.00 55.04  ? 281 ASP B C     1 
ATOM   3823  O O     . ASP B  1 281 ? 167.293 74.437  126.668 1.00 55.84  ? 281 ASP B O     1 
ATOM   3824  C CB    . ASP B  1 281 ? 165.461 74.180  124.028 1.00 124.10 ? 281 ASP B CB    1 
ATOM   3825  C CG    . ASP B  1 281 ? 164.511 75.082  123.247 1.00 130.39 ? 281 ASP B CG    1 
ATOM   3826  O OD1   . ASP B  1 281 ? 163.931 75.994  123.870 1.00 133.16 ? 281 ASP B OD1   1 
ATOM   3827  O OD2   . ASP B  1 281 ? 164.345 74.887  122.019 1.00 133.35 ? 281 ASP B OD2   1 
ATOM   3828  N N     . LEU B  1 282 ? 168.347 73.162  125.144 1.00 34.89  ? 282 LEU B N     1 
ATOM   3829  C CA    . LEU B  1 282 ? 169.065 72.407  126.163 1.00 29.66  ? 282 LEU B CA    1 
ATOM   3830  C C     . LEU B  1 282 ? 170.290 73.118  126.656 1.00 28.12  ? 282 LEU B C     1 
ATOM   3831  O O     . LEU B  1 282 ? 170.714 72.872  127.769 1.00 28.73  ? 282 LEU B O     1 
ATOM   3832  C CB    . LEU B  1 282 ? 169.492 71.030  125.667 1.00 7.48   ? 282 LEU B CB    1 
ATOM   3833  C CG    . LEU B  1 282 ? 168.467 69.912  125.437 1.00 6.50   ? 282 LEU B CG    1 
ATOM   3834  C CD1   . LEU B  1 282 ? 169.229 68.695  124.918 1.00 6.21   ? 282 LEU B CD1   1 
ATOM   3835  C CD2   . LEU B  1 282 ? 167.725 69.549  126.689 1.00 4.51   ? 282 LEU B CD2   1 
ATOM   3836  N N     . LEU B  1 283 ? 170.871 73.992  125.842 1.00 10.20  ? 283 LEU B N     1 
ATOM   3837  C CA    . LEU B  1 283 ? 172.072 74.729  126.255 1.00 9.07   ? 283 LEU B CA    1 
ATOM   3838  C C     . LEU B  1 283 ? 172.104 75.144  127.704 1.00 8.36   ? 283 LEU B C     1 
ATOM   3839  O O     . LEU B  1 283 ? 172.965 74.721  128.467 1.00 6.82   ? 283 LEU B O     1 
ATOM   3840  C CB    . LEU B  1 283 ? 172.247 75.955  125.399 1.00 3.72   ? 283 LEU B CB    1 
ATOM   3841  C CG    . LEU B  1 283 ? 172.994 75.424  124.207 1.00 3.34   ? 283 LEU B CG    1 
ATOM   3842  C CD1   . LEU B  1 283 ? 173.177 76.525  123.194 1.00 3.49   ? 283 LEU B CD1   1 
ATOM   3843  C CD2   . LEU B  1 283 ? 174.332 74.887  124.687 1.00 3.34   ? 283 LEU B CD2   1 
ATOM   3844  N N     . PRO B  1 284 ? 171.153 75.984  128.100 1.00 18.18  ? 284 PRO B N     1 
ATOM   3845  C CA    . PRO B  1 284 ? 171.022 76.487  129.463 1.00 18.46  ? 284 PRO B CA    1 
ATOM   3846  C C     . PRO B  1 284 ? 171.232 75.420  130.536 1.00 18.82  ? 284 PRO B C     1 
ATOM   3847  O O     . PRO B  1 284 ? 171.850 75.699  131.555 1.00 19.95  ? 284 PRO B O     1 
ATOM   3848  C CB    . PRO B  1 284 ? 169.611 77.026  129.482 1.00 28.86  ? 284 PRO B CB    1 
ATOM   3849  C CG    . PRO B  1 284 ? 169.440 77.505  128.078 1.00 29.05  ? 284 PRO B CG    1 
ATOM   3850  C CD    . PRO B  1 284 ? 170.015 76.406  127.272 1.00 27.60  ? 284 PRO B CD    1 
ATOM   3851  N N     . LEU B  1 285 ? 170.701 74.215  130.333 1.00 11.71  ? 285 LEU B N     1 
ATOM   3852  C CA    . LEU B  1 285 ? 170.879 73.147  131.314 1.00 11.65  ? 285 LEU B CA    1 
ATOM   3853  C C     . LEU B  1 285 ? 172.319 72.738  131.293 1.00 13.21  ? 285 LEU B C     1 
ATOM   3854  O O     . LEU B  1 285 ? 173.051 72.899  132.270 1.00 13.50  ? 285 LEU B O     1 
ATOM   3855  C CB    . LEU B  1 285 ? 170.054 71.929  130.970 1.00 22.86  ? 285 LEU B CB    1 
ATOM   3856  C CG    . LEU B  1 285 ? 168.662 71.975  131.544 1.00 23.63  ? 285 LEU B CG    1 
ATOM   3857  C CD1   . LEU B  1 285 ? 168.029 73.272  131.114 1.00 25.26  ? 285 LEU B CD1   1 
ATOM   3858  C CD2   . LEU B  1 285 ? 167.853 70.770  131.061 1.00 23.52  ? 285 LEU B CD2   1 
ATOM   3859  N N     . VAL B  1 286 ? 172.716 72.183  130.159 1.00 30.45  ? 286 VAL B N     1 
ATOM   3860  C CA    . VAL B  1 286 ? 174.073 71.742  129.969 1.00 33.07  ? 286 VAL B CA    1 
ATOM   3861  C C     . VAL B  1 286 ? 175.033 72.824  130.414 1.00 36.57  ? 286 VAL B C     1 
ATOM   3862  O O     . VAL B  1 286 ? 175.852 72.586  131.312 1.00 36.47  ? 286 VAL B O     1 
ATOM   3863  C CB    . VAL B  1 286 ? 174.312 71.435  128.516 1.00 10.98  ? 286 VAL B CB    1 
ATOM   3864  C CG1   . VAL B  1 286 ? 175.769 71.522  128.196 1.00 10.81  ? 286 VAL B CG1   1 
ATOM   3865  C CG2   . VAL B  1 286 ? 173.818 70.073  128.233 1.00 9.56   ? 286 VAL B CG2   1 
ATOM   3866  N N     . GLU B  1 287 ? 174.888 74.005  129.792 1.00 20.89  ? 287 GLU B N     1 
ATOM   3867  C CA    . GLU B  1 287 ? 175.718 75.197  130.024 1.00 23.56  ? 287 GLU B CA    1 
ATOM   3868  C C     . GLU B  1 287 ? 175.693 75.728  131.438 1.00 22.58  ? 287 GLU B C     1 
ATOM   3869  O O     . GLU B  1 287 ? 176.638 76.368  131.884 1.00 22.50  ? 287 GLU B O     1 
ATOM   3870  C CB    . GLU B  1 287 ? 175.313 76.315  129.073 1.00 137.53 ? 287 GLU B CB    1 
ATOM   3871  C CG    . GLU B  1 287 ? 176.430 76.748  128.165 1.00 146.20 ? 287 GLU B CG    1 
ATOM   3872  C CD    . GLU B  1 287 ? 176.031 77.908  127.290 1.00 151.86 ? 287 GLU B CD    1 
ATOM   3873  O OE1   . GLU B  1 287 ? 175.761 79.002  127.833 1.00 154.63 ? 287 GLU B OE1   1 
ATOM   3874  O OE2   . GLU B  1 287 ? 175.982 77.723  126.056 1.00 155.43 ? 287 GLU B OE2   1 
ATOM   3875  N N     . GLY B  1 288 ? 174.615 75.467  132.155 1.00 37.54  ? 288 GLY B N     1 
ATOM   3876  C CA    . GLY B  1 288 ? 174.565 75.931  133.521 1.00 39.69  ? 288 GLY B CA    1 
ATOM   3877  C C     . GLY B  1 288 ? 173.580 77.044  133.766 1.00 41.44  ? 288 GLY B C     1 
ATOM   3878  O O     . GLY B  1 288 ? 173.788 78.189  133.365 1.00 41.83  ? 288 GLY B O     1 
ATOM   3879  N N     . SER B  1 289 ? 172.489 76.706  134.436 1.00 35.90  ? 289 SER B N     1 
ATOM   3880  C CA    . SER B  1 289 ? 171.484 77.695  134.750 1.00 37.57  ? 289 SER B CA    1 
ATOM   3881  C C     . SER B  1 289 ? 170.783 77.239  136.011 1.00 37.81  ? 289 SER B C     1 
ATOM   3882  O O     . SER B  1 289 ? 171.280 76.360  136.728 1.00 36.73  ? 289 SER B O     1 
ATOM   3883  C CB    . SER B  1 289 ? 170.489 77.840  133.583 1.00 51.00  ? 289 SER B CB    1 
ATOM   3884  O OG    . SER B  1 289 ? 169.769 76.644  133.317 1.00 51.42  ? 289 SER B OG    1 
ATOM   3885  N N     . THR B  1 290 ? 169.638 77.854  136.279 1.00 33.89  ? 290 THR B N     1 
ATOM   3886  C CA    . THR B  1 290 ? 168.833 77.521  137.435 1.00 35.68  ? 290 THR B CA    1 
ATOM   3887  C C     . THR B  1 290 ? 167.420 77.283  136.981 1.00 37.18  ? 290 THR B C     1 
ATOM   3888  O O     . THR B  1 290 ? 166.948 77.967  136.084 1.00 38.47  ? 290 THR B O     1 
ATOM   3889  C CB    . THR B  1 290 ? 168.770 78.659  138.378 1.00 39.88  ? 290 THR B CB    1 
ATOM   3890  O OG1   . THR B  1 290 ? 170.091 79.171  138.575 1.00 40.07  ? 290 THR B OG1   1 
ATOM   3891  C CG2   . THR B  1 290 ? 168.149 78.204  139.676 1.00 39.96  ? 290 THR B CG2   1 
ATOM   3892  N N     . VAL B  1 291 ? 166.741 76.310  137.566 1.00 36.64  ? 291 VAL B N     1 
ATOM   3893  C CA    . VAL B  1 291 ? 165.359 76.085  137.179 1.00 39.16  ? 291 VAL B CA    1 
ATOM   3894  C C     . VAL B  1 291 ? 164.624 75.881  138.480 1.00 40.94  ? 291 VAL B C     1 
ATOM   3895  O O     . VAL B  1 291 ? 165.166 75.297  139.421 1.00 41.66  ? 291 VAL B O     1 
ATOM   3896  C CB    . VAL B  1 291 ? 165.168 74.854  136.225 1.00 33.23  ? 291 VAL B CB    1 
ATOM   3897  C CG1   . VAL B  1 291 ? 166.233 74.861  135.157 1.00 33.64  ? 291 VAL B CG1   1 
ATOM   3898  C CG2   . VAL B  1 291 ? 165.192 73.562  136.989 1.00 33.09  ? 291 VAL B CG2   1 
ATOM   3899  N N     . SER B  1 292 ? 163.404 76.392  138.549 1.00 42.29  ? 292 SER B N     1 
ATOM   3900  C CA    . SER B  1 292 ? 162.641 76.266  139.769 1.00 44.23  ? 292 SER B CA    1 
ATOM   3901  C C     . SER B  1 292 ? 161.933 74.927  139.790 1.00 45.64  ? 292 SER B C     1 
ATOM   3902  O O     . SER B  1 292 ? 161.345 74.518  138.787 1.00 46.06  ? 292 SER B O     1 
ATOM   3903  C CB    . SER B  1 292 ? 161.634 77.415  139.875 1.00 92.68  ? 292 SER B CB    1 
ATOM   3904  O OG    . SER B  1 292 ? 160.942 77.389  141.110 1.00 94.73  ? 292 SER B OG    1 
ATOM   3905  N N     . THR B  1 293 ? 162.013 74.246  140.934 1.00 54.61  ? 293 THR B N     1 
ATOM   3906  C CA    . THR B  1 293 ? 161.373 72.946  141.150 1.00 55.56  ? 293 THR B CA    1 
ATOM   3907  C C     . THR B  1 293 ? 160.470 73.086  142.353 1.00 56.00  ? 293 THR B C     1 
ATOM   3908  O O     . THR B  1 293 ? 160.680 73.957  143.196 1.00 55.74  ? 293 THR B O     1 
ATOM   3909  C CB    . THR B  1 293 ? 162.381 71.889  141.493 1.00 64.67  ? 293 THR B CB    1 
ATOM   3910  O OG1   . THR B  1 293 ? 163.115 72.314  142.649 1.00 65.05  ? 293 THR B OG1   1 
ATOM   3911  C CG2   . THR B  1 293 ? 163.331 71.680  140.337 1.00 65.08  ? 293 THR B CG2   1 
ATOM   3912  N N     . LYS B  1 294 ? 159.481 72.214  142.456 1.00 68.13  ? 294 LYS B N     1 
ATOM   3913  C CA    . LYS B  1 294 ? 158.569 72.305  143.576 1.00 68.66  ? 294 LYS B CA    1 
ATOM   3914  C C     . LYS B  1 294 ? 159.263 71.997  144.875 1.00 69.13  ? 294 LYS B C     1 
ATOM   3915  O O     . LYS B  1 294 ? 158.619 71.681  145.863 1.00 70.16  ? 294 LYS B O     1 
ATOM   3916  C CB    . LYS B  1 294 ? 157.381 71.370  143.398 1.00 84.21  ? 294 LYS B CB    1 
ATOM   3917  C CG    . LYS B  1 294 ? 157.677 69.914  143.536 1.00 85.14  ? 294 LYS B CG    1 
ATOM   3918  C CD    . LYS B  1 294 ? 156.387 69.160  143.327 1.00 87.77  ? 294 LYS B CD    1 
ATOM   3919  C CE    . LYS B  1 294 ? 156.586 67.658  143.378 1.00 89.44  ? 294 LYS B CE    1 
ATOM   3920  N NZ    . LYS B  1 294 ? 155.300 66.924  143.143 1.00 90.89  ? 294 LYS B NZ    1 
ATOM   3921  N N     . HIS B  1 295 ? 160.582 72.091  144.874 1.00 68.02  ? 295 HIS B N     1 
ATOM   3922  C CA    . HIS B  1 295 ? 161.344 71.833  146.077 1.00 67.78  ? 295 HIS B CA    1 
ATOM   3923  C C     . HIS B  1 295 ? 162.285 73.003  146.289 1.00 67.12  ? 295 HIS B C     1 
ATOM   3924  O O     . HIS B  1 295 ? 162.968 73.118  147.316 1.00 66.91  ? 295 HIS B O     1 
ATOM   3925  C CB    . HIS B  1 295 ? 162.106 70.529  145.920 1.00 63.39  ? 295 HIS B CB    1 
ATOM   3926  C CG    . HIS B  1 295 ? 161.214 69.336  145.811 1.00 64.64  ? 295 HIS B CG    1 
ATOM   3927  N ND1   . HIS B  1 295 ? 160.464 68.870  146.871 1.00 65.51  ? 295 HIS B ND1   1 
ATOM   3928  C CD2   . HIS B  1 295 ? 160.932 68.524  144.765 1.00 65.70  ? 295 HIS B CD2   1 
ATOM   3929  C CE1   . HIS B  1 295 ? 159.761 67.821  146.480 1.00 66.84  ? 295 HIS B CE1   1 
ATOM   3930  N NE2   . HIS B  1 295 ? 160.026 67.590  145.206 1.00 66.87  ? 295 HIS B NE2   1 
ATOM   3931  N N     . GLY B  1 296 ? 162.291 73.890  145.305 1.00 49.12  ? 296 GLY B N     1 
ATOM   3932  C CA    . GLY B  1 296 ? 163.146 75.054  145.381 1.00 48.30  ? 296 GLY B CA    1 
ATOM   3933  C C     . GLY B  1 296 ? 163.945 75.257  144.114 1.00 46.89  ? 296 GLY B C     1 
ATOM   3934  O O     . GLY B  1 296 ? 163.608 74.729  143.057 1.00 45.54  ? 296 GLY B O     1 
ATOM   3935  N N     . MET B  1 297 ? 165.020 76.019  144.237 1.00 46.81  ? 297 MET B N     1 
ATOM   3936  C CA    . MET B  1 297 ? 165.880 76.311  143.110 1.00 45.79  ? 297 MET B CA    1 
ATOM   3937  C C     . MET B  1 297 ? 167.052 75.328  142.998 1.00 44.00  ? 297 MET B C     1 
ATOM   3938  O O     . MET B  1 297 ? 167.804 75.142  143.971 1.00 44.14  ? 297 MET B O     1 
ATOM   3939  C CB    . MET B  1 297 ? 166.415 77.739  143.249 1.00 72.99  ? 297 MET B CB    1 
ATOM   3940  C CG    . MET B  1 297 ? 165.336 78.793  143.414 1.00 76.04  ? 297 MET B CG    1 
ATOM   3941  S SD    . MET B  1 297 ? 164.243 78.877  141.982 1.00 78.32  ? 297 MET B SD    1 
ATOM   3942  C CE    . MET B  1 297 ? 165.293 79.778  140.851 1.00 79.44  ? 297 MET B CE    1 
ATOM   3943  N N     . VAL B  1 298 ? 167.211 74.699  141.827 1.00 32.67  ? 298 VAL B N     1 
ATOM   3944  C CA    . VAL B  1 298 ? 168.334 73.770  141.601 1.00 30.04  ? 298 VAL B CA    1 
ATOM   3945  C C     . VAL B  1 298 ? 169.195 74.277  140.442 1.00 27.61  ? 298 VAL B C     1 
ATOM   3946  O O     . VAL B  1 298 ? 168.686 74.914  139.537 1.00 27.82  ? 298 VAL B O     1 
ATOM   3947  C CB    . VAL B  1 298 ? 167.836 72.346  141.300 1.00 29.86  ? 298 VAL B CB    1 
ATOM   3948  C CG1   . VAL B  1 298 ? 166.755 71.958  142.303 1.00 29.89  ? 298 VAL B CG1   1 
ATOM   3949  C CG2   . VAL B  1 298 ? 167.315 72.260  139.905 1.00 29.86  ? 298 VAL B CG2   1 
ATOM   3950  N N     . LYS B  1 299 ? 170.493 74.027  140.480 1.00 35.65  ? 299 LYS B N     1 
ATOM   3951  C CA    . LYS B  1 299 ? 171.363 74.506  139.420 1.00 35.30  ? 299 LYS B CA    1 
ATOM   3952  C C     . LYS B  1 299 ? 171.998 73.374  138.607 1.00 35.16  ? 299 LYS B C     1 
ATOM   3953  O O     . LYS B  1 299 ? 172.724 72.498  139.119 1.00 35.16  ? 299 LYS B O     1 
ATOM   3954  C CB    . LYS B  1 299 ? 172.477 75.391  139.979 1.00 61.79  ? 299 LYS B CB    1 
ATOM   3955  C CG    . LYS B  1 299 ? 172.059 76.274  141.117 1.00 65.82  ? 299 LYS B CG    1 
ATOM   3956  C CD    . LYS B  1 299 ? 173.043 77.421  141.328 1.00 70.19  ? 299 LYS B CD    1 
ATOM   3957  C CE    . LYS B  1 299 ? 174.446 76.945  141.723 1.00 72.42  ? 299 LYS B CE    1 
ATOM   3958  N NZ    . LYS B  1 299 ? 175.422 78.081  141.950 1.00 73.08  ? 299 LYS B NZ    1 
ATOM   3959  N N     . THR B  1 300 ? 171.740 73.419  137.312 1.00 39.44  ? 300 THR B N     1 
ATOM   3960  C CA    . THR B  1 300 ? 172.264 72.445  136.379 1.00 36.44  ? 300 THR B CA    1 
ATOM   3961  C C     . THR B  1 300 ? 173.756 72.653  136.238 1.00 36.26  ? 300 THR B C     1 
ATOM   3962  O O     . THR B  1 300 ? 174.410 71.930  135.508 1.00 36.42  ? 300 THR B O     1 
ATOM   3963  C CB    . THR B  1 300 ? 171.701 72.699  135.021 1.00 18.19  ? 300 THR B CB    1 
ATOM   3964  O OG1   . THR B  1 300 ? 172.024 74.051  134.668 1.00 16.01  ? 300 THR B OG1   1 
ATOM   3965  C CG2   . THR B  1 300 ? 170.183 72.503  135.010 1.00 17.99  ? 300 THR B CG2   1 
ATOM   3966  N N     . ASP B  1 301 ? 174.295 73.662  136.908 1.00 48.80  ? 301 ASP B N     1 
ATOM   3967  C CA    . ASP B  1 301 ? 175.718 73.956  136.777 1.00 48.47  ? 301 ASP B CA    1 
ATOM   3968  C C     . ASP B  1 301 ? 176.609 72.755  136.861 1.00 46.63  ? 301 ASP B C     1 
ATOM   3969  O O     . ASP B  1 301 ? 177.545 72.639  136.071 1.00 47.10  ? 301 ASP B O     1 
ATOM   3970  C CB    . ASP B  1 301 ? 176.173 74.995  137.802 1.00 104.82 ? 301 ASP B CB    1 
ATOM   3971  C CG    . ASP B  1 301 ? 175.958 76.422  137.319 1.00 108.15 ? 301 ASP B CG    1 
ATOM   3972  O OD1   . ASP B  1 301 ? 174.801 76.893  137.362 1.00 108.28 ? 301 ASP B OD1   1 
ATOM   3973  O OD2   . ASP B  1 301 ? 176.944 77.065  136.884 1.00 110.26 ? 301 ASP B OD2   1 
ATOM   3974  N N     . HIS B  1 302 ? 176.293 71.858  137.793 1.00 50.19  ? 302 HIS B N     1 
ATOM   3975  C CA    . HIS B  1 302 ? 177.086 70.652  138.004 1.00 47.40  ? 302 HIS B CA    1 
ATOM   3976  C C     . HIS B  1 302 ? 176.471 69.283  137.679 1.00 45.00  ? 302 HIS B C     1 
ATOM   3977  O O     . HIS B  1 302 ? 177.034 68.252  138.018 1.00 45.59  ? 302 HIS B O     1 
ATOM   3978  C CB    . HIS B  1 302 ? 177.585 70.649  139.431 1.00 42.16  ? 302 HIS B CB    1 
ATOM   3979  C CG    . HIS B  1 302 ? 178.608 71.699  139.696 1.00 44.35  ? 302 HIS B CG    1 
ATOM   3980  N ND1   . HIS B  1 302 ? 179.800 71.760  139.006 1.00 45.16  ? 302 HIS B ND1   1 
ATOM   3981  C CD2   . HIS B  1 302 ? 178.650 72.694  140.612 1.00 45.40  ? 302 HIS B CD2   1 
ATOM   3982  C CE1   . HIS B  1 302 ? 180.538 72.741  139.491 1.00 45.59  ? 302 HIS B CE1   1 
ATOM   3983  N NE2   . HIS B  1 302 ? 179.863 73.323  140.468 1.00 46.41  ? 302 HIS B NE2   1 
ATOM   3984  N N     . ILE B  1 303 ? 175.317 69.268  137.036 1.00 28.19  ? 303 ILE B N     1 
ATOM   3985  C CA    . ILE B  1 303 ? 174.671 68.027  136.638 1.00 24.18  ? 303 ILE B CA    1 
ATOM   3986  C C     . ILE B  1 303 ? 175.552 67.316  135.606 1.00 21.93  ? 303 ILE B C     1 
ATOM   3987  O O     . ILE B  1 303 ? 176.082 67.954  134.706 1.00 22.66  ? 303 ILE B O     1 
ATOM   3988  C CB    . ILE B  1 303 ? 173.331 68.340  135.962 1.00 32.33  ? 303 ILE B CB    1 
ATOM   3989  C CG1   . ILE B  1 303 ? 172.418 69.052  136.953 1.00 32.51  ? 303 ILE B CG1   1 
ATOM   3990  C CG2   . ILE B  1 303 ? 172.727 67.079  135.371 1.00 31.64  ? 303 ILE B CG2   1 
ATOM   3991  C CD1   . ILE B  1 303 ? 172.143 68.243  138.192 1.00 32.98  ? 303 ILE B CD1   1 
ATOM   3992  N N     . LEU B  1 304 ? 175.735 66.009  135.715 1.00 11.98  ? 304 LEU B N     1 
ATOM   3993  C CA    . LEU B  1 304 ? 176.539 65.343  134.705 1.00 8.51   ? 304 LEU B CA    1 
ATOM   3994  C C     . LEU B  1 304 ? 175.581 65.007  133.581 1.00 8.71   ? 304 LEU B C     1 
ATOM   3995  O O     . LEU B  1 304 ? 174.526 64.435  133.832 1.00 10.25  ? 304 LEU B O     1 
ATOM   3996  C CB    . LEU B  1 304 ? 177.150 64.055  135.252 1.00 3.99   ? 304 LEU B CB    1 
ATOM   3997  C CG    . LEU B  1 304 ? 177.646 63.077  134.171 1.00 2.93   ? 304 LEU B CG    1 
ATOM   3998  C CD1   . LEU B  1 304 ? 178.815 63.676  133.442 1.00 4.42   ? 304 LEU B CD1   1 
ATOM   3999  C CD2   . LEU B  1 304 ? 178.036 61.762  134.755 1.00 1.86   ? 304 LEU B CD2   1 
ATOM   4000  N N     . PHE B  1 305 ? 175.912 65.364  132.348 1.00 8.63   ? 305 PHE B N     1 
ATOM   4001  C CA    . PHE B  1 305 ? 175.017 65.027  131.242 1.00 7.45   ? 305 PHE B CA    1 
ATOM   4002  C C     . PHE B  1 305 ? 175.611 63.943  130.384 1.00 7.48   ? 305 PHE B C     1 
ATOM   4003  O O     . PHE B  1 305 ? 176.790 64.010  130.054 1.00 9.11   ? 305 PHE B O     1 
ATOM   4004  C CB    . PHE B  1 305 ? 174.754 66.230  130.321 1.00 14.82  ? 305 PHE B CB    1 
ATOM   4005  C CG    . PHE B  1 305 ? 173.826 67.240  130.891 1.00 16.37  ? 305 PHE B CG    1 
ATOM   4006  C CD1   . PHE B  1 305 ? 174.310 68.281  131.652 1.00 17.23  ? 305 PHE B CD1   1 
ATOM   4007  C CD2   . PHE B  1 305 ? 172.460 67.089  130.759 1.00 17.63  ? 305 PHE B CD2   1 
ATOM   4008  C CE1   . PHE B  1 305 ? 173.443 69.147  132.285 1.00 18.12  ? 305 PHE B CE1   1 
ATOM   4009  C CE2   . PHE B  1 305 ? 171.595 67.947  131.387 1.00 17.93  ? 305 PHE B CE2   1 
ATOM   4010  C CZ    . PHE B  1 305 ? 172.083 68.978  132.157 1.00 17.71  ? 305 PHE B CZ    1 
ATOM   4011  N N     . ILE B  1 306 ? 174.816 62.944  130.017 1.00 9.47   ? 306 ILE B N     1 
ATOM   4012  C CA    . ILE B  1 306 ? 175.298 61.897  129.115 1.00 8.65   ? 306 ILE B CA    1 
ATOM   4013  C C     . ILE B  1 306 ? 174.319 61.852  127.964 1.00 6.94   ? 306 ILE B C     1 
ATOM   4014  O O     . ILE B  1 306 ? 173.163 61.573  128.178 1.00 6.84   ? 306 ILE B O     1 
ATOM   4015  C CB    . ILE B  1 306 ? 175.349 60.542  129.792 1.00 18.70  ? 306 ILE B CB    1 
ATOM   4016  C CG1   . ILE B  1 306 ? 176.380 60.580  130.917 1.00 20.26  ? 306 ILE B CG1   1 
ATOM   4017  C CG2   . ILE B  1 306 ? 175.735 59.497  128.790 1.00 18.76  ? 306 ILE B CG2   1 
ATOM   4018  C CD1   . ILE B  1 306 ? 176.262 59.452  131.886 1.00 21.00  ? 306 ILE B CD1   1 
ATOM   4019  N N     . ALA B  1 307 ? 174.779 62.167  126.763 1.00 10.14  ? 307 ALA B N     1 
ATOM   4020  C CA    . ALA B  1 307 ? 173.931 62.175  125.590 1.00 11.48  ? 307 ALA B CA    1 
ATOM   4021  C C     . ALA B  1 307 ? 174.283 60.983  124.759 1.00 12.94  ? 307 ALA B C     1 
ATOM   4022  O O     . ALA B  1 307 ? 175.420 60.565  124.765 1.00 17.13  ? 307 ALA B O     1 
ATOM   4023  C CB    . ALA B  1 307 ? 174.184 63.384  124.807 1.00 10.61  ? 307 ALA B CB    1 
ATOM   4024  N N     . SER B  1 308 ? 173.337 60.438  124.015 1.00 6.10   ? 308 SER B N     1 
ATOM   4025  C CA    . SER B  1 308 ? 173.641 59.267  123.220 1.00 6.38   ? 308 SER B CA    1 
ATOM   4026  C C     . SER B  1 308 ? 172.991 59.385  121.881 1.00 6.45   ? 308 SER B C     1 
ATOM   4027  O O     . SER B  1 308 ? 172.039 60.133  121.714 1.00 6.40   ? 308 SER B O     1 
ATOM   4028  C CB    . SER B  1 308 ? 173.112 58.002  123.909 1.00 20.79  ? 308 SER B CB    1 
ATOM   4029  O OG    . SER B  1 308 ? 171.853 57.604  123.391 1.00 22.49  ? 308 SER B OG    1 
ATOM   4030  N N     . GLY B  1 309 ? 173.487 58.607  120.930 1.00 12.12  ? 309 GLY B N     1 
ATOM   4031  C CA    . GLY B  1 309 ? 172.909 58.608  119.601 1.00 12.05  ? 309 GLY B CA    1 
ATOM   4032  C C     . GLY B  1 309 ? 173.635 57.679  118.667 1.00 12.81  ? 309 GLY B C     1 
ATOM   4033  O O     . GLY B  1 309 ? 174.810 57.392  118.849 1.00 13.24  ? 309 GLY B O     1 
ATOM   4034  N N     . ALA B  1 310 ? 172.919 57.202  117.667 1.00 8.03   ? 310 ALA B N     1 
ATOM   4035  C CA    . ALA B  1 310 ? 173.471 56.314  116.651 1.00 9.46   ? 310 ALA B CA    1 
ATOM   4036  C C     . ALA B  1 310 ? 174.324 57.101  115.693 1.00 12.77  ? 310 ALA B C     1 
ATOM   4037  O O     . ALA B  1 310 ? 175.456 56.756  115.380 1.00 15.46  ? 310 ALA B O     1 
ATOM   4038  C CB    . ALA B  1 310 ? 172.374 55.677  115.886 1.00 42.93  ? 310 ALA B CB    1 
ATOM   4039  N N     . PHE B  1 311 ? 173.764 58.173  115.201 1.00 29.74  ? 311 PHE B N     1 
ATOM   4040  C CA    . PHE B  1 311 ? 174.537 58.971  114.304 1.00 33.04  ? 311 PHE B CA    1 
ATOM   4041  C C     . PHE B  1 311 ? 174.886 58.196  113.074 1.00 36.91  ? 311 PHE B C     1 
ATOM   4042  O O     . PHE B  1 311 ? 176.053 58.073  112.738 1.00 38.38  ? 311 PHE B O     1 
ATOM   4043  C CB    . PHE B  1 311 ? 175.807 59.454  114.983 1.00 15.62  ? 311 PHE B CB    1 
ATOM   4044  C CG    . PHE B  1 311 ? 175.574 60.560  115.959 1.00 15.02  ? 311 PHE B CG    1 
ATOM   4045  C CD1   . PHE B  1 311 ? 175.632 61.880  115.567 1.00 13.53  ? 311 PHE B CD1   1 
ATOM   4046  C CD2   . PHE B  1 311 ? 175.320 60.287  117.286 1.00 15.38  ? 311 PHE B CD2   1 
ATOM   4047  C CE1   . PHE B  1 311 ? 175.450 62.895  116.487 1.00 11.91  ? 311 PHE B CE1   1 
ATOM   4048  C CE2   . PHE B  1 311 ? 175.140 61.329  118.208 1.00 14.19  ? 311 PHE B CE2   1 
ATOM   4049  C CZ    . PHE B  1 311 ? 175.209 62.616  117.800 1.00 11.31  ? 311 PHE B CZ    1 
ATOM   4050  N N     . GLN B  1 312 ? 173.879 57.649  112.409 1.00 35.71  ? 312 GLN B N     1 
ATOM   4051  C CA    . GLN B  1 312 ? 174.163 56.957  111.168 1.00 40.65  ? 312 GLN B CA    1 
ATOM   4052  C C     . GLN B  1 312 ? 174.089 57.970  110.023 1.00 42.21  ? 312 GLN B C     1 
ATOM   4053  O O     . GLN B  1 312 ? 174.734 57.836  108.988 1.00 42.20  ? 312 GLN B O     1 
ATOM   4054  C CB    . GLN B  1 312 ? 173.195 55.778  110.933 1.00 103.59 ? 312 GLN B CB    1 
ATOM   4055  C CG    . GLN B  1 312 ? 171.821 55.858  111.583 1.00 106.41 ? 312 GLN B CG    1 
ATOM   4056  C CD    . GLN B  1 312 ? 171.050 54.544  111.437 1.00 106.40 ? 312 GLN B CD    1 
ATOM   4057  O OE1   . GLN B  1 312 ? 171.565 53.481  111.773 1.00 105.93 ? 312 GLN B OE1   1 
ATOM   4058  N NE2   . GLN B  1 312 ? 169.816 54.617  110.943 1.00 106.58 ? 312 GLN B NE2   1 
ATOM   4059  N N     . VAL B  1 313 ? 173.317 59.013  110.235 1.00 47.13  ? 313 VAL B N     1 
ATOM   4060  C CA    . VAL B  1 313 ? 173.156 60.027  109.226 1.00 49.94  ? 313 VAL B CA    1 
ATOM   4061  C C     . VAL B  1 313 ? 173.936 61.260  109.573 1.00 50.17  ? 313 VAL B C     1 
ATOM   4062  O O     . VAL B  1 313 ? 174.686 61.764  108.758 1.00 51.43  ? 313 VAL B O     1 
ATOM   4063  C CB    . VAL B  1 313 ? 171.701 60.388  109.090 1.00 56.29  ? 313 VAL B CB    1 
ATOM   4064  C CG1   . VAL B  1 313 ? 171.057 59.451  108.100 1.00 56.58  ? 313 VAL B CG1   1 
ATOM   4065  C CG2   . VAL B  1 313 ? 171.010 60.295  110.474 1.00 58.10  ? 313 VAL B CG2   1 
ATOM   4066  N N     . ALA B  1 314 ? 173.752 61.755  110.785 1.00 38.86  ? 314 ALA B N     1 
ATOM   4067  C CA    . ALA B  1 314 ? 174.460 62.944  111.215 1.00 40.10  ? 314 ALA B CA    1 
ATOM   4068  C C     . ALA B  1 314 ? 175.749 62.627  111.979 1.00 40.70  ? 314 ALA B C     1 
ATOM   4069  O O     . ALA B  1 314 ? 175.868 61.576  112.617 1.00 40.72  ? 314 ALA B O     1 
ATOM   4070  C CB    . ALA B  1 314 ? 173.555 63.768  112.059 1.00 28.96  ? 314 ALA B CB    1 
ATOM   4071  N N     . ARG B  1 315 ? 176.722 63.534  111.895 1.00 22.78  ? 315 ARG B N     1 
ATOM   4072  C CA    . ARG B  1 315 ? 177.995 63.371  112.592 1.00 23.99  ? 315 ARG B CA    1 
ATOM   4073  C C     . ARG B  1 315 ? 177.752 64.119  113.879 1.00 21.24  ? 315 ARG B C     1 
ATOM   4074  O O     . ARG B  1 315 ? 176.846 64.941  113.928 1.00 22.10  ? 315 ARG B O     1 
ATOM   4075  C CB    . ARG B  1 315 ? 179.122 64.010  111.778 1.00 175.55 ? 315 ARG B CB    1 
ATOM   4076  C CG    . ARG B  1 315 ? 179.389 63.309  110.443 1.00 185.18 ? 315 ARG B CG    1 
ATOM   4077  C CD    . ARG B  1 315 ? 179.440 64.287  109.255 1.00 192.85 ? 315 ARG B CD    1 
ATOM   4078  N NE    . ARG B  1 315 ? 178.118 64.765  108.838 1.00 198.39 ? 315 ARG B NE    1 
ATOM   4079  C CZ    . ARG B  1 315 ? 177.889 65.530  107.770 1.00 199.84 ? 315 ARG B CZ    1 
ATOM   4080  N NH1   . ARG B  1 315 ? 178.895 65.917  106.995 1.00 200.00 ? 315 ARG B NH1   1 
ATOM   4081  N NH2   . ARG B  1 315 ? 176.650 65.905  107.468 1.00 199.07 ? 315 ARG B NH2   1 
ATOM   4082  N N     . PRO B  1 316 ? 178.511 63.843  114.945 1.00 16.38  ? 316 PRO B N     1 
ATOM   4083  C CA    . PRO B  1 316 ? 178.183 64.631  116.139 1.00 16.05  ? 316 PRO B CA    1 
ATOM   4084  C C     . PRO B  1 316 ? 178.537 66.108  115.917 1.00 16.00  ? 316 PRO B C     1 
ATOM   4085  O O     . PRO B  1 316 ? 177.947 67.042  116.518 1.00 14.92  ? 316 PRO B O     1 
ATOM   4086  C CB    . PRO B  1 316 ? 179.016 63.965  117.217 1.00 64.33  ? 316 PRO B CB    1 
ATOM   4087  C CG    . PRO B  1 316 ? 179.017 62.553  116.769 1.00 65.06  ? 316 PRO B CG    1 
ATOM   4088  C CD    . PRO B  1 316 ? 179.344 62.694  115.304 1.00 64.02  ? 316 PRO B CD    1 
ATOM   4089  N N     . SER B  1 317 ? 179.493 66.276  114.999 1.00 51.99  ? 317 SER B N     1 
ATOM   4090  C CA    . SER B  1 317 ? 180.019 67.560  114.543 1.00 49.97  ? 317 SER B CA    1 
ATOM   4091  C C     . SER B  1 317 ? 178.949 68.242  113.714 1.00 47.49  ? 317 SER B C     1 
ATOM   4092  O O     . SER B  1 317 ? 179.238 69.000  112.807 1.00 47.94  ? 317 SER B O     1 
ATOM   4093  C CB    . SER B  1 317 ? 181.235 67.315  113.660 1.00 80.33  ? 317 SER B CB    1 
ATOM   4094  O OG    . SER B  1 317 ? 180.882 66.512  112.544 1.00 81.83  ? 317 SER B OG    1 
ATOM   4095  N N     . ASP B  1 318 ? 177.704 67.930  114.021 1.00 22.12  ? 318 ASP B N     1 
ATOM   4096  C CA    . ASP B  1 318 ? 176.586 68.495  113.325 1.00 19.69  ? 318 ASP B CA    1 
ATOM   4097  C C     . ASP B  1 318 ? 175.701 69.126  114.344 1.00 16.78  ? 318 ASP B C     1 
ATOM   4098  O O     . ASP B  1 318 ? 174.676 69.704  114.027 1.00 17.06  ? 318 ASP B O     1 
ATOM   4099  C CB    . ASP B  1 318 ? 175.836 67.424  112.561 1.00 56.77  ? 318 ASP B CB    1 
ATOM   4100  C CG    . ASP B  1 318 ? 176.275 67.349  111.123 1.00 59.31  ? 318 ASP B CG    1 
ATOM   4101  O OD1   . ASP B  1 318 ? 177.436 67.750  110.834 1.00 56.71  ? 318 ASP B OD1   1 
ATOM   4102  O OD2   . ASP B  1 318 ? 175.462 66.886  110.294 1.00 61.46  ? 318 ASP B OD2   1 
ATOM   4103  N N     . LEU B  1 319 ? 176.088 69.018  115.596 1.00 27.79  ? 319 LEU B N     1 
ATOM   4104  C CA    . LEU B  1 319 ? 175.279 69.654  116.598 1.00 24.15  ? 319 LEU B CA    1 
ATOM   4105  C C     . LEU B  1 319 ? 175.761 71.094  116.607 1.00 22.24  ? 319 LEU B C     1 
ATOM   4106  O O     . LEU B  1 319 ? 176.799 71.407  116.012 1.00 21.73  ? 319 LEU B O     1 
ATOM   4107  C CB    . LEU B  1 319 ? 175.516 68.985  117.935 1.00 1.32   ? 319 LEU B CB    1 
ATOM   4108  C CG    . LEU B  1 319 ? 175.389 67.473  117.879 1.00 1.00   ? 319 LEU B CG    1 
ATOM   4109  C CD1   . LEU B  1 319 ? 176.269 66.847  118.917 1.00 1.00   ? 319 LEU B CD1   1 
ATOM   4110  C CD2   . LEU B  1 319 ? 173.963 67.123  118.126 1.00 1.00   ? 319 LEU B CD2   1 
ATOM   4111  N N     . ILE B  1 320 ? 174.999 71.961  117.264 1.00 13.64  ? 320 ILE B N     1 
ATOM   4112  C CA    . ILE B  1 320 ? 175.344 73.375  117.368 1.00 12.90  ? 320 ILE B CA    1 
ATOM   4113  C C     . ILE B  1 320 ? 176.617 73.472  118.205 1.00 12.98  ? 320 ILE B C     1 
ATOM   4114  O O     . ILE B  1 320 ? 176.716 72.862  119.275 1.00 14.05  ? 320 ILE B O     1 
ATOM   4115  C CB    . ILE B  1 320 ? 174.201 74.147  118.020 1.00 5.61   ? 320 ILE B CB    1 
ATOM   4116  C CG1   . ILE B  1 320 ? 173.958 73.617  119.421 1.00 4.91   ? 320 ILE B CG1   1 
ATOM   4117  C CG2   . ILE B  1 320 ? 172.919 73.953  117.209 1.00 4.68   ? 320 ILE B CG2   1 
ATOM   4118  C CD1   . ILE B  1 320 ? 172.801 74.265  120.119 1.00 5.83   ? 320 ILE B CD1   1 
ATOM   4119  N N     . PRO B  1 321 ? 177.609 74.241  117.728 1.00 7.43   ? 321 PRO B N     1 
ATOM   4120  C CA    . PRO B  1 321 ? 178.877 74.390  118.428 1.00 7.43   ? 321 PRO B CA    1 
ATOM   4121  C C     . PRO B  1 321 ? 178.727 74.638  119.900 1.00 7.43   ? 321 PRO B C     1 
ATOM   4122  O O     . PRO B  1 321 ? 179.431 74.049  120.698 1.00 7.43   ? 321 PRO B O     1 
ATOM   4123  C CB    . PRO B  1 321 ? 179.537 75.536  117.691 1.00 7.00   ? 321 PRO B CB    1 
ATOM   4124  C CG    . PRO B  1 321 ? 179.040 75.378  116.330 1.00 6.90   ? 321 PRO B CG    1 
ATOM   4125  C CD    . PRO B  1 321 ? 177.572 75.134  116.564 1.00 7.98   ? 321 PRO B CD    1 
ATOM   4126  N N     . GLU B  1 322 ? 177.794 75.495  120.282 1.00 15.19  ? 322 GLU B N     1 
ATOM   4127  C CA    . GLU B  1 322 ? 177.634 75.778  121.701 1.00 18.53  ? 322 GLU B CA    1 
ATOM   4128  C C     . GLU B  1 322 ? 177.581 74.467  122.488 1.00 17.31  ? 322 GLU B C     1 
ATOM   4129  O O     . GLU B  1 322 ? 178.234 74.326  123.509 1.00 17.07  ? 322 GLU B O     1 
ATOM   4130  C CB    . GLU B  1 322 ? 176.386 76.640  121.944 1.00 54.85  ? 322 GLU B CB    1 
ATOM   4131  C CG    . GLU B  1 322 ? 176.566 78.133  121.590 1.00 63.95  ? 322 GLU B CG    1 
ATOM   4132  C CD    . GLU B  1 322 ? 176.716 78.410  120.081 1.00 70.14  ? 322 GLU B CD    1 
ATOM   4133  O OE1   . GLU B  1 322 ? 176.854 79.609  119.689 1.00 71.37  ? 322 GLU B OE1   1 
ATOM   4134  O OE2   . GLU B  1 322 ? 176.690 77.431  119.290 1.00 72.11  ? 322 GLU B OE2   1 
ATOM   4135  N N     . LEU B  1 323 ? 176.850 73.494  121.957 1.00 24.76  ? 323 LEU B N     1 
ATOM   4136  C CA    . LEU B  1 323 ? 176.653 72.177  122.571 1.00 24.30  ? 323 LEU B CA    1 
ATOM   4137  C C     . LEU B  1 323 ? 177.806 71.227  122.294 1.00 25.87  ? 323 LEU B C     1 
ATOM   4138  O O     . LEU B  1 323 ? 178.338 70.547  123.179 1.00 26.48  ? 323 LEU B O     1 
ATOM   4139  C CB    . LEU B  1 323 ? 175.392 71.588  122.002 1.00 16.32  ? 323 LEU B CB    1 
ATOM   4140  C CG    . LEU B  1 323 ? 174.846 70.337  122.630 1.00 15.53  ? 323 LEU B CG    1 
ATOM   4141  C CD1   . LEU B  1 323 ? 174.660 70.484  124.146 1.00 14.38  ? 323 LEU B CD1   1 
ATOM   4142  C CD2   . LEU B  1 323 ? 173.533 70.074  121.919 1.00 15.42  ? 323 LEU B CD2   1 
ATOM   4143  N N     . GLN B  1 324 ? 178.169 71.184  121.028 1.00 24.33  ? 324 GLN B N     1 
ATOM   4144  C CA    . GLN B  1 324 ? 179.263 70.374  120.548 1.00 25.11  ? 324 GLN B CA    1 
ATOM   4145  C C     . GLN B  1 324 ? 180.543 70.545  121.370 1.00 24.44  ? 324 GLN B C     1 
ATOM   4146  O O     . GLN B  1 324 ? 181.496 69.817  121.194 1.00 24.99  ? 324 GLN B O     1 
ATOM   4147  C CB    . GLN B  1 324 ? 179.508 70.761  119.103 1.00 32.29  ? 324 GLN B CB    1 
ATOM   4148  C CG    . GLN B  1 324 ? 180.681 70.145  118.479 1.00 36.07  ? 324 GLN B CG    1 
ATOM   4149  C CD    . GLN B  1 324 ? 180.653 70.345  116.996 1.00 39.23  ? 324 GLN B CD    1 
ATOM   4150  O OE1   . GLN B  1 324 ? 181.668 70.175  116.317 1.00 43.21  ? 324 GLN B OE1   1 
ATOM   4151  N NE2   . GLN B  1 324 ? 179.485 70.705  116.471 1.00 38.97  ? 324 GLN B NE2   1 
ATOM   4152  N N     . GLY B  1 325 ? 180.568 71.502  122.277 1.00 16.67  ? 325 GLY B N     1 
ATOM   4153  C CA    . GLY B  1 325 ? 181.774 71.709  123.037 1.00 16.70  ? 325 GLY B CA    1 
ATOM   4154  C C     . GLY B  1 325 ? 181.484 71.529  124.486 1.00 16.98  ? 325 GLY B C     1 
ATOM   4155  O O     . GLY B  1 325 ? 182.391 71.597  125.314 1.00 17.32  ? 325 GLY B O     1 
ATOM   4156  N N     . ARG B  1 326 ? 180.213 71.338  124.801 1.00 35.10  ? 326 ARG B N     1 
ATOM   4157  C CA    . ARG B  1 326 ? 179.830 71.110  126.174 1.00 38.08  ? 326 ARG B CA    1 
ATOM   4158  C C     . ARG B  1 326 ? 179.739 69.592  126.328 1.00 37.18  ? 326 ARG B C     1 
ATOM   4159  O O     . ARG B  1 326 ? 179.473 69.053  127.420 1.00 36.69  ? 326 ARG B O     1 
ATOM   4160  C CB    . ARG B  1 326 ? 178.526 71.820  126.470 1.00 89.39  ? 326 ARG B CB    1 
ATOM   4161  C CG    . ARG B  1 326 ? 178.740 73.313  126.629 1.00 98.97  ? 326 ARG B CG    1 
ATOM   4162  C CD    . ARG B  1 326 ? 178.906 73.697  128.093 1.00 106.78 ? 326 ARG B CD    1 
ATOM   4163  N NE    . ARG B  1 326 ? 179.339 72.565  128.917 1.00 114.48 ? 326 ARG B NE    1 
ATOM   4164  C CZ    . ARG B  1 326 ? 179.418 72.590  130.247 1.00 117.76 ? 326 ARG B CZ    1 
ATOM   4165  N NH1   . ARG B  1 326 ? 179.093 73.695  130.916 1.00 119.43 ? 326 ARG B NH1   1 
ATOM   4166  N NH2   . ARG B  1 326 ? 179.813 71.508  130.913 1.00 117.97 ? 326 ARG B NH2   1 
ATOM   4167  N N     . LEU B  1 327 ? 179.998 68.912  125.208 1.00 20.67  ? 327 LEU B N     1 
ATOM   4168  C CA    . LEU B  1 327 ? 180.040 67.454  125.151 1.00 17.98  ? 327 LEU B CA    1 
ATOM   4169  C C     . LEU B  1 327 ? 181.468 67.165  124.662 1.00 18.66  ? 327 LEU B C     1 
ATOM   4170  O O     . LEU B  1 327 ? 181.712 66.866  123.495 1.00 18.23  ? 327 LEU B O     1 
ATOM   4171  C CB    . LEU B  1 327 ? 178.998 66.924  124.167 1.00 6.70   ? 327 LEU B CB    1 
ATOM   4172  C CG    . LEU B  1 327 ? 177.535 67.259  124.449 1.00 2.74   ? 327 LEU B CG    1 
ATOM   4173  C CD1   . LEU B  1 327 ? 176.613 66.495  123.509 1.00 2.03   ? 327 LEU B CD1   1 
ATOM   4174  C CD2   . LEU B  1 327 ? 177.254 66.919  125.888 1.00 3.18   ? 327 LEU B CD2   1 
ATOM   4175  N N     . PRO B  1 328 ? 182.433 67.266  125.568 1.00 46.18  ? 328 PRO B N     1 
ATOM   4176  C CA    . PRO B  1 328 ? 183.845 67.051  125.315 1.00 48.33  ? 328 PRO B CA    1 
ATOM   4177  C C     . PRO B  1 328 ? 184.228 65.603  125.119 1.00 50.82  ? 328 PRO B C     1 
ATOM   4178  O O     . PRO B  1 328 ? 184.976 65.286  124.189 1.00 54.81  ? 328 PRO B O     1 
ATOM   4179  C CB    . PRO B  1 328 ? 184.507 67.640  126.538 1.00 11.81  ? 328 PRO B CB    1 
ATOM   4180  C CG    . PRO B  1 328 ? 183.390 67.862  127.546 1.00 11.43  ? 328 PRO B CG    1 
ATOM   4181  C CD    . PRO B  1 328 ? 182.168 67.251  127.005 1.00 11.51  ? 328 PRO B CD    1 
ATOM   4182  N N     . ILE B  1 329 ? 183.743 64.723  125.993 1.00 13.04  ? 329 ILE B N     1 
ATOM   4183  C CA    . ILE B  1 329 ? 184.065 63.310  125.879 1.00 11.98  ? 329 ILE B CA    1 
ATOM   4184  C C     . ILE B  1 329 ? 183.248 62.564  124.806 1.00 11.11  ? 329 ILE B C     1 
ATOM   4185  O O     . ILE B  1 329 ? 182.036 62.406  124.935 1.00 10.79  ? 329 ILE B O     1 
ATOM   4186  C CB    . ILE B  1 329 ? 183.844 62.609  127.215 1.00 51.10  ? 329 ILE B CB    1 
ATOM   4187  C CG1   . ILE B  1 329 ? 184.874 63.090  128.228 1.00 54.21  ? 329 ILE B CG1   1 
ATOM   4188  C CG2   . ILE B  1 329 ? 183.963 61.127  127.042 1.00 52.08  ? 329 ILE B CG2   1 
ATOM   4189  C CD1   . ILE B  1 329 ? 184.837 62.344  129.595 1.00 55.34  ? 329 ILE B CD1   1 
ATOM   4190  N N     . ARG B  1 330 ? 183.885 62.130  123.728 1.00 29.84  ? 330 ARG B N     1 
ATOM   4191  C CA    . ARG B  1 330 ? 183.147 61.342  122.754 1.00 29.82  ? 330 ARG B CA    1 
ATOM   4192  C C     . ARG B  1 330 ? 183.654 59.922  123.027 1.00 28.43  ? 330 ARG B C     1 
ATOM   4193  O O     . ARG B  1 330 ? 184.857 59.709  123.187 1.00 27.84  ? 330 ARG B O     1 
ATOM   4194  C CB    . ARG B  1 330 ? 183.470 61.718  121.300 1.00 54.75  ? 330 ARG B CB    1 
ATOM   4195  C CG    . ARG B  1 330 ? 183.369 63.178  120.942 1.00 57.09  ? 330 ARG B CG    1 
ATOM   4196  C CD    . ARG B  1 330 ? 182.043 63.788  121.298 1.00 61.88  ? 330 ARG B CD    1 
ATOM   4197  N NE    . ARG B  1 330 ? 182.047 65.226  121.020 1.00 65.20  ? 330 ARG B NE    1 
ATOM   4198  C CZ    . ARG B  1 330 ? 182.096 65.744  119.797 1.00 67.27  ? 330 ARG B CZ    1 
ATOM   4199  N NH1   . ARG B  1 330 ? 182.138 64.931  118.742 1.00 68.74  ? 330 ARG B NH1   1 
ATOM   4200  N NH2   . ARG B  1 330 ? 182.119 67.062  119.630 1.00 65.40  ? 330 ARG B NH2   1 
ATOM   4201  N N     . VAL B  1 331 ? 182.734 58.965  123.113 1.00 5.64   ? 331 VAL B N     1 
ATOM   4202  C CA    . VAL B  1 331 ? 183.073 57.567  123.360 1.00 3.43   ? 331 VAL B CA    1 
ATOM   4203  C C     . VAL B  1 331 ? 182.196 56.730  122.428 1.00 3.09   ? 331 VAL B C     1 
ATOM   4204  O O     . VAL B  1 331 ? 181.026 57.049  122.198 1.00 2.03   ? 331 VAL B O     1 
ATOM   4205  C CB    . VAL B  1 331 ? 182.821 57.197  124.832 1.00 2.03   ? 331 VAL B CB    1 
ATOM   4206  C CG1   . VAL B  1 331 ? 181.411 57.513  125.201 1.00 1.05   ? 331 VAL B CG1   1 
ATOM   4207  C CG2   . VAL B  1 331 ? 183.064 55.744  125.044 1.00 3.27   ? 331 VAL B CG2   1 
ATOM   4208  N N     . GLU B  1 332 ? 182.769 55.675  121.873 1.00 8.53   ? 332 GLU B N     1 
ATOM   4209  C CA    . GLU B  1 332 ? 182.029 54.846  120.947 1.00 10.84  ? 332 GLU B CA    1 
ATOM   4210  C C     . GLU B  1 332 ? 181.612 53.516  121.585 1.00 9.37   ? 332 GLU B C     1 
ATOM   4211  O O     . GLU B  1 332 ? 182.260 53.042  122.511 1.00 11.47  ? 332 GLU B O     1 
ATOM   4212  C CB    . GLU B  1 332 ? 182.913 54.605  119.736 1.00 84.78  ? 332 GLU B CB    1 
ATOM   4213  C CG    . GLU B  1 332 ? 182.178 54.428  118.455 1.00 94.33  ? 332 GLU B CG    1 
ATOM   4214  C CD    . GLU B  1 332 ? 183.093 54.636  117.274 1.00 100.65 ? 332 GLU B CD    1 
ATOM   4215  O OE1   . GLU B  1 332 ? 183.556 55.776  117.073 1.00 102.28 ? 332 GLU B OE1   1 
ATOM   4216  O OE2   . GLU B  1 332 ? 183.364 53.658  116.551 1.00 105.38 ? 332 GLU B OE2   1 
ATOM   4217  N N     . LEU B  1 333 ? 180.506 52.926  121.144 1.00 19.27  ? 333 LEU B N     1 
ATOM   4218  C CA    . LEU B  1 333 ? 180.090 51.630  121.669 1.00 16.99  ? 333 LEU B CA    1 
ATOM   4219  C C     . LEU B  1 333 ? 179.989 50.770  120.456 1.00 16.47  ? 333 LEU B C     1 
ATOM   4220  O O     . LEU B  1 333 ? 179.756 51.259  119.355 1.00 16.78  ? 333 LEU B O     1 
ATOM   4221  C CB    . LEU B  1 333 ? 178.752 51.683  122.354 1.00 15.69  ? 333 LEU B CB    1 
ATOM   4222  C CG    . LEU B  1 333 ? 178.929 52.231  123.751 1.00 16.34  ? 333 LEU B CG    1 
ATOM   4223  C CD1   . LEU B  1 333 ? 178.894 53.724  123.667 1.00 17.28  ? 333 LEU B CD1   1 
ATOM   4224  C CD2   . LEU B  1 333 ? 177.812 51.747  124.668 1.00 17.10  ? 333 LEU B CD2   1 
ATOM   4225  N N     . THR B  1 334 ? 180.161 49.480  120.639 1.00 1.22   ? 334 THR B N     1 
ATOM   4226  C CA    . THR B  1 334 ? 180.136 48.589  119.501 1.00 1.22   ? 334 THR B CA    1 
ATOM   4227  C C     . THR B  1 334 ? 178.901 47.811  119.276 1.00 1.22   ? 334 THR B C     1 
ATOM   4228  O O     . THR B  1 334 ? 178.086 47.620  120.178 1.00 1.22   ? 334 THR B O     1 
ATOM   4229  C CB    . THR B  1 334 ? 181.171 47.576  119.633 1.00 1.99   ? 334 THR B CB    1 
ATOM   4230  O OG1   . THR B  1 334 ? 181.033 46.978  120.927 1.00 1.73   ? 334 THR B OG1   1 
ATOM   4231  C CG2   . THR B  1 334 ? 182.536 48.217  119.481 1.00 5.73   ? 334 THR B CG2   1 
ATOM   4232  N N     . ALA B  1 335 ? 178.792 47.336  118.046 1.00 31.38  ? 335 ALA B N     1 
ATOM   4233  C CA    . ALA B  1 335 ? 177.675 46.508  117.682 1.00 34.05  ? 335 ALA B CA    1 
ATOM   4234  C C     . ALA B  1 335 ? 177.898 45.302  118.565 1.00 35.41  ? 335 ALA B C     1 
ATOM   4235  O O     . ALA B  1 335 ? 179.033 44.977  118.931 1.00 35.72  ? 335 ALA B O     1 
ATOM   4236  C CB    . ALA B  1 335 ? 177.751 46.117  116.212 1.00 35.93  ? 335 ALA B CB    1 
ATOM   4237  N N     . LEU B  1 336 ? 176.817 44.654  118.937 1.00 36.95  ? 336 LEU B N     1 
ATOM   4238  C CA    . LEU B  1 336 ? 176.957 43.497  119.767 1.00 37.47  ? 336 LEU B CA    1 
ATOM   4239  C C     . LEU B  1 336 ? 177.142 42.263  118.877 1.00 40.85  ? 336 LEU B C     1 
ATOM   4240  O O     . LEU B  1 336 ? 176.420 42.052  117.898 1.00 43.44  ? 336 LEU B O     1 
ATOM   4241  C CB    . LEU B  1 336 ? 175.740 43.402  120.669 1.00 1.00   ? 336 LEU B CB    1 
ATOM   4242  C CG    . LEU B  1 336 ? 176.095 43.618  122.150 1.00 1.00   ? 336 LEU B CG    1 
ATOM   4243  C CD1   . LEU B  1 336 ? 177.323 44.497  122.307 1.00 1.00   ? 336 LEU B CD1   1 
ATOM   4244  C CD2   . LEU B  1 336 ? 174.900 44.199  122.877 1.00 1.00   ? 336 LEU B CD2   1 
ATOM   4245  N N     . SER B  1 337 ? 178.139 41.455  119.208 1.00 47.67  ? 337 SER B N     1 
ATOM   4246  C CA    . SER B  1 337 ? 178.432 40.270  118.427 1.00 48.38  ? 337 SER B CA    1 
ATOM   4247  C C     . SER B  1 337 ? 177.806 38.997  118.915 1.00 49.01  ? 337 SER B C     1 
ATOM   4248  O O     . SER B  1 337 ? 177.348 38.882  120.061 1.00 49.81  ? 337 SER B O     1 
ATOM   4249  C CB    . SER B  1 337 ? 179.925 40.031  118.368 1.00 38.14  ? 337 SER B CB    1 
ATOM   4250  O OG    . SER B  1 337 ? 180.168 38.649  118.241 1.00 41.01  ? 337 SER B OG    1 
ATOM   4251  N N     . ALA B  1 338 ? 177.830 38.025  118.013 1.00 17.58  ? 338 ALA B N     1 
ATOM   4252  C CA    . ALA B  1 338 ? 177.308 36.712  118.284 1.00 16.79  ? 338 ALA B CA    1 
ATOM   4253  C C     . ALA B  1 338 ? 177.937 36.346  119.632 1.00 16.10  ? 338 ALA B C     1 
ATOM   4254  O O     . ALA B  1 338 ? 177.264 36.189  120.669 1.00 15.71  ? 338 ALA B O     1 
ATOM   4255  C CB    . ALA B  1 338 ? 177.769 35.778  117.175 1.00 25.48  ? 338 ALA B CB    1 
ATOM   4256  N N     . ALA B  1 339 ? 179.254 36.267  119.609 1.00 1.00   ? 339 ALA B N     1 
ATOM   4257  C CA    . ALA B  1 339 ? 179.982 35.937  120.804 1.00 1.00   ? 339 ALA B CA    1 
ATOM   4258  C C     . ALA B  1 339 ? 179.552 36.801  121.990 1.00 1.00   ? 339 ALA B C     1 
ATOM   4259  O O     . ALA B  1 339 ? 179.439 36.329  123.135 1.00 1.00   ? 339 ALA B O     1 
ATOM   4260  C CB    . ALA B  1 339 ? 181.450 36.092  120.556 1.00 9.31   ? 339 ALA B CB    1 
ATOM   4261  N N     . ASP B  1 340 ? 179.321 38.079  121.724 1.00 19.14  ? 340 ASP B N     1 
ATOM   4262  C CA    . ASP B  1 340 ? 178.932 38.947  122.795 1.00 19.46  ? 340 ASP B CA    1 
ATOM   4263  C C     . ASP B  1 340 ? 177.616 38.468  123.328 1.00 18.31  ? 340 ASP B C     1 
ATOM   4264  O O     . ASP B  1 340 ? 177.454 38.312  124.539 1.00 18.12  ? 340 ASP B O     1 
ATOM   4265  C CB    . ASP B  1 340 ? 178.858 40.367  122.298 1.00 59.55  ? 340 ASP B CB    1 
ATOM   4266  C CG    . ASP B  1 340 ? 180.210 40.916  122.010 1.00 63.84  ? 340 ASP B CG    1 
ATOM   4267  O OD1   . ASP B  1 340 ? 180.969 41.137  122.973 1.00 67.37  ? 340 ASP B OD1   1 
ATOM   4268  O OD2   . ASP B  1 340 ? 180.531 41.102  120.826 1.00 67.34  ? 340 ASP B OD2   1 
ATOM   4269  N N     . PHE B  1 341 ? 176.679 38.190  122.436 1.00 23.81  ? 341 PHE B N     1 
ATOM   4270  C CA    . PHE B  1 341 ? 175.397 37.731  122.921 1.00 23.97  ? 341 PHE B CA    1 
ATOM   4271  C C     . PHE B  1 341 ? 175.584 36.573  123.881 1.00 24.56  ? 341 PHE B C     1 
ATOM   4272  O O     . PHE B  1 341 ? 175.013 36.568  124.996 1.00 23.56  ? 341 PHE B O     1 
ATOM   4273  C CB    . PHE B  1 341 ? 174.495 37.306  121.773 1.00 33.73  ? 341 PHE B CB    1 
ATOM   4274  C CG    . PHE B  1 341 ? 173.900 38.450  121.024 1.00 32.56  ? 341 PHE B CG    1 
ATOM   4275  C CD1   . PHE B  1 341 ? 173.766 39.697  121.624 1.00 32.96  ? 341 PHE B CD1   1 
ATOM   4276  C CD2   . PHE B  1 341 ? 173.412 38.273  119.742 1.00 32.76  ? 341 PHE B CD2   1 
ATOM   4277  C CE1   . PHE B  1 341 ? 173.150 40.753  120.959 1.00 32.69  ? 341 PHE B CE1   1 
ATOM   4278  C CE2   . PHE B  1 341 ? 172.798 39.313  119.071 1.00 33.89  ? 341 PHE B CE2   1 
ATOM   4279  C CZ    . PHE B  1 341 ? 172.665 40.560  119.682 1.00 33.11  ? 341 PHE B CZ    1 
ATOM   4280  N N     . GLU B  1 342 ? 176.410 35.611  123.458 1.00 15.51  ? 342 GLU B N     1 
ATOM   4281  C CA    . GLU B  1 342 ? 176.645 34.428  124.264 1.00 15.24  ? 342 GLU B CA    1 
ATOM   4282  C C     . GLU B  1 342 ? 176.802 34.781  125.729 1.00 13.68  ? 342 GLU B C     1 
ATOM   4283  O O     . GLU B  1 342 ? 176.283 34.097  126.630 1.00 12.12  ? 342 GLU B O     1 
ATOM   4284  C CB    . GLU B  1 342 ? 177.879 33.695  123.768 1.00 51.92  ? 342 GLU B CB    1 
ATOM   4285  C CG    . GLU B  1 342 ? 177.658 32.943  122.468 1.00 56.41  ? 342 GLU B CG    1 
ATOM   4286  C CD    . GLU B  1 342 ? 178.901 32.187  121.994 1.00 59.69  ? 342 GLU B CD    1 
ATOM   4287  O OE1   . GLU B  1 342 ? 179.625 31.619  122.851 1.00 59.87  ? 342 GLU B OE1   1 
ATOM   4288  O OE2   . GLU B  1 342 ? 179.138 32.154  120.760 1.00 60.92  ? 342 GLU B OE2   1 
ATOM   4289  N N     . ARG B  1 343 ? 177.484 35.888  125.957 1.00 8.28   ? 343 ARG B N     1 
ATOM   4290  C CA    . ARG B  1 343 ? 177.748 36.315  127.299 1.00 7.94   ? 343 ARG B CA    1 
ATOM   4291  C C     . ARG B  1 343 ? 176.634 37.106  127.944 1.00 9.04   ? 343 ARG B C     1 
ATOM   4292  O O     . ARG B  1 343 ? 176.297 36.882  129.106 1.00 8.32   ? 343 ARG B O     1 
ATOM   4293  C CB    . ARG B  1 343 ? 179.021 37.122  127.299 1.00 26.69  ? 343 ARG B CB    1 
ATOM   4294  C CG    . ARG B  1 343 ? 180.132 36.461  126.545 1.00 30.14  ? 343 ARG B CG    1 
ATOM   4295  C CD    . ARG B  1 343 ? 181.332 37.379  126.523 1.00 34.08  ? 343 ARG B CD    1 
ATOM   4296  N NE    . ARG B  1 343 ? 181.709 37.784  127.878 1.00 35.69  ? 343 ARG B NE    1 
ATOM   4297  C CZ    . ARG B  1 343 ? 182.467 38.837  128.162 1.00 37.18  ? 343 ARG B CZ    1 
ATOM   4298  N NH1   . ARG B  1 343 ? 182.938 39.610  127.172 1.00 39.25  ? 343 ARG B NH1   1 
ATOM   4299  N NH2   . ARG B  1 343 ? 182.740 39.109  129.438 1.00 37.23  ? 343 ARG B NH2   1 
ATOM   4300  N N     . ILE B  1 344 ? 176.064 38.052  127.209 1.00 28.69  ? 344 ILE B N     1 
ATOM   4301  C CA    . ILE B  1 344 ? 175.009 38.868  127.801 1.00 29.63  ? 344 ILE B CA    1 
ATOM   4302  C C     . ILE B  1 344 ? 174.009 37.845  128.216 1.00 28.07  ? 344 ILE B C     1 
ATOM   4303  O O     . ILE B  1 344 ? 173.230 38.063  129.134 1.00 28.36  ? 344 ILE B O     1 
ATOM   4304  C CB    . ILE B  1 344 ? 174.309 39.839  126.781 1.00 35.97  ? 344 ILE B CB    1 
ATOM   4305  C CG1   . ILE B  1 344 ? 175.051 39.876  125.457 1.00 37.22  ? 344 ILE B CG1   1 
ATOM   4306  C CG2   . ILE B  1 344 ? 174.322 41.250  127.305 1.00 34.18  ? 344 ILE B CG2   1 
ATOM   4307  C CD1   . ILE B  1 344 ? 176.339 40.633  125.529 1.00 39.05  ? 344 ILE B CD1   1 
ATOM   4308  N N     . LEU B  1 345 ? 174.080 36.703  127.540 1.00 24.61  ? 345 LEU B N     1 
ATOM   4309  C CA    . LEU B  1 345 ? 173.129 35.638  127.779 1.00 25.00  ? 345 LEU B CA    1 
ATOM   4310  C C     . LEU B  1 345 ? 173.137 34.986  129.167 1.00 26.45  ? 345 LEU B C     1 
ATOM   4311  O O     . LEU B  1 345 ? 172.065 34.666  129.728 1.00 24.99  ? 345 LEU B O     1 
ATOM   4312  C CB    . LEU B  1 345 ? 173.279 34.576  126.689 1.00 16.05  ? 345 LEU B CB    1 
ATOM   4313  C CG    . LEU B  1 345 ? 171.925 34.018  126.231 1.00 13.61  ? 345 LEU B CG    1 
ATOM   4314  C CD1   . LEU B  1 345 ? 170.769 34.911  126.713 1.00 10.91  ? 345 LEU B CD1   1 
ATOM   4315  C CD2   . LEU B  1 345 ? 171.906 33.904  124.700 1.00 13.17  ? 345 LEU B CD2   1 
ATOM   4316  N N     . THR B  1 346 ? 174.343 34.850  129.730 1.00 57.56  ? 346 THR B N     1 
ATOM   4317  C CA    . THR B  1 346 ? 174.556 34.195  131.029 1.00 57.56  ? 346 THR B CA    1 
ATOM   4318  C C     . THR B  1 346 ? 175.380 34.886  132.139 1.00 59.73  ? 346 THR B C     1 
ATOM   4319  O O     . THR B  1 346 ? 175.122 34.666  133.328 1.00 59.80  ? 346 THR B O     1 
ATOM   4320  C CB    . THR B  1 346 ? 175.186 32.809  130.791 1.00 28.61  ? 346 THR B CB    1 
ATOM   4321  O OG1   . THR B  1 346 ? 176.537 32.933  130.324 1.00 25.62  ? 346 THR B OG1   1 
ATOM   4322  C CG2   . THR B  1 346 ? 174.416 32.098  129.718 1.00 30.95  ? 346 THR B CG2   1 
ATOM   4323  N N     . GLU B  1 347 ? 176.365 35.703  131.762 1.00 38.40  ? 347 GLU B N     1 
ATOM   4324  C CA    . GLU B  1 347 ? 177.230 36.367  132.728 1.00 38.63  ? 347 GLU B CA    1 
ATOM   4325  C C     . GLU B  1 347 ? 176.556 37.413  133.626 1.00 39.00  ? 347 GLU B C     1 
ATOM   4326  O O     . GLU B  1 347 ? 176.562 37.300  134.849 1.00 40.48  ? 347 GLU B O     1 
ATOM   4327  C CB    . GLU B  1 347 ? 178.407 37.020  132.000 1.00 31.16  ? 347 GLU B CB    1 
ATOM   4328  C CG    . GLU B  1 347 ? 179.139 36.138  131.006 1.00 35.21  ? 347 GLU B CG    1 
ATOM   4329  C CD    . GLU B  1 347 ? 180.537 36.673  130.611 1.00 38.53  ? 347 GLU B CD    1 
ATOM   4330  O OE1   . GLU B  1 347 ? 181.170 36.055  129.720 1.00 40.23  ? 347 GLU B OE1   1 
ATOM   4331  O OE2   . GLU B  1 347 ? 181.014 37.693  131.184 1.00 39.33  ? 347 GLU B OE2   1 
ATOM   4332  N N     . PRO B  1 348 ? 175.954 38.442  133.017 1.00 23.28  ? 348 PRO B N     1 
ATOM   4333  C CA    . PRO B  1 348 ? 175.266 39.554  133.687 1.00 22.88  ? 348 PRO B CA    1 
ATOM   4334  C C     . PRO B  1 348 ? 174.459 39.178  134.918 1.00 24.43  ? 348 PRO B C     1 
ATOM   4335  O O     . PRO B  1 348 ? 173.759 38.173  134.896 1.00 25.01  ? 348 PRO B O     1 
ATOM   4336  C CB    . PRO B  1 348 ? 174.354 40.078  132.595 1.00 9.68   ? 348 PRO B CB    1 
ATOM   4337  C CG    . PRO B  1 348 ? 175.115 39.741  131.296 1.00 7.60   ? 348 PRO B CG    1 
ATOM   4338  C CD    . PRO B  1 348 ? 175.613 38.387  131.574 1.00 8.02   ? 348 PRO B CD    1 
ATOM   4339  N N     . HIS B  1 349 ? 174.530 39.974  135.985 1.00 27.51  ? 349 HIS B N     1 
ATOM   4340  C CA    . HIS B  1 349 ? 173.717 39.682  137.175 1.00 29.89  ? 349 HIS B CA    1 
ATOM   4341  C C     . HIS B  1 349 ? 172.262 39.704  136.779 1.00 28.56  ? 349 HIS B C     1 
ATOM   4342  O O     . HIS B  1 349 ? 171.734 40.765  136.489 1.00 28.88  ? 349 HIS B O     1 
ATOM   4343  C CB    . HIS B  1 349 ? 173.866 40.730  138.262 1.00 85.90  ? 349 HIS B CB    1 
ATOM   4344  C CG    . HIS B  1 349 ? 175.053 40.527  139.136 1.00 92.59  ? 349 HIS B CG    1 
ATOM   4345  N ND1   . HIS B  1 349 ? 175.125 41.038  140.413 1.00 96.13  ? 349 HIS B ND1   1 
ATOM   4346  C CD2   . HIS B  1 349 ? 176.232 39.904  138.911 1.00 95.90  ? 349 HIS B CD2   1 
ATOM   4347  C CE1   . HIS B  1 349 ? 176.300 40.739  140.938 1.00 97.99  ? 349 HIS B CE1   1 
ATOM   4348  N NE2   . HIS B  1 349 ? 176.991 40.052  140.046 1.00 98.40  ? 349 HIS B NE2   1 
ATOM   4349  N N     . ALA B  1 350 ? 171.622 38.540  136.792 1.00 26.98  ? 350 ALA B N     1 
ATOM   4350  C CA    . ALA B  1 350 ? 170.217 38.387  136.431 1.00 25.51  ? 350 ALA B CA    1 
ATOM   4351  C C     . ALA B  1 350 ? 170.047 38.295  134.929 1.00 24.04  ? 350 ALA B C     1 
ATOM   4352  O O     . ALA B  1 350 ? 169.169 38.947  134.366 1.00 23.69  ? 350 ALA B O     1 
ATOM   4353  C CB    . ALA B  1 350 ? 169.383 39.548  136.990 1.00 25.14  ? 350 ALA B CB    1 
ATOM   4354  N N     . SER B  1 351 ? 170.875 37.474  134.291 1.00 38.34  ? 351 SER B N     1 
ATOM   4355  C CA    . SER B  1 351 ? 170.814 37.322  132.843 1.00 40.43  ? 351 SER B CA    1 
ATOM   4356  C C     . SER B  1 351 ? 169.494 36.727  132.457 1.00 39.39  ? 351 SER B C     1 
ATOM   4357  O O     . SER B  1 351 ? 168.715 36.346  133.322 1.00 39.41  ? 351 SER B O     1 
ATOM   4358  C CB    . SER B  1 351 ? 171.923 36.412  132.333 1.00 99.53  ? 351 SER B CB    1 
ATOM   4359  O OG    . SER B  1 351 ? 171.601 35.060  132.569 1.00 101.29 ? 351 SER B OG    1 
ATOM   4360  N N     . LEU B  1 352 ? 169.229 36.648  131.162 1.00 41.89  ? 352 LEU B N     1 
ATOM   4361  C CA    . LEU B  1 352 ? 167.966 36.071  130.737 1.00 41.83  ? 352 LEU B CA    1 
ATOM   4362  C C     . LEU B  1 352 ? 167.802 34.630  131.272 1.00 42.39  ? 352 LEU B C     1 
ATOM   4363  O O     . LEU B  1 352 ? 166.850 34.333  132.001 1.00 42.76  ? 352 LEU B O     1 
ATOM   4364  C CB    . LEU B  1 352 ? 167.875 36.067  129.208 1.00 17.63  ? 352 LEU B CB    1 
ATOM   4365  C CG    . LEU B  1 352 ? 167.359 37.282  128.456 1.00 15.14  ? 352 LEU B CG    1 
ATOM   4366  C CD1   . LEU B  1 352 ? 167.404 37.068  126.949 1.00 13.34  ? 352 LEU B CD1   1 
ATOM   4367  C CD2   . LEU B  1 352 ? 165.968 37.521  128.899 1.00 14.85  ? 352 LEU B CD2   1 
ATOM   4368  N N     . THR B  1 353 ? 168.723 33.737  130.909 1.00 23.03  ? 353 THR B N     1 
ATOM   4369  C CA    . THR B  1 353 ? 168.619 32.374  131.366 1.00 21.61  ? 353 THR B CA    1 
ATOM   4370  C C     . THR B  1 353 ? 168.515 32.422  132.847 1.00 23.99  ? 353 THR B C     1 
ATOM   4371  O O     . THR B  1 353 ? 167.597 31.863  133.388 1.00 25.33  ? 353 THR B O     1 
ATOM   4372  C CB    . THR B  1 353 ? 169.803 31.554  130.994 1.00 11.28  ? 353 THR B CB    1 
ATOM   4373  O OG1   . THR B  1 353 ? 170.974 32.141  131.565 1.00 10.95  ? 353 THR B OG1   1 
ATOM   4374  C CG2   . THR B  1 353 ? 169.901 31.461  129.486 1.00 8.86   ? 353 THR B CG2   1 
ATOM   4375  N N     . GLU B  1 354 ? 169.426 33.098  133.521 1.00 25.21  ? 354 GLU B N     1 
ATOM   4376  C CA    . GLU B  1 354 ? 169.323 33.178  134.976 1.00 28.70  ? 354 GLU B CA    1 
ATOM   4377  C C     . GLU B  1 354 ? 167.890 33.537  135.409 1.00 27.33  ? 354 GLU B C     1 
ATOM   4378  O O     . GLU B  1 354 ? 167.471 33.223  136.532 1.00 26.28  ? 354 GLU B O     1 
ATOM   4379  C CB    . GLU B  1 354 ? 170.280 34.231  135.534 1.00 136.32 ? 354 GLU B CB    1 
ATOM   4380  C CG    . GLU B  1 354 ? 171.445 33.675  136.344 1.00 143.43 ? 354 GLU B CG    1 
ATOM   4381  C CD    . GLU B  1 354 ? 172.239 34.773  137.037 1.00 148.45 ? 354 GLU B CD    1 
ATOM   4382  O OE1   . GLU B  1 354 ? 171.672 35.439  137.934 1.00 150.29 ? 354 GLU B OE1   1 
ATOM   4383  O OE2   . GLU B  1 354 ? 173.424 34.971  136.683 1.00 148.78 ? 354 GLU B OE2   1 
ATOM   4384  N N     . GLN B  1 355 ? 167.148 34.191  134.513 1.00 30.36  ? 355 GLN B N     1 
ATOM   4385  C CA    . GLN B  1 355 ? 165.770 34.593  134.789 1.00 30.81  ? 355 GLN B CA    1 
ATOM   4386  C C     . GLN B  1 355 ? 164.780 33.487  134.521 1.00 31.21  ? 355 GLN B C     1 
ATOM   4387  O O     . GLN B  1 355 ? 163.966 33.157  135.374 1.00 30.84  ? 355 GLN B O     1 
ATOM   4388  C CB    . GLN B  1 355 ? 165.372 35.794  133.945 1.00 48.38  ? 355 GLN B CB    1 
ATOM   4389  C CG    . GLN B  1 355 ? 166.070 37.053  134.325 1.00 50.78  ? 355 GLN B CG    1 
ATOM   4390  C CD    . GLN B  1 355 ? 165.443 38.231  133.680 1.00 50.95  ? 355 GLN B CD    1 
ATOM   4391  O OE1   . GLN B  1 355 ? 164.365 38.674  134.071 1.00 51.61  ? 355 GLN B OE1   1 
ATOM   4392  N NE2   . GLN B  1 355 ? 166.095 38.742  132.668 1.00 51.68  ? 355 GLN B NE2   1 
ATOM   4393  N N     . TYR B  1 356 ? 164.813 32.919  133.329 1.00 37.32  ? 356 TYR B N     1 
ATOM   4394  C CA    . TYR B  1 356 ? 163.883 31.848  133.068 1.00 38.74  ? 356 TYR B CA    1 
ATOM   4395  C C     . TYR B  1 356 ? 164.064 30.749  134.102 1.00 39.00  ? 356 TYR B C     1 
ATOM   4396  O O     . TYR B  1 356 ? 163.088 30.337  134.730 1.00 38.29  ? 356 TYR B O     1 
ATOM   4397  C CB    . TYR B  1 356 ? 164.065 31.322  131.658 1.00 36.55  ? 356 TYR B CB    1 
ATOM   4398  C CG    . TYR B  1 356 ? 163.378 32.213  130.668 1.00 36.31  ? 356 TYR B CG    1 
ATOM   4399  C CD1   . TYR B  1 356 ? 164.099 32.901  129.695 1.00 36.22  ? 356 TYR B CD1   1 
ATOM   4400  C CD2   . TYR B  1 356 ? 161.998 32.396  130.721 1.00 36.18  ? 356 TYR B CD2   1 
ATOM   4401  C CE1   . TYR B  1 356 ? 163.454 33.750  128.799 1.00 37.29  ? 356 TYR B CE1   1 
ATOM   4402  C CE2   . TYR B  1 356 ? 161.352 33.242  129.834 1.00 36.85  ? 356 TYR B CE2   1 
ATOM   4403  C CZ    . TYR B  1 356 ? 162.085 33.910  128.882 1.00 36.35  ? 356 TYR B CZ    1 
ATOM   4404  O OH    . TYR B  1 356 ? 161.447 34.743  128.016 1.00 35.39  ? 356 TYR B OH    1 
ATOM   4405  N N     . LYS B  1 357 ? 165.301 30.287  134.292 1.00 50.34  ? 357 LYS B N     1 
ATOM   4406  C CA    . LYS B  1 357 ? 165.561 29.265  135.293 1.00 51.22  ? 357 LYS B CA    1 
ATOM   4407  C C     . LYS B  1 357 ? 164.734 29.674  136.495 1.00 49.31  ? 357 LYS B C     1 
ATOM   4408  O O     . LYS B  1 357 ? 163.799 28.978  136.872 1.00 49.81  ? 357 LYS B O     1 
ATOM   4409  C CB    . LYS B  1 357 ? 167.046 29.208  135.669 1.00 145.72 ? 357 LYS B CB    1 
ATOM   4410  C CG    . LYS B  1 357 ? 167.827 28.103  134.957 1.00 150.78 ? 357 LYS B CG    1 
ATOM   4411  C CD    . LYS B  1 357 ? 169.227 27.910  135.553 1.00 154.52 ? 357 LYS B CD    1 
ATOM   4412  C CE    . LYS B  1 357 ? 169.941 26.646  135.019 1.00 158.32 ? 357 LYS B CE    1 
ATOM   4413  N NZ    . LYS B  1 357 ? 170.465 26.728  133.616 1.00 157.72 ? 357 LYS B NZ    1 
ATOM   4414  N N     . ALA B  1 358 ? 165.047 30.827  137.067 1.00 35.84  ? 358 ALA B N     1 
ATOM   4415  C CA    . ALA B  1 358 ? 164.306 31.338  138.222 1.00 34.93  ? 358 ALA B CA    1 
ATOM   4416  C C     . ALA B  1 358 ? 162.774 31.379  138.062 1.00 33.65  ? 358 ALA B C     1 
ATOM   4417  O O     . ALA B  1 358 ? 162.042 31.220  139.049 1.00 33.93  ? 358 ALA B O     1 
ATOM   4418  C CB    . ALA B  1 358 ? 164.811 32.723  138.577 1.00 120.72 ? 358 ALA B CB    1 
ATOM   4419  N N     . LEU B  1 359 ? 162.292 31.594  136.835 1.00 23.12  ? 359 LEU B N     1 
ATOM   4420  C CA    . LEU B  1 359 ? 160.850 31.661  136.578 1.00 21.79  ? 359 LEU B CA    1 
ATOM   4421  C C     . LEU B  1 359 ? 160.188 30.296  136.492 1.00 20.97  ? 359 LEU B C     1 
ATOM   4422  O O     . LEU B  1 359 ? 159.139 30.071  137.088 1.00 20.35  ? 359 LEU B O     1 
ATOM   4423  C CB    . LEU B  1 359 ? 160.544 32.454  135.299 1.00 23.10  ? 359 LEU B CB    1 
ATOM   4424  C CG    . LEU B  1 359 ? 160.207 33.957  135.408 1.00 21.28  ? 359 LEU B CG    1 
ATOM   4425  C CD1   . LEU B  1 359 ? 159.121 34.249  136.441 1.00 18.88  ? 359 LEU B CD1   1 
ATOM   4426  C CD2   . LEU B  1 359 ? 161.444 34.700  135.802 1.00 23.32  ? 359 LEU B CD2   1 
ATOM   4427  N N     . MET B  1 360 ? 160.787 29.392  135.737 1.00 20.66  ? 360 MET B N     1 
ATOM   4428  C CA    . MET B  1 360 ? 160.237 28.059  135.639 1.00 22.79  ? 360 MET B CA    1 
ATOM   4429  C C     . MET B  1 360 ? 160.377 27.348  136.985 1.00 23.97  ? 360 MET B C     1 
ATOM   4430  O O     . MET B  1 360 ? 159.615 26.434  137.298 1.00 23.76  ? 360 MET B O     1 
ATOM   4431  C CB    . MET B  1 360 ? 160.952 27.273  134.552 1.00 33.16  ? 360 MET B CB    1 
ATOM   4432  C CG    . MET B  1 360 ? 160.852 27.918  133.206 1.00 33.42  ? 360 MET B CG    1 
ATOM   4433  S SD    . MET B  1 360 ? 159.160 28.046  132.682 1.00 36.54  ? 360 MET B SD    1 
ATOM   4434  C CE    . MET B  1 360 ? 158.599 29.482  133.661 1.00 32.15  ? 360 MET B CE    1 
ATOM   4435  N N     . ALA B  1 361 ? 161.360 27.770  137.773 1.00 52.39  ? 361 ALA B N     1 
ATOM   4436  C CA    . ALA B  1 361 ? 161.588 27.204  139.095 1.00 53.68  ? 361 ALA B CA    1 
ATOM   4437  C C     . ALA B  1 361 ? 160.271 27.210  139.847 1.00 54.57  ? 361 ALA B C     1 
ATOM   4438  O O     . ALA B  1 361 ? 159.817 26.180  140.342 1.00 55.96  ? 361 ALA B O     1 
ATOM   4439  C CB    . ALA B  1 361 ? 162.577 28.043  139.831 1.00 69.52  ? 361 ALA B CB    1 
ATOM   4440  N N     . THR B  1 362 ? 159.671 28.394  139.923 1.00 26.67  ? 362 THR B N     1 
ATOM   4441  C CA    . THR B  1 362 ? 158.389 28.610  140.589 1.00 28.87  ? 362 THR B CA    1 
ATOM   4442  C C     . THR B  1 362 ? 157.257 27.634  140.218 1.00 28.76  ? 362 THR B C     1 
ATOM   4443  O O     . THR B  1 362 ? 156.412 27.319  141.048 1.00 27.28  ? 362 THR B O     1 
ATOM   4444  C CB    . THR B  1 362 ? 157.869 30.006  140.295 1.00 85.98  ? 362 THR B CB    1 
ATOM   4445  O OG1   . THR B  1 362 ? 158.968 30.865  139.965 1.00 87.66  ? 362 THR B OG1   1 
ATOM   4446  C CG2   . THR B  1 362 ? 157.128 30.541  141.499 1.00 86.97  ? 362 THR B CG2   1 
ATOM   4447  N N     . GLU B  1 363 ? 157.203 27.200  138.967 1.00 107.51 ? 363 GLU B N     1 
ATOM   4448  C CA    . GLU B  1 363 ? 156.155 26.271  138.568 1.00 110.63 ? 363 GLU B CA    1 
ATOM   4449  C C     . GLU B  1 363 ? 156.628 24.880  138.915 1.00 111.40 ? 363 GLU B C     1 
ATOM   4450  O O     . GLU B  1 363 ? 155.963 23.890  138.620 1.00 113.17 ? 363 GLU B O     1 
ATOM   4451  C CB    . GLU B  1 363 ? 155.879 26.368  137.070 1.00 83.09  ? 363 GLU B CB    1 
ATOM   4452  C CG    . GLU B  1 363 ? 155.277 27.696  136.651 1.00 84.13  ? 363 GLU B CG    1 
ATOM   4453  C CD    . GLU B  1 363 ? 153.784 27.751  136.852 1.00 83.89  ? 363 GLU B CD    1 
ATOM   4454  O OE1   . GLU B  1 363 ? 153.274 27.078  137.774 1.00 83.12  ? 363 GLU B OE1   1 
ATOM   4455  O OE2   . GLU B  1 363 ? 153.127 28.480  136.084 1.00 83.59  ? 363 GLU B OE2   1 
ATOM   4456  N N     . GLY B  1 364 ? 157.793 24.815  139.545 1.00 54.44  ? 364 GLY B N     1 
ATOM   4457  C CA    . GLY B  1 364 ? 158.335 23.536  139.930 1.00 53.17  ? 364 GLY B CA    1 
ATOM   4458  C C     . GLY B  1 364 ? 159.220 22.900  138.880 1.00 53.41  ? 364 GLY B C     1 
ATOM   4459  O O     . GLY B  1 364 ? 159.824 21.863  139.143 1.00 55.68  ? 364 GLY B O     1 
ATOM   4460  N N     . VAL B  1 365 ? 159.315 23.480  137.690 1.00 38.37  ? 365 VAL B N     1 
ATOM   4461  C CA    . VAL B  1 365 ? 160.177 22.873  136.685 1.00 38.28  ? 365 VAL B CA    1 
ATOM   4462  C C     . VAL B  1 365 ? 161.604 23.308  136.872 1.00 39.59  ? 365 VAL B C     1 
ATOM   4463  O O     . VAL B  1 365 ? 161.878 24.497  137.109 1.00 40.21  ? 365 VAL B O     1 
ATOM   4464  C CB    . VAL B  1 365 ? 159.782 23.241  135.263 1.00 34.77  ? 365 VAL B CB    1 
ATOM   4465  C CG1   . VAL B  1 365 ? 160.747 22.603  134.284 1.00 32.52  ? 365 VAL B CG1   1 
ATOM   4466  C CG2   . VAL B  1 365 ? 158.377 22.752  134.981 1.00 35.48  ? 365 VAL B CG2   1 
ATOM   4467  N N     . ASN B  1 366 ? 162.515 22.340  136.786 1.00 64.27  ? 366 ASN B N     1 
ATOM   4468  C CA    . ASN B  1 366 ? 163.938 22.628  136.907 1.00 65.07  ? 366 ASN B CA    1 
ATOM   4469  C C     . ASN B  1 366 ? 164.484 22.611  135.493 1.00 63.87  ? 366 ASN B C     1 
ATOM   4470  O O     . ASN B  1 366 ? 164.445 21.585  134.791 1.00 62.47  ? 366 ASN B O     1 
ATOM   4471  C CB    . ASN B  1 366 ? 164.646 21.589  137.765 1.00 144.10 ? 366 ASN B CB    1 
ATOM   4472  C CG    . ASN B  1 366 ? 166.107 21.916  137.970 1.00 146.94 ? 366 ASN B CG    1 
ATOM   4473  O OD1   . ASN B  1 366 ? 166.944 21.619  137.122 1.00 148.82 ? 366 ASN B OD1   1 
ATOM   4474  N ND2   . ASN B  1 366 ? 166.421 22.549  139.094 1.00 148.31 ? 366 ASN B ND2   1 
ATOM   4475  N N     . ILE B  1 367 ? 164.982 23.770  135.082 1.00 54.02  ? 367 ILE B N     1 
ATOM   4476  C CA    . ILE B  1 367 ? 165.492 23.939  133.740 1.00 52.20  ? 367 ILE B CA    1 
ATOM   4477  C C     . ILE B  1 367 ? 167.005 24.178  133.693 1.00 49.87  ? 367 ILE B C     1 
ATOM   4478  O O     . ILE B  1 367 ? 167.612 24.632  134.663 1.00 49.07  ? 367 ILE B O     1 
ATOM   4479  C CB    . ILE B  1 367 ? 164.726 25.081  133.093 1.00 58.17  ? 367 ILE B CB    1 
ATOM   4480  C CG1   . ILE B  1 367 ? 165.296 25.394  131.720 1.00 59.74  ? 367 ILE B CG1   1 
ATOM   4481  C CG2   . ILE B  1 367 ? 164.715 26.259  134.037 1.00 56.47  ? 367 ILE B CG2   1 
ATOM   4482  C CD1   . ILE B  1 367 ? 164.503 26.442  130.986 1.00 62.72  ? 367 ILE B CD1   1 
ATOM   4483  N N     . ALA B  1 368 ? 167.618 23.854  132.565 1.00 18.47  ? 368 ALA B N     1 
ATOM   4484  C CA    . ALA B  1 368 ? 169.048 24.021  132.426 1.00 17.66  ? 368 ALA B CA    1 
ATOM   4485  C C     . ALA B  1 368 ? 169.396 24.202  130.955 1.00 17.12  ? 368 ALA B C     1 
ATOM   4486  O O     . ALA B  1 368 ? 168.902 23.456  130.061 1.00 15.81  ? 368 ALA B O     1 
ATOM   4487  C CB    . ALA B  1 368 ? 169.777 22.799  132.990 1.00 117.05 ? 368 ALA B CB    1 
ATOM   4488  N N     . PHE B  1 369 ? 170.251 25.203  130.718 1.00 42.81  ? 369 PHE B N     1 
ATOM   4489  C CA    . PHE B  1 369 ? 170.703 25.514  129.370 1.00 42.01  ? 369 PHE B CA    1 
ATOM   4490  C C     . PHE B  1 369 ? 172.117 24.994  129.149 1.00 43.02  ? 369 PHE B C     1 
ATOM   4491  O O     . PHE B  1 369 ? 173.009 25.254  129.951 1.00 43.07  ? 369 PHE B O     1 
ATOM   4492  C CB    . PHE B  1 369 ? 170.686 27.030  129.106 1.00 16.08  ? 369 PHE B CB    1 
ATOM   4493  C CG    . PHE B  1 369 ? 169.313 27.671  129.180 1.00 12.07  ? 369 PHE B CG    1 
ATOM   4494  C CD1   . PHE B  1 369 ? 168.870 28.256  130.365 1.00 10.68  ? 369 PHE B CD1   1 
ATOM   4495  C CD2   . PHE B  1 369 ? 168.481 27.714  128.068 1.00 9.50   ? 369 PHE B CD2   1 
ATOM   4496  C CE1   . PHE B  1 369 ? 167.632 28.870  130.442 1.00 9.29   ? 369 PHE B CE1   1 
ATOM   4497  C CE2   . PHE B  1 369 ? 167.235 28.331  128.137 1.00 7.65   ? 369 PHE B CE2   1 
ATOM   4498  C CZ    . PHE B  1 369 ? 166.813 28.907  129.324 1.00 8.44   ? 369 PHE B CZ    1 
ATOM   4499  N N     . THR B  1 370 ? 172.310 24.253  128.063 1.00 19.87  ? 370 THR B N     1 
ATOM   4500  C CA    . THR B  1 370 ? 173.623 23.735  127.751 1.00 22.16  ? 370 THR B CA    1 
ATOM   4501  C C     . THR B  1 370 ? 174.340 24.770  126.933 1.00 23.34  ? 370 THR B C     1 
ATOM   4502  O O     . THR B  1 370 ? 173.730 25.484  126.148 1.00 21.94  ? 370 THR B O     1 
ATOM   4503  C CB    . THR B  1 370 ? 173.582 22.431  126.934 1.00 36.43  ? 370 THR B CB    1 
ATOM   4504  O OG1   . THR B  1 370 ? 173.804 22.681  125.526 1.00 37.24  ? 370 THR B OG1   1 
ATOM   4505  C CG2   . THR B  1 370 ? 172.260 21.789  127.150 1.00 38.02  ? 370 THR B CG2   1 
ATOM   4506  N N     . THR B  1 371 ? 175.651 24.838  127.145 1.00 31.93  ? 371 THR B N     1 
ATOM   4507  C CA    . THR B  1 371 ? 176.532 25.758  126.454 1.00 32.51  ? 371 THR B CA    1 
ATOM   4508  C C     . THR B  1 371 ? 176.073 25.850  125.015 1.00 31.24  ? 371 THR B C     1 
ATOM   4509  O O     . THR B  1 371 ? 175.621 26.888  124.562 1.00 32.15  ? 371 THR B O     1 
ATOM   4510  C CB    . THR B  1 371 ? 177.967 25.237  126.499 1.00 92.43  ? 371 THR B CB    1 
ATOM   4511  O OG1   . THR B  1 371 ? 178.239 24.707  127.802 1.00 95.33  ? 371 THR B OG1   1 
ATOM   4512  C CG2   . THR B  1 371 ? 178.934 26.352  126.216 1.00 93.95  ? 371 THR B CG2   1 
ATOM   4513  N N     . ASP B  1 372 ? 176.157 24.739  124.312 1.00 36.09  ? 372 ASP B N     1 
ATOM   4514  C CA    . ASP B  1 372 ? 175.774 24.709  122.927 1.00 38.12  ? 372 ASP B CA    1 
ATOM   4515  C C     . ASP B  1 372 ? 174.402 25.293  122.724 1.00 35.62  ? 372 ASP B C     1 
ATOM   4516  O O     . ASP B  1 372 ? 174.070 25.743  121.635 1.00 36.17  ? 372 ASP B O     1 
ATOM   4517  C CB    . ASP B  1 372 ? 175.825 23.285  122.404 1.00 168.07 ? 372 ASP B CB    1 
ATOM   4518  C CG    . ASP B  1 372 ? 177.233 22.752  122.340 1.00 175.61 ? 372 ASP B CG    1 
ATOM   4519  O OD1   . ASP B  1 372 ? 178.073 23.351  121.632 1.00 175.67 ? 372 ASP B OD1   1 
ATOM   4520  O OD2   . ASP B  1 372 ? 177.502 21.737  123.008 1.00 179.99 ? 372 ASP B OD2   1 
ATOM   4521  N N     . ALA B  1 373 ? 173.588 25.299  123.761 1.00 27.05  ? 373 ALA B N     1 
ATOM   4522  C CA    . ALA B  1 373 ? 172.257 25.866  123.602 1.00 23.74  ? 373 ALA B CA    1 
ATOM   4523  C C     . ALA B  1 373 ? 172.381 27.393  123.542 1.00 21.24  ? 373 ALA B C     1 
ATOM   4524  O O     . ALA B  1 373 ? 171.837 28.044  122.651 1.00 20.97  ? 373 ALA B O     1 
ATOM   4525  C CB    . ALA B  1 373 ? 171.363 25.439  124.762 1.00 70.03  ? 373 ALA B CB    1 
ATOM   4526  N N     . VAL B  1 374 ? 173.112 27.963  124.494 1.00 10.45  ? 374 VAL B N     1 
ATOM   4527  C CA    . VAL B  1 374 ? 173.317 29.402  124.539 1.00 5.71   ? 374 VAL B CA    1 
ATOM   4528  C C     . VAL B  1 374 ? 173.983 29.737  123.254 1.00 4.44   ? 374 VAL B C     1 
ATOM   4529  O O     . VAL B  1 374 ? 173.478 30.494  122.465 1.00 4.23   ? 374 VAL B O     1 
ATOM   4530  C CB    . VAL B  1 374 ? 174.246 29.806  125.650 1.00 2.92   ? 374 VAL B CB    1 
ATOM   4531  C CG1   . VAL B  1 374 ? 174.483 31.275  125.571 1.00 3.18   ? 374 VAL B CG1   1 
ATOM   4532  C CG2   . VAL B  1 374 ? 173.633 29.462  126.998 1.00 1.00   ? 374 VAL B CG2   1 
ATOM   4533  N N     . LYS B  1 375 ? 175.136 29.155  123.034 1.00 7.10   ? 375 LYS B N     1 
ATOM   4534  C CA    . LYS B  1 375 ? 175.802 29.401  121.779 1.00 10.79  ? 375 LYS B CA    1 
ATOM   4535  C C     . LYS B  1 375 ? 174.770 29.412  120.624 1.00 10.70  ? 375 LYS B C     1 
ATOM   4536  O O     . LYS B  1 375 ? 174.800 30.266  119.773 1.00 10.38  ? 375 LYS B O     1 
ATOM   4537  C CB    . LYS B  1 375 ? 176.884 28.337  121.553 1.00 30.98  ? 375 LYS B CB    1 
ATOM   4538  C CG    . LYS B  1 375 ? 178.000 28.746  120.623 1.00 35.35  ? 375 LYS B CG    1 
ATOM   4539  C CD    . LYS B  1 375 ? 179.299 28.036  120.999 1.00 39.06  ? 375 LYS B CD    1 
ATOM   4540  C CE    . LYS B  1 375 ? 180.486 28.442  120.087 1.00 42.40  ? 375 LYS B CE    1 
ATOM   4541  N NZ    . LYS B  1 375 ? 180.220 28.387  118.582 1.00 42.33  ? 375 LYS B NZ    1 
ATOM   4542  N N     . LYS B  1 376 ? 173.826 28.495  120.617 1.00 8.28   ? 376 LYS B N     1 
ATOM   4543  C CA    . LYS B  1 376 ? 172.843 28.454  119.544 1.00 9.37   ? 376 LYS B CA    1 
ATOM   4544  C C     . LYS B  1 376 ? 171.833 29.605  119.628 1.00 8.20   ? 376 LYS B C     1 
ATOM   4545  O O     . LYS B  1 376 ? 171.544 30.254  118.616 1.00 7.55   ? 376 LYS B O     1 
ATOM   4546  C CB    . LYS B  1 376 ? 172.101 27.119  119.577 1.00 9.70   ? 376 LYS B CB    1 
ATOM   4547  C CG    . LYS B  1 376 ? 171.166 26.895  118.415 1.00 12.86  ? 376 LYS B CG    1 
ATOM   4548  C CD    . LYS B  1 376 ? 171.932 26.418  117.190 1.00 16.17  ? 376 LYS B CD    1 
ATOM   4549  C CE    . LYS B  1 376 ? 170.970 26.073  116.046 1.00 19.89  ? 376 LYS B CE    1 
ATOM   4550  N NZ    . LYS B  1 376 ? 171.714 25.668  114.820 1.00 21.23  ? 376 LYS B NZ    1 
ATOM   4551  N N     . ILE B  1 377 ? 171.279 29.831  120.822 1.00 17.58  ? 377 ILE B N     1 
ATOM   4552  C CA    . ILE B  1 377 ? 170.311 30.914  121.061 1.00 16.77  ? 377 ILE B CA    1 
ATOM   4553  C C     . ILE B  1 377 ? 170.871 32.237  120.530 1.00 17.32  ? 377 ILE B C     1 
ATOM   4554  O O     . ILE B  1 377 ? 170.220 32.968  119.798 1.00 15.92  ? 377 ILE B O     1 
ATOM   4555  C CB    . ILE B  1 377 ? 170.042 31.070  122.584 1.00 20.28  ? 377 ILE B CB    1 
ATOM   4556  C CG1   . ILE B  1 377 ? 169.219 29.887  123.057 1.00 20.67  ? 377 ILE B CG1   1 
ATOM   4557  C CG2   . ILE B  1 377 ? 169.360 32.408  122.906 1.00 17.28  ? 377 ILE B CG2   1 
ATOM   4558  C CD1   . ILE B  1 377 ? 168.591 30.105  124.403 1.00 23.84  ? 377 ILE B CD1   1 
ATOM   4559  N N     . ALA B  1 378 ? 172.110 32.507  120.922 1.00 10.93  ? 378 ALA B N     1 
ATOM   4560  C CA    . ALA B  1 378 ? 172.834 33.697  120.549 1.00 9.67   ? 378 ALA B CA    1 
ATOM   4561  C C     . ALA B  1 378 ? 173.012 33.743  119.061 1.00 10.13  ? 378 ALA B C     1 
ATOM   4562  O O     . ALA B  1 378 ? 172.460 34.584  118.371 1.00 10.74  ? 378 ALA B O     1 
ATOM   4563  C CB    . ALA B  1 378 ? 174.182 33.686  121.221 1.00 16.86  ? 378 ALA B CB    1 
ATOM   4564  N N     . GLU B  1 379 ? 173.806 32.829  118.558 1.00 16.74  ? 379 GLU B N     1 
ATOM   4565  C CA    . GLU B  1 379 ? 174.036 32.802  117.135 1.00 20.70  ? 379 GLU B CA    1 
ATOM   4566  C C     . GLU B  1 379 ? 172.704 33.077  116.462 1.00 19.61  ? 379 GLU B C     1 
ATOM   4567  O O     . GLU B  1 379 ? 172.654 33.675  115.390 1.00 19.84  ? 379 GLU B O     1 
ATOM   4568  C CB    . GLU B  1 379 ? 174.596 31.435  116.693 1.00 96.14  ? 379 GLU B CB    1 
ATOM   4569  C CG    . GLU B  1 379 ? 176.009 31.488  116.064 1.00 105.10 ? 379 GLU B CG    1 
ATOM   4570  C CD    . GLU B  1 379 ? 177.097 30.807  116.912 1.00 110.71 ? 379 GLU B CD    1 
ATOM   4571  O OE1   . GLU B  1 379 ? 177.079 29.562  117.046 1.00 112.90 ? 379 GLU B OE1   1 
ATOM   4572  O OE2   . GLU B  1 379 ? 177.977 31.518  117.446 1.00 109.59 ? 379 GLU B OE2   1 
ATOM   4573  N N     . ALA B  1 380 ? 171.616 32.675  117.110 1.00 9.59   ? 380 ALA B N     1 
ATOM   4574  C CA    . ALA B  1 380 ? 170.296 32.865  116.526 1.00 7.78   ? 380 ALA B CA    1 
ATOM   4575  C C     . ALA B  1 380 ? 169.834 34.299  116.531 1.00 7.69   ? 380 ALA B C     1 
ATOM   4576  O O     . ALA B  1 380 ? 169.370 34.777  115.509 1.00 8.34   ? 380 ALA B O     1 
ATOM   4577  C CB    . ALA B  1 380 ? 169.299 32.012  117.224 1.00 6.59   ? 380 ALA B CB    1 
ATOM   4578  N N     . ALA B  1 381 ? 169.950 34.980  117.674 1.00 11.71  ? 381 ALA B N     1 
ATOM   4579  C CA    . ALA B  1 381 ? 169.539 36.386  117.782 1.00 11.36  ? 381 ALA B CA    1 
ATOM   4580  C C     . ALA B  1 381 ? 170.359 37.135  116.773 1.00 12.27  ? 381 ALA B C     1 
ATOM   4581  O O     . ALA B  1 381 ? 169.815 37.787  115.884 1.00 12.24  ? 381 ALA B O     1 
ATOM   4582  C CB    . ALA B  1 381 ? 169.814 36.946  119.165 1.00 1.00   ? 381 ALA B CB    1 
ATOM   4583  N N     . PHE B  1 382 ? 171.679 37.029  116.903 1.00 12.13  ? 382 PHE B N     1 
ATOM   4584  C CA    . PHE B  1 382 ? 172.565 37.705  115.969 1.00 15.94  ? 382 PHE B CA    1 
ATOM   4585  C C     . PHE B  1 382 ? 172.086 37.430  114.551 1.00 18.09  ? 382 PHE B C     1 
ATOM   4586  O O     . PHE B  1 382 ? 171.763 38.352  113.803 1.00 19.97  ? 382 PHE B O     1 
ATOM   4587  C CB    . PHE B  1 382 ? 173.998 37.222  116.163 1.00 36.77  ? 382 PHE B CB    1 
ATOM   4588  C CG    . PHE B  1 382 ? 175.002 37.878  115.243 1.00 40.26  ? 382 PHE B CG    1 
ATOM   4589  C CD1   . PHE B  1 382 ? 176.220 38.323  115.741 1.00 42.31  ? 382 PHE B CD1   1 
ATOM   4590  C CD2   . PHE B  1 382 ? 174.780 37.967  113.874 1.00 40.85  ? 382 PHE B CD2   1 
ATOM   4591  C CE1   . PHE B  1 382 ? 177.198 38.834  114.899 1.00 43.50  ? 382 PHE B CE1   1 
ATOM   4592  C CE2   . PHE B  1 382 ? 175.756 38.475  113.022 1.00 42.00  ? 382 PHE B CE2   1 
ATOM   4593  C CZ    . PHE B  1 382 ? 176.964 38.906  113.536 1.00 43.56  ? 382 PHE B CZ    1 
ATOM   4594  N N     . ARG B  1 383 ? 172.031 36.153  114.196 1.00 18.82  ? 383 ARG B N     1 
ATOM   4595  C CA    . ARG B  1 383 ? 171.584 35.728  112.884 1.00 21.39  ? 383 ARG B CA    1 
ATOM   4596  C C     . ARG B  1 383 ? 170.486 36.657  112.353 1.00 18.68  ? 383 ARG B C     1 
ATOM   4597  O O     . ARG B  1 383 ? 170.681 37.320  111.336 1.00 17.62  ? 383 ARG B O     1 
ATOM   4598  C CB    . ARG B  1 383 ? 171.063 34.288  112.963 1.00 134.19 ? 383 ARG B CB    1 
ATOM   4599  C CG    . ARG B  1 383 ? 170.604 33.694  111.641 1.00 144.68 ? 383 ARG B CG    1 
ATOM   4600  C CD    . ARG B  1 383 ? 171.760 33.452  110.688 1.00 151.25 ? 383 ARG B CD    1 
ATOM   4601  N NE    . ARG B  1 383 ? 171.300 32.918  109.406 1.00 157.69 ? 383 ARG B NE    1 
ATOM   4602  C CZ    . ARG B  1 383 ? 172.107 32.477  108.447 1.00 160.59 ? 383 ARG B CZ    1 
ATOM   4603  N NH1   . ARG B  1 383 ? 173.422 32.502  108.619 1.00 161.87 ? 383 ARG B NH1   1 
ATOM   4604  N NH2   . ARG B  1 383 ? 171.601 32.013  107.313 1.00 161.30 ? 383 ARG B NH2   1 
ATOM   4605  N N     . VAL B  1 384 ? 169.342 36.715  113.034 1.00 16.35  ? 384 VAL B N     1 
ATOM   4606  C CA    . VAL B  1 384 ? 168.245 37.552  112.557 1.00 16.29  ? 384 VAL B CA    1 
ATOM   4607  C C     . VAL B  1 384 ? 168.625 39.038  112.483 1.00 17.54  ? 384 VAL B C     1 
ATOM   4608  O O     . VAL B  1 384 ? 168.433 39.683  111.450 1.00 17.90  ? 384 VAL B O     1 
ATOM   4609  C CB    . VAL B  1 384 ? 166.963 37.354  113.419 1.00 16.14  ? 384 VAL B CB    1 
ATOM   4610  C CG1   . VAL B  1 384 ? 167.339 37.123  114.833 1.00 16.16  ? 384 VAL B CG1   1 
ATOM   4611  C CG2   . VAL B  1 384 ? 166.082 38.582  113.360 1.00 16.84  ? 384 VAL B CG2   1 
ATOM   4612  N N     . ASN B  1 385 ? 169.154 39.586  113.570 1.00 41.26  ? 385 ASN B N     1 
ATOM   4613  C CA    . ASN B  1 385 ? 169.553 40.980  113.554 1.00 41.39  ? 385 ASN B CA    1 
ATOM   4614  C C     . ASN B  1 385 ? 170.238 41.308  112.236 1.00 42.72  ? 385 ASN B C     1 
ATOM   4615  O O     . ASN B  1 385 ? 169.879 42.274  111.578 1.00 43.96  ? 385 ASN B O     1 
ATOM   4616  C CB    . ASN B  1 385 ? 170.488 41.268  114.720 1.00 37.20  ? 385 ASN B CB    1 
ATOM   4617  C CG    . ASN B  1 385 ? 169.758 41.803  115.898 1.00 36.55  ? 385 ASN B CG    1 
ATOM   4618  O OD1   . ASN B  1 385 ? 168.564 41.568  116.034 1.00 38.82  ? 385 ASN B OD1   1 
ATOM   4619  N ND2   . ASN B  1 385 ? 170.455 42.521  116.764 1.00 36.54  ? 385 ASN B ND2   1 
ATOM   4620  N N     . GLU B  1 386 ? 171.216 40.505  111.836 1.00 12.64  ? 386 GLU B N     1 
ATOM   4621  C CA    . GLU B  1 386 ? 171.878 40.787  110.585 1.00 16.10  ? 386 GLU B CA    1 
ATOM   4622  C C     . GLU B  1 386 ? 170.906 40.743  109.413 1.00 17.06  ? 386 GLU B C     1 
ATOM   4623  O O     . GLU B  1 386 ? 170.896 41.636  108.571 1.00 17.47  ? 386 GLU B O     1 
ATOM   4624  C CB    . GLU B  1 386 ? 173.004 39.806  110.312 1.00 99.30  ? 386 GLU B CB    1 
ATOM   4625  C CG    . GLU B  1 386 ? 173.471 39.882  108.864 1.00 107.00 ? 386 GLU B CG    1 
ATOM   4626  C CD    . GLU B  1 386 ? 174.736 39.097  108.601 1.00 112.49 ? 386 GLU B CD    1 
ATOM   4627  O OE1   . GLU B  1 386 ? 175.805 39.514  109.092 1.00 114.33 ? 386 GLU B OE1   1 
ATOM   4628  O OE2   . GLU B  1 386 ? 174.665 38.064  107.901 1.00 115.37 ? 386 GLU B OE2   1 
ATOM   4629  N N     . LYS B  1 387 ? 170.074 39.711  109.362 1.00 26.36  ? 387 LYS B N     1 
ATOM   4630  C CA    . LYS B  1 387 ? 169.140 39.540  108.253 1.00 26.33  ? 387 LYS B CA    1 
ATOM   4631  C C     . LYS B  1 387 ? 167.996 40.540  108.151 1.00 24.58  ? 387 LYS B C     1 
ATOM   4632  O O     . LYS B  1 387 ? 167.461 40.737  107.081 1.00 24.17  ? 387 LYS B O     1 
ATOM   4633  C CB    . LYS B  1 387 ? 168.577 38.116  108.285 1.00 85.39  ? 387 LYS B CB    1 
ATOM   4634  C CG    . LYS B  1 387 ? 169.655 37.028  108.326 1.00 89.75  ? 387 LYS B CG    1 
ATOM   4635  C CD    . LYS B  1 387 ? 170.568 37.072  107.102 1.00 92.97  ? 387 LYS B CD    1 
ATOM   4636  C CE    . LYS B  1 387 ? 171.648 35.993  107.166 1.00 94.34  ? 387 LYS B CE    1 
ATOM   4637  N NZ    . LYS B  1 387 ? 172.524 36.009  105.955 1.00 97.01  ? 387 LYS B NZ    1 
ATOM   4638  N N     . THR B  1 388 ? 167.629 41.181  109.249 1.00 26.73  ? 388 THR B N     1 
ATOM   4639  C CA    . THR B  1 388 ? 166.517 42.118  109.212 1.00 25.91  ? 388 THR B CA    1 
ATOM   4640  C C     . THR B  1 388 ? 166.732 43.432  109.971 1.00 25.81  ? 388 THR B C     1 
ATOM   4641  O O     . THR B  1 388 ? 167.694 44.143  109.719 1.00 25.59  ? 388 THR B O     1 
ATOM   4642  C CB    . THR B  1 388 ? 165.262 41.427  109.715 1.00 12.11  ? 388 THR B CB    1 
ATOM   4643  O OG1   . THR B  1 388 ? 165.481 40.913  111.038 1.00 11.87  ? 388 THR B OG1   1 
ATOM   4644  C CG2   . THR B  1 388 ? 164.937 40.274  108.808 1.00 12.48  ? 388 THR B CG2   1 
ATOM   4645  N N     . GLU B  1 389 ? 165.835 43.771  110.886 1.00 29.42  ? 389 GLU B N     1 
ATOM   4646  C CA    . GLU B  1 389 ? 165.975 45.011  111.646 1.00 29.24  ? 389 GLU B CA    1 
ATOM   4647  C C     . GLU B  1 389 ? 166.834 44.760  112.882 1.00 26.12  ? 389 GLU B C     1 
ATOM   4648  O O     . GLU B  1 389 ? 166.331 44.287  113.888 1.00 27.54  ? 389 GLU B O     1 
ATOM   4649  C CB    . GLU B  1 389 ? 164.581 45.515  112.060 1.00 114.08 ? 389 GLU B CB    1 
ATOM   4650  C CG    . GLU B  1 389 ? 164.560 46.879  112.759 1.00 120.58 ? 389 GLU B CG    1 
ATOM   4651  C CD    . GLU B  1 389 ? 164.663 48.061  111.804 1.00 123.53 ? 389 GLU B CD    1 
ATOM   4652  O OE1   . GLU B  1 389 ? 163.707 48.301  111.032 1.00 126.27 ? 389 GLU B OE1   1 
ATOM   4653  O OE2   . GLU B  1 389 ? 165.702 48.754  111.832 1.00 124.13 ? 389 GLU B OE2   1 
ATOM   4654  N N     . ASN B  1 390 ? 168.121 45.072  112.822 1.00 12.60  ? 390 ASN B N     1 
ATOM   4655  C CA    . ASN B  1 390 ? 169.016 44.830  113.965 1.00 9.92   ? 390 ASN B CA    1 
ATOM   4656  C C     . ASN B  1 390 ? 168.616 45.603  115.225 1.00 7.89   ? 390 ASN B C     1 
ATOM   4657  O O     . ASN B  1 390 ? 168.992 46.715  115.422 1.00 10.51  ? 390 ASN B O     1 
ATOM   4658  C CB    . ASN B  1 390 ? 170.437 45.191  113.560 1.00 35.28  ? 390 ASN B CB    1 
ATOM   4659  C CG    . ASN B  1 390 ? 171.416 45.080  114.698 1.00 37.17  ? 390 ASN B CG    1 
ATOM   4660  O OD1   . ASN B  1 390 ? 171.156 45.520  115.822 1.00 38.54  ? 390 ASN B OD1   1 
ATOM   4661  N ND2   . ASN B  1 390 ? 172.577 44.507  114.404 1.00 38.07  ? 390 ASN B ND2   1 
ATOM   4662  N N     . ILE B  1 391 ? 167.863 45.018  116.112 1.00 12.21  ? 391 ILE B N     1 
ATOM   4663  C CA    . ILE B  1 391 ? 167.465 45.750  117.292 1.00 9.91   ? 391 ILE B CA    1 
ATOM   4664  C C     . ILE B  1 391 ? 168.406 45.519  118.467 1.00 9.80   ? 391 ILE B C     1 
ATOM   4665  O O     . ILE B  1 391 ? 168.010 45.582  119.654 1.00 9.08   ? 391 ILE B O     1 
ATOM   4666  C CB    . ILE B  1 391 ? 166.070 45.333  117.672 1.00 11.93  ? 391 ILE B CB    1 
ATOM   4667  C CG1   . ILE B  1 391 ? 165.983 43.812  117.839 1.00 10.64  ? 391 ILE B CG1   1 
ATOM   4668  C CG2   . ILE B  1 391 ? 165.150 45.717  116.567 1.00 13.01  ? 391 ILE B CG2   1 
ATOM   4669  C CD1   . ILE B  1 391 ? 164.619 43.333  118.133 1.00 9.63   ? 391 ILE B CD1   1 
ATOM   4670  N N     . GLY B  1 392 ? 169.658 45.237  118.139 1.00 22.48  ? 392 GLY B N     1 
ATOM   4671  C CA    . GLY B  1 392 ? 170.623 45.002  119.186 1.00 22.45  ? 392 GLY B CA    1 
ATOM   4672  C C     . GLY B  1 392 ? 170.339 43.804  120.073 1.00 22.73  ? 392 GLY B C     1 
ATOM   4673  O O     . GLY B  1 392 ? 169.955 42.733  119.611 1.00 22.31  ? 392 GLY B O     1 
ATOM   4674  N N     . ALA B  1 393 ? 170.530 44.004  121.370 1.00 13.53  ? 393 ALA B N     1 
ATOM   4675  C CA    . ALA B  1 393 ? 170.356 42.955  122.375 1.00 13.36  ? 393 ALA B CA    1 
ATOM   4676  C C     . ALA B  1 393 ? 168.919 42.633  122.654 1.00 13.50  ? 393 ALA B C     1 
ATOM   4677  O O     . ALA B  1 393 ? 168.624 41.644  123.281 1.00 11.40  ? 393 ALA B O     1 
ATOM   4678  C CB    . ALA B  1 393 ? 171.026 43.374  123.676 1.00 18.08  ? 393 ALA B CB    1 
ATOM   4679  N N     . ARG B  1 394 ? 168.013 43.490  122.227 1.00 30.11  ? 394 ARG B N     1 
ATOM   4680  C CA    . ARG B  1 394 ? 166.627 43.205  122.500 1.00 32.33  ? 394 ARG B CA    1 
ATOM   4681  C C     . ARG B  1 394 ? 166.308 41.908  121.833 1.00 30.95  ? 394 ARG B C     1 
ATOM   4682  O O     . ARG B  1 394 ? 165.492 41.134  122.315 1.00 31.92  ? 394 ARG B O     1 
ATOM   4683  C CB    . ARG B  1 394 ? 165.726 44.309  121.964 1.00 82.60  ? 394 ARG B CB    1 
ATOM   4684  C CG    . ARG B  1 394 ? 165.491 45.409  122.964 1.00 90.37  ? 394 ARG B CG    1 
ATOM   4685  C CD    . ARG B  1 394 ? 164.889 44.841  124.247 1.00 95.76  ? 394 ARG B CD    1 
ATOM   4686  N NE    . ARG B  1 394 ? 164.661 45.893  125.234 1.00 103.04 ? 394 ARG B NE    1 
ATOM   4687  C CZ    . ARG B  1 394 ? 164.136 45.695  126.441 1.00 106.37 ? 394 ARG B CZ    1 
ATOM   4688  N NH1   . ARG B  1 394 ? 163.780 44.468  126.817 1.00 105.72 ? 394 ARG B NH1   1 
ATOM   4689  N NH2   . ARG B  1 394 ? 163.962 46.729  127.266 1.00 107.58 ? 394 ARG B NH2   1 
ATOM   4690  N N     . ARG B  1 395 ? 166.984 41.645  120.727 1.00 20.48  ? 395 ARG B N     1 
ATOM   4691  C CA    . ARG B  1 395 ? 166.706 40.438  120.006 1.00 18.83  ? 395 ARG B CA    1 
ATOM   4692  C C     . ARG B  1 395 ? 166.814 39.188  120.870 1.00 18.20  ? 395 ARG B C     1 
ATOM   4693  O O     . ARG B  1 395 ? 166.207 38.198  120.544 1.00 18.13  ? 395 ARG B O     1 
ATOM   4694  C CB    . ARG B  1 395 ? 167.608 40.340  118.805 1.00 18.86  ? 395 ARG B CB    1 
ATOM   4695  C CG    . ARG B  1 395 ? 167.199 39.234  117.891 1.00 19.26  ? 395 ARG B CG    1 
ATOM   4696  C CD    . ARG B  1 395 ? 165.879 39.545  117.241 1.00 18.51  ? 395 ARG B CD    1 
ATOM   4697  N NE    . ARG B  1 395 ? 166.058 40.520  116.187 1.00 21.13  ? 395 ARG B NE    1 
ATOM   4698  C CZ    . ARG B  1 395 ? 165.062 41.032  115.487 1.00 24.34  ? 395 ARG B CZ    1 
ATOM   4699  N NH1   . ARG B  1 395 ? 163.820 40.652  115.743 1.00 28.01  ? 395 ARG B NH1   1 
ATOM   4700  N NH2   . ARG B  1 395 ? 165.299 41.922  114.537 1.00 24.84  ? 395 ARG B NH2   1 
ATOM   4701  N N     . LEU B  1 396 ? 167.575 39.208  121.967 1.00 16.95  ? 396 LEU B N     1 
ATOM   4702  C CA    . LEU B  1 396 ? 167.650 38.026  122.834 1.00 15.42  ? 396 LEU B CA    1 
ATOM   4703  C C     . LEU B  1 396 ? 166.314 37.885  123.541 1.00 17.71  ? 396 LEU B C     1 
ATOM   4704  O O     . LEU B  1 396 ? 165.700 36.833  123.471 1.00 18.69  ? 396 LEU B O     1 
ATOM   4705  C CB    . LEU B  1 396 ? 168.757 38.138  123.870 1.00 5.58   ? 396 LEU B CB    1 
ATOM   4706  C CG    . LEU B  1 396 ? 170.108 38.313  123.194 1.00 5.39   ? 396 LEU B CG    1 
ATOM   4707  C CD1   . LEU B  1 396 ? 171.193 38.492  124.221 1.00 3.58   ? 396 LEU B CD1   1 
ATOM   4708  C CD2   . LEU B  1 396 ? 170.412 37.126  122.325 1.00 4.71   ? 396 LEU B CD2   1 
ATOM   4709  N N     . HIS B  1 397 ? 165.841 38.941  124.203 1.00 20.96  ? 397 HIS B N     1 
ATOM   4710  C CA    . HIS B  1 397 ? 164.548 38.887  124.899 1.00 21.78  ? 397 HIS B CA    1 
ATOM   4711  C C     . HIS B  1 397 ? 163.529 38.319  123.944 1.00 20.22  ? 397 HIS B C     1 
ATOM   4712  O O     . HIS B  1 397 ? 162.679 37.522  124.333 1.00 19.21  ? 397 HIS B O     1 
ATOM   4713  C CB    . HIS B  1 397 ? 164.131 40.276  125.366 1.00 62.95  ? 397 HIS B CB    1 
ATOM   4714  C CG    . HIS B  1 397 ? 165.068 40.857  126.373 1.00 69.86  ? 397 HIS B CG    1 
ATOM   4715  N ND1   . HIS B  1 397 ? 164.693 41.122  127.671 1.00 73.73  ? 397 HIS B ND1   1 
ATOM   4716  C CD2   . HIS B  1 397 ? 166.389 41.152  126.296 1.00 72.79  ? 397 HIS B CD2   1 
ATOM   4717  C CE1   . HIS B  1 397 ? 165.744 41.551  128.353 1.00 75.55  ? 397 HIS B CE1   1 
ATOM   4718  N NE2   . HIS B  1 397 ? 166.787 41.577  127.542 1.00 75.85  ? 397 HIS B NE2   1 
ATOM   4719  N N     . THR B  1 398 ? 163.663 38.706  122.680 1.00 20.51  ? 398 THR B N     1 
ATOM   4720  C CA    . THR B  1 398 ? 162.780 38.248  121.627 1.00 20.53  ? 398 THR B CA    1 
ATOM   4721  C C     . THR B  1 398 ? 162.888 36.788  121.302 1.00 19.70  ? 398 THR B C     1 
ATOM   4722  O O     . THR B  1 398 ? 161.874 36.115  121.210 1.00 20.35  ? 398 THR B O     1 
ATOM   4723  C CB    . THR B  1 398 ? 163.035 38.980  120.352 1.00 52.68  ? 398 THR B CB    1 
ATOM   4724  O OG1   . THR B  1 398 ? 162.239 40.167  120.363 1.00 56.45  ? 398 THR B OG1   1 
ATOM   4725  C CG2   . THR B  1 398 ? 162.692 38.080  119.120 1.00 53.83  ? 398 THR B CG2   1 
ATOM   4726  N N     . VAL B  1 399 ? 164.115 36.318  121.078 1.00 17.61  ? 399 VAL B N     1 
ATOM   4727  C CA    . VAL B  1 399 ? 164.363 34.921  120.762 1.00 14.67  ? 399 VAL B CA    1 
ATOM   4728  C C     . VAL B  1 399 ? 164.114 34.033  121.974 1.00 14.41  ? 399 VAL B C     1 
ATOM   4729  O O     . VAL B  1 399 ? 163.633 32.911  121.818 1.00 13.46  ? 399 VAL B O     1 
ATOM   4730  C CB    . VAL B  1 399 ? 165.786 34.672  120.308 1.00 12.86  ? 399 VAL B CB    1 
ATOM   4731  C CG1   . VAL B  1 399 ? 166.030 33.185  120.299 1.00 14.44  ? 399 VAL B CG1   1 
ATOM   4732  C CG2   . VAL B  1 399 ? 166.014 35.209  118.918 1.00 11.19  ? 399 VAL B CG2   1 
ATOM   4733  N N     . MET B  1 400 ? 164.455 34.507  123.173 1.00 18.51  ? 400 MET B N     1 
ATOM   4734  C CA    . MET B  1 400 ? 164.186 33.714  124.362 1.00 20.30  ? 400 MET B CA    1 
ATOM   4735  C C     . MET B  1 400 ? 162.696 33.492  124.475 1.00 23.43  ? 400 MET B C     1 
ATOM   4736  O O     . MET B  1 400 ? 162.252 32.343  124.546 1.00 25.95  ? 400 MET B O     1 
ATOM   4737  C CB    . MET B  1 400 ? 164.664 34.392  125.622 1.00 22.28  ? 400 MET B CB    1 
ATOM   4738  C CG    . MET B  1 400 ? 166.131 34.265  125.799 1.00 25.91  ? 400 MET B CG    1 
ATOM   4739  S SD    . MET B  1 400 ? 166.720 32.572  125.805 1.00 27.48  ? 400 MET B SD    1 
ATOM   4740  C CE    . MET B  1 400 ? 166.915 32.384  127.584 1.00 27.40  ? 400 MET B CE    1 
ATOM   4741  N N     . GLU B  1 401 ? 161.901 34.566  124.476 1.00 12.76  ? 401 GLU B N     1 
ATOM   4742  C CA    . GLU B  1 401 ? 160.469 34.355  124.589 1.00 14.03  ? 401 GLU B CA    1 
ATOM   4743  C C     . GLU B  1 401 ? 159.923 33.472  123.469 1.00 13.08  ? 401 GLU B C     1 
ATOM   4744  O O     . GLU B  1 401 ? 158.890 32.853  123.623 1.00 12.78  ? 401 GLU B O     1 
ATOM   4745  C CB    . GLU B  1 401 ? 159.702 35.665  124.654 1.00 50.20  ? 401 GLU B CB    1 
ATOM   4746  C CG    . GLU B  1 401 ? 158.288 35.479  125.231 1.00 58.02  ? 401 GLU B CG    1 
ATOM   4747  C CD    . GLU B  1 401 ? 158.259 34.870  126.665 1.00 63.45  ? 401 GLU B CD    1 
ATOM   4748  O OE1   . GLU B  1 401 ? 158.936 35.435  127.556 1.00 65.48  ? 401 GLU B OE1   1 
ATOM   4749  O OE2   . GLU B  1 401 ? 157.555 33.843  126.914 1.00 62.29  ? 401 GLU B OE2   1 
ATOM   4750  N N     . ARG B  1 402 ? 160.622 33.373  122.351 1.00 29.98  ? 402 ARG B N     1 
ATOM   4751  C CA    . ARG B  1 402 ? 160.137 32.525  121.269 1.00 31.66  ? 402 ARG B CA    1 
ATOM   4752  C C     . ARG B  1 402 ? 160.472 31.058  121.549 1.00 31.79  ? 402 ARG B C     1 
ATOM   4753  O O     . ARG B  1 402 ? 159.710 30.159  121.166 1.00 32.36  ? 402 ARG B O     1 
ATOM   4754  C CB    . ARG B  1 402 ? 160.740 32.971  119.933 1.00 43.10  ? 402 ARG B CB    1 
ATOM   4755  C CG    . ARG B  1 402 ? 160.126 32.330  118.704 1.00 44.40  ? 402 ARG B CG    1 
ATOM   4756  C CD    . ARG B  1 402 ? 160.393 33.207  117.495 1.00 48.71  ? 402 ARG B CD    1 
ATOM   4757  N NE    . ARG B  1 402 ? 161.332 32.659  116.505 1.00 53.51  ? 402 ARG B NE    1 
ATOM   4758  C CZ    . ARG B  1 402 ? 162.364 33.333  115.970 1.00 56.64  ? 402 ARG B CZ    1 
ATOM   4759  N NH1   . ARG B  1 402 ? 162.618 34.602  116.334 1.00 57.50  ? 402 ARG B NH1   1 
ATOM   4760  N NH2   . ARG B  1 402 ? 163.140 32.747  115.047 1.00 56.26  ? 402 ARG B NH2   1 
ATOM   4761  N N     . LEU B  1 403 ? 161.603 30.823  122.221 1.00 33.08  ? 403 LEU B N     1 
ATOM   4762  C CA    . LEU B  1 403 ? 162.054 29.470  122.564 1.00 32.51  ? 403 LEU B CA    1 
ATOM   4763  C C     . LEU B  1 403 ? 161.368 28.982  123.823 1.00 33.31  ? 403 LEU B C     1 
ATOM   4764  O O     . LEU B  1 403 ? 160.796 27.904  123.835 1.00 34.87  ? 403 LEU B O     1 
ATOM   4765  C CB    . LEU B  1 403 ? 163.579 29.432  122.747 1.00 26.27  ? 403 LEU B CB    1 
ATOM   4766  C CG    . LEU B  1 403 ? 164.277 28.412  123.663 1.00 24.67  ? 403 LEU B CG    1 
ATOM   4767  C CD1   . LEU B  1 403 ? 165.791 28.495  123.527 1.00 24.13  ? 403 LEU B CD1   1 
ATOM   4768  C CD2   . LEU B  1 403 ? 163.940 28.722  125.089 1.00 23.22  ? 403 LEU B CD2   1 
ATOM   4769  N N     . MET B  1 404 ? 161.412 29.768  124.885 1.00 24.79  ? 404 MET B N     1 
ATOM   4770  C CA    . MET B  1 404 ? 160.771 29.362  126.123 1.00 28.70  ? 404 MET B CA    1 
ATOM   4771  C C     . MET B  1 404 ? 159.238 29.305  125.984 1.00 31.45  ? 404 MET B C     1 
ATOM   4772  O O     . MET B  1 404 ? 158.494 29.152  126.972 1.00 32.72  ? 404 MET B O     1 
ATOM   4773  C CB    . MET B  1 404 ? 161.150 30.335  127.231 1.00 50.96  ? 404 MET B CB    1 
ATOM   4774  C CG    . MET B  1 404 ? 162.617 30.361  127.515 1.00 51.86  ? 404 MET B CG    1 
ATOM   4775  S SD    . MET B  1 404 ? 163.163 28.794  128.167 1.00 52.39  ? 404 MET B SD    1 
ATOM   4776  C CE    . MET B  1 404 ? 162.296 28.798  129.687 1.00 50.17  ? 404 MET B CE    1 
ATOM   4777  N N     . ASP B  1 405 ? 158.769 29.447  124.751 1.00 29.73  ? 405 ASP B N     1 
ATOM   4778  C CA    . ASP B  1 405 ? 157.341 29.418  124.444 1.00 30.52  ? 405 ASP B CA    1 
ATOM   4779  C C     . ASP B  1 405 ? 156.622 28.295  125.212 1.00 29.93  ? 405 ASP B C     1 
ATOM   4780  O O     . ASP B  1 405 ? 156.037 28.528  126.276 1.00 28.53  ? 405 ASP B O     1 
ATOM   4781  C CB    . ASP B  1 405 ? 157.164 29.215  122.924 1.00 54.24  ? 405 ASP B CB    1 
ATOM   4782  C CG    . ASP B  1 405 ? 155.777 29.599  122.417 1.00 57.03  ? 405 ASP B CG    1 
ATOM   4783  O OD1   . ASP B  1 405 ? 154.745 29.176  122.997 1.00 57.77  ? 405 ASP B OD1   1 
ATOM   4784  O OD2   . ASP B  1 405 ? 155.736 30.326  121.405 1.00 59.65  ? 405 ASP B OD2   1 
ATOM   4785  N N     . LYS B  1 406 ? 156.705 27.084  124.646 1.00 44.64  ? 406 LYS B N     1 
ATOM   4786  C CA    . LYS B  1 406 ? 156.077 25.856  125.146 1.00 45.58  ? 406 LYS B CA    1 
ATOM   4787  C C     . LYS B  1 406 ? 156.177 25.672  126.653 1.00 43.81  ? 406 LYS B C     1 
ATOM   4788  O O     . LYS B  1 406 ? 155.172 25.716  127.373 1.00 42.72  ? 406 LYS B O     1 
ATOM   4789  C CB    . LYS B  1 406 ? 156.672 24.625  124.438 1.00 101.04 ? 406 LYS B CB    1 
ATOM   4790  C CG    . LYS B  1 406 ? 156.538 24.621  122.916 1.00 106.45 ? 406 LYS B CG    1 
ATOM   4791  C CD    . LYS B  1 406 ? 157.434 25.690  122.281 1.00 113.26 ? 406 LYS B CD    1 
ATOM   4792  C CE    . LYS B  1 406 ? 157.134 25.930  120.786 1.00 115.65 ? 406 LYS B CE    1 
ATOM   4793  N NZ    . LYS B  1 406 ? 157.713 27.225  120.251 1.00 114.87 ? 406 LYS B NZ    1 
ATOM   4794  N N     . ILE B  1 407 ? 157.390 25.454  127.129 1.00 40.58  ? 407 ILE B N     1 
ATOM   4795  C CA    . ILE B  1 407 ? 157.591 25.268  128.549 1.00 38.47  ? 407 ILE B CA    1 
ATOM   4796  C C     . ILE B  1 407 ? 156.882 26.345  129.365 1.00 38.70  ? 407 ILE B C     1 
ATOM   4797  O O     . ILE B  1 407 ? 156.303 26.032  130.388 1.00 39.09  ? 407 ILE B O     1 
ATOM   4798  C CB    . ILE B  1 407 ? 159.070 25.327  128.905 1.00 27.88  ? 407 ILE B CB    1 
ATOM   4799  C CG1   . ILE B  1 407 ? 159.814 24.261  128.126 1.00 27.25  ? 407 ILE B CG1   1 
ATOM   4800  C CG2   . ILE B  1 407 ? 159.271 25.205  130.421 1.00 24.33  ? 407 ILE B CG2   1 
ATOM   4801  C CD1   . ILE B  1 407 ? 161.330 24.421  128.218 1.00 27.56  ? 407 ILE B CD1   1 
ATOM   4802  N N     . SER B  1 408 ? 156.928 27.607  128.931 1.00 25.68  ? 408 SER B N     1 
ATOM   4803  C CA    . SER B  1 408 ? 156.301 28.673  129.684 1.00 24.50  ? 408 SER B CA    1 
ATOM   4804  C C     . SER B  1 408 ? 154.803 28.397  129.918 1.00 23.42  ? 408 SER B C     1 
ATOM   4805  O O     . SER B  1 408 ? 154.229 28.841  130.903 1.00 22.41  ? 408 SER B O     1 
ATOM   4806  C CB    . SER B  1 408 ? 156.510 29.995  128.964 1.00 65.14  ? 408 SER B CB    1 
ATOM   4807  O OG    . SER B  1 408 ? 156.423 31.073  129.875 1.00 70.18  ? 408 SER B OG    1 
ATOM   4808  N N     . PHE B  1 409 ? 154.165 27.635  129.043 1.00 48.96  ? 409 PHE B N     1 
ATOM   4809  C CA    . PHE B  1 409 ? 152.740 27.324  129.223 1.00 50.19  ? 409 PHE B CA    1 
ATOM   4810  C C     . PHE B  1 409 ? 152.509 26.174  130.198 1.00 52.26  ? 409 PHE B C     1 
ATOM   4811  O O     . PHE B  1 409 ? 151.950 26.309  131.301 1.00 52.87  ? 409 PHE B O     1 
ATOM   4812  C CB    . PHE B  1 409 ? 152.139 26.911  127.892 1.00 41.06  ? 409 PHE B CB    1 
ATOM   4813  C CG    . PHE B  1 409 ? 150.651 26.890  127.885 1.00 37.44  ? 409 PHE B CG    1 
ATOM   4814  C CD1   . PHE B  1 409 ? 149.916 27.987  128.338 1.00 38.07  ? 409 PHE B CD1   1 
ATOM   4815  C CD2   . PHE B  1 409 ? 149.980 25.824  127.345 1.00 36.43  ? 409 PHE B CD2   1 
ATOM   4816  C CE1   . PHE B  1 409 ? 148.532 28.027  128.246 1.00 37.89  ? 409 PHE B CE1   1 
ATOM   4817  C CE2   . PHE B  1 409 ? 148.584 25.850  127.243 1.00 38.35  ? 409 PHE B CE2   1 
ATOM   4818  C CZ    . PHE B  1 409 ? 147.862 26.957  127.694 1.00 38.52  ? 409 PHE B CZ    1 
ATOM   4819  N N     . SER B  1 410 ? 152.949 25.024  129.717 1.00 52.36  ? 410 SER B N     1 
ATOM   4820  C CA    . SER B  1 410 ? 152.872 23.749  130.399 1.00 52.97  ? 410 SER B CA    1 
ATOM   4821  C C     . SER B  1 410 ? 153.666 23.688  131.708 1.00 53.21  ? 410 SER B C     1 
ATOM   4822  O O     . SER B  1 410 ? 153.293 22.978  132.614 1.00 53.54  ? 410 SER B O     1 
ATOM   4823  C CB    . SER B  1 410 ? 153.352 22.677  129.414 1.00 48.71  ? 410 SER B CB    1 
ATOM   4824  O OG    . SER B  1 410 ? 152.965 23.039  128.079 1.00 49.23  ? 410 SER B OG    1 
ATOM   4825  N N     . ALA B  1 411 ? 154.750 24.441  131.812 1.00 37.34  ? 411 ALA B N     1 
ATOM   4826  C CA    . ALA B  1 411 ? 155.581 24.448  133.018 1.00 39.66  ? 411 ALA B CA    1 
ATOM   4827  C C     . ALA B  1 411 ? 154.756 24.412  134.290 1.00 40.54  ? 411 ALA B C     1 
ATOM   4828  O O     . ALA B  1 411 ? 155.231 23.990  135.349 1.00 39.94  ? 411 ALA B O     1 
ATOM   4829  C CB    . ALA B  1 411 ? 156.471 25.688  133.036 1.00 75.94  ? 411 ALA B CB    1 
ATOM   4830  N N     . SER B  1 412 ? 153.516 24.865  134.183 1.00 49.55  ? 412 SER B N     1 
ATOM   4831  C CA    . SER B  1 412 ? 152.656 24.898  135.336 1.00 51.91  ? 412 SER B CA    1 
ATOM   4832  C C     . SER B  1 412 ? 152.295 23.499  135.836 1.00 52.79  ? 412 SER B C     1 
ATOM   4833  O O     . SER B  1 412 ? 152.541 23.161  136.993 1.00 53.11  ? 412 SER B O     1 
ATOM   4834  C CB    . SER B  1 412 ? 151.400 25.690  135.000 1.00 165.58 ? 412 SER B CB    1 
ATOM   4835  O OG    . SER B  1 412 ? 150.717 26.042  136.184 1.00 168.26 ? 412 SER B OG    1 
ATOM   4836  N N     . ASP B  1 413 ? 151.714 22.685  134.963 1.00 89.23  ? 413 ASP B N     1 
ATOM   4837  C CA    . ASP B  1 413 ? 151.307 21.336  135.340 1.00 91.05  ? 413 ASP B CA    1 
ATOM   4838  C C     . ASP B  1 413 ? 152.386 20.340  134.945 1.00 91.25  ? 413 ASP B C     1 
ATOM   4839  O O     . ASP B  1 413 ? 152.165 19.138  134.832 1.00 92.53  ? 413 ASP B O     1 
ATOM   4840  C CB    . ASP B  1 413 ? 149.954 20.999  134.673 1.00 76.76  ? 413 ASP B CB    1 
ATOM   4841  C CG    . ASP B  1 413 ? 150.024 20.950  133.147 1.00 76.98  ? 413 ASP B CG    1 
ATOM   4842  O OD1   . ASP B  1 413 ? 148.996 21.242  132.504 1.00 76.53  ? 413 ASP B OD1   1 
ATOM   4843  O OD2   . ASP B  1 413 ? 151.087 20.600  132.591 1.00 76.17  ? 413 ASP B OD2   1 
ATOM   4844  N N     . MET B  1 414 ? 153.577 20.863  134.762 1.00 51.54  ? 414 MET B N     1 
ATOM   4845  C CA    . MET B  1 414 ? 154.696 20.058  134.344 1.00 51.64  ? 414 MET B CA    1 
ATOM   4846  C C     . MET B  1 414 ? 155.651 19.902  135.515 1.00 51.53  ? 414 MET B C     1 
ATOM   4847  O O     . MET B  1 414 ? 156.830 19.584  135.348 1.00 50.93  ? 414 MET B O     1 
ATOM   4848  C CB    . MET B  1 414 ? 155.371 20.769  133.189 1.00 59.42  ? 414 MET B CB    1 
ATOM   4849  C CG    . MET B  1 414 ? 156.489 20.031  132.604 1.00 59.31  ? 414 MET B CG    1 
ATOM   4850  S SD    . MET B  1 414 ? 157.054 20.987  131.290 1.00 60.34  ? 414 MET B SD    1 
ATOM   4851  C CE    . MET B  1 414 ? 156.115 20.285  129.946 1.00 56.91  ? 414 MET B CE    1 
ATOM   4852  N N     . ASN B  1 415 ? 155.118 20.110  136.711 1.00 67.28  ? 415 ASN B N     1 
ATOM   4853  C CA    . ASN B  1 415 ? 155.914 20.036  137.925 1.00 68.64  ? 415 ASN B CA    1 
ATOM   4854  C C     . ASN B  1 415 ? 156.941 18.907  138.011 1.00 68.65  ? 415 ASN B C     1 
ATOM   4855  O O     . ASN B  1 415 ? 156.807 17.867  137.360 1.00 69.39  ? 415 ASN B O     1 
ATOM   4856  C CB    . ASN B  1 415 ? 154.995 19.969  139.141 1.00 52.68  ? 415 ASN B CB    1 
ATOM   4857  C CG    . ASN B  1 415 ? 155.753 20.121  140.443 1.00 52.83  ? 415 ASN B CG    1 
ATOM   4858  O OD1   . ASN B  1 415 ? 156.645 19.333  140.740 1.00 53.16  ? 415 ASN B OD1   1 
ATOM   4859  N ND2   . ASN B  1 415 ? 155.404 21.141  141.224 1.00 50.99  ? 415 ASN B ND2   1 
ATOM   4860  N N     . GLY B  1 416 ? 157.973 19.149  138.820 1.00 25.86  ? 416 GLY B N     1 
ATOM   4861  C CA    . GLY B  1 416 ? 159.023 18.179  139.044 1.00 26.17  ? 416 GLY B CA    1 
ATOM   4862  C C     . GLY B  1 416 ? 159.995 17.941  137.910 1.00 27.01  ? 416 GLY B C     1 
ATOM   4863  O O     . GLY B  1 416 ? 161.199 18.073  138.110 1.00 26.94  ? 416 GLY B O     1 
ATOM   4864  N N     . GLN B  1 417 ? 159.494 17.583  136.731 1.00 98.31  ? 417 GLN B N     1 
ATOM   4865  C CA    . GLN B  1 417 ? 160.364 17.316  135.591 1.00 99.61  ? 417 GLN B CA    1 
ATOM   4866  C C     . GLN B  1 417 ? 161.515 18.315  135.481 1.00 99.90  ? 417 GLN B C     1 
ATOM   4867  O O     . GLN B  1 417 ? 161.515 19.369  136.123 1.00 100.87 ? 417 GLN B O     1 
ATOM   4868  C CB    . GLN B  1 417 ? 159.578 17.376  134.290 1.00 80.20  ? 417 GLN B CB    1 
ATOM   4869  C CG    . GLN B  1 417 ? 158.236 16.707  134.306 1.00 83.01  ? 417 GLN B CG    1 
ATOM   4870  C CD    . GLN B  1 417 ? 157.623 16.637  132.911 1.00 85.21  ? 417 GLN B CD    1 
ATOM   4871  O OE1   . GLN B  1 417 ? 156.471 16.230  132.744 1.00 86.89  ? 417 GLN B OE1   1 
ATOM   4872  N NE2   . GLN B  1 417 ? 158.398 17.029  131.899 1.00 85.57  ? 417 GLN B NE2   1 
ATOM   4873  N N     . THR B  1 418 ? 162.497 17.978  134.653 1.00 55.19  ? 418 THR B N     1 
ATOM   4874  C CA    . THR B  1 418 ? 163.634 18.859  134.422 1.00 54.58  ? 418 THR B CA    1 
ATOM   4875  C C     . THR B  1 418 ? 163.807 18.901  132.911 1.00 54.42  ? 418 THR B C     1 
ATOM   4876  O O     . THR B  1 418 ? 163.883 17.854  132.257 1.00 54.15  ? 418 THR B O     1 
ATOM   4877  C CB    . THR B  1 418 ? 164.928 18.320  135.077 1.00 50.87  ? 418 THR B CB    1 
ATOM   4878  O OG1   . THR B  1 418 ? 165.213 17.015  134.566 1.00 51.71  ? 418 THR B OG1   1 
ATOM   4879  C CG2   . THR B  1 418 ? 164.769 18.217  136.578 1.00 50.47  ? 418 THR B CG2   1 
ATOM   4880  N N     . VAL B  1 419 ? 163.836 20.102  132.344 1.00 49.35  ? 419 VAL B N     1 
ATOM   4881  C CA    . VAL B  1 419 ? 163.996 20.221  130.902 1.00 48.05  ? 419 VAL B CA    1 
ATOM   4882  C C     . VAL B  1 419 ? 165.459 20.509  130.611 1.00 46.95  ? 419 VAL B C     1 
ATOM   4883  O O     . VAL B  1 419 ? 166.082 21.339  131.256 1.00 47.59  ? 419 VAL B O     1 
ATOM   4884  C CB    . VAL B  1 419 ? 163.131 21.353  130.324 1.00 92.04  ? 419 VAL B CB    1 
ATOM   4885  C CG1   . VAL B  1 419 ? 162.950 21.133  128.835 1.00 93.22  ? 419 VAL B CG1   1 
ATOM   4886  C CG2   . VAL B  1 419 ? 161.778 21.414  131.036 1.00 92.37  ? 419 VAL B CG2   1 
ATOM   4887  N N     . ASN B  1 420 ? 166.011 19.822  129.631 1.00 46.40  ? 420 ASN B N     1 
ATOM   4888  C CA    . ASN B  1 420 ? 167.411 20.009  129.307 1.00 45.29  ? 420 ASN B CA    1 
ATOM   4889  C C     . ASN B  1 420 ? 167.575 20.657  127.929 1.00 43.49  ? 420 ASN B C     1 
ATOM   4890  O O     . ASN B  1 420 ? 167.723 19.947  126.908 1.00 43.11  ? 420 ASN B O     1 
ATOM   4891  C CB    . ASN B  1 420 ? 168.074 18.658  129.337 1.00 96.36  ? 420 ASN B CB    1 
ATOM   4892  C CG    . ASN B  1 420 ? 169.541 18.759  129.367 1.00 99.10  ? 420 ASN B CG    1 
ATOM   4893  O OD1   . ASN B  1 420 ? 170.220 18.418  128.389 1.00 101.15 ? 420 ASN B OD1   1 
ATOM   4894  N ND2   . ASN B  1 420 ? 170.068 19.239  130.491 1.00 98.70  ? 420 ASN B ND2   1 
ATOM   4895  N N     . ILE B  1 421 ? 167.577 22.003  127.925 1.00 16.35  ? 421 ILE B N     1 
ATOM   4896  C CA    . ILE B  1 421 ? 167.654 22.825  126.702 1.00 12.28  ? 421 ILE B CA    1 
ATOM   4897  C C     . ILE B  1 421 ? 168.999 22.821  126.036 1.00 10.61  ? 421 ILE B C     1 
ATOM   4898  O O     . ILE B  1 421 ? 169.919 23.479  126.476 1.00 8.99   ? 421 ILE B O     1 
ATOM   4899  C CB    . ILE B  1 421 ? 167.271 24.268  126.984 1.00 26.04  ? 421 ILE B CB    1 
ATOM   4900  C CG1   . ILE B  1 421 ? 166.143 24.302  128.014 1.00 24.55  ? 421 ILE B CG1   1 
ATOM   4901  C CG2   . ILE B  1 421 ? 166.847 24.923  125.690 1.00 27.18  ? 421 ILE B CG2   1 
ATOM   4902  C CD1   . ILE B  1 421 ? 165.228 25.472  127.921 1.00 24.38  ? 421 ILE B CD1   1 
ATOM   4903  N N     . ASP B  1 422 ? 169.090 22.076  124.948 1.00 17.90  ? 422 ASP B N     1 
ATOM   4904  C CA    . ASP B  1 422 ? 170.333 21.917  124.207 1.00 19.23  ? 422 ASP B CA    1 
ATOM   4905  C C     . ASP B  1 422 ? 170.166 22.420  122.810 1.00 18.24  ? 422 ASP B C     1 
ATOM   4906  O O     . ASP B  1 422 ? 169.063 22.714  122.391 1.00 18.32  ? 422 ASP B O     1 
ATOM   4907  C CB    . ASP B  1 422 ? 170.714 20.429  124.162 1.00 60.16  ? 422 ASP B CB    1 
ATOM   4908  C CG    . ASP B  1 422 ? 169.548 19.534  123.768 1.00 63.48  ? 422 ASP B CG    1 
ATOM   4909  O OD1   . ASP B  1 422 ? 169.606 18.317  124.030 1.00 64.59  ? 422 ASP B OD1   1 
ATOM   4910  O OD2   . ASP B  1 422 ? 168.576 20.054  123.192 1.00 66.35  ? 422 ASP B OD2   1 
ATOM   4911  N N     . ALA B  1 423 ? 171.254 22.505  122.069 1.00 23.83  ? 423 ALA B N     1 
ATOM   4912  C CA    . ALA B  1 423 ? 171.152 22.961  120.688 1.00 24.10  ? 423 ALA B CA    1 
ATOM   4913  C C     . ALA B  1 423 ? 169.951 22.322  119.963 1.00 24.06  ? 423 ALA B C     1 
ATOM   4914  O O     . ALA B  1 423 ? 169.201 23.000  119.280 1.00 24.72  ? 423 ALA B O     1 
ATOM   4915  C CB    . ALA B  1 423 ? 172.448 22.649  119.916 1.00 24.14  ? 423 ALA B CB    1 
ATOM   4916  N N     . ALA B  1 424 ? 169.758 21.020  120.108 1.00 18.87  ? 424 ALA B N     1 
ATOM   4917  C CA    . ALA B  1 424 ? 168.642 20.371  119.434 1.00 19.29  ? 424 ALA B CA    1 
ATOM   4918  C C     . ALA B  1 424 ? 167.342 21.060  119.802 1.00 18.17  ? 424 ALA B C     1 
ATOM   4919  O O     . ALA B  1 424 ? 166.556 21.417  118.938 1.00 17.18  ? 424 ALA B O     1 
ATOM   4920  C CB    . ALA B  1 424 ? 168.570 18.905  119.829 1.00 133.48 ? 424 ALA B CB    1 
ATOM   4921  N N     . TYR B  1 425 ? 167.136 21.240  121.100 1.00 28.39  ? 425 TYR B N     1 
ATOM   4922  C CA    . TYR B  1 425 ? 165.928 21.861  121.603 1.00 28.75  ? 425 TYR B CA    1 
ATOM   4923  C C     . TYR B  1 425 ? 165.700 23.167  120.903 1.00 28.73  ? 425 TYR B C     1 
ATOM   4924  O O     . TYR B  1 425 ? 164.689 23.360  120.236 1.00 29.16  ? 425 TYR B O     1 
ATOM   4925  C CB    . TYR B  1 425 ? 166.020 22.139  123.114 1.00 31.70  ? 425 TYR B CB    1 
ATOM   4926  C CG    . TYR B  1 425 ? 164.677 22.490  123.737 1.00 32.67  ? 425 TYR B CG    1 
ATOM   4927  C CD1   . TYR B  1 425 ? 164.581 22.922  125.064 1.00 32.25  ? 425 TYR B CD1   1 
ATOM   4928  C CD2   . TYR B  1 425 ? 163.487 22.313  123.007 1.00 34.31  ? 425 TYR B CD2   1 
ATOM   4929  C CE1   . TYR B  1 425 ? 163.337 23.161  125.651 1.00 32.79  ? 425 TYR B CE1   1 
ATOM   4930  C CE2   . TYR B  1 425 ? 162.241 22.543  123.579 1.00 34.44  ? 425 TYR B CE2   1 
ATOM   4931  C CZ    . TYR B  1 425 ? 162.166 22.964  124.898 1.00 33.44  ? 425 TYR B CZ    1 
ATOM   4932  O OH    . TYR B  1 425 ? 160.909 23.161  125.432 1.00 34.36  ? 425 TYR B OH    1 
ATOM   4933  N N     . VAL B  1 426 ? 166.661 24.065  121.083 1.00 22.71  ? 426 VAL B N     1 
ATOM   4934  C CA    . VAL B  1 426 ? 166.614 25.404  120.516 1.00 21.47  ? 426 VAL B CA    1 
ATOM   4935  C C     . VAL B  1 426 ? 166.416 25.328  119.021 1.00 22.29  ? 426 VAL B C     1 
ATOM   4936  O O     . VAL B  1 426 ? 165.449 25.853  118.476 1.00 23.34  ? 426 VAL B O     1 
ATOM   4937  C CB    . VAL B  1 426 ? 167.912 26.167  120.830 1.00 20.27  ? 426 VAL B CB    1 
ATOM   4938  C CG1   . VAL B  1 426 ? 167.889 27.508  120.167 1.00 20.93  ? 426 VAL B CG1   1 
ATOM   4939  C CG2   . VAL B  1 426 ? 168.057 26.339  122.340 1.00 20.11  ? 426 VAL B CG2   1 
ATOM   4940  N N     . ALA B  1 427 ? 167.329 24.631  118.365 1.00 22.31  ? 427 ALA B N     1 
ATOM   4941  C CA    . ALA B  1 427 ? 167.284 24.486  116.918 1.00 24.22  ? 427 ALA B CA    1 
ATOM   4942  C C     . ALA B  1 427 ? 165.885 24.185  116.438 1.00 25.18  ? 427 ALA B C     1 
ATOM   4943  O O     . ALA B  1 427 ? 165.514 24.498  115.315 1.00 24.24  ? 427 ALA B O     1 
ATOM   4944  C CB    . ALA B  1 427 ? 168.230 23.382  116.481 1.00 80.34  ? 427 ALA B CB    1 
ATOM   4945  N N     . ASP B  1 428 ? 165.113 23.567  117.304 1.00 28.55  ? 428 ASP B N     1 
ATOM   4946  C CA    . ASP B  1 428 ? 163.762 23.204  116.970 1.00 32.93  ? 428 ASP B CA    1 
ATOM   4947  C C     . ASP B  1 428 ? 162.854 24.361  117.365 1.00 35.14  ? 428 ASP B C     1 
ATOM   4948  O O     . ASP B  1 428 ? 162.313 25.043  116.504 1.00 35.93  ? 428 ASP B O     1 
ATOM   4949  C CB    . ASP B  1 428 ? 163.432 21.893  117.702 1.00 40.64  ? 428 ASP B CB    1 
ATOM   4950  C CG    . ASP B  1 428 ? 161.953 21.602  117.790 1.00 40.65  ? 428 ASP B CG    1 
ATOM   4951  O OD1   . ASP B  1 428 ? 161.295 22.125  118.722 1.00 42.18  ? 428 ASP B OD1   1 
ATOM   4952  O OD2   . ASP B  1 428 ? 161.463 20.837  116.939 1.00 37.98  ? 428 ASP B OD2   1 
ATOM   4953  N N     . ALA B  1 429 ? 162.720 24.606  118.663 1.00 71.37  ? 429 ALA B N     1 
ATOM   4954  C CA    . ALA B  1 429 ? 161.859 25.673  119.160 1.00 74.98  ? 429 ALA B CA    1 
ATOM   4955  C C     . ALA B  1 429 ? 161.877 26.926  118.314 1.00 77.58  ? 429 ALA B C     1 
ATOM   4956  O O     . ALA B  1 429 ? 160.907 27.670  118.304 1.00 79.09  ? 429 ALA B O     1 
ATOM   4957  C CB    . ALA B  1 429 ? 162.236 26.031  120.594 1.00 101.94 ? 429 ALA B CB    1 
ATOM   4958  N N     . LEU B  1 430 ? 162.967 27.180  117.605 1.00 36.15  ? 430 LEU B N     1 
ATOM   4959  C CA    . LEU B  1 430 ? 163.006 28.389  116.811 1.00 39.26  ? 430 LEU B CA    1 
ATOM   4960  C C     . LEU B  1 430 ? 162.492 28.195  115.420 1.00 45.32  ? 430 LEU B C     1 
ATOM   4961  O O     . LEU B  1 430 ? 162.084 29.150  114.805 1.00 46.87  ? 430 LEU B O     1 
ATOM   4962  C CB    . LEU B  1 430 ? 164.406 28.998  116.781 1.00 21.96  ? 430 LEU B CB    1 
ATOM   4963  C CG    . LEU B  1 430 ? 164.974 29.359  118.175 1.00 17.50  ? 430 LEU B CG    1 
ATOM   4964  C CD1   . LEU B  1 430 ? 166.239 30.102  117.989 1.00 15.58  ? 430 LEU B CD1   1 
ATOM   4965  C CD2   . LEU B  1 430 ? 164.029 30.210  119.007 1.00 14.91  ? 430 LEU B CD2   1 
ATOM   4966  N N     . GLY B  1 431 ? 162.470 26.973  114.914 1.00 58.69  ? 431 GLY B N     1 
ATOM   4967  C CA    . GLY B  1 431 ? 161.944 26.782  113.570 1.00 67.33  ? 431 GLY B CA    1 
ATOM   4968  C C     . GLY B  1 431 ? 162.876 27.383  112.546 1.00 73.44  ? 431 GLY B C     1 
ATOM   4969  O O     . GLY B  1 431 ? 164.000 27.748  112.904 1.00 73.84  ? 431 GLY B O     1 
ATOM   4970  N N     . GLU B  1 432 ? 162.431 27.519  111.296 1.00 104.43 ? 432 GLU B N     1 
ATOM   4971  C CA    . GLU B  1 432 ? 163.310 28.053  110.252 1.00 111.74 ? 432 GLU B CA    1 
ATOM   4972  C C     . GLU B  1 432 ? 163.251 29.558  110.000 1.00 116.26 ? 432 GLU B C     1 
ATOM   4973  O O     . GLU B  1 432 ? 162.250 30.210  110.305 1.00 117.34 ? 432 GLU B O     1 
ATOM   4974  C CB    . GLU B  1 432 ? 163.069 27.299  108.940 1.00 191.65 ? 432 GLU B CB    1 
ATOM   4975  C CG    . GLU B  1 432 ? 163.307 25.798  109.060 1.00 194.20 ? 432 GLU B CG    1 
ATOM   4976  C CD    . GLU B  1 432 ? 163.380 25.097  107.719 1.00 194.40 ? 432 GLU B CD    1 
ATOM   4977  O OE1   . GLU B  1 432 ? 164.285 25.424  106.924 1.00 194.40 ? 432 GLU B OE1   1 
ATOM   4978  O OE2   . GLU B  1 432 ? 162.536 24.213  107.461 1.00 194.40 ? 432 GLU B OE2   1 
ATOM   4979  N N     . VAL B  1 433 ? 164.335 30.097  109.439 1.00 157.70 ? 433 VAL B N     1 
ATOM   4980  C CA    . VAL B  1 433 ? 164.432 31.527  109.133 1.00 162.70 ? 433 VAL B CA    1 
ATOM   4981  C C     . VAL B  1 433 ? 163.689 31.916  107.856 1.00 166.00 ? 433 VAL B C     1 
ATOM   4982  O O     . VAL B  1 433 ? 163.614 31.141  106.901 1.00 166.65 ? 433 VAL B O     1 
ATOM   4983  C CB    . VAL B  1 433 ? 165.925 31.987  108.994 1.00 119.15 ? 433 VAL B CB    1 
ATOM   4984  C CG1   . VAL B  1 433 ? 166.017 33.351  108.302 1.00 119.29 ? 433 VAL B CG1   1 
ATOM   4985  C CG2   . VAL B  1 433 ? 166.556 32.094  110.364 1.00 119.05 ? 433 VAL B CG2   1 
ATOM   4986  N N     . VAL B  1 434 ? 163.127 33.123  107.871 1.00 200.00 ? 434 VAL B N     1 
ATOM   4987  C CA    . VAL B  1 434 ? 162.409 33.694  106.731 1.00 200.00 ? 434 VAL B CA    1 
ATOM   4988  C C     . VAL B  1 434 ? 163.383 34.781  106.248 1.00 200.00 ? 434 VAL B C     1 
ATOM   4989  O O     . VAL B  1 434 ? 164.322 35.125  106.975 1.00 200.00 ? 434 VAL B O     1 
ATOM   4990  C CB    . VAL B  1 434 ? 161.047 34.329  107.184 1.00 144.79 ? 434 VAL B CB    1 
ATOM   4991  C CG1   . VAL B  1 434 ? 160.188 34.719  105.956 1.00 60.62  ? 434 VAL B CG1   1 
ATOM   4992  C CG2   . VAL B  1 434 ? 160.299 33.349  108.111 1.00 60.62  ? 434 VAL B CG2   1 
ATOM   4993  N N     . GLU B  1 435 ? 163.192 35.317  105.043 1.00 200.00 ? 435 GLU B N     1 
ATOM   4994  C CA    . GLU B  1 435 ? 164.117 36.340  104.552 1.00 200.00 ? 435 GLU B CA    1 
ATOM   4995  C C     . GLU B  1 435 ? 163.773 36.929  103.188 1.00 200.00 ? 435 GLU B C     1 
ATOM   4996  O O     . GLU B  1 435 ? 162.964 36.377  102.444 1.00 200.00 ? 435 GLU B O     1 
ATOM   4997  C CB    . GLU B  1 435 ? 165.536 35.762  104.488 1.00 180.46 ? 435 GLU B CB    1 
ATOM   4998  C CG    . GLU B  1 435 ? 166.593 36.756  104.047 1.00 181.85 ? 435 GLU B CG    1 
ATOM   4999  C CD    . GLU B  1 435 ? 167.902 36.089  103.710 1.00 182.52 ? 435 GLU B CD    1 
ATOM   5000  O OE1   . GLU B  1 435 ? 168.865 36.809  103.365 1.00 183.13 ? 435 GLU B OE1   1 
ATOM   5001  O OE2   . GLU B  1 435 ? 167.964 34.844  103.786 1.00 182.07 ? 435 GLU B OE2   1 
ATOM   5002  N N     . ASN B  1 436 ? 164.408 38.057  102.879 1.00 113.76 ? 436 ASN B N     1 
ATOM   5003  C CA    . ASN B  1 436 ? 164.242 38.754  101.609 1.00 113.25 ? 436 ASN B CA    1 
ATOM   5004  C C     . ASN B  1 436 ? 162.816 38.821  101.073 1.00 112.63 ? 436 ASN B C     1 
ATOM   5005  O O     . ASN B  1 436 ? 162.595 38.664  99.863  1.00 112.62 ? 436 ASN B O     1 
ATOM   5006  C CB    . ASN B  1 436 ? 165.140 38.116  100.542 1.00 200.00 ? 436 ASN B CB    1 
ATOM   5007  C CG    . ASN B  1 436 ? 166.615 38.237  100.865 1.00 184.90 ? 436 ASN B CG    1 
ATOM   5008  O OD1   . ASN B  1 436 ? 167.149 39.340  100.982 1.00 184.90 ? 436 ASN B OD1   1 
ATOM   5009  N ND2   . ASN B  1 436 ? 167.284 37.099  101.008 1.00 184.90 ? 436 ASN B ND2   1 
ATOM   5010  N N     . GLU B  1 437 ? 161.850 39.044  101.961 1.00 150.58 ? 437 GLU B N     1 
ATOM   5011  C CA    . GLU B  1 437 ? 160.460 39.153  101.530 1.00 149.09 ? 437 GLU B CA    1 
ATOM   5012  C C     . GLU B  1 437 ? 160.472 39.972  100.240 1.00 147.03 ? 437 GLU B C     1 
ATOM   5013  O O     . GLU B  1 437 ? 160.150 39.466  99.155  1.00 146.54 ? 437 GLU B O     1 
ATOM   5014  C CB    . GLU B  1 437 ? 159.631 39.883  102.590 1.00 194.52 ? 437 GLU B CB    1 
ATOM   5015  C CG    . GLU B  1 437 ? 158.250 40.305  102.106 1.00 196.00 ? 437 GLU B CG    1 
ATOM   5016  C CD    . GLU B  1 437 ? 157.695 41.486  102.879 1.00 197.14 ? 437 GLU B CD    1 
ATOM   5017  O OE1   . GLU B  1 437 ? 158.379 42.532  102.945 1.00 197.65 ? 437 GLU B OE1   1 
ATOM   5018  O OE2   . GLU B  1 437 ? 156.574 41.375  103.417 1.00 197.95 ? 437 GLU B OE2   1 
ATOM   5019  N N     . ASP B  1 438 ? 160.881 41.235  100.397 1.00 199.64 ? 438 ASP B N     1 
ATOM   5020  C CA    . ASP B  1 438 ? 160.992 42.229  99.324  1.00 196.20 ? 438 ASP B CA    1 
ATOM   5021  C C     . ASP B  1 438 ? 161.308 41.583  97.998  1.00 194.16 ? 438 ASP B C     1 
ATOM   5022  O O     . ASP B  1 438 ? 160.542 40.778  97.460  1.00 194.58 ? 438 ASP B O     1 
ATOM   5023  C CB    . ASP B  1 438 ? 162.104 43.256  99.648  1.00 200.00 ? 438 ASP B CB    1 
ATOM   5024  C CG    . ASP B  1 438 ? 163.439 42.600  99.947  1.00 191.32 ? 438 ASP B CG    1 
ATOM   5025  O OD1   . ASP B  1 438 ? 163.509 41.797  100.902 1.00 191.32 ? 438 ASP B OD1   1 
ATOM   5026  O OD2   . ASP B  1 438 ? 164.419 42.887  99.227  1.00 191.32 ? 438 ASP B OD2   1 
ATOM   5027  N N     . LEU B  1 439 ? 162.453 41.965  97.465  1.00 56.27  ? 439 LEU B N     1 
ATOM   5028  C CA    . LEU B  1 439 ? 162.870 41.400  96.219  1.00 53.96  ? 439 LEU B CA    1 
ATOM   5029  C C     . LEU B  1 439 ? 161.739 41.471  95.210  1.00 52.07  ? 439 LEU B C     1 
ATOM   5030  O O     . LEU B  1 439 ? 161.038 42.482  95.113  1.00 51.90  ? 439 LEU B O     1 
ATOM   5031  C CB    . LEU B  1 439 ? 163.272 39.934  96.420  1.00 200.00 ? 439 LEU B CB    1 
ATOM   5032  C CG    . LEU B  1 439 ? 164.472 39.628  97.317  1.00 146.20 ? 439 LEU B CG    1 
ATOM   5033  C CD1   . LEU B  1 439 ? 164.745 38.132  97.291  1.00 146.20 ? 439 LEU B CD1   1 
ATOM   5034  C CD2   . LEU B  1 439 ? 165.694 40.395  96.837  1.00 146.20 ? 439 LEU B CD2   1 
ATOM   5035  N N     . SER B  1 440 ? 161.600 40.369  94.471  1.00 52.21  ? 440 SER B N     1 
ATOM   5036  C CA    . SER B  1 440 ? 160.607 40.165  93.432  1.00 50.47  ? 440 SER B CA    1 
ATOM   5037  C C     . SER B  1 440 ? 159.630 41.328  93.197  1.00 47.99  ? 440 SER B C     1 
ATOM   5038  O O     . SER B  1 440 ? 159.881 42.214  92.374  1.00 46.63  ? 440 SER B O     1 
ATOM   5039  C CB    . SER B  1 440 ? 159.842 38.877  93.757  1.00 184.72 ? 440 SER B CB    1 
ATOM   5040  O OG    . SER B  1 440 ? 160.175 38.406  95.059  1.00 185.86 ? 440 SER B OG    1 
ATOM   5041  N N     . ARG B  1 441 ? 158.522 41.298  93.934  1.00 103.07 ? 441 ARG B N     1 
ATOM   5042  C CA    . ARG B  1 441 ? 157.447 42.285  93.874  1.00 101.32 ? 441 ARG B CA    1 
ATOM   5043  C C     . ARG B  1 441 ? 157.831 43.711  93.510  1.00 98.52  ? 441 ARG B C     1 
ATOM   5044  O O     . ARG B  1 441 ? 156.985 44.466  93.043  1.00 98.27  ? 441 ARG B O     1 
ATOM   5045  C CB    . ARG B  1 441 ? 156.723 42.350  95.219  1.00 200.00 ? 441 ARG B CB    1 
ATOM   5046  C CG    . ARG B  1 441 ? 156.215 41.033  95.758  1.00 200.00 ? 441 ARG B CG    1 
ATOM   5047  C CD    . ARG B  1 441 ? 154.920 40.590  95.100  1.00 200.00 ? 441 ARG B CD    1 
ATOM   5048  N NE    . ARG B  1 441 ? 154.242 39.614  95.948  1.00 200.00 ? 441 ARG B NE    1 
ATOM   5049  C CZ    . ARG B  1 441 ? 153.767 39.888  97.160  1.00 200.00 ? 441 ARG B CZ    1 
ATOM   5050  N NH1   . ARG B  1 441 ? 153.890 41.112  97.659  1.00 200.00 ? 441 ARG B NH1   1 
ATOM   5051  N NH2   . ARG B  1 441 ? 153.188 38.938  97.884  1.00 200.00 ? 441 ARG B NH2   1 
ATOM   5052  N N     . PHE B  1 442 ? 159.078 44.102  93.747  1.00 78.59  ? 442 PHE B N     1 
ATOM   5053  C CA    . PHE B  1 442 ? 159.479 45.467  93.453  1.00 74.00  ? 442 PHE B CA    1 
ATOM   5054  C C     . PHE B  1 442 ? 160.527 45.564  92.364  1.00 71.57  ? 442 PHE B C     1 
ATOM   5055  O O     . PHE B  1 442 ? 160.971 46.657  92.018  1.00 71.46  ? 442 PHE B O     1 
ATOM   5056  C CB    . PHE B  1 442 ? 160.032 46.128  94.707  1.00 69.69  ? 442 PHE B CB    1 
ATOM   5057  C CG    . PHE B  1 442 ? 159.117 46.064  95.886  1.00 68.98  ? 442 PHE B CG    1 
ATOM   5058  C CD1   . PHE B  1 442 ? 157.845 46.614  95.828  1.00 68.54  ? 442 PHE B CD1   1 
ATOM   5059  C CD2   . PHE B  1 442 ? 159.541 45.480  97.076  1.00 67.95  ? 442 PHE B CD2   1 
ATOM   5060  C CE1   . PHE B  1 442 ? 157.004 46.584  96.949  1.00 68.57  ? 442 PHE B CE1   1 
ATOM   5061  C CE2   . PHE B  1 442 ? 158.710 45.445  98.204  1.00 67.85  ? 442 PHE B CE2   1 
ATOM   5062  C CZ    . PHE B  1 442 ? 157.443 45.997  98.139  1.00 67.93  ? 442 PHE B CZ    1 
ATOM   5063  N N     . ILE B  1 443 ? 160.909 44.439  91.789  1.00 66.44  ? 443 ILE B N     1 
ATOM   5064  C CA    . ILE B  1 443 ? 161.955 44.490  90.795  1.00 63.83  ? 443 ILE B CA    1 
ATOM   5065  C C     . ILE B  1 443 ? 161.615 44.080  89.382  1.00 64.08  ? 443 ILE B C     1 
ATOM   5066  O O     . ILE B  1 443 ? 160.761 43.229  89.174  1.00 65.27  ? 443 ILE B O     1 
ATOM   5067  C CB    . ILE B  1 443 ? 163.098 43.637  91.263  1.00 25.01  ? 443 ILE B CB    1 
ATOM   5068  C CG1   . ILE B  1 443 ? 163.366 43.969  92.731  1.00 24.12  ? 443 ILE B CG1   1 
ATOM   5069  C CG2   . ILE B  1 443 ? 164.303 43.840  90.359  1.00 24.07  ? 443 ILE B CG2   1 
ATOM   5070  C CD1   . ILE B  1 443 ? 164.736 43.554  93.243  1.00 22.17  ? 443 ILE B CD1   1 
ATOM   5071  N N     . LEU B  1 444 ? 162.285 44.691  88.408  1.00 59.68  ? 444 LEU B N     1 
ATOM   5072  C CA    . LEU B  1 444 ? 162.086 44.325  87.007  1.00 58.66  ? 444 LEU B CA    1 
ATOM   5073  C C     . LEU B  1 444 ? 163.415 43.834  86.463  1.00 58.55  ? 444 LEU B C     1 
ATOM   5074  O O     . LEU B  1 444 ? 163.430 42.778  85.794  1.00 58.62  ? 444 LEU B O     1 
ATOM   5075  C CB    . LEU B  1 444 ? 161.603 45.505  86.164  1.00 45.33  ? 444 LEU B CB    1 
ATOM   5076  C CG    . LEU B  1 444 ? 161.658 45.354  84.632  1.00 43.52  ? 444 LEU B CG    1 
ATOM   5077  C CD1   . LEU B  1 444 ? 160.632 46.242  83.972  1.00 43.29  ? 444 LEU B CD1   1 
ATOM   5078  C CD2   . LEU B  1 444 ? 163.030 45.727  84.137  1.00 43.37  ? 444 LEU B CD2   1 
ATOM   5079  N N     . SER C  1 2   ? 146.487 30.386  144.550 1.00 137.50 ? 2   SER C N     1 
ATOM   5080  C CA    . SER C  1 2   ? 147.062 31.761  144.586 1.00 138.02 ? 2   SER C CA    1 
ATOM   5081  C C     . SER C  1 2   ? 146.686 32.537  143.319 1.00 136.22 ? 2   SER C C     1 
ATOM   5082  O O     . SER C  1 2   ? 146.561 33.771  143.334 1.00 135.95 ? 2   SER C O     1 
ATOM   5083  C CB    . SER C  1 2   ? 148.590 31.681  144.697 1.00 174.00 ? 2   SER C CB    1 
ATOM   5084  O OG    . SER C  1 2   ? 148.991 30.913  145.817 1.00 175.04 ? 2   SER C OG    1 
ATOM   5085  N N     . GLU C  1 3   ? 146.506 31.796  142.228 1.00 74.73  ? 3   GLU C N     1 
ATOM   5086  C CA    . GLU C  1 3   ? 146.176 32.385  140.937 1.00 70.85  ? 3   GLU C CA    1 
ATOM   5087  C C     . GLU C  1 3   ? 145.948 31.285  139.908 1.00 66.78  ? 3   GLU C C     1 
ATOM   5088  O O     . GLU C  1 3   ? 146.400 30.139  140.058 1.00 65.26  ? 3   GLU C O     1 
ATOM   5089  C CB    . GLU C  1 3   ? 147.318 33.290  140.461 1.00 113.28 ? 3   GLU C CB    1 
ATOM   5090  C CG    . GLU C  1 3   ? 146.993 34.122  139.247 1.00 114.66 ? 3   GLU C CG    1 
ATOM   5091  C CD    . GLU C  1 3   ? 145.773 34.963  139.480 1.00 115.60 ? 3   GLU C CD    1 
ATOM   5092  O OE1   . GLU C  1 3   ? 144.651 34.470  139.226 1.00 115.83 ? 3   GLU C OE1   1 
ATOM   5093  O OE2   . GLU C  1 3   ? 145.944 36.109  139.942 1.00 114.75 ? 3   GLU C OE2   1 
ATOM   5094  N N     . MET C  1 4   ? 145.254 31.656  138.847 1.00 47.27  ? 4   MET C N     1 
ATOM   5095  C CA    . MET C  1 4   ? 144.940 30.720  137.798 1.00 43.30  ? 4   MET C CA    1 
ATOM   5096  C C     . MET C  1 4   ? 146.196 30.255  137.119 1.00 40.18  ? 4   MET C C     1 
ATOM   5097  O O     . MET C  1 4   ? 147.283 30.619  137.533 1.00 39.36  ? 4   MET C O     1 
ATOM   5098  C CB    . MET C  1 4   ? 144.000 31.384  136.804 1.00 51.36  ? 4   MET C CB    1 
ATOM   5099  C CG    . MET C  1 4   ? 142.742 31.939  137.466 1.00 50.80  ? 4   MET C CG    1 
ATOM   5100  S SD    . MET C  1 4   ? 141.316 32.003  136.366 1.00 50.86  ? 4   MET C SD    1 
ATOM   5101  C CE    . MET C  1 4   ? 141.713 30.795  135.113 1.00 45.73  ? 4   MET C CE    1 
ATOM   5102  N N     . THR C  1 5   ? 146.046 29.461  136.067 1.00 25.70  ? 5   THR C N     1 
ATOM   5103  C CA    . THR C  1 5   ? 147.198 28.937  135.351 1.00 24.07  ? 5   THR C CA    1 
ATOM   5104  C C     . THR C  1 5   ? 147.029 29.077  133.850 1.00 22.57  ? 5   THR C C     1 
ATOM   5105  O O     . THR C  1 5   ? 145.951 29.397  133.382 1.00 20.97  ? 5   THR C O     1 
ATOM   5106  C CB    . THR C  1 5   ? 147.391 27.464  135.674 1.00 59.07  ? 5   THR C CB    1 
ATOM   5107  O OG1   . THR C  1 5   ? 146.753 26.661  134.671 1.00 59.32  ? 5   THR C OG1   1 
ATOM   5108  C CG2   . THR C  1 5   ? 146.773 27.163  137.017 1.00 59.98  ? 5   THR C CG2   1 
ATOM   5109  N N     . PRO C  1 6   ? 148.105 28.845  133.080 1.00 35.44  ? 6   PRO C N     1 
ATOM   5110  C CA    . PRO C  1 6   ? 148.091 28.935  131.625 1.00 35.31  ? 6   PRO C CA    1 
ATOM   5111  C C     . PRO C  1 6   ? 146.836 28.324  131.042 1.00 36.09  ? 6   PRO C C     1 
ATOM   5112  O O     . PRO C  1 6   ? 145.965 29.038  130.537 1.00 36.72  ? 6   PRO C O     1 
ATOM   5113  C CB    . PRO C  1 6   ? 149.333 28.161  131.245 1.00 53.11  ? 6   PRO C CB    1 
ATOM   5114  C CG    . PRO C  1 6   ? 150.287 28.585  132.275 1.00 53.59  ? 6   PRO C CG    1 
ATOM   5115  C CD    . PRO C  1 6   ? 149.461 28.501  133.547 1.00 54.23  ? 6   PRO C CD    1 
ATOM   5116  N N     . ARG C  1 7   ? 146.732 26.999  131.144 1.00 55.29  ? 7   ARG C N     1 
ATOM   5117  C CA    . ARG C  1 7   ? 145.592 26.252  130.600 1.00 56.21  ? 7   ARG C CA    1 
ATOM   5118  C C     . ARG C  1 7   ? 144.301 26.645  131.299 1.00 54.78  ? 7   ARG C C     1 
ATOM   5119  O O     . ARG C  1 7   ? 143.227 26.698  130.697 1.00 53.89  ? 7   ARG C O     1 
ATOM   5120  C CB    . ARG C  1 7   ? 145.860 24.749  130.749 1.00 167.16 ? 7   ARG C CB    1 
ATOM   5121  C CG    . ARG C  1 7   ? 145.083 23.833  129.803 1.00 173.22 ? 7   ARG C CG    1 
ATOM   5122  C CD    . ARG C  1 7   ? 145.723 22.445  129.778 1.00 177.72 ? 7   ARG C CD    1 
ATOM   5123  N NE    . ARG C  1 7   ? 146.191 22.065  131.107 1.00 183.53 ? 7   ARG C NE    1 
ATOM   5124  C CZ    . ARG C  1 7   ? 145.395 21.864  132.151 1.00 187.03 ? 7   ARG C CZ    1 
ATOM   5125  N NH1   . ARG C  1 7   ? 144.081 21.995  132.021 1.00 186.59 ? 7   ARG C NH1   1 
ATOM   5126  N NH2   . ARG C  1 7   ? 145.912 21.561  133.336 1.00 188.66 ? 7   ARG C NH2   1 
ATOM   5127  N N     . GLU C  1 8   ? 144.441 26.947  132.579 1.00 61.01  ? 8   GLU C N     1 
ATOM   5128  C CA    . GLU C  1 8   ? 143.332 27.340  133.421 1.00 59.82  ? 8   GLU C CA    1 
ATOM   5129  C C     . GLU C  1 8   ? 142.671 28.624  132.917 1.00 57.27  ? 8   GLU C C     1 
ATOM   5130  O O     . GLU C  1 8   ? 141.446 28.710  132.868 1.00 57.07  ? 8   GLU C O     1 
ATOM   5131  C CB    . GLU C  1 8   ? 143.852 27.514  134.851 1.00 107.33 ? 8   GLU C CB    1 
ATOM   5132  C CG    . GLU C  1 8   ? 142.813 27.430  135.950 1.00 111.63 ? 8   GLU C CG    1 
ATOM   5133  C CD    . GLU C  1 8   ? 143.359 26.747  137.192 1.00 114.49 ? 8   GLU C CD    1 
ATOM   5134  O OE1   . GLU C  1 8   ? 143.455 25.498  137.184 1.00 114.41 ? 8   GLU C OE1   1 
ATOM   5135  O OE2   . GLU C  1 8   ? 143.706 27.454  138.167 1.00 115.69 ? 8   GLU C OE2   1 
ATOM   5136  N N     . ILE C  1 9   ? 143.480 29.610  132.530 1.00 44.85  ? 9   ILE C N     1 
ATOM   5137  C CA    . ILE C  1 9   ? 142.960 30.888  132.047 1.00 40.61  ? 9   ILE C CA    1 
ATOM   5138  C C     . ILE C  1 9   ? 142.345 30.771  130.674 1.00 38.93  ? 9   ILE C C     1 
ATOM   5139  O O     . ILE C  1 9   ? 141.352 31.431  130.388 1.00 38.53  ? 9   ILE C O     1 
ATOM   5140  C CB    . ILE C  1 9   ? 144.035 31.965  131.908 1.00 26.84  ? 9   ILE C CB    1 
ATOM   5141  C CG1   . ILE C  1 9   ? 144.908 32.043  133.143 1.00 26.20  ? 9   ILE C CG1   1 
ATOM   5142  C CG2   . ILE C  1 9   ? 143.370 33.307  131.731 1.00 26.39  ? 9   ILE C CG2   1 
ATOM   5143  C CD1   . ILE C  1 9   ? 145.957 33.115  133.020 1.00 25.84  ? 9   ILE C CD1   1 
ATOM   5144  N N     . VAL C  1 10  ? 142.954 29.970  129.808 1.00 17.85  ? 10  VAL C N     1 
ATOM   5145  C CA    . VAL C  1 10  ? 142.413 29.807  128.469 1.00 17.65  ? 10  VAL C CA    1 
ATOM   5146  C C     . VAL C  1 10  ? 140.979 29.292  128.584 1.00 19.58  ? 10  VAL C C     1 
ATOM   5147  O O     . VAL C  1 10  ? 140.084 29.704  127.829 1.00 18.14  ? 10  VAL C O     1 
ATOM   5148  C CB    . VAL C  1 10  ? 143.246 28.813  127.658 1.00 8.00   ? 10  VAL C CB    1 
ATOM   5149  C CG1   . VAL C  1 10  ? 142.767 28.731  126.205 1.00 5.26   ? 10  VAL C CG1   1 
ATOM   5150  C CG2   . VAL C  1 10  ? 144.663 29.247  127.688 1.00 9.32   ? 10  VAL C CG2   1 
ATOM   5151  N N     . SER C  1 11  ? 140.758 28.380  129.528 1.00 49.03  ? 11  SER C N     1 
ATOM   5152  C CA    . SER C  1 11  ? 139.422 27.840  129.746 1.00 52.29  ? 11  SER C CA    1 
ATOM   5153  C C     . SER C  1 11  ? 138.494 29.036  129.908 1.00 52.65  ? 11  SER C C     1 
ATOM   5154  O O     . SER C  1 11  ? 137.645 29.271  129.059 1.00 53.39  ? 11  SER C O     1 
ATOM   5155  C CB    . SER C  1 11  ? 139.407 26.980  131.004 1.00 116.62 ? 11  SER C CB    1 
ATOM   5156  O OG    . SER C  1 11  ? 140.378 25.954  130.910 1.00 122.60 ? 11  SER C OG    1 
ATOM   5157  N N     . GLU C  1 12  ? 138.689 29.798  130.988 1.00 47.04  ? 12  GLU C N     1 
ATOM   5158  C CA    . GLU C  1 12  ? 137.915 31.020  131.291 1.00 46.68  ? 12  GLU C CA    1 
ATOM   5159  C C     . GLU C  1 12  ? 137.689 31.889  130.046 1.00 44.18  ? 12  GLU C C     1 
ATOM   5160  O O     . GLU C  1 12  ? 136.596 32.405  129.819 1.00 42.00  ? 12  GLU C O     1 
ATOM   5161  C CB    . GLU C  1 12  ? 138.655 31.852  132.342 1.00 88.46  ? 12  GLU C CB    1 
ATOM   5162  C CG    . GLU C  1 12  ? 137.923 33.099  132.809 1.00 94.64  ? 12  GLU C CG    1 
ATOM   5163  C CD    . GLU C  1 12  ? 136.684 32.783  133.622 1.00 100.05 ? 12  GLU C CD    1 
ATOM   5164  O OE1   . GLU C  1 12  ? 136.761 31.871  134.476 1.00 102.98 ? 12  GLU C OE1   1 
ATOM   5165  O OE2   . GLU C  1 12  ? 135.642 33.453  133.419 1.00 101.55 ? 12  GLU C OE2   1 
ATOM   5166  N N     . LEU C  1 13  ? 138.737 32.059  129.248 1.00 33.02  ? 13  LEU C N     1 
ATOM   5167  C CA    . LEU C  1 13  ? 138.637 32.843  128.031 1.00 32.00  ? 13  LEU C CA    1 
ATOM   5168  C C     . LEU C  1 13  ? 137.765 32.147  127.014 1.00 32.11  ? 13  LEU C C     1 
ATOM   5169  O O     . LEU C  1 13  ? 137.007 32.786  126.311 1.00 31.38  ? 13  LEU C O     1 
ATOM   5170  C CB    . LEU C  1 13  ? 140.011 33.064  127.409 1.00 33.68  ? 13  LEU C CB    1 
ATOM   5171  C CG    . LEU C  1 13  ? 141.040 33.901  128.151 1.00 31.69  ? 13  LEU C CG    1 
ATOM   5172  C CD1   . LEU C  1 13  ? 142.191 34.097  127.176 1.00 30.54  ? 13  LEU C CD1   1 
ATOM   5173  C CD2   . LEU C  1 13  ? 140.471 35.251  128.611 1.00 29.18  ? 13  LEU C CD2   1 
ATOM   5174  N N     . ASP C  1 14  ? 137.889 30.836  126.910 1.00 54.06  ? 14  ASP C N     1 
ATOM   5175  C CA    . ASP C  1 14  ? 137.076 30.130  125.942 1.00 58.22  ? 14  ASP C CA    1 
ATOM   5176  C C     . ASP C  1 14  ? 135.602 30.351  126.241 1.00 59.26  ? 14  ASP C C     1 
ATOM   5177  O O     . ASP C  1 14  ? 134.743 30.116  125.387 1.00 60.72  ? 14  ASP C O     1 
ATOM   5178  C CB    . ASP C  1 14  ? 137.376 28.633  125.961 1.00 110.92 ? 14  ASP C CB    1 
ATOM   5179  C CG    . ASP C  1 14  ? 138.715 28.305  125.367 1.00 114.74 ? 14  ASP C CG    1 
ATOM   5180  O OD1   . ASP C  1 14  ? 138.971 28.718  124.217 1.00 115.57 ? 14  ASP C OD1   1 
ATOM   5181  O OD2   . ASP C  1 14  ? 139.505 27.626  126.052 1.00 117.62 ? 14  ASP C OD2   1 
ATOM   5182  N N     . GLN C  1 15  ? 135.306 30.792  127.456 1.00 52.18  ? 15  GLN C N     1 
ATOM   5183  C CA    . GLN C  1 15  ? 133.929 31.024  127.823 1.00 53.57  ? 15  GLN C CA    1 
ATOM   5184  C C     . GLN C  1 15  ? 133.306 32.194  127.061 1.00 52.31  ? 15  GLN C C     1 
ATOM   5185  O O     . GLN C  1 15  ? 132.119 32.154  126.760 1.00 53.37  ? 15  GLN C O     1 
ATOM   5186  C CB    . GLN C  1 15  ? 133.818 31.230  129.327 1.00 111.56 ? 15  GLN C CB    1 
ATOM   5187  C CG    . GLN C  1 15  ? 133.524 29.935  130.052 1.00 118.91 ? 15  GLN C CG    1 
ATOM   5188  C CD    . GLN C  1 15  ? 133.568 30.078  131.558 1.00 124.42 ? 15  GLN C CD    1 
ATOM   5189  O OE1   . GLN C  1 15  ? 133.086 31.065  132.115 1.00 125.60 ? 15  GLN C OE1   1 
ATOM   5190  N NE2   . GLN C  1 15  ? 134.137 29.081  132.231 1.00 126.98 ? 15  GLN C NE2   1 
ATOM   5191  N N     . HIS C  1 16  ? 134.091 33.216  126.712 1.00 49.37  ? 16  HIS C N     1 
ATOM   5192  C CA    . HIS C  1 16  ? 133.556 34.369  125.979 1.00 46.76  ? 16  HIS C CA    1 
ATOM   5193  C C     . HIS C  1 16  ? 134.021 34.597  124.554 1.00 43.98  ? 16  HIS C C     1 
ATOM   5194  O O     . HIS C  1 16  ? 133.381 35.334  123.825 1.00 44.36  ? 16  HIS C O     1 
ATOM   5195  C CB    . HIS C  1 16  ? 133.840 35.642  126.723 1.00 48.04  ? 16  HIS C CB    1 
ATOM   5196  C CG    . HIS C  1 16  ? 133.408 35.609  128.140 1.00 51.84  ? 16  HIS C CG    1 
ATOM   5197  N ND1   . HIS C  1 16  ? 134.004 34.790  129.070 1.00 54.26  ? 16  HIS C ND1   1 
ATOM   5198  C CD2   . HIS C  1 16  ? 132.478 36.332  128.802 1.00 53.13  ? 16  HIS C CD2   1 
ATOM   5199  C CE1   . HIS C  1 16  ? 133.465 35.016  130.252 1.00 56.54  ? 16  HIS C CE1   1 
ATOM   5200  N NE2   . HIS C  1 16  ? 132.536 35.949  130.118 1.00 57.31  ? 16  HIS C NE2   1 
ATOM   5201  N N     . ILE C  1 17  ? 135.149 34.023  124.161 1.00 14.49  ? 17  ILE C N     1 
ATOM   5202  C CA    . ILE C  1 17  ? 135.636 34.206  122.803 1.00 10.79  ? 17  ILE C CA    1 
ATOM   5203  C C     . ILE C  1 17  ? 135.676 32.878  122.109 1.00 9.07   ? 17  ILE C C     1 
ATOM   5204  O O     . ILE C  1 17  ? 136.097 31.888  122.683 1.00 7.35   ? 17  ILE C O     1 
ATOM   5205  C CB    . ILE C  1 17  ? 137.061 34.752  122.741 1.00 27.22  ? 17  ILE C CB    1 
ATOM   5206  C CG1   . ILE C  1 17  ? 137.195 36.066  123.520 1.00 28.46  ? 17  ILE C CG1   1 
ATOM   5207  C CG2   . ILE C  1 17  ? 137.420 34.986  121.291 1.00 26.95  ? 17  ILE C CG2   1 
ATOM   5208  C CD1   . ILE C  1 17  ? 137.221 35.945  125.037 1.00 27.97  ? 17  ILE C CD1   1 
ATOM   5209  N N     . ILE C  1 18  ? 135.256 32.859  120.859 1.00 13.06  ? 18  ILE C N     1 
ATOM   5210  C CA    . ILE C  1 18  ? 135.258 31.626  120.086 1.00 13.75  ? 18  ILE C CA    1 
ATOM   5211  C C     . ILE C  1 18  ? 136.506 31.609  119.260 1.00 13.41  ? 18  ILE C C     1 
ATOM   5212  O O     . ILE C  1 18  ? 136.833 32.604  118.651 1.00 13.21  ? 18  ILE C O     1 
ATOM   5213  C CB    . ILE C  1 18  ? 134.073 31.574  119.124 1.00 34.43  ? 18  ILE C CB    1 
ATOM   5214  C CG1   . ILE C  1 18  ? 132.774 31.546  119.909 1.00 33.88  ? 18  ILE C CG1   1 
ATOM   5215  C CG2   . ILE C  1 18  ? 134.188 30.397  118.225 1.00 33.44  ? 18  ILE C CG2   1 
ATOM   5216  C CD1   . ILE C  1 18  ? 132.769 30.538  120.986 1.00 36.83  ? 18  ILE C CD1   1 
ATOM   5217  N N     . GLY C  1 19  ? 137.211 30.491  119.237 1.00 28.53  ? 19  GLY C N     1 
ATOM   5218  C CA    . GLY C  1 19  ? 138.421 30.427  118.430 1.00 30.93  ? 19  GLY C CA    1 
ATOM   5219  C C     . GLY C  1 19  ? 139.563 31.312  118.894 1.00 31.14  ? 19  GLY C C     1 
ATOM   5220  O O     . GLY C  1 19  ? 139.697 31.583  120.092 1.00 28.55  ? 19  GLY C O     1 
ATOM   5221  N N     . GLN C  1 20  ? 140.388 31.756  117.947 1.00 49.69  ? 20  GLN C N     1 
ATOM   5222  C CA    . GLN C  1 20  ? 141.521 32.611  118.285 1.00 52.86  ? 20  GLN C CA    1 
ATOM   5223  C C     . GLN C  1 20  ? 142.216 31.960  119.481 1.00 54.94  ? 20  GLN C C     1 
ATOM   5224  O O     . GLN C  1 20  ? 142.113 32.431  120.621 1.00 54.42  ? 20  GLN C O     1 
ATOM   5225  C CB    . GLN C  1 20  ? 141.036 34.027  118.660 1.00 26.80  ? 20  GLN C CB    1 
ATOM   5226  C CG    . GLN C  1 20  ? 140.150 34.748  117.628 1.00 22.74  ? 20  GLN C CG    1 
ATOM   5227  C CD    . GLN C  1 20  ? 140.682 34.653  116.211 1.00 20.69  ? 20  GLN C CD    1 
ATOM   5228  O OE1   . GLN C  1 20  ? 140.829 35.657  115.523 1.00 18.76  ? 20  GLN C OE1   1 
ATOM   5229  N NE2   . GLN C  1 20  ? 140.956 33.435  115.767 1.00 18.02  ? 20  GLN C NE2   1 
ATOM   5230  N N     . ALA C  1 21  ? 142.912 30.861  119.221 1.00 54.45  ? 21  ALA C N     1 
ATOM   5231  C CA    . ALA C  1 21  ? 143.591 30.130  120.288 1.00 55.52  ? 21  ALA C CA    1 
ATOM   5232  C C     . ALA C  1 21  ? 144.913 30.723  120.699 1.00 56.82  ? 21  ALA C C     1 
ATOM   5233  O O     . ALA C  1 21  ? 145.104 31.124  121.859 1.00 57.16  ? 21  ALA C O     1 
ATOM   5234  C CB    . ALA C  1 21  ? 143.815 28.715  119.869 1.00 26.91  ? 21  ALA C CB    1 
ATOM   5235  N N     . ASP C  1 22  ? 145.830 30.739  119.732 1.00 44.99  ? 22  ASP C N     1 
ATOM   5236  C CA    . ASP C  1 22  ? 147.176 31.253  119.925 1.00 44.44  ? 22  ASP C CA    1 
ATOM   5237  C C     . ASP C  1 22  ? 147.093 32.482  120.792 1.00 42.22  ? 22  ASP C C     1 
ATOM   5238  O O     . ASP C  1 22  ? 147.794 32.597  121.793 1.00 42.16  ? 22  ASP C O     1 
ATOM   5239  C CB    . ASP C  1 22  ? 147.806 31.595  118.578 1.00 100.48 ? 22  ASP C CB    1 
ATOM   5240  C CG    . ASP C  1 22  ? 147.704 30.456  117.584 1.00 105.68 ? 22  ASP C CG    1 
ATOM   5241  O OD1   . ASP C  1 22  ? 147.998 29.301  117.960 1.00 107.98 ? 22  ASP C OD1   1 
ATOM   5242  O OD2   . ASP C  1 22  ? 147.335 30.715  116.420 1.00 109.01 ? 22  ASP C OD2   1 
ATOM   5243  N N     . ALA C  1 23  ? 146.204 33.389  120.421 1.00 34.95  ? 23  ALA C N     1 
ATOM   5244  C CA    . ALA C  1 23  ? 146.028 34.609  121.181 1.00 33.15  ? 23  ALA C CA    1 
ATOM   5245  C C     . ALA C  1 23  ? 145.757 34.333  122.663 1.00 32.08  ? 23  ALA C C     1 
ATOM   5246  O O     . ALA C  1 23  ? 146.455 34.855  123.549 1.00 30.53  ? 23  ALA C O     1 
ATOM   5247  C CB    . ALA C  1 23  ? 144.894 35.411  120.586 1.00 5.72   ? 23  ALA C CB    1 
ATOM   5248  N N     . LYS C  1 24  ? 144.743 33.511  122.928 1.00 28.36  ? 24  LYS C N     1 
ATOM   5249  C CA    . LYS C  1 24  ? 144.365 33.184  124.294 1.00 27.60  ? 24  LYS C CA    1 
ATOM   5250  C C     . LYS C  1 24  ? 145.550 32.654  125.072 1.00 27.29  ? 24  LYS C C     1 
ATOM   5251  O O     . LYS C  1 24  ? 145.790 33.043  126.216 1.00 26.31  ? 24  LYS C O     1 
ATOM   5252  C CB    . LYS C  1 24  ? 143.239 32.170  124.281 1.00 52.27  ? 24  LYS C CB    1 
ATOM   5253  C CG    . LYS C  1 24  ? 141.876 32.770  123.995 1.00 51.89  ? 24  LYS C CG    1 
ATOM   5254  C CD    . LYS C  1 24  ? 140.914 31.687  123.518 1.00 52.77  ? 24  LYS C CD    1 
ATOM   5255  C CE    . LYS C  1 24  ? 139.477 32.163  123.475 1.00 53.04  ? 24  LYS C CE    1 
ATOM   5256  N NZ    . LYS C  1 24  ? 138.643 31.221  122.687 1.00 55.68  ? 24  LYS C NZ    1 
ATOM   5257  N N     . ARG C  1 25  ? 146.296 31.768  124.438 1.00 35.76  ? 25  ARG C N     1 
ATOM   5258  C CA    . ARG C  1 25  ? 147.480 31.192  125.056 1.00 37.64  ? 25  ARG C CA    1 
ATOM   5259  C C     . ARG C  1 25  ? 148.445 32.321  125.415 1.00 36.84  ? 25  ARG C C     1 
ATOM   5260  O O     . ARG C  1 25  ? 148.872 32.477  126.564 1.00 35.55  ? 25  ARG C O     1 
ATOM   5261  C CB    . ARG C  1 25  ? 148.150 30.259  124.061 1.00 57.68  ? 25  ARG C CB    1 
ATOM   5262  C CG    . ARG C  1 25  ? 148.639 28.967  124.636 1.00 61.32  ? 25  ARG C CG    1 
ATOM   5263  C CD    . ARG C  1 25  ? 148.567 27.922  123.552 1.00 66.74  ? 25  ARG C CD    1 
ATOM   5264  N NE    . ARG C  1 25  ? 149.169 26.652  123.939 1.00 71.84  ? 25  ARG C NE    1 
ATOM   5265  C CZ    . ARG C  1 25  ? 150.475 26.463  124.116 1.00 74.76  ? 25  ARG C CZ    1 
ATOM   5266  N NH1   . ARG C  1 25  ? 151.321 27.474  123.943 1.00 73.73  ? 25  ARG C NH1   1 
ATOM   5267  N NH2   . ARG C  1 25  ? 150.938 25.256  124.447 1.00 76.55  ? 25  ARG C NH2   1 
ATOM   5268  N N     . ALA C  1 26  ? 148.782 33.104  124.400 1.00 31.72  ? 26  ALA C N     1 
ATOM   5269  C CA    . ALA C  1 26  ? 149.688 34.213  124.561 1.00 30.61  ? 26  ALA C CA    1 
ATOM   5270  C C     . ALA C  1 26  ? 149.364 35.036  125.795 1.00 28.71  ? 26  ALA C C     1 
ATOM   5271  O O     . ALA C  1 26  ? 150.218 35.186  126.661 1.00 27.27  ? 26  ALA C O     1 
ATOM   5272  C CB    . ALA C  1 26  ? 149.648 35.085  123.328 1.00 84.34  ? 26  ALA C CB    1 
ATOM   5273  N N     . VAL C  1 27  ? 148.149 35.570  125.898 1.00 17.66  ? 27  VAL C N     1 
ATOM   5274  C CA    . VAL C  1 27  ? 147.858 36.381  127.073 1.00 18.20  ? 27  VAL C CA    1 
ATOM   5275  C C     . VAL C  1 27  ? 147.899 35.542  128.332 1.00 18.72  ? 27  VAL C C     1 
ATOM   5276  O O     . VAL C  1 27  ? 148.166 36.054  129.426 1.00 17.58  ? 27  VAL C O     1 
ATOM   5277  C CB    . VAL C  1 27  ? 146.494 37.077  127.003 1.00 23.25  ? 27  VAL C CB    1 
ATOM   5278  C CG1   . VAL C  1 27  ? 146.606 38.325  126.198 1.00 22.17  ? 27  VAL C CG1   1 
ATOM   5279  C CG2   . VAL C  1 27  ? 145.473 36.158  126.411 1.00 23.58  ? 27  VAL C CG2   1 
ATOM   5280  N N     . ALA C  1 28  ? 147.645 34.246  128.176 1.00 42.39  ? 28  ALA C N     1 
ATOM   5281  C CA    . ALA C  1 28  ? 147.648 33.338  129.311 1.00 43.44  ? 28  ALA C CA    1 
ATOM   5282  C C     . ALA C  1 28  ? 149.050 33.229  129.900 1.00 42.94  ? 28  ALA C C     1 
ATOM   5283  O O     . ALA C  1 28  ? 149.273 33.603  131.062 1.00 42.07  ? 28  ALA C O     1 
ATOM   5284  C CB    . ALA C  1 28  ? 147.149 31.975  128.878 1.00 68.11  ? 28  ALA C CB    1 
ATOM   5285  N N     . ILE C  1 29  ? 149.988 32.730  129.091 1.00 21.55  ? 29  ILE C N     1 
ATOM   5286  C CA    . ILE C  1 29  ? 151.373 32.565  129.535 1.00 22.07  ? 29  ILE C CA    1 
ATOM   5287  C C     . ILE C  1 29  ? 151.843 33.875  130.083 1.00 21.51  ? 29  ILE C C     1 
ATOM   5288  O O     . ILE C  1 29  ? 152.711 33.914  130.936 1.00 20.14  ? 29  ILE C O     1 
ATOM   5289  C CB    . ILE C  1 29  ? 152.345 32.201  128.401 1.00 33.67  ? 29  ILE C CB    1 
ATOM   5290  C CG1   . ILE C  1 29  ? 152.204 33.215  127.278 1.00 38.50  ? 29  ILE C CG1   1 
ATOM   5291  C CG2   . ILE C  1 29  ? 152.068 30.837  127.860 1.00 33.14  ? 29  ILE C CG2   1 
ATOM   5292  C CD1   . ILE C  1 29  ? 153.109 32.954  126.064 1.00 44.96  ? 29  ILE C CD1   1 
ATOM   5293  N N     . ALA C  1 30  ? 151.265 34.953  129.569 1.00 32.11  ? 30  ALA C N     1 
ATOM   5294  C CA    . ALA C  1 30  ? 151.631 36.294  129.984 1.00 33.54  ? 30  ALA C CA    1 
ATOM   5295  C C     . ALA C  1 30  ? 151.102 36.573  131.372 1.00 34.52  ? 30  ALA C C     1 
ATOM   5296  O O     . ALA C  1 30  ? 151.850 36.952  132.276 1.00 35.62  ? 30  ALA C O     1 
ATOM   5297  C CB    . ALA C  1 30  ? 151.069 37.295  129.007 1.00 22.15  ? 30  ALA C CB    1 
ATOM   5298  N N     . LEU C  1 31  ? 149.802 36.375  131.544 1.00 33.28  ? 31  LEU C N     1 
ATOM   5299  C CA    . LEU C  1 31  ? 149.191 36.627  132.828 1.00 33.47  ? 31  LEU C CA    1 
ATOM   5300  C C     . LEU C  1 31  ? 149.819 35.738  133.858 1.00 34.60  ? 31  LEU C C     1 
ATOM   5301  O O     . LEU C  1 31  ? 150.016 36.129  135.006 1.00 35.23  ? 31  LEU C O     1 
ATOM   5302  C CB    . LEU C  1 31  ? 147.708 36.355  132.769 1.00 19.73  ? 31  LEU C CB    1 
ATOM   5303  C CG    . LEU C  1 31  ? 147.068 36.628  134.122 1.00 21.06  ? 31  LEU C CG    1 
ATOM   5304  C CD1   . LEU C  1 31  ? 147.608 37.923  134.753 1.00 21.10  ? 31  LEU C CD1   1 
ATOM   5305  C CD2   . LEU C  1 31  ? 145.561 36.700  133.914 1.00 21.81  ? 31  LEU C CD2   1 
ATOM   5306  N N     . ARG C  1 32  ? 150.141 34.530  133.438 1.00 24.08  ? 32  ARG C N     1 
ATOM   5307  C CA    . ARG C  1 32  ? 150.754 33.600  134.348 1.00 26.81  ? 32  ARG C CA    1 
ATOM   5308  C C     . ARG C  1 32  ? 152.155 34.046  134.814 1.00 27.61  ? 32  ARG C C     1 
ATOM   5309  O O     . ARG C  1 32  ? 152.477 33.938  136.000 1.00 26.91  ? 32  ARG C O     1 
ATOM   5310  C CB    . ARG C  1 32  ? 150.822 32.225  133.701 1.00 81.84  ? 32  ARG C CB    1 
ATOM   5311  C CG    . ARG C  1 32  ? 151.317 31.138  134.625 1.00 85.95  ? 32  ARG C CG    1 
ATOM   5312  C CD    . ARG C  1 32  ? 150.502 31.077  135.900 1.00 89.09  ? 32  ARG C CD    1 
ATOM   5313  N NE    . ARG C  1 32  ? 150.812 29.880  136.671 1.00 91.70  ? 32  ARG C NE    1 
ATOM   5314  C CZ    . ARG C  1 32  ? 150.501 29.709  137.952 1.00 92.72  ? 32  ARG C CZ    1 
ATOM   5315  N NH1   . ARG C  1 32  ? 149.868 30.665  138.620 1.00 92.70  ? 32  ARG C NH1   1 
ATOM   5316  N NH2   . ARG C  1 32  ? 150.832 28.582  138.570 1.00 92.00  ? 32  ARG C NH2   1 
ATOM   5317  N N     . ASN C  1 33  ? 152.989 34.551  133.900 1.00 25.60  ? 33  ASN C N     1 
ATOM   5318  C CA    . ASN C  1 33  ? 154.339 34.980  134.270 1.00 26.22  ? 33  ASN C CA    1 
ATOM   5319  C C     . ASN C  1 33  ? 154.248 35.995  135.373 1.00 25.98  ? 33  ASN C C     1 
ATOM   5320  O O     . ASN C  1 33  ? 155.182 36.172  136.134 1.00 24.38  ? 33  ASN C O     1 
ATOM   5321  C CB    . ASN C  1 33  ? 155.085 35.574  133.073 1.00 68.10  ? 33  ASN C CB    1 
ATOM   5322  C CG    . ASN C  1 33  ? 155.722 34.501  132.196 1.00 71.94  ? 33  ASN C CG    1 
ATOM   5323  O OD1   . ASN C  1 33  ? 156.209 33.500  132.700 1.00 72.78  ? 33  ASN C OD1   1 
ATOM   5324  N ND2   . ASN C  1 33  ? 155.733 34.715  130.884 1.00 75.28  ? 33  ASN C ND2   1 
ATOM   5325  N N     . ARG C  1 34  ? 153.095 36.638  135.478 1.00 32.65  ? 34  ARG C N     1 
ATOM   5326  C CA    . ARG C  1 34  ? 152.914 37.643  136.505 1.00 35.75  ? 34  ARG C CA    1 
ATOM   5327  C C     . ARG C  1 34  ? 152.994 37.024  137.888 1.00 37.19  ? 34  ARG C C     1 
ATOM   5328  O O     . ARG C  1 34  ? 153.606 37.565  138.807 1.00 36.63  ? 34  ARG C O     1 
ATOM   5329  C CB    . ARG C  1 34  ? 151.572 38.348  136.337 1.00 45.35  ? 34  ARG C CB    1 
ATOM   5330  C CG    . ARG C  1 34  ? 151.569 39.720  136.986 1.00 47.57  ? 34  ARG C CG    1 
ATOM   5331  C CD    . ARG C  1 34  ? 151.748 40.845  135.959 1.00 48.84  ? 34  ARG C CD    1 
ATOM   5332  N NE    . ARG C  1 34  ? 150.448 41.389  135.569 1.00 50.65  ? 34  ARG C NE    1 
ATOM   5333  C CZ    . ARG C  1 34  ? 150.273 42.546  134.945 1.00 51.69  ? 34  ARG C CZ    1 
ATOM   5334  N NH1   . ARG C  1 34  ? 151.324 43.296  134.624 1.00 50.63  ? 34  ARG C NH1   1 
ATOM   5335  N NH2   . ARG C  1 34  ? 149.040 42.963  134.673 1.00 51.50  ? 34  ARG C NH2   1 
ATOM   5336  N N     . TRP C  1 35  ? 152.354 35.883  138.042 1.00 70.23  ? 35  TRP C N     1 
ATOM   5337  C CA    . TRP C  1 35  ? 152.369 35.217  139.323 1.00 71.73  ? 35  TRP C CA    1 
ATOM   5338  C C     . TRP C  1 35  ? 153.766 34.661  139.561 1.00 70.90  ? 35  TRP C C     1 
ATOM   5339  O O     . TRP C  1 35  ? 154.281 34.737  140.674 1.00 71.51  ? 35  TRP C O     1 
ATOM   5340  C CB    . TRP C  1 35  ? 151.313 34.096  139.334 1.00 76.60  ? 35  TRP C CB    1 
ATOM   5341  C CG    . TRP C  1 35  ? 151.475 33.074  140.435 1.00 77.33  ? 35  TRP C CG    1 
ATOM   5342  C CD1   . TRP C  1 35  ? 151.092 33.190  141.746 1.00 76.82  ? 35  TRP C CD1   1 
ATOM   5343  C CD2   . TRP C  1 35  ? 152.131 31.815  140.319 1.00 76.61  ? 35  TRP C CD2   1 
ATOM   5344  N NE1   . TRP C  1 35  ? 151.476 32.077  142.446 1.00 75.91  ? 35  TRP C NE1   1 
ATOM   5345  C CE2   . TRP C  1 35  ? 152.116 31.219  141.591 1.00 76.57  ? 35  TRP C CE2   1 
ATOM   5346  C CE3   . TRP C  1 35  ? 152.736 31.135  139.259 1.00 76.30  ? 35  TRP C CE3   1 
ATOM   5347  C CZ2   . TRP C  1 35  ? 152.685 29.974  141.830 1.00 77.66  ? 35  TRP C CZ2   1 
ATOM   5348  C CZ3   . TRP C  1 35  ? 153.299 29.903  139.496 1.00 76.89  ? 35  TRP C CZ3   1 
ATOM   5349  C CH2   . TRP C  1 35  ? 153.271 29.332  140.771 1.00 77.42  ? 35  TRP C CH2   1 
ATOM   5350  N N     . ARG C  1 36  ? 154.385 34.127  138.512 1.00 21.55  ? 36  ARG C N     1 
ATOM   5351  C CA    . ARG C  1 36  ? 155.715 33.540  138.638 1.00 21.37  ? 36  ARG C CA    1 
ATOM   5352  C C     . ARG C  1 36  ? 156.672 34.565  139.209 1.00 23.00  ? 36  ARG C C     1 
ATOM   5353  O O     . ARG C  1 36  ? 157.225 34.371  140.281 1.00 22.90  ? 36  ARG C O     1 
ATOM   5354  C CB    . ARG C  1 36  ? 156.191 33.022  137.286 1.00 33.66  ? 36  ARG C CB    1 
ATOM   5355  C CG    . ARG C  1 36  ? 155.295 31.937  136.751 1.00 30.32  ? 36  ARG C CG    1 
ATOM   5356  C CD    . ARG C  1 36  ? 155.641 31.585  135.354 1.00 28.37  ? 36  ARG C CD    1 
ATOM   5357  N NE    . ARG C  1 36  ? 154.843 30.455  134.920 1.00 27.50  ? 36  ARG C NE    1 
ATOM   5358  C CZ    . ARG C  1 36  ? 155.023 29.812  133.773 1.00 29.04  ? 36  ARG C CZ    1 
ATOM   5359  N NH1   . ARG C  1 36  ? 155.989 30.205  132.943 1.00 28.64  ? 36  ARG C NH1   1 
ATOM   5360  N NH2   . ARG C  1 36  ? 154.236 28.778  133.458 1.00 28.18  ? 36  ARG C NH2   1 
ATOM   5361  N N     . ARG C  1 37  ? 156.886 35.662  138.505 1.00 40.76  ? 37  ARG C N     1 
ATOM   5362  C CA    . ARG C  1 37  ? 157.727 36.699  139.070 1.00 44.35  ? 37  ARG C CA    1 
ATOM   5363  C C     . ARG C  1 37  ? 156.891 37.100  140.289 1.00 47.29  ? 37  ARG C C     1 
ATOM   5364  O O     . ARG C  1 37  ? 155.783 36.604  140.457 1.00 47.40  ? 37  ARG C O     1 
ATOM   5365  C CB    . ARG C  1 37  ? 157.840 37.871  138.089 1.00 70.43  ? 37  ARG C CB    1 
ATOM   5366  C CG    . ARG C  1 37  ? 157.946 39.210  138.785 1.00 70.59  ? 37  ARG C CG    1 
ATOM   5367  C CD    . ARG C  1 37  ? 157.882 40.412  137.868 1.00 70.65  ? 37  ARG C CD    1 
ATOM   5368  N NE    . ARG C  1 37  ? 157.869 41.618  138.693 1.00 70.49  ? 37  ARG C NE    1 
ATOM   5369  C CZ    . ARG C  1 37  ? 156.776 42.135  139.235 1.00 69.69  ? 37  ARG C CZ    1 
ATOM   5370  N NH1   . ARG C  1 37  ? 155.605 41.563  139.021 1.00 69.58  ? 37  ARG C NH1   1 
ATOM   5371  N NH2   . ARG C  1 37  ? 156.863 43.193  140.026 1.00 68.83  ? 37  ARG C NH2   1 
ATOM   5372  N N     . MET C  1 38  ? 157.387 37.976  141.146 1.00 82.88  ? 38  MET C N     1 
ATOM   5373  C CA    . MET C  1 38  ? 156.578 38.382  142.293 1.00 88.16  ? 38  MET C CA    1 
ATOM   5374  C C     . MET C  1 38  ? 156.350 37.148  143.133 1.00 88.99  ? 38  MET C C     1 
ATOM   5375  O O     . MET C  1 38  ? 155.430 37.076  143.951 1.00 88.90  ? 38  MET C O     1 
ATOM   5376  C CB    . MET C  1 38  ? 155.236 38.943  141.827 1.00 123.59 ? 38  MET C CB    1 
ATOM   5377  C CG    . MET C  1 38  ? 154.514 39.773  142.862 1.00 129.43 ? 38  MET C CG    1 
ATOM   5378  S SD    . MET C  1 38  ? 152.877 40.244  142.287 1.00 138.77 ? 38  MET C SD    1 
ATOM   5379  C CE    . MET C  1 38  ? 153.163 40.523  140.510 1.00 135.58 ? 38  MET C CE    1 
ATOM   5380  N N     . GLN C  1 39  ? 157.210 36.172  142.884 1.00 69.82  ? 39  GLN C N     1 
ATOM   5381  C CA    . GLN C  1 39  ? 157.211 34.909  143.587 1.00 71.06  ? 39  GLN C CA    1 
ATOM   5382  C C     . GLN C  1 39  ? 158.698 34.614  143.672 1.00 72.03  ? 39  GLN C C     1 
ATOM   5383  O O     . GLN C  1 39  ? 159.123 33.655  144.305 1.00 72.50  ? 39  GLN C O     1 
ATOM   5384  C CB    . GLN C  1 39  ? 156.505 33.841  142.766 1.00 95.68  ? 39  GLN C CB    1 
ATOM   5385  C CG    . GLN C  1 39  ? 156.122 32.605  143.549 1.00 98.10  ? 39  GLN C CG    1 
ATOM   5386  C CD    . GLN C  1 39  ? 154.661 32.598  143.968 1.00 98.86  ? 39  GLN C CD    1 
ATOM   5387  O OE1   . GLN C  1 39  ? 154.195 31.661  144.610 1.00 100.18 ? 39  GLN C OE1   1 
ATOM   5388  N NE2   . GLN C  1 39  ? 153.931 33.643  143.602 1.00 98.96  ? 39  GLN C NE2   1 
ATOM   5389  N N     . LEU C  1 40  ? 159.481 35.470  143.017 1.00 62.38  ? 40  LEU C N     1 
ATOM   5390  C CA    . LEU C  1 40  ? 160.936 35.361  142.996 1.00 62.70  ? 40  LEU C CA    1 
ATOM   5391  C C     . LEU C  1 40  ? 161.481 36.247  144.109 1.00 64.39  ? 40  LEU C C     1 
ATOM   5392  O O     . LEU C  1 40  ? 160.736 37.036  144.679 1.00 64.21  ? 40  LEU C O     1 
ATOM   5393  C CB    . LEU C  1 40  ? 161.467 35.833  141.647 1.00 45.01  ? 40  LEU C CB    1 
ATOM   5394  C CG    . LEU C  1 40  ? 160.928 35.079  140.422 1.00 43.74  ? 40  LEU C CG    1 
ATOM   5395  C CD1   . LEU C  1 40  ? 161.068 35.916  139.174 1.00 42.63  ? 40  LEU C CD1   1 
ATOM   5396  C CD2   . LEU C  1 40  ? 161.676 33.781  140.240 1.00 43.06  ? 40  LEU C CD2   1 
ATOM   5397  N N     . GLN C  1 41  ? 162.767 36.116  144.428 1.00 118.48 ? 41  GLN C N     1 
ATOM   5398  C CA    . GLN C  1 41  ? 163.368 36.928  145.491 1.00 122.54 ? 41  GLN C CA    1 
ATOM   5399  C C     . GLN C  1 41  ? 163.792 38.313  145.005 1.00 123.16 ? 41  GLN C C     1 
ATOM   5400  O O     . GLN C  1 41  ? 164.305 38.455  143.898 1.00 123.60 ? 41  GLN C O     1 
ATOM   5401  C CB    . GLN C  1 41  ? 164.560 36.194  146.118 1.00 143.38 ? 41  GLN C CB    1 
ATOM   5402  C CG    . GLN C  1 41  ? 164.163 35.163  147.164 1.00 147.59 ? 41  GLN C CG    1 
ATOM   5403  C CD    . GLN C  1 41  ? 163.400 35.778  148.325 1.00 150.62 ? 41  GLN C CD    1 
ATOM   5404  O OE1   . GLN C  1 41  ? 162.965 35.075  149.235 1.00 152.20 ? 41  GLN C OE1   1 
ATOM   5405  N NE2   . GLN C  1 41  ? 163.237 37.097  148.299 1.00 150.62 ? 41  GLN C NE2   1 
ATOM   5406  N N     . GLU C  1 42  ? 163.598 39.318  145.857 1.00 150.06 ? 42  GLU C N     1 
ATOM   5407  C CA    . GLU C  1 42  ? 163.881 40.726  145.544 1.00 151.55 ? 42  GLU C CA    1 
ATOM   5408  C C     . GLU C  1 42  ? 164.768 41.108  144.346 1.00 150.81 ? 42  GLU C C     1 
ATOM   5409  O O     . GLU C  1 42  ? 164.373 41.943  143.520 1.00 151.00 ? 42  GLU C O     1 
ATOM   5410  C CB    . GLU C  1 42  ? 164.378 41.460  146.793 1.00 171.40 ? 42  GLU C CB    1 
ATOM   5411  C CG    . GLU C  1 42  ? 164.208 42.967  146.660 1.00 175.21 ? 42  GLU C CG    1 
ATOM   5412  C CD    . GLU C  1 42  ? 162.856 43.340  146.048 1.00 176.99 ? 42  GLU C CD    1 
ATOM   5413  O OE1   . GLU C  1 42  ? 161.818 43.186  146.730 1.00 176.75 ? 42  GLU C OE1   1 
ATOM   5414  O OE2   . GLU C  1 42  ? 162.830 43.775  144.874 1.00 177.99 ? 42  GLU C OE2   1 
ATOM   5415  N N     . PRO C  1 43  ? 165.979 40.538  144.244 1.00 95.49  ? 43  PRO C N     1 
ATOM   5416  C CA    . PRO C  1 43  ? 166.842 40.882  143.106 1.00 93.47  ? 43  PRO C CA    1 
ATOM   5417  C C     . PRO C  1 43  ? 166.094 40.777  141.779 1.00 91.48  ? 43  PRO C C     1 
ATOM   5418  O O     . PRO C  1 43  ? 165.925 41.764  141.068 1.00 91.52  ? 43  PRO C O     1 
ATOM   5419  C CB    . PRO C  1 43  ? 167.960 39.861  143.218 1.00 122.18 ? 43  PRO C CB    1 
ATOM   5420  C CG    . PRO C  1 43  ? 168.113 39.737  144.702 1.00 123.55 ? 43  PRO C CG    1 
ATOM   5421  C CD    . PRO C  1 43  ? 166.685 39.660  145.194 1.00 122.73 ? 43  PRO C CD    1 
ATOM   5422  N N     . LEU C  1 44  ? 165.635 39.568  141.472 1.00 55.59  ? 44  LEU C N     1 
ATOM   5423  C CA    . LEU C  1 44  ? 164.897 39.280  140.244 1.00 52.96  ? 44  LEU C CA    1 
ATOM   5424  C C     . LEU C  1 44  ? 163.451 39.731  140.256 1.00 53.40  ? 44  LEU C C     1 
ATOM   5425  O O     . LEU C  1 44  ? 162.914 40.104  139.217 1.00 52.57  ? 44  LEU C O     1 
ATOM   5426  C CB    . LEU C  1 44  ? 164.885 37.782  139.971 1.00 42.48  ? 44  LEU C CB    1 
ATOM   5427  C CG    . LEU C  1 44  ? 166.213 37.109  139.734 1.00 40.59  ? 44  LEU C CG    1 
ATOM   5428  C CD1   . LEU C  1 44  ? 166.010 35.637  139.525 1.00 40.16  ? 44  LEU C CD1   1 
ATOM   5429  C CD2   . LEU C  1 44  ? 166.821 37.728  138.521 1.00 40.39  ? 44  LEU C CD2   1 
ATOM   5430  N N     . ARG C  1 45  ? 162.814 39.659  141.422 1.00 75.50  ? 45  ARG C N     1 
ATOM   5431  C CA    . ARG C  1 45  ? 161.406 40.026  141.550 1.00 77.67  ? 45  ARG C CA    1 
ATOM   5432  C C     . ARG C  1 45  ? 161.181 41.365  140.897 1.00 78.29  ? 45  ARG C C     1 
ATOM   5433  O O     . ARG C  1 45  ? 160.062 41.679  140.503 1.00 78.04  ? 45  ARG C O     1 
ATOM   5434  C CB    . ARG C  1 45  ? 160.984 40.098  143.021 1.00 111.56 ? 45  ARG C CB    1 
ATOM   5435  C CG    . ARG C  1 45  ? 159.509 39.771  143.277 1.00 113.76 ? 45  ARG C CG    1 
ATOM   5436  C CD    . ARG C  1 45  ? 159.157 39.859  144.767 1.00 116.67 ? 45  ARG C CD    1 
ATOM   5437  N NE    . ARG C  1 45  ? 158.849 41.223  145.190 1.00 119.17 ? 45  ARG C NE    1 
ATOM   5438  C CZ    . ARG C  1 45  ? 157.671 41.809  145.003 1.00 121.58 ? 45  ARG C CZ    1 
ATOM   5439  N NH1   . ARG C  1 45  ? 156.686 41.150  144.406 1.00 121.70 ? 45  ARG C NH1   1 
ATOM   5440  N NH2   . ARG C  1 45  ? 157.481 43.058  145.405 1.00 122.53 ? 45  ARG C NH2   1 
ATOM   5441  N N     . HIS C  1 46  ? 162.247 42.154  140.781 1.00 68.55  ? 46  HIS C N     1 
ATOM   5442  C CA    . HIS C  1 46  ? 162.124 43.456  140.154 1.00 68.74  ? 46  HIS C CA    1 
ATOM   5443  C C     . HIS C  1 46  ? 162.870 43.561  138.835 1.00 66.04  ? 46  HIS C C     1 
ATOM   5444  O O     . HIS C  1 46  ? 162.615 44.453  138.031 1.00 65.53  ? 46  HIS C O     1 
ATOM   5445  C CB    . HIS C  1 46  ? 162.591 44.556  141.103 1.00 200.00 ? 46  HIS C CB    1 
ATOM   5446  C CG    . HIS C  1 46  ? 161.607 45.677  141.234 1.00 200.00 ? 46  HIS C CG    1 
ATOM   5447  N ND1   . HIS C  1 46  ? 160.364 45.511  141.812 1.00 200.00 ? 46  HIS C ND1   1 
ATOM   5448  C CD2   . HIS C  1 46  ? 161.656 46.964  140.816 1.00 200.00 ? 46  HIS C CD2   1 
ATOM   5449  C CE1   . HIS C  1 46  ? 159.691 46.646  141.741 1.00 200.00 ? 46  HIS C CE1   1 
ATOM   5450  N NE2   . HIS C  1 46  ? 160.452 47.544  141.141 1.00 200.00 ? 46  HIS C NE2   1 
ATOM   5451  N N     . GLU C  1 47  ? 163.778 42.630  138.603 1.00 42.92  ? 47  GLU C N     1 
ATOM   5452  C CA    . GLU C  1 47  ? 164.564 42.651  137.384 1.00 40.84  ? 47  GLU C CA    1 
ATOM   5453  C C     . GLU C  1 47  ? 163.817 42.127  136.167 1.00 38.76  ? 47  GLU C C     1 
ATOM   5454  O O     . GLU C  1 47  ? 163.960 42.656  135.058 1.00 37.98  ? 47  GLU C O     1 
ATOM   5455  C CB    . GLU C  1 47  ? 165.852 41.841  137.584 1.00 93.35  ? 47  GLU C CB    1 
ATOM   5456  C CG    . GLU C  1 47  ? 166.964 42.572  138.322 1.00 95.54  ? 47  GLU C CG    1 
ATOM   5457  C CD    . GLU C  1 47  ? 167.666 43.600  137.453 1.00 97.48  ? 47  GLU C CD    1 
ATOM   5458  O OE1   . GLU C  1 47  ? 168.566 44.293  137.970 1.00 98.81  ? 47  GLU C OE1   1 
ATOM   5459  O OE2   . GLU C  1 47  ? 167.326 43.713  136.255 1.00 97.94  ? 47  GLU C OE2   1 
ATOM   5460  N N     . VAL C  1 48  ? 163.026 41.082  136.364 1.00 72.84  ? 48  VAL C N     1 
ATOM   5461  C CA    . VAL C  1 48  ? 162.304 40.495  135.252 1.00 70.96  ? 48  VAL C CA    1 
ATOM   5462  C C     . VAL C  1 48  ? 161.177 41.421  134.816 1.00 69.59  ? 48  VAL C C     1 
ATOM   5463  O O     . VAL C  1 48  ? 160.544 42.060  135.651 1.00 69.15  ? 48  VAL C O     1 
ATOM   5464  C CB    . VAL C  1 48  ? 161.785 39.115  135.643 1.00 50.14  ? 48  VAL C CB    1 
ATOM   5465  C CG1   . VAL C  1 48  ? 160.907 39.224  136.855 1.00 49.64  ? 48  VAL C CG1   1 
ATOM   5466  C CG2   . VAL C  1 48  ? 161.066 38.489  134.473 1.00 49.64  ? 48  VAL C CG2   1 
ATOM   5467  N N     . THR C  1 49  ? 160.940 41.504  133.508 1.00 59.87  ? 49  THR C N     1 
ATOM   5468  C CA    . THR C  1 49  ? 159.909 42.393  132.970 1.00 58.76  ? 49  THR C CA    1 
ATOM   5469  C C     . THR C  1 49  ? 158.884 41.721  132.051 1.00 56.03  ? 49  THR C C     1 
ATOM   5470  O O     . THR C  1 49  ? 159.206 40.745  131.378 1.00 56.75  ? 49  THR C O     1 
ATOM   5471  C CB    . THR C  1 49  ? 160.561 43.527  132.177 1.00 91.70  ? 49  THR C CB    1 
ATOM   5472  O OG1   . THR C  1 49  ? 161.293 42.973  131.074 1.00 93.56  ? 49  THR C OG1   1 
ATOM   5473  C CG2   . THR C  1 49  ? 161.515 44.304  133.062 1.00 92.82  ? 49  THR C CG2   1 
ATOM   5474  N N     . PRO C  1 50  ? 157.640 42.257  132.002 1.00 22.19  ? 50  PRO C N     1 
ATOM   5475  C CA    . PRO C  1 50  ? 156.475 41.820  131.211 1.00 19.78  ? 50  PRO C CA    1 
ATOM   5476  C C     . PRO C  1 50  ? 156.822 41.482  129.791 1.00 18.21  ? 50  PRO C C     1 
ATOM   5477  O O     . PRO C  1 50  ? 157.655 42.134  129.200 1.00 18.81  ? 50  PRO C O     1 
ATOM   5478  C CB    . PRO C  1 50  ? 155.550 43.014  131.281 1.00 100.59 ? 50  PRO C CB    1 
ATOM   5479  C CG    . PRO C  1 50  ? 155.786 43.492  132.668 1.00 102.48 ? 50  PRO C CG    1 
ATOM   5480  C CD    . PRO C  1 50  ? 157.289 43.447  132.796 1.00 101.60 ? 50  PRO C CD    1 
ATOM   5481  N N     . LYS C  1 51  ? 156.185 40.488  129.214 1.00 52.98  ? 51  LYS C N     1 
ATOM   5482  C CA    . LYS C  1 51  ? 156.582 40.147  127.872 1.00 52.78  ? 51  LYS C CA    1 
ATOM   5483  C C     . LYS C  1 51  ? 155.615 40.639  126.830 1.00 50.53  ? 51  LYS C C     1 
ATOM   5484  O O     . LYS C  1 51  ? 155.236 39.897  125.938 1.00 52.86  ? 51  LYS C O     1 
ATOM   5485  C CB    . LYS C  1 51  ? 156.781 38.629  127.768 1.00 74.99  ? 51  LYS C CB    1 
ATOM   5486  C CG    . LYS C  1 51  ? 157.918 38.086  128.644 1.00 76.00  ? 51  LYS C CG    1 
ATOM   5487  C CD    . LYS C  1 51  ? 159.258 38.696  128.252 1.00 78.33  ? 51  LYS C CD    1 
ATOM   5488  C CE    . LYS C  1 51  ? 160.376 38.241  129.164 1.00 80.99  ? 51  LYS C CE    1 
ATOM   5489  N NZ    . LYS C  1 51  ? 161.662 38.901  128.809 1.00 81.27  ? 51  LYS C NZ    1 
ATOM   5490  N N     . ASN C  1 52  ? 155.224 41.897  126.940 1.00 42.78  ? 52  ASN C N     1 
ATOM   5491  C CA    . ASN C  1 52  ? 154.286 42.517  126.004 1.00 38.51  ? 52  ASN C CA    1 
ATOM   5492  C C     . ASN C  1 52  ? 153.937 41.764  124.721 1.00 35.69  ? 52  ASN C C     1 
ATOM   5493  O O     . ASN C  1 52  ? 154.782 41.171  124.080 1.00 38.51  ? 52  ASN C O     1 
ATOM   5494  C CB    . ASN C  1 52  ? 154.788 43.903  125.674 1.00 25.06  ? 52  ASN C CB    1 
ATOM   5495  C CG    . ASN C  1 52  ? 154.943 44.745  126.917 1.00 25.35  ? 52  ASN C CG    1 
ATOM   5496  O OD1   . ASN C  1 52  ? 156.005 45.155  127.271 1.00 24.07  ? 52  ASN C OD1   1 
ATOM   5497  N ND2   . ASN C  1 52  ? 153.881 44.976  127.591 1.00 24.50  ? 52  ASN C ND2   1 
ATOM   5498  N N     . ILE C  1 53  ? 152.675 41.823  124.337 1.00 19.73  ? 53  ILE C N     1 
ATOM   5499  C CA    . ILE C  1 53  ? 152.177 41.113  123.167 1.00 14.54  ? 53  ILE C CA    1 
ATOM   5500  C C     . ILE C  1 53  ? 151.724 42.042  122.077 1.00 13.69  ? 53  ILE C C     1 
ATOM   5501  O O     . ILE C  1 53  ? 151.261 43.138  122.349 1.00 14.90  ? 53  ILE C O     1 
ATOM   5502  C CB    . ILE C  1 53  ? 150.943 40.291  123.563 1.00 13.53  ? 53  ILE C CB    1 
ATOM   5503  C CG1   . ILE C  1 53  ? 151.299 39.441  124.771 1.00 13.46  ? 53  ILE C CG1   1 
ATOM   5504  C CG2   . ILE C  1 53  ? 150.401 39.488  122.386 1.00 10.09  ? 53  ILE C CG2   1 
ATOM   5505  C CD1   . ILE C  1 53  ? 150.170 39.294  125.735 1.00 14.90  ? 53  ILE C CD1   1 
ATOM   5506  N N     . LEU C  1 54  ? 151.842 41.599  120.841 1.00 15.17  ? 54  LEU C N     1 
ATOM   5507  C CA    . LEU C  1 54  ? 151.348 42.384  119.734 1.00 14.87  ? 54  LEU C CA    1 
ATOM   5508  C C     . LEU C  1 54  ? 150.413 41.461  118.984 1.00 14.56  ? 54  LEU C C     1 
ATOM   5509  O O     . LEU C  1 54  ? 150.879 40.519  118.374 1.00 13.70  ? 54  LEU C O     1 
ATOM   5510  C CB    . LEU C  1 54  ? 152.465 42.816  118.791 1.00 17.99  ? 54  LEU C CB    1 
ATOM   5511  C CG    . LEU C  1 54  ? 151.895 43.354  117.474 1.00 17.82  ? 54  LEU C CG    1 
ATOM   5512  C CD1   . LEU C  1 54  ? 151.048 44.572  117.788 1.00 17.49  ? 54  LEU C CD1   1 
ATOM   5513  C CD2   . LEU C  1 54  ? 152.986 43.711  116.498 1.00 17.41  ? 54  LEU C CD2   1 
ATOM   5514  N N     . MET C  1 55  ? 149.106 41.703  119.036 1.00 15.20  ? 55  MET C N     1 
ATOM   5515  C CA    . MET C  1 55  ? 148.163 40.857  118.313 1.00 14.14  ? 55  MET C CA    1 
ATOM   5516  C C     . MET C  1 55  ? 147.945 41.414  116.924 1.00 12.95  ? 55  MET C C     1 
ATOM   5517  O O     . MET C  1 55  ? 147.638 42.574  116.786 1.00 14.08  ? 55  MET C O     1 
ATOM   5518  C CB    . MET C  1 55  ? 146.818 40.817  119.020 1.00 20.40  ? 55  MET C CB    1 
ATOM   5519  C CG    . MET C  1 55  ? 146.914 40.455  120.470 1.00 23.12  ? 55  MET C CG    1 
ATOM   5520  S SD    . MET C  1 55  ? 145.293 40.088  121.158 1.00 29.24  ? 55  MET C SD    1 
ATOM   5521  C CE    . MET C  1 55  ? 145.468 40.649  122.803 1.00 27.21  ? 55  MET C CE    1 
ATOM   5522  N N     . ILE C  1 56  ? 148.117 40.600  115.895 1.00 1.41   ? 56  ILE C N     1 
ATOM   5523  C CA    . ILE C  1 56  ? 147.884 41.052  114.536 1.00 1.41   ? 56  ILE C CA    1 
ATOM   5524  C C     . ILE C  1 56  ? 146.586 40.394  114.121 1.00 1.41   ? 56  ILE C C     1 
ATOM   5525  O O     . ILE C  1 56  ? 146.379 39.256  114.459 1.00 1.41   ? 56  ILE C O     1 
ATOM   5526  C CB    . ILE C  1 56  ? 148.975 40.573  113.591 1.00 13.37  ? 56  ILE C CB    1 
ATOM   5527  C CG1   . ILE C  1 56  ? 150.290 41.270  113.908 1.00 15.41  ? 56  ILE C CG1   1 
ATOM   5528  C CG2   . ILE C  1 56  ? 148.597 40.905  112.168 1.00 12.36  ? 56  ILE C CG2   1 
ATOM   5529  C CD1   . ILE C  1 56  ? 150.706 41.190  115.351 1.00 16.75  ? 56  ILE C CD1   1 
ATOM   5530  N N     . GLY C  1 57  ? 145.693 41.071  113.412 1.00 25.62  ? 57  GLY C N     1 
ATOM   5531  C CA    . GLY C  1 57  ? 144.463 40.402  113.023 1.00 26.98  ? 57  GLY C CA    1 
ATOM   5532  C C     . GLY C  1 57  ? 143.526 41.294  112.245 1.00 28.66  ? 57  GLY C C     1 
ATOM   5533  O O     . GLY C  1 57  ? 143.825 42.457  112.089 1.00 30.15  ? 57  GLY C O     1 
ATOM   5534  N N     . PRO C  1 58  ? 142.400 40.777  111.729 1.00 21.40  ? 58  PRO C N     1 
ATOM   5535  C CA    . PRO C  1 58  ? 141.368 41.463  110.956 1.00 21.44  ? 58  PRO C CA    1 
ATOM   5536  C C     . PRO C  1 58  ? 140.522 42.251  111.922 1.00 22.44  ? 58  PRO C C     1 
ATOM   5537  O O     . PRO C  1 58  ? 140.832 42.274  113.108 1.00 23.68  ? 58  PRO C O     1 
ATOM   5538  C CB    . PRO C  1 58  ? 140.572 40.319  110.366 1.00 39.91  ? 58  PRO C CB    1 
ATOM   5539  C CG    . PRO C  1 58  ? 141.530 39.232  110.321 1.00 40.66  ? 58  PRO C CG    1 
ATOM   5540  C CD    . PRO C  1 58  ? 142.169 39.336  111.649 1.00 40.71  ? 58  PRO C CD    1 
ATOM   5541  N N     . THR C  1 59  ? 139.438 42.862  111.438 1.00 19.91  ? 59  THR C N     1 
ATOM   5542  C CA    . THR C  1 59  ? 138.562 43.677  112.297 1.00 20.45  ? 59  THR C CA    1 
ATOM   5543  C C     . THR C  1 59  ? 137.593 42.892  113.157 1.00 19.68  ? 59  THR C C     1 
ATOM   5544  O O     . THR C  1 59  ? 136.905 42.009  112.664 1.00 18.30  ? 59  THR C O     1 
ATOM   5545  C CB    . THR C  1 59  ? 137.689 44.655  111.486 1.00 51.98  ? 59  THR C CB    1 
ATOM   5546  O OG1   . THR C  1 59  ? 138.464 45.314  110.481 1.00 55.17  ? 59  THR C OG1   1 
ATOM   5547  C CG2   . THR C  1 59  ? 137.116 45.700  112.410 1.00 51.08  ? 59  THR C CG2   1 
ATOM   5548  N N     . GLY C  1 60  ? 137.523 43.231  114.438 1.00 48.59  ? 60  GLY C N     1 
ATOM   5549  C CA    . GLY C  1 60  ? 136.595 42.559  115.332 1.00 49.98  ? 60  GLY C CA    1 
ATOM   5550  C C     . GLY C  1 60  ? 136.490 41.049  115.218 1.00 50.71  ? 60  GLY C C     1 
ATOM   5551  O O     . GLY C  1 60  ? 135.519 40.510  114.681 1.00 51.32  ? 60  GLY C O     1 
ATOM   5552  N N     . VAL C  1 61  ? 137.504 40.366  115.734 1.00 36.41  ? 61  VAL C N     1 
ATOM   5553  C CA    . VAL C  1 61  ? 137.549 38.925  115.726 1.00 33.42  ? 61  VAL C CA    1 
ATOM   5554  C C     . VAL C  1 61  ? 138.088 38.527  117.056 1.00 33.73  ? 61  VAL C C     1 
ATOM   5555  O O     . VAL C  1 61  ? 138.487 37.399  117.229 1.00 36.35  ? 61  VAL C O     1 
ATOM   5556  C CB    . VAL C  1 61  ? 138.475 38.395  114.660 1.00 8.04   ? 61  VAL C CB    1 
ATOM   5557  C CG1   . VAL C  1 61  ? 137.801 38.484  113.316 1.00 6.34   ? 61  VAL C CG1   1 
ATOM   5558  C CG2   . VAL C  1 61  ? 139.762 39.186  114.671 1.00 8.19   ? 61  VAL C CG2   1 
ATOM   5559  N N     . GLY C  1 62  ? 138.149 39.470  117.982 1.00 7.46   ? 62  GLY C N     1 
ATOM   5560  C CA    . GLY C  1 62  ? 138.602 39.127  119.308 1.00 8.39   ? 62  GLY C CA    1 
ATOM   5561  C C     . GLY C  1 62  ? 139.729 39.852  120.018 1.00 8.82   ? 62  GLY C C     1 
ATOM   5562  O O     . GLY C  1 62  ? 139.733 39.931  121.263 1.00 8.16   ? 62  GLY C O     1 
ATOM   5563  N N     . LYS C  1 63  ? 140.686 40.389  119.276 1.00 29.99  ? 63  LYS C N     1 
ATOM   5564  C CA    . LYS C  1 63  ? 141.803 41.064  119.928 1.00 31.26  ? 63  LYS C CA    1 
ATOM   5565  C C     . LYS C  1 63  ? 141.385 41.759  121.210 1.00 32.64  ? 63  LYS C C     1 
ATOM   5566  O O     . LYS C  1 63  ? 141.849 41.420  122.298 1.00 33.52  ? 63  LYS C O     1 
ATOM   5567  C CB    . LYS C  1 63  ? 142.449 42.068  118.984 1.00 18.41  ? 63  LYS C CB    1 
ATOM   5568  C CG    . LYS C  1 63  ? 142.850 41.439  117.687 1.00 17.64  ? 63  LYS C CG    1 
ATOM   5569  C CD    . LYS C  1 63  ? 143.682 42.335  116.829 1.00 18.04  ? 63  LYS C CD    1 
ATOM   5570  C CE    . LYS C  1 63  ? 143.369 42.125  115.351 1.00 15.69  ? 63  LYS C CE    1 
ATOM   5571  N NZ    . LYS C  1 63  ? 142.009 42.630  115.055 1.00 15.80  ? 63  LYS C NZ    1 
ATOM   5572  N N     . THR C  1 64  ? 140.472 42.703  121.094 1.00 32.72  ? 64  THR C N     1 
ATOM   5573  C CA    . THR C  1 64  ? 140.056 43.419  122.269 1.00 34.30  ? 64  THR C CA    1 
ATOM   5574  C C     . THR C  1 64  ? 139.376 42.606  123.365 1.00 35.43  ? 64  THR C C     1 
ATOM   5575  O O     . THR C  1 64  ? 139.731 42.756  124.531 1.00 36.22  ? 64  THR C O     1 
ATOM   5576  C CB    . THR C  1 64  ? 139.145 44.551  121.900 1.00 25.49  ? 64  THR C CB    1 
ATOM   5577  O OG1   . THR C  1 64  ? 139.757 45.335  120.867 1.00 23.17  ? 64  THR C OG1   1 
ATOM   5578  C CG2   . THR C  1 64  ? 138.860 45.401  123.151 1.00 26.54  ? 64  THR C CG2   1 
ATOM   5579  N N     . GLU C  1 65  ? 138.397 41.768  123.015 1.00 34.03  ? 65  GLU C N     1 
ATOM   5580  C CA    . GLU C  1 65  ? 137.694 40.988  124.032 1.00 34.17  ? 65  GLU C CA    1 
ATOM   5581  C C     . GLU C  1 65  ? 138.694 40.194  124.827 1.00 32.38  ? 65  GLU C C     1 
ATOM   5582  O O     . GLU C  1 65  ? 138.731 40.242  126.069 1.00 32.13  ? 65  GLU C O     1 
ATOM   5583  C CB    . GLU C  1 65  ? 136.661 40.049  123.410 1.00 61.83  ? 65  GLU C CB    1 
ATOM   5584  C CG    . GLU C  1 65  ? 135.281 40.684  123.227 1.00 70.28  ? 65  GLU C CG    1 
ATOM   5585  C CD    . GLU C  1 65  ? 134.546 40.966  124.544 1.00 73.79  ? 65  GLU C CD    1 
ATOM   5586  O OE1   . GLU C  1 65  ? 134.125 42.126  124.753 1.00 76.57  ? 65  GLU C OE1   1 
ATOM   5587  O OE2   . GLU C  1 65  ? 134.376 40.036  125.365 1.00 74.55  ? 65  GLU C OE2   1 
ATOM   5588  N N     . ILE C  1 66  ? 139.541 39.493  124.097 1.00 20.66  ? 66  ILE C N     1 
ATOM   5589  C CA    . ILE C  1 66  ? 140.537 38.686  124.732 1.00 18.63  ? 66  ILE C CA    1 
ATOM   5590  C C     . ILE C  1 66  ? 141.268 39.525  125.751 1.00 17.93  ? 66  ILE C C     1 
ATOM   5591  O O     . ILE C  1 66  ? 141.455 39.101  126.887 1.00 18.37  ? 66  ILE C O     1 
ATOM   5592  C CB    . ILE C  1 66  ? 141.479 38.126  123.697 1.00 6.01   ? 66  ILE C CB    1 
ATOM   5593  C CG1   . ILE C  1 66  ? 140.698 37.170  122.805 1.00 4.20   ? 66  ILE C CG1   1 
ATOM   5594  C CG2   . ILE C  1 66  ? 142.548 37.319  124.356 1.00 6.82   ? 66  ILE C CG2   1 
ATOM   5595  C CD1   . ILE C  1 66  ? 141.479 36.581  121.692 1.00 1.87   ? 66  ILE C CD1   1 
ATOM   5596  N N     . ALA C  1 67  ? 141.641 40.738  125.367 1.00 10.14  ? 67  ALA C N     1 
ATOM   5597  C CA    . ALA C  1 67  ? 142.372 41.623  126.279 1.00 13.21  ? 67  ALA C CA    1 
ATOM   5598  C C     . ALA C  1 67  ? 141.574 42.102  127.483 1.00 14.55  ? 67  ALA C C     1 
ATOM   5599  O O     . ALA C  1 67  ? 142.042 42.034  128.625 1.00 11.95  ? 67  ALA C O     1 
ATOM   5600  C CB    . ALA C  1 67  ? 142.891 42.822  125.517 1.00 96.25  ? 67  ALA C CB    1 
ATOM   5601  N N     . ARG C  1 68  ? 140.373 42.598  127.203 1.00 42.44  ? 68  ARG C N     1 
ATOM   5602  C CA    . ARG C  1 68  ? 139.486 43.123  128.218 1.00 45.42  ? 68  ARG C CA    1 
ATOM   5603  C C     . ARG C  1 68  ? 139.134 42.004  129.185 1.00 46.21  ? 68  ARG C C     1 
ATOM   5604  O O     . ARG C  1 68  ? 139.100 42.212  130.409 1.00 45.80  ? 68  ARG C O     1 
ATOM   5605  C CB    . ARG C  1 68  ? 138.235 43.683  127.550 1.00 47.86  ? 68  ARG C CB    1 
ATOM   5606  C CG    . ARG C  1 68  ? 137.627 44.886  128.259 1.00 51.81  ? 68  ARG C CG    1 
ATOM   5607  C CD    . ARG C  1 68  ? 136.316 45.268  127.582 1.00 56.91  ? 68  ARG C CD    1 
ATOM   5608  N NE    . ARG C  1 68  ? 136.466 46.009  126.322 1.00 60.50  ? 68  ARG C NE    1 
ATOM   5609  C CZ    . ARG C  1 68  ? 136.745 47.311  126.250 1.00 61.56  ? 68  ARG C CZ    1 
ATOM   5610  N NH1   . ARG C  1 68  ? 136.919 48.014  127.367 1.00 61.49  ? 68  ARG C NH1   1 
ATOM   5611  N NH2   . ARG C  1 68  ? 136.800 47.920  125.069 1.00 61.25  ? 68  ARG C NH2   1 
ATOM   5612  N N     . ARG C  1 69  ? 138.886 40.815  128.636 1.00 26.42  ? 69  ARG C N     1 
ATOM   5613  C CA    . ARG C  1 69  ? 138.547 39.657  129.464 1.00 27.12  ? 69  ARG C CA    1 
ATOM   5614  C C     . ARG C  1 69  ? 139.691 39.277  130.369 1.00 26.60  ? 69  ARG C C     1 
ATOM   5615  O O     . ARG C  1 69  ? 139.502 39.090  131.567 1.00 27.87  ? 69  ARG C O     1 
ATOM   5616  C CB    . ARG C  1 69  ? 138.201 38.444  128.606 1.00 55.97  ? 69  ARG C CB    1 
ATOM   5617  C CG    . ARG C  1 69  ? 136.890 38.568  127.860 1.00 58.82  ? 69  ARG C CG    1 
ATOM   5618  C CD    . ARG C  1 69  ? 135.713 38.620  128.821 1.00 59.12  ? 69  ARG C CD    1 
ATOM   5619  N NE    . ARG C  1 69  ? 134.513 39.089  128.146 1.00 59.83  ? 69  ARG C NE    1 
ATOM   5620  C CZ    . ARG C  1 69  ? 133.412 39.436  128.778 1.00 60.86  ? 69  ARG C CZ    1 
ATOM   5621  N NH1   . ARG C  1 69  ? 133.372 39.359  130.096 1.00 63.18  ? 69  ARG C NH1   1 
ATOM   5622  N NH2   . ARG C  1 69  ? 132.371 39.863  128.091 1.00 62.23  ? 69  ARG C NH2   1 
ATOM   5623  N N     . LEU C  1 70  ? 140.880 39.163  129.784 1.00 17.45  ? 70  LEU C N     1 
ATOM   5624  C CA    . LEU C  1 70  ? 142.060 38.793  130.545 1.00 17.23  ? 70  LEU C CA    1 
ATOM   5625  C C     . LEU C  1 70  ? 142.069 39.639  131.792 1.00 17.71  ? 70  LEU C C     1 
ATOM   5626  O O     . LEU C  1 70  ? 142.117 39.147  132.931 1.00 17.25  ? 70  LEU C O     1 
ATOM   5627  C CB    . LEU C  1 70  ? 143.331 39.050  129.736 1.00 44.89  ? 70  LEU C CB    1 
ATOM   5628  C CG    . LEU C  1 70  ? 144.634 38.565  130.383 1.00 44.11  ? 70  LEU C CG    1 
ATOM   5629  C CD1   . LEU C  1 70  ? 144.706 37.048  130.371 1.00 42.86  ? 70  LEU C CD1   1 
ATOM   5630  C CD2   . LEU C  1 70  ? 145.810 39.136  129.621 1.00 43.14  ? 70  LEU C CD2   1 
ATOM   5631  N N     . ALA C  1 71  ? 141.994 40.935  131.562 1.00 30.59  ? 71  ALA C N     1 
ATOM   5632  C CA    . ALA C  1 71  ? 141.996 41.881  132.656 1.00 32.71  ? 71  ALA C CA    1 
ATOM   5633  C C     . ALA C  1 71  ? 140.914 41.498  133.636 1.00 33.43  ? 71  ALA C C     1 
ATOM   5634  O O     . ALA C  1 71  ? 141.155 41.343  134.836 1.00 31.71  ? 71  ALA C O     1 
ATOM   5635  C CB    . ALA C  1 71  ? 141.739 43.274  132.122 1.00 133.11 ? 71  ALA C CB    1 
ATOM   5636  N N     . LYS C  1 72  ? 139.719 41.330  133.092 1.00 37.96  ? 72  LYS C N     1 
ATOM   5637  C CA    . LYS C  1 72  ? 138.581 41.015  133.908 1.00 40.43  ? 72  LYS C CA    1 
ATOM   5638  C C     . LYS C  1 72  ? 138.811 39.810  134.797 1.00 39.41  ? 72  LYS C C     1 
ATOM   5639  O O     . LYS C  1 72  ? 138.639 39.894  136.010 1.00 40.39  ? 72  LYS C O     1 
ATOM   5640  C CB    . LYS C  1 72  ? 137.343 40.807  133.033 1.00 156.33 ? 72  LYS C CB    1 
ATOM   5641  C CG    . LYS C  1 72  ? 136.017 40.868  133.793 1.00 163.83 ? 72  LYS C CG    1 
ATOM   5642  C CD    . LYS C  1 72  ? 135.839 42.200  134.522 1.00 169.38 ? 72  LYS C CD    1 
ATOM   5643  C CE    . LYS C  1 72  ? 134.466 42.301  135.169 1.00 173.67 ? 72  LYS C CE    1 
ATOM   5644  N NZ    . LYS C  1 72  ? 133.388 42.217  134.146 1.00 175.34 ? 72  LYS C NZ    1 
ATOM   5645  N N     . LEU C  1 73  ? 139.225 38.692  134.216 1.00 35.13  ? 73  LEU C N     1 
ATOM   5646  C CA    . LEU C  1 73  ? 139.400 37.495  135.020 1.00 34.72  ? 73  LEU C CA    1 
ATOM   5647  C C     . LEU C  1 73  ? 140.594 37.603  135.933 1.00 34.97  ? 73  LEU C C     1 
ATOM   5648  O O     . LEU C  1 73  ? 140.815 36.757  136.805 1.00 35.35  ? 73  LEU C O     1 
ATOM   5649  C CB    . LEU C  1 73  ? 139.514 36.263  134.130 1.00 37.83  ? 73  LEU C CB    1 
ATOM   5650  C CG    . LEU C  1 73  ? 140.820 36.033  133.399 1.00 37.48  ? 73  LEU C CG    1 
ATOM   5651  C CD1   . LEU C  1 73  ? 141.796 35.350  134.328 1.00 36.04  ? 73  LEU C CD1   1 
ATOM   5652  C CD2   . LEU C  1 73  ? 140.573 35.167  132.172 1.00 38.61  ? 73  LEU C CD2   1 
ATOM   5653  N N     . ALA C  1 74  ? 141.373 38.651  135.748 1.00 31.42  ? 74  ALA C N     1 
ATOM   5654  C CA    . ALA C  1 74  ? 142.526 38.814  136.602 1.00 33.23  ? 74  ALA C CA    1 
ATOM   5655  C C     . ALA C  1 74  ? 142.238 39.902  137.614 1.00 34.04  ? 74  ALA C C     1 
ATOM   5656  O O     . ALA C  1 74  ? 143.067 40.191  138.486 1.00 33.60  ? 74  ALA C O     1 
ATOM   5657  C CB    . ALA C  1 74  ? 143.742 39.170  135.773 1.00 108.95 ? 74  ALA C CB    1 
ATOM   5658  N N     . ASN C  1 75  ? 141.054 40.499  137.501 1.00 68.66  ? 75  ASN C N     1 
ATOM   5659  C CA    . ASN C  1 75  ? 140.673 41.575  138.401 1.00 70.55  ? 75  ASN C CA    1 
ATOM   5660  C C     . ASN C  1 75  ? 141.849 42.547  138.363 1.00 69.65  ? 75  ASN C C     1 
ATOM   5661  O O     . ASN C  1 75  ? 142.451 42.866  139.394 1.00 69.70  ? 75  ASN C O     1 
ATOM   5662  C CB    . ASN C  1 75  ? 140.479 41.027  139.817 1.00 176.29 ? 75  ASN C CB    1 
ATOM   5663  C CG    . ASN C  1 75  ? 140.027 42.089  140.797 1.00 180.54 ? 75  ASN C CG    1 
ATOM   5664  O OD1   . ASN C  1 75  ? 138.953 42.673  140.649 1.00 181.51 ? 75  ASN C OD1   1 
ATOM   5665  N ND2   . ASN C  1 75  ? 140.847 42.345  141.809 1.00 182.41 ? 75  ASN C ND2   1 
ATOM   5666  N N     . ALA C  1 76  ? 142.182 43.000  137.156 1.00 53.98  ? 76  ALA C N     1 
ATOM   5667  C CA    . ALA C  1 76  ? 143.304 43.907  136.968 1.00 51.84  ? 76  ALA C CA    1 
ATOM   5668  C C     . ALA C  1 76  ? 142.910 45.229  136.352 1.00 50.58  ? 76  ALA C C     1 
ATOM   5669  O O     . ALA C  1 76  ? 142.017 45.285  135.511 1.00 51.99  ? 76  ALA C O     1 
ATOM   5670  C CB    . ALA C  1 76  ? 144.324 43.253  136.100 1.00 77.03  ? 76  ALA C CB    1 
ATOM   5671  N N     . PRO C  1 77  ? 143.569 46.322  136.763 1.00 42.84  ? 77  PRO C N     1 
ATOM   5672  C CA    . PRO C  1 77  ? 143.228 47.625  136.187 1.00 41.06  ? 77  PRO C CA    1 
ATOM   5673  C C     . PRO C  1 77  ? 143.491 47.525  134.684 1.00 39.81  ? 77  PRO C C     1 
ATOM   5674  O O     . PRO C  1 77  ? 144.597 47.199  134.261 1.00 39.69  ? 77  PRO C O     1 
ATOM   5675  C CB    . PRO C  1 77  ? 144.196 48.582  136.885 1.00 57.48  ? 77  PRO C CB    1 
ATOM   5676  C CG    . PRO C  1 77  ? 144.418 47.937  138.201 1.00 58.78  ? 77  PRO C CG    1 
ATOM   5677  C CD    . PRO C  1 77  ? 144.565 46.466  137.836 1.00 58.71  ? 77  PRO C CD    1 
ATOM   5678  N N     . PHE C  1 78  ? 142.466 47.782  133.881 1.00 28.31  ? 78  PHE C N     1 
ATOM   5679  C CA    . PHE C  1 78  ? 142.591 47.709  132.436 1.00 25.74  ? 78  PHE C CA    1 
ATOM   5680  C C     . PHE C  1 78  ? 142.230 49.016  131.788 1.00 25.98  ? 78  PHE C C     1 
ATOM   5681  O O     . PHE C  1 78  ? 141.453 49.787  132.320 1.00 26.77  ? 78  PHE C O     1 
ATOM   5682  C CB    . PHE C  1 78  ? 141.664 46.651  131.896 1.00 22.59  ? 78  PHE C CB    1 
ATOM   5683  C CG    . PHE C  1 78  ? 141.713 46.511  130.411 1.00 21.26  ? 78  PHE C CG    1 
ATOM   5684  C CD1   . PHE C  1 78  ? 142.651 45.688  129.801 1.00 22.46  ? 78  PHE C CD1   1 
ATOM   5685  C CD2   . PHE C  1 78  ? 140.801 47.163  129.619 1.00 21.77  ? 78  PHE C CD2   1 
ATOM   5686  C CE1   . PHE C  1 78  ? 142.671 45.512  128.420 1.00 21.39  ? 78  PHE C CE1   1 
ATOM   5687  C CE2   . PHE C  1 78  ? 140.813 46.996  128.240 1.00 22.30  ? 78  PHE C CE2   1 
ATOM   5688  C CZ    . PHE C  1 78  ? 141.750 46.167  127.642 1.00 21.81  ? 78  PHE C CZ    1 
ATOM   5689  N N     . ILE C  1 79  ? 142.782 49.256  130.616 1.00 20.29  ? 79  ILE C N     1 
ATOM   5690  C CA    . ILE C  1 79  ? 142.494 50.486  129.898 1.00 20.29  ? 79  ILE C CA    1 
ATOM   5691  C C     . ILE C  1 79  ? 142.879 50.356  128.419 1.00 19.96  ? 79  ILE C C     1 
ATOM   5692  O O     . ILE C  1 79  ? 143.948 49.843  128.058 1.00 18.55  ? 79  ILE C O     1 
ATOM   5693  C CB    . ILE C  1 79  ? 143.186 51.744  130.609 1.00 46.44  ? 79  ILE C CB    1 
ATOM   5694  C CG1   . ILE C  1 79  ? 143.092 52.977  129.721 1.00 46.66  ? 79  ILE C CG1   1 
ATOM   5695  C CG2   . ILE C  1 79  ? 144.637 51.493  130.922 1.00 47.48  ? 79  ILE C CG2   1 
ATOM   5696  C CD1   . ILE C  1 79  ? 141.691 53.367  129.381 1.00 48.52  ? 79  ILE C CD1   1 
ATOM   5697  N N     . LYS C  1 80  ? 141.973 50.782  127.558 1.00 25.84  ? 80  LYS C N     1 
ATOM   5698  C CA    . LYS C  1 80  ? 142.230 50.704  126.136 1.00 26.96  ? 80  LYS C CA    1 
ATOM   5699  C C     . LYS C  1 80  ? 142.394 52.106  125.595 1.00 26.76  ? 80  LYS C C     1 
ATOM   5700  O O     . LYS C  1 80  ? 141.780 53.041  126.103 1.00 26.84  ? 80  LYS C O     1 
ATOM   5701  C CB    . LYS C  1 80  ? 141.073 49.984  125.428 1.00 40.07  ? 80  LYS C CB    1 
ATOM   5702  C CG    . LYS C  1 80  ? 141.083 50.113  123.905 1.00 41.80  ? 80  LYS C CG    1 
ATOM   5703  C CD    . LYS C  1 80  ? 140.022 49.245  123.259 1.00 42.85  ? 80  LYS C CD    1 
ATOM   5704  C CE    . LYS C  1 80  ? 139.981 49.455  121.762 1.00 42.97  ? 80  LYS C CE    1 
ATOM   5705  N NZ    . LYS C  1 80  ? 138.962 48.596  121.092 1.00 45.44  ? 80  LYS C NZ    1 
ATOM   5706  N N     . VAL C  1 81  ? 143.225 52.252  124.569 1.00 20.88  ? 81  VAL C N     1 
ATOM   5707  C CA    . VAL C  1 81  ? 143.456 53.556  123.968 1.00 21.20  ? 81  VAL C CA    1 
ATOM   5708  C C     . VAL C  1 81  ? 143.767 53.449  122.483 1.00 22.04  ? 81  VAL C C     1 
ATOM   5709  O O     . VAL C  1 81  ? 144.489 52.553  122.077 1.00 21.56  ? 81  VAL C O     1 
ATOM   5710  C CB    . VAL C  1 81  ? 144.631 54.268  124.664 1.00 17.61  ? 81  VAL C CB    1 
ATOM   5711  C CG1   . VAL C  1 81  ? 144.396 54.321  126.130 1.00 18.33  ? 81  VAL C CG1   1 
ATOM   5712  C CG2   . VAL C  1 81  ? 145.894 53.540  124.426 1.00 15.77  ? 81  VAL C CG2   1 
ATOM   5713  N N     . GLU C  1 82  ? 143.211 54.331  121.660 1.00 22.09  ? 82  GLU C N     1 
ATOM   5714  C CA    . GLU C  1 82  ? 143.557 54.261  120.249 1.00 24.15  ? 82  GLU C CA    1 
ATOM   5715  C C     . GLU C  1 82  ? 144.955 54.898  120.161 1.00 23.71  ? 82  GLU C C     1 
ATOM   5716  O O     . GLU C  1 82  ? 145.239 55.905  120.812 1.00 23.72  ? 82  GLU C O     1 
ATOM   5717  C CB    . GLU C  1 82  ? 142.571 55.040  119.395 1.00 55.59  ? 82  GLU C CB    1 
ATOM   5718  C CG    . GLU C  1 82  ? 142.438 54.491  117.994 1.00 62.13  ? 82  GLU C CG    1 
ATOM   5719  C CD    . GLU C  1 82  ? 141.049 53.914  117.724 1.00 66.76  ? 82  GLU C CD    1 
ATOM   5720  O OE1   . GLU C  1 82  ? 140.426 53.347  118.660 1.00 68.64  ? 82  GLU C OE1   1 
ATOM   5721  O OE2   . GLU C  1 82  ? 140.584 54.018  116.564 1.00 68.04  ? 82  GLU C OE2   1 
ATOM   5722  N N     . ALA C  1 83  ? 145.841 54.296  119.382 1.00 27.00  ? 83  ALA C N     1 
ATOM   5723  C CA    . ALA C  1 83  ? 147.198 54.808  119.266 1.00 24.00  ? 83  ALA C CA    1 
ATOM   5724  C C     . ALA C  1 83  ? 147.189 56.159  118.597 1.00 23.80  ? 83  ALA C C     1 
ATOM   5725  O O     . ALA C  1 83  ? 147.978 57.034  118.932 1.00 22.34  ? 83  ALA C O     1 
ATOM   5726  C CB    . ALA C  1 83  ? 148.035 53.846  118.465 1.00 35.47  ? 83  ALA C CB    1 
ATOM   5727  N N     . THR C  1 84  ? 146.277 56.311  117.646 1.00 20.43  ? 84  THR C N     1 
ATOM   5728  C CA    . THR C  1 84  ? 146.161 57.530  116.881 1.00 21.34  ? 84  THR C CA    1 
ATOM   5729  C C     . THR C  1 84  ? 145.605 58.637  117.710 1.00 21.98  ? 84  THR C C     1 
ATOM   5730  O O     . THR C  1 84  ? 145.659 59.801  117.311 1.00 21.67  ? 84  THR C O     1 
ATOM   5731  C CB    . THR C  1 84  ? 145.258 57.351  115.679 1.00 41.78  ? 84  THR C CB    1 
ATOM   5732  O OG1   . THR C  1 84  ? 144.174 56.479  116.031 1.00 42.73  ? 84  THR C OG1   1 
ATOM   5733  C CG2   . THR C  1 84  ? 146.049 56.799  114.507 1.00 42.42  ? 84  THR C CG2   1 
ATOM   5734  N N     . LYS C  1 85  ? 145.059 58.284  118.865 1.00 33.77  ? 85  LYS C N     1 
ATOM   5735  C CA    . LYS C  1 85  ? 144.521 59.304  119.747 1.00 35.67  ? 85  LYS C CA    1 
ATOM   5736  C C     . LYS C  1 85  ? 145.576 60.378  119.968 1.00 36.18  ? 85  LYS C C     1 
ATOM   5737  O O     . LYS C  1 85  ? 145.214 61.507  120.240 1.00 37.93  ? 85  LYS C O     1 
ATOM   5738  C CB    . LYS C  1 85  ? 144.132 58.711  121.104 1.00 62.33  ? 85  LYS C CB    1 
ATOM   5739  C CG    . LYS C  1 85  ? 143.594 59.717  122.129 1.00 64.44  ? 85  LYS C CG    1 
ATOM   5740  C CD    . LYS C  1 85  ? 143.479 59.088  123.533 1.00 67.90  ? 85  LYS C CD    1 
ATOM   5741  C CE    . LYS C  1 85  ? 142.960 60.085  124.573 1.00 69.48  ? 85  LYS C CE    1 
ATOM   5742  N NZ    . LYS C  1 85  ? 142.921 59.541  125.967 1.00 71.49  ? 85  LYS C NZ    1 
ATOM   5743  N N     . PHE C  1 86  ? 146.865 60.051  119.828 1.00 23.98  ? 86  PHE C N     1 
ATOM   5744  C CA    . PHE C  1 86  ? 147.914 61.035  120.070 1.00 25.53  ? 86  PHE C CA    1 
ATOM   5745  C C     . PHE C  1 86  ? 148.649 61.638  118.869 1.00 27.14  ? 86  PHE C C     1 
ATOM   5746  O O     . PHE C  1 86  ? 149.682 62.304  119.052 1.00 27.52  ? 86  PHE C O     1 
ATOM   5747  C CB    . PHE C  1 86  ? 148.951 60.460  121.017 1.00 49.70  ? 86  PHE C CB    1 
ATOM   5748  C CG    . PHE C  1 86  ? 148.371 59.667  122.113 1.00 50.04  ? 86  PHE C CG    1 
ATOM   5749  C CD1   . PHE C  1 86  ? 148.071 58.325  121.929 1.00 51.08  ? 86  PHE C CD1   1 
ATOM   5750  C CD2   . PHE C  1 86  ? 148.098 60.259  123.328 1.00 50.79  ? 86  PHE C CD2   1 
ATOM   5751  C CE1   . PHE C  1 86  ? 147.503 57.576  122.949 1.00 52.03  ? 86  PHE C CE1   1 
ATOM   5752  C CE2   . PHE C  1 86  ? 147.529 59.531  124.361 1.00 53.19  ? 86  PHE C CE2   1 
ATOM   5753  C CZ    . PHE C  1 86  ? 147.228 58.179  124.172 1.00 53.60  ? 86  PHE C CZ    1 
ATOM   5754  N N     . THR C  1 87  ? 148.133 61.448  117.657 1.00 44.21  ? 87  THR C N     1 
ATOM   5755  C CA    . THR C  1 87  ? 148.800 61.998  116.476 1.00 47.35  ? 87  THR C CA    1 
ATOM   5756  C C     . THR C  1 87  ? 148.978 63.535  116.502 1.00 48.04  ? 87  THR C C     1 
ATOM   5757  O O     . THR C  1 87  ? 148.368 64.264  117.303 1.00 49.05  ? 87  THR C O     1 
ATOM   5758  C CB    . THR C  1 87  ? 148.046 61.603  115.173 1.00 76.14  ? 87  THR C CB    1 
ATOM   5759  O OG1   . THR C  1 87  ? 147.562 60.261  115.279 1.00 79.09  ? 87  THR C OG1   1 
ATOM   5760  C CG2   . THR C  1 87  ? 148.979 61.666  113.978 1.00 77.39  ? 87  THR C CG2   1 
ATOM   5761  N N     . GLU C  1 95  ? 148.303 63.966  125.185 1.00 100.41 ? 95  GLU C N     1 
ATOM   5762  C CA    . GLU C  1 95  ? 149.242 63.623  126.260 1.00 100.04 ? 95  GLU C CA    1 
ATOM   5763  C C     . GLU C  1 95  ? 149.302 62.111  126.524 1.00 97.78  ? 95  GLU C C     1 
ATOM   5764  O O     . GLU C  1 95  ? 148.384 61.531  127.104 1.00 97.03  ? 95  GLU C O     1 
ATOM   5765  C CB    . GLU C  1 95  ? 148.844 64.352  127.546 1.00 132.51 ? 95  GLU C CB    1 
ATOM   5766  C CG    . GLU C  1 95  ? 149.736 64.047  128.743 1.00 137.67 ? 95  GLU C CG    1 
ATOM   5767  C CD    . GLU C  1 95  ? 151.177 64.508  128.552 1.00 141.47 ? 95  GLU C CD    1 
ATOM   5768  O OE1   . GLU C  1 95  ? 151.793 64.138  127.528 1.00 142.31 ? 95  GLU C OE1   1 
ATOM   5769  O OE2   . GLU C  1 95  ? 151.699 65.234  129.430 1.00 143.31 ? 95  GLU C OE2   1 
ATOM   5770  N N     . VAL C  1 96  ? 150.396 61.475  126.123 1.00 46.82  ? 96  VAL C N     1 
ATOM   5771  C CA    . VAL C  1 96  ? 150.526 60.041  126.300 1.00 43.25  ? 96  VAL C CA    1 
ATOM   5772  C C     . VAL C  1 96  ? 150.579 59.552  127.732 1.00 41.35  ? 96  VAL C C     1 
ATOM   5773  O O     . VAL C  1 96  ? 150.072 58.484  128.025 1.00 41.77  ? 96  VAL C O     1 
ATOM   5774  C CB    . VAL C  1 96  ? 151.739 59.521  125.567 1.00 38.21  ? 96  VAL C CB    1 
ATOM   5775  C CG1   . VAL C  1 96  ? 152.704 58.890  126.544 1.00 37.89  ? 96  VAL C CG1   1 
ATOM   5776  C CG2   . VAL C  1 96  ? 151.296 58.524  124.522 1.00 39.68  ? 96  VAL C CG2   1 
ATOM   5777  N N     . ASP C  1 97  ? 151.213 60.298  128.623 1.00 42.69  ? 97  ASP C N     1 
ATOM   5778  C CA    . ASP C  1 97  ? 151.258 59.880  130.016 1.00 41.51  ? 97  ASP C CA    1 
ATOM   5779  C C     . ASP C  1 97  ? 149.841 59.692  130.572 1.00 39.46  ? 97  ASP C C     1 
ATOM   5780  O O     . ASP C  1 97  ? 149.655 59.059  131.607 1.00 38.94  ? 97  ASP C O     1 
ATOM   5781  C CB    . ASP C  1 97  ? 151.969 60.915  130.884 1.00 104.95 ? 97  ASP C CB    1 
ATOM   5782  C CG    . ASP C  1 97  ? 153.433 61.037  130.567 1.00 108.61 ? 97  ASP C CG    1 
ATOM   5783  O OD1   . ASP C  1 97  ? 154.074 59.995  130.334 1.00 111.29 ? 97  ASP C OD1   1 
ATOM   5784  O OD2   . ASP C  1 97  ? 153.946 62.175  130.571 1.00 109.50 ? 97  ASP C OD2   1 
ATOM   5785  N N     . SER C  1 98  ? 148.837 60.253  129.908 1.00 43.00  ? 98  SER C N     1 
ATOM   5786  C CA    . SER C  1 98  ? 147.473 60.109  130.395 1.00 40.02  ? 98  SER C CA    1 
ATOM   5787  C C     . SER C  1 98  ? 147.123 58.636  130.537 1.00 37.70  ? 98  SER C C     1 
ATOM   5788  O O     . SER C  1 98  ? 146.458 58.234  131.484 1.00 36.79  ? 98  SER C O     1 
ATOM   5789  C CB    . SER C  1 98  ? 146.498 60.749  129.422 1.00 54.37  ? 98  SER C CB    1 
ATOM   5790  O OG    . SER C  1 98  ? 146.513 60.066  128.177 1.00 54.49  ? 98  SER C OG    1 
ATOM   5791  N N     . ILE C  1 99  ? 147.573 57.824  129.588 1.00 43.32  ? 99  ILE C N     1 
ATOM   5792  C CA    . ILE C  1 99  ? 147.265 56.410  129.615 1.00 41.40  ? 99  ILE C CA    1 
ATOM   5793  C C     . ILE C  1 99  ? 147.498 55.855  130.991 1.00 41.83  ? 99  ILE C C     1 
ATOM   5794  O O     . ILE C  1 99  ? 146.609 55.266  131.589 1.00 42.72  ? 99  ILE C O     1 
ATOM   5795  C CB    . ILE C  1 99  ? 148.103 55.642  128.611 1.00 31.74  ? 99  ILE C CB    1 
ATOM   5796  C CG1   . ILE C  1 99  ? 147.677 56.032  127.191 1.00 29.88  ? 99  ILE C CG1   1 
ATOM   5797  C CG2   . ILE C  1 99  ? 147.904 54.153  128.830 1.00 30.93  ? 99  ILE C CG2   1 
ATOM   5798  C CD1   . ILE C  1 99  ? 148.659 55.644  126.102 1.00 30.50  ? 99  ILE C CD1   1 
ATOM   5799  N N     . ILE C  1 100 ? 148.697 56.059  131.502 1.00 15.45  ? 100 ILE C N     1 
ATOM   5800  C CA    . ILE C  1 100 ? 149.016 55.563  132.820 1.00 16.48  ? 100 ILE C CA    1 
ATOM   5801  C C     . ILE C  1 100 ? 148.199 56.277  133.862 1.00 19.81  ? 100 ILE C C     1 
ATOM   5802  O O     . ILE C  1 100 ? 147.910 55.743  134.929 1.00 20.08  ? 100 ILE C O     1 
ATOM   5803  C CB    . ILE C  1 100 ? 150.464 55.791  133.154 1.00 25.84  ? 100 ILE C CB    1 
ATOM   5804  C CG1   . ILE C  1 100 ? 151.324 55.138  132.086 1.00 25.81  ? 100 ILE C CG1   1 
ATOM   5805  C CG2   . ILE C  1 100 ? 150.764 55.246  134.526 1.00 24.76  ? 100 ILE C CG2   1 
ATOM   5806  C CD1   . ILE C  1 100 ? 150.909 53.712  131.793 1.00 26.41  ? 100 ILE C CD1   1 
ATOM   5807  N N     . ARG C  1 101 ? 147.840 57.509  133.563 1.00 36.60  ? 101 ARG C N     1 
ATOM   5808  C CA    . ARG C  1 101 ? 147.066 58.279  134.504 1.00 41.40  ? 101 ARG C CA    1 
ATOM   5809  C C     . ARG C  1 101 ? 145.708 57.596  134.617 1.00 42.56  ? 101 ARG C C     1 
ATOM   5810  O O     . ARG C  1 101 ? 145.364 57.077  135.671 1.00 42.74  ? 101 ARG C O     1 
ATOM   5811  C CB    . ARG C  1 101 ? 146.945 59.713  133.995 1.00 63.72  ? 101 ARG C CB    1 
ATOM   5812  C CG    . ARG C  1 101 ? 146.758 60.754  135.062 1.00 67.59  ? 101 ARG C CG    1 
ATOM   5813  C CD    . ARG C  1 101 ? 147.168 62.082  134.490 1.00 70.91  ? 101 ARG C CD    1 
ATOM   5814  N NE    . ARG C  1 101 ? 148.616 62.158  134.314 1.00 74.08  ? 101 ARG C NE    1 
ATOM   5815  C CZ    . ARG C  1 101 ? 149.226 62.947  133.435 1.00 76.55  ? 101 ARG C CZ    1 
ATOM   5816  N NH1   . ARG C  1 101 ? 148.514 63.729  132.628 1.00 78.10  ? 101 ARG C NH1   1 
ATOM   5817  N NH2   . ARG C  1 101 ? 150.553 62.973  133.382 1.00 76.78  ? 101 ARG C NH2   1 
ATOM   5818  N N     . ASP C  1 102 ? 144.963 57.564  133.517 1.00 31.18  ? 102 ASP C N     1 
ATOM   5819  C CA    . ASP C  1 102 ? 143.635 56.948  133.485 1.00 33.82  ? 102 ASP C CA    1 
ATOM   5820  C C     . ASP C  1 102 ? 143.639 55.556  134.128 1.00 32.74  ? 102 ASP C C     1 
ATOM   5821  O O     . ASP C  1 102 ? 142.705 55.184  134.859 1.00 31.10  ? 102 ASP C O     1 
ATOM   5822  C CB    . ASP C  1 102 ? 143.136 56.833  132.031 1.00 104.55 ? 102 ASP C CB    1 
ATOM   5823  C CG    . ASP C  1 102 ? 142.824 58.180  131.401 1.00 108.70 ? 102 ASP C CG    1 
ATOM   5824  O OD1   . ASP C  1 102 ? 142.718 58.237  130.156 1.00 109.66 ? 102 ASP C OD1   1 
ATOM   5825  O OD2   . ASP C  1 102 ? 142.675 59.172  132.148 1.00 111.34 ? 102 ASP C OD2   1 
ATOM   5826  N N     . LEU C  1 103 ? 144.691 54.792  133.836 1.00 42.32  ? 103 LEU C N     1 
ATOM   5827  C CA    . LEU C  1 103 ? 144.828 53.447  134.363 1.00 42.63  ? 103 LEU C CA    1 
ATOM   5828  C C     . LEU C  1 103 ? 144.725 53.530  135.870 1.00 43.72  ? 103 LEU C C     1 
ATOM   5829  O O     . LEU C  1 103 ? 143.820 52.960  136.462 1.00 43.75  ? 103 LEU C O     1 
ATOM   5830  C CB    . LEU C  1 103 ? 146.172 52.865  133.964 1.00 69.94  ? 103 LEU C CB    1 
ATOM   5831  C CG    . LEU C  1 103 ? 146.376 51.424  134.401 1.00 69.48  ? 103 LEU C CG    1 
ATOM   5832  C CD1   . LEU C  1 103 ? 145.302 50.558  133.763 1.00 68.40  ? 103 LEU C CD1   1 
ATOM   5833  C CD2   . LEU C  1 103 ? 147.768 50.962  133.995 1.00 69.21  ? 103 LEU C CD2   1 
ATOM   5834  N N     . THR C  1 104 ? 145.644 54.265  136.485 1.00 38.23  ? 104 THR C N     1 
ATOM   5835  C CA    . THR C  1 104 ? 145.647 54.443  137.934 1.00 39.94  ? 104 THR C CA    1 
ATOM   5836  C C     . THR C  1 104 ? 144.266 54.846  138.426 1.00 41.68  ? 104 THR C C     1 
ATOM   5837  O O     . THR C  1 104 ? 143.796 54.338  139.433 1.00 41.32  ? 104 THR C O     1 
ATOM   5838  C CB    . THR C  1 104 ? 146.631 55.537  138.364 1.00 50.38  ? 104 THR C CB    1 
ATOM   5839  O OG1   . THR C  1 104 ? 147.924 55.261  137.812 1.00 50.20  ? 104 THR C OG1   1 
ATOM   5840  C CG2   . THR C  1 104 ? 146.726 55.596  139.891 1.00 50.03  ? 104 THR C CG2   1 
ATOM   5841  N N     . ASP C  1 105 ? 143.626 55.767  137.714 1.00 81.96  ? 105 ASP C N     1 
ATOM   5842  C CA    . ASP C  1 105 ? 142.295 56.228  138.083 1.00 85.49  ? 105 ASP C CA    1 
ATOM   5843  C C     . ASP C  1 105 ? 141.351 55.038  138.161 1.00 87.14  ? 105 ASP C C     1 
ATOM   5844  O O     . ASP C  1 105 ? 140.559 54.910  139.100 1.00 87.54  ? 105 ASP C O     1 
ATOM   5845  C CB    . ASP C  1 105 ? 141.782 57.239  137.053 1.00 93.41  ? 105 ASP C CB    1 
ATOM   5846  C CG    . ASP C  1 105 ? 141.682 58.647  137.614 1.00 94.30  ? 105 ASP C CG    1 
ATOM   5847  O OD1   . ASP C  1 105 ? 142.306 58.917  138.658 1.00 93.77  ? 105 ASP C OD1   1 
ATOM   5848  O OD2   . ASP C  1 105 ? 140.990 59.488  137.006 1.00 95.49  ? 105 ASP C OD2   1 
ATOM   5849  N N     . SER C  1 106 ? 141.435 54.161  137.172 1.00 56.74  ? 106 SER C N     1 
ATOM   5850  C CA    . SER C  1 106 ? 140.586 52.993  137.167 1.00 58.54  ? 106 SER C CA    1 
ATOM   5851  C C     . SER C  1 106 ? 140.960 52.190  138.398 1.00 59.41  ? 106 SER C C     1 
ATOM   5852  O O     . SER C  1 106 ? 140.092 51.769  139.147 1.00 60.67  ? 106 SER C O     1 
ATOM   5853  C CB    . SER C  1 106 ? 140.823 52.178  135.904 1.00 82.17  ? 106 SER C CB    1 
ATOM   5854  O OG    . SER C  1 106 ? 139.959 51.062  135.861 1.00 83.80  ? 106 SER C OG    1 
ATOM   5855  N N     . ALA C  1 107 ? 142.261 52.022  138.618 1.00 61.69  ? 107 ALA C N     1 
ATOM   5856  C CA    . ALA C  1 107 ? 142.793 51.263  139.758 1.00 63.83  ? 107 ALA C CA    1 
ATOM   5857  C C     . ALA C  1 107 ? 142.091 51.548  141.080 1.00 65.35  ? 107 ALA C C     1 
ATOM   5858  O O     . ALA C  1 107 ? 141.868 50.634  141.875 1.00 65.41  ? 107 ALA C O     1 
ATOM   5859  C CB    . ALA C  1 107 ? 144.291 51.525  139.913 1.00 89.51  ? 107 ALA C CB    1 
ATOM   5860  N N     . MET C  1 108 ? 141.763 52.811  141.331 1.00 69.23  ? 108 MET C N     1 
ATOM   5861  C CA    . MET C  1 108 ? 141.072 53.149  142.567 1.00 71.62  ? 108 MET C CA    1 
ATOM   5862  C C     . MET C  1 108 ? 139.724 52.447  142.570 1.00 73.12  ? 108 MET C C     1 
ATOM   5863  O O     . MET C  1 108 ? 139.534 51.461  143.277 1.00 73.16  ? 108 MET C O     1 
ATOM   5864  C CB    . MET C  1 108 ? 140.864 54.662  142.702 1.00 83.57  ? 108 MET C CB    1 
ATOM   5865  C CG    . MET C  1 108 ? 141.992 55.376  143.419 1.00 85.38  ? 108 MET C CG    1 
ATOM   5866  S SD    . MET C  1 108 ? 142.355 54.673  145.046 1.00 86.65  ? 108 MET C SD    1 
ATOM   5867  C CE    . MET C  1 108 ? 141.224 55.596  146.067 1.00 87.11  ? 108 MET C CE    1 
ATOM   5868  N N     . LYS C  1 109 ? 138.794 52.949  141.765 1.00 101.26 ? 109 LYS C N     1 
ATOM   5869  C CA    . LYS C  1 109 ? 137.467 52.360  141.691 1.00 103.28 ? 109 LYS C CA    1 
ATOM   5870  C C     . LYS C  1 109 ? 137.546 50.860  141.956 1.00 104.05 ? 109 LYS C C     1 
ATOM   5871  O O     . LYS C  1 109 ? 136.739 50.316  142.703 1.00 104.57 ? 109 LYS C O     1 
ATOM   5872  C CB    . LYS C  1 109 ? 136.842 52.621  140.317 1.00 131.42 ? 109 LYS C CB    1 
ATOM   5873  C CG    . LYS C  1 109 ? 135.381 52.179  140.208 1.00 132.98 ? 109 LYS C CG    1 
ATOM   5874  C CD    . LYS C  1 109 ? 134.762 52.568  138.871 1.00 133.03 ? 109 LYS C CD    1 
ATOM   5875  C CE    . LYS C  1 109 ? 135.433 51.851  137.715 1.00 133.06 ? 109 LYS C CE    1 
ATOM   5876  N NZ    . LYS C  1 109 ? 134.879 52.301  136.415 1.00 132.52 ? 109 LYS C NZ    1 
ATOM   5877  N N     . LEU C  1 110 ? 138.535 50.201  141.361 1.00 52.07  ? 110 LEU C N     1 
ATOM   5878  C CA    . LEU C  1 110 ? 138.705 48.769  141.548 1.00 53.81  ? 110 LEU C CA    1 
ATOM   5879  C C     . LEU C  1 110 ? 138.997 48.453  143.008 1.00 55.10  ? 110 LEU C C     1 
ATOM   5880  O O     . LEU C  1 110 ? 138.160 47.873  143.690 1.00 55.31  ? 110 LEU C O     1 
ATOM   5881  C CB    . LEU C  1 110 ? 139.833 48.243  140.682 1.00 123.92 ? 110 LEU C CB    1 
ATOM   5882  C CG    . LEU C  1 110 ? 139.775 46.723  140.626 1.00 125.16 ? 110 LEU C CG    1 
ATOM   5883  C CD1   . LEU C  1 110 ? 138.448 46.300  140.001 1.00 125.46 ? 110 LEU C CD1   1 
ATOM   5884  C CD2   . LEU C  1 110 ? 140.948 46.190  139.829 1.00 125.48 ? 110 LEU C CD2   1 
ATOM   5885  N N     . VAL C  1 111 ? 140.177 48.821  143.496 1.00 79.57  ? 111 VAL C N     1 
ATOM   5886  C CA    . VAL C  1 111 ? 140.511 48.577  144.903 1.00 82.12  ? 111 VAL C CA    1 
ATOM   5887  C C     . VAL C  1 111 ? 139.367 49.050  145.825 1.00 84.45  ? 111 VAL C C     1 
ATOM   5888  O O     . VAL C  1 111 ? 138.861 48.282  146.645 1.00 84.26  ? 111 VAL C O     1 
ATOM   5889  C CB    . VAL C  1 111 ? 141.841 49.304  145.307 1.00 61.59  ? 111 VAL C CB    1 
ATOM   5890  C CG1   . VAL C  1 111 ? 141.714 49.935  146.697 1.00 61.64  ? 111 VAL C CG1   1 
ATOM   5891  C CG2   . VAL C  1 111 ? 142.998 48.316  145.300 1.00 61.50  ? 111 VAL C CG2   1 
ATOM   5892  N N     . ARG C  1 112 ? 138.960 50.310  145.677 1.00 83.68  ? 112 ARG C N     1 
ATOM   5893  C CA    . ARG C  1 112 ? 137.887 50.888  146.484 1.00 86.80  ? 112 ARG C CA    1 
ATOM   5894  C C     . ARG C  1 112 ? 136.692 49.949  146.598 1.00 88.40  ? 112 ARG C C     1 
ATOM   5895  O O     . ARG C  1 112 ? 136.375 49.476  147.682 1.00 88.34  ? 112 ARG C O     1 
ATOM   5896  C CB    . ARG C  1 112 ? 137.430 52.216  145.876 1.00 151.87 ? 112 ARG C CB    1 
ATOM   5897  C CG    . ARG C  1 112 ? 136.474 53.004  146.754 1.00 153.45 ? 112 ARG C CG    1 
ATOM   5898  C CD    . ARG C  1 112 ? 136.076 54.322  146.105 1.00 155.16 ? 112 ARG C CD    1 
ATOM   5899  N NE    . ARG C  1 112 ? 135.469 55.240  147.067 1.00 156.80 ? 112 ARG C NE    1 
ATOM   5900  C CZ    . ARG C  1 112 ? 134.358 54.988  147.751 1.00 158.09 ? 112 ARG C CZ    1 
ATOM   5901  N NH1   . ARG C  1 112 ? 133.714 53.841  147.585 1.00 158.47 ? 112 ARG C NH1   1 
ATOM   5902  N NH2   . ARG C  1 112 ? 133.891 55.884  148.611 1.00 158.36 ? 112 ARG C NH2   1 
ATOM   5903  N N     . GLN C  1 113 ? 136.034 49.687  145.473 1.00 130.67 ? 113 GLN C N     1 
ATOM   5904  C CA    . GLN C  1 113 ? 134.864 48.807  145.437 1.00 133.35 ? 113 GLN C CA    1 
ATOM   5905  C C     . GLN C  1 113 ? 134.991 47.544  146.283 1.00 134.57 ? 113 GLN C C     1 
ATOM   5906  O O     . GLN C  1 113 ? 134.046 47.165  146.976 1.00 134.55 ? 113 GLN C O     1 
ATOM   5907  C CB    . GLN C  1 113 ? 134.557 48.399  143.995 1.00 170.40 ? 113 GLN C CB    1 
ATOM   5908  C CG    . GLN C  1 113 ? 133.548 47.270  143.878 1.00 171.59 ? 113 GLN C CG    1 
ATOM   5909  C CD    . GLN C  1 113 ? 133.529 46.661  142.494 1.00 172.45 ? 113 GLN C CD    1 
ATOM   5910  O OE1   . GLN C  1 113 ? 133.110 47.296  141.527 1.00 172.80 ? 113 GLN C OE1   1 
ATOM   5911  N NE2   . GLN C  1 113 ? 134.000 45.424  142.389 1.00 172.67 ? 113 GLN C NE2   1 
ATOM   5912  N N     . GLN C  1 114 ? 136.150 46.891  146.209 1.00 164.53 ? 114 GLN C N     1 
ATOM   5913  C CA    . GLN C  1 114 ? 136.405 45.660  146.957 1.00 166.07 ? 114 GLN C CA    1 
ATOM   5914  C C     . GLN C  1 114 ? 136.900 45.913  148.374 1.00 166.59 ? 114 GLN C C     1 
ATOM   5915  O O     . GLN C  1 114 ? 137.355 44.990  149.053 1.00 166.82 ? 114 GLN C O     1 
ATOM   5916  C CB    . GLN C  1 114 ? 137.430 44.794  146.223 1.00 134.04 ? 114 GLN C CB    1 
ATOM   5917  C CG    . GLN C  1 114 ? 138.715 45.525  145.878 1.00 135.22 ? 114 GLN C CG    1 
ATOM   5918  C CD    . GLN C  1 114 ? 139.809 44.594  145.401 1.00 135.82 ? 114 GLN C CD    1 
ATOM   5919  O OE1   . GLN C  1 114 ? 140.437 43.898  146.198 1.00 135.85 ? 114 GLN C OE1   1 
ATOM   5920  N NE2   . GLN C  1 114 ? 140.036 44.568  144.093 1.00 135.92 ? 114 GLN C NE2   1 
ATOM   5921  N N     . GLU C  1 115 ? 136.819 47.166  148.810 1.00 143.97 ? 115 GLU C N     1 
ATOM   5922  C CA    . GLU C  1 115 ? 137.241 47.546  150.156 1.00 143.97 ? 115 GLU C CA    1 
ATOM   5923  C C     . GLU C  1 115 ? 135.983 47.754  151.008 1.00 143.97 ? 115 GLU C C     1 
ATOM   5924  O O     . GLU C  1 115 ? 135.888 47.262  152.136 1.00 143.97 ? 115 GLU C O     1 
ATOM   5925  C CB    . GLU C  1 115 ? 138.074 48.834  150.106 1.00 171.85 ? 115 GLU C CB    1 
ATOM   5926  C CG    . GLU C  1 115 ? 138.970 49.078  151.324 1.00 171.85 ? 115 GLU C CG    1 
ATOM   5927  C CD    . GLU C  1 115 ? 139.958 47.942  151.576 1.00 171.85 ? 115 GLU C CD    1 
ATOM   5928  O OE1   . GLU C  1 115 ? 140.563 47.434  150.604 1.00 171.85 ? 115 GLU C OE1   1 
ATOM   5929  O OE2   . GLU C  1 115 ? 140.141 47.563  152.753 1.00 171.85 ? 115 GLU C OE2   1 
ATOM   5930  N N     . ILE C  1 116 ? 135.011 48.473  150.456 1.00 143.05 ? 116 ILE C N     1 
ATOM   5931  C CA    . ILE C  1 116 ? 133.760 48.720  151.156 1.00 143.05 ? 116 ILE C CA    1 
ATOM   5932  C C     . ILE C  1 116 ? 132.994 47.405  151.320 1.00 143.05 ? 116 ILE C C     1 
ATOM   5933  O O     . ILE C  1 116 ? 131.896 47.373  151.882 1.00 143.05 ? 116 ILE C O     1 
ATOM   5934  C CB    . ILE C  1 116 ? 132.889 49.750  150.384 1.00 171.93 ? 116 ILE C CB    1 
ATOM   5935  C CG1   . ILE C  1 116 ? 132.623 49.275  148.946 1.00 171.93 ? 116 ILE C CG1   1 
ATOM   5936  C CG2   . ILE C  1 116 ? 133.593 51.094  150.358 1.00 171.93 ? 116 ILE C CG2   1 
ATOM   5937  C CD1   . ILE C  1 116 ? 131.402 48.378  148.781 1.00 171.93 ? 116 ILE C CD1   1 
ATOM   5938  N N     . ALA C  1 117 ? 133.589 46.323  150.823 1.00 168.49 ? 117 ALA C N     1 
ATOM   5939  C CA    . ALA C  1 117 ? 132.990 44.993  150.898 1.00 168.49 ? 117 ALA C CA    1 
ATOM   5940  C C     . ALA C  1 117 ? 133.327 44.339  152.230 1.00 168.49 ? 117 ALA C C     1 
ATOM   5941  O O     . ALA C  1 117 ? 132.487 43.677  152.846 1.00 168.49 ? 117 ALA C O     1 
ATOM   5942  C CB    . ALA C  1 117 ? 133.498 44.128  149.751 1.00 89.01  ? 117 ALA C CB    1 
ATOM   5943  N N     . LYS C  1 118 ? 134.567 44.521  152.668 1.00 103.17 ? 118 LYS C N     1 
ATOM   5944  C CA    . LYS C  1 118 ? 134.994 43.952  153.935 1.00 103.17 ? 118 LYS C CA    1 
ATOM   5945  C C     . LYS C  1 118 ? 134.851 45.018  155.025 1.00 103.17 ? 118 LYS C C     1 
ATOM   5946  O O     . LYS C  1 118 ? 134.577 44.707  156.190 1.00 103.17 ? 118 LYS C O     1 
ATOM   5947  C CB    . LYS C  1 118 ? 136.446 43.444  153.829 1.00 132.41 ? 118 LYS C CB    1 
ATOM   5948  C CG    . LYS C  1 118 ? 137.531 44.448  154.189 1.00 132.41 ? 118 LYS C CG    1 
ATOM   5949  C CD    . LYS C  1 118 ? 137.787 44.471  155.690 1.00 132.41 ? 118 LYS C CD    1 
ATOM   5950  C CE    . LYS C  1 118 ? 138.726 45.600  156.082 1.00 132.41 ? 118 LYS C CE    1 
ATOM   5951  N NZ    . LYS C  1 118 ? 140.055 45.480  155.431 1.00 132.41 ? 118 LYS C NZ    1 
ATOM   5952  N N     . ASN C  1 119 ? 135.018 46.278  154.629 1.00 178.92 ? 119 ASN C N     1 
ATOM   5953  C CA    . ASN C  1 119 ? 134.912 47.400  155.556 1.00 178.92 ? 119 ASN C CA    1 
ATOM   5954  C C     . ASN C  1 119 ? 133.455 47.796  155.807 1.00 178.92 ? 119 ASN C C     1 
ATOM   5955  O O     . ASN C  1 119 ? 133.185 48.883  156.324 1.00 178.92 ? 119 ASN C O     1 
ATOM   5956  C CB    . ASN C  1 119 ? 135.694 48.610  155.022 1.00 174.17 ? 119 ASN C CB    1 
ATOM   5957  C CG    . ASN C  1 119 ? 136.792 49.066  155.974 1.00 174.17 ? 119 ASN C CG    1 
ATOM   5958  O OD1   . ASN C  1 119 ? 136.525 49.436  157.117 1.00 174.17 ? 119 ASN C OD1   1 
ATOM   5959  N ND2   . ASN C  1 119 ? 138.036 49.040  155.501 1.00 174.17 ? 119 ASN C ND2   1 
ATOM   5960  N N     . ARG C  1 120 ? 132.520 46.919  155.435 1.00 200.00 ? 120 ARG C N     1 
ATOM   5961  C CA    . ARG C  1 120 ? 131.097 47.183  155.653 1.00 200.00 ? 120 ARG C CA    1 
ATOM   5962  C C     . ARG C  1 120 ? 130.601 46.369  156.849 1.00 200.00 ? 120 ARG C C     1 
ATOM   5963  O O     . ARG C  1 120 ? 129.860 46.874  157.699 1.00 200.00 ? 120 ARG C O     1 
ATOM   5964  C CB    . ARG C  1 120 ? 130.270 46.832  154.408 1.00 199.59 ? 120 ARG C CB    1 
ATOM   5965  C CG    . ARG C  1 120 ? 128.793 47.204  154.538 1.00 199.59 ? 120 ARG C CG    1 
ATOM   5966  C CD    . ARG C  1 120 ? 128.620 48.701  154.836 1.00 199.59 ? 120 ARG C CD    1 
ATOM   5967  N NE    . ARG C  1 120 ? 127.255 49.068  155.226 1.00 199.59 ? 120 ARG C NE    1 
ATOM   5968  C CZ    . ARG C  1 120 ? 126.686 48.759  156.392 1.00 199.59 ? 120 ARG C CZ    1 
ATOM   5969  N NH1   . ARG C  1 120 ? 127.355 48.070  157.310 1.00 199.59 ? 120 ARG C NH1   1 
ATOM   5970  N NH2   . ARG C  1 120 ? 125.442 49.145  156.644 1.00 199.59 ? 120 ARG C NH2   1 
ATOM   5971  N N     . ALA C  1 121 ? 131.021 45.110  156.915 1.00 171.39 ? 121 ALA C N     1 
ATOM   5972  C CA    . ALA C  1 121 ? 130.630 44.231  158.010 1.00 171.39 ? 121 ALA C CA    1 
ATOM   5973  C C     . ALA C  1 121 ? 131.270 44.668  159.333 1.00 171.39 ? 121 ALA C C     1 
ATOM   5974  O O     . ALA C  1 121 ? 130.973 45.743  159.864 1.00 171.39 ? 121 ALA C O     1 
ATOM   5975  C CB    . ALA C  1 121 ? 131.030 42.798  157.682 1.00 124.63 ? 121 ALA C CB    1 
ATOM   5976  N N     . ILE C  1 235 ? 138.971 52.190  157.037 1.00 200.00 ? 235 ILE C N     1 
ATOM   5977  C CA    . ILE C  1 235 ? 139.112 52.652  155.661 1.00 200.00 ? 235 ILE C CA    1 
ATOM   5978  C C     . ILE C  1 235 ? 140.436 53.395  155.459 1.00 200.00 ? 235 ILE C C     1 
ATOM   5979  O O     . ILE C  1 235 ? 141.447 52.773  155.126 1.00 200.00 ? 235 ILE C O     1 
ATOM   5980  C CB    . ILE C  1 235 ? 137.919 53.558  155.266 1.00 121.59 ? 235 ILE C CB    1 
ATOM   5981  C CG1   . ILE C  1 235 ? 136.637 52.706  155.166 1.00 121.59 ? 235 ILE C CG1   1 
ATOM   5982  C CG2   . ILE C  1 235 ? 138.221 54.266  153.956 1.00 121.59 ? 235 ILE C CG2   1 
ATOM   5983  C CD1   . ILE C  1 235 ? 135.321 53.494  155.158 1.00 121.59 ? 235 ILE C CD1   1 
ATOM   5984  N N     . ASN C  1 236 ? 140.431 54.712  155.660 1.00 182.04 ? 236 ASN C N     1 
ATOM   5985  C CA    . ASN C  1 236 ? 141.638 55.530  155.503 1.00 182.04 ? 236 ASN C CA    1 
ATOM   5986  C C     . ASN C  1 236 ? 142.012 55.783  154.044 1.00 182.04 ? 236 ASN C C     1 
ATOM   5987  O O     . ASN C  1 236 ? 141.944 54.884  153.206 1.00 182.04 ? 236 ASN C O     1 
ATOM   5988  C CB    . ASN C  1 236 ? 142.822 54.877  156.240 1.00 137.16 ? 236 ASN C CB    1 
ATOM   5989  C CG    . ASN C  1 236 ? 144.169 55.463  155.837 1.00 137.16 ? 236 ASN C CG    1 
ATOM   5990  O OD1   . ASN C  1 236 ? 144.351 56.684  155.787 1.00 137.16 ? 236 ASN C OD1   1 
ATOM   5991  N ND2   . ASN C  1 236 ? 145.126 54.587  155.558 1.00 137.16 ? 236 ASN C ND2   1 
ATOM   5992  N N     . PRO C  1 237 ? 142.403 57.026  153.720 1.00 149.08 ? 237 PRO C N     1 
ATOM   5993  C CA    . PRO C  1 237 ? 142.787 57.381  152.352 1.00 149.08 ? 237 PRO C CA    1 
ATOM   5994  C C     . PRO C  1 237 ? 144.086 56.712  151.898 1.00 149.08 ? 237 PRO C C     1 
ATOM   5995  O O     . PRO C  1 237 ? 144.098 55.956  150.926 1.00 149.08 ? 237 PRO C O     1 
ATOM   5996  C CB    . PRO C  1 237 ? 142.913 58.901  152.417 1.00 124.82 ? 237 PRO C CB    1 
ATOM   5997  C CG    . PRO C  1 237 ? 141.901 59.271  153.451 1.00 124.82 ? 237 PRO C CG    1 
ATOM   5998  C CD    . PRO C  1 237 ? 142.180 58.242  154.520 1.00 124.82 ? 237 PRO C CD    1 
ATOM   5999  N N     . GLU C  1 238 ? 145.172 56.990  152.615 1.00 98.18  ? 238 GLU C N     1 
ATOM   6000  C CA    . GLU C  1 238 ? 146.495 56.444  152.292 1.00 98.18  ? 238 GLU C CA    1 
ATOM   6001  C C     . GLU C  1 238 ? 146.536 54.994  151.809 1.00 98.18  ? 238 GLU C C     1 
ATOM   6002  O O     . GLU C  1 238 ? 146.933 54.723  150.675 1.00 98.18  ? 238 GLU C O     1 
ATOM   6003  C CB    . GLU C  1 238 ? 147.435 56.599  153.493 1.00 164.75 ? 238 GLU C CB    1 
ATOM   6004  C CG    . GLU C  1 238 ? 147.834 58.035  153.782 1.00 164.75 ? 238 GLU C CG    1 
ATOM   6005  C CD    . GLU C  1 238 ? 148.325 58.763  152.539 1.00 164.75 ? 238 GLU C CD    1 
ATOM   6006  O OE1   . GLU C  1 238 ? 149.231 58.239  151.854 1.00 164.75 ? 238 GLU C OE1   1 
ATOM   6007  O OE2   . GLU C  1 238 ? 147.805 59.862  152.247 1.00 164.75 ? 238 GLU C OE2   1 
ATOM   6008  N N     . GLU C  1 239 ? 146.135 54.066  152.672 1.00 166.35 ? 239 GLU C N     1 
ATOM   6009  C CA    . GLU C  1 239 ? 146.153 52.651  152.325 1.00 166.35 ? 239 GLU C CA    1 
ATOM   6010  C C     . GLU C  1 239 ? 145.513 52.424  150.955 1.00 166.35 ? 239 GLU C C     1 
ATOM   6011  O O     . GLU C  1 239 ? 146.032 51.650  150.149 1.00 166.35 ? 239 GLU C O     1 
ATOM   6012  C CB    . GLU C  1 239 ? 145.424 51.822  153.398 1.00 186.38 ? 239 GLU C CB    1 
ATOM   6013  C CG    . GLU C  1 239 ? 145.802 50.330  153.423 1.00 186.38 ? 239 GLU C CG    1 
ATOM   6014  C CD    . GLU C  1 239 ? 146.857 49.981  154.473 1.00 186.38 ? 239 GLU C CD    1 
ATOM   6015  O OE1   . GLU C  1 239 ? 146.517 49.956  155.675 1.00 186.38 ? 239 GLU C OE1   1 
ATOM   6016  O OE2   . GLU C  1 239 ? 148.025 49.733  154.100 1.00 186.38 ? 239 GLU C OE2   1 
ATOM   6017  N N     . LEU C  1 240 ? 144.400 53.103  150.684 1.00 76.11  ? 240 LEU C N     1 
ATOM   6018  C CA    . LEU C  1 240 ? 143.719 52.942  149.396 1.00 76.11  ? 240 LEU C CA    1 
ATOM   6019  C C     . LEU C  1 240 ? 144.619 53.324  148.233 1.00 76.11  ? 240 LEU C C     1 
ATOM   6020  O O     . LEU C  1 240 ? 144.986 52.487  147.409 1.00 76.11  ? 240 LEU C O     1 
ATOM   6021  C CB    . LEU C  1 240 ? 142.444 53.789  149.338 1.00 169.07 ? 240 LEU C CB    1 
ATOM   6022  C CG    . LEU C  1 240 ? 141.134 53.084  149.693 1.00 169.07 ? 240 LEU C CG    1 
ATOM   6023  C CD1   . LEU C  1 240 ? 141.117 52.735  151.170 1.00 169.07 ? 240 LEU C CD1   1 
ATOM   6024  C CD2   . LEU C  1 240 ? 139.967 53.987  149.348 1.00 169.07 ? 240 LEU C CD2   1 
ATOM   6025  N N     . LYS C  1 241 ? 144.966 54.601  148.170 1.00 100.27 ? 241 LYS C N     1 
ATOM   6026  C CA    . LYS C  1 241 ? 145.827 55.092  147.116 1.00 100.27 ? 241 LYS C CA    1 
ATOM   6027  C C     . LYS C  1 241 ? 147.032 54.181  146.917 1.00 100.27 ? 241 LYS C C     1 
ATOM   6028  O O     . LYS C  1 241 ? 147.253 53.675  145.821 1.00 100.27 ? 241 LYS C O     1 
ATOM   6029  C CB    . LYS C  1 241 ? 146.267 56.521  147.432 1.00 179.96 ? 241 LYS C CB    1 
ATOM   6030  C CG    . LYS C  1 241 ? 145.160 57.545  147.214 1.00 179.96 ? 241 LYS C CG    1 
ATOM   6031  C CD    . LYS C  1 241 ? 145.548 58.923  147.725 1.00 179.96 ? 241 LYS C CD    1 
ATOM   6032  C CE    . LYS C  1 241 ? 145.491 58.993  149.244 1.00 179.96 ? 241 LYS C CE    1 
ATOM   6033  N NZ    . LYS C  1 241 ? 144.102 58.810  149.749 1.00 179.96 ? 241 LYS C NZ    1 
ATOM   6034  N N     . GLN C  1 242 ? 147.806 53.945  147.968 1.00 87.53  ? 242 GLN C N     1 
ATOM   6035  C CA    . GLN C  1 242 ? 148.969 53.079  147.815 1.00 87.53  ? 242 GLN C CA    1 
ATOM   6036  C C     . GLN C  1 242 ? 148.568 51.667  147.381 1.00 87.53  ? 242 GLN C C     1 
ATOM   6037  O O     . GLN C  1 242 ? 149.305 51.023  146.636 1.00 87.53  ? 242 GLN C O     1 
ATOM   6038  C CB    . GLN C  1 242 ? 149.784 53.021  149.113 1.00 193.02 ? 242 GLN C CB    1 
ATOM   6039  C CG    . GLN C  1 242 ? 151.128 52.277  148.995 1.00 193.02 ? 242 GLN C CG    1 
ATOM   6040  C CD    . GLN C  1 242 ? 152.131 52.955  148.060 1.00 193.02 ? 242 GLN C CD    1 
ATOM   6041  O OE1   . GLN C  1 242 ? 152.494 54.116  148.251 1.00 193.02 ? 242 GLN C OE1   1 
ATOM   6042  N NE2   . GLN C  1 242 ? 152.591 52.220  147.051 1.00 193.02 ? 242 GLN C NE2   1 
ATOM   6043  N N     . LYS C  1 243 ? 147.407 51.187  147.832 1.00 84.31  ? 243 LYS C N     1 
ATOM   6044  C CA    . LYS C  1 243 ? 146.949 49.849  147.455 1.00 84.31  ? 243 LYS C CA    1 
ATOM   6045  C C     . LYS C  1 243 ? 146.392 49.811  146.035 1.00 84.31  ? 243 LYS C C     1 
ATOM   6046  O O     . LYS C  1 243 ? 146.289 48.744  145.424 1.00 84.31  ? 243 LYS C O     1 
ATOM   6047  C CB    . LYS C  1 243 ? 145.911 49.327  148.447 1.00 161.81 ? 243 LYS C CB    1 
ATOM   6048  C CG    . LYS C  1 243 ? 146.536 48.740  149.700 1.00 161.81 ? 243 LYS C CG    1 
ATOM   6049  C CD    . LYS C  1 243 ? 145.502 48.063  150.580 1.00 161.81 ? 243 LYS C CD    1 
ATOM   6050  C CE    . LYS C  1 243 ? 146.165 47.347  151.752 1.00 161.81 ? 243 LYS C CE    1 
ATOM   6051  N NZ    . LYS C  1 243 ? 145.176 46.667  152.640 1.00 161.81 ? 243 LYS C NZ    1 
ATOM   6052  N N     . ALA C  1 244 ? 146.028 50.978  145.513 1.00 85.02  ? 244 ALA C N     1 
ATOM   6053  C CA    . ALA C  1 244 ? 145.539 51.066  144.143 1.00 81.31  ? 244 ALA C CA    1 
ATOM   6054  C C     . ALA C  1 244 ? 146.807 51.121  143.299 1.00 78.61  ? 244 ALA C C     1 
ATOM   6055  O O     . ALA C  1 244 ? 146.962 50.376  142.333 1.00 77.58  ? 244 ALA C O     1 
ATOM   6056  C CB    . ALA C  1 244 ? 144.710 52.328  143.942 1.00 81.80  ? 244 ALA C CB    1 
ATOM   6057  N N     . ILE C  1 245 ? 147.721 52.008  143.679 1.00 76.61  ? 245 ILE C N     1 
ATOM   6058  C CA    . ILE C  1 245 ? 148.982 52.118  142.970 1.00 74.35  ? 245 ILE C CA    1 
ATOM   6059  C C     . ILE C  1 245 ? 149.482 50.699  142.847 1.00 72.91  ? 245 ILE C C     1 
ATOM   6060  O O     . ILE C  1 245 ? 149.625 50.174  141.746 1.00 72.98  ? 245 ILE C O     1 
ATOM   6061  C CB    . ILE C  1 245 ? 150.024 52.908  143.762 1.00 66.00  ? 245 ILE C CB    1 
ATOM   6062  C CG1   . ILE C  1 245 ? 149.753 54.405  143.635 1.00 66.78  ? 245 ILE C CG1   1 
ATOM   6063  C CG2   . ILE C  1 245 ? 151.418 52.548  143.271 1.00 65.98  ? 245 ILE C CG2   1 
ATOM   6064  C CD1   . ILE C  1 245 ? 150.773 55.282  144.369 1.00 67.27  ? 245 ILE C CD1   1 
ATOM   6065  N N     . ASP C  1 246 ? 149.734 50.083  143.996 1.00 60.98  ? 246 ASP C N     1 
ATOM   6066  C CA    . ASP C  1 246 ? 150.210 48.715  144.029 1.00 59.79  ? 246 ASP C CA    1 
ATOM   6067  C C     . ASP C  1 246 ? 149.593 47.980  142.853 1.00 57.11  ? 246 ASP C C     1 
ATOM   6068  O O     . ASP C  1 246 ? 150.308 47.443  142.010 1.00 56.99  ? 246 ASP C O     1 
ATOM   6069  C CB    . ASP C  1 246 ? 149.811 48.025  145.342 1.00 162.84 ? 246 ASP C CB    1 
ATOM   6070  C CG    . ASP C  1 246 ? 150.762 48.342  146.496 1.00 165.82 ? 246 ASP C CG    1 
ATOM   6071  O OD1   . ASP C  1 246 ? 150.498 47.875  147.629 1.00 168.08 ? 246 ASP C OD1   1 
ATOM   6072  O OD2   . ASP C  1 246 ? 151.772 49.047  146.271 1.00 166.81 ? 246 ASP C OD2   1 
ATOM   6073  N N     . ALA C  1 247 ? 148.266 47.997  142.776 1.00 68.91  ? 247 ALA C N     1 
ATOM   6074  C CA    . ALA C  1 247 ? 147.566 47.304  141.699 1.00 65.48  ? 247 ALA C CA    1 
ATOM   6075  C C     . ALA C  1 247 ? 147.977 47.744  140.290 1.00 62.37  ? 247 ALA C C     1 
ATOM   6076  O O     . ALA C  1 247 ? 148.236 46.899  139.424 1.00 61.35  ? 247 ALA C O     1 
ATOM   6077  C CB    . ALA C  1 247 ? 146.072 47.455  141.882 1.00 141.72 ? 247 ALA C CB    1 
ATOM   6078  N N     . VAL C  1 248 ? 148.023 49.052  140.047 1.00 47.45  ? 248 VAL C N     1 
ATOM   6079  C CA    . VAL C  1 248 ? 148.422 49.521  138.733 1.00 44.55  ? 248 VAL C CA    1 
ATOM   6080  C C     . VAL C  1 248 ? 149.797 48.969  138.460 1.00 43.49  ? 248 VAL C C     1 
ATOM   6081  O O     . VAL C  1 248 ? 149.970 48.061  137.647 1.00 43.92  ? 248 VAL C O     1 
ATOM   6082  C CB    . VAL C  1 248 ? 148.541 51.035  138.656 1.00 40.84  ? 248 VAL C CB    1 
ATOM   6083  C CG1   . VAL C  1 248 ? 149.252 51.408  137.366 1.00 40.53  ? 248 VAL C CG1   1 
ATOM   6084  C CG2   . VAL C  1 248 ? 147.164 51.675  138.717 1.00 40.00  ? 248 VAL C CG2   1 
ATOM   6085  N N     . GLU C  1 249 ? 150.773 49.534  139.162 1.00 52.51  ? 249 GLU C N     1 
ATOM   6086  C CA    . GLU C  1 249 ? 152.169 49.141  139.030 1.00 51.46  ? 249 GLU C CA    1 
ATOM   6087  C C     . GLU C  1 249 ? 152.376 47.636  138.892 1.00 50.25  ? 249 GLU C C     1 
ATOM   6088  O O     . GLU C  1 249 ? 153.199 47.186  138.083 1.00 49.20  ? 249 GLU C O     1 
ATOM   6089  C CB    . GLU C  1 249 ? 152.970 49.647  140.238 1.00 75.83  ? 249 GLU C CB    1 
ATOM   6090  C CG    . GLU C  1 249 ? 153.238 51.139  140.246 1.00 77.19  ? 249 GLU C CG    1 
ATOM   6091  C CD    . GLU C  1 249 ? 154.320 51.528  141.238 1.00 79.42  ? 249 GLU C CD    1 
ATOM   6092  O OE1   . GLU C  1 249 ? 154.761 52.699  141.198 1.00 80.56  ? 249 GLU C OE1   1 
ATOM   6093  O OE2   . GLU C  1 249 ? 154.731 50.669  142.055 1.00 80.99  ? 249 GLU C OE2   1 
ATOM   6094  N N     . GLN C  1 250 ? 151.613 46.871  139.673 1.00 42.22  ? 250 GLN C N     1 
ATOM   6095  C CA    . GLN C  1 250 ? 151.734 45.413  139.697 1.00 41.36  ? 250 GLN C CA    1 
ATOM   6096  C C     . GLN C  1 250 ? 150.992 44.618  138.648 1.00 37.95  ? 250 GLN C C     1 
ATOM   6097  O O     . GLN C  1 250 ? 151.597 43.751  138.024 1.00 36.30  ? 250 GLN C O     1 
ATOM   6098  C CB    . GLN C  1 250 ? 151.367 44.869  141.083 1.00 116.40 ? 250 GLN C CB    1 
ATOM   6099  C CG    . GLN C  1 250 ? 152.383 45.194  142.165 1.00 120.74 ? 250 GLN C CG    1 
ATOM   6100  C CD    . GLN C  1 250 ? 153.774 44.697  141.821 1.00 123.30 ? 250 GLN C CD    1 
ATOM   6101  O OE1   . GLN C  1 250 ? 154.738 44.984  142.528 1.00 124.93 ? 250 GLN C OE1   1 
ATOM   6102  N NE2   . GLN C  1 250 ? 153.886 43.944  140.730 1.00 124.01 ? 250 GLN C NE2   1 
ATOM   6103  N N     . ASN C  1 251 ? 149.698 44.877  138.464 1.00 39.65  ? 251 ASN C N     1 
ATOM   6104  C CA    . ASN C  1 251 ? 148.951 44.138  137.454 1.00 38.48  ? 251 ASN C CA    1 
ATOM   6105  C C     . ASN C  1 251 ? 148.110 44.975  136.502 1.00 35.01  ? 251 ASN C C     1 
ATOM   6106  O O     . ASN C  1 251 ? 146.949 44.684  136.290 1.00 34.57  ? 251 ASN C O     1 
ATOM   6107  C CB    . ASN C  1 251 ? 148.045 43.081  138.088 1.00 73.35  ? 251 ASN C CB    1 
ATOM   6108  C CG    . ASN C  1 251 ? 148.156 43.044  139.583 1.00 76.79  ? 251 ASN C CG    1 
ATOM   6109  O OD1   . ASN C  1 251 ? 149.186 42.669  140.121 1.00 78.95  ? 251 ASN C OD1   1 
ATOM   6110  N ND2   . ASN C  1 251 ? 147.091 43.437  140.271 1.00 78.88  ? 251 ASN C ND2   1 
ATOM   6111  N N     . GLY C  1 252 ? 148.681 46.004  135.903 1.00 47.76  ? 252 GLY C N     1 
ATOM   6112  C CA    . GLY C  1 252 ? 147.887 46.780  134.977 1.00 42.99  ? 252 GLY C CA    1 
ATOM   6113  C C     . GLY C  1 252 ? 148.018 46.258  133.563 1.00 39.91  ? 252 GLY C C     1 
ATOM   6114  O O     . GLY C  1 252 ? 149.095 45.872  133.151 1.00 40.68  ? 252 GLY C O     1 
ATOM   6115  N N     . ILE C  1 253 ? 146.923 46.212  132.826 1.00 16.16  ? 253 ILE C N     1 
ATOM   6116  C CA    . ILE C  1 253 ? 146.982 45.787  131.438 1.00 13.24  ? 253 ILE C CA    1 
ATOM   6117  C C     . ILE C  1 253 ? 146.631 47.044  130.647 1.00 11.71  ? 253 ILE C C     1 
ATOM   6118  O O     . ILE C  1 253 ? 145.721 47.769  131.022 1.00 12.95  ? 253 ILE C O     1 
ATOM   6119  C CB    . ILE C  1 253 ? 145.936 44.699  131.098 1.00 26.23  ? 253 ILE C CB    1 
ATOM   6120  C CG1   . ILE C  1 253 ? 145.733 43.780  132.294 1.00 27.56  ? 253 ILE C CG1   1 
ATOM   6121  C CG2   . ILE C  1 253 ? 146.392 43.863  129.902 1.00 27.46  ? 253 ILE C CG2   1 
ATOM   6122  C CD1   . ILE C  1 253 ? 146.964 43.083  132.765 1.00 28.56  ? 253 ILE C CD1   1 
ATOM   6123  N N     . VAL C  1 254 ? 147.364 47.323  129.577 1.00 36.72  ? 254 VAL C N     1 
ATOM   6124  C CA    . VAL C  1 254 ? 147.096 48.490  128.741 1.00 34.56  ? 254 VAL C CA    1 
ATOM   6125  C C     . VAL C  1 254 ? 146.986 47.993  127.323 1.00 35.42  ? 254 VAL C C     1 
ATOM   6126  O O     . VAL C  1 254 ? 147.884 47.344  126.799 1.00 36.06  ? 254 VAL C O     1 
ATOM   6127  C CB    . VAL C  1 254 ? 148.220 49.520  128.820 1.00 14.29  ? 254 VAL C CB    1 
ATOM   6128  C CG1   . VAL C  1 254 ? 148.129 50.454  127.624 1.00 10.98  ? 254 VAL C CG1   1 
ATOM   6129  C CG2   . VAL C  1 254 ? 148.142 50.281  130.148 1.00 11.12  ? 254 VAL C CG2   1 
ATOM   6130  N N     . PHE C  1 255 ? 145.880 48.302  126.688 1.00 27.66  ? 255 PHE C N     1 
ATOM   6131  C CA    . PHE C  1 255 ? 145.672 47.801  125.347 1.00 26.99  ? 255 PHE C CA    1 
ATOM   6132  C C     . PHE C  1 255 ? 145.774 48.937  124.359 1.00 26.94  ? 255 PHE C C     1 
ATOM   6133  O O     . PHE C  1 255 ? 144.987 49.862  124.383 1.00 28.03  ? 255 PHE C O     1 
ATOM   6134  C CB    . PHE C  1 255 ? 144.299 47.125  125.291 1.00 19.33  ? 255 PHE C CB    1 
ATOM   6135  C CG    . PHE C  1 255 ? 143.998 46.488  124.001 1.00 17.94  ? 255 PHE C CG    1 
ATOM   6136  C CD1   . PHE C  1 255 ? 144.633 45.353  123.623 1.00 16.60  ? 255 PHE C CD1   1 
ATOM   6137  C CD2   . PHE C  1 255 ? 143.091 47.050  123.141 1.00 18.16  ? 255 PHE C CD2   1 
ATOM   6138  C CE1   . PHE C  1 255 ? 144.367 44.781  122.390 1.00 16.27  ? 255 PHE C CE1   1 
ATOM   6139  C CE2   . PHE C  1 255 ? 142.822 46.484  121.911 1.00 17.36  ? 255 PHE C CE2   1 
ATOM   6140  C CZ    . PHE C  1 255 ? 143.462 45.351  121.538 1.00 15.85  ? 255 PHE C CZ    1 
ATOM   6141  N N     . ILE C  1 256 ? 146.760 48.864  123.488 1.00 24.02  ? 256 ILE C N     1 
ATOM   6142  C CA    . ILE C  1 256 ? 146.988 49.897  122.483 1.00 24.94  ? 256 ILE C CA    1 
ATOM   6143  C C     . ILE C  1 256 ? 146.406 49.474  121.141 1.00 26.57  ? 256 ILE C C     1 
ATOM   6144  O O     . ILE C  1 256 ? 147.038 48.755  120.384 1.00 27.94  ? 256 ILE C O     1 
ATOM   6145  C CB    . ILE C  1 256 ? 148.512 50.170  122.360 1.00 9.29   ? 256 ILE C CB    1 
ATOM   6146  C CG1   . ILE C  1 256 ? 148.986 50.850  123.655 1.00 8.36   ? 256 ILE C CG1   1 
ATOM   6147  C CG2   . ILE C  1 256 ? 148.827 50.929  121.086 1.00 7.29   ? 256 ILE C CG2   1 
ATOM   6148  C CD1   . ILE C  1 256 ? 150.450 51.079  123.729 1.00 7.80   ? 256 ILE C CD1   1 
ATOM   6149  N N     . ASP C  1 257 ? 145.197 49.930  120.846 1.00 18.98  ? 257 ASP C N     1 
ATOM   6150  C CA    . ASP C  1 257 ? 144.550 49.558  119.605 1.00 20.61  ? 257 ASP C CA    1 
ATOM   6151  C C     . ASP C  1 257 ? 145.122 50.242  118.373 1.00 20.67  ? 257 ASP C C     1 
ATOM   6152  O O     . ASP C  1 257 ? 145.713 51.310  118.463 1.00 22.08  ? 257 ASP C O     1 
ATOM   6153  C CB    . ASP C  1 257 ? 143.049 49.813  119.696 1.00 68.97  ? 257 ASP C CB    1 
ATOM   6154  C CG    . ASP C  1 257 ? 142.263 48.974  118.705 1.00 73.65  ? 257 ASP C CG    1 
ATOM   6155  O OD1   . ASP C  1 257 ? 142.756 47.878  118.366 1.00 78.40  ? 257 ASP C OD1   1 
ATOM   6156  O OD2   . ASP C  1 257 ? 141.159 49.379  118.270 1.00 73.76  ? 257 ASP C OD2   1 
ATOM   6157  N N     . GLU C  1 258 ? 144.934 49.599  117.221 1.00 27.62  ? 258 GLU C N     1 
ATOM   6158  C CA    . GLU C  1 258 ? 145.408 50.070  115.916 1.00 28.94  ? 258 GLU C CA    1 
ATOM   6159  C C     . GLU C  1 258 ? 146.774 50.801  115.907 1.00 26.12  ? 258 GLU C C     1 
ATOM   6160  O O     . GLU C  1 258 ? 146.950 51.869  115.330 1.00 23.73  ? 258 GLU C O     1 
ATOM   6161  C CB    . GLU C  1 258 ? 144.291 50.886  115.228 1.00 82.05  ? 258 GLU C CB    1 
ATOM   6162  C CG    . GLU C  1 258 ? 143.162 49.963  114.689 1.00 90.28  ? 258 GLU C CG    1 
ATOM   6163  C CD    . GLU C  1 258 ? 142.019 50.671  113.949 1.00 94.77  ? 258 GLU C CD    1 
ATOM   6164  O OE1   . GLU C  1 258 ? 141.169 49.966  113.342 1.00 95.22  ? 258 GLU C OE1   1 
ATOM   6165  O OE2   . GLU C  1 258 ? 141.960 51.918  113.976 1.00 98.27  ? 258 GLU C OE2   1 
ATOM   6166  N N     . ILE C  1 259 ? 147.754 50.183  116.550 1.00 8.07   ? 259 ILE C N     1 
ATOM   6167  C CA    . ILE C  1 259 ? 149.092 50.729  116.601 1.00 5.70   ? 259 ILE C CA    1 
ATOM   6168  C C     . ILE C  1 259 ? 149.673 50.655  115.202 1.00 6.63   ? 259 ILE C C     1 
ATOM   6169  O O     . ILE C  1 259 ? 150.649 51.329  114.888 1.00 7.06   ? 259 ILE C O     1 
ATOM   6170  C CB    . ILE C  1 259 ? 149.991 49.915  117.566 1.00 5.16   ? 259 ILE C CB    1 
ATOM   6171  C CG1   . ILE C  1 259 ? 151.193 50.751  117.979 1.00 5.16   ? 259 ILE C CG1   1 
ATOM   6172  C CG2   . ILE C  1 259 ? 150.526 48.657  116.884 1.00 5.16   ? 259 ILE C CG2   1 
ATOM   6173  C CD1   . ILE C  1 259 ? 151.707 50.383  119.335 1.00 5.16   ? 259 ILE C CD1   1 
ATOM   6174  N N     . ASP C  1 260 ? 149.068 49.821  114.367 1.00 6.31   ? 260 ASP C N     1 
ATOM   6175  C CA    . ASP C  1 260 ? 149.538 49.643  113.021 1.00 9.18   ? 260 ASP C CA    1 
ATOM   6176  C C     . ASP C  1 260 ? 149.275 50.924  112.268 1.00 11.50  ? 260 ASP C C     1 
ATOM   6177  O O     . ASP C  1 260 ? 149.890 51.198  111.234 1.00 11.68  ? 260 ASP C O     1 
ATOM   6178  C CB    . ASP C  1 260 ? 148.836 48.456  112.371 1.00 24.67  ? 260 ASP C CB    1 
ATOM   6179  C CG    . ASP C  1 260 ? 147.311 48.609  112.321 1.00 28.86  ? 260 ASP C CG    1 
ATOM   6180  O OD1   . ASP C  1 260 ? 146.712 49.072  113.321 1.00 29.07  ? 260 ASP C OD1   1 
ATOM   6181  O OD2   . ASP C  1 260 ? 146.707 48.235  111.277 1.00 31.46  ? 260 ASP C OD2   1 
ATOM   6182  N N     . LYS C  1 261 ? 148.371 51.740  112.792 1.00 30.77  ? 261 LYS C N     1 
ATOM   6183  C CA    . LYS C  1 261 ? 148.075 53.006  112.142 1.00 32.84  ? 261 LYS C CA    1 
ATOM   6184  C C     . LYS C  1 261 ? 149.179 54.056  112.375 1.00 33.25  ? 261 LYS C C     1 
ATOM   6185  O O     . LYS C  1 261 ? 149.418 54.887  111.489 1.00 34.11  ? 261 LYS C O     1 
ATOM   6186  C CB    . LYS C  1 261 ? 146.747 53.541  112.646 1.00 80.25  ? 261 LYS C CB    1 
ATOM   6187  C CG    . LYS C  1 261 ? 145.529 52.727  112.231 1.00 83.92  ? 261 LYS C CG    1 
ATOM   6188  C CD    . LYS C  1 261 ? 145.227 52.882  110.747 1.00 87.25  ? 261 LYS C CD    1 
ATOM   6189  C CE    . LYS C  1 261 ? 143.896 52.242  110.385 1.00 89.01  ? 261 LYS C CE    1 
ATOM   6190  N NZ    . LYS C  1 261 ? 143.589 52.347  108.929 1.00 91.60  ? 261 LYS C NZ    1 
ATOM   6191  N N     . ILE C  1 262 ? 149.837 54.025  113.551 1.00 3.02   ? 262 ILE C N     1 
ATOM   6192  C CA    . ILE C  1 262 ? 150.907 54.972  113.855 1.00 3.02   ? 262 ILE C CA    1 
ATOM   6193  C C     . ILE C  1 262 ? 152.244 54.406  113.448 1.00 3.02   ? 262 ILE C C     1 
ATOM   6194  O O     . ILE C  1 262 ? 153.291 54.665  114.055 1.00 3.02   ? 262 ILE C O     1 
ATOM   6195  C CB    . ILE C  1 262 ? 150.932 55.370  115.324 1.00 1.00   ? 262 ILE C CB    1 
ATOM   6196  C CG1   . ILE C  1 262 ? 151.493 54.272  116.194 1.00 1.00   ? 262 ILE C CG1   1 
ATOM   6197  C CG2   . ILE C  1 262 ? 149.540 55.659  115.767 1.00 1.00   ? 262 ILE C CG2   1 
ATOM   6198  C CD1   . ILE C  1 262 ? 151.582 54.679  117.682 1.00 1.00   ? 262 ILE C CD1   1 
ATOM   6199  N N     . CYS C  1 263 ? 152.187 53.643  112.369 1.00 41.73  ? 263 CYS C N     1 
ATOM   6200  C CA    . CYS C  1 263 ? 153.356 53.022  111.794 1.00 48.39  ? 263 CYS C CA    1 
ATOM   6201  C C     . CYS C  1 263 ? 153.746 53.943  110.654 1.00 51.99  ? 263 CYS C C     1 
ATOM   6202  O O     . CYS C  1 263 ? 153.163 55.005  110.515 1.00 53.80  ? 263 CYS C O     1 
ATOM   6203  C CB    . CYS C  1 263 ? 152.978 51.649  111.267 1.00 61.60  ? 263 CYS C CB    1 
ATOM   6204  S SG    . CYS C  1 263 ? 154.261 50.445  111.505 1.00 66.11  ? 263 CYS C SG    1 
ATOM   6205  N N     . LYS C  1 264 ? 154.716 53.554  109.839 1.00 33.23  ? 264 LYS C N     1 
ATOM   6206  C CA    . LYS C  1 264 ? 155.127 54.387  108.714 1.00 39.32  ? 264 LYS C CA    1 
ATOM   6207  C C     . LYS C  1 264 ? 154.530 53.887  107.395 1.00 42.96  ? 264 LYS C C     1 
ATOM   6208  O O     . LYS C  1 264 ? 154.127 52.718  107.268 1.00 43.55  ? 264 LYS C O     1 
ATOM   6209  C CB    . LYS C  1 264 ? 156.649 54.389  108.546 1.00 158.93 ? 264 LYS C CB    1 
ATOM   6210  C CG    . LYS C  1 264 ? 157.467 55.022  109.646 1.00 161.88 ? 264 LYS C CG    1 
ATOM   6211  C CD    . LYS C  1 264 ? 157.911 54.047  110.725 1.00 162.99 ? 264 LYS C CD    1 
ATOM   6212  C CE    . LYS C  1 264 ? 156.799 53.723  111.705 1.00 163.57 ? 264 LYS C CE    1 
ATOM   6213  N NZ    . LYS C  1 264 ? 157.288 52.867  112.821 1.00 163.09 ? 264 LYS C NZ    1 
ATOM   6214  N N     . LYS C  1 265 ? 154.501 54.774  106.404 1.00 94.41  ? 265 LYS C N     1 
ATOM   6215  C CA    . LYS C  1 265 ? 153.998 54.431  105.082 1.00 98.66  ? 265 LYS C CA    1 
ATOM   6216  C C     . LYS C  1 265 ? 153.803 55.673  104.213 1.00 100.03 ? 265 LYS C C     1 
ATOM   6217  O O     . LYS C  1 265 ? 154.345 55.766  103.105 1.00 101.11 ? 265 LYS C O     1 
ATOM   6218  C CB    . LYS C  1 265 ? 152.684 53.644  105.197 1.00 93.85  ? 265 LYS C CB    1 
ATOM   6219  C CG    . LYS C  1 265 ? 151.556 54.399  105.874 1.00 96.09  ? 265 LYS C CG    1 
ATOM   6220  C CD    . LYS C  1 265 ? 150.261 53.606  105.852 1.00 98.26  ? 265 LYS C CD    1 
ATOM   6221  C CE    . LYS C  1 265 ? 149.075 54.478  106.256 1.00 99.82  ? 265 LYS C CE    1 
ATOM   6222  N NZ    . LYS C  1 265 ? 147.772 53.741  106.231 1.00 101.04 ? 265 LYS C NZ    1 
ATOM   6223  N N     . GLY C  1 270 ? 156.667 63.486  104.898 1.00 148.16 ? 270 GLY C N     1 
ATOM   6224  C CA    . GLY C  1 270 ? 156.057 64.456  105.790 1.00 148.04 ? 270 GLY C CA    1 
ATOM   6225  C C     . GLY C  1 270 ? 154.704 63.998  106.304 1.00 147.90 ? 270 GLY C C     1 
ATOM   6226  O O     . GLY C  1 270 ? 154.013 63.208  105.647 1.00 147.92 ? 270 GLY C O     1 
ATOM   6227  N N     . ALA C  1 271 ? 154.326 64.499  107.481 1.00 176.04 ? 271 ALA C N     1 
ATOM   6228  C CA    . ALA C  1 271 ? 153.053 64.157  108.122 1.00 175.41 ? 271 ALA C CA    1 
ATOM   6229  C C     . ALA C  1 271 ? 153.042 62.709  108.623 1.00 174.70 ? 271 ALA C C     1 
ATOM   6230  O O     . ALA C  1 271 ? 152.095 62.271  109.283 1.00 174.37 ? 271 ALA C O     1 
ATOM   6231  C CB    . ALA C  1 271 ? 151.889 64.390  107.153 1.00 125.71 ? 271 ALA C CB    1 
ATOM   6232  N N     . ASP C  1 272 ? 154.107 61.980  108.300 1.00 149.69 ? 272 ASP C N     1 
ATOM   6233  C CA    . ASP C  1 272 ? 154.274 60.585  108.701 1.00 147.49 ? 272 ASP C CA    1 
ATOM   6234  C C     . ASP C  1 272 ? 155.092 60.557  109.988 1.00 145.50 ? 272 ASP C C     1 
ATOM   6235  O O     . ASP C  1 272 ? 154.880 59.710  110.850 1.00 145.84 ? 272 ASP C O     1 
ATOM   6236  C CB    . ASP C  1 272 ? 154.998 59.814  107.589 1.00 151.08 ? 272 ASP C CB    1 
ATOM   6237  C CG    . ASP C  1 272 ? 155.274 58.366  107.955 1.00 152.13 ? 272 ASP C CG    1 
ATOM   6238  O OD1   . ASP C  1 272 ? 156.019 58.128  108.930 1.00 152.67 ? 272 ASP C OD1   1 
ATOM   6239  O OD2   . ASP C  1 272 ? 154.749 57.466  107.259 1.00 151.60 ? 272 ASP C OD2   1 
ATOM   6240  N N     . VAL C  1 273 ? 156.030 61.492  110.105 1.00 139.01 ? 273 VAL C N     1 
ATOM   6241  C CA    . VAL C  1 273 ? 156.869 61.600  111.293 1.00 136.13 ? 273 VAL C CA    1 
ATOM   6242  C C     . VAL C  1 273 ? 155.982 62.056  112.441 1.00 133.32 ? 273 VAL C C     1 
ATOM   6243  O O     . VAL C  1 273 ? 156.388 62.055  113.603 1.00 132.81 ? 273 VAL C O     1 
ATOM   6244  C CB    . VAL C  1 273 ? 158.008 62.630  111.099 1.00 149.11 ? 273 VAL C CB    1 
ATOM   6245  C CG1   . VAL C  1 273 ? 158.977 62.134  110.038 1.00 149.02 ? 273 VAL C CG1   1 
ATOM   6246  C CG2   . VAL C  1 273 ? 157.430 63.990  110.706 1.00 149.44 ? 273 VAL C CG2   1 
ATOM   6247  N N     . SER C  1 274 ? 154.765 62.457  112.094 1.00 126.65 ? 274 SER C N     1 
ATOM   6248  C CA    . SER C  1 274 ? 153.799 62.905  113.079 1.00 123.28 ? 274 SER C CA    1 
ATOM   6249  C C     . SER C  1 274 ? 153.310 61.657  113.773 1.00 119.88 ? 274 SER C C     1 
ATOM   6250  O O     . SER C  1 274 ? 152.966 61.687  114.952 1.00 120.37 ? 274 SER C O     1 
ATOM   6251  C CB    . SER C  1 274 ? 152.627 63.611  112.398 1.00 200.00 ? 274 SER C CB    1 
ATOM   6252  O OG    . SER C  1 274 ? 153.072 64.705  111.615 1.00 200.00 ? 274 SER C OG    1 
ATOM   6253  N N     . ARG C  1 275 ? 153.289 60.557  113.022 1.00 84.25  ? 275 ARG C N     1 
ATOM   6254  C CA    . ARG C  1 275 ? 152.848 59.269  113.540 1.00 79.00  ? 275 ARG C CA    1 
ATOM   6255  C C     . ARG C  1 275 ? 154.024 58.489  114.103 1.00 74.38  ? 275 ARG C C     1 
ATOM   6256  O O     . ARG C  1 275 ? 153.977 58.021  115.240 1.00 73.87  ? 275 ARG C O     1 
ATOM   6257  C CB    . ARG C  1 275 ? 152.147 58.478  112.439 1.00 106.13 ? 275 ARG C CB    1 
ATOM   6258  C CG    . ARG C  1 275 ? 150.837 59.113  112.040 1.00 108.67 ? 275 ARG C CG    1 
ATOM   6259  C CD    . ARG C  1 275 ? 150.125 58.340  110.965 1.00 111.88 ? 275 ARG C CD    1 
ATOM   6260  N NE    . ARG C  1 275 ? 150.862 58.354  109.709 1.00 115.15 ? 275 ARG C NE    1 
ATOM   6261  C CZ    . ARG C  1 275 ? 150.384 57.876  108.563 1.00 117.31 ? 275 ARG C CZ    1 
ATOM   6262  N NH1   . ARG C  1 275 ? 149.164 57.347  108.517 1.00 117.88 ? 275 ARG C NH1   1 
ATOM   6263  N NH2   . ARG C  1 275 ? 151.127 57.918  107.463 1.00 118.56 ? 275 ARG C NH2   1 
ATOM   6264  N N     . GLU C  1 276 ? 155.088 58.371  113.314 1.00 51.35  ? 276 GLU C N     1 
ATOM   6265  C CA    . GLU C  1 276 ? 156.290 57.655  113.745 1.00 46.55  ? 276 GLU C CA    1 
ATOM   6266  C C     . GLU C  1 276 ? 156.831 58.317  114.994 1.00 41.88  ? 276 GLU C C     1 
ATOM   6267  O O     . GLU C  1 276 ? 157.877 57.946  115.530 1.00 40.12  ? 276 GLU C O     1 
ATOM   6268  C CB    . GLU C  1 276 ? 157.351 57.676  112.646 1.00 103.23 ? 276 GLU C CB    1 
ATOM   6269  C CG    . GLU C  1 276 ? 158.607 56.903  112.988 1.00 105.51 ? 276 GLU C CG    1 
ATOM   6270  C CD    . GLU C  1 276 ? 159.512 56.720  111.791 1.00 108.20 ? 276 GLU C CD    1 
ATOM   6271  O OE1   . GLU C  1 276 ? 160.582 56.093  111.946 1.00 109.34 ? 276 GLU C OE1   1 
ATOM   6272  O OE2   . GLU C  1 276 ? 159.155 57.199  110.691 1.00 109.30 ? 276 GLU C OE2   1 
ATOM   6273  N N     . GLY C  1 277 ? 156.086 59.314  115.443 1.00 45.58  ? 277 GLY C N     1 
ATOM   6274  C CA    . GLY C  1 277 ? 156.468 60.034  116.625 1.00 41.14  ? 277 GLY C CA    1 
ATOM   6275  C C     . GLY C  1 277 ? 155.766 59.442  117.815 1.00 37.88  ? 277 GLY C C     1 
ATOM   6276  O O     . GLY C  1 277 ? 156.393 59.197  118.834 1.00 37.18  ? 277 GLY C O     1 
ATOM   6277  N N     . VAL C  1 278 ? 154.466 59.207  117.697 1.00 59.10  ? 278 VAL C N     1 
ATOM   6278  C CA    . VAL C  1 278 ? 153.724 58.637  118.809 1.00 56.28  ? 278 VAL C CA    1 
ATOM   6279  C C     . VAL C  1 278 ? 154.473 57.433  119.397 1.00 55.01  ? 278 VAL C C     1 
ATOM   6280  O O     . VAL C  1 278 ? 154.489 57.246  120.620 1.00 54.97  ? 278 VAL C O     1 
ATOM   6281  C CB    . VAL C  1 278 ? 152.341 58.195  118.363 1.00 51.97  ? 278 VAL C CB    1 
ATOM   6282  C CG1   . VAL C  1 278 ? 151.463 57.958  119.571 1.00 51.90  ? 278 VAL C CG1   1 
ATOM   6283  C CG2   . VAL C  1 278 ? 151.751 59.239  117.460 1.00 51.41  ? 278 VAL C CG2   1 
ATOM   6284  N N     . GLN C  1 279 ? 155.093 56.624  118.531 1.00 36.08  ? 279 GLN C N     1 
ATOM   6285  C CA    . GLN C  1 279 ? 155.846 55.470  118.990 1.00 33.26  ? 279 GLN C CA    1 
ATOM   6286  C C     . GLN C  1 279 ? 156.880 55.990  119.975 1.00 34.38  ? 279 GLN C C     1 
ATOM   6287  O O     . GLN C  1 279 ? 156.828 55.670  121.165 1.00 34.34  ? 279 GLN C O     1 
ATOM   6288  C CB    . GLN C  1 279 ? 156.521 54.783  117.822 1.00 23.97  ? 279 GLN C CB    1 
ATOM   6289  C CG    . GLN C  1 279 ? 155.535 54.434  116.761 1.00 21.64  ? 279 GLN C CG    1 
ATOM   6290  C CD    . GLN C  1 279 ? 156.118 53.577  115.649 1.00 21.75  ? 279 GLN C CD    1 
ATOM   6291  O OE1   . GLN C  1 279 ? 156.817 52.585  115.916 1.00 22.33  ? 279 GLN C OE1   1 
ATOM   6292  N NE2   . GLN C  1 279 ? 155.813 53.931  114.393 1.00 18.29  ? 279 GLN C NE2   1 
ATOM   6293  N N     . ARG C  1 280 ? 157.801 56.827  119.503 1.00 28.21  ? 280 ARG C N     1 
ATOM   6294  C CA    . ARG C  1 280 ? 158.827 57.366  120.404 1.00 29.42  ? 280 ARG C CA    1 
ATOM   6295  C C     . ARG C  1 280 ? 158.189 57.911  121.687 1.00 28.44  ? 280 ARG C C     1 
ATOM   6296  O O     . ARG C  1 280 ? 158.816 57.959  122.746 1.00 28.46  ? 280 ARG C O     1 
ATOM   6297  C CB    . ARG C  1 280 ? 159.621 58.486  119.717 1.00 60.71  ? 280 ARG C CB    1 
ATOM   6298  C CG    . ARG C  1 280 ? 160.320 58.085  118.435 1.00 65.87  ? 280 ARG C CG    1 
ATOM   6299  C CD    . ARG C  1 280 ? 161.836 57.957  118.588 1.00 69.32  ? 280 ARG C CD    1 
ATOM   6300  N NE    . ARG C  1 280 ? 162.419 57.414  117.360 1.00 74.64  ? 280 ARG C NE    1 
ATOM   6301  C CZ    . ARG C  1 280 ? 162.330 57.985  116.154 1.00 77.12  ? 280 ARG C CZ    1 
ATOM   6302  N NH1   . ARG C  1 280 ? 161.687 59.140  115.993 1.00 77.57  ? 280 ARG C NH1   1 
ATOM   6303  N NH2   . ARG C  1 280 ? 162.863 57.382  115.091 1.00 77.14  ? 280 ARG C NH2   1 
ATOM   6304  N N     . ASP C  1 281 ? 156.930 58.321  121.572 1.00 52.36  ? 281 ASP C N     1 
ATOM   6305  C CA    . ASP C  1 281 ? 156.211 58.878  122.692 1.00 51.70  ? 281 ASP C CA    1 
ATOM   6306  C C     . ASP C  1 281 ? 155.755 57.789  123.638 1.00 49.33  ? 281 ASP C C     1 
ATOM   6307  O O     . ASP C  1 281 ? 155.669 58.021  124.843 1.00 50.26  ? 281 ASP C O     1 
ATOM   6308  C CB    . ASP C  1 281 ? 155.021 59.694  122.187 1.00 86.10  ? 281 ASP C CB    1 
ATOM   6309  C CG    . ASP C  1 281 ? 155.430 61.064  121.658 1.00 90.82  ? 281 ASP C CG    1 
ATOM   6310  O OD1   . ASP C  1 281 ? 155.768 61.952  122.472 1.00 94.89  ? 281 ASP C OD1   1 
ATOM   6311  O OD2   . ASP C  1 281 ? 155.414 61.253  120.427 1.00 92.93  ? 281 ASP C OD2   1 
ATOM   6312  N N     . LEU C  1 282 ? 155.477 56.600  123.106 1.00 36.85  ? 282 LEU C N     1 
ATOM   6313  C CA    . LEU C  1 282 ? 155.036 55.479  123.947 1.00 33.25  ? 282 LEU C CA    1 
ATOM   6314  C C     . LEU C  1 282 ? 156.184 54.751  124.612 1.00 31.16  ? 282 LEU C C     1 
ATOM   6315  O O     . LEU C  1 282 ? 155.991 54.096  125.630 1.00 30.95  ? 282 LEU C O     1 
ATOM   6316  C CB    . LEU C  1 282 ? 154.250 54.438  123.145 1.00 17.88  ? 282 LEU C CB    1 
ATOM   6317  C CG    . LEU C  1 282 ? 152.830 54.745  122.714 1.00 17.54  ? 282 LEU C CG    1 
ATOM   6318  C CD1   . LEU C  1 282 ? 152.312 53.653  121.781 1.00 14.95  ? 282 LEU C CD1   1 
ATOM   6319  C CD2   . LEU C  1 282 ? 151.975 54.887  123.969 1.00 18.22  ? 282 LEU C CD2   1 
ATOM   6320  N N     . LEU C  1 283 ? 157.370 54.848  124.028 1.00 23.93  ? 283 LEU C N     1 
ATOM   6321  C CA    . LEU C  1 283 ? 158.511 54.158  124.578 1.00 23.29  ? 283 LEU C CA    1 
ATOM   6322  C C     . LEU C  1 283 ? 158.635 54.237  126.067 1.00 22.85  ? 283 LEU C C     1 
ATOM   6323  O O     . LEU C  1 283 ? 158.564 53.232  126.757 1.00 24.16  ? 283 LEU C O     1 
ATOM   6324  C CB    . LEU C  1 283 ? 159.773 54.654  123.933 1.00 8.96   ? 283 LEU C CB    1 
ATOM   6325  C CG    . LEU C  1 283 ? 159.719 53.883  122.629 1.00 8.49   ? 283 LEU C CG    1 
ATOM   6326  C CD1   . LEU C  1 283 ? 160.805 54.317  121.665 1.00 10.15  ? 283 LEU C CD1   1 
ATOM   6327  C CD2   . LEU C  1 283 ? 159.863 52.430  122.972 1.00 8.51   ? 283 LEU C CD2   1 
ATOM   6328  N N     . PRO C  1 284 ? 158.825 55.432  126.595 1.00 13.84  ? 284 PRO C N     1 
ATOM   6329  C CA    . PRO C  1 284 ? 158.951 55.613  128.046 1.00 13.18  ? 284 PRO C CA    1 
ATOM   6330  C C     . PRO C  1 284 ? 157.986 54.764  128.890 1.00 12.16  ? 284 PRO C C     1 
ATOM   6331  O O     . PRO C  1 284 ? 158.348 54.336  129.975 1.00 12.16  ? 284 PRO C O     1 
ATOM   6332  C CB    . PRO C  1 284 ? 158.676 57.097  128.228 1.00 54.29  ? 284 PRO C CB    1 
ATOM   6333  C CG    . PRO C  1 284 ? 159.181 57.680  126.949 1.00 55.45  ? 284 PRO C CG    1 
ATOM   6334  C CD    . PRO C  1 284 ? 158.721 56.719  125.898 1.00 54.14  ? 284 PRO C CD    1 
ATOM   6335  N N     . LEU C  1 285 ? 156.758 54.563  128.402 1.00 5.81   ? 285 LEU C N     1 
ATOM   6336  C CA    . LEU C  1 285 ? 155.742 53.768  129.099 1.00 6.21   ? 285 LEU C CA    1 
ATOM   6337  C C     . LEU C  1 285 ? 156.116 52.317  129.000 1.00 7.92   ? 285 LEU C C     1 
ATOM   6338  O O     . LEU C  1 285 ? 156.355 51.627  129.986 1.00 8.37   ? 285 LEU C O     1 
ATOM   6339  C CB    . LEU C  1 285 ? 154.387 53.934  128.436 1.00 24.79  ? 285 LEU C CB    1 
ATOM   6340  C CG    . LEU C  1 285 ? 153.498 55.038  128.974 1.00 25.68  ? 285 LEU C CG    1 
ATOM   6341  C CD1   . LEU C  1 285 ? 154.306 56.322  129.053 1.00 26.61  ? 285 LEU C CD1   1 
ATOM   6342  C CD2   . LEU C  1 285 ? 152.246 55.173  128.084 1.00 23.90  ? 285 LEU C CD2   1 
ATOM   6343  N N     . VAL C  1 286 ? 156.150 51.852  127.767 1.00 31.56  ? 286 VAL C N     1 
ATOM   6344  C CA    . VAL C  1 286 ? 156.507 50.484  127.482 1.00 32.83  ? 286 VAL C CA    1 
ATOM   6345  C C     . VAL C  1 286 ? 157.813 50.172  128.181 1.00 35.32  ? 286 VAL C C     1 
ATOM   6346  O O     . VAL C  1 286 ? 157.873 49.291  129.030 1.00 35.61  ? 286 VAL C O     1 
ATOM   6347  C CB    . VAL C  1 286 ? 156.653 50.298  125.975 1.00 1.00   ? 286 VAL C CB    1 
ATOM   6348  C CG1   . VAL C  1 286 ? 157.552 49.158  125.689 1.00 1.00   ? 286 VAL C CG1   1 
ATOM   6349  C CG2   . VAL C  1 286 ? 155.293 50.035  125.377 1.00 1.00   ? 286 VAL C CG2   1 
ATOM   6350  N N     . GLU C  1 287 ? 158.833 50.947  127.829 1.00 36.91  ? 287 GLU C N     1 
ATOM   6351  C CA    . GLU C  1 287 ? 160.187 50.809  128.352 1.00 41.01  ? 287 GLU C CA    1 
ATOM   6352  C C     . GLU C  1 287 ? 160.301 50.954  129.856 1.00 40.99  ? 287 GLU C C     1 
ATOM   6353  O O     . GLU C  1 287 ? 161.293 50.559  130.451 1.00 41.09  ? 287 GLU C O     1 
ATOM   6354  C CB    . GLU C  1 287 ? 161.123 51.814  127.666 1.00 151.35 ? 287 GLU C CB    1 
ATOM   6355  C CG    . GLU C  1 287 ? 162.160 51.169  126.748 1.00 159.48 ? 287 GLU C CG    1 
ATOM   6356  C CD    . GLU C  1 287 ? 163.111 52.177  126.128 1.00 165.17 ? 287 GLU C CD    1 
ATOM   6357  O OE1   . GLU C  1 287 ? 163.820 52.883  126.883 1.00 168.00 ? 287 GLU C OE1   1 
ATOM   6358  O OE2   . GLU C  1 287 ? 163.148 52.257  124.881 1.00 167.01 ? 287 GLU C OE2   1 
ATOM   6359  N N     . GLY C  1 288 ? 159.289 51.515  130.486 1.00 46.38  ? 288 GLY C N     1 
ATOM   6360  C CA    . GLY C  1 288 ? 159.375 51.657  131.921 1.00 48.09  ? 288 GLY C CA    1 
ATOM   6361  C C     . GLY C  1 288 ? 159.903 53.003  132.384 1.00 50.65  ? 288 GLY C C     1 
ATOM   6362  O O     . GLY C  1 288 ? 161.089 53.309  132.250 1.00 51.90  ? 288 GLY C O     1 
ATOM   6363  N N     . SER C  1 289 ? 159.006 53.808  132.944 1.00 40.61  ? 289 SER C N     1 
ATOM   6364  C CA    . SER C  1 289 ? 159.344 55.125  133.451 1.00 41.95  ? 289 SER C CA    1 
ATOM   6365  C C     . SER C  1 289 ? 158.334 55.382  134.535 1.00 42.60  ? 289 SER C C     1 
ATOM   6366  O O     . SER C  1 289 ? 157.661 54.456  134.981 1.00 42.22  ? 289 SER C O     1 
ATOM   6367  C CB    . SER C  1 289 ? 159.201 56.175  132.349 1.00 62.97  ? 289 SER C CB    1 
ATOM   6368  O OG    . SER C  1 289 ? 157.915 56.116  131.757 1.00 63.97  ? 289 SER C OG    1 
ATOM   6369  N N     . THR C  1 290 ? 158.219 56.636  134.953 1.00 67.92  ? 290 THR C N     1 
ATOM   6370  C CA    . THR C  1 290 ? 157.263 56.995  135.987 1.00 69.51  ? 290 THR C CA    1 
ATOM   6371  C C     . THR C  1 290 ? 156.420 58.145  135.475 1.00 71.52  ? 290 THR C C     1 
ATOM   6372  O O     . THR C  1 290 ? 156.918 58.980  134.716 1.00 71.99  ? 290 THR C O     1 
ATOM   6373  C CB    . THR C  1 290 ? 157.961 57.486  137.258 1.00 35.50  ? 290 THR C CB    1 
ATOM   6374  O OG1   . THR C  1 290 ? 159.027 56.596  137.616 1.00 36.19  ? 290 THR C OG1   1 
ATOM   6375  C CG2   . THR C  1 290 ? 156.984 57.555  138.380 1.00 34.70  ? 290 THR C CG2   1 
ATOM   6376  N N     . VAL C  1 291 ? 155.146 58.176  135.856 1.00 50.79  ? 291 VAL C N     1 
ATOM   6377  C CA    . VAL C  1 291 ? 154.277 59.283  135.460 1.00 52.18  ? 291 VAL C CA    1 
ATOM   6378  C C     . VAL C  1 291 ? 153.507 59.639  136.718 1.00 54.25  ? 291 VAL C C     1 
ATOM   6379  O O     . VAL C  1 291 ? 153.163 58.756  137.509 1.00 54.13  ? 291 VAL C O     1 
ATOM   6380  C CB    . VAL C  1 291 ? 153.282 58.915  134.319 1.00 43.97  ? 291 VAL C CB    1 
ATOM   6381  C CG1   . VAL C  1 291 ? 153.987 58.171  133.217 1.00 44.48  ? 291 VAL C CG1   1 
ATOM   6382  C CG2   . VAL C  1 291 ? 152.158 58.094  134.846 1.00 43.87  ? 291 VAL C CG2   1 
ATOM   6383  N N     . SER C  1 292 ? 153.262 60.927  136.924 1.00 75.88  ? 292 SER C N     1 
ATOM   6384  C CA    . SER C  1 292 ? 152.545 61.351  138.114 1.00 78.22  ? 292 SER C CA    1 
ATOM   6385  C C     . SER C  1 292 ? 151.043 61.357  137.907 1.00 79.28  ? 292 SER C C     1 
ATOM   6386  O O     . SER C  1 292 ? 150.538 61.926  136.939 1.00 79.59  ? 292 SER C O     1 
ATOM   6387  C CB    . SER C  1 292 ? 152.999 62.739  138.545 1.00 86.58  ? 292 SER C CB    1 
ATOM   6388  O OG    . SER C  1 292 ? 152.280 63.159  139.692 1.00 88.51  ? 292 SER C OG    1 
ATOM   6389  N N     . THR C  1 293 ? 150.338 60.719  138.833 1.00 89.07  ? 293 THR C N     1 
ATOM   6390  C CA    . THR C  1 293 ? 148.886 60.635  138.799 1.00 90.50  ? 293 THR C CA    1 
ATOM   6391  C C     . THR C  1 293 ? 148.365 61.337  140.042 1.00 91.59  ? 293 THR C C     1 
ATOM   6392  O O     . THR C  1 293 ? 149.109 61.537  141.003 1.00 91.01  ? 293 THR C O     1 
ATOM   6393  C CB    . THR C  1 293 ? 148.433 59.192  138.858 1.00 81.12  ? 293 THR C CB    1 
ATOM   6394  O OG1   . THR C  1 293 ? 148.952 58.590  140.053 1.00 81.99  ? 293 THR C OG1   1 
ATOM   6395  C CG2   . THR C  1 293 ? 148.937 58.432  137.652 1.00 80.95  ? 293 THR C CG2   1 
ATOM   6396  N N     . LYS C  1 294 ? 147.089 61.698  140.044 1.00 98.40  ? 294 LYS C N     1 
ATOM   6397  C CA    . LYS C  1 294 ? 146.534 62.379  141.205 1.00 98.66  ? 294 LYS C CA    1 
ATOM   6398  C C     . LYS C  1 294 ? 146.450 61.470  142.443 1.00 98.04  ? 294 LYS C C     1 
ATOM   6399  O O     . LYS C  1 294 ? 145.825 61.816  143.440 1.00 98.60  ? 294 LYS C O     1 
ATOM   6400  C CB    . LYS C  1 294 ? 145.152 62.966  140.869 1.00 104.43 ? 294 LYS C CB    1 
ATOM   6401  C CG    . LYS C  1 294 ? 144.044 61.949  140.593 1.00 104.76 ? 294 LYS C CG    1 
ATOM   6402  C CD    . LYS C  1 294 ? 142.725 62.670  140.301 1.00 105.10 ? 294 LYS C CD    1 
ATOM   6403  C CE    . LYS C  1 294 ? 141.584 61.707  139.997 1.00 105.92 ? 294 LYS C CE    1 
ATOM   6404  N NZ    . LYS C  1 294 ? 140.348 62.459  139.645 1.00 105.32 ? 294 LYS C NZ    1 
ATOM   6405  N N     . HIS C  1 295 ? 147.089 60.310  142.381 1.00 76.71  ? 295 HIS C N     1 
ATOM   6406  C CA    . HIS C  1 295 ? 147.085 59.379  143.504 1.00 76.96  ? 295 HIS C CA    1 
ATOM   6407  C C     . HIS C  1 295 ? 148.516 59.104  143.923 1.00 77.29  ? 295 HIS C C     1 
ATOM   6408  O O     . HIS C  1 295 ? 148.766 58.394  144.895 1.00 77.59  ? 295 HIS C O     1 
ATOM   6409  C CB    . HIS C  1 295 ? 146.419 58.066  143.110 1.00 84.58  ? 295 HIS C CB    1 
ATOM   6410  C CG    . HIS C  1 295 ? 144.976 58.215  142.762 1.00 85.55  ? 295 HIS C CG    1 
ATOM   6411  N ND1   . HIS C  1 295 ? 144.015 58.519  143.700 1.00 85.81  ? 295 HIS C ND1   1 
ATOM   6412  C CD2   . HIS C  1 295 ? 144.332 58.143  141.573 1.00 86.58  ? 295 HIS C CD2   1 
ATOM   6413  C CE1   . HIS C  1 295 ? 142.841 58.628  143.104 1.00 86.31  ? 295 HIS C CE1   1 
ATOM   6414  N NE2   . HIS C  1 295 ? 143.005 58.405  141.812 1.00 86.09  ? 295 HIS C NE2   1 
ATOM   6415  N N     . GLY C  1 296 ? 149.460 59.666  143.180 1.00 83.93  ? 296 GLY C N     1 
ATOM   6416  C CA    . GLY C  1 296 ? 150.853 59.461  143.510 1.00 83.21  ? 296 GLY C CA    1 
ATOM   6417  C C     . GLY C  1 296 ? 151.676 59.131  142.289 1.00 82.59  ? 296 GLY C C     1 
ATOM   6418  O O     . GLY C  1 296 ? 151.259 59.387  141.159 1.00 82.74  ? 296 GLY C O     1 
ATOM   6419  N N     . MET C  1 297 ? 152.850 58.557  142.526 1.00 48.08  ? 297 MET C N     1 
ATOM   6420  C CA    . MET C  1 297 ? 153.766 58.186  141.463 1.00 46.41  ? 297 MET C CA    1 
ATOM   6421  C C     . MET C  1 297 ? 153.644 56.705  141.091 1.00 44.53  ? 297 MET C C     1 
ATOM   6422  O O     . MET C  1 297 ? 153.865 55.831  141.940 1.00 43.95  ? 297 MET C O     1 
ATOM   6423  C CB    . MET C  1 297 ? 155.205 58.479  141.900 1.00 85.92  ? 297 MET C CB    1 
ATOM   6424  C CG    . MET C  1 297 ? 155.492 59.935  142.197 1.00 89.34  ? 297 MET C CG    1 
ATOM   6425  S SD    . MET C  1 297 ? 155.144 61.020  140.788 1.00 94.49  ? 297 MET C SD    1 
ATOM   6426  C CE    . MET C  1 297 ? 156.662 60.847  139.860 1.00 93.79  ? 297 MET C CE    1 
ATOM   6427  N N     . VAL C  1 298 ? 153.304 56.430  139.827 1.00 63.35  ? 298 VAL C N     1 
ATOM   6428  C CA    . VAL C  1 298 ? 153.181 55.053  139.344 1.00 60.97  ? 298 VAL C CA    1 
ATOM   6429  C C     . VAL C  1 298 ? 154.260 54.733  138.309 1.00 59.33  ? 298 VAL C C     1 
ATOM   6430  O O     . VAL C  1 298 ? 154.653 55.588  137.506 1.00 58.25  ? 298 VAL C O     1 
ATOM   6431  C CB    . VAL C  1 298 ? 151.796 54.768  138.707 1.00 61.92  ? 298 VAL C CB    1 
ATOM   6432  C CG1   . VAL C  1 298 ? 150.684 55.059  139.703 1.00 60.84  ? 298 VAL C CG1   1 
ATOM   6433  C CG2   . VAL C  1 298 ? 151.630 55.577  137.444 1.00 60.23  ? 298 VAL C CG2   1 
ATOM   6434  N N     . LYS C  1 299 ? 154.726 53.490  138.331 1.00 35.48  ? 299 LYS C N     1 
ATOM   6435  C CA    . LYS C  1 299 ? 155.763 53.070  137.425 1.00 34.41  ? 299 LYS C CA    1 
ATOM   6436  C C     . LYS C  1 299 ? 155.256 52.095  136.390 1.00 32.66  ? 299 LYS C C     1 
ATOM   6437  O O     . LYS C  1 299 ? 154.712 51.043  136.712 1.00 32.82  ? 299 LYS C O     1 
ATOM   6438  C CB    . LYS C  1 299 ? 156.913 52.437  138.206 1.00 135.62 ? 299 LYS C CB    1 
ATOM   6439  C CG    . LYS C  1 299 ? 157.276 53.192  139.477 1.00 137.89 ? 299 LYS C CG    1 
ATOM   6440  C CD    . LYS C  1 299 ? 158.712 52.919  139.920 1.00 140.90 ? 299 LYS C CD    1 
ATOM   6441  C CE    . LYS C  1 299 ? 158.969 51.442  140.193 1.00 143.80 ? 299 LYS C CE    1 
ATOM   6442  N NZ    . LYS C  1 299 ? 160.398 51.183  140.550 1.00 146.51 ? 299 LYS C NZ    1 
ATOM   6443  N N     . THR C  1 300 ? 155.461 52.463  135.135 1.00 30.85  ? 300 THR C N     1 
ATOM   6444  C CA    . THR C  1 300 ? 155.066 51.663  133.978 1.00 29.12  ? 300 THR C CA    1 
ATOM   6445  C C     . THR C  1 300 ? 155.960 50.423  133.850 1.00 28.77  ? 300 THR C C     1 
ATOM   6446  O O     . THR C  1 300 ? 155.685 49.509  133.076 1.00 27.87  ? 300 THR C O     1 
ATOM   6447  C CB    . THR C  1 300 ? 155.217 52.518  132.685 1.00 13.02  ? 300 THR C CB    1 
ATOM   6448  O OG1   . THR C  1 300 ? 156.552 53.038  132.622 1.00 11.02  ? 300 THR C OG1   1 
ATOM   6449  C CG2   . THR C  1 300 ? 154.242 53.702  132.682 1.00 11.58  ? 300 THR C CG2   1 
ATOM   6450  N N     . ASP C  1 301 ? 157.043 50.408  134.617 1.00 66.61  ? 301 ASP C N     1 
ATOM   6451  C CA    . ASP C  1 301 ? 158.002 49.317  134.560 1.00 66.80  ? 301 ASP C CA    1 
ATOM   6452  C C     . ASP C  1 301 ? 157.372 47.968  134.388 1.00 64.52  ? 301 ASP C C     1 
ATOM   6453  O O     . ASP C  1 301 ? 157.767 47.221  133.504 1.00 64.97  ? 301 ASP C O     1 
ATOM   6454  C CB    . ASP C  1 301 ? 158.892 49.301  135.802 1.00 146.09 ? 301 ASP C CB    1 
ATOM   6455  C CG    . ASP C  1 301 ? 160.091 50.218  135.670 1.00 149.95 ? 301 ASP C CG    1 
ATOM   6456  O OD1   . ASP C  1 301 ? 159.925 51.449  135.785 1.00 150.66 ? 301 ASP C OD1   1 
ATOM   6457  O OD2   . ASP C  1 301 ? 161.202 49.702  135.438 1.00 152.06 ? 301 ASP C OD2   1 
ATOM   6458  N N     . HIS C  1 302 ? 156.368 47.672  135.204 1.00 45.82  ? 302 HIS C N     1 
ATOM   6459  C CA    . HIS C  1 302 ? 155.723 46.368  135.157 1.00 43.87  ? 302 HIS C CA    1 
ATOM   6460  C C     . HIS C  1 302 ? 154.322 46.215  134.557 1.00 42.10  ? 302 HIS C C     1 
ATOM   6461  O O     . HIS C  1 302 ? 153.682 45.176  134.721 1.00 42.12  ? 302 HIS C O     1 
ATOM   6462  C CB    . HIS C  1 302 ? 155.735 45.782  136.553 1.00 73.99  ? 302 HIS C CB    1 
ATOM   6463  C CG    . HIS C  1 302 ? 157.101 45.393  137.020 1.00 76.36  ? 302 HIS C CG    1 
ATOM   6464  N ND1   . HIS C  1 302 ? 157.899 44.508  136.325 1.00 76.58  ? 302 HIS C ND1   1 
ATOM   6465  C CD2   . HIS C  1 302 ? 157.803 45.745  138.123 1.00 76.57  ? 302 HIS C CD2   1 
ATOM   6466  C CE1   . HIS C  1 302 ? 159.032 44.330  136.980 1.00 75.72  ? 302 HIS C CE1   1 
ATOM   6467  N NE2   . HIS C  1 302 ? 158.999 45.068  138.075 1.00 76.28  ? 302 HIS C NE2   1 
ATOM   6468  N N     . ILE C  1 303 ? 153.849 47.246  133.861 1.00 44.99  ? 303 ILE C N     1 
ATOM   6469  C CA    . ILE C  1 303 ? 152.541 47.232  133.209 1.00 39.45  ? 303 ILE C CA    1 
ATOM   6470  C C     . ILE C  1 303 ? 152.597 46.270  132.050 1.00 37.28  ? 303 ILE C C     1 
ATOM   6471  O O     . ILE C  1 303 ? 153.536 46.294  131.281 1.00 37.96  ? 303 ILE C O     1 
ATOM   6472  C CB    . ILE C  1 303 ? 152.231 48.582  132.595 1.00 25.28  ? 303 ILE C CB    1 
ATOM   6473  C CG1   . ILE C  1 303 ? 152.276 49.678  133.668 1.00 25.25  ? 303 ILE C CG1   1 
ATOM   6474  C CG2   . ILE C  1 303 ? 150.963 48.482  131.812 1.00 23.37  ? 303 ILE C CG2   1 
ATOM   6475  C CD1   . ILE C  1 303 ? 151.470 49.376  134.909 1.00 28.61  ? 303 ILE C CD1   1 
ATOM   6476  N N     . LEU C  1 304 ? 151.603 45.423  131.908 1.00 31.33  ? 304 LEU C N     1 
ATOM   6477  C CA    . LEU C  1 304 ? 151.595 44.503  130.781 1.00 28.19  ? 304 LEU C CA    1 
ATOM   6478  C C     . LEU C  1 304 ? 150.979 45.227  129.584 1.00 28.64  ? 304 LEU C C     1 
ATOM   6479  O O     . LEU C  1 304 ? 149.845 45.688  129.654 1.00 30.42  ? 304 LEU C O     1 
ATOM   6480  C CB    . LEU C  1 304 ? 150.746 43.285  131.105 1.00 5.77   ? 304 LEU C CB    1 
ATOM   6481  C CG    . LEU C  1 304 ? 150.380 42.519  129.847 1.00 5.21   ? 304 LEU C CG    1 
ATOM   6482  C CD1   . LEU C  1 304 ? 151.645 41.879  129.293 1.00 6.75   ? 304 LEU C CD1   1 
ATOM   6483  C CD2   . LEU C  1 304 ? 149.326 41.492  130.126 1.00 4.51   ? 304 LEU C CD2   1 
ATOM   6484  N N     . PHE C  1 305 ? 151.696 45.332  128.477 1.00 11.77  ? 305 PHE C N     1 
ATOM   6485  C CA    . PHE C  1 305 ? 151.123 46.024  127.330 1.00 10.93  ? 305 PHE C CA    1 
ATOM   6486  C C     . PHE C  1 305 ? 150.629 45.054  126.263 1.00 9.11   ? 305 PHE C C     1 
ATOM   6487  O O     . PHE C  1 305 ? 151.223 44.017  126.026 1.00 8.73   ? 305 PHE C O     1 
ATOM   6488  C CB    . PHE C  1 305 ? 152.152 47.001  126.697 1.00 28.61  ? 305 PHE C CB    1 
ATOM   6489  C CG    . PHE C  1 305 ? 152.426 48.219  127.521 1.00 28.55  ? 305 PHE C CG    1 
ATOM   6490  C CD1   . PHE C  1 305 ? 153.324 48.176  128.565 1.00 29.34  ? 305 PHE C CD1   1 
ATOM   6491  C CD2   . PHE C  1 305 ? 151.704 49.379  127.314 1.00 28.41  ? 305 PHE C CD2   1 
ATOM   6492  C CE1   . PHE C  1 305 ? 153.493 49.265  129.401 1.00 30.17  ? 305 PHE C CE1   1 
ATOM   6493  C CE2   . PHE C  1 305 ? 151.863 50.470  128.142 1.00 28.86  ? 305 PHE C CE2   1 
ATOM   6494  C CZ    . PHE C  1 305 ? 152.761 50.413  129.193 1.00 29.42  ? 305 PHE C CZ    1 
ATOM   6495  N N     . ILE C  1 306 ? 149.532 45.382  125.616 1.00 14.40  ? 306 ILE C N     1 
ATOM   6496  C CA    . ILE C  1 306 ? 149.064 44.528  124.556 1.00 13.99  ? 306 ILE C CA    1 
ATOM   6497  C C     . ILE C  1 306 ? 148.685 45.487  123.456 1.00 13.72  ? 306 ILE C C     1 
ATOM   6498  O O     . ILE C  1 306 ? 147.768 46.285  123.628 1.00 14.88  ? 306 ILE C O     1 
ATOM   6499  C CB    . ILE C  1 306 ? 147.832 43.693  124.982 1.00 13.48  ? 306 ILE C CB    1 
ATOM   6500  C CG1   . ILE C  1 306 ? 148.205 42.750  126.131 1.00 14.03  ? 306 ILE C CG1   1 
ATOM   6501  C CG2   . ILE C  1 306 ? 147.302 42.903  123.787 1.00 12.04  ? 306 ILE C CG2   1 
ATOM   6502  C CD1   . ILE C  1 306 ? 147.048 41.953  126.668 1.00 14.50  ? 306 ILE C CD1   1 
ATOM   6503  N N     . ALA C  1 307 ? 149.415 45.431  122.348 1.00 3.19   ? 307 ALA C N     1 
ATOM   6504  C CA    . ALA C  1 307 ? 149.146 46.280  121.194 1.00 3.19   ? 307 ALA C CA    1 
ATOM   6505  C C     . ALA C  1 307 ? 148.457 45.498  120.080 1.00 3.19   ? 307 ALA C C     1 
ATOM   6506  O O     . ALA C  1 307 ? 148.832 44.385  119.775 1.00 3.19   ? 307 ALA C O     1 
ATOM   6507  C CB    . ALA C  1 307 ? 150.424 46.854  120.681 1.00 51.36  ? 307 ALA C CB    1 
ATOM   6508  N N     . SER C  1 308 ? 147.457 46.094  119.458 1.00 4.28   ? 308 SER C N     1 
ATOM   6509  C CA    . SER C  1 308 ? 146.735 45.422  118.388 1.00 5.98   ? 308 SER C CA    1 
ATOM   6510  C C     . SER C  1 308 ? 146.885 46.101  117.041 1.00 5.40   ? 308 SER C C     1 
ATOM   6511  O O     . SER C  1 308 ? 147.322 47.217  116.979 1.00 6.20   ? 308 SER C O     1 
ATOM   6512  C CB    . SER C  1 308 ? 145.240 45.369  118.735 1.00 22.27  ? 308 SER C CB    1 
ATOM   6513  O OG    . SER C  1 308 ? 144.432 46.033  117.753 1.00 23.09  ? 308 SER C OG    1 
ATOM   6514  N N     . GLY C  1 309 ? 146.491 45.432  115.968 1.00 1.00   ? 309 GLY C N     1 
ATOM   6515  C CA    . GLY C  1 309 ? 146.570 46.036  114.659 1.00 1.00   ? 309 GLY C CA    1 
ATOM   6516  C C     . GLY C  1 309 ? 146.383 45.048  113.526 1.00 1.00   ? 309 GLY C C     1 
ATOM   6517  O O     . GLY C  1 309 ? 146.780 43.903  113.641 1.00 1.00   ? 309 GLY C O     1 
ATOM   6518  N N     . ALA C  1 310 ? 145.789 45.512  112.426 1.00 17.94  ? 310 ALA C N     1 
ATOM   6519  C CA    . ALA C  1 310 ? 145.514 44.708  111.228 1.00 19.38  ? 310 ALA C CA    1 
ATOM   6520  C C     . ALA C  1 310 ? 146.750 44.482  110.429 1.00 21.27  ? 310 ALA C C     1 
ATOM   6521  O O     . ALA C  1 310 ? 147.012 43.393  109.933 1.00 22.24  ? 310 ALA C O     1 
ATOM   6522  C CB    . ALA C  1 310 ? 144.529 45.407  110.356 1.00 35.74  ? 310 ALA C CB    1 
ATOM   6523  N N     . PHE C  1 311 ? 147.497 45.550  110.255 1.00 35.50  ? 311 PHE C N     1 
ATOM   6524  C CA    . PHE C  1 311 ? 148.719 45.438  109.516 1.00 38.70  ? 311 PHE C CA    1 
ATOM   6525  C C     . PHE C  1 311 ? 148.451 44.911  108.128 1.00 43.25  ? 311 PHE C C     1 
ATOM   6526  O O     . PHE C  1 311 ? 149.040 43.922  107.725 1.00 43.55  ? 311 PHE C O     1 
ATOM   6527  C CB    . PHE C  1 311 ? 149.672 44.521  110.263 1.00 6.15   ? 311 PHE C CB    1 
ATOM   6528  C CG    . PHE C  1 311 ? 150.227 45.134  111.505 1.00 4.21   ? 311 PHE C CG    1 
ATOM   6529  C CD1   . PHE C  1 311 ? 151.400 45.874  111.458 1.00 5.21   ? 311 PHE C CD1   1 
ATOM   6530  C CD2   . PHE C  1 311 ? 149.581 44.995  112.723 1.00 3.27   ? 311 PHE C CD2   1 
ATOM   6531  C CE1   . PHE C  1 311 ? 151.927 46.471  112.620 1.00 4.77   ? 311 PHE C CE1   1 
ATOM   6532  C CE2   . PHE C  1 311 ? 150.102 45.589  113.881 1.00 3.70   ? 311 PHE C CE2   1 
ATOM   6533  C CZ    . PHE C  1 311 ? 151.272 46.325  113.828 1.00 3.58   ? 311 PHE C CZ    1 
ATOM   6534  N N     . GLN C  1 312 ? 147.536 45.548  107.405 1.00 40.08  ? 312 GLN C N     1 
ATOM   6535  C CA    . GLN C  1 312 ? 147.301 45.114  106.048 1.00 44.36  ? 312 GLN C CA    1 
ATOM   6536  C C     . GLN C  1 312 ? 148.325 45.806  105.164 1.00 46.73  ? 312 GLN C C     1 
ATOM   6537  O O     . GLN C  1 312 ? 148.753 45.251  104.158 1.00 49.26  ? 312 GLN C O     1 
ATOM   6538  C CB    . GLN C  1 312 ? 145.883 45.431  105.571 1.00 56.59  ? 312 GLN C CB    1 
ATOM   6539  C CG    . GLN C  1 312 ? 145.097 46.426  106.394 1.00 59.87  ? 312 GLN C CG    1 
ATOM   6540  C CD    . GLN C  1 312 ? 143.616 46.460  105.986 1.00 61.32  ? 312 GLN C CD    1 
ATOM   6541  O OE1   . GLN C  1 312 ? 142.899 45.470  106.113 1.00 59.92  ? 312 GLN C OE1   1 
ATOM   6542  N NE2   . GLN C  1 312 ? 143.164 47.605  105.490 1.00 62.01  ? 312 GLN C NE2   1 
ATOM   6543  N N     . VAL C  1 313 ? 148.745 47.008  105.555 1.00 35.70  ? 313 VAL C N     1 
ATOM   6544  C CA    . VAL C  1 313 ? 149.733 47.770  104.787 1.00 37.40  ? 313 VAL C CA    1 
ATOM   6545  C C     . VAL C  1 313 ? 151.118 47.692  105.372 1.00 37.47  ? 313 VAL C C     1 
ATOM   6546  O O     . VAL C  1 313 ? 152.058 47.373  104.664 1.00 37.98  ? 313 VAL C O     1 
ATOM   6547  C CB    . VAL C  1 313 ? 149.363 49.234  104.700 1.00 83.01  ? 313 VAL C CB    1 
ATOM   6548  C CG1   . VAL C  1 313 ? 148.407 49.442  103.534 1.00 84.66  ? 313 VAL C CG1   1 
ATOM   6549  C CG2   . VAL C  1 313 ? 148.760 49.690  106.040 1.00 84.27  ? 313 VAL C CG2   1 
ATOM   6550  N N     . ALA C  1 314 ? 151.262 47.990  106.656 1.00 38.70  ? 314 ALA C N     1 
ATOM   6551  C CA    . ALA C  1 314 ? 152.583 47.913  107.260 1.00 40.34  ? 314 ALA C CA    1 
ATOM   6552  C C     . ALA C  1 314 ? 152.819 46.589  107.961 1.00 41.56  ? 314 ALA C C     1 
ATOM   6553  O O     . ALA C  1 314 ? 151.873 45.935  108.426 1.00 42.44  ? 314 ALA C O     1 
ATOM   6554  C CB    . ALA C  1 314 ? 152.771 49.017  108.224 1.00 15.13  ? 314 ALA C CB    1 
ATOM   6555  N N     . ARG C  1 315 ? 154.085 46.185  108.017 1.00 42.83  ? 315 ARG C N     1 
ATOM   6556  C CA    . ARG C  1 315 ? 154.457 44.947  108.688 1.00 44.73  ? 315 ARG C CA    1 
ATOM   6557  C C     . ARG C  1 315 ? 154.717 45.416  110.105 1.00 41.92  ? 315 ARG C C     1 
ATOM   6558  O O     . ARG C  1 315 ? 154.978 46.579  110.319 1.00 43.43  ? 315 ARG C O     1 
ATOM   6559  C CB    . ARG C  1 315 ? 155.726 44.377  108.054 1.00 178.50 ? 315 ARG C CB    1 
ATOM   6560  C CG    . ARG C  1 315 ? 155.534 43.945  106.603 1.00 187.79 ? 315 ARG C CG    1 
ATOM   6561  C CD    . ARG C  1 315 ? 156.569 44.561  105.647 1.00 195.16 ? 315 ARG C CD    1 
ATOM   6562  N NE    . ARG C  1 315 ? 156.338 45.984  105.374 1.00 200.00 ? 315 ARG C NE    1 
ATOM   6563  C CZ    . ARG C  1 315 ? 157.034 46.710  104.497 1.00 200.00 ? 315 ARG C CZ    1 
ATOM   6564  N NH1   . ARG C  1 315 ? 158.017 46.157  103.794 1.00 200.00 ? 315 ARG C NH1   1 
ATOM   6565  N NH2   . ARG C  1 315 ? 156.746 47.995  104.319 1.00 200.00 ? 315 ARG C NH2   1 
ATOM   6566  N N     . PRO C  1 316 ? 154.614 44.545  111.099 1.00 28.35  ? 316 PRO C N     1 
ATOM   6567  C CA    . PRO C  1 316 ? 154.889 45.120  112.408 1.00 27.61  ? 316 PRO C CA    1 
ATOM   6568  C C     . PRO C  1 316 ? 156.365 45.487  112.458 1.00 28.42  ? 316 PRO C C     1 
ATOM   6569  O O     . PRO C  1 316 ? 156.784 46.299  113.288 1.00 29.33  ? 316 PRO C O     1 
ATOM   6570  C CB    . PRO C  1 316 ? 154.547 43.989  113.354 1.00 39.73  ? 316 PRO C CB    1 
ATOM   6571  C CG    . PRO C  1 316 ? 153.533 43.219  112.611 1.00 38.99  ? 316 PRO C CG    1 
ATOM   6572  C CD    . PRO C  1 316 ? 154.102 43.181  111.225 1.00 39.85  ? 316 PRO C CD    1 
ATOM   6573  N N     . SER C  1 317 ? 157.141 44.875  111.557 1.00 62.95  ? 317 SER C N     1 
ATOM   6574  C CA    . SER C  1 317 ? 158.586 45.097  111.422 1.00 61.55  ? 317 SER C CA    1 
ATOM   6575  C C     . SER C  1 317 ? 158.844 46.474  110.817 1.00 59.59  ? 317 SER C C     1 
ATOM   6576  O O     . SER C  1 317 ? 159.887 46.737  110.220 1.00 59.42  ? 317 SER C O     1 
ATOM   6577  C CB    . SER C  1 317 ? 159.178 44.024  110.514 1.00 108.46 ? 317 SER C CB    1 
ATOM   6578  O OG    . SER C  1 317 ? 158.465 43.970  109.289 1.00 109.41 ? 317 SER C OG    1 
ATOM   6579  N N     . ASP C  1 318 ? 157.856 47.341  110.979 1.00 45.20  ? 318 ASP C N     1 
ATOM   6580  C CA    . ASP C  1 318 ? 157.895 48.696  110.483 1.00 41.87  ? 318 ASP C CA    1 
ATOM   6581  C C     . ASP C  1 318 ? 157.803 49.630  111.639 1.00 38.23  ? 318 ASP C C     1 
ATOM   6582  O O     . ASP C  1 318 ? 157.762 50.819  111.440 1.00 40.14  ? 318 ASP C O     1 
ATOM   6583  C CB    . ASP C  1 318 ? 156.719 48.979  109.557 1.00 37.16  ? 318 ASP C CB    1 
ATOM   6584  C CG    . ASP C  1 318 ? 157.014 48.636  108.131 1.00 39.35  ? 318 ASP C CG    1 
ATOM   6585  O OD1   . ASP C  1 318 ? 158.082 48.019  107.887 1.00 38.74  ? 318 ASP C OD1   1 
ATOM   6586  O OD2   . ASP C  1 318 ? 156.175 48.988  107.268 1.00 39.63  ? 318 ASP C OD2   1 
ATOM   6587  N N     . LEU C  1 319 ? 157.726 49.109  112.850 1.00 21.77  ? 319 LEU C N     1 
ATOM   6588  C CA    . LEU C  1 319 ? 157.672 49.984  114.012 1.00 19.70  ? 319 LEU C CA    1 
ATOM   6589  C C     . LEU C  1 319 ? 159.106 50.364  114.312 1.00 19.13  ? 319 LEU C C     1 
ATOM   6590  O O     . LEU C  1 319 ? 160.046 49.780  113.749 1.00 18.94  ? 319 LEU C O     1 
ATOM   6591  C CB    . LEU C  1 319 ? 157.106 49.255  115.216 1.00 21.81  ? 319 LEU C CB    1 
ATOM   6592  C CG    . LEU C  1 319 ? 155.760 48.628  114.920 1.00 20.89  ? 319 LEU C CG    1 
ATOM   6593  C CD1   . LEU C  1 319 ? 155.572 47.389  115.761 1.00 18.39  ? 319 LEU C CD1   1 
ATOM   6594  C CD2   . LEU C  1 319 ? 154.676 49.673  115.158 1.00 19.85  ? 319 LEU C CD2   1 
ATOM   6595  N N     . ILE C  1 320 ? 159.286 51.339  115.193 1.00 21.03  ? 320 ILE C N     1 
ATOM   6596  C CA    . ILE C  1 320 ? 160.633 51.739  115.542 1.00 21.13  ? 320 ILE C CA    1 
ATOM   6597  C C     . ILE C  1 320 ? 161.249 50.601  116.324 1.00 20.97  ? 320 ILE C C     1 
ATOM   6598  O O     . ILE C  1 320 ? 160.628 50.039  117.225 1.00 22.61  ? 320 ILE C O     1 
ATOM   6599  C CB    . ILE C  1 320 ? 160.652 53.010  116.385 1.00 14.37  ? 320 ILE C CB    1 
ATOM   6600  C CG1   . ILE C  1 320 ? 159.810 52.836  117.640 1.00 14.43  ? 320 ILE C CG1   1 
ATOM   6601  C CG2   . ILE C  1 320 ? 160.102 54.129  115.593 1.00 15.86  ? 320 ILE C CG2   1 
ATOM   6602  C CD1   . ILE C  1 320 ? 159.823 54.038  118.541 1.00 11.32  ? 320 ILE C CD1   1 
ATOM   6603  N N     . PRO C  1 321 ? 162.478 50.233  115.971 1.00 8.87   ? 321 PRO C N     1 
ATOM   6604  C CA    . PRO C  1 321 ? 163.184 49.154  116.632 1.00 8.06   ? 321 PRO C CA    1 
ATOM   6605  C C     . PRO C  1 321 ? 163.059 49.189  118.136 1.00 7.99   ? 321 PRO C C     1 
ATOM   6606  O O     . PRO C  1 321 ? 162.811 48.160  118.763 1.00 7.64   ? 321 PRO C O     1 
ATOM   6607  C CB    . PRO C  1 321 ? 164.601 49.355  116.151 1.00 38.14  ? 321 PRO C CB    1 
ATOM   6608  C CG    . PRO C  1 321 ? 164.383 49.769  114.752 1.00 38.37  ? 321 PRO C CG    1 
ATOM   6609  C CD    . PRO C  1 321 ? 163.298 50.798  114.891 1.00 38.12  ? 321 PRO C CD    1 
ATOM   6610  N N     . GLU C  1 322 ? 163.224 50.364  118.724 1.00 5.77   ? 322 GLU C N     1 
ATOM   6611  C CA    . GLU C  1 322 ? 163.126 50.461  120.176 1.00 9.33   ? 322 GLU C CA    1 
ATOM   6612  C C     . GLU C  1 322 ? 161.852 49.733  120.690 1.00 9.29   ? 322 GLU C C     1 
ATOM   6613  O O     . GLU C  1 322 ? 161.881 48.969  121.672 1.00 8.89   ? 322 GLU C O     1 
ATOM   6614  C CB    . GLU C  1 322 ? 163.152 51.942  120.612 1.00 74.67  ? 322 GLU C CB    1 
ATOM   6615  C CG    . GLU C  1 322 ? 164.546 52.645  120.560 1.00 83.85  ? 322 GLU C CG    1 
ATOM   6616  C CD    . GLU C  1 322 ? 165.132 52.811  119.138 1.00 90.53  ? 322 GLU C CD    1 
ATOM   6617  O OE1   . GLU C  1 322 ? 166.200 53.464  118.980 1.00 92.15  ? 322 GLU C OE1   1 
ATOM   6618  O OE2   . GLU C  1 322 ? 164.532 52.288  118.175 1.00 93.55  ? 322 GLU C OE2   1 
ATOM   6619  N N     . LEU C  1 323 ? 160.750 49.938  119.978 1.00 40.51  ? 323 LEU C N     1 
ATOM   6620  C CA    . LEU C  1 323 ? 159.455 49.361  120.317 1.00 40.57  ? 323 LEU C CA    1 
ATOM   6621  C C     . LEU C  1 323 ? 159.333 47.934  119.788 1.00 41.85  ? 323 LEU C C     1 
ATOM   6622  O O     . LEU C  1 323 ? 158.882 47.016  120.473 1.00 43.06  ? 323 LEU C O     1 
ATOM   6623  C CB    . LEU C  1 323 ? 158.381 50.228  119.696 1.00 41.04  ? 323 LEU C CB    1 
ATOM   6624  C CG    . LEU C  1 323 ? 156.959 49.942  120.098 1.00 42.75  ? 323 LEU C CG    1 
ATOM   6625  C CD1   . LEU C  1 323 ? 156.822 50.104  121.609 1.00 41.58  ? 323 LEU C CD1   1 
ATOM   6626  C CD2   . LEU C  1 323 ? 156.055 50.890  119.322 1.00 42.99  ? 323 LEU C CD2   1 
ATOM   6627  N N     . GLN C  1 324 ? 159.741 47.759  118.545 1.00 16.45  ? 324 GLN C N     1 
ATOM   6628  C CA    . GLN C  1 324 ? 159.701 46.469  117.901 1.00 16.84  ? 324 GLN C CA    1 
ATOM   6629  C C     . GLN C  1 324 ? 160.263 45.388  118.792 1.00 16.34  ? 324 GLN C C     1 
ATOM   6630  O O     . GLN C  1 324 ? 159.981 44.222  118.614 1.00 16.33  ? 324 GLN C O     1 
ATOM   6631  C CB    . GLN C  1 324 ? 160.500 46.553  116.627 1.00 51.21  ? 324 GLN C CB    1 
ATOM   6632  C CG    . GLN C  1 324 ? 160.507 45.307  115.859 1.00 56.83  ? 324 GLN C CG    1 
ATOM   6633  C CD    . GLN C  1 324 ? 160.955 45.563  114.462 1.00 61.49  ? 324 GLN C CD    1 
ATOM   6634  O OE1   . GLN C  1 324 ? 161.364 44.646  113.740 1.00 64.63  ? 324 GLN C OE1   1 
ATOM   6635  N NE2   . GLN C  1 324 ? 160.881 46.826  114.053 1.00 62.37  ? 324 GLN C NE2   1 
ATOM   6636  N N     . GLY C  1 325 ? 161.057 45.786  119.771 1.00 24.64  ? 325 GLY C N     1 
ATOM   6637  C CA    . GLY C  1 325 ? 161.677 44.813  120.647 1.00 25.97  ? 325 GLY C CA    1 
ATOM   6638  C C     . GLY C  1 325 ? 161.123 44.758  122.041 1.00 26.50  ? 325 GLY C C     1 
ATOM   6639  O O     . GLY C  1 325 ? 161.544 43.954  122.860 1.00 26.75  ? 325 GLY C O     1 
ATOM   6640  N N     . ARG C  1 326 ? 160.192 45.638  122.330 1.00 26.32  ? 326 ARG C N     1 
ATOM   6641  C CA    . ARG C  1 326 ? 159.574 45.633  123.635 1.00 28.64  ? 326 ARG C CA    1 
ATOM   6642  C C     . ARG C  1 326 ? 158.220 44.960  123.438 1.00 27.08  ? 326 ARG C C     1 
ATOM   6643  O O     . ARG C  1 326 ? 157.419 44.820  124.376 1.00 26.68  ? 326 ARG C O     1 
ATOM   6644  C CB    . ARG C  1 326 ? 159.458 47.058  124.124 1.00 49.34  ? 326 ARG C CB    1 
ATOM   6645  C CG    . ARG C  1 326 ? 160.812 47.623  124.481 1.00 56.19  ? 326 ARG C CG    1 
ATOM   6646  C CD    . ARG C  1 326 ? 161.013 47.519  125.972 1.00 62.29  ? 326 ARG C CD    1 
ATOM   6647  N NE    . ARG C  1 326 ? 160.051 46.598  126.573 1.00 68.16  ? 326 ARG C NE    1 
ATOM   6648  C CZ    . ARG C  1 326 ? 159.859 46.466  127.884 1.00 72.32  ? 326 ARG C CZ    1 
ATOM   6649  N NH1   . ARG C  1 326 ? 160.564 47.199  128.747 1.00 72.92  ? 326 ARG C NH1   1 
ATOM   6650  N NH2   . ARG C  1 326 ? 158.967 45.591  128.337 1.00 74.36  ? 326 ARG C NH2   1 
ATOM   6651  N N     . LEU C  1 327 ? 158.006 44.541  122.183 1.00 31.68  ? 327 LEU C N     1 
ATOM   6652  C CA    . LEU C  1 327 ? 156.809 43.820  121.731 1.00 30.12  ? 327 LEU C CA    1 
ATOM   6653  C C     . LEU C  1 327 ? 157.340 42.490  121.194 1.00 30.69  ? 327 LEU C C     1 
ATOM   6654  O O     . LEU C  1 327 ? 157.286 42.183  120.000 1.00 28.55  ? 327 LEU C O     1 
ATOM   6655  C CB    . LEU C  1 327 ? 156.067 44.605  120.640 1.00 19.70  ? 327 LEU C CB    1 
ATOM   6656  C CG    . LEU C  1 327 ? 155.460 45.961  121.061 1.00 18.07  ? 327 LEU C CG    1 
ATOM   6657  C CD1   . LEU C  1 327 ? 154.426 46.360  120.028 1.00 16.55  ? 327 LEU C CD1   1 
ATOM   6658  C CD2   . LEU C  1 327 ? 154.813 45.894  122.450 1.00 16.72  ? 327 LEU C CD2   1 
ATOM   6659  N N     . PRO C  1 328 ? 157.839 41.665  122.117 1.00 63.56  ? 328 PRO C N     1 
ATOM   6660  C CA    . PRO C  1 328 ? 158.409 40.369  121.805 1.00 63.50  ? 328 PRO C CA    1 
ATOM   6661  C C     . PRO C  1 328 ? 157.423 39.375  121.247 1.00 64.42  ? 328 PRO C C     1 
ATOM   6662  O O     . PRO C  1 328 ? 157.642 38.831  120.176 1.00 66.21  ? 328 PRO C O     1 
ATOM   6663  C CB    . PRO C  1 328 ? 158.989 39.925  123.135 1.00 18.95  ? 328 PRO C CB    1 
ATOM   6664  C CG    . PRO C  1 328 ? 158.473 40.937  124.187 1.00 18.14  ? 328 PRO C CG    1 
ATOM   6665  C CD    . PRO C  1 328 ? 157.430 41.718  123.532 1.00 19.26  ? 328 PRO C CD    1 
ATOM   6666  N N     . ILE C  1 329 ? 156.335 39.143  121.967 1.00 34.59  ? 329 ILE C N     1 
ATOM   6667  C CA    . ILE C  1 329 ? 155.336 38.173  121.539 1.00 33.57  ? 329 ILE C CA    1 
ATOM   6668  C C     . ILE C  1 329 ? 154.419 38.583  120.395 1.00 33.60  ? 329 ILE C C     1 
ATOM   6669  O O     . ILE C  1 329 ? 153.553 39.423  120.595 1.00 35.35  ? 329 ILE C O     1 
ATOM   6670  C CB    . ILE C  1 329 ? 154.427 37.823  122.674 1.00 30.85  ? 329 ILE C CB    1 
ATOM   6671  C CG1   . ILE C  1 329 ? 155.246 37.293  123.858 1.00 32.76  ? 329 ILE C CG1   1 
ATOM   6672  C CG2   . ILE C  1 329 ? 153.391 36.869  122.167 1.00 30.23  ? 329 ILE C CG2   1 
ATOM   6673  C CD1   . ILE C  1 329 ? 154.411 36.891  125.112 1.00 34.74  ? 329 ILE C CD1   1 
ATOM   6674  N N     . ARG C  1 330 ? 154.587 38.016  119.203 1.00 37.59  ? 330 ARG C N     1 
ATOM   6675  C CA    . ARG C  1 330 ? 153.672 38.365  118.124 1.00 37.89  ? 330 ARG C CA    1 
ATOM   6676  C C     . ARG C  1 330 ? 152.781 37.160  118.071 1.00 37.44  ? 330 ARG C C     1 
ATOM   6677  O O     . ARG C  1 330 ? 153.287 36.040  118.071 1.00 38.54  ? 330 ARG C O     1 
ATOM   6678  C CB    . ARG C  1 330 ? 154.338 38.493  116.762 1.00 31.21  ? 330 ARG C CB    1 
ATOM   6679  C CG    . ARG C  1 330 ? 155.566 39.319  116.713 1.00 35.28  ? 330 ARG C CG    1 
ATOM   6680  C CD    . ARG C  1 330 ? 155.400 40.699  117.285 1.00 36.94  ? 330 ARG C CD    1 
ATOM   6681  N NE    . ARG C  1 330 ? 156.671 41.428  117.239 1.00 38.39  ? 330 ARG C NE    1 
ATOM   6682  C CZ    . ARG C  1 330 ? 157.361 41.658  116.121 1.00 38.45  ? 330 ARG C CZ    1 
ATOM   6683  N NH1   . ARG C  1 330 ? 156.899 41.221  114.948 1.00 37.70  ? 330 ARG C NH1   1 
ATOM   6684  N NH2   . ARG C  1 330 ? 158.524 42.304  116.172 1.00 38.48  ? 330 ARG C NH2   1 
ATOM   6685  N N     . VAL C  1 331 ? 151.467 37.396  118.038 1.00 31.94  ? 331 VAL C N     1 
ATOM   6686  C CA    . VAL C  1 331 ? 150.439 36.352  117.988 1.00 30.67  ? 331 VAL C CA    1 
ATOM   6687  C C     . VAL C  1 331 ? 149.456 36.728  116.907 1.00 30.26  ? 331 VAL C C     1 
ATOM   6688  O O     . VAL C  1 331 ? 149.172 37.894  116.711 1.00 30.07  ? 331 VAL C O     1 
ATOM   6689  C CB    . VAL C  1 331 ? 149.679 36.251  119.309 1.00 47.88  ? 331 VAL C CB    1 
ATOM   6690  C CG1   . VAL C  1 331 ? 149.169 37.613  119.733 1.00 48.34  ? 331 VAL C CG1   1 
ATOM   6691  C CG2   . VAL C  1 331 ? 148.534 35.302  119.151 1.00 47.53  ? 331 VAL C CG2   1 
ATOM   6692  N N     . GLU C  1 332 ? 148.917 35.752  116.207 1.00 36.26  ? 332 GLU C N     1 
ATOM   6693  C CA    . GLU C  1 332 ? 148.011 36.091  115.137 1.00 37.94  ? 332 GLU C CA    1 
ATOM   6694  C C     . GLU C  1 332 ? 146.576 35.655  115.382 1.00 37.49  ? 332 GLU C C     1 
ATOM   6695  O O     . GLU C  1 332 ? 146.331 34.611  115.978 1.00 39.69  ? 332 GLU C O     1 
ATOM   6696  C CB    . GLU C  1 332 ? 148.531 35.473  113.860 1.00 58.59  ? 332 GLU C CB    1 
ATOM   6697  C CG    . GLU C  1 332 ? 148.057 36.135  112.637 1.00 65.32  ? 332 GLU C CG    1 
ATOM   6698  C CD    . GLU C  1 332 ? 148.855 35.685  111.467 1.00 72.74  ? 332 GLU C CD    1 
ATOM   6699  O OE1   . GLU C  1 332 ? 150.087 35.919  111.471 1.00 74.77  ? 332 GLU C OE1   1 
ATOM   6700  O OE2   . GLU C  1 332 ? 148.254 35.087  110.549 1.00 78.32  ? 332 GLU C OE2   1 
ATOM   6701  N N     . LEU C  1 333 ? 145.619 36.472  114.947 1.00 32.85  ? 333 LEU C N     1 
ATOM   6702  C CA    . LEU C  1 333 ? 144.208 36.134  115.080 1.00 29.89  ? 333 LEU C CA    1 
ATOM   6703  C C     . LEU C  1 333 ? 143.658 35.946  113.670 1.00 30.04  ? 333 LEU C C     1 
ATOM   6704  O O     . LEU C  1 333 ? 144.134 36.555  112.707 1.00 28.72  ? 333 LEU C O     1 
ATOM   6705  C CB    . LEU C  1 333 ? 143.463 37.216  115.843 1.00 4.76   ? 333 LEU C CB    1 
ATOM   6706  C CG    . LEU C  1 333 ? 143.847 37.243  117.334 1.00 3.71   ? 333 LEU C CG    1 
ATOM   6707  C CD1   . LEU C  1 333 ? 145.045 38.165  117.575 1.00 2.78   ? 333 LEU C CD1   1 
ATOM   6708  C CD2   . LEU C  1 333 ? 142.643 37.697  118.167 1.00 4.25   ? 333 LEU C CD2   1 
ATOM   6709  N N     . THR C  1 334 ? 142.667 35.079  113.550 1.00 15.57  ? 334 THR C N     1 
ATOM   6710  C CA    . THR C  1 334 ? 142.102 34.738  112.251 1.00 15.84  ? 334 THR C CA    1 
ATOM   6711  C C     . THR C  1 334 ? 140.793 35.389  111.867 1.00 15.61  ? 334 THR C C     1 
ATOM   6712  O O     . THR C  1 334 ? 140.043 35.888  112.707 1.00 14.05  ? 334 THR C O     1 
ATOM   6713  C CB    . THR C  1 334 ? 141.881 33.215  112.149 1.00 33.79  ? 334 THR C CB    1 
ATOM   6714  O OG1   . THR C  1 334 ? 140.963 32.798  113.164 1.00 34.15  ? 334 THR C OG1   1 
ATOM   6715  C CG2   . THR C  1 334 ? 143.187 32.466  112.353 1.00 32.46  ? 334 THR C CG2   1 
ATOM   6716  N N     . ALA C  1 335 ? 140.511 35.359  110.576 1.00 42.14  ? 335 ALA C N     1 
ATOM   6717  C CA    . ALA C  1 335 ? 139.265 35.920  110.108 1.00 45.32  ? 335 ALA C CA    1 
ATOM   6718  C C     . ALA C  1 335 ? 138.213 34.995  110.695 1.00 47.00  ? 335 ALA C C     1 
ATOM   6719  O O     . ALA C  1 335 ? 138.495 33.816  110.922 1.00 46.72  ? 335 ALA C O     1 
ATOM   6720  C CB    . ALA C  1 335 ? 139.204 35.898  108.583 1.00 67.00  ? 335 ALA C CB    1 
ATOM   6721  N N     . LEU C  1 336 ? 137.014 35.520  110.946 1.00 43.21  ? 336 LEU C N     1 
ATOM   6722  C CA    . LEU C  1 336 ? 135.943 34.715  111.505 1.00 42.73  ? 336 LEU C CA    1 
ATOM   6723  C C     . LEU C  1 336 ? 135.077 34.127  110.393 1.00 44.40  ? 336 LEU C C     1 
ATOM   6724  O O     . LEU C  1 336 ? 134.777 34.793  109.403 1.00 45.67  ? 336 LEU C O     1 
ATOM   6725  C CB    . LEU C  1 336 ? 135.129 35.559  112.489 1.00 9.00   ? 336 LEU C CB    1 
ATOM   6726  C CG    . LEU C  1 336 ? 135.320 35.153  113.965 1.00 7.30   ? 336 LEU C CG    1 
ATOM   6727  C CD1   . LEU C  1 336 ? 136.761 34.873  114.217 1.00 5.73   ? 336 LEU C CD1   1 
ATOM   6728  C CD2   . LEU C  1 336 ? 134.857 36.233  114.905 1.00 8.87   ? 336 LEU C CD2   1 
ATOM   6729  N N     . SER C  1 337 ? 134.698 32.862  110.558 1.00 37.37  ? 337 SER C N     1 
ATOM   6730  C CA    . SER C  1 337 ? 133.900 32.161  109.561 1.00 38.12  ? 337 SER C CA    1 
ATOM   6731  C C     . SER C  1 337 ? 132.416 32.021  109.793 1.00 37.65  ? 337 SER C C     1 
ATOM   6732  O O     . SER C  1 337 ? 131.889 32.217  110.885 1.00 36.20  ? 337 SER C O     1 
ATOM   6733  C CB    . SER C  1 337 ? 134.430 30.752  109.340 1.00 83.51  ? 337 SER C CB    1 
ATOM   6734  O OG    . SER C  1 337 ? 133.356 29.857  109.076 1.00 83.64  ? 337 SER C OG    1 
ATOM   6735  N N     . ALA C  1 338 ? 131.752 31.648  108.714 1.00 31.04  ? 338 ALA C N     1 
ATOM   6736  C CA    . ALA C  1 338 ? 130.336 31.417  108.728 1.00 31.47  ? 338 ALA C CA    1 
ATOM   6737  C C     . ALA C  1 338 ? 130.174 30.476  109.902 1.00 31.58  ? 338 ALA C C     1 
ATOM   6738  O O     . ALA C  1 338 ? 129.475 30.780  110.881 1.00 31.44  ? 338 ALA C O     1 
ATOM   6739  C CB    . ALA C  1 338 ? 129.941 30.738  107.420 1.00 19.62  ? 338 ALA C CB    1 
ATOM   6740  N N     . ALA C  1 339 ? 130.875 29.347  109.791 1.00 30.42  ? 339 ALA C N     1 
ATOM   6741  C CA    . ALA C  1 339 ? 130.850 28.309  110.803 1.00 30.96  ? 339 ALA C CA    1 
ATOM   6742  C C     . ALA C  1 339 ? 131.164 28.849  112.184 1.00 30.86  ? 339 ALA C C     1 
ATOM   6743  O O     . ALA C  1 339 ? 130.593 28.412  113.181 1.00 30.53  ? 339 ALA C O     1 
ATOM   6744  C CB    . ALA C  1 339 ? 131.834 27.225  110.445 1.00 134.14 ? 339 ALA C CB    1 
ATOM   6745  N N     . ASP C  1 340 ? 132.088 29.798  112.236 1.00 35.21  ? 340 ASP C N     1 
ATOM   6746  C CA    . ASP C  1 340 ? 132.479 30.388  113.501 1.00 34.53  ? 340 ASP C CA    1 
ATOM   6747  C C     . ASP C  1 340 ? 131.349 31.215  114.058 1.00 31.73  ? 340 ASP C C     1 
ATOM   6748  O O     . ASP C  1 340 ? 131.007 31.071  115.223 1.00 29.32  ? 340 ASP C O     1 
ATOM   6749  C CB    . ASP C  1 340 ? 133.725 31.237  113.307 1.00 80.19  ? 340 ASP C CB    1 
ATOM   6750  C CG    . ASP C  1 340 ? 134.929 30.405  112.959 1.00 84.52  ? 340 ASP C CG    1 
ATOM   6751  O OD1   . ASP C  1 340 ? 135.380 29.613  113.818 1.00 87.49  ? 340 ASP C OD1   1 
ATOM   6752  O OD2   . ASP C  1 340 ? 135.415 30.535  111.824 1.00 86.55  ? 340 ASP C OD2   1 
ATOM   6753  N N     . PHE C  1 341 ? 130.769 32.070  113.220 1.00 37.81  ? 341 PHE C N     1 
ATOM   6754  C CA    . PHE C  1 341 ? 129.659 32.912  113.643 1.00 37.90  ? 341 PHE C CA    1 
ATOM   6755  C C     . PHE C  1 341 ? 128.610 32.036  114.316 1.00 39.26  ? 341 PHE C C     1 
ATOM   6756  O O     . PHE C  1 341 ? 128.082 32.378  115.396 1.00 38.73  ? 341 PHE C O     1 
ATOM   6757  C CB    . PHE C  1 341 ? 129.016 33.604  112.444 1.00 34.54  ? 341 PHE C CB    1 
ATOM   6758  C CG    . PHE C  1 341 ? 129.741 34.820  111.985 1.00 33.40  ? 341 PHE C CG    1 
ATOM   6759  C CD1   . PHE C  1 341 ? 130.654 35.451  112.810 1.00 32.22  ? 341 PHE C CD1   1 
ATOM   6760  C CD2   . PHE C  1 341 ? 129.491 35.354  110.718 1.00 34.12  ? 341 PHE C CD2   1 
ATOM   6761  C CE1   . PHE C  1 341 ? 131.318 36.600  112.383 1.00 33.17  ? 341 PHE C CE1   1 
ATOM   6762  C CE2   . PHE C  1 341 ? 130.148 36.510  110.274 1.00 34.25  ? 341 PHE C CE2   1 
ATOM   6763  C CZ    . PHE C  1 341 ? 131.066 37.134  111.109 1.00 33.87  ? 341 PHE C CZ    1 
ATOM   6764  N N     . GLU C  1 342 ? 128.315 30.907  113.659 1.00 28.14  ? 342 GLU C N     1 
ATOM   6765  C CA    . GLU C  1 342 ? 127.332 29.968  114.158 1.00 27.79  ? 342 GLU C CA    1 
ATOM   6766  C C     . GLU C  1 342 ? 127.529 29.757  115.640 1.00 26.34  ? 342 GLU C C     1 
ATOM   6767  O O     . GLU C  1 342 ? 126.580 29.647  116.393 1.00 26.06  ? 342 GLU C O     1 
ATOM   6768  C CB    . GLU C  1 342 ? 127.447 28.632  113.431 1.00 75.34  ? 342 GLU C CB    1 
ATOM   6769  C CG    . GLU C  1 342 ? 126.851 28.626  112.044 1.00 82.60  ? 342 GLU C CG    1 
ATOM   6770  C CD    . GLU C  1 342 ? 126.810 27.234  111.427 1.00 87.85  ? 342 GLU C CD    1 
ATOM   6771  O OE1   . GLU C  1 342 ? 126.504 26.262  112.152 1.00 89.95  ? 342 GLU C OE1   1 
ATOM   6772  O OE2   . GLU C  1 342 ? 127.068 27.107  110.210 1.00 89.68  ? 342 GLU C OE2   1 
ATOM   6773  N N     . ARG C  1 343 ? 128.781 29.748  116.059 1.00 15.42  ? 343 ARG C N     1 
ATOM   6774  C CA    . ARG C  1 343 ? 129.122 29.486  117.446 1.00 15.55  ? 343 ARG C CA    1 
ATOM   6775  C C     . ARG C  1 343 ? 129.058 30.677  118.358 1.00 16.38  ? 343 ARG C C     1 
ATOM   6776  O O     . ARG C  1 343 ? 128.497 30.567  119.451 1.00 14.99  ? 343 ARG C O     1 
ATOM   6777  C CB    . ARG C  1 343 ? 130.514 28.859  117.501 1.00 39.31  ? 343 ARG C CB    1 
ATOM   6778  C CG    . ARG C  1 343 ? 130.650 27.612  116.629 1.00 40.94  ? 343 ARG C CG    1 
ATOM   6779  C CD    . ARG C  1 343 ? 132.032 27.016  116.741 1.00 44.24  ? 343 ARG C CD    1 
ATOM   6780  N NE    . ARG C  1 343 ? 132.376 26.782  118.144 1.00 46.15  ? 343 ARG C NE    1 
ATOM   6781  C CZ    . ARG C  1 343 ? 133.608 26.567  118.609 1.00 46.78  ? 343 ARG C CZ    1 
ATOM   6782  N NH1   . ARG C  1 343 ? 134.656 26.544  117.782 1.00 46.69  ? 343 ARG C NH1   1 
ATOM   6783  N NH2   . ARG C  1 343 ? 133.793 26.409  119.915 1.00 46.48  ? 343 ARG C NH2   1 
ATOM   6784  N N     . ILE C  1 344 ? 129.653 31.791  117.906 1.00 38.36  ? 344 ILE C N     1 
ATOM   6785  C CA    . ILE C  1 344 ? 129.691 33.055  118.657 1.00 37.98  ? 344 ILE C CA    1 
ATOM   6786  C C     . ILE C  1 344 ? 128.254 33.393  118.878 1.00 36.69  ? 344 ILE C C     1 
ATOM   6787  O O     . ILE C  1 344 ? 127.892 34.061  119.842 1.00 37.41  ? 344 ILE C O     1 
ATOM   6788  C CB    . ILE C  1 344 ? 130.284 34.254  117.846 1.00 61.97  ? 344 ILE C CB    1 
ATOM   6789  C CG1   . ILE C  1 344 ? 130.799 33.790  116.487 1.00 64.54  ? 344 ILE C CG1   1 
ATOM   6790  C CG2   . ILE C  1 344 ? 131.410 34.923  118.631 1.00 61.10  ? 344 ILE C CG2   1 
ATOM   6791  C CD1   . ILE C  1 344 ? 132.143 33.088  116.558 1.00 69.15  ? 344 ILE C CD1   1 
ATOM   6792  N N     . LEU C  1 345 ? 127.438 32.915  117.950 1.00 30.12  ? 345 LEU C N     1 
ATOM   6793  C CA    . LEU C  1 345 ? 126.024 33.167  117.991 1.00 29.60  ? 345 LEU C CA    1 
ATOM   6794  C C     . LEU C  1 345 ? 125.305 32.498  119.178 1.00 31.73  ? 345 LEU C C     1 
ATOM   6795  O O     . LEU C  1 345 ? 124.304 33.029  119.664 1.00 32.09  ? 345 LEU C O     1 
ATOM   6796  C CB    . LEU C  1 345 ? 125.421 32.753  116.648 1.00 12.81  ? 345 LEU C CB    1 
ATOM   6797  C CG    . LEU C  1 345 ? 124.220 33.538  116.101 1.00 11.63  ? 345 LEU C CG    1 
ATOM   6798  C CD1   . LEU C  1 345 ? 124.091 34.895  116.768 1.00 10.46  ? 345 LEU C CD1   1 
ATOM   6799  C CD2   . LEU C  1 345 ? 124.373 33.712  114.586 1.00 10.15  ? 345 LEU C CD2   1 
ATOM   6800  N N     . THR C  1 346 ? 125.830 31.372  119.681 1.00 35.40  ? 346 THR C N     1 
ATOM   6801  C CA    . THR C  1 346 ? 125.174 30.649  120.789 1.00 35.87  ? 346 THR C CA    1 
ATOM   6802  C C     . THR C  1 346 ? 126.008 30.114  121.970 1.00 37.13  ? 346 THR C C     1 
ATOM   6803  O O     . THR C  1 346 ? 125.492 29.989  123.090 1.00 35.77  ? 346 THR C O     1 
ATOM   6804  C CB    . THR C  1 346 ? 124.354 29.447  120.233 1.00 17.78  ? 346 THR C CB    1 
ATOM   6805  O OG1   . THR C  1 346 ? 125.226 28.512  119.558 1.00 14.64  ? 346 THR C OG1   1 
ATOM   6806  C CG2   . THR C  1 346 ? 123.263 29.956  119.277 1.00 17.11  ? 346 THR C CG2   1 
ATOM   6807  N N     . GLU C  1 347 ? 127.275 29.790  121.719 1.00 33.89  ? 347 GLU C N     1 
ATOM   6808  C CA    . GLU C  1 347 ? 128.144 29.232  122.752 1.00 35.28  ? 347 GLU C CA    1 
ATOM   6809  C C     . GLU C  1 347 ? 128.538 30.169  123.882 1.00 34.70  ? 347 GLU C C     1 
ATOM   6810  O O     . GLU C  1 347 ? 128.307 29.889  125.049 1.00 36.55  ? 347 GLU C O     1 
ATOM   6811  C CB    . GLU C  1 347 ? 129.406 28.652  122.114 1.00 62.94  ? 347 GLU C CB    1 
ATOM   6812  C CG    . GLU C  1 347 ? 129.126 27.704  120.954 1.00 68.29  ? 347 GLU C CG    1 
ATOM   6813  C CD    . GLU C  1 347 ? 130.321 26.820  120.589 1.00 71.73  ? 347 GLU C CD    1 
ATOM   6814  O OE1   . GLU C  1 347 ? 130.224 26.101  119.569 1.00 72.97  ? 347 GLU C OE1   1 
ATOM   6815  O OE2   . GLU C  1 347 ? 131.349 26.830  121.313 1.00 72.66  ? 347 GLU C OE2   1 
ATOM   6816  N N     . PRO C  1 348 ? 129.125 31.309  123.548 1.00 26.58  ? 348 PRO C N     1 
ATOM   6817  C CA    . PRO C  1 348 ? 129.596 32.360  124.461 1.00 26.73  ? 348 PRO C CA    1 
ATOM   6818  C C     . PRO C  1 348 ? 128.696 32.729  125.647 1.00 27.89  ? 348 PRO C C     1 
ATOM   6819  O O     . PRO C  1 348 ? 127.537 33.048  125.436 1.00 28.92  ? 348 PRO C O     1 
ATOM   6820  C CB    . PRO C  1 348 ? 129.740 33.550  123.537 1.00 13.75  ? 348 PRO C CB    1 
ATOM   6821  C CG    . PRO C  1 348 ? 130.014 32.930  122.205 1.00 12.77  ? 348 PRO C CG    1 
ATOM   6822  C CD    . PRO C  1 348 ? 129.064 31.813  122.169 1.00 13.14  ? 348 PRO C CD    1 
ATOM   6823  N N     . HIS C  1 349 ? 129.215 32.718  126.877 1.00 28.54  ? 349 HIS C N     1 
ATOM   6824  C CA    . HIS C  1 349 ? 128.397 33.126  128.026 1.00 31.45  ? 349 HIS C CA    1 
ATOM   6825  C C     . HIS C  1 349 ? 127.740 34.466  127.708 1.00 30.39  ? 349 HIS C C     1 
ATOM   6826  O O     . HIS C  1 349 ? 128.403 35.488  127.590 1.00 31.47  ? 349 HIS C O     1 
ATOM   6827  C CB    . HIS C  1 349 ? 129.222 33.327  129.297 1.00 168.18 ? 349 HIS C CB    1 
ATOM   6828  C CG    . HIS C  1 349 ? 129.496 32.069  130.056 1.00 176.11 ? 349 HIS C CG    1 
ATOM   6829  N ND1   . HIS C  1 349 ? 129.845 32.072  131.389 1.00 178.82 ? 349 HIS C ND1   1 
ATOM   6830  C CD2   . HIS C  1 349 ? 129.514 30.773  129.664 1.00 179.09 ? 349 HIS C CD2   1 
ATOM   6831  C CE1   . HIS C  1 349 ? 130.068 30.832  131.786 1.00 179.89 ? 349 HIS C CE1   1 
ATOM   6832  N NE2   . HIS C  1 349 ? 129.875 30.024  130.758 1.00 180.08 ? 349 HIS C NE2   1 
ATOM   6833  N N     . ALA C  1 350 ? 126.427 34.460  127.577 1.00 29.20  ? 350 ALA C N     1 
ATOM   6834  C CA    . ALA C  1 350 ? 125.713 35.678  127.266 1.00 26.90  ? 350 ALA C CA    1 
ATOM   6835  C C     . ALA C  1 350 ? 125.822 36.024  125.774 1.00 24.86  ? 350 ALA C C     1 
ATOM   6836  O O     . ALA C  1 350 ? 126.100 37.157  125.410 1.00 22.62  ? 350 ALA C O     1 
ATOM   6837  C CB    . ALA C  1 350 ? 126.241 36.810  128.140 1.00 19.65  ? 350 ALA C CB    1 
ATOM   6838  N N     . SER C  1 351 ? 125.576 35.029  124.923 1.00 35.83  ? 351 SER C N     1 
ATOM   6839  C CA    . SER C  1 351 ? 125.619 35.216  123.475 1.00 36.26  ? 351 SER C CA    1 
ATOM   6840  C C     . SER C  1 351 ? 124.478 36.130  123.058 1.00 35.94  ? 351 SER C C     1 
ATOM   6841  O O     . SER C  1 351 ? 123.729 36.621  123.897 1.00 35.96  ? 351 SER C O     1 
ATOM   6842  C CB    . SER C  1 351 ? 125.473 33.884  122.738 1.00 58.81  ? 351 SER C CB    1 
ATOM   6843  O OG    . SER C  1 351 ? 124.130 33.432  122.751 1.00 60.58  ? 351 SER C OG    1 
ATOM   6844  N N     . LEU C  1 352 ? 124.353 36.372  121.762 1.00 34.15  ? 352 LEU C N     1 
ATOM   6845  C CA    . LEU C  1 352 ? 123.285 37.234  121.281 1.00 34.53  ? 352 LEU C CA    1 
ATOM   6846  C C     . LEU C  1 352 ? 121.925 36.580  121.461 1.00 34.16  ? 352 LEU C C     1 
ATOM   6847  O O     . LEU C  1 352 ? 120.991 37.189  121.983 1.00 34.45  ? 352 LEU C O     1 
ATOM   6848  C CB    . LEU C  1 352 ? 123.480 37.556  119.803 1.00 38.17  ? 352 LEU C CB    1 
ATOM   6849  C CG    . LEU C  1 352 ? 124.513 38.622  119.476 1.00 36.61  ? 352 LEU C CG    1 
ATOM   6850  C CD1   . LEU C  1 352 ? 124.670 38.818  117.935 1.00 35.43  ? 352 LEU C CD1   1 
ATOM   6851  C CD2   . LEU C  1 352 ? 124.055 39.881  120.189 1.00 34.65  ? 352 LEU C CD2   1 
ATOM   6852  N N     . THR C  1 353 ? 121.799 35.344  121.004 1.00 19.62  ? 353 THR C N     1 
ATOM   6853  C CA    . THR C  1 353 ? 120.535 34.658  121.151 1.00 18.20  ? 353 THR C CA    1 
ATOM   6854  C C     . THR C  1 353 ? 120.229 34.535  122.627 1.00 19.36  ? 353 THR C C     1 
ATOM   6855  O O     . THR C  1 353 ? 119.099 34.780  123.049 1.00 18.41  ? 353 THR C O     1 
ATOM   6856  C CB    . THR C  1 353 ? 120.567 33.272  120.535 1.00 11.01  ? 353 THR C CB    1 
ATOM   6857  O OG1   . THR C  1 353 ? 121.707 32.545  121.018 1.00 8.49   ? 353 THR C OG1   1 
ATOM   6858  C CG2   . THR C  1 353 ? 120.620 33.385  119.060 1.00 9.57   ? 353 THR C CG2   1 
ATOM   6859  N N     . GLU C  1 354 ? 121.231 34.155  123.415 1.00 12.97  ? 354 GLU C N     1 
ATOM   6860  C CA    . GLU C  1 354 ? 121.020 34.033  124.841 1.00 16.47  ? 354 GLU C CA    1 
ATOM   6861  C C     . GLU C  1 354 ? 120.449 35.335  125.346 1.00 16.61  ? 354 GLU C C     1 
ATOM   6862  O O     . GLU C  1 354 ? 119.625 35.315  126.246 1.00 18.79  ? 354 GLU C O     1 
ATOM   6863  C CB    . GLU C  1 354 ? 122.323 33.742  125.576 1.00 88.21  ? 354 GLU C CB    1 
ATOM   6864  C CG    . GLU C  1 354 ? 122.375 32.365  126.207 1.00 96.36  ? 354 GLU C CG    1 
ATOM   6865  C CD    . GLU C  1 354 ? 123.615 32.165  127.063 1.00 101.19 ? 354 GLU C CD    1 
ATOM   6866  O OE1   . GLU C  1 354 ? 123.746 32.898  128.067 1.00 103.25 ? 354 GLU C OE1   1 
ATOM   6867  O OE2   . GLU C  1 354 ? 124.451 31.286  126.738 1.00 102.14 ? 354 GLU C OE2   1 
ATOM   6868  N N     . GLN C  1 355 ? 120.867 36.465  124.755 1.00 11.74  ? 355 GLN C N     1 
ATOM   6869  C CA    . GLN C  1 355 ? 120.405 37.818  125.157 1.00 10.66  ? 355 GLN C CA    1 
ATOM   6870  C C     . GLN C  1 355 ? 118.996 38.140  124.719 1.00 8.83   ? 355 GLN C C     1 
ATOM   6871  O O     . GLN C  1 355 ? 118.152 38.445  125.537 1.00 8.01   ? 355 GLN C O     1 
ATOM   6872  C CB    . GLN C  1 355 ? 121.335 38.903  124.616 1.00 81.99  ? 355 GLN C CB    1 
ATOM   6873  C CG    . GLN C  1 355 ? 122.718 38.949  125.217 1.00 84.70  ? 355 GLN C CG    1 
ATOM   6874  C CD    . GLN C  1 355 ? 123.458 40.175  124.762 1.00 86.81  ? 355 GLN C CD    1 
ATOM   6875  O OE1   . GLN C  1 355 ? 123.172 41.293  125.211 1.00 90.12  ? 355 GLN C OE1   1 
ATOM   6876  N NE2   . GLN C  1 355 ? 124.396 39.988  123.841 1.00 85.48  ? 355 GLN C NE2   1 
ATOM   6877  N N     . TYR C  1 356 ? 118.726 38.099  123.428 1.00 5.44   ? 356 TYR C N     1 
ATOM   6878  C CA    . TYR C  1 356 ? 117.365 38.377  123.016 1.00 7.67   ? 356 TYR C CA    1 
ATOM   6879  C C     . TYR C  1 356 ? 116.349 37.527  123.793 1.00 8.69   ? 356 TYR C C     1 
ATOM   6880  O O     . TYR C  1 356 ? 115.346 38.055  124.284 1.00 8.18   ? 356 TYR C O     1 
ATOM   6881  C CB    . TYR C  1 356 ? 117.197 38.149  121.523 1.00 38.18  ? 356 TYR C CB    1 
ATOM   6882  C CG    . TYR C  1 356 ? 117.723 39.301  120.756 1.00 39.91  ? 356 TYR C CG    1 
ATOM   6883  C CD1   . TYR C  1 356 ? 118.711 39.128  119.807 1.00 42.87  ? 356 TYR C CD1   1 
ATOM   6884  C CD2   . TYR C  1 356 ? 117.266 40.585  121.004 1.00 39.77  ? 356 TYR C CD2   1 
ATOM   6885  C CE1   . TYR C  1 356 ? 119.242 40.225  119.108 1.00 43.25  ? 356 TYR C CE1   1 
ATOM   6886  C CE2   . TYR C  1 356 ? 117.785 41.677  120.319 1.00 40.93  ? 356 TYR C CE2   1 
ATOM   6887  C CZ    . TYR C  1 356 ? 118.773 41.488  119.370 1.00 41.56  ? 356 TYR C CZ    1 
ATOM   6888  O OH    . TYR C  1 356 ? 119.302 42.537  118.665 1.00 41.73  ? 356 TYR C OH    1 
ATOM   6889  N N     . LYS C  1 357 ? 116.600 36.219  123.897 1.00 39.71  ? 357 LYS C N     1 
ATOM   6890  C CA    . LYS C  1 357 ? 115.697 35.344  124.634 1.00 40.10  ? 357 LYS C CA    1 
ATOM   6891  C C     . LYS C  1 357 ? 115.436 36.029  125.964 1.00 38.25  ? 357 LYS C C     1 
ATOM   6892  O O     . LYS C  1 357 ? 114.303 36.382  126.288 1.00 39.14  ? 357 LYS C O     1 
ATOM   6893  C CB    . LYS C  1 357 ? 116.325 33.963  124.864 1.00 91.13  ? 357 LYS C CB    1 
ATOM   6894  C CG    . LYS C  1 357 ? 115.864 32.870  123.879 1.00 96.01  ? 357 LYS C CG    1 
ATOM   6895  C CD    . LYS C  1 357 ? 116.312 31.458  124.338 1.00 100.13 ? 357 LYS C CD    1 
ATOM   6896  C CE    . LYS C  1 357 ? 115.709 30.296  123.501 1.00 102.13 ? 357 LYS C CE    1 
ATOM   6897  N NZ    . LYS C  1 357 ? 116.327 30.023  122.155 1.00 100.82 ? 357 LYS C NZ    1 
ATOM   6898  N N     . ALA C  1 358 ? 116.496 36.237  126.721 1.00 23.55  ? 358 ALA C N     1 
ATOM   6899  C CA    . ALA C  1 358 ? 116.379 36.909  128.003 1.00 22.68  ? 358 ALA C CA    1 
ATOM   6900  C C     . ALA C  1 358 ? 115.664 38.280  127.942 1.00 20.92  ? 358 ALA C C     1 
ATOM   6901  O O     . ALA C  1 358 ? 114.985 38.674  128.902 1.00 20.33  ? 358 ALA C O     1 
ATOM   6902  C CB    . ALA C  1 358 ? 117.766 37.084  128.616 1.00 133.97 ? 358 ALA C CB    1 
ATOM   6903  N N     . LEU C  1 359 ? 115.833 39.008  126.836 1.00 21.50  ? 359 LEU C N     1 
ATOM   6904  C CA    . LEU C  1 359 ? 115.205 40.322  126.673 1.00 19.88  ? 359 LEU C CA    1 
ATOM   6905  C C     . LEU C  1 359 ? 113.680 40.233  126.322 1.00 19.54  ? 359 LEU C C     1 
ATOM   6906  O O     . LEU C  1 359 ? 112.837 40.841  126.984 1.00 19.53  ? 359 LEU C O     1 
ATOM   6907  C CB    . LEU C  1 359 ? 115.973 41.144  125.608 1.00 13.49  ? 359 LEU C CB    1 
ATOM   6908  C CG    . LEU C  1 359 ? 117.036 42.229  125.876 1.00 8.06   ? 359 LEU C CG    1 
ATOM   6909  C CD1   . LEU C  1 359 ? 116.622 43.186  126.964 1.00 7.42   ? 359 LEU C CD1   1 
ATOM   6910  C CD2   . LEU C  1 359 ? 118.259 41.577  126.275 1.00 10.88  ? 359 LEU C CD2   1 
ATOM   6911  N N     . MET C  1 360 ? 113.320 39.508  125.275 1.00 9.63   ? 360 MET C N     1 
ATOM   6912  C CA    . MET C  1 360 ? 111.907 39.354  124.968 1.00 12.19  ? 360 MET C CA    1 
ATOM   6913  C C     . MET C  1 360 ? 111.191 38.719  126.185 1.00 13.86  ? 360 MET C C     1 
ATOM   6914  O O     . MET C  1 360 ? 110.014 38.993  126.445 1.00 14.40  ? 360 MET C O     1 
ATOM   6915  C CB    . MET C  1 360 ? 111.742 38.467  123.735 1.00 36.48  ? 360 MET C CB    1 
ATOM   6916  C CG    . MET C  1 360 ? 112.456 39.005  122.524 1.00 36.29  ? 360 MET C CG    1 
ATOM   6917  S SD    . MET C  1 360 ? 111.846 40.630  122.060 1.00 36.04  ? 360 MET C SD    1 
ATOM   6918  C CE    . MET C  1 360 ? 112.731 41.638  123.163 1.00 32.90  ? 360 MET C CE    1 
ATOM   6919  N N     . ALA C  1 361 ? 111.906 37.857  126.909 1.00 37.02  ? 361 ALA C N     1 
ATOM   6920  C CA    . ALA C  1 361 ? 111.390 37.221  128.115 1.00 37.03  ? 361 ALA C CA    1 
ATOM   6921  C C     . ALA C  1 361 ? 110.664 38.263  128.973 1.00 38.10  ? 361 ALA C C     1 
ATOM   6922  O O     . ALA C  1 361 ? 109.509 38.089  129.329 1.00 38.71  ? 361 ALA C O     1 
ATOM   6923  C CB    . ALA C  1 361 ? 112.529 36.655  128.895 1.00 34.79  ? 361 ALA C CB    1 
ATOM   6924  N N     . THR C  1 362 ? 111.374 39.338  129.303 1.00 10.75  ? 362 THR C N     1 
ATOM   6925  C CA    . THR C  1 362 ? 110.863 40.452  130.098 1.00 11.21  ? 362 THR C CA    1 
ATOM   6926  C C     . THR C  1 362 ? 109.522 40.971  129.677 1.00 12.19  ? 362 THR C C     1 
ATOM   6927  O O     . THR C  1 362 ? 108.768 41.437  130.526 1.00 10.89  ? 362 THR C O     1 
ATOM   6928  C CB    . THR C  1 362 ? 111.726 41.674  129.992 1.00 34.06  ? 362 THR C CB    1 
ATOM   6929  O OG1   . THR C  1 362 ? 113.071 41.285  129.702 1.00 33.74  ? 362 THR C OG1   1 
ATOM   6930  C CG2   . THR C  1 362 ? 111.642 42.477  131.282 1.00 36.09  ? 362 THR C CG2   1 
ATOM   6931  N N     . GLU C  1 363 ? 109.253 40.967  128.366 1.00 67.99  ? 363 GLU C N     1 
ATOM   6932  C CA    . GLU C  1 363 ? 107.973 41.445  127.827 1.00 69.25  ? 363 GLU C CA    1 
ATOM   6933  C C     . GLU C  1 363 ? 106.940 40.337  127.911 1.00 69.47  ? 363 GLU C C     1 
ATOM   6934  O O     . GLU C  1 363 ? 105.760 40.544  127.648 1.00 69.74  ? 363 GLU C O     1 
ATOM   6935  C CB    . GLU C  1 363 ? 108.135 41.902  126.377 1.00 28.02  ? 363 GLU C CB    1 
ATOM   6936  C CG    . GLU C  1 363 ? 109.009 43.137  126.245 1.00 29.16  ? 363 GLU C CG    1 
ATOM   6937  C CD    . GLU C  1 363 ? 108.287 44.443  126.568 1.00 29.39  ? 363 GLU C CD    1 
ATOM   6938  O OE1   . GLU C  1 363 ? 107.234 44.414  127.252 1.00 29.64  ? 363 GLU C OE1   1 
ATOM   6939  O OE2   . GLU C  1 363 ? 108.796 45.504  126.138 1.00 29.15  ? 363 GLU C OE2   1 
ATOM   6940  N N     . GLY C  1 364 ? 107.411 39.153  128.285 1.00 40.34  ? 364 GLY C N     1 
ATOM   6941  C CA    . GLY C  1 364 ? 106.539 38.014  128.434 1.00 38.97  ? 364 GLY C CA    1 
ATOM   6942  C C     . GLY C  1 364 ? 106.642 37.063  127.278 1.00 39.46  ? 364 GLY C C     1 
ATOM   6943  O O     . GLY C  1 364 ? 106.143 35.942  127.348 1.00 41.33  ? 364 GLY C O     1 
ATOM   6944  N N     . VAL C  1 365 ? 107.302 37.492  126.214 1.00 20.24  ? 365 VAL C N     1 
ATOM   6945  C CA    . VAL C  1 365 ? 107.416 36.645  125.045 1.00 19.14  ? 365 VAL C CA    1 
ATOM   6946  C C     . VAL C  1 365 ? 108.502 35.623  125.196 1.00 21.02  ? 365 VAL C C     1 
ATOM   6947  O O     . VAL C  1 365 ? 109.611 35.932  125.671 1.00 21.60  ? 365 VAL C O     1 
ATOM   6948  C CB    . VAL C  1 365 ? 107.671 37.469  123.768 1.00 8.40   ? 365 VAL C CB    1 
ATOM   6949  C CG1   . VAL C  1 365 ? 107.887 36.553  122.592 1.00 7.22   ? 365 VAL C CG1   1 
ATOM   6950  C CG2   . VAL C  1 365 ? 106.462 38.388  123.489 1.00 8.93   ? 365 VAL C CG2   1 
ATOM   6951  N N     . ASN C  1 366 ? 108.158 34.392  124.816 1.00 38.43  ? 366 ASN C N     1 
ATOM   6952  C CA    . ASN C  1 366 ? 109.097 33.272  124.861 1.00 39.93  ? 366 ASN C CA    1 
ATOM   6953  C C     . ASN C  1 366 ? 109.523 32.971  123.433 1.00 37.99  ? 366 ASN C C     1 
ATOM   6954  O O     . ASN C  1 366 ? 108.727 32.627  122.547 1.00 36.04  ? 366 ASN C O     1 
ATOM   6955  C CB    . ASN C  1 366 ? 108.485 32.028  125.505 1.00 103.99 ? 366 ASN C CB    1 
ATOM   6956  C CG    . ASN C  1 366 ? 109.515 30.953  125.746 1.00 106.94 ? 366 ASN C CG    1 
ATOM   6957  O OD1   . ASN C  1 366 ? 109.923 30.243  124.821 1.00 108.83 ? 366 ASN C OD1   1 
ATOM   6958  N ND2   . ASN C  1 366 ? 109.971 30.846  126.991 1.00 108.48 ? 366 ASN C ND2   1 
ATOM   6959  N N     . ILE C  1 367 ? 110.814 33.105  123.225 1.00 42.12  ? 367 ILE C N     1 
ATOM   6960  C CA    . ILE C  1 367 ? 111.349 32.938  121.910 1.00 41.90  ? 367 ILE C CA    1 
ATOM   6961  C C     . ILE C  1 367 ? 112.275 31.748  121.822 1.00 39.79  ? 367 ILE C C     1 
ATOM   6962  O O     . ILE C  1 367 ? 112.845 31.327  122.824 1.00 40.14  ? 367 ILE C O     1 
ATOM   6963  C CB    . ILE C  1 367 ? 112.052 34.230  121.547 1.00 64.22  ? 367 ILE C CB    1 
ATOM   6964  C CG1   . ILE C  1 367 ? 112.827 34.062  120.261 1.00 65.45  ? 367 ILE C CG1   1 
ATOM   6965  C CG2   . ILE C  1 367 ? 112.910 34.682  122.721 1.00 64.08  ? 367 ILE C CG2   1 
ATOM   6966  C CD1   . ILE C  1 367 ? 113.433 35.331  119.830 1.00 67.62  ? 367 ILE C CD1   1 
ATOM   6967  N N     . ALA C  1 368 ? 112.394 31.180  120.626 1.00 14.73  ? 368 ALA C N     1 
ATOM   6968  C CA    . ALA C  1 368 ? 113.271 30.032  120.432 1.00 13.94  ? 368 ALA C CA    1 
ATOM   6969  C C     . ALA C  1 368 ? 113.854 30.049  119.032 1.00 12.79  ? 368 ALA C C     1 
ATOM   6970  O O     . ALA C  1 368 ? 113.113 30.156  118.047 1.00 10.26  ? 368 ALA C O     1 
ATOM   6971  C CB    . ALA C  1 368 ? 112.512 28.744  120.668 1.00 106.63 ? 368 ALA C CB    1 
ATOM   6972  N N     . PHE C  1 369 ? 115.187 29.964  118.966 1.00 25.93  ? 369 PHE C N     1 
ATOM   6973  C CA    . PHE C  1 369 ? 115.903 29.980  117.701 1.00 25.19  ? 369 PHE C CA    1 
ATOM   6974  C C     . PHE C  1 369 ? 116.231 28.560  117.358 1.00 27.04  ? 369 PHE C C     1 
ATOM   6975  O O     . PHE C  1 369 ? 116.822 27.848  118.177 1.00 27.17  ? 369 PHE C O     1 
ATOM   6976  C CB    . PHE C  1 369 ? 117.239 30.723  117.798 1.00 25.97  ? 369 PHE C CB    1 
ATOM   6977  C CG    . PHE C  1 369 ? 117.126 32.204  118.080 1.00 23.53  ? 369 PHE C CG    1 
ATOM   6978  C CD1   . PHE C  1 369 ? 117.311 32.690  119.371 1.00 23.59  ? 369 PHE C CD1   1 
ATOM   6979  C CD2   . PHE C  1 369 ? 116.878 33.108  117.055 1.00 21.64  ? 369 PHE C CD2   1 
ATOM   6980  C CE1   . PHE C  1 369 ? 117.253 34.035  119.642 1.00 22.25  ? 369 PHE C CE1   1 
ATOM   6981  C CE2   . PHE C  1 369 ? 116.818 34.449  117.310 1.00 21.04  ? 369 PHE C CE2   1 
ATOM   6982  C CZ    . PHE C  1 369 ? 117.007 34.915  118.613 1.00 22.60  ? 369 PHE C CZ    1 
ATOM   6983  N N     . THR C  1 370 ? 115.871 28.155  116.146 1.00 26.33  ? 370 THR C N     1 
ATOM   6984  C CA    . THR C  1 370 ? 116.152 26.801  115.693 1.00 28.64  ? 370 THR C CA    1 
ATOM   6985  C C     . THR C  1 370 ? 117.544 26.766  115.111 1.00 29.75  ? 370 THR C C     1 
ATOM   6986  O O     . THR C  1 370 ? 118.055 27.787  114.630 1.00 28.81  ? 370 THR C O     1 
ATOM   6987  C CB    . THR C  1 370 ? 115.156 26.341  114.607 1.00 40.70  ? 370 THR C CB    1 
ATOM   6988  O OG1   . THR C  1 370 ? 115.669 26.606  113.296 1.00 41.23  ? 370 THR C OG1   1 
ATOM   6989  C CG2   . THR C  1 370 ? 113.861 27.085  114.768 1.00 43.57  ? 370 THR C CG2   1 
ATOM   6990  N N     . THR C  1 371 ? 118.157 25.588  115.164 1.00 65.46  ? 371 THR C N     1 
ATOM   6991  C CA    . THR C  1 371 ? 119.499 25.378  114.634 1.00 68.23  ? 371 THR C CA    1 
ATOM   6992  C C     . THR C  1 371 ? 119.638 26.051  113.282 1.00 68.85  ? 371 THR C C     1 
ATOM   6993  O O     . THR C  1 371 ? 120.365 27.028  113.139 1.00 71.27  ? 371 THR C O     1 
ATOM   6994  C CB    . THR C  1 371 ? 119.750 23.921  114.447 1.00 74.59  ? 371 THR C CB    1 
ATOM   6995  O OG1   . THR C  1 371 ? 119.293 23.224  115.612 1.00 77.53  ? 371 THR C OG1   1 
ATOM   6996  C CG2   . THR C  1 371 ? 121.221 23.678  114.225 1.00 75.81  ? 371 THR C CG2   1 
ATOM   6997  N N     . ASP C  1 372 ? 118.950 25.498  112.288 1.00 20.69  ? 372 ASP C N     1 
ATOM   6998  C CA    . ASP C  1 372 ? 118.927 26.061  110.938 1.00 21.14  ? 372 ASP C CA    1 
ATOM   6999  C C     . ASP C  1 372 ? 118.724 27.587  110.969 1.00 18.15  ? 372 ASP C C     1 
ATOM   7000  O O     . ASP C  1 372 ? 119.204 28.290  110.080 1.00 16.87  ? 372 ASP C O     1 
ATOM   7001  C CB    . ASP C  1 372 ? 117.786 25.438  110.123 1.00 111.65 ? 372 ASP C CB    1 
ATOM   7002  C CG    . ASP C  1 372 ? 118.014 23.985  109.820 1.00 117.93 ? 372 ASP C CG    1 
ATOM   7003  O OD1   . ASP C  1 372 ? 118.996 23.684  109.121 1.00 121.16 ? 372 ASP C OD1   1 
ATOM   7004  O OD2   . ASP C  1 372 ? 117.215 23.145  110.277 1.00 120.79 ? 372 ASP C OD2   1 
ATOM   7005  N N     . ALA C  1 373 ? 118.003 28.091  111.970 1.00 41.63  ? 373 ALA C N     1 
ATOM   7006  C CA    . ALA C  1 373 ? 117.775 29.519  112.079 1.00 39.56  ? 373 ALA C CA    1 
ATOM   7007  C C     . ALA C  1 373 ? 119.128 30.184  112.368 1.00 37.14  ? 373 ALA C C     1 
ATOM   7008  O O     . ALA C  1 373 ? 119.534 31.125  111.677 1.00 38.12  ? 373 ALA C O     1 
ATOM   7009  C CB    . ALA C  1 373 ? 116.782 29.802  113.183 1.00 39.28  ? 373 ALA C CB    1 
ATOM   7010  N N     . VAL C  1 374 ? 119.833 29.707  113.385 1.00 1.00   ? 374 VAL C N     1 
ATOM   7011  C CA    . VAL C  1 374 ? 121.137 30.283  113.662 1.00 1.00   ? 374 VAL C CA    1 
ATOM   7012  C C     . VAL C  1 374 ? 121.987 30.137  112.419 1.00 1.00   ? 374 VAL C C     1 
ATOM   7013  O O     . VAL C  1 374 ? 122.441 31.125  111.857 1.00 1.00   ? 374 VAL C O     1 
ATOM   7014  C CB    . VAL C  1 374 ? 121.805 29.593  114.861 1.00 4.12   ? 374 VAL C CB    1 
ATOM   7015  C CG1   . VAL C  1 374 ? 123.220 30.073  115.057 1.00 2.40   ? 374 VAL C CG1   1 
ATOM   7016  C CG2   . VAL C  1 374 ? 120.980 29.885  116.104 1.00 2.09   ? 374 VAL C CG2   1 
ATOM   7017  N N     . LYS C  1 375 ? 122.178 28.904  111.977 1.00 31.40  ? 375 LYS C N     1 
ATOM   7018  C CA    . LYS C  1 375 ? 122.966 28.652  110.783 1.00 35.51  ? 375 LYS C CA    1 
ATOM   7019  C C     . LYS C  1 375 ? 122.627 29.726  109.739 1.00 36.15  ? 375 LYS C C     1 
ATOM   7020  O O     . LYS C  1 375 ? 123.514 30.340  109.143 1.00 36.20  ? 375 LYS C O     1 
ATOM   7021  C CB    . LYS C  1 375 ? 122.659 27.248  110.245 1.00 97.95  ? 375 LYS C CB    1 
ATOM   7022  C CG    . LYS C  1 375 ? 123.764 26.612  109.399 1.00 101.97 ? 375 LYS C CG    1 
ATOM   7023  C CD    . LYS C  1 375 ? 123.659 25.086  109.435 1.00 107.26 ? 375 LYS C CD    1 
ATOM   7024  C CE    . LYS C  1 375 ? 124.821 24.424  108.727 1.00 110.41 ? 375 LYS C CE    1 
ATOM   7025  N NZ    . LYS C  1 375 ? 124.850 24.843  107.299 1.00 112.43 ? 375 LYS C NZ    1 
ATOM   7026  N N     . LYS C  1 376 ? 121.345 29.984  109.535 1.00 25.15  ? 376 LYS C N     1 
ATOM   7027  C CA    . LYS C  1 376 ? 120.950 30.990  108.553 1.00 26.78  ? 376 LYS C CA    1 
ATOM   7028  C C     . LYS C  1 376 ? 121.450 32.387  108.970 1.00 24.80  ? 376 LYS C C     1 
ATOM   7029  O O     . LYS C  1 376 ? 122.150 33.052  108.215 1.00 23.49  ? 376 LYS C O     1 
ATOM   7030  C CB    . LYS C  1 376 ? 119.429 30.981  108.403 1.00 113.83 ? 376 LYS C CB    1 
ATOM   7031  C CG    . LYS C  1 376 ? 118.904 31.820  107.263 1.00 120.08 ? 376 LYS C CG    1 
ATOM   7032  C CD    . LYS C  1 376 ? 119.229 31.215  105.910 1.00 125.55 ? 376 LYS C CD    1 
ATOM   7033  C CE    . LYS C  1 376 ? 118.669 32.096  104.800 1.00 128.58 ? 376 LYS C CE    1 
ATOM   7034  N NZ    . LYS C  1 376 ? 118.880 31.518  103.448 1.00 129.68 ? 376 LYS C NZ    1 
ATOM   7035  N N     . ILE C  1 377 ? 121.078 32.817  110.176 1.00 35.49  ? 377 ILE C N     1 
ATOM   7036  C CA    . ILE C  1 377 ? 121.489 34.107  110.708 1.00 33.46  ? 377 ILE C CA    1 
ATOM   7037  C C     . ILE C  1 377 ? 122.970 34.286  110.444 1.00 33.73  ? 377 ILE C C     1 
ATOM   7038  O O     . ILE C  1 377 ? 123.377 35.266  109.833 1.00 33.15  ? 377 ILE C O     1 
ATOM   7039  C CB    . ILE C  1 377 ? 121.236 34.172  112.224 1.00 23.83  ? 377 ILE C CB    1 
ATOM   7040  C CG1   . ILE C  1 377 ? 119.734 34.059  112.485 1.00 22.77  ? 377 ILE C CG1   1 
ATOM   7041  C CG2   . ILE C  1 377 ? 121.820 35.441  112.809 1.00 22.30  ? 377 ILE C CG2   1 
ATOM   7042  C CD1   . ILE C  1 377 ? 119.325 34.284  113.930 1.00 23.63  ? 377 ILE C CD1   1 
ATOM   7043  N N     . ALA C  1 378 ? 123.774 33.322  110.889 1.00 22.10  ? 378 ALA C N     1 
ATOM   7044  C CA    . ALA C  1 378 ? 125.225 33.398  110.694 1.00 23.23  ? 378 ALA C CA    1 
ATOM   7045  C C     . ALA C  1 378 ? 125.641 33.436  109.226 1.00 24.50  ? 378 ALA C C     1 
ATOM   7046  O O     . ALA C  1 378 ? 126.339 34.354  108.790 1.00 24.31  ? 378 ALA C O     1 
ATOM   7047  C CB    . ALA C  1 378 ? 125.922 32.238  111.393 1.00 1.00   ? 378 ALA C CB    1 
ATOM   7048  N N     . GLU C  1 379 ? 125.226 32.433  108.468 1.00 44.54  ? 379 GLU C N     1 
ATOM   7049  C CA    . GLU C  1 379 ? 125.571 32.396  107.063 1.00 47.40  ? 379 GLU C CA    1 
ATOM   7050  C C     . GLU C  1 379 ? 125.260 33.763  106.463 1.00 47.08  ? 379 GLU C C     1 
ATOM   7051  O O     . GLU C  1 379 ? 125.851 34.145  105.456 1.00 48.58  ? 379 GLU C O     1 
ATOM   7052  C CB    . GLU C  1 379 ? 124.755 31.330  106.341 1.00 143.74 ? 379 GLU C CB    1 
ATOM   7053  C CG    . GLU C  1 379 ? 125.601 30.334  105.577 1.00 152.04 ? 379 GLU C CG    1 
ATOM   7054  C CD    . GLU C  1 379 ? 125.504 28.925  106.143 1.00 158.01 ? 379 GLU C CD    1 
ATOM   7055  O OE1   . GLU C  1 379 ? 124.407 28.330  106.077 1.00 160.00 ? 379 GLU C OE1   1 
ATOM   7056  O OE2   . GLU C  1 379 ? 126.521 28.407  106.655 1.00 158.80 ? 379 GLU C OE2   1 
ATOM   7057  N N     . ALA C  1 380 ? 124.338 34.497  107.095 1.00 39.44  ? 380 ALA C N     1 
ATOM   7058  C CA    . ALA C  1 380 ? 123.919 35.817  106.614 1.00 38.39  ? 380 ALA C CA    1 
ATOM   7059  C C     . ALA C  1 380 ? 124.898 36.891  107.015 1.00 38.71  ? 380 ALA C C     1 
ATOM   7060  O O     . ALA C  1 380 ? 125.282 37.718  106.197 1.00 39.06  ? 380 ALA C O     1 
ATOM   7061  C CB    . ALA C  1 380 ? 122.539 36.160  107.144 1.00 80.28  ? 380 ALA C CB    1 
ATOM   7062  N N     . ALA C  1 381 ? 125.289 36.901  108.282 1.00 39.29  ? 381 ALA C N     1 
ATOM   7063  C CA    . ALA C  1 381 ? 126.257 37.886  108.742 1.00 40.23  ? 381 ALA C CA    1 
ATOM   7064  C C     . ALA C  1 381 ? 127.414 37.775  107.761 1.00 40.45  ? 381 ALA C C     1 
ATOM   7065  O O     . ALA C  1 381 ? 127.696 38.698  107.002 1.00 39.59  ? 381 ALA C O     1 
ATOM   7066  C CB    . ALA C  1 381 ? 126.729 37.550  110.162 1.00 13.77  ? 381 ALA C CB    1 
ATOM   7067  N N     . PHE C  1 382 ? 128.059 36.616  107.776 1.00 31.80  ? 382 PHE C N     1 
ATOM   7068  C CA    . PHE C  1 382 ? 129.171 36.348  106.885 1.00 35.55  ? 382 PHE C CA    1 
ATOM   7069  C C     . PHE C  1 382 ? 128.864 36.831  105.471 1.00 37.09  ? 382 PHE C C     1 
ATOM   7070  O O     . PHE C  1 382 ? 129.637 37.578  104.881 1.00 39.62  ? 382 PHE C O     1 
ATOM   7071  C CB    . PHE C  1 382 ? 129.465 34.851  106.868 1.00 54.76  ? 382 PHE C CB    1 
ATOM   7072  C CG    . PHE C  1 382 ? 130.687 34.468  106.081 1.00 56.39  ? 382 PHE C CG    1 
ATOM   7073  C CD1   . PHE C  1 382 ? 131.597 33.560  106.603 1.00 57.29  ? 382 PHE C CD1   1 
ATOM   7074  C CD2   . PHE C  1 382 ? 130.920 34.985  104.824 1.00 56.63  ? 382 PHE C CD2   1 
ATOM   7075  C CE1   . PHE C  1 382 ? 132.712 33.175  105.893 1.00 58.36  ? 382 PHE C CE1   1 
ATOM   7076  C CE2   . PHE C  1 382 ? 132.035 34.606  104.103 1.00 57.91  ? 382 PHE C CE2   1 
ATOM   7077  C CZ    . PHE C  1 382 ? 132.933 33.700  104.640 1.00 59.33  ? 382 PHE C CZ    1 
ATOM   7078  N N     . ARG C  1 383 ? 127.738 36.399  104.922 1.00 27.65  ? 383 ARG C N     1 
ATOM   7079  C CA    . ARG C  1 383 ? 127.339 36.787  103.567 1.00 29.75  ? 383 ARG C CA    1 
ATOM   7080  C C     . ARG C  1 383 ? 127.643 38.258  103.244 1.00 27.00  ? 383 ARG C C     1 
ATOM   7081  O O     . ARG C  1 383 ? 128.358 38.565  102.297 1.00 25.33  ? 383 ARG C O     1 
ATOM   7082  C CB    . ARG C  1 383 ? 125.844 36.514  103.376 1.00 150.03 ? 383 ARG C CB    1 
ATOM   7083  C CG    . ARG C  1 383 ? 125.325 36.794  101.983 1.00 159.30 ? 383 ARG C CG    1 
ATOM   7084  C CD    . ARG C  1 383 ? 125.836 35.780  100.990 1.00 167.12 ? 383 ARG C CD    1 
ATOM   7085  N NE    . ARG C  1 383 ? 125.372 36.082  99.640  1.00 174.22 ? 383 ARG C NE    1 
ATOM   7086  C CZ    . ARG C  1 383 ? 125.544 35.281  98.595  1.00 177.24 ? 383 ARG C CZ    1 
ATOM   7087  N NH1   . ARG C  1 383 ? 126.171 34.119  98.741  1.00 178.84 ? 383 ARG C NH1   1 
ATOM   7088  N NH2   . ARG C  1 383 ? 125.090 35.641  97.404  1.00 178.14 ? 383 ARG C NH2   1 
ATOM   7089  N N     . VAL C  1 384 ? 127.104 39.171  104.038 1.00 41.54  ? 384 VAL C N     1 
ATOM   7090  C CA    . VAL C  1 384 ? 127.336 40.587  103.801 1.00 41.28  ? 384 VAL C CA    1 
ATOM   7091  C C     . VAL C  1 384 ? 128.791 40.964  104.044 1.00 42.72  ? 384 VAL C C     1 
ATOM   7092  O O     . VAL C  1 384 ? 129.416 41.588  103.196 1.00 43.88  ? 384 VAL C O     1 
ATOM   7093  C CB    . VAL C  1 384 ? 126.405 41.449  104.678 1.00 18.89  ? 384 VAL C CB    1 
ATOM   7094  C CG1   . VAL C  1 384 ? 126.214 40.769  106.019 1.00 18.18  ? 384 VAL C CG1   1 
ATOM   7095  C CG2   . VAL C  1 384 ? 126.988 42.854  104.861 1.00 16.73  ? 384 VAL C CG2   1 
ATOM   7096  N N     . ASN C  1 385 ? 129.340 40.602  105.194 1.00 25.14  ? 385 ASN C N     1 
ATOM   7097  C CA    . ASN C  1 385 ? 130.736 40.921  105.447 1.00 26.16  ? 385 ASN C CA    1 
ATOM   7098  C C     . ASN C  1 385 ? 131.531 40.697  104.168 1.00 27.78  ? 385 ASN C C     1 
ATOM   7099  O O     . ASN C  1 385 ? 132.251 41.587  103.727 1.00 28.43  ? 385 ASN C O     1 
ATOM   7100  C CB    . ASN C  1 385 ? 131.302 40.057  106.565 1.00 45.61  ? 385 ASN C CB    1 
ATOM   7101  C CG    . ASN C  1 385 ? 131.193 40.720  107.916 1.00 46.91  ? 385 ASN C CG    1 
ATOM   7102  O OD1   . ASN C  1 385 ? 130.448 41.682  108.098 1.00 46.85  ? 385 ASN C OD1   1 
ATOM   7103  N ND2   . ASN C  1 385 ? 131.933 40.199  108.882 1.00 47.55  ? 385 ASN C ND2   1 
ATOM   7104  N N     . GLU C  1 386 ? 131.394 39.524  103.554 1.00 43.37  ? 386 GLU C N     1 
ATOM   7105  C CA    . GLU C  1 386 ? 132.114 39.275  102.311 1.00 46.06  ? 386 GLU C CA    1 
ATOM   7106  C C     . GLU C  1 386 ? 131.715 40.227  101.180 1.00 45.13  ? 386 GLU C C     1 
ATOM   7107  O O     . GLU C  1 386 ? 132.580 40.748  100.494 1.00 45.02  ? 386 GLU C O     1 
ATOM   7108  C CB    . GLU C  1 386 ? 131.922 37.840  101.821 1.00 139.43 ? 386 GLU C CB    1 
ATOM   7109  C CG    . GLU C  1 386 ? 132.437 37.650  100.394 1.00 146.63 ? 386 GLU C CG    1 
ATOM   7110  C CD    . GLU C  1 386 ? 132.397 36.215  99.920  1.00 151.62 ? 386 GLU C CD    1 
ATOM   7111  O OE1   . GLU C  1 386 ? 133.159 35.393  100.469 1.00 153.89 ? 386 GLU C OE1   1 
ATOM   7112  O OE2   . GLU C  1 386 ? 131.608 35.909  98.999  1.00 152.98 ? 386 GLU C OE2   1 
ATOM   7113  N N     . LYS C  1 387 ? 130.419 40.454  100.983 1.00 37.55  ? 387 LYS C N     1 
ATOM   7114  C CA    . LYS C  1 387 ? 129.951 41.326  99.908  1.00 39.09  ? 387 LYS C CA    1 
ATOM   7115  C C     . LYS C  1 387 ? 130.211 42.823  100.126 1.00 38.80  ? 387 LYS C C     1 
ATOM   7116  O O     . LYS C  1 387 ? 130.140 43.604  99.182  1.00 39.27  ? 387 LYS C O     1 
ATOM   7117  C CB    . LYS C  1 387 ? 128.453 41.111  99.674  1.00 152.10 ? 387 LYS C CB    1 
ATOM   7118  C CG    . LYS C  1 387 ? 128.049 39.666  99.408  1.00 157.24 ? 387 LYS C CG    1 
ATOM   7119  C CD    . LYS C  1 387 ? 128.718 39.106  98.158  1.00 161.09 ? 387 LYS C CD    1 
ATOM   7120  C CE    . LYS C  1 387 ? 128.336 37.644  97.922  1.00 163.00 ? 387 LYS C CE    1 
ATOM   7121  N NZ    . LYS C  1 387 ? 129.041 37.054  96.744  1.00 164.37 ? 387 LYS C NZ    1 
ATOM   7122  N N     . THR C  1 388 ? 130.504 43.245  101.353 1.00 69.93  ? 388 THR C N     1 
ATOM   7123  C CA    . THR C  1 388 ? 130.744 44.666  101.579 1.00 69.99  ? 388 THR C CA    1 
ATOM   7124  C C     . THR C  1 388 ? 131.856 45.014  102.560 1.00 69.99  ? 388 THR C C     1 
ATOM   7125  O O     . THR C  1 388 ? 132.978 44.557  102.423 1.00 71.99  ? 388 THR C O     1 
ATOM   7126  C CB    . THR C  1 388 ? 129.465 45.351  102.020 1.00 46.99  ? 388 THR C CB    1 
ATOM   7127  O OG1   . THR C  1 388 ? 129.003 44.779  103.254 1.00 47.11  ? 388 THR C OG1   1 
ATOM   7128  C CG2   . THR C  1 388 ? 128.417 45.191  100.939 1.00 45.75  ? 388 THR C CG2   1 
ATOM   7129  N N     . GLU C  1 389 ? 131.558 45.848  103.540 1.00 57.18  ? 389 GLU C N     1 
ATOM   7130  C CA    . GLU C  1 389 ? 132.560 46.243  104.518 1.00 55.95  ? 389 GLU C CA    1 
ATOM   7131  C C     . GLU C  1 389 ? 132.635 45.194  105.657 1.00 53.19  ? 389 GLU C C     1 
ATOM   7132  O O     . GLU C  1 389 ? 131.935 45.315  106.662 1.00 53.79  ? 389 GLU C O     1 
ATOM   7133  C CB    . GLU C  1 389 ? 132.181 47.626  105.068 1.00 108.29 ? 389 GLU C CB    1 
ATOM   7134  C CG    . GLU C  1 389 ? 133.162 48.234  106.046 1.00 113.63 ? 389 GLU C CG    1 
ATOM   7135  C CD    . GLU C  1 389 ? 134.309 48.927  105.364 1.00 117.75 ? 389 GLU C CD    1 
ATOM   7136  O OE1   . GLU C  1 389 ? 134.066 49.967  104.711 1.00 118.77 ? 389 GLU C OE1   1 
ATOM   7137  O OE2   . GLU C  1 389 ? 135.450 48.427  105.484 1.00 121.50 ? 389 GLU C OE2   1 
ATOM   7138  N N     . ASN C  1 390 ? 133.480 44.172  105.513 1.00 38.43  ? 390 ASN C N     1 
ATOM   7139  C CA    . ASN C  1 390 ? 133.591 43.129  106.545 1.00 35.29  ? 390 ASN C CA    1 
ATOM   7140  C C     . ASN C  1 390 ? 133.879 43.722  107.916 1.00 32.42  ? 390 ASN C C     1 
ATOM   7141  O O     . ASN C  1 390 ? 135.008 44.006  108.247 1.00 33.77  ? 390 ASN C O     1 
ATOM   7142  C CB    . ASN C  1 390 ? 134.693 42.125  106.171 1.00 64.59  ? 390 ASN C CB    1 
ATOM   7143  C CG    . ASN C  1 390 ? 134.885 41.021  107.217 1.00 67.24  ? 390 ASN C CG    1 
ATOM   7144  O OD1   . ASN C  1 390 ? 135.166 41.284  108.395 1.00 69.39  ? 390 ASN C OD1   1 
ATOM   7145  N ND2   . ASN C  1 390 ? 134.747 39.773  106.778 1.00 68.04  ? 390 ASN C ND2   1 
ATOM   7146  N N     . ILE C  1 391 ? 132.868 43.918  108.733 1.00 25.00  ? 391 ILE C N     1 
ATOM   7147  C CA    . ILE C  1 391 ? 133.158 44.486  110.027 1.00 24.18  ? 391 ILE C CA    1 
ATOM   7148  C C     . ILE C  1 391 ? 133.314 43.413  111.062 1.00 24.29  ? 391 ILE C C     1 
ATOM   7149  O O     . ILE C  1 391 ? 133.035 43.652  112.246 1.00 24.84  ? 391 ILE C O     1 
ATOM   7150  C CB    . ILE C  1 391 ? 132.067 45.436  110.499 1.00 40.92  ? 391 ILE C CB    1 
ATOM   7151  C CG1   . ILE C  1 391 ? 130.720 44.728  110.503 1.00 40.87  ? 391 ILE C CG1   1 
ATOM   7152  C CG2   . ILE C  1 391 ? 132.002 46.611  109.590 1.00 42.37  ? 391 ILE C CG2   1 
ATOM   7153  C CD1   . ILE C  1 391 ? 129.602 45.604  110.961 1.00 39.54  ? 391 ILE C CD1   1 
ATOM   7154  N N     . GLY C  1 392 ? 133.756 42.237  110.626 1.00 15.49  ? 392 GLY C N     1 
ATOM   7155  C CA    . GLY C  1 392 ? 133.943 41.139  111.556 1.00 15.17  ? 392 GLY C CA    1 
ATOM   7156  C C     . GLY C  1 392 ? 132.674 40.641  112.239 1.00 15.15  ? 392 GLY C C     1 
ATOM   7157  O O     . GLY C  1 392 ? 131.614 40.536  111.614 1.00 14.19  ? 392 GLY C O     1 
ATOM   7158  N N     . ALA C  1 393 ? 132.788 40.342  113.532 1.00 36.24  ? 393 ALA C N     1 
ATOM   7159  C CA    . ALA C  1 393 ? 131.672 39.826  114.311 1.00 36.11  ? 393 ALA C CA    1 
ATOM   7160  C C     . ALA C  1 393 ? 130.614 40.855  114.615 1.00 37.07  ? 393 ALA C C     1 
ATOM   7161  O O     . ALA C  1 393 ? 129.491 40.495  114.949 1.00 36.58  ? 393 ALA C O     1 
ATOM   7162  C CB    . ALA C  1 393 ? 132.167 39.233  115.594 1.00 1.00   ? 393 ALA C CB    1 
ATOM   7163  N N     . ARG C  1 394 ? 130.952 42.132  114.528 1.00 39.97  ? 394 ARG C N     1 
ATOM   7164  C CA    . ARG C  1 394 ? 129.942 43.132  114.802 1.00 42.51  ? 394 ARG C CA    1 
ATOM   7165  C C     . ARG C  1 394 ? 128.753 42.841  113.916 1.00 42.02  ? 394 ARG C C     1 
ATOM   7166  O O     . ARG C  1 394 ? 127.598 42.982  114.334 1.00 44.12  ? 394 ARG C O     1 
ATOM   7167  C CB    . ARG C  1 394 ? 130.461 44.530  114.516 1.00 109.69 ? 394 ARG C CB    1 
ATOM   7168  C CG    . ARG C  1 394 ? 131.099 45.172  115.717 1.00 117.29 ? 394 ARG C CG    1 
ATOM   7169  C CD    . ARG C  1 394 ? 130.129 45.217  116.892 1.00 120.94 ? 394 ARG C CD    1 
ATOM   7170  N NE    . ARG C  1 394 ? 130.756 45.830  118.061 1.00 129.18 ? 394 ARG C NE    1 
ATOM   7171  C CZ    . ARG C  1 394 ? 130.175 45.975  119.250 1.00 131.88 ? 394 ARG C CZ    1 
ATOM   7172  N NH1   . ARG C  1 394 ? 128.932 45.548  119.443 1.00 132.64 ? 394 ARG C NH1   1 
ATOM   7173  N NH2   . ARG C  1 394 ? 130.841 46.552  120.249 1.00 132.59 ? 394 ARG C NH2   1 
ATOM   7174  N N     . ARG C  1 395 ? 129.031 42.400  112.694 1.00 22.22  ? 395 ARG C N     1 
ATOM   7175  C CA    . ARG C  1 395 ? 127.949 42.107  111.770 1.00 19.69  ? 395 ARG C CA    1 
ATOM   7176  C C     . ARG C  1 395 ? 126.843 41.233  112.382 1.00 18.50  ? 395 ARG C C     1 
ATOM   7177  O O     . ARG C  1 395 ? 125.738 41.184  111.853 1.00 17.65  ? 395 ARG C O     1 
ATOM   7178  C CB    . ARG C  1 395 ? 128.491 41.460  110.501 1.00 21.22  ? 395 ARG C CB    1 
ATOM   7179  C CG    . ARG C  1 395 ? 127.441 41.346  109.431 1.00 22.72  ? 395 ARG C CG    1 
ATOM   7180  C CD    . ARG C  1 395 ? 127.058 42.709  108.961 1.00 23.36  ? 395 ARG C CD    1 
ATOM   7181  N NE    . ARG C  1 395 ? 128.127 43.276  108.158 1.00 25.56  ? 395 ARG C NE    1 
ATOM   7182  C CZ    . ARG C  1 395 ? 128.142 44.528  107.725 1.00 28.03  ? 395 ARG C CZ    1 
ATOM   7183  N NH1   . ARG C  1 395 ? 127.142 45.335  108.035 1.00 30.26  ? 395 ARG C NH1   1 
ATOM   7184  N NH2   . ARG C  1 395 ? 129.136 44.970  106.967 1.00 29.96  ? 395 ARG C NH2   1 
ATOM   7185  N N     . LEU C  1 396 ? 127.121 40.545  113.491 1.00 23.60  ? 396 LEU C N     1 
ATOM   7186  C CA    . LEU C  1 396 ? 126.088 39.714  114.103 1.00 22.95  ? 396 LEU C CA    1 
ATOM   7187  C C     . LEU C  1 396 ? 125.136 40.623  114.825 1.00 24.29  ? 396 LEU C C     1 
ATOM   7188  O O     . LEU C  1 396 ? 123.925 40.512  114.631 1.00 24.87  ? 396 LEU C O     1 
ATOM   7189  C CB    . LEU C  1 396 ? 126.672 38.654  115.053 1.00 14.78  ? 396 LEU C CB    1 
ATOM   7190  C CG    . LEU C  1 396 ? 127.497 37.620  114.257 1.00 14.12  ? 396 LEU C CG    1 
ATOM   7191  C CD1   . LEU C  1 396 ? 128.186 36.627  115.177 1.00 12.63  ? 396 LEU C CD1   1 
ATOM   7192  C CD2   . LEU C  1 396 ? 126.602 36.888  113.271 1.00 12.76  ? 396 LEU C CD2   1 
ATOM   7193  N N     . HIS C  1 397 ? 125.676 41.548  115.620 1.00 36.32  ? 397 HIS C N     1 
ATOM   7194  C CA    . HIS C  1 397 ? 124.837 42.504  116.352 1.00 38.26  ? 397 HIS C CA    1 
ATOM   7195  C C     . HIS C  1 397 ? 123.968 43.278  115.390 1.00 36.66  ? 397 HIS C C     1 
ATOM   7196  O O     . HIS C  1 397 ? 122.852 43.678  115.744 1.00 36.47  ? 397 HIS C O     1 
ATOM   7197  C CB    . HIS C  1 397 ? 125.676 43.478  117.137 1.00 56.32  ? 397 HIS C CB    1 
ATOM   7198  C CG    . HIS C  1 397 ? 126.510 42.827  118.175 1.00 61.49  ? 397 HIS C CG    1 
ATOM   7199  N ND1   . HIS C  1 397 ? 126.391 43.128  119.513 1.00 64.38  ? 397 HIS C ND1   1 
ATOM   7200  C CD2   . HIS C  1 397 ? 127.479 41.887  118.078 1.00 64.43  ? 397 HIS C CD2   1 
ATOM   7201  C CE1   . HIS C  1 397 ? 127.256 42.400  120.198 1.00 67.41  ? 397 HIS C CE1   1 
ATOM   7202  N NE2   . HIS C  1 397 ? 127.928 41.639  119.351 1.00 67.48  ? 397 HIS C NE2   1 
ATOM   7203  N N     . THR C  1 398 ? 124.508 43.499  114.190 1.00 10.26  ? 398 THR C N     1 
ATOM   7204  C CA    . THR C  1 398 ? 123.803 44.163  113.109 1.00 10.16  ? 398 THR C CA    1 
ATOM   7205  C C     . THR C  1 398 ? 122.664 43.327  112.551 1.00 9.60   ? 398 THR C C     1 
ATOM   7206  O O     . THR C  1 398 ? 121.543 43.812  112.445 1.00 10.43  ? 398 THR C O     1 
ATOM   7207  C CB    . THR C  1 398 ? 124.718 44.416  111.956 1.00 26.96  ? 398 THR C CB    1 
ATOM   7208  O OG1   . THR C  1 398 ? 125.439 45.598  112.246 1.00 30.99  ? 398 THR C OG1   1 
ATOM   7209  C CG2   . THR C  1 398 ? 123.942 44.533  110.595 1.00 26.53  ? 398 THR C CG2   1 
ATOM   7210  N N     . VAL C  1 399 ? 122.961 42.082  112.166 1.00 10.96  ? 399 VAL C N     1 
ATOM   7211  C CA    . VAL C  1 399 ? 121.954 41.211  111.592 1.00 8.85   ? 399 VAL C CA    1 
ATOM   7212  C C     . VAL C  1 399 ? 120.932 40.853  112.621 1.00 9.12   ? 399 VAL C C     1 
ATOM   7213  O O     . VAL C  1 399 ? 119.736 40.744  112.321 1.00 9.90   ? 399 VAL C O     1 
ATOM   7214  C CB    . VAL C  1 399 ? 122.532 39.926  111.054 1.00 15.68  ? 399 VAL C CB    1 
ATOM   7215  C CG1   . VAL C  1 399 ? 121.408 38.992  110.687 1.00 16.19  ? 399 VAL C CG1   1 
ATOM   7216  C CG2   . VAL C  1 399 ? 123.340 40.204  109.830 1.00 15.97  ? 399 VAL C CG2   1 
ATOM   7217  N N     . MET C  1 400 ? 121.379 40.654  113.847 1.00 17.94  ? 400 MET C N     1 
ATOM   7218  C CA    . MET C  1 400 ? 120.406 40.336  114.864 1.00 20.26  ? 400 MET C CA    1 
ATOM   7219  C C     . MET C  1 400 ? 119.386 41.448  114.944 1.00 21.57  ? 400 MET C C     1 
ATOM   7220  O O     . MET C  1 400 ? 118.214 41.241  114.627 1.00 20.89  ? 400 MET C O     1 
ATOM   7221  C CB    . MET C  1 400 ? 121.071 40.137  116.210 1.00 24.78  ? 400 MET C CB    1 
ATOM   7222  C CG    . MET C  1 400 ? 121.712 38.784  116.300 1.00 26.20  ? 400 MET C CG    1 
ATOM   7223  S SD    . MET C  1 400 ? 120.505 37.501  116.067 1.00 25.61  ? 400 MET C SD    1 
ATOM   7224  C CE    . MET C  1 400 ? 120.260 37.077  117.789 1.00 27.32  ? 400 MET C CE    1 
ATOM   7225  N N     . GLU C  1 401 ? 119.834 42.644  115.319 1.00 32.61  ? 401 GLU C N     1 
ATOM   7226  C CA    . GLU C  1 401 ? 118.901 43.753  115.451 1.00 34.10  ? 401 GLU C CA    1 
ATOM   7227  C C     . GLU C  1 401 ? 118.047 43.942  114.229 1.00 33.48  ? 401 GLU C C     1 
ATOM   7228  O O     . GLU C  1 401 ? 116.937 44.418  114.332 1.00 34.98  ? 401 GLU C O     1 
ATOM   7229  C CB    . GLU C  1 401 ? 119.603 45.059  115.784 1.00 41.89  ? 401 GLU C CB    1 
ATOM   7230  C CG    . GLU C  1 401 ? 118.635 46.101  116.348 1.00 48.90  ? 401 GLU C CG    1 
ATOM   7231  C CD    . GLU C  1 401 ? 117.924 45.654  117.651 1.00 54.04  ? 401 GLU C CD    1 
ATOM   7232  O OE1   . GLU C  1 401 ? 118.612 45.155  118.578 1.00 56.64  ? 401 GLU C OE1   1 
ATOM   7233  O OE2   . GLU C  1 401 ? 116.681 45.822  117.762 1.00 54.46  ? 401 GLU C OE2   1 
ATOM   7234  N N     . ARG C  1 402 ? 118.545 43.554  113.072 1.00 31.08  ? 402 ARG C N     1 
ATOM   7235  C CA    . ARG C  1 402 ? 117.751 43.701  111.875 1.00 32.07  ? 402 ARG C CA    1 
ATOM   7236  C C     . ARG C  1 402 ? 116.667 42.638  111.865 1.00 32.80  ? 402 ARG C C     1 
ATOM   7237  O O     . ARG C  1 402 ? 115.546 42.902  111.392 1.00 34.42  ? 402 ARG C O     1 
ATOM   7238  C CB    . ARG C  1 402 ? 118.629 43.580  110.636 1.00 52.21  ? 402 ARG C CB    1 
ATOM   7239  C CG    . ARG C  1 402 ? 117.921 43.845  109.325 1.00 54.66  ? 402 ARG C CG    1 
ATOM   7240  C CD    . ARG C  1 402 ? 118.946 44.263  108.276 1.00 58.49  ? 402 ARG C CD    1 
ATOM   7241  N NE    . ARG C  1 402 ? 119.064 43.318  107.167 1.00 62.87  ? 402 ARG C NE    1 
ATOM   7242  C CZ    . ARG C  1 402 ? 120.219 42.826  106.706 1.00 64.75  ? 402 ARG C CZ    1 
ATOM   7243  N NH1   . ARG C  1 402 ? 121.389 43.191  107.268 1.00 63.82  ? 402 ARG C NH1   1 
ATOM   7244  N NH2   . ARG C  1 402 ? 120.198 41.967  105.676 1.00 63.64  ? 402 ARG C NH2   1 
ATOM   7245  N N     . LEU C  1 403 ? 116.985 41.449  112.399 1.00 15.77  ? 403 LEU C N     1 
ATOM   7246  C CA    . LEU C  1 403 ? 116.023 40.330  112.440 1.00 14.85  ? 403 LEU C CA    1 
ATOM   7247  C C     . LEU C  1 403 ? 114.983 40.513  113.522 1.00 16.04  ? 403 LEU C C     1 
ATOM   7248  O O     . LEU C  1 403 ? 113.792 40.488  113.245 1.00 16.21  ? 403 LEU C O     1 
ATOM   7249  C CB    . LEU C  1 403 ? 116.746 38.997  112.656 1.00 18.88  ? 403 LEU C CB    1 
ATOM   7250  C CG    . LEU C  1 403 ? 115.943 37.777  113.142 1.00 17.04  ? 403 LEU C CG    1 
ATOM   7251  C CD1   . LEU C  1 403 ? 116.812 36.530  113.070 1.00 15.95  ? 403 LEU C CD1   1 
ATOM   7252  C CD2   . LEU C  1 403 ? 115.485 37.961  114.566 1.00 15.28  ? 403 LEU C CD2   1 
ATOM   7253  N N     . MET C  1 404 ? 115.465 40.701  114.748 1.00 49.07  ? 404 MET C N     1 
ATOM   7254  C CA    . MET C  1 404 ? 114.634 40.896  115.940 1.00 51.95  ? 404 MET C CA    1 
ATOM   7255  C C     . MET C  1 404 ? 113.878 42.219  115.936 1.00 54.32  ? 404 MET C C     1 
ATOM   7256  O O     . MET C  1 404 ? 113.286 42.615  116.935 1.00 55.35  ? 404 MET C O     1 
ATOM   7257  C CB    . MET C  1 404 ? 115.510 40.817  117.189 1.00 26.26  ? 404 MET C CB    1 
ATOM   7258  C CG    . MET C  1 404 ? 116.186 39.483  117.308 1.00 24.70  ? 404 MET C CG    1 
ATOM   7259  S SD    . MET C  1 404 ? 114.895 38.307  117.403 1.00 16.48  ? 404 MET C SD    1 
ATOM   7260  C CE    . MET C  1 404 ? 114.557 38.600  119.078 1.00 22.50  ? 404 MET C CE    1 
ATOM   7261  N N     . ASP C  1 405 ? 113.926 42.889  114.794 1.00 36.03  ? 405 ASP C N     1 
ATOM   7262  C CA    . ASP C  1 405 ? 113.266 44.158  114.547 1.00 36.54  ? 405 ASP C CA    1 
ATOM   7263  C C     . ASP C  1 405 ? 111.817 44.172  115.072 1.00 36.79  ? 405 ASP C C     1 
ATOM   7264  O O     . ASP C  1 405 ? 111.560 44.668  116.170 1.00 37.06  ? 405 ASP C O     1 
ATOM   7265  C CB    . ASP C  1 405 ? 113.268 44.386  113.037 1.00 68.99  ? 405 ASP C CB    1 
ATOM   7266  C CG    . ASP C  1 405 ? 113.030 45.809  112.659 1.00 72.77  ? 405 ASP C CG    1 
ATOM   7267  O OD1   . ASP C  1 405 ? 112.164 46.470  113.264 1.00 76.81  ? 405 ASP C OD1   1 
ATOM   7268  O OD2   . ASP C  1 405 ? 113.709 46.264  111.727 1.00 75.07  ? 405 ASP C OD2   1 
ATOM   7269  N N     . LYS C  1 406 ? 110.888 43.610  114.278 1.00 37.40  ? 406 LYS C N     1 
ATOM   7270  C CA    . LYS C  1 406 ? 109.448 43.569  114.568 1.00 37.24  ? 406 LYS C CA    1 
ATOM   7271  C C     . LYS C  1 406 ? 109.132 43.101  115.973 1.00 36.33  ? 406 LYS C C     1 
ATOM   7272  O O     . LYS C  1 406 ? 108.542 43.841  116.759 1.00 36.46  ? 406 LYS C O     1 
ATOM   7273  C CB    . LYS C  1 406 ? 108.721 42.674  113.557 1.00 77.11  ? 406 LYS C CB    1 
ATOM   7274  C CG    . LYS C  1 406 ? 108.941 43.037  112.087 1.00 80.59  ? 406 LYS C CG    1 
ATOM   7275  C CD    . LYS C  1 406 ? 110.364 42.673  111.614 1.00 87.26  ? 406 LYS C CD    1 
ATOM   7276  C CE    . LYS C  1 406 ? 110.672 43.178  110.183 1.00 88.96  ? 406 LYS C CE    1 
ATOM   7277  N NZ    . LYS C  1 406 ? 112.154 43.347  109.899 1.00 87.42  ? 406 LYS C NZ    1 
ATOM   7278  N N     . ILE C  1 407 ? 109.528 41.874  116.292 1.00 33.18  ? 407 ILE C N     1 
ATOM   7279  C CA    . ILE C  1 407 ? 109.261 41.342  117.615 1.00 30.60  ? 407 ILE C CA    1 
ATOM   7280  C C     . ILE C  1 407 ? 109.577 42.377  118.684 1.00 29.85  ? 407 ILE C C     1 
ATOM   7281  O O     . ILE C  1 407 ? 108.726 42.668  119.514 1.00 29.46  ? 407 ILE C O     1 
ATOM   7282  C CB    . ILE C  1 407 ? 110.073 40.047  117.871 1.00 57.23  ? 407 ILE C CB    1 
ATOM   7283  C CG1   . ILE C  1 407 ? 109.608 38.979  116.886 1.00 57.31  ? 407 ILE C CG1   1 
ATOM   7284  C CG2   . ILE C  1 407 ? 109.911 39.571  119.330 1.00 56.20  ? 407 ILE C CG2   1 
ATOM   7285  C CD1   . ILE C  1 407 ? 110.296 37.665  117.039 1.00 58.81  ? 407 ILE C CD1   1 
ATOM   7286  N N     . SER C  1 408 ? 110.778 42.964  118.625 1.00 24.04  ? 408 SER C N     1 
ATOM   7287  C CA    . SER C  1 408 ? 111.245 43.950  119.619 1.00 21.70  ? 408 SER C CA    1 
ATOM   7288  C C     . SER C  1 408 ? 110.238 45.033  119.904 1.00 18.51  ? 408 SER C C     1 
ATOM   7289  O O     . SER C  1 408 ? 110.193 45.567  120.993 1.00 16.75  ? 408 SER C O     1 
ATOM   7290  C CB    . SER C  1 408 ? 112.570 44.584  119.189 1.00 40.72  ? 408 SER C CB    1 
ATOM   7291  O OG    . SER C  1 408 ? 113.362 44.930  120.317 1.00 44.63  ? 408 SER C OG    1 
ATOM   7292  N N     . PHE C  1 409 ? 109.398 45.333  118.935 1.00 17.50  ? 409 PHE C N     1 
ATOM   7293  C CA    . PHE C  1 409 ? 108.403 46.360  119.140 1.00 17.51  ? 409 PHE C CA    1 
ATOM   7294  C C     . PHE C  1 409 ? 107.158 45.816  119.773 1.00 19.58  ? 409 PHE C C     1 
ATOM   7295  O O     . PHE C  1 409 ? 106.715 46.270  120.824 1.00 20.86  ? 409 PHE C O     1 
ATOM   7296  C CB    . PHE C  1 409 ? 107.994 46.970  117.823 1.00 1.37   ? 409 PHE C CB    1 
ATOM   7297  C CG    . PHE C  1 409 ? 107.130 48.170  117.972 1.00 1.37   ? 409 PHE C CG    1 
ATOM   7298  C CD1   . PHE C  1 409 ? 107.574 49.277  118.687 1.00 1.37   ? 409 PHE C CD1   1 
ATOM   7299  C CD2   . PHE C  1 409 ? 105.928 48.253  117.315 1.00 1.37   ? 409 PHE C CD2   1 
ATOM   7300  C CE1   . PHE C  1 409 ? 106.847 50.457  118.741 1.00 1.37   ? 409 PHE C CE1   1 
ATOM   7301  C CE2   . PHE C  1 409 ? 105.179 49.443  117.355 1.00 1.37   ? 409 PHE C CE2   1 
ATOM   7302  C CZ    . PHE C  1 409 ? 105.650 50.542  118.071 1.00 1.37   ? 409 PHE C CZ    1 
ATOM   7303  N N     . SER C  1 410 ? 106.591 44.843  119.078 1.00 12.53  ? 410 SER C N     1 
ATOM   7304  C CA    . SER C  1 410 ? 105.360 44.178  119.460 1.00 11.66  ? 410 SER C CA    1 
ATOM   7305  C C     . SER C  1 410 ? 105.508 43.266  120.693 1.00 12.65  ? 410 SER C C     1 
ATOM   7306  O O     . SER C  1 410 ? 104.561 43.019  121.447 1.00 10.75  ? 410 SER C O     1 
ATOM   7307  C CB    . SER C  1 410 ? 104.878 43.398  118.236 1.00 10.63  ? 410 SER C CB    1 
ATOM   7308  O OG    . SER C  1 410 ? 104.950 44.208  117.057 1.00 5.38   ? 410 SER C OG    1 
ATOM   7309  N N     . ALA C  1 411 ? 106.718 42.797  120.918 1.00 19.84  ? 411 ALA C N     1 
ATOM   7310  C CA    . ALA C  1 411 ? 106.982 41.918  122.041 1.00 23.69  ? 411 ALA C CA    1 
ATOM   7311  C C     . ALA C  1 411 ? 106.244 42.346  123.282 1.00 25.71  ? 411 ALA C C     1 
ATOM   7312  O O     . ALA C  1 411 ? 105.846 41.528  124.100 1.00 25.97  ? 411 ALA C O     1 
ATOM   7313  C CB    . ALA C  1 411 ? 108.487 41.880  122.328 1.00 16.40  ? 411 ALA C CB    1 
ATOM   7314  N N     . SER C  1 412 ? 106.074 43.649  123.405 1.00 21.99  ? 412 SER C N     1 
ATOM   7315  C CA    . SER C  1 412 ? 105.438 44.231  124.563 1.00 24.05  ? 412 SER C CA    1 
ATOM   7316  C C     . SER C  1 412 ? 104.006 43.793  124.779 1.00 23.98  ? 412 SER C C     1 
ATOM   7317  O O     . SER C  1 412 ? 103.660 43.292  125.841 1.00 23.09  ? 412 SER C O     1 
ATOM   7318  C CB    . SER C  1 412 ? 105.504 45.747  124.458 1.00 106.84 ? 412 SER C CB    1 
ATOM   7319  O OG    . SER C  1 412 ? 105.241 46.334  125.711 1.00 110.17 ? 412 SER C OG    1 
ATOM   7320  N N     . ASP C  1 413 ? 103.159 43.991  123.783 1.00 53.47  ? 413 ASP C N     1 
ATOM   7321  C CA    . ASP C  1 413 ? 101.764 43.623  123.946 1.00 55.19  ? 413 ASP C CA    1 
ATOM   7322  C C     . ASP C  1 413 ? 101.529 42.254  123.322 1.00 54.50  ? 413 ASP C C     1 
ATOM   7323  O O     . ASP C  1 413 ? 100.412 41.828  123.064 1.00 55.76  ? 413 ASP C O     1 
ATOM   7324  C CB    . ASP C  1 413 ? 100.859 44.722  123.337 1.00 62.04  ? 413 ASP C CB    1 
ATOM   7325  C CG    . ASP C  1 413 ? 101.140 44.978  121.865 1.00 63.91  ? 413 ASP C CG    1 
ATOM   7326  O OD1   . ASP C  1 413 ? 100.852 46.104  121.398 1.00 62.96  ? 413 ASP C OD1   1 
ATOM   7327  O OD2   . ASP C  1 413 ? 101.625 44.050  121.174 1.00 66.39  ? 413 ASP C OD2   1 
ATOM   7328  N N     . MET C  1 414 ? 102.620 41.551  123.120 1.00 20.40  ? 414 MET C N     1 
ATOM   7329  C CA    . MET C  1 414 ? 102.580 40.228  122.526 1.00 19.53  ? 414 MET C CA    1 
ATOM   7330  C C     . MET C  1 414 ? 102.845 39.180  123.601 1.00 19.95  ? 414 MET C C     1 
ATOM   7331  O O     . MET C  1 414 ? 103.388 38.117  123.340 1.00 19.18  ? 414 MET C O     1 
ATOM   7332  C CB    . MET C  1 414 ? 103.663 40.181  121.487 1.00 18.01  ? 414 MET C CB    1 
ATOM   7333  C CG    . MET C  1 414 ? 103.846 38.903  120.838 1.00 15.07  ? 414 MET C CG    1 
ATOM   7334  S SD    . MET C  1 414 ? 105.317 39.179  119.929 1.00 8.88   ? 414 MET C SD    1 
ATOM   7335  C CE    . MET C  1 414 ? 104.546 39.898  118.306 1.00 13.52  ? 414 MET C CE    1 
ATOM   7336  N N     . ASN C  1 415 ? 102.455 39.501  124.822 1.00 43.99  ? 415 ASN C N     1 
ATOM   7337  C CA    . ASN C  1 415 ? 102.670 38.620  125.955 1.00 45.17  ? 415 ASN C CA    1 
ATOM   7338  C C     . ASN C  1 415 ? 102.170 37.206  125.756 1.00 46.27  ? 415 ASN C C     1 
ATOM   7339  O O     . ASN C  1 415 ? 101.259 36.944  124.965 1.00 47.13  ? 415 ASN C O     1 
ATOM   7340  C CB    . ASN C  1 415 ? 102.006 39.206  127.200 1.00 39.96  ? 415 ASN C CB    1 
ATOM   7341  C CG    . ASN C  1 415 ? 102.229 38.363  128.441 1.00 39.61  ? 415 ASN C CG    1 
ATOM   7342  O OD1   . ASN C  1 415 ? 101.958 37.175  128.443 1.00 39.01  ? 415 ASN C OD1   1 
ATOM   7343  N ND2   . ASN C  1 415 ? 102.712 38.983  129.507 1.00 40.63  ? 415 ASN C ND2   1 
ATOM   7344  N N     . GLY C  1 416 ? 102.783 36.298  126.504 1.00 60.92  ? 416 GLY C N     1 
ATOM   7345  C CA    . GLY C  1 416 ? 102.407 34.906  126.463 1.00 61.43  ? 416 GLY C CA    1 
ATOM   7346  C C     . GLY C  1 416 ? 102.948 34.165  125.269 1.00 62.09  ? 416 GLY C C     1 
ATOM   7347  O O     . GLY C  1 416 ? 103.622 33.153  125.437 1.00 62.96  ? 416 GLY C O     1 
ATOM   7348  N N     . GLN C  1 417 ? 102.656 34.668  124.073 1.00 45.36  ? 417 GLN C N     1 
ATOM   7349  C CA    . GLN C  1 417 ? 103.096 34.042  122.822 1.00 45.83  ? 417 GLN C CA    1 
ATOM   7350  C C     . GLN C  1 417 ? 104.470 33.446  122.876 1.00 44.93  ? 417 GLN C C     1 
ATOM   7351  O O     . GLN C  1 417 ? 105.259 33.776  123.748 1.00 45.33  ? 417 GLN C O     1 
ATOM   7352  C CB    . GLN C  1 417 ? 103.114 35.046  121.676 1.00 25.07  ? 417 GLN C CB    1 
ATOM   7353  C CG    . GLN C  1 417 ? 101.892 35.898  121.627 1.00 27.70  ? 417 GLN C CG    1 
ATOM   7354  C CD    . GLN C  1 417 ? 101.633 36.392  120.253 1.00 26.72  ? 417 GLN C CD    1 
ATOM   7355  O OE1   . GLN C  1 417 ? 100.665 37.121  120.009 1.00 28.95  ? 417 GLN C OE1   1 
ATOM   7356  N NE2   . GLN C  1 417 ? 102.486 35.988  119.326 1.00 25.26  ? 417 GLN C NE2   1 
ATOM   7357  N N     . THR C  1 418 ? 104.758 32.567  121.931 1.00 49.49  ? 418 THR C N     1 
ATOM   7358  C CA    . THR C  1 418 ? 106.077 31.972  121.844 1.00 50.53  ? 418 THR C CA    1 
ATOM   7359  C C     . THR C  1 418 ? 106.450 32.067  120.374 1.00 50.29  ? 418 THR C C     1 
ATOM   7360  O O     . THR C  1 418 ? 105.741 31.547  119.507 1.00 50.57  ? 418 THR C O     1 
ATOM   7361  C CB    . THR C  1 418 ? 106.081 30.515  122.314 1.00 74.21  ? 418 THR C CB    1 
ATOM   7362  O OG1   . THR C  1 418 ? 105.168 29.754  121.524 1.00 76.35  ? 418 THR C OG1   1 
ATOM   7363  C CG2   . THR C  1 418 ? 105.661 30.430  123.771 1.00 73.85  ? 418 THR C CG2   1 
ATOM   7364  N N     . VAL C  1 419 ? 107.542 32.767  120.085 1.00 45.42  ? 419 VAL C N     1 
ATOM   7365  C CA    . VAL C  1 419 ? 107.947 32.940  118.703 1.00 44.73  ? 419 VAL C CA    1 
ATOM   7366  C C     . VAL C  1 419 ? 108.919 31.841  118.365 1.00 44.55  ? 419 VAL C C     1 
ATOM   7367  O O     . VAL C  1 419 ? 109.868 31.595  119.113 1.00 45.46  ? 419 VAL C O     1 
ATOM   7368  C CB    . VAL C  1 419 ? 108.644 34.298  118.466 1.00 42.54  ? 419 VAL C CB    1 
ATOM   7369  C CG1   . VAL C  1 419 ? 108.622 34.634  116.993 1.00 42.90  ? 419 VAL C CG1   1 
ATOM   7370  C CG2   . VAL C  1 419 ? 107.961 35.402  119.242 1.00 43.07  ? 419 VAL C CG2   1 
ATOM   7371  N N     . ASN C  1 420 ? 108.689 31.171  117.242 1.00 63.40  ? 420 ASN C N     1 
ATOM   7372  C CA    . ASN C  1 420 ? 109.579 30.099  116.838 1.00 63.24  ? 420 ASN C CA    1 
ATOM   7373  C C     . ASN C  1 420 ? 110.398 30.542  115.634 1.00 60.74  ? 420 ASN C C     1 
ATOM   7374  O O     . ASN C  1 420 ? 110.009 30.318  114.487 1.00 61.00  ? 420 ASN C O     1 
ATOM   7375  C CB    . ASN C  1 420 ? 108.776 28.850  116.503 1.00 124.22 ? 420 ASN C CB    1 
ATOM   7376  C CG    . ASN C  1 420 ? 109.634 27.613  116.467 1.00 127.30 ? 420 ASN C CG    1 
ATOM   7377  O OD1   . ASN C  1 420 ? 109.867 27.032  115.404 1.00 128.06 ? 420 ASN C OD1   1 
ATOM   7378  N ND2   . ASN C  1 420 ? 110.127 27.203  117.637 1.00 127.99 ? 420 ASN C ND2   1 
ATOM   7379  N N     . ILE C  1 421 ? 111.547 31.156  115.908 1.00 12.33  ? 421 ILE C N     1 
ATOM   7380  C CA    . ILE C  1 421 ? 112.411 31.672  114.852 1.00 8.97   ? 421 ILE C CA    1 
ATOM   7381  C C     . ILE C  1 421 ? 113.173 30.570  114.183 1.00 8.04   ? 421 ILE C C     1 
ATOM   7382  O O     . ILE C  1 421 ? 114.141 30.024  114.754 1.00 5.89   ? 421 ILE C O     1 
ATOM   7383  C CB    . ILE C  1 421 ? 113.409 32.720  115.395 1.00 24.63  ? 421 ILE C CB    1 
ATOM   7384  C CG1   . ILE C  1 421 ? 112.675 33.689  116.316 1.00 20.83  ? 421 ILE C CG1   1 
ATOM   7385  C CG2   . ILE C  1 421 ? 114.050 33.489  114.236 1.00 23.99  ? 421 ILE C CG2   1 
ATOM   7386  C CD1   . ILE C  1 421 ? 113.516 34.760  116.782 1.00 19.49  ? 421 ILE C CD1   1 
ATOM   7387  N N     . ASP C  1 422 ? 112.722 30.268  112.966 1.00 33.59  ? 422 ASP C N     1 
ATOM   7388  C CA    . ASP C  1 422 ? 113.301 29.221  112.142 1.00 35.93  ? 422 ASP C CA    1 
ATOM   7389  C C     . ASP C  1 422 ? 113.926 29.794  110.900 1.00 34.68  ? 422 ASP C C     1 
ATOM   7390  O O     . ASP C  1 422 ? 113.969 30.995  110.742 1.00 36.18  ? 422 ASP C O     1 
ATOM   7391  C CB    . ASP C  1 422 ? 112.220 28.210  111.757 1.00 101.56 ? 422 ASP C CB    1 
ATOM   7392  C CG    . ASP C  1 422 ? 111.018 28.863  111.112 1.00 105.33 ? 422 ASP C CG    1 
ATOM   7393  O OD1   . ASP C  1 422 ? 109.982 28.177  110.937 1.00 105.70 ? 422 ASP C OD1   1 
ATOM   7394  O OD2   . ASP C  1 422 ? 111.121 30.063  110.780 1.00 107.67 ? 422 ASP C OD2   1 
ATOM   7395  N N     . ALA C  1 423 ? 114.398 28.924  110.020 1.00 39.79  ? 423 ALA C N     1 
ATOM   7396  C CA    . ALA C  1 423 ? 115.026 29.339  108.769 1.00 41.02  ? 423 ALA C CA    1 
ATOM   7397  C C     . ALA C  1 423 ? 114.104 30.155  107.878 1.00 39.58  ? 423 ALA C C     1 
ATOM   7398  O O     . ALA C  1 423 ? 114.555 31.001  107.114 1.00 39.17  ? 423 ALA C O     1 
ATOM   7399  C CB    . ALA C  1 423 ? 115.514 28.125  108.008 1.00 178.28 ? 423 ALA C CB    1 
ATOM   7400  N N     . ALA C  1 424 ? 112.811 29.880  107.954 1.00 31.22  ? 424 ALA C N     1 
ATOM   7401  C CA    . ALA C  1 424 ? 111.849 30.636  107.172 1.00 31.09  ? 424 ALA C CA    1 
ATOM   7402  C C     . ALA C  1 424 ? 111.835 32.020  107.769 1.00 30.65  ? 424 ALA C C     1 
ATOM   7403  O O     . ALA C  1 424 ? 112.063 32.993  107.072 1.00 30.37  ? 424 ALA C O     1 
ATOM   7404  C CB    . ALA C  1 424 ? 110.485 30.024  107.290 1.00 100.52 ? 424 ALA C CB    1 
ATOM   7405  N N     . TYR C  1 425 ? 111.585 32.095  109.075 1.00 32.37  ? 425 TYR C N     1 
ATOM   7406  C CA    . TYR C  1 425 ? 111.536 33.370  109.792 1.00 32.70  ? 425 TYR C CA    1 
ATOM   7407  C C     . TYR C  1 425 ? 112.672 34.276  109.411 1.00 32.33  ? 425 TYR C C     1 
ATOM   7408  O O     . TYR C  1 425 ? 112.477 35.373  108.889 1.00 32.83  ? 425 TYR C O     1 
ATOM   7409  C CB    . TYR C  1 425 ? 111.623 33.171  111.306 1.00 41.21  ? 425 TYR C CB    1 
ATOM   7410  C CG    . TYR C  1 425 ? 111.138 34.372  112.082 1.00 43.36  ? 425 TYR C CG    1 
ATOM   7411  C CD1   . TYR C  1 425 ? 111.157 34.383  113.469 1.00 43.42  ? 425 TYR C CD1   1 
ATOM   7412  C CD2   . TYR C  1 425 ? 110.549 35.444  111.430 1.00 44.65  ? 425 TYR C CD2   1 
ATOM   7413  C CE1   . TYR C  1 425 ? 110.590 35.412  114.193 1.00 44.44  ? 425 TYR C CE1   1 
ATOM   7414  C CE2   . TYR C  1 425 ? 109.977 36.482  112.140 1.00 47.07  ? 425 TYR C CE2   1 
ATOM   7415  C CZ    . TYR C  1 425 ? 109.994 36.460  113.528 1.00 46.40  ? 425 TYR C CZ    1 
ATOM   7416  O OH    . TYR C  1 425 ? 109.383 37.477  114.239 1.00 47.63  ? 425 TYR C OH    1 
ATOM   7417  N N     . VAL C  1 426 ? 113.869 33.802  109.710 1.00 14.86  ? 426 VAL C N     1 
ATOM   7418  C CA    . VAL C  1 426 ? 115.055 34.554  109.442 1.00 14.03  ? 426 VAL C CA    1 
ATOM   7419  C C     . VAL C  1 426 ? 115.129 34.916  107.991 1.00 15.51  ? 426 VAL C C     1 
ATOM   7420  O O     . VAL C  1 426 ? 115.365 36.064  107.653 1.00 18.41  ? 426 VAL C O     1 
ATOM   7421  C CB    . VAL C  1 426 ? 116.301 33.775  109.812 1.00 8.42   ? 426 VAL C CB    1 
ATOM   7422  C CG1   . VAL C  1 426 ? 117.530 34.622  109.539 1.00 9.70   ? 426 VAL C CG1   1 
ATOM   7423  C CG2   . VAL C  1 426 ? 116.243 33.385  111.261 1.00 8.48   ? 426 VAL C CG2   1 
ATOM   7424  N N     . ALA C  1 427 ? 114.913 33.946  107.121 1.00 13.28  ? 427 ALA C N     1 
ATOM   7425  C CA    . ALA C  1 427 ? 115.009 34.205  105.690 1.00 15.62  ? 427 ALA C CA    1 
ATOM   7426  C C     . ALA C  1 427 ? 114.074 35.315  105.257 1.00 16.23  ? 427 ALA C C     1 
ATOM   7427  O O     . ALA C  1 427 ? 114.279 35.951  104.229 1.00 15.23  ? 427 ALA C O     1 
ATOM   7428  C CB    . ALA C  1 427 ? 114.711 32.936  104.912 1.00 160.35 ? 427 ALA C CB    1 
ATOM   7429  N N     . ASP C  1 428 ? 113.038 35.541  106.041 1.00 30.35  ? 428 ASP C N     1 
ATOM   7430  C CA    . ASP C  1 428 ? 112.097 36.584  105.721 1.00 35.21  ? 428 ASP C CA    1 
ATOM   7431  C C     . ASP C  1 428 ? 112.572 37.883  106.369 1.00 37.77  ? 428 ASP C C     1 
ATOM   7432  O O     . ASP C  1 428 ? 112.934 38.839  105.687 1.00 38.17  ? 428 ASP C O     1 
ATOM   7433  C CB    . ASP C  1 428 ? 110.718 36.188  106.228 1.00 88.75  ? 428 ASP C CB    1 
ATOM   7434  C CG    . ASP C  1 428 ? 109.787 37.361  106.343 1.00 91.42  ? 428 ASP C CG    1 
ATOM   7435  O OD1   . ASP C  1 428 ? 109.905 38.122  107.327 1.00 93.12  ? 428 ASP C OD1   1 
ATOM   7436  O OD2   . ASP C  1 428 ? 108.939 37.531  105.449 1.00 92.51  ? 428 ASP C OD2   1 
ATOM   7437  N N     . ALA C  1 429 ? 112.601 37.911  107.691 1.00 96.96  ? 429 ALA C N     1 
ATOM   7438  C CA    . ALA C  1 429 ? 113.028 39.104  108.407 1.00 100.55 ? 429 ALA C CA    1 
ATOM   7439  C C     . ALA C  1 429 ? 114.192 39.846  107.761 1.00 102.95 ? 429 ALA C C     1 
ATOM   7440  O O     . ALA C  1 429 ? 114.315 41.055  107.921 1.00 105.40 ? 429 ALA C O     1 
ATOM   7441  C CB    . ALA C  1 429 ? 113.381 38.745  109.840 1.00 108.63 ? 429 ALA C CB    1 
ATOM   7442  N N     . LEU C  1 430 ? 115.039 39.136  107.026 1.00 51.78  ? 430 LEU C N     1 
ATOM   7443  C CA    . LEU C  1 430 ? 116.187 39.770  106.399 1.00 54.89  ? 430 LEU C CA    1 
ATOM   7444  C C     . LEU C  1 430 ? 115.949 40.305  105.001 1.00 60.95  ? 430 LEU C C     1 
ATOM   7445  O O     . LEU C  1 430 ? 116.299 41.443  104.714 1.00 62.50  ? 430 LEU C O     1 
ATOM   7446  C CB    . LEU C  1 430 ? 117.373 38.829  106.414 1.00 21.02  ? 430 LEU C CB    1 
ATOM   7447  C CG    . LEU C  1 430 ? 117.743 38.415  107.848 1.00 16.56  ? 430 LEU C CG    1 
ATOM   7448  C CD1   . LEU C  1 430 ? 119.100 37.721  107.801 1.00 14.64  ? 430 LEU C CD1   1 
ATOM   7449  C CD2   . LEU C  1 430 ? 117.778 39.631  108.803 1.00 13.97  ? 430 LEU C CD2   1 
ATOM   7450  N N     . GLY C  1 431 ? 115.390 39.505  104.110 1.00 63.27  ? 431 GLY C N     1 
ATOM   7451  C CA    . GLY C  1 431 ? 115.084 40.052  102.797 1.00 71.91  ? 431 GLY C CA    1 
ATOM   7452  C C     . GLY C  1 431 ? 116.007 39.880  101.612 1.00 78.02  ? 431 GLY C C     1 
ATOM   7453  O O     . GLY C  1 431 ? 116.138 38.783  101.073 1.00 78.42  ? 431 GLY C O     1 
ATOM   7454  N N     . GLU C  1 432 ? 116.639 40.966  101.183 1.00 109.46 ? 432 GLU C N     1 
ATOM   7455  C CA    . GLU C  1 432 ? 117.522 40.892  100.025 1.00 116.77 ? 432 GLU C CA    1 
ATOM   7456  C C     . GLU C  1 432 ? 118.812 41.712  100.111 1.00 121.29 ? 432 GLU C C     1 
ATOM   7457  O O     . GLU C  1 432 ? 118.784 42.917  100.353 1.00 122.37 ? 432 GLU C O     1 
ATOM   7458  C CB    . GLU C  1 432 ? 116.718 41.280  98.782  1.00 185.67 ? 432 GLU C CB    1 
ATOM   7459  C CG    . GLU C  1 432 ? 115.559 42.220  99.091  1.00 188.22 ? 432 GLU C CG    1 
ATOM   7460  C CD    . GLU C  1 432 ? 114.372 42.003  98.174  1.00 189.40 ? 432 GLU C CD    1 
ATOM   7461  O OE1   . GLU C  1 432 ? 113.919 40.843  98.056  1.00 189.90 ? 432 GLU C OE1   1 
ATOM   7462  O OE2   . GLU C  1 432 ? 113.888 42.990  97.580  1.00 189.40 ? 432 GLU C OE2   1 
ATOM   7463  N N     . VAL C  1 433 ? 119.944 41.038  99.910  1.00 186.53 ? 433 VAL C N     1 
ATOM   7464  C CA    . VAL C  1 433 ? 121.256 41.681  99.946  1.00 191.53 ? 433 VAL C CA    1 
ATOM   7465  C C     . VAL C  1 433 ? 121.354 42.675  98.779  1.00 194.83 ? 433 VAL C C     1 
ATOM   7466  O O     . VAL C  1 433 ? 120.962 42.364  97.653  1.00 195.48 ? 433 VAL C O     1 
ATOM   7467  C CB    . VAL C  1 433 ? 122.401 40.623  99.835  1.00 119.76 ? 433 VAL C CB    1 
ATOM   7468  C CG1   . VAL C  1 433 ? 123.756 41.293  100.010 1.00 119.90 ? 433 VAL C CG1   1 
ATOM   7469  C CG2   . VAL C  1 433 ? 122.210 39.521  100.884 1.00 119.66 ? 433 VAL C CG2   1 
ATOM   7470  N N     . VAL C  1 434 ? 121.874 43.867  99.058  1.00 200.00 ? 434 VAL C N     1 
ATOM   7471  C CA    . VAL C  1 434 ? 122.014 44.927  98.052  1.00 200.00 ? 434 VAL C CA    1 
ATOM   7472  C C     . VAL C  1 434 ? 123.484 45.227  97.716  1.00 200.00 ? 434 VAL C C     1 
ATOM   7473  O O     . VAL C  1 434 ? 124.113 46.070  98.359  1.00 200.00 ? 434 VAL C O     1 
ATOM   7474  C CB    . VAL C  1 434 ? 121.337 46.226  98.556  1.00 170.58 ? 434 VAL C CB    1 
ATOM   7475  C CG1   . VAL C  1 434 ? 119.878 46.287  98.097  1.00 86.41  ? 434 VAL C CG1   1 
ATOM   7476  C CG2   . VAL C  1 434 ? 121.399 46.267  100.084 1.00 86.41  ? 434 VAL C CG2   1 
ATOM   7477  N N     . GLU C  1 435 ? 124.017 44.557  96.694  1.00 200.00 ? 435 GLU C N     1 
ATOM   7478  C CA    . GLU C  1 435 ? 125.419 44.726  96.296  1.00 200.00 ? 435 GLU C CA    1 
ATOM   7479  C C     . GLU C  1 435 ? 125.653 45.612  95.057  1.00 200.00 ? 435 GLU C C     1 
ATOM   7480  O O     . GLU C  1 435 ? 125.147 46.734  94.981  1.00 200.00 ? 435 GLU C O     1 
ATOM   7481  C CB    . GLU C  1 435 ? 126.044 43.343  96.068  1.00 162.54 ? 435 GLU C CB    1 
ATOM   7482  C CG    . GLU C  1 435 ? 127.548 43.350  95.865  1.00 163.93 ? 435 GLU C CG    1 
ATOM   7483  C CD    . GLU C  1 435 ? 128.042 42.063  95.253  1.00 164.60 ? 435 GLU C CD    1 
ATOM   7484  O OE1   . GLU C  1 435 ? 127.847 41.000  95.878  1.00 165.21 ? 435 GLU C OE1   1 
ATOM   7485  O OE2   . GLU C  1 435 ? 128.619 42.112  94.144  1.00 164.15 ? 435 GLU C OE2   1 
ATOM   7486  N N     . ASN C  1 436 ? 126.436 45.085  94.110  1.00 185.19 ? 436 ASN C N     1 
ATOM   7487  C CA    . ASN C  1 436 ? 126.817 45.729  92.842  1.00 184.68 ? 436 ASN C CA    1 
ATOM   7488  C C     . ASN C  1 436 ? 126.340 47.151  92.528  1.00 184.06 ? 436 ASN C C     1 
ATOM   7489  O O     . ASN C  1 436 ? 125.731 47.392  91.478  1.00 184.05 ? 436 ASN C O     1 
ATOM   7490  C CB    . ASN C  1 436 ? 126.439 44.816  91.667  1.00 200.00 ? 436 ASN C CB    1 
ATOM   7491  C CG    . ASN C  1 436 ? 127.379 43.637  91.517  1.00 200.00 ? 436 ASN C CG    1 
ATOM   7492  O OD1   . ASN C  1 436 ? 128.581 43.810  91.312  1.00 200.00 ? 436 ASN C OD1   1 
ATOM   7493  N ND2   . ASN C  1 436 ? 126.836 42.429  91.615  1.00 200.00 ? 436 ASN C ND2   1 
ATOM   7494  N N     . GLU C  1 437 ? 126.636 48.096  93.418  1.00 153.46 ? 437 GLU C N     1 
ATOM   7495  C CA    . GLU C  1 437 ? 126.239 49.478  93.189  1.00 151.97 ? 437 GLU C CA    1 
ATOM   7496  C C     . GLU C  1 437 ? 127.282 50.154  92.306  1.00 149.91 ? 437 GLU C C     1 
ATOM   7497  O O     . GLU C  1 437 ? 126.939 51.004  91.480  1.00 149.42 ? 437 GLU C O     1 
ATOM   7498  C CB    . GLU C  1 437 ? 126.078 50.237  94.520  1.00 170.75 ? 437 GLU C CB    1 
ATOM   7499  C CG    . GLU C  1 437 ? 127.324 50.314  95.406  1.00 172.23 ? 437 GLU C CG    1 
ATOM   7500  C CD    . GLU C  1 437 ? 127.105 51.156  96.665  1.00 173.37 ? 437 GLU C CD    1 
ATOM   7501  O OE1   . GLU C  1 437 ? 126.235 50.798  97.490  1.00 173.88 ? 437 GLU C OE1   1 
ATOM   7502  O OE2   . GLU C  1 437 ? 127.806 52.179  96.826  1.00 174.18 ? 437 GLU C OE2   1 
ATOM   7503  N N     . ASP C  1 438 ? 128.547 49.757  92.474  1.00 150.71 ? 438 ASP C N     1 
ATOM   7504  C CA    . ASP C  1 438 ? 129.656 50.313  91.694  1.00 147.27 ? 438 ASP C CA    1 
ATOM   7505  C C     . ASP C  1 438 ? 129.390 50.068  90.235  1.00 145.23 ? 438 ASP C C     1 
ATOM   7506  O O     . ASP C  1 438 ? 128.282 50.272  89.738  1.00 145.65 ? 438 ASP C O     1 
ATOM   7507  C CB    . ASP C  1 438 ? 130.997 49.644  92.040  1.00 189.08 ? 438 ASP C CB    1 
ATOM   7508  C CG    . ASP C  1 438 ? 131.334 49.740  93.515  1.00 189.08 ? 438 ASP C CG    1 
ATOM   7509  O OD1   . ASP C  1 438 ? 131.447 50.873  94.029  1.00 189.08 ? 438 ASP C OD1   1 
ATOM   7510  O OD2   . ASP C  1 438 ? 131.487 48.682  94.161  1.00 189.08 ? 438 ASP C OD2   1 
ATOM   7511  N N     . LEU C  1 439 ? 130.427 49.612  89.552  1.00 93.14  ? 439 LEU C N     1 
ATOM   7512  C CA    . LEU C  1 439 ? 130.308 49.321  88.141  1.00 90.83  ? 439 LEU C CA    1 
ATOM   7513  C C     . LEU C  1 439 ? 129.595 50.486  87.499  1.00 88.94  ? 439 LEU C C     1 
ATOM   7514  O O     . LEU C  1 439 ? 129.697 51.621  87.977  1.00 88.77  ? 439 LEU C O     1 
ATOM   7515  C CB    . LEU C  1 439 ? 129.489 48.041  87.933  1.00 200.00 ? 439 LEU C CB    1 
ATOM   7516  C CG    . LEU C  1 439 ? 130.116 46.714  88.365  1.00 163.13 ? 439 LEU C CG    1 
ATOM   7517  C CD1   . LEU C  1 439 ? 129.075 45.606  88.303  1.00 163.13 ? 439 LEU C CD1   1 
ATOM   7518  C CD2   . LEU C  1 439 ? 131.294 46.390  87.462  1.00 163.13 ? 439 LEU C CD2   1 
ATOM   7519  N N     . SER C  1 440 ? 128.868 50.181  86.429  1.00 110.85 ? 440 SER C N     1 
ATOM   7520  C CA    . SER C  1 440 ? 128.106 51.171  85.697  1.00 109.11 ? 440 SER C CA    1 
ATOM   7521  C C     . SER C  1 440 ? 128.573 52.593  86.025  1.00 106.63 ? 440 SER C C     1 
ATOM   7522  O O     . SER C  1 440 ? 129.590 53.058  85.506  1.00 105.27 ? 440 SER C O     1 
ATOM   7523  C CB    . SER C  1 440 ? 126.611 50.997  86.011  1.00 181.35 ? 440 SER C CB    1 
ATOM   7524  O OG    . SER C  1 440 ? 126.394 50.626  87.366  1.00 182.49 ? 440 SER C OG    1 
ATOM   7525  N N     . ARG C  1 441 ? 127.831 53.264  86.901  1.00 177.21 ? 441 ARG C N     1 
ATOM   7526  C CA    . ARG C  1 441 ? 128.127 54.630  87.327  1.00 175.46 ? 441 ARG C CA    1 
ATOM   7527  C C     . ARG C  1 441 ? 129.564 55.118  87.170  1.00 172.66 ? 441 ARG C C     1 
ATOM   7528  O O     . ARG C  1 441 ? 129.793 56.285  86.847  1.00 172.41 ? 441 ARG C O     1 
ATOM   7529  C CB    . ARG C  1 441 ? 127.708 54.808  88.786  1.00 163.68 ? 441 ARG C CB    1 
ATOM   7530  C CG    . ARG C  1 441 ? 126.367 55.476  88.963  1.00 166.67 ? 441 ARG C CG    1 
ATOM   7531  C CD    . ARG C  1 441 ? 126.442 56.933  88.553  1.00 169.58 ? 441 ARG C CD    1 
ATOM   7532  N NE    . ARG C  1 441 ? 125.801 57.773  89.554  1.00 171.71 ? 441 ARG C NE    1 
ATOM   7533  C CZ    . ARG C  1 441 ? 126.161 57.807  90.834  1.00 172.66 ? 441 ARG C CZ    1 
ATOM   7534  N NH1   . ARG C  1 441 ? 127.160 57.050  91.267  1.00 172.83 ? 441 ARG C NH1   1 
ATOM   7535  N NH2   . ARG C  1 441 ? 125.512 58.587  91.686  1.00 173.26 ? 441 ARG C NH2   1 
ATOM   7536  N N     . PHE C  1 442 ? 130.527 54.230  87.393  1.00 92.31  ? 442 PHE C N     1 
ATOM   7537  C CA    . PHE C  1 442 ? 131.929 54.613  87.309  1.00 87.72  ? 442 PHE C CA    1 
ATOM   7538  C C     . PHE C  1 442 ? 132.749 53.971  86.203  1.00 85.29  ? 442 PHE C C     1 
ATOM   7539  O O     . PHE C  1 442 ? 133.865 54.394  85.937  1.00 85.18  ? 442 PHE C O     1 
ATOM   7540  C CB    . PHE C  1 442 ? 132.622 54.285  88.622  1.00 72.34  ? 442 PHE C CB    1 
ATOM   7541  C CG    . PHE C  1 442 ? 131.956 54.862  89.818  1.00 71.63  ? 442 PHE C CG    1 
ATOM   7542  C CD1   . PHE C  1 442 ? 131.749 56.232  89.920  1.00 71.19  ? 442 PHE C CD1   1 
ATOM   7543  C CD2   . PHE C  1 442 ? 131.592 54.044  90.873  1.00 70.60  ? 442 PHE C CD2   1 
ATOM   7544  C CE1   . PHE C  1 442 ? 131.191 56.778  91.064  1.00 71.22  ? 442 PHE C CE1   1 
ATOM   7545  C CE2   . PHE C  1 442 ? 131.037 54.574  92.020  1.00 70.50  ? 442 PHE C CE2   1 
ATOM   7546  C CZ    . PHE C  1 442 ? 130.835 55.945  92.120  1.00 70.58  ? 442 PHE C CZ    1 
ATOM   7547  N N     . ILE C  1 443 ? 132.209 52.962  85.550  1.00 71.52  ? 443 ILE C N     1 
ATOM   7548  C CA    . ILE C  1 443 ? 132.979 52.262  84.546  1.00 68.91  ? 443 ILE C CA    1 
ATOM   7549  C C     . ILE C  1 443 ? 132.722 52.603  83.084  1.00 69.16  ? 443 ILE C C     1 
ATOM   7550  O O     . ILE C  1 443 ? 131.654 53.096  82.730  1.00 70.35  ? 443 ILE C O     1 
ATOM   7551  C CB    . ILE C  1 443 ? 132.813 50.773  84.808  1.00 42.57  ? 443 ILE C CB    1 
ATOM   7552  C CG1   . ILE C  1 443 ? 133.410 50.482  86.193  1.00 41.68  ? 443 ILE C CG1   1 
ATOM   7553  C CG2   . ILE C  1 443 ? 133.413 49.954  83.686  1.00 41.63  ? 443 ILE C CG2   1 
ATOM   7554  C CD1   . ILE C  1 443 ? 133.303 49.050  86.663  1.00 39.73  ? 443 ILE C CD1   1 
ATOM   7555  N N     . LEU C  1 444 ? 133.722 52.353  82.237  1.00 114.47 ? 444 LEU C N     1 
ATOM   7556  C CA    . LEU C  1 444 ? 133.608 52.631  80.805  1.00 113.45 ? 444 LEU C CA    1 
ATOM   7557  C C     . LEU C  1 444 ? 133.269 51.387  80.000  1.00 113.34 ? 444 LEU C C     1 
ATOM   7558  O O     . LEU C  1 444 ? 132.317 51.462  79.188  1.00 113.41 ? 444 LEU C O     1 
ATOM   7559  C CB    . LEU C  1 444 ? 134.903 53.224  80.252  1.00 59.07  ? 444 LEU C CB    1 
ATOM   7560  C CG    . LEU C  1 444 ? 134.778 53.725  78.810  1.00 57.26  ? 444 LEU C CG    1 
ATOM   7561  C CD1   . LEU C  1 444 ? 133.742 54.825  78.741  1.00 57.03  ? 444 LEU C CD1   1 
ATOM   7562  C CD2   . LEU C  1 444 ? 136.106 54.248  78.325  1.00 57.11  ? 444 LEU C CD2   1 
ATOM   7563  N N     . SER D  1 2   ? 105.794 50.811  135.496 1.00 177.99 ? 2   SER D N     1 
ATOM   7564  C CA    . SER D  1 2   ? 107.261 50.994  135.726 1.00 178.05 ? 2   SER D CA    1 
ATOM   7565  C C     . SER D  1 2   ? 107.918 51.882  134.662 1.00 176.34 ? 2   SER D C     1 
ATOM   7566  O O     . SER D  1 2   ? 108.924 52.547  134.920 1.00 177.64 ? 2   SER D O     1 
ATOM   7567  C CB    . SER D  1 2   ? 107.969 49.632  135.748 1.00 135.69 ? 2   SER D CB    1 
ATOM   7568  O OG    . SER D  1 2   ? 107.463 48.798  136.776 1.00 137.44 ? 2   SER D OG    1 
ATOM   7569  N N     . GLU D  1 3   ? 107.343 51.891  133.467 1.00 54.63  ? 3   GLU D N     1 
ATOM   7570  C CA    . GLU D  1 3   ? 107.876 52.671  132.373 1.00 49.83  ? 3   GLU D CA    1 
ATOM   7571  C C     . GLU D  1 3   ? 106.962 52.536  131.177 1.00 46.83  ? 3   GLU D C     1 
ATOM   7572  O O     . GLU D  1 3   ? 106.069 51.683  131.144 1.00 47.08  ? 3   GLU D O     1 
ATOM   7573  C CB    . GLU D  1 3   ? 109.254 52.168  132.001 1.00 54.07  ? 3   GLU D CB    1 
ATOM   7574  C CG    . GLU D  1 3   ? 109.901 52.945  130.905 1.00 56.09  ? 3   GLU D CG    1 
ATOM   7575  C CD    . GLU D  1 3   ? 110.023 54.382  131.279 1.00 56.98  ? 3   GLU D CD    1 
ATOM   7576  O OE1   . GLU D  1 3   ? 109.127 55.169  130.912 1.00 59.44  ? 3   GLU D OE1   1 
ATOM   7577  O OE2   . GLU D  1 3   ? 111.007 54.715  131.962 1.00 56.16  ? 3   GLU D OE2   1 
ATOM   7578  N N     . MET D  1 4   ? 107.218 53.363  130.176 1.00 31.57  ? 4   MET D N     1 
ATOM   7579  C CA    . MET D  1 4   ? 106.405 53.387  128.980 1.00 27.84  ? 4   MET D CA    1 
ATOM   7580  C C     . MET D  1 4   ? 106.710 52.238  128.078 1.00 24.75  ? 4   MET D C     1 
ATOM   7581  O O     . MET D  1 4   ? 107.666 51.531  128.313 1.00 23.56  ? 4   MET D O     1 
ATOM   7582  C CB    . MET D  1 4   ? 106.602 54.714  128.276 1.00 40.98  ? 4   MET D CB    1 
ATOM   7583  C CG    . MET D  1 4   ? 106.247 55.859  129.209 1.00 39.48  ? 4   MET D CG    1 
ATOM   7584  S SD    . MET D  1 4   ? 106.085 57.356  128.353 1.00 36.01  ? 4   MET D SD    1 
ATOM   7585  C CE    . MET D  1 4   ? 105.047 56.818  126.889 1.00 40.20  ? 4   MET D CE    1 
ATOM   7586  N N     . THR D  1 5   ? 105.899 52.055  127.046 1.00 24.36  ? 5   THR D N     1 
ATOM   7587  C CA    . THR D  1 5   ? 106.075 50.946  126.128 1.00 21.78  ? 5   THR D CA    1 
ATOM   7588  C C     . THR D  1 5   ? 106.195 51.370  124.674 1.00 20.02  ? 5   THR D C     1 
ATOM   7589  O O     . THR D  1 5   ? 105.803 52.455  124.291 1.00 19.37  ? 5   THR D O     1 
ATOM   7590  C CB    . THR D  1 5   ? 104.903 50.002  126.235 1.00 19.63  ? 5   THR D CB    1 
ATOM   7591  O OG1   . THR D  1 5   ? 104.023 50.207  125.115 1.00 20.03  ? 5   THR D OG1   1 
ATOM   7592  C CG2   . THR D  1 5   ? 104.163 50.265  127.543 1.00 18.96  ? 5   THR D CG2   1 
ATOM   7593  N N     . PRO D  1 6   ? 106.742 50.494  123.840 1.00 12.02  ? 6   PRO D N     1 
ATOM   7594  C CA    . PRO D  1 6   ? 106.908 50.782  122.429 1.00 11.48  ? 6   PRO D CA    1 
ATOM   7595  C C     . PRO D  1 6   ? 105.784 51.609  121.880 1.00 11.73  ? 6   PRO D C     1 
ATOM   7596  O O     . PRO D  1 6   ? 105.976 52.768  121.575 1.00 11.49  ? 6   PRO D O     1 
ATOM   7597  C CB    . PRO D  1 6   ? 106.969 49.401  121.821 1.00 37.19  ? 6   PRO D CB    1 
ATOM   7598  C CG    . PRO D  1 6   ? 107.818 48.698  122.809 1.00 37.24  ? 6   PRO D CG    1 
ATOM   7599  C CD    . PRO D  1 6   ? 107.229 49.140  124.143 1.00 38.00  ? 6   PRO D CD    1 
ATOM   7600  N N     . ARG D  1 7   ? 104.600 51.020  121.787 1.00 29.23  ? 7   ARG D N     1 
ATOM   7601  C CA    . ARG D  1 7   ? 103.432 51.701  121.223 1.00 30.03  ? 7   ARG D CA    1 
ATOM   7602  C C     . ARG D  1 7   ? 103.000 52.896  122.047 1.00 27.88  ? 7   ARG D C     1 
ATOM   7603  O O     . ARG D  1 7   ? 102.488 53.894  121.527 1.00 27.01  ? 7   ARG D O     1 
ATOM   7604  C CB    . ARG D  1 7   ? 102.277 50.698  121.104 1.00 31.38  ? 7   ARG D CB    1 
ATOM   7605  C CG    . ARG D  1 7   ? 101.230 50.986  120.003 1.00 36.88  ? 7   ARG D CG    1 
ATOM   7606  C CD    . ARG D  1 7   ? 100.343 49.742  119.772 1.00 39.93  ? 7   ARG D CD    1 
ATOM   7607  N NE    . ARG D  1 7   ? 100.176 49.035  121.032 1.00 41.08  ? 7   ARG D NE    1 
ATOM   7608  C CZ    . ARG D  1 7   ? 99.487  49.515  122.052 1.00 41.79  ? 7   ARG D CZ    1 
ATOM   7609  N NH1   . ARG D  1 7   ? 98.882  50.686  121.948 1.00 42.94  ? 7   ARG D NH1   1 
ATOM   7610  N NH2   . ARG D  1 7   ? 99.464  48.860  123.194 1.00 42.98  ? 7   ARG D NH2   1 
ATOM   7611  N N     . GLU D  1 8   ? 103.223 52.776  123.341 1.00 41.20  ? 8   GLU D N     1 
ATOM   7612  C CA    . GLU D  1 8   ? 102.864 53.808  124.294 1.00 40.10  ? 8   GLU D CA    1 
ATOM   7613  C C     . GLU D  1 8   ? 103.683 55.105  124.081 1.00 38.07  ? 8   GLU D C     1 
ATOM   7614  O O     . GLU D  1 8   ? 103.148 56.224  124.187 1.00 38.55  ? 8   GLU D O     1 
ATOM   7615  C CB    . GLU D  1 8   ? 103.086 53.233  125.697 1.00 61.46  ? 8   GLU D CB    1 
ATOM   7616  C CG    . GLU D  1 8   ? 102.394 53.923  126.850 1.00 64.77  ? 8   GLU D CG    1 
ATOM   7617  C CD    . GLU D  1 8   ? 101.988 52.926  127.924 1.00 68.28  ? 8   GLU D CD    1 
ATOM   7618  O OE1   . GLU D  1 8   ? 100.987 52.198  127.709 1.00 70.83  ? 8   GLU D OE1   1 
ATOM   7619  O OE2   . GLU D  1 8   ? 102.668 52.849  128.973 1.00 68.42  ? 8   GLU D OE2   1 
ATOM   7620  N N     . ILE D  1 9   ? 104.976 54.945  123.781 1.00 20.66  ? 9   ILE D N     1 
ATOM   7621  C CA    . ILE D  1 9   ? 105.889 56.065  123.563 1.00 15.22  ? 9   ILE D CA    1 
ATOM   7622  C C     . ILE D  1 9   ? 105.637 56.709  122.225 1.00 13.29  ? 9   ILE D C     1 
ATOM   7623  O O     . ILE D  1 9   ? 105.669 57.908  122.108 1.00 12.52  ? 9   ILE D O     1 
ATOM   7624  C CB    . ILE D  1 9   ? 107.334 55.615  123.539 1.00 10.84  ? 9   ILE D CB    1 
ATOM   7625  C CG1   . ILE D  1 9   ? 107.668 54.841  124.808 1.00 10.10  ? 9   ILE D CG1   1 
ATOM   7626  C CG2   . ILE D  1 9   ? 108.240 56.808  123.356 1.00 11.00  ? 9   ILE D CG2   1 
ATOM   7627  C CD1   . ILE D  1 9   ? 109.103 54.374  124.809 1.00 8.67   ? 9   ILE D CD1   1 
ATOM   7628  N N     . VAL D  1 10  ? 105.419 55.913  121.193 1.00 9.54   ? 10  VAL D N     1 
ATOM   7629  C CA    . VAL D  1 10  ? 105.160 56.494  119.894 1.00 9.50   ? 10  VAL D CA    1 
ATOM   7630  C C     . VAL D  1 10  ? 104.034 57.476  120.077 1.00 12.73  ? 10  VAL D C     1 
ATOM   7631  O O     . VAL D  1 10  ? 104.120 58.590  119.583 1.00 13.35  ? 10  VAL D O     1 
ATOM   7632  C CB    . VAL D  1 10  ? 104.743 55.442  118.862 1.00 1.00   ? 10  VAL D CB    1 
ATOM   7633  C CG1   . VAL D  1 10  ? 104.488 56.081  117.536 1.00 1.00   ? 10  VAL D CG1   1 
ATOM   7634  C CG2   . VAL D  1 10  ? 105.834 54.467  118.688 1.00 1.00   ? 10  VAL D CG2   1 
ATOM   7635  N N     . SER D  1 11  ? 102.987 57.057  120.802 1.00 27.70  ? 11  SER D N     1 
ATOM   7636  C CA    . SER D  1 11  ? 101.803 57.892  121.080 1.00 30.38  ? 11  SER D CA    1 
ATOM   7637  C C     . SER D  1 11  ? 102.237 59.279  121.538 1.00 29.45  ? 11  SER D C     1 
ATOM   7638  O O     . SER D  1 11  ? 101.966 60.268  120.877 1.00 31.00  ? 11  SER D O     1 
ATOM   7639  C CB    . SER D  1 11  ? 100.938 57.234  122.155 1.00 128.90 ? 11  SER D CB    1 
ATOM   7640  O OG    . SER D  1 11  ? 100.569 55.918  121.770 1.00 134.57 ? 11  SER D OG    1 
ATOM   7641  N N     . GLU D  1 12  ? 102.914 59.333  122.678 1.00 7.46   ? 12  GLU D N     1 
ATOM   7642  C CA    . GLU D  1 12  ? 103.457 60.577  123.235 1.00 6.95   ? 12  GLU D CA    1 
ATOM   7643  C C     . GLU D  1 12  ? 104.197 61.403  122.182 1.00 3.65   ? 12  GLU D C     1 
ATOM   7644  O O     . GLU D  1 12  ? 103.976 62.575  122.078 1.00 1.00   ? 12  GLU D O     1 
ATOM   7645  C CB    . GLU D  1 12  ? 104.427 60.236  124.359 1.00 69.19  ? 12  GLU D CB    1 
ATOM   7646  C CG    . GLU D  1 12  ? 105.040 61.416  125.063 1.00 74.66  ? 12  GLU D CG    1 
ATOM   7647  C CD    . GLU D  1 12  ? 104.022 62.177  125.851 1.00 79.67  ? 12  GLU D CD    1 
ATOM   7648  O OE1   . GLU D  1 12  ? 103.061 61.537  126.324 1.00 82.70  ? 12  GLU D OE1   1 
ATOM   7649  O OE2   . GLU D  1 12  ? 104.177 63.406  126.006 1.00 83.12  ? 12  GLU D OE2   1 
ATOM   7650  N N     . LEU D  1 13  ? 105.087 60.786  121.412 1.00 14.42  ? 13  LEU D N     1 
ATOM   7651  C CA    . LEU D  1 13  ? 105.829 61.488  120.355 1.00 13.48  ? 13  LEU D CA    1 
ATOM   7652  C C     . LEU D  1 13  ? 104.906 62.010  119.260 1.00 13.62  ? 13  LEU D C     1 
ATOM   7653  O O     . LEU D  1 13  ? 105.141 63.063  118.702 1.00 13.41  ? 13  LEU D O     1 
ATOM   7654  C CB    . LEU D  1 13  ? 106.822 60.560  119.677 1.00 9.43   ? 13  LEU D CB    1 
ATOM   7655  C CG    . LEU D  1 13  ? 107.937 59.953  120.486 1.00 6.38   ? 13  LEU D CG    1 
ATOM   7656  C CD1   . LEU D  1 13  ? 108.659 59.037  119.537 1.00 6.24   ? 13  LEU D CD1   1 
ATOM   7657  C CD2   . LEU D  1 13  ? 108.857 60.996  121.076 1.00 2.16   ? 13  LEU D CD2   1 
ATOM   7658  N N     . ASP D  1 14  ? 103.884 61.237  118.921 1.00 13.08  ? 14  ASP D N     1 
ATOM   7659  C CA    . ASP D  1 14  ? 102.942 61.651  117.896 1.00 15.16  ? 14  ASP D CA    1 
ATOM   7660  C C     . ASP D  1 14  ? 102.289 62.964  118.317 1.00 14.81  ? 14  ASP D C     1 
ATOM   7661  O O     . ASP D  1 14  ? 101.667 63.655  117.502 1.00 13.85  ? 14  ASP D O     1 
ATOM   7662  C CB    . ASP D  1 14  ? 101.830 60.603  117.690 1.00 51.55  ? 14  ASP D CB    1 
ATOM   7663  C CG    . ASP D  1 14  ? 102.287 59.376  116.921 1.00 53.56  ? 14  ASP D CG    1 
ATOM   7664  O OD1   . ASP D  1 14  ? 102.981 59.493  115.884 1.00 55.75  ? 14  ASP D OD1   1 
ATOM   7665  O OD2   . ASP D  1 14  ? 101.909 58.279  117.355 1.00 54.80  ? 14  ASP D OD2   1 
ATOM   7666  N N     . GLN D  1 15  ? 102.397 63.280  119.603 1.00 28.87  ? 15  GLN D N     1 
ATOM   7667  C CA    . GLN D  1 15  ? 101.820 64.499  120.123 1.00 30.07  ? 15  GLN D CA    1 
ATOM   7668  C C     . GLN D  1 15  ? 102.611 65.722  119.712 1.00 28.90  ? 15  GLN D C     1 
ATOM   7669  O O     . GLN D  1 15  ? 102.071 66.808  119.723 1.00 29.02  ? 15  GLN D O     1 
ATOM   7670  C CB    . GLN D  1 15  ? 101.731 64.441  121.627 1.00 42.64  ? 15  GLN D CB    1 
ATOM   7671  C CG    . GLN D  1 15  ? 100.433 63.916  122.106 1.00 49.49  ? 15  GLN D CG    1 
ATOM   7672  C CD    . GLN D  1 15  ? 100.446 63.721  123.596 1.00 54.48  ? 15  GLN D CD    1 
ATOM   7673  O OE1   . GLN D  1 15  ? 101.047 64.513  124.331 1.00 55.61  ? 15  GLN D OE1   1 
ATOM   7674  N NE2   . GLN D  1 15  ? 99.779  62.667  124.065 1.00 57.69  ? 15  GLN D NE2   1 
ATOM   7675  N N     . HIS D  1 16  ? 103.881 65.565  119.345 1.00 27.56  ? 16  HIS D N     1 
ATOM   7676  C CA    . HIS D  1 16  ? 104.666 66.708  118.920 1.00 24.25  ? 16  HIS D CA    1 
ATOM   7677  C C     . HIS D  1 16  ? 105.289 66.620  117.549 1.00 21.19  ? 16  HIS D C     1 
ATOM   7678  O O     . HIS D  1 16  ? 105.683 67.632  117.012 1.00 22.62  ? 16  HIS D O     1 
ATOM   7679  C CB    . HIS D  1 16  ? 105.785 66.976  119.873 1.00 35.85  ? 16  HIS D CB    1 
ATOM   7680  C CG    . HIS D  1 16  ? 105.355 67.111  121.281 1.00 40.59  ? 16  HIS D CG    1 
ATOM   7681  N ND1   . HIS D  1 16  ? 105.034 66.023  122.056 1.00 43.50  ? 16  HIS D ND1   1 
ATOM   7682  C CD2   . HIS D  1 16  ? 105.268 68.192  122.084 1.00 42.56  ? 16  HIS D CD2   1 
ATOM   7683  C CE1   . HIS D  1 16  ? 104.777 66.425  123.286 1.00 44.93  ? 16  HIS D CE1   1 
ATOM   7684  N NE2   . HIS D  1 16  ? 104.913 67.738  123.330 1.00 46.68  ? 16  HIS D NE2   1 
ATOM   7685  N N     . ILE D  1 17  ? 105.437 65.435  116.984 1.00 1.00   ? 17  ILE D N     1 
ATOM   7686  C CA    . ILE D  1 17  ? 106.032 65.338  115.661 1.00 1.00   ? 17  ILE D CA    1 
ATOM   7687  C C     . ILE D  1 17  ? 105.007 64.819  114.737 1.00 1.00   ? 17  ILE D C     1 
ATOM   7688  O O     . ILE D  1 17  ? 104.223 63.977  115.117 1.00 1.00   ? 17  ILE D O     1 
ATOM   7689  C CB    . ILE D  1 17  ? 107.132 64.351  115.596 1.00 4.21   ? 17  ILE D CB    1 
ATOM   7690  C CG1   . ILE D  1 17  ? 108.239 64.789  116.505 1.00 4.52   ? 17  ILE D CG1   1 
ATOM   7691  C CG2   . ILE D  1 17  ? 107.626 64.243  114.203 1.00 4.21   ? 17  ILE D CG2   1 
ATOM   7692  C CD1   . ILE D  1 17  ? 107.865 64.780  117.952 1.00 8.04   ? 17  ILE D CD1   1 
ATOM   7693  N N     . ILE D  1 18  ? 105.019 65.296  113.510 1.00 8.87   ? 18  ILE D N     1 
ATOM   7694  C CA    . ILE D  1 18  ? 104.066 64.807  112.536 1.00 10.19  ? 18  ILE D CA    1 
ATOM   7695  C C     . ILE D  1 18  ? 104.733 63.842  111.609 1.00 11.27  ? 18  ILE D C     1 
ATOM   7696  O O     . ILE D  1 18  ? 105.755 64.156  111.038 1.00 12.87  ? 18  ILE D O     1 
ATOM   7697  C CB    . ILE D  1 18  ? 103.518 65.914  111.691 1.00 2.93   ? 18  ILE D CB    1 
ATOM   7698  C CG1   . ILE D  1 18  ? 102.688 66.830  112.568 1.00 2.82   ? 18  ILE D CG1   1 
ATOM   7699  C CG2   . ILE D  1 18  ? 102.718 65.340  110.561 1.00 1.36   ? 18  ILE D CG2   1 
ATOM   7700  C CD1   . ILE D  1 18  ? 101.514 66.114  113.239 1.00 5.19   ? 18  ILE D CD1   1 
ATOM   7701  N N     . GLY D  1 19  ? 104.173 62.657  111.456 1.00 14.99  ? 19  GLY D N     1 
ATOM   7702  C CA    . GLY D  1 19  ? 104.789 61.717  110.541 1.00 17.00  ? 19  GLY D CA    1 
ATOM   7703  C C     . GLY D  1 19  ? 106.086 61.167  111.077 1.00 18.34  ? 19  GLY D C     1 
ATOM   7704  O O     . GLY D  1 19  ? 106.226 61.024  112.289 1.00 18.34  ? 19  GLY D O     1 
ATOM   7705  N N     . GLN D  1 20  ? 107.039 60.873  110.196 1.00 24.47  ? 20  GLN D N     1 
ATOM   7706  C CA    . GLN D  1 20  ? 108.313 60.310  110.648 1.00 26.94  ? 20  GLN D CA    1 
ATOM   7707  C C     . GLN D  1 20  ? 107.986 59.202  111.649 1.00 29.03  ? 20  GLN D C     1 
ATOM   7708  O O     . GLN D  1 20  ? 108.365 59.258  112.821 1.00 28.35  ? 20  GLN D O     1 
ATOM   7709  C CB    . GLN D  1 20  ? 109.196 61.390  111.302 1.00 17.42  ? 20  GLN D CB    1 
ATOM   7710  C CG    . GLN D  1 20  ? 109.398 62.619  110.434 1.00 15.31  ? 20  GLN D CG    1 
ATOM   7711  C CD    . GLN D  1 20  ? 109.728 62.256  109.005 1.00 14.14  ? 20  GLN D CD    1 
ATOM   7712  O OE1   . GLN D  1 20  ? 110.807 62.552  108.509 1.00 14.54  ? 20  GLN D OE1   1 
ATOM   7713  N NE2   . GLN D  1 20  ? 108.786 61.602  108.333 1.00 11.70  ? 20  GLN D NE2   1 
ATOM   7714  N N     . ALA D  1 21  ? 107.272 58.192  111.158 1.00 31.27  ? 21  ALA D N     1 
ATOM   7715  C CA    . ALA D  1 21  ? 106.845 57.071  111.978 1.00 32.73  ? 21  ALA D CA    1 
ATOM   7716  C C     . ALA D  1 21  ? 107.926 56.062  112.327 1.00 33.87  ? 21  ALA D C     1 
ATOM   7717  O O     . ALA D  1 21  ? 108.144 55.768  113.510 1.00 33.82  ? 21  ALA D O     1 
ATOM   7718  C CB    . ALA D  1 21  ? 105.755 56.406  111.305 1.00 7.73   ? 21  ALA D CB    1 
ATOM   7719  N N     . ASP D  1 22  ? 108.585 55.531  111.296 1.00 37.36  ? 22  ASP D N     1 
ATOM   7720  C CA    . ASP D  1 22  ? 109.657 54.562  111.488 1.00 37.18  ? 22  ASP D CA    1 
ATOM   7721  C C     . ASP D  1 22  ? 110.603 55.091  112.550 1.00 34.10  ? 22  ASP D C     1 
ATOM   7722  O O     . ASP D  1 22  ? 111.015 54.357  113.471 1.00 32.84  ? 22  ASP D O     1 
ATOM   7723  C CB    . ASP D  1 22  ? 110.427 54.354  110.188 1.00 60.53  ? 22  ASP D CB    1 
ATOM   7724  C CG    . ASP D  1 22  ? 109.523 54.054  109.027 1.00 63.36  ? 22  ASP D CG    1 
ATOM   7725  O OD1   . ASP D  1 22  ? 108.647 53.177  109.168 1.00 63.92  ? 22  ASP D OD1   1 
ATOM   7726  O OD2   . ASP D  1 22  ? 109.692 54.694  107.973 1.00 65.16  ? 22  ASP D OD2   1 
ATOM   7727  N N     . ALA D  1 23  ? 110.928 56.375  112.406 1.00 17.01  ? 23  ALA D N     1 
ATOM   7728  C CA    . ALA D  1 23  ? 111.816 57.064  113.327 1.00 15.08  ? 23  ALA D CA    1 
ATOM   7729  C C     . ALA D  1 23  ? 111.326 56.976  114.784 1.00 12.74  ? 23  ALA D C     1 
ATOM   7730  O O     . ALA D  1 23  ? 112.095 56.648  115.719 1.00 10.56  ? 23  ALA D O     1 
ATOM   7731  C CB    . ALA D  1 23  ? 111.945 58.494  112.899 1.00 37.59  ? 23  ALA D CB    1 
ATOM   7732  N N     . LYS D  1 24  ? 110.043 57.267  114.966 1.00 16.05  ? 24  LYS D N     1 
ATOM   7733  C CA    . LYS D  1 24  ? 109.456 57.210  116.285 1.00 15.55  ? 24  LYS D CA    1 
ATOM   7734  C C     . LYS D  1 24  ? 109.590 55.804  116.846 1.00 16.97  ? 24  LYS D C     1 
ATOM   7735  O O     . LYS D  1 24  ? 110.051 55.610  117.974 1.00 18.65  ? 24  LYS D O     1 
ATOM   7736  C CB    . LYS D  1 24  ? 108.001 57.607  116.222 1.00 4.45   ? 24  LYS D CB    1 
ATOM   7737  C CG    . LYS D  1 24  ? 107.768 59.092  116.247 1.00 4.45   ? 24  LYS D CG    1 
ATOM   7738  C CD    . LYS D  1 24  ? 106.472 59.423  115.480 1.00 4.45   ? 24  LYS D CD    1 
ATOM   7739  C CE    . LYS D  1 24  ? 106.023 60.880  115.614 1.00 4.45   ? 24  LYS D CE    1 
ATOM   7740  N NZ    . LYS D  1 24  ? 105.012 61.232  114.564 1.00 4.45   ? 24  LYS D NZ    1 
ATOM   7741  N N     . ARG D  1 25  ? 109.207 54.813  116.055 1.00 3.18   ? 25  ARG D N     1 
ATOM   7742  C CA    . ARG D  1 25  ? 109.301 53.431  116.508 1.00 2.90   ? 25  ARG D CA    1 
ATOM   7743  C C     . ARG D  1 25  ? 110.740 53.139  116.943 1.00 1.48   ? 25  ARG D C     1 
ATOM   7744  O O     . ARG D  1 25  ? 111.023 52.676  118.062 1.00 1.00   ? 25  ARG D O     1 
ATOM   7745  C CB    . ARG D  1 25  ? 108.890 52.511  115.371 1.00 24.87  ? 25  ARG D CB    1 
ATOM   7746  C CG    . ARG D  1 25  ? 107.695 51.613  115.679 1.00 28.61  ? 25  ARG D CG    1 
ATOM   7747  C CD    . ARG D  1 25  ? 106.939 51.273  114.374 1.00 35.05  ? 25  ARG D CD    1 
ATOM   7748  N NE    . ARG D  1 25  ? 106.175 50.023  114.389 1.00 40.20  ? 25  ARG D NE    1 
ATOM   7749  C CZ    . ARG D  1 25  ? 106.720 48.800  114.357 1.00 44.20  ? 25  ARG D CZ    1 
ATOM   7750  N NH1   . ARG D  1 25  ? 108.055 48.606  114.308 1.00 44.57  ? 25  ARG D NH1   1 
ATOM   7751  N NH2   . ARG D  1 25  ? 105.915 47.751  114.377 1.00 44.95  ? 25  ARG D NH2   1 
ATOM   7752  N N     . ALA D  1 26  ? 111.658 53.435  116.045 1.00 13.36  ? 26  ALA D N     1 
ATOM   7753  C CA    . ALA D  1 26  ? 113.040 53.188  116.330 1.00 13.53  ? 26  ALA D CA    1 
ATOM   7754  C C     . ALA D  1 26  ? 113.439 53.651  117.728 1.00 11.74  ? 26  ALA D C     1 
ATOM   7755  O O     . ALA D  1 26  ? 113.960 52.862  118.526 1.00 11.19  ? 26  ALA D O     1 
ATOM   7756  C CB    . ALA D  1 26  ? 113.890 53.849  115.282 1.00 31.62  ? 26  ALA D CB    1 
ATOM   7757  N N     . VAL D  1 27  ? 113.202 54.916  118.041 1.00 9.66   ? 27  VAL D N     1 
ATOM   7758  C CA    . VAL D  1 27  ? 113.604 55.375  119.371 1.00 9.85   ? 27  VAL D CA    1 
ATOM   7759  C C     . VAL D  1 27  ? 112.748 54.741  120.471 1.00 9.43   ? 27  VAL D C     1 
ATOM   7760  O O     . VAL D  1 27  ? 113.135 54.689  121.655 1.00 6.70   ? 27  VAL D O     1 
ATOM   7761  C CB    . VAL D  1 27  ? 113.558 56.935  119.503 1.00 15.58  ? 27  VAL D CB    1 
ATOM   7762  C CG1   . VAL D  1 27  ? 114.624 57.584  118.623 1.00 15.92  ? 27  VAL D CG1   1 
ATOM   7763  C CG2   . VAL D  1 27  ? 112.203 57.435  119.138 1.00 15.17  ? 27  VAL D CG2   1 
ATOM   7764  N N     . ALA D  1 28  ? 111.590 54.244  120.056 1.00 12.76  ? 28  ALA D N     1 
ATOM   7765  C CA    . ALA D  1 28  ? 110.667 53.618  120.979 1.00 12.48  ? 28  ALA D CA    1 
ATOM   7766  C C     . ALA D  1 28  ? 111.238 52.309  121.429 1.00 12.51  ? 28  ALA D C     1 
ATOM   7767  O O     . ALA D  1 28  ? 111.516 52.109  122.610 1.00 14.09  ? 28  ALA D O     1 
ATOM   7768  C CB    . ALA D  1 28  ? 109.338 53.381  120.312 1.00 2.55   ? 28  ALA D CB    1 
ATOM   7769  N N     . ILE D  1 29  ? 111.408 51.404  120.474 1.00 1.74   ? 29  ILE D N     1 
ATOM   7770  C CA    . ILE D  1 29  ? 111.948 50.089  120.787 1.00 1.74   ? 29  ILE D CA    1 
ATOM   7771  C C     . ILE D  1 29  ? 113.183 50.325  121.619 1.00 1.74   ? 29  ILE D C     1 
ATOM   7772  O O     . ILE D  1 29  ? 113.432 49.657  122.609 1.00 1.74   ? 29  ILE D O     1 
ATOM   7773  C CB    . ILE D  1 29  ? 112.324 49.305  119.500 1.00 30.22  ? 29  ILE D CB    1 
ATOM   7774  C CG1   . ILE D  1 29  ? 113.329 50.079  118.689 1.00 33.78  ? 29  ILE D CG1   1 
ATOM   7775  C CG2   . ILE D  1 29  ? 111.137 49.162  118.574 1.00 29.48  ? 29  ILE D CG2   1 
ATOM   7776  C CD1   . ILE D  1 29  ? 113.635 49.391  117.408 1.00 39.29  ? 29  ILE D CD1   1 
ATOM   7777  N N     . ALA D  1 30  ? 113.915 51.346  121.210 1.00 7.51   ? 30  ALA D N     1 
ATOM   7778  C CA    . ALA D  1 30  ? 115.136 51.727  121.853 1.00 9.06   ? 30  ALA D CA    1 
ATOM   7779  C C     . ALA D  1 30  ? 114.918 52.089  123.305 1.00 9.74   ? 30  ALA D C     1 
ATOM   7780  O O     . ALA D  1 30  ? 115.385 51.410  124.210 1.00 10.37  ? 30  ALA D O     1 
ATOM   7781  C CB    . ALA D  1 30  ? 115.746 52.884  121.105 1.00 37.52  ? 30  ALA D CB    1 
ATOM   7782  N N     . LEU D  1 31  ? 114.215 53.171  123.552 1.00 18.19  ? 31  LEU D N     1 
ATOM   7783  C CA    . LEU D  1 31  ? 114.017 53.531  124.933 1.00 19.32  ? 31  LEU D CA    1 
ATOM   7784  C C     . LEU D  1 31  ? 113.426 52.361  125.736 1.00 20.94  ? 31  LEU D C     1 
ATOM   7785  O O     . LEU D  1 31  ? 113.677 52.242  126.936 1.00 21.53  ? 31  LEU D O     1 
ATOM   7786  C CB    . LEU D  1 31  ? 113.127 54.757  125.013 1.00 7.09   ? 31  LEU D CB    1 
ATOM   7787  C CG    . LEU D  1 31  ? 112.699 55.025  126.443 1.00 7.37   ? 31  LEU D CG    1 
ATOM   7788  C CD1   . LEU D  1 31  ? 113.905 55.290  127.329 1.00 6.86   ? 31  LEU D CD1   1 
ATOM   7789  C CD2   . LEU D  1 31  ? 111.725 56.195  126.427 1.00 8.56   ? 31  LEU D CD2   1 
ATOM   7790  N N     . ARG D  1 32  ? 112.668 51.486  125.071 1.00 10.63  ? 32  ARG D N     1 
ATOM   7791  C CA    . ARG D  1 32  ? 112.052 50.357  125.769 1.00 12.48  ? 32  ARG D CA    1 
ATOM   7792  C C     . ARG D  1 32  ? 113.078 49.306  126.204 1.00 12.41  ? 32  ARG D C     1 
ATOM   7793  O O     . ARG D  1 32  ? 112.983 48.743  127.314 1.00 12.14  ? 32  ARG D O     1 
ATOM   7794  C CB    . ARG D  1 32  ? 110.955 49.697  124.907 1.00 37.99  ? 32  ARG D CB    1 
ATOM   7795  C CG    . ARG D  1 32  ? 110.153 48.549  125.594 1.00 39.33  ? 32  ARG D CG    1 
ATOM   7796  C CD    . ARG D  1 32  ? 109.433 48.995  126.861 1.00 41.80  ? 32  ARG D CD    1 
ATOM   7797  N NE    . ARG D  1 32  ? 108.395 48.057  127.294 1.00 44.02  ? 32  ARG D NE    1 
ATOM   7798  C CZ    . ARG D  1 32  ? 107.888 48.015  128.527 1.00 44.99  ? 32  ARG D CZ    1 
ATOM   7799  N NH1   . ARG D  1 32  ? 108.323 48.854  129.449 1.00 46.57  ? 32  ARG D NH1   1 
ATOM   7800  N NH2   . ARG D  1 32  ? 106.961 47.128  128.854 1.00 43.22  ? 32  ARG D NH2   1 
ATOM   7801  N N     . ASN D  1 33  ? 114.058 49.043  125.341 1.00 4.43   ? 33  ASN D N     1 
ATOM   7802  C CA    . ASN D  1 33  ? 115.078 48.056  125.674 1.00 6.42   ? 33  ASN D CA    1 
ATOM   7803  C C     . ASN D  1 33  ? 115.720 48.432  126.981 1.00 6.98   ? 33  ASN D C     1 
ATOM   7804  O O     . ASN D  1 33  ? 116.208 47.580  127.716 1.00 5.90   ? 33  ASN D O     1 
ATOM   7805  C CB    . ASN D  1 33  ? 116.133 47.931  124.575 1.00 45.66  ? 33  ASN D CB    1 
ATOM   7806  C CG    . ASN D  1 33  ? 115.688 47.000  123.458 1.00 50.12  ? 33  ASN D CG    1 
ATOM   7807  O OD1   . ASN D  1 33  ? 115.076 45.950  123.702 1.00 54.64  ? 33  ASN D OD1   1 
ATOM   7808  N ND2   . ASN D  1 33  ? 115.995 47.370  122.227 1.00 52.07  ? 33  ASN D ND2   1 
ATOM   7809  N N     . ARG D  1 34  ? 115.673 49.715  127.297 1.00 27.62  ? 34  ARG D N     1 
ATOM   7810  C CA    . ARG D  1 34  ? 116.288 50.172  128.515 1.00 31.09  ? 34  ARG D CA    1 
ATOM   7811  C C     . ARG D  1 34  ? 115.601 49.566  129.726 1.00 32.07  ? 34  ARG D C     1 
ATOM   7812  O O     . ARG D  1 34  ? 116.258 49.184  130.708 1.00 31.33  ? 34  ARG D O     1 
ATOM   7813  C CB    . ARG D  1 34  ? 116.235 51.697  128.585 1.00 73.72  ? 34  ARG D CB    1 
ATOM   7814  C CG    . ARG D  1 34  ? 117.277 52.289  129.546 1.00 78.06  ? 34  ARG D CG    1 
ATOM   7815  C CD    . ARG D  1 34  ? 118.504 52.858  128.827 1.00 77.43  ? 34  ARG D CD    1 
ATOM   7816  N NE    . ARG D  1 34  ? 118.346 54.286  128.586 1.00 77.10  ? 34  ARG D NE    1 
ATOM   7817  C CZ    . ARG D  1 34  ? 119.291 55.068  128.086 1.00 77.24  ? 34  ARG D CZ    1 
ATOM   7818  N NH1   . ARG D  1 34  ? 120.468 54.562  127.772 1.00 77.11  ? 34  ARG D NH1   1 
ATOM   7819  N NH2   . ARG D  1 34  ? 119.058 56.357  127.903 1.00 78.21  ? 34  ARG D NH2   1 
ATOM   7820  N N     . TRP D  1 35  ? 114.273 49.491  129.650 1.00 36.68  ? 35  TRP D N     1 
ATOM   7821  C CA    . TRP D  1 35  ? 113.471 48.942  130.732 1.00 36.79  ? 35  TRP D CA    1 
ATOM   7822  C C     . TRP D  1 35  ? 113.637 47.442  130.732 1.00 35.33  ? 35  TRP D C     1 
ATOM   7823  O O     . TRP D  1 35  ? 113.615 46.827  131.785 1.00 34.83  ? 35  TRP D O     1 
ATOM   7824  C CB    . TRP D  1 35  ? 111.986 49.315  130.556 1.00 51.55  ? 35  TRP D CB    1 
ATOM   7825  C CG    . TRP D  1 35  ? 111.058 48.545  131.466 1.00 53.15  ? 35  TRP D CG    1 
ATOM   7826  C CD1   . TRP D  1 35  ? 110.841 48.752  132.796 1.00 53.37  ? 35  TRP D CD1   1 
ATOM   7827  C CD2   . TRP D  1 35  ? 110.324 47.376  131.122 1.00 52.97  ? 35  TRP D CD2   1 
ATOM   7828  N NE1   . TRP D  1 35  ? 110.029 47.776  133.296 1.00 53.07  ? 35  TRP D NE1   1 
ATOM   7829  C CE2   . TRP D  1 35  ? 109.699 46.917  132.285 1.00 52.51  ? 35  TRP D CE2   1 
ATOM   7830  C CE3   . TRP D  1 35  ? 110.143 46.666  129.937 1.00 54.11  ? 35  TRP D CE3   1 
ATOM   7831  C CZ2   . TRP D  1 35  ? 108.904 45.780  132.300 1.00 53.63  ? 35  TRP D CZ2   1 
ATOM   7832  C CZ3   . TRP D  1 35  ? 109.352 45.536  129.952 1.00 54.05  ? 35  TRP D CZ3   1 
ATOM   7833  C CH2   . TRP D  1 35  ? 108.744 45.104  131.125 1.00 54.55  ? 35  TRP D CH2   1 
ATOM   7834  N N     . ARG D  1 36  ? 113.807 46.851  129.555 1.00 29.13  ? 36  ARG D N     1 
ATOM   7835  C CA    . ARG D  1 36  ? 113.976 45.408  129.488 1.00 30.99  ? 36  ARG D CA    1 
ATOM   7836  C C     . ARG D  1 36  ? 115.233 44.988  130.227 1.00 34.21  ? 36  ARG D C     1 
ATOM   7837  O O     . ARG D  1 36  ? 115.160 44.240  131.199 1.00 37.08  ? 36  ARG D O     1 
ATOM   7838  C CB    . ARG D  1 36  ? 114.014 44.934  128.049 1.00 12.13  ? 36  ARG D CB    1 
ATOM   7839  C CG    . ARG D  1 36  ? 112.670 45.043  127.406 1.00 7.16   ? 36  ARG D CG    1 
ATOM   7840  C CD    . ARG D  1 36  ? 112.788 44.972  125.928 1.00 4.25   ? 36  ARG D CD    1 
ATOM   7841  N NE    . ARG D  1 36  ? 111.510 45.213  125.280 1.00 4.81   ? 36  ARG D NE    1 
ATOM   7842  C CZ    . ARG D  1 36  ? 111.328 45.119  123.965 1.00 4.07   ? 36  ARG D CZ    1 
ATOM   7843  N NH1   . ARG D  1 36  ? 112.349 44.807  123.173 1.00 1.71   ? 36  ARG D NH1   1 
ATOM   7844  N NH2   . ARG D  1 36  ? 110.108 45.272  123.443 1.00 5.11   ? 36  ARG D NH2   1 
ATOM   7845  N N     . ARG D  1 37  ? 116.397 45.435  129.780 1.00 19.25  ? 37  ARG D N     1 
ATOM   7846  C CA    . ARG D  1 37  ? 117.605 45.109  130.521 1.00 21.74  ? 37  ARG D CA    1 
ATOM   7847  C C     . ARG D  1 37  ? 117.351 45.881  131.800 1.00 24.79  ? 37  ARG D C     1 
ATOM   7848  O O     . ARG D  1 37  ? 116.400 46.644  131.869 1.00 26.25  ? 37  ARG D O     1 
ATOM   7849  C CB    . ARG D  1 37  ? 118.813 45.674  129.795 1.00 41.79  ? 37  ARG D CB    1 
ATOM   7850  C CG    . ARG D  1 37  ? 119.892 46.189  130.719 1.00 42.08  ? 37  ARG D CG    1 
ATOM   7851  C CD    . ARG D  1 37  ? 121.017 46.931  130.000 1.00 41.04  ? 37  ARG D CD    1 
ATOM   7852  N NE    . ARG D  1 37  ? 121.915 47.514  130.989 1.00 40.05  ? 37  ARG D NE    1 
ATOM   7853  C CZ    . ARG D  1 37  ? 121.722 48.695  131.565 1.00 40.20  ? 37  ARG D CZ    1 
ATOM   7854  N NH1   . ARG D  1 37  ? 120.665 49.423  131.228 1.00 40.64  ? 37  ARG D NH1   1 
ATOM   7855  N NH2   . ARG D  1 37  ? 122.559 49.129  132.506 1.00 39.97  ? 37  ARG D NH2   1 
ATOM   7856  N N     . MET D  1 38  ? 118.163 45.723  132.823 1.00 53.44  ? 38  MET D N     1 
ATOM   7857  C CA    . MET D  1 38  ? 117.907 46.499  134.045 1.00 58.86  ? 38  MET D CA    1 
ATOM   7858  C C     . MET D  1 38  ? 116.608 45.981  134.607 1.00 59.58  ? 38  MET D C     1 
ATOM   7859  O O     . MET D  1 38  ? 115.886 46.673  135.315 1.00 59.35  ? 38  MET D O     1 
ATOM   7860  C CB    . MET D  1 38  ? 117.764 47.992  133.727 1.00 116.11 ? 38  MET D CB    1 
ATOM   7861  C CG    . MET D  1 38  ? 117.997 48.909  134.907 1.00 121.51 ? 38  MET D CG    1 
ATOM   7862  S SD    . MET D  1 38  ? 117.655 50.628  134.480 1.00 129.50 ? 38  MET D SD    1 
ATOM   7863  C CE    . MET D  1 38  ? 118.247 50.730  132.806 1.00 126.81 ? 38  MET D CE    1 
ATOM   7864  N N     . GLN D  1 39  ? 116.344 44.737  134.242 1.00 60.68  ? 39  GLN D N     1 
ATOM   7865  C CA    . GLN D  1 39  ? 115.171 43.991  134.637 1.00 62.32  ? 39  GLN D CA    1 
ATOM   7866  C C     . GLN D  1 39  ? 115.691 42.557  134.507 1.00 63.24  ? 39  GLN D C     1 
ATOM   7867  O O     . GLN D  1 39  ? 115.026 41.591  134.867 1.00 64.55  ? 39  GLN D O     1 
ATOM   7868  C CB    . GLN D  1 39  ? 114.037 44.237  133.638 1.00 62.41  ? 39  GLN D CB    1 
ATOM   7869  C CG    . GLN D  1 39  ? 112.677 43.758  134.062 1.00 65.01  ? 39  GLN D CG    1 
ATOM   7870  C CD    . GLN D  1 39  ? 111.841 44.852  134.670 1.00 67.52  ? 39  GLN D CD    1 
ATOM   7871  O OE1   . GLN D  1 39  ? 110.751 44.596  135.167 1.00 69.31  ? 39  GLN D OE1   1 
ATOM   7872  N NE2   . GLN D  1 39  ? 112.341 46.083  134.633 1.00 68.50  ? 39  GLN D NE2   1 
ATOM   7873  N N     . LEU D  1 40  ? 116.899 42.434  133.968 1.00 29.29  ? 40  LEU D N     1 
ATOM   7874  C CA    . LEU D  1 40  ? 117.535 41.143  133.796 1.00 29.14  ? 40  LEU D CA    1 
ATOM   7875  C C     . LEU D  1 40  ? 118.421 40.958  135.017 1.00 31.42  ? 40  LEU D C     1 
ATOM   7876  O O     . LEU D  1 40  ? 118.633 41.915  135.759 1.00 31.41  ? 40  LEU D O     1 
ATOM   7877  C CB    . LEU D  1 40  ? 118.378 41.166  132.525 1.00 24.67  ? 40  LEU D CB    1 
ATOM   7878  C CG    . LEU D  1 40  ? 117.663 41.558  131.222 1.00 22.32  ? 40  LEU D CG    1 
ATOM   7879  C CD1   . LEU D  1 40  ? 118.640 42.146  130.301 1.00 20.89  ? 40  LEU D CD1   1 
ATOM   7880  C CD2   . LEU D  1 40  ? 117.029 40.366  130.542 1.00 23.90  ? 40  LEU D CD2   1 
ATOM   7881  N N     . GLN D  1 41  ? 118.945 39.750  135.231 1.00 40.65  ? 41  GLN D N     1 
ATOM   7882  C CA    . GLN D  1 41  ? 119.812 39.490  136.394 1.00 44.68  ? 41  GLN D CA    1 
ATOM   7883  C C     . GLN D  1 41  ? 121.292 39.846  136.171 1.00 45.11  ? 41  GLN D C     1 
ATOM   7884  O O     . GLN D  1 41  ? 121.862 39.545  135.124 1.00 44.44  ? 41  GLN D O     1 
ATOM   7885  C CB    . GLN D  1 41  ? 119.698 38.025  136.828 1.00 140.50 ? 41  GLN D CB    1 
ATOM   7886  C CG    . GLN D  1 41  ? 118.482 37.718  137.695 1.00 144.30 ? 41  GLN D CG    1 
ATOM   7887  C CD    . GLN D  1 41  ? 118.461 38.506  138.998 1.00 146.50 ? 41  GLN D CD    1 
ATOM   7888  O OE1   . GLN D  1 41  ? 117.566 38.332  139.824 1.00 148.14 ? 41  GLN D OE1   1 
ATOM   7889  N NE2   . GLN D  1 41  ? 119.447 39.378  139.186 1.00 146.92 ? 41  GLN D NE2   1 
ATOM   7890  N N     . GLU D  1 42  ? 121.905 40.442  137.191 1.00 113.21 ? 42  GLU D N     1 
ATOM   7891  C CA    . GLU D  1 42  ? 123.288 40.921  137.146 1.00 115.35 ? 42  GLU D CA    1 
ATOM   7892  C C     . GLU D  1 42  ? 124.224 40.524  136.000 1.00 114.65 ? 42  GLU D C     1 
ATOM   7893  O O     . GLU D  1 42  ? 124.840 41.398  135.387 1.00 115.12 ? 42  GLU D O     1 
ATOM   7894  C CB    . GLU D  1 42  ? 123.991 40.672  138.481 1.00 139.72 ? 42  GLU D CB    1 
ATOM   7895  C CG    . GLU D  1 42  ? 125.205 41.585  138.649 1.00 143.81 ? 42  GLU D CG    1 
ATOM   7896  C CD    . GLU D  1 42  ? 124.907 43.031  138.246 1.00 145.84 ? 42  GLU D CD    1 
ATOM   7897  O OE1   . GLU D  1 42  ? 124.181 43.723  138.990 1.00 146.72 ? 42  GLU D OE1   1 
ATOM   7898  O OE2   . GLU D  1 42  ? 125.387 43.472  137.176 1.00 146.74 ? 42  GLU D OE2   1 
ATOM   7899  N N     . PRO D  1 43  ? 124.369 39.223  135.705 1.00 61.05  ? 43  PRO D N     1 
ATOM   7900  C CA    . PRO D  1 43  ? 125.265 38.842  134.602 1.00 58.95  ? 43  PRO D CA    1 
ATOM   7901  C C     . PRO D  1 43  ? 124.941 39.596  133.305 1.00 56.63  ? 43  PRO D C     1 
ATOM   7902  O O     . PRO D  1 43  ? 125.772 40.307  132.751 1.00 56.76  ? 43  PRO D O     1 
ATOM   7903  C CB    . PRO D  1 43  ? 125.019 37.351  134.474 1.00 107.45 ? 43  PRO D CB    1 
ATOM   7904  C CG    . PRO D  1 43  ? 124.785 36.958  135.899 1.00 108.94 ? 43  PRO D CG    1 
ATOM   7905  C CD    . PRO D  1 43  ? 123.862 38.033  136.407 1.00 107.65 ? 43  PRO D CD    1 
ATOM   7906  N N     . LEU D  1 44  ? 123.718 39.436  132.828 1.00 21.30  ? 44  LEU D N     1 
ATOM   7907  C CA    . LEU D  1 44  ? 123.275 40.102  131.624 1.00 18.48  ? 44  LEU D CA    1 
ATOM   7908  C C     . LEU D  1 44  ? 122.913 41.576  131.818 1.00 18.95  ? 44  LEU D C     1 
ATOM   7909  O O     . LEU D  1 44  ? 123.104 42.383  130.910 1.00 17.86  ? 44  LEU D O     1 
ATOM   7910  C CB    . LEU D  1 44  ? 122.052 39.388  131.094 1.00 27.13  ? 44  LEU D CB    1 
ATOM   7911  C CG    . LEU D  1 44  ? 122.260 38.023  130.477 1.00 24.96  ? 44  LEU D CG    1 
ATOM   7912  C CD1   . LEU D  1 44  ? 120.934 37.526  129.874 1.00 24.48  ? 44  LEU D CD1   1 
ATOM   7913  C CD2   . LEU D  1 44  ? 123.317 38.143  129.413 1.00 22.94  ? 44  LEU D CD2   1 
ATOM   7914  N N     . ARG D  1 45  ? 122.360 41.921  132.984 1.00 49.87  ? 45  ARG D N     1 
ATOM   7915  C CA    . ARG D  1 45  ? 121.941 43.298  133.271 1.00 51.80  ? 45  ARG D CA    1 
ATOM   7916  C C     . ARG D  1 45  ? 123.032 44.262  132.855 1.00 52.17  ? 45  ARG D C     1 
ATOM   7917  O O     . ARG D  1 45  ? 122.754 45.410  132.530 1.00 52.56  ? 45  ARG D O     1 
ATOM   7918  C CB    . ARG D  1 45  ? 121.620 43.482  134.764 1.00 116.14 ? 45  ARG D CB    1 
ATOM   7919  C CG    . ARG D  1 45  ? 120.505 44.493  135.050 1.00 118.50 ? 45  ARG D CG    1 
ATOM   7920  C CD    . ARG D  1 45  ? 120.220 44.642  136.545 1.00 121.26 ? 45  ARG D CD    1 
ATOM   7921  N NE    . ARG D  1 45  ? 121.169 45.536  137.210 1.00 125.07 ? 45  ARG D NE    1 
ATOM   7922  C CZ    . ARG D  1 45  ? 121.095 46.868  137.197 1.00 127.89 ? 45  ARG D CZ    1 
ATOM   7923  N NH1   . ARG D  1 45  ? 120.107 47.482  136.555 1.00 128.21 ? 45  ARG D NH1   1 
ATOM   7924  N NH2   . ARG D  1 45  ? 122.018 47.592  137.822 1.00 129.28 ? 45  ARG D NH2   1 
ATOM   7925  N N     . HIS D  1 46  ? 124.275 43.787  132.857 1.00 44.65  ? 46  HIS D N     1 
ATOM   7926  C CA    . HIS D  1 46  ? 125.391 44.622  132.461 1.00 44.47  ? 46  HIS D CA    1 
ATOM   7927  C C     . HIS D  1 46  ? 126.004 44.195  131.131 1.00 41.86  ? 46  HIS D C     1 
ATOM   7928  O O     . HIS D  1 46  ? 126.713 44.961  130.487 1.00 41.82  ? 46  HIS D O     1 
ATOM   7929  C CB    . HIS D  1 46  ? 126.463 44.636  133.545 1.00 137.34 ? 46  HIS D CB    1 
ATOM   7930  C CG    . HIS D  1 46  ? 126.892 46.017  133.924 1.00 144.04 ? 46  HIS D CG    1 
ATOM   7931  N ND1   . HIS D  1 46  ? 126.038 46.919  134.523 1.00 146.16 ? 46  HIS D ND1   1 
ATOM   7932  C CD2   . HIS D  1 46  ? 128.063 46.672  133.739 1.00 146.42 ? 46  HIS D CD2   1 
ATOM   7933  C CE1   . HIS D  1 46  ? 126.664 48.070  134.690 1.00 147.79 ? 46  HIS D CE1   1 
ATOM   7934  N NE2   . HIS D  1 46  ? 127.894 47.947  134.222 1.00 147.83 ? 46  HIS D NE2   1 
ATOM   7935  N N     . GLU D  1 47  ? 125.712 42.983  130.697 1.00 30.56  ? 47  GLU D N     1 
ATOM   7936  C CA    . GLU D  1 47  ? 126.264 42.497  129.440 1.00 29.12  ? 47  GLU D CA    1 
ATOM   7937  C C     . GLU D  1 47  ? 125.580 43.001  128.168 1.00 26.41  ? 47  GLU D C     1 
ATOM   7938  O O     . GLU D  1 47  ? 126.199 43.111  127.105 1.00 25.23  ? 47  GLU D O     1 
ATOM   7939  C CB    . GLU D  1 47  ? 126.240 40.973  129.433 1.00 112.44 ? 47  GLU D CB    1 
ATOM   7940  C CG    . GLU D  1 47  ? 127.353 40.331  130.222 1.00 115.87 ? 47  GLU D CG    1 
ATOM   7941  C CD    . GLU D  1 47  ? 128.668 40.345  129.482 1.00 117.80 ? 47  GLU D CD    1 
ATOM   7942  O OE1   . GLU D  1 47  ? 129.650 39.812  130.037 1.00 119.64 ? 47  GLU D OE1   1 
ATOM   7943  O OE2   . GLU D  1 47  ? 128.716 40.878  128.353 1.00 117.49 ? 47  GLU D OE2   1 
ATOM   7944  N N     . VAL D  1 48  ? 124.294 43.277  128.254 1.00 48.34  ? 48  VAL D N     1 
ATOM   7945  C CA    . VAL D  1 48  ? 123.587 43.728  127.083 1.00 46.78  ? 48  VAL D CA    1 
ATOM   7946  C C     . VAL D  1 48  ? 123.818 45.230  126.915 1.00 46.57  ? 48  VAL D C     1 
ATOM   7947  O O     . VAL D  1 48  ? 123.857 45.969  127.898 1.00 46.96  ? 48  VAL D O     1 
ATOM   7948  C CB    . VAL D  1 48  ? 122.132 43.395  127.239 1.00 35.05  ? 48  VAL D CB    1 
ATOM   7949  C CG1   . VAL D  1 48  ? 121.620 43.988  128.530 1.00 34.46  ? 48  VAL D CG1   1 
ATOM   7950  C CG2   . VAL D  1 48  ? 121.377 43.885  126.051 1.00 35.18  ? 48  VAL D CG2   1 
ATOM   7951  N N     . THR D  1 49  ? 123.985 45.684  125.675 1.00 70.59  ? 49  THR D N     1 
ATOM   7952  C CA    . THR D  1 49  ? 124.264 47.098  125.411 1.00 68.66  ? 49  THR D CA    1 
ATOM   7953  C C     . THR D  1 49  ? 123.289 47.762  124.458 1.00 66.85  ? 49  THR D C     1 
ATOM   7954  O O     . THR D  1 49  ? 122.729 47.090  123.594 1.00 67.80  ? 49  THR D O     1 
ATOM   7955  C CB    . THR D  1 49  ? 125.617 47.244  124.805 1.00 78.02  ? 49  THR D CB    1 
ATOM   7956  O OG1   . THR D  1 49  ? 125.647 46.530  123.562 1.00 79.01  ? 49  THR D OG1   1 
ATOM   7957  C CG2   . THR D  1 49  ? 126.660 46.685  125.745 1.00 80.40  ? 49  THR D CG2   1 
ATOM   7958  N N     . PRO D  1 50  ? 123.117 49.101  124.571 1.00 32.64  ? 50  PRO D N     1 
ATOM   7959  C CA    . PRO D  1 50  ? 122.224 49.949  123.769 1.00 29.76  ? 50  PRO D CA    1 
ATOM   7960  C C     . PRO D  1 50  ? 122.258 49.624  122.280 1.00 26.96  ? 50  PRO D C     1 
ATOM   7961  O O     . PRO D  1 50  ? 123.280 49.188  121.772 1.00 24.98  ? 50  PRO D O     1 
ATOM   7962  C CB    . PRO D  1 50  ? 122.749 51.349  124.058 1.00 79.87  ? 50  PRO D CB    1 
ATOM   7963  C CG    . PRO D  1 50  ? 123.205 51.242  125.450 1.00 81.24  ? 50  PRO D CG    1 
ATOM   7964  C CD    . PRO D  1 50  ? 123.952 49.941  125.448 1.00 80.66  ? 50  PRO D CD    1 
ATOM   7965  N N     . LYS D  1 51  ? 121.162 49.835  121.565 1.00 56.28  ? 51  LYS D N     1 
ATOM   7966  C CA    . LYS D  1 51  ? 121.197 49.536  120.146 1.00 55.94  ? 51  LYS D CA    1 
ATOM   7967  C C     . LYS D  1 51  ? 121.181 50.821  119.336 1.00 54.47  ? 51  LYS D C     1 
ATOM   7968  O O     . LYS D  1 51  ? 120.397 50.965  118.410 1.00 55.21  ? 51  LYS D O     1 
ATOM   7969  C CB    . LYS D  1 51  ? 120.014 48.654  119.771 1.00 89.49  ? 51  LYS D CB    1 
ATOM   7970  C CG    . LYS D  1 51  ? 119.976 47.306  120.511 1.00 93.10  ? 51  LYS D CG    1 
ATOM   7971  C CD    . LYS D  1 51  ? 121.188 46.428  120.187 1.00 96.19  ? 51  LYS D CD    1 
ATOM   7972  C CE    . LYS D  1 51  ? 121.235 45.146  121.034 1.00 97.02  ? 51  LYS D CE    1 
ATOM   7973  N NZ    . LYS D  1 51  ? 122.521 44.394  120.849 1.00 97.47  ? 51  LYS D NZ    1 
ATOM   7974  N N     . ASN D  1 52  ? 122.057 51.751  119.708 1.00 43.32  ? 52  ASN D N     1 
ATOM   7975  C CA    . ASN D  1 52  ? 122.215 53.057  119.075 1.00 37.60  ? 52  ASN D CA    1 
ATOM   7976  C C     . ASN D  1 52  ? 121.543 53.268  117.716 1.00 35.80  ? 52  ASN D C     1 
ATOM   7977  O O     . ASN D  1 52  ? 121.481 52.358  116.891 1.00 36.87  ? 52  ASN D O     1 
ATOM   7978  C CB    . ASN D  1 52  ? 123.707 53.365  118.971 1.00 28.59  ? 52  ASN D CB    1 
ATOM   7979  C CG    . ASN D  1 52  ? 124.376 53.447  120.334 1.00 28.13  ? 52  ASN D CG    1 
ATOM   7980  O OD1   . ASN D  1 52  ? 123.800 53.943  121.283 1.00 26.61  ? 52  ASN D OD1   1 
ATOM   7981  N ND2   . ASN D  1 52  ? 125.589 52.969  120.430 1.00 27.54  ? 52  ASN D ND2   1 
ATOM   7982  N N     . ILE D  1 53  ? 121.073 54.493  117.475 1.00 26.78  ? 53  ILE D N     1 
ATOM   7983  C CA    . ILE D  1 53  ? 120.386 54.832  116.229 1.00 21.25  ? 53  ILE D CA    1 
ATOM   7984  C C     . ILE D  1 53  ? 121.049 55.840  115.322 1.00 19.42  ? 53  ILE D C     1 
ATOM   7985  O O     . ILE D  1 53  ? 121.657 56.793  115.791 1.00 18.67  ? 53  ILE D O     1 
ATOM   7986  C CB    . ILE D  1 53  ? 119.036 55.415  116.510 1.00 3.04   ? 53  ILE D CB    1 
ATOM   7987  C CG1   . ILE D  1 53  ? 118.293 54.497  117.443 1.00 3.04   ? 53  ILE D CG1   1 
ATOM   7988  C CG2   . ILE D  1 53  ? 118.278 55.590  115.226 1.00 3.04   ? 53  ILE D CG2   1 
ATOM   7989  C CD1   . ILE D  1 53  ? 117.163 55.156  118.125 1.00 3.04   ? 53  ILE D CD1   1 
ATOM   7990  N N     . LEU D  1 54  ? 120.914 55.629  114.019 1.00 13.98  ? 54  LEU D N     1 
ATOM   7991  C CA    . LEU D  1 54  ? 121.434 56.574  113.048 1.00 13.21  ? 54  LEU D CA    1 
ATOM   7992  C C     . LEU D  1 54  ? 120.245 56.960  112.182 1.00 12.80  ? 54  LEU D C     1 
ATOM   7993  O O     . LEU D  1 54  ? 119.765 56.140  111.428 1.00 14.12  ? 54  LEU D O     1 
ATOM   7994  C CB    . LEU D  1 54  ? 122.500 55.946  112.178 1.00 7.93   ? 54  LEU D CB    1 
ATOM   7995  C CG    . LEU D  1 54  ? 122.803 56.891  111.022 1.00 8.90   ? 54  LEU D CG    1 
ATOM   7996  C CD1   . LEU D  1 54  ? 123.405 58.156  111.582 1.00 8.21   ? 54  LEU D CD1   1 
ATOM   7997  C CD2   . LEU D  1 54  ? 123.760 56.244  110.035 1.00 9.22   ? 54  LEU D CD2   1 
ATOM   7998  N N     . MET D  1 55  ? 119.745 58.188  112.306 1.00 7.38   ? 55  MET D N     1 
ATOM   7999  C CA    . MET D  1 55  ? 118.590 58.614  111.517 1.00 5.19   ? 55  MET D CA    1 
ATOM   8000  C C     . MET D  1 55  ? 119.138 59.260  110.307 1.00 4.90   ? 55  MET D C     1 
ATOM   8001  O O     . MET D  1 55  ? 120.084 60.002  110.405 1.00 6.84   ? 55  MET D O     1 
ATOM   8002  C CB    . MET D  1 55  ? 117.771 59.645  112.248 1.00 16.24  ? 55  MET D CB    1 
ATOM   8003  C CG    . MET D  1 55  ? 117.533 59.316  113.667 1.00 18.83  ? 55  MET D CG    1 
ATOM   8004  S SD    . MET D  1 55  ? 116.198 60.330  114.219 1.00 22.45  ? 55  MET D SD    1 
ATOM   8005  C CE    . MET D  1 55  ? 116.416 60.136  116.038 1.00 25.72  ? 55  MET D CE    1 
ATOM   8006  N N     . ILE D  1 56  ? 118.558 58.982  109.160 1.00 14.59  ? 56  ILE D N     1 
ATOM   8007  C CA    . ILE D  1 56  ? 119.036 59.560  107.914 1.00 15.96  ? 56  ILE D CA    1 
ATOM   8008  C C     . ILE D  1 56  ? 117.908 60.403  107.375 1.00 18.77  ? 56  ILE D C     1 
ATOM   8009  O O     . ILE D  1 56  ? 116.834 59.888  107.119 1.00 23.39  ? 56  ILE D O     1 
ATOM   8010  C CB    . ILE D  1 56  ? 119.338 58.468  106.855 1.00 14.76  ? 56  ILE D CB    1 
ATOM   8011  C CG1   . ILE D  1 56  ? 120.653 57.745  107.145 1.00 15.10  ? 56  ILE D CG1   1 
ATOM   8012  C CG2   . ILE D  1 56  ? 119.422 59.086  105.508 1.00 15.00  ? 56  ILE D CG2   1 
ATOM   8013  C CD1   . ILE D  1 56  ? 120.660 56.933  108.417 1.00 16.98  ? 56  ILE D CD1   1 
ATOM   8014  N N     . GLY D  1 57  ? 118.100 61.687  107.168 1.00 24.64  ? 57  GLY D N     1 
ATOM   8015  C CA    . GLY D  1 57  ? 116.965 62.419  106.653 1.00 25.27  ? 57  GLY D CA    1 
ATOM   8016  C C     . GLY D  1 57  ? 117.366 63.718  106.026 1.00 26.76  ? 57  GLY D C     1 
ATOM   8017  O O     . GLY D  1 57  ? 118.548 63.930  105.822 1.00 29.42  ? 57  GLY D O     1 
ATOM   8018  N N     . PRO D  1 58  ? 116.408 64.579  105.664 1.00 13.81  ? 58  PRO D N     1 
ATOM   8019  C CA    . PRO D  1 58  ? 116.669 65.869  105.058 1.00 14.29  ? 58  PRO D CA    1 
ATOM   8020  C C     . PRO D  1 58  ? 116.723 66.821  106.227 1.00 15.63  ? 58  PRO D C     1 
ATOM   8021  O O     . PRO D  1 58  ? 116.710 66.361  107.372 1.00 16.97  ? 58  PRO D O     1 
ATOM   8022  C CB    . PRO D  1 58  ? 115.449 66.086  104.197 1.00 26.51  ? 58  PRO D CB    1 
ATOM   8023  C CG    . PRO D  1 58  ? 115.015 64.729  103.897 1.00 25.56  ? 58  PRO D CG    1 
ATOM   8024  C CD    . PRO D  1 58  ? 115.082 64.141  105.256 1.00 25.39  ? 58  PRO D CD    1 
ATOM   8025  N N     . THR D  1 59  ? 116.764 68.128  105.955 1.00 17.51  ? 59  THR D N     1 
ATOM   8026  C CA    . THR D  1 59  ? 116.844 69.131  107.014 1.00 17.42  ? 59  THR D CA    1 
ATOM   8027  C C     . THR D  1 59  ? 115.518 69.434  107.702 1.00 17.07  ? 59  THR D C     1 
ATOM   8028  O O     . THR D  1 59  ? 114.475 69.587  107.036 1.00 16.77  ? 59  THR D O     1 
ATOM   8029  C CB    . THR D  1 59  ? 117.382 70.434  106.472 1.00 34.58  ? 59  THR D CB    1 
ATOM   8030  O OG1   . THR D  1 59  ? 118.624 70.186  105.827 1.00 39.74  ? 59  THR D OG1   1 
ATOM   8031  C CG2   . THR D  1 59  ? 117.616 71.407  107.571 1.00 34.27  ? 59  THR D CG2   1 
ATOM   8032  N N     . GLY D  1 60  ? 115.593 69.514  109.041 1.00 20.42  ? 60  GLY D N     1 
ATOM   8033  C CA    . GLY D  1 60  ? 114.458 69.831  109.905 1.00 20.30  ? 60  GLY D CA    1 
ATOM   8034  C C     . GLY D  1 60  ? 113.127 69.203  109.528 1.00 20.95  ? 60  GLY D C     1 
ATOM   8035  O O     . GLY D  1 60  ? 112.197 69.872  109.091 1.00 20.22  ? 60  GLY D O     1 
ATOM   8036  N N     . VAL D  1 61  ? 113.055 67.889  109.706 1.00 25.15  ? 61  VAL D N     1 
ATOM   8037  C CA    . VAL D  1 61  ? 111.876 67.112  109.416 1.00 22.87  ? 61  VAL D CA    1 
ATOM   8038  C C     . VAL D  1 61  ? 111.587 66.256  110.608 1.00 22.44  ? 61  VAL D C     1 
ATOM   8039  O O     . VAL D  1 61  ? 110.751 65.391  110.512 1.00 23.53  ? 61  VAL D O     1 
ATOM   8040  C CB    . VAL D  1 61  ? 112.098 66.206  108.237 1.00 20.80  ? 61  VAL D CB    1 
ATOM   8041  C CG1   . VAL D  1 61  ? 112.011 67.003  106.945 1.00 22.51  ? 61  VAL D CG1   1 
ATOM   8042  C CG2   . VAL D  1 61  ? 113.445 65.579  108.355 1.00 21.09  ? 61  VAL D CG2   1 
ATOM   8043  N N     . GLY D  1 62  ? 112.319 66.475  111.704 1.00 9.80   ? 62  GLY D N     1 
ATOM   8044  C CA    . GLY D  1 62  ? 112.101 65.770  112.967 1.00 8.68   ? 62  GLY D CA    1 
ATOM   8045  C C     . GLY D  1 62  ? 113.229 65.129  113.774 1.00 8.85   ? 62  GLY D C     1 
ATOM   8046  O O     . GLY D  1 62  ? 113.121 65.021  115.010 1.00 6.20   ? 62  GLY D O     1 
ATOM   8047  N N     . LYS D  1 63  ? 114.304 64.712  113.092 1.00 19.29  ? 63  LYS D N     1 
ATOM   8048  C CA    . LYS D  1 63  ? 115.429 64.012  113.732 1.00 20.96  ? 63  LYS D CA    1 
ATOM   8049  C C     . LYS D  1 63  ? 115.732 64.461  115.133 1.00 22.52  ? 63  LYS D C     1 
ATOM   8050  O O     . LYS D  1 63  ? 115.868 63.665  116.046 1.00 21.36  ? 63  LYS D O     1 
ATOM   8051  C CB    . LYS D  1 63  ? 116.697 64.153  112.917 1.00 9.70   ? 63  LYS D CB    1 
ATOM   8052  C CG    . LYS D  1 63  ? 116.530 63.813  111.475 1.00 10.44  ? 63  LYS D CG    1 
ATOM   8053  C CD    . LYS D  1 63  ? 117.893 63.703  110.790 1.00 11.06  ? 63  LYS D CD    1 
ATOM   8054  C CE    . LYS D  1 63  ? 117.831 64.006  109.299 1.00 8.16   ? 63  LYS D CE    1 
ATOM   8055  N NZ    . LYS D  1 63  ? 117.663 65.449  109.093 1.00 7.95   ? 63  LYS D NZ    1 
ATOM   8056  N N     . THR D  1 64  ? 115.839 65.757  115.307 1.00 46.32  ? 64  THR D N     1 
ATOM   8057  C CA    . THR D  1 64  ? 116.149 66.253  116.614 1.00 48.14  ? 64  THR D CA    1 
ATOM   8058  C C     . THR D  1 64  ? 114.954 66.262  117.566 1.00 49.67  ? 64  THR D C     1 
ATOM   8059  O O     . THR D  1 64  ? 115.064 65.787  118.700 1.00 50.69  ? 64  THR D O     1 
ATOM   8060  C CB    . THR D  1 64  ? 116.764 67.634  116.502 1.00 33.53  ? 64  THR D CB    1 
ATOM   8061  O OG1   . THR D  1 64  ? 117.936 67.554  115.680 1.00 33.55  ? 64  THR D OG1   1 
ATOM   8062  C CG2   . THR D  1 64  ? 117.151 68.151  117.861 1.00 33.48  ? 64  THR D CG2   1 
ATOM   8063  N N     . GLU D  1 65  ? 113.807 66.779  117.135 1.00 38.24  ? 65  GLU D N     1 
ATOM   8064  C CA    . GLU D  1 65  ? 112.657 66.807  118.050 1.00 38.65  ? 65  GLU D CA    1 
ATOM   8065  C C     . GLU D  1 65  ? 112.433 65.432  118.584 1.00 37.22  ? 65  GLU D C     1 
ATOM   8066  O O     . GLU D  1 65  ? 112.364 65.218  119.800 1.00 37.73  ? 65  GLU D O     1 
ATOM   8067  C CB    . GLU D  1 65  ? 111.369 67.298  117.372 1.00 57.31  ? 65  GLU D CB    1 
ATOM   8068  C CG    . GLU D  1 65  ? 111.205 68.832  117.357 1.00 64.39  ? 65  GLU D CG    1 
ATOM   8069  C CD    . GLU D  1 65  ? 110.889 69.448  118.727 1.00 67.18  ? 65  GLU D CD    1 
ATOM   8070  O OE1   . GLU D  1 65  ? 111.552 70.449  119.106 1.00 68.18  ? 65  GLU D OE1   1 
ATOM   8071  O OE2   . GLU D  1 65  ? 109.971 68.942  119.409 1.00 66.84  ? 65  GLU D OE2   1 
ATOM   8072  N N     . ILE D  1 66  ? 112.367 64.491  117.656 1.00 25.02  ? 66  ILE D N     1 
ATOM   8073  C CA    . ILE D  1 66  ? 112.132 63.134  118.040 1.00 21.99  ? 66  ILE D CA    1 
ATOM   8074  C C     . ILE D  1 66  ? 113.061 62.750  119.166 1.00 21.95  ? 66  ILE D C     1 
ATOM   8075  O O     . ILE D  1 66  ? 112.629 62.198  120.178 1.00 21.92  ? 66  ILE D O     1 
ATOM   8076  C CB    . ILE D  1 66  ? 112.275 62.231  116.857 1.00 6.71   ? 66  ILE D CB    1 
ATOM   8077  C CG1   . ILE D  1 66  ? 111.184 62.586  115.862 1.00 5.59   ? 66  ILE D CG1   1 
ATOM   8078  C CG2   . ILE D  1 66  ? 112.015 60.829  117.258 1.00 5.07   ? 66  ILE D CG2   1 
ATOM   8079  C CD1   . ILE D  1 66  ? 111.239 61.859  114.552 1.00 5.01   ? 66  ILE D CD1   1 
ATOM   8080  N N     . ALA D  1 67  ? 114.331 63.086  119.034 1.00 10.55  ? 67  ALA D N     1 
ATOM   8081  C CA    . ALA D  1 67  ? 115.283 62.742  120.090 1.00 12.02  ? 67  ALA D CA    1 
ATOM   8082  C C     . ALA D  1 67  ? 115.041 63.530  121.369 1.00 13.15  ? 67  ALA D C     1 
ATOM   8083  O O     . ALA D  1 67  ? 114.882 62.967  122.463 1.00 10.32  ? 67  ALA D O     1 
ATOM   8084  C CB    . ALA D  1 67  ? 116.706 62.984  119.606 1.00 15.57  ? 67  ALA D CB    1 
ATOM   8085  N N     . ARG D  1 68  ? 115.013 64.847  121.209 1.00 34.14  ? 68  ARG D N     1 
ATOM   8086  C CA    . ARG D  1 68  ? 114.844 65.732  122.334 1.00 37.33  ? 68  ARG D CA    1 
ATOM   8087  C C     . ARG D  1 68  ? 113.596 65.364  123.109 1.00 37.50  ? 68  ARG D C     1 
ATOM   8088  O O     . ARG D  1 68  ? 113.578 65.413  124.342 1.00 37.87  ? 68  ARG D O     1 
ATOM   8089  C CB    . ARG D  1 68  ? 114.793 67.172  121.848 1.00 46.60  ? 68  ARG D CB    1 
ATOM   8090  C CG    . ARG D  1 68  ? 115.396 68.147  122.823 1.00 50.99  ? 68  ARG D CG    1 
ATOM   8091  C CD    . ARG D  1 68  ? 115.162 69.568  122.362 1.00 54.88  ? 68  ARG D CD    1 
ATOM   8092  N NE    . ARG D  1 68  ? 116.045 70.027  121.281 1.00 59.04  ? 68  ARG D NE    1 
ATOM   8093  C CZ    . ARG D  1 68  ? 117.292 70.491  121.443 1.00 60.91  ? 68  ARG D CZ    1 
ATOM   8094  N NH1   . ARG D  1 68  ? 117.844 70.555  122.655 1.00 60.74  ? 68  ARG D NH1   1 
ATOM   8095  N NH2   . ARG D  1 68  ? 117.979 70.943  120.386 1.00 61.36  ? 68  ARG D NH2   1 
ATOM   8096  N N     . ARG D  1 69  ? 112.560 64.975  122.381 1.00 30.36  ? 69  ARG D N     1 
ATOM   8097  C CA    . ARG D  1 69  ? 111.314 64.581  123.004 1.00 31.46  ? 69  ARG D CA    1 
ATOM   8098  C C     . ARG D  1 69  ? 111.427 63.234  123.734 1.00 31.82  ? 69  ARG D C     1 
ATOM   8099  O O     . ARG D  1 69  ? 110.997 63.100  124.893 1.00 32.79  ? 69  ARG D O     1 
ATOM   8100  C CB    . ARG D  1 69  ? 110.238 64.478  121.951 1.00 46.09  ? 69  ARG D CB    1 
ATOM   8101  C CG    . ARG D  1 69  ? 109.852 65.770  121.392 1.00 47.99  ? 69  ARG D CG    1 
ATOM   8102  C CD    . ARG D  1 69  ? 109.147 66.548  122.441 1.00 50.93  ? 69  ARG D CD    1 
ATOM   8103  N NE    . ARG D  1 69  ? 108.854 67.883  121.940 1.00 53.82  ? 69  ARG D NE    1 
ATOM   8104  C CZ    . ARG D  1 69  ? 108.344 68.862  122.675 1.00 53.60  ? 69  ARG D CZ    1 
ATOM   8105  N NH1   . ARG D  1 69  ? 108.072 68.656  123.963 1.00 54.86  ? 69  ARG D NH1   1 
ATOM   8106  N NH2   . ARG D  1 69  ? 108.092 70.036  122.114 1.00 53.08  ? 69  ARG D NH2   1 
ATOM   8107  N N     . LEU D  1 70  ? 111.980 62.235  123.043 1.00 21.13  ? 70  LEU D N     1 
ATOM   8108  C CA    . LEU D  1 70  ? 112.150 60.904  123.614 1.00 19.21  ? 70  LEU D CA    1 
ATOM   8109  C C     . LEU D  1 70  ? 112.746 61.075  124.984 1.00 19.96  ? 70  LEU D C     1 
ATOM   8110  O O     . LEU D  1 70  ? 112.273 60.500  125.964 1.00 18.71  ? 70  LEU D O     1 
ATOM   8111  C CB    . LEU D  1 70  ? 113.119 60.096  122.768 1.00 2.11   ? 70  LEU D CB    1 
ATOM   8112  C CG    . LEU D  1 70  ? 113.510 58.709  123.253 1.00 2.11   ? 70  LEU D CG    1 
ATOM   8113  C CD1   . LEU D  1 70  ? 112.336 57.783  123.128 1.00 2.11   ? 70  LEU D CD1   1 
ATOM   8114  C CD2   . LEU D  1 70  ? 114.638 58.203  122.413 1.00 2.11   ? 70  LEU D CD2   1 
ATOM   8115  N N     . ALA D  1 71  ? 113.796 61.890  125.019 1.00 30.03  ? 71  ALA D N     1 
ATOM   8116  C CA    . ALA D  1 71  ? 114.529 62.182  126.234 1.00 32.48  ? 71  ALA D CA    1 
ATOM   8117  C C     . ALA D  1 71  ? 113.595 62.779  127.243 1.00 33.85  ? 71  ALA D C     1 
ATOM   8118  O O     . ALA D  1 71  ? 113.502 62.299  128.385 1.00 32.82  ? 71  ALA D O     1 
ATOM   8119  C CB    . ALA D  1 71  ? 115.631 63.153  125.938 1.00 42.87  ? 71  ALA D CB    1 
ATOM   8120  N N     . LYS D  1 72  ? 112.910 63.831  126.795 1.00 59.23  ? 72  LYS D N     1 
ATOM   8121  C CA    . LYS D  1 72  ? 111.976 64.569  127.620 1.00 61.18  ? 72  LYS D CA    1 
ATOM   8122  C C     . LYS D  1 72  ? 110.955 63.662  128.245 1.00 60.39  ? 72  LYS D C     1 
ATOM   8123  O O     . LYS D  1 72  ? 110.761 63.692  129.460 1.00 62.34  ? 72  LYS D O     1 
ATOM   8124  C CB    . LYS D  1 72  ? 111.267 65.637  126.808 1.00 106.46 ? 72  LYS D CB    1 
ATOM   8125  C CG    . LYS D  1 72  ? 110.484 66.615  127.666 1.00 113.54 ? 72  LYS D CG    1 
ATOM   8126  C CD    . LYS D  1 72  ? 111.394 67.320  128.665 1.00 119.28 ? 72  LYS D CD    1 
ATOM   8127  C CE    . LYS D  1 72  ? 110.680 68.481  129.351 1.00 123.46 ? 72  LYS D CE    1 
ATOM   8128  N NZ    . LYS D  1 72  ? 110.281 69.558  128.393 1.00 124.87 ? 72  LYS D NZ    1 
ATOM   8129  N N     . LEU D  1 73  ? 110.304 62.845  127.423 1.00 18.83  ? 73  LEU D N     1 
ATOM   8130  C CA    . LEU D  1 73  ? 109.290 61.919  127.939 1.00 17.09  ? 73  LEU D CA    1 
ATOM   8131  C C     . LEU D  1 73  ? 109.876 60.808  128.792 1.00 16.42  ? 73  LEU D C     1 
ATOM   8132  O O     . LEU D  1 73  ? 109.177 60.128  129.522 1.00 15.80  ? 73  LEU D O     1 
ATOM   8133  C CB    . LEU D  1 73  ? 108.509 61.303  126.789 1.00 15.62  ? 73  LEU D CB    1 
ATOM   8134  C CG    . LEU D  1 73  ? 109.114 60.202  125.946 1.00 13.14  ? 73  LEU D CG    1 
ATOM   8135  C CD1   . LEU D  1 73  ? 108.843 58.862  126.580 1.00 11.35  ? 73  LEU D CD1   1 
ATOM   8136  C CD2   . LEU D  1 73  ? 108.466 60.268  124.584 1.00 12.97  ? 73  LEU D CD2   1 
ATOM   8137  N N     . ALA D  1 74  ? 111.171 60.618  128.694 1.00 33.88  ? 74  ALA D N     1 
ATOM   8138  C CA    . ALA D  1 74  ? 111.772 59.584  129.472 1.00 35.94  ? 74  ALA D CA    1 
ATOM   8139  C C     . ALA D  1 74  ? 112.409 60.218  130.665 1.00 37.37  ? 74  ALA D C     1 
ATOM   8140  O O     . ALA D  1 74  ? 113.025 59.525  131.471 1.00 36.92  ? 74  ALA D O     1 
ATOM   8141  C CB    . ALA D  1 74  ? 112.795 58.866  128.654 1.00 24.42  ? 74  ALA D CB    1 
ATOM   8142  N N     . ASN D  1 75  ? 112.243 61.528  130.793 1.00 75.15  ? 75  ASN D N     1 
ATOM   8143  C CA    . ASN D  1 75  ? 112.854 62.240  131.900 1.00 78.17  ? 75  ASN D CA    1 
ATOM   8144  C C     . ASN D  1 75  ? 114.315 61.764  131.949 1.00 77.72  ? 75  ASN D C     1 
ATOM   8145  O O     . ASN D  1 75  ? 114.816 61.293  132.990 1.00 79.12  ? 75  ASN D O     1 
ATOM   8146  C CB    . ASN D  1 75  ? 112.130 61.916  133.213 1.00 98.77  ? 75  ASN D CB    1 
ATOM   8147  C CG    . ASN D  1 75  ? 112.702 62.677  134.402 1.00 101.90 ? 75  ASN D CG    1 
ATOM   8148  O OD1   . ASN D  1 75  ? 112.639 63.911  134.457 1.00 103.77 ? 75  ASN D OD1   1 
ATOM   8149  N ND2   . ASN D  1 75  ? 113.267 61.942  135.358 1.00 102.48 ? 75  ASN D ND2   1 
ATOM   8150  N N     . ALA D  1 76  ? 114.990 61.880  130.804 1.00 35.16  ? 76  ALA D N     1 
ATOM   8151  C CA    . ALA D  1 76  ? 116.374 61.457  130.712 1.00 32.41  ? 76  ALA D CA    1 
ATOM   8152  C C     . ALA D  1 76  ? 117.382 62.570  130.454 1.00 30.42  ? 76  ALA D C     1 
ATOM   8153  O O     . ALA D  1 76  ? 117.085 63.561  129.784 1.00 31.26  ? 76  ALA D O     1 
ATOM   8154  C CB    . ALA D  1 76  ? 116.503 60.412  129.630 1.00 34.47  ? 76  ALA D CB    1 
ATOM   8155  N N     . PRO D  1 77  ? 118.590 62.429  131.013 1.00 32.08  ? 77  PRO D N     1 
ATOM   8156  C CA    . PRO D  1 77  ? 119.600 63.446  130.784 1.00 31.38  ? 77  PRO D CA    1 
ATOM   8157  C C     . PRO D  1 77  ? 119.836 63.404  129.263 1.00 30.74  ? 77  PRO D C     1 
ATOM   8158  O O     . PRO D  1 77  ? 120.130 62.339  128.702 1.00 30.92  ? 77  PRO D O     1 
ATOM   8159  C CB    . PRO D  1 77  ? 120.790 62.904  131.566 1.00 20.80  ? 77  PRO D CB    1 
ATOM   8160  C CG    . PRO D  1 77  ? 120.183 62.152  132.659 1.00 19.96  ? 77  PRO D CG    1 
ATOM   8161  C CD    . PRO D  1 77  ? 119.067 61.438  131.989 1.00 19.94  ? 77  PRO D CD    1 
ATOM   8162  N N     . PHE D  1 78  ? 119.698 64.537  128.593 1.00 30.70  ? 78  PHE D N     1 
ATOM   8163  C CA    . PHE D  1 78  ? 119.890 64.551  127.156 1.00 29.57  ? 78  PHE D CA    1 
ATOM   8164  C C     . PHE D  1 78  ? 120.901 65.592  126.785 1.00 30.87  ? 78  PHE D C     1 
ATOM   8165  O O     . PHE D  1 78  ? 121.209 66.443  127.605 1.00 33.50  ? 78  PHE D O     1 
ATOM   8166  C CB    . PHE D  1 78  ? 118.601 64.895  126.497 1.00 16.80  ? 78  PHE D CB    1 
ATOM   8167  C CG    . PHE D  1 78  ? 118.703 65.064  125.043 1.00 14.42  ? 78  PHE D CG    1 
ATOM   8168  C CD1   . PHE D  1 78  ? 118.582 63.992  124.220 1.00 16.09  ? 78  PHE D CD1   1 
ATOM   8169  C CD2   . PHE D  1 78  ? 118.802 66.309  124.498 1.00 13.56  ? 78  PHE D CD2   1 
ATOM   8170  C CE1   . PHE D  1 78  ? 118.541 64.156  122.859 1.00 17.58  ? 78  PHE D CE1   1 
ATOM   8171  C CE2   . PHE D  1 78  ? 118.765 66.491  123.151 1.00 15.15  ? 78  PHE D CE2   1 
ATOM   8172  C CZ    . PHE D  1 78  ? 118.629 65.411  122.316 1.00 16.84  ? 78  PHE D CZ    1 
ATOM   8173  N N     . ILE D  1 79  ? 121.397 65.555  125.549 1.00 20.92  ? 79  ILE D N     1 
ATOM   8174  C CA    . ILE D  1 79  ? 122.402 66.521  125.099 1.00 20.23  ? 79  ILE D CA    1 
ATOM   8175  C C     . ILE D  1 79  ? 122.675 66.348  123.617 1.00 18.16  ? 79  ILE D C     1 
ATOM   8176  O O     . ILE D  1 79  ? 122.877 65.246  123.127 1.00 17.26  ? 79  ILE D O     1 
ATOM   8177  C CB    . ILE D  1 79  ? 123.744 66.380  125.925 1.00 41.69  ? 79  ILE D CB    1 
ATOM   8178  C CG1   . ILE D  1 79  ? 124.787 67.328  125.386 1.00 42.07  ? 79  ILE D CG1   1 
ATOM   8179  C CG2   . ILE D  1 79  ? 124.308 64.991  125.845 1.00 43.24  ? 79  ILE D CG2   1 
ATOM   8180  C CD1   . ILE D  1 79  ? 124.345 68.728  125.485 1.00 44.26  ? 79  ILE D CD1   1 
ATOM   8181  N N     . LYS D  1 80  ? 122.658 67.440  122.889 1.00 14.29  ? 80  LYS D N     1 
ATOM   8182  C CA    . LYS D  1 80  ? 122.908 67.356  121.469 1.00 15.88  ? 80  LYS D CA    1 
ATOM   8183  C C     . LYS D  1 80  ? 124.246 67.998  121.167 1.00 17.35  ? 80  LYS D C     1 
ATOM   8184  O O     . LYS D  1 80  ? 124.643 68.908  121.872 1.00 19.95  ? 80  LYS D O     1 
ATOM   8185  C CB    . LYS D  1 80  ? 121.810 68.089  120.725 1.00 25.13  ? 80  LYS D CB    1 
ATOM   8186  C CG    . LYS D  1 80  ? 122.146 68.445  119.312 1.00 25.63  ? 80  LYS D CG    1 
ATOM   8187  C CD    . LYS D  1 80  ? 120.945 69.013  118.621 1.00 26.94  ? 80  LYS D CD    1 
ATOM   8188  C CE    . LYS D  1 80  ? 121.259 69.290  117.168 1.00 29.40  ? 80  LYS D CE    1 
ATOM   8189  N NZ    . LYS D  1 80  ? 120.129 69.952  116.435 1.00 33.05  ? 80  LYS D NZ    1 
ATOM   8190  N N     . VAL D  1 81  ? 124.956 67.537  120.138 1.00 18.70  ? 81  VAL D N     1 
ATOM   8191  C CA    . VAL D  1 81  ? 126.240 68.152  119.783 1.00 19.05  ? 81  VAL D CA    1 
ATOM   8192  C C     . VAL D  1 81  ? 126.511 68.051  118.289 1.00 19.82  ? 81  VAL D C     1 
ATOM   8193  O O     . VAL D  1 81  ? 126.144 67.052  117.659 1.00 19.44  ? 81  VAL D O     1 
ATOM   8194  C CB    . VAL D  1 81  ? 127.390 67.490  120.527 1.00 28.81  ? 81  VAL D CB    1 
ATOM   8195  C CG1   . VAL D  1 81  ? 127.182 67.610  122.010 1.00 29.64  ? 81  VAL D CG1   1 
ATOM   8196  C CG2   . VAL D  1 81  ? 127.469 66.044  120.144 1.00 29.06  ? 81  VAL D CG2   1 
ATOM   8197  N N     . GLU D  1 82  ? 127.113 69.084  117.703 1.00 19.60  ? 82  GLU D N     1 
ATOM   8198  C CA    . GLU D  1 82  ? 127.426 68.983  116.287 1.00 22.45  ? 82  GLU D CA    1 
ATOM   8199  C C     . GLU D  1 82  ? 128.665 68.078  116.226 1.00 22.26  ? 82  GLU D C     1 
ATOM   8200  O O     . GLU D  1 82  ? 129.563 68.175  117.063 1.00 22.79  ? 82  GLU D O     1 
ATOM   8201  C CB    . GLU D  1 82  ? 127.735 70.344  115.694 1.00 80.00  ? 82  GLU D CB    1 
ATOM   8202  C CG    . GLU D  1 82  ? 127.351 70.424  114.236 1.00 88.41  ? 82  GLU D CG    1 
ATOM   8203  C CD    . GLU D  1 82  ? 126.033 71.171  113.997 1.00 94.49  ? 82  GLU D CD    1 
ATOM   8204  O OE1   . GLU D  1 82  ? 125.192 71.258  114.924 1.00 96.40  ? 82  GLU D OE1   1 
ATOM   8205  O OE2   . GLU D  1 82  ? 125.829 71.670  112.866 1.00 97.25  ? 82  GLU D OE2   1 
ATOM   8206  N N     . ALA D  1 83  ? 128.709 67.167  115.265 1.00 18.96  ? 83  ALA D N     1 
ATOM   8207  C CA    . ALA D  1 83  ? 129.845 66.251  115.157 1.00 16.51  ? 83  ALA D CA    1 
ATOM   8208  C C     . ALA D  1 83  ? 131.080 67.035  114.818 1.00 15.83  ? 83  ALA D C     1 
ATOM   8209  O O     . ALA D  1 83  ? 132.152 66.801  115.354 1.00 14.65  ? 83  ALA D O     1 
ATOM   8210  C CB    . ALA D  1 83  ? 129.581 65.219  114.072 1.00 47.21  ? 83  ALA D CB    1 
ATOM   8211  N N     . THR D  1 84  ? 130.897 67.972  113.902 1.00 20.56  ? 84  THR D N     1 
ATOM   8212  C CA    . THR D  1 84  ? 131.953 68.825  113.433 1.00 21.53  ? 84  THR D CA    1 
ATOM   8213  C C     . THR D  1 84  ? 132.479 69.732  114.520 1.00 21.97  ? 84  THR D C     1 
ATOM   8214  O O     . THR D  1 84  ? 133.560 70.287  114.388 1.00 22.42  ? 84  THR D O     1 
ATOM   8215  C CB    . THR D  1 84  ? 131.467 69.658  112.291 1.00 35.89  ? 84  THR D CB    1 
ATOM   8216  O OG1   . THR D  1 84  ? 130.136 70.098  112.577 1.00 38.49  ? 84  THR D OG1   1 
ATOM   8217  C CG2   . THR D  1 84  ? 131.464 68.844  111.034 1.00 36.84  ? 84  THR D CG2   1 
ATOM   8218  N N     . LYS D  1 85  ? 131.733 69.898  115.602 1.00 26.02  ? 85  LYS D N     1 
ATOM   8219  C CA    . LYS D  1 85  ? 132.225 70.735  116.681 1.00 26.93  ? 85  LYS D CA    1 
ATOM   8220  C C     . LYS D  1 85  ? 133.615 70.285  117.080 1.00 28.47  ? 85  LYS D C     1 
ATOM   8221  O O     . LYS D  1 85  ? 134.281 70.985  117.814 1.00 30.46  ? 85  LYS D O     1 
ATOM   8222  C CB    . LYS D  1 85  ? 131.336 70.631  117.903 1.00 37.77  ? 85  LYS D CB    1 
ATOM   8223  C CG    . LYS D  1 85  ? 131.821 71.398  119.123 1.00 39.86  ? 85  LYS D CG    1 
ATOM   8224  C CD    . LYS D  1 85  ? 130.958 71.017  120.331 1.00 43.92  ? 85  LYS D CD    1 
ATOM   8225  C CE    . LYS D  1 85  ? 131.261 71.831  121.584 1.00 47.24  ? 85  LYS D CE    1 
ATOM   8226  N NZ    . LYS D  1 85  ? 130.493 71.391  122.800 1.00 48.95  ? 85  LYS D NZ    1 
ATOM   8227  N N     . PHE D  1 86  ? 134.064 69.125  116.611 1.00 27.16  ? 86  PHE D N     1 
ATOM   8228  C CA    . PHE D  1 86  ? 135.380 68.662  116.992 1.00 28.18  ? 86  PHE D CA    1 
ATOM   8229  C C     . PHE D  1 86  ? 136.353 68.512  115.845 1.00 30.60  ? 86  PHE D C     1 
ATOM   8230  O O     . PHE D  1 86  ? 137.274 67.710  115.939 1.00 32.72  ? 86  PHE D O     1 
ATOM   8231  C CB    . PHE D  1 86  ? 135.284 67.325  117.721 1.00 20.51  ? 86  PHE D CB    1 
ATOM   8232  C CG    . PHE D  1 86  ? 134.188 67.260  118.715 1.00 19.68  ? 86  PHE D CG    1 
ATOM   8233  C CD1   . PHE D  1 86  ? 132.914 66.859  118.334 1.00 19.92  ? 86  PHE D CD1   1 
ATOM   8234  C CD2   . PHE D  1 86  ? 134.415 67.624  120.035 1.00 20.40  ? 86  PHE D CD2   1 
ATOM   8235  C CE1   . PHE D  1 86  ? 131.868 66.821  119.262 1.00 21.12  ? 86  PHE D CE1   1 
ATOM   8236  C CE2   . PHE D  1 86  ? 133.375 67.597  120.994 1.00 20.83  ? 86  PHE D CE2   1 
ATOM   8237  C CZ    . PHE D  1 86  ? 132.101 67.196  120.609 1.00 21.64  ? 86  PHE D CZ    1 
ATOM   8238  N N     . THR D  1 87  ? 136.193 69.260  114.766 1.00 50.55  ? 87  THR D N     1 
ATOM   8239  C CA    . THR D  1 87  ? 137.142 69.094  113.667 1.00 54.74  ? 87  THR D CA    1 
ATOM   8240  C C     . THR D  1 87  ? 138.488 69.763  113.971 1.00 55.90  ? 87  THR D C     1 
ATOM   8241  O O     . THR D  1 87  ? 138.696 70.335  115.051 1.00 56.80  ? 87  THR D O     1 
ATOM   8242  C CB    . THR D  1 87  ? 136.612 69.668  112.326 1.00 76.00  ? 87  THR D CB    1 
ATOM   8243  O OG1   . THR D  1 87  ? 135.246 69.293  112.136 1.00 78.56  ? 87  THR D OG1   1 
ATOM   8244  C CG2   . THR D  1 87  ? 137.416 69.112  111.162 1.00 76.70  ? 87  THR D CG2   1 
ATOM   8245  N N     . GLU D  1 95  ? 137.572 68.908  122.475 1.00 50.18  ? 95  GLU D N     1 
ATOM   8246  C CA    . GLU D  1 95  ? 137.546 67.810  123.457 1.00 51.39  ? 95  GLU D CA    1 
ATOM   8247  C C     . GLU D  1 95  ? 136.236 66.988  123.463 1.00 49.01  ? 95  GLU D C     1 
ATOM   8248  O O     . GLU D  1 95  ? 135.208 67.426  123.995 1.00 49.06  ? 95  GLU D O     1 
ATOM   8249  C CB    . GLU D  1 95  ? 137.805 68.354  124.872 1.00 118.63 ? 95  GLU D CB    1 
ATOM   8250  C CG    . GLU D  1 95  ? 137.823 67.280  125.965 1.00 124.50 ? 95  GLU D CG    1 
ATOM   8251  C CD    . GLU D  1 95  ? 138.963 66.276  125.816 1.00 128.73 ? 95  GLU D CD    1 
ATOM   8252  O OE1   . GLU D  1 95  ? 139.108 65.672  124.726 1.00 130.27 ? 95  GLU D OE1   1 
ATOM   8253  O OE2   . GLU D  1 95  ? 139.709 66.086  126.803 1.00 130.69 ? 95  GLU D OE2   1 
ATOM   8254  N N     . VAL D  1 96  ? 136.281 65.778  122.907 1.00 19.74  ? 96  VAL D N     1 
ATOM   8255  C CA    . VAL D  1 96  ? 135.089 64.952  122.828 1.00 15.85  ? 96  VAL D CA    1 
ATOM   8256  C C     . VAL D  1 96  ? 134.523 64.441  124.157 1.00 14.60  ? 96  VAL D C     1 
ATOM   8257  O O     . VAL D  1 96  ? 133.312 64.227  124.279 1.00 14.22  ? 96  VAL D O     1 
ATOM   8258  C CB    . VAL D  1 96  ? 135.343 63.799  121.892 1.00 23.30  ? 96  VAL D CB    1 
ATOM   8259  C CG1   . VAL D  1 96  ? 135.313 62.490  122.652 1.00 24.36  ? 96  VAL D CG1   1 
ATOM   8260  C CG2   . VAL D  1 96  ? 134.319 63.831  120.792 1.00 24.91  ? 96  VAL D CG2   1 
ATOM   8261  N N     . ASP D  1 97  ? 135.390 64.234  125.147 1.00 19.57  ? 97  ASP D N     1 
ATOM   8262  C CA    . ASP D  1 97  ? 134.940 63.772  126.447 1.00 18.20  ? 97  ASP D CA    1 
ATOM   8263  C C     . ASP D  1 97  ? 133.973 64.773  127.052 1.00 15.79  ? 97  ASP D C     1 
ATOM   8264  O O     . ASP D  1 97  ? 133.226 64.450  127.953 1.00 15.94  ? 97  ASP D O     1 
ATOM   8265  C CB    . ASP D  1 97  ? 136.106 63.587  127.407 1.00 90.58  ? 97  ASP D CB    1 
ATOM   8266  C CG    . ASP D  1 97  ? 136.968 62.419  127.041 1.00 95.51  ? 97  ASP D CG    1 
ATOM   8267  O OD1   . ASP D  1 97  ? 136.430 61.435  126.480 1.00 98.11  ? 97  ASP D OD1   1 
ATOM   8268  O OD2   . ASP D  1 97  ? 138.181 62.475  127.330 1.00 97.36  ? 97  ASP D OD2   1 
ATOM   8269  N N     . SER D  1 98  ? 133.980 66.003  126.572 1.00 29.86  ? 98  SER D N     1 
ATOM   8270  C CA    . SER D  1 98  ? 133.078 67.010  127.121 1.00 26.82  ? 98  SER D CA    1 
ATOM   8271  C C     . SER D  1 98  ? 131.618 66.568  126.989 1.00 24.73  ? 98  SER D C     1 
ATOM   8272  O O     . SER D  1 98  ? 130.790 66.835  127.856 1.00 22.88  ? 98  SER D O     1 
ATOM   8273  C CB    . SER D  1 98  ? 133.266 68.319  126.370 1.00 40.36  ? 98  SER D CB    1 
ATOM   8274  O OG    . SER D  1 98  ? 132.924 68.159  125.002 1.00 41.28  ? 98  SER D OG    1 
ATOM   8275  N N     . ILE D  1 99  ? 131.312 65.892  125.886 1.00 15.40  ? 99  ILE D N     1 
ATOM   8276  C CA    . ILE D  1 99  ? 129.970 65.441  125.620 1.00 12.01  ? 99  ILE D CA    1 
ATOM   8277  C C     . ILE D  1 99  ? 129.454 64.793  126.875 1.00 12.10  ? 99  ILE D C     1 
ATOM   8278  O O     . ILE D  1 99  ? 128.457 65.226  127.444 1.00 10.70  ? 99  ILE D O     1 
ATOM   8279  C CB    . ILE D  1 99  ? 129.965 64.460  124.436 1.00 16.02  ? 99  ILE D CB    1 
ATOM   8280  C CG1   . ILE D  1 99  ? 130.189 65.230  123.135 1.00 13.73  ? 99  ILE D CG1   1 
ATOM   8281  C CG2   . ILE D  1 99  ? 128.638 63.773  124.330 1.00 17.05  ? 99  ILE D CG2   1 
ATOM   8282  C CD1   . ILE D  1 99  ? 130.359 64.365  121.923 1.00 12.63  ? 99  ILE D CD1   1 
ATOM   8283  N N     . ILE D  1 100 ? 130.164 63.770  127.327 1.00 9.79   ? 100 ILE D N     1 
ATOM   8284  C CA    . ILE D  1 100 ? 129.758 63.036  128.528 1.00 11.37  ? 100 ILE D CA    1 
ATOM   8285  C C     . ILE D  1 100 ? 129.844 63.882  129.770 1.00 14.28  ? 100 ILE D C     1 
ATOM   8286  O O     . ILE D  1 100 ? 129.200 63.600  130.770 1.00 13.62  ? 100 ILE D O     1 
ATOM   8287  C CB    . ILE D  1 100 ? 130.638 61.795  128.757 1.00 21.51  ? 100 ILE D CB    1 
ATOM   8288  C CG1   . ILE D  1 100 ? 130.669 60.957  127.483 1.00 21.10  ? 100 ILE D CG1   1 
ATOM   8289  C CG2   . ILE D  1 100 ? 130.119 60.992  129.918 1.00 19.89  ? 100 ILE D CG2   1 
ATOM   8290  C CD1   . ILE D  1 100 ? 129.276 60.677  126.901 1.00 20.74  ? 100 ILE D CD1   1 
ATOM   8291  N N     . ARG D  1 101 ? 130.668 64.915  129.704 1.00 38.26  ? 101 ARG D N     1 
ATOM   8292  C CA    . ARG D  1 101 ? 130.861 65.794  130.838 1.00 43.08  ? 101 ARG D CA    1 
ATOM   8293  C C     . ARG D  1 101 ? 129.627 66.665  130.959 1.00 44.58  ? 101 ARG D C     1 
ATOM   8294  O O     . ARG D  1 101 ? 128.996 66.725  132.012 1.00 43.65  ? 101 ARG D O     1 
ATOM   8295  C CB    . ARG D  1 101 ? 132.112 66.634  130.608 1.00 96.72  ? 101 ARG D CB    1 
ATOM   8296  C CG    . ARG D  1 101 ? 132.798 67.131  131.868 1.00 101.40 ? 101 ARG D CG    1 
ATOM   8297  C CD    . ARG D  1 101 ? 134.231 67.523  131.525 1.00 105.79 ? 101 ARG D CD    1 
ATOM   8298  N NE    . ARG D  1 101 ? 135.037 66.351  131.174 1.00 109.94 ? 101 ARG D NE    1 
ATOM   8299  C CZ    . ARG D  1 101 ? 136.099 66.378  130.376 1.00 111.79 ? 101 ARG D CZ    1 
ATOM   8300  N NH1   . ARG D  1 101 ? 136.489 67.523  129.831 1.00 113.20 ? 101 ARG D NH1   1 
ATOM   8301  N NH2   . ARG D  1 101 ? 136.777 65.262  130.128 1.00 110.55 ? 101 ARG D NH2   1 
ATOM   8302  N N     . ASP D  1 102 ? 129.289 67.325  129.859 1.00 68.81  ? 102 ASP D N     1 
ATOM   8303  C CA    . ASP D  1 102 ? 128.126 68.194  129.798 1.00 71.49  ? 102 ASP D CA    1 
ATOM   8304  C C     . ASP D  1 102 ? 126.876 67.385  130.141 1.00 71.83  ? 102 ASP D C     1 
ATOM   8305  O O     . ASP D  1 102 ? 125.983 67.868  130.835 1.00 71.85  ? 102 ASP D O     1 
ATOM   8306  C CB    . ASP D  1 102 ? 127.990 68.776  128.386 1.00 74.50  ? 102 ASP D CB    1 
ATOM   8307  C CG    . ASP D  1 102 ? 129.125 69.713  128.025 1.00 77.13  ? 102 ASP D CG    1 
ATOM   8308  O OD1   . ASP D  1 102 ? 129.413 69.881  126.816 1.00 78.30  ? 102 ASP D OD1   1 
ATOM   8309  O OD2   . ASP D  1 102 ? 129.714 70.293  128.958 1.00 79.32  ? 102 ASP D OD2   1 
ATOM   8310  N N     . LEU D  1 103 ? 126.816 66.152  129.649 1.00 51.93  ? 103 LEU D N     1 
ATOM   8311  C CA    . LEU D  1 103 ? 125.669 65.299  129.914 1.00 51.26  ? 103 LEU D CA    1 
ATOM   8312  C C     . LEU D  1 103 ? 125.478 65.173  131.418 1.00 51.72  ? 103 LEU D C     1 
ATOM   8313  O O     . LEU D  1 103 ? 124.430 65.503  131.937 1.00 52.19  ? 103 LEU D O     1 
ATOM   8314  C CB    . LEU D  1 103 ? 125.883 63.919  129.303 1.00 71.83  ? 103 LEU D CB    1 
ATOM   8315  C CG    . LEU D  1 103 ? 124.696 62.960  129.371 1.00 69.75  ? 103 LEU D CG    1 
ATOM   8316  C CD1   . LEU D  1 103 ? 123.532 63.554  128.603 1.00 67.70  ? 103 LEU D CD1   1 
ATOM   8317  C CD2   . LEU D  1 103 ? 125.085 61.608  128.786 1.00 68.45  ? 103 LEU D CD2   1 
ATOM   8318  N N     . THR D  1 104 ? 126.502 64.705  132.116 1.00 29.65  ? 104 THR D N     1 
ATOM   8319  C CA    . THR D  1 104 ? 126.441 64.548  133.567 1.00 30.88  ? 104 THR D CA    1 
ATOM   8320  C C     . THR D  1 104 ? 125.992 65.850  134.218 1.00 33.41  ? 104 THR D C     1 
ATOM   8321  O O     . THR D  1 104 ? 125.215 65.853  135.176 1.00 32.90  ? 104 THR D O     1 
ATOM   8322  C CB    . THR D  1 104 ? 127.819 64.170  134.143 1.00 41.10  ? 104 THR D CB    1 
ATOM   8323  O OG1   . THR D  1 104 ? 128.308 62.996  133.486 1.00 40.25  ? 104 THR D OG1   1 
ATOM   8324  C CG2   . THR D  1 104 ? 127.714 63.883  135.616 1.00 40.01  ? 104 THR D CG2   1 
ATOM   8325  N N     . ASP D  1 105 ? 126.499 66.960  133.695 1.00 86.05  ? 105 ASP D N     1 
ATOM   8326  C CA    . ASP D  1 105 ? 126.152 68.275  134.216 1.00 89.32  ? 105 ASP D CA    1 
ATOM   8327  C C     . ASP D  1 105 ? 124.645 68.486  134.148 1.00 90.48  ? 105 ASP D C     1 
ATOM   8328  O O     . ASP D  1 105 ? 124.032 69.021  135.068 1.00 91.16  ? 105 ASP D O     1 
ATOM   8329  C CB    . ASP D  1 105 ? 126.879 69.354  133.417 1.00 94.15  ? 105 ASP D CB    1 
ATOM   8330  C CG    . ASP D  1 105 ? 127.911 70.083  134.244 1.00 96.34  ? 105 ASP D CG    1 
ATOM   8331  O OD1   . ASP D  1 105 ? 128.390 69.505  135.243 1.00 97.15  ? 105 ASP D OD1   1 
ATOM   8332  O OD2   . ASP D  1 105 ? 128.249 71.230  133.889 1.00 97.88  ? 105 ASP D OD2   1 
ATOM   8333  N N     . SER D  1 106 ? 124.047 68.052  133.050 1.00 51.11  ? 106 SER D N     1 
ATOM   8334  C CA    . SER D  1 106 ? 122.606 68.181  132.872 1.00 53.00  ? 106 SER D CA    1 
ATOM   8335  C C     . SER D  1 106 ? 121.851 67.269  133.846 1.00 53.67  ? 106 SER D C     1 
ATOM   8336  O O     . SER D  1 106 ? 120.958 67.715  134.542 1.00 53.56  ? 106 SER D O     1 
ATOM   8337  C CB    . SER D  1 106 ? 122.226 67.838  131.430 1.00 72.80  ? 106 SER D CB    1 
ATOM   8338  O OG    . SER D  1 106 ? 120.823 67.873  131.258 1.00 74.24  ? 106 SER D OG    1 
ATOM   8339  N N     . ALA D  1 107 ? 122.210 65.992  133.887 1.00 50.73  ? 107 ALA D N     1 
ATOM   8340  C CA    . ALA D  1 107 ? 121.572 65.043  134.792 1.00 52.17  ? 107 ALA D CA    1 
ATOM   8341  C C     . ALA D  1 107 ? 121.622 65.585  136.202 1.00 54.29  ? 107 ALA D C     1 
ATOM   8342  O O     . ALA D  1 107 ? 120.705 65.360  136.980 1.00 55.33  ? 107 ALA D O     1 
ATOM   8343  C CB    . ALA D  1 107 ? 122.277 63.685  134.747 1.00 4.21   ? 107 ALA D CB    1 
ATOM   8344  N N     . MET D  1 108 ? 122.695 66.292  136.544 1.00 69.25  ? 108 MET D N     1 
ATOM   8345  C CA    . MET D  1 108 ? 122.805 66.856  137.889 1.00 71.87  ? 108 MET D CA    1 
ATOM   8346  C C     . MET D  1 108 ? 121.588 67.742  138.161 1.00 73.27  ? 108 MET D C     1 
ATOM   8347  O O     . MET D  1 108 ? 120.986 67.668  139.233 1.00 73.22  ? 108 MET D O     1 
ATOM   8348  C CB    . MET D  1 108 ? 124.088 67.675  138.030 1.00 77.95  ? 108 MET D CB    1 
ATOM   8349  C CG    . MET D  1 108 ? 124.854 67.407  139.327 1.00 78.99  ? 108 MET D CG    1 
ATOM   8350  S SD    . MET D  1 108 ? 123.832 67.343  140.816 1.00 78.17  ? 108 MET D SD    1 
ATOM   8351  C CE    . MET D  1 108 ? 124.123 65.688  141.333 1.00 78.99  ? 108 MET D CE    1 
ATOM   8352  N N     . LYS D  1 109 ? 121.240 68.574  137.177 1.00 61.51  ? 109 LYS D N     1 
ATOM   8353  C CA    . LYS D  1 109 ? 120.072 69.446  137.275 1.00 63.84  ? 109 LYS D CA    1 
ATOM   8354  C C     . LYS D  1 109 ? 118.892 68.532  137.588 1.00 64.75  ? 109 LYS D C     1 
ATOM   8355  O O     . LYS D  1 109 ? 118.358 68.529  138.694 1.00 65.42  ? 109 LYS D O     1 
ATOM   8356  C CB    . LYS D  1 109 ? 119.808 70.176  135.948 1.00 94.96  ? 109 LYS D CB    1 
ATOM   8357  C CG    . LYS D  1 109 ? 118.475 70.940  135.942 1.00 96.38  ? 109 LYS D CG    1 
ATOM   8358  C CD    . LYS D  1 109 ? 118.229 71.763  134.670 1.00 96.89  ? 109 LYS D CD    1 
ATOM   8359  C CE    . LYS D  1 109 ? 117.192 72.880  135.009 1.00 97.73  ? 109 LYS D CE    1 
ATOM   8360  N NZ    . LYS D  1 109 ? 116.945 73.868  133.920 1.00 97.81  ? 109 LYS D NZ    1 
ATOM   8361  N N     . LEU D  1 110 ? 118.512 67.741  136.592 1.00 51.65  ? 110 LEU D N     1 
ATOM   8362  C CA    . LEU D  1 110 ? 117.420 66.770  136.694 1.00 53.02  ? 110 LEU D CA    1 
ATOM   8363  C C     . LEU D  1 110 ? 117.372 66.197  138.101 1.00 53.76  ? 110 LEU D C     1 
ATOM   8364  O O     . LEU D  1 110 ? 116.465 66.485  138.875 1.00 54.06  ? 110 LEU D O     1 
ATOM   8365  C CB    . LEU D  1 110 ? 117.660 65.644  135.682 1.00 73.32  ? 110 LEU D CB    1 
ATOM   8366  C CG    . LEU D  1 110 ? 116.561 65.202  134.711 1.00 73.20  ? 110 LEU D CG    1 
ATOM   8367  C CD1   . LEU D  1 110 ? 115.703 66.376  134.270 1.00 73.41  ? 110 LEU D CD1   1 
ATOM   8368  C CD2   . LEU D  1 110 ? 117.224 64.534  133.509 1.00 73.11  ? 110 LEU D CD2   1 
ATOM   8369  N N     . VAL D  1 111 ? 118.365 65.386  138.424 1.00 30.40  ? 111 VAL D N     1 
ATOM   8370  C CA    . VAL D  1 111 ? 118.451 64.784  139.735 1.00 32.70  ? 111 VAL D CA    1 
ATOM   8371  C C     . VAL D  1 111 ? 118.139 65.817  140.790 1.00 35.09  ? 111 VAL D C     1 
ATOM   8372  O O     . VAL D  1 111 ? 117.295 65.577  141.635 1.00 35.93  ? 111 VAL D O     1 
ATOM   8373  C CB    . VAL D  1 111 ? 119.856 64.216  140.007 1.00 61.18  ? 111 VAL D CB    1 
ATOM   8374  C CG1   . VAL D  1 111 ? 120.011 63.884  141.474 1.00 61.08  ? 111 VAL D CG1   1 
ATOM   8375  C CG2   . VAL D  1 111 ? 120.063 62.964  139.191 1.00 61.94  ? 111 VAL D CG2   1 
ATOM   8376  N N     . ARG D  1 112 ? 118.821 66.961  140.739 1.00 57.10  ? 112 ARG D N     1 
ATOM   8377  C CA    . ARG D  1 112 ? 118.629 68.050  141.710 1.00 60.66  ? 112 ARG D CA    1 
ATOM   8378  C C     . ARG D  1 112 ? 117.200 68.573  141.759 1.00 62.91  ? 112 ARG D C     1 
ATOM   8379  O O     . ARG D  1 112 ? 116.484 68.334  142.719 1.00 63.80  ? 112 ARG D O     1 
ATOM   8380  C CB    . ARG D  1 112 ? 119.559 69.213  141.380 1.00 103.19 ? 112 ARG D CB    1 
ATOM   8381  C CG    . ARG D  1 112 ? 119.252 70.506  142.114 1.00 104.50 ? 112 ARG D CG    1 
ATOM   8382  C CD    . ARG D  1 112 ? 119.907 70.520  143.461 1.00 106.29 ? 112 ARG D CD    1 
ATOM   8383  N NE    . ARG D  1 112 ? 119.929 71.865  144.019 1.00 108.74 ? 112 ARG D NE    1 
ATOM   8384  C CZ    . ARG D  1 112 ? 120.744 72.243  145.000 1.00 110.17 ? 112 ARG D CZ    1 
ATOM   8385  N NH1   . ARG D  1 112 ? 121.595 71.367  145.518 1.00 111.27 ? 112 ARG D NH1   1 
ATOM   8386  N NH2   . ARG D  1 112 ? 120.715 73.491  145.460 1.00 110.35 ? 112 ARG D NH2   1 
ATOM   8387  N N     . GLN D  1 113 ? 116.799 69.306  140.726 1.00 68.82  ? 113 GLN D N     1 
ATOM   8388  C CA    . GLN D  1 113 ? 115.454 69.873  140.637 1.00 71.06  ? 113 GLN D CA    1 
ATOM   8389  C C     . GLN D  1 113 ? 114.357 68.831  140.907 1.00 72.41  ? 113 GLN D C     1 
ATOM   8390  O O     . GLN D  1 113 ? 113.177 69.167  141.022 1.00 72.84  ? 113 GLN D O     1 
ATOM   8391  C CB    . GLN D  1 113 ? 115.277 70.505  139.249 1.00 136.74 ? 113 GLN D CB    1 
ATOM   8392  C CG    . GLN D  1 113 ? 113.913 70.323  138.606 1.00 138.17 ? 113 GLN D CG    1 
ATOM   8393  C CD    . GLN D  1 113 ? 114.012 70.127  137.102 1.00 138.81 ? 113 GLN D CD    1 
ATOM   8394  O OE1   . GLN D  1 113 ? 114.490 71.000  136.379 1.00 138.88 ? 113 GLN D OE1   1 
ATOM   8395  N NE2   . GLN D  1 113 ? 113.565 68.971  136.626 1.00 139.27 ? 113 GLN D NE2   1 
ATOM   8396  N N     . GLN D  1 114 ? 114.758 67.571  141.028 1.00 77.60  ? 114 GLN D N     1 
ATOM   8397  C CA    . GLN D  1 114 ? 113.824 66.480  141.275 1.00 78.99  ? 114 GLN D CA    1 
ATOM   8398  C C     . GLN D  1 114 ? 113.777 66.091  142.753 1.00 79.49  ? 114 GLN D C     1 
ATOM   8399  O O     . GLN D  1 114 ? 112.711 65.802  143.286 1.00 79.51  ? 114 GLN D O     1 
ATOM   8400  C CB    . GLN D  1 114 ? 114.240 65.264  140.450 1.00 197.99 ? 114 GLN D CB    1 
ATOM   8401  C CG    . GLN D  1 114 ? 113.102 64.340  140.067 1.00 199.17 ? 114 GLN D CG    1 
ATOM   8402  C CD    . GLN D  1 114 ? 113.601 62.999  139.571 1.00 199.17 ? 114 GLN D CD    1 
ATOM   8403  O OE1   . GLN D  1 114 ? 112.880 62.274  138.880 1.00 199.17 ? 114 GLN D OE1   1 
ATOM   8404  N NE2   . GLN D  1 114 ? 114.835 62.652  139.932 1.00 199.17 ? 114 GLN D NE2   1 
ATOM   8405  N N     . GLU D  1 115 ? 114.943 66.083  143.400 1.00 92.86  ? 115 GLU D N     1 
ATOM   8406  C CA    . GLU D  1 115 ? 115.079 65.716  144.813 1.00 92.86  ? 115 GLU D CA    1 
ATOM   8407  C C     . GLU D  1 115 ? 114.781 66.890  145.739 1.00 92.86  ? 115 GLU D C     1 
ATOM   8408  O O     . GLU D  1 115 ? 114.657 66.723  146.953 1.00 92.86  ? 115 GLU D O     1 
ATOM   8409  C CB    . GLU D  1 115 ? 116.496 65.206  145.089 1.00 138.96 ? 115 GLU D CB    1 
ATOM   8410  C CG    . GLU D  1 115 ? 116.582 64.158  146.177 1.00 138.96 ? 115 GLU D CG    1 
ATOM   8411  C CD    . GLU D  1 115 ? 115.880 62.869  145.787 1.00 138.96 ? 115 GLU D CD    1 
ATOM   8412  O OE1   . GLU D  1 115 ? 116.189 62.325  144.702 1.00 138.96 ? 115 GLU D OE1   1 
ATOM   8413  O OE2   . GLU D  1 115 ? 115.022 62.396  146.564 1.00 138.96 ? 115 GLU D OE2   1 
ATOM   8414  N N     . ILE D  1 116 ? 114.690 68.084  145.163 1.00 93.30  ? 116 ILE D N     1 
ATOM   8415  C CA    . ILE D  1 116 ? 114.384 69.260  145.952 1.00 93.30  ? 116 ILE D CA    1 
ATOM   8416  C C     . ILE D  1 116 ? 112.884 69.242  146.142 1.00 93.30  ? 116 ILE D C     1 
ATOM   8417  O O     . ILE D  1 116 ? 112.386 69.463  147.246 1.00 93.30  ? 116 ILE D O     1 
ATOM   8418  C CB    . ILE D  1 116 ? 114.781 70.584  145.238 1.00 96.75  ? 116 ILE D CB    1 
ATOM   8419  C CG1   . ILE D  1 116 ? 114.023 70.727  143.909 1.00 96.75  ? 116 ILE D CG1   1 
ATOM   8420  C CG2   . ILE D  1 116 ? 116.294 70.648  145.056 1.00 96.75  ? 116 ILE D CG2   1 
ATOM   8421  C CD1   . ILE D  1 116 ? 112.663 71.442  144.012 1.00 96.75  ? 116 ILE D CD1   1 
ATOM   8422  N N     . ALA D  1 117 ? 112.171 68.960  145.054 1.00 169.37 ? 117 ALA D N     1 
ATOM   8423  C CA    . ALA D  1 117 ? 110.719 68.910  145.078 1.00 169.37 ? 117 ALA D CA    1 
ATOM   8424  C C     . ALA D  1 117 ? 110.268 67.642  145.796 1.00 169.37 ? 117 ALA D C     1 
ATOM   8425  O O     . ALA D  1 117 ? 109.087 67.477  146.103 1.00 169.37 ? 117 ALA D O     1 
ATOM   8426  C CB    . ALA D  1 117 ? 110.166 68.953  143.659 1.00 102.70 ? 117 ALA D CB    1 
ATOM   8427  N N     . LYS D  1 118 ? 111.217 66.745  146.051 1.00 141.81 ? 118 LYS D N     1 
ATOM   8428  C CA    . LYS D  1 118 ? 110.921 65.516  146.773 1.00 141.81 ? 118 LYS D CA    1 
ATOM   8429  C C     . LYS D  1 118 ? 110.779 65.929  148.232 1.00 141.81 ? 118 LYS D C     1 
ATOM   8430  O O     . LYS D  1 118 ? 109.903 65.449  148.953 1.00 141.81 ? 118 LYS D O     1 
ATOM   8431  C CB    . LYS D  1 118 ? 112.066 64.503  146.610 1.00 199.11 ? 118 LYS D CB    1 
ATOM   8432  C CG    . LYS D  1 118 ? 112.380 63.662  147.859 1.00 199.11 ? 118 LYS D CG    1 
ATOM   8433  C CD    . LYS D  1 118 ? 111.176 62.862  148.367 1.00 199.11 ? 118 LYS D CD    1 
ATOM   8434  C CE    . LYS D  1 118 ? 111.443 62.263  149.753 1.00 199.11 ? 118 LYS D CE    1 
ATOM   8435  N NZ    . LYS D  1 118 ? 110.231 61.635  150.366 1.00 199.11 ? 118 LYS D NZ    1 
ATOM   8436  N N     . ASN D  1 119 ? 111.643 66.840  148.659 1.00 158.51 ? 119 ASN D N     1 
ATOM   8437  C CA    . ASN D  1 119 ? 111.605 67.315  150.028 1.00 158.51 ? 119 ASN D CA    1 
ATOM   8438  C C     . ASN D  1 119 ? 111.066 68.732  150.132 1.00 158.51 ? 119 ASN D C     1 
ATOM   8439  O O     . ASN D  1 119 ? 111.791 69.705  149.914 1.00 158.51 ? 119 ASN D O     1 
ATOM   8440  C CB    . ASN D  1 119 ? 113.000 67.235  150.646 1.00 86.82  ? 119 ASN D CB    1 
ATOM   8441  C CG    . ASN D  1 119 ? 113.530 65.822  150.675 1.00 86.82  ? 119 ASN D CG    1 
ATOM   8442  O OD1   . ASN D  1 119 ? 112.836 64.899  151.105 1.00 86.82  ? 119 ASN D OD1   1 
ATOM   8443  N ND2   . ASN D  1 119 ? 114.765 65.640  150.218 1.00 86.82  ? 119 ASN D ND2   1 
ATOM   8444  N N     . ARG D  1 120 ? 109.778 68.834  150.445 1.00 200.00 ? 120 ARG D N     1 
ATOM   8445  C CA    . ARG D  1 120 ? 109.134 70.127  150.616 1.00 200.00 ? 120 ARG D CA    1 
ATOM   8446  C C     . ARG D  1 120 ? 108.311 70.059  151.904 1.00 200.00 ? 120 ARG D C     1 
ATOM   8447  O O     . ARG D  1 120 ? 107.636 71.018  152.285 1.00 200.00 ? 120 ARG D O     1 
ATOM   8448  C CB    . ARG D  1 120 ? 108.233 70.463  149.421 1.00 133.07 ? 120 ARG D CB    1 
ATOM   8449  C CG    . ARG D  1 120 ? 108.249 71.956  149.091 1.00 133.07 ? 120 ARG D CG    1 
ATOM   8450  C CD    . ARG D  1 120 ? 107.013 72.440  148.335 1.00 133.07 ? 120 ARG D CD    1 
ATOM   8451  N NE    . ARG D  1 120 ? 107.055 73.889  148.110 1.00 133.07 ? 120 ARG D NE    1 
ATOM   8452  C CZ    . ARG D  1 120 ? 106.038 74.615  147.651 1.00 133.07 ? 120 ARG D CZ    1 
ATOM   8453  N NH1   . ARG D  1 120 ? 104.879 74.038  147.361 1.00 133.07 ? 120 ARG D NH1   1 
ATOM   8454  N NH2   . ARG D  1 120 ? 106.180 75.923  147.480 1.00 133.07 ? 120 ARG D NH2   1 
ATOM   8455  N N     . ALA D  1 121 ? 108.387 68.910  152.571 1.00 175.26 ? 121 ALA D N     1 
ATOM   8456  C CA    . ALA D  1 121 ? 107.675 68.685  153.823 1.00 175.26 ? 121 ALA D CA    1 
ATOM   8457  C C     . ALA D  1 121 ? 108.671 68.310  154.914 1.00 175.26 ? 121 ALA D C     1 
ATOM   8458  O O     . ALA D  1 121 ? 109.773 68.857  154.977 1.00 175.26 ? 121 ALA D O     1 
ATOM   8459  C CB    . ALA D  1 121 ? 106.638 67.573  153.649 1.00 114.40 ? 121 ALA D CB    1 
ATOM   8460  N N     . ASN D  1 236 ? 121.269 66.872  151.225 1.00 119.77 ? 236 ASN D N     1 
ATOM   8461  C CA    . ASN D  1 236 ? 122.413 65.959  151.178 1.00 119.77 ? 236 ASN D CA    1 
ATOM   8462  C C     . ASN D  1 236 ? 122.977 65.808  149.760 1.00 119.77 ? 236 ASN D C     1 
ATOM   8463  O O     . ASN D  1 236 ? 122.382 65.144  148.917 1.00 119.77 ? 236 ASN D O     1 
ATOM   8464  C CB    . ASN D  1 236 ? 122.013 64.583  151.740 1.00 102.91 ? 236 ASN D CB    1 
ATOM   8465  C CG    . ASN D  1 236 ? 123.124 63.537  151.611 1.00 102.91 ? 236 ASN D CG    1 
ATOM   8466  O OD1   . ASN D  1 236 ? 124.306 63.830  151.806 1.00 102.91 ? 236 ASN D OD1   1 
ATOM   8467  N ND2   . ASN D  1 236 ? 122.738 62.305  151.298 1.00 102.91 ? 236 ASN D ND2   1 
ATOM   8468  N N     . PRO D  1 237 ? 124.132 66.442  149.484 1.00 105.12 ? 237 PRO D N     1 
ATOM   8469  C CA    . PRO D  1 237 ? 124.831 66.422  148.191 1.00 105.12 ? 237 PRO D CA    1 
ATOM   8470  C C     . PRO D  1 237 ? 125.527 65.131  147.741 1.00 105.12 ? 237 PRO D C     1 
ATOM   8471  O O     . PRO D  1 237 ? 125.412 64.746  146.579 1.00 105.12 ? 237 PRO D O     1 
ATOM   8472  C CB    . PRO D  1 237 ? 125.820 67.583  148.318 1.00 159.47 ? 237 PRO D CB    1 
ATOM   8473  C CG    . PRO D  1 237 ? 125.095 68.539  149.204 1.00 159.47 ? 237 PRO D CG    1 
ATOM   8474  C CD    . PRO D  1 237 ? 124.580 67.602  150.275 1.00 159.47 ? 237 PRO D CD    1 
ATOM   8475  N N     . GLU D  1 238 ? 126.250 64.463  148.633 1.00 121.90 ? 238 GLU D N     1 
ATOM   8476  C CA    . GLU D  1 238 ? 126.958 63.239  148.240 1.00 121.90 ? 238 GLU D CA    1 
ATOM   8477  C C     . GLU D  1 238 ? 126.119 62.228  147.442 1.00 121.90 ? 238 GLU D C     1 
ATOM   8478  O O     . GLU D  1 238 ? 126.556 61.741  146.393 1.00 121.90 ? 238 GLU D O     1 
ATOM   8479  C CB    . GLU D  1 238 ? 127.575 62.554  149.470 1.00 179.12 ? 238 GLU D CB    1 
ATOM   8480  C CG    . GLU D  1 238 ? 128.914 63.153  149.926 1.00 179.12 ? 238 GLU D CG    1 
ATOM   8481  C CD    . GLU D  1 238 ? 130.010 63.046  148.869 1.00 179.12 ? 238 GLU D CD    1 
ATOM   8482  O OE1   . GLU D  1 238 ? 130.349 61.915  148.465 1.00 179.12 ? 238 GLU D OE1   1 
ATOM   8483  O OE2   . GLU D  1 238 ? 130.535 64.096  148.443 1.00 179.12 ? 238 GLU D OE2   1 
ATOM   8484  N N     . GLU D  1 239 ? 124.925 61.911  147.940 1.00 106.26 ? 239 GLU D N     1 
ATOM   8485  C CA    . GLU D  1 239 ? 124.035 60.967  147.263 1.00 106.26 ? 239 GLU D CA    1 
ATOM   8486  C C     . GLU D  1 239 ? 123.600 61.609  145.951 1.00 106.26 ? 239 GLU D C     1 
ATOM   8487  O O     . GLU D  1 239 ? 123.546 60.948  144.915 1.00 106.26 ? 239 GLU D O     1 
ATOM   8488  C CB    . GLU D  1 239 ? 122.810 60.646  148.157 1.00 178.89 ? 239 GLU D CB    1 
ATOM   8489  C CG    . GLU D  1 239 ? 121.774 59.650  147.575 1.00 178.89 ? 239 GLU D CG    1 
ATOM   8490  C CD    . GLU D  1 239 ? 120.668 59.260  148.569 1.00 178.89 ? 239 GLU D CD    1 
ATOM   8491  O OE1   . GLU D  1 239 ? 120.108 60.155  149.240 1.00 178.89 ? 239 GLU D OE1   1 
ATOM   8492  O OE2   . GLU D  1 239 ? 120.349 58.054  148.668 1.00 178.89 ? 239 GLU D OE2   1 
ATOM   8493  N N     . LEU D  1 240 ? 123.318 62.908  146.001 1.00 65.60  ? 240 LEU D N     1 
ATOM   8494  C CA    . LEU D  1 240 ? 122.896 63.646  144.815 1.00 65.60  ? 240 LEU D CA    1 
ATOM   8495  C C     . LEU D  1 240 ? 123.841 63.257  143.692 1.00 65.60  ? 240 LEU D C     1 
ATOM   8496  O O     . LEU D  1 240 ? 123.487 62.442  142.840 1.00 65.60  ? 240 LEU D O     1 
ATOM   8497  C CB    . LEU D  1 240 ? 122.961 65.157  145.066 1.00 79.35  ? 240 LEU D CB    1 
ATOM   8498  C CG    . LEU D  1 240 ? 122.187 66.077  144.113 1.00 79.35  ? 240 LEU D CG    1 
ATOM   8499  C CD1   . LEU D  1 240 ? 120.702 65.766  144.200 1.00 79.35  ? 240 LEU D CD1   1 
ATOM   8500  C CD2   . LEU D  1 240 ? 122.445 67.542  144.472 1.00 79.35  ? 240 LEU D CD2   1 
ATOM   8501  N N     . LYS D  1 241 ? 125.047 63.818  143.697 1.00 54.16  ? 241 LYS D N     1 
ATOM   8502  C CA    . LYS D  1 241 ? 126.027 63.481  142.671 1.00 52.37  ? 241 LYS D CA    1 
ATOM   8503  C C     . LYS D  1 241 ? 125.905 62.003  142.295 1.00 50.66  ? 241 LYS D C     1 
ATOM   8504  O O     . LYS D  1 241 ? 125.621 61.661  141.147 1.00 50.36  ? 241 LYS D O     1 
ATOM   8505  C CB    . LYS D  1 241 ? 127.445 63.782  143.168 1.00 115.20 ? 241 LYS D CB    1 
ATOM   8506  C CG    . LYS D  1 241 ? 127.710 65.269  143.352 1.00 116.41 ? 241 LYS D CG    1 
ATOM   8507  C CD    . LYS D  1 241 ? 129.168 65.567  143.668 1.00 116.64 ? 241 LYS D CD    1 
ATOM   8508  C CE    . LYS D  1 241 ? 129.426 67.072  143.665 1.00 116.68 ? 241 LYS D CE    1 
ATOM   8509  N NZ    . LYS D  1 241 ? 130.848 67.407  143.956 1.00 117.21 ? 241 LYS D NZ    1 
ATOM   8510  N N     . GLN D  1 242 ? 126.093 61.133  143.277 1.00 65.06  ? 242 GLN D N     1 
ATOM   8511  C CA    . GLN D  1 242 ? 125.997 59.705  143.044 1.00 63.40  ? 242 GLN D CA    1 
ATOM   8512  C C     . GLN D  1 242 ? 124.827 59.373  142.117 1.00 61.37  ? 242 GLN D C     1 
ATOM   8513  O O     . GLN D  1 242 ? 124.941 58.503  141.257 1.00 61.37  ? 242 GLN D O     1 
ATOM   8514  C CB    . GLN D  1 242 ? 125.845 58.968  144.381 1.00 121.27 ? 242 GLN D CB    1 
ATOM   8515  C CG    . GLN D  1 242 ? 125.831 57.444  144.281 1.00 122.79 ? 242 GLN D CG    1 
ATOM   8516  C CD    . GLN D  1 242 ? 127.047 56.881  143.562 1.00 123.60 ? 242 GLN D CD    1 
ATOM   8517  O OE1   . GLN D  1 242 ? 127.099 56.846  142.333 1.00 124.06 ? 242 GLN D OE1   1 
ATOM   8518  N NE2   . GLN D  1 242 ? 128.037 56.446  144.331 1.00 124.22 ? 242 GLN D NE2   1 
ATOM   8519  N N     . LYS D  1 243 ? 123.704 60.065  142.278 1.00 60.20  ? 243 LYS D N     1 
ATOM   8520  C CA    . LYS D  1 243 ? 122.545 59.797  141.433 1.00 57.25  ? 243 LYS D CA    1 
ATOM   8521  C C     . LYS D  1 243 ? 122.696 60.338  140.015 1.00 54.44  ? 243 LYS D C     1 
ATOM   8522  O O     . LYS D  1 243 ? 122.506 59.605  139.044 1.00 54.17  ? 243 LYS D O     1 
ATOM   8523  C CB    . LYS D  1 243 ? 121.274 60.364  142.064 1.00 92.94  ? 243 LYS D CB    1 
ATOM   8524  C CG    . LYS D  1 243 ? 120.610 59.432  143.058 1.00 94.27  ? 243 LYS D CG    1 
ATOM   8525  C CD    . LYS D  1 243 ? 119.346 60.055  143.634 1.00 95.78  ? 243 LYS D CD    1 
ATOM   8526  C CE    . LYS D  1 243 ? 118.722 59.179  144.717 1.00 97.35  ? 243 LYS D CE    1 
ATOM   8527  N NZ    . LYS D  1 243 ? 117.543 59.840  145.352 1.00 97.41  ? 243 LYS D NZ    1 
ATOM   8528  N N     . ALA D  1 244 ? 123.026 61.620  139.891 1.00 47.38  ? 244 ALA D N     1 
ATOM   8529  C CA    . ALA D  1 244 ? 123.198 62.227  138.576 1.00 43.22  ? 244 ALA D CA    1 
ATOM   8530  C C     . ALA D  1 244 ? 124.095 61.297  137.783 1.00 40.62  ? 244 ALA D C     1 
ATOM   8531  O O     . ALA D  1 244 ? 123.894 61.091  136.593 1.00 39.64  ? 244 ALA D O     1 
ATOM   8532  C CB    . ALA D  1 244 ? 123.833 63.610  138.705 1.00 33.68  ? 244 ALA D CB    1 
ATOM   8533  N N     . ILE D  1 245 ? 125.078 60.732  138.474 1.00 39.71  ? 245 ILE D N     1 
ATOM   8534  C CA    . ILE D  1 245 ? 126.014 59.795  137.878 1.00 37.71  ? 245 ILE D CA    1 
ATOM   8535  C C     . ILE D  1 245 ? 125.189 58.641  137.354 1.00 36.03  ? 245 ILE D C     1 
ATOM   8536  O O     . ILE D  1 245 ? 125.251 58.316  136.180 1.00 35.38  ? 245 ILE D O     1 
ATOM   8537  C CB    . ILE D  1 245 ? 126.989 59.249  138.918 1.00 105.35 ? 245 ILE D CB    1 
ATOM   8538  C CG1   . ILE D  1 245 ? 127.703 60.408  139.612 1.00 105.96 ? 245 ILE D CG1   1 
ATOM   8539  C CG2   . ILE D  1 245 ? 127.977 58.314  138.251 1.00 104.83 ? 245 ILE D CG2   1 
ATOM   8540  C CD1   . ILE D  1 245 ? 128.566 59.992  140.797 1.00 107.21 ? 245 ILE D CD1   1 
ATOM   8541  N N     . ASP D  1 246 ? 124.411 58.016  138.230 1.00 56.51  ? 246 ASP D N     1 
ATOM   8542  C CA    . ASP D  1 246 ? 123.555 56.911  137.817 1.00 54.36  ? 246 ASP D CA    1 
ATOM   8543  C C     . ASP D  1 246 ? 122.667 57.415  136.683 1.00 51.08  ? 246 ASP D C     1 
ATOM   8544  O O     . ASP D  1 246 ? 122.614 56.825  135.610 1.00 50.81  ? 246 ASP D O     1 
ATOM   8545  C CB    . ASP D  1 246 ? 122.700 56.448  138.995 1.00 92.82  ? 246 ASP D CB    1 
ATOM   8546  C CG    . ASP D  1 246 ? 123.486 55.641  140.007 1.00 94.59  ? 246 ASP D CG    1 
ATOM   8547  O OD1   . ASP D  1 246 ? 123.015 55.524  141.158 1.00 95.59  ? 246 ASP D OD1   1 
ATOM   8548  O OD2   . ASP D  1 246 ? 124.563 55.115  139.650 1.00 95.71  ? 246 ASP D OD2   1 
ATOM   8549  N N     . ALA D  1 247 ? 121.987 58.524  136.934 1.00 48.01  ? 247 ALA D N     1 
ATOM   8550  C CA    . ALA D  1 247 ? 121.121 59.135  135.950 1.00 44.66  ? 247 ALA D CA    1 
ATOM   8551  C C     . ALA D  1 247 ? 121.767 59.192  134.563 1.00 42.30  ? 247 ALA D C     1 
ATOM   8552  O O     . ALA D  1 247 ? 121.101 58.952  133.572 1.00 42.29  ? 247 ALA D O     1 
ATOM   8553  C CB    . ALA D  1 247 ? 120.746 60.521  136.400 1.00 61.29  ? 247 ALA D CB    1 
ATOM   8554  N N     . VAL D  1 248 ? 123.049 59.526  134.471 1.00 32.12  ? 248 VAL D N     1 
ATOM   8555  C CA    . VAL D  1 248 ? 123.693 59.559  133.160 1.00 29.02  ? 248 VAL D CA    1 
ATOM   8556  C C     . VAL D  1 248 ? 123.961 58.143  132.737 1.00 28.45  ? 248 VAL D C     1 
ATOM   8557  O O     . VAL D  1 248 ? 123.436 57.702  131.727 1.00 29.25  ? 248 VAL D O     1 
ATOM   8558  C CB    . VAL D  1 248 ? 125.066 60.293  133.150 1.00 12.27  ? 248 VAL D CB    1 
ATOM   8559  C CG1   . VAL D  1 248 ? 125.787 60.058  131.837 1.00 10.38  ? 248 VAL D CG1   1 
ATOM   8560  C CG2   . VAL D  1 248 ? 124.869 61.774  133.322 1.00 12.28  ? 248 VAL D CG2   1 
ATOM   8561  N N     . GLU D  1 249 ? 124.772 57.437  133.523 1.00 50.34  ? 249 GLU D N     1 
ATOM   8562  C CA    . GLU D  1 249 ? 125.171 56.059  133.235 1.00 49.90  ? 249 GLU D CA    1 
ATOM   8563  C C     . GLU D  1 249 ? 124.050 55.134  132.828 1.00 49.31  ? 249 GLU D C     1 
ATOM   8564  O O     . GLU D  1 249 ? 124.244 54.253  131.966 1.00 48.65  ? 249 GLU D O     1 
ATOM   8565  C CB    . GLU D  1 249 ? 125.883 55.440  134.429 1.00 71.64  ? 249 GLU D CB    1 
ATOM   8566  C CG    . GLU D  1 249 ? 127.315 55.867  134.557 1.00 74.34  ? 249 GLU D CG    1 
ATOM   8567  C CD    . GLU D  1 249 ? 128.079 54.993  135.520 1.00 76.26  ? 249 GLU D CD    1 
ATOM   8568  O OE1   . GLU D  1 249 ? 129.307 55.222  135.711 1.00 76.86  ? 249 GLU D OE1   1 
ATOM   8569  O OE2   . GLU D  1 249 ? 127.436 54.072  136.076 1.00 76.69  ? 249 GLU D OE2   1 
ATOM   8570  N N     . GLN D  1 250 ? 122.885 55.330  133.451 1.00 65.95  ? 250 GLN D N     1 
ATOM   8571  C CA    . GLN D  1 250 ? 121.709 54.511  133.189 1.00 64.79  ? 250 GLN D CA    1 
ATOM   8572  C C     . GLN D  1 250 ? 120.824 54.965  132.041 1.00 61.69  ? 250 GLN D C     1 
ATOM   8573  O O     . GLN D  1 250 ? 120.522 54.164  131.152 1.00 61.76  ? 250 GLN D O     1 
ATOM   8574  C CB    . GLN D  1 250 ? 120.870 54.375  134.454 1.00 95.88  ? 250 GLN D CB    1 
ATOM   8575  C CG    . GLN D  1 250 ? 121.508 53.487  135.494 1.00 101.06 ? 250 GLN D CG    1 
ATOM   8576  C CD    . GLN D  1 250 ? 121.814 52.102  134.953 1.00 105.12 ? 250 GLN D CD    1 
ATOM   8577  O OE1   . GLN D  1 250 ? 122.404 51.269  135.639 1.00 108.21 ? 250 GLN D OE1   1 
ATOM   8578  N NE2   . GLN D  1 250 ? 121.410 51.848  133.714 1.00 106.72 ? 250 GLN D NE2   1 
ATOM   8579  N N     . ASN D  1 251 ? 120.394 56.224  132.038 1.00 23.25  ? 251 ASN D N     1 
ATOM   8580  C CA    . ASN D  1 251 ? 119.546 56.669  130.934 1.00 20.97  ? 251 ASN D CA    1 
ATOM   8581  C C     . ASN D  1 251 ? 119.940 57.946  130.199 1.00 16.67  ? 251 ASN D C     1 
ATOM   8582  O O     . ASN D  1 251 ? 119.123 58.844  130.019 1.00 16.70  ? 251 ASN D O     1 
ATOM   8583  C CB    . ASN D  1 251 ? 118.071 56.792  131.368 1.00 97.06  ? 251 ASN D CB    1 
ATOM   8584  C CG    . ASN D  1 251 ? 117.855 56.464  132.828 1.00 100.31 ? 251 ASN D CG    1 
ATOM   8585  O OD1   . ASN D  1 251 ? 118.079 55.335  133.264 1.00 102.85 ? 251 ASN D OD1   1 
ATOM   8586  N ND2   . ASN D  1 251 ? 117.412 57.452  133.594 1.00 100.82 ? 251 ASN D ND2   1 
ATOM   8587  N N     . GLY D  1 252 ? 121.172 58.040  129.740 1.00 16.83  ? 252 GLY D N     1 
ATOM   8588  C CA    . GLY D  1 252 ? 121.517 59.243  129.018 1.00 11.79  ? 252 GLY D CA    1 
ATOM   8589  C C     . GLY D  1 252 ? 121.318 59.088  127.518 1.00 7.94   ? 252 GLY D C     1 
ATOM   8590  O O     . GLY D  1 252 ? 121.581 58.038  126.940 1.00 7.45   ? 252 GLY D O     1 
ATOM   8591  N N     . ILE D  1 253 ? 120.849 60.136  126.872 1.00 18.47  ? 253 ILE D N     1 
ATOM   8592  C CA    . ILE D  1 253 ? 120.660 60.066  125.442 1.00 16.80  ? 253 ILE D CA    1 
ATOM   8593  C C     . ILE D  1 253 ? 121.613 61.110  124.937 1.00 14.18  ? 253 ILE D C     1 
ATOM   8594  O O     . ILE D  1 253 ? 121.636 62.194  125.471 1.00 15.81  ? 253 ILE D O     1 
ATOM   8595  C CB    . ILE D  1 253 ? 119.202 60.473  125.013 1.00 23.04  ? 253 ILE D CB    1 
ATOM   8596  C CG1   . ILE D  1 253 ? 118.192 60.020  126.087 1.00 23.35  ? 253 ILE D CG1   1 
ATOM   8597  C CG2   . ILE D  1 253 ? 118.842 59.893  123.588 1.00 22.14  ? 253 ILE D CG2   1 
ATOM   8598  C CD1   . ILE D  1 253 ? 118.152 58.532  126.353 1.00 22.67  ? 253 ILE D CD1   1 
ATOM   8599  N N     . VAL D  1 254 ? 122.408 60.783  123.931 1.00 5.69   ? 254 VAL D N     1 
ATOM   8600  C CA    . VAL D  1 254 ? 123.342 61.724  123.341 1.00 2.43   ? 254 VAL D CA    1 
ATOM   8601  C C     . VAL D  1 254 ? 123.010 61.819  121.864 1.00 3.12   ? 254 VAL D C     1 
ATOM   8602  O O     . VAL D  1 254 ? 123.063 60.834  121.136 1.00 3.61   ? 254 VAL D O     1 
ATOM   8603  C CB    . VAL D  1 254 ? 124.752 61.226  123.493 1.00 1.00   ? 254 VAL D CB    1 
ATOM   8604  C CG1   . VAL D  1 254 ? 125.648 61.957  122.552 1.00 1.00   ? 254 VAL D CG1   1 
ATOM   8605  C CG2   . VAL D  1 254 ? 125.190 61.372  124.922 1.00 1.00   ? 254 VAL D CG2   1 
ATOM   8606  N N     . PHE D  1 255 ? 122.650 63.001  121.412 1.00 14.99  ? 255 PHE D N     1 
ATOM   8607  C CA    . PHE D  1 255 ? 122.302 63.160  120.019 1.00 15.36  ? 255 PHE D CA    1 
ATOM   8608  C C     . PHE D  1 255 ? 123.506 63.761  119.303 1.00 18.29  ? 255 PHE D C     1 
ATOM   8609  O O     . PHE D  1 255 ? 123.972 64.827  119.678 1.00 20.71  ? 255 PHE D O     1 
ATOM   8610  C CB    . PHE D  1 255 ? 121.089 64.066  119.917 1.00 1.00   ? 255 PHE D CB    1 
ATOM   8611  C CG    . PHE D  1 255 ? 120.558 64.195  118.549 1.00 1.00   ? 255 PHE D CG    1 
ATOM   8612  C CD1   . PHE D  1 255 ? 119.956 63.152  117.924 1.00 1.00   ? 255 PHE D CD1   1 
ATOM   8613  C CD2   . PHE D  1 255 ? 120.645 65.381  117.866 1.00 1.00   ? 255 PHE D CD2   1 
ATOM   8614  C CE1   . PHE D  1 255 ? 119.431 63.283  116.614 1.00 1.00   ? 255 PHE D CE1   1 
ATOM   8615  C CE2   . PHE D  1 255 ? 120.128 65.524  116.549 1.00 1.00   ? 255 PHE D CE2   1 
ATOM   8616  C CZ    . PHE D  1 255 ? 119.522 64.463  115.939 1.00 1.00   ? 255 PHE D CZ    1 
ATOM   8617  N N     . ILE D  1 256 ? 124.032 63.070  118.295 1.00 27.42  ? 256 ILE D N     1 
ATOM   8618  C CA    . ILE D  1 256 ? 125.194 63.548  117.534 1.00 27.50  ? 256 ILE D CA    1 
ATOM   8619  C C     . ILE D  1 256 ? 124.722 63.985  116.160 1.00 29.53  ? 256 ILE D C     1 
ATOM   8620  O O     . ILE D  1 256 ? 124.528 63.157  115.268 1.00 30.51  ? 256 ILE D O     1 
ATOM   8621  C CB    . ILE D  1 256 ? 126.219 62.437  117.368 1.00 4.48   ? 256 ILE D CB    1 
ATOM   8622  C CG1   . ILE D  1 256 ? 126.859 62.133  118.728 1.00 3.25   ? 256 ILE D CG1   1 
ATOM   8623  C CG2   . ILE D  1 256 ? 127.187 62.800  116.275 1.00 3.55   ? 256 ILE D CG2   1 
ATOM   8624  C CD1   . ILE D  1 256 ? 127.742 60.923  118.720 1.00 1.62   ? 256 ILE D CD1   1 
ATOM   8625  N N     . ASP D  1 257 ? 124.567 65.293  115.987 1.00 22.90  ? 257 ASP D N     1 
ATOM   8626  C CA    . ASP D  1 257 ? 124.049 65.834  114.739 1.00 25.20  ? 257 ASP D CA    1 
ATOM   8627  C C     . ASP D  1 257 ? 125.046 65.866  113.592 1.00 24.35  ? 257 ASP D C     1 
ATOM   8628  O O     . ASP D  1 257 ? 126.255 65.875  113.807 1.00 23.49  ? 257 ASP D O     1 
ATOM   8629  C CB    . ASP D  1 257 ? 123.464 67.232  114.987 1.00 101.02 ? 257 ASP D CB    1 
ATOM   8630  C CG    . ASP D  1 257 ? 122.413 67.622  113.957 1.00 105.76 ? 257 ASP D CG    1 
ATOM   8631  O OD1   . ASP D  1 257 ? 121.813 66.700  113.371 1.00 107.26 ? 257 ASP D OD1   1 
ATOM   8632  O OD2   . ASP D  1 257 ? 122.172 68.837  113.744 1.00 108.34 ? 257 ASP D OD2   1 
ATOM   8633  N N     . GLU D  1 258 ? 124.511 65.893  112.373 1.00 19.77  ? 258 GLU D N     1 
ATOM   8634  C CA    . GLU D  1 258 ? 125.303 65.904  111.154 1.00 22.44  ? 258 GLU D CA    1 
ATOM   8635  C C     . GLU D  1 258 ? 126.630 65.117  111.315 1.00 21.43  ? 258 GLU D C     1 
ATOM   8636  O O     . GLU D  1 258 ? 127.741 65.628  111.177 1.00 20.02  ? 258 GLU D O     1 
ATOM   8637  C CB    . GLU D  1 258 ? 125.507 67.360  110.652 1.00 55.60  ? 258 GLU D CB    1 
ATOM   8638  C CG    . GLU D  1 258 ? 124.266 67.922  109.879 1.00 62.16  ? 258 GLU D CG    1 
ATOM   8639  C CD    . GLU D  1 258 ? 124.399 69.381  109.353 1.00 66.27  ? 258 GLU D CD    1 
ATOM   8640  O OE1   . GLU D  1 258 ? 123.427 69.883  108.701 1.00 64.42  ? 258 GLU D OE1   1 
ATOM   8641  O OE2   . GLU D  1 258 ? 125.461 70.016  109.589 1.00 68.91  ? 258 GLU D OE2   1 
ATOM   8642  N N     . ILE D  1 259 ? 126.494 63.838  111.628 1.00 29.81  ? 259 ILE D N     1 
ATOM   8643  C CA    . ILE D  1 259 ? 127.650 62.976  111.756 1.00 27.99  ? 259 ILE D CA    1 
ATOM   8644  C C     . ILE D  1 259 ? 128.044 62.660  110.315 1.00 29.29  ? 259 ILE D C     1 
ATOM   8645  O O     . ILE D  1 259 ? 129.141 62.176  110.050 1.00 31.44  ? 259 ILE D O     1 
ATOM   8646  C CB    . ILE D  1 259 ? 127.288 61.663  112.470 1.00 8.70   ? 259 ILE D CB    1 
ATOM   8647  C CG1   . ILE D  1 259 ? 128.525 61.043  113.114 1.00 7.70   ? 259 ILE D CG1   1 
ATOM   8648  C CG2   . ILE D  1 259 ? 126.784 60.656  111.443 1.00 8.33   ? 259 ILE D CG2   1 
ATOM   8649  C CD1   . ILE D  1 259 ? 128.247 60.133  114.319 1.00 6.26   ? 259 ILE D CD1   1 
ATOM   8650  N N     . ASP D  1 260 ? 127.128 62.915  109.388 1.00 9.47   ? 260 ASP D N     1 
ATOM   8651  C CA    . ASP D  1 260 ? 127.408 62.665  108.000 1.00 11.02  ? 260 ASP D CA    1 
ATOM   8652  C C     . ASP D  1 260 ? 128.420 63.675  107.480 1.00 13.04  ? 260 ASP D C     1 
ATOM   8653  O O     . ASP D  1 260 ? 128.977 63.508  106.397 1.00 13.10  ? 260 ASP D O     1 
ATOM   8654  C CB    . ASP D  1 260 ? 126.130 62.712  107.176 1.00 30.35  ? 260 ASP D CB    1 
ATOM   8655  C CG    . ASP D  1 260 ? 125.461 64.067  107.191 1.00 34.28  ? 260 ASP D CG    1 
ATOM   8656  O OD1   . ASP D  1 260 ? 125.386 64.698  108.267 1.00 34.21  ? 260 ASP D OD1   1 
ATOM   8657  O OD2   . ASP D  1 260 ? 124.978 64.490  106.115 1.00 36.92  ? 260 ASP D OD2   1 
ATOM   8658  N N     . LYS D  1 261 ? 128.684 64.721  108.249 1.00 43.87  ? 261 LYS D N     1 
ATOM   8659  C CA    . LYS D  1 261 ? 129.661 65.705  107.816 1.00 46.55  ? 261 LYS D CA    1 
ATOM   8660  C C     . LYS D  1 261 ? 131.084 65.215  108.115 1.00 47.74  ? 261 LYS D C     1 
ATOM   8661  O O     . LYS D  1 261 ? 131.980 65.409  107.295 1.00 48.67  ? 261 LYS D O     1 
ATOM   8662  C CB    . LYS D  1 261 ? 129.409 67.042  108.506 1.00 69.60  ? 261 LYS D CB    1 
ATOM   8663  C CG    . LYS D  1 261 ? 128.114 67.736  108.106 1.00 72.41  ? 261 LYS D CG    1 
ATOM   8664  C CD    . LYS D  1 261 ? 128.176 68.286  106.706 1.00 74.75  ? 261 LYS D CD    1 
ATOM   8665  C CE    . LYS D  1 261 ? 126.989 69.205  106.444 1.00 75.56  ? 261 LYS D CE    1 
ATOM   8666  N NZ    . LYS D  1 261 ? 127.045 69.863  105.101 1.00 78.39  ? 261 LYS D NZ    1 
ATOM   8667  N N     . ILE D  1 262 ? 131.291 64.581  109.273 1.00 22.34  ? 262 ILE D N     1 
ATOM   8668  C CA    . ILE D  1 262 ? 132.616 64.065  109.636 1.00 21.24  ? 262 ILE D CA    1 
ATOM   8669  C C     . ILE D  1 262 ? 132.854 62.696  109.057 1.00 24.25  ? 262 ILE D C     1 
ATOM   8670  O O     . ILE D  1 262 ? 133.533 61.863  109.653 1.00 24.77  ? 262 ILE D O     1 
ATOM   8671  C CB    . ILE D  1 262 ? 132.818 64.001  111.151 1.00 8.64   ? 262 ILE D CB    1 
ATOM   8672  C CG1   . ILE D  1 262 ? 132.111 62.790  111.782 1.00 6.04   ? 262 ILE D CG1   1 
ATOM   8673  C CG2   . ILE D  1 262 ? 132.279 65.287  111.739 1.00 9.28   ? 262 ILE D CG2   1 
ATOM   8674  C CD1   . ILE D  1 262 ? 132.128 62.786  113.329 1.00 2.42   ? 262 ILE D CD1   1 
ATOM   8675  N N     . CYS D  1 263 ? 132.283 62.491  107.875 1.00 29.99  ? 263 CYS D N     1 
ATOM   8676  C CA    . CYS D  1 263 ? 132.407 61.264  107.124 1.00 35.35  ? 263 CYS D CA    1 
ATOM   8677  C C     . CYS D  1 263 ? 133.535 61.531  106.117 1.00 39.60  ? 263 CYS D C     1 
ATOM   8678  O O     . CYS D  1 263 ? 134.178 62.558  106.201 1.00 40.49  ? 263 CYS D O     1 
ATOM   8679  C CB    . CYS D  1 263 ? 131.107 61.031  106.410 1.00 72.84  ? 263 CYS D CB    1 
ATOM   8680  S SG    . CYS D  1 263 ? 130.862 59.356  106.097 1.00 79.61  ? 263 CYS D SG    1 
ATOM   8681  N N     . LYS D  1 264 ? 133.790 60.642  105.163 1.00 60.08  ? 264 LYS D N     1 
ATOM   8682  C CA    . LYS D  1 264 ? 134.868 60.887  104.191 1.00 65.26  ? 264 LYS D CA    1 
ATOM   8683  C C     . LYS D  1 264 ? 134.322 61.319  102.838 1.00 68.98  ? 264 LYS D C     1 
ATOM   8684  O O     . LYS D  1 264 ? 133.187 60.988  102.492 1.00 69.38  ? 264 LYS D O     1 
ATOM   8685  C CB    . LYS D  1 264 ? 135.698 59.629  103.934 1.00 108.31 ? 264 LYS D CB    1 
ATOM   8686  C CG    . LYS D  1 264 ? 136.517 59.080  105.074 1.00 109.97 ? 264 LYS D CG    1 
ATOM   8687  C CD    . LYS D  1 264 ? 135.776 58.057  105.917 1.00 110.99 ? 264 LYS D CD    1 
ATOM   8688  C CE    . LYS D  1 264 ? 134.770 58.715  106.850 1.00 111.90 ? 264 LYS D CE    1 
ATOM   8689  N NZ    . LYS D  1 264 ? 134.078 57.732  107.723 1.00 110.99 ? 264 LYS D NZ    1 
ATOM   8690  N N     . LYS D  1 265 ? 135.148 62.029  102.067 1.00 93.27  ? 265 LYS D N     1 
ATOM   8691  C CA    . LYS D  1 265 ? 134.784 62.489  100.718 1.00 96.74  ? 265 LYS D CA    1 
ATOM   8692  C C     . LYS D  1 265 ? 135.853 63.419  100.128 1.00 97.72  ? 265 LYS D C     1 
ATOM   8693  O O     . LYS D  1 265 ? 136.372 63.193  99.029  1.00 98.64  ? 265 LYS D O     1 
ATOM   8694  C CB    . LYS D  1 265 ? 133.418 63.204  100.729 1.00 88.52  ? 265 LYS D CB    1 
ATOM   8695  C CG    . LYS D  1 265 ? 133.391 64.504  101.523 1.00 91.41  ? 265 LYS D CG    1 
ATOM   8696  C CD    . LYS D  1 265 ? 132.032 65.177  101.479 1.00 94.35  ? 265 LYS D CD    1 
ATOM   8697  C CE    . LYS D  1 265 ? 132.069 66.533  102.176 1.00 96.29  ? 265 LYS D CE    1 
ATOM   8698  N NZ    . LYS D  1 265 ? 130.731 67.201  102.231 1.00 98.27  ? 265 LYS D NZ    1 
ATOM   8699  N N     . GLY D  1 270 ? 143.890 64.748  101.995 1.00 198.72 ? 270 GLY D N     1 
ATOM   8700  C CA    . GLY D  1 270 ? 144.268 65.603  103.107 1.00 199.17 ? 270 GLY D CA    1 
ATOM   8701  C C     . GLY D  1 270 ? 143.120 66.452  103.629 1.00 199.17 ? 270 GLY D C     1 
ATOM   8702  O O     . GLY D  1 270 ? 142.178 66.751  102.890 1.00 199.17 ? 270 GLY D O     1 
ATOM   8703  N N     . ALA D  1 271 ? 143.208 66.846  104.901 1.00 153.02 ? 271 ALA D N     1 
ATOM   8704  C CA    . ALA D  1 271 ? 142.185 67.663  105.566 1.00 151.45 ? 271 ALA D CA    1 
ATOM   8705  C C     . ALA D  1 271 ? 140.877 66.897  105.751 1.00 150.28 ? 271 ALA D C     1 
ATOM   8706  O O     . ALA D  1 271 ? 139.907 67.435  106.289 1.00 149.78 ? 271 ALA D O     1 
ATOM   8707  C CB    . ALA D  1 271 ? 141.932 68.953  104.783 1.00 122.16 ? 271 ALA D CB    1 
ATOM   8708  N N     . ASP D  1 272 ? 140.868 65.644  105.295 1.00 120.17 ? 272 ASP D N     1 
ATOM   8709  C CA    . ASP D  1 272 ? 139.714 64.751  105.407 1.00 118.40 ? 272 ASP D CA    1 
ATOM   8710  C C     . ASP D  1 272 ? 139.962 63.824  106.593 1.00 116.14 ? 272 ASP D C     1 
ATOM   8711  O O     . ASP D  1 272 ? 139.028 63.391  107.275 1.00 115.66 ? 272 ASP D O     1 
ATOM   8712  C CB    . ASP D  1 272 ? 139.552 63.921  104.127 1.00 183.53 ? 272 ASP D CB    1 
ATOM   8713  C CG    . ASP D  1 272 ? 138.415 62.909  104.218 1.00 185.01 ? 272 ASP D CG    1 
ATOM   8714  O OD1   . ASP D  1 272 ? 138.484 62.001  105.074 1.00 185.52 ? 272 ASP D OD1   1 
ATOM   8715  O OD2   . ASP D  1 272 ? 137.452 63.021  103.428 1.00 185.03 ? 272 ASP D OD2   1 
ATOM   8716  N N     . VAL D  1 273 ? 141.236 63.521  106.824 1.00 123.03 ? 273 VAL D N     1 
ATOM   8717  C CA    . VAL D  1 273 ? 141.635 62.670  107.938 1.00 120.48 ? 273 VAL D CA    1 
ATOM   8718  C C     . VAL D  1 273 ? 141.413 63.461  109.221 1.00 117.41 ? 273 VAL D C     1 
ATOM   8719  O O     . VAL D  1 273 ? 141.497 62.922  110.320 1.00 117.00 ? 273 VAL D O     1 
ATOM   8720  C CB    . VAL D  1 273 ? 143.129 62.261  107.837 1.00 173.34 ? 273 VAL D CB    1 
ATOM   8721  C CG1   . VAL D  1 273 ? 143.340 61.348  106.636 1.00 173.68 ? 273 VAL D CG1   1 
ATOM   8722  C CG2   . VAL D  1 273 ? 144.007 63.498  107.715 1.00 172.89 ? 273 VAL D CG2   1 
ATOM   8723  N N     . SER D  1 274 ? 141.137 64.751  109.061 1.00 119.67 ? 274 SER D N     1 
ATOM   8724  C CA    . SER D  1 274 ? 140.878 65.634  110.189 1.00 116.48 ? 274 SER D CA    1 
ATOM   8725  C C     . SER D  1 274 ? 139.460 65.342  110.649 1.00 113.69 ? 274 SER D C     1 
ATOM   8726  O O     . SER D  1 274 ? 139.123 65.543  111.816 1.00 113.82 ? 274 SER D O     1 
ATOM   8727  C CB    . SER D  1 274 ? 140.980 67.104  109.766 1.00 157.10 ? 274 SER D CB    1 
ATOM   8728  O OG    . SER D  1 274 ? 142.246 67.403  109.201 1.00 158.04 ? 274 SER D OG    1 
ATOM   8729  N N     . ARG D  1 275 ? 138.637 64.866  109.716 1.00 85.02  ? 275 ARG D N     1 
ATOM   8730  C CA    . ARG D  1 275 ? 137.242 64.536  109.998 1.00 80.04  ? 275 ARG D CA    1 
ATOM   8731  C C     . ARG D  1 275 ? 137.097 63.060  110.309 1.00 75.05  ? 275 ARG D C     1 
ATOM   8732  O O     . ARG D  1 275 ? 136.535 62.678  111.343 1.00 73.85  ? 275 ARG D O     1 
ATOM   8733  C CB    . ARG D  1 275 ? 136.359 64.918  108.810 1.00 148.92 ? 275 ARG D CB    1 
ATOM   8734  C CG    . ARG D  1 275 ? 136.245 66.424  108.625 1.00 152.26 ? 275 ARG D CG    1 
ATOM   8735  C CD    . ARG D  1 275 ? 135.358 66.808  107.457 1.00 155.07 ? 275 ARG D CD    1 
ATOM   8736  N NE    . ARG D  1 275 ? 135.911 66.360  106.185 1.00 157.61 ? 275 ARG D NE    1 
ATOM   8737  C CZ    . ARG D  1 275 ? 135.433 66.718  104.999 1.00 158.55 ? 275 ARG D CZ    1 
ATOM   8738  N NH1   . ARG D  1 275 ? 134.390 67.534  104.923 1.00 158.66 ? 275 ARG D NH1   1 
ATOM   8739  N NH2   . ARG D  1 275 ? 135.999 66.263  103.891 1.00 158.88 ? 275 ARG D NH2   1 
ATOM   8740  N N     . GLU D  1 276 ? 137.621 62.231  109.413 1.00 54.71  ? 276 GLU D N     1 
ATOM   8741  C CA    . GLU D  1 276 ? 137.574 60.790  109.598 1.00 49.66  ? 276 GLU D CA    1 
ATOM   8742  C C     . GLU D  1 276 ? 138.277 60.506  110.901 1.00 45.23  ? 276 GLU D C     1 
ATOM   8743  O O     . GLU D  1 276 ? 138.531 59.359  111.257 1.00 45.81  ? 276 GLU D O     1 
ATOM   8744  C CB    . GLU D  1 276 ? 138.309 60.077  108.461 1.00 119.05 ? 276 GLU D CB    1 
ATOM   8745  C CG    . GLU D  1 276 ? 138.322 58.560  108.599 1.00 121.72 ? 276 GLU D CG    1 
ATOM   8746  C CD    . GLU D  1 276 ? 138.786 57.863  107.340 1.00 123.94 ? 276 GLU D CD    1 
ATOM   8747  O OE1   . GLU D  1 276 ? 138.723 56.614  107.287 1.00 125.34 ? 276 GLU D OE1   1 
ATOM   8748  O OE2   . GLU D  1 276 ? 139.214 58.569  106.403 1.00 125.30 ? 276 GLU D OE2   1 
ATOM   8749  N N     . GLY D  1 277 ? 138.596 61.576  111.609 1.00 32.57  ? 277 GLY D N     1 
ATOM   8750  C CA    . GLY D  1 277 ? 139.306 61.445  112.850 1.00 27.72  ? 277 GLY D CA    1 
ATOM   8751  C C     . GLY D  1 277 ? 138.362 61.597  113.982 1.00 24.03  ? 277 GLY D C     1 
ATOM   8752  O O     . GLY D  1 277 ? 138.425 60.851  114.938 1.00 23.42  ? 277 GLY D O     1 
ATOM   8753  N N     . VAL D  1 278 ? 137.482 62.566  113.885 1.00 68.22  ? 278 VAL D N     1 
ATOM   8754  C CA    . VAL D  1 278 ? 136.533 62.752  114.949 1.00 66.34  ? 278 VAL D CA    1 
ATOM   8755  C C     . VAL D  1 278 ? 135.851 61.397  115.244 1.00 65.24  ? 278 VAL D C     1 
ATOM   8756  O O     . VAL D  1 278 ? 135.557 61.069  116.410 1.00 64.94  ? 278 VAL D O     1 
ATOM   8757  C CB    . VAL D  1 278 ? 135.501 63.783  114.533 1.00 52.37  ? 278 VAL D CB    1 
ATOM   8758  C CG1   . VAL D  1 278 ? 134.731 64.263  115.746 1.00 51.78  ? 278 VAL D CG1   1 
ATOM   8759  C CG2   . VAL D  1 278 ? 136.193 64.923  113.833 1.00 52.06  ? 278 VAL D CG2   1 
ATOM   8760  N N     . GLN D  1 279 ? 135.621 60.602  114.193 1.00 28.95  ? 279 GLN D N     1 
ATOM   8761  C CA    . GLN D  1 279 ? 134.976 59.317  114.381 1.00 24.85  ? 279 GLN D CA    1 
ATOM   8762  C C     . GLN D  1 279 ? 135.782 58.553  115.395 1.00 24.94  ? 279 GLN D C     1 
ATOM   8763  O O     . GLN D  1 279 ? 135.292 58.311  116.481 1.00 24.39  ? 279 GLN D O     1 
ATOM   8764  C CB    . GLN D  1 279 ? 134.893 58.568  113.070 1.00 24.02  ? 279 GLN D CB    1 
ATOM   8765  C CG    . GLN D  1 279 ? 134.105 59.307  112.070 1.00 19.16  ? 279 GLN D CG    1 
ATOM   8766  C CD    . GLN D  1 279 ? 133.797 58.470  110.857 1.00 19.46  ? 279 GLN D CD    1 
ATOM   8767  O OE1   . GLN D  1 279 ? 133.260 57.356  110.962 1.00 17.89  ? 279 GLN D OE1   1 
ATOM   8768  N NE2   . GLN D  1 279 ? 134.114 59.004  109.682 1.00 20.21  ? 279 GLN D NE2   1 
ATOM   8769  N N     . ARG D  1 280 ? 137.027 58.221  115.059 1.00 28.07  ? 280 ARG D N     1 
ATOM   8770  C CA    . ARG D  1 280 ? 137.895 57.477  115.969 1.00 30.89  ? 280 ARG D CA    1 
ATOM   8771  C C     . ARG D  1 280 ? 137.895 58.103  117.368 1.00 30.97  ? 280 ARG D C     1 
ATOM   8772  O O     . ARG D  1 280 ? 138.174 57.434  118.378 1.00 30.62  ? 280 ARG D O     1 
ATOM   8773  C CB    . ARG D  1 280 ? 139.338 57.432  115.444 1.00 71.93  ? 280 ARG D CB    1 
ATOM   8774  C CG    . ARG D  1 280 ? 139.504 56.781  114.078 1.00 76.91  ? 280 ARG D CG    1 
ATOM   8775  C CD    . ARG D  1 280 ? 140.081 55.357  114.114 1.00 81.86  ? 280 ARG D CD    1 
ATOM   8776  N NE    . ARG D  1 280 ? 140.096 54.772  112.772 1.00 87.84  ? 280 ARG D NE    1 
ATOM   8777  C CZ    . ARG D  1 280 ? 140.696 55.325  111.714 1.00 90.95  ? 280 ARG D CZ    1 
ATOM   8778  N NH1   . ARG D  1 280 ? 141.350 56.482  111.823 1.00 91.44  ? 280 ARG D NH1   1 
ATOM   8779  N NH2   . ARG D  1 280 ? 140.618 54.735  110.527 1.00 90.98  ? 280 ARG D NH2   1 
ATOM   8780  N N     . ASP D  1 281 ? 137.576 59.393  117.432 1.00 43.49  ? 281 ASP D N     1 
ATOM   8781  C CA    . ASP D  1 281 ? 137.564 60.092  118.707 1.00 42.12  ? 281 ASP D CA    1 
ATOM   8782  C C     . ASP D  1 281 ? 136.298 59.784  119.459 1.00 38.73  ? 281 ASP D C     1 
ATOM   8783  O O     . ASP D  1 281 ? 136.314 59.694  120.672 1.00 39.01  ? 281 ASP D O     1 
ATOM   8784  C CB    . ASP D  1 281 ? 137.709 61.598  118.486 1.00 97.08  ? 281 ASP D CB    1 
ATOM   8785  C CG    . ASP D  1 281 ? 139.140 62.006  118.177 1.00 101.54 ? 281 ASP D CG    1 
ATOM   8786  O OD1   . ASP D  1 281 ? 139.977 61.996  119.108 1.00 103.45 ? 281 ASP D OD1   1 
ATOM   8787  O OD2   . ASP D  1 281 ? 139.425 62.331  117.004 1.00 104.36 ? 281 ASP D OD2   1 
ATOM   8788  N N     . LEU D  1 282 ? 135.204 59.608  118.732 1.00 39.46  ? 282 LEU D N     1 
ATOM   8789  C CA    . LEU D  1 282 ? 133.920 59.301  119.355 1.00 36.25  ? 282 LEU D CA    1 
ATOM   8790  C C     . LEU D  1 282 ? 133.804 57.844  119.809 1.00 35.32  ? 282 LEU D C     1 
ATOM   8791  O O     . LEU D  1 282 ? 133.023 57.533  120.709 1.00 34.87  ? 282 LEU D O     1 
ATOM   8792  C CB    . LEU D  1 282 ? 132.776 59.594  118.380 1.00 25.71  ? 282 LEU D CB    1 
ATOM   8793  C CG    . LEU D  1 282 ? 132.387 61.038  118.041 1.00 24.44  ? 282 LEU D CG    1 
ATOM   8794  C CD1   . LEU D  1 282 ? 131.285 61.005  116.977 1.00 21.69  ? 282 LEU D CD1   1 
ATOM   8795  C CD2   . LEU D  1 282 ? 131.922 61.786  119.304 1.00 23.56  ? 282 LEU D CD2   1 
ATOM   8796  N N     . LEU D  1 283 ? 134.582 56.958  119.186 1.00 34.09  ? 283 LEU D N     1 
ATOM   8797  C CA    . LEU D  1 283 ? 134.537 55.539  119.494 1.00 31.51  ? 283 LEU D CA    1 
ATOM   8798  C C     . LEU D  1 283 ? 134.471 55.242  120.950 1.00 30.99  ? 283 LEU D C     1 
ATOM   8799  O O     . LEU D  1 283 ? 133.499 54.694  121.432 1.00 32.02  ? 283 LEU D O     1 
ATOM   8800  C CB    . LEU D  1 283 ? 135.717 54.827  118.860 1.00 11.58  ? 283 LEU D CB    1 
ATOM   8801  C CG    . LEU D  1 283 ? 135.238 54.552  117.432 1.00 12.85  ? 283 LEU D CG    1 
ATOM   8802  C CD1   . LEU D  1 283 ? 136.373 54.130  116.591 1.00 13.79  ? 283 LEU D CD1   1 
ATOM   8803  C CD2   . LEU D  1 283 ? 134.132 53.478  117.423 1.00 12.76  ? 283 LEU D CD2   1 
ATOM   8804  N N     . PRO D  1 284 ? 135.496 55.630  121.685 1.00 15.50  ? 284 PRO D N     1 
ATOM   8805  C CA    . PRO D  1 284 ? 135.537 55.388  123.126 1.00 15.22  ? 284 PRO D CA    1 
ATOM   8806  C C     . PRO D  1 284 ? 134.217 55.619  123.824 1.00 13.15  ? 284 PRO D C     1 
ATOM   8807  O O     . PRO D  1 284 ? 133.864 54.875  124.720 1.00 13.51  ? 284 PRO D O     1 
ATOM   8808  C CB    . PRO D  1 284 ? 136.610 56.340  123.602 1.00 78.49  ? 284 PRO D CB    1 
ATOM   8809  C CG    . PRO D  1 284 ? 137.545 56.335  122.447 1.00 81.39  ? 284 PRO D CG    1 
ATOM   8810  C CD    . PRO D  1 284 ? 136.630 56.452  121.257 1.00 79.26  ? 284 PRO D CD    1 
ATOM   8811  N N     . LEU D  1 285 ? 133.483 56.645  123.423 1.00 4.89   ? 285 LEU D N     1 
ATOM   8812  C CA    . LEU D  1 285 ? 132.192 56.919  124.050 1.00 5.08   ? 285 LEU D CA    1 
ATOM   8813  C C     . LEU D  1 285 ? 131.194 55.849  123.635 1.00 6.02   ? 285 LEU D C     1 
ATOM   8814  O O     . LEU D  1 285 ? 130.731 55.036  124.452 1.00 4.77   ? 285 LEU D O     1 
ATOM   8815  C CB    . LEU D  1 285 ? 131.671 58.285  123.621 1.00 24.88  ? 285 LEU D CB    1 
ATOM   8816  C CG    . LEU D  1 285 ? 132.240 59.467  124.389 1.00 22.80  ? 285 LEU D CG    1 
ATOM   8817  C CD1   . LEU D  1 285 ? 133.718 59.495  124.209 1.00 23.45  ? 285 LEU D CD1   1 
ATOM   8818  C CD2   . LEU D  1 285 ? 131.642 60.758  123.882 1.00 22.85  ? 285 LEU D CD2   1 
ATOM   8819  N N     . VAL D  1 286 ? 130.871 55.862  122.350 1.00 39.52  ? 286 VAL D N     1 
ATOM   8820  C CA    . VAL D  1 286 ? 129.960 54.893  121.784 1.00 41.95  ? 286 VAL D CA    1 
ATOM   8821  C C     . VAL D  1 286 ? 130.318 53.492  122.269 1.00 44.25  ? 286 VAL D C     1 
ATOM   8822  O O     . VAL D  1 286 ? 129.502 52.808  122.874 1.00 45.01  ? 286 VAL D O     1 
ATOM   8823  C CB    . VAL D  1 286 ? 130.034 54.914  120.261 1.00 11.30  ? 286 VAL D CB    1 
ATOM   8824  C CG1   . VAL D  1 286 ? 129.527 53.631  119.723 1.00 10.46  ? 286 VAL D CG1   1 
ATOM   8825  C CG2   . VAL D  1 286 ? 129.200 56.036  119.718 1.00 10.13  ? 286 VAL D CG2   1 
ATOM   8826  N N     . GLU D  1 287 ? 131.553 53.088  121.999 1.00 21.08  ? 287 GLU D N     1 
ATOM   8827  C CA    . GLU D  1 287 ? 132.093 51.784  122.371 1.00 25.05  ? 287 GLU D CA    1 
ATOM   8828  C C     . GLU D  1 287 ? 132.148 51.527  123.864 1.00 25.73  ? 287 GLU D C     1 
ATOM   8829  O O     . GLU D  1 287 ? 132.347 50.399  124.283 1.00 26.62  ? 287 GLU D O     1 
ATOM   8830  C CB    . GLU D  1 287 ? 133.504 51.625  121.808 1.00 120.22 ? 287 GLU D CB    1 
ATOM   8831  C CG    . GLU D  1 287 ? 133.639 50.561  120.740 1.00 129.12 ? 287 GLU D CG    1 
ATOM   8832  C CD    . GLU D  1 287 ? 135.068 50.411  120.267 1.00 133.62 ? 287 GLU D CD    1 
ATOM   8833  O OE1   . GLU D  1 287 ? 135.931 50.041  121.094 1.00 136.63 ? 287 GLU D OE1   1 
ATOM   8834  O OE2   . GLU D  1 287 ? 135.327 50.666  119.071 1.00 134.27 ? 287 GLU D OE2   1 
ATOM   8835  N N     . GLY D  1 288 ? 132.005 52.563  124.677 1.00 44.01  ? 288 GLY D N     1 
ATOM   8836  C CA    . GLY D  1 288 ? 132.016 52.327  126.107 1.00 45.75  ? 288 GLY D CA    1 
ATOM   8837  C C     . GLY D  1 288 ? 133.345 52.480  126.812 1.00 47.96  ? 288 GLY D C     1 
ATOM   8838  O O     . GLY D  1 288 ? 134.236 51.644  126.708 1.00 48.20  ? 288 GLY D O     1 
ATOM   8839  N N     . SER D  1 289 ? 133.459 53.571  127.554 1.00 59.57  ? 289 SER D N     1 
ATOM   8840  C CA    . SER D  1 289 ? 134.654 53.891  128.301 1.00 60.62  ? 289 SER D CA    1 
ATOM   8841  C C     . SER D  1 289 ? 134.180 54.737  129.463 1.00 61.27  ? 289 SER D C     1 
ATOM   8842  O O     . SER D  1 289 ? 132.980 54.888  129.679 1.00 61.58  ? 289 SER D O     1 
ATOM   8843  C CB    . SER D  1 289 ? 135.615 54.701  127.436 1.00 75.74  ? 289 SER D CB    1 
ATOM   8844  O OG    . SER D  1 289 ? 135.026 55.932  127.053 1.00 76.61  ? 289 SER D OG    1 
ATOM   8845  N N     . THR D  1 290 ? 135.119 55.314  130.193 1.00 39.14  ? 290 THR D N     1 
ATOM   8846  C CA    . THR D  1 290 ? 134.783 56.124  131.349 1.00 40.29  ? 290 THR D CA    1 
ATOM   8847  C C     . THR D  1 290 ? 135.350 57.494  131.128 1.00 42.23  ? 290 THR D C     1 
ATOM   8848  O O     . THR D  1 290 ? 136.370 57.613  130.463 1.00 43.30  ? 290 THR D O     1 
ATOM   8849  C CB    . THR D  1 290 ? 135.457 55.569  132.605 1.00 34.01  ? 290 THR D CB    1 
ATOM   8850  O OG1   . THR D  1 290 ? 135.225 54.147  132.698 1.00 32.61  ? 290 THR D OG1   1 
ATOM   8851  C CG2   . THR D  1 290 ? 134.946 56.308  133.846 1.00 32.59  ? 290 THR D CG2   1 
ATOM   8852  N N     . VAL D  1 291 ? 134.700 58.532  131.648 1.00 44.46  ? 291 VAL D N     1 
ATOM   8853  C CA    . VAL D  1 291 ? 135.258 59.886  131.520 1.00 45.83  ? 291 VAL D CA    1 
ATOM   8854  C C     . VAL D  1 291 ? 135.044 60.577  132.846 1.00 47.01  ? 291 VAL D C     1 
ATOM   8855  O O     . VAL D  1 291 ? 133.998 60.425  133.465 1.00 46.63  ? 291 VAL D O     1 
ATOM   8856  C CB    . VAL D  1 291 ? 134.619 60.768  130.368 1.00 44.87  ? 291 VAL D CB    1 
ATOM   8857  C CG1   . VAL D  1 291 ? 134.473 59.953  129.084 1.00 44.76  ? 291 VAL D CG1   1 
ATOM   8858  C CG2   . VAL D  1 291 ? 133.302 61.379  130.814 1.00 43.99  ? 291 VAL D CG2   1 
ATOM   8859  N N     . SER D  1 292 ? 136.047 61.313  133.294 1.00 46.21  ? 292 SER D N     1 
ATOM   8860  C CA    . SER D  1 292 ? 135.937 62.013  134.554 1.00 48.78  ? 292 SER D CA    1 
ATOM   8861  C C     . SER D  1 292 ? 135.163 63.321  134.462 1.00 49.96  ? 292 SER D C     1 
ATOM   8862  O O     . SER D  1 292 ? 135.510 64.220  133.687 1.00 50.34  ? 292 SER D O     1 
ATOM   8863  C CB    . SER D  1 292 ? 137.314 62.308  135.120 1.00 101.82 ? 292 SER D CB    1 
ATOM   8864  O OG    . SER D  1 292 ? 137.196 63.177  136.233 1.00 105.43 ? 292 SER D OG    1 
ATOM   8865  N N     . THR D  1 293 ? 134.126 63.425  135.283 1.00 56.66  ? 293 THR D N     1 
ATOM   8866  C CA    . THR D  1 293 ? 133.290 64.611  135.332 1.00 58.06  ? 293 THR D CA    1 
ATOM   8867  C C     . THR D  1 293 ? 133.458 65.222  136.702 1.00 58.97  ? 293 THR D C     1 
ATOM   8868  O O     . THR D  1 293 ? 133.824 64.528  137.652 1.00 58.49  ? 293 THR D O     1 
ATOM   8869  C CB    . THR D  1 293 ? 131.829 64.246  135.190 1.00 70.45  ? 293 THR D CB    1 
ATOM   8870  O OG1   . THR D  1 293 ? 131.482 63.334  136.241 1.00 70.34  ? 293 THR D OG1   1 
ATOM   8871  C CG2   . THR D  1 293 ? 131.569 63.599  133.833 1.00 71.23  ? 293 THR D CG2   1 
ATOM   8872  N N     . LYS D  1 294 ? 133.157 66.508  136.817 1.00 85.39  ? 294 LYS D N     1 
ATOM   8873  C CA    . LYS D  1 294 ? 133.282 67.177  138.101 1.00 85.93  ? 294 LYS D CA    1 
ATOM   8874  C C     . LYS D  1 294 ? 132.374 66.618  139.178 1.00 85.97  ? 294 LYS D C     1 
ATOM   8875  O O     . LYS D  1 294 ? 132.266 67.194  140.255 1.00 86.51  ? 294 LYS D O     1 
ATOM   8876  C CB    . LYS D  1 294 ? 133.002 68.667  137.962 1.00 52.83  ? 294 LYS D CB    1 
ATOM   8877  C CG    . LYS D  1 294 ? 131.573 69.095  137.709 1.00 52.29  ? 294 LYS D CG    1 
ATOM   8878  C CD    . LYS D  1 294 ? 131.567 70.619  137.710 1.00 53.94  ? 294 LYS D CD    1 
ATOM   8879  C CE    . LYS D  1 294 ? 130.284 71.224  137.202 1.00 55.94  ? 294 LYS D CE    1 
ATOM   8880  N NZ    . LYS D  1 294 ? 130.463 72.704  137.004 1.00 57.33  ? 294 LYS D NZ    1 
ATOM   8881  N N     . HIS D  1 295 ? 131.728 65.495  138.894 1.00 53.57  ? 295 HIS D N     1 
ATOM   8882  C CA    . HIS D  1 295 ? 130.813 64.891  139.852 1.00 53.72  ? 295 HIS D CA    1 
ATOM   8883  C C     . HIS D  1 295 ? 131.278 63.484  140.164 1.00 53.43  ? 295 HIS D C     1 
ATOM   8884  O O     . HIS D  1 295 ? 130.739 62.806  141.049 1.00 52.73  ? 295 HIS D O     1 
ATOM   8885  C CB    . HIS D  1 295 ? 129.382 64.875  139.280 1.00 86.68  ? 295 HIS D CB    1 
ATOM   8886  C CG    . HIS D  1 295 ? 128.810 66.240  139.030 1.00 87.84  ? 295 HIS D CG    1 
ATOM   8887  N ND1   . HIS D  1 295 ? 128.501 67.115  140.050 1.00 88.01  ? 295 HIS D ND1   1 
ATOM   8888  C CD2   . HIS D  1 295 ? 128.513 66.887  137.877 1.00 88.92  ? 295 HIS D CD2   1 
ATOM   8889  C CE1   . HIS D  1 295 ? 128.042 68.243  139.536 1.00 88.84  ? 295 HIS D CE1   1 
ATOM   8890  N NE2   . HIS D  1 295 ? 128.038 68.131  138.220 1.00 88.97  ? 295 HIS D NE2   1 
ATOM   8891  N N     . GLY D  1 296 ? 132.295 63.052  139.432 1.00 100.17 ? 296 GLY D N     1 
ATOM   8892  C CA    . GLY D  1 296 ? 132.819 61.720  139.634 1.00 100.08 ? 296 GLY D CA    1 
ATOM   8893  C C     . GLY D  1 296 ? 133.026 61.042  138.306 1.00 99.07  ? 296 GLY D C     1 
ATOM   8894  O O     . GLY D  1 296 ? 133.100 61.697  137.266 1.00 100.22 ? 296 GLY D O     1 
ATOM   8895  N N     . MET D  1 297 ? 133.099 59.722  138.338 1.00 63.25  ? 297 MET D N     1 
ATOM   8896  C CA    . MET D  1 297 ? 133.325 58.966  137.120 1.00 62.86  ? 297 MET D CA    1 
ATOM   8897  C C     . MET D  1 297 ? 132.049 58.408  136.481 1.00 60.50  ? 297 MET D C     1 
ATOM   8898  O O     . MET D  1 297 ? 131.278 57.708  137.131 1.00 60.96  ? 297 MET D O     1 
ATOM   8899  C CB    . MET D  1 297 ? 134.292 57.808  137.412 1.00 124.83 ? 297 MET D CB    1 
ATOM   8900  C CG    . MET D  1 297 ? 135.633 58.215  138.009 1.00 127.31 ? 297 MET D CG    1 
ATOM   8901  S SD    . MET D  1 297 ? 136.613 59.167  136.853 1.00 130.93 ? 297 MET D SD    1 
ATOM   8902  C CE    . MET D  1 297 ? 137.206 57.888  135.768 1.00 130.77 ? 297 MET D CE    1 
ATOM   8903  N N     . VAL D  1 298 ? 131.826 58.699  135.207 1.00 41.27  ? 298 VAL D N     1 
ATOM   8904  C CA    . VAL D  1 298 ? 130.655 58.152  134.551 1.00 38.36  ? 298 VAL D CA    1 
ATOM   8905  C C     . VAL D  1 298 ? 131.092 57.259  133.391 1.00 37.31  ? 298 VAL D C     1 
ATOM   8906  O O     . VAL D  1 298 ? 132.135 57.515  132.762 1.00 36.70  ? 298 VAL D O     1 
ATOM   8907  C CB    . VAL D  1 298 ? 129.755 59.250  134.038 1.00 43.35  ? 298 VAL D CB    1 
ATOM   8908  C CG1   . VAL D  1 298 ? 129.463 60.218  135.152 1.00 41.83  ? 298 VAL D CG1   1 
ATOM   8909  C CG2   . VAL D  1 298 ? 130.406 59.938  132.875 1.00 45.06  ? 298 VAL D CG2   1 
ATOM   8910  N N     . LYS D  1 299 ? 130.302 56.217  133.115 1.00 42.21  ? 299 LYS D N     1 
ATOM   8911  C CA    . LYS D  1 299 ? 130.620 55.274  132.053 1.00 40.80  ? 299 LYS D CA    1 
ATOM   8912  C C     . LYS D  1 299 ? 129.690 55.330  130.855 1.00 39.70  ? 299 LYS D C     1 
ATOM   8913  O O     . LYS D  1 299 ? 128.486 55.081  130.958 1.00 40.56  ? 299 LYS D O     1 
ATOM   8914  C CB    . LYS D  1 299 ? 130.625 53.864  132.610 1.00 78.37  ? 299 LYS D CB    1 
ATOM   8915  C CG    . LYS D  1 299 ? 131.256 53.763  133.970 1.00 80.89  ? 299 LYS D CG    1 
ATOM   8916  C CD    . LYS D  1 299 ? 131.748 52.345  134.247 1.00 85.11  ? 299 LYS D CD    1 
ATOM   8917  C CE    . LYS D  1 299 ? 130.624 51.304  134.265 1.00 87.80  ? 299 LYS D CE    1 
ATOM   8918  N NZ    . LYS D  1 299 ? 131.130 49.896  134.453 1.00 89.03  ? 299 LYS D NZ    1 
ATOM   8919  N N     . THR D  1 300 ? 130.269 55.639  129.706 1.00 40.96  ? 300 THR D N     1 
ATOM   8920  C CA    . THR D  1 300 ? 129.519 55.725  128.468 1.00 39.83  ? 300 THR D CA    1 
ATOM   8921  C C     . THR D  1 300 ? 128.994 54.355  128.028 1.00 39.72  ? 300 THR D C     1 
ATOM   8922  O O     . THR D  1 300 ? 128.262 54.247  127.041 1.00 39.09  ? 300 THR D O     1 
ATOM   8923  C CB    . THR D  1 300 ? 130.414 56.251  127.348 1.00 45.81  ? 300 THR D CB    1 
ATOM   8924  O OG1   . THR D  1 300 ? 131.501 55.344  127.160 1.00 45.41  ? 300 THR D OG1   1 
ATOM   8925  C CG2   . THR D  1 300 ? 130.977 57.605  127.698 1.00 44.89  ? 300 THR D CG2   1 
ATOM   8926  N N     . ASP D  1 301 ? 129.368 53.307  128.755 1.00 56.39  ? 301 ASP D N     1 
ATOM   8927  C CA    . ASP D  1 301 ? 128.959 51.951  128.393 1.00 55.57  ? 301 ASP D CA    1 
ATOM   8928  C C     . ASP D  1 301 ? 127.517 51.826  127.965 1.00 53.14  ? 301 ASP D C     1 
ATOM   8929  O O     . ASP D  1 301 ? 127.220 51.294  126.896 1.00 52.81  ? 301 ASP D O     1 
ATOM   8930  C CB    . ASP D  1 301 ? 129.232 50.980  129.543 1.00 107.80 ? 301 ASP D CB    1 
ATOM   8931  C CG    . ASP D  1 301 ? 130.638 50.413  129.498 1.00 112.50 ? 301 ASP D CG    1 
ATOM   8932  O OD1   . ASP D  1 301 ? 131.592 51.121  129.876 1.00 114.52 ? 301 ASP D OD1   1 
ATOM   8933  O OD2   . ASP D  1 301 ? 130.796 49.256  129.064 1.00 114.94 ? 301 ASP D OD2   1 
ATOM   8934  N N     . HIS D  1 302 ? 126.633 52.365  128.791 1.00 37.92  ? 302 HIS D N     1 
ATOM   8935  C CA    . HIS D  1 302 ? 125.209 52.275  128.550 1.00 34.91  ? 302 HIS D CA    1 
ATOM   8936  C C     . HIS D  1 302 ? 124.448 53.497  128.050 1.00 32.62  ? 302 HIS D C     1 
ATOM   8937  O O     . HIS D  1 302 ? 123.229 53.510  128.048 1.00 33.10  ? 302 HIS D O     1 
ATOM   8938  C CB    . HIS D  1 302 ? 124.558 51.741  129.819 1.00 48.26  ? 302 HIS D CB    1 
ATOM   8939  C CG    . HIS D  1 302 ? 124.910 50.311  130.108 1.00 49.74  ? 302 HIS D CG    1 
ATOM   8940  N ND1   . HIS D  1 302 ? 124.859 49.322  129.145 1.00 49.87  ? 302 HIS D ND1   1 
ATOM   8941  C CD2   . HIS D  1 302 ? 125.280 49.696  131.256 1.00 50.79  ? 302 HIS D CD2   1 
ATOM   8942  C CE1   . HIS D  1 302 ? 125.178 48.161  129.688 1.00 49.31  ? 302 HIS D CE1   1 
ATOM   8943  N NE2   . HIS D  1 302 ? 125.437 48.359  130.968 1.00 50.41  ? 302 HIS D NE2   1 
ATOM   8944  N N     . ILE D  1 303 ? 125.155 54.527  127.623 1.00 25.15  ? 303 ILE D N     1 
ATOM   8945  C CA    . ILE D  1 303 ? 124.500 55.722  127.111 1.00 20.68  ? 303 ILE D CA    1 
ATOM   8946  C C     . ILE D  1 303 ? 123.829 55.377  125.780 1.00 17.58  ? 303 ILE D C     1 
ATOM   8947  O O     . ILE D  1 303 ? 124.376 54.626  124.992 1.00 18.25  ? 303 ILE D O     1 
ATOM   8948  C CB    . ILE D  1 303 ? 125.544 56.826  126.847 1.00 23.30  ? 303 ILE D CB    1 
ATOM   8949  C CG1   . ILE D  1 303 ? 126.300 57.179  128.134 1.00 21.70  ? 303 ILE D CG1   1 
ATOM   8950  C CG2   . ILE D  1 303 ? 124.867 58.013  126.209 1.00 23.77  ? 303 ILE D CG2   1 
ATOM   8951  C CD1   . ILE D  1 303 ? 125.435 57.715  129.216 1.00 20.60  ? 303 ILE D CD1   1 
ATOM   8952  N N     . LEU D  1 304 ? 122.640 55.890  125.522 1.00 12.96  ? 304 LEU D N     1 
ATOM   8953  C CA    . LEU D  1 304 ? 122.021 55.626  124.229 1.00 11.09  ? 304 LEU D CA    1 
ATOM   8954  C C     . LEU D  1 304 ? 122.464 56.759  123.250 1.00 10.68  ? 304 LEU D C     1 
ATOM   8955  O O     . LEU D  1 304 ? 122.329 57.948  123.543 1.00 11.32  ? 304 LEU D O     1 
ATOM   8956  C CB    . LEU D  1 304 ? 120.489 55.593  124.352 1.00 15.33  ? 304 LEU D CB    1 
ATOM   8957  C CG    . LEU D  1 304 ? 119.783 55.797  122.994 1.00 14.41  ? 304 LEU D CG    1 
ATOM   8958  C CD1   . LEU D  1 304 ? 120.253 54.728  122.016 1.00 14.54  ? 304 LEU D CD1   1 
ATOM   8959  C CD2   . LEU D  1 304 ? 118.300 55.741  123.130 1.00 10.23  ? 304 LEU D CD2   1 
ATOM   8960  N N     . PHE D  1 305 ? 123.009 56.394  122.096 1.00 16.48  ? 305 PHE D N     1 
ATOM   8961  C CA    . PHE D  1 305 ? 123.463 57.389  121.135 1.00 14.51  ? 305 PHE D CA    1 
ATOM   8962  C C     . PHE D  1 305 ? 122.587 57.458  119.910 1.00 14.18  ? 305 PHE D C     1 
ATOM   8963  O O     . PHE D  1 305 ? 122.287 56.446  119.285 1.00 16.23  ? 305 PHE D O     1 
ATOM   8964  C CB    . PHE D  1 305 ? 124.886 57.076  120.675 1.00 28.56  ? 305 PHE D CB    1 
ATOM   8965  C CG    . PHE D  1 305 ? 125.917 57.321  121.711 1.00 30.81  ? 305 PHE D CG    1 
ATOM   8966  C CD1   . PHE D  1 305 ? 126.298 56.327  122.576 1.00 33.13  ? 305 PHE D CD1   1 
ATOM   8967  C CD2   . PHE D  1 305 ? 126.488 58.570  121.849 1.00 32.36  ? 305 PHE D CD2   1 
ATOM   8968  C CE1   . PHE D  1 305 ? 127.244 56.583  123.571 1.00 34.50  ? 305 PHE D CE1   1 
ATOM   8969  C CE2   . PHE D  1 305 ? 127.426 58.830  122.836 1.00 32.67  ? 305 PHE D CE2   1 
ATOM   8970  C CZ    . PHE D  1 305 ? 127.805 57.838  123.696 1.00 32.91  ? 305 PHE D CZ    1 
ATOM   8971  N N     . ILE D  1 306 ? 122.175 58.653  119.540 1.00 10.47  ? 306 ILE D N     1 
ATOM   8972  C CA    . ILE D  1 306 ? 121.362 58.781  118.337 1.00 9.48   ? 306 ILE D CA    1 
ATOM   8973  C C     . ILE D  1 306 ? 122.143 59.694  117.406 1.00 9.25   ? 306 ILE D C     1 
ATOM   8974  O O     . ILE D  1 306 ? 122.380 60.848  117.743 1.00 8.59   ? 306 ILE D O     1 
ATOM   8975  C CB    . ILE D  1 306 ? 119.977 59.418  118.639 1.00 1.36   ? 306 ILE D CB    1 
ATOM   8976  C CG1   . ILE D  1 306 ? 119.170 58.552  119.586 1.00 1.00   ? 306 ILE D CG1   1 
ATOM   8977  C CG2   . ILE D  1 306 ? 119.179 59.577  117.371 1.00 1.00   ? 306 ILE D CG2   1 
ATOM   8978  C CD1   . ILE D  1 306 ? 117.961 59.279  120.066 1.00 1.00   ? 306 ILE D CD1   1 
ATOM   8979  N N     . ALA D  1 307 ? 122.564 59.180  116.257 1.00 16.39  ? 307 ALA D N     1 
ATOM   8980  C CA    . ALA D  1 307 ? 123.321 59.982  115.310 1.00 16.70  ? 307 ALA D CA    1 
ATOM   8981  C C     . ALA D  1 307 ? 122.393 60.357  114.198 1.00 17.01  ? 307 ALA D C     1 
ATOM   8982  O O     . ALA D  1 307 ? 121.495 59.591  113.874 1.00 18.68  ? 307 ALA D O     1 
ATOM   8983  C CB    . ALA D  1 307 ? 124.443 59.203  114.768 1.00 1.00   ? 307 ALA D CB    1 
ATOM   8984  N N     . SER D  1 308 ? 122.599 61.522  113.598 1.00 6.90   ? 308 SER D N     1 
ATOM   8985  C CA    . SER D  1 308 ? 121.703 61.937  112.540 1.00 6.85   ? 308 SER D CA    1 
ATOM   8986  C C     . SER D  1 308 ? 122.534 62.507  111.462 1.00 7.26   ? 308 SER D C     1 
ATOM   8987  O O     . SER D  1 308 ? 123.628 62.950  111.733 1.00 7.84   ? 308 SER D O     1 
ATOM   8988  C CB    . SER D  1 308 ? 120.770 63.030  113.022 1.00 35.33  ? 308 SER D CB    1 
ATOM   8989  O OG    . SER D  1 308 ? 121.411 64.281  112.891 1.00 38.56  ? 308 SER D OG    1 
ATOM   8990  N N     . GLY D  1 309 ? 122.005 62.534  110.250 1.00 10.40  ? 309 GLY D N     1 
ATOM   8991  C CA    . GLY D  1 309 ? 122.750 63.089  109.152 1.00 10.94  ? 309 GLY D CA    1 
ATOM   8992  C C     . GLY D  1 309 ? 121.907 63.015  107.917 1.00 11.82  ? 309 GLY D C     1 
ATOM   8993  O O     . GLY D  1 309 ? 121.029 62.166  107.838 1.00 12.23  ? 309 GLY D O     1 
ATOM   8994  N N     . ALA D  1 310 ? 122.172 63.900  106.956 1.00 5.39   ? 310 ALA D N     1 
ATOM   8995  C CA    . ALA D  1 310 ? 121.431 63.948  105.700 1.00 6.03   ? 310 ALA D CA    1 
ATOM   8996  C C     . ALA D  1 310 ? 121.934 62.868  104.789 1.00 8.39   ? 310 ALA D C     1 
ATOM   8997  O O     . ALA D  1 310 ? 121.150 62.137  104.205 1.00 8.83   ? 310 ALA D O     1 
ATOM   8998  C CB    . ALA D  1 310 ? 121.619 65.302  105.040 1.00 60.04  ? 310 ALA D CB    1 
ATOM   8999  N N     . PHE D  1 311 ? 123.255 62.793  104.672 1.00 39.68  ? 311 PHE D N     1 
ATOM   9000  C CA    . PHE D  1 311 ? 123.902 61.808  103.830 1.00 43.86  ? 311 PHE D CA    1 
ATOM   9001  C C     . PHE D  1 311 ? 123.551 61.996  102.364 1.00 48.74  ? 311 PHE D C     1 
ATOM   9002  O O     . PHE D  1 311 ? 123.128 61.041  101.708 1.00 50.52  ? 311 PHE D O     1 
ATOM   9003  C CB    . PHE D  1 311 ? 123.508 60.399  104.269 1.00 10.34  ? 311 PHE D CB    1 
ATOM   9004  C CG    . PHE D  1 311 ? 124.180 59.952  105.522 1.00 8.01   ? 311 PHE D CG    1 
ATOM   9005  C CD1   . PHE D  1 311 ? 125.457 59.400  105.487 1.00 6.98   ? 311 PHE D CD1   1 
ATOM   9006  C CD2   . PHE D  1 311 ? 123.577 60.136  106.747 1.00 7.76   ? 311 PHE D CD2   1 
ATOM   9007  C CE1   . PHE D  1 311 ? 126.133 59.040  106.664 1.00 6.59   ? 311 PHE D CE1   1 
ATOM   9008  C CE2   . PHE D  1 311 ? 124.242 59.782  107.925 1.00 7.79   ? 311 PHE D CE2   1 
ATOM   9009  C CZ    . PHE D  1 311 ? 125.528 59.233  107.879 1.00 7.07   ? 311 PHE D CZ    1 
ATOM   9010  N N     . GLN D  1 312 ? 123.718 63.210  101.841 1.00 57.34  ? 312 GLN D N     1 
ATOM   9011  C CA    . GLN D  1 312 ? 123.401 63.421  100.434 1.00 62.20  ? 312 GLN D CA    1 
ATOM   9012  C C     . GLN D  1 312 ? 124.600 63.082  99.567  1.00 64.56  ? 312 GLN D C     1 
ATOM   9013  O O     . GLN D  1 312 ? 124.457 62.712  98.395  1.00 65.18  ? 312 GLN D O     1 
ATOM   9014  C CB    . GLN D  1 312 ? 122.921 64.861  100.164 1.00 80.73  ? 312 GLN D CB    1 
ATOM   9015  C CG    . GLN D  1 312 ? 123.395 65.950  101.139 1.00 83.28  ? 312 GLN D CG    1 
ATOM   9016  C CD    . GLN D  1 312 ? 122.720 67.312  100.875 1.00 82.69  ? 312 GLN D CD    1 
ATOM   9017  O OE1   . GLN D  1 312 ? 121.490 67.416  100.819 1.00 82.34  ? 312 GLN D OE1   1 
ATOM   9018  N NE2   . GLN D  1 312 ? 123.527 68.353  100.720 1.00 81.12  ? 312 GLN D NE2   1 
ATOM   9019  N N     . VAL D  1 313 ? 125.785 63.185  100.162 1.00 39.29  ? 313 VAL D N     1 
ATOM   9020  C CA    . VAL D  1 313 ? 127.029 62.888  99.463  1.00 41.01  ? 313 VAL D CA    1 
ATOM   9021  C C     . VAL D  1 313 ? 127.618 61.592  99.936  1.00 41.21  ? 313 VAL D C     1 
ATOM   9022  O O     . VAL D  1 313 ? 128.080 60.805  99.142  1.00 42.43  ? 313 VAL D O     1 
ATOM   9023  C CB    . VAL D  1 313 ? 128.054 63.956  99.702  1.00 56.97  ? 313 VAL D CB    1 
ATOM   9024  C CG1   . VAL D  1 313 ? 127.871 65.070  98.681  1.00 59.23  ? 313 VAL D CG1   1 
ATOM   9025  C CG2   . VAL D  1 313 ? 127.922 64.464  101.154 1.00 58.23  ? 313 VAL D CG2   1 
ATOM   9026  N N     . ALA D  1 314 ? 127.616 61.374  101.238 1.00 46.42  ? 314 ALA D N     1 
ATOM   9027  C CA    . ALA D  1 314 ? 128.150 60.135  101.772 1.00 48.13  ? 314 ALA D CA    1 
ATOM   9028  C C     . ALA D  1 314 ? 127.042 59.117  102.121 1.00 48.68  ? 314 ALA D C     1 
ATOM   9029  O O     . ALA D  1 314 ? 125.876 59.479  102.318 1.00 48.64  ? 314 ALA D O     1 
ATOM   9030  C CB    . ALA D  1 314 ? 129.002 60.435  103.005 1.00 65.55  ? 314 ALA D CB    1 
ATOM   9031  N N     . ARG D  1 315 ? 127.415 57.838  102.157 1.00 25.13  ? 315 ARG D N     1 
ATOM   9032  C CA    . ARG D  1 315 ? 126.513 56.757  102.527 1.00 25.99  ? 315 ARG D CA    1 
ATOM   9033  C C     . ARG D  1 315 ? 126.910 56.487  103.996 1.00 23.39  ? 315 ARG D C     1 
ATOM   9034  O O     . ARG D  1 315 ? 128.043 56.772  104.382 1.00 23.01  ? 315 ARG D O     1 
ATOM   9035  C CB    . ARG D  1 315 ? 126.788 55.540  101.648 1.00 150.94 ? 315 ARG D CB    1 
ATOM   9036  C CG    . ARG D  1 315 ? 126.528 55.784  100.166 1.00 159.68 ? 315 ARG D CG    1 
ATOM   9037  C CD    . ARG D  1 315 ? 127.699 55.336  99.274  1.00 167.31 ? 315 ARG D CD    1 
ATOM   9038  N NE    . ARG D  1 315 ? 128.838 56.260  99.315  1.00 172.45 ? 315 ARG D NE    1 
ATOM   9039  C CZ    . ARG D  1 315 ? 129.921 56.165  98.541  1.00 174.25 ? 315 ARG D CZ    1 
ATOM   9040  N NH1   . ARG D  1 315 ? 130.024 55.183  97.653  1.00 175.89 ? 315 ARG D NH1   1 
ATOM   9041  N NH2   . ARG D  1 315 ? 130.904 57.054  98.652  1.00 173.84 ? 315 ARG D NH2   1 
ATOM   9042  N N     . PRO D  1 316 ? 125.991 55.971  104.841 1.00 32.55  ? 316 PRO D N     1 
ATOM   9043  C CA    . PRO D  1 316 ? 126.449 55.753  106.209 1.00 31.66  ? 316 PRO D CA    1 
ATOM   9044  C C     . PRO D  1 316 ? 127.555 54.736  106.184 1.00 31.99  ? 316 PRO D C     1 
ATOM   9045  O O     . PRO D  1 316 ? 128.456 54.761  107.025 1.00 31.83  ? 316 PRO D O     1 
ATOM   9046  C CB    . PRO D  1 316 ? 125.198 55.259  106.915 1.00 13.94  ? 316 PRO D CB    1 
ATOM   9047  C CG    . PRO D  1 316 ? 124.130 56.032  106.241 1.00 14.67  ? 316 PRO D CG    1 
ATOM   9048  C CD    . PRO D  1 316 ? 124.533 55.795  104.778 1.00 16.61  ? 316 PRO D CD    1 
ATOM   9049  N N     . SER D  1 317 ? 127.492 53.860  105.184 1.00 57.36  ? 317 SER D N     1 
ATOM   9050  C CA    . SER D  1 317 ? 128.491 52.814  104.967 1.00 56.37  ? 317 SER D CA    1 
ATOM   9051  C C     . SER D  1 317 ? 129.834 53.432  104.594 1.00 54.54  ? 317 SER D C     1 
ATOM   9052  O O     . SER D  1 317 ? 130.674 52.785  103.976 1.00 55.07  ? 317 SER D O     1 
ATOM   9053  C CB    . SER D  1 317 ? 128.040 51.898  103.834 1.00 87.41  ? 317 SER D CB    1 
ATOM   9054  O OG    . SER D  1 317 ? 127.876 52.628  102.630 1.00 90.90  ? 317 SER D OG    1 
ATOM   9055  N N     . ASP D  1 318 ? 130.015 54.698  104.950 1.00 31.71  ? 318 ASP D N     1 
ATOM   9056  C CA    . ASP D  1 318 ? 131.237 55.401  104.663 1.00 28.50  ? 318 ASP D CA    1 
ATOM   9057  C C     . ASP D  1 318 ? 131.880 55.783  105.954 1.00 25.06  ? 318 ASP D C     1 
ATOM   9058  O O     . ASP D  1 318 ? 132.938 56.382  105.943 1.00 24.34  ? 318 ASP D O     1 
ATOM   9059  C CB    . ASP D  1 318 ? 130.969 56.639  103.822 1.00 80.84  ? 318 ASP D CB    1 
ATOM   9060  C CG    . ASP D  1 318 ? 131.299 56.413  102.368 1.00 86.33  ? 318 ASP D CG    1 
ATOM   9061  O OD1   . ASP D  1 318 ? 131.258 55.236  101.954 1.00 85.26  ? 318 ASP D OD1   1 
ATOM   9062  O OD2   . ASP D  1 318 ? 131.594 57.390  101.638 1.00 90.78  ? 318 ASP D OD2   1 
ATOM   9063  N N     . LEU D  1 319 ? 131.249 55.465  107.078 1.00 41.68  ? 319 LEU D N     1 
ATOM   9064  C CA    . LEU D  1 319 ? 131.872 55.782  108.360 1.00 39.78  ? 319 LEU D CA    1 
ATOM   9065  C C     . LEU D  1 319 ? 132.860 54.665  108.626 1.00 40.02  ? 319 LEU D C     1 
ATOM   9066  O O     . LEU D  1 319 ? 132.892 53.662  107.896 1.00 40.41  ? 319 LEU D O     1 
ATOM   9067  C CB    . LEU D  1 319 ? 130.865 55.777  109.479 1.00 15.98  ? 319 LEU D CB    1 
ATOM   9068  C CG    . LEU D  1 319 ? 129.646 56.607  109.200 1.00 13.72  ? 319 LEU D CG    1 
ATOM   9069  C CD1   . LEU D  1 319 ? 128.432 55.993  109.860 1.00 13.38  ? 319 LEU D CD1   1 
ATOM   9070  C CD2   . LEU D  1 319 ? 129.922 58.006  109.719 1.00 13.61  ? 319 LEU D CD2   1 
ATOM   9071  N N     . ILE D  1 320 ? 133.659 54.824  109.674 1.00 43.69  ? 320 ILE D N     1 
ATOM   9072  C CA    . ILE D  1 320 ? 134.637 53.802  110.010 1.00 41.98  ? 320 ILE D CA    1 
ATOM   9073  C C     . ILE D  1 320 ? 133.861 52.589  110.516 1.00 42.30  ? 320 ILE D C     1 
ATOM   9074  O O     . ILE D  1 320 ? 132.896 52.739  111.260 1.00 42.29  ? 320 ILE D O     1 
ATOM   9075  C CB    . ILE D  1 320 ? 135.611 54.297  111.102 1.00 9.79   ? 320 ILE D CB    1 
ATOM   9076  C CG1   . ILE D  1 320 ? 134.822 54.697  112.347 1.00 8.92   ? 320 ILE D CG1   1 
ATOM   9077  C CG2   . ILE D  1 320 ? 136.400 55.486  110.594 1.00 9.13   ? 320 ILE D CG2   1 
ATOM   9078  C CD1   . ILE D  1 320 ? 135.650 55.205  113.493 1.00 7.49   ? 320 ILE D CD1   1 
ATOM   9079  N N     . PRO D  1 321 ? 134.263 51.372  110.098 1.00 23.77  ? 321 PRO D N     1 
ATOM   9080  C CA    . PRO D  1 321 ? 133.635 50.111  110.482 1.00 22.46  ? 321 PRO D CA    1 
ATOM   9081  C C     . PRO D  1 321 ? 133.422 50.034  111.963 1.00 22.69  ? 321 PRO D C     1 
ATOM   9082  O O     . PRO D  1 321 ? 132.328 49.697  112.416 1.00 21.99  ? 321 PRO D O     1 
ATOM   9083  C CB    . PRO D  1 321 ? 134.632 49.084  110.008 1.00 34.97  ? 321 PRO D CB    1 
ATOM   9084  C CG    . PRO D  1 321 ? 135.117 49.682  108.758 1.00 36.44  ? 321 PRO D CG    1 
ATOM   9085  C CD    . PRO D  1 321 ? 135.386 51.106  109.185 1.00 37.58  ? 321 PRO D CD    1 
ATOM   9086  N N     . GLU D  1 322 ? 134.466 50.358  112.719 1.00 23.33  ? 322 GLU D N     1 
ATOM   9087  C CA    . GLU D  1 322 ? 134.369 50.316  114.167 1.00 26.12  ? 322 GLU D CA    1 
ATOM   9088  C C     . GLU D  1 322 ? 133.027 50.879  114.612 1.00 26.46  ? 322 GLU D C     1 
ATOM   9089  O O     . GLU D  1 322 ? 132.275 50.215  115.335 1.00 26.87  ? 322 GLU D O     1 
ATOM   9090  C CB    . GLU D  1 322 ? 135.525 51.083  114.800 1.00 61.85  ? 322 GLU D CB    1 
ATOM   9091  C CG    . GLU D  1 322 ? 136.848 50.314  114.789 1.00 70.84  ? 322 GLU D CG    1 
ATOM   9092  C CD    . GLU D  1 322 ? 137.392 50.051  113.385 1.00 76.45  ? 322 GLU D CD    1 
ATOM   9093  O OE1   . GLU D  1 322 ? 138.470 49.401  113.244 1.00 78.50  ? 322 GLU D OE1   1 
ATOM   9094  O OE2   . GLU D  1 322 ? 136.735 50.500  112.420 1.00 78.96  ? 322 GLU D OE2   1 
ATOM   9095  N N     . LEU D  1 323 ? 132.720 52.078  114.118 1.00 32.19  ? 323 LEU D N     1 
ATOM   9096  C CA    . LEU D  1 323 ? 131.492 52.815  114.418 1.00 31.59  ? 323 LEU D CA    1 
ATOM   9097  C C     . LEU D  1 323 ? 130.272 52.274  113.661 1.00 32.29  ? 323 LEU D C     1 
ATOM   9098  O O     . LEU D  1 323 ? 129.205 52.035  114.231 1.00 32.89  ? 323 LEU D O     1 
ATOM   9099  C CB    . LEU D  1 323 ? 131.714 54.280  114.045 1.00 26.83  ? 323 LEU D CB    1 
ATOM   9100  C CG    . LEU D  1 323 ? 130.643 55.269  114.435 1.00 25.46  ? 323 LEU D CG    1 
ATOM   9101  C CD1   . LEU D  1 323 ? 130.649 55.400  115.955 1.00 25.55  ? 323 LEU D CD1   1 
ATOM   9102  C CD2   . LEU D  1 323 ? 130.922 56.575  113.741 1.00 25.57  ? 323 LEU D CD2   1 
ATOM   9103  N N     . GLN D  1 324 ? 130.453 52.079  112.365 1.00 34.41  ? 324 GLN D N     1 
ATOM   9104  C CA    . GLN D  1 324 ? 129.398 51.606  111.494 1.00 36.30  ? 324 GLN D CA    1 
ATOM   9105  C C     . GLN D  1 324 ? 128.648 50.428  112.080 1.00 36.70  ? 324 GLN D C     1 
ATOM   9106  O O     . GLN D  1 324 ? 127.536 50.104  111.655 1.00 36.87  ? 324 GLN D O     1 
ATOM   9107  C CB    . GLN D  1 324 ? 130.005 51.230  110.160 1.00 50.76  ? 324 GLN D CB    1 
ATOM   9108  C CG    . GLN D  1 324 ? 129.039 50.664  109.204 1.00 54.72  ? 324 GLN D CG    1 
ATOM   9109  C CD    . GLN D  1 324 ? 129.653 50.529  107.852 1.00 59.30  ? 324 GLN D CD    1 
ATOM   9110  O OE1   . GLN D  1 324 ? 129.164 49.765  107.011 1.00 63.00  ? 324 GLN D OE1   1 
ATOM   9111  N NE2   . GLN D  1 324 ? 130.736 51.277  107.614 1.00 60.48  ? 324 GLN D NE2   1 
ATOM   9112  N N     . GLY D  1 325 ? 129.251 49.791  113.072 1.00 21.65  ? 325 GLY D N     1 
ATOM   9113  C CA    . GLY D  1 325 ? 128.619 48.635  113.662 1.00 21.33  ? 325 GLY D CA    1 
ATOM   9114  C C     . GLY D  1 325 ? 128.086 48.932  115.029 1.00 21.90  ? 325 GLY D C     1 
ATOM   9115  O O     . GLY D  1 325 ? 127.368 48.123  115.617 1.00 22.00  ? 325 GLY D O     1 
ATOM   9116  N N     . ARG D  1 326 ? 128.453 50.083  115.560 1.00 24.80  ? 326 ARG D N     1 
ATOM   9117  C CA    . ARG D  1 326 ? 127.950 50.442  116.858 1.00 26.81  ? 326 ARG D CA    1 
ATOM   9118  C C     . ARG D  1 326 ? 126.688 51.297  116.634 1.00 26.24  ? 326 ARG D C     1 
ATOM   9119  O O     . ARG D  1 326 ? 126.013 51.774  117.571 1.00 26.94  ? 326 ARG D O     1 
ATOM   9120  C CB    . ARG D  1 326 ? 129.045 51.143  117.619 1.00 65.10  ? 326 ARG D CB    1 
ATOM   9121  C CG    . ARG D  1 326 ? 130.143 50.174  117.976 1.00 72.58  ? 326 ARG D CG    1 
ATOM   9122  C CD    . ARG D  1 326 ? 130.031 49.784  119.425 1.00 80.54  ? 326 ARG D CD    1 
ATOM   9123  N NE    . ARG D  1 326 ? 128.673 50.004  119.907 1.00 87.34  ? 326 ARG D NE    1 
ATOM   9124  C CZ    . ARG D  1 326 ? 128.303 49.908  121.182 1.00 90.62  ? 326 ARG D CZ    1 
ATOM   9125  N NH1   . ARG D  1 326 ? 129.200 49.586  122.122 1.00 90.75  ? 326 ARG D NH1   1 
ATOM   9126  N NH2   . ARG D  1 326 ? 127.035 50.148  121.515 1.00 91.96  ? 326 ARG D NH2   1 
ATOM   9127  N N     . LEU D  1 327 ? 126.360 51.449  115.355 1.00 31.16  ? 327 LEU D N     1 
ATOM   9128  C CA    . LEU D  1 327 ? 125.168 52.167  114.941 1.00 29.78  ? 327 LEU D CA    1 
ATOM   9129  C C     . LEU D  1 327 ? 124.383 51.140  114.119 1.00 30.23  ? 327 LEU D C     1 
ATOM   9130  O O     . LEU D  1 327 ? 124.346 51.199  112.881 1.00 28.80  ? 327 LEU D O     1 
ATOM   9131  C CB    . LEU D  1 327 ? 125.537 53.381  114.087 1.00 25.03  ? 327 LEU D CB    1 
ATOM   9132  C CG    . LEU D  1 327 ? 126.316 54.531  114.731 1.00 21.61  ? 327 LEU D CG    1 
ATOM   9133  C CD1   . LEU D  1 327 ? 126.090 55.716  113.837 1.00 21.60  ? 327 LEU D CD1   1 
ATOM   9134  C CD2   . LEU D  1 327 ? 125.853 54.853  116.146 1.00 19.15  ? 327 LEU D CD2   1 
ATOM   9135  N N     . PRO D  1 328 ? 123.746 50.180  114.820 1.00 49.10  ? 328 PRO D N     1 
ATOM   9136  C CA    . PRO D  1 328 ? 122.929 49.050  114.360 1.00 49.10  ? 328 PRO D CA    1 
ATOM   9137  C C     . PRO D  1 328 ? 121.673 49.437  113.623 1.00 50.04  ? 328 PRO D C     1 
ATOM   9138  O O     . PRO D  1 328 ? 121.422 48.997  112.500 1.00 52.60  ? 328 PRO D O     1 
ATOM   9139  C CB    . PRO D  1 328 ? 122.553 48.335  115.647 1.00 6.61   ? 328 PRO D CB    1 
ATOM   9140  C CG    . PRO D  1 328 ? 123.384 48.946  116.713 1.00 6.99   ? 328 PRO D CG    1 
ATOM   9141  C CD    . PRO D  1 328 ? 123.579 50.351  116.271 1.00 8.42   ? 328 PRO D CD    1 
ATOM   9142  N N     . ILE D  1 329 ? 120.867 50.237  114.305 1.00 19.84  ? 329 ILE D N     1 
ATOM   9143  C CA    . ILE D  1 329 ? 119.597 50.722  113.788 1.00 18.66  ? 329 ILE D CA    1 
ATOM   9144  C C     . ILE D  1 329 ? 119.673 51.896  112.796 1.00 17.67  ? 329 ILE D C     1 
ATOM   9145  O O     . ILE D  1 329 ? 120.041 53.009  113.170 1.00 17.55  ? 329 ILE D O     1 
ATOM   9146  C CB    . ILE D  1 329 ? 118.708 51.171  114.950 1.00 46.19  ? 329 ILE D CB    1 
ATOM   9147  C CG1   . ILE D  1 329 ? 118.468 50.007  115.913 1.00 49.12  ? 329 ILE D CG1   1 
ATOM   9148  C CG2   . ILE D  1 329 ? 117.414 51.723  114.416 1.00 45.81  ? 329 ILE D CG2   1 
ATOM   9149  C CD1   . ILE D  1 329 ? 117.488 50.327  117.048 1.00 51.14  ? 329 ILE D CD1   1 
ATOM   9150  N N     . ARG D  1 330 ? 119.361 51.656  111.529 1.00 29.35  ? 330 ARG D N     1 
ATOM   9151  C CA    . ARG D  1 330 ? 119.347 52.760  110.577 1.00 29.21  ? 330 ARG D CA    1 
ATOM   9152  C C     . ARG D  1 330 ? 117.853 52.953  110.350 1.00 28.74  ? 330 ARG D C     1 
ATOM   9153  O O     . ARG D  1 330 ? 117.115 51.989  110.130 1.00 28.99  ? 330 ARG D O     1 
ATOM   9154  C CB    . ARG D  1 330 ? 120.006 52.437  109.230 1.00 26.32  ? 330 ARG D CB    1 
ATOM   9155  C CG    . ARG D  1 330 ? 121.347 51.759  109.280 1.00 30.79  ? 330 ARG D CG    1 
ATOM   9156  C CD    . ARG D  1 330 ? 122.382 52.540  110.041 1.00 34.04  ? 330 ARG D CD    1 
ATOM   9157  N NE    . ARG D  1 330 ? 123.651 51.813  110.101 1.00 35.94  ? 330 ARG D NE    1 
ATOM   9158  C CZ    . ARG D  1 330 ? 124.423 51.568  109.048 1.00 37.54  ? 330 ARG D CZ    1 
ATOM   9159  N NH1   . ARG D  1 330 ? 124.063 51.994  107.837 1.00 37.45  ? 330 ARG D NH1   1 
ATOM   9160  N NH2   . ARG D  1 330 ? 125.552 50.887  109.207 1.00 38.98  ? 330 ARG D NH2   1 
ATOM   9161  N N     . VAL D  1 331 ? 117.400 54.197  110.417 1.00 18.35  ? 331 VAL D N     1 
ATOM   9162  C CA    . VAL D  1 331 ? 115.994 54.502  110.241 1.00 15.87  ? 331 VAL D CA    1 
ATOM   9163  C C     . VAL D  1 331 ? 115.979 55.695  109.330 1.00 16.61  ? 331 VAL D C     1 
ATOM   9164  O O     . VAL D  1 331 ? 116.870 56.535  109.408 1.00 16.25  ? 331 VAL D O     1 
ATOM   9165  C CB    . VAL D  1 331 ? 115.394 54.841  111.591 1.00 1.00   ? 331 VAL D CB    1 
ATOM   9166  C CG1   . VAL D  1 331 ? 116.291 55.811  112.306 1.00 1.00   ? 331 VAL D CG1   1 
ATOM   9167  C CG2   . VAL D  1 331 ? 114.024 55.360  111.428 1.00 1.00   ? 331 VAL D CG2   1 
ATOM   9168  N N     . GLU D  1 332 ? 114.988 55.785  108.462 1.00 19.45  ? 332 GLU D N     1 
ATOM   9169  C CA    . GLU D  1 332 ? 114.961 56.908  107.552 1.00 21.96  ? 332 GLU D CA    1 
ATOM   9170  C C     . GLU D  1 332 ? 113.798 57.889  107.785 1.00 21.73  ? 332 GLU D C     1 
ATOM   9171  O O     . GLU D  1 332 ? 112.683 57.471  108.042 1.00 24.48  ? 332 GLU D O     1 
ATOM   9172  C CB    . GLU D  1 332 ? 114.898 56.351  106.145 1.00 66.40  ? 332 GLU D CB    1 
ATOM   9173  C CG    . GLU D  1 332 ? 115.402 57.249  105.059 1.00 75.38  ? 332 GLU D CG    1 
ATOM   9174  C CD    . GLU D  1 332 ? 115.481 56.494  103.749 1.00 82.22  ? 332 GLU D CD    1 
ATOM   9175  O OE1   . GLU D  1 332 ? 116.287 55.544  103.664 1.00 85.24  ? 332 GLU D OE1   1 
ATOM   9176  O OE2   . GLU D  1 332 ? 114.728 56.824  102.805 1.00 85.86  ? 332 GLU D OE2   1 
ATOM   9177  N N     . LEU D  1 333 ? 114.040 59.197  107.726 1.00 21.85  ? 333 LEU D N     1 
ATOM   9178  C CA    . LEU D  1 333 ? 112.940 60.147  107.849 1.00 19.21  ? 333 LEU D CA    1 
ATOM   9179  C C     . LEU D  1 333 ? 112.726 60.753  106.464 1.00 18.75  ? 333 LEU D C     1 
ATOM   9180  O O     . LEU D  1 333 ? 113.662 60.800  105.626 1.00 18.01  ? 333 LEU D O     1 
ATOM   9181  C CB    . LEU D  1 333 ? 113.254 61.222  108.835 1.00 10.59  ? 333 LEU D CB    1 
ATOM   9182  C CG    . LEU D  1 333 ? 113.306 60.648  110.218 1.00 11.50  ? 333 LEU D CG    1 
ATOM   9183  C CD1   . LEU D  1 333 ? 114.648 59.984  110.437 1.00 11.84  ? 333 LEU D CD1   1 
ATOM   9184  C CD2   . LEU D  1 333 ? 113.132 61.778  111.201 1.00 12.16  ? 333 LEU D CD2   1 
ATOM   9185  N N     . THR D  1 334 ? 111.490 61.204  106.232 1.00 7.37   ? 334 THR D N     1 
ATOM   9186  C CA    . THR D  1 334 ? 111.065 61.767  104.947 1.00 7.37   ? 334 THR D CA    1 
ATOM   9187  C C     . THR D  1 334 ? 110.998 63.258  104.833 1.00 8.32   ? 334 THR D C     1 
ATOM   9188  O O     . THR D  1 334 ? 110.816 63.962  105.825 1.00 6.29   ? 334 THR D O     1 
ATOM   9189  C CB    . THR D  1 334 ? 109.668 61.345  104.562 1.00 14.76  ? 334 THR D CB    1 
ATOM   9190  O OG1   . THR D  1 334 ? 108.766 61.718  105.610 1.00 13.54  ? 334 THR D OG1   1 
ATOM   9191  C CG2   . THR D  1 334 ? 109.613 59.864  104.298 1.00 17.84  ? 334 THR D CG2   1 
ATOM   9192  N N     . ALA D  1 335 ? 111.106 63.717  103.589 1.00 34.03  ? 335 ALA D N     1 
ATOM   9193  C CA    . ALA D  1 335 ? 111.026 65.127  103.290 1.00 35.99  ? 335 ALA D CA    1 
ATOM   9194  C C     . ALA D  1 335 ? 109.636 65.483  103.730 1.00 37.62  ? 335 ALA D C     1 
ATOM   9195  O O     . ALA D  1 335 ? 108.741 64.647  103.677 1.00 38.20  ? 335 ALA D O     1 
ATOM   9196  C CB    . ALA D  1 335 ? 111.174 65.353  101.811 1.00 83.99  ? 335 ALA D CB    1 
ATOM   9197  N N     . LEU D  1 336 ? 109.445 66.711  104.173 1.00 37.25  ? 336 LEU D N     1 
ATOM   9198  C CA    . LEU D  1 336 ? 108.133 67.110  104.624 1.00 37.66  ? 336 LEU D CA    1 
ATOM   9199  C C     . LEU D  1 336 ? 107.300 67.645  103.463 1.00 39.95  ? 336 LEU D C     1 
ATOM   9200  O O     . LEU D  1 336 ? 107.797 68.383  102.631 1.00 42.20  ? 336 LEU D O     1 
ATOM   9201  C CB    . LEU D  1 336 ? 108.307 68.132  105.734 1.00 6.00   ? 336 LEU D CB    1 
ATOM   9202  C CG    . LEU D  1 336 ? 107.824 67.582  107.073 1.00 4.87   ? 336 LEU D CG    1 
ATOM   9203  C CD1   . LEU D  1 336 ? 108.027 66.068  107.163 1.00 3.02   ? 336 LEU D CD1   1 
ATOM   9204  C CD2   . LEU D  1 336 ? 108.533 68.320  108.193 1.00 4.31   ? 336 LEU D CD2   1 
ATOM   9205  N N     . SER D  1 337 ? 106.036 67.265  103.385 1.00 55.56  ? 337 SER D N     1 
ATOM   9206  C CA    . SER D  1 337 ? 105.213 67.740  102.284 1.00 57.85  ? 337 SER D CA    1 
ATOM   9207  C C     . SER D  1 337 ? 104.270 68.895  102.601 1.00 59.57  ? 337 SER D C     1 
ATOM   9208  O O     . SER D  1 337 ? 104.090 69.302  103.757 1.00 60.34  ? 337 SER D O     1 
ATOM   9209  C CB    . SER D  1 337 ? 104.386 66.595  101.722 1.00 53.54  ? 337 SER D CB    1 
ATOM   9210  O OG    . SER D  1 337 ? 103.125 67.050  101.254 1.00 54.16  ? 337 SER D OG    1 
ATOM   9211  N N     . ALA D  1 338 ? 103.665 69.413  101.536 1.00 24.64  ? 338 ALA D N     1 
ATOM   9212  C CA    . ALA D  1 338 ? 102.700 70.499  101.622 1.00 24.61  ? 338 ALA D CA    1 
ATOM   9213  C C     . ALA D  1 338 ? 101.688 70.044  102.659 1.00 23.84  ? 338 ALA D C     1 
ATOM   9214  O O     . ALA D  1 338 ? 101.518 70.639  103.743 1.00 22.15  ? 338 ALA D O     1 
ATOM   9215  C CB    . ALA D  1 338 ? 102.019 70.676  100.255 1.00 52.84  ? 338 ALA D CB    1 
ATOM   9216  N N     . ALA D  1 339 ? 101.041 68.944  102.285 1.00 29.95  ? 339 ALA D N     1 
ATOM   9217  C CA    . ALA D  1 339 ? 100.035 68.300  103.100 1.00 29.97  ? 339 ALA D CA    1 
ATOM   9218  C C     . ALA D  1 339 ? 100.552 68.147  104.513 1.00 29.45  ? 339 ALA D C     1 
ATOM   9219  O O     . ALA D  1 339 ? 99.825  68.376  105.473 1.00 29.70  ? 339 ALA D O     1 
ATOM   9220  C CB    . ALA D  1 339 ? 99.695  66.946  102.519 1.00 74.23  ? 339 ALA D CB    1 
ATOM   9221  N N     . ASP D  1 340 ? 101.815 67.755  104.637 1.00 30.49  ? 340 ASP D N     1 
ATOM   9222  C CA    . ASP D  1 340 ? 102.401 67.578  105.947 1.00 30.23  ? 340 ASP D CA    1 
ATOM   9223  C C     . ASP D  1 340 ? 102.431 68.900  106.666 1.00 28.61  ? 340 ASP D C     1 
ATOM   9224  O O     . ASP D  1 340 ? 101.976 68.985  107.814 1.00 25.93  ? 340 ASP D O     1 
ATOM   9225  C CB    . ASP D  1 340 ? 103.802 67.009  105.841 1.00 76.30  ? 340 ASP D CB    1 
ATOM   9226  C CG    . ASP D  1 340 ? 103.796 65.586  105.402 1.00 81.37  ? 340 ASP D CG    1 
ATOM   9227  O OD1   . ASP D  1 340 ? 103.271 64.731  106.154 1.00 81.64  ? 340 ASP D OD1   1 
ATOM   9228  O OD2   . ASP D  1 340 ? 104.304 65.327  104.295 1.00 85.24  ? 340 ASP D OD2   1 
ATOM   9229  N N     . PHE D  1 341 ? 102.942 69.932  105.988 1.00 30.23  ? 341 PHE D N     1 
ATOM   9230  C CA    . PHE D  1 341 ? 103.025 71.256  106.588 1.00 28.81  ? 341 PHE D CA    1 
ATOM   9231  C C     . PHE D  1 341 ? 101.674 71.642  107.162 1.00 28.73  ? 341 PHE D C     1 
ATOM   9232  O O     . PHE D  1 341 ? 101.584 72.095  108.314 1.00 28.64  ? 341 PHE D O     1 
ATOM   9233  C CB    . PHE D  1 341 ? 103.465 72.286  105.558 1.00 19.24  ? 341 PHE D CB    1 
ATOM   9234  C CG    . PHE D  1 341 ? 104.942 72.284  105.283 1.00 17.72  ? 341 PHE D CG    1 
ATOM   9235  C CD1   . PHE D  1 341 ? 105.830 71.665  106.152 1.00 17.48  ? 341 PHE D CD1   1 
ATOM   9236  C CD2   . PHE D  1 341 ? 105.449 72.915  104.159 1.00 17.23  ? 341 PHE D CD2   1 
ATOM   9237  C CE1   . PHE D  1 341 ? 107.217 71.667  105.906 1.00 16.86  ? 341 PHE D CE1   1 
ATOM   9238  C CE2   . PHE D  1 341 ? 106.808 72.923  103.905 1.00 16.88  ? 341 PHE D CE2   1 
ATOM   9239  C CZ    . PHE D  1 341 ? 107.699 72.292  104.785 1.00 16.74  ? 341 PHE D CZ    1 
ATOM   9240  N N     . GLU D  1 342 ? 100.630 71.441  106.355 1.00 18.82  ? 342 GLU D N     1 
ATOM   9241  C CA    . GLU D  1 342 ? 99.268  71.743  106.766 1.00 19.43  ? 342 GLU D CA    1 
ATOM   9242  C C     . GLU D  1 342 ? 98.955  71.194  108.144 1.00 18.33  ? 342 GLU D C     1 
ATOM   9243  O O     . GLU D  1 342 ? 98.136  71.752  108.860 1.00 18.33  ? 342 GLU D O     1 
ATOM   9244  C CB    . GLU D  1 342 ? 98.265  71.145  105.793 1.00 53.53  ? 342 GLU D CB    1 
ATOM   9245  C CG    . GLU D  1 342 ? 98.216  71.798  104.441 1.00 59.62  ? 342 GLU D CG    1 
ATOM   9246  C CD    . GLU D  1 342 ? 97.168  71.163  103.543 1.00 63.54  ? 342 GLU D CD    1 
ATOM   9247  O OE1   . GLU D  1 342 ? 96.078  70.812  104.061 1.00 64.95  ? 342 GLU D OE1   1 
ATOM   9248  O OE2   . GLU D  1 342 ? 97.429  71.023  102.321 1.00 65.31  ? 342 GLU D OE2   1 
ATOM   9249  N N     . ARG D  1 343 ? 99.595  70.088  108.512 1.00 8.45   ? 343 ARG D N     1 
ATOM   9250  C CA    . ARG D  1 343 ? 99.350  69.458  109.800 1.00 7.67   ? 343 ARG D CA    1 
ATOM   9251  C C     . ARG D  1 343 ? 100.221 70.015  110.894 1.00 7.19   ? 343 ARG D C     1 
ATOM   9252  O O     . ARG D  1 343 ? 99.729  70.361  111.971 1.00 4.41   ? 343 ARG D O     1 
ATOM   9253  C CB    . ARG D  1 343 ? 99.570  67.962  109.667 1.00 28.40  ? 343 ARG D CB    1 
ATOM   9254  C CG    . ARG D  1 343 ? 98.743  67.389  108.557 1.00 30.86  ? 343 ARG D CG    1 
ATOM   9255  C CD    . ARG D  1 343 ? 98.881  65.911  108.434 1.00 33.54  ? 343 ARG D CD    1 
ATOM   9256  N NE    . ARG D  1 343 ? 98.714  65.297  109.727 1.00 37.26  ? 343 ARG D NE    1 
ATOM   9257  C CZ    . ARG D  1 343 ? 99.189  64.097  110.035 1.00 41.01  ? 343 ARG D CZ    1 
ATOM   9258  N NH1   . ARG D  1 343 ? 99.851  63.387  109.123 1.00 41.39  ? 343 ARG D NH1   1 
ATOM   9259  N NH2   . ARG D  1 343 ? 99.039  63.626  111.269 1.00 43.28  ? 343 ARG D NH2   1 
ATOM   9260  N N     . ILE D  1 344 ? 101.520 70.092  110.608 1.00 15.75  ? 344 ILE D N     1 
ATOM   9261  C CA    . ILE D  1 344 ? 102.479 70.592  111.567 1.00 16.62  ? 344 ILE D CA    1 
ATOM   9262  C C     . ILE D  1 344 ? 102.012 71.949  111.918 1.00 16.27  ? 344 ILE D C     1 
ATOM   9263  O O     . ILE D  1 344 ? 102.303 72.454  112.991 1.00 18.48  ? 344 ILE D O     1 
ATOM   9264  C CB    . ILE D  1 344 ? 103.870 70.753  110.983 1.00 25.30  ? 344 ILE D CB    1 
ATOM   9265  C CG1   . ILE D  1 344 ? 103.882 70.323  109.530 1.00 28.06  ? 344 ILE D CG1   1 
ATOM   9266  C CG2   . ILE D  1 344 ? 104.856 69.886  111.771 1.00 25.11  ? 344 ILE D CG2   1 
ATOM   9267  C CD1   . ILE D  1 344 ? 104.067 68.846  109.380 1.00 32.03  ? 344 ILE D CD1   1 
ATOM   9268  N N     . LEU D  1 345 ? 101.266 72.538  110.995 1.00 16.22  ? 345 LEU D N     1 
ATOM   9269  C CA    . LEU D  1 345 ? 100.748 73.888  111.176 1.00 14.94  ? 345 LEU D CA    1 
ATOM   9270  C C     . LEU D  1 345 ? 99.678  74.028  112.264 1.00 16.40  ? 345 LEU D C     1 
ATOM   9271  O O     . LEU D  1 345 ? 99.572  75.079  112.889 1.00 15.66  ? 345 LEU D O     1 
ATOM   9272  C CB    . LEU D  1 345 ? 100.217 74.409  109.829 1.00 1.00   ? 345 LEU D CB    1 
ATOM   9273  C CG    . LEU D  1 345 ? 100.520 75.876  109.531 1.00 1.00   ? 345 LEU D CG    1 
ATOM   9274  C CD1   . LEU D  1 345 ? 101.734 76.311  110.365 1.00 1.00   ? 345 LEU D CD1   1 
ATOM   9275  C CD2   . LEU D  1 345 ? 100.775 76.076  108.052 1.00 1.00   ? 345 LEU D CD2   1 
ATOM   9276  N N     . THR D  1 346 ? 98.926  72.956  112.524 1.00 37.12  ? 346 THR D N     1 
ATOM   9277  C CA    . THR D  1 346 ? 97.848  73.008  113.511 1.00 39.52  ? 346 THR D CA    1 
ATOM   9278  C C     . THR D  1 346 ? 97.603  71.859  114.506 1.00 41.95  ? 346 THR D C     1 
ATOM   9279  O O     . THR D  1 346 ? 96.999  72.074  115.564 1.00 42.78  ? 346 THR D O     1 
ATOM   9280  C CB    . THR D  1 346 ? 96.557  73.244  112.784 1.00 23.91  ? 346 THR D CB    1 
ATOM   9281  O OG1   . THR D  1 346 ? 96.310  72.176  111.854 1.00 22.50  ? 346 THR D OG1   1 
ATOM   9282  C CG2   . THR D  1 346 ? 96.668  74.510  112.017 1.00 25.97  ? 346 THR D CG2   1 
ATOM   9283  N N     . GLU D  1 347 ? 98.049  70.649  114.184 1.00 48.21  ? 347 GLU D N     1 
ATOM   9284  C CA    . GLU D  1 347 ? 97.811  69.508  115.067 1.00 49.77  ? 347 GLU D CA    1 
ATOM   9285  C C     . GLU D  1 347 ? 98.671  69.473  116.328 1.00 49.14  ? 347 GLU D C     1 
ATOM   9286  O O     . GLU D  1 347 ? 98.163  69.457  117.445 1.00 51.40  ? 347 GLU D O     1 
ATOM   9287  C CB    . GLU D  1 347 ? 98.001  68.196  114.294 1.00 47.25  ? 347 GLU D CB    1 
ATOM   9288  C CG    . GLU D  1 347 ? 97.264  68.125  112.957 1.00 50.82  ? 347 GLU D CG    1 
ATOM   9289  C CD    . GLU D  1 347 ? 97.226  66.726  112.380 1.00 52.50  ? 347 GLU D CD    1 
ATOM   9290  O OE1   . GLU D  1 347 ? 96.865  66.615  111.192 1.00 54.04  ? 347 GLU D OE1   1 
ATOM   9291  O OE2   . GLU D  1 347 ? 97.545  65.750  113.105 1.00 51.60  ? 347 GLU D OE2   1 
ATOM   9292  N N     . PRO D  1 348 ? 99.992  69.477  116.156 1.00 15.99  ? 348 PRO D N     1 
ATOM   9293  C CA    . PRO D  1 348 ? 101.004 69.442  117.222 1.00 15.47  ? 348 PRO D CA    1 
ATOM   9294  C C     . PRO D  1 348 ? 100.641 70.196  118.493 1.00 16.68  ? 348 PRO D C     1 
ATOM   9295  O O     . PRO D  1 348 ? 100.083 71.263  118.410 1.00 18.42  ? 348 PRO D O     1 
ATOM   9296  C CB    . PRO D  1 348 ? 102.202 70.088  116.556 1.00 11.64  ? 348 PRO D CB    1 
ATOM   9297  C CG    . PRO D  1 348 ? 102.007 69.727  115.105 1.00 10.67  ? 348 PRO D CG    1 
ATOM   9298  C CD    . PRO D  1 348 ? 100.576 69.965  114.894 1.00 11.26  ? 348 PRO D CD    1 
ATOM   9299  N N     . HIS D  1 349 ? 100.945 69.666  119.669 1.00 26.23  ? 349 HIS D N     1 
ATOM   9300  C CA    . HIS D  1 349 ? 100.655 70.431  120.885 1.00 29.09  ? 349 HIS D CA    1 
ATOM   9301  C C     . HIS D  1 349 ? 101.473 71.701  120.748 1.00 27.87  ? 349 HIS D C     1 
ATOM   9302  O O     . HIS D  1 349 ? 102.669 71.631  120.456 1.00 27.76  ? 349 HIS D O     1 
ATOM   9303  C CB    . HIS D  1 349 ? 101.084 69.703  122.169 1.00 108.91 ? 349 HIS D CB    1 
ATOM   9304  C CG    . HIS D  1 349 ? 100.090 68.692  122.662 1.00 116.21 ? 349 HIS D CG    1 
ATOM   9305  N ND1   . HIS D  1 349 ? 100.062 68.255  123.970 1.00 117.56 ? 349 HIS D ND1   1 
ATOM   9306  C CD2   . HIS D  1 349 ? 99.104  68.019  122.022 1.00 119.69 ? 349 HIS D CD2   1 
ATOM   9307  C CE1   . HIS D  1 349 ? 99.102  67.358  124.115 1.00 119.04 ? 349 HIS D CE1   1 
ATOM   9308  N NE2   . HIS D  1 349 ? 98.505  67.196  122.948 1.00 121.14 ? 349 HIS D NE2   1 
ATOM   9309  N N     . ALA D  1 350 ? 100.816 72.850  120.933 1.00 12.97  ? 350 ALA D N     1 
ATOM   9310  C CA    . ALA D  1 350 ? 101.445 74.166  120.803 1.00 9.44   ? 350 ALA D CA    1 
ATOM   9311  C C     . ALA D  1 350 ? 101.946 74.411  119.385 1.00 7.50   ? 350 ALA D C     1 
ATOM   9312  O O     . ALA D  1 350 ? 103.116 74.654  119.182 1.00 5.39   ? 350 ALA D O     1 
ATOM   9313  C CB    . ALA D  1 350 ? 102.594 74.286  121.789 1.00 19.87  ? 350 ALA D CB    1 
ATOM   9314  N N     . SER D  1 351 ? 101.062 74.342  118.404 1.00 32.70  ? 351 SER D N     1 
ATOM   9315  C CA    . SER D  1 351 ? 101.479 74.563  117.030 1.00 34.52  ? 351 SER D CA    1 
ATOM   9316  C C     . SER D  1 351 ? 101.769 76.040  116.786 1.00 35.00  ? 351 SER D C     1 
ATOM   9317  O O     . SER D  1 351 ? 101.648 76.860  117.695 1.00 35.76  ? 351 SER D O     1 
ATOM   9318  C CB    . SER D  1 351 ? 100.387 74.105  116.071 1.00 26.46  ? 351 SER D CB    1 
ATOM   9319  O OG    . SER D  1 351 ? 99.237  74.913  116.193 1.00 24.61  ? 351 SER D OG    1 
ATOM   9320  N N     . LEU D  1 352 ? 102.172 76.381  115.566 1.00 24.39  ? 352 LEU D N     1 
ATOM   9321  C CA    . LEU D  1 352 ? 102.419 77.775  115.256 1.00 23.57  ? 352 LEU D CA    1 
ATOM   9322  C C     . LEU D  1 352 ? 101.128 78.547  115.479 1.00 23.58  ? 352 LEU D C     1 
ATOM   9323  O O     . LEU D  1 352 ? 101.044 79.406  116.357 1.00 24.34  ? 352 LEU D O     1 
ATOM   9324  C CB    . LEU D  1 352 ? 102.849 77.931  113.808 1.00 16.84  ? 352 LEU D CB    1 
ATOM   9325  C CG    . LEU D  1 352 ? 104.344 77.744  113.609 1.00 17.34  ? 352 LEU D CG    1 
ATOM   9326  C CD1   . LEU D  1 352 ? 104.776 77.996  112.153 1.00 16.81  ? 352 LEU D CD1   1 
ATOM   9327  C CD2   . LEU D  1 352 ? 105.031 78.701  114.527 1.00 16.75  ? 352 LEU D CD2   1 
ATOM   9328  N N     . THR D  1 353 ? 100.117 78.231  114.678 1.00 14.92  ? 353 THR D N     1 
ATOM   9329  C CA    . THR D  1 353 ? 98.843  78.902  114.808 1.00 13.90  ? 353 THR D CA    1 
ATOM   9330  C C     . THR D  1 353 ? 98.434  78.954  116.269 1.00 16.06  ? 353 THR D C     1 
ATOM   9331  O O     . THR D  1 353 ? 98.176  80.031  116.801 1.00 17.41  ? 353 THR D O     1 
ATOM   9332  C CB    . THR D  1 353 ? 97.726  78.227  113.950 1.00 7.97   ? 353 THR D CB    1 
ATOM   9333  O OG1   . THR D  1 353 ? 97.619  76.829  114.246 1.00 4.38   ? 353 THR D OG1   1 
ATOM   9334  C CG2   . THR D  1 353 ? 98.026  78.410  112.490 1.00 6.55   ? 353 THR D CG2   1 
ATOM   9335  N N     . GLU D  1 354 ? 98.398  77.805  116.927 1.00 4.87   ? 354 GLU D N     1 
ATOM   9336  C CA    . GLU D  1 354 ? 98.017  77.755  118.334 1.00 7.15   ? 354 GLU D CA    1 
ATOM   9337  C C     . GLU D  1 354 ? 98.821  78.769  119.129 1.00 5.78   ? 354 GLU D C     1 
ATOM   9338  O O     . GLU D  1 354 ? 98.331  79.305  120.110 1.00 4.94   ? 354 GLU D O     1 
ATOM   9339  C CB    . GLU D  1 354 ? 98.268  76.357  118.921 1.00 124.96 ? 354 GLU D CB    1 
ATOM   9340  C CG    . GLU D  1 354 ? 97.018  75.526  119.215 1.00 133.22 ? 354 GLU D CG    1 
ATOM   9341  C CD    . GLU D  1 354 ? 97.344  74.222  119.934 1.00 137.96 ? 354 GLU D CD    1 
ATOM   9342  O OE1   . GLU D  1 354 ? 97.866  74.289  121.070 1.00 140.09 ? 354 GLU D OE1   1 
ATOM   9343  O OE2   . GLU D  1 354 ? 97.084  73.138  119.363 1.00 138.97 ? 354 GLU D OE2   1 
ATOM   9344  N N     . GLN D  1 355 ? 100.061 79.019  118.716 1.00 7.36   ? 355 GLN D N     1 
ATOM   9345  C CA    . GLN D  1 355 ? 100.905 79.985  119.401 1.00 7.92   ? 355 GLN D CA    1 
ATOM   9346  C C     . GLN D  1 355 ? 100.510 81.420  119.083 1.00 8.32   ? 355 GLN D C     1 
ATOM   9347  O O     . GLN D  1 355 ? 100.282 82.208  119.991 1.00 7.99   ? 355 GLN D O     1 
ATOM   9348  C CB    . GLN D  1 355 ? 102.341 79.817  119.008 1.00 63.13  ? 355 GLN D CB    1 
ATOM   9349  C CG    . GLN D  1 355 ? 103.003 78.638  119.573 1.00 66.33  ? 355 GLN D CG    1 
ATOM   9350  C CD    . GLN D  1 355 ? 104.486 78.721  119.324 1.00 69.87  ? 355 GLN D CD    1 
ATOM   9351  O OE1   . GLN D  1 355 ? 105.201 79.468  120.000 1.00 71.10  ? 355 GLN D OE1   1 
ATOM   9352  N NE2   . GLN D  1 355 ? 104.960 77.979  118.329 1.00 70.81  ? 355 GLN D NE2   1 
ATOM   9353  N N     . TYR D  1 356 ? 100.450 81.788  117.811 1.00 22.34  ? 356 TYR D N     1 
ATOM   9354  C CA    . TYR D  1 356 ? 100.056 83.154  117.519 1.00 24.39  ? 356 TYR D CA    1 
ATOM   9355  C C     . TYR D  1 356 ? 98.703  83.494  118.131 1.00 24.99  ? 356 TYR D C     1 
ATOM   9356  O O     . TYR D  1 356 ? 98.565  84.558  118.756 1.00 24.86  ? 356 TYR D O     1 
ATOM   9357  C CB    . TYR D  1 356 ? 100.026 83.416  116.023 1.00 42.19  ? 356 TYR D CB    1 
ATOM   9358  C CG    . TYR D  1 356 ? 101.397 83.704  115.474 1.00 43.80  ? 356 TYR D CG    1 
ATOM   9359  C CD1   . TYR D  1 356 ? 101.996 82.827  114.578 1.00 44.52  ? 356 TYR D CD1   1 
ATOM   9360  C CD2   . TYR D  1 356 ? 102.112 84.838  115.867 1.00 42.44  ? 356 TYR D CD2   1 
ATOM   9361  C CE1   . TYR D  1 356 ? 103.258 83.063  114.091 1.00 43.75  ? 356 TYR D CE1   1 
ATOM   9362  C CE2   . TYR D  1 356 ? 103.370 85.075  115.383 1.00 41.60  ? 356 TYR D CE2   1 
ATOM   9363  C CZ    . TYR D  1 356 ? 103.928 84.180  114.498 1.00 42.48  ? 356 TYR D CZ    1 
ATOM   9364  O OH    . TYR D  1 356 ? 105.174 84.373  114.004 1.00 43.31  ? 356 TYR D OH    1 
ATOM   9365  N N     . LYS D  1 357 ? 97.707  82.618  117.956 1.00 26.58  ? 357 LYS D N     1 
ATOM   9366  C CA    . LYS D  1 357 ? 96.403  82.876  118.553 1.00 27.27  ? 357 LYS D CA    1 
ATOM   9367  C C     . LYS D  1 357 ? 96.713  83.286  119.989 1.00 26.37  ? 357 LYS D C     1 
ATOM   9368  O O     . LYS D  1 357 ? 96.499  84.437  120.395 1.00 27.38  ? 357 LYS D O     1 
ATOM   9369  C CB    . LYS D  1 357 ? 95.520  81.623  118.536 1.00 128.61 ? 357 LYS D CB    1 
ATOM   9370  C CG    . LYS D  1 357 ? 94.496  81.575  117.386 1.00 134.56 ? 357 LYS D CG    1 
ATOM   9371  C CD    . LYS D  1 357 ? 93.448  80.461  117.596 1.00 139.14 ? 357 LYS D CD    1 
ATOM   9372  C CE    . LYS D  1 357 ? 92.288  80.511  116.588 1.00 141.61 ? 357 LYS D CE    1 
ATOM   9373  N NZ    . LYS D  1 357 ? 92.636  80.054  115.209 1.00 142.97 ? 357 LYS D NZ    1 
ATOM   9374  N N     . ALA D  1 358 ? 97.277  82.350  120.739 1.00 21.85  ? 358 ALA D N     1 
ATOM   9375  C CA    . ALA D  1 358 ? 97.643  82.596  122.124 1.00 19.82  ? 358 ALA D CA    1 
ATOM   9376  C C     . ALA D  1 358 ? 98.350  83.921  122.349 1.00 17.75  ? 358 ALA D C     1 
ATOM   9377  O O     . ALA D  1 358 ? 98.095  84.569  123.360 1.00 16.93  ? 358 ALA D O     1 
ATOM   9378  C CB    . ALA D  1 358 ? 98.514  81.469  122.627 1.00 43.87  ? 358 ALA D CB    1 
ATOM   9379  N N     . LEU D  1 359 ? 99.235  84.304  121.420 1.00 5.28   ? 359 LEU D N     1 
ATOM   9380  C CA    . LEU D  1 359 ? 100.015 85.553  121.511 1.00 4.02   ? 359 LEU D CA    1 
ATOM   9381  C C     . LEU D  1 359 ? 99.223  86.856  121.261 1.00 3.64   ? 359 LEU D C     1 
ATOM   9382  O O     . LEU D  1 359 ? 99.263  87.806  122.056 1.00 3.64   ? 359 LEU D O     1 
ATOM   9383  C CB    . LEU D  1 359 ? 101.233 85.513  120.562 1.00 12.29  ? 359 LEU D CB    1 
ATOM   9384  C CG    . LEU D  1 359 ? 102.614 85.007  121.018 1.00 9.71   ? 359 LEU D CG    1 
ATOM   9385  C CD1   . LEU D  1 359 ? 103.200 85.714  122.254 1.00 7.99   ? 359 LEU D CD1   1 
ATOM   9386  C CD2   . LEU D  1 359 ? 102.423 83.576  121.334 1.00 12.36  ? 359 LEU D CD2   1 
ATOM   9387  N N     . MET D  1 360 ? 98.520  86.924  120.149 1.00 13.12  ? 360 MET D N     1 
ATOM   9388  C CA    . MET D  1 360 ? 97.745  88.117  119.891 1.00 14.60  ? 360 MET D CA    1 
ATOM   9389  C C     . MET D  1 360 ? 96.714  88.216  121.016 1.00 16.30  ? 360 MET D C     1 
ATOM   9390  O O     . MET D  1 360 ? 96.311  89.302  121.428 1.00 16.65  ? 360 MET D O     1 
ATOM   9391  C CB    . MET D  1 360 ? 97.065  87.998  118.531 1.00 24.38  ? 360 MET D CB    1 
ATOM   9392  C CG    . MET D  1 360 ? 98.039  87.801  117.407 1.00 25.02  ? 360 MET D CG    1 
ATOM   9393  S SD    . MET D  1 360 ? 99.111  89.215  117.314 1.00 26.05  ? 360 MET D SD    1 
ATOM   9394  C CE    . MET D  1 360 ? 100.296 88.929  118.668 1.00 24.70  ? 360 MET D CE    1 
ATOM   9395  N N     . ALA D  1 361 ? 96.292  87.059  121.509 1.00 33.18  ? 361 ALA D N     1 
ATOM   9396  C CA    . ALA D  1 361 ? 95.324  87.003  122.587 1.00 33.55  ? 361 ALA D CA    1 
ATOM   9397  C C     . ALA D  1 361 ? 95.705  88.055  123.594 1.00 34.37  ? 361 ALA D C     1 
ATOM   9398  O O     . ALA D  1 361 ? 94.942  88.953  123.883 1.00 36.82  ? 361 ALA D O     1 
ATOM   9399  C CB    . ALA D  1 361 ? 95.366  85.642  123.239 1.00 51.94  ? 361 ALA D CB    1 
ATOM   9400  N N     . THR D  1 362 ? 96.921  87.934  124.099 1.00 13.41  ? 362 THR D N     1 
ATOM   9401  C CA    . THR D  1 362 ? 97.456  88.835  125.098 1.00 14.32  ? 362 THR D CA    1 
ATOM   9402  C C     . THR D  1 362 ? 97.219  90.291  124.849 1.00 14.62  ? 362 THR D C     1 
ATOM   9403  O O     . THR D  1 362 ? 96.967  91.023  125.792 1.00 14.54  ? 362 THR D O     1 
ATOM   9404  C CB    . THR D  1 362 ? 98.952  88.712  125.234 1.00 46.10  ? 362 THR D CB    1 
ATOM   9405  O OG1   . THR D  1 362 ? 99.381  87.421  124.797 1.00 47.60  ? 362 THR D OG1   1 
ATOM   9406  C CG2   . THR D  1 362 ? 99.331  88.927  126.677 1.00 48.07  ? 362 THR D CG2   1 
ATOM   9407  N N     . GLU D  1 363 ? 97.353  90.714  123.592 1.00 57.35  ? 363 GLU D N     1 
ATOM   9408  C CA    . GLU D  1 363 ? 97.157  92.110  123.217 1.00 58.61  ? 363 GLU D CA    1 
ATOM   9409  C C     . GLU D  1 363 ? 95.690  92.399  123.078 1.00 58.78  ? 363 GLU D C     1 
ATOM   9410  O O     . GLU D  1 363 ? 95.307  93.527  122.807 1.00 60.04  ? 363 GLU D O     1 
ATOM   9411  C CB    . GLU D  1 363 ? 97.853  92.418  121.905 1.00 37.06  ? 363 GLU D CB    1 
ATOM   9412  C CG    . GLU D  1 363 ? 99.358  92.282  121.990 1.00 39.50  ? 363 GLU D CG    1 
ATOM   9413  C CD    . GLU D  1 363 ? 100.033 93.488  122.622 1.00 40.89  ? 363 GLU D CD    1 
ATOM   9414  O OE1   . GLU D  1 363 ? 99.403  94.161  123.484 1.00 39.30  ? 363 GLU D OE1   1 
ATOM   9415  O OE2   . GLU D  1 363 ? 101.204 93.751  122.249 1.00 43.32  ? 363 GLU D OE2   1 
ATOM   9416  N N     . GLY D  1 364 ? 94.875  91.364  123.255 1.00 21.82  ? 364 GLY D N     1 
ATOM   9417  C CA    . GLY D  1 364 ? 93.434  91.514  123.177 1.00 20.20  ? 364 GLY D CA    1 
ATOM   9418  C C     . GLY D  1 364 ? 92.827  91.215  121.826 1.00 19.05  ? 364 GLY D C     1 
ATOM   9419  O O     . GLY D  1 364 ? 91.622  91.209  121.674 1.00 19.73  ? 364 GLY D O     1 
ATOM   9420  N N     . VAL D  1 365 ? 93.641  90.990  120.823 1.00 21.39  ? 365 VAL D N     1 
ATOM   9421  C CA    . VAL D  1 365 ? 93.068  90.697  119.535 1.00 22.87  ? 365 VAL D CA    1 
ATOM   9422  C C     . VAL D  1 365 ? 92.765  89.205  119.495 1.00 26.09  ? 365 VAL D C     1 
ATOM   9423  O O     . VAL D  1 365 ? 93.529  88.384  120.028 1.00 28.03  ? 365 VAL D O     1 
ATOM   9424  C CB    . VAL D  1 365 ? 94.028  91.042  118.387 1.00 17.30  ? 365 VAL D CB    1 
ATOM   9425  C CG1   . VAL D  1 365 ? 93.428  90.646  117.056 1.00 15.19  ? 365 VAL D CG1   1 
ATOM   9426  C CG2   . VAL D  1 365 ? 94.314  92.503  118.398 1.00 16.67  ? 365 VAL D CG2   1 
ATOM   9427  N N     . ASN D  1 366 ? 91.629  88.866  118.882 1.00 42.47  ? 366 ASN D N     1 
ATOM   9428  C CA    . ASN D  1 366 ? 91.198  87.488  118.728 1.00 42.58  ? 366 ASN D CA    1 
ATOM   9429  C C     . ASN D  1 366 ? 91.391  87.129  117.273 1.00 41.06  ? 366 ASN D C     1 
ATOM   9430  O O     . ASN D  1 366 ? 90.730  87.651  116.374 1.00 40.65  ? 366 ASN D O     1 
ATOM   9431  C CB    . ASN D  1 366 ? 89.735  87.322  119.123 1.00 102.41 ? 366 ASN D CB    1 
ATOM   9432  C CG    . ASN D  1 366 ? 89.279  85.883  119.043 1.00 106.48 ? 366 ASN D CG    1 
ATOM   9433  O OD1   . ASN D  1 366 ? 88.876  85.412  117.982 1.00 107.79 ? 366 ASN D OD1   1 
ATOM   9434  N ND2   . ASN D  1 366 ? 89.358  85.167  120.165 1.00 109.07 ? 366 ASN D ND2   1 
ATOM   9435  N N     . ILE D  1 367 ? 92.323  86.227  117.046 1.00 22.25  ? 367 ILE D N     1 
ATOM   9436  C CA    . ILE D  1 367 ? 92.623  85.802  115.696 1.00 21.36  ? 367 ILE D CA    1 
ATOM   9437  C C     . ILE D  1 367 ? 92.086  84.397  115.313 1.00 18.87  ? 367 ILE D C     1 
ATOM   9438  O O     . ILE D  1 367 ? 91.847  83.519  116.162 1.00 17.09  ? 367 ILE D O     1 
ATOM   9439  C CB    . ILE D  1 367 ? 94.120  85.893  115.508 1.00 50.87  ? 367 ILE D CB    1 
ATOM   9440  C CG1   . ILE D  1 367 ? 94.537  85.236  114.200 1.00 51.26  ? 367 ILE D CG1   1 
ATOM   9441  C CG2   . ILE D  1 367 ? 94.802  85.316  116.736 1.00 52.01  ? 367 ILE D CG2   1 
ATOM   9442  C CD1   . ILE D  1 367 ? 95.984  85.444  113.903 1.00 51.97  ? 367 ILE D CD1   1 
ATOM   9443  N N     . ALA D  1 368 ? 91.859  84.201  114.023 1.00 15.75  ? 368 ALA D N     1 
ATOM   9444  C CA    . ALA D  1 368 ? 91.337  82.935  113.579 1.00 14.95  ? 368 ALA D CA    1 
ATOM   9445  C C     . ALA D  1 368 ? 91.869  82.618  112.210 1.00 14.49  ? 368 ALA D C     1 
ATOM   9446  O O     . ALA D  1 368 ? 91.840  83.464  111.325 1.00 12.93  ? 368 ALA D O     1 
ATOM   9447  C CB    . ALA D  1 368 ? 89.839  82.976  113.548 1.00 69.57  ? 368 ALA D CB    1 
ATOM   9448  N N     . PHE D  1 369 ? 92.387  81.403  112.049 1.00 33.65  ? 369 PHE D N     1 
ATOM   9449  C CA    . PHE D  1 369 ? 92.913  80.993  110.763 1.00 32.23  ? 369 PHE D CA    1 
ATOM   9450  C C     . PHE D  1 369 ? 91.885  80.063  110.170 1.00 33.16  ? 369 PHE D C     1 
ATOM   9451  O O     . PHE D  1 369 ? 91.373  79.170  110.858 1.00 32.55  ? 369 PHE D O     1 
ATOM   9452  C CB    . PHE D  1 369 ? 94.231  80.219  110.877 1.00 14.78  ? 369 PHE D CB    1 
ATOM   9453  C CG    . PHE D  1 369 ? 95.371  80.997  111.440 1.00 9.64   ? 369 PHE D CG    1 
ATOM   9454  C CD1   . PHE D  1 369 ? 95.671  80.919  112.788 1.00 8.83   ? 369 PHE D CD1   1 
ATOM   9455  C CD2   . PHE D  1 369 ? 96.155  81.766  110.626 1.00 7.77   ? 369 PHE D CD2   1 
ATOM   9456  C CE1   . PHE D  1 369 ? 96.731  81.590  113.314 1.00 9.02   ? 369 PHE D CE1   1 
ATOM   9457  C CE2   . PHE D  1 369 ? 97.223  82.447  111.136 1.00 8.58   ? 369 PHE D CE2   1 
ATOM   9458  C CZ    . PHE D  1 369 ? 97.516  82.361  112.486 1.00 9.07   ? 369 PHE D CZ    1 
ATOM   9459  N N     . THR D  1 370 ? 91.600  80.284  108.891 1.00 19.01  ? 370 THR D N     1 
ATOM   9460  C CA    . THR D  1 370 ? 90.644  79.471  108.179 1.00 21.48  ? 370 THR D CA    1 
ATOM   9461  C C     . THR D  1 370 ? 91.425  78.350  107.537 1.00 22.38  ? 370 THR D C     1 
ATOM   9462  O O     . THR D  1 370 ? 92.611  78.495  107.258 1.00 21.94  ? 370 THR D O     1 
ATOM   9463  C CB    . THR D  1 370 ? 89.882  80.290  107.082 1.00 28.81  ? 370 THR D CB    1 
ATOM   9464  O OG1   . THR D  1 370 ? 90.593  80.279  105.835 1.00 29.24  ? 370 THR D OG1   1 
ATOM   9465  C CG2   . THR D  1 370 ? 89.728  81.717  107.537 1.00 29.52  ? 370 THR D CG2   1 
ATOM   9466  N N     . THR D  1 371 ? 90.746  77.225  107.342 1.00 39.74  ? 371 THR D N     1 
ATOM   9467  C CA    . THR D  1 371 ? 91.315  76.059  106.715 1.00 41.41  ? 371 THR D CA    1 
ATOM   9468  C C     . THR D  1 371 ? 92.093  76.504  105.499 1.00 41.05  ? 371 THR D C     1 
ATOM   9469  O O     . THR D  1 371 ? 93.320  76.437  105.494 1.00 42.79  ? 371 THR D O     1 
ATOM   9470  C CB    . THR D  1 371 ? 90.233  75.145  106.278 1.00 75.39  ? 371 THR D CB    1 
ATOM   9471  O OG1   . THR D  1 371 ? 89.319  74.975  107.364 1.00 78.70  ? 371 THR D OG1   1 
ATOM   9472  C CG2   . THR D  1 371 ? 90.814  73.817  105.880 1.00 79.11  ? 371 THR D CG2   1 
ATOM   9473  N N     . ASP D  1 372 ? 91.389  76.961  104.467 1.00 9.41   ? 372 ASP D N     1 
ATOM   9474  C CA    . ASP D  1 372 ? 92.061  77.440  103.262 1.00 11.25  ? 372 ASP D CA    1 
ATOM   9475  C C     . ASP D  1 372 ? 93.257  78.350  103.586 1.00 9.60   ? 372 ASP D C     1 
ATOM   9476  O O     . ASP D  1 372 ? 94.210  78.435  102.815 1.00 9.85   ? 372 ASP D O     1 
ATOM   9477  C CB    . ASP D  1 372 ? 91.075  78.176  102.374 1.00 113.45 ? 372 ASP D CB    1 
ATOM   9478  C CG    . ASP D  1 372 ? 90.083  77.245  101.750 1.00 121.36 ? 372 ASP D CG    1 
ATOM   9479  O OD1   . ASP D  1 372 ? 90.514  76.381  100.957 1.00 124.20 ? 372 ASP D OD1   1 
ATOM   9480  O OD2   . ASP D  1 372 ? 88.879  77.367  102.058 1.00 125.58 ? 372 ASP D OD2   1 
ATOM   9481  N N     . ALA D  1 373 ? 93.231  79.025  104.728 1.00 40.07  ? 373 ALA D N     1 
ATOM   9482  C CA    . ALA D  1 373 ? 94.348  79.893  105.086 1.00 36.81  ? 373 ALA D CA    1 
ATOM   9483  C C     . ALA D  1 373 ? 95.585  79.044  105.397 1.00 33.90  ? 373 ALA D C     1 
ATOM   9484  O O     . ALA D  1 373 ? 96.672  79.264  104.859 1.00 32.92  ? 373 ALA D O     1 
ATOM   9485  C CB    . ALA D  1 373 ? 93.974  80.764  106.291 1.00 89.09  ? 373 ALA D CB    1 
ATOM   9486  N N     . VAL D  1 374 ? 95.412  78.061  106.263 1.00 15.77  ? 374 VAL D N     1 
ATOM   9487  C CA    . VAL D  1 374 ? 96.529  77.222  106.605 1.00 13.93  ? 374 VAL D CA    1 
ATOM   9488  C C     . VAL D  1 374 ? 96.959  76.511  105.335 1.00 14.79  ? 374 VAL D C     1 
ATOM   9489  O O     . VAL D  1 374 ? 98.137  76.496  104.999 1.00 14.48  ? 374 VAL D O     1 
ATOM   9490  C CB    . VAL D  1 374 ? 96.172  76.191  107.715 1.00 6.26   ? 374 VAL D CB    1 
ATOM   9491  C CG1   . VAL D  1 374 ? 97.369  75.356  108.021 1.00 6.66   ? 374 VAL D CG1   1 
ATOM   9492  C CG2   . VAL D  1 374 ? 95.788  76.891  108.986 1.00 2.54   ? 374 VAL D CG2   1 
ATOM   9493  N N     . LYS D  1 375 ? 96.006  75.933  104.616 1.00 23.62  ? 375 LYS D N     1 
ATOM   9494  C CA    . LYS D  1 375 ? 96.346  75.239  103.388 1.00 25.87  ? 375 LYS D CA    1 
ATOM   9495  C C     . LYS D  1 375 ? 97.257  76.171  102.610 1.00 26.15  ? 375 LYS D C     1 
ATOM   9496  O O     . LYS D  1 375 ? 98.336  75.757  102.174 1.00 25.49  ? 375 LYS D O     1 
ATOM   9497  C CB    . LYS D  1 375 ? 95.090  74.909  102.585 1.00 111.80 ? 375 LYS D CB    1 
ATOM   9498  C CG    . LYS D  1 375 ? 95.281  73.795  101.572 1.00 116.29 ? 375 LYS D CG    1 
ATOM   9499  C CD    . LYS D  1 375 ? 93.974  73.059  101.333 1.00 122.16 ? 375 LYS D CD    1 
ATOM   9500  C CE    . LYS D  1 375 ? 94.187  71.804  100.505 1.00 125.05 ? 375 LYS D CE    1 
ATOM   9501  N NZ    . LYS D  1 375 ? 94.827  72.124  99.199  1.00 127.16 ? 375 LYS D NZ    1 
ATOM   9502  N N     . LYS D  1 376 ? 96.852  77.442  102.493 1.00 29.01  ? 376 LYS D N     1 
ATOM   9503  C CA    . LYS D  1 376 ? 97.622  78.463  101.770 1.00 30.10  ? 376 LYS D CA    1 
ATOM   9504  C C     . LYS D  1 376 ? 99.011  78.700  102.396 1.00 28.13  ? 376 LYS D C     1 
ATOM   9505  O O     . LYS D  1 376 ? 100.040 78.629  101.706 1.00 27.20  ? 376 LYS D O     1 
ATOM   9506  C CB    . LYS D  1 376 ? 96.835  79.770  101.724 1.00 126.95 ? 376 LYS D CB    1 
ATOM   9507  C CG    . LYS D  1 376 ? 97.420  80.820  100.798 1.00 134.77 ? 376 LYS D CG    1 
ATOM   9508  C CD    . LYS D  1 376 ? 97.265  80.446  99.330  1.00 140.78 ? 376 LYS D CD    1 
ATOM   9509  C CE    . LYS D  1 376 ? 97.897  81.511  98.435  1.00 143.43 ? 376 LYS D CE    1 
ATOM   9510  N NZ    . LYS D  1 376 ? 97.768  81.203  96.978  1.00 147.29 ? 376 LYS D NZ    1 
ATOM   9511  N N     . ILE D  1 377 ? 99.035  78.981  103.696 1.00 24.30  ? 377 ILE D N     1 
ATOM   9512  C CA    . ILE D  1 377 ? 100.290 79.203  104.415 1.00 22.29  ? 377 ILE D CA    1 
ATOM   9513  C C     . ILE D  1 377 ? 101.258 78.061  104.124 1.00 23.52  ? 377 ILE D C     1 
ATOM   9514  O O     . ILE D  1 377 ? 102.381 78.289  103.683 1.00 23.06  ? 377 ILE D O     1 
ATOM   9515  C CB    . ILE D  1 377 ? 100.050 79.273  105.942 1.00 1.31   ? 377 ILE D CB    1 
ATOM   9516  C CG1   . ILE D  1 377 ? 99.055  80.390  106.234 1.00 1.48   ? 377 ILE D CG1   1 
ATOM   9517  C CG2   . ILE D  1 377 ? 101.358 79.446  106.690 1.00 1.00   ? 377 ILE D CG2   1 
ATOM   9518  C CD1   . ILE D  1 377 ? 99.019  80.857  107.654 1.00 3.90   ? 377 ILE D CD1   1 
ATOM   9519  N N     . ALA D  1 378 ? 100.797 76.834  104.364 1.00 7.79   ? 378 ALA D N     1 
ATOM   9520  C CA    . ALA D  1 378 ? 101.585 75.637  104.153 1.00 8.03   ? 378 ALA D CA    1 
ATOM   9521  C C     . ALA D  1 378 ? 102.027 75.489  102.722 1.00 9.09   ? 378 ALA D C     1 
ATOM   9522  O O     . ALA D  1 378 ? 103.218 75.350  102.458 1.00 9.39   ? 378 ALA D O     1 
ATOM   9523  C CB    . ALA D  1 378 ? 100.797 74.446  104.550 1.00 65.80  ? 378 ALA D CB    1 
ATOM   9524  N N     . GLU D  1 379 ? 101.077 75.495  101.793 1.00 24.47  ? 379 GLU D N     1 
ATOM   9525  C CA    . GLU D  1 379 ? 101.432 75.369  100.380 1.00 27.88  ? 379 GLU D CA    1 
ATOM   9526  C C     . GLU D  1 379 ? 102.561 76.363  100.112 1.00 26.93  ? 379 GLU D C     1 
ATOM   9527  O O     . GLU D  1 379 ? 103.506 76.068  99.375  1.00 27.11  ? 379 GLU D O     1 
ATOM   9528  C CB    . GLU D  1 379 ? 100.228 75.694  99.477  1.00 100.44 ? 379 GLU D CB    1 
ATOM   9529  C CG    . GLU D  1 379 ? 99.873  74.599  98.462  1.00 108.48 ? 379 GLU D CG    1 
ATOM   9530  C CD    . GLU D  1 379 ? 98.535  73.915  98.762  1.00 113.58 ? 379 GLU D CD    1 
ATOM   9531  O OE1   . GLU D  1 379 ? 97.489  74.588  98.661  1.00 114.67 ? 379 GLU D OE1   1 
ATOM   9532  O OE2   . GLU D  1 379 ? 98.518  72.709  99.102  1.00 114.10 ? 379 GLU D OE2   1 
ATOM   9533  N N     . ALA D  1 380 ? 102.455 77.532  100.747 1.00 23.80  ? 380 ALA D N     1 
ATOM   9534  C CA    . ALA D  1 380 ? 103.425 78.601  100.606 1.00 22.93  ? 380 ALA D CA    1 
ATOM   9535  C C     . ALA D  1 380 ? 104.814 78.252  101.140 1.00 22.72  ? 380 ALA D C     1 
ATOM   9536  O O     . ALA D  1 380 ? 105.809 78.482  100.455 1.00 22.66  ? 380 ALA D O     1 
ATOM   9537  C CB    . ALA D  1 380 ? 102.906 79.834  101.286 1.00 73.87  ? 380 ALA D CB    1 
ATOM   9538  N N     . ALA D  1 381 ? 104.890 77.718  102.359 1.00 17.90  ? 381 ALA D N     1 
ATOM   9539  C CA    . ALA D  1 381 ? 106.181 77.336  102.942 1.00 18.60  ? 381 ALA D CA    1 
ATOM   9540  C C     . ALA D  1 381 ? 106.824 76.334  102.015 1.00 19.21  ? 381 ALA D C     1 
ATOM   9541  O O     . ALA D  1 381 ? 107.953 76.515  101.584 1.00 18.91  ? 381 ALA D O     1 
ATOM   9542  C CB    . ALA D  1 381 ? 105.991 76.716  104.296 1.00 33.96  ? 381 ALA D CB    1 
ATOM   9543  N N     . PHE D  1 382 ? 106.098 75.271  101.706 1.00 23.67  ? 382 PHE D N     1 
ATOM   9544  C CA    . PHE D  1 382 ? 106.618 74.263  100.803 1.00 26.24  ? 382 PHE D CA    1 
ATOM   9545  C C     . PHE D  1 382 ? 107.066 74.909  99.505  1.00 27.32  ? 382 PHE D C     1 
ATOM   9546  O O     . PHE D  1 382 ? 108.170 74.638  99.031  1.00 28.45  ? 382 PHE D O     1 
ATOM   9547  C CB    . PHE D  1 382 ? 105.549 73.230  100.520 1.00 49.77  ? 382 PHE D CB    1 
ATOM   9548  C CG    . PHE D  1 382 ? 105.983 72.139  99.589  1.00 52.77  ? 382 PHE D CG    1 
ATOM   9549  C CD1   . PHE D  1 382 ? 105.720 70.813  99.905  1.00 54.03  ? 382 PHE D CD1   1 
ATOM   9550  C CD2   . PHE D  1 382 ? 106.557 72.425  98.361  1.00 53.29  ? 382 PHE D CD2   1 
ATOM   9551  C CE1   . PHE D  1 382 ? 106.012 69.782  99.010  1.00 54.84  ? 382 PHE D CE1   1 
ATOM   9552  C CE2   . PHE D  1 382 ? 106.852 71.411  97.460  1.00 54.90  ? 382 PHE D CE2   1 
ATOM   9553  C CZ    . PHE D  1 382 ? 106.576 70.083  97.784  1.00 55.65  ? 382 PHE D CZ    1 
ATOM   9554  N N     . ARG D  1 383 ? 106.203 75.746  98.932  1.00 29.25  ? 383 ARG D N     1 
ATOM   9555  C CA    . ARG D  1 383 ? 106.496 76.449  97.681  1.00 32.52  ? 383 ARG D CA    1 
ATOM   9556  C C     . ARG D  1 383 ? 107.945 76.967  97.636  1.00 31.00  ? 383 ARG D C     1 
ATOM   9557  O O     . ARG D  1 383 ? 108.747 76.548  96.799  1.00 29.32  ? 383 ARG D O     1 
ATOM   9558  C CB    . ARG D  1 383 ? 105.525 77.625  97.508  1.00 165.36 ? 383 ARG D CB    1 
ATOM   9559  C CG    . ARG D  1 383 ? 105.684 78.411  96.218  1.00 174.13 ? 383 ARG D CG    1 
ATOM   9560  C CD    . ARG D  1 383 ? 105.164 77.632  95.029  1.00 182.74 ? 383 ARG D CD    1 
ATOM   9561  N NE    . ARG D  1 383 ? 105.362 78.363  93.779  1.00 190.49 ? 383 ARG D NE    1 
ATOM   9562  C CZ    . ARG D  1 383 ? 104.965 77.930  92.585  1.00 193.15 ? 383 ARG D CZ    1 
ATOM   9563  N NH1   . ARG D  1 383 ? 104.341 76.764  92.476  1.00 194.43 ? 383 ARG D NH1   1 
ATOM   9564  N NH2   . ARG D  1 383 ? 105.192 78.660  91.501  1.00 193.76 ? 383 ARG D NH2   1 
ATOM   9565  N N     . VAL D  1 384 ? 108.294 77.875  98.539  1.00 44.77  ? 384 VAL D N     1 
ATOM   9566  C CA    . VAL D  1 384 ? 109.641 78.415  98.533  1.00 43.83  ? 384 VAL D CA    1 
ATOM   9567  C C     . VAL D  1 384 ? 110.684 77.347  98.749  1.00 45.67  ? 384 VAL D C     1 
ATOM   9568  O O     . VAL D  1 384 ? 111.605 77.235  97.954  1.00 47.90  ? 384 VAL D O     1 
ATOM   9569  C CB    . VAL D  1 384 ? 109.811 79.509  99.577  1.00 15.67  ? 384 VAL D CB    1 
ATOM   9570  C CG1   . VAL D  1 384 ? 108.794 79.337  100.656 1.00 16.38  ? 384 VAL D CG1   1 
ATOM   9571  C CG2   . VAL D  1 384 ? 111.206 79.464  100.150 1.00 14.00  ? 384 VAL D CG2   1 
ATOM   9572  N N     . ASN D  1 385 ? 110.558 76.571  99.820  1.00 42.62  ? 385 ASN D N     1 
ATOM   9573  C CA    . ASN D  1 385 ? 111.519 75.511  100.065 1.00 42.87  ? 385 ASN D CA    1 
ATOM   9574  C C     . ASN D  1 385 ? 111.898 74.881  98.738  1.00 44.14  ? 385 ASN D C     1 
ATOM   9575  O O     . ASN D  1 385 ? 113.080 74.774  98.424  1.00 42.69  ? 385 ASN D O     1 
ATOM   9576  C CB    . ASN D  1 385 ? 110.931 74.463  100.994 1.00 36.88  ? 385 ASN D CB    1 
ATOM   9577  C CG    . ASN D  1 385 ? 111.302 74.714  102.409 1.00 35.50  ? 385 ASN D CG    1 
ATOM   9578  O OD1   . ASN D  1 385 ? 111.797 75.778  102.727 1.00 35.08  ? 385 ASN D OD1   1 
ATOM   9579  N ND2   . ASN D  1 385 ? 111.074 73.741  103.274 1.00 36.31  ? 385 ASN D ND2   1 
ATOM   9580  N N     . GLU D  1 386 ? 110.905 74.491  97.940  1.00 33.55  ? 386 GLU D N     1 
ATOM   9581  C CA    . GLU D  1 386 ? 111.226 73.891  96.654  1.00 37.51  ? 386 GLU D CA    1 
ATOM   9582  C C     . GLU D  1 386 ? 112.003 74.839  95.741  1.00 36.88  ? 386 GLU D C     1 
ATOM   9583  O O     . GLU D  1 386 ? 112.967 74.411  95.099  1.00 35.87  ? 386 GLU D O     1 
ATOM   9584  C CB    . GLU D  1 386 ? 109.971 73.408  95.917  1.00 168.48 ? 386 GLU D CB    1 
ATOM   9585  C CG    . GLU D  1 386 ? 110.252 73.043  94.453  1.00 175.12 ? 386 GLU D CG    1 
ATOM   9586  C CD    . GLU D  1 386 ? 109.063 72.427  93.739  1.00 179.82 ? 386 GLU D CD    1 
ATOM   9587  O OE1   . GLU D  1 386 ? 108.702 71.280  94.074  1.00 181.93 ? 386 GLU D OE1   1 
ATOM   9588  O OE2   . GLU D  1 386 ? 108.489 73.088  92.844  1.00 180.55 ? 386 GLU D OE2   1 
ATOM   9589  N N     . LYS D  1 387 ? 111.590 76.113  95.687  1.00 32.01  ? 387 LYS D N     1 
ATOM   9590  C CA    . LYS D  1 387 ? 112.231 77.113  94.820  1.00 32.11  ? 387 LYS D CA    1 
ATOM   9591  C C     . LYS D  1 387 ? 113.596 77.616  95.296  1.00 30.75  ? 387 LYS D C     1 
ATOM   9592  O O     . LYS D  1 387 ? 114.357 78.175  94.512  1.00 29.72  ? 387 LYS D O     1 
ATOM   9593  C CB    . LYS D  1 387 ? 111.299 78.303  94.615  1.00 124.36 ? 387 LYS D CB    1 
ATOM   9594  C CG    . LYS D  1 387 ? 109.937 77.922  94.078  1.00 130.63 ? 387 LYS D CG    1 
ATOM   9595  C CD    . LYS D  1 387 ? 110.020 77.200  92.734  1.00 133.83 ? 387 LYS D CD    1 
ATOM   9596  C CE    . LYS D  1 387 ? 108.627 76.781  92.250  1.00 135.50 ? 387 LYS D CE    1 
ATOM   9597  N NZ    . LYS D  1 387 ? 108.628 76.084  90.929  1.00 138.69 ? 387 LYS D NZ    1 
ATOM   9598  N N     . THR D  1 388 ? 113.920 77.406  96.569  1.00 84.35  ? 388 THR D N     1 
ATOM   9599  C CA    . THR D  1 388 ? 115.203 77.868  97.090  1.00 84.86  ? 388 THR D CA    1 
ATOM   9600  C C     . THR D  1 388 ? 115.908 76.927  98.063  1.00 85.17  ? 388 THR D C     1 
ATOM   9601  O O     . THR D  1 388 ? 116.079 75.741  97.771  1.00 86.96  ? 388 THR D O     1 
ATOM   9602  C CB    . THR D  1 388 ? 115.047 79.223  97.763  1.00 53.04  ? 388 THR D CB    1 
ATOM   9603  O OG1   . THR D  1 388 ? 114.109 79.128  98.840  1.00 52.26  ? 388 THR D OG1   1 
ATOM   9604  C CG2   . THR D  1 388 ? 114.563 80.236  96.756  1.00 54.34  ? 388 THR D CG2   1 
ATOM   9605  N N     . GLU D  1 389 ? 116.336 77.455  99.210  1.00 41.49  ? 389 GLU D N     1 
ATOM   9606  C CA    . GLU D  1 389 ? 117.027 76.638  100.205 1.00 40.42  ? 389 GLU D CA    1 
ATOM   9607  C C     . GLU D  1 389 ? 115.999 75.913  101.102 1.00 38.40  ? 389 GLU D C     1 
ATOM   9608  O O     . GLU D  1 389 ? 115.533 76.451  102.098 1.00 37.68  ? 389 GLU D O     1 
ATOM   9609  C CB    . GLU D  1 389 ? 117.957 77.526  101.042 1.00 153.94 ? 389 GLU D CB    1 
ATOM   9610  C CG    . GLU D  1 389 ? 118.893 76.774  101.987 1.00 160.28 ? 389 GLU D CG    1 
ATOM   9611  C CD    . GLU D  1 389 ? 120.124 76.210  101.297 1.00 164.54 ? 389 GLU D CD    1 
ATOM   9612  O OE1   . GLU D  1 389 ? 120.999 77.003  100.882 1.00 166.60 ? 389 GLU D OE1   1 
ATOM   9613  O OE2   . GLU D  1 389 ? 120.218 74.971  101.174 1.00 166.93 ? 389 GLU D OE2   1 
ATOM   9614  N N     . ASN D  1 390 ? 115.632 74.687  100.733 1.00 41.39  ? 390 ASN D N     1 
ATOM   9615  C CA    . ASN D  1 390 ? 114.652 73.913  101.491 1.00 36.92  ? 390 ASN D CA    1 
ATOM   9616  C C     . ASN D  1 390 ? 115.179 73.747  102.891 1.00 33.36  ? 390 ASN D C     1 
ATOM   9617  O O     . ASN D  1 390 ? 116.057 72.948  103.124 1.00 33.10  ? 390 ASN D O     1 
ATOM   9618  C CB    . ASN D  1 390 ? 114.461 72.540  100.840 1.00 61.65  ? 390 ASN D CB    1 
ATOM   9619  C CG    . ASN D  1 390 ? 113.509 71.649  101.613 1.00 64.80  ? 390 ASN D CG    1 
ATOM   9620  O OD1   . ASN D  1 390 ? 113.647 71.477  102.832 1.00 67.17  ? 390 ASN D OD1   1 
ATOM   9621  N ND2   . ASN D  1 390 ? 112.539 71.062  100.906 1.00 64.17  ? 390 ASN D ND2   1 
ATOM   9622  N N     . ILE D  1 391 ? 114.661 74.512  103.830 1.00 21.83  ? 391 ILE D N     1 
ATOM   9623  C CA    . ILE D  1 391 ? 115.136 74.394  105.206 1.00 20.11  ? 391 ILE D CA    1 
ATOM   9624  C C     . ILE D  1 391 ? 114.183 73.579  106.054 1.00 19.17  ? 391 ILE D C     1 
ATOM   9625  O O     . ILE D  1 391 ? 114.109 73.767  107.271 1.00 17.73  ? 391 ILE D O     1 
ATOM   9626  C CB    . ILE D  1 391 ? 115.282 75.759  105.859 1.00 28.19  ? 391 ILE D CB    1 
ATOM   9627  C CG1   . ILE D  1 391 ? 113.989 76.550  105.661 1.00 27.77  ? 391 ILE D CG1   1 
ATOM   9628  C CG2   . ILE D  1 391 ? 116.461 76.479  105.276 1.00 28.34  ? 391 ILE D CG2   1 
ATOM   9629  C CD1   . ILE D  1 391 ? 114.055 77.963  106.121 1.00 25.83  ? 391 ILE D CD1   1 
ATOM   9630  N N     . GLY D  1 392 ? 113.452 72.680  105.408 1.00 14.14  ? 392 GLY D N     1 
ATOM   9631  C CA    . GLY D  1 392 ? 112.525 71.855  106.141 1.00 13.55  ? 392 GLY D CA    1 
ATOM   9632  C C     . GLY D  1 392 ? 111.375 72.665  106.698 1.00 14.75  ? 392 GLY D C     1 
ATOM   9633  O O     . GLY D  1 392 ? 110.952 73.644  106.087 1.00 14.88  ? 392 GLY D O     1 
ATOM   9634  N N     . ALA D  1 393 ? 110.881 72.255  107.864 1.00 35.52  ? 393 ALA D N     1 
ATOM   9635  C CA    . ALA D  1 393 ? 109.755 72.896  108.536 1.00 35.71  ? 393 ALA D CA    1 
ATOM   9636  C C     . ALA D  1 393 ? 110.062 74.268  109.057 1.00 37.22  ? 393 ALA D C     1 
ATOM   9637  O O     . ALA D  1 393 ? 109.145 75.001  109.410 1.00 38.12  ? 393 ALA D O     1 
ATOM   9638  C CB    . ALA D  1 393 ? 109.285 72.060  109.677 1.00 6.93   ? 393 ALA D CB    1 
ATOM   9639  N N     . ARG D  1 394 ? 111.334 74.626  109.154 1.00 20.70  ? 394 ARG D N     1 
ATOM   9640  C CA    . ARG D  1 394 ? 111.632 75.953  109.642 1.00 21.31  ? 394 ARG D CA    1 
ATOM   9641  C C     . ARG D  1 394 ? 110.916 76.912  108.735 1.00 19.44  ? 394 ARG D C     1 
ATOM   9642  O O     . ARG D  1 394 ? 110.387 77.916  109.174 1.00 20.62  ? 394 ARG D O     1 
ATOM   9643  C CB    . ARG D  1 394 ? 113.124 76.237  109.630 1.00 62.76  ? 394 ARG D CB    1 
ATOM   9644  C CG    . ARG D  1 394 ? 113.809 75.795  110.896 1.00 70.29  ? 394 ARG D CG    1 
ATOM   9645  C CD    . ARG D  1 394 ? 113.138 76.373  112.139 1.00 75.47  ? 394 ARG D CD    1 
ATOM   9646  N NE    . ARG D  1 394 ? 113.877 75.992  113.340 1.00 82.03  ? 394 ARG D NE    1 
ATOM   9647  C CZ    . ARG D  1 394 ? 113.606 76.442  114.558 1.00 85.29  ? 394 ARG D CZ    1 
ATOM   9648  N NH1   . ARG D  1 394 ? 112.597 77.294  114.733 1.00 86.52  ? 394 ARG D NH1   1 
ATOM   9649  N NH2   . ARG D  1 394 ? 114.356 76.055  115.590 1.00 85.85  ? 394 ARG D NH2   1 
ATOM   9650  N N     . ARG D  1 395 ? 110.857 76.600  107.461 1.00 19.06  ? 395 ARG D N     1 
ATOM   9651  C CA    . ARG D  1 395 ? 110.173 77.508  106.578 1.00 19.32  ? 395 ARG D CA    1 
ATOM   9652  C C     . ARG D  1 395 ? 108.749 77.892  107.063 1.00 18.65  ? 395 ARG D C     1 
ATOM   9653  O O     . ARG D  1 395 ? 108.129 78.799  106.518 1.00 19.57  ? 395 ARG D O     1 
ATOM   9654  C CB    . ARG D  1 395 ? 110.116 76.920  105.175 1.00 29.64  ? 395 ARG D CB    1 
ATOM   9655  C CG    . ARG D  1 395 ? 109.667 77.929  104.145 1.00 30.51  ? 395 ARG D CG    1 
ATOM   9656  C CD    . ARG D  1 395 ? 110.712 79.008  103.978 1.00 29.70  ? 395 ARG D CD    1 
ATOM   9657  N NE    . ARG D  1 395 ? 111.824 78.488  103.209 1.00 31.85  ? 395 ARG D NE    1 
ATOM   9658  C CZ    . ARG D  1 395 ? 112.987 79.104  103.052 1.00 34.02  ? 395 ARG D CZ    1 
ATOM   9659  N NH1   . ARG D  1 395 ? 113.200 80.270  103.614 1.00 38.34  ? 395 ARG D NH1   1 
ATOM   9660  N NH2   . ARG D  1 395 ? 113.944 78.559  102.322 1.00 36.02  ? 395 ARG D NH2   1 
ATOM   9661  N N     . LEU D  1 396 ? 108.205 77.212  108.065 1.00 27.44  ? 396 LEU D N     1 
ATOM   9662  C CA    . LEU D  1 396 ? 106.885 77.603  108.542 1.00 26.78  ? 396 LEU D CA    1 
ATOM   9663  C C     . LEU D  1 396 ? 107.061 78.771  109.495 1.00 29.06  ? 396 LEU D C     1 
ATOM   9664  O O     . LEU D  1 396 ? 106.405 79.800  109.347 1.00 29.89  ? 396 LEU D O     1 
ATOM   9665  C CB    . LEU D  1 396 ? 106.190 76.453  109.248 1.00 8.61   ? 396 LEU D CB    1 
ATOM   9666  C CG    . LEU D  1 396 ? 105.870 75.358  108.239 1.00 7.13   ? 396 LEU D CG    1 
ATOM   9667  C CD1   . LEU D  1 396 ? 105.191 74.173  108.915 1.00 5.63   ? 396 LEU D CD1   1 
ATOM   9668  C CD2   . LEU D  1 396 ? 104.994 75.931  107.154 1.00 7.18   ? 396 LEU D CD2   1 
ATOM   9669  N N     . HIS D  1 397 ? 107.954 78.625  110.470 1.00 46.70  ? 397 HIS D N     1 
ATOM   9670  C CA    . HIS D  1 397 ? 108.212 79.705  111.416 1.00 48.61  ? 397 HIS D CA    1 
ATOM   9671  C C     . HIS D  1 397 ? 108.497 80.941  110.605 1.00 47.38  ? 397 HIS D C     1 
ATOM   9672  O O     . HIS D  1 397 ? 108.047 82.027  110.949 1.00 48.60  ? 397 HIS D O     1 
ATOM   9673  C CB    . HIS D  1 397 ? 109.412 79.380  112.291 1.00 73.36  ? 397 HIS D CB    1 
ATOM   9674  C CG    . HIS D  1 397 ? 109.185 78.213  113.186 1.00 79.11  ? 397 HIS D CG    1 
ATOM   9675  N ND1   . HIS D  1 397 ? 109.099 78.333  114.554 1.00 81.45  ? 397 HIS D ND1   1 
ATOM   9676  C CD2   . HIS D  1 397 ? 108.953 76.909  112.903 1.00 81.16  ? 397 HIS D CD2   1 
ATOM   9677  C CE1   . HIS D  1 397 ? 108.820 77.151  115.076 1.00 83.99  ? 397 HIS D CE1   1 
ATOM   9678  N NE2   . HIS D  1 397 ? 108.725 76.270  114.096 1.00 84.09  ? 397 HIS D NE2   1 
ATOM   9679  N N     . THR D  1 398 ? 109.246 80.758  109.523 1.00 23.74  ? 398 THR D N     1 
ATOM   9680  C CA    . THR D  1 398 ? 109.583 81.841  108.620 1.00 24.06  ? 398 THR D CA    1 
ATOM   9681  C C     . THR D  1 398 ? 108.329 82.473  108.060 1.00 23.96  ? 398 THR D C     1 
ATOM   9682  O O     . THR D  1 398 ? 107.964 83.588  108.422 1.00 25.02  ? 398 THR D O     1 
ATOM   9683  C CB    . THR D  1 398 ? 110.394 81.329  107.446 1.00 39.25  ? 398 THR D CB    1 
ATOM   9684  O OG1   . THR D  1 398 ? 111.764 81.281  107.841 1.00 41.94  ? 398 THR D OG1   1 
ATOM   9685  C CG2   . THR D  1 398 ? 110.203 82.228  106.183 1.00 38.75  ? 398 THR D CG2   1 
ATOM   9686  N N     . VAL D  1 399 ? 107.675 81.755  107.159 1.00 24.83  ? 399 VAL D N     1 
ATOM   9687  C CA    . VAL D  1 399 ? 106.470 82.250  106.542 1.00 22.57  ? 399 VAL D CA    1 
ATOM   9688  C C     . VAL D  1 399 ? 105.503 82.802  107.563 1.00 23.80  ? 399 VAL D C     1 
ATOM   9689  O O     . VAL D  1 399 ? 104.870 83.819  107.322 1.00 26.17  ? 399 VAL D O     1 
ATOM   9690  C CB    . VAL D  1 399 ? 105.762 81.163  105.768 1.00 9.94   ? 399 VAL D CB    1 
ATOM   9691  C CG1   . VAL D  1 399 ? 104.430 81.653  105.347 1.00 10.74  ? 399 VAL D CG1   1 
ATOM   9692  C CG2   . VAL D  1 399 ? 106.534 80.809  104.555 1.00 9.57   ? 399 VAL D CG2   1 
ATOM   9693  N N     . MET D  1 400 ? 105.363 82.144  108.701 1.00 10.39  ? 400 MET D N     1 
ATOM   9694  C CA    . MET D  1 400 ? 104.440 82.672  109.666 1.00 12.09  ? 400 MET D CA    1 
ATOM   9695  C C     . MET D  1 400 ? 104.830 84.074  110.071 1.00 14.67  ? 400 MET D C     1 
ATOM   9696  O O     . MET D  1 400 ? 104.031 85.011  109.937 1.00 15.45  ? 400 MET D O     1 
ATOM   9697  C CB    . MET D  1 400 ? 104.369 81.793  110.890 1.00 25.76  ? 400 MET D CB    1 
ATOM   9698  C CG    . MET D  1 400 ? 103.435 80.650  110.686 1.00 29.02  ? 400 MET D CG    1 
ATOM   9699  S SD    . MET D  1 400 ? 101.737 81.168  110.366 1.00 31.30  ? 400 MET D SD    1 
ATOM   9700  C CE    . MET D  1 400 ? 100.973 80.726  111.900 1.00 29.49  ? 400 MET D CE    1 
ATOM   9701  N N     . GLU D  1 401 ? 106.062 84.246  110.546 1.00 31.86  ? 401 GLU D N     1 
ATOM   9702  C CA    . GLU D  1 401 ? 106.470 85.570  110.998 1.00 33.26  ? 401 GLU D CA    1 
ATOM   9703  C C     . GLU D  1 401 ? 106.319 86.579  109.899 1.00 32.07  ? 401 GLU D C     1 
ATOM   9704  O O     . GLU D  1 401 ? 106.061 87.740  110.156 1.00 32.52  ? 401 GLU D O     1 
ATOM   9705  C CB    . GLU D  1 401 ? 107.900 85.577  111.528 1.00 54.40  ? 401 GLU D CB    1 
ATOM   9706  C CG    . GLU D  1 401 ? 108.207 86.807  112.378 1.00 61.34  ? 401 GLU D CG    1 
ATOM   9707  C CD    . GLU D  1 401 ? 107.322 86.927  113.639 1.00 66.90  ? 401 GLU D CD    1 
ATOM   9708  O OE1   . GLU D  1 401 ? 107.296 85.956  114.432 1.00 67.68  ? 401 GLU D OE1   1 
ATOM   9709  O OE2   . GLU D  1 401 ? 106.668 87.992  113.845 1.00 69.08  ? 401 GLU D OE2   1 
ATOM   9710  N N     . ARG D  1 402 ? 106.447 86.134  108.664 1.00 33.70  ? 402 ARG D N     1 
ATOM   9711  C CA    . ARG D  1 402 ? 106.303 87.048  107.558 1.00 34.94  ? 402 ARG D CA    1 
ATOM   9712  C C     . ARG D  1 402 ? 104.839 87.489  107.397 1.00 34.97  ? 402 ARG D C     1 
ATOM   9713  O O     . ARG D  1 402 ? 104.595 88.649  107.026 1.00 36.40  ? 402 ARG D O     1 
ATOM   9714  C CB    . ARG D  1 402 ? 106.830 86.396  106.282 1.00 51.77  ? 402 ARG D CB    1 
ATOM   9715  C CG    . ARG D  1 402 ? 106.892 87.310  105.076 1.00 55.00  ? 402 ARG D CG    1 
ATOM   9716  C CD    . ARG D  1 402 ? 107.857 86.712  104.071 1.00 58.35  ? 402 ARG D CD    1 
ATOM   9717  N NE    . ARG D  1 402 ? 107.247 86.323  102.799 1.00 61.78  ? 402 ARG D NE    1 
ATOM   9718  C CZ    . ARG D  1 402 ? 107.503 85.176  102.169 1.00 63.14  ? 402 ARG D CZ    1 
ATOM   9719  N NH1   . ARG D  1 402 ? 108.356 84.286  102.696 1.00 64.12  ? 402 ARG D NH1   1 
ATOM   9720  N NH2   . ARG D  1 402 ? 106.924 84.929  100.997 1.00 63.03  ? 402 ARG D NH2   1 
ATOM   9721  N N     . LEU D  1 403 ? 103.879 86.591  107.687 1.00 18.61  ? 403 LEU D N     1 
ATOM   9722  C CA    . LEU D  1 403 ? 102.431 86.889  107.568 1.00 17.39  ? 403 LEU D CA    1 
ATOM   9723  C C     . LEU D  1 403 ? 101.870 87.633  108.780 1.00 17.77  ? 403 LEU D C     1 
ATOM   9724  O O     . LEU D  1 403 ? 101.232 88.674  108.649 1.00 17.40  ? 403 LEU D O     1 
ATOM   9725  C CB    . LEU D  1 403 ? 101.624 85.596  107.319 1.00 12.97  ? 403 LEU D CB    1 
ATOM   9726  C CG    . LEU D  1 403 ? 100.127 85.492  107.687 1.00 10.02  ? 403 LEU D CG    1 
ATOM   9727  C CD1   . LEU D  1 403 ? 99.495  84.190  107.193 1.00 7.66   ? 403 LEU D CD1   1 
ATOM   9728  C CD2   . LEU D  1 403 ? 100.015 85.507  109.187 1.00 10.18  ? 403 LEU D CD2   1 
ATOM   9729  N N     . MET D  1 404 ? 102.110 87.101  109.963 1.00 25.98  ? 404 MET D N     1 
ATOM   9730  C CA    . MET D  1 404 ? 101.644 87.739  111.183 1.00 29.55  ? 404 MET D CA    1 
ATOM   9731  C C     . MET D  1 404 ? 102.370 89.078  111.434 1.00 32.94  ? 404 MET D C     1 
ATOM   9732  O O     . MET D  1 404 ? 102.250 89.675  112.502 1.00 33.22  ? 404 MET D O     1 
ATOM   9733  C CB    . MET D  1 404 ? 101.896 86.796  112.343 1.00 31.14  ? 404 MET D CB    1 
ATOM   9734  C CG    . MET D  1 404 ? 101.300 85.459  112.125 1.00 29.54  ? 404 MET D CG    1 
ATOM   9735  S SD    . MET D  1 404 ? 99.584  85.700  112.076 1.00 26.74  ? 404 MET D SD    1 
ATOM   9736  C CE    . MET D  1 404 ? 99.374  86.318  113.750 1.00 28.85  ? 404 MET D CE    1 
ATOM   9737  N N     . ASP D  1 405 ? 103.142 89.519  110.447 1.00 57.22  ? 405 ASP D N     1 
ATOM   9738  C CA    . ASP D  1 405 ? 103.910 90.770  110.482 1.00 59.03  ? 405 ASP D CA    1 
ATOM   9739  C C     . ASP D  1 405 ? 103.100 91.963  111.059 1.00 58.77  ? 405 ASP D C     1 
ATOM   9740  O O     . ASP D  1 405 ? 103.250 92.333  112.228 1.00 58.49  ? 405 ASP D O     1 
ATOM   9741  C CB    . ASP D  1 405 ? 104.341 91.077  109.036 1.00 71.80  ? 405 ASP D CB    1 
ATOM   9742  C CG    . ASP D  1 405 ? 105.436 92.113  108.937 1.00 74.64  ? 405 ASP D CG    1 
ATOM   9743  O OD1   . ASP D  1 405 ? 105.359 93.161  109.622 1.00 75.18  ? 405 ASP D OD1   1 
ATOM   9744  O OD2   . ASP D  1 405 ? 106.366 91.870  108.141 1.00 76.88  ? 405 ASP D OD2   1 
ATOM   9745  N N     . LYS D  1 406 ? 102.247 92.544  110.204 1.00 22.98  ? 406 LYS D N     1 
ATOM   9746  C CA    . LYS D  1 406 ? 101.398 93.686  110.508 1.00 21.56  ? 406 LYS D CA    1 
ATOM   9747  C C     . LYS D  1 406 ? 100.720 93.502  111.852 1.00 18.82  ? 406 LYS D C     1 
ATOM   9748  O O     . LYS D  1 406 ? 101.013 94.202  112.804 1.00 17.67  ? 406 LYS D O     1 
ATOM   9749  C CB    . LYS D  1 406 ? 100.338 93.864  109.405 1.00 84.55  ? 406 LYS D CB    1 
ATOM   9750  C CG    . LYS D  1 406 ? 100.890 94.051  107.985 1.00 89.70  ? 406 LYS D CG    1 
ATOM   9751  C CD    . LYS D  1 406 ? 101.538 92.751  107.434 1.00 94.93  ? 406 LYS D CD    1 
ATOM   9752  C CE    . LYS D  1 406 ? 102.379 92.962  106.124 1.00 97.16  ? 406 LYS D CE    1 
ATOM   9753  N NZ    . LYS D  1 406 ? 103.399 91.876  105.789 1.00 93.99  ? 406 LYS D NZ    1 
ATOM   9754  N N     . ILE D  1 407 ? 99.824  92.531  111.928 1.00 19.30  ? 407 ILE D N     1 
ATOM   9755  C CA    . ILE D  1 407 ? 99.095  92.280  113.153 1.00 16.42  ? 407 ILE D CA    1 
ATOM   9756  C C     . ILE D  1 407 ? 99.957  92.240  114.381 1.00 15.92  ? 407 ILE D C     1 
ATOM   9757  O O     . ILE D  1 407 ? 99.516  92.660  115.433 1.00 16.10  ? 407 ILE D O     1 
ATOM   9758  C CB    . ILE D  1 407 ? 98.376  90.959  113.116 1.00 14.73  ? 407 ILE D CB    1 
ATOM   9759  C CG1   . ILE D  1 407 ? 97.339  90.972  112.020 1.00 15.31  ? 407 ILE D CG1   1 
ATOM   9760  C CG2   . ILE D  1 407 ? 97.697  90.710  114.419 1.00 13.10  ? 407 ILE D CG2   1 
ATOM   9761  C CD1   . ILE D  1 407 ? 96.498  89.703  111.981 1.00 16.17  ? 407 ILE D CD1   1 
ATOM   9762  N N     . SER D  1 408 ? 101.182 91.732  114.269 1.00 15.12  ? 408 SER D N     1 
ATOM   9763  C CA    . SER D  1 408 ? 102.029 91.606  115.445 1.00 13.53  ? 408 SER D CA    1 
ATOM   9764  C C     . SER D  1 408 ? 102.383 92.954  116.021 1.00 11.50  ? 408 SER D C     1 
ATOM   9765  O O     . SER D  1 408 ? 102.546 93.081  117.217 1.00 11.24  ? 408 SER D O     1 
ATOM   9766  C CB    . SER D  1 408 ? 103.283 90.799  115.122 1.00 45.40  ? 408 SER D CB    1 
ATOM   9767  O OG    . SER D  1 408 ? 103.780 90.149  116.285 1.00 48.37  ? 408 SER D OG    1 
ATOM   9768  N N     . PHE D  1 409 ? 102.476 93.969  115.177 1.00 18.94  ? 409 PHE D N     1 
ATOM   9769  C CA    . PHE D  1 409 ? 102.786 95.325  115.639 1.00 18.62  ? 409 PHE D CA    1 
ATOM   9770  C C     . PHE D  1 409 ? 101.544 95.999  116.248 1.00 20.26  ? 409 PHE D C     1 
ATOM   9771  O O     . PHE D  1 409 ? 101.441 96.234  117.462 1.00 19.83  ? 409 PHE D O     1 
ATOM   9772  C CB    . PHE D  1 409 ? 103.241 96.155  114.461 1.00 17.62  ? 409 PHE D CB    1 
ATOM   9773  C CG    . PHE D  1 409 ? 103.745 97.491  114.834 1.00 15.43  ? 409 PHE D CG    1 
ATOM   9774  C CD1   . PHE D  1 409 ? 104.835 97.607  115.671 1.00 15.11  ? 409 PHE D CD1   1 
ATOM   9775  C CD2   . PHE D  1 409 ? 103.209 98.630  114.276 1.00 16.03  ? 409 PHE D CD2   1 
ATOM   9776  C CE1   . PHE D  1 409 ? 105.405 98.833  115.942 1.00 14.39  ? 409 PHE D CE1   1 
ATOM   9777  C CE2   . PHE D  1 409 ? 103.775 99.872  114.542 1.00 15.79  ? 409 PHE D CE2   1 
ATOM   9778  C CZ    . PHE D  1 409 ? 104.879 99.967  115.376 1.00 14.31  ? 409 PHE D CZ    1 
ATOM   9779  N N     . SER D  1 410 ? 100.607 96.298  115.354 1.00 21.38  ? 410 SER D N     1 
ATOM   9780  C CA    . SER D  1 410 ? 99.333  96.923  115.658 1.00 23.14  ? 410 SER D CA    1 
ATOM   9781  C C     . SER D  1 410 ? 98.461  96.118  116.644 1.00 24.17  ? 410 SER D C     1 
ATOM   9782  O O     . SER D  1 410 ? 97.594  96.648  117.310 1.00 24.02  ? 410 SER D O     1 
ATOM   9783  C CB    . SER D  1 410 ? 98.596  97.117  114.332 1.00 67.64  ? 410 SER D CB    1 
ATOM   9784  O OG    . SER D  1 410 ? 99.530  97.331  113.277 1.00 68.83  ? 410 SER D OG    1 
ATOM   9785  N N     . ALA D  1 411 ? 98.689  94.825  116.748 1.00 38.70  ? 411 ALA D N     1 
ATOM   9786  C CA    . ALA D  1 411 ? 97.883  94.017  117.642 1.00 40.82  ? 411 ALA D CA    1 
ATOM   9787  C C     . ALA D  1 411 ? 97.682  94.723  118.955 1.00 41.63  ? 411 ALA D C     1 
ATOM   9788  O O     . ALA D  1 411 ? 96.635  94.617  119.583 1.00 41.93  ? 411 ALA D O     1 
ATOM   9789  C CB    . ALA D  1 411 ? 98.566  92.682  117.888 1.00 59.22  ? 411 ALA D CB    1 
ATOM   9790  N N     . SER D  1 412 ? 98.692  95.472  119.353 1.00 13.25  ? 412 SER D N     1 
ATOM   9791  C CA    . SER D  1 412 ? 98.642  96.129  120.639 1.00 14.09  ? 412 SER D CA    1 
ATOM   9792  C C     . SER D  1 412 ? 97.544  97.141  120.914 1.00 14.02  ? 412 SER D C     1 
ATOM   9793  O O     . SER D  1 412 ? 96.921  97.126  121.973 1.00 13.54  ? 412 SER D O     1 
ATOM   9794  C CB    . SER D  1 412 ? 99.984  96.752  120.922 1.00 24.15  ? 412 SER D CB    1 
ATOM   9795  O OG    . SER D  1 412 ? 100.024 97.050  122.292 1.00 24.70  ? 412 SER D OG    1 
ATOM   9796  N N     . ASP D  1 413 ? 97.332  98.042  119.974 1.00 33.08  ? 413 ASP D N     1 
ATOM   9797  C CA    . ASP D  1 413 ? 96.308  99.049  120.127 1.00 35.30  ? 413 ASP D CA    1 
ATOM   9798  C C     . ASP D  1 413 ? 95.115  98.650  119.258 1.00 35.46  ? 413 ASP D C     1 
ATOM   9799  O O     . ASP D  1 413 ? 94.182  99.403  119.016 1.00 35.43  ? 413 ASP D O     1 
ATOM   9800  C CB    . ASP D  1 413 ? 96.890  100.422 119.731 1.00 96.09  ? 413 ASP D CB    1 
ATOM   9801  C CG    . ASP D  1 413 ? 97.444  100.454 118.305 1.00 98.19  ? 413 ASP D CG    1 
ATOM   9802  O OD1   . ASP D  1 413 ? 98.456  101.145 118.072 1.00 98.63  ? 413 ASP D OD1   1 
ATOM   9803  O OD2   . ASP D  1 413 ? 96.865  99.813  117.408 1.00 98.80  ? 413 ASP D OD2   1 
ATOM   9804  N N     . MET D  1 414 ? 95.132  97.418  118.808 1.00 75.90  ? 414 MET D N     1 
ATOM   9805  C CA    . MET D  1 414 ? 94.077  96.947  117.946 1.00 76.19  ? 414 MET D CA    1 
ATOM   9806  C C     . MET D  1 414 ? 93.058  96.158  118.761 1.00 76.82  ? 414 MET D C     1 
ATOM   9807  O O     . MET D  1 414 ? 92.235  95.420  118.219 1.00 76.43  ? 414 MET D O     1 
ATOM   9808  C CB    . MET D  1 414 ? 94.737  96.084  116.901 1.00 43.42  ? 414 MET D CB    1 
ATOM   9809  C CG    . MET D  1 414 ? 93.852  95.588  115.872 1.00 42.98  ? 414 MET D CG    1 
ATOM   9810  S SD    . MET D  1 414 ? 94.902  94.632  114.851 1.00 43.99  ? 414 MET D SD    1 
ATOM   9811  C CE    . MET D  1 414 ? 95.279  95.833  113.573 1.00 43.64  ? 414 MET D CE    1 
ATOM   9812  N N     . ASN D  1 415 ? 93.112  96.354  120.073 1.00 49.26  ? 415 ASN D N     1 
ATOM   9813  C CA    . ASN D  1 415 ? 92.266  95.644  121.026 1.00 48.67  ? 415 ASN D CA    1 
ATOM   9814  C C     . ASN D  1 415 ? 90.835  95.375  120.631 1.00 48.53  ? 415 ASN D C     1 
ATOM   9815  O O     . ASN D  1 415 ? 90.234  96.124  119.880 1.00 48.29  ? 415 ASN D O     1 
ATOM   9816  C CB    . ASN D  1 415 ? 92.277  96.361  122.368 1.00 49.61  ? 415 ASN D CB    1 
ATOM   9817  C CG    . ASN D  1 415 ? 91.510  95.619  123.421 1.00 50.49  ? 415 ASN D CG    1 
ATOM   9818  O OD1   . ASN D  1 415 ? 90.304  95.406  123.296 1.00 51.53  ? 415 ASN D OD1   1 
ATOM   9819  N ND2   . ASN D  1 415 ? 92.205  95.210  124.473 1.00 50.67  ? 415 ASN D ND2   1 
ATOM   9820  N N     . GLY D  1 416 ? 90.317  94.271  121.157 1.00 46.44  ? 416 GLY D N     1 
ATOM   9821  C CA    . GLY D  1 416 ? 88.958  93.872  120.910 1.00 45.42  ? 416 GLY D CA    1 
ATOM   9822  C C     . GLY D  1 416 ? 88.740  93.228  119.574 1.00 45.44  ? 416 GLY D C     1 
ATOM   9823  O O     . GLY D  1 416 ? 88.263  92.108  119.523 1.00 47.14  ? 416 GLY D O     1 
ATOM   9824  N N     . GLN D  1 417 ? 89.106  93.923  118.502 1.00 9.58   ? 417 GLN D N     1 
ATOM   9825  C CA    . GLN D  1 417 ? 88.895  93.444  117.131 1.00 10.50  ? 417 GLN D CA    1 
ATOM   9826  C C     . GLN D  1 417 ? 89.220  91.994  116.931 1.00 9.75   ? 417 GLN D C     1 
ATOM   9827  O O     . GLN D  1 417 ? 89.958  91.424  117.713 1.00 10.87  ? 417 GLN D O     1 
ATOM   9828  C CB    . GLN D  1 417 ? 89.749  94.219  116.143 1.00 80.08  ? 417 GLN D CB    1 
ATOM   9829  C CG    . GLN D  1 417 ? 89.736  95.711  116.287 1.00 83.74  ? 417 GLN D CG    1 
ATOM   9830  C CD    . GLN D  1 417 ? 90.270  96.383  115.046 1.00 86.26  ? 417 GLN D CD    1 
ATOM   9831  O OE1   . GLN D  1 417 ? 90.551  97.575  115.047 1.00 88.16  ? 417 GLN D OE1   1 
ATOM   9832  N NE2   . GLN D  1 417 ? 90.403  95.618  113.969 1.00 87.76  ? 417 GLN D NE2   1 
ATOM   9833  N N     . THR D  1 418 ? 88.687  91.397  115.874 1.00 26.21  ? 418 THR D N     1 
ATOM   9834  C CA    . THR D  1 418 ? 88.991  90.001  115.599 1.00 27.05  ? 418 THR D CA    1 
ATOM   9835  C C     . THR D  1 418 ? 89.459  89.926  114.171 1.00 27.25  ? 418 THR D C     1 
ATOM   9836  O O     . THR D  1 418 ? 88.754  90.397  113.292 1.00 27.66  ? 418 THR D O     1 
ATOM   9837  C CB    . THR D  1 418 ? 87.761  89.071  115.789 1.00 26.69  ? 418 THR D CB    1 
ATOM   9838  O OG1   . THR D  1 418 ? 86.766  89.344  114.784 1.00 28.21  ? 418 THR D OG1   1 
ATOM   9839  C CG2   . THR D  1 418 ? 87.186  89.252  117.208 1.00 26.11  ? 418 THR D CG2   1 
ATOM   9840  N N     . VAL D  1 419 ? 90.644  89.357  113.936 1.00 36.84  ? 419 VAL D N     1 
ATOM   9841  C CA    . VAL D  1 419 ? 91.166  89.259  112.572 1.00 36.17  ? 419 VAL D CA    1 
ATOM   9842  C C     . VAL D  1 419 ? 90.848  87.894  112.051 1.00 35.65  ? 419 VAL D C     1 
ATOM   9843  O O     . VAL D  1 419 ? 91.049  86.895  112.753 1.00 35.14  ? 419 VAL D O     1 
ATOM   9844  C CB    . VAL D  1 419 ? 92.672  89.426  112.503 1.00 46.37  ? 419 VAL D CB    1 
ATOM   9845  C CG1   . VAL D  1 419 ? 93.082  89.716  111.081 1.00 45.98  ? 419 VAL D CG1   1 
ATOM   9846  C CG2   . VAL D  1 419 ? 93.111  90.533  113.435 1.00 48.09  ? 419 VAL D CG2   1 
ATOM   9847  N N     . ASN D  1 420 ? 90.353  87.853  110.819 1.00 46.55  ? 420 ASN D N     1 
ATOM   9848  C CA    . ASN D  1 420 ? 89.976  86.591  110.215 1.00 45.40  ? 420 ASN D CA    1 
ATOM   9849  C C     . ASN D  1 420 ? 90.900  86.220  109.066 1.00 43.40  ? 420 ASN D C     1 
ATOM   9850  O O     . ASN D  1 420 ? 90.605  86.480  107.904 1.00 43.02  ? 420 ASN D O     1 
ATOM   9851  C CB    . ASN D  1 420 ? 88.533  86.664  109.740 1.00 66.09  ? 420 ASN D CB    1 
ATOM   9852  C CG    . ASN D  1 420 ? 87.976  85.313  109.418 1.00 68.35  ? 420 ASN D CG    1 
ATOM   9853  O OD1   . ASN D  1 420 ? 87.794  84.969  108.244 1.00 70.40  ? 420 ASN D OD1   1 
ATOM   9854  N ND2   . ASN D  1 420 ? 87.719  84.514  110.460 1.00 69.05  ? 420 ASN D ND2   1 
ATOM   9855  N N     . ILE D  1 421 ? 92.017  85.586  109.406 1.00 20.30  ? 421 ILE D N     1 
ATOM   9856  C CA    . ILE D  1 421 ? 93.009  85.196  108.421 1.00 17.63  ? 421 ILE D CA    1 
ATOM   9857  C C     . ILE D  1 421 ? 92.527  84.135  107.448 1.00 17.22  ? 421 ILE D C     1 
ATOM   9858  O O     . ILE D  1 421 ? 92.496  82.937  107.767 1.00 16.35  ? 421 ILE D O     1 
ATOM   9859  C CB    . ILE D  1 421 ? 94.290  84.696  109.089 1.00 20.98  ? 421 ILE D CB    1 
ATOM   9860  C CG1   . ILE D  1 421 ? 94.551  85.481  110.383 1.00 19.05  ? 421 ILE D CG1   1 
ATOM   9861  C CG2   . ILE D  1 421 ? 95.435  84.844  108.097 1.00 21.68  ? 421 ILE D CG2   1 
ATOM   9862  C CD1   . ILE D  1 421 ? 95.981  85.479  110.889 1.00 16.12  ? 421 ILE D CD1   1 
ATOM   9863  N N     . ASP D  1 422 ? 92.165  84.588  106.252 1.00 23.32  ? 422 ASP D N     1 
ATOM   9864  C CA    . ASP D  1 422 ? 91.675  83.696  105.224 1.00 25.65  ? 422 ASP D CA    1 
ATOM   9865  C C     . ASP D  1 422 ? 92.640  83.642  104.081 1.00 25.30  ? 422 ASP D C     1 
ATOM   9866  O O     . ASP D  1 422 ? 93.649  84.320  104.092 1.00 25.68  ? 422 ASP D O     1 
ATOM   9867  C CB    . ASP D  1 422 ? 90.343  84.182  104.710 1.00 80.53  ? 422 ASP D CB    1 
ATOM   9868  C CG    . ASP D  1 422 ? 90.422  85.582  104.197 1.00 84.14  ? 422 ASP D CG    1 
ATOM   9869  O OD1   . ASP D  1 422 ? 89.364  86.173  103.885 1.00 86.79  ? 422 ASP D OD1   1 
ATOM   9870  O OD2   . ASP D  1 422 ? 91.557  86.088  104.111 1.00 85.24  ? 422 ASP D OD2   1 
ATOM   9871  N N     . ALA D  1 423 ? 92.302  82.840  103.083 1.00 41.74  ? 423 ALA D N     1 
ATOM   9872  C CA    . ALA D  1 423 ? 93.148  82.663  101.921 1.00 42.15  ? 423 ALA D CA    1 
ATOM   9873  C C     . ALA D  1 423 ? 93.566  83.991  101.375 1.00 41.50  ? 423 ALA D C     1 
ATOM   9874  O O     . ALA D  1 423 ? 94.732  84.205  101.059 1.00 42.97  ? 423 ALA D O     1 
ATOM   9875  C CB    . ALA D  1 423 ? 92.411  81.875  100.857 1.00 136.53 ? 423 ALA D CB    1 
ATOM   9876  N N     . ALA D  1 424 ? 92.604  84.891  101.263 1.00 31.96  ? 424 ALA D N     1 
ATOM   9877  C CA    . ALA D  1 424 ? 92.888  86.223  100.738 1.00 31.84  ? 424 ALA D CA    1 
ATOM   9878  C C     . ALA D  1 424 ? 93.992  86.868  101.560 1.00 30.58  ? 424 ALA D C     1 
ATOM   9879  O O     . ALA D  1 424 ? 95.037  87.222  101.020 1.00 28.81  ? 424 ALA D O     1 
ATOM   9880  C CB    . ALA D  1 424 ? 91.632  87.080  100.784 1.00 133.20 ? 424 ALA D CB    1 
ATOM   9881  N N     . TYR D  1 425 ? 93.747  86.995  102.868 1.00 24.14  ? 425 TYR D N     1 
ATOM   9882  C CA    . TYR D  1 425 ? 94.684  87.595  103.811 1.00 24.50  ? 425 TYR D CA    1 
ATOM   9883  C C     . TYR D  1 425 ? 96.096  87.113  103.595 1.00 24.96  ? 425 TYR D C     1 
ATOM   9884  O O     . TYR D  1 425 ? 96.990  87.907  103.338 1.00 25.73  ? 425 TYR D O     1 
ATOM   9885  C CB    . TYR D  1 425 ? 94.296  87.274  105.250 1.00 36.12  ? 425 TYR D CB    1 
ATOM   9886  C CG    . TYR D  1 425 ? 95.013  88.158  106.257 1.00 37.66  ? 425 TYR D CG    1 
ATOM   9887  C CD1   . TYR D  1 425 ? 94.855  87.964  107.636 1.00 37.88  ? 425 TYR D CD1   1 
ATOM   9888  C CD2   . TYR D  1 425 ? 95.818  89.232  105.832 1.00 38.36  ? 425 TYR D CD2   1 
ATOM   9889  C CE1   . TYR D  1 425 ? 95.472  88.818  108.566 1.00 36.88  ? 425 TYR D CE1   1 
ATOM   9890  C CE2   . TYR D  1 425 ? 96.434  90.086  106.755 1.00 37.78  ? 425 TYR D CE2   1 
ATOM   9891  C CZ    . TYR D  1 425 ? 96.253  89.870  108.115 1.00 36.70  ? 425 TYR D CZ    1 
ATOM   9892  O OH    . TYR D  1 425 ? 96.850  90.715  109.011 1.00 35.61  ? 425 TYR D OH    1 
ATOM   9893  N N     . VAL D  1 426 ? 96.289  85.805  103.732 1.00 30.36  ? 426 VAL D N     1 
ATOM   9894  C CA    . VAL D  1 426 ? 97.590  85.178  103.548 1.00 28.77  ? 426 VAL D CA    1 
ATOM   9895  C C     . VAL D  1 426 ? 98.114  85.517  102.180 1.00 30.28  ? 426 VAL D C     1 
ATOM   9896  O O     . VAL D  1 426 ? 99.184  86.095  102.045 1.00 31.40  ? 426 VAL D O     1 
ATOM   9897  C CB    . VAL D  1 426 ? 97.499  83.662  103.621 1.00 1.28   ? 426 VAL D CB    1 
ATOM   9898  C CG1   . VAL D  1 426 ? 98.867  83.069  103.401 1.00 1.00   ? 426 VAL D CG1   1 
ATOM   9899  C CG2   . VAL D  1 426 ? 96.915  83.241  104.973 1.00 2.35   ? 426 VAL D CG2   1 
ATOM   9900  N N     . ALA D  1 427 ? 97.350  85.148  101.162 1.00 36.03  ? 427 ALA D N     1 
ATOM   9901  C CA    . ALA D  1 427 ? 97.738  85.412  99.788  1.00 38.21  ? 427 ALA D CA    1 
ATOM   9902  C C     . ALA D  1 427 ? 98.204  86.857  99.594  1.00 39.73  ? 427 ALA D C     1 
ATOM   9903  O O     . ALA D  1 427 ? 98.906  87.178  98.625  1.00 39.26  ? 427 ALA D O     1 
ATOM   9904  C CB    . ALA D  1 427 ? 96.580  85.113  98.863  1.00 127.08 ? 427 ALA D CB    1 
ATOM   9905  N N     . ASP D  1 428 ? 97.805  87.732  100.504 1.00 43.78  ? 428 ASP D N     1 
ATOM   9906  C CA    . ASP D  1 428 ? 98.210  89.125  100.424 1.00 48.04  ? 428 ASP D CA    1 
ATOM   9907  C C     . ASP D  1 428 ? 99.508  89.302  101.211 1.00 49.87  ? 428 ASP D C     1 
ATOM   9908  O O     . ASP D  1 428 ? 100.586 89.484  100.640 1.00 49.69  ? 428 ASP D O     1 
ATOM   9909  C CB    . ASP D  1 428 ? 97.092  90.012  100.981 1.00 89.72  ? 428 ASP D CB    1 
ATOM   9910  C CG    . ASP D  1 428 ? 97.562  91.400  101.334 1.00 92.44  ? 428 ASP D CG    1 
ATOM   9911  O OD1   . ASP D  1 428 ? 98.153  91.571  102.423 1.00 94.73  ? 428 ASP D OD1   1 
ATOM   9912  O OD2   . ASP D  1 428 ? 97.342  92.320  100.521 1.00 93.12  ? 428 ASP D OD2   1 
ATOM   9913  N N     . ALA D  1 429 ? 99.394  89.211  102.529 1.00 61.03  ? 429 ALA D N     1 
ATOM   9914  C CA    . ALA D  1 429 ? 100.531 89.372  103.426 1.00 64.02  ? 429 ALA D CA    1 
ATOM   9915  C C     . ALA D  1 429 ? 101.821 88.735  102.936 1.00 66.21  ? 429 ALA D C     1 
ATOM   9916  O O     . ALA D  1 429 ? 102.892 89.059  103.440 1.00 67.70  ? 429 ALA D O     1 
ATOM   9917  C CB    . ALA D  1 429 ? 100.179 88.825  104.807 1.00 108.11 ? 429 ALA D CB    1 
ATOM   9918  N N     . LEU D  1 430 ? 101.739 87.841  101.961 1.00 55.64  ? 430 LEU D N     1 
ATOM   9919  C CA    . LEU D  1 430 ? 102.951 87.201  101.490 1.00 58.75  ? 430 LEU D CA    1 
ATOM   9920  C C     . LEU D  1 430 ? 103.563 87.823  100.254 1.00 64.81  ? 430 LEU D C     1 
ATOM   9921  O O     . LEU D  1 430 ? 104.759 88.107  100.231 1.00 66.36  ? 430 LEU D O     1 
ATOM   9922  C CB    . LEU D  1 430 ? 102.722 85.704  101.250 1.00 14.24  ? 430 LEU D CB    1 
ATOM   9923  C CG    . LEU D  1 430 ? 102.372 84.883  102.505 1.00 9.78   ? 430 LEU D CG    1 
ATOM   9924  C CD1   . LEU D  1 430 ? 102.480 83.433  102.153 1.00 7.86   ? 430 LEU D CD1   1 
ATOM   9925  C CD2   . LEU D  1 430 ? 103.298 85.213  103.707 1.00 7.19   ? 430 LEU D CD2   1 
ATOM   9926  N N     . GLY D  1 431 ? 102.766 88.048  99.221  1.00 86.80  ? 431 GLY D N     1 
ATOM   9927  C CA    . GLY D  1 431 ? 103.332 88.610  98.009  1.00 95.44  ? 431 GLY D CA    1 
ATOM   9928  C C     . GLY D  1 431 ? 103.721 87.464  97.093  1.00 101.55 ? 431 GLY D C     1 
ATOM   9929  O O     . GLY D  1 431 ? 103.106 86.394  97.141  1.00 101.95 ? 431 GLY D O     1 
ATOM   9930  N N     . GLU D  1 432 ? 104.748 87.665  96.276  1.00 133.76 ? 432 GLU D N     1 
ATOM   9931  C CA    . GLU D  1 432 ? 105.199 86.637  95.335  1.00 141.07 ? 432 GLU D CA    1 
ATOM   9932  C C     . GLU D  1 432 ? 106.616 86.201  95.694  1.00 145.59 ? 432 GLU D C     1 
ATOM   9933  O O     . GLU D  1 432 ? 107.340 86.960  96.332  1.00 146.67 ? 432 GLU D O     1 
ATOM   9934  C CB    . GLU D  1 432 ? 105.192 87.222  93.925  1.00 178.70 ? 432 GLU D CB    1 
ATOM   9935  C CG    . GLU D  1 432 ? 104.548 88.599  93.869  1.00 181.25 ? 432 GLU D CG    1 
ATOM   9936  C CD    . GLU D  1 432 ? 105.098 89.467  92.759  1.00 182.43 ? 432 GLU D CD    1 
ATOM   9937  O OE1   . GLU D  1 432 ? 106.323 89.722  92.747  1.00 182.93 ? 432 GLU D OE1   1 
ATOM   9938  O OE2   . GLU D  1 432 ? 104.303 89.901  91.902  1.00 182.43 ? 432 GLU D OE2   1 
ATOM   9939  N N     . VAL D  1 433 ? 107.014 84.988  95.305  1.00 200.00 ? 433 VAL D N     1 
ATOM   9940  C CA    . VAL D  1 433 ? 108.379 84.528  95.587  1.00 200.00 ? 433 VAL D CA    1 
ATOM   9941  C C     . VAL D  1 433 ? 109.283 85.386  94.704  1.00 200.00 ? 433 VAL D C     1 
ATOM   9942  O O     . VAL D  1 433 ? 108.795 86.000  93.756  1.00 200.00 ? 433 VAL D O     1 
ATOM   9943  C CB    . VAL D  1 433 ? 108.577 83.026  95.247  1.00 104.26 ? 433 VAL D CB    1 
ATOM   9944  C CG1   . VAL D  1 433 ? 108.197 82.760  93.793  1.00 104.40 ? 433 VAL D CG1   1 
ATOM   9945  C CG2   . VAL D  1 433 ? 110.022 82.621  95.526  1.00 104.16 ? 433 VAL D CG2   1 
ATOM   9946  N N     . VAL D  1 434 ? 110.582 85.441  94.989  1.00 183.54 ? 434 VAL D N     1 
ATOM   9947  C CA    . VAL D  1 434 ? 111.446 86.295  94.175  1.00 186.87 ? 434 VAL D CA    1 
ATOM   9948  C C     . VAL D  1 434 ? 112.848 85.842  93.762  1.00 189.06 ? 434 VAL D C     1 
ATOM   9949  O O     . VAL D  1 434 ? 113.519 85.060  94.441  1.00 189.61 ? 434 VAL D O     1 
ATOM   9950  C CB    . VAL D  1 434 ? 111.603 87.707  94.825  1.00 182.12 ? 434 VAL D CB    1 
ATOM   9951  C CG1   . VAL D  1 434 ? 110.876 88.755  93.988  1.00 97.95  ? 434 VAL D CG1   1 
ATOM   9952  C CG2   . VAL D  1 434 ? 111.064 87.699  96.254  1.00 97.95  ? 434 VAL D CG2   1 
ATOM   9953  N N     . GLU D  1 435 ? 113.253 86.380  92.615  1.00 200.00 ? 435 GLU D N     1 
ATOM   9954  C CA    . GLU D  1 435 ? 114.554 86.181  91.989  1.00 200.00 ? 435 GLU D CA    1 
ATOM   9955  C C     . GLU D  1 435 ? 115.224 84.816  91.942  1.00 200.00 ? 435 GLU D C     1 
ATOM   9956  O O     . GLU D  1 435 ? 115.489 84.184  92.967  1.00 200.00 ? 435 GLU D O     1 
ATOM   9957  C CB    . GLU D  1 435 ? 115.537 87.196  92.570  1.00 200.00 ? 435 GLU D CB    1 
ATOM   9958  C CG    . GLU D  1 435 ? 115.093 88.628  92.345  1.00 200.00 ? 435 GLU D CG    1 
ATOM   9959  C CD    . GLU D  1 435 ? 116.014 89.642  92.985  1.00 200.00 ? 435 GLU D CD    1 
ATOM   9960  O OE1   . GLU D  1 435 ? 117.203 89.688  92.606  1.00 200.00 ? 435 GLU D OE1   1 
ATOM   9961  O OE2   . GLU D  1 435 ? 115.544 90.392  93.870  1.00 200.00 ? 435 GLU D OE2   1 
ATOM   9962  N N     . ASN D  1 436 ? 115.507 84.399  90.710  1.00 167.04 ? 436 ASN D N     1 
ATOM   9963  C CA    . ASN D  1 436 ? 116.188 83.150  90.388  1.00 166.53 ? 436 ASN D CA    1 
ATOM   9964  C C     . ASN D  1 436 ? 117.156 83.605  89.291  1.00 165.91 ? 436 ASN D C     1 
ATOM   9965  O O     . ASN D  1 436 ? 117.274 82.986  88.231  1.00 165.90 ? 436 ASN D O     1 
ATOM   9966  C CB    . ASN D  1 436 ? 115.196 82.117  89.839  1.00 200.00 ? 436 ASN D CB    1 
ATOM   9967  C CG    . ASN D  1 436 ? 115.593 80.691  90.171  1.00 167.57 ? 436 ASN D CG    1 
ATOM   9968  O OD1   . ASN D  1 436 ? 116.680 80.235  89.816  1.00 167.57 ? 436 ASN D OD1   1 
ATOM   9969  N ND2   . ASN D  1 436 ? 114.708 79.979  90.861  1.00 167.57 ? 436 ASN D ND2   1 
ATOM   9970  N N     . GLU D  1 437 ? 117.825 84.722  89.576  1.00 143.31 ? 437 GLU D N     1 
ATOM   9971  C CA    . GLU D  1 437 ? 118.787 85.371  88.683  1.00 141.82 ? 437 GLU D CA    1 
ATOM   9972  C C     . GLU D  1 437 ? 119.820 84.443  88.056  1.00 139.76 ? 437 GLU D C     1 
ATOM   9973  O O     . GLU D  1 437 ? 120.223 84.654  86.913  1.00 139.27 ? 437 GLU D O     1 
ATOM   9974  C CB    . GLU D  1 437 ? 119.529 86.485  89.440  1.00 200.00 ? 437 GLU D CB    1 
ATOM   9975  C CG    . GLU D  1 437 ? 120.688 85.990  90.324  1.00 200.00 ? 437 GLU D CG    1 
ATOM   9976  C CD    . GLU D  1 437 ? 120.475 86.224  91.816  1.00 200.00 ? 437 GLU D CD    1 
ATOM   9977  O OE1   . GLU D  1 437 ? 119.425 85.799  92.352  1.00 200.00 ? 437 GLU D OE1   1 
ATOM   9978  O OE2   . GLU D  1 437 ? 121.372 86.827  92.454  1.00 200.00 ? 437 GLU D OE2   1 
ATOM   9979  N N     . ASP D  1 438 ? 120.255 83.439  88.820  1.00 120.47 ? 438 ASP D N     1 
ATOM   9980  C CA    . ASP D  1 438 ? 121.259 82.470  88.378  1.00 117.03 ? 438 ASP D CA    1 
ATOM   9981  C C     . ASP D  1 438 ? 121.343 82.488  86.873  1.00 114.99 ? 438 ASP D C     1 
ATOM   9982  O O     . ASP D  1 438 ? 122.408 82.695  86.299  1.00 115.41 ? 438 ASP D O     1 
ATOM   9983  C CB    . ASP D  1 438 ? 120.900 81.057  88.853  1.00 176.05 ? 438 ASP D CB    1 
ATOM   9984  C CG    . ASP D  1 438 ? 120.765 80.964  90.361  1.00 176.05 ? 438 ASP D CG    1 
ATOM   9985  O OD1   . ASP D  1 438 ? 121.753 81.260  91.066  1.00 176.05 ? 438 ASP D OD1   1 
ATOM   9986  O OD2   . ASP D  1 438 ? 119.672 80.596  90.841  1.00 176.05 ? 438 ASP D OD2   1 
ATOM   9987  N N     . LEU D  1 439 ? 120.194 82.285  86.245  1.00 146.09 ? 439 LEU D N     1 
ATOM   9988  C CA    . LEU D  1 439 ? 120.094 82.286  84.798  1.00 143.78 ? 439 LEU D CA    1 
ATOM   9989  C C     . LEU D  1 439 ? 121.035 83.321  84.168  1.00 141.89 ? 439 LEU D C     1 
ATOM   9990  O O     . LEU D  1 439 ? 122.062 82.974  83.582  1.00 141.72 ? 439 LEU D O     1 
ATOM   9991  C CB    . LEU D  1 439 ? 118.643 82.576  84.384  1.00 200.00 ? 439 LEU D CB    1 
ATOM   9992  C CG    . LEU D  1 439 ? 117.568 81.617  84.903  1.00 148.27 ? 439 LEU D CG    1 
ATOM   9993  C CD1   . LEU D  1 439 ? 116.193 82.113  84.482  1.00 148.27 ? 439 LEU D CD1   1 
ATOM   9994  C CD2   . LEU D  1 439 ? 117.821 80.218  84.366  1.00 148.27 ? 439 LEU D CD2   1 
ATOM   9995  N N     . SER D  1 440 ? 120.679 84.594  84.300  1.00 69.09  ? 440 SER D N     1 
ATOM   9996  C CA    . SER D  1 440 ? 121.468 85.688  83.737  1.00 67.35  ? 440 SER D CA    1 
ATOM   9997  C C     . SER D  1 440 ? 122.904 85.713  84.242  1.00 64.87  ? 440 SER D C     1 
ATOM   9998  O O     . SER D  1 440 ? 123.505 84.683  84.488  1.00 63.51  ? 440 SER D O     1 
ATOM   9999  C CB    . SER D  1 440 ? 120.786 87.019  84.068  1.00 200.00 ? 440 SER D CB    1 
ATOM   10000 O OG    . SER D  1 440 ? 120.501 87.114  85.455  1.00 200.00 ? 440 SER D OG    1 
ATOM   10001 N N     . ARG D  1 441 ? 123.450 86.908  84.370  1.00 104.99 ? 441 ARG D N     1 
ATOM   10002 C CA    . ARG D  1 441 ? 124.792 87.059  84.877  1.00 103.24 ? 441 ARG D CA    1 
ATOM   10003 C C     . ARG D  1 441 ? 125.811 85.980  84.512  1.00 100.44 ? 441 ARG D C     1 
ATOM   10004 O O     . ARG D  1 441 ? 126.774 86.240  83.788  1.00 100.19 ? 441 ARG D O     1 
ATOM   10005 C CB    . ARG D  1 441 ? 124.739 87.168  86.398  1.00 193.21 ? 441 ARG D CB    1 
ATOM   10006 C CG    . ARG D  1 441 ? 124.216 88.482  86.905  1.00 196.20 ? 441 ARG D CG    1 
ATOM   10007 C CD    . ARG D  1 441 ? 125.166 89.607  86.538  1.00 199.11 ? 441 ARG D CD    1 
ATOM   10008 N NE    . ARG D  1 441 ? 125.214 90.601  87.600  1.00 200.00 ? 441 ARG D NE    1 
ATOM   10009 C CZ    . ARG D  1 441 ? 125.605 90.335  88.842  1.00 200.00 ? 441 ARG D CZ    1 
ATOM   10010 N NH1   . ARG D  1 441 ? 125.989 89.107  89.172  1.00 200.00 ? 441 ARG D NH1   1 
ATOM   10011 N NH2   . ARG D  1 441 ? 125.592 91.291  89.760  1.00 200.00 ? 441 ARG D NH2   1 
ATOM   10012 N N     . PHE D  1 442 ? 125.598 84.773  85.021  1.00 64.26  ? 442 PHE D N     1 
ATOM   10013 C CA    . PHE D  1 442 ? 126.537 83.677  84.824  1.00 59.67  ? 442 PHE D CA    1 
ATOM   10014 C C     . PHE D  1 442 ? 126.406 82.801  83.604  1.00 57.24  ? 442 PHE D C     1 
ATOM   10015 O O     . PHE D  1 442 ? 127.156 81.845  83.461  1.00 57.13  ? 442 PHE D O     1 
ATOM   10016 C CB    . PHE D  1 442 ? 126.515 82.781  86.053  1.00 66.05  ? 442 PHE D CB    1 
ATOM   10017 C CG    . PHE D  1 442 ? 126.274 83.522  87.328  1.00 65.34  ? 442 PHE D CG    1 
ATOM   10018 C CD1   . PHE D  1 442 ? 127.008 84.664  87.629  1.00 64.90  ? 442 PHE D CD1   1 
ATOM   10019 C CD2   . PHE D  1 442 ? 125.314 83.076  88.230  1.00 64.31  ? 442 PHE D CD2   1 
ATOM   10020 C CE1   . PHE D  1 442 ? 126.786 85.346  88.807  1.00 64.93  ? 442 PHE D CE1   1 
ATOM   10021 C CE2   . PHE D  1 442 ? 125.085 83.747  89.410  1.00 64.21  ? 442 PHE D CE2   1 
ATOM   10022 C CZ    . PHE D  1 442 ? 125.818 84.882  89.703  1.00 64.29  ? 442 PHE D CZ    1 
ATOM   10023 N N     . ILE D  1 443 ? 125.480 83.095  82.712  1.00 54.56  ? 443 ILE D N     1 
ATOM   10024 C CA    . ILE D  1 443 ? 125.361 82.230  81.560  1.00 51.95  ? 443 ILE D CA    1 
ATOM   10025 C C     . ILE D  1 443 ? 125.561 82.931  80.250  1.00 52.20  ? 443 ILE D C     1 
ATOM   10026 O O     . ILE D  1 443 ? 125.211 84.095  80.095  1.00 53.39  ? 443 ILE D O     1 
ATOM   10027 C CB    . ILE D  1 443 ? 124.015 81.529  81.536  1.00 45.86  ? 443 ILE D CB    1 
ATOM   10028 C CG1   . ILE D  1 443 ? 123.861 80.706  82.815  1.00 44.97  ? 443 ILE D CG1   1 
ATOM   10029 C CG2   . ILE D  1 443 ? 123.905 80.663  80.280  1.00 44.92  ? 443 ILE D CG2   1 
ATOM   10030 C CD1   . ILE D  1 443 ? 122.581 79.915  82.880  1.00 43.02  ? 443 ILE D CD1   1 
ATOM   10031 N N     . LEU D  1 444 ? 126.115 82.192  79.301  1.00 68.21  ? 444 LEU D N     1 
ATOM   10032 C CA    . LEU D  1 444 ? 126.388 82.716  77.978  1.00 67.19  ? 444 LEU D CA    1 
ATOM   10033 C C     . LEU D  1 444 ? 125.794 81.851  76.871  1.00 67.08  ? 444 LEU D C     1 
ATOM   10034 O O     . LEU D  1 444 ? 125.202 82.430  75.930  1.00 67.15  ? 444 LEU D O     1 
ATOM   10035 C CB    . LEU D  1 444 ? 127.891 82.838  77.784  1.00 68.54  ? 444 LEU D CB    1 
ATOM   10036 C CG    . LEU D  1 444 ? 128.290 83.129  76.346  1.00 66.73  ? 444 LEU D CG    1 
ATOM   10037 C CD1   . LEU D  1 444 ? 129.326 84.241  76.361  1.00 66.50  ? 444 LEU D CD1   1 
ATOM   10038 C CD2   . LEU D  1 444 ? 128.799 81.848  75.667  1.00 66.58  ? 444 LEU D CD2   1 
ATOM   10039 N N     . SER E  1 2   ? 102.827 97.487  132.481 1.00 185.91 ? 2   SER E N     1 
ATOM   10040 C CA    . SER E  1 2   ? 103.691 96.284  132.667 1.00 185.10 ? 2   SER E CA    1 
ATOM   10041 C C     . SER E  1 2   ? 104.935 96.381  131.795 1.00 183.59 ? 2   SER E C     1 
ATOM   10042 O O     . SER E  1 2   ? 106.004 95.877  132.156 1.00 184.51 ? 2   SER E O     1 
ATOM   10043 C CB    . SER E  1 2   ? 102.927 95.008  132.284 1.00 109.39 ? 2   SER E CB    1 
ATOM   10044 O OG    . SER E  1 2   ? 101.749 94.849  133.050 1.00 111.79 ? 2   SER E OG    1 
ATOM   10045 N N     . GLU E  1 3   ? 104.790 97.041  130.649 1.00 51.67  ? 3   GLU E N     1 
ATOM   10046 C CA    . GLU E  1 3   ? 105.889 97.169  129.700 1.00 47.49  ? 3   GLU E CA    1 
ATOM   10047 C C     . GLU E  1 3   ? 105.432 98.041  128.550 1.00 44.44  ? 3   GLU E C     1 
ATOM   10048 O O     . GLU E  1 3   ? 104.239 98.277  128.368 1.00 44.03  ? 3   GLU E O     1 
ATOM   10049 C CB    . GLU E  1 3   ? 106.264 95.789  129.155 1.00 70.02  ? 3   GLU E CB    1 
ATOM   10050 C CG    . GLU E  1 3   ? 107.464 95.772  128.262 1.00 70.66  ? 3   GLU E CG    1 
ATOM   10051 C CD    . GLU E  1 3   ? 108.632 96.375  128.957 1.00 71.75  ? 3   GLU E CD    1 
ATOM   10052 O OE1   . GLU E  1 3   ? 108.773 97.619  128.907 1.00 72.24  ? 3   GLU E OE1   1 
ATOM   10053 O OE2   . GLU E  1 3   ? 109.388 95.600  129.576 1.00 72.29  ? 3   GLU E OE2   1 
ATOM   10054 N N     . MET E  1 4   ? 106.388 98.496  127.753 1.00 37.54  ? 4   MET E N     1 
ATOM   10055 C CA    . MET E  1 4   ? 106.081 99.359  126.625 1.00 32.20  ? 4   MET E CA    1 
ATOM   10056 C C     . MET E  1 4   ? 105.376 98.637  125.518 1.00 28.12  ? 4   MET E C     1 
ATOM   10057 O O     . MET E  1 4   ? 105.031 97.477  125.630 1.00 27.06  ? 4   MET E O     1 
ATOM   10058 C CB    . MET E  1 4   ? 107.361 99.9