data_1G50
# 
_entry.id   1G50 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1G50         
RCSB  RCSB012240   
WWPDB D_1000012240 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB      1qkw           
;same structure at 3.2 angstrom 
resolution
;
unspecified 
PDB      1qkt           'structure of a mutant'                      unspecified 
TargetDB IGBMC-0005-000 .                                            unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1G50 
_pdbx_database_status.recvd_initial_deposition_date   2000-10-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Eiler, S.'                               1 
'Gangloff, M.'                            2 
'Duclaud, S.'                             3 
'Moras, D.'                               4 
'Ruff, M.'                                5 
'Structural Proteomics in Europe (SPINE)' 6 
# 
_citation.id                        primary 
_citation.title                     'Overexpression, Purification, and Crystal Structure of Native ER alpha LBD' 
_citation.journal_abbrev            'Protein Expr.Purif.' 
_citation.journal_volume            22 
_citation.page_first                165 
_citation.page_last                 173 
_citation.year                      2001 
_citation.journal_id_ASTM           PEXPEJ 
_citation.country                   US 
_citation.journal_id_ISSN           1046-5928 
_citation.journal_id_CSD            0757 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11437591 
_citation.pdbx_database_id_DOI      10.1006/prep.2001.1409 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Eiler, S.'    1 
primary 'Gangloff, M.' 2 
primary 'Duclaud, S.'  3 
primary 'Moras, D.'    4 
primary 'Ruff, M.'     5 
# 
_cell.entry_id           1G50 
_cell.length_a           105.500 
_cell.length_b           105.500 
_cell.length_c           136.080 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1G50 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ESTROGEN RECEPTOR' 28274.289 3   ? ? ? ? 
2 non-polymer syn ESTRADIOL           272.382   3   ? ? ? ? 
3 water       nat water               18.015    165 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;NSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAW
LEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLS
STLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEM
LDAHRLH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;NSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAW
LEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLS
STLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEM
LDAHRLH
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         IGBMC-0005-000 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASN n 
1 2   SER n 
1 3   LEU n 
1 4   ALA n 
1 5   LEU n 
1 6   SER n 
1 7   LEU n 
1 8   THR n 
1 9   ALA n 
1 10  ASP n 
1 11  GLN n 
1 12  MET n 
1 13  VAL n 
1 14  SER n 
1 15  ALA n 
1 16  LEU n 
1 17  LEU n 
1 18  ASP n 
1 19  ALA n 
1 20  GLU n 
1 21  PRO n 
1 22  PRO n 
1 23  ILE n 
1 24  LEU n 
1 25  TYR n 
1 26  SER n 
1 27  GLU n 
1 28  TYR n 
1 29  ASP n 
1 30  PRO n 
1 31  THR n 
1 32  ARG n 
1 33  PRO n 
1 34  PHE n 
1 35  SER n 
1 36  GLU n 
1 37  ALA n 
1 38  SER n 
1 39  MET n 
1 40  MET n 
1 41  GLY n 
1 42  LEU n 
1 43  LEU n 
1 44  THR n 
1 45  ASN n 
1 46  LEU n 
1 47  ALA n 
1 48  ASP n 
1 49  ARG n 
1 50  GLU n 
1 51  LEU n 
1 52  VAL n 
1 53  HIS n 
1 54  MET n 
1 55  ILE n 
1 56  ASN n 
1 57  TRP n 
1 58  ALA n 
1 59  LYS n 
1 60  ARG n 
1 61  VAL n 
1 62  PRO n 
1 63  GLY n 
1 64  PHE n 
1 65  VAL n 
1 66  ASP n 
1 67  LEU n 
1 68  THR n 
1 69  LEU n 
1 70  HIS n 
1 71  ASP n 
1 72  GLN n 
1 73  VAL n 
1 74  HIS n 
1 75  LEU n 
1 76  LEU n 
1 77  GLU n 
1 78  CYS n 
1 79  ALA n 
1 80  TRP n 
1 81  LEU n 
1 82  GLU n 
1 83  ILE n 
1 84  LEU n 
1 85  MET n 
1 86  ILE n 
1 87  GLY n 
1 88  LEU n 
1 89  VAL n 
1 90  TRP n 
1 91  ARG n 
1 92  SER n 
1 93  MET n 
1 94  GLU n 
1 95  HIS n 
1 96  PRO n 
1 97  GLY n 
1 98  LYS n 
1 99  LEU n 
1 100 LEU n 
1 101 PHE n 
1 102 ALA n 
1 103 PRO n 
1 104 ASN n 
1 105 LEU n 
1 106 LEU n 
1 107 LEU n 
1 108 ASP n 
1 109 ARG n 
1 110 ASN n 
1 111 GLN n 
1 112 GLY n 
1 113 LYS n 
1 114 CYS n 
1 115 VAL n 
1 116 GLU n 
1 117 GLY n 
1 118 MET n 
1 119 VAL n 
1 120 GLU n 
1 121 ILE n 
1 122 PHE n 
1 123 ASP n 
1 124 MET n 
1 125 LEU n 
1 126 LEU n 
1 127 ALA n 
1 128 THR n 
1 129 SER n 
1 130 SER n 
1 131 ARG n 
1 132 PHE n 
1 133 ARG n 
1 134 MET n 
1 135 MET n 
1 136 ASN n 
1 137 LEU n 
1 138 GLN n 
1 139 GLY n 
1 140 GLU n 
1 141 GLU n 
1 142 PHE n 
1 143 VAL n 
1 144 CYS n 
1 145 LEU n 
1 146 LYS n 
1 147 SER n 
1 148 ILE n 
1 149 ILE n 
1 150 LEU n 
1 151 LEU n 
1 152 ASN n 
1 153 SER n 
1 154 GLY n 
1 155 VAL n 
1 156 TYR n 
1 157 THR n 
1 158 PHE n 
1 159 LEU n 
1 160 SER n 
1 161 SER n 
1 162 THR n 
1 163 LEU n 
1 164 LYS n 
1 165 SER n 
1 166 LEU n 
1 167 GLU n 
1 168 GLU n 
1 169 LYS n 
1 170 ASP n 
1 171 HIS n 
1 172 ILE n 
1 173 HIS n 
1 174 ARG n 
1 175 VAL n 
1 176 LEU n 
1 177 ASP n 
1 178 LYS n 
1 179 ILE n 
1 180 THR n 
1 181 ASP n 
1 182 THR n 
1 183 LEU n 
1 184 ILE n 
1 185 HIS n 
1 186 LEU n 
1 187 MET n 
1 188 ALA n 
1 189 LYS n 
1 190 ALA n 
1 191 GLY n 
1 192 LEU n 
1 193 THR n 
1 194 LEU n 
1 195 GLN n 
1 196 GLN n 
1 197 GLN n 
1 198 HIS n 
1 199 GLN n 
1 200 ARG n 
1 201 LEU n 
1 202 ALA n 
1 203 GLN n 
1 204 LEU n 
1 205 LEU n 
1 206 LEU n 
1 207 ILE n 
1 208 LEU n 
1 209 SER n 
1 210 HIS n 
1 211 ILE n 
1 212 ARG n 
1 213 HIS n 
1 214 MET n 
1 215 SER n 
1 216 ASN n 
1 217 LYS n 
1 218 GLY n 
1 219 MET n 
1 220 GLU n 
1 221 HIS n 
1 222 LEU n 
1 223 TYR n 
1 224 SER n 
1 225 MET n 
1 226 LYS n 
1 227 CYS n 
1 228 LYS n 
1 229 ASN n 
1 230 VAL n 
1 231 VAL n 
1 232 PRO n 
1 233 LEU n 
1 234 TYR n 
1 235 ASP n 
1 236 LEU n 
1 237 LEU n 
1 238 LEU n 
1 239 GLU n 
1 240 MET n 
1 241 LEU n 
1 242 ASP n 
1 243 ALA n 
1 244 HIS n 
1 245 ARG n 
1 246 LEU n 
1 247 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET15B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ESR1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P03372 
_struct_ref.pdbx_align_begin           304 
_struct_ref.pdbx_seq_one_letter_code   
;NSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAW
LEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLS
STLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEM
LDAHRLH
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1G50 A 1 ? 247 ? P03372 304 ? 550 ? 304  550  
2 1 1G50 B 1 ? 247 ? P03372 304 ? 550 ? 1304 1550 
3 1 1G50 C 1 ? 247 ? P03372 304 ? 550 ? 2304 2550 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
EST non-polymer         . ESTRADIOL       ? 'C18 H24 O2'     272.382 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1G50 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.58 
_exptl_crystal.density_percent_sol   52.26 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.1 
_exptl_crystal_grow.pdbx_details    'PEG400, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   1997-04-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9934 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM30A' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM30A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9934 
# 
_reflns.entry_id                     1G50 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             40.0 
_reflns.d_resolution_high            2.9 
_reflns.number_obs                   18142 
_reflns.number_all                   20000 
_reflns.percent_possible_obs         91 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              8.0000000 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        34.9 
_reflns.pdbx_redundancy              1.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1G50 
_refine.ls_number_reflns_obs                     18142 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1999535.89 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             49.18 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    91.0 
_refine.ls_R_factor_obs                          0.2410000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2410000 
_refine.ls_R_factor_R_free                       0.3100000 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.8 
_refine.ls_number_reflns_R_free                  1778 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               61.2 
_refine.aniso_B[1][1]                            18.90 
_refine.aniso_B[2][2]                            18.90 
_refine.aniso_B[3][3]                            -37.80 
_refine.aniso_B[1][2]                            -0.97 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.322 
_refine.solvent_model_param_bsol                 44.13 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'pdb entry 1qkt' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           1999535.89 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1G50 
_refine_analyze.Luzzati_coordinate_error_obs    0.41 
_refine_analyze.Luzzati_sigma_a_obs             0.67 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.56 
_refine_analyze.Luzzati_sigma_a_free            0.84 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5884 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             165 
_refine_hist.number_atoms_total               6109 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        49.18 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.014 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.5   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 19.4  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.87  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.19  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.08  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.51  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.39  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.90 
_refine_ls_shell.d_res_low                        3.08 
_refine_ls_shell.number_reflns_R_work             2288 
_refine_ls_shell.R_factor_R_work                  0.3820000 
_refine_ls_shell.percent_reflns_obs               78.0 
_refine_ls_shell.R_factor_R_free                  0.4650000 
_refine_ls_shell.R_factor_R_free_error            0.029 
_refine_ls_shell.percent_reflns_R_free            9.9 
_refine_ls_shell.number_reflns_R_free             252 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PA  PROTEIN.TOP   'X-RAY DIFFRACTION' 
2 ESTRADIOL.PARAM ESTRADIOL.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARA  WATER.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1G50 
_struct.title                     'CRYSTAL STRUCTURE OF A WILD TYPE HER ALPHA LBD AT 2.9 ANGSTROM RESOLUTION' 
_struct.pdbx_descriptor           'ESTROGEN RECEPTOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1G50 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            
'alpha helices, estradiol, Structural Proteomics in Europe, SPINE, Structural Genomics, DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
0 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 8   ? ALA A 19  ? THR A 311  ALA A 322  1 ? 12 
HELX_P HELX_P2  2  ALA A 37  ? VAL A 61  ? ALA A 340  VAL A 364  1 ? 25 
HELX_P HELX_P3  3  THR A 68  ? SER A 92  ? THR A 371  SER A 395  1 ? 25 
HELX_P HELX_P4  4  ARG A 109 ? VAL A 115 ? ARG A 412  VAL A 418  1 ? 7  
HELX_P HELX_P5  5  GLY A 117 ? MET A 134 ? GLY A 420  MET A 437  1 ? 18 
HELX_P HELX_P6  6  GLN A 138 ? ASN A 152 ? GLN A 441  ASN A 455  1 ? 15 
HELX_P HELX_P7  7  LYS A 164 ? LYS A 189 ? LYS A 467  LYS A 492  1 ? 26 
HELX_P HELX_P8  8  THR A 193 ? CYS A 227 ? THR A 496  CYS A 530  1 ? 35 
HELX_P HELX_P9  9  TYR A 234 ? ARG A 245 ? TYR A 537  ARG A 548  1 ? 12 
HELX_P HELX_P10 10 LEU B 3   ? LEU B 7   ? LEU B 1306 LEU B 1310 5 ? 5  
HELX_P HELX_P11 11 THR B 8   ? GLU B 20  ? THR B 1311 GLU B 1323 1 ? 13 
HELX_P HELX_P12 12 SER B 35  ? VAL B 61  ? SER B 1338 VAL B 1364 1 ? 27 
HELX_P HELX_P13 13 GLY B 63  ? LEU B 67  ? GLY B 1366 LEU B 1370 5 ? 5  
HELX_P HELX_P14 14 THR B 68  ? ARG B 91  ? THR B 1371 ARG B 1394 1 ? 24 
HELX_P HELX_P15 15 ASN B 110 ? VAL B 115 ? ASN B 1413 VAL B 1418 5 ? 6  
HELX_P HELX_P16 16 MET B 118 ? MET B 134 ? MET B 1421 MET B 1437 1 ? 17 
HELX_P HELX_P17 17 GLN B 138 ? SER B 153 ? GLN B 1441 SER B 1456 1 ? 16 
HELX_P HELX_P18 18 THR B 162 ? LYS B 189 ? THR B 1465 LYS B 1492 1 ? 28 
HELX_P HELX_P19 19 THR B 193 ? LYS B 228 ? THR B 1496 LYS B 1531 1 ? 36 
HELX_P HELX_P20 20 TYR B 234 ? ALA B 243 ? TYR B 1537 ALA B 1546 1 ? 10 
HELX_P HELX_P21 21 SER C 2   ? LEU C 7   ? SER C 2305 LEU C 2310 5 ? 6  
HELX_P HELX_P22 22 THR C 8   ? GLU C 20  ? THR C 2311 GLU C 2323 1 ? 13 
HELX_P HELX_P23 23 SER C 35  ? VAL C 61  ? SER C 2338 VAL C 2364 1 ? 27 
HELX_P HELX_P24 24 GLY C 63  ? LEU C 67  ? GLY C 2366 LEU C 2370 5 ? 5  
HELX_P HELX_P25 25 THR C 68  ? ARG C 91  ? THR C 2371 ARG C 2394 1 ? 24 
HELX_P HELX_P26 26 ASN C 110 ? VAL C 115 ? ASN C 2413 VAL C 2418 5 ? 6  
HELX_P HELX_P27 27 GLY C 117 ? MET C 134 ? GLY C 2420 MET C 2437 1 ? 18 
HELX_P HELX_P28 28 GLN C 138 ? SER C 153 ? GLN C 2441 SER C 2456 1 ? 16 
HELX_P HELX_P29 29 THR C 162 ? LYS C 189 ? THR C 2465 LYS C 2492 1 ? 28 
HELX_P HELX_P30 30 THR C 193 ? LYS C 228 ? THR C 2496 LYS C 2531 1 ? 36 
HELX_P HELX_P31 31 TYR C 234 ? ALA C 243 ? TYR C 2537 ALA C 2546 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 98  ? LEU A 100 ? LYS A 401  LEU A 403  
A 2 LEU A 106 ? ASP A 108 ? LEU A 409  ASP A 411  
B 1 LYS B 98  ? ALA B 102 ? LYS B 1401 ALA B 1405 
B 2 LEU B 105 ? ASP B 108 ? LEU B 1408 ASP B 1411 
C 1 LYS C 98  ? ALA C 102 ? LYS C 2401 ALA C 2405 
C 2 LEU C 105 ? ASP C 108 ? LEU C 2408 ASP C 2411 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 99  ? N LEU A 402  O LEU A 107 ? O LEU A 410  
B 1 2 N ALA B 102 ? N ALA B 1405 O LEU B 105 ? O LEU B 1408 
C 1 2 N ALA C 102 ? N ALA C 2405 O LEU C 105 ? O LEU C 2408 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE EST A 600'  
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE EST B 1600' 
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE EST C 2600' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  GLU A 50  ? GLU A 353  . ? 1_555 ? 
2  AC1 8  LEU A 84  ? LEU A 387  . ? 1_555 ? 
3  AC1 8  MET A 85  ? MET A 388  . ? 1_555 ? 
4  AC1 8  ARG A 91  ? ARG A 394  . ? 1_555 ? 
5  AC1 8  PHE A 101 ? PHE A 404  . ? 1_555 ? 
6  AC1 8  MET A 118 ? MET A 421  . ? 1_555 ? 
7  AC1 8  HIS A 221 ? HIS A 524  . ? 1_555 ? 
8  AC1 8  LEU A 222 ? LEU A 525  . ? 1_555 ? 
9  AC2 11 GLU B 50  ? GLU B 1353 . ? 1_555 ? 
10 AC2 11 LEU B 84  ? LEU B 1387 . ? 1_555 ? 
11 AC2 11 MET B 85  ? MET B 1388 . ? 1_555 ? 
12 AC2 11 LEU B 88  ? LEU B 1391 . ? 1_555 ? 
13 AC2 11 ARG B 91  ? ARG B 1394 . ? 1_555 ? 
14 AC2 11 PHE B 101 ? PHE B 1404 . ? 1_555 ? 
15 AC2 11 MET B 118 ? MET B 1421 . ? 1_555 ? 
16 AC2 11 ILE B 121 ? ILE B 1424 . ? 1_555 ? 
17 AC2 11 GLY B 218 ? GLY B 1521 . ? 1_555 ? 
18 AC2 11 HIS B 221 ? HIS B 1524 . ? 1_555 ? 
19 AC2 11 LEU B 222 ? LEU B 1525 . ? 1_555 ? 
20 AC3 10 GLU C 50  ? GLU C 2353 . ? 1_555 ? 
21 AC3 10 LEU C 84  ? LEU C 2387 . ? 1_555 ? 
22 AC3 10 MET C 85  ? MET C 2388 . ? 1_555 ? 
23 AC3 10 LEU C 88  ? LEU C 2391 . ? 1_555 ? 
24 AC3 10 ARG C 91  ? ARG C 2394 . ? 1_555 ? 
25 AC3 10 PHE C 101 ? PHE C 2404 . ? 1_555 ? 
26 AC3 10 ILE C 121 ? ILE C 2424 . ? 1_555 ? 
27 AC3 10 GLY C 218 ? GLY C 2521 . ? 1_555 ? 
28 AC3 10 HIS C 221 ? HIS C 2524 . ? 1_555 ? 
29 AC3 10 LEU C 222 ? LEU C 2525 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1G50 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1G50 
_atom_sites.fract_transf_matrix[1][1]   0.009479 
_atom_sites.fract_transf_matrix[1][2]   0.005473 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010945 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007349 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASN A 1 1   ? 81.334  1.669   47.017 1.00 78.15  ? 304  ASN A N   1 
ATOM   2    C CA  . ASN A 1 1   ? 80.100  2.450   46.697 1.00 79.65  ? 304  ASN A CA  1 
ATOM   3    C C   . ASN A 1 1   ? 80.129  3.888   47.246 1.00 80.32  ? 304  ASN A C   1 
ATOM   4    O O   . ASN A 1 1   ? 79.673  4.145   48.367 1.00 80.08  ? 304  ASN A O   1 
ATOM   5    C CB  . ASN A 1 1   ? 78.864  1.714   47.238 1.00 78.71  ? 304  ASN A CB  1 
ATOM   6    C CG  . ASN A 1 1   ? 78.890  1.549   48.748 1.00 77.22  ? 304  ASN A CG  1 
ATOM   7    O OD1 . ASN A 1 1   ? 79.833  0.990   49.304 1.00 76.04  ? 304  ASN A OD1 1 
ATOM   8    N ND2 . ASN A 1 1   ? 77.847  2.033   49.416 1.00 76.61  ? 304  ASN A ND2 1 
ATOM   9    N N   . SER A 1 2   ? 80.648  4.820   46.440 1.00 80.64  ? 305  SER A N   1 
ATOM   10   C CA  . SER A 1 2   ? 80.752  6.234   46.829 1.00 79.95  ? 305  SER A CA  1 
ATOM   11   C C   . SER A 1 2   ? 80.014  7.186   45.881 1.00 78.36  ? 305  SER A C   1 
ATOM   12   O O   . SER A 1 2   ? 78.942  6.873   45.374 1.00 78.13  ? 305  SER A O   1 
ATOM   13   C CB  . SER A 1 2   ? 82.221  6.668   46.888 1.00 81.79  ? 305  SER A CB  1 
ATOM   14   O OG  . SER A 1 2   ? 82.726  6.935   45.582 1.00 83.99  ? 305  SER A OG  1 
ATOM   15   N N   . LEU A 1 3   ? 80.616  8.348   45.640 1.00 76.59  ? 306  LEU A N   1 
ATOM   16   C CA  . LEU A 1 3   ? 80.034  9.366   44.773 1.00 74.96  ? 306  LEU A CA  1 
ATOM   17   C C   . LEU A 1 3   ? 79.783  8.866   43.345 1.00 73.07  ? 306  LEU A C   1 
ATOM   18   O O   . LEU A 1 3   ? 78.671  8.468   42.997 1.00 72.78  ? 306  LEU A O   1 
ATOM   19   C CB  . LEU A 1 3   ? 80.953  10.595  44.734 1.00 75.82  ? 306  LEU A CB  1 
ATOM   20   C CG  . LEU A 1 3   ? 80.296  11.980  44.614 1.00 75.86  ? 306  LEU A CG  1 
ATOM   21   C CD1 . LEU A 1 3   ? 81.378  13.042  44.471 1.00 75.88  ? 306  LEU A CD1 1 
ATOM   22   C CD2 . LEU A 1 3   ? 79.352  12.025  43.425 1.00 75.33  ? 306  LEU A CD2 1 
ATOM   23   N N   . ALA A 1 4   ? 80.822  8.910   42.520 1.00 70.56  ? 307  ALA A N   1 
ATOM   24   C CA  . ALA A 1 4   ? 80.736  8.479   41.135 1.00 67.47  ? 307  ALA A CA  1 
ATOM   25   C C   . ALA A 1 4   ? 79.528  7.598   40.850 1.00 64.91  ? 307  ALA A C   1 
ATOM   26   O O   . ALA A 1 4   ? 78.617  8.018   40.148 1.00 65.49  ? 307  ALA A O   1 
ATOM   27   C CB  . ALA A 1 4   ? 82.009  7.751   40.747 1.00 68.75  ? 307  ALA A CB  1 
ATOM   28   N N   . LEU A 1 5   ? 79.525  6.388   41.408 1.00 61.83  ? 308  LEU A N   1 
ATOM   29   C CA  . LEU A 1 5   ? 78.441  5.408   41.217 1.00 59.49  ? 308  LEU A CA  1 
ATOM   30   C C   . LEU A 1 5   ? 77.002  5.907   41.295 1.00 57.67  ? 308  LEU A C   1 
ATOM   31   O O   . LEU A 1 5   ? 76.072  5.157   41.044 1.00 55.23  ? 308  LEU A O   1 
ATOM   32   C CB  . LEU A 1 5   ? 78.587  4.265   42.217 1.00 58.14  ? 308  LEU A CB  1 
ATOM   33   C CG  . LEU A 1 5   ? 79.741  3.299   41.990 1.00 56.91  ? 308  LEU A CG  1 
ATOM   34   C CD1 . LEU A 1 5   ? 79.985  2.511   43.271 1.00 58.17  ? 308  LEU A CD1 1 
ATOM   35   C CD2 . LEU A 1 5   ? 79.429  2.392   40.818 1.00 54.83  ? 308  LEU A CD2 1 
ATOM   36   N N   . SER A 1 6   ? 76.816  7.168   41.648 1.00 57.83  ? 309  SER A N   1 
ATOM   37   C CA  . SER A 1 6   ? 75.481  7.718   41.747 1.00 57.47  ? 309  SER A CA  1 
ATOM   38   C C   . SER A 1 6   ? 75.228  8.757   40.656 1.00 58.25  ? 309  SER A C   1 
ATOM   39   O O   . SER A 1 6   ? 74.267  8.631   39.890 1.00 59.44  ? 309  SER A O   1 
ATOM   40   C CB  . SER A 1 6   ? 75.298  8.367   43.112 1.00 56.91  ? 309  SER A CB  1 
ATOM   41   O OG  . SER A 1 6   ? 76.178  9.472   43.234 1.00 56.27  ? 309  SER A OG  1 
ATOM   42   N N   . LEU A 1 7   ? 76.099  9.768   40.589 1.00 56.62  ? 310  LEU A N   1 
ATOM   43   C CA  . LEU A 1 7   ? 75.979  10.865  39.622 1.00 55.10  ? 310  LEU A CA  1 
ATOM   44   C C   . LEU A 1 7   ? 75.200  10.558  38.346 1.00 54.64  ? 310  LEU A C   1 
ATOM   45   O O   . LEU A 1 7   ? 75.471  9.566   37.662 1.00 53.37  ? 310  LEU A O   1 
ATOM   46   C CB  . LEU A 1 7   ? 77.361  11.388  39.232 1.00 54.31  ? 310  LEU A CB  1 
ATOM   47   C CG  . LEU A 1 7   ? 78.221  11.987  40.338 1.00 54.28  ? 310  LEU A CG  1 
ATOM   48   C CD1 . LEU A 1 7   ? 79.506  12.502  39.738 1.00 54.08  ? 310  LEU A CD1 1 
ATOM   49   C CD2 . LEU A 1 7   ? 77.479  13.112  41.034 1.00 55.64  ? 310  LEU A CD2 1 
ATOM   50   N N   . THR A 1 8   ? 74.231  11.416  38.028 1.00 54.09  ? 311  THR A N   1 
ATOM   51   C CA  . THR A 1 8   ? 73.442  11.225  36.819 1.00 53.17  ? 311  THR A CA  1 
ATOM   52   C C   . THR A 1 8   ? 74.393  11.493  35.672 1.00 52.69  ? 311  THR A C   1 
ATOM   53   O O   . THR A 1 8   ? 75.439  12.122  35.853 1.00 50.98  ? 311  THR A O   1 
ATOM   54   C CB  . THR A 1 8   ? 72.253  12.224  36.695 1.00 51.82  ? 311  THR A CB  1 
ATOM   55   O OG1 . THR A 1 8   ? 72.590  13.269  35.772 1.00 50.80  ? 311  THR A OG1 1 
ATOM   56   C CG2 . THR A 1 8   ? 71.929  12.836  38.026 1.00 51.31  ? 311  THR A CG2 1 
ATOM   57   N N   . ALA A 1 9   ? 74.036  11.009  34.495 1.00 51.86  ? 312  ALA A N   1 
ATOM   58   C CA  . ALA A 1 9   ? 74.876  11.234  33.347 1.00 52.16  ? 312  ALA A CA  1 
ATOM   59   C C   . ALA A 1 9   ? 75.405  12.675  33.378 1.00 52.51  ? 312  ALA A C   1 
ATOM   60   O O   . ALA A 1 9   ? 76.564  12.906  33.707 1.00 53.68  ? 312  ALA A O   1 
ATOM   61   C CB  . ALA A 1 9   ? 74.094  10.979  32.086 1.00 52.40  ? 312  ALA A CB  1 
ATOM   62   N N   . ASP A 1 10  ? 74.552  13.641  33.064 1.00 51.77  ? 313  ASP A N   1 
ATOM   63   C CA  . ASP A 1 10  ? 74.959  15.040  33.041 1.00 50.31  ? 313  ASP A CA  1 
ATOM   64   C C   . ASP A 1 10  ? 75.849  15.358  34.216 1.00 49.04  ? 313  ASP A C   1 
ATOM   65   O O   . ASP A 1 10  ? 76.902  15.975  34.063 1.00 47.76  ? 313  ASP A O   1 
ATOM   66   C CB  . ASP A 1 10  ? 73.731  15.920  33.087 1.00 51.75  ? 313  ASP A CB  1 
ATOM   67   C CG  . ASP A 1 10  ? 72.604  15.340  32.291 1.00 54.73  ? 313  ASP A CG  1 
ATOM   68   O OD1 . ASP A 1 10  ? 72.652  15.429  31.038 1.00 55.14  ? 313  ASP A OD1 1 
ATOM   69   O OD2 . ASP A 1 10  ? 71.686  14.768  32.928 1.00 55.66  ? 313  ASP A OD2 1 
ATOM   70   N N   . GLN A 1 11  ? 75.416  14.936  35.397 1.00 48.25  ? 314  GLN A N   1 
ATOM   71   C CA  . GLN A 1 11  ? 76.193  15.182  36.594 1.00 48.54  ? 314  GLN A CA  1 
ATOM   72   C C   . GLN A 1 11  ? 77.598  14.731  36.309 1.00 48.07  ? 314  GLN A C   1 
ATOM   73   O O   . GLN A 1 11  ? 78.544  15.506  36.421 1.00 47.56  ? 314  GLN A O   1 
ATOM   74   C CB  . GLN A 1 11  ? 75.634  14.397  37.762 1.00 49.53  ? 314  GLN A CB  1 
ATOM   75   C CG  . GLN A 1 11  ? 74.612  15.154  38.537 1.00 51.16  ? 314  GLN A CG  1 
ATOM   76   C CD  . GLN A 1 11  ? 74.418  14.549  39.893 1.00 53.58  ? 314  GLN A CD  1 
ATOM   77   O OE1 . GLN A 1 11  ? 73.998  13.401  40.002 1.00 56.33  ? 314  GLN A OE1 1 
ATOM   78   N NE2 . GLN A 1 11  ? 74.742  15.306  40.946 1.00 53.49  ? 314  GLN A NE2 1 
ATOM   79   N N   . MET A 1 12  ? 77.714  13.463  35.932 1.00 48.14  ? 315  MET A N   1 
ATOM   80   C CA  . MET A 1 12  ? 78.990  12.864  35.579 1.00 47.26  ? 315  MET A CA  1 
ATOM   81   C C   . MET A 1 12  ? 79.739  13.822  34.659 1.00 46.49  ? 315  MET A C   1 
ATOM   82   O O   . MET A 1 12  ? 80.864  14.230  34.943 1.00 46.26  ? 315  MET A O   1 
ATOM   83   C CB  . MET A 1 12  ? 78.740  11.558  34.846 1.00 49.29  ? 315  MET A CB  1 
ATOM   84   C CG  . MET A 1 12  ? 79.969  10.953  34.226 1.00 50.81  ? 315  MET A CG  1 
ATOM   85   S SD  . MET A 1 12  ? 80.977  10.272  35.511 1.00 52.49  ? 315  MET A SD  1 
ATOM   86   C CE  . MET A 1 12  ? 79.904  8.899   36.022 1.00 52.37  ? 315  MET A CE  1 
ATOM   87   N N   . VAL A 1 13  ? 79.090  14.185  33.560 1.00 45.22  ? 316  VAL A N   1 
ATOM   88   C CA  . VAL A 1 13  ? 79.668  15.094  32.587 1.00 44.62  ? 316  VAL A CA  1 
ATOM   89   C C   . VAL A 1 13  ? 80.136  16.430  33.157 1.00 46.71  ? 316  VAL A C   1 
ATOM   90   O O   . VAL A 1 13  ? 81.332  16.731  33.133 1.00 48.17  ? 316  VAL A O   1 
ATOM   91   C CB  . VAL A 1 13  ? 78.687  15.408  31.466 1.00 42.21  ? 316  VAL A CB  1 
ATOM   92   C CG1 . VAL A 1 13  ? 79.333  16.348  30.479 1.00 41.57  ? 316  VAL A CG1 1 
ATOM   93   C CG2 . VAL A 1 13  ? 78.267  14.141  30.779 1.00 42.90  ? 316  VAL A CG2 1 
ATOM   94   N N   . SER A 1 14  ? 79.205  17.238  33.660 1.00 46.44  ? 317  SER A N   1 
ATOM   95   C CA  . SER A 1 14  ? 79.584  18.541  34.186 1.00 45.95  ? 317  SER A CA  1 
ATOM   96   C C   . SER A 1 14  ? 80.828  18.391  35.053 1.00 45.12  ? 317  SER A C   1 
ATOM   97   O O   . SER A 1 14  ? 81.813  19.128  34.887 1.00 43.89  ? 317  SER A O   1 
ATOM   98   C CB  . SER A 1 14  ? 78.440  19.157  34.990 1.00 46.51  ? 317  SER A CB  1 
ATOM   99   O OG  . SER A 1 14  ? 78.422  18.661  36.311 1.00 51.21  ? 317  SER A OG  1 
ATOM   100  N N   . ALA A 1 15  ? 80.785  17.425  35.966 1.00 43.68  ? 318  ALA A N   1 
ATOM   101  C CA  . ALA A 1 15  ? 81.917  17.169  36.840 1.00 44.71  ? 318  ALA A CA  1 
ATOM   102  C C   . ALA A 1 15  ? 83.148  17.110  35.949 1.00 46.87  ? 318  ALA A C   1 
ATOM   103  O O   . ALA A 1 15  ? 84.053  17.948  36.022 1.00 47.71  ? 318  ALA A O   1 
ATOM   104  C CB  . ALA A 1 15  ? 81.738  15.857  37.544 1.00 39.93  ? 318  ALA A CB  1 
ATOM   105  N N   . LEU A 1 16  ? 83.158  16.107  35.084 1.00 47.85  ? 319  LEU A N   1 
ATOM   106  C CA  . LEU A 1 16  ? 84.259  15.914  34.165 1.00 48.18  ? 319  LEU A CA  1 
ATOM   107  C C   . LEU A 1 16  ? 84.604  17.186  33.418 1.00 48.38  ? 319  LEU A C   1 
ATOM   108  O O   . LEU A 1 16  ? 85.772  17.499  33.190 1.00 48.85  ? 319  LEU A O   1 
ATOM   109  C CB  . LEU A 1 16  ? 83.904  14.816  33.174 1.00 46.66  ? 319  LEU A CB  1 
ATOM   110  C CG  . LEU A 1 16  ? 84.579  13.496  33.512 1.00 46.83  ? 319  LEU A CG  1 
ATOM   111  C CD1 . LEU A 1 16  ? 83.714  12.362  33.002 1.00 47.49  ? 319  LEU A CD1 1 
ATOM   112  C CD2 . LEU A 1 16  ? 86.001  13.459  32.909 1.00 47.06  ? 319  LEU A CD2 1 
ATOM   113  N N   . LEU A 1 17  ? 83.582  17.925  33.034 1.00 48.38  ? 320  LEU A N   1 
ATOM   114  C CA  . LEU A 1 17  ? 83.823  19.137  32.299 1.00 49.13  ? 320  LEU A CA  1 
ATOM   115  C C   . LEU A 1 17  ? 84.554  20.126  33.194 1.00 49.90  ? 320  LEU A C   1 
ATOM   116  O O   . LEU A 1 17  ? 85.689  20.511  32.903 1.00 48.96  ? 320  LEU A O   1 
ATOM   117  C CB  . LEU A 1 17  ? 82.492  19.704  31.814 1.00 50.31  ? 320  LEU A CB  1 
ATOM   118  C CG  . LEU A 1 17  ? 82.431  20.147  30.348 1.00 50.21  ? 320  LEU A CG  1 
ATOM   119  C CD1 . LEU A 1 17  ? 82.919  19.036  29.434 1.00 48.67  ? 320  LEU A CD1 1 
ATOM   120  C CD2 . LEU A 1 17  ? 81.002  20.537  30.009 1.00 50.75  ? 320  LEU A CD2 1 
ATOM   121  N N   . ASP A 1 18  ? 83.914  20.503  34.300 1.00 50.78  ? 321  ASP A N   1 
ATOM   122  C CA  . ASP A 1 18  ? 84.489  21.470  35.231 1.00 51.70  ? 321  ASP A CA  1 
ATOM   123  C C   . ASP A 1 18  ? 85.862  21.061  35.768 1.00 50.99  ? 321  ASP A C   1 
ATOM   124  O O   . ASP A 1 18  ? 86.664  21.908  36.161 1.00 52.04  ? 321  ASP A O   1 
ATOM   125  C CB  . ASP A 1 18  ? 83.536  21.706  36.412 1.00 53.00  ? 321  ASP A CB  1 
ATOM   126  C CG  . ASP A 1 18  ? 83.723  23.092  37.053 1.00 55.85  ? 321  ASP A CG  1 
ATOM   127  O OD1 . ASP A 1 18  ? 83.678  23.199  38.303 1.00 56.34  ? 321  ASP A OD1 1 
ATOM   128  O OD2 . ASP A 1 18  ? 83.902  24.083  36.303 1.00 56.22  ? 321  ASP A OD2 1 
ATOM   129  N N   . ALA A 1 19  ? 86.142  19.767  35.767 1.00 49.89  ? 322  ALA A N   1 
ATOM   130  C CA  . ALA A 1 19  ? 87.406  19.273  36.298 1.00 48.62  ? 322  ALA A CA  1 
ATOM   131  C C   . ALA A 1 19  ? 88.618  19.472  35.393 1.00 47.89  ? 322  ALA A C   1 
ATOM   132  O O   . ALA A 1 19  ? 89.755  19.260  35.811 1.00 46.15  ? 322  ALA A O   1 
ATOM   133  C CB  . ALA A 1 19  ? 87.259  17.810  36.651 1.00 48.86  ? 322  ALA A CB  1 
ATOM   134  N N   . GLU A 1 20  ? 88.378  19.881  34.155 1.00 47.08  ? 323  GLU A N   1 
ATOM   135  C CA  . GLU A 1 20  ? 89.458  20.085  33.209 1.00 47.32  ? 323  GLU A CA  1 
ATOM   136  C C   . GLU A 1 20  ? 90.557  21.024  33.680 1.00 47.84  ? 323  GLU A C   1 
ATOM   137  O O   . GLU A 1 20  ? 90.343  21.856  34.558 1.00 48.15  ? 323  GLU A O   1 
ATOM   138  C CB  . GLU A 1 20  ? 88.878  20.597  31.912 1.00 48.36  ? 323  GLU A CB  1 
ATOM   139  C CG  . GLU A 1 20  ? 88.310  19.505  31.060 1.00 52.22  ? 323  GLU A CG  1 
ATOM   140  C CD  . GLU A 1 20  ? 89.388  18.846  30.231 1.00 55.21  ? 323  GLU A CD  1 
ATOM   141  O OE1 . GLU A 1 20  ? 89.973  19.546  29.372 1.00 56.01  ? 323  GLU A OE1 1 
ATOM   142  O OE2 . GLU A 1 20  ? 89.662  17.642  30.440 1.00 56.51  ? 323  GLU A OE2 1 
ATOM   143  N N   . PRO A 1 21  ? 91.766  20.873  33.115 1.00 48.73  ? 324  PRO A N   1 
ATOM   144  C CA  . PRO A 1 21  ? 92.951  21.679  33.421 1.00 49.05  ? 324  PRO A CA  1 
ATOM   145  C C   . PRO A 1 21  ? 93.059  22.842  32.435 1.00 49.74  ? 324  PRO A C   1 
ATOM   146  O O   . PRO A 1 21  ? 92.388  22.853  31.408 1.00 51.32  ? 324  PRO A O   1 
ATOM   147  C CB  . PRO A 1 21  ? 94.082  20.684  33.248 1.00 48.52  ? 324  PRO A CB  1 
ATOM   148  C CG  . PRO A 1 21  ? 93.623  19.916  32.070 1.00 47.83  ? 324  PRO A CG  1 
ATOM   149  C CD  . PRO A 1 21  ? 92.171  19.640  32.415 1.00 49.16  ? 324  PRO A CD  1 
ATOM   150  N N   . PRO A 1 22  ? 93.927  23.821  32.720 1.00 50.21  ? 325  PRO A N   1 
ATOM   151  C CA  . PRO A 1 22  ? 94.097  24.979  31.842 1.00 51.04  ? 325  PRO A CA  1 
ATOM   152  C C   . PRO A 1 22  ? 95.024  24.691  30.661 1.00 52.28  ? 325  PRO A C   1 
ATOM   153  O O   . PRO A 1 22  ? 95.952  23.878  30.779 1.00 54.21  ? 325  PRO A O   1 
ATOM   154  C CB  . PRO A 1 22  ? 94.692  26.006  32.782 1.00 50.86  ? 325  PRO A CB  1 
ATOM   155  C CG  . PRO A 1 22  ? 95.656  25.150  33.567 1.00 49.92  ? 325  PRO A CG  1 
ATOM   156  C CD  . PRO A 1 22  ? 94.832  23.915  33.882 1.00 50.73  ? 325  PRO A CD  1 
ATOM   157  N N   . ILE A 1 23  ? 94.782  25.361  29.533 1.00 51.09  ? 326  ILE A N   1 
ATOM   158  C CA  . ILE A 1 23  ? 95.610  25.179  28.347 1.00 50.11  ? 326  ILE A CA  1 
ATOM   159  C C   . ILE A 1 23  ? 96.871  25.986  28.504 1.00 50.08  ? 326  ILE A C   1 
ATOM   160  O O   . ILE A 1 23  ? 96.848  27.202  28.397 1.00 50.60  ? 326  ILE A O   1 
ATOM   161  C CB  . ILE A 1 23  ? 94.930  25.676  27.072 1.00 50.49  ? 326  ILE A CB  1 
ATOM   162  C CG1 . ILE A 1 23  ? 93.646  24.885  26.795 1.00 50.47  ? 326  ILE A CG1 1 
ATOM   163  C CG2 . ILE A 1 23  ? 95.901  25.556  25.918 1.00 49.68  ? 326  ILE A CG2 1 
ATOM   164  C CD1 . ILE A 1 23  ? 92.494  25.215  27.733 1.00 50.21  ? 326  ILE A CD1 1 
ATOM   165  N N   . LEU A 1 24  ? 97.979  25.310  28.745 1.00 51.40  ? 327  LEU A N   1 
ATOM   166  C CA  . LEU A 1 24  ? 99.246  25.993  28.925 1.00 51.21  ? 327  LEU A CA  1 
ATOM   167  C C   . LEU A 1 24  ? 99.717  26.682  27.663 1.00 52.21  ? 327  LEU A C   1 
ATOM   168  O O   . LEU A 1 24  ? 99.101  26.577  26.609 1.00 53.62  ? 327  LEU A O   1 
ATOM   169  C CB  . LEU A 1 24  ? 100.307 25.005  29.395 1.00 50.06  ? 327  LEU A CB  1 
ATOM   170  C CG  . LEU A 1 24  ? 100.075 24.539  30.832 1.00 49.77  ? 327  LEU A CG  1 
ATOM   171  C CD1 . LEU A 1 24  ? 98.799  23.715  30.942 1.00 50.97  ? 327  LEU A CD1 1 
ATOM   172  C CD2 . LEU A 1 24  ? 101.257 23.724  31.273 1.00 50.69  ? 327  LEU A CD2 1 
ATOM   173  N N   . TYR A 1 25  ? 100.817 27.403  27.793 1.00 53.04  ? 328  TYR A N   1 
ATOM   174  C CA  . TYR A 1 25  ? 101.421 28.119  26.692 1.00 53.81  ? 328  TYR A CA  1 
ATOM   175  C C   . TYR A 1 25  ? 102.832 27.622  26.695 1.00 54.89  ? 328  TYR A C   1 
ATOM   176  O O   . TYR A 1 25  ? 103.158 26.731  27.455 1.00 56.01  ? 328  TYR A O   1 
ATOM   177  C CB  . TYR A 1 25  ? 101.424 29.613  26.978 1.00 54.84  ? 328  TYR A CB  1 
ATOM   178  C CG  . TYR A 1 25  ? 100.226 30.344  26.446 1.00 55.82  ? 328  TYR A CG  1 
ATOM   179  C CD1 . TYR A 1 25  ? 98.941  29.967  26.815 1.00 56.46  ? 328  TYR A CD1 1 
ATOM   180  C CD2 . TYR A 1 25  ? 100.378 31.390  25.534 1.00 56.05  ? 328  TYR A CD2 1 
ATOM   181  C CE1 . TYR A 1 25  ? 97.833  30.605  26.283 1.00 58.62  ? 328  TYR A CE1 1 
ATOM   182  C CE2 . TYR A 1 25  ? 99.280  32.038  24.997 1.00 57.38  ? 328  TYR A CE2 1 
ATOM   183  C CZ  . TYR A 1 25  ? 98.006  31.638  25.370 1.00 58.65  ? 328  TYR A CZ  1 
ATOM   184  O OH  . TYR A 1 25  ? 96.901  32.234  24.798 1.00 59.62  ? 328  TYR A OH  1 
ATOM   185  N N   . SER A 1 26  ? 103.680 28.201  25.866 1.00 56.67  ? 329  SER A N   1 
ATOM   186  C CA  . SER A 1 26  ? 105.068 27.798  25.836 1.00 60.79  ? 329  SER A CA  1 
ATOM   187  C C   . SER A 1 26  ? 105.925 29.013  25.630 1.00 64.06  ? 329  SER A C   1 
ATOM   188  O O   . SER A 1 26  ? 105.612 29.838  24.787 1.00 64.71  ? 329  SER A O   1 
ATOM   189  C CB  . SER A 1 26  ? 105.324 26.829  24.696 1.00 60.79  ? 329  SER A CB  1 
ATOM   190  O OG  . SER A 1 26  ? 106.719 26.622  24.544 1.00 62.67  ? 329  SER A OG  1 
ATOM   191  N N   . GLU A 1 27  ? 107.005 29.138  26.389 1.00 69.45  ? 330  GLU A N   1 
ATOM   192  C CA  . GLU A 1 27  ? 107.890 30.285  26.210 1.00 75.47  ? 330  GLU A CA  1 
ATOM   193  C C   . GLU A 1 27  ? 108.586 30.167  24.849 1.00 77.78  ? 330  GLU A C   1 
ATOM   194  O O   . GLU A 1 27  ? 109.768 30.496  24.680 1.00 77.60  ? 330  GLU A O   1 
ATOM   195  C CB  . GLU A 1 27  ? 108.913 30.365  27.346 1.00 78.04  ? 330  GLU A CB  1 
ATOM   196  C CG  . GLU A 1 27  ? 109.429 29.027  27.830 1.00 81.59  ? 330  GLU A CG  1 
ATOM   197  C CD  . GLU A 1 27  ? 110.647 29.179  28.716 1.00 83.79  ? 330  GLU A CD  1 
ATOM   198  O OE1 . GLU A 1 27  ? 110.588 29.988  29.670 1.00 85.50  ? 330  GLU A OE1 1 
ATOM   199  O OE2 . GLU A 1 27  ? 111.663 28.493  28.457 1.00 84.85  ? 330  GLU A OE2 1 
ATOM   200  N N   . TYR A 1 28  ? 107.805 29.681  23.887 1.00 80.27  ? 331  TYR A N   1 
ATOM   201  C CA  . TYR A 1 28  ? 108.208 29.492  22.502 1.00 82.51  ? 331  TYR A CA  1 
ATOM   202  C C   . TYR A 1 28  ? 109.118 30.615  22.021 1.00 84.31  ? 331  TYR A C   1 
ATOM   203  O O   . TYR A 1 28  ? 108.819 31.797  22.206 1.00 83.82  ? 331  TYR A O   1 
ATOM   204  C CB  . TYR A 1 28  ? 106.936 29.411  21.634 1.00 81.52  ? 331  TYR A CB  1 
ATOM   205  C CG  . TYR A 1 28  ? 107.153 29.375  20.136 1.00 80.61  ? 331  TYR A CG  1 
ATOM   206  C CD1 . TYR A 1 28  ? 108.123 28.550  19.569 1.00 79.43  ? 331  TYR A CD1 1 
ATOM   207  C CD2 . TYR A 1 28  ? 106.368 30.159  19.283 1.00 80.24  ? 331  TYR A CD2 1 
ATOM   208  C CE1 . TYR A 1 28  ? 108.308 28.507  18.196 1.00 79.94  ? 331  TYR A CE1 1 
ATOM   209  C CE2 . TYR A 1 28  ? 106.542 30.123  17.904 1.00 79.47  ? 331  TYR A CE2 1 
ATOM   210  C CZ  . TYR A 1 28  ? 107.515 29.294  17.365 1.00 80.26  ? 331  TYR A CZ  1 
ATOM   211  O OH  . TYR A 1 28  ? 107.700 29.242  16.000 1.00 80.52  ? 331  TYR A OH  1 
ATOM   212  N N   . ASP A 1 29  ? 110.238 30.236  21.417 1.00 86.99  ? 332  ASP A N   1 
ATOM   213  C CA  . ASP A 1 29  ? 111.179 31.213  20.886 1.00 90.08  ? 332  ASP A CA  1 
ATOM   214  C C   . ASP A 1 29  ? 111.316 31.071  19.362 1.00 90.77  ? 332  ASP A C   1 
ATOM   215  O O   . ASP A 1 29  ? 112.184 30.346  18.859 1.00 90.25  ? 332  ASP A O   1 
ATOM   216  C CB  . ASP A 1 29  ? 112.539 31.076  21.587 1.00 92.34  ? 332  ASP A CB  1 
ATOM   217  C CG  . ASP A 1 29  ? 112.806 32.219  22.578 1.00 93.92  ? 332  ASP A CG  1 
ATOM   218  O OD1 . ASP A 1 29  ? 113.446 31.975  23.631 1.00 94.07  ? 332  ASP A OD1 1 
ATOM   219  O OD2 . ASP A 1 29  ? 112.382 33.366  22.294 1.00 94.12  ? 332  ASP A OD2 1 
ATOM   220  N N   . PRO A 1 30  ? 110.432 31.765  18.613 1.00 91.59  ? 333  PRO A N   1 
ATOM   221  C CA  . PRO A 1 30  ? 110.362 31.789  17.148 1.00 92.00  ? 333  PRO A CA  1 
ATOM   222  C C   . PRO A 1 30  ? 111.463 32.675  16.607 1.00 92.32  ? 333  PRO A C   1 
ATOM   223  O O   . PRO A 1 30  ? 111.576 32.893  15.402 1.00 92.46  ? 333  PRO A O   1 
ATOM   224  C CB  . PRO A 1 30  ? 108.986 32.377  16.887 1.00 92.14  ? 333  PRO A CB  1 
ATOM   225  C CG  . PRO A 1 30  ? 108.879 33.392  17.977 1.00 91.76  ? 333  PRO A CG  1 
ATOM   226  C CD  . PRO A 1 30  ? 109.385 32.633  19.188 1.00 91.69  ? 333  PRO A CD  1 
ATOM   227  N N   . THR A 1 31  ? 112.260 33.198  17.529 1.00 92.83  ? 334  THR A N   1 
ATOM   228  C CA  . THR A 1 31  ? 113.378 34.062  17.198 1.00 93.19  ? 334  THR A CA  1 
ATOM   229  C C   . THR A 1 31  ? 114.475 33.213  16.553 1.00 93.95  ? 334  THR A C   1 
ATOM   230  O O   . THR A 1 31  ? 115.074 33.607  15.551 1.00 93.97  ? 334  THR A O   1 
ATOM   231  C CB  . THR A 1 31  ? 113.919 34.728  18.469 1.00 92.62  ? 334  THR A CB  1 
ATOM   232  O OG1 . THR A 1 31  ? 114.583 33.749  19.279 1.00 90.85  ? 334  THR A OG1 1 
ATOM   233  C CG2 . THR A 1 31  ? 112.768 35.312  19.270 1.00 91.16  ? 334  THR A CG2 1 
ATOM   234  N N   . ARG A 1 32  ? 114.717 32.037  17.131 1.00 94.15  ? 335  ARG A N   1 
ATOM   235  C CA  . ARG A 1 32  ? 115.736 31.120  16.629 1.00 93.71  ? 335  ARG A CA  1 
ATOM   236  C C   . ARG A 1 32  ? 115.157 29.776  16.183 1.00 92.40  ? 335  ARG A C   1 
ATOM   237  O O   . ARG A 1 32  ? 114.173 29.283  16.756 1.00 92.45  ? 335  ARG A O   1 
ATOM   238  C CB  . ARG A 1 32  ? 116.803 30.866  17.702 1.00 95.58  ? 335  ARG A CB  1 
ATOM   239  C CG  . ARG A 1 32  ? 116.303 30.101  18.930 1.00 98.16  ? 335  ARG A CG  1 
ATOM   240  C CD  . ARG A 1 32  ? 115.746 31.030  20.008 1.00 99.94  ? 335  ARG A CD  1 
ATOM   241  N NE  . ARG A 1 32  ? 116.775 31.931  20.526 1.00 101.30 ? 335  ARG A NE  1 
ATOM   242  C CZ  . ARG A 1 32  ? 116.764 32.464  21.745 1.00 101.69 ? 335  ARG A CZ  1 
ATOM   243  N NH1 . ARG A 1 32  ? 115.773 32.186  22.582 1.00 101.61 ? 335  ARG A NH1 1 
ATOM   244  N NH2 . ARG A 1 32  ? 117.748 33.269  22.132 1.00 101.74 ? 335  ARG A NH2 1 
ATOM   245  N N   . PRO A 1 33  ? 115.782 29.156  15.162 1.00 90.70  ? 336  PRO A N   1 
ATOM   246  C CA  . PRO A 1 33  ? 115.373 27.863  14.600 1.00 88.62  ? 336  PRO A CA  1 
ATOM   247  C C   . PRO A 1 33  ? 115.465 26.699  15.589 1.00 86.03  ? 336  PRO A C   1 
ATOM   248  O O   . PRO A 1 33  ? 116.344 26.656  16.455 1.00 84.84  ? 336  PRO A O   1 
ATOM   249  C CB  . PRO A 1 33  ? 116.315 27.693  13.411 1.00 89.17  ? 336  PRO A CB  1 
ATOM   250  C CG  . PRO A 1 33  ? 117.558 28.392  13.874 1.00 89.53  ? 336  PRO A CG  1 
ATOM   251  C CD  . PRO A 1 33  ? 116.991 29.653  14.480 1.00 90.17  ? 336  PRO A CD  1 
ATOM   252  N N   . PHE A 1 34  ? 114.544 25.755  15.443 1.00 83.31  ? 337  PHE A N   1 
ATOM   253  C CA  . PHE A 1 34  ? 114.504 24.594  16.315 1.00 80.60  ? 337  PHE A CA  1 
ATOM   254  C C   . PHE A 1 34  ? 115.470 23.553  15.785 1.00 78.90  ? 337  PHE A C   1 
ATOM   255  O O   . PHE A 1 34  ? 115.573 23.356  14.578 1.00 78.53  ? 337  PHE A O   1 
ATOM   256  C CB  . PHE A 1 34  ? 113.096 23.988  16.346 1.00 79.38  ? 337  PHE A CB  1 
ATOM   257  C CG  . PHE A 1 34  ? 111.998 24.973  16.065 1.00 77.78  ? 337  PHE A CG  1 
ATOM   258  C CD1 . PHE A 1 34  ? 111.870 25.555  14.806 1.00 77.42  ? 337  PHE A CD1 1 
ATOM   259  C CD2 . PHE A 1 34  ? 111.084 25.310  17.051 1.00 76.62  ? 337  PHE A CD2 1 
ATOM   260  C CE1 . PHE A 1 34  ? 110.849 26.453  14.538 1.00 77.30  ? 337  PHE A CE1 1 
ATOM   261  C CE2 . PHE A 1 34  ? 110.061 26.205  16.794 1.00 76.72  ? 337  PHE A CE2 1 
ATOM   262  C CZ  . PHE A 1 34  ? 109.940 26.779  15.536 1.00 77.22  ? 337  PHE A CZ  1 
ATOM   263  N N   . SER A 1 35  ? 116.190 22.903  16.688 1.00 76.97  ? 338  SER A N   1 
ATOM   264  C CA  . SER A 1 35  ? 117.114 21.847  16.300 1.00 75.44  ? 338  SER A CA  1 
ATOM   265  C C   . SER A 1 35  ? 116.545 20.590  16.942 1.00 74.70  ? 338  SER A C   1 
ATOM   266  O O   . SER A 1 35  ? 115.565 20.670  17.691 1.00 75.04  ? 338  SER A O   1 
ATOM   267  C CB  . SER A 1 35  ? 118.528 22.131  16.828 1.00 75.48  ? 338  SER A CB  1 
ATOM   268  O OG  . SER A 1 35  ? 118.566 22.227  18.242 1.00 74.71  ? 338  SER A OG  1 
ATOM   269  N N   . GLU A 1 36  ? 117.127 19.432  16.649 1.00 72.59  ? 339  GLU A N   1 
ATOM   270  C CA  . GLU A 1 36  ? 116.638 18.195  17.251 1.00 70.49  ? 339  GLU A CA  1 
ATOM   271  C C   . GLU A 1 36  ? 116.807 18.263  18.772 1.00 68.06  ? 339  GLU A C   1 
ATOM   272  O O   . GLU A 1 36  ? 116.855 17.235  19.453 1.00 67.21  ? 339  GLU A O   1 
ATOM   273  C CB  . GLU A 1 36  ? 117.405 16.990  16.705 1.00 71.95  ? 339  GLU A CB  1 
ATOM   274  C CG  . GLU A 1 36  ? 117.134 15.687  17.443 1.00 73.39  ? 339  GLU A CG  1 
ATOM   275  C CD  . GLU A 1 36  ? 118.216 14.652  17.211 1.00 75.81  ? 339  GLU A CD  1 
ATOM   276  O OE1 . GLU A 1 36  ? 118.030 13.763  16.349 1.00 78.34  ? 339  GLU A OE1 1 
ATOM   277  O OE2 . GLU A 1 36  ? 119.264 14.738  17.886 1.00 75.83  ? 339  GLU A OE2 1 
ATOM   278  N N   . ALA A 1 37  ? 116.906 19.481  19.295 1.00 64.65  ? 340  ALA A N   1 
ATOM   279  C CA  . ALA A 1 37  ? 117.059 19.691  20.725 1.00 62.71  ? 340  ALA A CA  1 
ATOM   280  C C   . ALA A 1 37  ? 116.256 20.905  21.179 1.00 61.42  ? 340  ALA A C   1 
ATOM   281  O O   . ALA A 1 37  ? 115.687 20.920  22.273 1.00 61.48  ? 340  ALA A O   1 
ATOM   282  C CB  . ALA A 1 37  ? 118.511 19.878  21.062 1.00 61.12  ? 340  ALA A CB  1 
ATOM   283  N N   . SER A 1 38  ? 116.222 21.927  20.335 1.00 59.50  ? 341  SER A N   1 
ATOM   284  C CA  . SER A 1 38  ? 115.489 23.140  20.642 1.00 56.99  ? 341  SER A CA  1 
ATOM   285  C C   . SER A 1 38  ? 114.029 22.780  20.875 1.00 56.00  ? 341  SER A C   1 
ATOM   286  O O   . SER A 1 38  ? 113.476 23.020  21.948 1.00 54.68  ? 341  SER A O   1 
ATOM   287  C CB  . SER A 1 38  ? 115.600 24.116  19.474 1.00 56.86  ? 341  SER A CB  1 
ATOM   288  O OG  . SER A 1 38  ? 114.790 25.253  19.693 1.00 57.89  ? 341  SER A OG  1 
ATOM   289  N N   . MET A 1 39  ? 113.414 22.187  19.857 1.00 55.05  ? 342  MET A N   1 
ATOM   290  C CA  . MET A 1 39  ? 112.014 21.800  19.940 1.00 52.72  ? 342  MET A CA  1 
ATOM   291  C C   . MET A 1 39  ? 111.846 20.795  21.044 1.00 50.10  ? 342  MET A C   1 
ATOM   292  O O   . MET A 1 39  ? 111.008 20.973  21.918 1.00 49.91  ? 342  MET A O   1 
ATOM   293  C CB  . MET A 1 39  ? 111.538 21.209  18.615 1.00 55.13  ? 342  MET A CB  1 
ATOM   294  C CG  . MET A 1 39  ? 110.068 20.820  18.594 1.00 57.61  ? 342  MET A CG  1 
ATOM   295  S SD  . MET A 1 39  ? 109.457 20.458  16.918 1.00 64.50  ? 342  MET A SD  1 
ATOM   296  C CE  . MET A 1 39  ? 110.090 18.748  16.636 1.00 61.58  ? 342  MET A CE  1 
ATOM   297  N N   . MET A 1 40  ? 112.648 19.739  21.011 1.00 47.61  ? 343  MET A N   1 
ATOM   298  C CA  . MET A 1 40  ? 112.559 18.733  22.049 1.00 46.69  ? 343  MET A CA  1 
ATOM   299  C C   . MET A 1 40  ? 112.325 19.449  23.370 1.00 45.97  ? 343  MET A C   1 
ATOM   300  O O   . MET A 1 40  ? 111.447 19.083  24.154 1.00 46.48  ? 343  MET A O   1 
ATOM   301  C CB  . MET A 1 40  ? 113.850 17.913  22.120 1.00 47.63  ? 343  MET A CB  1 
ATOM   302  C CG  . MET A 1 40  ? 113.744 16.568  21.445 1.00 48.94  ? 343  MET A CG  1 
ATOM   303  S SD  . MET A 1 40  ? 112.179 15.787  21.907 1.00 52.82  ? 343  MET A SD  1 
ATOM   304  C CE  . MET A 1 40  ? 111.254 16.075  20.421 1.00 52.56  ? 343  MET A CE  1 
ATOM   305  N N   . GLY A 1 41  ? 113.107 20.493  23.601 1.00 44.75  ? 344  GLY A N   1 
ATOM   306  C CA  . GLY A 1 41  ? 112.954 21.245  24.823 1.00 42.59  ? 344  GLY A CA  1 
ATOM   307  C C   . GLY A 1 41  ? 111.524 21.703  24.955 1.00 40.63  ? 344  GLY A C   1 
ATOM   308  O O   . GLY A 1 41  ? 110.792 21.223  25.806 1.00 39.47  ? 344  GLY A O   1 
ATOM   309  N N   . LEU A 1 42  ? 111.123 22.625  24.093 1.00 41.33  ? 345  LEU A N   1 
ATOM   310  C CA  . LEU A 1 42  ? 109.764 23.163  24.117 1.00 42.67  ? 345  LEU A CA  1 
ATOM   311  C C   . LEU A 1 42  ? 108.747 22.101  24.448 1.00 41.33  ? 345  LEU A C   1 
ATOM   312  O O   . LEU A 1 42  ? 107.883 22.297  25.306 1.00 40.71  ? 345  LEU A O   1 
ATOM   313  C CB  . LEU A 1 42  ? 109.402 23.783  22.759 1.00 45.86  ? 345  LEU A CB  1 
ATOM   314  C CG  . LEU A 1 42  ? 110.003 25.154  22.412 1.00 48.28  ? 345  LEU A CG  1 
ATOM   315  C CD1 . LEU A 1 42  ? 109.395 26.242  23.326 1.00 48.51  ? 345  LEU A CD1 1 
ATOM   316  C CD2 . LEU A 1 42  ? 111.533 25.089  22.555 1.00 48.60  ? 345  LEU A CD2 1 
ATOM   317  N N   . LEU A 1 43  ? 108.867 20.976  23.753 1.00 39.85  ? 346  LEU A N   1 
ATOM   318  C CA  . LEU A 1 43  ? 107.968 19.850  23.920 1.00 39.08  ? 346  LEU A CA  1 
ATOM   319  C C   . LEU A 1 43  ? 108.028 19.244  25.315 1.00 40.99  ? 346  LEU A C   1 
ATOM   320  O O   . LEU A 1 43  ? 107.024 19.258  26.047 1.00 41.15  ? 346  LEU A O   1 
ATOM   321  C CB  . LEU A 1 43  ? 108.289 18.789  22.874 1.00 37.71  ? 346  LEU A CB  1 
ATOM   322  C CG  . LEU A 1 43  ? 108.192 19.287  21.434 1.00 37.99  ? 346  LEU A CG  1 
ATOM   323  C CD1 . LEU A 1 43  ? 108.792 18.249  20.532 1.00 38.53  ? 346  LEU A CD1 1 
ATOM   324  C CD2 . LEU A 1 43  ? 106.747 19.583  21.039 1.00 36.18  ? 346  LEU A CD2 1 
ATOM   325  N N   . THR A 1 44  ? 109.200 18.715  25.678 1.00 41.43  ? 347  THR A N   1 
ATOM   326  C CA  . THR A 1 44  ? 109.394 18.090  26.988 1.00 41.84  ? 347  THR A CA  1 
ATOM   327  C C   . THR A 1 44  ? 109.051 19.079  28.094 1.00 40.94  ? 347  THR A C   1 
ATOM   328  O O   . THR A 1 44  ? 108.498 18.711  29.134 1.00 41.28  ? 347  THR A O   1 
ATOM   329  C CB  . THR A 1 44  ? 110.843 17.646  27.201 1.00 41.81  ? 347  THR A CB  1 
ATOM   330  O OG1 . THR A 1 44  ? 111.634 18.777  27.564 1.00 44.23  ? 347  THR A OG1 1 
ATOM   331  C CG2 . THR A 1 44  ? 111.401 17.050  25.944 1.00 41.78  ? 347  THR A CG2 1 
ATOM   332  N N   . ASN A 1 45  ? 109.393 20.337  27.860 1.00 40.12  ? 348  ASN A N   1 
ATOM   333  C CA  . ASN A 1 45  ? 109.113 21.373  28.822 1.00 40.12  ? 348  ASN A CA  1 
ATOM   334  C C   . ASN A 1 45  ? 107.602 21.507  28.984 1.00 40.36  ? 348  ASN A C   1 
ATOM   335  O O   . ASN A 1 45  ? 107.092 21.499  30.112 1.00 41.31  ? 348  ASN A O   1 
ATOM   336  C CB  . ASN A 1 45  ? 109.730 22.695  28.364 1.00 40.72  ? 348  ASN A CB  1 
ATOM   337  C CG  . ASN A 1 45  ? 109.423 23.834  29.310 1.00 41.82  ? 348  ASN A CG  1 
ATOM   338  O OD1 . ASN A 1 45  ? 108.302 24.360  29.336 1.00 42.55  ? 348  ASN A OD1 1 
ATOM   339  N ND2 . ASN A 1 45  ? 110.408 24.215  30.107 1.00 39.96  ? 348  ASN A ND2 1 
ATOM   340  N N   . LEU A 1 46  ? 106.877 21.611  27.871 1.00 39.57  ? 349  LEU A N   1 
ATOM   341  C CA  . LEU A 1 46  ? 105.425 21.746  27.956 1.00 39.17  ? 349  LEU A CA  1 
ATOM   342  C C   . LEU A 1 46  ? 104.899 20.572  28.744 1.00 38.70  ? 349  LEU A C   1 
ATOM   343  O O   . LEU A 1 46  ? 104.165 20.743  29.709 1.00 37.96  ? 349  LEU A O   1 
ATOM   344  C CB  . LEU A 1 46  ? 104.779 21.755  26.568 1.00 40.06  ? 349  LEU A CB  1 
ATOM   345  C CG  . LEU A 1 46  ? 103.265 22.022  26.581 1.00 40.23  ? 349  LEU A CG  1 
ATOM   346  C CD1 . LEU A 1 46  ? 103.007 23.397  27.173 1.00 40.06  ? 349  LEU A CD1 1 
ATOM   347  C CD2 . LEU A 1 46  ? 102.679 21.925  25.173 1.00 39.49  ? 349  LEU A CD2 1 
ATOM   348  N N   . ALA A 1 47  ? 105.309 19.378  28.327 1.00 39.50  ? 350  ALA A N   1 
ATOM   349  C CA  . ALA A 1 47  ? 104.911 18.129  28.971 1.00 39.31  ? 350  ALA A CA  1 
ATOM   350  C C   . ALA A 1 47  ? 105.040 18.229  30.467 1.00 39.49  ? 350  ALA A C   1 
ATOM   351  O O   . ALA A 1 47  ? 104.058 18.099  31.205 1.00 40.61  ? 350  ALA A O   1 
ATOM   352  C CB  . ALA A 1 47  ? 105.777 16.998  28.482 1.00 39.16  ? 350  ALA A CB  1 
ATOM   353  N N   . ASP A 1 48  ? 106.267 18.447  30.913 1.00 38.74  ? 351  ASP A N   1 
ATOM   354  C CA  . ASP A 1 48  ? 106.528 18.549  32.331 1.00 39.29  ? 351  ASP A CA  1 
ATOM   355  C C   . ASP A 1 48  ? 105.517 19.453  33.036 1.00 38.24  ? 351  ASP A C   1 
ATOM   356  O O   . ASP A 1 48  ? 104.875 19.056  34.012 1.00 35.65  ? 351  ASP A O   1 
ATOM   357  C CB  . ASP A 1 48  ? 107.952 19.062  32.563 1.00 41.23  ? 351  ASP A CB  1 
ATOM   358  C CG  . ASP A 1 48  ? 108.308 19.139  34.041 1.00 44.31  ? 351  ASP A CG  1 
ATOM   359  O OD1 . ASP A 1 48  ? 108.198 20.236  34.639 1.00 45.14  ? 351  ASP A OD1 1 
ATOM   360  O OD2 . ASP A 1 48  ? 108.677 18.090  34.614 1.00 44.92  ? 351  ASP A OD2 1 
ATOM   361  N N   . ARG A 1 49  ? 105.357 20.663  32.521 1.00 38.41  ? 352  ARG A N   1 
ATOM   362  C CA  . ARG A 1 49  ? 104.450 21.614  33.142 1.00 38.88  ? 352  ARG A CA  1 
ATOM   363  C C   . ARG A 1 49  ? 102.982 21.200  33.091 1.00 37.56  ? 352  ARG A C   1 
ATOM   364  O O   . ARG A 1 49  ? 102.229 21.465  34.026 1.00 37.40  ? 352  ARG A O   1 
ATOM   365  C CB  . ARG A 1 49  ? 104.660 22.993  32.519 1.00 39.85  ? 352  ARG A CB  1 
ATOM   366  C CG  . ARG A 1 49  ? 103.987 24.138  33.265 1.00 42.42  ? 352  ARG A CG  1 
ATOM   367  C CD  . ARG A 1 49  ? 104.675 25.457  32.942 1.00 44.04  ? 352  ARG A CD  1 
ATOM   368  N NE  . ARG A 1 49  ? 105.281 25.450  31.612 1.00 45.41  ? 352  ARG A NE  1 
ATOM   369  C CZ  . ARG A 1 49  ? 104.601 25.541  30.474 1.00 46.68  ? 352  ARG A CZ  1 
ATOM   370  N NH1 . ARG A 1 49  ? 103.281 25.656  30.499 1.00 45.15  ? 352  ARG A NH1 1 
ATOM   371  N NH2 . ARG A 1 49  ? 105.242 25.499  29.310 1.00 47.53  ? 352  ARG A NH2 1 
ATOM   372  N N   . GLU A 1 50  ? 102.572 20.545  32.014 1.00 37.21  ? 353  GLU A N   1 
ATOM   373  C CA  . GLU A 1 50  ? 101.185 20.099  31.900 1.00 37.46  ? 353  GLU A CA  1 
ATOM   374  C C   . GLU A 1 50  ? 100.904 19.034  32.952 1.00 38.19  ? 353  GLU A C   1 
ATOM   375  O O   . GLU A 1 50  ? 99.854  19.043  33.621 1.00 38.55  ? 353  GLU A O   1 
ATOM   376  C CB  . GLU A 1 50  ? 100.912 19.512  30.514 1.00 36.88  ? 353  GLU A CB  1 
ATOM   377  C CG  . GLU A 1 50  ? 100.940 20.521  29.407 1.00 38.78  ? 353  GLU A CG  1 
ATOM   378  C CD  . GLU A 1 50  ? 100.499 19.952  28.080 1.00 41.17  ? 353  GLU A CD  1 
ATOM   379  O OE1 . GLU A 1 50  ? 99.324  19.530  27.964 1.00 43.27  ? 353  GLU A OE1 1 
ATOM   380  O OE2 . GLU A 1 50  ? 101.330 19.933  27.148 1.00 42.08  ? 353  GLU A OE2 1 
ATOM   381  N N   . LEU A 1 51  ? 101.858 18.117  33.089 1.00 36.48  ? 354  LEU A N   1 
ATOM   382  C CA  . LEU A 1 51  ? 101.741 17.027  34.040 1.00 35.86  ? 354  LEU A CA  1 
ATOM   383  C C   . LEU A 1 51  ? 101.370 17.481  35.469 1.00 36.28  ? 354  LEU A C   1 
ATOM   384  O O   . LEU A 1 51  ? 100.727 16.739  36.224 1.00 36.64  ? 354  LEU A O   1 
ATOM   385  C CB  . LEU A 1 51  ? 103.045 16.212  34.050 1.00 35.04  ? 354  LEU A CB  1 
ATOM   386  C CG  . LEU A 1 51  ? 103.215 14.961  33.170 1.00 31.98  ? 354  LEU A CG  1 
ATOM   387  C CD1 . LEU A 1 51  ? 102.980 15.297  31.717 1.00 32.54  ? 354  LEU A CD1 1 
ATOM   388  C CD2 . LEU A 1 51  ? 104.614 14.403  33.359 1.00 30.59  ? 354  LEU A CD2 1 
ATOM   389  N N   . VAL A 1 52  ? 101.761 18.693  35.848 1.00 34.90  ? 355  VAL A N   1 
ATOM   390  C CA  . VAL A 1 52  ? 101.432 19.164  37.185 1.00 32.87  ? 355  VAL A CA  1 
ATOM   391  C C   . VAL A 1 52  ? 99.926  19.268  37.284 1.00 31.93  ? 355  VAL A C   1 
ATOM   392  O O   . VAL A 1 52  ? 99.323  18.890  38.279 1.00 31.22  ? 355  VAL A O   1 
ATOM   393  C CB  . VAL A 1 52  ? 102.034 20.563  37.491 1.00 32.17  ? 355  VAL A CB  1 
ATOM   394  C CG1 . VAL A 1 52  ? 101.684 20.963  38.907 1.00 33.20  ? 355  VAL A CG1 1 
ATOM   395  C CG2 . VAL A 1 52  ? 103.543 20.546  37.348 1.00 33.30  ? 355  VAL A CG2 1 
ATOM   396  N N   . HIS A 1 53  ? 99.305  19.774  36.235 1.00 33.02  ? 356  HIS A N   1 
ATOM   397  C CA  . HIS A 1 53  ? 97.869  19.935  36.273 1.00 34.96  ? 356  HIS A CA  1 
ATOM   398  C C   . HIS A 1 53  ? 97.189  18.603  36.143 1.00 34.17  ? 356  HIS A C   1 
ATOM   399  O O   . HIS A 1 53  ? 96.281  18.273  36.907 1.00 32.13  ? 356  HIS A O   1 
ATOM   400  C CB  . HIS A 1 53  ? 97.422  20.890  35.168 1.00 37.38  ? 356  HIS A CB  1 
ATOM   401  C CG  . HIS A 1 53  ? 98.027  22.250  35.291 1.00 41.22  ? 356  HIS A CG  1 
ATOM   402  N ND1 . HIS A 1 53  ? 99.263  22.566  34.765 1.00 42.98  ? 356  HIS A ND1 1 
ATOM   403  C CD2 . HIS A 1 53  ? 97.603  23.356  35.946 1.00 41.78  ? 356  HIS A CD2 1 
ATOM   404  C CE1 . HIS A 1 53  ? 99.574  23.807  35.090 1.00 42.12  ? 356  HIS A CE1 1 
ATOM   405  N NE2 . HIS A 1 53  ? 98.584  24.308  35.807 1.00 43.39  ? 356  HIS A NE2 1 
ATOM   406  N N   . MET A 1 54  ? 97.659  17.830  35.180 1.00 34.09  ? 357  MET A N   1 
ATOM   407  C CA  . MET A 1 54  ? 97.088  16.528  34.934 1.00 35.19  ? 357  MET A CA  1 
ATOM   408  C C   . MET A 1 54  ? 96.946  15.730  36.227 1.00 33.96  ? 357  MET A C   1 
ATOM   409  O O   . MET A 1 54  ? 96.001  14.948  36.397 1.00 33.14  ? 357  MET A O   1 
ATOM   410  C CB  . MET A 1 54  ? 97.956  15.763  33.946 1.00 36.86  ? 357  MET A CB  1 
ATOM   411  C CG  . MET A 1 54  ? 97.324  14.458  33.511 1.00 38.94  ? 357  MET A CG  1 
ATOM   412  S SD  . MET A 1 54  ? 98.599  13.279  33.126 1.00 40.50  ? 357  MET A SD  1 
ATOM   413  C CE  . MET A 1 54  ? 99.107  13.845  31.478 1.00 40.96  ? 357  MET A CE  1 
ATOM   414  N N   . ILE A 1 55  ? 97.881  15.922  37.144 1.00 32.00  ? 358  ILE A N   1 
ATOM   415  C CA  . ILE A 1 55  ? 97.803  15.197  38.391 1.00 31.43  ? 358  ILE A CA  1 
ATOM   416  C C   . ILE A 1 55  ? 96.666  15.746  39.210 1.00 31.07  ? 358  ILE A C   1 
ATOM   417  O O   . ILE A 1 55  ? 95.947  15.000  39.858 1.00 32.52  ? 358  ILE A O   1 
ATOM   418  C CB  . ILE A 1 55  ? 99.075  15.335  39.206 1.00 31.44  ? 358  ILE A CB  1 
ATOM   419  C CG1 . ILE A 1 55  ? 100.262 14.828  38.410 1.00 32.29  ? 358  ILE A CG1 1 
ATOM   420  C CG2 . ILE A 1 55  ? 98.974  14.524  40.456 1.00 32.39  ? 358  ILE A CG2 1 
ATOM   421  C CD1 . ILE A 1 55  ? 101.549 14.897  39.195 1.00 35.15  ? 358  ILE A CD1 1 
ATOM   422  N N   . ASN A 1 56  ? 96.501  17.060  39.195 1.00 32.04  ? 359  ASN A N   1 
ATOM   423  C CA  . ASN A 1 56  ? 95.428  17.651  39.973 1.00 32.56  ? 359  ASN A CA  1 
ATOM   424  C C   . ASN A 1 56  ? 94.114  17.302  39.328 1.00 30.84  ? 359  ASN A C   1 
ATOM   425  O O   . ASN A 1 56  ? 93.157  16.970  40.008 1.00 27.63  ? 359  ASN A O   1 
ATOM   426  C CB  . ASN A 1 56  ? 95.612  19.161  40.077 1.00 36.56  ? 359  ASN A CB  1 
ATOM   427  C CG  . ASN A 1 56  ? 96.776  19.532  40.971 1.00 39.68  ? 359  ASN A CG  1 
ATOM   428  O OD1 . ASN A 1 56  ? 97.912  19.676  40.510 1.00 41.80  ? 359  ASN A OD1 1 
ATOM   429  N ND2 . ASN A 1 56  ? 96.506  19.660  42.272 1.00 40.94  ? 359  ASN A ND2 1 
ATOM   430  N N   . TRP A 1 57  ? 94.088  17.375  38.003 1.00 31.58  ? 360  TRP A N   1 
ATOM   431  C CA  . TRP A 1 57  ? 92.909  17.019  37.242 1.00 33.85  ? 360  TRP A CA  1 
ATOM   432  C C   . TRP A 1 57  ? 92.502  15.635  37.712 1.00 35.53  ? 360  TRP A C   1 
ATOM   433  O O   . TRP A 1 57  ? 91.332  15.368  38.012 1.00 35.12  ? 360  TRP A O   1 
ATOM   434  C CB  . TRP A 1 57  ? 93.239  16.948  35.756 1.00 36.16  ? 360  TRP A CB  1 
ATOM   435  C CG  . TRP A 1 57  ? 92.213  16.169  34.965 1.00 40.06  ? 360  TRP A CG  1 
ATOM   436  C CD1 . TRP A 1 57  ? 90.935  16.561  34.659 1.00 40.84  ? 360  TRP A CD1 1 
ATOM   437  C CD2 . TRP A 1 57  ? 92.368  14.852  34.412 1.00 41.34  ? 360  TRP A CD2 1 
ATOM   438  N NE1 . TRP A 1 57  ? 90.286  15.570  33.952 1.00 41.16  ? 360  TRP A NE1 1 
ATOM   439  C CE2 . TRP A 1 57  ? 91.142  14.512  33.785 1.00 41.57  ? 360  TRP A CE2 1 
ATOM   440  C CE3 . TRP A 1 57  ? 93.421  13.927  34.383 1.00 41.22  ? 360  TRP A CE3 1 
ATOM   441  C CZ2 . TRP A 1 57  ? 90.944  13.289  33.140 1.00 40.21  ? 360  TRP A CZ2 1 
ATOM   442  C CZ3 . TRP A 1 57  ? 93.222  12.710  33.740 1.00 39.62  ? 360  TRP A CZ3 1 
ATOM   443  C CH2 . TRP A 1 57  ? 91.992  12.406  33.127 1.00 40.18  ? 360  TRP A CH2 1 
ATOM   444  N N   . ALA A 1 58  ? 93.500  14.755  37.766 1.00 37.20  ? 361  ALA A N   1 
ATOM   445  C CA  . ALA A 1 58  ? 93.304  13.372  38.187 1.00 36.19  ? 361  ALA A CA  1 
ATOM   446  C C   . ALA A 1 58  ? 92.387  13.283  39.391 1.00 34.72  ? 361  ALA A C   1 
ATOM   447  O O   . ALA A 1 58  ? 91.253  12.826  39.272 1.00 32.53  ? 361  ALA A O   1 
ATOM   448  C CB  . ALA A 1 58  ? 94.640  12.730  38.495 1.00 36.62  ? 361  ALA A CB  1 
ATOM   449  N N   . LYS A 1 59  ? 92.867  13.742  40.539 1.00 33.67  ? 362  LYS A N   1 
ATOM   450  C CA  . LYS A 1 59  ? 92.063  13.694  41.750 1.00 37.07  ? 362  LYS A CA  1 
ATOM   451  C C   . LYS A 1 59  ? 90.615  14.123  41.520 1.00 37.72  ? 362  LYS A C   1 
ATOM   452  O O   . LYS A 1 59  ? 89.700  13.592  42.162 1.00 36.80  ? 362  LYS A O   1 
ATOM   453  C CB  . LYS A 1 59  ? 92.704  14.551  42.848 1.00 38.56  ? 362  LYS A CB  1 
ATOM   454  C CG  . LYS A 1 59  ? 93.640  13.783  43.815 1.00 44.06  ? 362  LYS A CG  1 
ATOM   455  C CD  . LYS A 1 59  ? 94.820  13.011  43.130 1.00 46.08  ? 362  LYS A CD  1 
ATOM   456  C CE  . LYS A 1 59  ? 95.568  12.113  44.161 1.00 47.19  ? 362  LYS A CE  1 
ATOM   457  N NZ  . LYS A 1 59  ? 96.533  11.080  43.625 1.00 45.65  ? 362  LYS A NZ  1 
ATOM   458  N N   . ARG A 1 60  ? 90.412  15.055  40.586 1.00 39.16  ? 363  ARG A N   1 
ATOM   459  C CA  . ARG A 1 60  ? 89.073  15.576  40.270 1.00 40.96  ? 363  ARG A CA  1 
ATOM   460  C C   . ARG A 1 60  ? 88.136  14.567  39.572 1.00 40.89  ? 363  ARG A C   1 
ATOM   461  O O   . ARG A 1 60  ? 86.923  14.769  39.510 1.00 40.04  ? 363  ARG A O   1 
ATOM   462  C CB  . ARG A 1 60  ? 89.187  16.866  39.434 1.00 41.88  ? 363  ARG A CB  1 
ATOM   463  C CG  . ARG A 1 60  ? 89.396  18.167  40.238 1.00 43.36  ? 363  ARG A CG  1 
ATOM   464  C CD  . ARG A 1 60  ? 89.831  19.343  39.324 1.00 46.89  ? 363  ARG A CD  1 
ATOM   465  N NE  . ARG A 1 60  ? 91.293  19.438  39.187 1.00 51.52  ? 363  ARG A NE  1 
ATOM   466  C CZ  . ARG A 1 60  ? 91.942  19.973  38.148 1.00 52.36  ? 363  ARG A CZ  1 
ATOM   467  N NH1 . ARG A 1 60  ? 91.276  20.478  37.117 1.00 54.60  ? 363  ARG A NH1 1 
ATOM   468  N NH2 . ARG A 1 60  ? 93.270  19.996  38.131 1.00 51.30  ? 363  ARG A NH2 1 
ATOM   469  N N   . VAL A 1 61  ? 88.691  13.480  39.051 1.00 40.19  ? 364  VAL A N   1 
ATOM   470  C CA  . VAL A 1 61  ? 87.867  12.464  38.408 1.00 38.80  ? 364  VAL A CA  1 
ATOM   471  C C   . VAL A 1 61  ? 87.106  11.702  39.488 1.00 39.57  ? 364  VAL A C   1 
ATOM   472  O O   . VAL A 1 61  ? 87.605  11.553  40.609 1.00 41.08  ? 364  VAL A O   1 
ATOM   473  C CB  . VAL A 1 61  ? 88.725  11.472  37.648 1.00 38.25  ? 364  VAL A CB  1 
ATOM   474  C CG1 . VAL A 1 61  ? 87.851  10.389  37.080 1.00 36.70  ? 364  VAL A CG1 1 
ATOM   475  C CG2 . VAL A 1 61  ? 89.503  12.188  36.551 1.00 36.58  ? 364  VAL A CG2 1 
ATOM   476  N N   . PRO A 1 62  ? 85.883  11.223  39.180 1.00 39.28  ? 365  PRO A N   1 
ATOM   477  C CA  . PRO A 1 62  ? 85.091  10.481  40.171 1.00 38.59  ? 365  PRO A CA  1 
ATOM   478  C C   . PRO A 1 62  ? 85.634  9.095   40.416 1.00 37.94  ? 365  PRO A C   1 
ATOM   479  O O   . PRO A 1 62  ? 86.171  8.476   39.511 1.00 36.87  ? 365  PRO A O   1 
ATOM   480  C CB  . PRO A 1 62  ? 83.702  10.436  39.548 1.00 37.22  ? 365  PRO A CB  1 
ATOM   481  C CG  . PRO A 1 62  ? 83.668  11.667  38.743 1.00 38.43  ? 365  PRO A CG  1 
ATOM   482  C CD  . PRO A 1 62  ? 85.017  11.661  38.079 1.00 38.72  ? 365  PRO A CD  1 
ATOM   483  N N   . GLY A 1 63  ? 85.499  8.613   41.645 1.00 37.82  ? 366  GLY A N   1 
ATOM   484  C CA  . GLY A 1 63  ? 85.983  7.284   41.951 1.00 37.66  ? 366  GLY A CA  1 
ATOM   485  C C   . GLY A 1 63  ? 87.490  7.167   41.935 1.00 37.56  ? 366  GLY A C   1 
ATOM   486  O O   . GLY A 1 63  ? 88.036  6.165   42.374 1.00 39.56  ? 366  GLY A O   1 
ATOM   487  N N   . PHE A 1 64  ? 88.177  8.183   41.438 1.00 36.17  ? 367  PHE A N   1 
ATOM   488  C CA  . PHE A 1 64  ? 89.621  8.121   41.406 1.00 35.41  ? 367  PHE A CA  1 
ATOM   489  C C   . PHE A 1 64  ? 90.237  8.276   42.803 1.00 37.29  ? 367  PHE A C   1 
ATOM   490  O O   . PHE A 1 64  ? 91.277  7.679   43.106 1.00 39.92  ? 367  PHE A O   1 
ATOM   491  C CB  . PHE A 1 64  ? 90.179  9.188   40.479 1.00 33.34  ? 367  PHE A CB  1 
ATOM   492  C CG  . PHE A 1 64  ? 91.634  9.029   40.212 1.00 33.42  ? 367  PHE A CG  1 
ATOM   493  C CD1 . PHE A 1 64  ? 92.083  8.094   39.296 1.00 34.88  ? 367  PHE A CD1 1 
ATOM   494  C CD2 . PHE A 1 64  ? 92.566  9.794   40.896 1.00 35.81  ? 367  PHE A CD2 1 
ATOM   495  C CE1 . PHE A 1 64  ? 93.447  7.922   39.061 1.00 36.29  ? 367  PHE A CE1 1 
ATOM   496  C CE2 . PHE A 1 64  ? 93.936  9.633   40.672 1.00 36.60  ? 367  PHE A CE2 1 
ATOM   497  C CZ  . PHE A 1 64  ? 94.375  8.698   39.754 1.00 36.04  ? 367  PHE A CZ  1 
ATOM   498  N N   . VAL A 1 65  ? 89.612  9.069   43.665 1.00 36.23  ? 368  VAL A N   1 
ATOM   499  C CA  . VAL A 1 65  ? 90.157  9.247   45.008 1.00 34.99  ? 368  VAL A CA  1 
ATOM   500  C C   . VAL A 1 65  ? 89.796  8.042   45.848 1.00 35.28  ? 368  VAL A C   1 
ATOM   501  O O   . VAL A 1 65  ? 90.356  7.826   46.922 1.00 37.56  ? 368  VAL A O   1 
ATOM   502  C CB  . VAL A 1 65  ? 89.577  10.486  45.719 1.00 34.11  ? 368  VAL A CB  1 
ATOM   503  C CG1 . VAL A 1 65  ? 89.750  11.714  44.854 1.00 35.83  ? 368  VAL A CG1 1 
ATOM   504  C CG2 . VAL A 1 65  ? 88.115  10.251  46.063 1.00 32.45  ? 368  VAL A CG2 1 
ATOM   505  N N   . ASP A 1 66  ? 88.846  7.264   45.353 1.00 33.45  ? 369  ASP A N   1 
ATOM   506  C CA  . ASP A 1 66  ? 88.378  6.095   46.061 1.00 31.30  ? 369  ASP A CA  1 
ATOM   507  C C   . ASP A 1 66  ? 89.328  4.921   45.917 1.00 29.28  ? 369  ASP A C   1 
ATOM   508  O O   . ASP A 1 66  ? 89.208  3.924   46.610 1.00 28.88  ? 369  ASP A O   1 
ATOM   509  C CB  . ASP A 1 66  ? 86.989  5.721   45.551 1.00 35.85  ? 369  ASP A CB  1 
ATOM   510  C CG  . ASP A 1 66  ? 86.004  6.887   45.610 1.00 36.76  ? 369  ASP A CG  1 
ATOM   511  O OD1 . ASP A 1 66  ? 85.750  7.406   46.723 1.00 35.17  ? 369  ASP A OD1 1 
ATOM   512  O OD2 . ASP A 1 66  ? 85.484  7.274   44.537 1.00 37.86  ? 369  ASP A OD2 1 
ATOM   513  N N   . LEU A 1 67  ? 90.278  5.026   45.007 1.00 29.18  ? 370  LEU A N   1 
ATOM   514  C CA  . LEU A 1 67  ? 91.243  3.949   44.839 1.00 28.74  ? 370  LEU A CA  1 
ATOM   515  C C   . LEU A 1 67  ? 92.309  4.107   45.910 1.00 27.81  ? 370  LEU A C   1 
ATOM   516  O O   . LEU A 1 67  ? 92.348  5.115   46.592 1.00 27.86  ? 370  LEU A O   1 
ATOM   517  C CB  . LEU A 1 67  ? 91.867  4.024   43.446 1.00 27.53  ? 370  LEU A CB  1 
ATOM   518  C CG  . LEU A 1 67  ? 90.902  3.669   42.318 1.00 27.77  ? 370  LEU A CG  1 
ATOM   519  C CD1 . LEU A 1 67  ? 91.590  3.857   41.000 1.00 31.03  ? 370  LEU A CD1 1 
ATOM   520  C CD2 . LEU A 1 67  ? 90.440  2.230   42.440 1.00 28.31  ? 370  LEU A CD2 1 
ATOM   521  N N   . THR A 1 68  ? 93.162  3.113   46.098 1.00 29.09  ? 371  THR A N   1 
ATOM   522  C CA  . THR A 1 68  ? 94.213  3.287   47.100 1.00 29.66  ? 371  THR A CA  1 
ATOM   523  C C   . THR A 1 68  ? 95.092  4.396   46.544 1.00 28.04  ? 371  THR A C   1 
ATOM   524  O O   . THR A 1 68  ? 95.052  4.679   45.351 1.00 24.26  ? 371  THR A O   1 
ATOM   525  C CB  . THR A 1 68  ? 95.070  2.008   47.297 1.00 29.95  ? 371  THR A CB  1 
ATOM   526  O OG1 . THR A 1 68  ? 95.411  1.462   46.018 1.00 31.79  ? 371  THR A OG1 1 
ATOM   527  C CG2 . THR A 1 68  ? 94.320  0.977   48.101 1.00 27.97  ? 371  THR A CG2 1 
ATOM   528  N N   . LEU A 1 69  ? 95.877  5.031   47.401 1.00 28.77  ? 372  LEU A N   1 
ATOM   529  C CA  . LEU A 1 69  ? 96.740  6.106   46.931 1.00 30.71  ? 372  LEU A CA  1 
ATOM   530  C C   . LEU A 1 69  ? 97.825  5.594   45.983 1.00 30.77  ? 372  LEU A C   1 
ATOM   531  O O   . LEU A 1 69  ? 98.077  6.188   44.934 1.00 30.51  ? 372  LEU A O   1 
ATOM   532  C CB  . LEU A 1 69  ? 97.342  6.846   48.127 1.00 32.31  ? 372  LEU A CB  1 
ATOM   533  C CG  . LEU A 1 69  ? 96.214  7.370   49.043 1.00 35.01  ? 372  LEU A CG  1 
ATOM   534  C CD1 . LEU A 1 69  ? 96.777  8.214   50.195 1.00 33.94  ? 372  LEU A CD1 1 
ATOM   535  C CD2 . LEU A 1 69  ? 95.225  8.190   48.200 1.00 34.51  ? 372  LEU A CD2 1 
ATOM   536  N N   . HIS A 1 70  ? 98.451  4.472   46.314 1.00 30.21  ? 373  HIS A N   1 
ATOM   537  C CA  . HIS A 1 70  ? 99.468  3.967   45.424 1.00 28.52  ? 373  HIS A CA  1 
ATOM   538  C C   . HIS A 1 70  ? 98.870  3.602   44.094 1.00 28.04  ? 373  HIS A C   1 
ATOM   539  O O   . HIS A 1 70  ? 99.480  3.847   43.061 1.00 29.03  ? 373  HIS A O   1 
ATOM   540  C CB  . HIS A 1 70  ? 100.187 2.763   46.019 1.00 30.17  ? 373  HIS A CB  1 
ATOM   541  C CG  . HIS A 1 70  ? 101.375 3.129   46.851 1.00 31.81  ? 373  HIS A CG  1 
ATOM   542  N ND1 . HIS A 1 70  ? 101.346 3.144   48.229 1.00 31.28  ? 373  HIS A ND1 1 
ATOM   543  C CD2 . HIS A 1 70  ? 102.616 3.539   46.496 1.00 33.26  ? 373  HIS A CD2 1 
ATOM   544  C CE1 . HIS A 1 70  ? 102.515 3.549   48.689 1.00 32.02  ? 373  HIS A CE1 1 
ATOM   545  N NE2 . HIS A 1 70  ? 103.303 3.795   47.658 1.00 35.78  ? 373  HIS A NE2 1 
ATOM   546  N N   . ASP A 1 71  ? 97.673  3.032   44.094 1.00 27.17  ? 374  ASP A N   1 
ATOM   547  C CA  . ASP A 1 71  ? 97.079  2.650   42.822 1.00 28.29  ? 374  ASP A CA  1 
ATOM   548  C C   . ASP A 1 71  ? 96.860  3.829   41.899 1.00 27.67  ? 374  ASP A C   1 
ATOM   549  O O   . ASP A 1 71  ? 97.094  3.740   40.691 1.00 27.26  ? 374  ASP A O   1 
ATOM   550  C CB  . ASP A 1 71  ? 95.790  1.891   43.053 1.00 30.64  ? 374  ASP A CB  1 
ATOM   551  C CG  . ASP A 1 71  ? 96.049  0.441   43.415 1.00 34.64  ? 374  ASP A CG  1 
ATOM   552  O OD1 . ASP A 1 71  ? 95.105  -0.225  43.892 1.00 36.93  ? 374  ASP A OD1 1 
ATOM   553  O OD2 . ASP A 1 71  ? 97.196  -0.037  43.213 1.00 33.78  ? 374  ASP A OD2 1 
ATOM   554  N N   . GLN A 1 72  ? 96.439  4.948   42.470 1.00 26.91  ? 375  GLN A N   1 
ATOM   555  C CA  . GLN A 1 72  ? 96.233  6.145   41.687 1.00 24.84  ? 375  GLN A CA  1 
ATOM   556  C C   . GLN A 1 72  ? 97.541  6.546   41.076 1.00 23.12  ? 375  GLN A C   1 
ATOM   557  O O   . GLN A 1 72  ? 97.604  6.872   39.899 1.00 22.00  ? 375  GLN A O   1 
ATOM   558  C CB  . GLN A 1 72  ? 95.771  7.274   42.557 1.00 27.52  ? 375  GLN A CB  1 
ATOM   559  C CG  . GLN A 1 72  ? 94.433  7.077   43.135 1.00 33.13  ? 375  GLN A CG  1 
ATOM   560  C CD  . GLN A 1 72  ? 94.271  7.975   44.304 1.00 36.58  ? 375  GLN A CD  1 
ATOM   561  O OE1 . GLN A 1 72  ? 94.687  9.139   44.253 1.00 38.90  ? 375  GLN A OE1 1 
ATOM   562  N NE2 . GLN A 1 72  ? 93.678  7.459   45.379 1.00 37.20  ? 375  GLN A NE2 1 
ATOM   563  N N   . VAL A 1 73  ? 98.599  6.556   41.874 1.00 21.48  ? 376  VAL A N   1 
ATOM   564  C CA  . VAL A 1 73  ? 99.878  6.925   41.299 1.00 21.31  ? 376  VAL A CA  1 
ATOM   565  C C   . VAL A 1 73  ? 100.128 5.950   40.156 1.00 22.09  ? 376  VAL A C   1 
ATOM   566  O O   . VAL A 1 73  ? 100.620 6.323   39.088 1.00 18.41  ? 376  VAL A O   1 
ATOM   567  C CB  . VAL A 1 73  ? 101.025 6.798   42.296 1.00 20.68  ? 376  VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 73  ? 102.265 7.425   41.711 1.00 22.70  ? 376  VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 73  ? 100.674 7.472   43.588 1.00 21.94  ? 376  VAL A CG2 1 
ATOM   570  N N   . HIS A 1 74  ? 99.753  4.692   40.383 1.00 24.46  ? 377  HIS A N   1 
ATOM   571  C CA  . HIS A 1 74  ? 99.953  3.669   39.380 1.00 26.40  ? 377  HIS A CA  1 
ATOM   572  C C   . HIS A 1 74  ? 99.197  3.998   38.109 1.00 26.31  ? 377  HIS A C   1 
ATOM   573  O O   . HIS A 1 74  ? 99.796  4.056   37.032 1.00 26.62  ? 377  HIS A O   1 
ATOM   574  C CB  . HIS A 1 74  ? 99.540  2.293   39.905 1.00 31.01  ? 377  HIS A CB  1 
ATOM   575  C CG  . HIS A 1 74  ? 99.796  1.205   38.921 1.00 33.32  ? 377  HIS A CG  1 
ATOM   576  N ND1 . HIS A 1 74  ? 101.051 0.975   38.400 1.00 34.93  ? 377  HIS A ND1 1 
ATOM   577  C CD2 . HIS A 1 74  ? 98.945  0.427   38.213 1.00 34.71  ? 377  HIS A CD2 1 
ATOM   578  C CE1 . HIS A 1 74  ? 100.960 0.116   37.400 1.00 36.44  ? 377  HIS A CE1 1 
ATOM   579  N NE2 . HIS A 1 74  ? 99.693  -0.231  37.263 1.00 37.38  ? 377  HIS A NE2 1 
ATOM   580  N N   . LEU A 1 75  ? 97.890  4.220   38.223 1.00 26.08  ? 378  LEU A N   1 
ATOM   581  C CA  . LEU A 1 75  ? 97.091  4.572   37.046 1.00 27.34  ? 378  LEU A CA  1 
ATOM   582  C C   . LEU A 1 75  ? 97.603  5.836   36.387 1.00 26.75  ? 378  LEU A C   1 
ATOM   583  O O   . LEU A 1 75  ? 97.781  5.902   35.176 1.00 28.54  ? 378  LEU A O   1 
ATOM   584  C CB  . LEU A 1 75  ? 95.622  4.807   37.404 1.00 28.00  ? 378  LEU A CB  1 
ATOM   585  C CG  . LEU A 1 75  ? 94.709  3.607   37.611 1.00 28.07  ? 378  LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 75  ? 94.577  3.319   39.077 1.00 28.30  ? 378  LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 75  ? 93.360  3.913   37.034 1.00 28.68  ? 378  LEU A CD2 1 
ATOM   588  N N   . LEU A 1 76  ? 97.827  6.850   37.198 1.00 26.90  ? 379  LEU A N   1 
ATOM   589  C CA  . LEU A 1 76  ? 98.297  8.111   36.690 1.00 28.02  ? 379  LEU A CA  1 
ATOM   590  C C   . LEU A 1 76  ? 99.599  7.948   35.917 1.00 29.34  ? 379  LEU A C   1 
ATOM   591  O O   . LEU A 1 76  ? 99.751  8.513   34.848 1.00 29.62  ? 379  LEU A O   1 
ATOM   592  C CB  . LEU A 1 76  ? 98.477  9.088   37.842 1.00 27.75  ? 379  LEU A CB  1 
ATOM   593  C CG  . LEU A 1 76  ? 98.091  10.512  37.463 1.00 28.42  ? 379  LEU A CG  1 
ATOM   594  C CD1 . LEU A 1 76  ? 98.222  11.451  38.667 1.00 25.03  ? 379  LEU A CD1 1 
ATOM   595  C CD2 . LEU A 1 76  ? 98.970  10.957  36.306 1.00 28.05  ? 379  LEU A CD2 1 
ATOM   596  N N   . GLU A 1 77  ? 100.536 7.167   36.435 1.00 30.69  ? 380  GLU A N   1 
ATOM   597  C CA  . GLU A 1 77  ? 101.798 6.997   35.726 1.00 33.73  ? 380  GLU A CA  1 
ATOM   598  C C   . GLU A 1 77  ? 101.762 5.915   34.649 1.00 33.03  ? 380  GLU A C   1 
ATOM   599  O O   . GLU A 1 77  ? 102.753 5.689   33.952 1.00 33.56  ? 380  GLU A O   1 
ATOM   600  C CB  . GLU A 1 77  ? 102.932 6.707   36.713 1.00 37.10  ? 380  GLU A CB  1 
ATOM   601  C CG  . GLU A 1 77  ? 102.744 5.413   37.474 1.00 43.85  ? 380  GLU A CG  1 
ATOM   602  C CD  . GLU A 1 77  ? 103.756 5.225   38.583 1.00 45.51  ? 380  GLU A CD  1 
ATOM   603  O OE1 . GLU A 1 77  ? 103.715 4.156   39.240 1.00 48.14  ? 380  GLU A OE1 1 
ATOM   604  O OE2 . GLU A 1 77  ? 104.580 6.143   38.792 1.00 44.68  ? 380  GLU A OE2 1 
ATOM   605  N N   . CYS A 1 78  ? 100.642 5.228   34.501 1.00 30.49  ? 381  CYS A N   1 
ATOM   606  C CA  . CYS A 1 78  ? 100.605 4.231   33.464 1.00 30.59  ? 381  CYS A CA  1 
ATOM   607  C C   . CYS A 1 78  ? 99.992  4.849   32.197 1.00 28.61  ? 381  CYS A C   1 
ATOM   608  O O   . CYS A 1 78  ? 100.325 4.470   31.087 1.00 27.37  ? 381  CYS A O   1 
ATOM   609  C CB  . CYS A 1 78  ? 99.817  2.994   33.934 1.00 32.25  ? 381  CYS A CB  1 
ATOM   610  S SG  . CYS A 1 78  ? 99.755  1.633   32.682 1.00 43.79  ? 381  CYS A SG  1 
ATOM   611  N N   . ALA A 1 79  ? 99.139  5.850   32.371 1.00 27.91  ? 382  ALA A N   1 
ATOM   612  C CA  . ALA A 1 79  ? 98.455  6.470   31.239 1.00 26.68  ? 382  ALA A CA  1 
ATOM   613  C C   . ALA A 1 79  ? 98.812  7.900   30.800 1.00 24.35  ? 382  ALA A C   1 
ATOM   614  O O   . ALA A 1 79  ? 98.362  8.350   29.758 1.00 21.05  ? 382  ALA A O   1 
ATOM   615  C CB  . ALA A 1 79  ? 96.955  6.392   31.485 1.00 28.77  ? 382  ALA A CB  1 
ATOM   616  N N   . TRP A 1 80  ? 99.618  8.611   31.570 1.00 25.31  ? 383  TRP A N   1 
ATOM   617  C CA  . TRP A 1 80  ? 99.970  9.990   31.228 1.00 26.93  ? 383  TRP A CA  1 
ATOM   618  C C   . TRP A 1 80  ? 100.269 10.341  29.753 1.00 25.99  ? 383  TRP A C   1 
ATOM   619  O O   . TRP A 1 80  ? 99.550  11.143  29.141 1.00 26.57  ? 383  TRP A O   1 
ATOM   620  C CB  . TRP A 1 80  ? 101.147 10.468  32.082 1.00 28.47  ? 383  TRP A CB  1 
ATOM   621  C CG  . TRP A 1 80  ? 102.459 9.913   31.678 1.00 33.12  ? 383  TRP A CG  1 
ATOM   622  C CD1 . TRP A 1 80  ? 102.965 8.691   31.997 1.00 35.42  ? 383  TRP A CD1 1 
ATOM   623  C CD2 . TRP A 1 80  ? 103.465 10.575  30.898 1.00 35.70  ? 383  TRP A CD2 1 
ATOM   624  N NE1 . TRP A 1 80  ? 104.229 8.550   31.472 1.00 37.44  ? 383  TRP A NE1 1 
ATOM   625  C CE2 . TRP A 1 80  ? 104.559 9.693   30.793 1.00 37.05  ? 383  TRP A CE2 1 
ATOM   626  C CE3 . TRP A 1 80  ? 103.548 11.831  30.282 1.00 36.95  ? 383  TRP A CE3 1 
ATOM   627  C CZ2 . TRP A 1 80  ? 105.723 10.023  30.098 1.00 37.63  ? 383  TRP A CZ2 1 
ATOM   628  C CZ3 . TRP A 1 80  ? 104.705 12.160  29.594 1.00 36.15  ? 383  TRP A CZ3 1 
ATOM   629  C CH2 . TRP A 1 80  ? 105.777 11.258  29.509 1.00 37.41  ? 383  TRP A CH2 1 
ATOM   630  N N   . LEU A 1 81  ? 101.322 9.767   29.181 1.00 21.37  ? 384  LEU A N   1 
ATOM   631  C CA  . LEU A 1 81  ? 101.650 10.111  27.818 1.00 19.20  ? 384  LEU A CA  1 
ATOM   632  C C   . LEU A 1 81  ? 100.445 10.018  26.915 1.00 17.73  ? 384  LEU A C   1 
ATOM   633  O O   . LEU A 1 81  ? 100.364 10.739  25.933 1.00 15.05  ? 384  LEU A O   1 
ATOM   634  C CB  . LEU A 1 81  ? 102.789 9.243   27.278 1.00 19.45  ? 384  LEU A CB  1 
ATOM   635  C CG  . LEU A 1 81  ? 103.287 9.708   25.895 1.00 19.87  ? 384  LEU A CG  1 
ATOM   636  C CD1 . LEU A 1 81  ? 103.551 11.228  25.870 1.00 18.90  ? 384  LEU A CD1 1 
ATOM   637  C CD2 . LEU A 1 81  ? 104.536 8.936   25.531 1.00 18.99  ? 384  LEU A CD2 1 
ATOM   638  N N   . GLU A 1 82  ? 99.515  9.119   27.232 1.00 19.50  ? 385  GLU A N   1 
ATOM   639  C CA  . GLU A 1 82  ? 98.299  8.998   26.436 1.00 19.12  ? 385  GLU A CA  1 
ATOM   640  C C   . GLU A 1 82  ? 97.492  10.263  26.688 1.00 20.69  ? 385  GLU A C   1 
ATOM   641  O O   . GLU A 1 82  ? 97.031  10.919  25.763 1.00 20.27  ? 385  GLU A O   1 
ATOM   642  C CB  . GLU A 1 82  ? 97.476  7.812   26.875 1.00 17.83  ? 385  GLU A CB  1 
ATOM   643  C CG  . GLU A 1 82  ? 98.167  6.510   26.740 1.00 23.52  ? 385  GLU A CG  1 
ATOM   644  C CD  . GLU A 1 82  ? 97.200  5.343   26.823 1.00 26.97  ? 385  GLU A CD  1 
ATOM   645  O OE1 . GLU A 1 82  ? 96.275  5.291   25.984 1.00 28.72  ? 385  GLU A OE1 1 
ATOM   646  O OE2 . GLU A 1 82  ? 97.367  4.484   27.719 1.00 26.47  ? 385  GLU A OE2 1 
ATOM   647  N N   . ILE A 1 83  ? 97.334  10.609  27.960 1.00 20.65  ? 386  ILE A N   1 
ATOM   648  C CA  . ILE A 1 83  ? 96.604  11.798  28.335 1.00 21.03  ? 386  ILE A CA  1 
ATOM   649  C C   . ILE A 1 83  ? 97.171  13.056  27.693 1.00 23.75  ? 386  ILE A C   1 
ATOM   650  O O   . ILE A 1 83  ? 96.445  13.962  27.304 1.00 26.13  ? 386  ILE A O   1 
ATOM   651  C CB  . ILE A 1 83  ? 96.620  11.959  29.813 1.00 19.13  ? 386  ILE A CB  1 
ATOM   652  C CG1 . ILE A 1 83  ? 95.849  10.805  30.432 1.00 18.47  ? 386  ILE A CG1 1 
ATOM   653  C CG2 . ILE A 1 83  ? 96.031  13.296  30.192 1.00 20.05  ? 386  ILE A CG2 1 
ATOM   654  C CD1 . ILE A 1 83  ? 95.645  10.961  31.891 1.00 18.45  ? 386  ILE A CD1 1 
ATOM   655  N N   . LEU A 1 84  ? 98.477  13.134  27.587 1.00 25.23  ? 387  LEU A N   1 
ATOM   656  C CA  . LEU A 1 84  ? 99.023  14.301  26.958 1.00 25.53  ? 387  LEU A CA  1 
ATOM   657  C C   . LEU A 1 84  ? 98.533  14.249  25.522 1.00 26.83  ? 387  LEU A C   1 
ATOM   658  O O   . LEU A 1 84  ? 97.941  15.200  25.035 1.00 29.08  ? 387  LEU A O   1 
ATOM   659  C CB  . LEU A 1 84  ? 100.552 14.272  27.016 1.00 24.03  ? 387  LEU A CB  1 
ATOM   660  C CG  . LEU A 1 84  ? 101.100 14.483  28.424 1.00 23.34  ? 387  LEU A CG  1 
ATOM   661  C CD1 . LEU A 1 84  ? 102.611 14.453  28.425 1.00 23.51  ? 387  LEU A CD1 1 
ATOM   662  C CD2 . LEU A 1 84  ? 100.595 15.810  28.932 1.00 20.68  ? 387  LEU A CD2 1 
ATOM   663  N N   . MET A 1 85  ? 98.744  13.114  24.864 1.00 27.85  ? 388  MET A N   1 
ATOM   664  C CA  . MET A 1 85  ? 98.372  12.952  23.460 1.00 28.81  ? 388  MET A CA  1 
ATOM   665  C C   . MET A 1 85  ? 96.903  13.080  23.132 1.00 29.99  ? 388  MET A C   1 
ATOM   666  O O   . MET A 1 85  ? 96.564  13.689  22.127 1.00 31.85  ? 388  MET A O   1 
ATOM   667  C CB  . MET A 1 85  ? 98.890  11.620  22.907 1.00 29.63  ? 388  MET A CB  1 
ATOM   668  C CG  . MET A 1 85  ? 100.373 11.601  22.596 1.00 31.66  ? 388  MET A CG  1 
ATOM   669  S SD  . MET A 1 85  ? 101.106 9.955   22.715 1.00 34.84  ? 388  MET A SD  1 
ATOM   670  C CE  . MET A 1 85  ? 101.878 9.795   21.148 1.00 33.84  ? 388  MET A CE  1 
ATOM   671  N N   . ILE A 1 86  ? 96.013  12.509  23.937 1.00 31.25  ? 389  ILE A N   1 
ATOM   672  C CA  . ILE A 1 86  ? 94.593  12.648  23.607 1.00 29.77  ? 389  ILE A CA  1 
ATOM   673  C C   . ILE A 1 86  ? 94.246  14.122  23.737 1.00 29.70  ? 389  ILE A C   1 
ATOM   674  O O   . ILE A 1 86  ? 93.356  14.622  23.047 1.00 30.71  ? 389  ILE A O   1 
ATOM   675  C CB  . ILE A 1 86  ? 93.670  11.823  24.519 1.00 29.08  ? 389  ILE A CB  1 
ATOM   676  C CG1 . ILE A 1 86  ? 92.230  11.986  24.027 1.00 27.82  ? 389  ILE A CG1 1 
ATOM   677  C CG2 . ILE A 1 86  ? 93.841  12.244  25.969 1.00 25.95  ? 389  ILE A CG2 1 
ATOM   678  C CD1 . ILE A 1 86  ? 91.212  11.199  24.813 1.00 30.92  ? 389  ILE A CD1 1 
ATOM   679  N N   . GLY A 1 87  ? 94.962  14.814  24.621 1.00 27.24  ? 390  GLY A N   1 
ATOM   680  C CA  . GLY A 1 87  ? 94.741  16.231  24.770 1.00 25.98  ? 390  GLY A CA  1 
ATOM   681  C C   . GLY A 1 87  ? 95.172  16.878  23.468 1.00 26.91  ? 390  GLY A C   1 
ATOM   682  O O   . GLY A 1 87  ? 94.377  17.499  22.792 1.00 28.46  ? 390  GLY A O   1 
ATOM   683  N N   . LEU A 1 88  ? 96.427  16.681  23.088 1.00 27.81  ? 391  LEU A N   1 
ATOM   684  C CA  . LEU A 1 88  ? 96.974  17.271  21.871 1.00 28.85  ? 391  LEU A CA  1 
ATOM   685  C C   . LEU A 1 88  ? 96.100  17.129  20.651 1.00 30.49  ? 391  LEU A C   1 
ATOM   686  O O   . LEU A 1 88  ? 95.837  18.096  19.944 1.00 32.03  ? 391  LEU A O   1 
ATOM   687  C CB  . LEU A 1 88  ? 98.333  16.665  21.541 1.00 27.41  ? 391  LEU A CB  1 
ATOM   688  C CG  . LEU A 1 88  ? 98.963  17.385  20.347 1.00 27.99  ? 391  LEU A CG  1 
ATOM   689  C CD1 . LEU A 1 88  ? 99.490  18.761  20.798 1.00 25.45  ? 391  LEU A CD1 1 
ATOM   690  C CD2 . LEU A 1 88  ? 100.076 16.537  19.763 1.00 27.09  ? 391  LEU A CD2 1 
ATOM   691  N N   . VAL A 1 89  ? 95.681  15.904  20.388 1.00 34.34  ? 392  VAL A N   1 
ATOM   692  C CA  . VAL A 1 89  ? 94.843  15.603  19.234 1.00 37.88  ? 392  VAL A CA  1 
ATOM   693  C C   . VAL A 1 89  ? 93.580  16.455  19.245 1.00 37.87  ? 392  VAL A C   1 
ATOM   694  O O   . VAL A 1 89  ? 93.190  17.032  18.229 1.00 35.73  ? 392  VAL A O   1 
ATOM   695  C CB  . VAL A 1 89  ? 94.502  14.069  19.204 1.00 38.89  ? 392  VAL A CB  1 
ATOM   696  C CG1 . VAL A 1 89  ? 93.228  13.795  18.402 1.00 38.40  ? 392  VAL A CG1 1 
ATOM   697  C CG2 . VAL A 1 89  ? 95.686  13.305  18.586 1.00 37.39  ? 392  VAL A CG2 1 
ATOM   698  N N   . TRP A 1 90  ? 92.942  16.530  20.400 1.00 39.23  ? 393  TRP A N   1 
ATOM   699  C CA  . TRP A 1 90  ? 91.747  17.339  20.513 1.00 42.94  ? 393  TRP A CA  1 
ATOM   700  C C   . TRP A 1 90  ? 92.134  18.770  20.185 1.00 43.37  ? 393  TRP A C   1 
ATOM   701  O O   . TRP A 1 90  ? 91.543  19.388  19.305 1.00 43.69  ? 393  TRP A O   1 
ATOM   702  C CB  . TRP A 1 90  ? 91.201  17.250  21.925 1.00 45.23  ? 393  TRP A CB  1 
ATOM   703  C CG  . TRP A 1 90  ? 90.117  18.193  22.217 1.00 48.29  ? 393  TRP A CG  1 
ATOM   704  C CD1 . TRP A 1 90  ? 90.162  19.223  23.102 1.00 50.63  ? 393  TRP A CD1 1 
ATOM   705  C CD2 . TRP A 1 90  ? 88.775  18.142  21.725 1.00 49.97  ? 393  TRP A CD2 1 
ATOM   706  N NE1 . TRP A 1 90  ? 88.926  19.815  23.211 1.00 52.20  ? 393  TRP A NE1 1 
ATOM   707  C CE2 . TRP A 1 90  ? 88.053  19.171  22.376 1.00 51.52  ? 393  TRP A CE2 1 
ATOM   708  C CE3 . TRP A 1 90  ? 88.108  17.325  20.807 1.00 51.43  ? 393  TRP A CE3 1 
ATOM   709  C CZ2 . TRP A 1 90  ? 86.691  19.405  22.138 1.00 50.67  ? 393  TRP A CZ2 1 
ATOM   710  C CZ3 . TRP A 1 90  ? 86.747  17.555  20.569 1.00 51.87  ? 393  TRP A CZ3 1 
ATOM   711  C CH2 . TRP A 1 90  ? 86.056  18.590  21.238 1.00 51.87  ? 393  TRP A CH2 1 
ATOM   712  N N   . ARG A 1 91  ? 93.138  19.282  20.895 1.00 44.05  ? 394  ARG A N   1 
ATOM   713  C CA  . ARG A 1 91  ? 93.635  20.637  20.689 1.00 44.08  ? 394  ARG A CA  1 
ATOM   714  C C   . ARG A 1 91  ? 93.830  20.918  19.208 1.00 44.95  ? 394  ARG A C   1 
ATOM   715  O O   . ARG A 1 91  ? 93.439  21.978  18.711 1.00 45.57  ? 394  ARG A O   1 
ATOM   716  C CB  . ARG A 1 91  ? 94.985  20.845  21.391 1.00 43.46  ? 394  ARG A CB  1 
ATOM   717  C CG  . ARG A 1 91  ? 94.938  20.931  22.905 1.00 43.80  ? 394  ARG A CG  1 
ATOM   718  C CD  . ARG A 1 91  ? 96.176  21.656  23.438 1.00 45.68  ? 394  ARG A CD  1 
ATOM   719  N NE  . ARG A 1 91  ? 97.411  20.916  23.205 1.00 48.70  ? 394  ARG A NE  1 
ATOM   720  C CZ  . ARG A 1 91  ? 97.926  20.020  24.049 1.00 51.57  ? 394  ARG A CZ  1 
ATOM   721  N NH1 . ARG A 1 91  ? 97.317  19.749  25.199 1.00 50.35  ? 394  ARG A NH1 1 
ATOM   722  N NH2 . ARG A 1 91  ? 99.053  19.385  23.741 1.00 51.68  ? 394  ARG A NH2 1 
ATOM   723  N N   . SER A 1 92  ? 94.434  19.957  18.512 1.00 44.98  ? 395  SER A N   1 
ATOM   724  C CA  . SER A 1 92  ? 94.730  20.078  17.086 1.00 45.59  ? 395  SER A CA  1 
ATOM   725  C C   . SER A 1 92  ? 93.593  19.658  16.155 1.00 46.76  ? 395  SER A C   1 
ATOM   726  O O   . SER A 1 92  ? 93.749  19.660  14.936 1.00 45.20  ? 395  SER A O   1 
ATOM   727  C CB  . SER A 1 92  ? 95.974  19.253  16.768 1.00 45.34  ? 395  SER A CB  1 
ATOM   728  O OG  . SER A 1 92  ? 96.978  19.506  17.731 1.00 44.71  ? 395  SER A OG  1 
ATOM   729  N N   . MET A 1 93  ? 92.462  19.281  16.742 1.00 49.23  ? 396  MET A N   1 
ATOM   730  C CA  . MET A 1 93  ? 91.296  18.862  15.985 1.00 51.18  ? 396  MET A CA  1 
ATOM   731  C C   . MET A 1 93  ? 91.081  19.763  14.784 1.00 53.64  ? 396  MET A C   1 
ATOM   732  O O   . MET A 1 93  ? 91.347  19.378  13.642 1.00 54.91  ? 396  MET A O   1 
ATOM   733  C CB  . MET A 1 93  ? 90.055  18.923  16.873 1.00 51.77  ? 396  MET A CB  1 
ATOM   734  C CG  . MET A 1 93  ? 89.550  17.583  17.368 1.00 52.63  ? 396  MET A CG  1 
ATOM   735  S SD  . MET A 1 93  ? 88.106  17.019  16.450 1.00 54.13  ? 396  MET A SD  1 
ATOM   736  C CE  . MET A 1 93  ? 86.780  17.649  17.460 1.00 51.07  ? 396  MET A CE  1 
ATOM   737  N N   . GLU A 1 94  ? 90.610  20.974  15.061 1.00 55.09  ? 397  GLU A N   1 
ATOM   738  C CA  . GLU A 1 94  ? 90.297  21.973  14.042 1.00 57.14  ? 397  GLU A CA  1 
ATOM   739  C C   . GLU A 1 94  ? 91.269  22.264  12.898 1.00 56.98  ? 397  GLU A C   1 
ATOM   740  O O   . GLU A 1 94  ? 90.850  22.406  11.746 1.00 56.72  ? 397  GLU A O   1 
ATOM   741  C CB  . GLU A 1 94  ? 89.981  23.286  14.725 1.00 59.49  ? 397  GLU A CB  1 
ATOM   742  C CG  . GLU A 1 94  ? 88.536  23.664  14.650 1.00 65.94  ? 397  GLU A CG  1 
ATOM   743  C CD  . GLU A 1 94  ? 88.254  24.930  15.429 1.00 69.98  ? 397  GLU A CD  1 
ATOM   744  O OE1 . GLU A 1 94  ? 88.321  24.873  16.683 1.00 71.88  ? 397  GLU A OE1 1 
ATOM   745  O OE2 . GLU A 1 94  ? 87.980  25.980  14.791 1.00 71.38  ? 397  GLU A OE2 1 
ATOM   746  N N   . HIS A 1 95  ? 92.556  22.355  13.212 1.00 56.21  ? 398  HIS A N   1 
ATOM   747  C CA  . HIS A 1 95  ? 93.571  22.691  12.218 1.00 54.93  ? 398  HIS A CA  1 
ATOM   748  C C   . HIS A 1 95  ? 94.320  21.488  11.676 1.00 52.76  ? 398  HIS A C   1 
ATOM   749  O O   . HIS A 1 95  ? 95.429  21.185  12.116 1.00 52.48  ? 398  HIS A O   1 
ATOM   750  C CB  . HIS A 1 95  ? 94.543  23.687  12.844 1.00 57.98  ? 398  HIS A CB  1 
ATOM   751  C CG  . HIS A 1 95  ? 93.985  24.376  14.051 1.00 60.62  ? 398  HIS A CG  1 
ATOM   752  N ND1 . HIS A 1 95  ? 92.645  24.682  14.179 1.00 61.88  ? 398  HIS A ND1 1 
ATOM   753  C CD2 . HIS A 1 95  ? 94.575  24.786  15.199 1.00 61.70  ? 398  HIS A CD2 1 
ATOM   754  C CE1 . HIS A 1 95  ? 92.433  25.244  15.356 1.00 62.30  ? 398  HIS A CE1 1 
ATOM   755  N NE2 . HIS A 1 95  ? 93.587  25.318  15.994 1.00 62.73  ? 398  HIS A NE2 1 
ATOM   756  N N   . PRO A 1 96  ? 93.738  20.815  10.668 1.00 51.06  ? 399  PRO A N   1 
ATOM   757  C CA  . PRO A 1 96  ? 94.314  19.626  10.034 1.00 48.85  ? 399  PRO A CA  1 
ATOM   758  C C   . PRO A 1 96  ? 95.735  19.863  9.591  1.00 46.94  ? 399  PRO A C   1 
ATOM   759  O O   . PRO A 1 96  ? 96.111  20.998  9.315  1.00 47.54  ? 399  PRO A O   1 
ATOM   760  C CB  . PRO A 1 96  ? 93.378  19.376  8.861  1.00 47.49  ? 399  PRO A CB  1 
ATOM   761  C CG  . PRO A 1 96  ? 93.010  20.727  8.473  1.00 48.11  ? 399  PRO A CG  1 
ATOM   762  C CD  . PRO A 1 96  ? 92.700  21.388  9.798  1.00 49.84  ? 399  PRO A CD  1 
ATOM   763  N N   . GLY A 1 97  ? 96.516  18.786  9.541  1.00 45.23  ? 400  GLY A N   1 
ATOM   764  C CA  . GLY A 1 97  ? 97.908  18.876  9.134  1.00 41.78  ? 400  GLY A CA  1 
ATOM   765  C C   . GLY A 1 97  ? 98.768  19.645  10.118 1.00 39.79  ? 400  GLY A C   1 
ATOM   766  O O   . GLY A 1 97  ? 99.948  19.893  9.855  1.00 38.80  ? 400  GLY A O   1 
ATOM   767  N N   . LYS A 1 98  ? 98.176  20.009  11.253 1.00 37.43  ? 401  LYS A N   1 
ATOM   768  C CA  . LYS A 1 98  ? 98.867  20.762  12.279 1.00 37.08  ? 401  LYS A CA  1 
ATOM   769  C C   . LYS A 1 98  ? 98.576  20.179  13.663 1.00 37.96  ? 401  LYS A C   1 
ATOM   770  O O   . LYS A 1 98  ? 97.542  19.536  13.854 1.00 39.58  ? 401  LYS A O   1 
ATOM   771  C CB  . LYS A 1 98  ? 98.412  22.220  12.227 1.00 38.00  ? 401  LYS A CB  1 
ATOM   772  C CG  . LYS A 1 98  ? 99.273  23.165  11.376 1.00 39.01  ? 401  LYS A CG  1 
ATOM   773  C CD  . LYS A 1 98  ? 99.052  23.014  9.872  1.00 40.10  ? 401  LYS A CD  1 
ATOM   774  C CE  . LYS A 1 98  ? 99.706  24.169  9.088  1.00 40.87  ? 401  LYS A CE  1 
ATOM   775  N NZ  . LYS A 1 98  ? 101.136 24.425  9.468  1.00 39.44  ? 401  LYS A NZ  1 
ATOM   776  N N   . LEU A 1 99  ? 99.483  20.413  14.619 1.00 37.30  ? 402  LEU A N   1 
ATOM   777  C CA  . LEU A 1 99  ? 99.355  19.934  16.000 1.00 36.47  ? 402  LEU A CA  1 
ATOM   778  C C   . LEU A 1 99  ? 99.409  21.084  17.028 1.00 37.16  ? 402  LEU A C   1 
ATOM   779  O O   . LEU A 1 99  ? 100.475 21.398  17.558 1.00 37.72  ? 402  LEU A O   1 
ATOM   780  C CB  . LEU A 1 99  ? 100.482 18.947  16.309 1.00 36.74  ? 402  LEU A CB  1 
ATOM   781  C CG  . LEU A 1 99  ? 100.480 17.549  15.684 1.00 40.41  ? 402  LEU A CG  1 
ATOM   782  C CD1 . LEU A 1 99  ? 101.851 16.888  15.892 1.00 40.81  ? 402  LEU A CD1 1 
ATOM   783  C CD2 . LEU A 1 99  ? 99.364  16.703  16.304 1.00 38.99  ? 402  LEU A CD2 1 
ATOM   784  N N   . LEU A 1 100 ? 98.270  21.706  17.328 1.00 36.13  ? 403  LEU A N   1 
ATOM   785  C CA  . LEU A 1 100 ? 98.251  22.810  18.286 1.00 35.44  ? 403  LEU A CA  1 
ATOM   786  C C   . LEU A 1 100 ? 98.749  22.380  19.668 1.00 38.10  ? 403  LEU A C   1 
ATOM   787  O O   . LEU A 1 100 ? 97.947  22.193  20.601 1.00 38.16  ? 403  LEU A O   1 
ATOM   788  C CB  . LEU A 1 100 ? 96.838  23.387  18.411 1.00 31.62  ? 403  LEU A CB  1 
ATOM   789  C CG  . LEU A 1 100 ? 96.579  24.703  19.159 1.00 28.13  ? 403  LEU A CG  1 
ATOM   790  C CD1 . LEU A 1 100 ? 95.156  25.100  18.889 1.00 26.82  ? 403  LEU A CD1 1 
ATOM   791  C CD2 . LEU A 1 100 ? 96.781  24.581  20.658 1.00 25.67  ? 403  LEU A CD2 1 
ATOM   792  N N   . PHE A 1 101 ? 100.066 22.216  19.800 1.00 39.00  ? 404  PHE A N   1 
ATOM   793  C CA  . PHE A 1 101 ? 100.637 21.839  21.079 1.00 41.07  ? 404  PHE A CA  1 
ATOM   794  C C   . PHE A 1 101 ? 100.136 22.842  22.104 1.00 42.66  ? 404  PHE A C   1 
ATOM   795  O O   . PHE A 1 101 ? 99.419  22.485  23.038 1.00 41.10  ? 404  PHE A O   1 
ATOM   796  C CB  . PHE A 1 101 ? 102.159 21.823  20.988 1.00 40.72  ? 404  PHE A CB  1 
ATOM   797  C CG  . PHE A 1 101 ? 102.703 20.489  20.586 1.00 39.88  ? 404  PHE A CG  1 
ATOM   798  C CD1 . PHE A 1 101 ? 102.512 20.007  19.310 1.00 40.33  ? 404  PHE A CD1 1 
ATOM   799  C CD2 . PHE A 1 101 ? 103.309 19.663  21.514 1.00 39.49  ? 404  PHE A CD2 1 
ATOM   800  C CE1 . PHE A 1 101 ? 102.914 18.707  18.969 1.00 40.06  ? 404  PHE A CE1 1 
ATOM   801  C CE2 . PHE A 1 101 ? 103.708 18.370  21.176 1.00 38.09  ? 404  PHE A CE2 1 
ATOM   802  C CZ  . PHE A 1 101 ? 103.507 17.897  19.907 1.00 35.79  ? 404  PHE A CZ  1 
ATOM   803  N N   . ALA A 1 102 ? 100.509 24.103  21.923 1.00 45.72  ? 405  ALA A N   1 
ATOM   804  C CA  . ALA A 1 102 ? 100.018 25.162  22.799 1.00 47.97  ? 405  ALA A CA  1 
ATOM   805  C C   . ALA A 1 102 ? 99.570  26.276  21.860 1.00 50.20  ? 405  ALA A C   1 
ATOM   806  O O   . ALA A 1 102 ? 100.028 26.347  20.711 1.00 48.64  ? 405  ALA A O   1 
ATOM   807  C CB  . ALA A 1 102 ? 101.098 25.651  23.737 1.00 47.25  ? 405  ALA A CB  1 
ATOM   808  N N   . PRO A 1 103 ? 98.648  27.139  22.326 1.00 53.25  ? 406  PRO A N   1 
ATOM   809  C CA  . PRO A 1 103 ? 98.097  28.269  21.568 1.00 54.98  ? 406  PRO A CA  1 
ATOM   810  C C   . PRO A 1 103 ? 99.201  29.141  20.965 1.00 56.93  ? 406  PRO A C   1 
ATOM   811  O O   . PRO A 1 103 ? 98.935  30.048  20.185 1.00 56.96  ? 406  PRO A O   1 
ATOM   812  C CB  . PRO A 1 103 ? 97.288  29.022  22.622 1.00 55.08  ? 406  PRO A CB  1 
ATOM   813  C CG  . PRO A 1 103 ? 96.849  27.954  23.549 1.00 54.17  ? 406  PRO A CG  1 
ATOM   814  C CD  . PRO A 1 103 ? 98.105  27.129  23.697 1.00 54.53  ? 406  PRO A CD  1 
ATOM   815  N N   . ASN A 1 104 ? 100.442 28.859  21.339 1.00 59.37  ? 407  ASN A N   1 
ATOM   816  C CA  . ASN A 1 104 ? 101.588 29.604  20.838 1.00 61.41  ? 407  ASN A CA  1 
ATOM   817  C C   . ASN A 1 104 ? 102.479 28.704  19.989 1.00 61.62  ? 407  ASN A C   1 
ATOM   818  O O   . ASN A 1 104 ? 103.074 29.158  19.012 1.00 62.52  ? 407  ASN A O   1 
ATOM   819  C CB  . ASN A 1 104 ? 102.385 30.150  22.012 1.00 63.82  ? 407  ASN A CB  1 
ATOM   820  C CG  . ASN A 1 104 ? 102.713 29.079  23.021 1.00 66.22  ? 407  ASN A CG  1 
ATOM   821  O OD1 . ASN A 1 104 ? 103.493 28.163  22.743 1.00 68.51  ? 407  ASN A OD1 1 
ATOM   822  N ND2 . ASN A 1 104 ? 102.103 29.171  24.198 1.00 67.11  ? 407  ASN A ND2 1 
ATOM   823  N N   . LEU A 1 105 ? 102.567 27.431  20.367 1.00 61.08  ? 408  LEU A N   1 
ATOM   824  C CA  . LEU A 1 105 ? 103.383 26.468  19.635 1.00 60.65  ? 408  LEU A CA  1 
ATOM   825  C C   . LEU A 1 105 ? 102.506 25.595  18.749 1.00 59.88  ? 408  LEU A C   1 
ATOM   826  O O   . LEU A 1 105 ? 101.963 24.587  19.200 1.00 61.30  ? 408  LEU A O   1 
ATOM   827  C CB  . LEU A 1 105 ? 104.166 25.590  20.610 1.00 60.93  ? 408  LEU A CB  1 
ATOM   828  C CG  . LEU A 1 105 ? 105.110 24.574  19.967 1.00 60.36  ? 408  LEU A CG  1 
ATOM   829  C CD1 . LEU A 1 105 ? 106.007 25.272  18.949 1.00 59.84  ? 408  LEU A CD1 1 
ATOM   830  C CD2 . LEU A 1 105 ? 105.935 23.899  21.048 1.00 57.88  ? 408  LEU A CD2 1 
ATOM   831  N N   . LEU A 1 106 ? 102.390 25.995  17.487 1.00 58.53  ? 409  LEU A N   1 
ATOM   832  C CA  . LEU A 1 106 ? 101.573 25.308  16.487 1.00 57.21  ? 409  LEU A CA  1 
ATOM   833  C C   . LEU A 1 106 ? 102.493 24.763  15.404 1.00 56.07  ? 409  LEU A C   1 
ATOM   834  O O   . LEU A 1 106 ? 102.988 25.527  14.574 1.00 55.43  ? 409  LEU A O   1 
ATOM   835  C CB  . LEU A 1 106 ? 100.607 26.312  15.851 1.00 58.33  ? 409  LEU A CB  1 
ATOM   836  C CG  . LEU A 1 106 ? 99.222  25.918  15.325 1.00 59.00  ? 409  LEU A CG  1 
ATOM   837  C CD1 . LEU A 1 106 ? 99.341  24.719  14.404 1.00 58.20  ? 409  LEU A CD1 1 
ATOM   838  C CD2 . LEU A 1 106 ? 98.292  25.625  16.508 1.00 60.00  ? 409  LEU A CD2 1 
ATOM   839  N N   . LEU A 1 107 ? 102.710 23.453  15.386 1.00 54.61  ? 410  LEU A N   1 
ATOM   840  C CA  . LEU A 1 107 ? 103.610 22.890  14.390 1.00 54.57  ? 410  LEU A CA  1 
ATOM   841  C C   . LEU A 1 107 ? 102.953 22.061  13.287 1.00 54.91  ? 410  LEU A C   1 
ATOM   842  O O   . LEU A 1 107 ? 101.764 21.763  13.331 1.00 55.10  ? 410  LEU A O   1 
ATOM   843  C CB  . LEU A 1 107 ? 104.684 22.063  15.090 1.00 54.17  ? 410  LEU A CB  1 
ATOM   844  C CG  . LEU A 1 107 ? 105.423 22.771  16.232 1.00 54.80  ? 410  LEU A CG  1 
ATOM   845  C CD1 . LEU A 1 107 ? 106.177 21.733  17.048 1.00 55.94  ? 410  LEU A CD1 1 
ATOM   846  C CD2 . LEU A 1 107 ? 106.369 23.836  15.696 1.00 54.10  ? 410  LEU A CD2 1 
ATOM   847  N N   . ASP A 1 108 ? 103.753 21.705  12.287 1.00 55.36  ? 411  ASP A N   1 
ATOM   848  C CA  . ASP A 1 108 ? 103.291 20.907  11.162 1.00 55.36  ? 411  ASP A CA  1 
ATOM   849  C C   . ASP A 1 108 ? 104.252 19.735  11.010 1.00 55.40  ? 411  ASP A C   1 
ATOM   850  O O   . ASP A 1 108 ? 105.300 19.689  11.658 1.00 53.55  ? 411  ASP A O   1 
ATOM   851  C CB  . ASP A 1 108 ? 103.307 21.730  9.884  1.00 57.56  ? 411  ASP A CB  1 
ATOM   852  C CG  . ASP A 1 108 ? 104.716 22.022  9.405  1.00 60.48  ? 411  ASP A CG  1 
ATOM   853  O OD1 . ASP A 1 108 ? 104.870 22.631  8.323  1.00 60.87  ? 411  ASP A OD1 1 
ATOM   854  O OD2 . ASP A 1 108 ? 105.675 21.638  10.116 1.00 63.25  ? 411  ASP A OD2 1 
ATOM   855  N N   . ARG A 1 109 ? 103.911 18.803  10.131 1.00 55.76  ? 412  ARG A N   1 
ATOM   856  C CA  . ARG A 1 109 ? 104.746 17.634  9.935  1.00 56.95  ? 412  ARG A CA  1 
ATOM   857  C C   . ARG A 1 109 ? 106.218 17.977  9.729  1.00 57.93  ? 412  ARG A C   1 
ATOM   858  O O   . ARG A 1 109 ? 107.096 17.184  10.082 1.00 58.31  ? 412  ARG A O   1 
ATOM   859  C CB  . ARG A 1 109 ? 104.252 16.814  8.745  1.00 57.30  ? 412  ARG A CB  1 
ATOM   860  C CG  . ARG A 1 109 ? 104.823 15.408  8.749  1.00 58.81  ? 412  ARG A CG  1 
ATOM   861  C CD  . ARG A 1 109 ? 105.048 14.845  7.363  1.00 59.55  ? 412  ARG A CD  1 
ATOM   862  N NE  . ARG A 1 109 ? 105.607 13.502  7.451  1.00 60.09  ? 412  ARG A NE  1 
ATOM   863  C CZ  . ARG A 1 109 ? 106.094 12.823  6.420  1.00 61.99  ? 412  ARG A CZ  1 
ATOM   864  N NH1 . ARG A 1 109 ? 106.093 13.365  5.205  1.00 64.24  ? 412  ARG A NH1 1 
ATOM   865  N NH2 . ARG A 1 109 ? 106.582 11.602  6.604  1.00 61.81  ? 412  ARG A NH2 1 
ATOM   866  N N   . ASN A 1 110 ? 106.482 19.152  9.158  1.00 58.82  ? 413  ASN A N   1 
ATOM   867  C CA  . ASN A 1 110 ? 107.851 19.594  8.891  1.00 58.65  ? 413  ASN A CA  1 
ATOM   868  C C   . ASN A 1 110 ? 108.703 19.694  10.148 1.00 58.06  ? 413  ASN A C   1 
ATOM   869  O O   . ASN A 1 110 ? 109.637 18.914  10.329 1.00 58.40  ? 413  ASN A O   1 
ATOM   870  C CB  . ASN A 1 110 ? 107.862 20.945  8.165  1.00 60.63  ? 413  ASN A CB  1 
ATOM   871  C CG  . ASN A 1 110 ? 107.451 20.831  6.699  1.00 64.87  ? 413  ASN A CG  1 
ATOM   872  O OD1 . ASN A 1 110 ? 107.591 19.768  6.075  1.00 65.98  ? 413  ASN A OD1 1 
ATOM   873  N ND2 . ASN A 1 110 ? 106.960 21.935  6.134  1.00 65.40  ? 413  ASN A ND2 1 
ATOM   874  N N   . GLN A 1 111 ? 108.399 20.644  11.023 1.00 56.35  ? 414  GLN A N   1 
ATOM   875  C CA  . GLN A 1 111 ? 109.196 20.764  12.230 1.00 56.43  ? 414  GLN A CA  1 
ATOM   876  C C   . GLN A 1 111 ? 109.353 19.377  12.821 1.00 55.65  ? 414  GLN A C   1 
ATOM   877  O O   . GLN A 1 111 ? 110.337 19.076  13.488 1.00 55.71  ? 414  GLN A O   1 
ATOM   878  C CB  . GLN A 1 111 ? 108.525 21.685  13.250 1.00 58.28  ? 414  GLN A CB  1 
ATOM   879  C CG  . GLN A 1 111 ? 108.414 23.138  12.810 1.00 60.35  ? 414  GLN A CG  1 
ATOM   880  C CD  . GLN A 1 111 ? 107.252 23.360  11.871 1.00 61.96  ? 414  GLN A CD  1 
ATOM   881  O OE1 . GLN A 1 111 ? 106.093 23.180  12.250 1.00 63.10  ? 414  GLN A OE1 1 
ATOM   882  N NE2 . GLN A 1 111 ? 107.552 23.748  10.634 1.00 62.55  ? 414  GLN A NE2 1 
ATOM   883  N N   . GLY A 1 112 ? 108.370 18.530  12.550 1.00 55.39  ? 415  GLY A N   1 
ATOM   884  C CA  . GLY A 1 112 ? 108.399 17.182  13.065 1.00 55.27  ? 415  GLY A CA  1 
ATOM   885  C C   . GLY A 1 112 ? 109.703 16.527  12.696 1.00 55.19  ? 415  GLY A C   1 
ATOM   886  O O   . GLY A 1 112 ? 110.287 15.774  13.478 1.00 56.64  ? 415  GLY A O   1 
ATOM   887  N N   . LYS A 1 113 ? 110.177 16.837  11.502 1.00 53.76  ? 416  LYS A N   1 
ATOM   888  C CA  . LYS A 1 113 ? 111.406 16.248  11.015 1.00 53.16  ? 416  LYS A CA  1 
ATOM   889  C C   . LYS A 1 113 ? 112.627 16.874  11.652 1.00 52.03  ? 416  LYS A C   1 
ATOM   890  O O   . LYS A 1 113 ? 113.699 16.280  11.667 1.00 52.25  ? 416  LYS A O   1 
ATOM   891  C CB  . LYS A 1 113 ? 111.460 16.372  9.498  1.00 53.66  ? 416  LYS A CB  1 
ATOM   892  C CG  . LYS A 1 113 ? 110.194 15.875  8.836  1.00 55.50  ? 416  LYS A CG  1 
ATOM   893  C CD  . LYS A 1 113 ? 110.224 16.100  7.344  1.00 59.68  ? 416  LYS A CD  1 
ATOM   894  C CE  . LYS A 1 113 ? 108.880 15.752  6.697  1.00 61.97  ? 416  LYS A CE  1 
ATOM   895  N NZ  . LYS A 1 113 ? 108.946 15.776  5.194  1.00 62.42  ? 416  LYS A NZ  1 
ATOM   896  N N   . CYS A 1 114 ? 112.472 18.073  12.190 1.00 51.36  ? 417  CYS A N   1 
ATOM   897  C CA  . CYS A 1 114 ? 113.605 18.710  12.824 1.00 52.44  ? 417  CYS A CA  1 
ATOM   898  C C   . CYS A 1 114 ? 114.220 17.701  13.773 1.00 52.02  ? 417  CYS A C   1 
ATOM   899  O O   . CYS A 1 114 ? 115.433 17.481  13.769 1.00 52.74  ? 417  CYS A O   1 
ATOM   900  C CB  . CYS A 1 114 ? 113.154 19.968  13.562 1.00 53.35  ? 417  CYS A CB  1 
ATOM   901  S SG  . CYS A 1 114 ? 112.743 21.309  12.400 1.00 59.60  ? 417  CYS A SG  1 
ATOM   902  N N   . VAL A 1 115 ? 113.364 17.060  14.560 1.00 51.62  ? 418  VAL A N   1 
ATOM   903  C CA  . VAL A 1 115 ? 113.807 16.058  15.514 1.00 50.14  ? 418  VAL A CA  1 
ATOM   904  C C   . VAL A 1 115 ? 113.695 14.676  14.903 1.00 48.61  ? 418  VAL A C   1 
ATOM   905  O O   . VAL A 1 115 ? 112.785 14.397  14.127 1.00 48.12  ? 418  VAL A O   1 
ATOM   906  C CB  . VAL A 1 115 ? 112.978 16.119  16.799 1.00 51.13  ? 418  VAL A CB  1 
ATOM   907  C CG1 . VAL A 1 115 ? 113.488 15.078  17.798 1.00 51.56  ? 418  VAL A CG1 1 
ATOM   908  C CG2 . VAL A 1 115 ? 113.055 17.527  17.388 1.00 50.40  ? 418  VAL A CG2 1 
ATOM   909  N N   . GLU A 1 116 ? 114.627 13.811  15.274 1.00 48.02  ? 419  GLU A N   1 
ATOM   910  C CA  . GLU A 1 116 ? 114.692 12.455  14.747 1.00 48.15  ? 419  GLU A CA  1 
ATOM   911  C C   . GLU A 1 116 ? 113.675 11.426  15.242 1.00 45.73  ? 419  GLU A C   1 
ATOM   912  O O   . GLU A 1 116 ? 113.306 11.402  16.406 1.00 44.69  ? 419  GLU A O   1 
ATOM   913  C CB  . GLU A 1 116 ? 116.090 11.908  14.970 1.00 50.20  ? 419  GLU A CB  1 
ATOM   914  C CG  . GLU A 1 116 ? 116.218 10.487  14.543 1.00 55.00  ? 419  GLU A CG  1 
ATOM   915  C CD  . GLU A 1 116 ? 117.619 9.991   14.691 1.00 58.09  ? 419  GLU A CD  1 
ATOM   916  O OE1 . GLU A 1 116 ? 118.119 9.984   15.840 1.00 59.66  ? 419  GLU A OE1 1 
ATOM   917  O OE2 . GLU A 1 116 ? 118.219 9.615   13.656 1.00 61.65  ? 419  GLU A OE2 1 
ATOM   918  N N   . GLY A 1 117 ? 113.253 10.552  14.339 1.00 44.48  ? 420  GLY A N   1 
ATOM   919  C CA  . GLY A 1 117 ? 112.278 9.538   14.692 1.00 46.07  ? 420  GLY A CA  1 
ATOM   920  C C   . GLY A 1 117 ? 110.954 10.181  15.069 1.00 46.41  ? 420  GLY A C   1 
ATOM   921  O O   . GLY A 1 117 ? 109.915 9.521   15.196 1.00 46.12  ? 420  GLY A O   1 
ATOM   922  N N   . MET A 1 118 ? 111.006 11.495  15.228 1.00 45.77  ? 421  MET A N   1 
ATOM   923  C CA  . MET A 1 118 ? 109.862 12.295  15.615 1.00 44.70  ? 421  MET A CA  1 
ATOM   924  C C   . MET A 1 118 ? 108.738 12.281  14.591 1.00 43.48  ? 421  MET A C   1 
ATOM   925  O O   . MET A 1 118 ? 107.564 12.169  14.945 1.00 43.22  ? 421  MET A O   1 
ATOM   926  C CB  . MET A 1 118 ? 110.326 13.729  15.832 1.00 46.40  ? 421  MET A CB  1 
ATOM   927  C CG  . MET A 1 118 ? 109.301 14.626  16.451 1.00 48.14  ? 421  MET A CG  1 
ATOM   928  S SD  . MET A 1 118 ? 109.096 14.238  18.176 1.00 48.24  ? 421  MET A SD  1 
ATOM   929  C CE  . MET A 1 118 ? 107.959 12.879  18.044 1.00 52.06  ? 421  MET A CE  1 
ATOM   930  N N   . VAL A 1 119 ? 109.112 12.407  13.322 1.00 42.18  ? 422  VAL A N   1 
ATOM   931  C CA  . VAL A 1 119 ? 108.159 12.447  12.211 1.00 40.21  ? 422  VAL A CA  1 
ATOM   932  C C   . VAL A 1 119 ? 107.015 11.446  12.368 1.00 41.07  ? 422  VAL A C   1 
ATOM   933  O O   . VAL A 1 119 ? 105.877 11.844  12.596 1.00 39.18  ? 422  VAL A O   1 
ATOM   934  C CB  . VAL A 1 119 ? 108.882 12.197  10.856 1.00 37.81  ? 422  VAL A CB  1 
ATOM   935  C CG1 . VAL A 1 119 ? 108.229 12.990  9.753  1.00 33.29  ? 422  VAL A CG1 1 
ATOM   936  C CG2 . VAL A 1 119 ? 110.361 12.571  10.976 1.00 39.09  ? 422  VAL A CG2 1 
ATOM   937  N N   . GLU A 1 120 ? 107.325 10.152  12.264 1.00 44.23  ? 423  GLU A N   1 
ATOM   938  C CA  . GLU A 1 120 ? 106.312 9.087   12.379 1.00 46.73  ? 423  GLU A CA  1 
ATOM   939  C C   . GLU A 1 120 ? 105.203 9.450   13.349 1.00 45.23  ? 423  GLU A C   1 
ATOM   940  O O   . GLU A 1 120 ? 104.093 9.769   12.958 1.00 47.96  ? 423  GLU A O   1 
ATOM   941  C CB  . GLU A 1 120 ? 106.934 7.791   12.871 1.00 49.15  ? 423  GLU A CB  1 
ATOM   942  C CG  . GLU A 1 120 ? 108.280 7.457   12.285 1.00 57.78  ? 423  GLU A CG  1 
ATOM   943  C CD  . GLU A 1 120 ? 108.868 6.185   12.923 1.00 63.18  ? 423  GLU A CD  1 
ATOM   944  O OE1 . GLU A 1 120 ? 109.070 6.167   14.177 1.00 63.70  ? 423  GLU A OE1 1 
ATOM   945  O OE2 . GLU A 1 120 ? 109.119 5.205   12.167 1.00 65.83  ? 423  GLU A OE2 1 
ATOM   946  N N   . ILE A 1 121 ? 105.515 9.370   14.627 1.00 43.24  ? 424  ILE A N   1 
ATOM   947  C CA  . ILE A 1 121 ? 104.568 9.701   15.666 1.00 41.85  ? 424  ILE A CA  1 
ATOM   948  C C   . ILE A 1 121 ? 103.674 10.879  15.270 1.00 42.03  ? 424  ILE A C   1 
ATOM   949  O O   . ILE A 1 121 ? 102.453 10.755  15.219 1.00 38.78  ? 424  ILE A O   1 
ATOM   950  C CB  . ILE A 1 121 ? 105.326 10.048  16.954 1.00 41.07  ? 424  ILE A CB  1 
ATOM   951  C CG1 . ILE A 1 121 ? 106.280 8.904   17.304 1.00 39.64  ? 424  ILE A CG1 1 
ATOM   952  C CG2 . ILE A 1 121 ? 104.344 10.319  18.083 1.00 40.55  ? 424  ILE A CG2 1 
ATOM   953  C CD1 . ILE A 1 121 ? 107.270 9.248   18.386 1.00 39.58  ? 424  ILE A CD1 1 
ATOM   954  N N   . PHE A 1 122 ? 104.295 12.021  14.993 1.00 43.87  ? 425  PHE A N   1 
ATOM   955  C CA  . PHE A 1 122 ? 103.556 13.220  14.617 1.00 46.07  ? 425  PHE A CA  1 
ATOM   956  C C   . PHE A 1 122 ? 102.413 12.862  13.692 1.00 47.02  ? 425  PHE A C   1 
ATOM   957  O O   . PHE A 1 122 ? 101.267 13.243  13.927 1.00 49.64  ? 425  PHE A O   1 
ATOM   958  C CB  . PHE A 1 122 ? 104.486 14.224  13.936 1.00 47.69  ? 425  PHE A CB  1 
ATOM   959  C CG  . PHE A 1 122 ? 105.078 15.236  14.873 1.00 50.81  ? 425  PHE A CG  1 
ATOM   960  C CD1 . PHE A 1 122 ? 105.650 14.841  16.086 1.00 52.83  ? 425  PHE A CD1 1 
ATOM   961  C CD2 . PHE A 1 122 ? 105.065 16.591  14.550 1.00 52.47  ? 425  PHE A CD2 1 
ATOM   962  C CE1 . PHE A 1 122 ? 106.201 15.783  16.970 1.00 52.29  ? 425  PHE A CE1 1 
ATOM   963  C CE2 . PHE A 1 122 ? 105.610 17.545  15.419 1.00 52.54  ? 425  PHE A CE2 1 
ATOM   964  C CZ  . PHE A 1 122 ? 106.179 17.138  16.631 1.00 53.50  ? 425  PHE A CZ  1 
ATOM   965  N N   . ASP A 1 123 ? 102.723 12.120  12.637 1.00 46.75  ? 426  ASP A N   1 
ATOM   966  C CA  . ASP A 1 123 ? 101.693 11.707  11.693 1.00 46.33  ? 426  ASP A CA  1 
ATOM   967  C C   . ASP A 1 123 ? 100.662 10.826  12.410 1.00 44.75  ? 426  ASP A C   1 
ATOM   968  O O   . ASP A 1 123 ? 99.465  10.949  12.169 1.00 43.24  ? 426  ASP A O   1 
ATOM   969  C CB  . ASP A 1 123 ? 102.313 10.957  10.492 1.00 48.29  ? 426  ASP A CB  1 
ATOM   970  C CG  . ASP A 1 123 ? 102.896 11.910  9.405  1.00 51.21  ? 426  ASP A CG  1 
ATOM   971  O OD1 . ASP A 1 123 ? 102.172 12.824  8.911  1.00 50.87  ? 426  ASP A OD1 1 
ATOM   972  O OD2 . ASP A 1 123 ? 104.081 11.722  9.030  1.00 50.91  ? 426  ASP A OD2 1 
ATOM   973  N N   . MET A 1 124 ? 101.119 9.956   13.307 1.00 43.92  ? 427  MET A N   1 
ATOM   974  C CA  . MET A 1 124 ? 100.194 9.089   14.036 1.00 42.78  ? 427  MET A CA  1 
ATOM   975  C C   . MET A 1 124 ? 99.202  9.943   14.804 1.00 40.47  ? 427  MET A C   1 
ATOM   976  O O   . MET A 1 124 ? 98.009  9.633   14.867 1.00 39.68  ? 427  MET A O   1 
ATOM   977  C CB  . MET A 1 124 ? 100.933 8.171   15.015 1.00 43.38  ? 427  MET A CB  1 
ATOM   978  C CG  . MET A 1 124 ? 101.934 7.235   14.365 1.00 43.48  ? 427  MET A CG  1 
ATOM   979  S SD  . MET A 1 124 ? 102.079 5.676   15.270 1.00 47.14  ? 427  MET A SD  1 
ATOM   980  C CE  . MET A 1 124 ? 102.535 6.224   16.853 1.00 44.65  ? 427  MET A CE  1 
ATOM   981  N N   . LEU A 1 125 ? 99.704  11.022  15.391 1.00 38.09  ? 428  LEU A N   1 
ATOM   982  C CA  . LEU A 1 125 ? 98.849  11.917  16.144 1.00 36.24  ? 428  LEU A CA  1 
ATOM   983  C C   . LEU A 1 125 ? 97.980  12.664  15.153 1.00 37.35  ? 428  LEU A C   1 
ATOM   984  O O   . LEU A 1 125 ? 96.781  12.887  15.400 1.00 39.39  ? 428  LEU A O   1 
ATOM   985  C CB  . LEU A 1 125 ? 99.686  12.895  16.957 1.00 33.22  ? 428  LEU A CB  1 
ATOM   986  C CG  . LEU A 1 125 ? 100.332 12.272  18.192 1.00 31.58  ? 428  LEU A CG  1 
ATOM   987  C CD1 . LEU A 1 125 ? 101.407 13.173  18.740 1.00 29.60  ? 428  LEU A CD1 1 
ATOM   988  C CD2 . LEU A 1 125 ? 99.272  12.020  19.230 1.00 28.83  ? 428  LEU A CD2 1 
ATOM   989  N N   . LEU A 1 126 ? 98.579  13.032  14.024 1.00 33.78  ? 429  LEU A N   1 
ATOM   990  C CA  . LEU A 1 126 ? 97.851  13.751  13.000 1.00 33.80  ? 429  LEU A CA  1 
ATOM   991  C C   . LEU A 1 126 ? 96.599  13.018  12.562 1.00 34.26  ? 429  LEU A C   1 
ATOM   992  O O   . LEU A 1 126 ? 95.492  13.553  12.633 1.00 35.64  ? 429  LEU A O   1 
ATOM   993  C CB  . LEU A 1 126 ? 98.751  13.987  11.811 1.00 33.07  ? 429  LEU A CB  1 
ATOM   994  C CG  . LEU A 1 126 ? 99.691  15.149  12.085 1.00 32.64  ? 429  LEU A CG  1 
ATOM   995  C CD1 . LEU A 1 126 ? 100.725 15.195  10.987 1.00 32.21  ? 429  LEU A CD1 1 
ATOM   996  C CD2 . LEU A 1 126 ? 98.896  16.451  12.174 1.00 28.71  ? 429  LEU A CD2 1 
ATOM   997  N N   . ALA A 1 127 ? 96.792  11.787  12.109 1.00 34.47  ? 430  ALA A N   1 
ATOM   998  C CA  . ALA A 1 127 ? 95.703  10.933  11.661 1.00 32.76  ? 430  ALA A CA  1 
ATOM   999  C C   . ALA A 1 127 ? 94.677  10.790  12.753 1.00 31.69  ? 430  ALA A C   1 
ATOM   1000 O O   . ALA A 1 127 ? 93.485  10.896  12.499 1.00 32.51  ? 430  ALA A O   1 
ATOM   1001 C CB  . ALA A 1 127 ? 96.234  9.571   11.288 1.00 34.77  ? 430  ALA A CB  1 
ATOM   1002 N N   . THR A 1 128 ? 95.124  10.531  13.974 1.00 30.10  ? 431  THR A N   1 
ATOM   1003 C CA  . THR A 1 128 ? 94.150  10.408  15.039 1.00 30.58  ? 431  THR A CA  1 
ATOM   1004 C C   . THR A 1 128 ? 93.400  11.729  15.123 1.00 32.24  ? 431  THR A C   1 
ATOM   1005 O O   . THR A 1 128 ? 92.165  11.757  15.194 1.00 31.01  ? 431  THR A O   1 
ATOM   1006 C CB  . THR A 1 128 ? 94.800  10.095  16.383 1.00 27.99  ? 431  THR A CB  1 
ATOM   1007 O OG1 . THR A 1 128 ? 95.567  8.890   16.264 1.00 26.32  ? 431  THR A OG1 1 
ATOM   1008 C CG2 . THR A 1 128 ? 93.709  9.905   17.454 1.00 24.41  ? 431  THR A CG2 1 
ATOM   1009 N N   . SER A 1 129 ? 94.175  12.814  15.087 1.00 34.11  ? 432  SER A N   1 
ATOM   1010 C CA  . SER A 1 129 ? 93.651  14.168  15.138 1.00 35.56  ? 432  SER A CA  1 
ATOM   1011 C C   . SER A 1 129 ? 92.581  14.370  14.079 1.00 36.00  ? 432  SER A C   1 
ATOM   1012 O O   . SER A 1 129 ? 91.647  15.135  14.286 1.00 35.54  ? 432  SER A O   1 
ATOM   1013 C CB  . SER A 1 129 ? 94.780  15.174  14.922 1.00 37.22  ? 432  SER A CB  1 
ATOM   1014 O OG  . SER A 1 129 ? 94.276  16.503  14.862 1.00 40.97  ? 432  SER A OG  1 
ATOM   1015 N N   . SER A 1 130 ? 92.722  13.684  12.948 1.00 36.98  ? 433  SER A N   1 
ATOM   1016 C CA  . SER A 1 130 ? 91.748  13.780  11.864 1.00 39.96  ? 433  SER A CA  1 
ATOM   1017 C C   . SER A 1 130 ? 90.545  12.901  12.138 1.00 42.92  ? 433  SER A C   1 
ATOM   1018 O O   . SER A 1 130 ? 89.404  13.369  12.121 1.00 45.24  ? 433  SER A O   1 
ATOM   1019 C CB  . SER A 1 130 ? 92.350  13.327  10.550 1.00 37.55  ? 433  SER A CB  1 
ATOM   1020 O OG  . SER A 1 130 ? 93.458  14.120  10.228 1.00 41.72  ? 433  SER A OG  1 
ATOM   1021 N N   . ARG A 1 131 ? 90.814  11.619  12.372 1.00 44.37  ? 434  ARG A N   1 
ATOM   1022 C CA  . ARG A 1 131 ? 89.773  10.639  12.637 1.00 44.68  ? 434  ARG A CA  1 
ATOM   1023 C C   . ARG A 1 131 ? 88.752  11.238  13.594 1.00 45.66  ? 434  ARG A C   1 
ATOM   1024 O O   . ARG A 1 131 ? 87.567  10.908  13.529 1.00 44.63  ? 434  ARG A O   1 
ATOM   1025 C CB  . ARG A 1 131 ? 90.384  9.373   13.242 1.00 44.59  ? 434  ARG A CB  1 
ATOM   1026 C CG  . ARG A 1 131 ? 89.385  8.274   13.501 1.00 44.31  ? 434  ARG A CG  1 
ATOM   1027 C CD  . ARG A 1 131 ? 89.019  7.569   12.211 1.00 47.99  ? 434  ARG A CD  1 
ATOM   1028 N NE  . ARG A 1 131 ? 87.582  7.305   12.071 1.00 48.32  ? 434  ARG A NE  1 
ATOM   1029 C CZ  . ARG A 1 131 ? 86.812  6.702   12.977 1.00 47.10  ? 434  ARG A CZ  1 
ATOM   1030 N NH1 . ARG A 1 131 ? 87.315  6.282   14.132 1.00 45.70  ? 434  ARG A NH1 1 
ATOM   1031 N NH2 . ARG A 1 131 ? 85.526  6.506   12.711 1.00 46.54  ? 434  ARG A NH2 1 
ATOM   1032 N N   . PHE A 1 132 ? 89.221  12.118  14.481 1.00 47.05  ? 435  PHE A N   1 
ATOM   1033 C CA  . PHE A 1 132 ? 88.351  12.785  15.451 1.00 48.55  ? 435  PHE A CA  1 
ATOM   1034 C C   . PHE A 1 132 ? 87.483  13.799  14.740 1.00 49.80  ? 435  PHE A C   1 
ATOM   1035 O O   . PHE A 1 132 ? 86.274  13.871  14.948 1.00 50.87  ? 435  PHE A O   1 
ATOM   1036 C CB  . PHE A 1 132 ? 89.171  13.530  16.499 1.00 48.33  ? 435  PHE A CB  1 
ATOM   1037 C CG  . PHE A 1 132 ? 89.519  12.712  17.698 1.00 48.81  ? 435  PHE A CG  1 
ATOM   1038 C CD1 . PHE A 1 132 ? 90.101  13.312  18.806 1.00 49.14  ? 435  PHE A CD1 1 
ATOM   1039 C CD2 . PHE A 1 132 ? 89.274  11.347  17.731 1.00 48.52  ? 435  PHE A CD2 1 
ATOM   1040 C CE1 . PHE A 1 132 ? 90.431  12.559  19.929 1.00 48.21  ? 435  PHE A CE1 1 
ATOM   1041 C CE2 . PHE A 1 132 ? 89.603  10.593  18.851 1.00 47.28  ? 435  PHE A CE2 1 
ATOM   1042 C CZ  . PHE A 1 132 ? 90.180  11.198  19.947 1.00 45.85  ? 435  PHE A CZ  1 
ATOM   1043 N N   . ARG A 1 133 ? 88.127  14.603  13.909 1.00 50.59  ? 436  ARG A N   1 
ATOM   1044 C CA  . ARG A 1 133 ? 87.439  15.628  13.147 1.00 51.37  ? 436  ARG A CA  1 
ATOM   1045 C C   . ARG A 1 133 ? 86.383  14.958  12.256 1.00 51.48  ? 436  ARG A C   1 
ATOM   1046 O O   . ARG A 1 133 ? 85.202  15.304  12.285 1.00 48.97  ? 436  ARG A O   1 
ATOM   1047 C CB  . ARG A 1 133 ? 88.474  16.385  12.308 1.00 50.74  ? 436  ARG A CB  1 
ATOM   1048 C CG  . ARG A 1 133 ? 88.130  17.827  12.000 1.00 50.13  ? 436  ARG A CG  1 
ATOM   1049 C CD  . ARG A 1 133 ? 89.366  18.547  11.515 1.00 50.00  ? 436  ARG A CD  1 
ATOM   1050 N NE  . ARG A 1 133 ? 90.025  17.798  10.452 1.00 51.63  ? 436  ARG A NE  1 
ATOM   1051 C CZ  . ARG A 1 133 ? 91.282  17.362  10.504 1.00 52.20  ? 436  ARG A CZ  1 
ATOM   1052 N NH1 . ARG A 1 133 ? 92.031  17.600  11.582 1.00 48.47  ? 436  ARG A NH1 1 
ATOM   1053 N NH2 . ARG A 1 133 ? 91.789  16.684  9.474  1.00 50.74  ? 436  ARG A NH2 1 
ATOM   1054 N N   . MET A 1 134 ? 86.827  13.982  11.477 1.00 53.05  ? 437  MET A N   1 
ATOM   1055 C CA  . MET A 1 134 ? 85.952  13.254  10.576 1.00 55.82  ? 437  MET A CA  1 
ATOM   1056 C C   . MET A 1 134 ? 84.771  12.635  11.336 1.00 56.35  ? 437  MET A C   1 
ATOM   1057 O O   . MET A 1 134 ? 83.779  12.231  10.741 1.00 57.71  ? 437  MET A O   1 
ATOM   1058 C CB  . MET A 1 134 ? 86.771  12.181  9.857  1.00 57.96  ? 437  MET A CB  1 
ATOM   1059 C CG  . MET A 1 134 ? 86.038  11.413  8.779  1.00 63.10  ? 437  MET A CG  1 
ATOM   1060 S SD  . MET A 1 134 ? 87.214  10.569  7.676  1.00 69.93  ? 437  MET A SD  1 
ATOM   1061 C CE  . MET A 1 134 ? 87.536  8.977   8.619  1.00 68.17  ? 437  MET A CE  1 
ATOM   1062 N N   . MET A 1 135 ? 84.872  12.575  12.657 1.00 56.51  ? 438  MET A N   1 
ATOM   1063 C CA  . MET A 1 135 ? 83.808  12.003  13.472 1.00 55.67  ? 438  MET A CA  1 
ATOM   1064 C C   . MET A 1 135 ? 83.032  13.090  14.162 1.00 54.85  ? 438  MET A C   1 
ATOM   1065 O O   . MET A 1 135 ? 81.999  12.834  14.776 1.00 54.38  ? 438  MET A O   1 
ATOM   1066 C CB  . MET A 1 135 ? 84.378  11.093  14.550 1.00 57.26  ? 438  MET A CB  1 
ATOM   1067 C CG  . MET A 1 135 ? 84.776  9.721   14.092 1.00 58.59  ? 438  MET A CG  1 
ATOM   1068 S SD  . MET A 1 135 ? 85.123  8.732   15.555 1.00 63.10  ? 438  MET A SD  1 
ATOM   1069 C CE  . MET A 1 135 ? 83.420  8.195   16.034 1.00 61.33  ? 438  MET A CE  1 
ATOM   1070 N N   . ASN A 1 136 ? 83.543  14.308  14.074 1.00 54.52  ? 439  ASN A N   1 
ATOM   1071 C CA  . ASN A 1 136 ? 82.892  15.433  14.719 1.00 54.58  ? 439  ASN A CA  1 
ATOM   1072 C C   . ASN A 1 136 ? 82.818  15.104  16.207 1.00 52.89  ? 439  ASN A C   1 
ATOM   1073 O O   . ASN A 1 136 ? 81.738  15.077  16.808 1.00 53.97  ? 439  ASN A O   1 
ATOM   1074 C CB  . ASN A 1 136 ? 81.482  15.641  14.144 1.00 57.24  ? 439  ASN A CB  1 
ATOM   1075 C CG  . ASN A 1 136 ? 80.789  16.859  14.727 1.00 59.79  ? 439  ASN A CG  1 
ATOM   1076 O OD1 . ASN A 1 136 ? 79.638  16.780  15.172 1.00 60.48  ? 439  ASN A OD1 1 
ATOM   1077 N ND2 . ASN A 1 136 ? 81.487  17.999  14.728 1.00 60.47  ? 439  ASN A ND2 1 
ATOM   1078 N N   . LEU A 1 137 ? 83.979  14.839  16.794 1.00 50.25  ? 440  LEU A N   1 
ATOM   1079 C CA  . LEU A 1 137 ? 84.045  14.514  18.205 1.00 46.94  ? 440  LEU A CA  1 
ATOM   1080 C C   . LEU A 1 137 ? 83.326  15.635  18.920 1.00 46.45  ? 440  LEU A C   1 
ATOM   1081 O O   . LEU A 1 137 ? 82.933  16.609  18.294 1.00 48.65  ? 440  LEU A O   1 
ATOM   1082 C CB  . LEU A 1 137 ? 85.499  14.435  18.666 1.00 45.67  ? 440  LEU A CB  1 
ATOM   1083 C CG  . LEU A 1 137 ? 85.712  13.591  19.921 1.00 44.06  ? 440  LEU A CG  1 
ATOM   1084 C CD1 . LEU A 1 137 ? 85.161  12.202  19.688 1.00 43.67  ? 440  LEU A CD1 1 
ATOM   1085 C CD2 . LEU A 1 137 ? 87.168  13.526  20.261 1.00 43.23  ? 440  LEU A CD2 1 
ATOM   1086 N N   . GLN A 1 138 ? 83.153  15.509  20.227 1.00 45.88  ? 441  GLN A N   1 
ATOM   1087 C CA  . GLN A 1 138 ? 82.456  16.526  20.997 1.00 45.07  ? 441  GLN A CA  1 
ATOM   1088 C C   . GLN A 1 138 ? 83.079  16.707  22.374 1.00 44.18  ? 441  GLN A C   1 
ATOM   1089 O O   . GLN A 1 138 ? 83.236  15.750  23.118 1.00 45.50  ? 441  GLN A O   1 
ATOM   1090 C CB  . GLN A 1 138 ? 80.976  16.134  21.160 1.00 47.29  ? 441  GLN A CB  1 
ATOM   1091 C CG  . GLN A 1 138 ? 80.121  16.220  19.877 1.00 49.81  ? 441  GLN A CG  1 
ATOM   1092 C CD  . GLN A 1 138 ? 79.532  17.614  19.632 1.00 50.44  ? 441  GLN A CD  1 
ATOM   1093 O OE1 . GLN A 1 138 ? 78.762  18.129  20.455 1.00 49.00  ? 441  GLN A OE1 1 
ATOM   1094 N NE2 . GLN A 1 138 ? 79.892  18.224  18.499 1.00 49.17  ? 441  GLN A NE2 1 
ATOM   1095 N N   . GLY A 1 139 ? 83.427  17.937  22.719 1.00 42.62  ? 442  GLY A N   1 
ATOM   1096 C CA  . GLY A 1 139 ? 83.996  18.187  24.029 1.00 39.97  ? 442  GLY A CA  1 
ATOM   1097 C C   . GLY A 1 139 ? 83.508  17.274  25.142 1.00 38.32  ? 442  GLY A C   1 
ATOM   1098 O O   . GLY A 1 139 ? 84.290  16.929  26.013 1.00 38.70  ? 442  GLY A O   1 
ATOM   1099 N N   . GLU A 1 140 ? 82.235  16.884  25.132 1.00 38.15  ? 443  GLU A N   1 
ATOM   1100 C CA  . GLU A 1 140 ? 81.688  15.997  26.174 1.00 40.19  ? 443  GLU A CA  1 
ATOM   1101 C C   . GLU A 1 140 ? 82.261  14.589  26.063 1.00 39.91  ? 443  GLU A C   1 
ATOM   1102 O O   . GLU A 1 140 ? 82.657  13.967  27.052 1.00 40.87  ? 443  GLU A O   1 
ATOM   1103 C CB  . GLU A 1 140 ? 80.163  15.894  26.064 1.00 40.69  ? 443  GLU A CB  1 
ATOM   1104 C CG  . GLU A 1 140 ? 79.393  17.092  26.570 1.00 43.38  ? 443  GLU A CG  1 
ATOM   1105 C CD  . GLU A 1 140 ? 79.864  18.395  25.959 1.00 44.61  ? 443  GLU A CD  1 
ATOM   1106 O OE1 . GLU A 1 140 ? 80.146  18.402  24.744 1.00 45.79  ? 443  GLU A OE1 1 
ATOM   1107 O OE2 . GLU A 1 140 ? 79.944  19.411  26.688 1.00 45.13  ? 443  GLU A OE2 1 
ATOM   1108 N N   . GLU A 1 141 ? 82.264  14.085  24.841 1.00 39.24  ? 444  GLU A N   1 
ATOM   1109 C CA  . GLU A 1 141 ? 82.784  12.768  24.552 1.00 38.33  ? 444  GLU A CA  1 
ATOM   1110 C C   . GLU A 1 141 ? 84.273  12.755  24.942 1.00 38.71  ? 444  GLU A C   1 
ATOM   1111 O O   . GLU A 1 141 ? 84.735  11.840  25.629 1.00 39.86  ? 444  GLU A O   1 
ATOM   1112 C CB  . GLU A 1 141 ? 82.562  12.464  23.051 1.00 37.92  ? 444  GLU A CB  1 
ATOM   1113 C CG  . GLU A 1 141 ? 81.056  12.454  22.654 1.00 37.32  ? 444  GLU A CG  1 
ATOM   1114 C CD  . GLU A 1 141 ? 80.769  12.278  21.156 1.00 36.34  ? 444  GLU A CD  1 
ATOM   1115 O OE1 . GLU A 1 141 ? 81.106  13.190  20.375 1.00 37.36  ? 444  GLU A OE1 1 
ATOM   1116 O OE2 . GLU A 1 141 ? 80.190  11.237  20.761 1.00 33.26  ? 444  GLU A OE2 1 
ATOM   1117 N N   . PHE A 1 142 ? 85.008  13.789  24.531 1.00 37.85  ? 445  PHE A N   1 
ATOM   1118 C CA  . PHE A 1 142 ? 86.429  13.897  24.831 1.00 35.76  ? 445  PHE A CA  1 
ATOM   1119 C C   . PHE A 1 142 ? 86.663  13.564  26.275 1.00 36.86  ? 445  PHE A C   1 
ATOM   1120 O O   . PHE A 1 142 ? 87.144  12.494  26.587 1.00 40.20  ? 445  PHE A O   1 
ATOM   1121 C CB  . PHE A 1 142 ? 86.943  15.308  24.564 1.00 34.15  ? 445  PHE A CB  1 
ATOM   1122 C CG  . PHE A 1 142 ? 88.366  15.521  24.989 1.00 34.22  ? 445  PHE A CG  1 
ATOM   1123 C CD1 . PHE A 1 142 ? 89.396  14.787  24.417 1.00 35.33  ? 445  PHE A CD1 1 
ATOM   1124 C CD2 . PHE A 1 142 ? 88.681  16.433  25.985 1.00 35.51  ? 445  PHE A CD2 1 
ATOM   1125 C CE1 . PHE A 1 142 ? 90.719  14.962  24.838 1.00 35.04  ? 445  PHE A CE1 1 
ATOM   1126 C CE2 . PHE A 1 142 ? 90.005  16.612  26.413 1.00 34.24  ? 445  PHE A CE2 1 
ATOM   1127 C CZ  . PHE A 1 142 ? 91.018  15.878  25.840 1.00 34.03  ? 445  PHE A CZ  1 
ATOM   1128 N N   . VAL A 1 143 ? 86.297  14.483  27.158 1.00 38.21  ? 446  VAL A N   1 
ATOM   1129 C CA  . VAL A 1 143 ? 86.480  14.318  28.600 1.00 37.11  ? 446  VAL A CA  1 
ATOM   1130 C C   . VAL A 1 143 ? 86.125  12.928  29.097 1.00 36.46  ? 446  VAL A C   1 
ATOM   1131 O O   . VAL A 1 143 ? 86.663  12.469  30.108 1.00 37.30  ? 446  VAL A O   1 
ATOM   1132 C CB  . VAL A 1 143 ? 85.658  15.367  29.386 1.00 37.69  ? 446  VAL A CB  1 
ATOM   1133 C CG1 . VAL A 1 143 ? 86.137  16.780  29.025 1.00 34.80  ? 446  VAL A CG1 1 
ATOM   1134 C CG2 . VAL A 1 143 ? 84.168  15.193  29.085 1.00 37.32  ? 446  VAL A CG2 1 
ATOM   1135 N N   . CYS A 1 144 ? 85.210  12.261  28.405 1.00 35.00  ? 447  CYS A N   1 
ATOM   1136 C CA  . CYS A 1 144 ? 84.858  10.903  28.789 1.00 34.99  ? 447  CYS A CA  1 
ATOM   1137 C C   . CYS A 1 144 ? 86.056  9.991   28.499 1.00 32.30  ? 447  CYS A C   1 
ATOM   1138 O O   . CYS A 1 144 ? 86.556  9.325   29.393 1.00 29.92  ? 447  CYS A O   1 
ATOM   1139 C CB  . CYS A 1 144 ? 83.621  10.440  28.029 1.00 37.79  ? 447  CYS A CB  1 
ATOM   1140 S SG  . CYS A 1 144 ? 82.086  10.973  28.805 1.00 41.40  ? 447  CYS A SG  1 
ATOM   1141 N N   . LEU A 1 145 ? 86.520  9.977   27.254 1.00 30.32  ? 448  LEU A N   1 
ATOM   1142 C CA  . LEU A 1 145 ? 87.694  9.185   26.882 1.00 31.47  ? 448  LEU A CA  1 
ATOM   1143 C C   . LEU A 1 145 ? 88.900  9.488   27.787 1.00 31.90  ? 448  LEU A C   1 
ATOM   1144 O O   . LEU A 1 145 ? 89.538  8.587   28.347 1.00 31.38  ? 448  LEU A O   1 
ATOM   1145 C CB  . LEU A 1 145 ? 88.080  9.491   25.442 1.00 29.16  ? 448  LEU A CB  1 
ATOM   1146 C CG  . LEU A 1 145 ? 86.929  9.228   24.489 1.00 29.86  ? 448  LEU A CG  1 
ATOM   1147 C CD1 . LEU A 1 145 ? 87.334  9.619   23.091 1.00 30.22  ? 448  LEU A CD1 1 
ATOM   1148 C CD2 . LEU A 1 145 ? 86.552  7.751   24.550 1.00 29.20  ? 448  LEU A CD2 1 
ATOM   1149 N N   . LYS A 1 146 ? 89.209  10.773  27.893 1.00 31.37  ? 449  LYS A N   1 
ATOM   1150 C CA  . LYS A 1 146 ? 90.303  11.254  28.699 1.00 32.31  ? 449  LYS A CA  1 
ATOM   1151 C C   . LYS A 1 146 ? 90.324  10.455  30.004 1.00 31.56  ? 449  LYS A C   1 
ATOM   1152 O O   . LYS A 1 146 ? 91.284  9.741   30.318 1.00 31.23  ? 449  LYS A O   1 
ATOM   1153 C CB  . LYS A 1 146 ? 90.082  12.750  28.967 1.00 36.14  ? 449  LYS A CB  1 
ATOM   1154 C CG  . LYS A 1 146 ? 91.312  13.548  29.418 1.00 40.90  ? 449  LYS A CG  1 
ATOM   1155 C CD  . LYS A 1 146 ? 91.063  15.052  29.255 1.00 44.27  ? 449  LYS A CD  1 
ATOM   1156 C CE  . LYS A 1 146 ? 92.356  15.877  29.348 1.00 45.55  ? 449  LYS A CE  1 
ATOM   1157 N NZ  . LYS A 1 146 ? 92.251  17.174  28.599 1.00 44.80  ? 449  LYS A NZ  1 
ATOM   1158 N N   . SER A 1 147 ? 89.244  10.568  30.754 1.00 29.59  ? 450  SER A N   1 
ATOM   1159 C CA  . SER A 1 147 ? 89.130  9.872   32.019 1.00 29.46  ? 450  SER A CA  1 
ATOM   1160 C C   . SER A 1 147 ? 89.173  8.346   31.845 1.00 28.11  ? 450  SER A C   1 
ATOM   1161 O O   . SER A 1 147 ? 89.763  7.638   32.652 1.00 26.57  ? 450  SER A O   1 
ATOM   1162 C CB  . SER A 1 147 ? 87.818  10.279  32.703 1.00 32.29  ? 450  SER A CB  1 
ATOM   1163 O OG  . SER A 1 147 ? 86.696  9.688   32.061 1.00 35.07  ? 450  SER A OG  1 
ATOM   1164 N N   . ILE A 1 148 ? 88.524  7.850   30.799 1.00 27.58  ? 451  ILE A N   1 
ATOM   1165 C CA  . ILE A 1 148 ? 88.486  6.428   30.520 1.00 26.68  ? 451  ILE A CA  1 
ATOM   1166 C C   . ILE A 1 148 ? 89.906  5.893   30.437 1.00 27.75  ? 451  ILE A C   1 
ATOM   1167 O O   . ILE A 1 148 ? 90.212  4.843   31.004 1.00 29.01  ? 451  ILE A O   1 
ATOM   1168 C CB  . ILE A 1 148 ? 87.709  6.158   29.216 1.00 25.56  ? 451  ILE A CB  1 
ATOM   1169 C CG1 . ILE A 1 148 ? 86.215  6.030   29.542 1.00 24.66  ? 451  ILE A CG1 1 
ATOM   1170 C CG2 . ILE A 1 148 ? 88.219  4.905   28.544 1.00 28.48  ? 451  ILE A CG2 1 
ATOM   1171 C CD1 . ILE A 1 148 ? 85.302  5.904   28.348 1.00 19.54  ? 451  ILE A CD1 1 
ATOM   1172 N N   . ILE A 1 149 ? 90.772  6.621   29.738 1.00 27.48  ? 452  ILE A N   1 
ATOM   1173 C CA  . ILE A 1 149 ? 92.181  6.245   29.623 1.00 26.60  ? 452  ILE A CA  1 
ATOM   1174 C C   . ILE A 1 149 ? 92.788  6.123   31.030 1.00 26.07  ? 452  ILE A C   1 
ATOM   1175 O O   . ILE A 1 149 ? 93.400  5.120   31.398 1.00 25.09  ? 452  ILE A O   1 
ATOM   1176 C CB  . ILE A 1 149 ? 92.993  7.330   28.872 1.00 26.73  ? 452  ILE A CB  1 
ATOM   1177 C CG1 . ILE A 1 149 ? 92.526  7.423   27.425 1.00 24.60  ? 452  ILE A CG1 1 
ATOM   1178 C CG2 . ILE A 1 149 ? 94.493  7.019   28.957 1.00 25.62  ? 452  ILE A CG2 1 
ATOM   1179 C CD1 . ILE A 1 149 ? 93.386  8.338   26.582 1.00 24.31  ? 452  ILE A CD1 1 
ATOM   1180 N N   . LEU A 1 150 ? 92.624  7.176   31.809 1.00 26.20  ? 453  LEU A N   1 
ATOM   1181 C CA  . LEU A 1 150 ? 93.153  7.187   33.150 1.00 27.39  ? 453  LEU A CA  1 
ATOM   1182 C C   . LEU A 1 150 ? 92.747  5.914   33.876 1.00 28.81  ? 453  LEU A C   1 
ATOM   1183 O O   . LEU A 1 150 ? 93.574  5.272   34.519 1.00 30.18  ? 453  LEU A O   1 
ATOM   1184 C CB  . LEU A 1 150 ? 92.642  8.415   33.888 1.00 26.80  ? 453  LEU A CB  1 
ATOM   1185 C CG  . LEU A 1 150 ? 93.098  8.621   35.324 1.00 28.28  ? 453  LEU A CG  1 
ATOM   1186 C CD1 . LEU A 1 150 ? 94.624  8.560   35.422 1.00 30.14  ? 453  LEU A CD1 1 
ATOM   1187 C CD2 . LEU A 1 150 ? 92.584  9.963   35.787 1.00 28.25  ? 453  LEU A CD2 1 
ATOM   1188 N N   . LEU A 1 151 ? 91.481  5.531   33.747 1.00 30.38  ? 454  LEU A N   1 
ATOM   1189 C CA  . LEU A 1 151 ? 90.979  4.335   34.414 1.00 30.88  ? 454  LEU A CA  1 
ATOM   1190 C C   . LEU A 1 151 ? 91.378  3.005   33.788 1.00 31.12  ? 454  LEU A C   1 
ATOM   1191 O O   . LEU A 1 151 ? 91.657  2.056   34.513 1.00 31.09  ? 454  LEU A O   1 
ATOM   1192 C CB  . LEU A 1 151 ? 89.460  4.399   34.544 1.00 32.02  ? 454  LEU A CB  1 
ATOM   1193 C CG  . LEU A 1 151 ? 88.966  5.316   35.674 1.00 34.56  ? 454  LEU A CG  1 
ATOM   1194 C CD1 . LEU A 1 151 ? 87.439  5.431   35.632 1.00 33.75  ? 454  LEU A CD1 1 
ATOM   1195 C CD2 . LEU A 1 151 ? 89.429  4.766   37.025 1.00 35.02  ? 454  LEU A CD2 1 
ATOM   1196 N N   . ASN A 1 152 ? 91.413  2.919   32.463 1.00 30.73  ? 455  ASN A N   1 
ATOM   1197 C CA  . ASN A 1 152 ? 91.790  1.666   31.821 1.00 31.49  ? 455  ASN A CA  1 
ATOM   1198 C C   . ASN A 1 152 ? 93.306  1.519   31.814 1.00 32.24  ? 455  ASN A C   1 
ATOM   1199 O O   . ASN A 1 152 ? 93.867  0.860   32.661 1.00 32.78  ? 455  ASN A O   1 
ATOM   1200 C CB  . ASN A 1 152 ? 91.231  1.606   30.400 1.00 30.87  ? 455  ASN A CB  1 
ATOM   1201 C CG  . ASN A 1 152 ? 91.043  0.181   29.908 1.00 31.63  ? 455  ASN A CG  1 
ATOM   1202 O OD1 . ASN A 1 152 ? 90.685  -0.699  30.674 1.00 31.63  ? 455  ASN A OD1 1 
ATOM   1203 N ND2 . ASN A 1 152 ? 91.265  -0.043  28.619 1.00 32.36  ? 455  ASN A ND2 1 
ATOM   1204 N N   . SER A 1 153 ? 93.973  2.139   30.863 1.00 35.05  ? 456  SER A N   1 
ATOM   1205 C CA  . SER A 1 153 ? 95.424  2.068   30.793 1.00 38.39  ? 456  SER A CA  1 
ATOM   1206 C C   . SER A 1 153 ? 96.039  1.783   32.154 1.00 39.43  ? 456  SER A C   1 
ATOM   1207 O O   . SER A 1 153 ? 96.198  2.699   32.973 1.00 40.07  ? 456  SER A O   1 
ATOM   1208 C CB  . SER A 1 153 ? 95.990  3.399   30.276 1.00 40.88  ? 456  SER A CB  1 
ATOM   1209 O OG  . SER A 1 153 ? 95.414  3.790   29.033 1.00 40.35  ? 456  SER A OG  1 
ATOM   1210 N N   . GLY A 1 154 ? 96.368  0.520   32.406 1.00 39.50  ? 457  GLY A N   1 
ATOM   1211 C CA  . GLY A 1 154 ? 96.978  0.172   33.680 1.00 42.24  ? 457  GLY A CA  1 
ATOM   1212 C C   . GLY A 1 154 ? 96.164  -0.567  34.736 1.00 43.88  ? 457  GLY A C   1 
ATOM   1213 O O   . GLY A 1 154 ? 96.739  -1.091  35.696 1.00 43.50  ? 457  GLY A O   1 
ATOM   1214 N N   . VAL A 1 155 ? 94.842  -0.615  34.585 1.00 46.26  ? 458  VAL A N   1 
ATOM   1215 C CA  . VAL A 1 155 ? 93.981  -1.309  35.554 1.00 48.91  ? 458  VAL A CA  1 
ATOM   1216 C C   . VAL A 1 155 ? 94.327  -2.789  35.737 1.00 52.53  ? 458  VAL A C   1 
ATOM   1217 O O   . VAL A 1 155 ? 94.473  -3.276  36.862 1.00 52.94  ? 458  VAL A O   1 
ATOM   1218 C CB  . VAL A 1 155 ? 92.480  -1.229  35.159 1.00 45.95  ? 458  VAL A CB  1 
ATOM   1219 C CG1 . VAL A 1 155 ? 92.266  -1.782  33.775 1.00 40.79  ? 458  VAL A CG1 1 
ATOM   1220 C CG2 . VAL A 1 155 ? 91.647  -2.011  36.156 1.00 43.64  ? 458  VAL A CG2 1 
ATOM   1221 N N   . TYR A 1 156 ? 94.443  -3.497  34.621 1.00 55.50  ? 459  TYR A N   1 
ATOM   1222 C CA  . TYR A 1 156 ? 94.758  -4.918  34.632 1.00 59.49  ? 459  TYR A CA  1 
ATOM   1223 C C   . TYR A 1 156 ? 96.101  -5.175  35.310 1.00 62.03  ? 459  TYR A C   1 
ATOM   1224 O O   . TYR A 1 156 ? 96.224  -6.068  36.140 1.00 62.13  ? 459  TYR A O   1 
ATOM   1225 C CB  . TYR A 1 156 ? 94.768  -5.426  33.188 1.00 59.39  ? 459  TYR A CB  1 
ATOM   1226 C CG  . TYR A 1 156 ? 93.508  -5.040  32.435 1.00 59.31  ? 459  TYR A CG  1 
ATOM   1227 C CD1 . TYR A 1 156 ? 93.570  -4.500  31.139 1.00 57.11  ? 459  TYR A CD1 1 
ATOM   1228 C CD2 . TYR A 1 156 ? 92.246  -5.192  33.035 1.00 59.42  ? 459  TYR A CD2 1 
ATOM   1229 C CE1 . TYR A 1 156 ? 92.408  -4.119  30.461 1.00 57.50  ? 459  TYR A CE1 1 
ATOM   1230 C CE2 . TYR A 1 156 ? 91.072  -4.815  32.365 1.00 58.20  ? 459  TYR A CE2 1 
ATOM   1231 C CZ  . TYR A 1 156 ? 91.157  -4.280  31.081 1.00 57.73  ? 459  TYR A CZ  1 
ATOM   1232 O OH  . TYR A 1 156 ? 89.992  -3.918  30.442 1.00 55.24  ? 459  TYR A OH  1 
ATOM   1233 N N   . THR A 1 157 ? 97.093  -4.360  34.967 1.00 66.53  ? 460  THR A N   1 
ATOM   1234 C CA  . THR A 1 157 ? 98.450  -4.476  35.506 1.00 70.48  ? 460  THR A CA  1 
ATOM   1235 C C   . THR A 1 157 ? 98.712  -3.620  36.739 1.00 72.52  ? 460  THR A C   1 
ATOM   1236 O O   . THR A 1 157 ? 99.391  -2.597  36.641 1.00 72.26  ? 460  THR A O   1 
ATOM   1237 C CB  . THR A 1 157 ? 99.503  -4.068  34.462 1.00 71.00  ? 460  THR A CB  1 
ATOM   1238 O OG1 . THR A 1 157 ? 99.473  -2.646  34.270 1.00 70.96  ? 460  THR A OG1 1 
ATOM   1239 C CG2 . THR A 1 157 ? 99.228  -4.759  33.126 1.00 73.14  ? 460  THR A CG2 1 
ATOM   1240 N N   . PHE A 1 158 ? 98.191  -4.041  37.890 1.00 75.77  ? 461  PHE A N   1 
ATOM   1241 C CA  . PHE A 1 158 ? 97.975  -2.950  38.986 1.00 78.84  ? 461  PHE A CA  1 
ATOM   1242 C C   . PHE A 1 158 ? 99.284  -3.168  39.741 1.00 81.36  ? 461  PHE A C   1 
ATOM   1243 O O   . PHE A 1 158 ? 100.323 -3.451  39.140 1.00 81.76  ? 461  PHE A O   1 
ATOM   1244 C CB  . PHE A 1 158 ? 96.808  -3.273  39.917 1.00 77.03  ? 461  PHE A CB  1 
ATOM   1245 C CG  . PHE A 1 158 ? 95.806  -2.176  40.014 1.00 75.56  ? 461  PHE A CG  1 
ATOM   1246 C CD1 . PHE A 1 158 ? 94.575  -2.397  40.617 1.00 75.04  ? 461  PHE A CD1 1 
ATOM   1247 C CD2 . PHE A 1 158 ? 96.098  -0.912  39.520 1.00 74.48  ? 461  PHE A CD2 1 
ATOM   1248 C CE1 . PHE A 1 158 ? 93.653  -1.380  40.727 1.00 73.96  ? 461  PHE A CE1 1 
ATOM   1249 C CE2 . PHE A 1 158 ? 95.188  0.104   39.626 1.00 74.36  ? 461  PHE A CE2 1 
ATOM   1250 C CZ  . PHE A 1 158 ? 93.961  -0.126  40.232 1.00 74.69  ? 461  PHE A CZ  1 
ATOM   1251 N N   . LEU A 1 159 ? 99.235  -3.009  41.060 1.00 84.28  ? 462  LEU A N   1 
ATOM   1252 C CA  . LEU A 1 159 ? 100.423 -3.228  41.875 1.00 88.05  ? 462  LEU A CA  1 
ATOM   1253 C C   . LEU A 1 159 ? 100.187 -4.418  42.817 1.00 89.33  ? 462  LEU A C   1 
ATOM   1254 O O   . LEU A 1 159 ? 101.132 -4.973  43.392 1.00 89.73  ? 462  LEU A O   1 
ATOM   1255 C CB  . LEU A 1 159 ? 100.787 -1.962  42.679 1.00 89.71  ? 462  LEU A CB  1 
ATOM   1256 C CG  . LEU A 1 159 ? 100.227 -1.648  44.083 1.00 91.24  ? 462  LEU A CG  1 
ATOM   1257 C CD1 . LEU A 1 159 ? 100.813 -2.585  45.161 1.00 90.72  ? 462  LEU A CD1 1 
ATOM   1258 C CD2 . LEU A 1 159 ? 100.589 -0.205  44.420 1.00 91.12  ? 462  LEU A CD2 1 
ATOM   1259 N N   . SER A 1 160 ? 98.927  -4.825  42.951 1.00 90.08  ? 463  SER A N   1 
ATOM   1260 C CA  . SER A 1 160 ? 98.585  -5.943  43.830 1.00 90.30  ? 463  SER A CA  1 
ATOM   1261 C C   . SER A 1 160 ? 98.026  -7.182  43.099 1.00 90.18  ? 463  SER A C   1 
ATOM   1262 O O   . SER A 1 160 ? 98.009  -7.251  41.863 1.00 90.19  ? 463  SER A O   1 
ATOM   1263 C CB  . SER A 1 160 ? 97.582  -5.473  44.902 1.00 89.73  ? 463  SER A CB  1 
ATOM   1264 O OG  . SER A 1 160 ? 98.081  -4.369  45.647 1.00 88.22  ? 463  SER A OG  1 
ATOM   1265 N N   . SER A 1 161 ? 97.595  -8.160  43.896 1.00 89.53  ? 464  SER A N   1 
ATOM   1266 C CA  . SER A 1 161 ? 97.010  -9.408  43.410 1.00 88.90  ? 464  SER A CA  1 
ATOM   1267 C C   . SER A 1 161 ? 96.309  -10.125 44.575 1.00 87.74  ? 464  SER A C   1 
ATOM   1268 O O   . SER A 1 161 ? 96.167  -11.351 44.591 1.00 86.81  ? 464  SER A O   1 
ATOM   1269 C CB  . SER A 1 161 ? 98.082  -10.307 42.773 1.00 89.33  ? 464  SER A CB  1 
ATOM   1270 O OG  . SER A 1 161 ? 98.409  -9.859  41.465 1.00 88.44  ? 464  SER A OG  1 
ATOM   1271 N N   . THR A 1 162 ? 95.871  -9.327  45.545 1.00 86.33  ? 465  THR A N   1 
ATOM   1272 C CA  . THR A 1 162 ? 95.165  -9.825  46.718 1.00 85.12  ? 465  THR A CA  1 
ATOM   1273 C C   . THR A 1 162 ? 93.696  -9.446  46.647 1.00 83.44  ? 465  THR A C   1 
ATOM   1274 O O   . THR A 1 162 ? 93.180  -9.115  45.582 1.00 83.62  ? 465  THR A O   1 
ATOM   1275 C CB  . THR A 1 162 ? 95.725  -9.223  48.021 1.00 85.91  ? 465  THR A CB  1 
ATOM   1276 O OG1 . THR A 1 162 ? 95.942  -7.817  47.837 1.00 86.52  ? 465  THR A OG1 1 
ATOM   1277 C CG2 . THR A 1 162 ? 97.017  -9.919  48.430 1.00 86.07  ? 465  THR A CG2 1 
ATOM   1278 N N   . LEU A 1 163 ? 93.044  -9.488  47.806 1.00 81.25  ? 466  LEU A N   1 
ATOM   1279 C CA  . LEU A 1 163 ? 91.629  -9.163  47.942 1.00 78.72  ? 466  LEU A CA  1 
ATOM   1280 C C   . LEU A 1 163 ? 91.277  -7.689  47.692 1.00 77.50  ? 466  LEU A C   1 
ATOM   1281 O O   . LEU A 1 163 ? 90.313  -7.389  46.981 1.00 76.21  ? 466  LEU A O   1 
ATOM   1282 C CB  . LEU A 1 163 ? 91.138  -9.580  49.334 1.00 78.49  ? 466  LEU A CB  1 
ATOM   1283 C CG  . LEU A 1 163 ? 92.112  -9.601  50.524 1.00 77.85  ? 466  LEU A CG  1 
ATOM   1284 C CD1 . LEU A 1 163 ? 92.907  -8.307  50.632 1.00 77.54  ? 466  LEU A CD1 1 
ATOM   1285 C CD2 . LEU A 1 163 ? 91.308  -9.839  51.791 1.00 77.63  ? 466  LEU A CD2 1 
ATOM   1286 N N   . LYS A 1 164 ? 92.040  -6.768  48.280 1.00 75.82  ? 467  LYS A N   1 
ATOM   1287 C CA  . LYS A 1 164 ? 91.759  -5.355  48.077 1.00 73.21  ? 467  LYS A CA  1 
ATOM   1288 C C   . LYS A 1 164 ? 92.077  -5.052  46.627 1.00 70.98  ? 467  LYS A C   1 
ATOM   1289 O O   . LYS A 1 164 ? 91.597  -4.070  46.062 1.00 70.46  ? 467  LYS A O   1 
ATOM   1290 C CB  . LYS A 1 164 ? 92.600  -4.473  49.012 1.00 74.03  ? 467  LYS A CB  1 
ATOM   1291 C CG  . LYS A 1 164 ? 92.231  -2.990  48.913 1.00 75.28  ? 467  LYS A CG  1 
ATOM   1292 C CD  . LYS A 1 164 ? 92.675  -2.173  50.125 1.00 77.05  ? 467  LYS A CD  1 
ATOM   1293 C CE  . LYS A 1 164 ? 94.195  -2.118  50.289 1.00 77.64  ? 467  LYS A CE  1 
ATOM   1294 N NZ  . LYS A 1 164 ? 94.609  -1.117  51.326 1.00 75.60  ? 467  LYS A NZ  1 
ATOM   1295 N N   . SER A 1 165 ? 92.887  -5.916  46.026 1.00 68.36  ? 468  SER A N   1 
ATOM   1296 C CA  . SER A 1 165 ? 93.251  -5.755  44.632 1.00 66.80  ? 468  SER A CA  1 
ATOM   1297 C C   . SER A 1 165 ? 92.018  -6.005  43.767 1.00 65.79  ? 468  SER A C   1 
ATOM   1298 O O   . SER A 1 165 ? 91.607  -5.146  42.986 1.00 65.28  ? 468  SER A O   1 
ATOM   1299 C CB  . SER A 1 165 ? 94.350  -6.741  44.258 1.00 66.55  ? 468  SER A CB  1 
ATOM   1300 O OG  . SER A 1 165 ? 94.762  -6.538  42.916 1.00 66.59  ? 468  SER A OG  1 
ATOM   1301 N N   . LEU A 1 166 ? 91.430  -7.188  43.921 1.00 64.68  ? 469  LEU A N   1 
ATOM   1302 C CA  . LEU A 1 166 ? 90.236  -7.563  43.167 1.00 63.25  ? 469  LEU A CA  1 
ATOM   1303 C C   . LEU A 1 166 ? 89.033  -6.684  43.523 1.00 61.63  ? 469  LEU A C   1 
ATOM   1304 O O   . LEU A 1 166 ? 87.956  -6.831  42.952 1.00 61.43  ? 469  LEU A O   1 
ATOM   1305 C CB  . LEU A 1 166 ? 89.904  -9.050  43.401 1.00 62.44  ? 469  LEU A CB  1 
ATOM   1306 C CG  . LEU A 1 166 ? 90.326  -10.101 42.350 1.00 61.78  ? 469  LEU A CG  1 
ATOM   1307 C CD1 . LEU A 1 166 ? 89.416  -9.994  41.121 1.00 61.98  ? 469  LEU A CD1 1 
ATOM   1308 C CD2 . LEU A 1 166 ? 91.804  -9.922  41.961 1.00 61.71  ? 469  LEU A CD2 1 
ATOM   1309 N N   . GLU A 1 167 ? 89.219  -5.774  44.471 1.00 60.38  ? 470  GLU A N   1 
ATOM   1310 C CA  . GLU A 1 167 ? 88.153  -4.866  44.872 1.00 59.64  ? 470  GLU A CA  1 
ATOM   1311 C C   . GLU A 1 167 ? 88.342  -3.630  44.010 1.00 57.54  ? 470  GLU A C   1 
ATOM   1312 O O   . GLU A 1 167 ? 87.429  -3.190  43.321 1.00 57.97  ? 470  GLU A O   1 
ATOM   1313 C CB  . GLU A 1 167 ? 88.284  -4.512  46.358 1.00 62.28  ? 470  GLU A CB  1 
ATOM   1314 C CG  . GLU A 1 167 ? 87.021  -4.769  47.185 1.00 66.91  ? 470  GLU A CG  1 
ATOM   1315 C CD  . GLU A 1 167 ? 87.321  -5.371  48.565 1.00 70.54  ? 470  GLU A CD  1 
ATOM   1316 O OE1 . GLU A 1 167 ? 87.930  -6.469  48.609 1.00 72.03  ? 470  GLU A OE1 1 
ATOM   1317 O OE2 . GLU A 1 167 ? 86.946  -4.757  49.601 1.00 71.84  ? 470  GLU A OE2 1 
ATOM   1318 N N   . GLU A 1 168 ? 89.552  -3.088  44.044 1.00 55.37  ? 471  GLU A N   1 
ATOM   1319 C CA  . GLU A 1 168 ? 89.908  -1.916  43.262 1.00 52.86  ? 471  GLU A CA  1 
ATOM   1320 C C   . GLU A 1 168 ? 89.582  -2.182  41.791 1.00 51.03  ? 471  GLU A C   1 
ATOM   1321 O O   . GLU A 1 168 ? 88.914  -1.394  41.124 1.00 52.40  ? 471  GLU A O   1 
ATOM   1322 C CB  . GLU A 1 168 ? 91.406  -1.646  43.407 1.00 54.37  ? 471  GLU A CB  1 
ATOM   1323 C CG  . GLU A 1 168 ? 91.883  -1.430  44.838 1.00 55.63  ? 471  GLU A CG  1 
ATOM   1324 C CD  . GLU A 1 168 ? 91.791  0.018   45.280 1.00 56.58  ? 471  GLU A CD  1 
ATOM   1325 O OE1 . GLU A 1 168 ? 92.575  0.857   44.780 1.00 53.53  ? 471  GLU A OE1 1 
ATOM   1326 O OE2 . GLU A 1 168 ? 90.926  0.315   46.132 1.00 60.31  ? 471  GLU A OE2 1 
ATOM   1327 N N   . LYS A 1 169 ? 90.079  -3.301  41.289 1.00 48.59  ? 472  LYS A N   1 
ATOM   1328 C CA  . LYS A 1 169 ? 89.846  -3.690  39.909 1.00 44.75  ? 472  LYS A CA  1 
ATOM   1329 C C   . LYS A 1 169 ? 88.338  -3.648  39.700 1.00 41.98  ? 472  LYS A C   1 
ATOM   1330 O O   . LYS A 1 169 ? 87.854  -3.260  38.650 1.00 42.24  ? 472  LYS A O   1 
ATOM   1331 C CB  . LYS A 1 169 ? 90.396  -5.115  39.682 1.00 45.53  ? 472  LYS A CB  1 
ATOM   1332 C CG  . LYS A 1 169 ? 90.512  -5.586  38.237 1.00 46.09  ? 472  LYS A CG  1 
ATOM   1333 C CD  . LYS A 1 169 ? 90.962  -7.049  38.197 1.00 48.71  ? 472  LYS A CD  1 
ATOM   1334 C CE  . LYS A 1 169 ? 91.020  -7.616  36.771 1.00 50.86  ? 472  LYS A CE  1 
ATOM   1335 N NZ  . LYS A 1 169 ? 91.364  -9.085  36.747 1.00 49.68  ? 472  LYS A NZ  1 
ATOM   1336 N N   . ASP A 1 170 ? 87.587  -4.018  40.726 1.00 39.40  ? 473  ASP A N   1 
ATOM   1337 C CA  . ASP A 1 170 ? 86.148  -4.037  40.597 1.00 38.22  ? 473  ASP A CA  1 
ATOM   1338 C C   . ASP A 1 170 ? 85.531  -2.646  40.661 1.00 37.63  ? 473  ASP A C   1 
ATOM   1339 O O   . ASP A 1 170 ? 84.462  -2.411  40.087 1.00 35.95  ? 473  ASP A O   1 
ATOM   1340 C CB  . ASP A 1 170 ? 85.544  -4.935  41.664 1.00 40.49  ? 473  ASP A CB  1 
ATOM   1341 C CG  . ASP A 1 170 ? 84.215  -5.504  41.243 1.00 43.84  ? 473  ASP A CG  1 
ATOM   1342 O OD1 . ASP A 1 170 ? 83.634  -6.316  41.992 1.00 47.60  ? 473  ASP A OD1 1 
ATOM   1343 O OD2 . ASP A 1 170 ? 83.748  -5.140  40.150 1.00 45.51  ? 473  ASP A OD2 1 
ATOM   1344 N N   . HIS A 1 171 ? 86.184  -1.723  41.367 1.00 35.91  ? 474  HIS A N   1 
ATOM   1345 C CA  . HIS A 1 171 ? 85.663  -0.372  41.439 1.00 34.51  ? 474  HIS A CA  1 
ATOM   1346 C C   . HIS A 1 171 ? 85.934  0.267   40.093 1.00 34.93  ? 474  HIS A C   1 
ATOM   1347 O O   . HIS A 1 171 ? 85.016  0.656   39.379 1.00 35.23  ? 474  HIS A O   1 
ATOM   1348 C CB  . HIS A 1 171 ? 86.348  0.443   42.522 1.00 33.65  ? 474  HIS A CB  1 
ATOM   1349 C CG  . HIS A 1 171 ? 85.725  1.791   42.752 1.00 35.94  ? 474  HIS A CG  1 
ATOM   1350 N ND1 . HIS A 1 171 ? 86.447  2.967   42.702 1.00 35.43  ? 474  HIS A ND1 1 
ATOM   1351 C CD2 . HIS A 1 171 ? 84.453  2.149   43.056 1.00 35.23  ? 474  HIS A CD2 1 
ATOM   1352 C CE1 . HIS A 1 171 ? 85.651  3.989   42.967 1.00 33.89  ? 474  HIS A CE1 1 
ATOM   1353 N NE2 . HIS A 1 171 ? 84.436  3.520   43.186 1.00 35.41  ? 474  HIS A NE2 1 
ATOM   1354 N N   . ILE A 1 172 ? 87.202  0.358   39.731 1.00 35.12  ? 475  ILE A N   1 
ATOM   1355 C CA  . ILE A 1 172 ? 87.555  0.967   38.457 1.00 34.66  ? 475  ILE A CA  1 
ATOM   1356 C C   . ILE A 1 172 ? 86.611  0.531   37.353 1.00 35.62  ? 475  ILE A C   1 
ATOM   1357 O O   . ILE A 1 172 ? 86.171  1.343   36.537 1.00 34.46  ? 475  ILE A O   1 
ATOM   1358 C CB  . ILE A 1 172 ? 88.996  0.615   38.051 1.00 32.61  ? 475  ILE A CB  1 
ATOM   1359 C CG1 . ILE A 1 172 ? 89.966  1.220   39.059 1.00 33.60  ? 475  ILE A CG1 1 
ATOM   1360 C CG2 . ILE A 1 172 ? 89.295  1.144   36.668 1.00 29.43  ? 475  ILE A CG2 1 
ATOM   1361 C CD1 . ILE A 1 172 ? 91.387  0.982   38.729 1.00 34.47  ? 475  ILE A CD1 1 
ATOM   1362 N N   . HIS A 1 173 ? 86.287  -0.754  37.330 1.00 37.12  ? 476  HIS A N   1 
ATOM   1363 C CA  . HIS A 1 173 ? 85.415  -1.251  36.287 1.00 39.06  ? 476  HIS A CA  1 
ATOM   1364 C C   . HIS A 1 173 ? 84.036  -0.663  36.441 1.00 39.57  ? 476  HIS A C   1 
ATOM   1365 O O   . HIS A 1 173 ? 83.439  -0.200  35.471 1.00 39.00  ? 476  HIS A O   1 
ATOM   1366 C CB  . HIS A 1 173 ? 85.368  -2.778  36.316 1.00 40.99  ? 476  HIS A CB  1 
ATOM   1367 C CG  . HIS A 1 173 ? 86.534  -3.427  35.630 1.00 44.45  ? 476  HIS A CG  1 
ATOM   1368 N ND1 . HIS A 1 173 ? 87.181  -4.535  36.141 1.00 46.10  ? 476  HIS A ND1 1 
ATOM   1369 C CD2 . HIS A 1 173 ? 87.149  -3.143  34.456 1.00 45.97  ? 476  HIS A CD2 1 
ATOM   1370 C CE1 . HIS A 1 173 ? 88.141  -4.905  35.310 1.00 47.23  ? 476  HIS A CE1 1 
ATOM   1371 N NE2 . HIS A 1 173 ? 88.143  -4.078  34.279 1.00 47.31  ? 476  HIS A NE2 1 
ATOM   1372 N N   . ARG A 1 174 ? 83.536  -0.648  37.670 1.00 41.01  ? 477  ARG A N   1 
ATOM   1373 C CA  . ARG A 1 174 ? 82.208  -0.107  37.913 1.00 41.54  ? 477  ARG A CA  1 
ATOM   1374 C C   . ARG A 1 174 ? 82.141  1.362   37.484 1.00 40.13  ? 477  ARG A C   1 
ATOM   1375 O O   . ARG A 1 174 ? 81.184  1.783   36.849 1.00 39.83  ? 477  ARG A O   1 
ATOM   1376 C CB  . ARG A 1 174 ? 81.821  -0.290  39.384 1.00 43.41  ? 477  ARG A CB  1 
ATOM   1377 C CG  . ARG A 1 174 ? 80.357  -0.672  39.547 1.00 47.99  ? 477  ARG A CG  1 
ATOM   1378 C CD  . ARG A 1 174 ? 79.978  -0.918  40.983 1.00 52.25  ? 477  ARG A CD  1 
ATOM   1379 N NE  . ARG A 1 174 ? 80.586  -2.138  41.507 1.00 58.28  ? 477  ARG A NE  1 
ATOM   1380 C CZ  . ARG A 1 174 ? 80.260  -3.369  41.125 1.00 59.47  ? 477  ARG A CZ  1 
ATOM   1381 N NH1 . ARG A 1 174 ? 79.321  -3.548  40.203 1.00 61.36  ? 477  ARG A NH1 1 
ATOM   1382 N NH2 . ARG A 1 174 ? 80.867  -4.416  41.674 1.00 59.29  ? 477  ARG A NH2 1 
ATOM   1383 N N   . VAL A 1 175 ? 83.158  2.142   37.824 1.00 39.57  ? 478  VAL A N   1 
ATOM   1384 C CA  . VAL A 1 175 ? 83.187  3.531   37.401 1.00 38.42  ? 478  VAL A CA  1 
ATOM   1385 C C   . VAL A 1 175 ? 83.157  3.540   35.879 1.00 39.13  ? 478  VAL A C   1 
ATOM   1386 O O   . VAL A 1 175 ? 82.284  4.140   35.283 1.00 40.62  ? 478  VAL A O   1 
ATOM   1387 C CB  . VAL A 1 175 ? 84.470  4.245   37.837 1.00 38.39  ? 478  VAL A CB  1 
ATOM   1388 C CG1 . VAL A 1 175 ? 84.597  5.548   37.092 1.00 38.70  ? 478  VAL A CG1 1 
ATOM   1389 C CG2 . VAL A 1 175 ? 84.453  4.505   39.321 1.00 38.14  ? 478  VAL A CG2 1 
ATOM   1390 N N   . LEU A 1 176 ? 84.119  2.876   35.249 1.00 40.24  ? 479  LEU A N   1 
ATOM   1391 C CA  . LEU A 1 176 ? 84.171  2.822   33.789 1.00 40.86  ? 479  LEU A CA  1 
ATOM   1392 C C   . LEU A 1 176 ? 82.785  2.680   33.141 1.00 42.34  ? 479  LEU A C   1 
ATOM   1393 O O   . LEU A 1 176 ? 82.409  3.505   32.308 1.00 42.91  ? 479  LEU A O   1 
ATOM   1394 C CB  . LEU A 1 176 ? 85.085  1.676   33.336 1.00 39.36  ? 479  LEU A CB  1 
ATOM   1395 C CG  . LEU A 1 176 ? 86.580  1.976   33.234 1.00 36.90  ? 479  LEU A CG  1 
ATOM   1396 C CD1 . LEU A 1 176 ? 87.388  0.690   33.190 1.00 38.07  ? 479  LEU A CD1 1 
ATOM   1397 C CD2 . LEU A 1 176 ? 86.818  2.789   31.988 1.00 35.04  ? 479  LEU A CD2 1 
ATOM   1398 N N   . ASP A 1 177 ? 82.029  1.649   33.524 1.00 42.70  ? 480  ASP A N   1 
ATOM   1399 C CA  . ASP A 1 177 ? 80.689  1.435   32.965 1.00 43.06  ? 480  ASP A CA  1 
ATOM   1400 C C   . ASP A 1 177 ? 79.817  2.666   33.124 1.00 42.94  ? 480  ASP A C   1 
ATOM   1401 O O   . ASP A 1 177 ? 79.093  3.051   32.216 1.00 43.19  ? 480  ASP A O   1 
ATOM   1402 C CB  . ASP A 1 177 ? 79.995  0.260   33.645 1.00 44.00  ? 480  ASP A CB  1 
ATOM   1403 C CG  . ASP A 1 177 ? 80.683  -1.055  33.374 1.00 45.20  ? 480  ASP A CG  1 
ATOM   1404 O OD1 . ASP A 1 177 ? 81.006  -1.319  32.189 1.00 46.51  ? 480  ASP A OD1 1 
ATOM   1405 O OD2 . ASP A 1 177 ? 80.889  -1.825  34.342 1.00 45.31  ? 480  ASP A OD2 1 
ATOM   1406 N N   . LYS A 1 178 ? 79.874  3.272   34.296 1.00 43.21  ? 481  LYS A N   1 
ATOM   1407 C CA  . LYS A 1 178 ? 79.105  4.470   34.555 1.00 44.45  ? 481  LYS A CA  1 
ATOM   1408 C C   . LYS A 1 178 ? 79.460  5.472   33.454 1.00 44.37  ? 481  LYS A C   1 
ATOM   1409 O O   . LYS A 1 178 ? 78.584  6.115   32.882 1.00 45.67  ? 481  LYS A O   1 
ATOM   1410 C CB  . LYS A 1 178 ? 79.487  5.032   35.925 1.00 46.89  ? 481  LYS A CB  1 
ATOM   1411 C CG  . LYS A 1 178 ? 78.509  6.023   36.518 1.00 51.13  ? 481  LYS A CG  1 
ATOM   1412 C CD  . LYS A 1 178 ? 77.292  5.309   37.097 1.00 54.85  ? 481  LYS A CD  1 
ATOM   1413 C CE  . LYS A 1 178 ? 76.206  6.295   37.536 1.00 55.35  ? 481  LYS A CE  1 
ATOM   1414 N NZ  . LYS A 1 178 ? 75.047  5.600   38.171 1.00 56.23  ? 481  LYS A NZ  1 
ATOM   1415 N N   . ILE A 1 179 ? 80.752  5.585   33.151 1.00 43.72  ? 482  ILE A N   1 
ATOM   1416 C CA  . ILE A 1 179 ? 81.247  6.511   32.124 1.00 42.99  ? 482  ILE A CA  1 
ATOM   1417 C C   . ILE A 1 179 ? 80.644  6.187   30.762 1.00 42.88  ? 482  ILE A C   1 
ATOM   1418 O O   . ILE A 1 179 ? 80.417  7.080   29.928 1.00 41.67  ? 482  ILE A O   1 
ATOM   1419 C CB  . ILE A 1 179 ? 82.791  6.439   31.989 1.00 42.37  ? 482  ILE A CB  1 
ATOM   1420 C CG1 . ILE A 1 179 ? 83.454  6.805   33.312 1.00 42.56  ? 482  ILE A CG1 1 
ATOM   1421 C CG2 . ILE A 1 179 ? 83.266  7.389   30.906 1.00 41.37  ? 482  ILE A CG2 1 
ATOM   1422 C CD1 . ILE A 1 179 ? 84.960  6.774   33.269 1.00 43.32  ? 482  ILE A CD1 1 
ATOM   1423 N N   . THR A 1 180 ? 80.412  4.895   30.546 1.00 42.64  ? 483  THR A N   1 
ATOM   1424 C CA  . THR A 1 180 ? 79.835  4.405   29.305 1.00 41.99  ? 483  THR A CA  1 
ATOM   1425 C C   . THR A 1 180 ? 78.377  4.803   29.235 1.00 40.88  ? 483  THR A C   1 
ATOM   1426 O O   . THR A 1 180 ? 77.923  5.294   28.204 1.00 40.71  ? 483  THR A O   1 
ATOM   1427 C CB  . THR A 1 180 ? 79.950  2.876   29.205 1.00 43.87  ? 483  THR A CB  1 
ATOM   1428 O OG1 . THR A 1 180 ? 81.301  2.523   28.865 1.00 43.80  ? 483  THR A OG1 1 
ATOM   1429 C CG2 . THR A 1 180 ? 78.958  2.315   28.165 1.00 43.04  ? 483  THR A CG2 1 
ATOM   1430 N N   . ASP A 1 181 ? 77.645  4.598   30.329 1.00 39.45  ? 484  ASP A N   1 
ATOM   1431 C CA  . ASP A 1 181 ? 76.240  4.971   30.356 1.00 38.98  ? 484  ASP A CA  1 
ATOM   1432 C C   . ASP A 1 181 ? 76.151  6.435   29.979 1.00 37.57  ? 484  ASP A C   1 
ATOM   1433 O O   . ASP A 1 181 ? 75.237  6.858   29.278 1.00 34.85  ? 484  ASP A O   1 
ATOM   1434 C CB  . ASP A 1 181 ? 75.652  4.751   31.744 1.00 41.27  ? 484  ASP A CB  1 
ATOM   1435 C CG  . ASP A 1 181 ? 75.596  3.287   32.125 1.00 43.07  ? 484  ASP A CG  1 
ATOM   1436 O OD1 . ASP A 1 181 ? 75.572  2.440   31.201 1.00 45.52  ? 484  ASP A OD1 1 
ATOM   1437 O OD2 . ASP A 1 181 ? 75.558  2.988   33.339 1.00 42.70  ? 484  ASP A OD2 1 
ATOM   1438 N N   . THR A 1 182 ? 77.128  7.200   30.449 1.00 38.07  ? 485  THR A N   1 
ATOM   1439 C CA  . THR A 1 182 ? 77.204  8.619   30.150 1.00 39.86  ? 485  THR A CA  1 
ATOM   1440 C C   . THR A 1 182 ? 77.415  8.777   28.652 1.00 42.30  ? 485  THR A C   1 
ATOM   1441 O O   . THR A 1 182 ? 76.552  9.314   27.959 1.00 43.73  ? 485  THR A O   1 
ATOM   1442 C CB  . THR A 1 182 ? 78.368  9.274   30.885 1.00 39.24  ? 485  THR A CB  1 
ATOM   1443 O OG1 . THR A 1 182 ? 78.263  8.977   32.282 1.00 40.49  ? 485  THR A OG1 1 
ATOM   1444 C CG2 . THR A 1 182 ? 78.343  10.772  30.686 1.00 37.22  ? 485  THR A CG2 1 
ATOM   1445 N N   . LEU A 1 183 ? 78.560  8.313   28.151 1.00 44.12  ? 486  LEU A N   1 
ATOM   1446 C CA  . LEU A 1 183 ? 78.836  8.398   26.721 1.00 45.23  ? 486  LEU A CA  1 
ATOM   1447 C C   . LEU A 1 183 ? 77.600  8.034   25.905 1.00 46.32  ? 486  LEU A C   1 
ATOM   1448 O O   . LEU A 1 183 ? 77.107  8.862   25.147 1.00 47.83  ? 486  LEU A O   1 
ATOM   1449 C CB  . LEU A 1 183 ? 79.982  7.468   26.328 1.00 45.63  ? 486  LEU A CB  1 
ATOM   1450 C CG  . LEU A 1 183 ? 81.413  7.963   26.524 1.00 45.38  ? 486  LEU A CG  1 
ATOM   1451 C CD1 . LEU A 1 183 ? 82.373  6.916   25.978 1.00 43.98  ? 486  LEU A CD1 1 
ATOM   1452 C CD2 . LEU A 1 183 ? 81.607  9.286   25.801 1.00 44.07  ? 486  LEU A CD2 1 
ATOM   1453 N N   . ILE A 1 184 ? 77.105  6.804   26.062 1.00 46.42  ? 487  ILE A N   1 
ATOM   1454 C CA  . ILE A 1 184 ? 75.917  6.342   25.343 1.00 46.51  ? 487  ILE A CA  1 
ATOM   1455 C C   . ILE A 1 184 ? 74.772  7.329   25.483 1.00 48.05  ? 487  ILE A C   1 
ATOM   1456 O O   . ILE A 1 184 ? 73.929  7.421   24.594 1.00 48.66  ? 487  ILE A O   1 
ATOM   1457 C CB  . ILE A 1 184 ? 75.453  4.941   25.839 1.00 45.71  ? 487  ILE A CB  1 
ATOM   1458 C CG1 . ILE A 1 184 ? 76.233  3.848   25.114 1.00 45.54  ? 487  ILE A CG1 1 
ATOM   1459 C CG2 . ILE A 1 184 ? 73.995  4.726   25.572 1.00 45.65  ? 487  ILE A CG2 1 
ATOM   1460 C CD1 . ILE A 1 184 ? 76.089  3.878   23.622 1.00 43.09  ? 487  ILE A CD1 1 
ATOM   1461 N N   . HIS A 1 185 ? 74.754  8.070   26.593 1.00 50.18  ? 488  HIS A N   1 
ATOM   1462 C CA  . HIS A 1 185 ? 73.722  9.085   26.861 1.00 53.37  ? 488  HIS A CA  1 
ATOM   1463 C C   . HIS A 1 185 ? 73.919  10.358  26.009 1.00 53.22  ? 488  HIS A C   1 
ATOM   1464 O O   . HIS A 1 185 ? 72.984  10.849  25.374 1.00 52.09  ? 488  HIS A O   1 
ATOM   1465 C CB  . HIS A 1 185 ? 73.741  9.464   28.341 1.00 56.65  ? 488  HIS A CB  1 
ATOM   1466 C CG  . HIS A 1 185 ? 72.553  10.266  28.777 1.00 60.82  ? 488  HIS A CG  1 
ATOM   1467 N ND1 . HIS A 1 185 ? 72.002  11.265  28.003 1.00 62.15  ? 488  HIS A ND1 1 
ATOM   1468 C CD2 . HIS A 1 185 ? 71.848  10.256  29.935 1.00 62.07  ? 488  HIS A CD2 1 
ATOM   1469 C CE1 . HIS A 1 185 ? 71.012  11.837  28.666 1.00 63.79  ? 488  HIS A CE1 1 
ATOM   1470 N NE2 . HIS A 1 185 ? 70.898  11.244  29.842 1.00 63.31  ? 488  HIS A NE2 1 
ATOM   1471 N N   . LEU A 1 186 ? 75.133  10.897  26.013 1.00 53.19  ? 489  LEU A N   1 
ATOM   1472 C CA  . LEU A 1 186 ? 75.441  12.079  25.217 1.00 54.96  ? 489  LEU A CA  1 
ATOM   1473 C C   . LEU A 1 186 ? 75.126  11.839  23.730 1.00 54.90  ? 489  LEU A C   1 
ATOM   1474 O O   . LEU A 1 186 ? 75.121  12.773  22.924 1.00 55.63  ? 489  LEU A O   1 
ATOM   1475 C CB  . LEU A 1 186 ? 76.925  12.436  25.370 1.00 57.04  ? 489  LEU A CB  1 
ATOM   1476 C CG  . LEU A 1 186 ? 77.384  13.139  26.651 1.00 58.11  ? 489  LEU A CG  1 
ATOM   1477 C CD1 . LEU A 1 186 ? 78.855  12.857  26.898 1.00 58.22  ? 489  LEU A CD1 1 
ATOM   1478 C CD2 . LEU A 1 186 ? 77.125  14.639  26.531 1.00 58.68  ? 489  LEU A CD2 1 
ATOM   1479 N N   . MET A 1 187 ? 74.876  10.586  23.368 1.00 53.24  ? 490  MET A N   1 
ATOM   1480 C CA  . MET A 1 187 ? 74.576  10.252  21.987 1.00 52.57  ? 490  MET A CA  1 
ATOM   1481 C C   . MET A 1 187 ? 73.092  10.178  21.744 1.00 52.84  ? 490  MET A C   1 
ATOM   1482 O O   . MET A 1 187 ? 72.629  10.441  20.639 1.00 52.61  ? 490  MET A O   1 
ATOM   1483 C CB  . MET A 1 187 ? 75.235  8.937   21.604 1.00 52.90  ? 490  MET A CB  1 
ATOM   1484 C CG  . MET A 1 187 ? 76.747  9.052   21.524 1.00 52.81  ? 490  MET A CG  1 
ATOM   1485 S SD  . MET A 1 187 ? 77.533  7.529   21.007 1.00 51.19  ? 490  MET A SD  1 
ATOM   1486 C CE  . MET A 1 187 ? 77.591  6.655   22.548 1.00 50.33  ? 490  MET A CE  1 
ATOM   1487 N N   . ALA A 1 188 ? 72.342  9.801   22.770 1.00 53.58  ? 491  ALA A N   1 
ATOM   1488 C CA  . ALA A 1 188 ? 70.893  9.752   22.640 1.00 54.23  ? 491  ALA A CA  1 
ATOM   1489 C C   . ALA A 1 188 ? 70.502  11.229  22.603 1.00 54.57  ? 491  ALA A C   1 
ATOM   1490 O O   . ALA A 1 188 ? 69.706  11.659  21.775 1.00 54.52  ? 491  ALA A O   1 
ATOM   1491 C CB  . ALA A 1 188 ? 70.280  9.064   23.841 1.00 53.66  ? 491  ALA A CB  1 
ATOM   1492 N N   . LYS A 1 189 ? 71.114  11.995  23.503 1.00 55.24  ? 492  LYS A N   1 
ATOM   1493 C CA  . LYS A 1 189 ? 70.917  13.440  23.619 1.00 54.99  ? 492  LYS A CA  1 
ATOM   1494 C C   . LYS A 1 189 ? 71.332  14.181  22.328 1.00 54.46  ? 492  LYS A C   1 
ATOM   1495 O O   . LYS A 1 189 ? 71.182  15.404  22.231 1.00 55.14  ? 492  LYS A O   1 
ATOM   1496 C CB  . LYS A 1 189 ? 71.718  13.956  24.834 1.00 55.68  ? 492  LYS A CB  1 
ATOM   1497 C CG  . LYS A 1 189 ? 72.531  15.255  24.643 1.00 58.75  ? 492  LYS A CG  1 
ATOM   1498 C CD  . LYS A 1 189 ? 73.855  15.058  23.877 1.00 59.72  ? 492  LYS A CD  1 
ATOM   1499 C CE  . LYS A 1 189 ? 74.661  16.369  23.803 1.00 61.70  ? 492  LYS A CE  1 
ATOM   1500 N NZ  . LYS A 1 189 ? 76.033  16.231  23.217 1.00 60.47  ? 492  LYS A NZ  1 
ATOM   1501 N N   . ALA A 1 190 ? 71.854  13.434  21.348 1.00 52.98  ? 493  ALA A N   1 
ATOM   1502 C CA  . ALA A 1 190 ? 72.282  13.989  20.058 1.00 49.78  ? 493  ALA A CA  1 
ATOM   1503 C C   . ALA A 1 190 ? 71.400  13.426  18.952 1.00 47.44  ? 493  ALA A C   1 
ATOM   1504 O O   . ALA A 1 190 ? 71.464  13.857  17.805 1.00 45.84  ? 493  ALA A O   1 
ATOM   1505 C CB  . ALA A 1 190 ? 73.741  13.647  19.791 1.00 49.76  ? 493  ALA A CB  1 
ATOM   1506 N N   . GLY A 1 191 ? 70.584  12.444  19.319 1.00 46.80  ? 494  GLY A N   1 
ATOM   1507 C CA  . GLY A 1 191 ? 69.664  11.839  18.378 1.00 46.52  ? 494  GLY A CA  1 
ATOM   1508 C C   . GLY A 1 191 ? 70.204  10.712  17.529 1.00 47.05  ? 494  GLY A C   1 
ATOM   1509 O O   . GLY A 1 191 ? 69.867  10.623  16.357 1.00 48.51  ? 494  GLY A O   1 
ATOM   1510 N N   . LEU A 1 192 ? 71.038  9.847   18.091 1.00 47.11  ? 495  LEU A N   1 
ATOM   1511 C CA  . LEU A 1 192 ? 71.570  8.733   17.314 1.00 46.28  ? 495  LEU A CA  1 
ATOM   1512 C C   . LEU A 1 192 ? 70.675  7.542   17.513 1.00 45.34  ? 495  LEU A C   1 
ATOM   1513 O O   . LEU A 1 192 ? 69.987  7.447   18.517 1.00 45.69  ? 495  LEU A O   1 
ATOM   1514 C CB  . LEU A 1 192 ? 72.983  8.364   17.758 1.00 46.54  ? 495  LEU A CB  1 
ATOM   1515 C CG  . LEU A 1 192 ? 74.064  9.432   17.615 1.00 45.64  ? 495  LEU A CG  1 
ATOM   1516 C CD1 . LEU A 1 192 ? 75.410  8.775   17.885 1.00 47.45  ? 495  LEU A CD1 1 
ATOM   1517 C CD2 . LEU A 1 192 ? 74.044  10.044  16.229 1.00 43.95  ? 495  LEU A CD2 1 
ATOM   1518 N N   . THR A 1 193 ? 70.676  6.631   16.556 1.00 44.99  ? 496  THR A N   1 
ATOM   1519 C CA  . THR A 1 193 ? 69.840  5.450   16.675 1.00 46.53  ? 496  THR A CA  1 
ATOM   1520 C C   . THR A 1 193 ? 70.464  4.622   17.772 1.00 46.25  ? 496  THR A C   1 
ATOM   1521 O O   . THR A 1 193 ? 71.363  5.080   18.460 1.00 44.89  ? 496  THR A O   1 
ATOM   1522 C CB  . THR A 1 193 ? 69.834  4.593   15.373 1.00 47.96  ? 496  THR A CB  1 
ATOM   1523 O OG1 . THR A 1 193 ? 71.027  3.791   15.311 1.00 49.01  ? 496  THR A OG1 1 
ATOM   1524 C CG2 . THR A 1 193 ? 69.762  5.489   14.134 1.00 45.62  ? 496  THR A CG2 1 
ATOM   1525 N N   . LEU A 1 194 ? 69.972  3.403   17.931 1.00 47.97  ? 497  LEU A N   1 
ATOM   1526 C CA  . LEU A 1 194 ? 70.515  2.485   18.911 1.00 49.85  ? 497  LEU A CA  1 
ATOM   1527 C C   . LEU A 1 194 ? 71.800  2.068   18.242 1.00 51.17  ? 497  LEU A C   1 
ATOM   1528 O O   . LEU A 1 194 ? 72.890  2.203   18.801 1.00 51.35  ? 497  LEU A O   1 
ATOM   1529 C CB  . LEU A 1 194 ? 69.633  1.247   19.039 1.00 51.04  ? 497  LEU A CB  1 
ATOM   1530 C CG  . LEU A 1 194 ? 68.142  1.436   19.321 1.00 52.30  ? 497  LEU A CG  1 
ATOM   1531 C CD1 . LEU A 1 194 ? 67.370  0.117   19.037 1.00 52.06  ? 497  LEU A CD1 1 
ATOM   1532 C CD2 . LEU A 1 194 ? 67.981  1.914   20.775 1.00 51.49  ? 497  LEU A CD2 1 
ATOM   1533 N N   . GLN A 1 195 ? 71.636  1.573   17.015 1.00 52.44  ? 498  GLN A N   1 
ATOM   1534 C CA  . GLN A 1 195 ? 72.737  1.094   16.181 1.00 52.80  ? 498  GLN A CA  1 
ATOM   1535 C C   . GLN A 1 195 ? 73.880  2.099   16.150 1.00 51.48  ? 498  GLN A C   1 
ATOM   1536 O O   . GLN A 1 195 ? 75.035  1.733   16.341 1.00 50.49  ? 498  GLN A O   1 
ATOM   1537 C CB  . GLN A 1 195 ? 72.237  0.841   14.757 1.00 53.74  ? 498  GLN A CB  1 
ATOM   1538 C CG  . GLN A 1 195 ? 73.106  -0.105  13.948 1.00 54.61  ? 498  GLN A CG  1 
ATOM   1539 C CD  . GLN A 1 195 ? 72.712  -0.130  12.484 1.00 55.97  ? 498  GLN A CD  1 
ATOM   1540 O OE1 . GLN A 1 195 ? 71.530  -0.239  12.151 1.00 56.34  ? 498  GLN A OE1 1 
ATOM   1541 N NE2 . GLN A 1 195 ? 73.702  -0.030  11.598 1.00 57.67  ? 498  GLN A NE2 1 
ATOM   1542 N N   . GLN A 1 196 ? 73.548  3.363   15.907 1.00 50.28  ? 499  GLN A N   1 
ATOM   1543 C CA  . GLN A 1 196 ? 74.553  4.412   15.868 1.00 50.32  ? 499  GLN A CA  1 
ATOM   1544 C C   . GLN A 1 196 ? 75.234  4.511   17.223 1.00 50.63  ? 499  GLN A C   1 
ATOM   1545 O O   . GLN A 1 196 ? 76.462  4.630   17.311 1.00 51.31  ? 499  GLN A O   1 
ATOM   1546 C CB  . GLN A 1 196 ? 73.910  5.749   15.521 1.00 50.00  ? 499  GLN A CB  1 
ATOM   1547 C CG  . GLN A 1 196 ? 73.185  5.739   14.192 1.00 50.91  ? 499  GLN A CG  1 
ATOM   1548 C CD  . GLN A 1 196 ? 72.580  7.082   13.832 1.00 50.79  ? 499  GLN A CD  1 
ATOM   1549 O OE1 . GLN A 1 196 ? 71.806  7.651   14.604 1.00 51.82  ? 499  GLN A OE1 1 
ATOM   1550 N NE2 . GLN A 1 196 ? 72.922  7.592   12.649 1.00 49.63  ? 499  GLN A NE2 1 
ATOM   1551 N N   . GLN A 1 197 ? 74.435  4.464   18.283 1.00 50.09  ? 500  GLN A N   1 
ATOM   1552 C CA  . GLN A 1 197 ? 74.985  4.549   19.622 1.00 49.88  ? 500  GLN A CA  1 
ATOM   1553 C C   . GLN A 1 197 ? 76.007  3.447   19.846 1.00 49.91  ? 500  GLN A C   1 
ATOM   1554 O O   . GLN A 1 197 ? 77.064  3.695   20.414 1.00 49.73  ? 500  GLN A O   1 
ATOM   1555 C CB  . GLN A 1 197 ? 73.868  4.485   20.659 1.00 49.27  ? 500  GLN A CB  1 
ATOM   1556 C CG  . GLN A 1 197 ? 73.057  5.769   20.736 1.00 50.19  ? 500  GLN A CG  1 
ATOM   1557 C CD  . GLN A 1 197 ? 71.745  5.596   21.485 1.00 50.25  ? 500  GLN A CD  1 
ATOM   1558 O OE1 . GLN A 1 197 ? 71.703  5.621   22.712 1.00 50.08  ? 500  GLN A OE1 1 
ATOM   1559 N NE2 . GLN A 1 197 ? 70.666  5.407   20.741 1.00 51.09  ? 500  GLN A NE2 1 
ATOM   1560 N N   . HIS A 1 198 ? 75.707  2.235   19.399 1.00 50.72  ? 501  HIS A N   1 
ATOM   1561 C CA  . HIS A 1 198 ? 76.666  1.147   19.551 1.00 52.14  ? 501  HIS A CA  1 
ATOM   1562 C C   . HIS A 1 198 ? 77.900  1.588   18.764 1.00 51.29  ? 501  HIS A C   1 
ATOM   1563 O O   . HIS A 1 198 ? 78.902  2.024   19.322 1.00 52.08  ? 501  HIS A O   1 
ATOM   1564 C CB  . HIS A 1 198 ? 76.162  -0.153  18.909 1.00 56.20  ? 501  HIS A CB  1 
ATOM   1565 C CG  . HIS A 1 198 ? 74.813  -0.600  19.380 1.00 60.72  ? 501  HIS A CG  1 
ATOM   1566 N ND1 . HIS A 1 198 ? 73.958  -1.332  18.580 1.00 62.06  ? 501  HIS A ND1 1 
ATOM   1567 C CD2 . HIS A 1 198 ? 74.182  -0.448  20.570 1.00 61.66  ? 501  HIS A CD2 1 
ATOM   1568 C CE1 . HIS A 1 198 ? 72.856  -1.608  19.257 1.00 62.85  ? 501  HIS A CE1 1 
ATOM   1569 N NE2 . HIS A 1 198 ? 72.967  -1.085  20.466 1.00 62.88  ? 501  HIS A NE2 1 
ATOM   1570 N N   . GLN A 1 199 ? 77.781  1.473   17.446 1.00 49.02  ? 502  GLN A N   1 
ATOM   1571 C CA  . GLN A 1 199 ? 78.824  1.807   16.488 1.00 46.33  ? 502  GLN A CA  1 
ATOM   1572 C C   . GLN A 1 199 ? 79.751  2.968   16.837 1.00 45.17  ? 502  GLN A C   1 
ATOM   1573 O O   . GLN A 1 199 ? 80.936  2.933   16.489 1.00 45.27  ? 502  GLN A O   1 
ATOM   1574 C CB  . GLN A 1 199 ? 78.189  2.080   15.124 1.00 45.99  ? 502  GLN A CB  1 
ATOM   1575 C CG  . GLN A 1 199 ? 77.224  1.008   14.649 1.00 46.37  ? 502  GLN A CG  1 
ATOM   1576 C CD  . GLN A 1 199 ? 77.069  0.999   13.140 1.00 47.42  ? 502  GLN A CD  1 
ATOM   1577 O OE1 . GLN A 1 199 ? 76.969  2.057   12.516 1.00 47.49  ? 502  GLN A OE1 1 
ATOM   1578 N NE2 . GLN A 1 199 ? 77.043  -0.197  12.544 1.00 46.89  ? 502  GLN A NE2 1 
ATOM   1579 N N   . ARG A 1 200 ? 79.222  4.000   17.494 1.00 42.76  ? 503  ARG A N   1 
ATOM   1580 C CA  . ARG A 1 200 ? 80.037  5.155   17.855 1.00 39.84  ? 503  ARG A CA  1 
ATOM   1581 C C   . ARG A 1 200 ? 80.869  4.849   19.090 1.00 38.14  ? 503  ARG A C   1 
ATOM   1582 O O   . ARG A 1 200 ? 82.035  5.214   19.172 1.00 38.10  ? 503  ARG A O   1 
ATOM   1583 C CB  . ARG A 1 200 ? 79.150  6.371   18.099 1.00 40.26  ? 503  ARG A CB  1 
ATOM   1584 C CG  . ARG A 1 200 ? 79.914  7.627   18.525 1.00 41.07  ? 503  ARG A CG  1 
ATOM   1585 C CD  . ARG A 1 200 ? 80.040  8.678   17.417 1.00 40.66  ? 503  ARG A CD  1 
ATOM   1586 N NE  . ARG A 1 200 ? 80.249  10.009  17.993 1.00 41.08  ? 503  ARG A NE  1 
ATOM   1587 C CZ  . ARG A 1 200 ? 80.510  11.112  17.293 1.00 41.43  ? 503  ARG A CZ  1 
ATOM   1588 N NH1 . ARG A 1 200 ? 80.598  11.059  15.970 1.00 40.77  ? 503  ARG A NH1 1 
ATOM   1589 N NH2 . ARG A 1 200 ? 80.691  12.274  17.915 1.00 39.57  ? 503  ARG A NH2 1 
ATOM   1590 N N   . LEU A 1 201 ? 80.265  4.178   20.055 1.00 35.73  ? 504  LEU A N   1 
ATOM   1591 C CA  . LEU A 1 201 ? 80.991  3.806   21.254 1.00 34.59  ? 504  LEU A CA  1 
ATOM   1592 C C   . LEU A 1 201 ? 82.211  3.033   20.774 1.00 34.85  ? 504  LEU A C   1 
ATOM   1593 O O   . LEU A 1 201 ? 83.316  3.259   21.231 1.00 35.00  ? 504  LEU A O   1 
ATOM   1594 C CB  . LEU A 1 201 ? 80.125  2.914   22.144 1.00 33.63  ? 504  LEU A CB  1 
ATOM   1595 C CG  . LEU A 1 201 ? 80.662  2.608   23.539 1.00 32.78  ? 504  LEU A CG  1 
ATOM   1596 C CD1 . LEU A 1 201 ? 80.889  3.907   24.274 1.00 33.07  ? 504  LEU A CD1 1 
ATOM   1597 C CD2 . LEU A 1 201 ? 79.691  1.730   24.299 1.00 32.48  ? 504  LEU A CD2 1 
ATOM   1598 N N   . ALA A 1 202 ? 82.003  2.112   19.844 1.00 34.60  ? 505  ALA A N   1 
ATOM   1599 C CA  . ALA A 1 202 ? 83.109  1.346   19.306 1.00 34.07  ? 505  ALA A CA  1 
ATOM   1600 C C   . ALA A 1 202 ? 84.102  2.334   18.745 1.00 33.63  ? 505  ALA A C   1 
ATOM   1601 O O   . ALA A 1 202 ? 85.149  2.551   19.330 1.00 35.88  ? 505  ALA A O   1 
ATOM   1602 C CB  . ALA A 1 202 ? 82.633  0.417   18.212 1.00 34.77  ? 505  ALA A CB  1 
ATOM   1603 N N   . GLN A 1 203 ? 83.749  2.947   17.621 1.00 34.41  ? 506  GLN A N   1 
ATOM   1604 C CA  . GLN A 1 203 ? 84.596  3.929   16.936 1.00 35.46  ? 506  GLN A CA  1 
ATOM   1605 C C   . GLN A 1 203 ? 85.529  4.712   17.840 1.00 33.97  ? 506  GLN A C   1 
ATOM   1606 O O   . GLN A 1 203 ? 86.728  4.839   17.566 1.00 33.08  ? 506  GLN A O   1 
ATOM   1607 C CB  . GLN A 1 203 ? 83.722  4.893   16.144 1.00 36.97  ? 506  GLN A CB  1 
ATOM   1608 C CG  . GLN A 1 203 ? 83.527  4.432   14.712 1.00 44.96  ? 506  GLN A CG  1 
ATOM   1609 C CD  . GLN A 1 203 ? 82.210  4.894   14.120 1.00 47.98  ? 506  GLN A CD  1 
ATOM   1610 O OE1 . GLN A 1 203 ? 81.150  4.546   14.630 1.00 50.26  ? 506  GLN A OE1 1 
ATOM   1611 N NE2 . GLN A 1 203 ? 82.270  5.675   13.039 1.00 46.91  ? 506  GLN A NE2 1 
ATOM   1612 N N   . LEU A 1 204 ? 84.961  5.225   18.920 1.00 32.48  ? 507  LEU A N   1 
ATOM   1613 C CA  . LEU A 1 204 ? 85.702  5.991   19.895 1.00 31.45  ? 507  LEU A CA  1 
ATOM   1614 C C   . LEU A 1 204 ? 86.724  5.095   20.574 1.00 31.27  ? 507  LEU A C   1 
ATOM   1615 O O   . LEU A 1 204 ? 87.923  5.238   20.360 1.00 33.79  ? 507  LEU A O   1 
ATOM   1616 C CB  . LEU A 1 204 ? 84.731  6.582   20.920 1.00 32.13  ? 507  LEU A CB  1 
ATOM   1617 C CG  . LEU A 1 204 ? 83.854  7.738   20.403 1.00 34.91  ? 507  LEU A CG  1 
ATOM   1618 C CD1 . LEU A 1 204 ? 82.487  7.761   21.075 1.00 35.96  ? 507  LEU A CD1 1 
ATOM   1619 C CD2 . LEU A 1 204 ? 84.574  9.049   20.640 1.00 34.83  ? 507  LEU A CD2 1 
ATOM   1620 N N   . LEU A 1 205 ? 86.242  4.156   21.376 1.00 30.90  ? 508  LEU A N   1 
ATOM   1621 C CA  . LEU A 1 205 ? 87.100  3.235   22.109 1.00 28.86  ? 508  LEU A CA  1 
ATOM   1622 C C   . LEU A 1 205 ? 88.240  2.683   21.276 1.00 30.18  ? 508  LEU A C   1 
ATOM   1623 O O   . LEU A 1 205 ? 89.412  2.720   21.689 1.00 30.31  ? 508  LEU A O   1 
ATOM   1624 C CB  . LEU A 1 205 ? 86.265  2.082   22.658 1.00 26.30  ? 508  LEU A CB  1 
ATOM   1625 C CG  . LEU A 1 205 ? 85.241  2.581   23.681 1.00 27.44  ? 508  LEU A CG  1 
ATOM   1626 C CD1 . LEU A 1 205 ? 84.339  1.470   24.166 1.00 27.91  ? 508  LEU A CD1 1 
ATOM   1627 C CD2 . LEU A 1 205 ? 85.981  3.198   24.839 1.00 26.03  ? 508  LEU A CD2 1 
ATOM   1628 N N   . LEU A 1 206 ? 87.893  2.174   20.100 1.00 28.49  ? 509  LEU A N   1 
ATOM   1629 C CA  . LEU A 1 206 ? 88.881  1.589   19.225 1.00 27.85  ? 509  LEU A CA  1 
ATOM   1630 C C   . LEU A 1 206 ? 90.064  2.507   19.044 1.00 28.40  ? 509  LEU A C   1 
ATOM   1631 O O   . LEU A 1 206 ? 91.212  2.074   19.098 1.00 27.23  ? 509  LEU A O   1 
ATOM   1632 C CB  . LEU A 1 206 ? 88.266  1.264   17.872 1.00 26.63  ? 509  LEU A CB  1 
ATOM   1633 C CG  . LEU A 1 206 ? 87.320  0.078   17.773 1.00 21.91  ? 509  LEU A CG  1 
ATOM   1634 C CD1 . LEU A 1 206 ? 87.025  -0.071  16.314 1.00 22.89  ? 509  LEU A CD1 1 
ATOM   1635 C CD2 . LEU A 1 206 ? 87.932  -1.214  18.309 1.00 19.03  ? 509  LEU A CD2 1 
ATOM   1636 N N   . ILE A 1 207 ? 89.781  3.779   18.819 1.00 29.79  ? 510  ILE A N   1 
ATOM   1637 C CA  . ILE A 1 207 ? 90.855  4.736   18.647 1.00 32.43  ? 510  ILE A CA  1 
ATOM   1638 C C   . ILE A 1 207 ? 91.823  4.597   19.806 1.00 33.49  ? 510  ILE A C   1 
ATOM   1639 O O   . ILE A 1 207 ? 93.046  4.556   19.634 1.00 34.41  ? 510  ILE A O   1 
ATOM   1640 C CB  . ILE A 1 207 ? 90.332  6.166   18.652 1.00 31.60  ? 510  ILE A CB  1 
ATOM   1641 C CG1 . ILE A 1 207 ? 89.582  6.437   17.361 1.00 32.99  ? 510  ILE A CG1 1 
ATOM   1642 C CG2 . ILE A 1 207 ? 91.478  7.130   18.798 1.00 31.89  ? 510  ILE A CG2 1 
ATOM   1643 C CD1 . ILE A 1 207 ? 89.185  7.877   17.197 1.00 35.13  ? 510  ILE A CD1 1 
ATOM   1644 N N   . LEU A 1 208 ? 91.249  4.507   20.994 1.00 33.87  ? 511  LEU A N   1 
ATOM   1645 C CA  . LEU A 1 208 ? 92.034  4.408   22.199 1.00 34.94  ? 511  LEU A CA  1 
ATOM   1646 C C   . LEU A 1 208 ? 93.156  3.399   22.087 1.00 35.50  ? 511  LEU A C   1 
ATOM   1647 O O   . LEU A 1 208 ? 94.198  3.556   22.730 1.00 36.29  ? 511  LEU A O   1 
ATOM   1648 C CB  . LEU A 1 208 ? 91.131  4.086   23.380 1.00 34.35  ? 511  LEU A CB  1 
ATOM   1649 C CG  . LEU A 1 208 ? 89.944  5.047   23.521 1.00 35.89  ? 511  LEU A CG  1 
ATOM   1650 C CD1 . LEU A 1 208 ? 89.652  5.218   25.000 1.00 35.86  ? 511  LEU A CD1 1 
ATOM   1651 C CD2 . LEU A 1 208 ? 90.235  6.417   22.893 1.00 34.89  ? 511  LEU A CD2 1 
ATOM   1652 N N   . SER A 1 209 ? 92.962  2.368   21.270 1.00 33.68  ? 512  SER A N   1 
ATOM   1653 C CA  . SER A 1 209 ? 94.005  1.377   21.119 1.00 28.89  ? 512  SER A CA  1 
ATOM   1654 C C   . SER A 1 209 ? 95.129  2.059   20.364 1.00 28.48  ? 512  SER A C   1 
ATOM   1655 O O   . SER A 1 209 ? 96.299  1.898   20.703 1.00 27.89  ? 512  SER A O   1 
ATOM   1656 C CB  . SER A 1 209 ? 93.496  0.188   20.337 1.00 24.87  ? 512  SER A CB  1 
ATOM   1657 O OG  . SER A 1 209 ? 94.081  0.190   19.058 1.00 25.01  ? 512  SER A OG  1 
ATOM   1658 N N   . HIS A 1 210 ? 94.773  2.844   19.354 1.00 29.47  ? 513  HIS A N   1 
ATOM   1659 C CA  . HIS A 1 210 ? 95.786  3.532   18.574 1.00 31.67  ? 513  HIS A CA  1 
ATOM   1660 C C   . HIS A 1 210 ? 96.546  4.488   19.462 1.00 29.75  ? 513  HIS A C   1 
ATOM   1661 O O   . HIS A 1 210 ? 97.757  4.672   19.315 1.00 30.99  ? 513  HIS A O   1 
ATOM   1662 C CB  . HIS A 1 210 ? 95.181  4.311   17.410 1.00 36.71  ? 513  HIS A CB  1 
ATOM   1663 C CG  . HIS A 1 210 ? 96.213  4.886   16.481 1.00 44.14  ? 513  HIS A CG  1 
ATOM   1664 N ND1 . HIS A 1 210 ? 95.887  5.619   15.356 1.00 48.57  ? 513  HIS A ND1 1 
ATOM   1665 C CD2 . HIS A 1 210 ? 97.566  4.793   16.485 1.00 44.40  ? 513  HIS A CD2 1 
ATOM   1666 C CE1 . HIS A 1 210 ? 96.993  5.945   14.708 1.00 47.42  ? 513  HIS A CE1 1 
ATOM   1667 N NE2 . HIS A 1 210 ? 98.025  5.456   15.372 1.00 45.76  ? 513  HIS A NE2 1 
ATOM   1668 N N   . ILE A 1 211 ? 95.828  5.099   20.387 1.00 24.65  ? 514  ILE A N   1 
ATOM   1669 C CA  . ILE A 1 211 ? 96.441  6.023   21.318 1.00 22.11  ? 514  ILE A CA  1 
ATOM   1670 C C   . ILE A 1 211 ? 97.451  5.258   22.173 1.00 21.18  ? 514  ILE A C   1 
ATOM   1671 O O   . ILE A 1 211 ? 98.604  5.641   22.309 1.00 17.44  ? 514  ILE A O   1 
ATOM   1672 C CB  . ILE A 1 211 ? 95.347  6.644   22.167 1.00 19.98  ? 514  ILE A CB  1 
ATOM   1673 C CG1 . ILE A 1 211 ? 94.446  7.461   21.254 1.00 18.29  ? 514  ILE A CG1 1 
ATOM   1674 C CG2 . ILE A 1 211 ? 95.930  7.465   23.274 1.00 18.74  ? 514  ILE A CG2 1 
ATOM   1675 C CD1 . ILE A 1 211 ? 93.243  8.030   21.925 1.00 19.02  ? 514  ILE A CD1 1 
ATOM   1676 N N   . ARG A 1 212 ? 96.971  4.154   22.723 1.00 24.52  ? 515  ARG A N   1 
ATOM   1677 C CA  . ARG A 1 212 ? 97.745  3.233   23.546 1.00 26.11  ? 515  ARG A CA  1 
ATOM   1678 C C   . ARG A 1 212 ? 99.013  2.957   22.790 1.00 26.26  ? 515  ARG A C   1 
ATOM   1679 O O   . ARG A 1 212 ? 100.093 2.901   23.366 1.00 23.04  ? 515  ARG A O   1 
ATOM   1680 C CB  . ARG A 1 212 ? 97.006  1.898   23.677 1.00 24.87  ? 515  ARG A CB  1 
ATOM   1681 C CG  . ARG A 1 212 ? 97.040  1.270   25.043 1.00 25.12  ? 515  ARG A CG  1 
ATOM   1682 C CD  . ARG A 1 212 ? 98.339  1.499   25.761 1.00 26.95  ? 515  ARG A CD  1 
ATOM   1683 N NE  . ARG A 1 212 ? 98.346  0.892   27.094 1.00 28.08  ? 515  ARG A NE  1 
ATOM   1684 C CZ  . ARG A 1 212 ? 97.297  0.834   27.906 1.00 28.07  ? 515  ARG A CZ  1 
ATOM   1685 N NH1 . ARG A 1 212 ? 96.141  1.349   27.522 1.00 28.08  ? 515  ARG A NH1 1 
ATOM   1686 N NH2 . ARG A 1 212 ? 97.398  0.251   29.097 1.00 28.21  ? 515  ARG A NH2 1 
ATOM   1687 N N   . HIS A 1 213 ? 98.838  2.758   21.483 1.00 27.79  ? 516  HIS A N   1 
ATOM   1688 C CA  . HIS A 1 213 ? 99.935  2.455   20.583 1.00 29.34  ? 516  HIS A CA  1 
ATOM   1689 C C   . HIS A 1 213 ? 100.852 3.641   20.449 1.00 29.01  ? 516  HIS A C   1 
ATOM   1690 O O   . HIS A 1 213 ? 102.057 3.519   20.637 1.00 29.88  ? 516  HIS A O   1 
ATOM   1691 C CB  . HIS A 1 213 ? 99.423  2.054   19.202 1.00 29.77  ? 516  HIS A CB  1 
ATOM   1692 C CG  . HIS A 1 213 ? 100.521 1.709   18.242 1.00 32.31  ? 516  HIS A CG  1 
ATOM   1693 N ND1 . HIS A 1 213 ? 101.499 0.780   18.534 1.00 31.96  ? 516  HIS A ND1 1 
ATOM   1694 C CD2 . HIS A 1 213 ? 100.803 2.171   17.000 1.00 32.35  ? 516  HIS A CD2 1 
ATOM   1695 C CE1 . HIS A 1 213 ? 102.334 0.686   17.515 1.00 31.66  ? 516  HIS A CE1 1 
ATOM   1696 N NE2 . HIS A 1 213 ? 101.934 1.519   16.571 1.00 32.52  ? 516  HIS A NE2 1 
ATOM   1697 N N   . MET A 1 214 ? 100.293 4.793   20.119 1.00 28.92  ? 517  MET A N   1 
ATOM   1698 C CA  . MET A 1 214 ? 101.129 5.973   19.997 1.00 29.63  ? 517  MET A CA  1 
ATOM   1699 C C   . MET A 1 214 ? 101.890 6.225   21.293 1.00 27.60  ? 517  MET A C   1 
ATOM   1700 O O   . MET A 1 214 ? 103.094 6.486   21.281 1.00 25.25  ? 517  MET A O   1 
ATOM   1701 C CB  . MET A 1 214 ? 100.283 7.194   19.663 1.00 31.94  ? 517  MET A CB  1 
ATOM   1702 C CG  . MET A 1 214 ? 99.788  7.185   18.248 1.00 34.81  ? 517  MET A CG  1 
ATOM   1703 S SD  . MET A 1 214 ? 98.944  8.695   17.888 1.00 36.40  ? 517  MET A SD  1 
ATOM   1704 C CE  . MET A 1 214 ? 97.485  8.509   18.839 1.00 33.36  ? 517  MET A CE  1 
ATOM   1705 N N   . SER A 1 215 ? 101.168 6.145   22.405 1.00 25.12  ? 518  SER A N   1 
ATOM   1706 C CA  . SER A 1 215 ? 101.755 6.379   23.701 1.00 23.63  ? 518  SER A CA  1 
ATOM   1707 C C   . SER A 1 215 ? 102.931 5.446   23.885 1.00 24.50  ? 518  SER A C   1 
ATOM   1708 O O   . SER A 1 215 ? 103.977 5.853   24.366 1.00 25.00  ? 518  SER A O   1 
ATOM   1709 C CB  . SER A 1 215 ? 100.714 6.149   24.789 1.00 23.75  ? 518  SER A CB  1 
ATOM   1710 O OG  . SER A 1 215 ? 101.107 6.701   26.042 1.00 22.35  ? 518  SER A OG  1 
ATOM   1711 N N   . ASN A 1 216 ? 102.765 4.188   23.497 1.00 26.59  ? 519  ASN A N   1 
ATOM   1712 C CA  . ASN A 1 216 ? 103.850 3.213   23.630 1.00 26.34  ? 519  ASN A CA  1 
ATOM   1713 C C   . ASN A 1 216 ? 105.085 3.693   22.850 1.00 27.28  ? 519  ASN A C   1 
ATOM   1714 O O   . ASN A 1 216 ? 106.174 3.835   23.412 1.00 23.13  ? 519  ASN A O   1 
ATOM   1715 C CB  . ASN A 1 216 ? 103.414 1.825   23.105 1.00 23.39  ? 519  ASN A CB  1 
ATOM   1716 C CG  . ASN A 1 216 ? 102.698 0.989   24.154 1.00 24.09  ? 519  ASN A CG  1 
ATOM   1717 O OD1 . ASN A 1 216 ? 103.152 0.879   25.286 1.00 26.69  ? 519  ASN A OD1 1 
ATOM   1718 N ND2 . ASN A 1 216 ? 101.581 0.386   23.778 1.00 25.46  ? 519  ASN A ND2 1 
ATOM   1719 N N   . LYS A 1 217 ? 104.883 3.950   21.556 1.00 28.98  ? 520  LYS A N   1 
ATOM   1720 C CA  . LYS A 1 217 ? 105.937 4.382   20.652 1.00 31.23  ? 520  LYS A CA  1 
ATOM   1721 C C   . LYS A 1 217 ? 106.580 5.681   21.093 1.00 33.47  ? 520  LYS A C   1 
ATOM   1722 O O   . LYS A 1 217 ? 107.799 5.772   21.177 1.00 36.15  ? 520  LYS A O   1 
ATOM   1723 C CB  . LYS A 1 217 ? 105.376 4.520   19.240 1.00 30.98  ? 520  LYS A CB  1 
ATOM   1724 C CG  . LYS A 1 217 ? 104.851 3.196   18.647 1.00 32.82  ? 520  LYS A CG  1 
ATOM   1725 C CD  . LYS A 1 217 ? 105.928 2.463   17.812 1.00 34.94  ? 520  LYS A CD  1 
ATOM   1726 C CE  . LYS A 1 217 ? 106.269 1.047   18.332 1.00 36.42  ? 520  LYS A CE  1 
ATOM   1727 N NZ  . LYS A 1 217 ? 106.947 0.980   19.683 1.00 37.05  ? 520  LYS A NZ  1 
ATOM   1728 N N   . GLY A 1 218 ? 105.764 6.688   21.379 1.00 34.70  ? 521  GLY A N   1 
ATOM   1729 C CA  . GLY A 1 218 ? 106.306 7.957   21.816 1.00 31.37  ? 521  GLY A CA  1 
ATOM   1730 C C   . GLY A 1 218 ? 107.267 7.712   22.954 1.00 30.91  ? 521  GLY A C   1 
ATOM   1731 O O   . GLY A 1 218 ? 108.412 8.123   22.907 1.00 32.34  ? 521  GLY A O   1 
ATOM   1732 N N   . MET A 1 219 ? 106.802 7.017   23.976 1.00 30.06  ? 522  MET A N   1 
ATOM   1733 C CA  . MET A 1 219 ? 107.630 6.730   25.131 1.00 30.62  ? 522  MET A CA  1 
ATOM   1734 C C   . MET A 1 219 ? 109.009 6.186   24.725 1.00 32.23  ? 522  MET A C   1 
ATOM   1735 O O   . MET A 1 219 ? 110.041 6.590   25.263 1.00 32.53  ? 522  MET A O   1 
ATOM   1736 C CB  . MET A 1 219 ? 106.917 5.721   26.013 1.00 29.75  ? 522  MET A CB  1 
ATOM   1737 C CG  . MET A 1 219 ? 107.436 5.638   27.422 1.00 31.26  ? 522  MET A CG  1 
ATOM   1738 S SD  . MET A 1 219 ? 106.552 6.793   28.441 1.00 37.69  ? 522  MET A SD  1 
ATOM   1739 C CE  . MET A 1 219 ? 104.833 6.271   28.155 1.00 34.51  ? 522  MET A CE  1 
ATOM   1740 N N   . GLU A 1 220 ? 109.030 5.253   23.787 1.00 32.17  ? 523  GLU A N   1 
ATOM   1741 C CA  . GLU A 1 220 ? 110.292 4.708   23.346 1.00 33.09  ? 523  GLU A CA  1 
ATOM   1742 C C   . GLU A 1 220 ? 111.165 5.836   22.810 1.00 33.37  ? 523  GLU A C   1 
ATOM   1743 O O   . GLU A 1 220 ? 112.358 5.901   23.103 1.00 34.48  ? 523  GLU A O   1 
ATOM   1744 C CB  . GLU A 1 220 ? 110.063 3.668   22.260 1.00 34.91  ? 523  GLU A CB  1 
ATOM   1745 C CG  . GLU A 1 220 ? 109.584 2.328   22.786 1.00 41.63  ? 523  GLU A CG  1 
ATOM   1746 C CD  . GLU A 1 220 ? 110.605 1.637   23.689 1.00 44.29  ? 523  GLU A CD  1 
ATOM   1747 O OE1 . GLU A 1 220 ? 111.812 1.648   23.335 1.00 46.16  ? 523  GLU A OE1 1 
ATOM   1748 O OE2 . GLU A 1 220 ? 110.201 1.069   24.735 1.00 43.61  ? 523  GLU A OE2 1 
ATOM   1749 N N   . HIS A 1 221 ? 110.562 6.720   22.019 1.00 32.32  ? 524  HIS A N   1 
ATOM   1750 C CA  . HIS A 1 221 ? 111.263 7.862   21.442 1.00 31.32  ? 524  HIS A CA  1 
ATOM   1751 C C   . HIS A 1 221 ? 111.866 8.685   22.574 1.00 31.93  ? 524  HIS A C   1 
ATOM   1752 O O   . HIS A 1 221 ? 113.085 8.817   22.690 1.00 31.66  ? 524  HIS A O   1 
ATOM   1753 C CB  . HIS A 1 221 ? 110.273 8.707   20.631 1.00 31.57  ? 524  HIS A CB  1 
ATOM   1754 C CG  . HIS A 1 221 ? 110.844 9.980   20.081 1.00 31.97  ? 524  HIS A CG  1 
ATOM   1755 N ND1 . HIS A 1 221 ? 111.169 11.059  20.875 1.00 31.61  ? 524  HIS A ND1 1 
ATOM   1756 C CD2 . HIS A 1 221 ? 111.120 10.355  18.809 1.00 31.28  ? 524  HIS A CD2 1 
ATOM   1757 C CE1 . HIS A 1 221 ? 111.617 12.043  20.115 1.00 30.18  ? 524  HIS A CE1 1 
ATOM   1758 N NE2 . HIS A 1 221 ? 111.598 11.641  18.858 1.00 29.71  ? 524  HIS A NE2 1 
ATOM   1759 N N   . LEU A 1 222 ? 111.012 9.221   23.431 1.00 31.92  ? 525  LEU A N   1 
ATOM   1760 C CA  . LEU A 1 222 ? 111.498 10.017  24.534 1.00 33.13  ? 525  LEU A CA  1 
ATOM   1761 C C   . LEU A 1 222 ? 112.680 9.377   25.264 1.00 33.68  ? 525  LEU A C   1 
ATOM   1762 O O   . LEU A 1 222 ? 113.679 10.032  25.533 1.00 34.04  ? 525  LEU A O   1 
ATOM   1763 C CB  . LEU A 1 222 ? 110.370 10.288  25.524 1.00 33.81  ? 525  LEU A CB  1 
ATOM   1764 C CG  . LEU A 1 222 ? 110.679 11.430  26.505 1.00 36.11  ? 525  LEU A CG  1 
ATOM   1765 C CD1 . LEU A 1 222 ? 111.173 12.661  25.725 1.00 38.48  ? 525  LEU A CD1 1 
ATOM   1766 C CD2 . LEU A 1 222 ? 109.436 11.790  27.315 1.00 36.00  ? 525  LEU A CD2 1 
ATOM   1767 N N   . TYR A 1 223 ? 112.584 8.094   25.572 1.00 35.38  ? 526  TYR A N   1 
ATOM   1768 C CA  . TYR A 1 223 ? 113.658 7.430   26.305 1.00 36.43  ? 526  TYR A CA  1 
ATOM   1769 C C   . TYR A 1 223 ? 114.954 7.398   25.512 1.00 37.66  ? 526  TYR A C   1 
ATOM   1770 O O   . TYR A 1 223 ? 116.039 7.262   26.072 1.00 36.38  ? 526  TYR A O   1 
ATOM   1771 C CB  . TYR A 1 223 ? 113.215 6.016   26.694 1.00 35.84  ? 526  TYR A CB  1 
ATOM   1772 C CG  . TYR A 1 223 ? 114.233 5.207   27.466 1.00 37.08  ? 526  TYR A CG  1 
ATOM   1773 C CD1 . TYR A 1 223 ? 115.220 4.474   26.801 1.00 37.28  ? 526  TYR A CD1 1 
ATOM   1774 C CD2 . TYR A 1 223 ? 114.176 5.120   28.856 1.00 37.19  ? 526  TYR A CD2 1 
ATOM   1775 C CE1 . TYR A 1 223 ? 116.117 3.661   27.500 1.00 37.07  ? 526  TYR A CE1 1 
ATOM   1776 C CE2 . TYR A 1 223 ? 115.071 4.310   29.566 1.00 38.18  ? 526  TYR A CE2 1 
ATOM   1777 C CZ  . TYR A 1 223 ? 116.036 3.578   28.877 1.00 37.48  ? 526  TYR A CZ  1 
ATOM   1778 O OH  . TYR A 1 223 ? 116.892 2.734   29.555 1.00 36.64  ? 526  TYR A OH  1 
ATOM   1779 N N   . SER A 1 224 ? 114.834 7.547   24.200 1.00 39.52  ? 527  SER A N   1 
ATOM   1780 C CA  . SER A 1 224 ? 115.998 7.523   23.329 1.00 42.01  ? 527  SER A CA  1 
ATOM   1781 C C   . SER A 1 224 ? 116.603 8.914   23.225 1.00 42.91  ? 527  SER A C   1 
ATOM   1782 O O   . SER A 1 224 ? 117.812 9.056   23.048 1.00 42.38  ? 527  SER A O   1 
ATOM   1783 C CB  . SER A 1 224 ? 115.597 7.057   21.945 1.00 42.01  ? 527  SER A CB  1 
ATOM   1784 O OG  . SER A 1 224 ? 114.838 8.078   21.337 1.00 46.78  ? 527  SER A OG  1 
ATOM   1785 N N   . MET A 1 225 ? 115.751 9.933   23.304 1.00 43.11  ? 528  MET A N   1 
ATOM   1786 C CA  . MET A 1 225 ? 116.215 11.309  23.250 1.00 43.89  ? 528  MET A CA  1 
ATOM   1787 C C   . MET A 1 225 ? 116.916 11.602  24.574 1.00 44.88  ? 528  MET A C   1 
ATOM   1788 O O   . MET A 1 225 ? 117.800 12.463  24.639 1.00 44.44  ? 528  MET A O   1 
ATOM   1789 C CB  . MET A 1 225 ? 115.042 12.260  23.068 1.00 43.87  ? 528  MET A CB  1 
ATOM   1790 C CG  . MET A 1 225 ? 114.260 12.033  21.800 1.00 45.13  ? 528  MET A CG  1 
ATOM   1791 S SD  . MET A 1 225 ? 114.874 12.935  20.367 1.00 45.96  ? 528  MET A SD  1 
ATOM   1792 C CE  . MET A 1 225 ? 115.731 11.641  19.416 1.00 45.69  ? 528  MET A CE  1 
ATOM   1793 N N   . LYS A 1 226 ? 116.512 10.891  25.630 1.00 45.32  ? 529  LYS A N   1 
ATOM   1794 C CA  . LYS A 1 226 ? 117.142 11.072  26.933 1.00 47.12  ? 529  LYS A CA  1 
ATOM   1795 C C   . LYS A 1 226 ? 118.493 10.366  26.877 1.00 49.52  ? 529  LYS A C   1 
ATOM   1796 O O   . LYS A 1 226 ? 119.491 10.876  27.377 1.00 51.03  ? 529  LYS A O   1 
ATOM   1797 C CB  . LYS A 1 226 ? 116.304 10.475  28.069 1.00 44.52  ? 529  LYS A CB  1 
ATOM   1798 C CG  . LYS A 1 226 ? 116.920 10.720  29.454 1.00 42.57  ? 529  LYS A CG  1 
ATOM   1799 C CD  . LYS A 1 226 ? 116.179 10.001  30.573 1.00 42.70  ? 529  LYS A CD  1 
ATOM   1800 C CE  . LYS A 1 226 ? 116.273 8.474   30.443 1.00 45.04  ? 529  LYS A CE  1 
ATOM   1801 N NZ  . LYS A 1 226 ? 115.523 7.728   31.521 1.00 45.68  ? 529  LYS A NZ  1 
ATOM   1802 N N   . CYS A 1 227 ? 118.536 9.191   26.265 1.00 50.35  ? 530  CYS A N   1 
ATOM   1803 C CA  . CYS A 1 227 ? 119.803 8.506   26.166 1.00 52.07  ? 530  CYS A CA  1 
ATOM   1804 C C   . CYS A 1 227 ? 120.649 9.238   25.146 1.00 53.08  ? 530  CYS A C   1 
ATOM   1805 O O   . CYS A 1 227 ? 121.613 8.697   24.627 1.00 52.76  ? 530  CYS A O   1 
ATOM   1806 C CB  . CYS A 1 227 ? 119.611 7.046   25.757 1.00 52.74  ? 530  CYS A CB  1 
ATOM   1807 S SG  . CYS A 1 227 ? 119.557 5.925   27.172 1.00 54.99  ? 530  CYS A SG  1 
ATOM   1808 N N   . LYS A 1 228 ? 120.273 10.476  24.847 1.00 55.21  ? 531  LYS A N   1 
ATOM   1809 C CA  . LYS A 1 228 ? 121.029 11.284  23.903 1.00 58.13  ? 531  LYS A CA  1 
ATOM   1810 C C   . LYS A 1 228 ? 121.397 12.618  24.515 1.00 59.60  ? 531  LYS A C   1 
ATOM   1811 O O   . LYS A 1 228 ? 121.904 13.506  23.834 1.00 60.00  ? 531  LYS A O   1 
ATOM   1812 C CB  . LYS A 1 228 ? 120.251 11.505  22.606 1.00 58.51  ? 531  LYS A CB  1 
ATOM   1813 C CG  . LYS A 1 228 ? 120.250 10.285  21.709 1.00 61.89  ? 531  LYS A CG  1 
ATOM   1814 C CD  . LYS A 1 228 ? 119.621 10.561  20.351 1.00 64.16  ? 531  LYS A CD  1 
ATOM   1815 C CE  . LYS A 1 228 ? 119.548 9.282   19.514 1.00 64.31  ? 531  LYS A CE  1 
ATOM   1816 N NZ  . LYS A 1 228 ? 119.165 9.545   18.096 1.00 64.53  ? 531  LYS A NZ  1 
ATOM   1817 N N   . ASN A 1 229 ? 121.144 12.756  25.809 1.00 61.28  ? 532  ASN A N   1 
ATOM   1818 C CA  . ASN A 1 229 ? 121.478 13.989  26.501 1.00 63.81  ? 532  ASN A CA  1 
ATOM   1819 C C   . ASN A 1 229 ? 120.986 15.163  25.664 1.00 63.51  ? 532  ASN A C   1 
ATOM   1820 O O   . ASN A 1 229 ? 121.755 16.033  25.248 1.00 63.69  ? 532  ASN A O   1 
ATOM   1821 C CB  . ASN A 1 229 ? 122.989 14.061  26.684 1.00 66.93  ? 532  ASN A CB  1 
ATOM   1822 C CG  . ASN A 1 229 ? 123.629 12.682  26.733 1.00 69.93  ? 532  ASN A CG  1 
ATOM   1823 O OD1 . ASN A 1 229 ? 123.256 11.837  27.555 1.00 70.21  ? 532  ASN A OD1 1 
ATOM   1824 N ND2 . ASN A 1 229 ? 124.598 12.447  25.845 1.00 71.10  ? 532  ASN A ND2 1 
ATOM   1825 N N   . VAL A 1 230 ? 119.688 15.159  25.409 1.00 62.35  ? 533  VAL A N   1 
ATOM   1826 C CA  . VAL A 1 230 ? 119.060 16.196  24.625 1.00 61.00  ? 533  VAL A CA  1 
ATOM   1827 C C   . VAL A 1 230 ? 117.870 16.698  25.426 1.00 60.87  ? 533  VAL A C   1 
ATOM   1828 O O   . VAL A 1 230 ? 117.506 17.867  25.373 1.00 59.70  ? 533  VAL A O   1 
ATOM   1829 C CB  . VAL A 1 230 ? 118.583 15.619  23.295 1.00 60.34  ? 533  VAL A CB  1 
ATOM   1830 C CG1 . VAL A 1 230 ? 118.125 16.726  22.375 1.00 61.21  ? 533  VAL A CG1 1 
ATOM   1831 C CG2 . VAL A 1 230 ? 119.698 14.835  22.663 1.00 59.68  ? 533  VAL A CG2 1 
ATOM   1832 N N   . VAL A 1 231 ? 117.287 15.786  26.192 1.00 62.45  ? 534  VAL A N   1 
ATOM   1833 C CA  . VAL A 1 231 ? 116.125 16.082  27.018 1.00 63.02  ? 534  VAL A CA  1 
ATOM   1834 C C   . VAL A 1 231 ? 116.492 16.818  28.307 1.00 64.03  ? 534  VAL A C   1 
ATOM   1835 O O   . VAL A 1 231 ? 117.332 16.362  29.092 1.00 62.95  ? 534  VAL A O   1 
ATOM   1836 C CB  . VAL A 1 231 ? 115.354 14.775  27.384 1.00 62.20  ? 534  VAL A CB  1 
ATOM   1837 C CG1 . VAL A 1 231 ? 115.426 13.808  26.217 1.00 60.62  ? 534  VAL A CG1 1 
ATOM   1838 C CG2 . VAL A 1 231 ? 115.911 14.139  28.668 1.00 60.71  ? 534  VAL A CG2 1 
ATOM   1839 N N   . PRO A 1 232 ? 115.871 17.983  28.533 1.00 64.95  ? 535  PRO A N   1 
ATOM   1840 C CA  . PRO A 1 232 ? 116.187 18.714  29.756 1.00 65.43  ? 535  PRO A CA  1 
ATOM   1841 C C   . PRO A 1 232 ? 115.853 17.809  30.935 1.00 65.89  ? 535  PRO A C   1 
ATOM   1842 O O   . PRO A 1 232 ? 114.956 16.966  30.843 1.00 66.20  ? 535  PRO A O   1 
ATOM   1843 C CB  . PRO A 1 232 ? 115.275 19.933  29.671 1.00 65.11  ? 535  PRO A CB  1 
ATOM   1844 C CG  . PRO A 1 232 ? 115.167 20.170  28.197 1.00 64.68  ? 535  PRO A CG  1 
ATOM   1845 C CD  . PRO A 1 232 ? 114.971 18.765  27.666 1.00 65.17  ? 535  PRO A CD  1 
ATOM   1846 N N   . LEU A 1 233 ? 116.590 17.978  32.030 1.00 66.00  ? 536  LEU A N   1 
ATOM   1847 C CA  . LEU A 1 233 ? 116.393 17.172  33.233 1.00 64.03  ? 536  LEU A CA  1 
ATOM   1848 C C   . LEU A 1 233 ? 115.145 17.643  33.955 1.00 61.66  ? 536  LEU A C   1 
ATOM   1849 O O   . LEU A 1 233 ? 115.224 18.454  34.873 1.00 61.66  ? 536  LEU A O   1 
ATOM   1850 C CB  . LEU A 1 233 ? 117.612 17.285  34.174 1.00 64.66  ? 536  LEU A CB  1 
ATOM   1851 C CG  . LEU A 1 233 ? 119.017 16.953  33.644 1.00 64.25  ? 536  LEU A CG  1 
ATOM   1852 C CD1 . LEU A 1 233 ? 119.511 18.053  32.692 1.00 64.79  ? 536  LEU A CD1 1 
ATOM   1853 C CD2 . LEU A 1 233 ? 119.969 16.822  34.815 1.00 64.00  ? 536  LEU A CD2 1 
ATOM   1854 N N   . TYR A 1 234 ? 113.992 17.138  33.538 1.00 59.26  ? 537  TYR A N   1 
ATOM   1855 C CA  . TYR A 1 234 ? 112.745 17.529  34.169 1.00 57.29  ? 537  TYR A CA  1 
ATOM   1856 C C   . TYR A 1 234 ? 112.217 16.543  35.197 1.00 54.82  ? 537  TYR A C   1 
ATOM   1857 O O   . TYR A 1 234 ? 111.654 15.506  34.857 1.00 53.18  ? 537  TYR A O   1 
ATOM   1858 C CB  . TYR A 1 234 ? 111.694 17.799  33.107 1.00 59.50  ? 537  TYR A CB  1 
ATOM   1859 C CG  . TYR A 1 234 ? 111.809 19.184  32.533 1.00 61.94  ? 537  TYR A CG  1 
ATOM   1860 C CD1 . TYR A 1 234 ? 112.292 19.389  31.242 1.00 63.80  ? 537  TYR A CD1 1 
ATOM   1861 C CD2 . TYR A 1 234 ? 111.442 20.298  33.292 1.00 62.47  ? 537  TYR A CD2 1 
ATOM   1862 C CE1 . TYR A 1 234 ? 112.404 20.676  30.715 1.00 65.50  ? 537  TYR A CE1 1 
ATOM   1863 C CE2 . TYR A 1 234 ? 111.555 21.588  32.779 1.00 64.62  ? 537  TYR A CE2 1 
ATOM   1864 C CZ  . TYR A 1 234 ? 112.035 21.769  31.489 1.00 65.84  ? 537  TYR A CZ  1 
ATOM   1865 O OH  . TYR A 1 234 ? 112.141 23.038  30.971 1.00 67.74  ? 537  TYR A OH  1 
ATOM   1866 N N   . ASP A 1 235 ? 112.404 16.899  36.462 1.00 53.37  ? 538  ASP A N   1 
ATOM   1867 C CA  . ASP A 1 235 ? 111.981 16.081  37.585 1.00 52.48  ? 538  ASP A CA  1 
ATOM   1868 C C   . ASP A 1 235 ? 110.777 15.225  37.251 1.00 49.20  ? 538  ASP A C   1 
ATOM   1869 O O   . ASP A 1 235 ? 110.898 14.021  37.026 1.00 50.13  ? 538  ASP A O   1 
ATOM   1870 C CB  . ASP A 1 235 ? 111.660 16.975  38.796 1.00 57.89  ? 538  ASP A CB  1 
ATOM   1871 C CG  . ASP A 1 235 ? 112.783 16.988  39.858 1.00 61.95  ? 538  ASP A CG  1 
ATOM   1872 O OD1 . ASP A 1 235 ? 112.695 16.190  40.835 1.00 61.35  ? 538  ASP A OD1 1 
ATOM   1873 O OD2 . ASP A 1 235 ? 113.747 17.796  39.709 1.00 62.60  ? 538  ASP A OD2 1 
ATOM   1874 N N   . LEU A 1 236 ? 109.616 15.862  37.207 1.00 44.58  ? 539  LEU A N   1 
ATOM   1875 C CA  . LEU A 1 236 ? 108.364 15.178  36.932 1.00 40.04  ? 539  LEU A CA  1 
ATOM   1876 C C   . LEU A 1 236 ? 108.355 14.254  35.714 1.00 38.71  ? 539  LEU A C   1 
ATOM   1877 O O   . LEU A 1 236 ? 108.055 13.063  35.837 1.00 36.93  ? 539  LEU A O   1 
ATOM   1878 C CB  . LEU A 1 236 ? 107.245 16.205  36.791 1.00 38.42  ? 539  LEU A CB  1 
ATOM   1879 C CG  . LEU A 1 236 ? 106.035 16.005  37.698 1.00 36.84  ? 539  LEU A CG  1 
ATOM   1880 C CD1 . LEU A 1 236 ? 104.915 16.907  37.222 1.00 36.74  ? 539  LEU A CD1 1 
ATOM   1881 C CD2 . LEU A 1 236 ? 105.591 14.564  37.676 1.00 36.03  ? 539  LEU A CD2 1 
ATOM   1882 N N   . LEU A 1 237 ? 108.665 14.804  34.542 1.00 36.89  ? 540  LEU A N   1 
ATOM   1883 C CA  . LEU A 1 237 ? 108.656 14.014  33.321 1.00 36.79  ? 540  LEU A CA  1 
ATOM   1884 C C   . LEU A 1 237 ? 109.512 12.776  33.456 1.00 37.74  ? 540  LEU A C   1 
ATOM   1885 O O   . LEU A 1 237 ? 109.079 11.688  33.105 1.00 38.88  ? 540  LEU A O   1 
ATOM   1886 C CB  . LEU A 1 237 ? 109.148 14.833  32.131 1.00 36.06  ? 540  LEU A CB  1 
ATOM   1887 C CG  . LEU A 1 237 ? 109.050 14.154  30.755 1.00 34.86  ? 540  LEU A CG  1 
ATOM   1888 C CD1 . LEU A 1 237 ? 107.601 14.087  30.265 1.00 31.75  ? 540  LEU A CD1 1 
ATOM   1889 C CD2 . LEU A 1 237 ? 109.896 14.947  29.774 1.00 35.29  ? 540  LEU A CD2 1 
ATOM   1890 N N   . LEU A 1 238 ? 110.731 12.937  33.951 1.00 39.00  ? 541  LEU A N   1 
ATOM   1891 C CA  . LEU A 1 238 ? 111.620 11.799  34.131 1.00 40.00  ? 541  LEU A CA  1 
ATOM   1892 C C   . LEU A 1 238 ? 110.946 10.710  34.967 1.00 39.76  ? 541  LEU A C   1 
ATOM   1893 O O   . LEU A 1 238 ? 111.081 9.518   34.674 1.00 38.21  ? 541  LEU A O   1 
ATOM   1894 C CB  . LEU A 1 238 ? 112.915 12.237  34.825 1.00 43.57  ? 541  LEU A CB  1 
ATOM   1895 C CG  . LEU A 1 238 ? 114.199 12.448  34.006 1.00 45.20  ? 541  LEU A CG  1 
ATOM   1896 C CD1 . LEU A 1 238 ? 114.334 11.285  33.000 1.00 46.41  ? 541  LEU A CD1 1 
ATOM   1897 C CD2 . LEU A 1 238 ? 114.183 13.800  33.296 1.00 43.78  ? 541  LEU A CD2 1 
ATOM   1898 N N   . GLU A 1 239 ? 110.223 11.132  36.006 1.00 39.35  ? 542  GLU A N   1 
ATOM   1899 C CA  . GLU A 1 239 ? 109.510 10.216  36.906 1.00 40.02  ? 542  GLU A CA  1 
ATOM   1900 C C   . GLU A 1 239 ? 108.480 9.346   36.176 1.00 38.36  ? 542  GLU A C   1 
ATOM   1901 O O   . GLU A 1 239 ? 108.357 8.156   36.439 1.00 37.86  ? 542  GLU A O   1 
ATOM   1902 C CB  . GLU A 1 239 ? 108.808 11.011  38.024 1.00 41.49  ? 542  GLU A CB  1 
ATOM   1903 C CG  . GLU A 1 239 ? 107.898 10.175  38.945 1.00 45.45  ? 542  GLU A CG  1 
ATOM   1904 C CD  . GLU A 1 239 ? 107.258 10.997  40.077 1.00 48.38  ? 542  GLU A CD  1 
ATOM   1905 O OE1 . GLU A 1 239 ? 106.449 10.439  40.855 1.00 48.00  ? 542  GLU A OE1 1 
ATOM   1906 O OE2 . GLU A 1 239 ? 107.569 12.202  40.192 1.00 51.09  ? 542  GLU A OE2 1 
ATOM   1907 N N   . MET A 1 240 ? 107.750 9.950   35.255 1.00 36.17  ? 543  MET A N   1 
ATOM   1908 C CA  . MET A 1 240 ? 106.736 9.243   34.513 1.00 36.17  ? 543  MET A CA  1 
ATOM   1909 C C   . MET A 1 240 ? 107.349 8.311   33.500 1.00 36.66  ? 543  MET A C   1 
ATOM   1910 O O   . MET A 1 240 ? 106.858 7.209   33.283 1.00 37.05  ? 543  MET A O   1 
ATOM   1911 C CB  . MET A 1 240 ? 105.826 10.251  33.831 1.00 35.94  ? 543  MET A CB  1 
ATOM   1912 C CG  . MET A 1 240 ? 105.234 11.235  34.826 1.00 35.83  ? 543  MET A CG  1 
ATOM   1913 S SD  . MET A 1 240 ? 104.013 10.492  35.963 1.00 34.97  ? 543  MET A SD  1 
ATOM   1914 C CE  . MET A 1 240 ? 105.005 9.827   37.329 1.00 35.19  ? 543  MET A CE  1 
ATOM   1915 N N   . LEU A 1 241 ? 108.427 8.748   32.873 1.00 36.78  ? 544  LEU A N   1 
ATOM   1916 C CA  . LEU A 1 241 ? 109.096 7.907   31.895 1.00 38.09  ? 544  LEU A CA  1 
ATOM   1917 C C   . LEU A 1 241 ? 109.719 6.697   32.596 1.00 40.27  ? 544  LEU A C   1 
ATOM   1918 O O   . LEU A 1 241 ? 109.749 5.581   32.068 1.00 38.91  ? 544  LEU A O   1 
ATOM   1919 C CB  . LEU A 1 241 ? 110.192 8.696   31.209 1.00 36.51  ? 544  LEU A CB  1 
ATOM   1920 C CG  . LEU A 1 241 ? 110.963 7.874   30.194 1.00 35.33  ? 544  LEU A CG  1 
ATOM   1921 C CD1 . LEU A 1 241 ? 110.092 7.642   28.940 1.00 33.90  ? 544  LEU A CD1 1 
ATOM   1922 C CD2 . LEU A 1 241 ? 112.240 8.604   29.869 1.00 33.63  ? 544  LEU A CD2 1 
ATOM   1923 N N   . ASP A 1 242 ? 110.219 6.935   33.801 1.00 42.53  ? 545  ASP A N   1 
ATOM   1924 C CA  . ASP A 1 242 ? 110.843 5.887   34.582 1.00 44.69  ? 545  ASP A CA  1 
ATOM   1925 C C   . ASP A 1 242 ? 109.909 4.793   35.030 1.00 46.81  ? 545  ASP A C   1 
ATOM   1926 O O   . ASP A 1 242 ? 110.322 3.650   35.212 1.00 47.94  ? 545  ASP A O   1 
ATOM   1927 C CB  . ASP A 1 242 ? 111.496 6.474   35.805 1.00 44.51  ? 545  ASP A CB  1 
ATOM   1928 C CG  . ASP A 1 242 ? 112.974 6.395   35.729 1.00 45.86  ? 545  ASP A CG  1 
ATOM   1929 O OD1 . ASP A 1 242 ? 113.595 6.108   36.774 1.00 47.14  ? 545  ASP A OD1 1 
ATOM   1930 O OD2 . ASP A 1 242 ? 113.511 6.619   34.617 1.00 46.97  ? 545  ASP A OD2 1 
ATOM   1931 N N   . ALA A 1 243 ? 108.653 5.152   35.242 1.00 48.62  ? 546  ALA A N   1 
ATOM   1932 C CA  . ALA A 1 243 ? 107.664 4.192   35.677 1.00 49.89  ? 546  ALA A CA  1 
ATOM   1933 C C   . ALA A 1 243 ? 107.537 3.071   34.653 1.00 51.17  ? 546  ALA A C   1 
ATOM   1934 O O   . ALA A 1 243 ? 107.172 1.941   34.996 1.00 51.32  ? 546  ALA A O   1 
ATOM   1935 C CB  . ALA A 1 243 ? 106.328 4.884   35.866 1.00 51.94  ? 546  ALA A CB  1 
ATOM   1936 N N   . HIS A 1 244 ? 107.844 3.378   33.395 1.00 51.72  ? 547  HIS A N   1 
ATOM   1937 C CA  . HIS A 1 244 ? 107.739 2.372   32.352 1.00 53.18  ? 547  HIS A CA  1 
ATOM   1938 C C   . HIS A 1 244 ? 108.950 1.469   32.229 1.00 52.95  ? 547  HIS A C   1 
ATOM   1939 O O   . HIS A 1 244 ? 108.833 0.324   31.805 1.00 52.40  ? 547  HIS A O   1 
ATOM   1940 C CB  . HIS A 1 244 ? 107.440 3.037   31.019 1.00 54.82  ? 547  HIS A CB  1 
ATOM   1941 C CG  . HIS A 1 244 ? 106.044 3.555   30.924 1.00 56.76  ? 547  HIS A CG  1 
ATOM   1942 N ND1 . HIS A 1 244 ? 105.592 4.610   31.686 1.00 58.07  ? 547  HIS A ND1 1 
ATOM   1943 C CD2 . HIS A 1 244 ? 104.978 3.119   30.213 1.00 58.28  ? 547  HIS A CD2 1 
ATOM   1944 C CE1 . HIS A 1 244 ? 104.305 4.799   31.454 1.00 59.15  ? 547  HIS A CE1 1 
ATOM   1945 N NE2 . HIS A 1 244 ? 103.908 3.906   30.564 1.00 60.10  ? 547  HIS A NE2 1 
ATOM   1946 N N   . ARG A 1 245 ? 110.102 2.000   32.621 1.00 53.66  ? 548  ARG A N   1 
ATOM   1947 C CA  . ARG A 1 245 ? 111.168 0.937   33.138 1.00 55.29  ? 548  ARG A CA  1 
ATOM   1948 C C   . ARG A 1 245 ? 111.397 0.178   31.838 1.00 56.38  ? 548  ARG A C   1 
ATOM   1949 O O   . ARG A 1 245 ? 111.704 -1.015  31.829 1.00 56.50  ? 548  ARG A O   1 
ATOM   1950 C CB  . ARG A 1 245 ? 111.121 -0.023  34.330 1.00 54.13  ? 548  ARG A CB  1 
ATOM   1951 C CG  . ARG A 1 245 ? 110.414 0.564   35.542 1.00 53.70  ? 548  ARG A CG  1 
ATOM   1952 C CD  . ARG A 1 245 ? 110.903 -0.062  36.827 1.00 57.11  ? 548  ARG A CD  1 
ATOM   1953 N NE  . ARG A 1 245 ? 109.991 0.173   37.949 1.00 59.80  ? 548  ARG A NE  1 
ATOM   1954 C CZ  . ARG A 1 245 ? 110.261 -0.111  39.226 1.00 61.05  ? 548  ARG A CZ  1 
ATOM   1955 N NH1 . ARG A 1 245 ? 111.436 -0.640  39.571 1.00 61.69  ? 548  ARG A NH1 1 
ATOM   1956 N NH2 . ARG A 1 245 ? 109.339 0.104   40.162 1.00 61.04  ? 548  ARG A NH2 1 
ATOM   1957 N N   . LEU A 1 246 ? 111.256 0.895   30.732 1.00 57.94  ? 549  LEU A N   1 
ATOM   1958 C CA  . LEU A 1 246 ? 111.409 0.291   29.423 1.00 59.35  ? 549  LEU A CA  1 
ATOM   1959 C C   . LEU A 1 246 ? 112.851 0.272   28.958 1.00 61.37  ? 549  LEU A C   1 
ATOM   1960 O O   . LEU A 1 246 ? 113.726 0.944   29.521 1.00 60.88  ? 549  LEU A O   1 
ATOM   1961 C CB  . LEU A 1 246 ? 110.544 1.035   28.399 1.00 56.78  ? 549  LEU A CB  1 
ATOM   1962 C CG  . LEU A 1 246 ? 111.138 2.271   27.731 1.00 53.72  ? 549  LEU A CG  1 
ATOM   1963 C CD1 . LEU A 1 246 ? 110.032 3.089   27.113 1.00 53.45  ? 549  LEU A CD1 1 
ATOM   1964 C CD2 . LEU A 1 246 ? 111.866 3.099   28.742 1.00 54.35  ? 549  LEU A CD2 1 
ATOM   1965 N N   . HIS A 1 247 ? 113.076 -0.517  27.914 1.00 64.00  ? 550  HIS A N   1 
ATOM   1966 C CA  . HIS A 1 247 ? 114.385 -0.672  27.301 1.00 65.29  ? 550  HIS A CA  1 
ATOM   1967 C C   . HIS A 1 247 ? 114.237 -0.820  25.781 1.00 65.44  ? 550  HIS A C   1 
ATOM   1968 O O   . HIS A 1 247 ? 114.862 -0.007  25.057 1.00 63.02  ? 550  HIS A O   1 
ATOM   1969 C CB  . HIS A 1 247 ? 115.106 -1.876  27.926 1.00 65.35  ? 550  HIS A CB  1 
ATOM   1970 C CG  . HIS A 1 247 ? 115.678 -1.580  29.276 1.00 66.68  ? 550  HIS A CG  1 
ATOM   1971 N ND1 . HIS A 1 247 ? 114.911 -1.105  30.319 1.00 67.60  ? 550  HIS A ND1 1 
ATOM   1972 C CD2 . HIS A 1 247 ? 116.954 -1.609  29.730 1.00 66.89  ? 550  HIS A CD2 1 
ATOM   1973 C CE1 . HIS A 1 247 ? 115.689 -0.848  31.355 1.00 68.02  ? 550  HIS A CE1 1 
ATOM   1974 N NE2 . HIS A 1 247 ? 116.933 -1.144  31.024 1.00 68.19  ? 550  HIS A NE2 1 
ATOM   1975 O OXT . HIS A 1 247 ? 113.484 -1.724  25.340 1.00 65.98  ? 550  HIS A OXT 1 
ATOM   1976 N N   . ASN B 1 1   ? 49.333  57.141  22.091 1.00 73.70  ? 1304 ASN B N   1 
ATOM   1977 C CA  . ASN B 1 1   ? 49.511  55.977  23.002 1.00 74.46  ? 1304 ASN B CA  1 
ATOM   1978 C C   . ASN B 1 1   ? 48.160  55.566  23.612 1.00 75.65  ? 1304 ASN B C   1 
ATOM   1979 O O   . ASN B 1 1   ? 47.105  56.027  23.162 1.00 74.65  ? 1304 ASN B O   1 
ATOM   1980 C CB  . ASN B 1 1   ? 50.524  56.339  24.097 1.00 73.67  ? 1304 ASN B CB  1 
ATOM   1981 C CG  . ASN B 1 1   ? 51.135  55.113  24.772 1.00 73.28  ? 1304 ASN B CG  1 
ATOM   1982 O OD1 . ASN B 1 1   ? 50.533  54.509  25.659 1.00 73.23  ? 1304 ASN B OD1 1 
ATOM   1983 N ND2 . ASN B 1 1   ? 52.339  54.743  24.346 1.00 71.68  ? 1304 ASN B ND2 1 
ATOM   1984 N N   . SER B 1 2   ? 48.204  54.697  24.624 1.00 77.27  ? 1305 SER B N   1 
ATOM   1985 C CA  . SER B 1 2   ? 47.002  54.193  25.307 1.00 79.32  ? 1305 SER B CA  1 
ATOM   1986 C C   . SER B 1 2   ? 45.987  55.255  25.763 1.00 80.28  ? 1305 SER B C   1 
ATOM   1987 O O   . SER B 1 2   ? 46.348  56.248  26.412 1.00 80.65  ? 1305 SER B O   1 
ATOM   1988 C CB  . SER B 1 2   ? 47.394  53.334  26.528 1.00 79.28  ? 1305 SER B CB  1 
ATOM   1989 O OG  . SER B 1 2   ? 47.864  52.049  26.152 1.00 78.91  ? 1305 SER B OG  1 
ATOM   1990 N N   . LEU B 1 3   ? 44.715  55.012  25.437 1.00 80.33  ? 1306 LEU B N   1 
ATOM   1991 C CA  . LEU B 1 3   ? 43.608  55.901  25.792 1.00 80.62  ? 1306 LEU B CA  1 
ATOM   1992 C C   . LEU B 1 3   ? 43.612  56.126  27.312 1.00 81.68  ? 1306 LEU B C   1 
ATOM   1993 O O   . LEU B 1 3   ? 43.087  57.120  27.821 1.00 80.79  ? 1306 LEU B O   1 
ATOM   1994 C CB  . LEU B 1 3   ? 42.283  55.254  25.352 1.00 79.45  ? 1306 LEU B CB  1 
ATOM   1995 C CG  . LEU B 1 3   ? 41.000  56.087  25.185 1.00 78.96  ? 1306 LEU B CG  1 
ATOM   1996 C CD1 . LEU B 1 3   ? 39.879  55.214  24.610 1.00 77.10  ? 1306 LEU B CD1 1 
ATOM   1997 C CD2 . LEU B 1 3   ? 40.580  56.677  26.521 1.00 79.08  ? 1306 LEU B CD2 1 
ATOM   1998 N N   . ALA B 1 4   ? 44.229  55.190  28.022 1.00 83.32  ? 1307 ALA B N   1 
ATOM   1999 C CA  . ALA B 1 4   ? 44.317  55.233  29.475 1.00 84.31  ? 1307 ALA B CA  1 
ATOM   2000 C C   . ALA B 1 4   ? 45.103  56.424  30.017 1.00 84.97  ? 1307 ALA B C   1 
ATOM   2001 O O   . ALA B 1 4   ? 44.526  57.314  30.647 1.00 85.41  ? 1307 ALA B O   1 
ATOM   2002 C CB  . ALA B 1 4   ? 44.932  53.929  29.988 1.00 84.27  ? 1307 ALA B CB  1 
ATOM   2003 N N   . LEU B 1 5   ? 46.416  56.418  29.779 1.00 85.27  ? 1308 LEU B N   1 
ATOM   2004 C CA  . LEU B 1 5   ? 47.328  57.471  30.240 1.00 85.51  ? 1308 LEU B CA  1 
ATOM   2005 C C   . LEU B 1 5   ? 46.733  58.874  30.347 1.00 86.37  ? 1308 LEU B C   1 
ATOM   2006 O O   . LEU B 1 5   ? 47.266  59.723  31.067 1.00 86.16  ? 1308 LEU B O   1 
ATOM   2007 C CB  . LEU B 1 5   ? 48.556  57.554  29.326 1.00 84.72  ? 1308 LEU B CB  1 
ATOM   2008 C CG  . LEU B 1 5   ? 49.852  56.803  29.623 1.00 82.69  ? 1308 LEU B CG  1 
ATOM   2009 C CD1 . LEU B 1 5   ? 49.762  55.360  29.165 1.00 81.84  ? 1308 LEU B CD1 1 
ATOM   2010 C CD2 . LEU B 1 5   ? 50.975  57.519  28.887 1.00 82.41  ? 1308 LEU B CD2 1 
ATOM   2011 N N   . SER B 1 6   ? 45.642  59.120  29.624 1.00 86.76  ? 1309 SER B N   1 
ATOM   2012 C CA  . SER B 1 6   ? 45.007  60.431  29.632 1.00 86.68  ? 1309 SER B CA  1 
ATOM   2013 C C   . SER B 1 6   ? 43.814  60.582  30.566 1.00 87.94  ? 1309 SER B C   1 
ATOM   2014 O O   . SER B 1 6   ? 43.109  61.586  30.501 1.00 88.30  ? 1309 SER B O   1 
ATOM   2015 C CB  . SER B 1 6   ? 44.567  60.808  28.216 1.00 84.91  ? 1309 SER B CB  1 
ATOM   2016 O OG  . SER B 1 6   ? 43.504  59.977  27.779 1.00 82.87  ? 1309 SER B OG  1 
ATOM   2017 N N   . LEU B 1 7   ? 43.592  59.593  31.429 1.00 89.14  ? 1310 LEU B N   1 
ATOM   2018 C CA  . LEU B 1 7   ? 41.677  59.685  31.344 1.00 89.69  ? 1310 LEU B CA  1 
ATOM   2019 C C   . LEU B 1 7   ? 41.751  60.630  32.523 1.00 89.84  ? 1310 LEU B C   1 
ATOM   2020 O O   . LEU B 1 7   ? 42.743  60.655  33.252 1.00 90.10  ? 1310 LEU B O   1 
ATOM   2021 C CB  . LEU B 1 7   ? 41.282  58.287  31.831 1.00 89.69  ? 1310 LEU B CB  1 
ATOM   2022 C CG  . LEU B 1 7   ? 40.552  57.444  30.782 1.00 90.27  ? 1310 LEU B CG  1 
ATOM   2023 C CD1 . LEU B 1 7   ? 40.653  55.976  31.136 1.00 90.71  ? 1310 LEU B CD1 1 
ATOM   2024 C CD2 . LEU B 1 7   ? 39.093  57.890  30.690 1.00 89.77  ? 1310 LEU B CD2 1 
ATOM   2025 N N   . THR B 1 8   ? 40.700  61.421  32.700 1.00 89.97  ? 1311 THR B N   1 
ATOM   2026 C CA  . THR B 1 8   ? 40.664  62.347  33.816 1.00 90.90  ? 1311 THR B CA  1 
ATOM   2027 C C   . THR B 1 8   ? 40.576  61.510  35.084 1.00 91.30  ? 1311 THR B C   1 
ATOM   2028 O O   . THR B 1 8   ? 39.906  60.475  35.115 1.00 90.76  ? 1311 THR B O   1 
ATOM   2029 C CB  . THR B 1 8   ? 39.438  63.272  33.758 1.00 91.02  ? 1311 THR B CB  1 
ATOM   2030 O OG1 . THR B 1 8   ? 38.254  62.505  33.992 1.00 91.22  ? 1311 THR B OG1 1 
ATOM   2031 C CG2 . THR B 1 8   ? 39.340  63.940  32.404 1.00 91.37  ? 1311 THR B CG2 1 
ATOM   2032 N N   . ALA B 1 9   ? 41.262  61.959  36.126 1.00 92.02  ? 1312 ALA B N   1 
ATOM   2033 C CA  . ALA B 1 9   ? 41.258  61.254  37.391 1.00 92.35  ? 1312 ALA B CA  1 
ATOM   2034 C C   . ALA B 1 9   ? 39.850  60.806  37.799 1.00 92.74  ? 1312 ALA B C   1 
ATOM   2035 O O   . ALA B 1 9   ? 39.700  59.851  38.559 1.00 93.45  ? 1312 ALA B O   1 
ATOM   2036 C CB  . ALA B 1 9   ? 41.862  62.146  38.471 1.00 92.24  ? 1312 ALA B CB  1 
ATOM   2037 N N   . ASP B 1 10  ? 38.823  61.474  37.283 1.00 92.70  ? 1313 ASP B N   1 
ATOM   2038 C CA  . ASP B 1 10  ? 37.446  61.136  37.642 1.00 93.28  ? 1313 ASP B CA  1 
ATOM   2039 C C   . ASP B 1 10  ? 36.738  60.156  36.709 1.00 93.17  ? 1313 ASP B C   1 
ATOM   2040 O O   . ASP B 1 10  ? 35.828  59.433  37.134 1.00 92.44  ? 1313 ASP B O   1 
ATOM   2041 C CB  . ASP B 1 10  ? 36.633  62.416  37.762 1.00 93.73  ? 1313 ASP B CB  1 
ATOM   2042 C CG  . ASP B 1 10  ? 37.379  63.487  38.509 1.00 94.81  ? 1313 ASP B CG  1 
ATOM   2043 O OD1 . ASP B 1 10  ? 37.805  63.219  39.653 1.00 95.32  ? 1313 ASP B OD1 1 
ATOM   2044 O OD2 . ASP B 1 10  ? 37.551  64.591  37.948 1.00 95.89  ? 1313 ASP B OD2 1 
ATOM   2045 N N   . GLN B 1 11  ? 37.129  60.149  35.437 1.00 92.75  ? 1314 GLN B N   1 
ATOM   2046 C CA  . GLN B 1 11  ? 36.534  59.223  34.485 1.00 91.96  ? 1314 GLN B CA  1 
ATOM   2047 C C   . GLN B 1 11  ? 37.091  57.883  34.915 1.00 91.62  ? 1314 GLN B C   1 
ATOM   2048 O O   . GLN B 1 11  ? 36.405  56.862  34.875 1.00 91.84  ? 1314 GLN B O   1 
ATOM   2049 C CB  . GLN B 1 11  ? 36.980  59.543  33.062 1.00 92.34  ? 1314 GLN B CB  1 
ATOM   2050 C CG  . GLN B 1 11  ? 36.558  60.915  32.591 1.00 93.18  ? 1314 GLN B CG  1 
ATOM   2051 C CD  . GLN B 1 11  ? 36.926  61.170  31.146 1.00 93.97  ? 1314 GLN B CD  1 
ATOM   2052 O OE1 . GLN B 1 11  ? 36.340  60.584  30.236 1.00 94.56  ? 1314 GLN B OE1 1 
ATOM   2053 N NE2 . GLN B 1 11  ? 37.906  62.040  30.925 1.00 94.30  ? 1314 GLN B NE2 1 
ATOM   2054 N N   . MET B 1 12  ? 38.348  57.914  35.345 1.00 90.76  ? 1315 MET B N   1 
ATOM   2055 C CA  . MET B 1 12  ? 39.037  56.729  35.830 1.00 89.60  ? 1315 MET B CA  1 
ATOM   2056 C C   . MET B 1 12  ? 38.112  56.006  36.799 1.00 88.39  ? 1315 MET B C   1 
ATOM   2057 O O   . MET B 1 12  ? 37.818  54.826  36.629 1.00 88.39  ? 1315 MET B O   1 
ATOM   2058 C CB  . MET B 1 12  ? 40.311  57.143  36.559 1.00 90.35  ? 1315 MET B CB  1 
ATOM   2059 C CG  . MET B 1 12  ? 41.042  55.992  37.195 1.00 90.51  ? 1315 MET B CG  1 
ATOM   2060 S SD  . MET B 1 12  ? 41.618  54.839  35.950 1.00 91.65  ? 1315 MET B SD  1 
ATOM   2061 C CE  . MET B 1 12  ? 43.422  55.150  36.004 1.00 92.62  ? 1315 MET B CE  1 
ATOM   2062 N N   . VAL B 1 13  ? 37.654  56.738  37.810 1.00 86.57  ? 1316 VAL B N   1 
ATOM   2063 C CA  . VAL B 1 13  ? 36.756  56.202  38.826 1.00 85.02  ? 1316 VAL B CA  1 
ATOM   2064 C C   . VAL B 1 13  ? 35.459  55.666  38.233 1.00 84.65  ? 1316 VAL B C   1 
ATOM   2065 O O   . VAL B 1 13  ? 35.175  54.471  38.321 1.00 84.37  ? 1316 VAL B O   1 
ATOM   2066 C CB  . VAL B 1 13  ? 36.395  57.279  39.863 1.00 84.93  ? 1316 VAL B CB  1 
ATOM   2067 C CG1 . VAL B 1 13  ? 35.504  56.687  40.955 1.00 83.70  ? 1316 VAL B CG1 1 
ATOM   2068 C CG2 . VAL B 1 13  ? 37.667  57.869  40.452 1.00 84.81  ? 1316 VAL B CG2 1 
ATOM   2069 N N   . SER B 1 14  ? 34.672  56.557  37.632 1.00 84.21  ? 1317 SER B N   1 
ATOM   2070 C CA  . SER B 1 14  ? 33.397  56.177  37.031 1.00 82.73  ? 1317 SER B CA  1 
ATOM   2071 C C   . SER B 1 14  ? 33.587  55.116  35.954 1.00 81.19  ? 1317 SER B C   1 
ATOM   2072 O O   . SER B 1 14  ? 32.616  54.565  35.432 1.00 80.62  ? 1317 SER B O   1 
ATOM   2073 C CB  . SER B 1 14  ? 32.706  57.400  36.431 1.00 83.05  ? 1317 SER B CB  1 
ATOM   2074 O OG  . SER B 1 14  ? 31.407  57.054  35.983 1.00 84.15  ? 1317 SER B OG  1 
ATOM   2075 N N   . ALA B 1 15  ? 34.846  54.840  35.627 1.00 79.52  ? 1318 ALA B N   1 
ATOM   2076 C CA  . ALA B 1 15  ? 35.183  53.832  34.630 1.00 78.48  ? 1318 ALA B CA  1 
ATOM   2077 C C   . ALA B 1 15  ? 35.234  52.460  35.297 1.00 77.97  ? 1318 ALA B C   1 
ATOM   2078 O O   . ALA B 1 15  ? 34.593  51.511  34.844 1.00 78.50  ? 1318 ALA B O   1 
ATOM   2079 C CB  . ALA B 1 15  ? 36.526  54.151  34.006 1.00 79.23  ? 1318 ALA B CB  1 
ATOM   2080 N N   . LEU B 1 16  ? 36.010  52.366  36.374 1.00 76.07  ? 1319 LEU B N   1 
ATOM   2081 C CA  . LEU B 1 16  ? 36.154  51.127  37.122 1.00 74.01  ? 1319 LEU B CA  1 
ATOM   2082 C C   . LEU B 1 16  ? 34.819  50.790  37.775 1.00 74.39  ? 1319 LEU B C   1 
ATOM   2083 O O   . LEU B 1 16  ? 34.482  49.612  37.960 1.00 73.85  ? 1319 LEU B O   1 
ATOM   2084 C CB  . LEU B 1 16  ? 37.221  51.301  38.202 1.00 72.41  ? 1319 LEU B CB  1 
ATOM   2085 C CG  . LEU B 1 16  ? 38.592  51.770  37.722 1.00 70.29  ? 1319 LEU B CG  1 
ATOM   2086 C CD1 . LEU B 1 16  ? 39.453  52.124  38.899 1.00 69.43  ? 1319 LEU B CD1 1 
ATOM   2087 C CD2 . LEU B 1 16  ? 39.242  50.679  36.899 1.00 70.98  ? 1319 LEU B CD2 1 
ATOM   2088 N N   . LEU B 1 17  ? 34.068  51.835  38.124 1.00 74.22  ? 1320 LEU B N   1 
ATOM   2089 C CA  . LEU B 1 17  ? 32.767  51.673  38.760 1.00 74.45  ? 1320 LEU B CA  1 
ATOM   2090 C C   . LEU B 1 17  ? 31.696  51.198  37.787 1.00 74.26  ? 1320 LEU B C   1 
ATOM   2091 O O   . LEU B 1 17  ? 30.758  50.507  38.182 1.00 74.50  ? 1320 LEU B O   1 
ATOM   2092 C CB  . LEU B 1 17  ? 32.329  52.977  39.437 1.00 75.06  ? 1320 LEU B CB  1 
ATOM   2093 C CG  . LEU B 1 17  ? 33.009  53.314  40.776 1.00 75.86  ? 1320 LEU B CG  1 
ATOM   2094 C CD1 . LEU B 1 17  ? 32.576  54.692  41.240 1.00 76.59  ? 1320 LEU B CD1 1 
ATOM   2095 C CD2 . LEU B 1 17  ? 32.652  52.279  41.828 1.00 75.57  ? 1320 LEU B CD2 1 
ATOM   2096 N N   . ASP B 1 18  ? 31.822  51.563  36.517 1.00 74.17  ? 1321 ASP B N   1 
ATOM   2097 C CA  . ASP B 1 18  ? 30.853  51.104  35.532 1.00 74.84  ? 1321 ASP B CA  1 
ATOM   2098 C C   . ASP B 1 18  ? 31.147  49.621  35.326 1.00 74.32  ? 1321 ASP B C   1 
ATOM   2099 O O   . ASP B 1 18  ? 30.246  48.788  35.263 1.00 72.62  ? 1321 ASP B O   1 
ATOM   2100 C CB  . ASP B 1 18  ? 31.030  51.855  34.205 1.00 76.75  ? 1321 ASP B CB  1 
ATOM   2101 C CG  . ASP B 1 18  ? 30.005  51.432  33.140 1.00 79.65  ? 1321 ASP B CG  1 
ATOM   2102 O OD1 . ASP B 1 18  ? 30.184  51.779  31.950 1.00 79.68  ? 1321 ASP B OD1 1 
ATOM   2103 O OD2 . ASP B 1 18  ? 29.010  50.756  33.488 1.00 81.71  ? 1321 ASP B OD2 1 
ATOM   2104 N N   . ALA B 1 19  ? 32.439  49.318  35.256 1.00 74.97  ? 1322 ALA B N   1 
ATOM   2105 C CA  . ALA B 1 19  ? 32.956  47.969  35.039 1.00 75.41  ? 1322 ALA B CA  1 
ATOM   2106 C C   . ALA B 1 19  ? 32.548  46.899  36.056 1.00 75.90  ? 1322 ALA B C   1 
ATOM   2107 O O   . ALA B 1 19  ? 32.388  45.726  35.695 1.00 75.80  ? 1322 ALA B O   1 
ATOM   2108 C CB  . ALA B 1 19  ? 34.477  48.026  34.951 1.00 75.41  ? 1322 ALA B CB  1 
ATOM   2109 N N   . GLU B 1 20  ? 32.400  47.290  37.319 1.00 75.39  ? 1323 GLU B N   1 
ATOM   2110 C CA  . GLU B 1 20  ? 32.031  46.346  38.369 1.00 75.12  ? 1323 GLU B CA  1 
ATOM   2111 C C   . GLU B 1 20  ? 31.053  45.240  37.943 1.00 74.78  ? 1323 GLU B C   1 
ATOM   2112 O O   . GLU B 1 20  ? 30.014  45.509  37.331 1.00 74.42  ? 1323 GLU B O   1 
ATOM   2113 C CB  . GLU B 1 20  ? 31.476  47.105  39.573 1.00 75.61  ? 1323 GLU B CB  1 
ATOM   2114 C CG  . GLU B 1 20  ? 32.553  47.539  40.533 1.00 76.65  ? 1323 GLU B CG  1 
ATOM   2115 C CD  . GLU B 1 20  ? 33.312  46.351  41.083 1.00 78.57  ? 1323 GLU B CD  1 
ATOM   2116 O OE1 . GLU B 1 20  ? 32.678  45.496  41.745 1.00 78.28  ? 1323 GLU B OE1 1 
ATOM   2117 O OE2 . GLU B 1 20  ? 34.538  46.267  40.847 1.00 80.52  ? 1323 GLU B OE2 1 
ATOM   2118 N N   . PRO B 1 21  ? 31.387  43.974  38.270 1.00 73.94  ? 1324 PRO B N   1 
ATOM   2119 C CA  . PRO B 1 21  ? 30.594  42.783  37.953 1.00 72.92  ? 1324 PRO B CA  1 
ATOM   2120 C C   . PRO B 1 21  ? 29.432  42.566  38.908 1.00 72.46  ? 1324 PRO B C   1 
ATOM   2121 O O   . PRO B 1 21  ? 29.451  43.052  40.032 1.00 72.55  ? 1324 PRO B O   1 
ATOM   2122 C CB  . PRO B 1 21  ? 31.620  41.670  38.058 1.00 72.56  ? 1324 PRO B CB  1 
ATOM   2123 C CG  . PRO B 1 21  ? 32.419  42.109  39.219 1.00 72.67  ? 1324 PRO B CG  1 
ATOM   2124 C CD  . PRO B 1 21  ? 32.646  43.582  38.929 1.00 73.41  ? 1324 PRO B CD  1 
ATOM   2125 N N   . PRO B 1 22  ? 28.403  41.822  38.469 1.00 72.76  ? 1325 PRO B N   1 
ATOM   2126 C CA  . PRO B 1 22  ? 27.245  41.559  39.324 1.00 73.24  ? 1325 PRO B CA  1 
ATOM   2127 C C   . PRO B 1 22  ? 27.626  40.727  40.532 1.00 74.09  ? 1325 PRO B C   1 
ATOM   2128 O O   . PRO B 1 22  ? 28.487  39.841  40.447 1.00 74.95  ? 1325 PRO B O   1 
ATOM   2129 C CB  . PRO B 1 22  ? 26.291  40.825  38.392 1.00 73.17  ? 1325 PRO B CB  1 
ATOM   2130 C CG  . PRO B 1 22  ? 27.210  40.100  37.480 1.00 71.87  ? 1325 PRO B CG  1 
ATOM   2131 C CD  . PRO B 1 22  ? 28.238  41.156  37.166 1.00 72.48  ? 1325 PRO B CD  1 
ATOM   2132 N N   . ILE B 1 23  ? 26.963  41.029  41.648 1.00 74.23  ? 1326 ILE B N   1 
ATOM   2133 C CA  . ILE B 1 23  ? 27.191  40.358  42.927 1.00 74.18  ? 1326 ILE B CA  1 
ATOM   2134 C C   . ILE B 1 23  ? 26.470  39.016  43.023 1.00 73.97  ? 1326 ILE B C   1 
ATOM   2135 O O   . ILE B 1 23  ? 25.401  38.927  43.631 1.00 74.42  ? 1326 ILE B O   1 
ATOM   2136 C CB  . ILE B 1 23  ? 26.718  41.240  44.122 1.00 74.25  ? 1326 ILE B CB  1 
ATOM   2137 C CG1 . ILE B 1 23  ? 25.187  41.394  44.102 1.00 74.30  ? 1326 ILE B CG1 1 
ATOM   2138 C CG2 . ILE B 1 23  ? 27.419  42.595  44.083 1.00 73.53  ? 1326 ILE B CG2 1 
ATOM   2139 C CD1 . ILE B 1 23  ? 24.624  42.026  42.835 1.00 75.48  ? 1326 ILE B CD1 1 
ATOM   2140 N N   . LEU B 1 24  ? 27.062  37.983  42.427 1.00 72.99  ? 1327 LEU B N   1 
ATOM   2141 C CA  . LEU B 1 24  ? 25.596  37.076  41.799 1.00 71.62  ? 1327 LEU B CA  1 
ATOM   2142 C C   . LEU B 1 24  ? 25.509  36.305  43.114 1.00 71.20  ? 1327 LEU B C   1 
ATOM   2143 O O   . LEU B 1 24  ? 26.504  36.113  43.819 1.00 70.70  ? 1327 LEU B O   1 
ATOM   2144 C CB  . LEU B 1 24  ? 26.263  36.193  40.745 1.00 70.69  ? 1327 LEU B CB  1 
ATOM   2145 C CG  . LEU B 1 24  ? 27.702  35.744  40.989 1.00 69.24  ? 1327 LEU B CG  1 
ATOM   2146 C CD1 . LEU B 1 24  ? 28.152  34.853  39.841 1.00 69.65  ? 1327 LEU B CD1 1 
ATOM   2147 C CD2 . LEU B 1 24  ? 28.605  36.952  41.100 1.00 69.48  ? 1327 LEU B CD2 1 
ATOM   2148 N N   . TYR B 1 25  ? 24.298  35.866  43.431 1.00 71.08  ? 1328 TYR B N   1 
ATOM   2149 C CA  . TYR B 1 25  ? 24.037  35.100  44.641 1.00 71.03  ? 1328 TYR B CA  1 
ATOM   2150 C C   . TYR B 1 25  ? 24.523  33.656  44.445 1.00 71.24  ? 1328 TYR B C   1 
ATOM   2151 O O   . TYR B 1 25  ? 24.674  33.194  43.313 1.00 70.41  ? 1328 TYR B O   1 
ATOM   2152 C CB  . TYR B 1 25  ? 22.534  35.126  44.952 1.00 70.21  ? 1328 TYR B CB  1 
ATOM   2153 C CG  . TYR B 1 25  ? 21.973  36.503  45.280 1.00 69.48  ? 1328 TYR B CG  1 
ATOM   2154 C CD1 . TYR B 1 25  ? 21.968  37.528  44.326 1.00 69.47  ? 1328 TYR B CD1 1 
ATOM   2155 C CD2 . TYR B 1 25  ? 21.424  36.774  46.539 1.00 69.11  ? 1328 TYR B CD2 1 
ATOM   2156 C CE1 . TYR B 1 25  ? 21.428  38.786  44.617 1.00 69.56  ? 1328 TYR B CE1 1 
ATOM   2157 C CE2 . TYR B 1 25  ? 20.883  38.027  46.841 1.00 69.18  ? 1328 TYR B CE2 1 
ATOM   2158 C CZ  . TYR B 1 25  ? 20.890  39.026  45.875 1.00 69.91  ? 1328 TYR B CZ  1 
ATOM   2159 O OH  . TYR B 1 25  ? 20.368  40.266  46.167 1.00 70.25  ? 1328 TYR B OH  1 
ATOM   2160 N N   . SER B 1 26  ? 24.764  32.947  45.544 1.00 71.63  ? 1329 SER B N   1 
ATOM   2161 C CA  . SER B 1 26  ? 25.258  31.571  45.479 1.00 73.22  ? 1329 SER B CA  1 
ATOM   2162 C C   . SER B 1 26  ? 24.197  30.480  45.445 1.00 74.73  ? 1329 SER B C   1 
ATOM   2163 O O   . SER B 1 26  ? 23.222  30.539  46.188 1.00 74.88  ? 1329 SER B O   1 
ATOM   2164 C CB  . SER B 1 26  ? 26.174  31.292  46.670 1.00 72.52  ? 1329 SER B CB  1 
ATOM   2165 O OG  . SER B 1 26  ? 26.456  29.909  46.771 1.00 70.66  ? 1329 SER B OG  1 
ATOM   2166 N N   . GLU B 1 27  ? 24.390  29.478  44.590 1.00 76.89  ? 1330 GLU B N   1 
ATOM   2167 C CA  . GLU B 1 27  ? 23.444  28.366  44.537 1.00 78.63  ? 1330 GLU B CA  1 
ATOM   2168 C C   . GLU B 1 27  ? 23.641  27.693  45.891 1.00 79.28  ? 1330 GLU B C   1 
ATOM   2169 O O   . GLU B 1 27  ? 24.718  27.164  46.185 1.00 79.30  ? 1330 GLU B O   1 
ATOM   2170 C CB  . GLU B 1 27  ? 23.775  27.408  43.377 1.00 79.85  ? 1330 GLU B CB  1 
ATOM   2171 C CG  . GLU B 1 27  ? 25.104  26.655  43.462 1.00 81.55  ? 1330 GLU B CG  1 
ATOM   2172 C CD  . GLU B 1 27  ? 24.992  25.328  44.203 1.00 82.76  ? 1330 GLU B CD  1 
ATOM   2173 O OE1 . GLU B 1 27  ? 25.981  24.558  44.215 1.00 83.96  ? 1330 GLU B OE1 1 
ATOM   2174 O OE2 . GLU B 1 27  ? 23.915  25.056  44.775 1.00 83.71  ? 1330 GLU B OE2 1 
ATOM   2175 N N   . TYR B 1 28  ? 22.604  27.728  46.725 1.00 79.59  ? 1331 TYR B N   1 
ATOM   2176 C CA  . TYR B 1 28  ? 22.724  27.175  48.068 1.00 79.28  ? 1331 TYR B CA  1 
ATOM   2177 C C   . TYR B 1 28  ? 21.447  27.322  48.916 1.00 79.72  ? 1331 TYR B C   1 
ATOM   2178 O O   . TYR B 1 28  ? 20.884  28.416  49.013 1.00 80.20  ? 1331 TYR B O   1 
ATOM   2179 C CB  . TYR B 1 28  ? 23.905  27.888  48.749 1.00 76.77  ? 1331 TYR B CB  1 
ATOM   2180 C CG  . TYR B 1 28  ? 23.880  27.921  50.254 1.00 74.87  ? 1331 TYR B CG  1 
ATOM   2181 C CD1 . TYR B 1 28  ? 24.303  26.823  51.000 1.00 74.18  ? 1331 TYR B CD1 1 
ATOM   2182 C CD2 . TYR B 1 28  ? 23.437  29.058  50.938 1.00 73.13  ? 1331 TYR B CD2 1 
ATOM   2183 C CE1 . TYR B 1 28  ? 24.286  26.854  52.388 1.00 73.15  ? 1331 TYR B CE1 1 
ATOM   2184 C CE2 . TYR B 1 28  ? 23.415  29.098  52.326 1.00 72.19  ? 1331 TYR B CE2 1 
ATOM   2185 C CZ  . TYR B 1 28  ? 23.842  27.991  53.044 1.00 72.34  ? 1331 TYR B CZ  1 
ATOM   2186 O OH  . TYR B 1 28  ? 23.840  28.010  54.417 1.00 71.75  ? 1331 TYR B OH  1 
ATOM   2187 N N   . ASP B 1 29  ? 20.985  26.223  49.516 1.00 79.81  ? 1332 ASP B N   1 
ATOM   2188 C CA  . ASP B 1 29  ? 19.809  26.280  50.387 1.00 80.20  ? 1332 ASP B CA  1 
ATOM   2189 C C   . ASP B 1 29  ? 20.280  26.181  51.836 1.00 80.17  ? 1332 ASP B C   1 
ATOM   2190 O O   . ASP B 1 29  ? 20.871  25.182  52.239 1.00 80.30  ? 1332 ASP B O   1 
ATOM   2191 C CB  . ASP B 1 29  ? 18.788  25.158  50.071 1.00 80.38  ? 1332 ASP B CB  1 
ATOM   2192 C CG  . ASP B 1 29  ? 19.363  23.749  50.221 1.00 80.74  ? 1332 ASP B CG  1 
ATOM   2193 O OD1 . ASP B 1 29  ? 18.556  22.794  50.344 1.00 78.10  ? 1332 ASP B OD1 1 
ATOM   2194 O OD2 . ASP B 1 29  ? 20.605  23.589  50.198 1.00 81.64  ? 1332 ASP B OD2 1 
ATOM   2195 N N   . PRO B 1 30  ? 20.030  27.226  52.641 1.00 80.28  ? 1333 PRO B N   1 
ATOM   2196 C CA  . PRO B 1 30  ? 20.453  27.211  54.043 1.00 80.53  ? 1333 PRO B CA  1 
ATOM   2197 C C   . PRO B 1 30  ? 19.846  26.053  54.838 1.00 80.80  ? 1333 PRO B C   1 
ATOM   2198 O O   . PRO B 1 30  ? 20.096  25.915  56.039 1.00 80.68  ? 1333 PRO B O   1 
ATOM   2199 C CB  . PRO B 1 30  ? 20.010  28.582  54.550 1.00 80.86  ? 1333 PRO B CB  1 
ATOM   2200 C CG  . PRO B 1 30  ? 18.764  28.831  53.762 1.00 81.66  ? 1333 PRO B CG  1 
ATOM   2201 C CD  . PRO B 1 30  ? 19.171  28.391  52.365 1.00 81.14  ? 1333 PRO B CD  1 
ATOM   2202 N N   . THR B 1 31  ? 19.047  25.229  54.159 1.00 80.66  ? 1334 THR B N   1 
ATOM   2203 C CA  . THR B 1 31  ? 18.413  24.063  54.774 1.00 79.77  ? 1334 THR B CA  1 
ATOM   2204 C C   . THR B 1 31  ? 19.263  22.839  54.454 1.00 78.75  ? 1334 THR B C   1 
ATOM   2205 O O   . THR B 1 31  ? 18.855  21.945  53.699 1.00 79.58  ? 1334 THR B O   1 
ATOM   2206 C CB  . THR B 1 31  ? 16.974  23.833  54.238 1.00 80.33  ? 1334 THR B CB  1 
ATOM   2207 O OG1 . THR B 1 31  ? 17.005  23.719  52.807 1.00 80.55  ? 1334 THR B OG1 1 
ATOM   2208 C CG2 . THR B 1 31  ? 16.053  24.980  54.660 1.00 79.87  ? 1334 THR B CG2 1 
ATOM   2209 N N   . ARG B 1 32  ? 20.454  22.826  55.033 1.00 76.18  ? 1335 ARG B N   1 
ATOM   2210 C CA  . ARG B 1 32  ? 21.288  21.617  55.044 1.00 74.52  ? 1335 ARG B CA  1 
ATOM   2211 C C   . ARG B 1 32  ? 22.558  22.050  55.744 1.00 73.81  ? 1335 ARG B C   1 
ATOM   2212 O O   . ARG B 1 32  ? 23.044  23.166  55.541 1.00 72.09  ? 1335 ARG B O   1 
ATOM   2213 C CB  . ARG B 1 32  ? 21.599  21.360  53.570 1.00 74.20  ? 1335 ARG B CB  1 
ATOM   2214 C CG  . ARG B 1 32  ? 22.637  20.275  53.344 1.00 72.73  ? 1335 ARG B CG  1 
ATOM   2215 C CD  . ARG B 1 32  ? 23.078  20.230  51.897 1.00 71.47  ? 1335 ARG B CD  1 
ATOM   2216 N NE  . ARG B 1 32  ? 23.855  19.028  51.616 1.00 71.00  ? 1335 ARG B NE  1 
ATOM   2217 C CZ  . ARG B 1 32  ? 24.349  18.718  50.422 1.00 69.91  ? 1335 ARG B CZ  1 
ATOM   2218 N NH1 . ARG B 1 32  ? 24.157  19.521  49.387 1.00 68.38  ? 1335 ARG B NH1 1 
ATOM   2219 N NH2 . ARG B 1 32  ? 25.024  17.592  50.261 1.00 70.40  ? 1335 ARG B NH2 1 
ATOM   2220 N N   . PRO B 1 33  ? 23.104  21.178  56.600 1.00 73.54  ? 1336 PRO B N   1 
ATOM   2221 C CA  . PRO B 1 33  ? 24.334  21.502  57.321 1.00 72.94  ? 1336 PRO B CA  1 
ATOM   2222 C C   . PRO B 1 33  ? 25.559  21.447  56.410 1.00 71.57  ? 1336 PRO B C   1 
ATOM   2223 O O   . PRO B 1 33  ? 25.498  20.951  55.283 1.00 70.88  ? 1336 PRO B O   1 
ATOM   2224 C CB  . PRO B 1 33  ? 24.365  20.447  58.425 1.00 73.42  ? 1336 PRO B CB  1 
ATOM   2225 C CG  . PRO B 1 33  ? 23.728  19.261  57.756 1.00 73.83  ? 1336 PRO B CG  1 
ATOM   2226 C CD  . PRO B 1 33  ? 22.544  19.896  57.067 1.00 73.74  ? 1336 PRO B CD  1 
ATOM   2227 N N   . PHE B 1 34  ? 26.670  21.966  56.909 1.00 70.31  ? 1337 PHE B N   1 
ATOM   2228 C CA  . PHE B 1 34  ? 27.909  21.986  56.157 1.00 70.02  ? 1337 PHE B CA  1 
ATOM   2229 C C   . PHE B 1 34  ? 28.764  20.748  56.404 1.00 70.65  ? 1337 PHE B C   1 
ATOM   2230 O O   . PHE B 1 34  ? 28.916  20.303  57.543 1.00 71.07  ? 1337 PHE B O   1 
ATOM   2231 C CB  . PHE B 1 34  ? 28.733  23.208  56.554 1.00 69.09  ? 1337 PHE B CB  1 
ATOM   2232 C CG  . PHE B 1 34  ? 28.258  24.495  55.954 1.00 67.00  ? 1337 PHE B CG  1 
ATOM   2233 C CD1 . PHE B 1 34  ? 28.150  25.639  56.741 1.00 66.05  ? 1337 PHE B CD1 1 
ATOM   2234 C CD2 . PHE B 1 34  ? 27.970  24.583  54.598 1.00 65.74  ? 1337 PHE B CD2 1 
ATOM   2235 C CE1 . PHE B 1 34  ? 27.764  26.851  56.186 1.00 64.47  ? 1337 PHE B CE1 1 
ATOM   2236 C CE2 . PHE B 1 34  ? 27.584  25.793  54.035 1.00 65.36  ? 1337 PHE B CE2 1 
ATOM   2237 C CZ  . PHE B 1 34  ? 27.481  26.929  54.834 1.00 64.50  ? 1337 PHE B CZ  1 
ATOM   2238 N N   . SER B 1 35  ? 29.318  20.195  55.332 1.00 70.69  ? 1338 SER B N   1 
ATOM   2239 C CA  . SER B 1 35  ? 30.219  19.060  55.441 1.00 71.09  ? 1338 SER B CA  1 
ATOM   2240 C C   . SER B 1 35  ? 31.482  19.599  54.780 1.00 72.26  ? 1338 SER B C   1 
ATOM   2241 O O   . SER B 1 35  ? 31.432  20.668  54.168 1.00 72.56  ? 1338 SER B O   1 
ATOM   2242 C CB  . SER B 1 35  ? 29.671  17.836  54.697 1.00 69.93  ? 1338 SER B CB  1 
ATOM   2243 O OG  . SER B 1 35  ? 29.592  18.043  53.304 1.00 69.97  ? 1338 SER B OG  1 
ATOM   2244 N N   . GLU B 1 36  ? 32.611  18.906  54.913 1.00 74.66  ? 1339 GLU B N   1 
ATOM   2245 C CA  . GLU B 1 36  ? 33.839  19.401  54.293 1.00 75.55  ? 1339 GLU B CA  1 
ATOM   2246 C C   . GLU B 1 36  ? 33.587  19.563  52.804 1.00 75.12  ? 1339 GLU B C   1 
ATOM   2247 O O   . GLU B 1 36  ? 33.794  20.642  52.246 1.00 76.09  ? 1339 GLU B O   1 
ATOM   2248 C CB  . GLU B 1 36  ? 35.009  18.441  54.525 1.00 77.09  ? 1339 GLU B CB  1 
ATOM   2249 C CG  . GLU B 1 36  ? 36.275  18.853  53.788 1.00 78.93  ? 1339 GLU B CG  1 
ATOM   2250 C CD  . GLU B 1 36  ? 37.531  18.205  54.345 1.00 80.21  ? 1339 GLU B CD  1 
ATOM   2251 O OE1 . GLU B 1 36  ? 37.856  18.454  55.527 1.00 80.73  ? 1339 GLU B OE1 1 
ATOM   2252 O OE2 . GLU B 1 36  ? 38.199  17.453  53.601 1.00 81.08  ? 1339 GLU B OE2 1 
ATOM   2253 N N   . ALA B 1 37  ? 33.116  18.489  52.174 1.00 73.89  ? 1340 ALA B N   1 
ATOM   2254 C CA  . ALA B 1 37  ? 32.816  18.484  50.745 1.00 72.04  ? 1340 ALA B CA  1 
ATOM   2255 C C   . ALA B 1 37  ? 31.713  19.490  50.413 1.00 70.87  ? 1340 ALA B C   1 
ATOM   2256 O O   . ALA B 1 37  ? 31.800  20.243  49.443 1.00 70.04  ? 1340 ALA B O   1 
ATOM   2257 C CB  . ALA B 1 37  ? 32.397  17.079  50.312 1.00 71.25  ? 1340 ALA B CB  1 
ATOM   2258 N N   . SER B 1 38  ? 30.676  19.499  51.233 1.00 70.10  ? 1341 SER B N   1 
ATOM   2259 C CA  . SER B 1 38  ? 29.559  20.398  51.022 1.00 70.01  ? 1341 SER B CA  1 
ATOM   2260 C C   . SER B 1 38  ? 29.984  21.855  50.858 1.00 69.44  ? 1341 SER B C   1 
ATOM   2261 O O   . SER B 1 38  ? 29.710  22.470  49.828 1.00 68.61  ? 1341 SER B O   1 
ATOM   2262 C CB  . SER B 1 38  ? 28.570  20.275  52.182 1.00 70.71  ? 1341 SER B CB  1 
ATOM   2263 O OG  . SER B 1 38  ? 27.408  21.048  51.954 1.00 70.97  ? 1341 SER B OG  1 
ATOM   2264 N N   . MET B 1 39  ? 30.656  22.409  51.865 1.00 69.54  ? 1342 MET B N   1 
ATOM   2265 C CA  . MET B 1 39  ? 31.072  23.806  51.790 1.00 70.10  ? 1342 MET B CA  1 
ATOM   2266 C C   . MET B 1 39  ? 32.123  24.100  50.721 1.00 69.82  ? 1342 MET B C   1 
ATOM   2267 O O   . MET B 1 39  ? 32.132  25.185  50.131 1.00 69.82  ? 1342 MET B O   1 
ATOM   2268 C CB  . MET B 1 39  ? 31.572  24.313  53.148 1.00 70.90  ? 1342 MET B CB  1 
ATOM   2269 C CG  . MET B 1 39  ? 31.874  25.825  53.137 1.00 71.38  ? 1342 MET B CG  1 
ATOM   2270 S SD  . MET B 1 39  ? 32.263  26.573  54.740 1.00 71.73  ? 1342 MET B SD  1 
ATOM   2271 C CE  . MET B 1 39  ? 34.079  26.286  54.819 1.00 71.31  ? 1342 MET B CE  1 
ATOM   2272 N N   . MET B 1 40  ? 33.023  23.160  50.473 1.00 68.53  ? 1343 MET B N   1 
ATOM   2273 C CA  . MET B 1 40  ? 34.011  23.401  49.444 1.00 67.83  ? 1343 MET B CA  1 
ATOM   2274 C C   . MET B 1 40  ? 33.267  23.531  48.117 1.00 68.58  ? 1343 MET B C   1 
ATOM   2275 O O   . MET B 1 40  ? 33.448  24.497  47.367 1.00 68.60  ? 1343 MET B O   1 
ATOM   2276 C CB  . MET B 1 40  ? 35.011  22.253  49.382 1.00 66.06  ? 1343 MET B CB  1 
ATOM   2277 C CG  . MET B 1 40  ? 36.221  22.469  50.258 1.00 64.36  ? 1343 MET B CG  1 
ATOM   2278 S SD  . MET B 1 40  ? 37.175  23.895  49.725 1.00 58.97  ? 1343 MET B SD  1 
ATOM   2279 C CE  . MET B 1 40  ? 36.413  25.183  50.670 1.00 62.65  ? 1343 MET B CE  1 
ATOM   2280 N N   . GLY B 1 41  ? 32.405  22.559  47.849 1.00 69.25  ? 1344 GLY B N   1 
ATOM   2281 C CA  . GLY B 1 41  ? 31.645  22.569  46.617 1.00 68.96  ? 1344 GLY B CA  1 
ATOM   2282 C C   . GLY B 1 41  ? 30.799  23.809  46.464 1.00 68.73  ? 1344 GLY B C   1 
ATOM   2283 O O   . GLY B 1 41  ? 30.621  24.317  45.355 1.00 69.57  ? 1344 GLY B O   1 
ATOM   2284 N N   . LEU B 1 42  ? 30.286  24.314  47.577 1.00 68.84  ? 1345 LEU B N   1 
ATOM   2285 C CA  . LEU B 1 42  ? 29.440  25.493  47.528 1.00 69.01  ? 1345 LEU B CA  1 
ATOM   2286 C C   . LEU B 1 42  ? 30.231  26.750  47.186 1.00 68.51  ? 1345 LEU B C   1 
ATOM   2287 O O   . LEU B 1 42  ? 29.767  27.588  46.406 1.00 69.05  ? 1345 LEU B O   1 
ATOM   2288 C CB  . LEU B 1 42  ? 28.718  25.679  48.862 1.00 70.27  ? 1345 LEU B CB  1 
ATOM   2289 C CG  . LEU B 1 42  ? 27.279  26.205  48.775 1.00 71.86  ? 1345 LEU B CG  1 
ATOM   2290 C CD1 . LEU B 1 42  ? 27.253  27.521  48.019 1.00 71.88  ? 1345 LEU B CD1 1 
ATOM   2291 C CD2 . LEU B 1 42  ? 26.389  25.170  48.078 1.00 72.75  ? 1345 LEU B CD2 1 
ATOM   2292 N N   . LEU B 1 43  ? 31.424  26.875  47.767 1.00 67.49  ? 1346 LEU B N   1 
ATOM   2293 C CA  . LEU B 1 43  ? 32.280  28.037  47.530 1.00 65.18  ? 1346 LEU B CA  1 
ATOM   2294 C C   . LEU B 1 43  ? 32.965  27.983  46.179 1.00 64.03  ? 1346 LEU B C   1 
ATOM   2295 O O   . LEU B 1 43  ? 32.948  28.958  45.434 1.00 64.83  ? 1346 LEU B O   1 
ATOM   2296 C CB  . LEU B 1 43  ? 33.346  28.164  48.618 1.00 64.26  ? 1346 LEU B CB  1 
ATOM   2297 C CG  . LEU B 1 43  ? 32.882  28.467  50.044 1.00 63.06  ? 1346 LEU B CG  1 
ATOM   2298 C CD1 . LEU B 1 43  ? 34.110  28.661  50.902 1.00 62.82  ? 1346 LEU B CD1 1 
ATOM   2299 C CD2 . LEU B 1 43  ? 31.998  29.714  50.087 1.00 61.90  ? 1346 LEU B CD2 1 
ATOM   2300 N N   . THR B 1 44  ? 33.580  26.851  45.861 1.00 62.50  ? 1347 THR B N   1 
ATOM   2301 C CA  . THR B 1 44  ? 34.250  26.732  44.577 1.00 61.37  ? 1347 THR B CA  1 
ATOM   2302 C C   . THR B 1 44  ? 33.231  26.990  43.478 1.00 61.48  ? 1347 THR B C   1 
ATOM   2303 O O   . THR B 1 44  ? 33.567  27.508  42.410 1.00 60.98  ? 1347 THR B O   1 
ATOM   2304 C CB  . THR B 1 44  ? 34.882  25.335  44.388 1.00 60.36  ? 1347 THR B CB  1 
ATOM   2305 O OG1 . THR B 1 44  ? 33.880  24.326  44.535 1.00 58.60  ? 1347 THR B OG1 1 
ATOM   2306 C CG2 . THR B 1 44  ? 35.980  25.109  45.417 1.00 59.78  ? 1347 THR B CG2 1 
ATOM   2307 N N   . ASN B 1 45  ? 31.980  26.629  43.753 1.00 62.07  ? 1348 ASN B N   1 
ATOM   2308 C CA  . ASN B 1 45  ? 30.913  26.835  42.797 1.00 62.72  ? 1348 ASN B CA  1 
ATOM   2309 C C   . ASN B 1 45  ? 30.730  28.323  42.601 1.00 63.06  ? 1348 ASN B C   1 
ATOM   2310 O O   . ASN B 1 45  ? 30.677  28.807  41.479 1.00 63.47  ? 1348 ASN B O   1 
ATOM   2311 C CB  . ASN B 1 45  ? 29.616  26.203  43.294 1.00 63.71  ? 1348 ASN B CB  1 
ATOM   2312 C CG  . ASN B 1 45  ? 28.380  26.834  42.663 1.00 66.16  ? 1348 ASN B CG  1 
ATOM   2313 O OD1 . ASN B 1 45  ? 27.928  27.917  43.080 1.00 67.20  ? 1348 ASN B OD1 1 
ATOM   2314 N ND2 . ASN B 1 45  ? 27.831  26.172  41.648 1.00 64.95  ? 1348 ASN B ND2 1 
ATOM   2315 N N   . LEU B 1 46  ? 30.646  29.050  43.706 1.00 64.15  ? 1349 LEU B N   1 
ATOM   2316 C CA  . LEU B 1 46  ? 30.471  30.496  43.658 1.00 63.38  ? 1349 LEU B CA  1 
ATOM   2317 C C   . LEU B 1 46  ? 31.644  31.162  42.954 1.00 62.98  ? 1349 LEU B C   1 
ATOM   2318 O O   . LEU B 1 46  ? 31.477  32.148  42.246 1.00 63.15  ? 1349 LEU B O   1 
ATOM   2319 C CB  . LEU B 1 46  ? 30.340  31.049  45.071 1.00 62.70  ? 1349 LEU B CB  1 
ATOM   2320 C CG  . LEU B 1 46  ? 30.165  32.559  45.122 1.00 62.74  ? 1349 LEU B CG  1 
ATOM   2321 C CD1 . LEU B 1 46  ? 28.957  32.967  44.277 1.00 61.42  ? 1349 LEU B CD1 1 
ATOM   2322 C CD2 . LEU B 1 46  ? 30.000  32.989  46.582 1.00 63.53  ? 1349 LEU B CD2 1 
ATOM   2323 N N   . ALA B 1 47  ? 32.834  30.610  43.151 1.00 62.90  ? 1350 ALA B N   1 
ATOM   2324 C CA  . ALA B 1 47  ? 34.032  31.147  42.535 1.00 62.88  ? 1350 ALA B CA  1 
ATOM   2325 C C   . ALA B 1 47  ? 33.976  30.973  41.034 1.00 63.33  ? 1350 ALA B C   1 
ATOM   2326 O O   . ALA B 1 47  ? 33.873  31.946  40.302 1.00 63.37  ? 1350 ALA B O   1 
ATOM   2327 C CB  . ALA B 1 47  ? 35.249  30.453  43.083 1.00 63.26  ? 1350 ALA B CB  1 
ATOM   2328 N N   . ASP B 1 48  ? 34.047  29.729  40.576 1.00 64.87  ? 1351 ASP B N   1 
ATOM   2329 C CA  . ASP B 1 48  ? 34.003  29.448  39.144 1.00 66.58  ? 1351 ASP B CA  1 
ATOM   2330 C C   . ASP B 1 48  ? 33.041  30.404  38.426 1.00 67.74  ? 1351 ASP B C   1 
ATOM   2331 O O   . ASP B 1 48  ? 33.412  31.038  37.436 1.00 67.84  ? 1351 ASP B O   1 
ATOM   2332 C CB  . ASP B 1 48  ? 33.572  27.996  38.890 1.00 66.30  ? 1351 ASP B CB  1 
ATOM   2333 C CG  . ASP B 1 48  ? 33.605  27.622  37.404 1.00 67.32  ? 1351 ASP B CG  1 
ATOM   2334 O OD1 . ASP B 1 48  ? 32.905  28.258  36.583 1.00 67.31  ? 1351 ASP B OD1 1 
ATOM   2335 O OD2 . ASP B 1 48  ? 34.338  26.683  37.048 1.00 67.95  ? 1351 ASP B OD2 1 
ATOM   2336 N N   . ARG B 1 49  ? 31.813  30.512  38.927 1.00 68.18  ? 1352 ARG B N   1 
ATOM   2337 C CA  . ARG B 1 49  ? 30.823  31.395  38.315 1.00 68.46  ? 1352 ARG B CA  1 
ATOM   2338 C C   . ARG B 1 49  ? 31.295  32.842  38.319 1.00 67.64  ? 1352 ARG B C   1 
ATOM   2339 O O   . ARG B 1 49  ? 31.427  33.469  37.272 1.00 66.78  ? 1352 ARG B O   1 
ATOM   2340 C CB  . ARG B 1 49  ? 29.468  31.273  39.033 1.00 68.98  ? 1352 ARG B CB  1 
ATOM   2341 C CG  . ARG B 1 49  ? 28.716  30.000  38.665 1.00 71.37  ? 1352 ARG B CG  1 
ATOM   2342 C CD  . ARG B 1 49  ? 27.261  29.995  39.126 1.00 72.82  ? 1352 ARG B CD  1 
ATOM   2343 N NE  . ARG B 1 49  ? 27.121  29.762  40.560 1.00 75.27  ? 1352 ARG B NE  1 
ATOM   2344 C CZ  . ARG B 1 49  ? 26.967  30.722  41.463 1.00 76.42  ? 1352 ARG B CZ  1 
ATOM   2345 N NH1 . ARG B 1 49  ? 26.928  31.990  41.075 1.00 76.78  ? 1352 ARG B NH1 1 
ATOM   2346 N NH2 . ARG B 1 49  ? 26.858  30.412  42.753 1.00 76.69  ? 1352 ARG B NH2 1 
ATOM   2347 N N   . GLU B 1 50  ? 31.554  33.364  39.507 1.00 67.67  ? 1353 GLU B N   1 
ATOM   2348 C CA  . GLU B 1 50  ? 32.021  34.737  39.671 1.00 67.76  ? 1353 GLU B CA  1 
ATOM   2349 C C   . GLU B 1 50  ? 33.310  34.961  38.866 1.00 66.26  ? 1353 GLU B C   1 
ATOM   2350 O O   . GLU B 1 50  ? 33.594  36.071  38.412 1.00 65.11  ? 1353 GLU B O   1 
ATOM   2351 C CB  . GLU B 1 50  ? 32.277  34.990  41.161 1.00 69.04  ? 1353 GLU B CB  1 
ATOM   2352 C CG  . GLU B 1 50  ? 32.491  36.432  41.568 1.00 70.69  ? 1353 GLU B CG  1 
ATOM   2353 C CD  . GLU B 1 50  ? 32.869  36.550  43.039 1.00 71.62  ? 1353 GLU B CD  1 
ATOM   2354 O OE1 . GLU B 1 50  ? 33.018  37.688  43.539 1.00 72.67  ? 1353 GLU B OE1 1 
ATOM   2355 O OE2 . GLU B 1 50  ? 33.025  35.497  43.694 1.00 70.96  ? 1353 GLU B OE2 1 
ATOM   2356 N N   . LEU B 1 51  ? 34.072  33.885  38.692 1.00 65.19  ? 1354 LEU B N   1 
ATOM   2357 C CA  . LEU B 1 51  ? 35.340  33.904  37.973 1.00 63.98  ? 1354 LEU B CA  1 
ATOM   2358 C C   . LEU B 1 51  ? 35.133  33.944  36.456 1.00 64.63  ? 1354 LEU B C   1 
ATOM   2359 O O   . LEU B 1 51  ? 36.047  33.642  35.688 1.00 64.79  ? 1354 LEU B O   1 
ATOM   2360 C CB  . LEU B 1 51  ? 36.149  32.665  38.357 1.00 62.41  ? 1354 LEU B CB  1 
ATOM   2361 C CG  . LEU B 1 51  ? 37.656  32.636  38.126 1.00 61.43  ? 1354 LEU B CG  1 
ATOM   2362 C CD1 . LEU B 1 51  ? 38.333  33.748  38.904 1.00 62.04  ? 1354 LEU B CD1 1 
ATOM   2363 C CD2 . LEU B 1 51  ? 38.188  31.302  38.588 1.00 61.91  ? 1354 LEU B CD2 1 
ATOM   2364 N N   . VAL B 1 52  ? 33.921  34.302  36.033 1.00 64.59  ? 1355 VAL B N   1 
ATOM   2365 C CA  . VAL B 1 52  ? 33.574  34.402  34.612 1.00 62.43  ? 1355 VAL B CA  1 
ATOM   2366 C C   . VAL B 1 52  ? 33.236  35.852  34.345 1.00 62.58  ? 1355 VAL B C   1 
ATOM   2367 O O   . VAL B 1 52  ? 33.582  36.403  33.309 1.00 62.32  ? 1355 VAL B O   1 
ATOM   2368 C CB  . VAL B 1 52  ? 32.346  33.531  34.250 1.00 60.42  ? 1355 VAL B CB  1 
ATOM   2369 C CG1 . VAL B 1 52  ? 31.793  33.953  32.916 1.00 57.82  ? 1355 VAL B CG1 1 
ATOM   2370 C CG2 . VAL B 1 52  ? 32.742  32.061  34.201 1.00 59.99  ? 1355 VAL B CG2 1 
ATOM   2371 N N   . HIS B 1 53  ? 32.544  36.462  35.298 1.00 63.13  ? 1356 HIS B N   1 
ATOM   2372 C CA  . HIS B 1 53  ? 32.181  37.863  35.193 1.00 63.71  ? 1356 HIS B CA  1 
ATOM   2373 C C   . HIS B 1 53  ? 33.464  38.651  35.402 1.00 62.88  ? 1356 HIS B C   1 
ATOM   2374 O O   . HIS B 1 53  ? 33.584  39.795  34.959 1.00 62.39  ? 1356 HIS B O   1 
ATOM   2375 C CB  . HIS B 1 53  ? 31.177  38.247  36.285 1.00 65.17  ? 1356 HIS B CB  1 
ATOM   2376 C CG  . HIS B 1 53  ? 29.852  37.568  36.162 1.00 65.77  ? 1356 HIS B CG  1 
ATOM   2377 N ND1 . HIS B 1 53  ? 28.885  37.651  37.140 1.00 66.93  ? 1356 HIS B ND1 1 
ATOM   2378 C CD2 . HIS B 1 53  ? 29.334  36.792  35.182 1.00 66.33  ? 1356 HIS B CD2 1 
ATOM   2379 C CE1 . HIS B 1 53  ? 27.828  36.951  36.768 1.00 68.24  ? 1356 HIS B CE1 1 
ATOM   2380 N NE2 . HIS B 1 53  ? 28.075  36.420  35.584 1.00 67.51  ? 1356 HIS B NE2 1 
ATOM   2381 N N   . MET B 1 54  ? 34.415  38.030  36.096 1.00 61.64  ? 1357 MET B N   1 
ATOM   2382 C CA  . MET B 1 54  ? 35.681  38.681  36.366 1.00 61.24  ? 1357 MET B CA  1 
ATOM   2383 C C   . MET B 1 54  ? 36.445  38.856  35.075 1.00 60.34  ? 1357 MET B C   1 
ATOM   2384 O O   . MET B 1 54  ? 37.111  39.865  34.884 1.00 60.09  ? 1357 MET B O   1 
ATOM   2385 C CB  . MET B 1 54  ? 36.534  37.869  37.342 1.00 62.23  ? 1357 MET B CB  1 
ATOM   2386 C CG  . MET B 1 54  ? 37.885  38.524  37.639 1.00 61.03  ? 1357 MET B CG  1 
ATOM   2387 S SD  . MET B 1 54  ? 39.058  37.441  38.458 1.00 59.48  ? 1357 MET B SD  1 
ATOM   2388 C CE  . MET B 1 54  ? 38.724  37.799  40.173 1.00 62.00  ? 1357 MET B CE  1 
ATOM   2389 N N   . ILE B 1 55  ? 36.358  37.870  34.190 1.00 60.15  ? 1358 ILE B N   1 
ATOM   2390 C CA  . ILE B 1 55  ? 37.061  37.967  32.916 1.00 60.58  ? 1358 ILE B CA  1 
ATOM   2391 C C   . ILE B 1 55  ? 36.586  39.210  32.171 1.00 60.99  ? 1358 ILE B C   1 
ATOM   2392 O O   . ILE B 1 55  ? 37.392  40.031  31.724 1.00 61.18  ? 1358 ILE B O   1 
ATOM   2393 C CB  . ILE B 1 55  ? 36.816  36.734  32.016 1.00 59.71  ? 1358 ILE B CB  1 
ATOM   2394 C CG1 . ILE B 1 55  ? 37.264  35.457  32.721 1.00 59.76  ? 1358 ILE B CG1 1 
ATOM   2395 C CG2 . ILE B 1 55  ? 37.627  36.860  30.750 1.00 59.81  ? 1358 ILE B CG2 1 
ATOM   2396 C CD1 . ILE B 1 55  ? 37.161  34.225  31.849 1.00 59.06  ? 1358 ILE B CD1 1 
ATOM   2397 N N   . ASN B 1 56  ? 35.270  39.346  32.046 1.00 61.28  ? 1359 ASN B N   1 
ATOM   2398 C CA  . ASN B 1 56  ? 34.680  40.496  31.374 1.00 61.31  ? 1359 ASN B CA  1 
ATOM   2399 C C   . ASN B 1 56  ? 35.081  41.804  32.063 1.00 61.50  ? 1359 ASN B C   1 
ATOM   2400 O O   . ASN B 1 56  ? 35.415  42.782  31.397 1.00 61.82  ? 1359 ASN B O   1 
ATOM   2401 C CB  . ASN B 1 56  ? 33.160  40.346  31.342 1.00 61.90  ? 1359 ASN B CB  1 
ATOM   2402 C CG  . ASN B 1 56  ? 32.714  39.125  30.552 1.00 62.71  ? 1359 ASN B CG  1 
ATOM   2403 O OD1 . ASN B 1 56  ? 31.525  38.816  30.474 1.00 62.48  ? 1359 ASN B OD1 1 
ATOM   2404 N ND2 . ASN B 1 56  ? 33.674  38.423  29.962 1.00 63.75  ? 1359 ASN B ND2 1 
ATOM   2405 N N   . TRP B 1 57  ? 35.043  41.827  33.391 1.00 61.47  ? 1360 TRP B N   1 
ATOM   2406 C CA  . TRP B 1 57  ? 35.445  43.015  34.130 1.00 61.60  ? 1360 TRP B CA  1 
ATOM   2407 C C   . TRP B 1 57  ? 36.847  43.392  33.668 1.00 62.49  ? 1360 TRP B C   1 
ATOM   2408 O O   . TRP B 1 57  ? 37.086  44.511  33.221 1.00 62.21  ? 1360 TRP B O   1 
ATOM   2409 C CB  . TRP B 1 57  ? 35.479  42.725  35.631 1.00 62.23  ? 1360 TRP B CB  1 
ATOM   2410 C CG  . TRP B 1 57  ? 36.194  43.782  36.450 1.00 63.39  ? 1360 TRP B CG  1 
ATOM   2411 C CD1 . TRP B 1 57  ? 35.721  45.022  36.793 1.00 64.07  ? 1360 TRP B CD1 1 
ATOM   2412 C CD2 . TRP B 1 57  ? 37.520  43.695  37.003 1.00 63.05  ? 1360 TRP B CD2 1 
ATOM   2413 N NE1 . TRP B 1 57  ? 36.669  45.710  37.523 1.00 62.79  ? 1360 TRP B NE1 1 
ATOM   2414 C CE2 . TRP B 1 57  ? 37.781  44.918  37.665 1.00 63.13  ? 1360 TRP B CE2 1 
ATOM   2415 C CE3 . TRP B 1 57  ? 38.512  42.703  37.004 1.00 61.48  ? 1360 TRP B CE3 1 
ATOM   2416 C CZ2 . TRP B 1 57  ? 38.994  45.172  38.321 1.00 62.69  ? 1360 TRP B CZ2 1 
ATOM   2417 C CZ3 . TRP B 1 57  ? 39.714  42.959  37.655 1.00 60.88  ? 1360 TRP B CZ3 1 
ATOM   2418 C CH2 . TRP B 1 57  ? 39.944  44.183  38.304 1.00 60.59  ? 1360 TRP B CH2 1 
ATOM   2419 N N   . ALA B 1 58  ? 37.766  42.436  33.779 1.00 63.70  ? 1361 ALA B N   1 
ATOM   2420 C CA  . ALA B 1 58  ? 39.163  42.626  33.400 1.00 63.92  ? 1361 ALA B CA  1 
ATOM   2421 C C   . ALA B 1 58  ? 39.296  43.387  32.098 1.00 64.64  ? 1361 ALA B C   1 
ATOM   2422 O O   . ALA B 1 58  ? 39.993  44.398  32.041 1.00 65.25  ? 1361 ALA B O   1 
ATOM   2423 C CB  . ALA B 1 58  ? 39.865  41.277  33.284 1.00 63.78  ? 1361 ALA B CB  1 
ATOM   2424 N N   . LYS B 1 59  ? 38.629  42.899  31.056 1.00 65.40  ? 1362 LYS B N   1 
ATOM   2425 C CA  . LYS B 1 59  ? 38.679  43.537  29.742 1.00 66.30  ? 1362 LYS B CA  1 
ATOM   2426 C C   . LYS B 1 59  ? 38.367  45.041  29.794 1.00 66.69  ? 1362 LYS B C   1 
ATOM   2427 O O   . LYS B 1 59  ? 38.871  45.815  28.978 1.00 67.24  ? 1362 LYS B O   1 
ATOM   2428 C CB  . LYS B 1 59  ? 37.715  42.831  28.768 1.00 66.30  ? 1362 LYS B CB  1 
ATOM   2429 C CG  . LYS B 1 59  ? 38.376  41.852  27.770 1.00 67.44  ? 1362 LYS B CG  1 
ATOM   2430 C CD  . LYS B 1 59  ? 39.036  40.630  28.446 1.00 68.52  ? 1362 LYS B CD  1 
ATOM   2431 C CE  . LYS B 1 59  ? 39.800  39.749  27.429 1.00 67.57  ? 1362 LYS B CE  1 
ATOM   2432 N NZ  . LYS B 1 59  ? 40.524  38.582  28.037 1.00 64.98  ? 1362 LYS B NZ  1 
ATOM   2433 N N   . ARG B 1 60  ? 37.560  45.458  30.767 1.00 66.63  ? 1363 ARG B N   1 
ATOM   2434 C CA  . ARG B 1 60  ? 37.184  46.861  30.887 1.00 65.77  ? 1363 ARG B CA  1 
ATOM   2435 C C   . ARG B 1 60  ? 38.160  47.742  31.649 1.00 65.20  ? 1363 ARG B C   1 
ATOM   2436 O O   . ARG B 1 60  ? 38.154  48.949  31.473 1.00 65.66  ? 1363 ARG B O   1 
ATOM   2437 C CB  . ARG B 1 60  ? 35.788  46.975  31.498 1.00 66.05  ? 1363 ARG B CB  1 
ATOM   2438 C CG  . ARG B 1 60  ? 34.714  46.380  30.605 1.00 69.74  ? 1363 ARG B CG  1 
ATOM   2439 C CD  . ARG B 1 60  ? 33.292  46.723  31.054 1.00 72.81  ? 1363 ARG B CD  1 
ATOM   2440 N NE  . ARG B 1 60  ? 32.301  46.379  30.030 1.00 75.61  ? 1363 ARG B NE  1 
ATOM   2441 C CZ  . ARG B 1 60  ? 31.971  45.134  29.685 1.00 76.77  ? 1363 ARG B CZ  1 
ATOM   2442 N NH1 . ARG B 1 60  ? 32.542  44.094  30.285 1.00 76.30  ? 1363 ARG B NH1 1 
ATOM   2443 N NH2 . ARG B 1 60  ? 31.077  44.928  28.723 1.00 77.48  ? 1363 ARG B NH2 1 
ATOM   2444 N N   . VAL B 1 61  ? 38.996  47.157  32.497 1.00 64.73  ? 1364 VAL B N   1 
ATOM   2445 C CA  . VAL B 1 61  ? 39.967  47.953  33.239 1.00 63.80  ? 1364 VAL B CA  1 
ATOM   2446 C C   . VAL B 1 61  ? 40.842  48.716  32.243 1.00 63.87  ? 1364 VAL B C   1 
ATOM   2447 O O   . VAL B 1 61  ? 41.345  48.145  31.270 1.00 64.37  ? 1364 VAL B O   1 
ATOM   2448 C CB  . VAL B 1 61  ? 40.858  47.068  34.133 1.00 63.32  ? 1364 VAL B CB  1 
ATOM   2449 C CG1 . VAL B 1 61  ? 41.924  47.915  34.814 1.00 64.22  ? 1364 VAL B CG1 1 
ATOM   2450 C CG2 . VAL B 1 61  ? 40.007  46.376  35.173 1.00 62.87  ? 1364 VAL B CG2 1 
ATOM   2451 N N   . PRO B 1 62  ? 41.020  50.028  32.467 1.00 63.55  ? 1365 PRO B N   1 
ATOM   2452 C CA  . PRO B 1 62  ? 41.821  50.908  31.612 1.00 63.35  ? 1365 PRO B CA  1 
ATOM   2453 C C   . PRO B 1 62  ? 43.245  50.422  31.363 1.00 63.58  ? 1365 PRO B C   1 
ATOM   2454 O O   . PRO B 1 62  ? 43.941  49.987  32.287 1.00 63.26  ? 1365 PRO B O   1 
ATOM   2455 C CB  . PRO B 1 62  ? 41.786  52.233  32.368 1.00 63.90  ? 1365 PRO B CB  1 
ATOM   2456 C CG  . PRO B 1 62  ? 40.441  52.211  33.009 1.00 63.20  ? 1365 PRO B CG  1 
ATOM   2457 C CD  . PRO B 1 62  ? 40.379  50.801  33.545 1.00 63.70  ? 1365 PRO B CD  1 
ATOM   2458 N N   . GLY B 1 63  ? 43.673  50.505  30.108 1.00 63.46  ? 1366 GLY B N   1 
ATOM   2459 C CA  . GLY B 1 63  ? 45.018  50.085  29.756 1.00 63.42  ? 1366 GLY B CA  1 
ATOM   2460 C C   . GLY B 1 63  ? 45.207  48.581  29.692 1.00 63.12  ? 1366 GLY B C   1 
ATOM   2461 O O   . GLY B 1 63  ? 46.214  48.105  29.165 1.00 62.96  ? 1366 GLY B O   1 
ATOM   2462 N N   . PHE B 1 64  ? 44.240  47.831  30.216 1.00 62.65  ? 1367 PHE B N   1 
ATOM   2463 C CA  . PHE B 1 64  ? 44.320  46.378  30.218 1.00 61.48  ? 1367 PHE B CA  1 
ATOM   2464 C C   . PHE B 1 64  ? 44.304  45.740  28.820 1.00 61.03  ? 1367 PHE B C   1 
ATOM   2465 O O   . PHE B 1 64  ? 45.142  44.887  28.520 1.00 61.58  ? 1367 PHE B O   1 
ATOM   2466 C CB  . PHE B 1 64  ? 43.189  45.789  31.059 1.00 61.88  ? 1367 PHE B CB  1 
ATOM   2467 C CG  . PHE B 1 64  ? 43.222  44.294  31.142 1.00 63.06  ? 1367 PHE B CG  1 
ATOM   2468 C CD1 . PHE B 1 64  ? 44.178  43.650  31.922 1.00 63.39  ? 1367 PHE B CD1 1 
ATOM   2469 C CD2 . PHE B 1 64  ? 42.328  43.520  30.398 1.00 63.36  ? 1367 PHE B CD2 1 
ATOM   2470 C CE1 . PHE B 1 64  ? 44.245  42.253  31.956 1.00 64.29  ? 1367 PHE B CE1 1 
ATOM   2471 C CE2 . PHE B 1 64  ? 42.387  42.122  30.424 1.00 63.29  ? 1367 PHE B CE2 1 
ATOM   2472 C CZ  . PHE B 1 64  ? 43.346  41.488  31.202 1.00 63.63  ? 1367 PHE B CZ  1 
ATOM   2473 N N   . VAL B 1 65  ? 43.368  46.134  27.959 1.00 59.66  ? 1368 VAL B N   1 
ATOM   2474 C CA  . VAL B 1 65  ? 43.320  45.534  26.623 1.00 58.45  ? 1368 VAL B CA  1 
ATOM   2475 C C   . VAL B 1 65  ? 44.382  46.057  25.667 1.00 57.73  ? 1368 VAL B C   1 
ATOM   2476 O O   . VAL B 1 65  ? 44.459  45.615  24.523 1.00 57.66  ? 1368 VAL B O   1 
ATOM   2477 C CB  . VAL B 1 65  ? 41.932  45.702  25.942 1.00 57.64  ? 1368 VAL B CB  1 
ATOM   2478 C CG1 . VAL B 1 65  ? 40.876  44.966  26.737 1.00 58.54  ? 1368 VAL B CG1 1 
ATOM   2479 C CG2 . VAL B 1 65  ? 41.583  47.161  25.804 1.00 56.22  ? 1368 VAL B CG2 1 
ATOM   2480 N N   . ASP B 1 66  ? 45.193  47.005  26.123 1.00 57.45  ? 1369 ASP B N   1 
ATOM   2481 C CA  . ASP B 1 66  ? 46.253  47.553  25.279 1.00 57.85  ? 1369 ASP B CA  1 
ATOM   2482 C C   . ASP B 1 66  ? 47.429  46.585  25.352 1.00 56.64  ? 1369 ASP B C   1 
ATOM   2483 O O   . ASP B 1 66  ? 48.506  46.846  24.814 1.00 57.34  ? 1369 ASP B O   1 
ATOM   2484 C CB  . ASP B 1 66  ? 46.694  48.939  25.775 1.00 60.74  ? 1369 ASP B CB  1 
ATOM   2485 C CG  . ASP B 1 66  ? 45.553  49.959  25.776 1.00 64.01  ? 1369 ASP B CG  1 
ATOM   2486 O OD1 . ASP B 1 66  ? 44.821  50.044  24.755 1.00 63.55  ? 1369 ASP B OD1 1 
ATOM   2487 O OD2 . ASP B 1 66  ? 45.403  50.684  26.795 1.00 65.12  ? 1369 ASP B OD2 1 
ATOM   2488 N N   . LEU B 1 67  ? 47.200  45.465  26.034 1.00 54.67  ? 1370 LEU B N   1 
ATOM   2489 C CA  . LEU B 1 67  ? 48.203  44.423  26.223 1.00 51.74  ? 1370 LEU B CA  1 
ATOM   2490 C C   . LEU B 1 67  ? 47.954  43.271  25.271 1.00 51.13  ? 1370 LEU B C   1 
ATOM   2491 O O   . LEU B 1 67  ? 46.869  43.148  24.701 1.00 52.45  ? 1370 LEU B O   1 
ATOM   2492 C CB  . LEU B 1 67  ? 48.127  43.890  27.650 1.00 50.61  ? 1370 LEU B CB  1 
ATOM   2493 C CG  . LEU B 1 67  ? 48.556  44.796  28.795 1.00 48.89  ? 1370 LEU B CG  1 
ATOM   2494 C CD1 . LEU B 1 67  ? 47.907  44.340  30.081 1.00 49.47  ? 1370 LEU B CD1 1 
ATOM   2495 C CD2 . LEU B 1 67  ? 50.070  44.765  28.900 1.00 49.28  ? 1370 LEU B CD2 1 
ATOM   2496 N N   . THR B 1 68  ? 48.963  42.423  25.106 1.00 49.90  ? 1371 THR B N   1 
ATOM   2497 C CA  . THR B 1 68  ? 48.844  41.253  24.241 1.00 48.11  ? 1371 THR B CA  1 
ATOM   2498 C C   . THR B 1 68  ? 47.880  40.268  24.896 1.00 48.02  ? 1371 THR B C   1 
ATOM   2499 O O   . THR B 1 68  ? 47.961  40.002  26.096 1.00 47.03  ? 1371 THR B O   1 
ATOM   2500 C CB  . THR B 1 68  ? 50.203  40.572  24.046 1.00 46.51  ? 1371 THR B CB  1 
ATOM   2501 O OG1 . THR B 1 68  ? 50.947  40.646  25.266 1.00 45.27  ? 1371 THR B OG1 1 
ATOM   2502 C CG2 . THR B 1 68  ? 50.980  41.243  22.951 1.00 45.79  ? 1371 THR B CG2 1 
ATOM   2503 N N   . LEU B 1 69  ? 46.966  39.724  24.108 1.00 47.92  ? 1372 LEU B N   1 
ATOM   2504 C CA  . LEU B 1 69  ? 45.995  38.796  24.651 1.00 49.22  ? 1372 LEU B CA  1 
ATOM   2505 C C   . LEU B 1 69  ? 46.592  37.843  25.671 1.00 50.31  ? 1372 LEU B C   1 
ATOM   2506 O O   . LEU B 1 69  ? 46.075  37.716  26.777 1.00 51.19  ? 1372 LEU B O   1 
ATOM   2507 C CB  . LEU B 1 69  ? 45.336  38.020  23.525 1.00 49.27  ? 1372 LEU B CB  1 
ATOM   2508 C CG  . LEU B 1 69  ? 44.683  38.953  22.505 1.00 50.73  ? 1372 LEU B CG  1 
ATOM   2509 C CD1 . LEU B 1 69  ? 43.875  38.134  21.520 1.00 50.16  ? 1372 LEU B CD1 1 
ATOM   2510 C CD2 . LEU B 1 69  ? 43.783  39.963  23.214 1.00 51.75  ? 1372 LEU B CD2 1 
ATOM   2511 N N   . HIS B 1 70  ? 47.693  37.191  25.321 1.00 51.38  ? 1373 HIS B N   1 
ATOM   2512 C CA  . HIS B 1 70  ? 48.315  36.251  26.247 1.00 51.04  ? 1373 HIS B CA  1 
ATOM   2513 C C   . HIS B 1 70  ? 48.741  36.856  27.575 1.00 51.19  ? 1373 HIS B C   1 
ATOM   2514 O O   . HIS B 1 70  ? 48.666  36.192  28.617 1.00 51.32  ? 1373 HIS B O   1 
ATOM   2515 C CB  . HIS B 1 70  ? 49.500  35.551  25.590 1.00 51.60  ? 1373 HIS B CB  1 
ATOM   2516 C CG  . HIS B 1 70  ? 49.102  34.417  24.699 1.00 52.49  ? 1373 HIS B CG  1 
ATOM   2517 N ND1 . HIS B 1 70  ? 48.899  34.563  23.344 1.00 53.44  ? 1373 HIS B ND1 1 
ATOM   2518 C CD2 . HIS B 1 70  ? 48.829  33.121  24.980 1.00 52.31  ? 1373 HIS B CD2 1 
ATOM   2519 C CE1 . HIS B 1 70  ? 48.521  33.406  22.830 1.00 52.71  ? 1373 HIS B CE1 1 
ATOM   2520 N NE2 . HIS B 1 70  ? 48.469  32.515  23.802 1.00 51.98  ? 1373 HIS B NE2 1 
ATOM   2521 N N   . ASP B 1 71  ? 49.181  38.109  27.556 1.00 51.24  ? 1374 ASP B N   1 
ATOM   2522 C CA  . ASP B 1 71  ? 49.592  38.755  28.796 1.00 51.50  ? 1374 ASP B CA  1 
ATOM   2523 C C   . ASP B 1 71  ? 48.369  39.117  29.619 1.00 50.28  ? 1374 ASP B C   1 
ATOM   2524 O O   . ASP B 1 71  ? 48.408  39.089  30.851 1.00 50.14  ? 1374 ASP B O   1 
ATOM   2525 C CB  . ASP B 1 71  ? 50.431  40.003  28.510 1.00 54.51  ? 1374 ASP B CB  1 
ATOM   2526 C CG  . ASP B 1 71  ? 51.862  39.665  28.124 1.00 56.43  ? 1374 ASP B CG  1 
ATOM   2527 O OD1 . ASP B 1 71  ? 52.061  38.997  27.090 1.00 58.62  ? 1374 ASP B OD1 1 
ATOM   2528 O OD2 . ASP B 1 71  ? 52.789  40.062  28.857 1.00 57.92  ? 1374 ASP B OD2 1 
ATOM   2529 N N   . GLN B 1 72  ? 47.281  39.455  28.933 1.00 49.28  ? 1375 GLN B N   1 
ATOM   2530 C CA  . GLN B 1 72  ? 46.034  39.785  29.613 1.00 49.00  ? 1375 GLN B CA  1 
ATOM   2531 C C   . GLN B 1 72  ? 45.603  38.539  30.372 1.00 49.25  ? 1375 GLN B C   1 
ATOM   2532 O O   . GLN B 1 72  ? 45.256  38.610  31.554 1.00 49.08  ? 1375 GLN B O   1 
ATOM   2533 C CB  . GLN B 1 72  ? 44.956  40.174  28.602 1.00 48.46  ? 1375 GLN B CB  1 
ATOM   2534 C CG  . GLN B 1 72  ? 45.271  41.434  27.827 1.00 46.78  ? 1375 GLN B CG  1 
ATOM   2535 C CD  . GLN B 1 72  ? 44.189  41.781  26.856 1.00 45.34  ? 1375 GLN B CD  1 
ATOM   2536 O OE1 . GLN B 1 72  ? 43.018  41.863  27.224 1.00 46.27  ? 1375 GLN B OE1 1 
ATOM   2537 N NE2 . GLN B 1 72  ? 44.566  41.988  25.603 1.00 44.29  ? 1375 GLN B NE2 1 
ATOM   2538 N N   . VAL B 1 73  ? 45.630  37.397  29.683 1.00 48.54  ? 1376 VAL B N   1 
ATOM   2539 C CA  . VAL B 1 73  ? 45.278  36.127  30.304 1.00 48.42  ? 1376 VAL B CA  1 
ATOM   2540 C C   . VAL B 1 73  ? 46.211  35.980  31.508 1.00 48.13  ? 1376 VAL B C   1 
ATOM   2541 O O   . VAL B 1 73  ? 45.762  35.928  32.660 1.00 45.83  ? 1376 VAL B O   1 
ATOM   2542 C CB  . VAL B 1 73  ? 45.505  34.943  29.336 1.00 47.77  ? 1376 VAL B CB  1 
ATOM   2543 C CG1 . VAL B 1 73  ? 44.809  33.706  29.853 1.00 47.16  ? 1376 VAL B CG1 1 
ATOM   2544 C CG2 . VAL B 1 73  ? 44.980  35.289  27.969 1.00 49.51  ? 1376 VAL B CG2 1 
ATOM   2545 N N   . HIS B 1 74  ? 47.512  35.945  31.220 1.00 48.69  ? 1377 HIS B N   1 
ATOM   2546 C CA  . HIS B 1 74  ? 48.545  35.824  32.244 1.00 50.00  ? 1377 HIS B CA  1 
ATOM   2547 C C   . HIS B 1 74  ? 48.241  36.641  33.512 1.00 49.51  ? 1377 HIS B C   1 
ATOM   2548 O O   . HIS B 1 74  ? 48.236  36.107  34.629 1.00 49.28  ? 1377 HIS B O   1 
ATOM   2549 C CB  . HIS B 1 74  ? 49.892  36.255  31.661 1.00 51.69  ? 1377 HIS B CB  1 
ATOM   2550 C CG  . HIS B 1 74  ? 51.013  36.220  32.651 1.00 54.56  ? 1377 HIS B CG  1 
ATOM   2551 N ND1 . HIS B 1 74  ? 51.032  37.013  33.779 1.00 56.10  ? 1377 HIS B ND1 1 
ATOM   2552 C CD2 . HIS B 1 74  ? 52.136  35.466  32.704 1.00 54.69  ? 1377 HIS B CD2 1 
ATOM   2553 C CE1 . HIS B 1 74  ? 52.115  36.745  34.486 1.00 56.46  ? 1377 HIS B CE1 1 
ATOM   2554 N NE2 . HIS B 1 74  ? 52.803  35.810  33.856 1.00 55.75  ? 1377 HIS B NE2 1 
ATOM   2555 N N   . LEU B 1 75  ? 47.998  37.937  33.339 1.00 48.88  ? 1378 LEU B N   1 
ATOM   2556 C CA  . LEU B 1 75  ? 47.689  38.803  34.474 1.00 48.22  ? 1378 LEU B CA  1 
ATOM   2557 C C   . LEU B 1 75  ? 46.558  38.223  35.291 1.00 46.94  ? 1378 LEU B C   1 
ATOM   2558 O O   . LEU B 1 75  ? 46.642  38.137  36.507 1.00 45.67  ? 1378 LEU B O   1 
ATOM   2559 C CB  . LEU B 1 75  ? 47.285  40.203  34.002 1.00 48.52  ? 1378 LEU B CB  1 
ATOM   2560 C CG  . LEU B 1 75  ? 48.392  41.127  33.500 1.00 47.92  ? 1378 LEU B CG  1 
ATOM   2561 C CD1 . LEU B 1 75  ? 47.804  42.488  33.191 1.00 46.53  ? 1378 LEU B CD1 1 
ATOM   2562 C CD2 . LEU B 1 75  ? 49.473  41.257  34.563 1.00 49.71  ? 1378 LEU B CD2 1 
ATOM   2563 N N   . LEU B 1 76  ? 45.503  37.824  34.596 1.00 47.35  ? 1379 LEU B N   1 
ATOM   2564 C CA  . LEU B 1 76  ? 44.329  37.261  35.228 1.00 48.11  ? 1379 LEU B CA  1 
ATOM   2565 C C   . LEU B 1 76  ? 44.611  36.011  36.018 1.00 48.20  ? 1379 LEU B C   1 
ATOM   2566 O O   . LEU B 1 76  ? 44.440  35.990  37.233 1.00 48.23  ? 1379 LEU B O   1 
ATOM   2567 C CB  . LEU B 1 76  ? 43.265  36.960  34.181 1.00 49.49  ? 1379 LEU B CB  1 
ATOM   2568 C CG  . LEU B 1 76  ? 42.510  38.189  33.661 1.00 51.80  ? 1379 LEU B CG  1 
ATOM   2569 C CD1 . LEU B 1 76  ? 41.904  37.921  32.279 1.00 50.76  ? 1379 LEU B CD1 1 
ATOM   2570 C CD2 . LEU B 1 76  ? 41.441  38.567  34.675 1.00 50.91  ? 1379 LEU B CD2 1 
ATOM   2571 N N   . GLU B 1 77  ? 45.043  34.957  35.345 1.00 48.89  ? 1380 GLU B N   1 
ATOM   2572 C CA  . GLU B 1 77  ? 45.294  33.723  36.067 1.00 49.64  ? 1380 GLU B CA  1 
ATOM   2573 C C   . GLU B 1 77  ? 46.352  33.926  37.118 1.00 50.16  ? 1380 GLU B C   1 
ATOM   2574 O O   . GLU B 1 77  ? 46.458  33.140  38.046 1.00 51.34  ? 1380 GLU B O   1 
ATOM   2575 C CB  . GLU B 1 77  ? 45.705  32.605  35.125 1.00 48.65  ? 1380 GLU B CB  1 
ATOM   2576 C CG  . GLU B 1 77  ? 47.020  32.818  34.453 1.00 50.59  ? 1380 GLU B CG  1 
ATOM   2577 C CD  . GLU B 1 77  ? 47.078  32.121  33.108 1.00 53.37  ? 1380 GLU B CD  1 
ATOM   2578 O OE1 . GLU B 1 77  ? 48.159  32.122  32.482 1.00 54.27  ? 1380 GLU B OE1 1 
ATOM   2579 O OE2 . GLU B 1 77  ? 46.037  31.577  32.669 1.00 53.75  ? 1380 GLU B OE2 1 
ATOM   2580 N N   . CYS B 1 78  ? 47.128  34.989  37.000 1.00 50.84  ? 1381 CYS B N   1 
ATOM   2581 C CA  . CYS B 1 78  ? 48.150  35.208  38.002 1.00 52.45  ? 1381 CYS B CA  1 
ATOM   2582 C C   . CYS B 1 78  ? 47.608  35.922  39.242 1.00 51.99  ? 1381 CYS B C   1 
ATOM   2583 O O   . CYS B 1 78  ? 48.241  35.905  40.296 1.00 51.99  ? 1381 CYS B O   1 
ATOM   2584 C CB  . CYS B 1 78  ? 49.323  35.999  37.418 1.00 52.90  ? 1381 CYS B CB  1 
ATOM   2585 S SG  . CYS B 1 78  ? 50.776  35.979  38.515 1.00 58.90  ? 1381 CYS B SG  1 
ATOM   2586 N N   . ALA B 1 79  ? 46.431  36.531  39.127 1.00 51.86  ? 1382 ALA B N   1 
ATOM   2587 C CA  . ALA B 1 79  ? 45.853  37.268  40.250 1.00 51.21  ? 1382 ALA B CA  1 
ATOM   2588 C C   . ALA B 1 79  ? 44.384  36.978  40.524 1.00 50.68  ? 1382 ALA B C   1 
ATOM   2589 O O   . ALA B 1 79  ? 43.810  37.542  41.450 1.00 50.14  ? 1382 ALA B O   1 
ATOM   2590 C CB  . ALA B 1 79  ? 46.042  38.777  40.026 1.00 50.77  ? 1382 ALA B CB  1 
ATOM   2591 N N   . TRP B 1 80  ? 43.782  36.102  39.726 1.00 50.55  ? 1383 TRP B N   1 
ATOM   2592 C CA  . TRP B 1 80  ? 42.367  35.767  39.875 1.00 50.82  ? 1383 TRP B CA  1 
ATOM   2593 C C   . TRP B 1 80  ? 41.893  35.556  41.320 1.00 51.06  ? 1383 TRP B C   1 
ATOM   2594 O O   . TRP B 1 80  ? 40.872  36.114  41.733 1.00 50.90  ? 1383 TRP B O   1 
ATOM   2595 C CB  . TRP B 1 80  ? 42.034  34.516  39.063 1.00 51.74  ? 1383 TRP B CB  1 
ATOM   2596 C CG  . TRP B 1 80  ? 42.611  33.265  39.647 1.00 53.24  ? 1383 TRP B CG  1 
ATOM   2597 C CD1 . TRP B 1 80  ? 43.901  32.833  39.554 1.00 52.39  ? 1383 TRP B CD1 1 
ATOM   2598 C CD2 . TRP B 1 80  ? 41.925  32.314  40.469 1.00 53.72  ? 1383 TRP B CD2 1 
ATOM   2599 N NE1 . TRP B 1 80  ? 44.062  31.673  40.267 1.00 53.59  ? 1383 TRP B NE1 1 
ATOM   2600 C CE2 . TRP B 1 80  ? 42.864  31.332  40.841 1.00 54.10  ? 1383 TRP B CE2 1 
ATOM   2601 C CE3 . TRP B 1 80  ? 40.608  32.200  40.929 1.00 54.30  ? 1383 TRP B CE3 1 
ATOM   2602 C CZ2 . TRP B 1 80  ? 42.527  30.240  41.656 1.00 53.66  ? 1383 TRP B CZ2 1 
ATOM   2603 C CZ3 . TRP B 1 80  ? 40.276  31.116  41.737 1.00 54.69  ? 1383 TRP B CZ3 1 
ATOM   2604 C CH2 . TRP B 1 80  ? 41.234  30.151  42.090 1.00 53.21  ? 1383 TRP B CH2 1 
ATOM   2605 N N   . LEU B 1 81  ? 42.613  34.740  42.085 1.00 50.86  ? 1384 LEU B N   1 
ATOM   2606 C CA  . LEU B 1 81  ? 42.206  34.487  43.457 1.00 49.93  ? 1384 LEU B CA  1 
ATOM   2607 C C   . LEU B 1 81  ? 42.408  35.749  44.283 1.00 50.06  ? 1384 LEU B C   1 
ATOM   2608 O O   . LEU B 1 81  ? 41.539  36.113  45.084 1.00 50.10  ? 1384 LEU B O   1 
ATOM   2609 C CB  . LEU B 1 81  ? 43.012  33.331  44.060 1.00 49.36  ? 1384 LEU B CB  1 
ATOM   2610 C CG  . LEU B 1 81  ? 42.644  33.027  45.520 1.00 48.15  ? 1384 LEU B CG  1 
ATOM   2611 C CD1 . LEU B 1 81  ? 41.202  32.591  45.584 1.00 49.14  ? 1384 LEU B CD1 1 
ATOM   2612 C CD2 . LEU B 1 81  ? 43.547  31.963  46.099 1.00 46.36  ? 1384 LEU B CD2 1 
ATOM   2613 N N   . GLU B 1 82  ? 43.553  36.409  44.067 1.00 49.44  ? 1385 GLU B N   1 
ATOM   2614 C CA  . GLU B 1 82  ? 43.926  37.644  44.771 1.00 48.33  ? 1385 GLU B CA  1 
ATOM   2615 C C   . GLU B 1 82  ? 42.813  38.699  44.631 1.00 47.64  ? 1385 GLU B C   1 
ATOM   2616 O O   . GLU B 1 82  ? 42.557  39.494  45.544 1.00 46.10  ? 1385 GLU B O   1 
ATOM   2617 C CB  . GLU B 1 82  ? 45.244  38.160  44.197 1.00 48.69  ? 1385 GLU B CB  1 
ATOM   2618 C CG  . GLU B 1 82  ? 46.096  39.006  45.132 1.00 50.44  ? 1385 GLU B CG  1 
ATOM   2619 C CD  . GLU B 1 82  ? 47.482  39.277  44.544 1.00 52.45  ? 1385 GLU B CD  1 
ATOM   2620 O OE1 . GLU B 1 82  ? 48.232  40.108  45.103 1.00 55.42  ? 1385 GLU B OE1 1 
ATOM   2621 O OE2 . GLU B 1 82  ? 47.830  38.654  43.519 1.00 51.15  ? 1385 GLU B OE2 1 
ATOM   2622 N N   . ILE B 1 83  ? 42.160  38.699  43.475 1.00 46.81  ? 1386 ILE B N   1 
ATOM   2623 C CA  . ILE B 1 83  ? 41.054  39.598  43.233 1.00 46.17  ? 1386 ILE B CA  1 
ATOM   2624 C C   . ILE B 1 83  ? 39.814  38.997  43.919 1.00 47.08  ? 1386 ILE B C   1 
ATOM   2625 O O   . ILE B 1 83  ? 39.171  39.665  44.725 1.00 47.91  ? 1386 ILE B O   1 
ATOM   2626 C CB  . ILE B 1 83  ? 40.804  39.766  41.729 1.00 45.74  ? 1386 ILE B CB  1 
ATOM   2627 C CG1 . ILE B 1 83  ? 42.068  40.298  41.063 1.00 44.08  ? 1386 ILE B CG1 1 
ATOM   2628 C CG2 . ILE B 1 83  ? 39.623  40.712  41.485 1.00 44.73  ? 1386 ILE B CG2 1 
ATOM   2629 C CD1 . ILE B 1 83  ? 41.952  40.371  39.552 1.00 45.31  ? 1386 ILE B CD1 1 
ATOM   2630 N N   . LEU B 1 84  ? 39.492  37.739  43.621 1.00 46.73  ? 1387 LEU B N   1 
ATOM   2631 C CA  . LEU B 1 84  ? 38.339  37.098  44.241 1.00 48.51  ? 1387 LEU B CA  1 
ATOM   2632 C C   . LEU B 1 84  ? 38.225  37.398  45.733 1.00 49.84  ? 1387 LEU B C   1 
ATOM   2633 O O   . LEU B 1 84  ? 37.113  37.520  46.263 1.00 51.64  ? 1387 LEU B O   1 
ATOM   2634 C CB  . LEU B 1 84  ? 38.393  35.583  44.058 1.00 49.31  ? 1387 LEU B CB  1 
ATOM   2635 C CG  . LEU B 1 84  ? 37.638  35.007  42.860 1.00 50.36  ? 1387 LEU B CG  1 
ATOM   2636 C CD1 . LEU B 1 84  ? 37.856  33.506  42.761 1.00 49.47  ? 1387 LEU B CD1 1 
ATOM   2637 C CD2 . LEU B 1 84  ? 36.164  35.324  43.013 1.00 51.10  ? 1387 LEU B CD2 1 
ATOM   2638 N N   . MET B 1 85  ? 39.362  37.529  46.410 1.00 48.81  ? 1388 MET B N   1 
ATOM   2639 C CA  . MET B 1 85  ? 39.343  37.785  47.841 1.00 48.94  ? 1388 MET B CA  1 
ATOM   2640 C C   . MET B 1 85  ? 39.106  39.244  48.234 1.00 49.24  ? 1388 MET B C   1 
ATOM   2641 O O   . MET B 1 85  ? 38.310  39.511  49.130 1.00 51.46  ? 1388 MET B O   1 
ATOM   2642 C CB  . MET B 1 85  ? 40.641  37.291  48.495 1.00 49.88  ? 1388 MET B CB  1 
ATOM   2643 C CG  . MET B 1 85  ? 40.923  35.784  48.419 1.00 48.18  ? 1388 MET B CG  1 
ATOM   2644 S SD  . MET B 1 85  ? 42.503  35.338  49.244 1.00 46.06  ? 1388 MET B SD  1 
ATOM   2645 C CE  . MET B 1 85  ? 42.307  33.539  49.483 1.00 48.32  ? 1388 MET B CE  1 
ATOM   2646 N N   . ILE B 1 86  ? 39.780  40.195  47.595 1.00 48.59  ? 1389 ILE B N   1 
ATOM   2647 C CA  . ILE B 1 86  ? 39.572  41.598  47.969 1.00 48.14  ? 1389 ILE B CA  1 
ATOM   2648 C C   . ILE B 1 86  ? 38.097  41.967  47.845 1.00 48.82  ? 1389 ILE B C   1 
ATOM   2649 O O   . ILE B 1 86  ? 37.599  42.812  48.579 1.00 48.31  ? 1389 ILE B O   1 
ATOM   2650 C CB  . ILE B 1 86  ? 40.396  42.572  47.103 1.00 46.77  ? 1389 ILE B CB  1 
ATOM   2651 C CG1 . ILE B 1 86  ? 40.375  43.956  47.735 1.00 45.26  ? 1389 ILE B CG1 1 
ATOM   2652 C CG2 . ILE B 1 86  ? 39.806  42.682  45.721 1.00 47.18  ? 1389 ILE B CG2 1 
ATOM   2653 C CD1 . ILE B 1 86  ? 41.029  45.009  46.898 1.00 46.31  ? 1389 ILE B CD1 1 
ATOM   2654 N N   . GLY B 1 87  ? 37.407  41.331  46.904 1.00 50.33  ? 1390 GLY B N   1 
ATOM   2655 C CA  . GLY B 1 87  ? 35.995  41.588  46.722 1.00 51.69  ? 1390 GLY B CA  1 
ATOM   2656 C C   . GLY B 1 87  ? 35.266  41.024  47.924 1.00 54.11  ? 1390 GLY B C   1 
ATOM   2657 O O   . GLY B 1 87  ? 34.575  41.761  48.630 1.00 55.43  ? 1390 GLY B O   1 
ATOM   2658 N N   . LEU B 1 88  ? 35.420  39.720  48.162 1.00 54.95  ? 1391 LEU B N   1 
ATOM   2659 C CA  . LEU B 1 88  ? 34.785  39.050  49.307 1.00 57.07  ? 1391 LEU B CA  1 
ATOM   2660 C C   . LEU B 1 88  ? 34.919  39.880  50.578 1.00 58.50  ? 1391 LEU B C   1 
ATOM   2661 O O   . LEU B 1 88  ? 33.958  40.084  51.313 1.00 58.17  ? 1391 LEU B O   1 
ATOM   2662 C CB  . LEU B 1 88  ? 35.437  37.688  49.550 1.00 56.21  ? 1391 LEU B CB  1 
ATOM   2663 C CG  . LEU B 1 88  ? 35.161  37.041  50.905 1.00 53.37  ? 1391 LEU B CG  1 
ATOM   2664 C CD1 . LEU B 1 88  ? 33.698  36.676  50.999 1.00 52.52  ? 1391 LEU B CD1 1 
ATOM   2665 C CD2 . LEU B 1 88  ? 36.025  35.811  51.061 1.00 53.67  ? 1391 LEU B CD2 1 
ATOM   2666 N N   . VAL B 1 89  ? 36.141  40.333  50.828 1.00 60.94  ? 1392 VAL B N   1 
ATOM   2667 C CA  . VAL B 1 89  ? 36.460  41.155  51.982 1.00 63.03  ? 1392 VAL B CA  1 
ATOM   2668 C C   . VAL B 1 89  ? 35.664  42.464  51.949 1.00 64.39  ? 1392 VAL B C   1 
ATOM   2669 O O   . VAL B 1 89  ? 35.196  42.939  52.984 1.00 64.85  ? 1392 VAL B O   1 
ATOM   2670 C CB  . VAL B 1 89  ? 37.971  41.442  52.007 1.00 62.76  ? 1392 VAL B CB  1 
ATOM   2671 C CG1 . VAL B 1 89  ? 38.316  42.428  53.110 1.00 63.50  ? 1392 VAL B CG1 1 
ATOM   2672 C CG2 . VAL B 1 89  ? 38.716  40.142  52.215 1.00 62.36  ? 1392 VAL B CG2 1 
ATOM   2673 N N   . TRP B 1 90  ? 35.511  43.038  50.758 1.00 65.81  ? 1393 TRP B N   1 
ATOM   2674 C CA  . TRP B 1 90  ? 34.752  44.270  50.591 1.00 67.59  ? 1393 TRP B CA  1 
ATOM   2675 C C   . TRP B 1 90  ? 33.285  44.014  50.929 1.00 68.58  ? 1393 TRP B C   1 
ATOM   2676 O O   . TRP B 1 90  ? 32.658  44.798  51.637 1.00 69.23  ? 1393 TRP B O   1 
ATOM   2677 C CB  . TRP B 1 90  ? 34.886  44.783  49.151 1.00 68.59  ? 1393 TRP B CB  1 
ATOM   2678 C CG  . TRP B 1 90  ? 34.004  45.966  48.826 1.00 69.55  ? 1393 TRP B CG  1 
ATOM   2679 C CD1 . TRP B 1 90  ? 32.835  45.946  48.122 1.00 69.52  ? 1393 TRP B CD1 1 
ATOM   2680 C CD2 . TRP B 1 90  ? 34.216  47.332  49.213 1.00 70.01  ? 1393 TRP B CD2 1 
ATOM   2681 N NE1 . TRP B 1 90  ? 32.305  47.212  48.041 1.00 69.24  ? 1393 TRP B NE1 1 
ATOM   2682 C CE2 . TRP B 1 90  ? 33.129  48.083  48.703 1.00 69.82  ? 1393 TRP B CE2 1 
ATOM   2683 C CE3 . TRP B 1 90  ? 35.216  47.996  49.942 1.00 70.57  ? 1393 TRP B CE3 1 
ATOM   2684 C CZ2 . TRP B 1 90  ? 33.012  49.465  48.900 1.00 69.76  ? 1393 TRP B CZ2 1 
ATOM   2685 C CZ3 . TRP B 1 90  ? 35.102  49.374  50.138 1.00 70.90  ? 1393 TRP B CZ3 1 
ATOM   2686 C CH2 . TRP B 1 90  ? 34.004  50.092  49.617 1.00 70.64  ? 1393 TRP B CH2 1 
ATOM   2687 N N   . ARG B 1 91  ? 32.737  42.915  50.427 1.00 69.60  ? 1394 ARG B N   1 
ATOM   2688 C CA  . ARG B 1 91  ? 31.347  42.569  50.711 1.00 71.32  ? 1394 ARG B CA  1 
ATOM   2689 C C   . ARG B 1 91  ? 31.148  42.265  52.206 1.00 72.40  ? 1394 ARG B C   1 
ATOM   2690 O O   . ARG B 1 91  ? 30.021  42.090  52.671 1.00 72.21  ? 1394 ARG B O   1 
ATOM   2691 C CB  . ARG B 1 91  ? 30.932  41.335  49.903 1.00 71.50  ? 1394 ARG B CB  1 
ATOM   2692 C CG  . ARG B 1 91  ? 30.929  41.514  48.399 1.00 72.39  ? 1394 ARG B CG  1 
ATOM   2693 C CD  . ARG B 1 91  ? 30.352  40.277  47.710 1.00 73.02  ? 1394 ARG B CD  1 
ATOM   2694 N NE  . ARG B 1 91  ? 31.263  39.129  47.706 1.00 74.18  ? 1394 ARG B NE  1 
ATOM   2695 C CZ  . ARG B 1 91  ? 32.374  39.057  46.976 1.00 74.69  ? 1394 ARG B CZ  1 
ATOM   2696 N NH1 . ARG B 1 91  ? 32.722  40.066  46.187 1.00 75.95  ? 1394 ARG B NH1 1 
ATOM   2697 N NH2 . ARG B 1 91  ? 33.136  37.975  47.022 1.00 74.42  ? 1394 ARG B NH2 1 
ATOM   2698 N N   . SER B 1 92  ? 32.249  42.203  52.950 1.00 73.64  ? 1395 SER B N   1 
ATOM   2699 C CA  . SER B 1 92  ? 32.202  41.885  54.371 1.00 74.23  ? 1395 SER B CA  1 
ATOM   2700 C C   . SER B 1 92  ? 32.458  43.078  55.282 1.00 75.30  ? 1395 SER B C   1 
ATOM   2701 O O   . SER B 1 92  ? 32.203  43.006  56.481 1.00 75.67  ? 1395 SER B O   1 
ATOM   2702 C CB  . SER B 1 92  ? 33.214  40.782  54.675 1.00 73.85  ? 1395 SER B CB  1 
ATOM   2703 O OG  . SER B 1 92  ? 33.005  39.669  53.826 1.00 73.91  ? 1395 SER B OG  1 
ATOM   2704 N N   . MET B 1 93  ? 32.975  44.162  54.710 1.00 76.60  ? 1396 MET B N   1 
ATOM   2705 C CA  . MET B 1 93  ? 33.257  45.396  55.451 1.00 77.39  ? 1396 MET B CA  1 
ATOM   2706 C C   . MET B 1 93  ? 32.345  45.561  56.664 1.00 78.21  ? 1396 MET B C   1 
ATOM   2707 O O   . MET B 1 93  ? 32.776  45.451  57.808 1.00 77.72  ? 1396 MET B O   1 
ATOM   2708 C CB  . MET B 1 93  ? 33.067  46.609  54.530 1.00 77.31  ? 1396 MET B CB  1 
ATOM   2709 C CG  . MET B 1 93  ? 34.323  47.115  53.850 1.00 77.40  ? 1396 MET B CG  1 
ATOM   2710 S SD  . MET B 1 93  ? 35.195  48.323  54.871 1.00 77.47  ? 1396 MET B SD  1 
ATOM   2711 C CE  . MET B 1 93  ? 34.450  49.877  54.279 1.00 78.13  ? 1396 MET B CE  1 
ATOM   2712 N N   . GLU B 1 94  ? 31.073  45.819  56.389 1.00 80.01  ? 1397 GLU B N   1 
ATOM   2713 C CA  . GLU B 1 94  ? 30.071  46.026  57.423 1.00 81.17  ? 1397 GLU B CA  1 
ATOM   2714 C C   . GLU B 1 94  ? 29.856  44.835  58.356 1.00 80.95  ? 1397 GLU B C   1 
ATOM   2715 O O   . GLU B 1 94  ? 30.244  44.888  59.520 1.00 81.39  ? 1397 GLU B O   1 
ATOM   2716 C CB  . GLU B 1 94  ? 28.758  46.432  56.762 1.00 82.56  ? 1397 GLU B CB  1 
ATOM   2717 C CG  . GLU B 1 94  ? 28.871  47.731  55.982 1.00 84.63  ? 1397 GLU B CG  1 
ATOM   2718 C CD  . GLU B 1 94  ? 27.611  48.050  55.209 1.00 87.13  ? 1397 GLU B CD  1 
ATOM   2719 O OE1 . GLU B 1 94  ? 27.204  47.208  54.379 1.00 87.37  ? 1397 GLU B OE1 1 
ATOM   2720 O OE2 . GLU B 1 94  ? 27.028  49.138  55.428 1.00 88.32  ? 1397 GLU B OE2 1 
ATOM   2721 N N   . HIS B 1 95  ? 29.240  43.773  57.846 1.00 80.33  ? 1398 HIS B N   1 
ATOM   2722 C CA  . HIS B 1 95  ? 28.973  42.573  58.640 1.00 80.68  ? 1398 HIS B CA  1 
ATOM   2723 C C   . HIS B 1 95  ? 30.237  42.074  59.337 1.00 80.29  ? 1398 HIS B C   1 
ATOM   2724 O O   . HIS B 1 95  ? 31.025  41.336  58.746 1.00 81.29  ? 1398 HIS B O   1 
ATOM   2725 C CB  . HIS B 1 95  ? 28.424  41.487  57.727 1.00 81.15  ? 1398 HIS B CB  1 
ATOM   2726 C CG  . HIS B 1 95  ? 27.401  41.992  56.764 1.00 82.31  ? 1398 HIS B CG  1 
ATOM   2727 N ND1 . HIS B 1 95  ? 27.642  43.057  55.924 1.00 83.77  ? 1398 HIS B ND1 1 
ATOM   2728 C CD2 . HIS B 1 95  ? 26.130  41.598  56.518 1.00 82.59  ? 1398 HIS B CD2 1 
ATOM   2729 C CE1 . HIS B 1 95  ? 26.562  43.298  55.201 1.00 83.74  ? 1398 HIS B CE1 1 
ATOM   2730 N NE2 . HIS B 1 95  ? 25.630  42.427  55.541 1.00 83.10  ? 1398 HIS B NE2 1 
ATOM   2731 N N   . PRO B 1 96  ? 30.435  42.452  60.613 1.00 79.01  ? 1399 PRO B N   1 
ATOM   2732 C CA  . PRO B 1 96  ? 31.617  42.043  61.380 1.00 77.75  ? 1399 PRO B CA  1 
ATOM   2733 C C   . PRO B 1 96  ? 31.679  40.560  61.725 1.00 76.84  ? 1399 PRO B C   1 
ATOM   2734 O O   . PRO B 1 96  ? 30.650  39.912  61.922 1.00 76.12  ? 1399 PRO B O   1 
ATOM   2735 C CB  . PRO B 1 96  ? 31.536  42.925  62.612 1.00 77.33  ? 1399 PRO B CB  1 
ATOM   2736 C CG  . PRO B 1 96  ? 30.074  42.983  62.847 1.00 78.98  ? 1399 PRO B CG  1 
ATOM   2737 C CD  . PRO B 1 96  ? 29.500  43.207  61.466 1.00 78.81  ? 1399 PRO B CD  1 
ATOM   2738 N N   . GLY B 1 97  ? 32.902  40.033  61.785 1.00 75.96  ? 1400 GLY B N   1 
ATOM   2739 C CA  . GLY B 1 97  ? 33.104  38.630  62.100 1.00 75.06  ? 1400 GLY B CA  1 
ATOM   2740 C C   . GLY B 1 97  ? 32.452  37.675  61.115 1.00 74.22  ? 1400 GLY B C   1 
ATOM   2741 O O   . GLY B 1 97  ? 32.325  36.482  61.387 1.00 74.44  ? 1400 GLY B O   1 
ATOM   2742 N N   . LYS B 1 98  ? 32.044  38.190  59.963 1.00 73.06  ? 1401 LYS B N   1 
ATOM   2743 C CA  . LYS B 1 98  ? 31.395  37.362  58.960 1.00 71.97  ? 1401 LYS B CA  1 
ATOM   2744 C C   . LYS B 1 98  ? 31.898  37.695  57.564 1.00 71.19  ? 1401 LYS B C   1 
ATOM   2745 O O   . LYS B 1 98  ? 32.059  38.859  57.221 1.00 71.76  ? 1401 LYS B O   1 
ATOM   2746 C CB  . LYS B 1 98  ? 29.885  37.569  59.028 1.00 72.20  ? 1401 LYS B CB  1 
ATOM   2747 C CG  . LYS B 1 98  ? 29.317  37.296  60.400 1.00 73.79  ? 1401 LYS B CG  1 
ATOM   2748 C CD  . LYS B 1 98  ? 27.814  37.485  60.441 1.00 75.46  ? 1401 LYS B CD  1 
ATOM   2749 C CE  . LYS B 1 98  ? 27.275  37.271  61.855 1.00 76.55  ? 1401 LYS B CE  1 
ATOM   2750 N NZ  . LYS B 1 98  ? 27.623  35.925  62.423 1.00 77.07  ? 1401 LYS B NZ  1 
ATOM   2751 N N   . LEU B 1 99  ? 32.157  36.668  56.764 1.00 70.06  ? 1402 LEU B N   1 
ATOM   2752 C CA  . LEU B 1 99  ? 32.631  36.857  55.397 1.00 68.99  ? 1402 LEU B CA  1 
ATOM   2753 C C   . LEU B 1 99  ? 31.420  36.679  54.499 1.00 68.42  ? 1402 LEU B C   1 
ATOM   2754 O O   . LEU B 1 99  ? 30.922  35.570  54.324 1.00 69.26  ? 1402 LEU B O   1 
ATOM   2755 C CB  . LEU B 1 99  ? 33.715  35.825  55.052 1.00 68.73  ? 1402 LEU B CB  1 
ATOM   2756 C CG  . LEU B 1 99  ? 34.981  35.862  55.925 1.00 68.80  ? 1402 LEU B CG  1 
ATOM   2757 C CD1 . LEU B 1 99  ? 35.826  34.635  55.639 1.00 69.38  ? 1402 LEU B CD1 1 
ATOM   2758 C CD2 . LEU B 1 99  ? 35.774  37.138  55.668 1.00 67.81  ? 1402 LEU B CD2 1 
ATOM   2759 N N   . LEU B 1 100 ? 30.942  37.782  53.938 1.00 68.02  ? 1403 LEU B N   1 
ATOM   2760 C CA  . LEU B 1 100 ? 29.765  37.752  53.087 1.00 67.93  ? 1403 LEU B CA  1 
ATOM   2761 C C   . LEU B 1 100 ? 30.075  37.252  51.683 1.00 68.13  ? 1403 LEU B C   1 
ATOM   2762 O O   . LEU B 1 100 ? 30.198  38.040  50.745 1.00 68.07  ? 1403 LEU B O   1 
ATOM   2763 C CB  . LEU B 1 100 ? 29.139  39.151  53.027 1.00 67.50  ? 1403 LEU B CB  1 
ATOM   2764 C CG  . LEU B 1 100 ? 27.635  39.268  52.739 1.00 66.55  ? 1403 LEU B CG  1 
ATOM   2765 C CD1 . LEU B 1 100 ? 27.204  40.694  52.988 1.00 66.61  ? 1403 LEU B CD1 1 
ATOM   2766 C CD2 . LEU B 1 100 ? 27.315  38.858  51.319 1.00 66.09  ? 1403 LEU B CD2 1 
ATOM   2767 N N   . PHE B 1 101 ? 30.202  35.938  51.536 1.00 68.42  ? 1404 PHE B N   1 
ATOM   2768 C CA  . PHE B 1 101 ? 30.484  35.374  50.226 1.00 68.74  ? 1404 PHE B CA  1 
ATOM   2769 C C   . PHE B 1 101 ? 29.399  35.856  49.292 1.00 69.49  ? 1404 PHE B C   1 
ATOM   2770 O O   . PHE B 1 101 ? 29.683  36.514  48.297 1.00 69.78  ? 1404 PHE B O   1 
ATOM   2771 C CB  . PHE B 1 101 ? 30.529  33.837  50.284 1.00 67.39  ? 1404 PHE B CB  1 
ATOM   2772 C CG  . PHE B 1 101 ? 31.815  33.310  50.845 1.00 65.39  ? 1404 PHE B CG  1 
ATOM   2773 C CD1 . PHE B 1 101 ? 32.116  33.475  52.190 1.00 64.66  ? 1404 PHE B CD1 1 
ATOM   2774 C CD2 . PHE B 1 101 ? 32.776  32.762  50.010 1.00 63.93  ? 1404 PHE B CD2 1 
ATOM   2775 C CE1 . PHE B 1 101 ? 33.352  33.118  52.684 1.00 63.04  ? 1404 PHE B CE1 1 
ATOM   2776 C CE2 . PHE B 1 101 ? 34.011  32.404  50.494 1.00 62.11  ? 1404 PHE B CE2 1 
ATOM   2777 C CZ  . PHE B 1 101 ? 34.300  32.582  51.832 1.00 62.76  ? 1404 PHE B CZ  1 
ATOM   2778 N N   . ALA B 1 102 ? 28.156  35.547  49.639 1.00 70.65  ? 1405 ALA B N   1 
ATOM   2779 C CA  . ALA B 1 102 ? 27.003  35.962  48.855 1.00 71.56  ? 1405 ALA B CA  1 
ATOM   2780 C C   . ALA B 1 102 ? 25.969  36.499  49.837 1.00 72.98  ? 1405 ALA B C   1 
ATOM   2781 O O   . ALA B 1 102 ? 26.072  36.261  51.047 1.00 72.99  ? 1405 ALA B O   1 
ATOM   2782 C CB  . ALA B 1 102 ? 26.437  34.776  48.079 1.00 71.49  ? 1405 ALA B CB  1 
ATOM   2783 N N   . PRO B 1 103 ? 24.973  37.254  49.343 1.00 74.06  ? 1406 PRO B N   1 
ATOM   2784 C CA  . PRO B 1 103 ? 23.978  37.767  50.281 1.00 75.24  ? 1406 PRO B CA  1 
ATOM   2785 C C   . PRO B 1 103 ? 23.250  36.592  50.926 1.00 76.10  ? 1406 PRO B C   1 
ATOM   2786 O O   . PRO B 1 103 ? 22.929  36.628  52.115 1.00 77.15  ? 1406 PRO B O   1 
ATOM   2787 C CB  . PRO B 1 103 ? 23.067  38.614  49.389 1.00 74.89  ? 1406 PRO B CB  1 
ATOM   2788 C CG  . PRO B 1 103 ? 23.989  39.100  48.333 1.00 73.74  ? 1406 PRO B CG  1 
ATOM   2789 C CD  . PRO B 1 103 ? 24.779  37.847  48.010 1.00 74.58  ? 1406 PRO B CD  1 
ATOM   2790 N N   . ASN B 1 104 ? 23.010  35.546  50.141 1.00 76.07  ? 1407 ASN B N   1 
ATOM   2791 C CA  . ASN B 1 104 ? 22.323  34.369  50.648 1.00 76.51  ? 1407 ASN B CA  1 
ATOM   2792 C C   . ASN B 1 104 ? 23.300  33.346  51.217 1.00 76.46  ? 1407 ASN B C   1 
ATOM   2793 O O   . ASN B 1 104 ? 22.900  32.288  51.700 1.00 77.11  ? 1407 ASN B O   1 
ATOM   2794 C CB  . ASN B 1 104 ? 21.492  33.728  49.542 1.00 77.32  ? 1407 ASN B CB  1 
ATOM   2795 C CG  . ASN B 1 104 ? 22.285  33.500  48.286 1.00 78.23  ? 1407 ASN B CG  1 
ATOM   2796 O OD1 . ASN B 1 104 ? 23.441  33.081  48.334 1.00 78.95  ? 1407 ASN B OD1 1 
ATOM   2797 N ND2 . ASN B 1 104 ? 21.665  33.761  47.144 1.00 79.75  ? 1407 ASN B ND2 1 
ATOM   2798 N N   . LEU B 1 105 ? 24.586  33.660  51.154 1.00 76.56  ? 1408 LEU B N   1 
ATOM   2799 C CA  . LEU B 1 105 ? 25.608  32.765  51.677 1.00 76.43  ? 1408 LEU B CA  1 
ATOM   2800 C C   . LEU B 1 105 ? 26.545  33.575  52.552 1.00 76.43  ? 1408 LEU B C   1 
ATOM   2801 O O   . LEU B 1 105 ? 27.558  34.096  52.087 1.00 76.20  ? 1408 LEU B O   1 
ATOM   2802 C CB  . LEU B 1 105 ? 26.389  32.104  50.537 1.00 76.47  ? 1408 LEU B CB  1 
ATOM   2803 C CG  . LEU B 1 105 ? 27.458  31.085  50.940 1.00 76.38  ? 1408 LEU B CG  1 
ATOM   2804 C CD1 . LEU B 1 105 ? 26.859  30.038  51.874 1.00 76.05  ? 1408 LEU B CD1 1 
ATOM   2805 C CD2 . LEU B 1 105 ? 28.025  30.433  49.693 1.00 76.73  ? 1408 LEU B CD2 1 
ATOM   2806 N N   . LEU B 1 106 ? 26.176  33.686  53.824 1.00 76.82  ? 1409 LEU B N   1 
ATOM   2807 C CA  . LEU B 1 106 ? 26.946  34.428  54.816 1.00 76.55  ? 1409 LEU B CA  1 
ATOM   2808 C C   . LEU B 1 106 ? 27.609  33.405  55.750 1.00 76.38  ? 1409 LEU B C   1 
ATOM   2809 O O   . LEU B 1 106 ? 26.960  32.452  56.187 1.00 76.75  ? 1409 LEU B O   1 
ATOM   2810 C CB  . LEU B 1 106 ? 25.997  35.340  55.594 1.00 75.97  ? 1409 LEU B CB  1 
ATOM   2811 C CG  . LEU B 1 106 ? 26.551  36.463  56.468 1.00 76.48  ? 1409 LEU B CG  1 
ATOM   2812 C CD1 . LEU B 1 106 ? 27.412  35.864  57.563 1.00 77.34  ? 1409 LEU B CD1 1 
ATOM   2813 C CD2 . LEU B 1 106 ? 27.337  37.452  55.625 1.00 75.63  ? 1409 LEU B CD2 1 
ATOM   2814 N N   . LEU B 1 107 ? 28.894  33.591  56.049 1.00 75.29  ? 1410 LEU B N   1 
ATOM   2815 C CA  . LEU B 1 107 ? 29.608  32.654  56.914 1.00 74.77  ? 1410 LEU B CA  1 
ATOM   2816 C C   . LEU B 1 107 ? 30.371  33.345  58.029 1.00 75.22  ? 1410 LEU B C   1 
ATOM   2817 O O   . LEU B 1 107 ? 30.679  34.526  57.937 1.00 76.31  ? 1410 LEU B O   1 
ATOM   2818 C CB  . LEU B 1 107 ? 30.591  31.825  56.088 1.00 73.81  ? 1410 LEU B CB  1 
ATOM   2819 C CG  . LEU B 1 107 ? 30.024  31.053  54.901 1.00 72.13  ? 1410 LEU B CG  1 
ATOM   2820 C CD1 . LEU B 1 107 ? 31.134  30.305  54.183 1.00 71.61  ? 1410 LEU B CD1 1 
ATOM   2821 C CD2 . LEU B 1 107 ? 28.974  30.103  55.399 1.00 72.80  ? 1410 LEU B CD2 1 
ATOM   2822 N N   . ASP B 1 108 ? 30.682  32.603  59.084 1.00 75.94  ? 1411 ASP B N   1 
ATOM   2823 C CA  . ASP B 1 108 ? 31.434  33.167  60.196 1.00 77.12  ? 1411 ASP B CA  1 
ATOM   2824 C C   . ASP B 1 108 ? 32.653  32.323  60.567 1.00 76.45  ? 1411 ASP B C   1 
ATOM   2825 O O   . ASP B 1 108 ? 32.794  31.170  60.153 1.00 75.67  ? 1411 ASP B O   1 
ATOM   2826 C CB  . ASP B 1 108 ? 30.536  33.361  61.424 1.00 80.01  ? 1411 ASP B CB  1 
ATOM   2827 C CG  . ASP B 1 108 ? 29.932  32.066  61.918 1.00 81.88  ? 1411 ASP B CG  1 
ATOM   2828 O OD1 . ASP B 1 108 ? 29.259  32.091  62.975 1.00 82.34  ? 1411 ASP B OD1 1 
ATOM   2829 O OD2 . ASP B 1 108 ? 30.128  31.028  61.247 1.00 83.43  ? 1411 ASP B OD2 1 
ATOM   2830 N N   . ARG B 1 109 ? 33.532  32.924  61.356 1.00 75.68  ? 1412 ARG B N   1 
ATOM   2831 C CA  . ARG B 1 109 ? 34.760  32.286  61.779 1.00 76.16  ? 1412 ARG B CA  1 
ATOM   2832 C C   . ARG B 1 109 ? 34.586  30.814  62.131 1.00 76.35  ? 1412 ARG B C   1 
ATOM   2833 O O   . ARG B 1 109 ? 35.478  30.004  61.912 1.00 76.67  ? 1412 ARG B O   1 
ATOM   2834 C CB  . ARG B 1 109 ? 35.336  33.051  62.972 1.00 77.09  ? 1412 ARG B CB  1 
ATOM   2835 C CG  . ARG B 1 109 ? 36.830  32.855  63.184 1.00 78.15  ? 1412 ARG B CG  1 
ATOM   2836 C CD  . ARG B 1 109 ? 37.137  31.641  64.033 1.00 79.34  ? 1412 ARG B CD  1 
ATOM   2837 N NE  . ARG B 1 109 ? 38.576  31.417  64.124 1.00 79.75  ? 1412 ARG B NE  1 
ATOM   2838 C CZ  . ARG B 1 109 ? 39.162  30.694  65.072 1.00 80.47  ? 1412 ARG B CZ  1 
ATOM   2839 N NH1 . ARG B 1 109 ? 38.431  30.119  66.025 1.00 80.56  ? 1412 ARG B NH1 1 
ATOM   2840 N NH2 . ARG B 1 109 ? 40.482  30.548  65.066 1.00 80.52  ? 1412 ARG B NH2 1 
ATOM   2841 N N   . ASN B 1 110 ? 33.432  30.457  62.667 1.00 77.09  ? 1413 ASN B N   1 
ATOM   2842 C CA  . ASN B 1 110 ? 33.203  29.076  63.050 1.00 77.57  ? 1413 ASN B CA  1 
ATOM   2843 C C   . ASN B 1 110 ? 32.878  28.179  61.867 1.00 77.05  ? 1413 ASN B C   1 
ATOM   2844 O O   . ASN B 1 110 ? 33.366  27.055  61.778 1.00 76.33  ? 1413 ASN B O   1 
ATOM   2845 C CB  . ASN B 1 110 ? 32.083  29.009  64.088 1.00 79.29  ? 1413 ASN B CB  1 
ATOM   2846 C CG  . ASN B 1 110 ? 32.571  28.499  65.435 1.00 80.99  ? 1413 ASN B CG  1 
ATOM   2847 O OD1 . ASN B 1 110 ? 33.646  28.885  65.909 1.00 79.97  ? 1413 ASN B OD1 1 
ATOM   2848 N ND2 . ASN B 1 110 ? 31.780  27.630  66.062 1.00 82.10  ? 1413 ASN B ND2 1 
ATOM   2849 N N   . GLN B 1 111 ? 32.051  28.675  60.960 1.00 76.62  ? 1414 GLN B N   1 
ATOM   2850 C CA  . GLN B 1 111 ? 31.677  27.893  59.800 1.00 76.17  ? 1414 GLN B CA  1 
ATOM   2851 C C   . GLN B 1 111 ? 32.910  27.303  59.120 1.00 76.06  ? 1414 GLN B C   1 
ATOM   2852 O O   . GLN B 1 111 ? 32.955  26.110  58.835 1.00 76.79  ? 1414 GLN B O   1 
ATOM   2853 C CB  . GLN B 1 111 ? 30.914  28.760  58.804 1.00 76.54  ? 1414 GLN B CB  1 
ATOM   2854 C CG  . GLN B 1 111 ? 29.445  28.425  58.680 1.00 77.06  ? 1414 GLN B CG  1 
ATOM   2855 C CD  . GLN B 1 111 ? 28.640  28.929  59.844 1.00 77.35  ? 1414 GLN B CD  1 
ATOM   2856 O OE1 . GLN B 1 111 ? 28.932  28.611  60.996 1.00 78.12  ? 1414 GLN B OE1 1 
ATOM   2857 N NE2 . GLN B 1 111 ? 27.613  29.723  59.553 1.00 77.26  ? 1414 GLN B NE2 1 
ATOM   2858 N N   . GLY B 1 112 ? 33.909  28.145  58.868 1.00 75.38  ? 1415 GLY B N   1 
ATOM   2859 C CA  . GLY B 1 112 ? 35.124  27.695  58.205 1.00 74.35  ? 1415 GLY B CA  1 
ATOM   2860 C C   . GLY B 1 112 ? 35.761  26.472  58.830 1.00 73.99  ? 1415 GLY B C   1 
ATOM   2861 O O   . GLY B 1 112 ? 36.559  25.778  58.199 1.00 73.42  ? 1415 GLY B O   1 
ATOM   2862 N N   . LYS B 1 113 ? 35.416  26.201  60.080 1.00 74.25  ? 1416 LYS B N   1 
ATOM   2863 C CA  . LYS B 1 113 ? 35.966  25.043  60.771 1.00 74.24  ? 1416 LYS B CA  1 
ATOM   2864 C C   . LYS B 1 113 ? 35.371  23.760  60.186 1.00 73.71  ? 1416 LYS B C   1 
ATOM   2865 O O   . LYS B 1 113 ? 35.860  22.667  60.452 1.00 72.72  ? 1416 LYS B O   1 
ATOM   2866 C CB  . LYS B 1 113 ? 35.673  25.146  62.273 1.00 74.83  ? 1416 LYS B CB  1 
ATOM   2867 C CG  . LYS B 1 113 ? 36.116  26.472  62.891 1.00 74.36  ? 1416 LYS B CG  1 
ATOM   2868 C CD  . LYS B 1 113 ? 35.737  26.592  64.356 1.00 74.21  ? 1416 LYS B CD  1 
ATOM   2869 C CE  . LYS B 1 113 ? 36.507  25.606  65.216 1.00 75.07  ? 1416 LYS B CE  1 
ATOM   2870 N NZ  . LYS B 1 113 ? 36.120  25.690  66.659 1.00 75.28  ? 1416 LYS B NZ  1 
ATOM   2871 N N   . CYS B 1 114 ? 34.318  23.910  59.384 1.00 73.83  ? 1417 CYS B N   1 
ATOM   2872 C CA  . CYS B 1 114 ? 33.661  22.780  58.737 1.00 73.68  ? 1417 CYS B CA  1 
ATOM   2873 C C   . CYS B 1 114 ? 34.626  22.121  57.772 1.00 73.25  ? 1417 CYS B C   1 
ATOM   2874 O O   . CYS B 1 114 ? 34.495  20.935  57.462 1.00 73.24  ? 1417 CYS B O   1 
ATOM   2875 C CB  . CYS B 1 114 ? 32.424  23.235  57.957 1.00 74.39  ? 1417 CYS B CB  1 
ATOM   2876 S SG  . CYS B 1 114 ? 30.989  23.690  58.961 1.00 78.31  ? 1417 CYS B SG  1 
ATOM   2877 N N   . VAL B 1 115 ? 35.592  22.899  57.288 1.00 72.86  ? 1418 VAL B N   1 
ATOM   2878 C CA  . VAL B 1 115 ? 36.583  22.385  56.349 1.00 71.93  ? 1418 VAL B CA  1 
ATOM   2879 C C   . VAL B 1 115 ? 37.994  22.455  56.918 1.00 71.25  ? 1418 VAL B C   1 
ATOM   2880 O O   . VAL B 1 115 ? 38.420  23.472  57.462 1.00 70.46  ? 1418 VAL B O   1 
ATOM   2881 C CB  . VAL B 1 115 ? 36.531  23.138  54.996 1.00 71.66  ? 1418 VAL B CB  1 
ATOM   2882 C CG1 . VAL B 1 115 ? 37.583  22.583  54.052 1.00 70.80  ? 1418 VAL B CG1 1 
ATOM   2883 C CG2 . VAL B 1 115 ? 35.146  22.996  54.374 1.00 70.97  ? 1418 VAL B CG2 1 
ATOM   2884 N N   . GLU B 1 116 ? 38.702  21.342  56.791 1.00 71.26  ? 1419 GLU B N   1 
ATOM   2885 C CA  . GLU B 1 116 ? 40.059  21.214  57.287 1.00 71.56  ? 1419 GLU B CA  1 
ATOM   2886 C C   . GLU B 1 116 ? 40.973  22.312  56.773 1.00 70.59  ? 1419 GLU B C   1 
ATOM   2887 O O   . GLU B 1 116 ? 40.992  22.601  55.586 1.00 71.17  ? 1419 GLU B O   1 
ATOM   2888 C CB  . GLU B 1 116 ? 40.616  19.856  56.880 1.00 72.79  ? 1419 GLU B CB  1 
ATOM   2889 C CG  . GLU B 1 116 ? 42.098  19.716  57.107 1.00 75.41  ? 1419 GLU B CG  1 
ATOM   2890 C CD  . GLU B 1 116 ? 42.632  18.426  56.535 1.00 77.45  ? 1419 GLU B CD  1 
ATOM   2891 O OE1 . GLU B 1 116 ? 42.338  18.149  55.349 1.00 78.36  ? 1419 GLU B OE1 1 
ATOM   2892 O OE2 . GLU B 1 116 ? 43.344  17.696  57.263 1.00 78.16  ? 1419 GLU B OE2 1 
ATOM   2893 N N   . GLY B 1 117 ? 41.735  22.917  57.675 1.00 69.91  ? 1420 GLY B N   1 
ATOM   2894 C CA  . GLY B 1 117 ? 42.650  23.973  57.281 1.00 69.66  ? 1420 GLY B CA  1 
ATOM   2895 C C   . GLY B 1 117 ? 41.990  25.238  56.751 1.00 69.50  ? 1420 GLY B C   1 
ATOM   2896 O O   . GLY B 1 117 ? 42.671  26.205  56.411 1.00 69.26  ? 1420 GLY B O   1 
ATOM   2897 N N   . MET B 1 118 ? 40.664  25.241  56.694 1.00 69.14  ? 1421 MET B N   1 
ATOM   2898 C CA  . MET B 1 118 ? 39.908  26.381  56.190 1.00 68.23  ? 1421 MET B CA  1 
ATOM   2899 C C   . MET B 1 118 ? 39.880  27.580  57.130 1.00 67.19  ? 1421 MET B C   1 
ATOM   2900 O O   . MET B 1 118 ? 39.905  28.719  56.683 1.00 66.94  ? 1421 MET B O   1 
ATOM   2901 C CB  . MET B 1 118 ? 38.474  25.948  55.908 1.00 70.37  ? 1421 MET B CB  1 
ATOM   2902 C CG  . MET B 1 118 ? 37.609  27.007  55.257 1.00 72.24  ? 1421 MET B CG  1 
ATOM   2903 S SD  . MET B 1 118 ? 37.936  27.146  53.487 1.00 73.65  ? 1421 MET B SD  1 
ATOM   2904 C CE  . MET B 1 118 ? 39.335  28.257  53.485 1.00 73.33  ? 1421 MET B CE  1 
ATOM   2905 N N   . VAL B 1 119 ? 39.824  27.316  58.431 1.00 67.09  ? 1422 VAL B N   1 
ATOM   2906 C CA  . VAL B 1 119 ? 39.762  28.367  59.454 1.00 66.42  ? 1422 VAL B CA  1 
ATOM   2907 C C   . VAL B 1 119 ? 40.773  29.497  59.310 1.00 66.50  ? 1422 VAL B C   1 
ATOM   2908 O O   . VAL B 1 119 ? 40.402  30.638  59.043 1.00 67.50  ? 1422 VAL B O   1 
ATOM   2909 C CB  . VAL B 1 119 ? 39.912  27.775  60.868 1.00 65.07  ? 1422 VAL B CB  1 
ATOM   2910 C CG1 . VAL B 1 119 ? 39.860  28.877  61.901 1.00 64.06  ? 1422 VAL B CG1 1 
ATOM   2911 C CG2 . VAL B 1 119 ? 38.811  26.767  61.118 1.00 66.34  ? 1422 VAL B CG2 1 
ATOM   2912 N N   . GLU B 1 120 ? 42.045  29.177  59.504 1.00 66.18  ? 1423 GLU B N   1 
ATOM   2913 C CA  . GLU B 1 120 ? 43.114  30.158  59.409 1.00 66.29  ? 1423 GLU B CA  1 
ATOM   2914 C C   . GLU B 1 120 ? 42.890  31.166  58.285 1.00 65.58  ? 1423 GLU B C   1 
ATOM   2915 O O   . GLU B 1 120 ? 43.173  32.356  58.445 1.00 66.67  ? 1423 GLU B O   1 
ATOM   2916 C CB  . GLU B 1 120 ? 44.458  29.463  59.184 1.00 68.90  ? 1423 GLU B CB  1 
ATOM   2917 C CG  . GLU B 1 120 ? 44.757  28.291  60.111 1.00 73.37  ? 1423 GLU B CG  1 
ATOM   2918 C CD  . GLU B 1 120 ? 44.025  27.006  59.713 1.00 75.79  ? 1423 GLU B CD  1 
ATOM   2919 O OE1 . GLU B 1 120 ? 42.790  26.925  59.921 1.00 77.85  ? 1423 GLU B OE1 1 
ATOM   2920 O OE2 . GLU B 1 120 ? 44.689  26.078  59.191 1.00 76.19  ? 1423 GLU B OE2 1 
ATOM   2921 N N   . ILE B 1 121 ? 42.393  30.703  57.145 1.00 63.21  ? 1424 ILE B N   1 
ATOM   2922 C CA  . ILE B 1 121 ? 42.163  31.613  56.043 1.00 62.34  ? 1424 ILE B CA  1 
ATOM   2923 C C   . ILE B 1 121 ? 41.058  32.606  56.374 1.00 62.87  ? 1424 ILE B C   1 
ATOM   2924 O O   . ILE B 1 121 ? 41.220  33.805  56.169 1.00 63.05  ? 1424 ILE B O   1 
ATOM   2925 C CB  . ILE B 1 121 ? 41.810  30.858  54.768 1.00 61.76  ? 1424 ILE B CB  1 
ATOM   2926 C CG1 . ILE B 1 121 ? 42.955  29.916  54.409 1.00 61.53  ? 1424 ILE B CG1 1 
ATOM   2927 C CG2 . ILE B 1 121 ? 41.592  31.844  53.628 1.00 61.67  ? 1424 ILE B CG2 1 
ATOM   2928 C CD1 . ILE B 1 121 ? 42.716  29.115  53.158 1.00 60.75  ? 1424 ILE B CD1 1 
ATOM   2929 N N   . PHE B 1 122 ? 39.933  32.116  56.884 1.00 63.18  ? 1425 PHE B N   1 
ATOM   2930 C CA  . PHE B 1 122 ? 38.837  33.002  57.251 1.00 62.95  ? 1425 PHE B CA  1 
ATOM   2931 C C   . PHE B 1 122 ? 39.383  34.095  58.156 1.00 63.66  ? 1425 PHE B C   1 
ATOM   2932 O O   . PHE B 1 122 ? 39.096  35.273  57.960 1.00 64.27  ? 1425 PHE B O   1 
ATOM   2933 C CB  . PHE B 1 122 ? 37.741  32.229  57.977 1.00 61.56  ? 1425 PHE B CB  1 
ATOM   2934 C CG  . PHE B 1 122 ? 36.809  31.505  57.063 1.00 61.66  ? 1425 PHE B CG  1 
ATOM   2935 C CD1 . PHE B 1 122 ? 37.273  30.930  55.890 1.00 63.64  ? 1425 PHE B CD1 1 
ATOM   2936 C CD2 . PHE B 1 122 ? 35.473  31.348  57.398 1.00 62.76  ? 1425 PHE B CD2 1 
ATOM   2937 C CE1 . PHE B 1 122 ? 36.414  30.195  55.054 1.00 64.93  ? 1425 PHE B CE1 1 
ATOM   2938 C CE2 . PHE B 1 122 ? 34.604  30.617  56.578 1.00 63.88  ? 1425 PHE B CE2 1 
ATOM   2939 C CZ  . PHE B 1 122 ? 35.080  30.036  55.399 1.00 64.43  ? 1425 PHE B CZ  1 
ATOM   2940 N N   . ASP B 1 123 ? 40.177  33.704  59.145 1.00 63.83  ? 1426 ASP B N   1 
ATOM   2941 C CA  . ASP B 1 123 ? 40.770  34.675  60.052 1.00 65.09  ? 1426 ASP B CA  1 
ATOM   2942 C C   . ASP B 1 123 ? 41.490  35.760  59.236 1.00 65.29  ? 1426 ASP B C   1 
ATOM   2943 O O   . ASP B 1 123 ? 41.142  36.938  59.328 1.00 65.43  ? 1426 ASP B O   1 
ATOM   2944 C CB  . ASP B 1 123 ? 41.747  33.978  61.007 1.00 67.11  ? 1426 ASP B CB  1 
ATOM   2945 C CG  . ASP B 1 123 ? 41.038  33.100  62.043 1.00 69.78  ? 1426 ASP B CG  1 
ATOM   2946 O OD1 . ASP B 1 123 ? 40.137  32.326  61.652 1.00 73.74  ? 1426 ASP B OD1 1 
ATOM   2947 O OD2 . ASP B 1 123 ? 41.383  33.167  63.248 1.00 69.37  ? 1426 ASP B OD2 1 
ATOM   2948 N N   . MET B 1 124 ? 42.478  35.370  58.429 1.00 64.39  ? 1427 MET B N   1 
ATOM   2949 C CA  . MET B 1 124 ? 43.201  36.335  57.605 1.00 63.24  ? 1427 MET B CA  1 
ATOM   2950 C C   . MET B 1 124 ? 42.218  37.195  56.806 1.00 61.61  ? 1427 MET B C   1 
ATOM   2951 O O   . MET B 1 124 ? 42.442  38.382  56.610 1.00 61.56  ? 1427 MET B O   1 
ATOM   2952 C CB  . MET B 1 124 ? 44.155  35.624  56.635 1.00 64.25  ? 1427 MET B CB  1 
ATOM   2953 C CG  . MET B 1 124 ? 45.295  34.859  57.307 1.00 65.83  ? 1427 MET B CG  1 
ATOM   2954 S SD  . MET B 1 124 ? 46.641  34.366  56.169 1.00 66.36  ? 1427 MET B SD  1 
ATOM   2955 C CE  . MET B 1 124 ? 45.849  33.004  55.300 1.00 66.11  ? 1427 MET B CE  1 
ATOM   2956 N N   . LEU B 1 125 ? 41.126  36.588  56.354 1.00 60.31  ? 1428 LEU B N   1 
ATOM   2957 C CA  . LEU B 1 125 ? 40.114  37.298  55.581 1.00 58.50  ? 1428 LEU B CA  1 
ATOM   2958 C C   . LEU B 1 125 ? 39.301  38.285  56.420 1.00 57.98  ? 1428 LEU B C   1 
ATOM   2959 O O   . LEU B 1 125 ? 38.950  39.361  55.941 1.00 57.77  ? 1428 LEU B O   1 
ATOM   2960 C CB  . LEU B 1 125 ? 39.173  36.304  54.881 1.00 57.57  ? 1428 LEU B CB  1 
ATOM   2961 C CG  . LEU B 1 125 ? 39.704  35.658  53.595 1.00 56.73  ? 1428 LEU B CG  1 
ATOM   2962 C CD1 . LEU B 1 125 ? 38.653  34.757  52.993 1.00 56.54  ? 1428 LEU B CD1 1 
ATOM   2963 C CD2 . LEU B 1 125 ? 40.079  36.731  52.592 1.00 56.40  ? 1428 LEU B CD2 1 
ATOM   2964 N N   . LEU B 1 126 ? 38.996  37.923  57.664 1.00 56.70  ? 1429 LEU B N   1 
ATOM   2965 C CA  . LEU B 1 126 ? 38.239  38.807  58.546 1.00 54.58  ? 1429 LEU B CA  1 
ATOM   2966 C C   . LEU B 1 126 ? 39.185  39.870  59.052 1.00 54.16  ? 1429 LEU B C   1 
ATOM   2967 O O   . LEU B 1 126 ? 38.792  41.008  59.285 1.00 53.02  ? 1429 LEU B O   1 
ATOM   2968 C CB  . LEU B 1 126 ? 37.672  38.024  59.721 1.00 53.23  ? 1429 LEU B CB  1 
ATOM   2969 C CG  . LEU B 1 126 ? 36.610  37.012  59.310 1.00 52.92  ? 1429 LEU B CG  1 
ATOM   2970 C CD1 . LEU B 1 126 ? 36.373  36.042  60.438 1.00 54.09  ? 1429 LEU B CD1 1 
ATOM   2971 C CD2 . LEU B 1 126 ? 35.337  37.735  58.931 1.00 53.21  ? 1429 LEU B CD2 1 
ATOM   2972 N N   . ALA B 1 127 ? 40.443  39.473  59.207 1.00 54.98  ? 1430 ALA B N   1 
ATOM   2973 C CA  . ALA B 1 127 ? 41.504  40.355  59.674 1.00 55.73  ? 1430 ALA B CA  1 
ATOM   2974 C C   . ALA B 1 127 ? 41.670  41.496  58.696 1.00 55.92  ? 1430 ALA B C   1 
ATOM   2975 O O   . ALA B 1 127 ? 42.080  42.597  59.054 1.00 55.95  ? 1430 ALA B O   1 
ATOM   2976 C CB  . ALA B 1 127 ? 42.807  39.581  59.783 1.00 57.24  ? 1430 ALA B CB  1 
ATOM   2977 N N   . THR B 1 128 ? 41.361  41.210  57.446 1.00 56.79  ? 1431 THR B N   1 
ATOM   2978 C CA  . THR B 1 128 ? 41.455  42.208  56.408 1.00 58.59  ? 1431 THR B CA  1 
ATOM   2979 C C   . THR B 1 128 ? 40.096  42.856  56.212 1.00 59.65  ? 1431 THR B C   1 
ATOM   2980 O O   . THR B 1 128 ? 40.010  44.030  55.886 1.00 59.71  ? 1431 THR B O   1 
ATOM   2981 C CB  . THR B 1 128 ? 41.916  41.581  55.099 1.00 58.83  ? 1431 THR B CB  1 
ATOM   2982 O OG1 . THR B 1 128 ? 43.266  41.117  55.251 1.00 59.53  ? 1431 THR B OG1 1 
ATOM   2983 C CG2 . THR B 1 128 ? 41.845  42.596  53.979 1.00 59.48  ? 1431 THR B CG2 1 
ATOM   2984 N N   . SER B 1 129 ? 39.031  42.084  56.409 1.00 61.52  ? 1432 SER B N   1 
ATOM   2985 C CA  . SER B 1 129 ? 37.682  42.616  56.270 1.00 62.09  ? 1432 SER B CA  1 
ATOM   2986 C C   . SER B 1 129 ? 37.552  43.732  57.297 1.00 63.89  ? 1432 SER B C   1 
ATOM   2987 O O   . SER B 1 129 ? 37.026  44.807  56.994 1.00 64.40  ? 1432 SER B O   1 
ATOM   2988 C CB  . SER B 1 129 ? 36.635  41.533  56.546 1.00 60.74  ? 1432 SER B CB  1 
ATOM   2989 O OG  . SER B 1 129 ? 35.330  42.002  56.257 1.00 58.11  ? 1432 SER B OG  1 
ATOM   2990 N N   . SER B 1 130 ? 38.041  43.470  58.511 1.00 64.27  ? 1433 SER B N   1 
ATOM   2991 C CA  . SER B 1 130 ? 37.998  44.457  59.584 1.00 64.24  ? 1433 SER B CA  1 
ATOM   2992 C C   . SER B 1 130 ? 38.846  45.662  59.218 1.00 65.61  ? 1433 SER B C   1 
ATOM   2993 O O   . SER B 1 130 ? 38.326  46.758  59.026 1.00 65.48  ? 1433 SER B O   1 
ATOM   2994 C CB  . SER B 1 130 ? 38.523  43.866  60.889 1.00 62.75  ? 1433 SER B CB  1 
ATOM   2995 O OG  . SER B 1 130 ? 38.945  44.898  61.766 1.00 59.96  ? 1433 SER B OG  1 
ATOM   2996 N N   . ARG B 1 131 ? 40.154  45.448  59.118 1.00 67.22  ? 1434 ARG B N   1 
ATOM   2997 C CA  . ARG B 1 131 ? 41.091  46.517  58.788 1.00 67.86  ? 1434 ARG B CA  1 
ATOM   2998 C C   . ARG B 1 131 ? 40.526  47.518  57.774 1.00 67.75  ? 1434 ARG B C   1 
ATOM   2999 O O   . ARG B 1 131 ? 40.748  48.718  57.892 1.00 66.14  ? 1434 ARG B O   1 
ATOM   3000 C CB  . ARG B 1 131 ? 42.409  45.917  58.281 1.00 67.85  ? 1434 ARG B CB  1 
ATOM   3001 C CG  . ARG B 1 131 ? 43.470  46.950  58.026 1.00 69.21  ? 1434 ARG B CG  1 
ATOM   3002 C CD  . ARG B 1 131 ? 43.591  47.878  59.220 1.00 72.95  ? 1434 ARG B CD  1 
ATOM   3003 N NE  . ARG B 1 131 ? 44.432  49.037  58.940 1.00 74.80  ? 1434 ARG B NE  1 
ATOM   3004 C CZ  . ARG B 1 131 ? 45.714  48.961  58.599 1.00 76.34  ? 1434 ARG B CZ  1 
ATOM   3005 N NH1 . ARG B 1 131 ? 46.304  47.776  58.494 1.00 76.21  ? 1434 ARG B NH1 1 
ATOM   3006 N NH2 . ARG B 1 131 ? 46.406  50.069  58.368 1.00 76.66  ? 1434 ARG B NH2 1 
ATOM   3007 N N   . PHE B 1 132 ? 39.791  47.022  56.785 1.00 69.04  ? 1435 PHE B N   1 
ATOM   3008 C CA  . PHE B 1 132 ? 39.182  47.888  55.775 1.00 71.40  ? 1435 PHE B CA  1 
ATOM   3009 C C   . PHE B 1 132 ? 38.192  48.816  56.456 1.00 72.93  ? 1435 PHE B C   1 
ATOM   3010 O O   . PHE B 1 132 ? 38.289  50.036  56.355 1.00 73.29  ? 1435 PHE B O   1 
ATOM   3011 C CB  . PHE B 1 132 ? 38.417  47.063  54.733 1.00 71.25  ? 1435 PHE B CB  1 
ATOM   3012 C CG  . PHE B 1 132 ? 39.225  46.696  53.523 1.00 71.15  ? 1435 PHE B CG  1 
ATOM   3013 C CD1 . PHE B 1 132 ? 38.646  45.951  52.499 1.00 71.13  ? 1435 PHE B CD1 1 
ATOM   3014 C CD2 . PHE B 1 132 ? 40.553  47.090  53.400 1.00 70.66  ? 1435 PHE B CD2 1 
ATOM   3015 C CE1 . PHE B 1 132 ? 39.375  45.602  51.375 1.00 70.97  ? 1435 PHE B CE1 1 
ATOM   3016 C CE2 . PHE B 1 132 ? 41.291  46.746  52.280 1.00 71.35  ? 1435 PHE B CE2 1 
ATOM   3017 C CZ  . PHE B 1 132 ? 40.701  45.999  51.263 1.00 71.11  ? 1435 PHE B CZ  1 
ATOM   3018 N N   . ARG B 1 133 ? 37.227  48.201  57.133 1.00 74.37  ? 1436 ARG B N   1 
ATOM   3019 C CA  . ARG B 1 133 ? 36.171  48.890  57.868 1.00 75.13  ? 1436 ARG B CA  1 
ATOM   3020 C C   . ARG B 1 133 ? 36.789  49.859  58.859 1.00 75.79  ? 1436 ARG B C   1 
ATOM   3021 O O   . ARG B 1 133 ? 36.392  51.022  58.950 1.00 74.66  ? 1436 ARG B O   1 
ATOM   3022 C CB  . ARG B 1 133 ? 35.329  47.850  58.609 1.00 74.78  ? 1436 ARG B CB  1 
ATOM   3023 C CG  . ARG B 1 133 ? 34.171  48.386  59.405 1.00 74.59  ? 1436 ARG B CG  1 
ATOM   3024 C CD  . ARG B 1 133 ? 33.462  47.240  60.096 1.00 75.85  ? 1436 ARG B CD  1 
ATOM   3025 N NE  . ARG B 1 133 ? 34.396  46.435  60.881 1.00 77.79  ? 1436 ARG B NE  1 
ATOM   3026 C CZ  . ARG B 1 133 ? 34.716  45.169  60.617 1.00 77.67  ? 1436 ARG B CZ  1 
ATOM   3027 N NH1 . ARG B 1 133 ? 34.176  44.543  59.580 1.00 76.77  ? 1436 ARG B NH1 1 
ATOM   3028 N NH2 . ARG B 1 133 ? 35.584  44.531  61.391 1.00 77.40  ? 1436 ARG B NH2 1 
ATOM   3029 N N   . MET B 1 134 ? 37.775  49.357  59.595 1.00 78.01  ? 1437 MET B N   1 
ATOM   3030 C CA  . MET B 1 134 ? 38.486  50.137  60.599 1.00 79.60  ? 1437 MET B CA  1 
ATOM   3031 C C   . MET B 1 134 ? 39.389  51.161  59.918 1.00 79.15  ? 1437 MET B C   1 
ATOM   3032 O O   . MET B 1 134 ? 40.403  51.576  60.473 1.00 79.24  ? 1437 MET B O   1 
ATOM   3033 C CB  . MET B 1 134 ? 39.323  49.204  61.479 1.00 80.55  ? 1437 MET B CB  1 
ATOM   3034 C CG  . MET B 1 134 ? 40.017  49.896  62.629 1.00 82.87  ? 1437 MET B CG  1 
ATOM   3035 S SD  . MET B 1 134 ? 41.260  48.837  63.366 1.00 87.84  ? 1437 MET B SD  1 
ATOM   3036 C CE  . MET B 1 134 ? 42.733  49.252  62.363 1.00 85.87  ? 1437 MET B CE  1 
ATOM   3037 N N   . MET B 1 135 ? 39.008  51.563  58.709 1.00 78.70  ? 1438 MET B N   1 
ATOM   3038 C CA  . MET B 1 135 ? 39.772  52.533  57.931 1.00 77.84  ? 1438 MET B CA  1 
ATOM   3039 C C   . MET B 1 135 ? 38.810  53.262  57.008 1.00 78.18  ? 1438 MET B C   1 
ATOM   3040 O O   . MET B 1 135 ? 39.200  54.159  56.256 1.00 77.45  ? 1438 MET B O   1 
ATOM   3041 C CB  . MET B 1 135 ? 40.837  51.813  57.109 1.00 76.44  ? 1438 MET B CB  1 
ATOM   3042 C CG  . MET B 1 135 ? 41.890  52.715  56.530 1.00 75.33  ? 1438 MET B CG  1 
ATOM   3043 S SD  . MET B 1 135 ? 43.341  51.764  56.054 1.00 74.71  ? 1438 MET B SD  1 
ATOM   3044 C CE  . MET B 1 135 ? 43.466  52.161  54.321 1.00 74.27  ? 1438 MET B CE  1 
ATOM   3045 N N   . ASN B 1 136 ? 37.545  52.857  57.084 1.00 78.75  ? 1439 ASN B N   1 
ATOM   3046 C CA  . ASN B 1 136 ? 36.481  53.433  56.276 1.00 79.76  ? 1439 ASN B CA  1 
ATOM   3047 C C   . ASN B 1 136 ? 36.930  53.504  54.820 1.00 79.35  ? 1439 ASN B C   1 
ATOM   3048 O O   . ASN B 1 136 ? 37.352  54.554  54.343 1.00 80.26  ? 1439 ASN B O   1 
ATOM   3049 C CB  . ASN B 1 136 ? 36.135  54.832  56.800 1.00 81.58  ? 1439 ASN B CB  1 
ATOM   3050 C CG  . ASN B 1 136 ? 34.678  55.210  56.555 1.00 82.78  ? 1439 ASN B CG  1 
ATOM   3051 O OD1 . ASN B 1 136 ? 34.238  56.303  56.922 1.00 83.40  ? 1439 ASN B OD1 1 
ATOM   3052 N ND2 . ASN B 1 136 ? 33.924  54.305  55.940 1.00 84.23  ? 1439 ASN B ND2 1 
ATOM   3053 N N   . LEU B 1 137 ? 36.858  52.376  54.125 1.00 78.10  ? 1440 LEU B N   1 
ATOM   3054 C CA  . LEU B 1 137 ? 37.261  52.327  52.730 1.00 77.41  ? 1440 LEU B CA  1 
ATOM   3055 C C   . LEU B 1 137 ? 36.024  52.601  51.900 1.00 77.08  ? 1440 LEU B C   1 
ATOM   3056 O O   . LEU B 1 137 ? 35.038  51.866  51.972 1.00 76.87  ? 1440 LEU B O   1 
ATOM   3057 C CB  . LEU B 1 137 ? 37.842  50.949  52.377 1.00 77.97  ? 1440 LEU B CB  1 
ATOM   3058 C CG  . LEU B 1 137 ? 38.451  50.728  50.982 1.00 77.20  ? 1440 LEU B CG  1 
ATOM   3059 C CD1 . LEU B 1 137 ? 39.634  51.656  50.778 1.00 76.24  ? 1440 LEU B CD1 1 
ATOM   3060 C CD2 . LEU B 1 137 ? 38.906  49.288  50.843 1.00 77.20  ? 1440 LEU B CD2 1 
ATOM   3061 N N   . GLN B 1 138 ? 36.080  53.673  51.120 1.00 76.60  ? 1441 GLN B N   1 
ATOM   3062 C CA  . GLN B 1 138 ? 34.963  54.061  50.274 1.00 75.87  ? 1441 GLN B CA  1 
ATOM   3063 C C   . GLN B 1 138 ? 34.975  53.367  48.921 1.00 75.06  ? 1441 GLN B C   1 
ATOM   3064 O O   . GLN B 1 138 ? 36.016  53.262  48.274 1.00 75.05  ? 1441 GLN B O   1 
ATOM   3065 C CB  . GLN B 1 138 ? 34.955  55.580  50.090 1.00 76.31  ? 1441 GLN B CB  1 
ATOM   3066 C CG  . GLN B 1 138 ? 34.310  56.321  51.253 1.00 76.10  ? 1441 GLN B CG  1 
ATOM   3067 C CD  . GLN B 1 138 ? 32.901  55.810  51.543 1.00 76.34  ? 1441 GLN B CD  1 
ATOM   3068 O OE1 . GLN B 1 138 ? 32.075  55.675  50.631 1.00 75.81  ? 1441 GLN B OE1 1 
ATOM   3069 N NE2 . GLN B 1 138 ? 32.621  55.526  52.814 1.00 75.09  ? 1441 GLN B NE2 1 
ATOM   3070 N N   . GLY B 1 139 ? 33.801  52.897  48.509 1.00 74.58  ? 1442 GLY B N   1 
ATOM   3071 C CA  . GLY B 1 139 ? 33.647  52.204  47.238 1.00 73.62  ? 1442 GLY B CA  1 
ATOM   3072 C C   . GLY B 1 139 ? 34.644  52.537  46.147 1.00 72.29  ? 1442 GLY B C   1 
ATOM   3073 O O   . GLY B 1 139 ? 35.144  51.638  45.478 1.00 71.60  ? 1442 GLY B O   1 
ATOM   3074 N N   . GLU B 1 140 ? 34.935  53.824  45.977 1.00 72.59  ? 1443 GLU B N   1 
ATOM   3075 C CA  . GLU B 1 140 ? 35.871  54.302  44.953 1.00 72.01  ? 1443 GLU B CA  1 
ATOM   3076 C C   . GLU B 1 140 ? 37.312  53.828  45.162 1.00 69.26  ? 1443 GLU B C   1 
ATOM   3077 O O   . GLU B 1 140 ? 37.963  53.386  44.226 1.00 68.06  ? 1443 GLU B O   1 
ATOM   3078 C CB  . GLU B 1 140 ? 35.867  55.839  44.885 1.00 75.24  ? 1443 GLU B CB  1 
ATOM   3079 C CG  . GLU B 1 140 ? 34.488  56.527  44.913 1.00 78.98  ? 1443 GLU B CG  1 
ATOM   3080 C CD  . GLU B 1 140 ? 34.062  56.963  46.320 1.00 81.08  ? 1443 GLU B CD  1 
ATOM   3081 O OE1 . GLU B 1 140 ? 34.861  57.663  46.992 1.00 82.29  ? 1443 GLU B OE1 1 
ATOM   3082 O OE2 . GLU B 1 140 ? 32.932  56.617  46.749 1.00 81.86  ? 1443 GLU B OE2 1 
ATOM   3083 N N   . GLU B 1 141 ? 37.820  53.946  46.381 1.00 67.83  ? 1444 GLU B N   1 
ATOM   3084 C CA  . GLU B 1 141 ? 39.183  53.501  46.666 1.00 68.11  ? 1444 GLU B CA  1 
ATOM   3085 C C   . GLU B 1 141 ? 39.280  52.007  46.327 1.00 67.82  ? 1444 GLU B C   1 
ATOM   3086 O O   . GLU B 1 141 ? 40.305  51.525  45.829 1.00 67.84  ? 1444 GLU B O   1 
ATOM   3087 C CB  . GLU B 1 141 ? 39.517  53.715  48.151 1.00 68.89  ? 1444 GLU B CB  1 
ATOM   3088 C CG  . GLU B 1 141 ? 39.499  55.172  48.617 1.00 68.60  ? 1444 GLU B CG  1 
ATOM   3089 C CD  . GLU B 1 141 ? 39.536  55.326  50.144 1.00 68.35  ? 1444 GLU B CD  1 
ATOM   3090 O OE1 . GLU B 1 141 ? 38.542  54.948  50.813 1.00 65.99  ? 1444 GLU B OE1 1 
ATOM   3091 O OE2 . GLU B 1 141 ? 40.561  55.828  50.668 1.00 66.81  ? 1444 GLU B OE2 1 
ATOM   3092 N N   . PHE B 1 142 ? 38.192  51.289  46.601 1.00 66.59  ? 1445 PHE B N   1 
ATOM   3093 C CA  . PHE B 1 142 ? 38.094  49.860  46.349 1.00 64.54  ? 1445 PHE B CA  1 
ATOM   3094 C C   . PHE B 1 142 ? 38.423  49.491  44.911 1.00 64.25  ? 1445 PHE B C   1 
ATOM   3095 O O   . PHE B 1 142 ? 39.343  48.708  44.658 1.00 64.09  ? 1445 PHE B O   1 
ATOM   3096 C CB  . PHE B 1 142 ? 36.685  49.367  46.690 1.00 63.99  ? 1445 PHE B CB  1 
ATOM   3097 C CG  . PHE B 1 142 ? 36.448  47.928  46.336 1.00 64.72  ? 1445 PHE B CG  1 
ATOM   3098 C CD1 . PHE B 1 142 ? 37.318  46.933  46.784 1.00 64.82  ? 1445 PHE B CD1 1 
ATOM   3099 C CD2 . PHE B 1 142 ? 35.377  47.566  45.529 1.00 64.72  ? 1445 PHE B CD2 1 
ATOM   3100 C CE1 . PHE B 1 142 ? 37.130  45.603  46.431 1.00 64.26  ? 1445 PHE B CE1 1 
ATOM   3101 C CE2 . PHE B 1 142 ? 35.178  46.234  45.168 1.00 64.79  ? 1445 PHE B CE2 1 
ATOM   3102 C CZ  . PHE B 1 142 ? 36.060  45.251  45.622 1.00 65.00  ? 1445 PHE B CZ  1 
ATOM   3103 N N   . VAL B 1 143 ? 37.665  50.047  43.971 1.00 64.30  ? 1446 VAL B N   1 
ATOM   3104 C CA  . VAL B 1 143 ? 37.888  49.758  42.557 1.00 64.53  ? 1446 VAL B CA  1 
ATOM   3105 C C   . VAL B 1 143 ? 39.331  50.045  42.147 1.00 64.62  ? 1446 VAL B C   1 
ATOM   3106 O O   . VAL B 1 143 ? 39.878  49.362  41.280 1.00 65.46  ? 1446 VAL B O   1 
ATOM   3107 C CB  . VAL B 1 143 ? 36.915  50.555  41.620 1.00 64.29  ? 1446 VAL B CB  1 
ATOM   3108 C CG1 . VAL B 1 143 ? 35.516  49.948  41.665 1.00 62.74  ? 1446 VAL B CG1 1 
ATOM   3109 C CG2 . VAL B 1 143 ? 36.872  52.011  42.023 1.00 63.39  ? 1446 VAL B CG2 1 
ATOM   3110 N N   . CYS B 1 144 ? 39.950  51.050  42.757 1.00 63.32  ? 1447 CYS B N   1 
ATOM   3111 C CA  . CYS B 1 144 ? 41.333  51.345  42.427 1.00 63.10  ? 1447 CYS B CA  1 
ATOM   3112 C C   . CYS B 1 144 ? 42.143  50.147  42.860 1.00 61.90  ? 1447 CYS B C   1 
ATOM   3113 O O   . CYS B 1 144 ? 42.897  49.576  42.073 1.00 61.53  ? 1447 CYS B O   1 
ATOM   3114 C CB  . CYS B 1 144 ? 41.823  52.581  43.175 1.00 65.45  ? 1447 CYS B CB  1 
ATOM   3115 S SG  . CYS B 1 144 ? 41.125  54.153  42.591 1.00 68.63  ? 1447 CYS B SG  1 
ATOM   3116 N N   . LEU B 1 145 ? 41.970  49.770  44.123 1.00 61.29  ? 1448 LEU B N   1 
ATOM   3117 C CA  . LEU B 1 145 ? 42.672  48.631  44.698 1.00 61.01  ? 1448 LEU B CA  1 
ATOM   3118 C C   . LEU B 1 145 ? 42.476  47.378  43.856 1.00 61.14  ? 1448 LEU B C   1 
ATOM   3119 O O   . LEU B 1 145 ? 43.442  46.765  43.399 1.00 61.65  ? 1448 LEU B O   1 
ATOM   3120 C CB  . LEU B 1 145 ? 42.178  48.386  46.121 1.00 60.19  ? 1448 LEU B CB  1 
ATOM   3121 C CG  . LEU B 1 145 ? 42.761  49.334  47.168 1.00 59.24  ? 1448 LEU B CG  1 
ATOM   3122 C CD1 . LEU B 1 145 ? 42.076  49.130  48.510 1.00 58.40  ? 1448 LEU B CD1 1 
ATOM   3123 C CD2 . LEU B 1 145 ? 44.259  49.077  47.278 1.00 58.30  ? 1448 LEU B CD2 1 
ATOM   3124 N N   . LYS B 1 146 ? 41.218  47.010  43.647 1.00 60.92  ? 1449 LYS B N   1 
ATOM   3125 C CA  . LYS B 1 146 ? 40.880  45.831  42.859 1.00 61.73  ? 1449 LYS B CA  1 
ATOM   3126 C C   . LYS B 1 146 ? 41.449  45.852  41.422 1.00 62.02  ? 1449 LYS B C   1 
ATOM   3127 O O   . LYS B 1 146 ? 41.509  44.820  40.747 1.00 62.75  ? 1449 LYS B O   1 
ATOM   3128 C CB  . LYS B 1 146 ? 39.355  45.676  42.830 1.00 60.49  ? 1449 LYS B CB  1 
ATOM   3129 C CG  . LYS B 1 146 ? 38.833  44.542  41.966 1.00 59.88  ? 1449 LYS B CG  1 
ATOM   3130 C CD  . LYS B 1 146 ? 37.309  44.490  42.030 1.00 61.95  ? 1449 LYS B CD  1 
ATOM   3131 C CE  . LYS B 1 146 ? 36.718  43.495  41.042 1.00 62.54  ? 1449 LYS B CE  1 
ATOM   3132 N NZ  . LYS B 1 146 ? 35.235  43.457  41.128 1.00 62.44  ? 1449 LYS B NZ  1 
ATOM   3133 N N   . SER B 1 147 ? 41.882  47.020  40.959 1.00 61.76  ? 1450 SER B N   1 
ATOM   3134 C CA  . SER B 1 147 ? 42.417  47.146  39.603 1.00 60.80  ? 1450 SER B CA  1 
ATOM   3135 C C   . SER B 1 147 ? 43.932  47.166  39.571 1.00 58.26  ? 1450 SER B C   1 
ATOM   3136 O O   . SER B 1 147 ? 44.541  47.044  38.514 1.00 57.44  ? 1450 SER B O   1 
ATOM   3137 C CB  . SER B 1 147 ? 41.882  48.417  38.934 1.00 62.47  ? 1450 SER B CB  1 
ATOM   3138 O OG  . SER B 1 147 ? 40.481  48.342  38.737 1.00 64.08  ? 1450 SER B OG  1 
ATOM   3139 N N   . ILE B 1 148 ? 44.532  47.333  40.735 1.00 56.55  ? 1451 ILE B N   1 
ATOM   3140 C CA  . ILE B 1 148 ? 45.975  47.356  40.840 1.00 55.83  ? 1451 ILE B CA  1 
ATOM   3141 C C   . ILE B 1 148 ? 46.461  45.914  41.009 1.00 56.24  ? 1451 ILE B C   1 
ATOM   3142 O O   . ILE B 1 148 ? 47.555  45.543  40.556 1.00 56.83  ? 1451 ILE B O   1 
ATOM   3143 C CB  . ILE B 1 148 ? 46.396  48.197  42.039 1.00 54.36  ? 1451 ILE B CB  1 
ATOM   3144 C CG1 . ILE B 1 148 ? 45.822  49.603  41.881 1.00 51.33  ? 1451 ILE B CG1 1 
ATOM   3145 C CG2 . ILE B 1 148 ? 47.912  48.219  42.159 1.00 53.98  ? 1451 ILE B CG2 1 
ATOM   3146 C CD1 . ILE B 1 148 ? 45.901  50.411  43.130 1.00 50.10  ? 1451 ILE B CD1 1 
ATOM   3147 N N   . ILE B 1 149 ? 45.629  45.102  41.656 1.00 54.96  ? 1452 ILE B N   1 
ATOM   3148 C CA  . ILE B 1 149 ? 45.948  43.701  41.874 1.00 53.88  ? 1452 ILE B CA  1 
ATOM   3149 C C   . ILE B 1 149 ? 45.975  43.010  40.520 1.00 53.53  ? 1452 ILE B C   1 
ATOM   3150 O O   . ILE B 1 149 ? 46.779  42.114  40.265 1.00 52.73  ? 1452 ILE B O   1 
ATOM   3151 C CB  . ILE B 1 149 ? 44.880  43.025  42.750 1.00 53.28  ? 1452 ILE B CB  1 
ATOM   3152 C CG1 . ILE B 1 149 ? 44.968  43.548  44.183 1.00 51.93  ? 1452 ILE B CG1 1 
ATOM   3153 C CG2 . ILE B 1 149 ? 45.064  41.523  42.708 1.00 55.07  ? 1452 ILE B CG2 1 
ATOM   3154 C CD1 . ILE B 1 149 ? 43.897  43.009  45.105 1.00 50.97  ? 1452 ILE B CD1 1 
ATOM   3155 N N   . LEU B 1 150 ? 45.073  43.448  39.653 1.00 54.32  ? 1453 LEU B N   1 
ATOM   3156 C CA  . LEU B 1 150 ? 44.947  42.896  38.314 1.00 53.72  ? 1453 LEU B CA  1 
ATOM   3157 C C   . LEU B 1 150 ? 46.186  43.148  37.484 1.00 53.95  ? 1453 LEU B C   1 
ATOM   3158 O O   . LEU B 1 150 ? 46.626  42.271  36.742 1.00 54.83  ? 1453 LEU B O   1 
ATOM   3159 C CB  . LEU B 1 150 ? 43.748  43.517  37.604 1.00 52.62  ? 1453 LEU B CB  1 
ATOM   3160 C CG  . LEU B 1 150 ? 43.555  43.073  36.158 1.00 52.89  ? 1453 LEU B CG  1 
ATOM   3161 C CD1 . LEU B 1 150 ? 43.269  41.583  36.124 1.00 52.91  ? 1453 LEU B CD1 1 
ATOM   3162 C CD2 . LEU B 1 150 ? 42.412  43.843  35.528 1.00 54.54  ? 1453 LEU B CD2 1 
ATOM   3163 N N   . LEU B 1 151 ? 46.756  44.343  37.627 1.00 53.63  ? 1454 LEU B N   1 
ATOM   3164 C CA  . LEU B 1 151 ? 47.928  44.739  36.851 1.00 52.29  ? 1454 LEU B CA  1 
ATOM   3165 C C   . LEU B 1 151 ? 49.302  44.582  37.496 1.00 51.04  ? 1454 LEU B C   1 
ATOM   3166 O O   . LEU B 1 151 ? 50.295  44.440  36.792 1.00 49.66  ? 1454 LEU B O   1 
ATOM   3167 C CB  . LEU B 1 151 ? 47.752  46.183  36.398 1.00 52.12  ? 1454 LEU B CB  1 
ATOM   3168 C CG  . LEU B 1 151 ? 46.496  46.448  35.576 1.00 51.43  ? 1454 LEU B CG  1 
ATOM   3169 C CD1 . LEU B 1 151 ? 46.272  47.940  35.501 1.00 51.71  ? 1454 LEU B CD1 1 
ATOM   3170 C CD2 . LEU B 1 151 ? 46.638  45.839  34.190 1.00 52.08  ? 1454 LEU B CD2 1 
ATOM   3171 N N   . ASN B 1 152 ? 49.369  44.600  38.818 1.00 50.73  ? 1455 ASN B N   1 
ATOM   3172 C CA  . ASN B 1 152 ? 50.651  44.480  39.487 1.00 53.14  ? 1455 ASN B CA  1 
ATOM   3173 C C   . ASN B 1 152 ? 51.072  43.054  39.857 1.00 55.17  ? 1455 ASN B C   1 
ATOM   3174 O O   . ASN B 1 152 ? 52.269  42.714  39.884 1.00 55.19  ? 1455 ASN B O   1 
ATOM   3175 C CB  . ASN B 1 152 ? 50.643  45.351  40.732 1.00 53.55  ? 1455 ASN B CB  1 
ATOM   3176 C CG  . ASN B 1 152 ? 51.927  45.247  41.510 1.00 55.14  ? 1455 ASN B CG  1 
ATOM   3177 O OD1 . ASN B 1 152 ? 53.016  45.169  40.930 1.00 56.26  ? 1455 ASN B OD1 1 
ATOM   3178 N ND2 . ASN B 1 152 ? 51.819  45.255  42.831 1.00 54.77  ? 1455 ASN B ND2 1 
ATOM   3179 N N   . SER B 1 153 ? 50.084  42.222  40.157 1.00 56.70  ? 1456 SER B N   1 
ATOM   3180 C CA  . SER B 1 153 ? 50.339  40.842  40.529 1.00 56.41  ? 1456 SER B CA  1 
ATOM   3181 C C   . SER B 1 153 ? 50.792  40.081  39.309 1.00 56.52  ? 1456 SER B C   1 
ATOM   3182 O O   . SER B 1 153 ? 50.024  39.889  38.358 1.00 55.49  ? 1456 SER B O   1 
ATOM   3183 C CB  . SER B 1 153 ? 49.074  40.216  41.104 1.00 56.71  ? 1456 SER B CB  1 
ATOM   3184 O OG  . SER B 1 153 ? 48.706  40.874  42.305 1.00 58.42  ? 1456 SER B OG  1 
ATOM   3185 N N   . GLY B 1 154 ? 52.049  39.657  39.336 1.00 56.92  ? 1457 GLY B N   1 
ATOM   3186 C CA  . GLY B 1 154 ? 52.581  38.935  38.203 1.00 59.42  ? 1457 GLY B CA  1 
ATOM   3187 C C   . GLY B 1 154 ? 52.758  39.848  37.000 1.00 60.41  ? 1457 GLY B C   1 
ATOM   3188 O O   . GLY B 1 154 ? 52.331  39.544  35.892 1.00 59.47  ? 1457 GLY B O   1 
ATOM   3189 N N   . VAL B 1 155 ? 53.375  40.996  37.231 1.00 62.74  ? 1458 VAL B N   1 
ATOM   3190 C CA  . VAL B 1 155 ? 53.647  41.943  36.163 1.00 63.63  ? 1458 VAL B CA  1 
ATOM   3191 C C   . VAL B 1 155 ? 55.117  41.759  35.797 1.00 65.97  ? 1458 VAL B C   1 
ATOM   3192 O O   . VAL B 1 155 ? 55.522  41.951  34.655 1.00 66.04  ? 1458 VAL B O   1 
ATOM   3193 C CB  . VAL B 1 155 ? 53.399  43.397  36.622 1.00 62.71  ? 1458 VAL B CB  1 
ATOM   3194 C CG1 . VAL B 1 155 ? 54.132  43.670  37.927 1.00 61.62  ? 1458 VAL B CG1 1 
ATOM   3195 C CG2 . VAL B 1 155 ? 53.844  44.368  35.538 1.00 61.38  ? 1458 VAL B CG2 1 
ATOM   3196 N N   . TYR B 1 156 ? 55.918  41.377  36.782 1.00 68.98  ? 1459 TYR B N   1 
ATOM   3197 C CA  . TYR B 1 156 ? 57.329  41.147  36.545 1.00 72.11  ? 1459 TYR B CA  1 
ATOM   3198 C C   . TYR B 1 156 ? 57.401  39.801  35.836 1.00 73.46  ? 1459 TYR B C   1 
ATOM   3199 O O   . TYR B 1 156 ? 58.064  39.665  34.807 1.00 72.54  ? 1459 TYR B O   1 
ATOM   3200 C CB  . TYR B 1 156 ? 58.082  41.124  37.877 1.00 73.12  ? 1459 TYR B CB  1 
ATOM   3201 C CG  . TYR B 1 156 ? 57.624  42.224  38.802 1.00 74.49  ? 1459 TYR B CG  1 
ATOM   3202 C CD1 . TYR B 1 156 ? 56.806  41.939  39.894 1.00 75.28  ? 1459 TYR B CD1 1 
ATOM   3203 C CD2 . TYR B 1 156 ? 57.944  43.559  38.547 1.00 75.40  ? 1459 TYR B CD2 1 
ATOM   3204 C CE1 . TYR B 1 156 ? 56.310  42.949  40.714 1.00 75.37  ? 1459 TYR B CE1 1 
ATOM   3205 C CE2 . TYR B 1 156 ? 57.452  44.585  39.361 1.00 75.41  ? 1459 TYR B CE2 1 
ATOM   3206 C CZ  . TYR B 1 156 ? 56.636  44.269  40.442 1.00 75.56  ? 1459 TYR B CZ  1 
ATOM   3207 O OH  . TYR B 1 156 ? 56.140  45.265  41.249 1.00 75.96  ? 1459 TYR B OH  1 
ATOM   3208 N N   . THR B 1 157 ? 56.705  38.807  36.378 1.00 75.44  ? 1460 THR B N   1 
ATOM   3209 C CA  . THR B 1 157 ? 56.675  37.488  35.751 1.00 77.57  ? 1460 THR B CA  1 
ATOM   3210 C C   . THR B 1 157 ? 55.912  37.705  34.442 1.00 79.15  ? 1460 THR B C   1 
ATOM   3211 O O   . THR B 1 157 ? 54.792  38.205  34.464 1.00 80.53  ? 1460 THR B O   1 
ATOM   3212 C CB  . THR B 1 157 ? 55.912  36.475  36.624 1.00 77.38  ? 1460 THR B CB  1 
ATOM   3213 O OG1 . THR B 1 157 ? 54.501  36.704  36.513 1.00 76.65  ? 1460 THR B OG1 1 
ATOM   3214 C CG2 . THR B 1 157 ? 56.322  36.631  38.086 1.00 78.13  ? 1460 THR B CG2 1 
ATOM   3215 N N   . PHE B 1 158 ? 56.502  37.347  33.306 1.00 80.39  ? 1461 PHE B N   1 
ATOM   3216 C CA  . PHE B 1 158 ? 55.824  37.572  32.036 1.00 81.69  ? 1461 PHE B CA  1 
ATOM   3217 C C   . PHE B 1 158 ? 56.168  36.618  30.905 1.00 84.71  ? 1461 PHE B C   1 
ATOM   3218 O O   . PHE B 1 158 ? 57.259  36.048  30.870 1.00 85.97  ? 1461 PHE B O   1 
ATOM   3219 C CB  . PHE B 1 158 ? 56.086  39.000  31.582 1.00 79.40  ? 1461 PHE B CB  1 
ATOM   3220 C CG  . PHE B 1 158 ? 54.871  39.855  31.588 1.00 77.14  ? 1461 PHE B CG  1 
ATOM   3221 C CD1 . PHE B 1 158 ? 54.977  41.229  31.466 1.00 76.37  ? 1461 PHE B CD1 1 
ATOM   3222 C CD2 . PHE B 1 158 ? 53.610  39.282  31.694 1.00 76.90  ? 1461 PHE B CD2 1 
ATOM   3223 C CE1 . PHE B 1 158 ? 53.847  42.026  31.449 1.00 76.19  ? 1461 PHE B CE1 1 
ATOM   3224 C CE2 . PHE B 1 158 ? 52.471  40.064  31.679 1.00 76.29  ? 1461 PHE B CE2 1 
ATOM   3225 C CZ  . PHE B 1 158 ? 52.587  41.443  31.555 1.00 76.72  ? 1461 PHE B CZ  1 
ATOM   3226 N N   . LEU B 1 159 ? 55.239  36.464  29.963 1.00 87.20  ? 1462 LEU B N   1 
ATOM   3227 C CA  . LEU B 1 159 ? 55.459  35.558  28.841 1.00 89.67  ? 1462 LEU B CA  1 
ATOM   3228 C C   . LEU B 1 159 ? 56.647  35.970  27.959 1.00 91.02  ? 1462 LEU B C   1 
ATOM   3229 O O   . LEU B 1 159 ? 57.753  35.465  28.168 1.00 91.22  ? 1462 LEU B O   1 
ATOM   3230 C CB  . LEU B 1 159 ? 54.176  35.411  28.007 1.00 89.34  ? 1462 LEU B CB  1 
ATOM   3231 C CG  . LEU B 1 159 ? 54.180  34.320  26.921 1.00 88.96  ? 1462 LEU B CG  1 
ATOM   3232 C CD1 . LEU B 1 159 ? 54.964  33.088  27.391 1.00 88.06  ? 1462 LEU B CD1 1 
ATOM   3233 C CD2 . LEU B 1 159 ? 52.741  33.952  26.571 1.00 87.17  ? 1462 LEU B CD2 1 
ATOM   3234 N N   . SER B 1 160 ? 56.444  36.872  26.994 1.00 92.21  ? 1463 SER B N   1 
ATOM   3235 C CA  . SER B 1 160 ? 57.553  37.290  26.123 1.00 93.58  ? 1463 SER B CA  1 
ATOM   3236 C C   . SER B 1 160 ? 58.732  37.839  26.943 1.00 94.31  ? 1463 SER B C   1 
ATOM   3237 O O   . SER B 1 160 ? 58.551  38.289  28.080 1.00 94.90  ? 1463 SER B O   1 
ATOM   3238 C CB  . SER B 1 160 ? 57.088  38.318  25.068 1.00 93.79  ? 1463 SER B CB  1 
ATOM   3239 O OG  . SER B 1 160 ? 56.678  39.551  25.629 1.00 95.25  ? 1463 SER B OG  1 
ATOM   3240 N N   . SER B 1 161 ? 59.936  37.785  26.368 1.00 94.69  ? 1464 SER B N   1 
ATOM   3241 C CA  . SER B 1 161 ? 61.153  38.230  27.061 1.00 94.63  ? 1464 SER B CA  1 
ATOM   3242 C C   . SER B 1 161 ? 61.993  39.242  26.277 1.00 94.27  ? 1464 SER B C   1 
ATOM   3243 O O   . SER B 1 161 ? 63.126  39.563  26.663 1.00 93.93  ? 1464 SER B O   1 
ATOM   3244 C CB  . SER B 1 161 ? 62.035  37.015  27.407 1.00 95.07  ? 1464 SER B CB  1 
ATOM   3245 O OG  . SER B 1 161 ? 61.342  36.043  28.180 1.00 94.42  ? 1464 SER B OG  1 
ATOM   3246 N N   . THR B 1 162 ? 61.441  39.733  25.173 1.00 93.52  ? 1465 THR B N   1 
ATOM   3247 C CA  . THR B 1 162 ? 62.130  40.713  24.344 1.00 92.63  ? 1465 THR B CA  1 
ATOM   3248 C C   . THR B 1 162 ? 61.807  42.121  24.832 1.00 91.69  ? 1465 THR B C   1 
ATOM   3249 O O   . THR B 1 162 ? 61.557  42.333  26.021 1.00 91.25  ? 1465 THR B O   1 
ATOM   3250 C CB  . THR B 1 162 ? 61.695  40.592  22.880 1.00 92.64  ? 1465 THR B CB  1 
ATOM   3251 O OG1 . THR B 1 162 ? 60.264  40.571  22.813 1.00 91.99  ? 1465 THR B OG1 1 
ATOM   3252 C CG2 . THR B 1 162 ? 62.255  39.323  22.263 1.00 93.23  ? 1465 THR B CG2 1 
ATOM   3253 N N   . LEU B 1 163 ? 61.821  43.080  23.910 1.00 90.88  ? 1466 LEU B N   1 
ATOM   3254 C CA  . LEU B 1 163 ? 61.514  44.470  24.240 1.00 90.02  ? 1466 LEU B CA  1 
ATOM   3255 C C   . LEU B 1 163 ? 59.997  44.638  24.328 1.00 89.28  ? 1466 LEU B C   1 
ATOM   3256 O O   . LEU B 1 163 ? 59.498  45.599  24.930 1.00 89.45  ? 1466 LEU B O   1 
ATOM   3257 C CB  . LEU B 1 163 ? 62.089  45.412  23.177 1.00 89.37  ? 1466 LEU B CB  1 
ATOM   3258 C CG  . LEU B 1 163 ? 63.610  45.594  23.138 1.00 88.87  ? 1466 LEU B CG  1 
ATOM   3259 C CD1 . LEU B 1 163 ? 64.055  46.308  24.403 1.00 88.47  ? 1466 LEU B CD1 1 
ATOM   3260 C CD2 . LEU B 1 163 ? 64.306  44.245  22.990 1.00 88.47  ? 1466 LEU B CD2 1 
ATOM   3261 N N   . LYS B 1 164 ? 59.284  43.688  23.716 1.00 87.22  ? 1467 LYS B N   1 
ATOM   3262 C CA  . LYS B 1 164 ? 57.824  43.666  23.708 1.00 85.09  ? 1467 LYS B CA  1 
ATOM   3263 C C   . LYS B 1 164 ? 57.314  43.458  25.127 1.00 83.45  ? 1467 LYS B C   1 
ATOM   3264 O O   . LYS B 1 164 ? 56.406  44.146  25.584 1.00 83.44  ? 1467 LYS B O   1 
ATOM   3265 C CB  . LYS B 1 164 ? 57.320  42.530  22.811 1.00 86.07  ? 1467 LYS B CB  1 
ATOM   3266 C CG  . LYS B 1 164 ? 55.810  42.370  22.763 1.00 85.86  ? 1467 LYS B CG  1 
ATOM   3267 C CD  . LYS B 1 164 ? 55.155  43.696  22.474 1.00 85.87  ? 1467 LYS B CD  1 
ATOM   3268 C CE  . LYS B 1 164 ? 53.917  43.527  21.630 1.00 85.86  ? 1467 LYS B CE  1 
ATOM   3269 N NZ  . LYS B 1 164 ? 53.275  44.853  21.417 1.00 87.22  ? 1467 LYS B NZ  1 
ATOM   3270 N N   . SER B 1 165 ? 57.897  42.494  25.824 1.00 81.50  ? 1468 SER B N   1 
ATOM   3271 C CA  . SER B 1 165 ? 57.494  42.230  27.192 1.00 79.01  ? 1468 SER B CA  1 
ATOM   3272 C C   . SER B 1 165 ? 57.800  43.480  27.993 1.00 77.50  ? 1468 SER B C   1 
ATOM   3273 O O   . SER B 1 165 ? 57.099  43.815  28.937 1.00 76.85  ? 1468 SER B O   1 
ATOM   3274 C CB  . SER B 1 165 ? 58.282  41.051  27.753 1.00 78.62  ? 1468 SER B CB  1 
ATOM   3275 O OG  . SER B 1 165 ? 57.802  40.681  29.032 1.00 78.40  ? 1468 SER B OG  1 
ATOM   3276 N N   . LEU B 1 166 ? 58.854  44.175  27.590 1.00 76.68  ? 1469 LEU B N   1 
ATOM   3277 C CA  . LEU B 1 166 ? 59.268  45.391  28.264 1.00 76.03  ? 1469 LEU B CA  1 
ATOM   3278 C C   . LEU B 1 166 ? 58.438  46.611  27.892 1.00 74.74  ? 1469 LEU B C   1 
ATOM   3279 O O   . LEU B 1 166 ? 58.333  47.542  28.678 1.00 74.02  ? 1469 LEU B O   1 
ATOM   3280 C CB  . LEU B 1 166 ? 60.749  45.650  28.002 1.00 77.47  ? 1469 LEU B CB  1 
ATOM   3281 C CG  . LEU B 1 166 ? 61.697  44.952  28.990 1.00 79.07  ? 1469 LEU B CG  1 
ATOM   3282 C CD1 . LEU B 1 166 ? 61.619  45.648  30.343 1.00 79.18  ? 1469 LEU B CD1 1 
ATOM   3283 C CD2 . LEU B 1 166 ? 61.335  43.475  29.127 1.00 79.25  ? 1469 LEU B CD2 1 
ATOM   3284 N N   . GLU B 1 167 ? 57.857  46.617  26.697 1.00 74.61  ? 1470 GLU B N   1 
ATOM   3285 C CA  . GLU B 1 167 ? 57.006  47.736  26.290 1.00 75.18  ? 1470 GLU B CA  1 
ATOM   3286 C C   . GLU B 1 167 ? 55.821  47.711  27.238 1.00 74.38  ? 1470 GLU B C   1 
ATOM   3287 O O   . GLU B 1 167 ? 55.377  48.745  27.725 1.00 74.51  ? 1470 GLU B O   1 
ATOM   3288 C CB  . GLU B 1 167 ? 56.441  47.552  24.880 1.00 77.27  ? 1470 GLU B CB  1 
ATOM   3289 C CG  . GLU B 1 167 ? 57.432  47.497  23.738 1.00 80.82  ? 1470 GLU B CG  1 
ATOM   3290 C CD  . GLU B 1 167 ? 56.738  47.205  22.406 1.00 82.99  ? 1470 GLU B CD  1 
ATOM   3291 O OE1 . GLU B 1 167 ? 57.444  47.015  21.390 1.00 84.25  ? 1470 GLU B OE1 1 
ATOM   3292 O OE2 . GLU B 1 167 ? 55.485  47.167  22.379 1.00 82.85  ? 1470 GLU B OE2 1 
ATOM   3293 N N   . GLU B 1 168 ? 55.306  46.505  27.470 1.00 73.81  ? 1471 GLU B N   1 
ATOM   3294 C CA  . GLU B 1 168 ? 54.161  46.288  28.349 1.00 72.68  ? 1471 GLU B CA  1 
ATOM   3295 C C   . GLU B 1 168 ? 54.485  46.564  29.823 1.00 72.99  ? 1471 GLU B C   1 
ATOM   3296 O O   . GLU B 1 168 ? 53.792  47.357  30.476 1.00 72.73  ? 1471 GLU B O   1 
ATOM   3297 C CB  . GLU B 1 168 ? 53.635  44.859  28.178 1.00 71.08  ? 1471 GLU B CB  1 
ATOM   3298 C CG  . GLU B 1 168 ? 53.197  44.535  26.758 1.00 69.58  ? 1471 GLU B CG  1 
ATOM   3299 C CD  . GLU B 1 168 ? 52.179  43.413  26.698 1.00 68.58  ? 1471 GLU B CD  1 
ATOM   3300 O OE1 . GLU B 1 168 ? 52.459  42.318  27.223 1.00 67.12  ? 1471 GLU B OE1 1 
ATOM   3301 O OE2 . GLU B 1 168 ? 51.096  43.629  26.118 1.00 67.63  ? 1471 GLU B OE2 1 
ATOM   3302 N N   . LYS B 1 169 ? 55.519  45.909  30.352 1.00 72.53  ? 1472 LYS B N   1 
ATOM   3303 C CA  . LYS B 1 169 ? 55.922  46.134  31.739 1.00 72.38  ? 1472 LYS B CA  1 
ATOM   3304 C C   . LYS B 1 169 ? 55.792  47.650  31.953 1.00 72.58  ? 1472 LYS B C   1 
ATOM   3305 O O   . LYS B 1 169 ? 55.182  48.119  32.921 1.00 71.74  ? 1472 LYS B O   1 
ATOM   3306 C CB  . LYS B 1 169 ? 57.377  45.670  31.938 1.00 72.92  ? 1472 LYS B CB  1 
ATOM   3307 C CG  . LYS B 1 169 ? 57.937  45.826  33.354 1.00 73.84  ? 1472 LYS B CG  1 
ATOM   3308 C CD  . LYS B 1 169 ? 59.393  45.352  33.455 1.00 73.98  ? 1472 LYS B CD  1 
ATOM   3309 C CE  . LYS B 1 169 ? 59.963  45.562  34.860 1.00 73.58  ? 1472 LYS B CE  1 
ATOM   3310 N NZ  . LYS B 1 169 ? 61.381  45.106  34.990 1.00 71.97  ? 1472 LYS B NZ  1 
ATOM   3311 N N   . ASP B 1 170 ? 56.340  48.397  30.997 1.00 72.63  ? 1473 ASP B N   1 
ATOM   3312 C CA  . ASP B 1 170 ? 56.326  49.858  30.989 1.00 71.98  ? 1473 ASP B CA  1 
ATOM   3313 C C   . ASP B 1 170 ? 54.918  50.420  31.052 1.00 70.44  ? 1473 ASP B C   1 
ATOM   3314 O O   . ASP B 1 170 ? 54.589  51.183  31.952 1.00 70.48  ? 1473 ASP B O   1 
ATOM   3315 C CB  . ASP B 1 170 ? 56.990  50.369  29.715 1.00 74.84  ? 1473 ASP B CB  1 
ATOM   3316 C CG  . ASP B 1 170 ? 58.232  51.172  29.987 1.00 76.74  ? 1473 ASP B CG  1 
ATOM   3317 O OD1 . ASP B 1 170 ? 59.183  50.619  30.587 1.00 76.82  ? 1473 ASP B OD1 1 
ATOM   3318 O OD2 . ASP B 1 170 ? 58.250  52.359  29.591 1.00 79.39  ? 1473 ASP B OD2 1 
ATOM   3319 N N   . HIS B 1 171 ? 54.099  50.048  30.075 1.00 69.39  ? 1474 HIS B N   1 
ATOM   3320 C CA  . HIS B 1 171 ? 52.720  50.513  29.993 1.00 69.03  ? 1474 HIS B CA  1 
ATOM   3321 C C   . HIS B 1 171 ? 51.976  50.346  31.307 1.00 69.39  ? 1474 HIS B C   1 
ATOM   3322 O O   . HIS B 1 171 ? 51.304  51.264  31.768 1.00 68.88  ? 1474 HIS B O   1 
ATOM   3323 C CB  . HIS B 1 171 ? 51.969  49.756  28.903 1.00 67.63  ? 1474 HIS B CB  1 
ATOM   3324 C CG  . HIS B 1 171 ? 50.545  50.177  28.758 1.00 66.57  ? 1474 HIS B CG  1 
ATOM   3325 N ND1 . HIS B 1 171 ? 49.500  49.283  28.803 1.00 66.36  ? 1474 HIS B ND1 1 
ATOM   3326 C CD2 . HIS B 1 171 ? 49.993  51.394  28.546 1.00 67.11  ? 1474 HIS B CD2 1 
ATOM   3327 C CE1 . HIS B 1 171 ? 48.363  49.930  28.619 1.00 67.32  ? 1474 HIS B CE1 1 
ATOM   3328 N NE2 . HIS B 1 171 ? 48.634  51.213  28.460 1.00 67.80  ? 1474 HIS B NE2 1 
ATOM   3329 N N   . ILE B 1 172 ? 52.093  49.168  31.908 1.00 70.06  ? 1475 ILE B N   1 
ATOM   3330 C CA  . ILE B 1 172 ? 51.416  48.904  33.171 1.00 69.08  ? 1475 ILE B CA  1 
ATOM   3331 C C   . ILE B 1 172 ? 51.942  49.855  34.239 1.00 68.71  ? 1475 ILE B C   1 
ATOM   3332 O O   . ILE B 1 172 ? 51.174  50.578  34.871 1.00 67.10  ? 1475 ILE B O   1 
ATOM   3333 C CB  . ILE B 1 172 ? 51.646  47.452  33.630 1.00 69.06  ? 1475 ILE B CB  1 
ATOM   3334 C CG1 . ILE B 1 172 ? 51.225  46.485  32.524 1.00 69.37  ? 1475 ILE B CG1 1 
ATOM   3335 C CG2 . ILE B 1 172 ? 50.850  47.178  34.888 1.00 68.05  ? 1475 ILE B CG2 1 
ATOM   3336 C CD1 . ILE B 1 172 ? 51.559  45.028  32.818 1.00 69.61  ? 1475 ILE B CD1 1 
ATOM   3337 N N   . HIS B 1 173 ? 53.257  49.846  34.433 1.00 68.87  ? 1476 HIS B N   1 
ATOM   3338 C CA  . HIS B 1 173 ? 53.884  50.712  35.419 1.00 69.33  ? 1476 HIS B CA  1 
ATOM   3339 C C   . HIS B 1 173 ? 53.331  52.123  35.257 1.00 68.99  ? 1476 HIS B C   1 
ATOM   3340 O O   . HIS B 1 173 ? 53.140  52.853  36.234 1.00 69.01  ? 1476 HIS B O   1 
ATOM   3341 C CB  . HIS B 1 173 ? 55.396  50.722  35.209 1.00 71.18  ? 1476 HIS B CB  1 
ATOM   3342 C CG  . HIS B 1 173 ? 56.081  49.463  35.644 1.00 73.18  ? 1476 HIS B CG  1 
ATOM   3343 N ND1 . HIS B 1 173 ? 57.357  49.133  35.237 1.00 74.51  ? 1476 HIS B ND1 1 
ATOM   3344 C CD2 . HIS B 1 173 ? 55.688  48.475  36.482 1.00 73.99  ? 1476 HIS B CD2 1 
ATOM   3345 C CE1 . HIS B 1 173 ? 57.721  47.998  35.805 1.00 74.55  ? 1476 HIS B CE1 1 
ATOM   3346 N NE2 . HIS B 1 173 ? 56.726  47.578  36.566 1.00 75.24  ? 1476 HIS B NE2 1 
ATOM   3347 N N   . ARG B 1 174 ? 53.066  52.485  34.005 1.00 68.12  ? 1477 ARG B N   1 
ATOM   3348 C CA  . ARG B 1 174 ? 52.538  53.796  33.650 1.00 67.53  ? 1477 ARG B CA  1 
ATOM   3349 C C   . ARG B 1 174 ? 51.058  53.935  34.045 1.00 66.64  ? 1477 ARG B C   1 
ATOM   3350 O O   . ARG B 1 174 ? 50.669  54.915  34.683 1.00 66.23  ? 1477 ARG B O   1 
ATOM   3351 C CB  . ARG B 1 174 ? 52.725  54.009  32.144 1.00 68.76  ? 1477 ARG B CB  1 
ATOM   3352 C CG  . ARG B 1 174 ? 52.525  55.429  31.649 1.00 71.66  ? 1477 ARG B CG  1 
ATOM   3353 C CD  . ARG B 1 174 ? 52.918  55.530  30.182 1.00 73.92  ? 1477 ARG B CD  1 
ATOM   3354 N NE  . ARG B 1 174 ? 54.310  55.143  29.964 1.00 76.67  ? 1477 ARG B NE  1 
ATOM   3355 C CZ  . ARG B 1 174 ? 55.364  55.871  30.331 1.00 78.30  ? 1477 ARG B CZ  1 
ATOM   3356 N NH1 . ARG B 1 174 ? 55.198  57.046  30.936 1.00 78.28  ? 1477 ARG B NH1 1 
ATOM   3357 N NH2 . ARG B 1 174 ? 56.591  55.415  30.102 1.00 78.12  ? 1477 ARG B NH2 1 
ATOM   3358 N N   . VAL B 1 175 ? 50.233  52.960  33.667 1.00 66.02  ? 1478 VAL B N   1 
ATOM   3359 C CA  . VAL B 1 175 ? 48.811  53.005  34.017 1.00 64.64  ? 1478 VAL B CA  1 
ATOM   3360 C C   . VAL B 1 175 ? 48.665  52.874  35.517 1.00 64.60  ? 1478 VAL B C   1 
ATOM   3361 O O   . VAL B 1 175 ? 47.848  53.559  36.121 1.00 64.90  ? 1478 VAL B O   1 
ATOM   3362 C CB  . VAL B 1 175 ? 47.992  51.860  33.380 1.00 63.72  ? 1478 VAL B CB  1 
ATOM   3363 C CG1 . VAL B 1 175 ? 46.614  51.818  34.007 1.00 61.71  ? 1478 VAL B CG1 1 
ATOM   3364 C CG2 . VAL B 1 175 ? 47.870  52.062  31.878 1.00 63.11  ? 1478 VAL B CG2 1 
ATOM   3365 N N   . LEU B 1 176 ? 49.446  51.977  36.113 1.00 64.23  ? 1479 LEU B N   1 
ATOM   3366 C CA  . LEU B 1 176 ? 49.387  51.796  37.552 1.00 64.43  ? 1479 LEU B CA  1 
ATOM   3367 C C   . LEU B 1 176 ? 49.724  53.141  38.172 1.00 64.81  ? 1479 LEU B C   1 
ATOM   3368 O O   . LEU B 1 176 ? 49.119  53.537  39.169 1.00 65.58  ? 1479 LEU B O   1 
ATOM   3369 C CB  . LEU B 1 176 ? 50.390  50.731  38.022 1.00 64.83  ? 1479 LEU B CB  1 
ATOM   3370 C CG  . LEU B 1 176 ? 50.018  49.243  37.883 1.00 65.07  ? 1479 LEU B CG  1 
ATOM   3371 C CD1 . LEU B 1 176 ? 51.128  48.377  38.481 1.00 64.73  ? 1479 LEU B CD1 1 
ATOM   3372 C CD2 . LEU B 1 176 ? 48.700  48.961  38.593 1.00 63.58  ? 1479 LEU B CD2 1 
ATOM   3373 N N   . ASP B 1 177 ? 50.679  53.846  37.560 1.00 64.05  ? 1480 ASP B N   1 
ATOM   3374 C CA  . ASP B 1 177 ? 51.103  55.157  38.038 1.00 61.35  ? 1480 ASP B CA  1 
ATOM   3375 C C   . ASP B 1 177 ? 49.952  56.134  38.089 1.00 60.59  ? 1480 ASP B C   1 
ATOM   3376 O O   . ASP B 1 177 ? 49.866  56.939  39.003 1.00 59.99  ? 1480 ASP B O   1 
ATOM   3377 C CB  . ASP B 1 177 ? 52.192  55.725  37.143 1.00 62.07  ? 1480 ASP B CB  1 
ATOM   3378 C CG  . ASP B 1 177 ? 53.558  55.642  37.774 1.00 63.39  ? 1480 ASP B CG  1 
ATOM   3379 O OD1 . ASP B 1 177 ? 53.668  55.969  38.978 1.00 64.23  ? 1480 ASP B OD1 1 
ATOM   3380 O OD2 . ASP B 1 177 ? 54.519  55.266  37.063 1.00 62.92  ? 1480 ASP B OD2 1 
ATOM   3381 N N   . LYS B 1 178 ? 49.071  56.071  37.097 1.00 60.71  ? 1481 LYS B N   1 
ATOM   3382 C CA  . LYS B 1 178 ? 47.918  56.961  37.056 1.00 60.91  ? 1481 LYS B CA  1 
ATOM   3383 C C   . LYS B 1 178 ? 46.938  56.620  38.166 1.00 61.30  ? 1481 LYS B C   1 
ATOM   3384 O O   . LYS B 1 178 ? 46.413  57.504  38.838 1.00 61.35  ? 1481 LYS B O   1 
ATOM   3385 C CB  . LYS B 1 178 ? 47.206  56.865  35.701 1.00 60.43  ? 1481 LYS B CB  1 
ATOM   3386 C CG  . LYS B 1 178 ? 45.773  57.392  35.732 1.00 59.96  ? 1481 LYS B CG  1 
ATOM   3387 C CD  . LYS B 1 178 ? 45.146  57.486  34.343 1.00 60.63  ? 1481 LYS B CD  1 
ATOM   3388 C CE  . LYS B 1 178 ? 45.607  58.722  33.584 1.00 59.92  ? 1481 LYS B CE  1 
ATOM   3389 N NZ  . LYS B 1 178 ? 45.215  59.974  34.292 1.00 60.12  ? 1481 LYS B NZ  1 
ATOM   3390 N N   . ILE B 1 179 ? 46.692  55.329  38.356 1.00 62.72  ? 1482 ILE B N   1 
ATOM   3391 C CA  . ILE B 1 179 ? 45.764  54.873  39.386 1.00 63.04  ? 1482 ILE B CA  1 
ATOM   3392 C C   . ILE B 1 179 ? 46.189  55.412  40.749 1.00 63.39  ? 1482 ILE B C   1 
ATOM   3393 O O   . ILE B 1 179 ? 45.351  55.662  41.616 1.00 62.30  ? 1482 ILE B O   1 
ATOM   3394 C CB  . ILE B 1 179 ? 45.709  53.341  39.438 1.00 62.66  ? 1482 ILE B CB  1 
ATOM   3395 C CG1 . ILE B 1 179 ? 45.436  52.788  38.040 1.00 63.34  ? 1482 ILE B CG1 1 
ATOM   3396 C CG2 . ILE B 1 179 ? 44.605  52.905  40.372 1.00 62.19  ? 1482 ILE B CG2 1 
ATOM   3397 C CD1 . ILE B 1 179 ? 45.660  51.301  37.903 1.00 63.32  ? 1482 ILE B CD1 1 
ATOM   3398 N N   . THR B 1 180 ? 47.497  55.587  40.927 1.00 64.32  ? 1483 THR B N   1 
ATOM   3399 C CA  . THR B 1 180 ? 48.048  56.119  42.172 1.00 65.16  ? 1483 THR B CA  1 
ATOM   3400 C C   . THR B 1 180 ? 47.475  57.518  42.322 1.00 65.91  ? 1483 THR B C   1 
ATOM   3401 O O   . THR B 1 180 ? 47.096  57.934  43.414 1.00 65.82  ? 1483 THR B O   1 
ATOM   3402 C CB  . THR B 1 180 ? 49.596  56.253  42.116 1.00 65.46  ? 1483 THR B CB  1 
ATOM   3403 O OG1 . THR B 1 180 ? 50.187  54.992  41.781 1.00 65.22  ? 1483 THR B OG1 1 
ATOM   3404 C CG2 . THR B 1 180 ? 50.145  56.721  43.459 1.00 64.60  ? 1483 THR B CG2 1 
ATOM   3405 N N   . ASP B 1 181 ? 47.419  58.231  41.201 1.00 67.22  ? 1484 ASP B N   1 
ATOM   3406 C CA  . ASP B 1 181 ? 46.905  59.594  41.166 1.00 68.49  ? 1484 ASP B CA  1 
ATOM   3407 C C   . ASP B 1 181 ? 45.399  59.634  41.360 1.00 68.31  ? 1484 ASP B C   1 
ATOM   3408 O O   . ASP B 1 181 ? 44.882  60.549  41.995 1.00 68.31  ? 1484 ASP B O   1 
ATOM   3409 C CB  . ASP B 1 181 ? 47.263  60.265  39.839 1.00 70.61  ? 1484 ASP B CB  1 
ATOM   3410 C CG  . ASP B 1 181 ? 48.742  60.128  39.492 1.00 73.64  ? 1484 ASP B CG  1 
ATOM   3411 O OD1 . ASP B 1 181 ? 49.585  60.081  40.431 1.00 72.95  ? 1484 ASP B OD1 1 
ATOM   3412 O OD2 . ASP B 1 181 ? 49.055  60.084  38.275 1.00 74.22  ? 1484 ASP B OD2 1 
ATOM   3413 N N   . THR B 1 182 ? 44.691  58.648  40.815 1.00 68.06  ? 1485 THR B N   1 
ATOM   3414 C CA  . THR B 1 182 ? 43.241  58.613  40.965 1.00 67.45  ? 1485 THR B CA  1 
ATOM   3415 C C   . THR B 1 182 ? 42.893  58.427  42.437 1.00 67.96  ? 1485 THR B C   1 
ATOM   3416 O O   . THR B 1 182 ? 41.812  58.806  42.880 1.00 68.30  ? 1485 THR B O   1 
ATOM   3417 C CB  . THR B 1 182 ? 42.614  57.472  40.163 1.00 66.52  ? 1485 THR B CB  1 
ATOM   3418 O OG1 . THR B 1 182 ? 43.032  57.553  38.794 1.00 65.33  ? 1485 THR B OG1 1 
ATOM   3419 C CG2 . THR B 1 182 ? 41.102  57.563  40.233 1.00 64.91  ? 1485 THR B CG2 1 
ATOM   3420 N N   . LEU B 1 183 ? 43.816  57.842  43.192 1.00 68.68  ? 1486 LEU B N   1 
ATOM   3421 C CA  . LEU B 1 183 ? 43.610  57.624  44.623 1.00 69.98  ? 1486 LEU B CA  1 
ATOM   3422 C C   . LEU B 1 183 ? 44.007  58.849  45.437 1.00 70.64  ? 1486 LEU B C   1 
ATOM   3423 O O   . LEU B 1 183 ? 43.230  59.314  46.270 1.00 70.74  ? 1486 LEU B O   1 
ATOM   3424 C CB  . LEU B 1 183 ? 44.406  56.408  45.112 1.00 69.30  ? 1486 LEU B CB  1 
ATOM   3425 C CG  . LEU B 1 183 ? 43.797  55.039  44.814 1.00 67.71  ? 1486 LEU B CG  1 
ATOM   3426 C CD1 . LEU B 1 183 ? 44.705  53.965  45.353 1.00 66.68  ? 1486 LEU B CD1 1 
ATOM   3427 C CD2 . LEU B 1 183 ? 42.419  54.941  45.449 1.00 67.08  ? 1486 LEU B CD2 1 
ATOM   3428 N N   . ILE B 1 184 ? 45.220  59.353  45.206 1.00 71.67  ? 1487 ILE B N   1 
ATOM   3429 C CA  . ILE B 1 184 ? 45.710  60.542  45.899 1.00 73.01  ? 1487 ILE B CA  1 
ATOM   3430 C C   . ILE B 1 184 ? 44.652  61.630  45.749 1.00 74.63  ? 1487 ILE B C   1 
ATOM   3431 O O   . ILE B 1 184 ? 44.329  62.342  46.698 1.00 75.06  ? 1487 ILE B O   1 
ATOM   3432 C CB  . ILE B 1 184 ? 47.017  61.067  45.274 1.00 72.27  ? 1487 ILE B CB  1 
ATOM   3433 C CG1 . ILE B 1 184 ? 48.177  60.122  45.581 1.00 72.87  ? 1487 ILE B CG1 1 
ATOM   3434 C CG2 . ILE B 1 184 ? 47.301  62.454  45.790 1.00 72.93  ? 1487 ILE B CG2 1 
ATOM   3435 C CD1 . ILE B 1 184 ? 48.552  60.040  47.051 1.00 72.09  ? 1487 ILE B CD1 1 
ATOM   3436 N N   . HIS B 1 185 ? 44.126  61.748  44.535 1.00 76.65  ? 1488 HIS B N   1 
ATOM   3437 C CA  . HIS B 1 185 ? 43.093  62.721  44.214 1.00 78.36  ? 1488 HIS B CA  1 
ATOM   3438 C C   . HIS B 1 185 ? 41.927  62.494  45.152 1.00 78.73  ? 1488 HIS B C   1 
ATOM   3439 O O   . HIS B 1 185 ? 41.675  63.288  46.051 1.00 78.95  ? 1488 HIS B O   1 
ATOM   3440 C CB  . HIS B 1 185 ? 42.627  62.530  42.763 1.00 80.47  ? 1488 HIS B CB  1 
ATOM   3441 C CG  . HIS B 1 185 ? 41.465  63.394  42.368 1.00 83.03  ? 1488 HIS B CG  1 
ATOM   3442 N ND1 . HIS B 1 185 ? 40.264  63.389  43.045 1.00 83.85  ? 1488 HIS B ND1 1 
ATOM   3443 C CD2 . HIS B 1 185 ? 41.310  64.264  41.339 1.00 84.19  ? 1488 HIS B CD2 1 
ATOM   3444 C CE1 . HIS B 1 185 ? 39.420  64.215  42.452 1.00 83.98  ? 1488 HIS B CE1 1 
ATOM   3445 N NE2 . HIS B 1 185 ? 40.030  64.759  41.414 1.00 84.20  ? 1488 HIS B NE2 1 
ATOM   3446 N N   . LEU B 1 186 ? 41.229  61.385  44.941 1.00 79.69  ? 1489 LEU B N   1 
ATOM   3447 C CA  . LEU B 1 186 ? 40.071  61.036  45.741 1.00 79.95  ? 1489 LEU B CA  1 
ATOM   3448 C C   . LEU B 1 186 ? 40.337  61.133  47.238 1.00 80.57  ? 1489 LEU B C   1 
ATOM   3449 O O   . LEU B 1 186 ? 39.409  61.047  48.036 1.00 80.32  ? 1489 LEU B O   1 
ATOM   3450 C CB  . LEU B 1 186 ? 39.600  59.634  45.367 1.00 79.46  ? 1489 LEU B CB  1 
ATOM   3451 C CG  . LEU B 1 186 ? 38.080  59.482  45.376 1.00 79.91  ? 1489 LEU B CG  1 
ATOM   3452 C CD1 . LEU B 1 186 ? 37.691  58.353  44.449 1.00 79.03  ? 1489 LEU B CD1 1 
ATOM   3453 C CD2 . LEU B 1 186 ? 37.574  59.251  46.798 1.00 80.23  ? 1489 LEU B CD2 1 
ATOM   3454 N N   . MET B 1 187 ? 41.601  61.312  47.615 1.00 81.64  ? 1490 MET B N   1 
ATOM   3455 C CA  . MET B 1 187 ? 41.965  61.449  49.024 1.00 83.24  ? 1490 MET B CA  1 
ATOM   3456 C C   . MET B 1 187 ? 42.133  62.917  49.403 1.00 83.79  ? 1490 MET B C   1 
ATOM   3457 O O   . MET B 1 187 ? 41.985  63.284  50.569 1.00 85.13  ? 1490 MET B O   1 
ATOM   3458 C CB  . MET B 1 187 ? 43.260  60.699  49.351 1.00 83.69  ? 1490 MET B CB  1 
ATOM   3459 C CG  . MET B 1 187 ? 43.113  59.197  49.515 1.00 83.07  ? 1490 MET B CG  1 
ATOM   3460 S SD  . MET B 1 187 ? 44.543  58.509  50.371 1.00 84.43  ? 1490 MET B SD  1 
ATOM   3461 C CE  . MET B 1 187 ? 45.850  58.913  49.245 1.00 83.60  ? 1490 MET B CE  1 
ATOM   3462 N N   . ALA B 1 188 ? 42.465  63.755  48.428 1.00 83.53  ? 1491 ALA B N   1 
ATOM   3463 C CA  . ALA B 1 188 ? 42.611  65.185  48.687 1.00 83.02  ? 1491 ALA B CA  1 
ATOM   3464 C C   . ALA B 1 188 ? 41.217  65.802  48.513 1.00 82.54  ? 1491 ALA B C   1 
ATOM   3465 O O   . ALA B 1 188 ? 40.879  66.812  49.136 1.00 81.96  ? 1491 ALA B O   1 
ATOM   3466 C CB  . ALA B 1 188 ? 43.595  65.796  47.708 1.00 83.31  ? 1491 ALA B CB  1 
ATOM   3467 N N   . LYS B 1 189 ? 40.418  65.159  47.664 1.00 82.03  ? 1492 LYS B N   1 
ATOM   3468 C CA  . LYS B 1 189 ? 39.045  65.564  47.378 1.00 81.48  ? 1492 LYS B CA  1 
ATOM   3469 C C   . LYS B 1 189 ? 38.203  65.138  48.581 1.00 80.60  ? 1492 LYS B C   1 
ATOM   3470 O O   . LYS B 1 189 ? 37.064  64.700  48.427 1.00 80.29  ? 1492 LYS B O   1 
ATOM   3471 C CB  . LYS B 1 189 ? 38.539  64.835  46.122 1.00 82.42  ? 1492 LYS B CB  1 
ATOM   3472 C CG  . LYS B 1 189 ? 37.825  65.687  45.062 1.00 84.32  ? 1492 LYS B CG  1 
ATOM   3473 C CD  . LYS B 1 189 ? 36.418  66.124  45.455 1.00 86.06  ? 1492 LYS B CD  1 
ATOM   3474 C CE  . LYS B 1 189 ? 36.434  67.332  46.395 1.00 88.17  ? 1492 LYS B CE  1 
ATOM   3475 N NZ  . LYS B 1 189 ? 35.061  67.802  46.778 1.00 89.54  ? 1492 LYS B NZ  1 
ATOM   3476 N N   . ALA B 1 190 ? 38.779  65.244  49.776 1.00 79.24  ? 1493 ALA B N   1 
ATOM   3477 C CA  . ALA B 1 190 ? 38.083  64.870  51.008 1.00 77.80  ? 1493 ALA B CA  1 
ATOM   3478 C C   . ALA B 1 190 ? 38.744  65.530  52.214 1.00 76.70  ? 1493 ALA B C   1 
ATOM   3479 O O   . ALA B 1 190 ? 38.515  65.138  53.364 1.00 74.95  ? 1493 ALA B O   1 
ATOM   3480 C CB  . ALA B 1 190 ? 38.085  63.363  51.173 1.00 78.45  ? 1493 ALA B CB  1 
ATOM   3481 N N   . GLY B 1 191 ? 39.575  66.529  51.927 1.00 75.93  ? 1494 GLY B N   1 
ATOM   3482 C CA  . GLY B 1 191 ? 40.258  67.270  52.967 1.00 74.53  ? 1494 GLY B CA  1 
ATOM   3483 C C   . GLY B 1 191 ? 41.280  66.488  53.757 1.00 73.59  ? 1494 GLY B C   1 
ATOM   3484 O O   . GLY B 1 191 ? 41.333  66.602  54.977 1.00 73.86  ? 1494 GLY B O   1 
ATOM   3485 N N   . LEU B 1 192 ? 42.093  65.689  53.082 1.00 72.90  ? 1495 LEU B N   1 
ATOM   3486 C CA  . LEU B 1 192 ? 43.112  64.924  53.787 1.00 73.25  ? 1495 LEU B CA  1 
ATOM   3487 C C   . LEU B 1 192 ? 44.447  65.594  53.560 1.00 74.07  ? 1495 LEU B C   1 
ATOM   3488 O O   . LEU B 1 192 ? 44.943  65.600  52.432 1.00 74.01  ? 1495 LEU B O   1 
ATOM   3489 C CB  . LEU B 1 192 ? 43.175  63.482  53.278 1.00 71.87  ? 1495 LEU B CB  1 
ATOM   3490 C CG  . LEU B 1 192 ? 42.059  62.509  53.671 1.00 70.33  ? 1495 LEU B CG  1 
ATOM   3491 C CD1 . LEU B 1 192 ? 42.372  61.146  53.087 1.00 70.47  ? 1495 LEU B CD1 1 
ATOM   3492 C CD2 . LEU B 1 192 ? 41.941  62.413  55.179 1.00 69.12  ? 1495 LEU B CD2 1 
ATOM   3493 N N   . THR B 1 193 ? 45.029  66.153  54.623 1.00 75.13  ? 1496 THR B N   1 
ATOM   3494 C CA  . THR B 1 193 ? 46.318  66.839  54.503 1.00 76.46  ? 1496 THR B CA  1 
ATOM   3495 C C   . THR B 1 193 ? 47.208  66.027  53.585 1.00 77.60  ? 1496 THR B C   1 
ATOM   3496 O O   . THR B 1 193 ? 47.085  64.808  53.528 1.00 79.22  ? 1496 THR B O   1 
ATOM   3497 C CB  . THR B 1 193 ? 47.058  66.983  55.851 1.00 75.76  ? 1496 THR B CB  1 
ATOM   3498 O OG1 . THR B 1 193 ? 48.036  65.942  55.971 1.00 75.39  ? 1496 THR B OG1 1 
ATOM   3499 C CG2 . THR B 1 193 ? 46.079  66.921  57.018 1.00 75.95  ? 1496 THR B CG2 1 
ATOM   3500 N N   . LEU B 1 194 ? 48.097  66.696  52.861 1.00 78.65  ? 1497 LEU B N   1 
ATOM   3501 C CA  . LEU B 1 194 ? 48.983  65.991  51.953 1.00 78.78  ? 1497 LEU B CA  1 
ATOM   3502 C C   . LEU B 1 194 ? 49.638  64.827  52.681 1.00 78.51  ? 1497 LEU B C   1 
ATOM   3503 O O   . LEU B 1 194 ? 49.815  63.758  52.103 1.00 78.56  ? 1497 LEU B O   1 
ATOM   3504 C CB  . LEU B 1 194 ? 50.043  66.939  51.406 1.00 79.76  ? 1497 LEU B CB  1 
ATOM   3505 C CG  . LEU B 1 194 ? 49.463  68.090  50.590 1.00 80.30  ? 1497 LEU B CG  1 
ATOM   3506 C CD1 . LEU B 1 194 ? 50.590  68.964  50.044 1.00 81.48  ? 1497 LEU B CD1 1 
ATOM   3507 C CD2 . LEU B 1 194 ? 48.623  67.514  49.465 1.00 80.36  ? 1497 LEU B CD2 1 
ATOM   3508 N N   . GLN B 1 195 ? 49.982  65.028  53.950 1.00 77.69  ? 1498 GLN B N   1 
ATOM   3509 C CA  . GLN B 1 195 ? 50.599  63.959  54.724 1.00 77.88  ? 1498 GLN B CA  1 
ATOM   3510 C C   . GLN B 1 195 ? 49.629  62.784  54.857 1.00 77.88  ? 1498 GLN B C   1 
ATOM   3511 O O   . GLN B 1 195 ? 50.025  61.621  54.717 1.00 78.14  ? 1498 GLN B O   1 
ATOM   3512 C CB  . GLN B 1 195 ? 50.993  64.451  56.124 1.00 78.53  ? 1498 GLN B CB  1 
ATOM   3513 C CG  . GLN B 1 195 ? 51.738  63.394  56.953 1.00 77.90  ? 1498 GLN B CG  1 
ATOM   3514 C CD  . GLN B 1 195 ? 52.097  63.862  58.352 1.00 77.02  ? 1498 GLN B CD  1 
ATOM   3515 O OE1 . GLN B 1 195 ? 51.222  64.136  59.172 1.00 75.83  ? 1498 GLN B OE1 1 
ATOM   3516 N NE2 . GLN B 1 195 ? 53.394  63.950  58.631 1.00 76.87  ? 1498 GLN B NE2 1 
ATOM   3517 N N   . GLN B 1 196 ? 48.360  63.097  55.122 1.00 77.29  ? 1499 GLN B N   1 
ATOM   3518 C CA  . GLN B 1 196 ? 47.318  62.082  55.285 1.00 76.23  ? 1499 GLN B CA  1 
ATOM   3519 C C   . GLN B 1 196 ? 47.068  61.238  54.033 1.00 76.60  ? 1499 GLN B C   1 
ATOM   3520 O O   . GLN B 1 196 ? 46.716  60.066  54.140 1.00 76.94  ? 1499 GLN B O   1 
ATOM   3521 C CB  . GLN B 1 196 ? 46.013  62.740  55.742 1.00 74.45  ? 1499 GLN B CB  1 
ATOM   3522 C CG  . GLN B 1 196 ? 46.164  63.527  57.039 1.00 73.06  ? 1499 GLN B CG  1 
ATOM   3523 C CD  . GLN B 1 196 ? 44.836  63.945  57.657 1.00 72.03  ? 1499 GLN B CD  1 
ATOM   3524 O OE1 . GLN B 1 196 ? 43.962  64.491  56.978 1.00 72.66  ? 1499 GLN B OE1 1 
ATOM   3525 N NE2 . GLN B 1 196 ? 44.686  63.700  58.955 1.00 69.73  ? 1499 GLN B NE2 1 
ATOM   3526 N N   . GLN B 1 197 ? 47.239  61.831  52.853 1.00 76.89  ? 1500 GLN B N   1 
ATOM   3527 C CA  . GLN B 1 197 ? 47.051  61.105  51.599 1.00 76.33  ? 1500 GLN B CA  1 
ATOM   3528 C C   . GLN B 1 197 ? 48.199  60.107  51.488 1.00 75.56  ? 1500 GLN B C   1 
ATOM   3529 O O   . GLN B 1 197 ? 47.993  58.943  51.156 1.00 74.52  ? 1500 GLN B O   1 
ATOM   3530 C CB  . GLN B 1 197 ? 47.069  62.073  50.411 1.00 76.62  ? 1500 GLN B CB  1 
ATOM   3531 C CG  . GLN B 1 197 ? 45.907  63.052  50.387 1.00 76.25  ? 1500 GLN B CG  1 
ATOM   3532 C CD  . GLN B 1 197 ? 46.217  64.290  49.581 1.00 77.12  ? 1500 GLN B CD  1 
ATOM   3533 O OE1 . GLN B 1 197 ? 46.418  64.223  48.369 1.00 77.55  ? 1500 GLN B OE1 1 
ATOM   3534 N NE2 . GLN B 1 197 ? 46.271  65.434  50.254 1.00 77.41  ? 1500 GLN B NE2 1 
ATOM   3535 N N   . HIS B 1 198 ? 49.408  60.581  51.773 1.00 75.27  ? 1501 HIS B N   1 
ATOM   3536 C CA  . HIS B 1 198 ? 50.594  59.741  51.741 1.00 75.72  ? 1501 HIS B CA  1 
ATOM   3537 C C   . HIS B 1 198 ? 50.325  58.543  52.624 1.00 74.96  ? 1501 HIS B C   1 
ATOM   3538 O O   . HIS B 1 198 ? 50.103  57.433  52.147 1.00 75.45  ? 1501 HIS B O   1 
ATOM   3539 C CB  . HIS B 1 198 ? 51.797  60.488  52.311 1.00 78.15  ? 1501 HIS B CB  1 
ATOM   3540 C CG  . HIS B 1 198 ? 52.219  61.666  51.495 1.00 81.38  ? 1501 HIS B CG  1 
ATOM   3541 N ND1 . HIS B 1 198 ? 53.072  62.638  51.975 1.00 82.84  ? 1501 HIS B ND1 1 
ATOM   3542 C CD2 . HIS B 1 198 ? 51.919  62.022  50.224 1.00 81.99  ? 1501 HIS B CD2 1 
ATOM   3543 C CE1 . HIS B 1 198 ? 53.277  63.543  51.033 1.00 82.95  ? 1501 HIS B CE1 1 
ATOM   3544 N NE2 . HIS B 1 198 ? 52.589  63.192  49.960 1.00 82.75  ? 1501 HIS B NE2 1 
ATOM   3545 N N   . GLN B 1 199 ? 50.344  58.792  53.928 1.00 73.55  ? 1502 GLN B N   1 
ATOM   3546 C CA  . GLN B 1 199 ? 50.118  57.756  54.918 1.00 71.90  ? 1502 GLN B CA  1 
ATOM   3547 C C   . GLN B 1 199 ? 48.979  56.806  54.574 1.00 71.30  ? 1502 GLN B C   1 
ATOM   3548 O O   . GLN B 1 199 ? 49.117  55.596  54.753 1.00 73.21  ? 1502 GLN B O   1 
ATOM   3549 C CB  . GLN B 1 199 ? 49.855  58.384  56.281 1.00 71.11  ? 1502 GLN B CB  1 
ATOM   3550 C CG  . GLN B 1 199 ? 50.928  59.349  56.720 1.00 70.08  ? 1502 GLN B CG  1 
ATOM   3551 C CD  . GLN B 1 199 ? 50.870  59.614  58.200 1.00 70.13  ? 1502 GLN B CD  1 
ATOM   3552 O OE1 . GLN B 1 199 ? 49.786  59.741  58.772 1.00 70.88  ? 1502 GLN B OE1 1 
ATOM   3553 N NE2 . GLN B 1 199 ? 52.034  59.705  58.834 1.00 69.56  ? 1502 GLN B NE2 1 
ATOM   3554 N N   . ARG B 1 200 ? 47.855  57.335  54.089 1.00 68.87  ? 1503 ARG B N   1 
ATOM   3555 C CA  . ARG B 1 200 ? 46.728  56.471  53.748 1.00 65.95  ? 1503 ARG B CA  1 
ATOM   3556 C C   . ARG B 1 200 ? 47.055  55.650  52.516 1.00 66.12  ? 1503 ARG B C   1 
ATOM   3557 O O   . ARG B 1 200 ? 46.674  54.488  52.435 1.00 66.08  ? 1503 ARG B O   1 
ATOM   3558 C CB  . ARG B 1 200 ? 45.450  57.279  53.507 1.00 63.64  ? 1503 ARG B CB  1 
ATOM   3559 C CG  . ARG B 1 200 ? 44.204  56.413  53.322 1.00 60.47  ? 1503 ARG B CG  1 
ATOM   3560 C CD  . ARG B 1 200 ? 42.983  57.273  53.056 1.00 59.76  ? 1503 ARG B CD  1 
ATOM   3561 N NE  . ARG B 1 200 ? 41.769  56.519  52.724 1.00 59.35  ? 1503 ARG B NE  1 
ATOM   3562 C CZ  . ARG B 1 200 ? 41.019  55.843  53.598 1.00 59.09  ? 1503 ARG B CZ  1 
ATOM   3563 N NH1 . ARG B 1 200 ? 41.344  55.800  54.887 1.00 58.18  ? 1503 ARG B NH1 1 
ATOM   3564 N NH2 . ARG B 1 200 ? 39.922  55.222  53.184 1.00 57.85  ? 1503 ARG B NH2 1 
ATOM   3565 N N   . LEU B 1 201 ? 47.754  56.254  51.555 1.00 66.65  ? 1504 LEU B N   1 
ATOM   3566 C CA  . LEU B 1 201 ? 48.144  55.536  50.343 1.00 66.87  ? 1504 LEU B CA  1 
ATOM   3567 C C   . LEU B 1 201 ? 48.910  54.318  50.824 1.00 66.71  ? 1504 LEU B C   1 
ATOM   3568 O O   . LEU B 1 201 ? 48.606  53.186  50.452 1.00 67.57  ? 1504 LEU B O   1 
ATOM   3569 C CB  . LEU B 1 201 ? 49.064  56.386  49.452 1.00 67.51  ? 1504 LEU B CB  1 
ATOM   3570 C CG  . LEU B 1 201 ? 49.621  55.710  48.183 1.00 66.97  ? 1504 LEU B CG  1 
ATOM   3571 C CD1 . LEU B 1 201 ? 48.484  55.449  47.217 1.00 66.87  ? 1504 LEU B CD1 1 
ATOM   3572 C CD2 . LEU B 1 201 ? 50.675  56.584  47.520 1.00 66.14  ? 1504 LEU B CD2 1 
ATOM   3573 N N   . ALA B 1 202 ? 49.904  54.572  51.666 1.00 65.61  ? 1505 ALA B N   1 
ATOM   3574 C CA  . ALA B 1 202 ? 50.730  53.520  52.227 1.00 65.31  ? 1505 ALA B CA  1 
ATOM   3575 C C   . ALA B 1 202 ? 49.882  52.423  52.875 1.00 65.03  ? 1505 ALA B C   1 
ATOM   3576 O O   . ALA B 1 202 ? 50.092  51.237  52.618 1.00 66.24  ? 1505 ALA B O   1 
ATOM   3577 C CB  . ALA B 1 202 ? 51.679  54.115  53.246 1.00 65.85  ? 1505 ALA B CB  1 
ATOM   3578 N N   . GLN B 1 203 ? 48.924  52.817  53.709 1.00 63.67  ? 1506 GLN B N   1 
ATOM   3579 C CA  . GLN B 1 203 ? 48.058  51.854  54.388 1.00 62.37  ? 1506 GLN B CA  1 
ATOM   3580 C C   . GLN B 1 203 ? 47.286  50.939  53.429 1.00 61.14  ? 1506 GLN B C   1 
ATOM   3581 O O   . GLN B 1 203 ? 47.061  49.766  53.724 1.00 60.18  ? 1506 GLN B O   1 
ATOM   3582 C CB  . GLN B 1 203 ? 47.076  52.589  55.297 1.00 62.18  ? 1506 GLN B CB  1 
ATOM   3583 C CG  . GLN B 1 203 ? 47.753  53.446  56.347 1.00 63.58  ? 1506 GLN B CG  1 
ATOM   3584 C CD  . GLN B 1 203 ? 46.761  54.095  57.296 1.00 63.89  ? 1506 GLN B CD  1 
ATOM   3585 O OE1 . GLN B 1 203 ? 45.809  54.742  56.860 1.00 63.48  ? 1506 GLN B OE1 1 
ATOM   3586 N NE2 . GLN B 1 203 ? 46.981  53.929  58.602 1.00 63.54  ? 1506 GLN B NE2 1 
ATOM   3587 N N   . LEU B 1 204 ? 46.891  51.477  52.281 1.00 59.63  ? 1507 LEU B N   1 
ATOM   3588 C CA  . LEU B 1 204 ? 46.149  50.710  51.298 1.00 58.05  ? 1507 LEU B CA  1 
ATOM   3589 C C   . LEU B 1 204 ? 47.032  49.756  50.522 1.00 57.63  ? 1507 LEU B C   1 
ATOM   3590 O O   . LEU B 1 204 ? 46.716  48.580  50.379 1.00 58.44  ? 1507 LEU B O   1 
ATOM   3591 C CB  . LEU B 1 204 ? 45.450  51.656  50.336 1.00 58.70  ? 1507 LEU B CB  1 
ATOM   3592 C CG  . LEU B 1 204 ? 44.247  52.363  50.959 1.00 61.26  ? 1507 LEU B CG  1 
ATOM   3593 C CD1 . LEU B 1 204 ? 44.156  53.804  50.448 1.00 63.05  ? 1507 LEU B CD1 1 
ATOM   3594 C CD2 . LEU B 1 204 ? 42.981  51.571  50.644 1.00 62.04  ? 1507 LEU B CD2 1 
ATOM   3595 N N   . LEU B 1 205 ? 48.145  50.261  50.016 1.00 57.17  ? 1508 LEU B N   1 
ATOM   3596 C CA  . LEU B 1 205 ? 49.051  49.435  49.240 1.00 56.80  ? 1508 LEU B CA  1 
ATOM   3597 C C   . LEU B 1 205 ? 49.649  48.314  50.074 1.00 57.40  ? 1508 LEU B C   1 
ATOM   3598 O O   . LEU B 1 205 ? 50.094  47.295  49.537 1.00 57.90  ? 1508 LEU B O   1 
ATOM   3599 C CB  . LEU B 1 205 ? 50.152  50.304  48.634 1.00 56.25  ? 1508 LEU B CB  1 
ATOM   3600 C CG  . LEU B 1 205 ? 49.588  51.386  47.707 1.00 56.50  ? 1508 LEU B CG  1 
ATOM   3601 C CD1 . LEU B 1 205 ? 50.714  52.194  47.083 1.00 56.45  ? 1508 LEU B CD1 1 
ATOM   3602 C CD2 . LEU B 1 205 ? 48.735  50.728  46.636 1.00 54.63  ? 1508 LEU B CD2 1 
ATOM   3603 N N   . LEU B 1 206 ? 49.657  48.489  51.390 1.00 57.06  ? 1509 LEU B N   1 
ATOM   3604 C CA  . LEU B 1 206 ? 50.201  47.455  52.253 1.00 57.15  ? 1509 LEU B CA  1 
ATOM   3605 C C   . LEU B 1 206 ? 49.184  46.338  52.466 1.00 57.89  ? 1509 LEU B C   1 
ATOM   3606 O O   . LEU B 1 206 ? 49.553  45.181  52.680 1.00 57.93  ? 1509 LEU B O   1 
ATOM   3607 C CB  . LEU B 1 206 ? 50.648  48.052  53.584 1.00 56.06  ? 1509 LEU B CB  1 
ATOM   3608 C CG  . LEU B 1 206 ? 51.952  48.846  53.486 1.00 55.13  ? 1509 LEU B CG  1 
ATOM   3609 C CD1 . LEU B 1 206 ? 52.394  49.267  54.870 1.00 54.81  ? 1509 LEU B CD1 1 
ATOM   3610 C CD2 . LEU B 1 206 ? 53.032  47.994  52.831 1.00 54.50  ? 1509 LEU B CD2 1 
ATOM   3611 N N   . ILE B 1 207 ? 47.902  46.680  52.405 1.00 58.60  ? 1510 ILE B N   1 
ATOM   3612 C CA  . ILE B 1 207 ? 46.864  45.669  52.548 1.00 58.26  ? 1510 ILE B CA  1 
ATOM   3613 C C   . ILE B 1 207 ? 47.077  44.684  51.398 1.00 57.60  ? 1510 ILE B C   1 
ATOM   3614 O O   . ILE B 1 207 ? 46.906  43.474  51.557 1.00 56.98  ? 1510 ILE B O   1 
ATOM   3615 C CB  . ILE B 1 207 ? 45.447  46.279  52.428 1.00 58.53  ? 1510 ILE B CB  1 
ATOM   3616 C CG1 . ILE B 1 207 ? 45.277  47.412  53.434 1.00 59.11  ? 1510 ILE B CG1 1 
ATOM   3617 C CG2 . ILE B 1 207 ? 44.395  45.223  52.712 1.00 59.08  ? 1510 ILE B CG2 1 
ATOM   3618 C CD1 . ILE B 1 207 ? 45.537  46.999  54.859 1.00 59.53  ? 1510 ILE B CD1 1 
ATOM   3619 N N   . LEU B 1 208 ? 47.470  45.217  50.243 1.00 56.69  ? 1511 LEU B N   1 
ATOM   3620 C CA  . LEU B 1 208 ? 47.716  44.400  49.063 1.00 56.28  ? 1511 LEU B CA  1 
ATOM   3621 C C   . LEU B 1 208 ? 48.809  43.374  49.315 1.00 56.72  ? 1511 LEU B C   1 
ATOM   3622 O O   . LEU B 1 208 ? 48.828  42.308  48.689 1.00 57.70  ? 1511 LEU B O   1 
ATOM   3623 C CB  . LEU B 1 208 ? 48.114  45.278  47.881 1.00 55.65  ? 1511 LEU B CB  1 
ATOM   3624 C CG  . LEU B 1 208 ? 47.133  46.385  47.515 1.00 55.70  ? 1511 LEU B CG  1 
ATOM   3625 C CD1 . LEU B 1 208 ? 47.580  47.030  46.229 1.00 55.95  ? 1511 LEU B CD1 1 
ATOM   3626 C CD2 . LEU B 1 208 ? 45.733  45.813  47.351 1.00 56.83  ? 1511 LEU B CD2 1 
ATOM   3627 N N   . SER B 1 209 ? 49.728  43.698  50.218 1.00 55.47  ? 1512 SER B N   1 
ATOM   3628 C CA  . SER B 1 209 ? 50.802  42.779  50.540 1.00 53.80  ? 1512 SER B CA  1 
ATOM   3629 C C   . SER B 1 209 ? 50.207  41.517  51.154 1.00 53.35  ? 1512 SER B C   1 
ATOM   3630 O O   . SER B 1 209 ? 50.483  40.406  50.707 1.00 52.80  ? 1512 SER B O   1 
ATOM   3631 C CB  . SER B 1 209 ? 51.756  43.438  51.524 1.00 54.17  ? 1512 SER B CB  1 
ATOM   3632 O OG  . SER B 1 209 ? 52.671  42.500  52.042 1.00 56.43  ? 1512 SER B OG  1 
ATOM   3633 N N   . HIS B 1 210 ? 49.373  41.698  52.172 1.00 53.53  ? 1513 HIS B N   1 
ATOM   3634 C CA  . HIS B 1 210 ? 48.747  40.583  52.865 1.00 54.23  ? 1513 HIS B CA  1 
ATOM   3635 C C   . HIS B 1 210 ? 47.706  39.896  51.980 1.00 52.49  ? 1513 HIS B C   1 
ATOM   3636 O O   . HIS B 1 210 ? 47.547  38.679  52.029 1.00 52.23  ? 1513 HIS B O   1 
ATOM   3637 C CB  . HIS B 1 210 ? 48.122  41.087  54.177 1.00 59.13  ? 1513 HIS B CB  1 
ATOM   3638 C CG  . HIS B 1 210 ? 47.787  40.004  55.171 1.00 65.17  ? 1513 HIS B CG  1 
ATOM   3639 N ND1 . HIS B 1 210 ? 46.606  39.283  55.134 1.00 65.77  ? 1513 HIS B ND1 1 
ATOM   3640 C CD2 . HIS B 1 210 ? 48.465  39.551  56.258 1.00 66.88  ? 1513 HIS B CD2 1 
ATOM   3641 C CE1 . HIS B 1 210 ? 46.572  38.440  56.153 1.00 66.02  ? 1513 HIS B CE1 1 
ATOM   3642 N NE2 . HIS B 1 210 ? 47.687  38.583  56.851 1.00 68.00  ? 1513 HIS B NE2 1 
ATOM   3643 N N   . ILE B 1 211 ? 46.999  40.663  51.159 1.00 50.22  ? 1514 ILE B N   1 
ATOM   3644 C CA  . ILE B 1 211 ? 46.000  40.062  50.281 1.00 48.67  ? 1514 ILE B CA  1 
ATOM   3645 C C   . ILE B 1 211 ? 46.696  39.071  49.378 1.00 48.36  ? 1514 ILE B C   1 
ATOM   3646 O O   . ILE B 1 211 ? 46.150  38.021  49.045 1.00 49.11  ? 1514 ILE B O   1 
ATOM   3647 C CB  . ILE B 1 211 ? 45.319  41.097  49.391 1.00 48.39  ? 1514 ILE B CB  1 
ATOM   3648 C CG1 . ILE B 1 211 ? 44.534  42.085  50.246 1.00 48.90  ? 1514 ILE B CG1 1 
ATOM   3649 C CG2 . ILE B 1 211 ? 44.385  40.406  48.419 1.00 48.20  ? 1514 ILE B CG2 1 
ATOM   3650 C CD1 . ILE B 1 211 ? 43.869  43.185  49.440 1.00 49.59  ? 1514 ILE B CD1 1 
ATOM   3651 N N   . ARG B 1 212 ? 47.908  39.431  48.973 1.00 47.80  ? 1515 ARG B N   1 
ATOM   3652 C CA  . ARG B 1 212 ? 48.732  38.589  48.111 1.00 46.63  ? 1515 ARG B CA  1 
ATOM   3653 C C   . ARG B 1 212 ? 48.962  37.301  48.882 1.00 44.33  ? 1515 ARG B C   1 
ATOM   3654 O O   . ARG B 1 212 ? 48.773  36.196  48.380 1.00 40.71  ? 1515 ARG B O   1 
ATOM   3655 C CB  . ARG B 1 212 ? 50.077  39.286  47.851 1.00 46.76  ? 1515 ARG B CB  1 
ATOM   3656 C CG  . ARG B 1 212 ? 50.524  39.309  46.397 1.00 46.77  ? 1515 ARG B CG  1 
ATOM   3657 C CD  . ARG B 1 212 ? 51.037  37.964  45.939 1.00 46.96  ? 1515 ARG B CD  1 
ATOM   3658 N NE  . ARG B 1 212 ? 51.258  37.914  44.497 1.00 47.18  ? 1515 ARG B NE  1 
ATOM   3659 C CZ  . ARG B 1 212 ? 51.901  38.848  43.805 1.00 48.90  ? 1515 ARG B CZ  1 
ATOM   3660 N NH1 . ARG B 1 212 ? 52.386  39.917  44.419 1.00 49.36  ? 1515 ARG B NH1 1 
ATOM   3661 N NH2 . ARG B 1 212 ? 52.069  38.708  42.496 1.00 51.06  ? 1515 ARG B NH2 1 
ATOM   3662 N N   . HIS B 1 213 ? 49.353  37.486  50.132 1.00 43.99  ? 1516 HIS B N   1 
ATOM   3663 C CA  . HIS B 1 213 ? 49.637  36.394  51.022 1.00 44.94  ? 1516 HIS B CA  1 
ATOM   3664 C C   . HIS B 1 213 ? 48.450  35.444  51.181 1.00 46.36  ? 1516 HIS B C   1 
ATOM   3665 O O   . HIS B 1 213 ? 48.604  34.223  51.101 1.00 46.16  ? 1516 HIS B O   1 
ATOM   3666 C CB  . HIS B 1 213 ? 50.053  36.959  52.370 1.00 44.68  ? 1516 HIS B CB  1 
ATOM   3667 C CG  . HIS B 1 213 ? 50.572  35.926  53.313 1.00 46.08  ? 1516 HIS B CG  1 
ATOM   3668 N ND1 . HIS B 1 213 ? 51.556  35.028  52.960 1.00 46.27  ? 1516 HIS B ND1 1 
ATOM   3669 C CD2 . HIS B 1 213 ? 50.270  35.667  54.606 1.00 46.88  ? 1516 HIS B CD2 1 
ATOM   3670 C CE1 . HIS B 1 213 ? 51.842  34.263  53.996 1.00 46.73  ? 1516 HIS B CE1 1 
ATOM   3671 N NE2 . HIS B 1 213 ? 51.076  34.630  55.008 1.00 48.04  ? 1516 HIS B NE2 1 
ATOM   3672 N N   . MET B 1 214 ? 47.262  35.995  51.404 1.00 47.54  ? 1517 MET B N   1 
ATOM   3673 C CA  . MET B 1 214 ? 46.089  35.151  51.578 1.00 48.54  ? 1517 MET B CA  1 
ATOM   3674 C C   . MET B 1 214 ? 45.858  34.328  50.337 1.00 48.92  ? 1517 MET B C   1 
ATOM   3675 O O   . MET B 1 214 ? 45.520  33.146  50.410 1.00 48.07  ? 1517 MET B O   1 
ATOM   3676 C CB  . MET B 1 214 ? 44.854  35.996  51.856 1.00 50.13  ? 1517 MET B CB  1 
ATOM   3677 C CG  . MET B 1 214 ? 44.769  36.491  53.269 1.00 51.24  ? 1517 MET B CG  1 
ATOM   3678 S SD  . MET B 1 214 ? 43.274  37.403  53.463 1.00 52.48  ? 1517 MET B SD  1 
ATOM   3679 C CE  . MET B 1 214 ? 43.887  39.056  53.203 1.00 54.37  ? 1517 MET B CE  1 
ATOM   3680 N N   . SER B 1 215 ? 46.029  34.976  49.191 1.00 49.18  ? 1518 SER B N   1 
ATOM   3681 C CA  . SER B 1 215 ? 45.848  34.320  47.916 1.00 48.92  ? 1518 SER B CA  1 
ATOM   3682 C C   . SER B 1 215 ? 46.816  33.153  47.808 1.00 49.27  ? 1518 SER B C   1 
ATOM   3683 O O   . SER B 1 215 ? 46.429  32.060  47.408 1.00 49.73  ? 1518 SER B O   1 
ATOM   3684 C CB  . SER B 1 215 ? 46.103  35.309  46.794 1.00 49.88  ? 1518 SER B CB  1 
ATOM   3685 O OG  . SER B 1 215 ? 46.043  34.661  45.539 1.00 52.57  ? 1518 SER B OG  1 
ATOM   3686 N N   . ASN B 1 216 ? 48.076  33.384  48.167 1.00 48.84  ? 1519 ASN B N   1 
ATOM   3687 C CA  . ASN B 1 216 ? 49.068  32.328  48.105 1.00 48.97  ? 1519 ASN B CA  1 
ATOM   3688 C C   . ASN B 1 216 ? 48.660  31.155  48.984 1.00 50.60  ? 1519 ASN B C   1 
ATOM   3689 O O   . ASN B 1 216 ? 48.579  30.025  48.502 1.00 51.92  ? 1519 ASN B O   1 
ATOM   3690 C CB  . ASN B 1 216 ? 50.447  32.838  48.528 1.00 49.35  ? 1519 ASN B CB  1 
ATOM   3691 C CG  . ASN B 1 216 ? 51.153  33.626  47.421 1.00 50.35  ? 1519 ASN B CG  1 
ATOM   3692 O OD1 . ASN B 1 216 ? 51.087  33.267  46.239 1.00 50.40  ? 1519 ASN B OD1 1 
ATOM   3693 N ND2 . ASN B 1 216 ? 51.851  34.690  47.805 1.00 48.26  ? 1519 ASN B ND2 1 
ATOM   3694 N N   . LYS B 1 217 ? 48.396  31.407  50.265 1.00 50.83  ? 1520 LYS B N   1 
ATOM   3695 C CA  . LYS B 1 217 ? 47.980  30.325  51.155 1.00 51.68  ? 1520 LYS B CA  1 
ATOM   3696 C C   . LYS B 1 217 ? 46.668  29.691  50.682 1.00 52.52  ? 1520 LYS B C   1 
ATOM   3697 O O   . LYS B 1 217 ? 46.512  28.469  50.682 1.00 52.51  ? 1520 LYS B O   1 
ATOM   3698 C CB  . LYS B 1 217 ? 47.797  30.834  52.585 1.00 53.13  ? 1520 LYS B CB  1 
ATOM   3699 C CG  . LYS B 1 217 ? 49.073  31.320  53.267 1.00 56.15  ? 1520 LYS B CG  1 
ATOM   3700 C CD  . LYS B 1 217 ? 50.161  30.246  53.296 1.00 57.01  ? 1520 LYS B CD  1 
ATOM   3701 C CE  . LYS B 1 217 ? 51.487  30.812  53.797 1.00 56.59  ? 1520 LYS B CE  1 
ATOM   3702 N NZ  . LYS B 1 217 ? 52.643  29.919  53.510 1.00 56.98  ? 1520 LYS B NZ  1 
ATOM   3703 N N   . GLY B 1 218 ? 45.728  30.529  50.270 1.00 52.93  ? 1521 GLY B N   1 
ATOM   3704 C CA  . GLY B 1 218 ? 44.445  30.027  49.823 1.00 53.62  ? 1521 GLY B CA  1 
ATOM   3705 C C   . GLY B 1 218 ? 44.498  29.156  48.585 1.00 53.76  ? 1521 GLY B C   1 
ATOM   3706 O O   . GLY B 1 218 ? 43.617  28.321  48.367 1.00 54.14  ? 1521 GLY B O   1 
ATOM   3707 N N   . MET B 1 219 ? 45.518  29.354  47.761 1.00 53.73  ? 1522 MET B N   1 
ATOM   3708 C CA  . MET B 1 219 ? 45.650  28.574  46.536 1.00 54.58  ? 1522 MET B CA  1 
ATOM   3709 C C   . MET B 1 219 ? 46.194  27.201  46.905 1.00 55.48  ? 1522 MET B C   1 
ATOM   3710 O O   . MET B 1 219 ? 45.729  26.171  46.410 1.00 54.11  ? 1522 MET B O   1 
ATOM   3711 C CB  . MET B 1 219 ? 46.603  29.275  45.569 1.00 53.81  ? 1522 MET B CB  1 
ATOM   3712 C CG  . MET B 1 219 ? 46.552  28.757  44.141 1.00 53.04  ? 1522 MET B CG  1 
ATOM   3713 S SD  . MET B 1 219 ? 45.641  29.856  43.047 1.00 53.60  ? 1522 MET B SD  1 
ATOM   3714 C CE  . MET B 1 219 ? 46.487  31.423  43.304 1.00 49.91  ? 1522 MET B CE  1 
ATOM   3715 N N   . GLU B 1 220 ? 47.195  27.201  47.778 1.00 56.44  ? 1523 GLU B N   1 
ATOM   3716 C CA  . GLU B 1 220 ? 47.789  25.961  48.242 1.00 56.95  ? 1523 GLU B CA  1 
ATOM   3717 C C   . GLU B 1 220 ? 46.666  25.131  48.843 1.00 56.07  ? 1523 GLU B C   1 
ATOM   3718 O O   . GLU B 1 220 ? 46.633  23.909  48.709 1.00 56.20  ? 1523 GLU B O   1 
ATOM   3719 C CB  . GLU B 1 220 ? 48.851  26.241  49.309 1.00 58.26  ? 1523 GLU B CB  1 
ATOM   3720 C CG  . GLU B 1 220 ? 50.267  26.395  48.775 1.00 61.98  ? 1523 GLU B CG  1 
ATOM   3721 C CD  . GLU B 1 220 ? 50.674  25.238  47.867 1.00 64.49  ? 1523 GLU B CD  1 
ATOM   3722 O OE1 . GLU B 1 220 ? 50.176  24.105  48.084 1.00 65.33  ? 1523 GLU B OE1 1 
ATOM   3723 O OE2 . GLU B 1 220 ? 51.495  25.460  46.945 1.00 64.75  ? 1523 GLU B OE2 1 
ATOM   3724 N N   . HIS B 1 221 ? 45.742  25.819  49.500 1.00 55.46  ? 1524 HIS B N   1 
ATOM   3725 C CA  . HIS B 1 221 ? 44.609  25.174  50.134 1.00 55.22  ? 1524 HIS B CA  1 
ATOM   3726 C C   . HIS B 1 221 ? 43.695  24.514  49.121 1.00 54.91  ? 1524 HIS B C   1 
ATOM   3727 O O   . HIS B 1 221 ? 43.340  23.346  49.271 1.00 54.27  ? 1524 HIS B O   1 
ATOM   3728 C CB  . HIS B 1 221 ? 43.810  26.189  50.951 1.00 56.03  ? 1524 HIS B CB  1 
ATOM   3729 C CG  . HIS B 1 221 ? 42.632  25.597  51.664 1.00 56.73  ? 1524 HIS B CG  1 
ATOM   3730 N ND1 . HIS B 1 221 ? 41.508  25.149  51.003 1.00 57.91  ? 1524 HIS B ND1 1 
ATOM   3731 C CD2 . HIS B 1 221 ? 42.411  25.360  52.980 1.00 56.70  ? 1524 HIS B CD2 1 
ATOM   3732 C CE1 . HIS B 1 221 ? 40.647  24.662  51.880 1.00 57.22  ? 1524 HIS B CE1 1 
ATOM   3733 N NE2 . HIS B 1 221 ? 41.171  24.777  53.087 1.00 55.35  ? 1524 HIS B NE2 1 
ATOM   3734 N N   . LEU B 1 222 ? 43.304  25.254  48.089 1.00 55.50  ? 1525 LEU B N   1 
ATOM   3735 C CA  . LEU B 1 222 ? 42.419  24.675  47.090 1.00 56.83  ? 1525 LEU B CA  1 
ATOM   3736 C C   . LEU B 1 222 ? 43.099  23.477  46.441 1.00 57.48  ? 1525 LEU B C   1 
ATOM   3737 O O   . LEU B 1 222 ? 42.468  22.438  46.232 1.00 57.19  ? 1525 LEU B O   1 
ATOM   3738 C CB  . LEU B 1 222 ? 42.040  25.703  46.018 1.00 56.98  ? 1525 LEU B CB  1 
ATOM   3739 C CG  . LEU B 1 222 ? 40.955  25.195  45.054 1.00 57.24  ? 1525 LEU B CG  1 
ATOM   3740 C CD1 . LEU B 1 222 ? 39.663  24.986  45.839 1.00 56.63  ? 1525 LEU B CD1 1 
ATOM   3741 C CD2 . LEU B 1 222 ? 40.740  26.174  43.897 1.00 56.20  ? 1525 LEU B CD2 1 
ATOM   3742 N N   . TYR B 1 223 ? 44.390  23.621  46.138 1.00 58.40  ? 1526 TYR B N   1 
ATOM   3743 C CA  . TYR B 1 223 ? 45.146  22.543  45.516 1.00 58.62  ? 1526 TYR B CA  1 
ATOM   3744 C C   . TYR B 1 223 ? 45.048  21.301  46.377 1.00 59.03  ? 1526 TYR B C   1 
ATOM   3745 O O   . TYR B 1 223 ? 45.062  20.168  45.885 1.00 58.78  ? 1526 TYR B O   1 
ATOM   3746 C CB  . TYR B 1 223 ? 46.610  22.936  45.342 1.00 58.98  ? 1526 TYR B CB  1 
ATOM   3747 C CG  . TYR B 1 223 ? 47.433  21.831  44.720 1.00 60.69  ? 1526 TYR B CG  1 
ATOM   3748 C CD1 . TYR B 1 223 ? 48.145  20.934  45.515 1.00 61.48  ? 1526 TYR B CD1 1 
ATOM   3749 C CD2 . TYR B 1 223 ? 47.458  21.645  43.336 1.00 60.70  ? 1526 TYR B CD2 1 
ATOM   3750 C CE1 . TYR B 1 223 ? 48.857  19.883  44.948 1.00 60.84  ? 1526 TYR B CE1 1 
ATOM   3751 C CE2 . TYR B 1 223 ? 48.164  20.597  42.766 1.00 60.38  ? 1526 TYR B CE2 1 
ATOM   3752 C CZ  . TYR B 1 223 ? 48.859  19.725  43.578 1.00 60.17  ? 1526 TYR B CZ  1 
ATOM   3753 O OH  . TYR B 1 223 ? 49.560  18.695  43.015 1.00 62.24  ? 1526 TYR B OH  1 
ATOM   3754 N N   . SER B 1 224 ? 44.943  21.531  47.676 1.00 60.36  ? 1527 SER B N   1 
ATOM   3755 C CA  . SER B 1 224 ? 44.827  20.457  48.637 1.00 61.59  ? 1527 SER B CA  1 
ATOM   3756 C C   . SER B 1 224 ? 43.481  19.746  48.545 1.00 62.72  ? 1527 SER B C   1 
ATOM   3757 O O   . SER B 1 224 ? 43.429  18.522  48.477 1.00 64.42  ? 1527 SER B O   1 
ATOM   3758 C CB  . SER B 1 224 ? 45.007  21.012  50.032 1.00 60.60  ? 1527 SER B CB  1 
ATOM   3759 O OG  . SER B 1 224 ? 44.353  20.171  50.958 1.00 64.92  ? 1527 SER B OG  1 
ATOM   3760 N N   . MET B 1 225 ? 42.397  20.516  48.558 1.00 64.00  ? 1528 MET B N   1 
ATOM   3761 C CA  . MET B 1 225 ? 41.047  19.961  48.476 1.00 64.91  ? 1528 MET B CA  1 
ATOM   3762 C C   . MET B 1 225 ? 40.860  19.236  47.149 1.00 66.35  ? 1528 MET B C   1 
ATOM   3763 O O   . MET B 1 225 ? 39.978  18.387  47.010 1.00 66.12  ? 1528 MET B O   1 
ATOM   3764 C CB  . MET B 1 225 ? 40.002  21.076  48.621 1.00 63.58  ? 1528 MET B CB  1 
ATOM   3765 C CG  . MET B 1 225 ? 40.115  21.874  49.917 1.00 61.08  ? 1528 MET B CG  1 
ATOM   3766 S SD  . MET B 1 225 ? 39.852  20.917  51.426 1.00 57.86  ? 1528 MET B SD  1 
ATOM   3767 C CE  . MET B 1 225 ? 41.480  20.252  51.764 1.00 59.77  ? 1528 MET B CE  1 
ATOM   3768 N N   . LYS B 1 226 ? 41.695  19.583  46.175 1.00 68.57  ? 1529 LYS B N   1 
ATOM   3769 C CA  . LYS B 1 226 ? 41.655  18.945  44.863 1.00 70.87  ? 1529 LYS B CA  1 
ATOM   3770 C C   . LYS B 1 226 ? 42.265  17.557  45.028 1.00 72.48  ? 1529 LYS B C   1 
ATOM   3771 O O   . LYS B 1 226 ? 41.755  16.572  44.498 1.00 72.68  ? 1529 LYS B O   1 
ATOM   3772 C CB  . LYS B 1 226 ? 42.473  19.760  43.850 1.00 70.90  ? 1529 LYS B CB  1 
ATOM   3773 C CG  . LYS B 1 226 ? 42.717  19.081  42.501 1.00 70.80  ? 1529 LYS B CG  1 
ATOM   3774 C CD  . LYS B 1 226 ? 43.650  19.916  41.622 1.00 70.58  ? 1529 LYS B CD  1 
ATOM   3775 C CE  . LYS B 1 226 ? 43.955  19.242  40.281 1.00 70.89  ? 1529 LYS B CE  1 
ATOM   3776 N NZ  . LYS B 1 226 ? 44.741  17.985  40.430 1.00 69.73  ? 1529 LYS B NZ  1 
ATOM   3777 N N   . CYS B 1 227 ? 43.360  17.492  45.779 1.00 73.76  ? 1530 CYS B N   1 
ATOM   3778 C CA  . CYS B 1 227 ? 44.041  16.234  46.022 1.00 75.28  ? 1530 CYS B CA  1 
ATOM   3779 C C   . CYS B 1 227 ? 43.244  15.312  46.942 1.00 76.23  ? 1530 CYS B C   1 
ATOM   3780 O O   . CYS B 1 227 ? 43.536  14.123  47.044 1.00 77.11  ? 1530 CYS B O   1 
ATOM   3781 C CB  . CYS B 1 227 ? 45.426  16.501  46.608 1.00 75.53  ? 1530 CYS B CB  1 
ATOM   3782 S SG  . CYS B 1 227 ? 46.581  17.187  45.410 1.00 76.13  ? 1530 CYS B SG  1 
ATOM   3783 N N   . LYS B 1 228 ? 42.243  15.861  47.618 1.00 77.27  ? 1531 LYS B N   1 
ATOM   3784 C CA  . LYS B 1 228 ? 41.407  15.068  48.509 1.00 78.22  ? 1531 LYS B CA  1 
ATOM   3785 C C   . LYS B 1 228 ? 40.063  14.815  47.838 1.00 78.47  ? 1531 LYS B C   1 
ATOM   3786 O O   . LYS B 1 228 ? 39.134  14.293  48.450 1.00 77.63  ? 1531 LYS B O   1 
ATOM   3787 C CB  . LYS B 1 228 ? 41.195  15.792  49.844 1.00 79.33  ? 1531 LYS B CB  1 
ATOM   3788 C CG  . LYS B 1 228 ? 42.423  15.824  50.754 1.00 81.08  ? 1531 LYS B CG  1 
ATOM   3789 C CD  . LYS B 1 228 ? 42.028  15.995  52.237 1.00 82.82  ? 1531 LYS B CD  1 
ATOM   3790 C CE  . LYS B 1 228 ? 43.196  15.662  53.183 1.00 82.73  ? 1531 LYS B CE  1 
ATOM   3791 N NZ  . LYS B 1 228 ? 42.810  15.636  54.627 1.00 81.55  ? 1531 LYS B NZ  1 
ATOM   3792 N N   . ASN B 1 229 ? 39.973  15.188  46.566 1.00 79.52  ? 1532 ASN B N   1 
ATOM   3793 C CA  . ASN B 1 229 ? 38.746  15.011  45.805 1.00 80.55  ? 1532 ASN B CA  1 
ATOM   3794 C C   . ASN B 1 229 ? 37.556  15.504  46.625 1.00 80.43  ? 1532 ASN B C   1 
ATOM   3795 O O   . ASN B 1 229 ? 36.659  14.740  46.971 1.00 79.68  ? 1532 ASN B O   1 
ATOM   3796 C CB  . ASN B 1 229 ? 38.576  13.538  45.439 1.00 81.94  ? 1532 ASN B CB  1 
ATOM   3797 C CG  . ASN B 1 229 ? 39.698  13.021  44.542 1.00 83.07  ? 1532 ASN B CG  1 
ATOM   3798 O OD1 . ASN B 1 229 ? 39.719  13.278  43.334 1.00 83.13  ? 1532 ASN B OD1 1 
ATOM   3799 N ND2 . ASN B 1 229 ? 40.642  12.293  45.134 1.00 83.13  ? 1532 ASN B ND2 1 
ATOM   3800 N N   . VAL B 1 230 ? 37.573  16.794  46.940 1.00 80.96  ? 1533 VAL B N   1 
ATOM   3801 C CA  . VAL B 1 230 ? 36.514  17.428  47.718 1.00 81.45  ? 1533 VAL B CA  1 
ATOM   3802 C C   . VAL B 1 230 ? 35.929  18.541  46.844 1.00 82.21  ? 1533 VAL B C   1 
ATOM   3803 O O   . VAL B 1 230 ? 34.785  18.978  47.010 1.00 81.30  ? 1533 VAL B O   1 
ATOM   3804 C CB  . VAL B 1 230 ? 37.088  18.052  49.012 1.00 81.01  ? 1533 VAL B CB  1 
ATOM   3805 C CG1 . VAL B 1 230 ? 35.969  18.439  49.952 1.00 79.99  ? 1533 VAL B CG1 1 
ATOM   3806 C CG2 . VAL B 1 230 ? 38.038  17.083  49.679 1.00 81.00  ? 1533 VAL B CG2 1 
ATOM   3807 N N   . VAL B 1 231 ? 36.742  18.984  45.897 1.00 83.11  ? 1534 VAL B N   1 
ATOM   3808 C CA  . VAL B 1 231 ? 36.362  20.043  44.985 1.00 84.48  ? 1534 VAL B CA  1 
ATOM   3809 C C   . VAL B 1 231 ? 35.787  19.491  43.689 1.00 84.48  ? 1534 VAL B C   1 
ATOM   3810 O O   . VAL B 1 231 ? 36.349  18.575  43.085 1.00 83.79  ? 1534 VAL B O   1 
ATOM   3811 C CB  . VAL B 1 231 ? 37.587  20.931  44.650 1.00 85.86  ? 1534 VAL B CB  1 
ATOM   3812 C CG1 . VAL B 1 231 ? 38.761  20.048  44.257 1.00 87.05  ? 1534 VAL B CG1 1 
ATOM   3813 C CG2 . VAL B 1 231 ? 37.254  21.901  43.510 1.00 85.73  ? 1534 VAL B CG2 1 
ATOM   3814 N N   . PRO B 1 232 ? 34.645  20.042  43.251 1.00 84.57  ? 1535 PRO B N   1 
ATOM   3815 C CA  . PRO B 1 232 ? 33.996  19.607  42.014 1.00 84.81  ? 1535 PRO B CA  1 
ATOM   3816 C C   . PRO B 1 232 ? 34.943  19.814  40.837 1.00 85.40  ? 1535 PRO B C   1 
ATOM   3817 O O   . PRO B 1 232 ? 36.036  20.377  40.989 1.00 85.28  ? 1535 PRO B O   1 
ATOM   3818 C CB  . PRO B 1 232 ? 32.775  20.514  41.929 1.00 84.57  ? 1535 PRO B CB  1 
ATOM   3819 C CG  . PRO B 1 232 ? 32.439  20.748  43.364 1.00 84.72  ? 1535 PRO B CG  1 
ATOM   3820 C CD  . PRO B 1 232 ? 33.794  20.997  43.980 1.00 84.49  ? 1535 PRO B CD  1 
ATOM   3821 N N   . LEU B 1 233 ? 34.515  19.376  39.659 1.00 85.73  ? 1536 LEU B N   1 
ATOM   3822 C CA  . LEU B 1 233 ? 35.350  19.501  38.472 1.00 85.42  ? 1536 LEU B CA  1 
ATOM   3823 C C   . LEU B 1 233 ? 35.079  20.753  37.642 1.00 84.17  ? 1536 LEU B C   1 
ATOM   3824 O O   . LEU B 1 233 ? 35.035  20.685  36.415 1.00 83.68  ? 1536 LEU B O   1 
ATOM   3825 C CB  . LEU B 1 233 ? 35.200  18.249  37.592 1.00 86.12  ? 1536 LEU B CB  1 
ATOM   3826 C CG  . LEU B 1 233 ? 35.622  16.899  38.195 1.00 85.83  ? 1536 LEU B CG  1 
ATOM   3827 C CD1 . LEU B 1 233 ? 34.613  16.459  39.253 1.00 84.63  ? 1536 LEU B CD1 1 
ATOM   3828 C CD2 . LEU B 1 233 ? 35.718  15.856  37.088 1.00 85.37  ? 1536 LEU B CD2 1 
ATOM   3829 N N   . TYR B 1 234 ? 34.900  21.892  38.306 1.00 82.92  ? 1537 TYR B N   1 
ATOM   3830 C CA  . TYR B 1 234 ? 34.656  23.144  37.594 1.00 81.53  ? 1537 TYR B CA  1 
ATOM   3831 C C   . TYR B 1 234 ? 35.951  23.478  36.866 1.00 79.59  ? 1537 TYR B C   1 
ATOM   3832 O O   . TYR B 1 234 ? 36.929  23.880  37.486 1.00 78.98  ? 1537 TYR B O   1 
ATOM   3833 C CB  . TYR B 1 234 ? 34.307  24.268  38.578 1.00 83.54  ? 1537 TYR B CB  1 
ATOM   3834 C CG  . TYR B 1 234 ? 33.084  24.006  39.432 1.00 85.73  ? 1537 TYR B CG  1 
ATOM   3835 C CD1 . TYR B 1 234 ? 33.022  24.475  40.743 1.00 86.82  ? 1537 TYR B CD1 1 
ATOM   3836 C CD2 . TYR B 1 234 ? 32.000  23.267  38.945 1.00 87.20  ? 1537 TYR B CD2 1 
ATOM   3837 C CE1 . TYR B 1 234 ? 31.917  24.208  41.560 1.00 87.56  ? 1537 TYR B CE1 1 
ATOM   3838 C CE2 . TYR B 1 234 ? 30.884  22.998  39.755 1.00 87.90  ? 1537 TYR B CE2 1 
ATOM   3839 C CZ  . TYR B 1 234 ? 30.856  23.472  41.065 1.00 87.85  ? 1537 TYR B CZ  1 
ATOM   3840 O OH  . TYR B 1 234 ? 29.785  23.204  41.891 1.00 87.95  ? 1537 TYR B OH  1 
ATOM   3841 N N   . ASP B 1 235 ? 35.956  23.304  35.550 1.00 77.92  ? 1538 ASP B N   1 
ATOM   3842 C CA  . ASP B 1 235 ? 37.149  23.559  34.750 1.00 76.11  ? 1538 ASP B CA  1 
ATOM   3843 C C   . ASP B 1 235 ? 37.630  25.013  34.654 1.00 73.96  ? 1538 ASP B C   1 
ATOM   3844 O O   . ASP B 1 235 ? 38.834  25.258  34.571 1.00 73.43  ? 1538 ASP B O   1 
ATOM   3845 C CB  . ASP B 1 235 ? 36.991  22.944  33.342 1.00 77.50  ? 1538 ASP B CB  1 
ATOM   3846 C CG  . ASP B 1 235 ? 35.534  22.878  32.864 1.00 79.56  ? 1538 ASP B CG  1 
ATOM   3847 O OD1 . ASP B 1 235 ? 35.314  22.362  31.739 1.00 79.48  ? 1538 ASP B OD1 1 
ATOM   3848 O OD2 . ASP B 1 235 ? 34.615  23.330  33.593 1.00 80.48  ? 1538 ASP B OD2 1 
ATOM   3849 N N   . LEU B 1 236 ? 36.713  25.976  34.667 1.00 71.82  ? 1539 LEU B N   1 
ATOM   3850 C CA  . LEU B 1 236 ? 37.111  27.383  34.598 1.00 69.64  ? 1539 LEU B CA  1 
ATOM   3851 C C   . LEU B 1 236 ? 38.004  27.683  35.796 1.00 67.82  ? 1539 LEU B C   1 
ATOM   3852 O O   . LEU B 1 236 ? 39.004  28.392  35.676 1.00 67.73  ? 1539 LEU B O   1 
ATOM   3853 C CB  . LEU B 1 236 ? 35.874  28.297  34.616 1.00 70.76  ? 1539 LEU B CB  1 
ATOM   3854 C CG  . LEU B 1 236 ? 35.995  29.835  34.512 1.00 70.85  ? 1539 LEU B CG  1 
ATOM   3855 C CD1 . LEU B 1 236 ? 36.373  30.441  35.856 1.00 70.74  ? 1539 LEU B CD1 1 
ATOM   3856 C CD2 . LEU B 1 236 ? 37.006  30.212  33.442 1.00 68.48  ? 1539 LEU B CD2 1 
ATOM   3857 N N   . LEU B 1 237 ? 37.627  27.126  36.948 1.00 65.22  ? 1540 LEU B N   1 
ATOM   3858 C CA  . LEU B 1 237 ? 38.366  27.289  38.198 1.00 62.12  ? 1540 LEU B CA  1 
ATOM   3859 C C   . LEU B 1 237 ? 39.589  26.363  38.226 1.00 60.89  ? 1540 LEU B C   1 
ATOM   3860 O O   . LEU B 1 237 ? 40.634  26.723  38.742 1.00 60.09  ? 1540 LEU B O   1 
ATOM   3861 C CB  . LEU B 1 237 ? 37.446  26.969  39.386 1.00 60.35  ? 1540 LEU B CB  1 
ATOM   3862 C CG  . LEU B 1 237 ? 37.985  27.094  40.819 1.00 59.10  ? 1540 LEU B CG  1 
ATOM   3863 C CD1 . LEU B 1 237 ? 38.131  28.565  41.197 1.00 58.39  ? 1540 LEU B CD1 1 
ATOM   3864 C CD2 . LEU B 1 237 ? 37.041  26.400  41.782 1.00 55.74  ? 1540 LEU B CD2 1 
ATOM   3865 N N   . LEU B 1 238 ? 39.451  25.169  37.667 1.00 61.05  ? 1541 LEU B N   1 
ATOM   3866 C CA  . LEU B 1 238 ? 40.544  24.208  37.640 1.00 61.80  ? 1541 LEU B CA  1 
ATOM   3867 C C   . LEU B 1 238 ? 41.680  24.781  36.804 1.00 62.73  ? 1541 LEU B C   1 
ATOM   3868 O O   . LEU B 1 238 ? 42.856  24.547  37.087 1.00 62.92  ? 1541 LEU B O   1 
ATOM   3869 C CB  . LEU B 1 238 ? 40.069  22.883  37.033 1.00 61.72  ? 1541 LEU B CB  1 
ATOM   3870 C CG  . LEU B 1 238 ? 40.438  21.578  37.751 1.00 62.82  ? 1541 LEU B CG  1 
ATOM   3871 C CD1 . LEU B 1 238 ? 41.952  21.507  37.973 1.00 63.12  ? 1541 LEU B CD1 1 
ATOM   3872 C CD2 . LEU B 1 238 ? 39.687  21.493  39.080 1.00 62.69  ? 1541 LEU B CD2 1 
ATOM   3873 N N   . GLU B 1 239 ? 41.311  25.534  35.771 1.00 63.41  ? 1542 GLU B N   1 
ATOM   3874 C CA  . GLU B 1 239 ? 42.262  26.172  34.862 1.00 64.18  ? 1542 GLU B CA  1 
ATOM   3875 C C   . GLU B 1 239 ? 43.134  27.196  35.604 1.00 63.66  ? 1542 GLU B C   1 
ATOM   3876 O O   . GLU B 1 239 ? 44.367  27.144  35.554 1.00 63.32  ? 1542 GLU B O   1 
ATOM   3877 C CB  . GLU B 1 239 ? 41.482  26.853  33.719 1.00 66.40  ? 1542 GLU B CB  1 
ATOM   3878 C CG  . GLU B 1 239 ? 42.288  27.784  32.796 1.00 67.96  ? 1542 GLU B CG  1 
ATOM   3879 C CD  . GLU B 1 239 ? 41.437  28.397  31.676 1.00 69.76  ? 1542 GLU B CD  1 
ATOM   3880 O OE1 . GLU B 1 239 ? 41.948  29.279  30.956 1.00 72.50  ? 1542 GLU B OE1 1 
ATOM   3881 O OE2 . GLU B 1 239 ? 40.261  28.002  31.504 1.00 69.98  ? 1542 GLU B OE2 1 
ATOM   3882 N N   . MET B 1 240 ? 42.482  28.123  36.293 1.00 62.14  ? 1543 MET B N   1 
ATOM   3883 C CA  . MET B 1 240 ? 43.182  29.150  37.042 1.00 61.81  ? 1543 MET B CA  1 
ATOM   3884 C C   . MET B 1 240 ? 44.096  28.548  38.096 1.00 61.88  ? 1543 MET B C   1 
ATOM   3885 O O   . MET B 1 240 ? 45.141  29.115  38.410 1.00 62.14  ? 1543 MET B O   1 
ATOM   3886 C CB  . MET B 1 240 ? 42.177  30.074  37.731 1.00 61.58  ? 1543 MET B CB  1 
ATOM   3887 C CG  . MET B 1 240 ? 41.312  30.861  36.780 1.00 60.28  ? 1543 MET B CG  1 
ATOM   3888 S SD  . MET B 1 240 ? 42.306  31.905  35.709 1.00 57.84  ? 1543 MET B SD  1 
ATOM   3889 C CE  . MET B 1 240 ? 42.530  30.823  34.313 1.00 60.65  ? 1543 MET B CE  1 
ATOM   3890 N N   . LEU B 1 241 ? 43.692  27.408  38.646 1.00 61.82  ? 1544 LEU B N   1 
ATOM   3891 C CA  . LEU B 1 241 ? 44.466  26.743  39.685 1.00 62.04  ? 1544 LEU B CA  1 
ATOM   3892 C C   . LEU B 1 241 ? 45.683  26.041  39.116 1.00 62.98  ? 1544 LEU B C   1 
ATOM   3893 O O   . LEU B 1 241 ? 46.786  26.128  39.668 1.00 62.53  ? 1544 LEU B O   1 
ATOM   3894 C CB  . LEU B 1 241 ? 43.597  25.729  40.427 1.00 61.96  ? 1544 LEU B CB  1 
ATOM   3895 C CG  . LEU B 1 241 ? 44.225  25.095  41.673 1.00 62.03  ? 1544 LEU B CG  1 
ATOM   3896 C CD1 . LEU B 1 241 ? 44.628  26.184  42.660 1.00 62.86  ? 1544 LEU B CD1 1 
ATOM   3897 C CD2 . LEU B 1 241 ? 43.237  24.133  42.315 1.00 61.90  ? 1544 LEU B CD2 1 
ATOM   3898 N N   . ASP B 1 242 ? 45.492  25.333  38.012 1.00 63.34  ? 1545 ASP B N   1 
ATOM   3899 C CA  . ASP B 1 242 ? 46.616  24.641  37.418 1.00 64.60  ? 1545 ASP B CA  1 
ATOM   3900 C C   . ASP B 1 242 ? 47.585  25.656  36.833 1.00 64.13  ? 1545 ASP B C   1 
ATOM   3901 O O   . ASP B 1 242 ? 48.729  25.339  36.519 1.00 64.87  ? 1545 ASP B O   1 
ATOM   3902 C CB  . ASP B 1 242 ? 46.129  23.656  36.356 1.00 66.30  ? 1545 ASP B CB  1 
ATOM   3903 C CG  . ASP B 1 242 ? 45.648  22.335  36.961 1.00 69.25  ? 1545 ASP B CG  1 
ATOM   3904 O OD1 . ASP B 1 242 ? 45.198  21.464  36.187 1.00 72.12  ? 1545 ASP B OD1 1 
ATOM   3905 O OD2 . ASP B 1 242 ? 45.719  22.159  38.203 1.00 69.14  ? 1545 ASP B OD2 1 
ATOM   3906 N N   . ALA B 1 243 ? 47.127  26.893  36.716 1.00 63.58  ? 1546 ALA B N   1 
ATOM   3907 C CA  . ALA B 1 243 ? 47.953  27.958  36.175 1.00 62.44  ? 1546 ALA B CA  1 
ATOM   3908 C C   . ALA B 1 243 ? 49.036  28.379  37.158 1.00 62.27  ? 1546 ALA B C   1 
ATOM   3909 O O   . ALA B 1 243 ? 49.963  29.096  36.789 1.00 61.72  ? 1546 ALA B O   1 
ATOM   3910 C CB  . ALA B 1 243 ? 47.082  29.156  35.822 1.00 62.34  ? 1546 ALA B CB  1 
ATOM   3911 N N   . HIS B 1 244 ? 48.909  27.947  38.409 1.00 63.25  ? 1547 HIS B N   1 
ATOM   3912 C CA  . HIS B 1 244 ? 49.883  28.319  39.422 1.00 65.74  ? 1547 HIS B CA  1 
ATOM   3913 C C   . HIS B 1 244 ? 50.967  27.307  39.707 1.00 67.91  ? 1547 HIS B C   1 
ATOM   3914 O O   . HIS B 1 244 ? 51.799  27.518  40.592 1.00 67.20  ? 1547 HIS B O   1 
ATOM   3915 C CB  . HIS B 1 244 ? 49.185  28.699  40.717 1.00 66.06  ? 1547 HIS B CB  1 
ATOM   3916 C CG  . HIS B 1 244 ? 48.782  30.135  40.768 1.00 67.32  ? 1547 HIS B CG  1 
ATOM   3917 N ND1 . HIS B 1 244 ? 47.757  30.648  40.004 1.00 67.58  ? 1547 HIS B ND1 1 
ATOM   3918 C CD2 . HIS B 1 244 ? 49.310  31.183  41.442 1.00 67.82  ? 1547 HIS B CD2 1 
ATOM   3919 C CE1 . HIS B 1 244 ? 47.673  31.950  40.203 1.00 67.86  ? 1547 HIS B CE1 1 
ATOM   3920 N NE2 . HIS B 1 244 ? 48.604  32.301  41.070 1.00 68.50  ? 1547 HIS B NE2 1 
ATOM   3921 N N   . ARG B 1 245 ? 50.946  26.207  38.961 1.00 71.56  ? 1548 ARG B N   1 
ATOM   3922 C CA  . ARG B 1 245 ? 51.952  25.153  39.078 1.00 74.50  ? 1548 ARG B CA  1 
ATOM   3923 C C   . ARG B 1 245 ? 52.434  24.858  40.516 1.00 76.08  ? 1548 ARG B C   1 
ATOM   3924 O O   . ARG B 1 245 ? 53.536  25.268  40.906 1.00 76.60  ? 1548 ARG B O   1 
ATOM   3925 C CB  . ARG B 1 245 ? 53.151  25.520  38.180 1.00 75.39  ? 1548 ARG B CB  1 
ATOM   3926 C CG  . ARG B 1 245 ? 52.766  25.865  36.724 1.00 75.28  ? 1548 ARG B CG  1 
ATOM   3927 C CD  . ARG B 1 245 ? 53.990  26.053  35.822 1.00 76.01  ? 1548 ARG B CD  1 
ATOM   3928 N NE  . ARG B 1 245 ? 53.676  25.775  34.416 1.00 77.63  ? 1548 ARG B NE  1 
ATOM   3929 C CZ  . ARG B 1 245 ? 54.568  25.777  33.421 1.00 77.57  ? 1548 ARG B CZ  1 
ATOM   3930 N NH1 . ARG B 1 245 ? 55.846  26.047  33.669 1.00 77.37  ? 1548 ARG B NH1 1 
ATOM   3931 N NH2 . ARG B 1 245 ? 54.187  25.494  32.177 1.00 74.66  ? 1548 ARG B NH2 1 
ATOM   3932 N N   . LEU B 1 246 ? 51.613  24.140  41.288 1.00 76.52  ? 1549 LEU B N   1 
ATOM   3933 C CA  . LEU B 1 246 ? 51.948  23.785  42.674 1.00 76.72  ? 1549 LEU B CA  1 
ATOM   3934 C C   . LEU B 1 246 ? 52.459  22.335  42.804 1.00 77.58  ? 1549 LEU B C   1 
ATOM   3935 O O   . LEU B 1 246 ? 51.984  21.606  43.709 1.00 77.35  ? 1549 LEU B O   1 
ATOM   3936 C CB  . LEU B 1 246 ? 50.717  23.991  43.578 1.00 75.68  ? 1549 LEU B CB  1 
ATOM   3937 C CG  . LEU B 1 246 ? 50.377  25.376  44.152 1.00 73.84  ? 1549 LEU B CG  1 
ATOM   3938 C CD1 . LEU B 1 246 ? 50.773  26.475  43.198 1.00 73.61  ? 1549 LEU B CD1 1 
ATOM   3939 C CD2 . LEU B 1 246 ? 48.896  25.437  44.452 1.00 72.30  ? 1549 LEU B CD2 1 
ATOM   3940 N N   . ASN C 1 1   ? 54.461  56.859  72.389 1.00 90.25  ? 2304 ASN C N   1 
ATOM   3941 C CA  . ASN C 1 1   ? 54.730  55.984  73.569 1.00 90.37  ? 2304 ASN C CA  1 
ATOM   3942 C C   . ASN C 1 1   ? 56.182  55.523  73.648 1.00 90.33  ? 2304 ASN C C   1 
ATOM   3943 O O   . ASN C 1 1   ? 56.600  54.953  74.660 1.00 90.37  ? 2304 ASN C O   1 
ATOM   3944 C CB  . ASN C 1 1   ? 53.813  54.757  73.541 1.00 90.04  ? 2304 ASN C CB  1 
ATOM   3945 C CG  . ASN C 1 1   ? 52.371  55.103  73.852 1.00 89.85  ? 2304 ASN C CG  1 
ATOM   3946 O OD1 . ASN C 1 1   ? 51.752  55.912  73.157 1.00 90.17  ? 2304 ASN C OD1 1 
ATOM   3947 N ND2 . ASN C 1 1   ? 51.827  54.492  74.901 1.00 88.29  ? 2304 ASN C ND2 1 
ATOM   3948 N N   . SER C 1 2   ? 56.945  55.768  72.583 1.00 89.88  ? 2305 SER C N   1 
ATOM   3949 C CA  . SER C 1 2   ? 58.354  55.380  72.544 1.00 88.85  ? 2305 SER C CA  1 
ATOM   3950 C C   . SER C 1 2   ? 59.159  56.171  71.509 1.00 88.08  ? 2305 SER C C   1 
ATOM   3951 O O   . SER C 1 2   ? 58.603  56.709  70.553 1.00 87.77  ? 2305 SER C O   1 
ATOM   3952 C CB  . SER C 1 2   ? 58.476  53.883  72.256 1.00 88.75  ? 2305 SER C CB  1 
ATOM   3953 O OG  . SER C 1 2   ? 59.834  53.478  72.257 1.00 89.28  ? 2305 SER C OG  1 
ATOM   3954 N N   . LEU C 1 3   ? 60.474  56.225  71.710 1.00 87.73  ? 2306 LEU C N   1 
ATOM   3955 C CA  . LEU C 1 3   ? 61.386  56.952  70.822 1.00 87.60  ? 2306 LEU C CA  1 
ATOM   3956 C C   . LEU C 1 3   ? 61.032  56.812  69.352 1.00 87.01  ? 2306 LEU C C   1 
ATOM   3957 O O   . LEU C 1 3   ? 61.138  57.762  68.584 1.00 86.60  ? 2306 LEU C O   1 
ATOM   3958 C CB  . LEU C 1 3   ? 62.835  56.478  71.034 1.00 87.82  ? 2306 LEU C CB  1 
ATOM   3959 C CG  . LEU C 1 3   ? 63.287  55.094  70.535 1.00 86.98  ? 2306 LEU C CG  1 
ATOM   3960 C CD1 . LEU C 1 3   ? 63.558  55.126  69.030 1.00 85.91  ? 2306 LEU C CD1 1 
ATOM   3961 C CD2 . LEU C 1 3   ? 64.555  54.690  71.275 1.00 86.02  ? 2306 LEU C CD2 1 
ATOM   3962 N N   . ALA C 1 4   ? 60.618  55.615  68.968 1.00 87.35  ? 2307 ALA C N   1 
ATOM   3963 C CA  . ALA C 1 4   ? 60.270  55.343  67.589 1.00 88.13  ? 2307 ALA C CA  1 
ATOM   3964 C C   . ALA C 1 4   ? 59.439  56.455  66.966 1.00 88.86  ? 2307 ALA C C   1 
ATOM   3965 O O   . ALA C 1 4   ? 59.854  57.060  65.980 1.00 89.40  ? 2307 ALA C O   1 
ATOM   3966 C CB  . ALA C 1 4   ? 59.528  54.026  67.496 1.00 88.56  ? 2307 ALA C CB  1 
ATOM   3967 N N   . LEU C 1 5   ? 58.275  56.732  67.547 1.00 89.36  ? 2308 LEU C N   1 
ATOM   3968 C CA  . LEU C 1 5   ? 57.376  57.757  67.013 1.00 89.95  ? 2308 LEU C CA  1 
ATOM   3969 C C   . LEU C 1 5   ? 57.751  59.215  67.301 1.00 89.93  ? 2308 LEU C C   1 
ATOM   3970 O O   . LEU C 1 5   ? 56.974  60.133  67.015 1.00 89.23  ? 2308 LEU C O   1 
ATOM   3971 C CB  . LEU C 1 5   ? 55.941  57.483  67.490 1.00 90.13  ? 2308 LEU C CB  1 
ATOM   3972 C CG  . LEU C 1 5   ? 55.677  57.073  68.946 1.00 90.63  ? 2308 LEU C CG  1 
ATOM   3973 C CD1 . LEU C 1 5   ? 56.165  58.140  69.925 1.00 90.06  ? 2308 LEU C CD1 1 
ATOM   3974 C CD2 . LEU C 1 5   ? 54.184  56.839  69.118 1.00 90.72  ? 2308 LEU C CD2 1 
ATOM   3975 N N   . SER C 1 6   ? 58.949  59.426  67.838 1.00 90.30  ? 2309 SER C N   1 
ATOM   3976 C CA  . SER C 1 6   ? 59.425  60.767  68.178 1.00 90.71  ? 2309 SER C CA  1 
ATOM   3977 C C   . SER C 1 6   ? 60.708  61.104  67.435 1.00 90.80  ? 2309 SER C C   1 
ATOM   3978 O O   . SER C 1 6   ? 61.323  62.144  67.665 1.00 91.14  ? 2309 SER C O   1 
ATOM   3979 C CB  . SER C 1 6   ? 59.696  60.847  69.675 1.00 90.54  ? 2309 SER C CB  1 
ATOM   3980 O OG  . SER C 1 6   ? 60.773  59.990  70.018 1.00 89.31  ? 2309 SER C OG  1 
ATOM   3981 N N   . LEU C 1 7   ? 61.107  60.200  66.556 1.00 90.93  ? 2310 LEU C N   1 
ATOM   3982 C CA  . LEU C 1 7   ? 62.323  60.346  65.771 1.00 90.91  ? 2310 LEU C CA  1 
ATOM   3983 C C   . LEU C 1 7   ? 62.173  61.269  64.570 1.00 91.40  ? 2310 LEU C C   1 
ATOM   3984 O O   . LEU C 1 7   ? 61.155  61.248  63.872 1.00 90.71  ? 2310 LEU C O   1 
ATOM   3985 C CB  . LEU C 1 7   ? 62.794  58.968  65.303 1.00 89.95  ? 2310 LEU C CB  1 
ATOM   3986 C CG  . LEU C 1 7   ? 63.527  58.150  66.365 1.00 89.25  ? 2310 LEU C CG  1 
ATOM   3987 C CD1 . LEU C 1 7   ? 63.470  56.671  66.041 1.00 89.32  ? 2310 LEU C CD1 1 
ATOM   3988 C CD2 . LEU C 1 7   ? 64.960  58.637  66.442 1.00 89.93  ? 2310 LEU C CD2 1 
ATOM   3989 N N   . THR C 1 8   ? 63.195  62.087  64.340 1.00 92.15  ? 2311 THR C N   1 
ATOM   3990 C CA  . THR C 1 8   ? 63.185  63.000  63.204 1.00 92.31  ? 2311 THR C CA  1 
ATOM   3991 C C   . THR C 1 8   ? 63.274  62.136  61.956 1.00 92.41  ? 2311 THR C C   1 
ATOM   3992 O O   . THR C 1 8   ? 63.975  61.119  61.940 1.00 92.32  ? 2311 THR C O   1 
ATOM   3993 C CB  . THR C 1 8   ? 64.396  63.960  63.219 1.00 92.26  ? 2311 THR C CB  1 
ATOM   3994 O OG1 . THR C 1 8   ? 65.601  63.223  62.976 1.00 90.71  ? 2311 THR C OG1 1 
ATOM   3995 C CG2 . THR C 1 8   ? 64.497  64.662  64.561 1.00 92.26  ? 2311 THR C CG2 1 
ATOM   3996 N N   . ALA C 1 9   ? 62.561  62.540  60.913 1.00 92.13  ? 2312 ALA C N   1 
ATOM   3997 C CA  . ALA C 1 9   ? 62.561  61.794  59.668 1.00 92.94  ? 2312 ALA C CA  1 
ATOM   3998 C C   . ALA C 1 9   ? 63.969  61.366  59.242 1.00 93.84  ? 2312 ALA C C   1 
ATOM   3999 O O   . ALA C 1 9   ? 64.134  60.392  58.506 1.00 93.96  ? 2312 ALA C O   1 
ATOM   4000 C CB  . ALA C 1 9   ? 61.919  62.626  58.579 1.00 92.48  ? 2312 ALA C CB  1 
ATOM   4001 N N   . ASP C 1 10  ? 64.986  62.074  59.724 1.00 94.92  ? 2313 ASP C N   1 
ATOM   4002 C CA  . ASP C 1 10  ? 66.367  61.770  59.345 1.00 94.90  ? 2313 ASP C CA  1 
ATOM   4003 C C   . ASP C 1 10  ? 67.118  60.831  60.286 1.00 94.39  ? 2313 ASP C C   1 
ATOM   4004 O O   . ASP C 1 10  ? 68.022  60.107  59.856 1.00 93.79  ? 2313 ASP C O   1 
ATOM   4005 C CB  . ASP C 1 10  ? 67.132  63.079  59.181 1.00 95.52  ? 2313 ASP C CB  1 
ATOM   4006 C CG  . ASP C 1 10  ? 66.333  64.113  58.409 1.00 95.92  ? 2313 ASP C CG  1 
ATOM   4007 O OD1 . ASP C 1 10  ? 65.912  63.814  57.269 1.00 95.07  ? 2313 ASP C OD1 1 
ATOM   4008 O OD2 . ASP C 1 10  ? 66.120  65.220  58.950 1.00 96.12  ? 2313 ASP C OD2 1 
ATOM   4009 N N   . GLN C 1 11  ? 66.765  60.856  61.569 1.00 94.06  ? 2314 GLN C N   1 
ATOM   4010 C CA  . GLN C 1 11  ? 67.399  59.965  62.536 1.00 93.32  ? 2314 GLN C CA  1 
ATOM   4011 C C   . GLN C 1 11  ? 66.893  58.590  62.156 1.00 92.32  ? 2314 GLN C C   1 
ATOM   4012 O O   . GLN C 1 11  ? 67.607  57.592  62.238 1.00 91.15  ? 2314 GLN C O   1 
ATOM   4013 C CB  . GLN C 1 11  ? 66.960  60.310  63.958 1.00 93.42  ? 2314 GLN C CB  1 
ATOM   4014 C CG  . GLN C 1 11  ? 67.336  61.717  64.384 1.00 93.68  ? 2314 GLN C CG  1 
ATOM   4015 C CD  . GLN C 1 11  ? 67.004  61.998  65.830 1.00 93.27  ? 2314 GLN C CD  1 
ATOM   4016 O OE1 . GLN C 1 11  ? 67.636  61.459  66.744 1.00 93.81  ? 2314 GLN C OE1 1 
ATOM   4017 N NE2 . GLN C 1 11  ? 66.005  62.842  66.050 1.00 92.08  ? 2314 GLN C NE2 1 
ATOM   4018 N N   . MET C 1 12  ? 65.635  58.575  61.729 1.00 91.57  ? 2315 MET C N   1 
ATOM   4019 C CA  . MET C 1 12  ? 64.972  57.367  61.284 1.00 90.61  ? 2315 MET C CA  1 
ATOM   4020 C C   . MET C 1 12  ? 65.908  56.651  60.317 1.00 89.31  ? 2315 MET C C   1 
ATOM   4021 O O   . MET C 1 12  ? 66.254  55.486  60.507 1.00 88.78  ? 2315 MET C O   1 
ATOM   4022 C CB  . MET C 1 12  ? 63.669  57.735  60.566 1.00 91.25  ? 2315 MET C CB  1 
ATOM   4023 C CG  . MET C 1 12  ? 62.932  56.554  59.973 1.00 92.12  ? 2315 MET C CG  1 
ATOM   4024 S SD  . MET C 1 12  ? 62.384  55.410  61.247 1.00 94.72  ? 2315 MET C SD  1 
ATOM   4025 C CE  . MET C 1 12  ? 60.614  55.675  61.226 1.00 92.78  ? 2315 MET C CE  1 
ATOM   4026 N N   . VAL C 1 13  ? 66.320  57.378  59.284 1.00 87.89  ? 2316 VAL C N   1 
ATOM   4027 C CA  . VAL C 1 13  ? 67.214  56.851  58.262 1.00 86.38  ? 2316 VAL C CA  1 
ATOM   4028 C C   . VAL C 1 13  ? 68.540  56.362  58.843 1.00 86.00  ? 2316 VAL C C   1 
ATOM   4029 O O   . VAL C 1 13  ? 68.858  55.171  58.778 1.00 85.55  ? 2316 VAL C O   1 
ATOM   4030 C CB  . VAL C 1 13  ? 67.519  57.926  57.196 1.00 85.99  ? 2316 VAL C CB  1 
ATOM   4031 C CG1 . VAL C 1 13  ? 68.397  57.342  56.096 1.00 85.80  ? 2316 VAL C CG1 1 
ATOM   4032 C CG2 . VAL C 1 13  ? 66.223  58.469  56.623 1.00 85.49  ? 2316 VAL C CG2 1 
ATOM   4033 N N   . SER C 1 14  ? 69.312  57.289  59.407 1.00 85.28  ? 2317 SER C N   1 
ATOM   4034 C CA  . SER C 1 14  ? 70.609  56.965  59.989 1.00 83.63  ? 2317 SER C CA  1 
ATOM   4035 C C   . SER C 1 14  ? 70.473  55.913  61.086 1.00 82.32  ? 2317 SER C C   1 
ATOM   4036 O O   . SER C 1 14  ? 71.467  55.383  61.586 1.00 81.12  ? 2317 SER C O   1 
ATOM   4037 C CB  . SER C 1 14  ? 71.258  58.230  60.552 1.00 83.99  ? 2317 SER C CB  1 
ATOM   4038 O OG  . SER C 1 14  ? 72.581  57.967  60.983 1.00 85.23  ? 2317 SER C OG  1 
ATOM   4039 N N   . ALA C 1 15  ? 69.230  55.621  61.453 1.00 81.22  ? 2318 ALA C N   1 
ATOM   4040 C CA  . ALA C 1 15  ? 68.939  54.626  62.475 1.00 79.96  ? 2318 ALA C CA  1 
ATOM   4041 C C   . ALA C 1 15  ? 68.919  53.236  61.835 1.00 79.32  ? 2318 ALA C C   1 
ATOM   4042 O O   . ALA C 1 15  ? 69.607  52.319  62.287 1.00 79.66  ? 2318 ALA C O   1 
ATOM   4043 C CB  . ALA C 1 15  ? 67.597  54.925  63.119 1.00 79.16  ? 2318 ALA C CB  1 
ATOM   4044 N N   . LEU C 1 16  ? 68.123  53.093  60.779 1.00 77.42  ? 2319 LEU C N   1 
ATOM   4045 C CA  . LEU C 1 16  ? 68.006  51.830  60.066 1.00 75.51  ? 2319 LEU C CA  1 
ATOM   4046 C C   . LEU C 1 16  ? 69.332  51.524  59.400 1.00 76.47  ? 2319 LEU C C   1 
ATOM   4047 O O   . LEU C 1 16  ? 69.710  50.358  59.247 1.00 77.72  ? 2319 LEU C O   1 
ATOM   4048 C CB  . LEU C 1 16  ? 66.919  51.928  59.003 1.00 72.84  ? 2319 LEU C CB  1 
ATOM   4049 C CG  . LEU C 1 16  ? 65.545  52.365  59.499 1.00 70.40  ? 2319 LEU C CG  1 
ATOM   4050 C CD1 . LEU C 1 16  ? 64.644  52.658  58.319 1.00 69.88  ? 2319 LEU C CD1 1 
ATOM   4051 C CD2 . LEU C 1 16  ? 64.956  51.281  60.369 1.00 69.95  ? 2319 LEU C CD2 1 
ATOM   4052 N N   . LEU C 1 17  ? 70.033  52.584  59.005 1.00 76.59  ? 2320 LEU C N   1 
ATOM   4053 C CA  . LEU C 1 17  ? 71.328  52.446  58.348 1.00 76.63  ? 2320 LEU C CA  1 
ATOM   4054 C C   . LEU C 1 17  ? 72.430  52.025  59.313 1.00 76.20  ? 2320 LEU C C   1 
ATOM   4055 O O   . LEU C 1 17  ? 73.366  51.339  58.914 1.00 76.41  ? 2320 LEU C O   1 
ATOM   4056 C CB  . LEU C 1 17  ? 71.716  53.748  57.637 1.00 77.27  ? 2320 LEU C CB  1 
ATOM   4057 C CG  . LEU C 1 17  ? 71.006  54.042  56.310 1.00 77.30  ? 2320 LEU C CG  1 
ATOM   4058 C CD1 . LEU C 1 17  ? 71.374  55.430  55.824 1.00 77.23  ? 2320 LEU C CD1 1 
ATOM   4059 C CD2 . LEU C 1 17  ? 71.399  53.002  55.279 1.00 77.26  ? 2320 LEU C CD2 1 
ATOM   4060 N N   . ASP C 1 18  ? 72.333  52.435  60.573 1.00 75.76  ? 2321 ASP C N   1 
ATOM   4061 C CA  . ASP C 1 18  ? 73.339  52.031  61.546 1.00 76.02  ? 2321 ASP C CA  1 
ATOM   4062 C C   . ASP C 1 18  ? 73.085  50.547  61.810 1.00 75.78  ? 2321 ASP C C   1 
ATOM   4063 O O   . ASP C 1 18  ? 74.017  49.749  61.917 1.00 75.44  ? 2321 ASP C O   1 
ATOM   4064 C CB  . ASP C 1 18  ? 73.182  52.823  62.849 1.00 78.09  ? 2321 ASP C CB  1 
ATOM   4065 C CG  . ASP C 1 18  ? 74.239  52.457  63.900 1.00 80.19  ? 2321 ASP C CG  1 
ATOM   4066 O OD1 . ASP C 1 18  ? 74.069  52.845  65.084 1.00 80.21  ? 2321 ASP C OD1 1 
ATOM   4067 O OD2 . ASP C 1 18  ? 75.239  51.789  63.544 1.00 80.56  ? 2321 ASP C OD2 1 
ATOM   4068 N N   . ALA C 1 19  ? 71.802  50.198  61.877 1.00 75.55  ? 2322 ALA C N   1 
ATOM   4069 C CA  . ALA C 1 19  ? 71.339  48.837  62.145 1.00 75.99  ? 2322 ALA C CA  1 
ATOM   4070 C C   . ALA C 1 19  ? 71.767  47.759  61.150 1.00 75.84  ? 2322 ALA C C   1 
ATOM   4071 O O   . ALA C 1 19  ? 71.987  46.608  61.536 1.00 75.77  ? 2322 ALA C O   1 
ATOM   4072 C CB  . ALA C 1 19  ? 69.823  48.835  62.266 1.00 76.56  ? 2322 ALA C CB  1 
ATOM   4073 N N   . GLU C 1 20  ? 71.870  48.121  59.877 1.00 75.07  ? 2323 GLU C N   1 
ATOM   4074 C CA  . GLU C 1 20  ? 72.257  47.162  58.851 1.00 75.08  ? 2323 GLU C CA  1 
ATOM   4075 C C   . GLU C 1 20  ? 73.278  46.103  59.281 1.00 74.56  ? 2323 GLU C C   1 
ATOM   4076 O O   . GLU C 1 20  ? 74.316  46.414  59.862 1.00 73.67  ? 2323 GLU C O   1 
ATOM   4077 C CB  . GLU C 1 20  ? 72.757  47.908  57.622 1.00 75.85  ? 2323 GLU C CB  1 
ATOM   4078 C CG  . GLU C 1 20  ? 71.642  48.283  56.675 1.00 76.62  ? 2323 GLU C CG  1 
ATOM   4079 C CD  . GLU C 1 20  ? 70.906  47.060  56.170 1.00 77.52  ? 2323 GLU C CD  1 
ATOM   4080 O OE1 . GLU C 1 20  ? 71.550  46.192  55.542 1.00 77.11  ? 2323 GLU C OE1 1 
ATOM   4081 O OE2 . GLU C 1 20  ? 69.685  46.962  56.408 1.00 78.74  ? 2323 GLU C OE2 1 
ATOM   4082 N N   . PRO C 1 21  ? 72.980  44.826  58.990 1.00 74.85  ? 2324 PRO C N   1 
ATOM   4083 C CA  . PRO C 1 21  ? 73.820  43.670  59.318 1.00 75.59  ? 2324 PRO C CA  1 
ATOM   4084 C C   . PRO C 1 21  ? 74.972  43.458  58.337 1.00 75.95  ? 2324 PRO C C   1 
ATOM   4085 O O   . PRO C 1 21  ? 74.918  43.916  57.194 1.00 76.17  ? 2324 PRO C O   1 
ATOM   4086 C CB  . PRO C 1 21  ? 72.827  42.517  59.276 1.00 75.72  ? 2324 PRO C CB  1 
ATOM   4087 C CG  . PRO C 1 21  ? 71.976  42.902  58.109 1.00 75.60  ? 2324 PRO C CG  1 
ATOM   4088 C CD  . PRO C 1 21  ? 71.723  44.384  58.355 1.00 74.84  ? 2324 PRO C CD  1 
ATOM   4089 N N   . PRO C 1 22  ? 76.029  42.750  58.773 1.00 75.90  ? 2325 PRO C N   1 
ATOM   4090 C CA  . PRO C 1 22  ? 77.172  42.498  57.894 1.00 76.21  ? 2325 PRO C CA  1 
ATOM   4091 C C   . PRO C 1 22  ? 76.746  41.589  56.739 1.00 77.10  ? 2325 PRO C C   1 
ATOM   4092 O O   . PRO C 1 22  ? 75.912  40.699  56.920 1.00 76.79  ? 2325 PRO C O   1 
ATOM   4093 C CB  . PRO C 1 22  ? 78.175  41.832  58.829 1.00 75.20  ? 2325 PRO C CB  1 
ATOM   4094 C CG  . PRO C 1 22  ? 77.292  41.090  59.771 1.00 74.06  ? 2325 PRO C CG  1 
ATOM   4095 C CD  . PRO C 1 22  ? 76.229  42.105  60.083 1.00 74.72  ? 2325 PRO C CD  1 
ATOM   4096 N N   . ILE C 1 23  ? 77.302  41.816  55.554 1.00 77.76  ? 2326 ILE C N   1 
ATOM   4097 C CA  . ILE C 1 23  ? 76.951  41.004  54.397 1.00 77.85  ? 2326 ILE C CA  1 
ATOM   4098 C C   . ILE C 1 23  ? 77.789  39.726  54.410 1.00 79.38  ? 2326 ILE C C   1 
ATOM   4099 O O   . ILE C 1 23  ? 78.379  39.342  53.401 1.00 79.54  ? 2326 ILE C O   1 
ATOM   4100 C CB  . ILE C 1 23  ? 77.199  41.775  53.082 1.00 76.81  ? 2326 ILE C CB  1 
ATOM   4101 C CG1 . ILE C 1 23  ? 76.937  43.272  53.285 1.00 76.00  ? 2326 ILE C CG1 1 
ATOM   4102 C CG2 . ILE C 1 23  ? 76.261  41.256  52.007 1.00 76.29  ? 2326 ILE C CG2 1 
ATOM   4103 C CD1 . ILE C 1 23  ? 77.186  44.126  52.055 1.00 73.76  ? 2326 ILE C CD1 1 
ATOM   4104 N N   . LEU C 1 24  ? 77.819  39.072  55.569 1.00 81.46  ? 2327 LEU C N   1 
ATOM   4105 C CA  . LEU C 1 24  ? 78.583  37.845  55.777 1.00 83.76  ? 2327 LEU C CA  1 
ATOM   4106 C C   . LEU C 1 24  ? 78.834  37.052  54.505 1.00 85.78  ? 2327 LEU C C   1 
ATOM   4107 O O   . LEU C 1 24  ? 77.907  36.752  53.754 1.00 85.61  ? 2327 LEU C O   1 
ATOM   4108 C CB  . LEU C 1 24  ? 77.882  36.946  56.802 1.00 83.62  ? 2327 LEU C CB  1 
ATOM   4109 C CG  . LEU C 1 24  ? 76.645  36.154  56.360 1.00 83.63  ? 2327 LEU C CG  1 
ATOM   4110 C CD1 . LEU C 1 24  ? 76.234  35.210  57.483 1.00 82.29  ? 2327 LEU C CD1 1 
ATOM   4111 C CD2 . LEU C 1 24  ? 75.504  37.102  55.987 1.00 83.52  ? 2327 LEU C CD2 1 
ATOM   4112 N N   . TYR C 1 25  ? 80.099  36.718  54.270 1.00 88.37  ? 2328 TYR C N   1 
ATOM   4113 C CA  . TYR C 1 25  ? 80.479  35.953  53.090 1.00 90.80  ? 2328 TYR C CA  1 
ATOM   4114 C C   . TYR C 1 25  ? 79.922  34.545  53.148 1.00 92.14  ? 2328 TYR C C   1 
ATOM   4115 O O   . TYR C 1 25  ? 79.195  34.190  54.079 1.00 92.03  ? 2328 TYR C O   1 
ATOM   4116 C CB  . TYR C 1 25  ? 81.993  35.865  52.969 1.00 91.70  ? 2328 TYR C CB  1 
ATOM   4117 C CG  . TYR C 1 25  ? 82.663  37.161  52.621 1.00 92.82  ? 2328 TYR C CG  1 
ATOM   4118 C CD1 . TYR C 1 25  ? 82.511  38.286  53.427 1.00 93.25  ? 2328 TYR C CD1 1 
ATOM   4119 C CD2 . TYR C 1 25  ? 83.495  37.249  51.508 1.00 93.48  ? 2328 TYR C CD2 1 
ATOM   4120 C CE1 . TYR C 1 25  ? 83.182  39.469  53.136 1.00 94.62  ? 2328 TYR C CE1 1 
ATOM   4121 C CE2 . TYR C 1 25  ? 84.170  38.420  51.206 1.00 94.62  ? 2328 TYR C CE2 1 
ATOM   4122 C CZ  . TYR C 1 25  ? 84.015  39.527  52.023 1.00 95.05  ? 2328 TYR C CZ  1 
ATOM   4123 O OH  . TYR C 1 25  ? 84.718  40.678  51.739 1.00 95.86  ? 2328 TYR C OH  1 
ATOM   4124 N N   . SER C 1 26  ? 80.294  33.741  52.157 1.00 93.63  ? 2329 SER C N   1 
ATOM   4125 C CA  . SER C 1 26  ? 79.824  32.365  52.065 1.00 95.49  ? 2329 SER C CA  1 
ATOM   4126 C C   . SER C 1 26  ? 80.918  31.338  52.351 1.00 96.87  ? 2329 SER C C   1 
ATOM   4127 O O   . SER C 1 26  ? 81.864  31.603  53.099 1.00 96.61  ? 2329 SER C O   1 
ATOM   4128 C CB  . SER C 1 26  ? 79.233  32.116  50.672 1.00 94.69  ? 2329 SER C CB  1 
ATOM   4129 O OG  . SER C 1 26  ? 78.585  30.858  50.602 1.00 94.89  ? 2329 SER C OG  1 
ATOM   4130 N N   . GLU C 1 27  ? 80.758  30.160  51.748 1.00 98.77  ? 2330 GLU C N   1 
ATOM   4131 C CA  . GLU C 1 27  ? 81.691  29.039  51.887 1.00 100.36 ? 2330 GLU C CA  1 
ATOM   4132 C C   . GLU C 1 27  ? 81.543  28.127  50.659 1.00 100.97 ? 2330 GLU C C   1 
ATOM   4133 O O   . GLU C 1 27  ? 81.733  26.908  50.743 1.00 100.82 ? 2330 GLU C O   1 
ATOM   4134 C CB  . GLU C 1 27  ? 81.389  28.247  53.175 1.00 100.55 ? 2330 GLU C CB  1 
ATOM   4135 C CG  . GLU C 1 27  ? 80.021  27.551  53.199 1.00 100.61 ? 2330 GLU C CG  1 
ATOM   4136 C CD  . GLU C 1 27  ? 80.108  26.053  52.935 1.00 100.00 ? 2330 GLU C CD  1 
ATOM   4137 O OE1 . GLU C 1 27  ? 79.052  25.422  52.703 1.00 98.94  ? 2330 GLU C OE1 1 
ATOM   4138 O OE2 . GLU C 1 27  ? 81.232  25.507  52.972 1.00 99.33  ? 2330 GLU C OE2 1 
ATOM   4139 N N   . TYR C 1 28  ? 81.213  28.735  49.519 1.00 101.56 ? 2331 TYR C N   1 
ATOM   4140 C CA  . TYR C 1 28  ? 81.010  28.006  48.265 1.00 101.74 ? 2331 TYR C CA  1 
ATOM   4141 C C   . TYR C 1 28  ? 82.285  27.352  47.718 1.00 101.74 ? 2331 TYR C C   1 
ATOM   4142 O O   . TYR C 1 28  ? 83.401  27.806  47.995 1.00 101.28 ? 2331 TYR C O   1 
ATOM   4143 C CB  . TYR C 1 28  ? 80.384  28.946  47.211 1.00 101.74 ? 2331 TYR C CB  1 
ATOM   4144 C CG  . TYR C 1 28  ? 81.327  29.450  46.125 1.00 101.74 ? 2331 TYR C CG  1 
ATOM   4145 C CD1 . TYR C 1 28  ? 81.100  29.136  44.779 1.00 101.74 ? 2331 TYR C CD1 1 
ATOM   4146 C CD2 . TYR C 1 28  ? 82.445  30.228  46.439 1.00 101.74 ? 2331 TYR C CD2 1 
ATOM   4147 C CE1 . TYR C 1 28  ? 81.962  29.580  43.774 1.00 101.59 ? 2331 TYR C CE1 1 
ATOM   4148 C CE2 . TYR C 1 28  ? 83.317  30.677  45.438 1.00 101.74 ? 2331 TYR C CE2 1 
ATOM   4149 C CZ  . TYR C 1 28  ? 83.068  30.347  44.111 1.00 101.72 ? 2331 TYR C CZ  1 
ATOM   4150 O OH  . TYR C 1 28  ? 83.932  30.767  43.127 1.00 101.27 ? 2331 TYR C OH  1 
ATOM   4151 N N   . ASP C 1 29  ? 82.107  26.283  46.941 1.00 101.74 ? 2332 ASP C N   1 
ATOM   4152 C CA  . ASP C 1 29  ? 83.232  25.561  46.352 1.00 101.74 ? 2332 ASP C CA  1 
ATOM   4153 C C   . ASP C 1 29  ? 83.256  25.576  44.821 1.00 101.71 ? 2332 ASP C C   1 
ATOM   4154 O O   . ASP C 1 29  ? 82.270  25.237  44.157 1.00 101.22 ? 2332 ASP C O   1 
ATOM   4155 C CB  . ASP C 1 29  ? 83.259  24.107  46.857 1.00 101.74 ? 2332 ASP C CB  1 
ATOM   4156 C CG  . ASP C 1 29  ? 81.924  23.391  46.676 1.00 101.74 ? 2332 ASP C CG  1 
ATOM   4157 O OD1 . ASP C 1 29  ? 81.480  23.231  45.520 1.00 101.74 ? 2332 ASP C OD1 1 
ATOM   4158 O OD2 . ASP C 1 29  ? 81.322  22.984  47.696 1.00 101.74 ? 2332 ASP C OD2 1 
ATOM   4159 N N   . PRO C 1 30  ? 84.389  26.003  44.242 1.00 101.74 ? 2333 PRO C N   1 
ATOM   4160 C CA  . PRO C 1 30  ? 84.554  26.064  42.788 1.00 101.74 ? 2333 PRO C CA  1 
ATOM   4161 C C   . PRO C 1 30  ? 85.133  24.736  42.292 1.00 101.74 ? 2333 PRO C C   1 
ATOM   4162 O O   . PRO C 1 30  ? 85.265  24.505  41.083 1.00 101.74 ? 2333 PRO C O   1 
ATOM   4163 C CB  . PRO C 1 30  ? 85.526  27.226  42.611 1.00 101.74 ? 2333 PRO C CB  1 
ATOM   4164 C CG  . PRO C 1 30  ? 86.448  27.040  43.784 1.00 101.74 ? 2333 PRO C CG  1 
ATOM   4165 C CD  . PRO C 1 30  ? 85.492  26.712  44.926 1.00 101.74 ? 2333 PRO C CD  1 
ATOM   4166 N N   . THR C 1 31  ? 85.471  23.871  43.250 1.00 101.74 ? 2334 THR C N   1 
ATOM   4167 C CA  . THR C 1 31  ? 86.049  22.552  42.980 1.00 101.74 ? 2334 THR C CA  1 
ATOM   4168 C C   . THR C 1 31  ? 84.991  21.489  42.618 1.00 101.74 ? 2334 THR C C   1 
ATOM   4169 O O   . THR C 1 31  ? 85.060  20.868  41.548 1.00 101.74 ? 2334 THR C O   1 
ATOM   4170 C CB  . THR C 1 31  ? 86.887  22.069  44.204 1.00 101.74 ? 2334 THR C CB  1 
ATOM   4171 O OG1 . THR C 1 31  ? 86.152  22.299  45.418 1.00 101.74 ? 2334 THR C OG1 1 
ATOM   4172 C CG2 . THR C 1 31  ? 88.225  22.816  44.265 1.00 101.29 ? 2334 THR C CG2 1 
ATOM   4173 N N   . ARG C 1 32  ? 84.025  21.284  43.514 1.00 101.37 ? 2335 ARG C N   1 
ATOM   4174 C CA  . ARG C 1 32  ? 82.939  20.324  43.304 1.00 100.90 ? 2335 ARG C CA  1 
ATOM   4175 C C   . ARG C 1 32  ? 81.718  21.048  42.713 1.00 100.93 ? 2335 ARG C C   1 
ATOM   4176 O O   . ARG C 1 32  ? 81.028  21.786  43.419 1.00 101.54 ? 2335 ARG C O   1 
ATOM   4177 C CB  . ARG C 1 32  ? 82.559  19.663  44.641 1.00 100.13 ? 2335 ARG C CB  1 
ATOM   4178 C CG  . ARG C 1 32  ? 83.375  18.423  44.999 1.00 98.74  ? 2335 ARG C CG  1 
ATOM   4179 C CD  . ARG C 1 32  ? 83.291  18.101  46.489 1.00 97.71  ? 2335 ARG C CD  1 
ATOM   4180 N NE  . ARG C 1 32  ? 84.142  18.985  47.282 1.00 96.22  ? 2335 ARG C NE  1 
ATOM   4181 C CZ  . ARG C 1 32  ? 84.200  18.979  48.608 1.00 95.40  ? 2335 ARG C CZ  1 
ATOM   4182 N NH1 . ARG C 1 32  ? 83.455  18.134  49.302 1.00 95.04  ? 2335 ARG C NH1 1 
ATOM   4183 N NH2 . ARG C 1 32  ? 85.006  19.819  49.241 1.00 95.59  ? 2335 ARG C NH2 1 
ATOM   4184 N N   . PRO C 1 33  ? 81.432  20.843  41.411 1.00 100.43 ? 2336 PRO C N   1 
ATOM   4185 C CA  . PRO C 1 33  ? 80.283  21.503  40.775 1.00 100.22 ? 2336 PRO C CA  1 
ATOM   4186 C C   . PRO C 1 33  ? 78.986  21.537  41.598 1.00 99.77  ? 2336 PRO C C   1 
ATOM   4187 O O   . PRO C 1 33  ? 78.852  20.838  42.607 1.00 99.47  ? 2336 PRO C O   1 
ATOM   4188 C CB  . PRO C 1 33  ? 80.140  20.759  39.434 1.00 100.09 ? 2336 PRO C CB  1 
ATOM   4189 C CG  . PRO C 1 33  ? 80.883  19.470  39.647 1.00 100.73 ? 2336 PRO C CG  1 
ATOM   4190 C CD  . PRO C 1 33  ? 82.059  19.890  40.483 1.00 100.39 ? 2336 PRO C CD  1 
ATOM   4191 N N   . PHE C 1 34  ? 78.039  22.361  41.149 1.00 99.22  ? 2337 PHE C N   1 
ATOM   4192 C CA  . PHE C 1 34  ? 76.756  22.559  41.830 1.00 98.34  ? 2337 PHE C CA  1 
ATOM   4193 C C   . PHE C 1 34  ? 75.676  21.496  41.623 1.00 97.05  ? 2337 PHE C C   1 
ATOM   4194 O O   . PHE C 1 34  ? 74.896  21.568  40.668 1.00 97.14  ? 2337 PHE C O   1 
ATOM   4195 C CB  . PHE C 1 34  ? 76.183  23.928  41.443 1.00 99.00  ? 2337 PHE C CB  1 
ATOM   4196 C CG  . PHE C 1 34  ? 77.141  25.064  41.658 1.00 99.91  ? 2337 PHE C CG  1 
ATOM   4197 C CD1 . PHE C 1 34  ? 77.016  26.240  40.927 1.00 100.65 ? 2337 PHE C CD1 1 
ATOM   4198 C CD2 . PHE C 1 34  ? 78.182  24.954  42.580 1.00 99.88  ? 2337 PHE C CD2 1 
ATOM   4199 C CE1 . PHE C 1 34  ? 77.918  27.292  41.107 1.00 101.03 ? 2337 PHE C CE1 1 
ATOM   4200 C CE2 . PHE C 1 34  ? 79.087  25.995  42.769 1.00 99.91  ? 2337 PHE C CE2 1 
ATOM   4201 C CZ  . PHE C 1 34  ? 78.956  27.167  42.031 1.00 100.60 ? 2337 PHE C CZ  1 
ATOM   4202 N N   . SER C 1 35  ? 75.634  20.524  42.534 1.00 94.71  ? 2338 SER C N   1 
ATOM   4203 C CA  . SER C 1 35  ? 74.636  19.454  42.508 1.00 91.41  ? 2338 SER C CA  1 
ATOM   4204 C C   . SER C 1 35  ? 73.358  20.026  43.115 1.00 88.81  ? 2338 SER C C   1 
ATOM   4205 O O   . SER C 1 35  ? 73.367  21.134  43.658 1.00 88.58  ? 2338 SER C O   1 
ATOM   4206 C CB  . SER C 1 35  ? 75.110  18.262  43.350 1.00 91.72  ? 2338 SER C CB  1 
ATOM   4207 O OG  . SER C 1 35  ? 74.084  17.292  43.507 1.00 91.22  ? 2338 SER C OG  1 
ATOM   4208 N N   . GLU C 1 36  ? 72.256  19.294  43.016 1.00 85.00  ? 2339 GLU C N   1 
ATOM   4209 C CA  . GLU C 1 36  ? 71.021  19.785  43.610 1.00 82.01  ? 2339 GLU C CA  1 
ATOM   4210 C C   . GLU C 1 36  ? 71.305  19.992  45.087 1.00 80.32  ? 2339 GLU C C   1 
ATOM   4211 O O   . GLU C 1 36  ? 71.093  21.078  45.624 1.00 79.87  ? 2339 GLU C O   1 
ATOM   4212 C CB  . GLU C 1 36  ? 69.883  18.779  43.438 1.00 81.68  ? 2339 GLU C CB  1 
ATOM   4213 C CG  . GLU C 1 36  ? 68.620  19.168  44.189 1.00 81.52  ? 2339 GLU C CG  1 
ATOM   4214 C CD  . GLU C 1 36  ? 67.374  18.469  43.671 1.00 82.73  ? 2339 GLU C CD  1 
ATOM   4215 O OE1 . GLU C 1 36  ? 67.010  18.681  42.491 1.00 82.58  ? 2339 GLU C OE1 1 
ATOM   4216 O OE2 . GLU C 1 36  ? 66.754  17.712  44.446 1.00 82.98  ? 2339 GLU C OE2 1 
ATOM   4217 N N   . ALA C 1 37  ? 71.808  18.941  45.731 1.00 78.31  ? 2340 ALA C N   1 
ATOM   4218 C CA  . ALA C 1 37  ? 72.138  18.984  47.149 1.00 76.17  ? 2340 ALA C CA  1 
ATOM   4219 C C   . ALA C 1 37  ? 73.214  20.028  47.440 1.00 75.47  ? 2340 ALA C C   1 
ATOM   4220 O O   . ALA C 1 37  ? 73.114  20.785  48.407 1.00 75.41  ? 2340 ALA C O   1 
ATOM   4221 C CB  . ALA C 1 37  ? 72.605  17.616  47.606 1.00 75.33  ? 2340 ALA C CB  1 
ATOM   4222 N N   . SER C 1 38  ? 74.237  20.067  46.594 1.00 74.18  ? 2341 SER C N   1 
ATOM   4223 C CA  . SER C 1 38  ? 75.337  21.008  46.763 1.00 72.99  ? 2341 SER C CA  1 
ATOM   4224 C C   . SER C 1 38  ? 74.882  22.463  46.898 1.00 71.56  ? 2341 SER C C   1 
ATOM   4225 O O   . SER C 1 38  ? 75.171  23.111  47.900 1.00 69.98  ? 2341 SER C O   1 
ATOM   4226 C CB  . SER C 1 38  ? 76.318  20.871  45.593 1.00 73.53  ? 2341 SER C CB  1 
ATOM   4227 O OG  . SER C 1 38  ? 77.468  21.673  45.782 1.00 74.22  ? 2341 SER C OG  1 
ATOM   4228 N N   . MET C 1 39  ? 74.164  22.974  45.901 1.00 71.94  ? 2342 MET C N   1 
ATOM   4229 C CA  . MET C 1 39  ? 73.713  24.362  45.947 1.00 73.21  ? 2342 MET C CA  1 
ATOM   4230 C C   . MET C 1 39  ? 72.671  24.646  47.022 1.00 73.44  ? 2342 MET C C   1 
ATOM   4231 O O   . MET C 1 39  ? 72.635  25.744  47.574 1.00 73.76  ? 2342 MET C O   1 
ATOM   4232 C CB  . MET C 1 39  ? 73.171  24.813  44.589 1.00 74.34  ? 2342 MET C CB  1 
ATOM   4233 C CG  . MET C 1 39  ? 72.805  26.293  44.572 1.00 75.42  ? 2342 MET C CG  1 
ATOM   4234 S SD  . MET C 1 39  ? 72.368  26.939  42.950 1.00 80.65  ? 2342 MET C SD  1 
ATOM   4235 C CE  . MET C 1 39  ? 70.581  26.658  42.916 1.00 78.35  ? 2342 MET C CE  1 
ATOM   4236 N N   . MET C 1 40  ? 71.807  23.681  47.313 1.00 72.86  ? 2343 MET C N   1 
ATOM   4237 C CA  . MET C 1 40  ? 70.823  23.901  48.360 1.00 72.57  ? 2343 MET C CA  1 
ATOM   4238 C C   . MET C 1 40  ? 71.583  24.089  49.662 1.00 72.49  ? 2343 MET C C   1 
ATOM   4239 O O   . MET C 1 40  ? 71.388  25.075  50.374 1.00 71.97  ? 2343 MET C O   1 
ATOM   4240 C CB  . MET C 1 40  ? 69.872  22.710  48.475 1.00 73.10  ? 2343 MET C CB  1 
ATOM   4241 C CG  . MET C 1 40  ? 68.617  22.854  47.634 1.00 73.34  ? 2343 MET C CG  1 
ATOM   4242 S SD  . MET C 1 40  ? 67.613  24.264  48.154 1.00 74.71  ? 2343 MET C SD  1 
ATOM   4243 C CE  . MET C 1 40  ? 68.350  25.598  47.149 1.00 72.48  ? 2343 MET C CE  1 
ATOM   4244 N N   . GLY C 1 41  ? 72.471  23.143  49.952 1.00 72.56  ? 2344 GLY C N   1 
ATOM   4245 C CA  . GLY C 1 41  ? 73.264  23.213  51.164 1.00 72.45  ? 2344 GLY C CA  1 
ATOM   4246 C C   . GLY C 1 41  ? 74.086  24.484  51.275 1.00 72.05  ? 2344 GLY C C   1 
ATOM   4247 O O   . GLY C 1 41  ? 74.285  25.012  52.369 1.00 72.44  ? 2344 GLY C O   1 
ATOM   4248 N N   . LEU C 1 42  ? 74.559  24.986  50.143 1.00 71.56  ? 2345 LEU C N   1 
ATOM   4249 C CA  . LEU C 1 42  ? 75.371  26.195  50.146 1.00 72.16  ? 2345 LEU C CA  1 
ATOM   4250 C C   . LEU C 1 42  ? 74.545  27.443  50.469 1.00 71.85  ? 2345 LEU C C   1 
ATOM   4251 O O   . LEU C 1 42  ? 74.998  28.329  51.205 1.00 71.86  ? 2345 LEU C O   1 
ATOM   4252 C CB  . LEU C 1 42  ? 76.057  26.365  48.785 1.00 73.15  ? 2345 LEU C CB  1 
ATOM   4253 C CG  . LEU C 1 42  ? 77.474  26.942  48.818 1.00 73.90  ? 2345 LEU C CG  1 
ATOM   4254 C CD1 . LEU C 1 42  ? 77.471  28.294  49.531 1.00 75.02  ? 2345 LEU C CD1 1 
ATOM   4255 C CD2 . LEU C 1 42  ? 78.399  25.956  49.530 1.00 74.30  ? 2345 LEU C CD2 1 
ATOM   4256 N N   . LEU C 1 43  ? 73.336  27.511  49.916 1.00 70.74  ? 2346 LEU C N   1 
ATOM   4257 C CA  . LEU C 1 43  ? 72.457  28.653  50.140 1.00 68.52  ? 2346 LEU C CA  1 
ATOM   4258 C C   . LEU C 1 43  ? 71.803  28.610  51.511 1.00 67.62  ? 2346 LEU C C   1 
ATOM   4259 O O   . LEU C 1 43  ? 71.817  29.603  52.232 1.00 67.72  ? 2346 LEU C O   1 
ATOM   4260 C CB  . LEU C 1 43  ? 71.364  28.717  49.071 1.00 67.55  ? 2346 LEU C CB  1 
ATOM   4261 C CG  . LEU C 1 43  ? 71.773  29.000  47.630 1.00 66.92  ? 2346 LEU C CG  1 
ATOM   4262 C CD1 . LEU C 1 43  ? 70.517  29.133  46.786 1.00 66.89  ? 2346 LEU C CD1 1 
ATOM   4263 C CD2 . LEU C 1 43  ? 72.606  30.269  47.560 1.00 66.13  ? 2346 LEU C CD2 1 
ATOM   4264 N N   . THR C 1 44  ? 71.222  27.468  51.868 1.00 66.12  ? 2347 THR C N   1 
ATOM   4265 C CA  . THR C 1 44  ? 70.573  27.353  53.165 1.00 65.70  ? 2347 THR C CA  1 
ATOM   4266 C C   . THR C 1 44  ? 71.602  27.658  54.241 1.00 66.09  ? 2347 THR C C   1 
ATOM   4267 O O   . THR C 1 44  ? 71.267  28.168  55.314 1.00 66.29  ? 2347 THR C O   1 
ATOM   4268 C CB  . THR C 1 44  ? 69.994  25.947  53.398 1.00 65.25  ? 2347 THR C CB  1 
ATOM   4269 O OG1 . THR C 1 44  ? 71.038  24.975  53.285 1.00 65.42  ? 2347 THR C OG1 1 
ATOM   4270 C CG2 . THR C 1 44  ? 68.891  25.647  52.383 1.00 65.01  ? 2347 THR C CG2 1 
ATOM   4271 N N   . ASN C 1 45  ? 72.859  27.345  53.944 1.00 66.44  ? 2348 ASN C N   1 
ATOM   4272 C CA  . ASN C 1 45  ? 73.947  27.610  54.870 1.00 66.42  ? 2348 ASN C CA  1 
ATOM   4273 C C   . ASN C 1 45  ? 74.097  29.110  55.023 1.00 65.68  ? 2348 ASN C C   1 
ATOM   4274 O O   . ASN C 1 45  ? 74.184  29.626  56.136 1.00 65.75  ? 2348 ASN C O   1 
ATOM   4275 C CB  . ASN C 1 45  ? 75.255  27.008  54.351 1.00 68.65  ? 2348 ASN C CB  1 
ATOM   4276 C CG  . ASN C 1 45  ? 76.487  27.695  54.930 1.00 70.87  ? 2348 ASN C CG  1 
ATOM   4277 O OD1 . ASN C 1 45  ? 76.888  28.771  54.470 1.00 71.64  ? 2348 ASN C OD1 1 
ATOM   4278 N ND2 . ASN C 1 45  ? 77.085  27.082  55.950 1.00 70.76  ? 2348 ASN C ND2 1 
ATOM   4279 N N   . LEU C 1 46  ? 74.123  29.806  53.895 1.00 65.00  ? 2349 LEU C N   1 
ATOM   4280 C CA  . LEU C 1 46  ? 74.256  31.252  53.902 1.00 65.51  ? 2349 LEU C CA  1 
ATOM   4281 C C   . LEU C 1 46  ? 73.075  31.908  54.620 1.00 66.04  ? 2349 LEU C C   1 
ATOM   4282 O O   . LEU C 1 46  ? 73.230  32.919  55.309 1.00 65.86  ? 2349 LEU C O   1 
ATOM   4283 C CB  . LEU C 1 46  ? 74.339  31.764  52.471 1.00 64.75  ? 2349 LEU C CB  1 
ATOM   4284 C CG  . LEU C 1 46  ? 74.450  33.281  52.380 1.00 64.81  ? 2349 LEU C CG  1 
ATOM   4285 C CD1 . LEU C 1 46  ? 75.652  33.755  53.194 1.00 63.83  ? 2349 LEU C CD1 1 
ATOM   4286 C CD2 . LEU C 1 46  ? 74.566  33.687  50.920 1.00 64.42  ? 2349 LEU C CD2 1 
ATOM   4287 N N   . ALA C 1 47  ? 71.893  31.324  54.448 1.00 66.59  ? 2350 ALA C N   1 
ATOM   4288 C CA  . ALA C 1 47  ? 70.682  31.830  55.076 1.00 66.21  ? 2350 ALA C CA  1 
ATOM   4289 C C   . ALA C 1 47  ? 70.782  31.677  56.587 1.00 66.68  ? 2350 ALA C C   1 
ATOM   4290 O O   . ALA C 1 47  ? 70.889  32.674  57.297 1.00 67.18  ? 2350 ALA C O   1 
ATOM   4291 C CB  . ALA C 1 47  ? 69.470  31.079  54.558 1.00 65.80  ? 2350 ALA C CB  1 
ATOM   4292 N N   . ASP C 1 48  ? 70.755  30.436  57.076 1.00 66.16  ? 2351 ASP C N   1 
ATOM   4293 C CA  . ASP C 1 48  ? 70.840  30.186  58.513 1.00 66.85  ? 2351 ASP C CA  1 
ATOM   4294 C C   . ASP C 1 48  ? 71.785  31.183  59.187 1.00 68.26  ? 2351 ASP C C   1 
ATOM   4295 O O   . ASP C 1 48  ? 71.419  31.823  60.175 1.00 69.36  ? 2351 ASP C O   1 
ATOM   4296 C CB  . ASP C 1 48  ? 71.317  28.754  58.785 1.00 65.59  ? 2351 ASP C CB  1 
ATOM   4297 C CG  . ASP C 1 48  ? 71.330  28.410  60.272 1.00 65.06  ? 2351 ASP C CG  1 
ATOM   4298 O OD1 . ASP C 1 48  ? 72.026  29.095  61.054 1.00 64.45  ? 2351 ASP C OD1 1 
ATOM   4299 O OD2 . ASP C 1 48  ? 70.644  27.444  60.662 1.00 64.64  ? 2351 ASP C OD2 1 
ATOM   4300 N N   . ARG C 1 49  ? 72.995  31.324  58.650 1.00 68.76  ? 2352 ARG C N   1 
ATOM   4301 C CA  . ARG C 1 49  ? 73.960  32.248  59.225 1.00 68.73  ? 2352 ARG C CA  1 
ATOM   4302 C C   . ARG C 1 49  ? 73.437  33.675  59.193 1.00 68.71  ? 2352 ARG C C   1 
ATOM   4303 O O   . ARG C 1 49  ? 73.283  34.316  60.233 1.00 68.57  ? 2352 ARG C O   1 
ATOM   4304 C CB  . ARG C 1 49  ? 75.296  32.148  58.485 1.00 69.78  ? 2352 ARG C CB  1 
ATOM   4305 C CG  . ARG C 1 49  ? 76.093  30.911  58.879 1.00 71.69  ? 2352 ARG C CG  1 
ATOM   4306 C CD  . ARG C 1 49  ? 77.532  30.942  58.383 1.00 73.52  ? 2352 ARG C CD  1 
ATOM   4307 N NE  . ARG C 1 49  ? 77.642  30.694  56.948 1.00 75.83  ? 2352 ARG C NE  1 
ATOM   4308 C CZ  . ARG C 1 49  ? 77.757  31.643  56.024 1.00 76.90  ? 2352 ARG C CZ  1 
ATOM   4309 N NH1 . ARG C 1 49  ? 77.780  32.921  56.384 1.00 77.82  ? 2352 ARG C NH1 1 
ATOM   4310 N NH2 . ARG C 1 49  ? 77.854  31.311  54.741 1.00 76.84  ? 2352 ARG C NH2 1 
ATOM   4311 N N   . GLU C 1 50  ? 73.153  34.166  57.996 1.00 68.47  ? 2353 GLU C N   1 
ATOM   4312 C CA  . GLU C 1 50  ? 72.638  35.522  57.819 1.00 68.98  ? 2353 GLU C CA  1 
ATOM   4313 C C   . GLU C 1 50  ? 71.358  35.734  58.647 1.00 67.99  ? 2353 GLU C C   1 
ATOM   4314 O O   . GLU C 1 50  ? 71.040  36.854  59.067 1.00 67.32  ? 2353 GLU C O   1 
ATOM   4315 C CB  . GLU C 1 50  ? 72.352  35.746  56.331 1.00 69.67  ? 2353 GLU C CB  1 
ATOM   4316 C CG  . GLU C 1 50  ? 72.081  37.176  55.904 1.00 69.91  ? 2353 GLU C CG  1 
ATOM   4317 C CD  . GLU C 1 50  ? 71.681  37.246  54.443 1.00 72.06  ? 2353 GLU C CD  1 
ATOM   4318 O OE1 . GLU C 1 50  ? 71.503  38.364  53.919 1.00 73.03  ? 2353 GLU C OE1 1 
ATOM   4319 O OE2 . GLU C 1 50  ? 71.538  36.171  53.817 1.00 72.95  ? 2353 GLU C OE2 1 
ATOM   4320 N N   . LEU C 1 51  ? 70.642  34.636  58.877 1.00 66.57  ? 2354 LEU C N   1 
ATOM   4321 C CA  . LEU C 1 51  ? 69.386  34.632  59.620 1.00 64.53  ? 2354 LEU C CA  1 
ATOM   4322 C C   . LEU C 1 51  ? 69.624  34.709  61.125 1.00 63.94  ? 2354 LEU C C   1 
ATOM   4323 O O   . LEU C 1 51  ? 68.743  34.395  61.920 1.00 63.70  ? 2354 LEU C O   1 
ATOM   4324 C CB  . LEU C 1 51  ? 68.607  33.360  59.276 1.00 63.59  ? 2354 LEU C CB  1 
ATOM   4325 C CG  . LEU C 1 51  ? 67.105  33.281  59.530 1.00 62.62  ? 2354 LEU C CG  1 
ATOM   4326 C CD1 . LEU C 1 51  ? 66.374  34.371  58.757 1.00 62.91  ? 2354 LEU C CD1 1 
ATOM   4327 C CD2 . LEU C 1 51  ? 66.616  31.908  59.097 1.00 62.59  ? 2354 LEU C CD2 1 
ATOM   4328 N N   . VAL C 1 52  ? 70.830  35.108  61.509 1.00 63.34  ? 2355 VAL C N   1 
ATOM   4329 C CA  . VAL C 1 52  ? 71.185  35.249  62.917 1.00 62.77  ? 2355 VAL C CA  1 
ATOM   4330 C C   . VAL C 1 52  ? 71.482  36.720  63.155 1.00 63.53  ? 2355 VAL C C   1 
ATOM   4331 O O   . VAL C 1 52  ? 71.156  37.275  64.203 1.00 63.68  ? 2355 VAL C O   1 
ATOM   4332 C CB  . VAL C 1 52  ? 72.430  34.421  63.282 1.00 60.59  ? 2355 VAL C CB  1 
ATOM   4333 C CG1 . VAL C 1 52  ? 72.977  34.880  64.614 1.00 59.45  ? 2355 VAL C CG1 1 
ATOM   4334 C CG2 . VAL C 1 52  ? 72.072  32.954  63.351 1.00 58.15  ? 2355 VAL C CG2 1 
ATOM   4335 N N   . HIS C 1 53  ? 72.116  37.338  62.165 1.00 64.69  ? 2356 HIS C N   1 
ATOM   4336 C CA  . HIS C 1 53  ? 72.448  38.755  62.222 1.00 65.27  ? 2356 HIS C CA  1 
ATOM   4337 C C   . HIS C 1 53  ? 71.143  39.495  62.011 1.00 64.48  ? 2356 HIS C C   1 
ATOM   4338 O O   . HIS C 1 53  ? 70.996  40.645  62.419 1.00 64.90  ? 2356 HIS C O   1 
ATOM   4339 C CB  . HIS C 1 53  ? 73.423  39.142  61.101 1.00 67.22  ? 2356 HIS C CB  1 
ATOM   4340 C CG  . HIS C 1 53  ? 74.768  38.490  61.205 1.00 68.43  ? 2356 HIS C CG  1 
ATOM   4341 N ND1 . HIS C 1 53  ? 75.713  38.577  60.205 1.00 69.59  ? 2356 HIS C ND1 1 
ATOM   4342 C CD2 . HIS C 1 53  ? 75.328  37.748  62.190 1.00 68.36  ? 2356 HIS C CD2 1 
ATOM   4343 C CE1 . HIS C 1 53  ? 76.797  37.915  60.570 1.00 69.39  ? 2356 HIS C CE1 1 
ATOM   4344 N NE2 . HIS C 1 53  ? 76.589  37.403  61.770 1.00 68.78  ? 2356 HIS C NE2 1 
ATOM   4345 N N   . MET C 1 54  ? 70.197  38.828  61.355 1.00 63.69  ? 2357 MET C N   1 
ATOM   4346 C CA  . MET C 1 54  ? 68.901  39.430  61.099 1.00 62.72  ? 2357 MET C CA  1 
ATOM   4347 C C   . MET C 1 54  ? 68.160  39.625  62.411 1.00 61.61  ? 2357 MET C C   1 
ATOM   4348 O O   . MET C 1 54  ? 67.485  40.641  62.598 1.00 60.94  ? 2357 MET C O   1 
ATOM   4349 C CB  . MET C 1 54  ? 68.060  38.555  60.171 1.00 63.03  ? 2357 MET C CB  1 
ATOM   4350 C CG  . MET C 1 54  ? 66.687  39.156  59.880 1.00 63.76  ? 2357 MET C CG  1 
ATOM   4351 S SD  . MET C 1 54  ? 65.552  38.001  59.103 1.00 64.23  ? 2357 MET C SD  1 
ATOM   4352 C CE  . MET C 1 54  ? 65.803  38.387  57.373 1.00 63.52  ? 2357 MET C CE  1 
ATOM   4353 N N   . ILE C 1 55  ? 68.282  38.654  63.314 1.00 60.55  ? 2358 ILE C N   1 
ATOM   4354 C CA  . ILE C 1 55  ? 67.616  38.757  64.604 1.00 61.06  ? 2358 ILE C CA  1 
ATOM   4355 C C   . ILE C 1 55  ? 68.069  40.034  65.307 1.00 61.10  ? 2358 ILE C C   1 
ATOM   4356 O O   . ILE C 1 55  ? 67.246  40.845  65.741 1.00 61.34  ? 2358 ILE C O   1 
ATOM   4357 C CB  . ILE C 1 55  ? 67.926  37.552  65.516 1.00 61.39  ? 2358 ILE C CB  1 
ATOM   4358 C CG1 . ILE C 1 55  ? 67.516  36.245  64.839 1.00 61.83  ? 2358 ILE C CG1 1 
ATOM   4359 C CG2 . ILE C 1 55  ? 67.142  37.676  66.807 1.00 62.65  ? 2358 ILE C CG2 1 
ATOM   4360 C CD1 . ILE C 1 55  ? 67.688  35.014  65.724 1.00 62.30  ? 2358 ILE C CD1 1 
ATOM   4361 N N   . ASN C 1 56  ? 69.381  40.210  65.415 1.00 60.97  ? 2359 ASN C N   1 
ATOM   4362 C CA  . ASN C 1 56  ? 69.939  41.396  66.052 1.00 62.12  ? 2359 ASN C CA  1 
ATOM   4363 C C   . ASN C 1 56  ? 69.481  42.669  65.340 1.00 62.30  ? 2359 ASN C C   1 
ATOM   4364 O O   . ASN C 1 56  ? 69.141  43.656  65.988 1.00 61.75  ? 2359 ASN C O   1 
ATOM   4365 C CB  . ASN C 1 56  ? 71.463  41.311  66.065 1.00 62.61  ? 2359 ASN C CB  1 
ATOM   4366 C CG  . ASN C 1 56  ? 71.964  40.129  66.869 1.00 63.57  ? 2359 ASN C CG  1 
ATOM   4367 O OD1 . ASN C 1 56  ? 73.167  39.868  66.936 1.00 64.54  ? 2359 ASN C OD1 1 
ATOM   4368 N ND2 . ASN C 1 56  ? 71.038  39.406  67.490 1.00 64.44  ? 2359 ASN C ND2 1 
ATOM   4369 N N   . TRP C 1 57  ? 69.475  42.645  64.010 1.00 62.73  ? 2360 TRP C N   1 
ATOM   4370 C CA  . TRP C 1 57  ? 69.027  43.795  63.237 1.00 63.58  ? 2360 TRP C CA  1 
ATOM   4371 C C   . TRP C 1 57  ? 67.625  44.134  63.712 1.00 64.39  ? 2360 TRP C C   1 
ATOM   4372 O O   . TRP C 1 57  ? 67.353  45.257  64.140 1.00 65.51  ? 2360 TRP C O   1 
ATOM   4373 C CB  . TRP C 1 57  ? 68.981  43.468  61.740 1.00 63.22  ? 2360 TRP C CB  1 
ATOM   4374 C CG  . TRP C 1 57  ? 68.227  44.490  60.902 1.00 64.46  ? 2360 TRP C CG  1 
ATOM   4375 C CD1 . TRP C 1 57  ? 68.654  45.743  60.529 1.00 64.75  ? 2360 TRP C CD1 1 
ATOM   4376 C CD2 . TRP C 1 57  ? 66.899  44.349  60.373 1.00 64.84  ? 2360 TRP C CD2 1 
ATOM   4377 N NE1 . TRP C 1 57  ? 67.672  46.385  59.805 1.00 65.16  ? 2360 TRP C NE1 1 
ATOM   4378 C CE2 . TRP C 1 57  ? 66.587  45.554  59.695 1.00 65.27  ? 2360 TRP C CE2 1 
ATOM   4379 C CE3 . TRP C 1 57  ? 65.944  43.322  60.409 1.00 63.80  ? 2360 TRP C CE3 1 
ATOM   4380 C CZ2 . TRP C 1 57  ? 65.353  45.756  59.059 1.00 64.81  ? 2360 TRP C CZ2 1 
ATOM   4381 C CZ3 . TRP C 1 57  ? 64.723  43.527  59.777 1.00 64.00  ? 2360 TRP C CZ3 1 
ATOM   4382 C CH2 . TRP C 1 57  ? 64.440  44.735  59.111 1.00 63.88  ? 2360 TRP C CH2 1 
ATOM   4383 N N   . ALA C 1 58  ? 66.743  43.143  63.637 1.00 64.47  ? 2361 ALA C N   1 
ATOM   4384 C CA  . ALA C 1 58  ? 65.356  43.305  64.042 1.00 64.51  ? 2361 ALA C CA  1 
ATOM   4385 C C   . ALA C 1 58  ? 65.222  44.102  65.333 1.00 65.06  ? 2361 ALA C C   1 
ATOM   4386 O O   . ALA C 1 58  ? 64.490  45.093  65.376 1.00 65.28  ? 2361 ALA C O   1 
ATOM   4387 C CB  . ALA C 1 58  ? 64.702  41.942  64.201 1.00 64.50  ? 2361 ALA C CB  1 
ATOM   4388 N N   . LYS C 1 59  ? 65.932  43.668  66.376 1.00 65.43  ? 2362 LYS C N   1 
ATOM   4389 C CA  . LYS C 1 59  ? 65.889  44.334  67.682 1.00 65.99  ? 2362 LYS C CA  1 
ATOM   4390 C C   . LYS C 1 59  ? 66.153  45.843  67.601 1.00 66.26  ? 2362 LYS C C   1 
ATOM   4391 O O   . LYS C 1 59  ? 65.652  46.616  68.419 1.00 65.87  ? 2362 LYS C O   1 
ATOM   4392 C CB  . LYS C 1 59  ? 66.894  43.677  68.646 1.00 65.89  ? 2362 LYS C CB  1 
ATOM   4393 C CG  . LYS C 1 59  ? 66.284  42.696  69.670 1.00 67.01  ? 2362 LYS C CG  1 
ATOM   4394 C CD  . LYS C 1 59  ? 65.631  41.446  69.027 1.00 66.64  ? 2362 LYS C CD  1 
ATOM   4395 C CE  . LYS C 1 59  ? 64.897  40.583  70.073 1.00 65.77  ? 2362 LYS C CE  1 
ATOM   4396 N NZ  . LYS C 1 59  ? 64.200  39.390  69.505 1.00 62.65  ? 2362 LYS C NZ  1 
ATOM   4397 N N   . ARG C 1 60  ? 66.923  46.263  66.603 1.00 66.80  ? 2363 ARG C N   1 
ATOM   4398 C CA  . ARG C 1 60  ? 67.247  47.673  66.437 1.00 66.79  ? 2363 ARG C CA  1 
ATOM   4399 C C   . ARG C 1 60  ? 66.212  48.516  65.669 1.00 66.36  ? 2363 ARG C C   1 
ATOM   4400 O O   . ARG C 1 60  ? 66.172  49.741  65.821 1.00 66.45  ? 2363 ARG C O   1 
ATOM   4401 C CB  . ARG C 1 60  ? 68.631  47.801  65.794 1.00 67.32  ? 2363 ARG C CB  1 
ATOM   4402 C CG  . ARG C 1 60  ? 69.730  47.249  66.681 1.00 68.60  ? 2363 ARG C CG  1 
ATOM   4403 C CD  . ARG C 1 60  ? 71.119  47.624  66.198 1.00 71.50  ? 2363 ARG C CD  1 
ATOM   4404 N NE  . ARG C 1 60  ? 72.139  47.333  67.211 1.00 73.49  ? 2363 ARG C NE  1 
ATOM   4405 C CZ  . ARG C 1 60  ? 72.526  46.111  67.575 1.00 74.05  ? 2363 ARG C CZ  1 
ATOM   4406 N NH1 . ARG C 1 60  ? 71.988  45.039  67.009 1.00 74.69  ? 2363 ARG C NH1 1 
ATOM   4407 N NH2 . ARG C 1 60  ? 73.448  45.957  68.519 1.00 73.73  ? 2363 ARG C NH2 1 
ATOM   4408 N N   . VAL C 1 61  ? 65.377  47.881  64.853 1.00 65.13  ? 2364 VAL C N   1 
ATOM   4409 C CA  . VAL C 1 61  ? 64.364  48.630  64.111 1.00 63.77  ? 2364 VAL C CA  1 
ATOM   4410 C C   . VAL C 1 61  ? 63.481  49.394  65.101 1.00 62.21  ? 2364 VAL C C   1 
ATOM   4411 O O   . VAL C 1 61  ? 63.010  48.832  66.078 1.00 62.63  ? 2364 VAL C O   1 
ATOM   4412 C CB  . VAL C 1 61  ? 63.485  47.690  63.253 1.00 64.22  ? 2364 VAL C CB  1 
ATOM   4413 C CG1 . VAL C 1 61  ? 62.370  48.479  62.579 1.00 64.32  ? 2364 VAL C CG1 1 
ATOM   4414 C CG2 . VAL C 1 61  ? 64.340  47.006  62.198 1.00 63.62  ? 2364 VAL C CG2 1 
ATOM   4415 N N   . PRO C 1 62  ? 63.266  50.695  64.861 1.00 61.00  ? 2365 PRO C N   1 
ATOM   4416 C CA  . PRO C 1 62  ? 62.453  51.574  65.706 1.00 60.77  ? 2365 PRO C CA  1 
ATOM   4417 C C   . PRO C 1 62  ? 61.049  51.056  65.987 1.00 61.35  ? 2365 PRO C C   1 
ATOM   4418 O O   . PRO C 1 62  ? 60.343  50.606  65.088 1.00 60.55  ? 2365 PRO C O   1 
ATOM   4419 C CB  . PRO C 1 62  ? 62.422  52.870  64.917 1.00 60.35  ? 2365 PRO C CB  1 
ATOM   4420 C CG  . PRO C 1 62  ? 63.742  52.870  64.246 1.00 60.81  ? 2365 PRO C CG  1 
ATOM   4421 C CD  . PRO C 1 62  ? 63.864  51.457  63.755 1.00 60.94  ? 2365 PRO C CD  1 
ATOM   4422 N N   . GLY C 1 63  ? 60.648  51.135  67.249 1.00 61.81  ? 2366 GLY C N   1 
ATOM   4423 C CA  . GLY C 1 63  ? 59.327  50.675  67.631 1.00 62.00  ? 2366 GLY C CA  1 
ATOM   4424 C C   . GLY C 1 63  ? 59.193  49.166  67.744 1.00 61.89  ? 2366 GLY C C   1 
ATOM   4425 O O   . GLY C 1 63  ? 58.222  48.671  68.317 1.00 62.02  ? 2366 GLY C O   1 
ATOM   4426 N N   . PHE C 1 64  ? 60.168  48.432  67.216 1.00 61.45  ? 2367 PHE C N   1 
ATOM   4427 C CA  . PHE C 1 64  ? 60.135  46.974  67.254 1.00 60.37  ? 2367 PHE C CA  1 
ATOM   4428 C C   . PHE C 1 64  ? 60.206  46.360  68.656 1.00 59.55  ? 2367 PHE C C   1 
ATOM   4429 O O   . PHE C 1 64  ? 59.422  45.473  68.983 1.00 59.70  ? 2367 PHE C O   1 
ATOM   4430 C CB  . PHE C 1 64  ? 61.260  46.401  66.401 1.00 61.31  ? 2367 PHE C CB  1 
ATOM   4431 C CG  . PHE C 1 64  ? 61.273  44.907  66.359 1.00 62.24  ? 2367 PHE C CG  1 
ATOM   4432 C CD1 . PHE C 1 64  ? 60.326  44.215  65.619 1.00 62.68  ? 2367 PHE C CD1 1 
ATOM   4433 C CD2 . PHE C 1 64  ? 62.211  44.186  67.092 1.00 62.98  ? 2367 PHE C CD2 1 
ATOM   4434 C CE1 . PHE C 1 64  ? 60.311  42.823  65.610 1.00 63.24  ? 2367 PHE C CE1 1 
ATOM   4435 C CE2 . PHE C 1 64  ? 62.205  42.786  67.091 1.00 62.74  ? 2367 PHE C CE2 1 
ATOM   4436 C CZ  . PHE C 1 64  ? 61.256  42.106  66.351 1.00 62.49  ? 2367 PHE C CZ  1 
ATOM   4437 N N   . VAL C 1 65  ? 61.140  46.808  69.487 1.00 58.59  ? 2368 VAL C N   1 
ATOM   4438 C CA  . VAL C 1 65  ? 61.235  46.245  70.834 1.00 58.75  ? 2368 VAL C CA  1 
ATOM   4439 C C   . VAL C 1 65  ? 60.179  46.776  71.805 1.00 57.95  ? 2368 VAL C C   1 
ATOM   4440 O O   . VAL C 1 65  ? 60.148  46.373  72.969 1.00 58.11  ? 2368 VAL C O   1 
ATOM   4441 C CB  . VAL C 1 65  ? 62.635  46.466  71.481 1.00 59.25  ? 2368 VAL C CB  1 
ATOM   4442 C CG1 . VAL C 1 65  ? 63.703  45.735  70.685 1.00 59.77  ? 2368 VAL C CG1 1 
ATOM   4443 C CG2 . VAL C 1 65  ? 62.946  47.952  71.577 1.00 59.53  ? 2368 VAL C CG2 1 
ATOM   4444 N N   . ASP C 1 66  ? 59.321  47.679  71.340 1.00 56.86  ? 2369 ASP C N   1 
ATOM   4445 C CA  . ASP C 1 66  ? 58.270  48.212  72.199 1.00 56.68  ? 2369 ASP C CA  1 
ATOM   4446 C C   . ASP C 1 66  ? 57.129  47.197  72.192 1.00 54.59  ? 2369 ASP C C   1 
ATOM   4447 O O   . ASP C 1 66  ? 56.087  47.408  72.806 1.00 53.97  ? 2369 ASP C O   1 
ATOM   4448 C CB  . ASP C 1 66  ? 57.769  49.567  71.676 1.00 60.35  ? 2369 ASP C CB  1 
ATOM   4449 C CG  . ASP C 1 66  ? 58.866  50.639  71.645 1.00 63.31  ? 2369 ASP C CG  1 
ATOM   4450 O OD1 . ASP C 1 66  ? 59.600  50.777  72.654 1.00 62.77  ? 2369 ASP C OD1 1 
ATOM   4451 O OD2 . ASP C 1 66  ? 58.981  51.352  70.612 1.00 64.24  ? 2369 ASP C OD2 1 
ATOM   4452 N N   . LEU C 1 67  ? 57.360  46.089  71.490 1.00 52.47  ? 2370 LEU C N   1 
ATOM   4453 C CA  . LEU C 1 67  ? 56.401  44.997  71.354 1.00 49.95  ? 2370 LEU C CA  1 
ATOM   4454 C C   . LEU C 1 67  ? 56.704  43.883  72.333 1.00 49.27  ? 2370 LEU C C   1 
ATOM   4455 O O   . LEU C 1 67  ? 57.792  43.822  72.892 1.00 49.85  ? 2370 LEU C O   1 
ATOM   4456 C CB  . LEU C 1 67  ? 56.470  44.414  69.949 1.00 49.33  ? 2370 LEU C CB  1 
ATOM   4457 C CG  . LEU C 1 67  ? 55.990  45.271  68.788 1.00 49.43  ? 2370 LEU C CG  1 
ATOM   4458 C CD1 . LEU C 1 67  ? 56.631  44.787  67.507 1.00 49.80  ? 2370 LEU C CD1 1 
ATOM   4459 C CD2 . LEU C 1 67  ? 54.483  45.203  68.699 1.00 49.79  ? 2370 LEU C CD2 1 
ATOM   4460 N N   . THR C 1 68  ? 55.734  42.995  72.533 1.00 48.91  ? 2371 THR C N   1 
ATOM   4461 C CA  . THR C 1 68  ? 55.909  41.855  73.428 1.00 47.87  ? 2371 THR C CA  1 
ATOM   4462 C C   . THR C 1 68  ? 56.882  40.889  72.771 1.00 48.02  ? 2371 THR C C   1 
ATOM   4463 O O   . THR C 1 68  ? 56.772  40.594  71.582 1.00 47.38  ? 2371 THR C O   1 
ATOM   4464 C CB  . THR C 1 68  ? 54.582  41.138  73.670 1.00 46.61  ? 2371 THR C CB  1 
ATOM   4465 O OG1 . THR C 1 68  ? 53.825  41.134  72.457 1.00 46.35  ? 2371 THR C OG1 1 
ATOM   4466 C CG2 . THR C 1 68  ? 53.791  41.837  74.752 1.00 46.85  ? 2371 THR C CG2 1 
ATOM   4467 N N   . LEU C 1 69  ? 57.839  40.399  73.545 1.00 48.06  ? 2372 LEU C N   1 
ATOM   4468 C CA  . LEU C 1 69  ? 58.833  39.495  73.003 1.00 48.48  ? 2372 LEU C CA  1 
ATOM   4469 C C   . LEU C 1 69  ? 58.230  38.503  72.031 1.00 49.18  ? 2372 LEU C C   1 
ATOM   4470 O O   . LEU C 1 69  ? 58.697  38.387  70.904 1.00 50.02  ? 2372 LEU C O   1 
ATOM   4471 C CB  . LEU C 1 69  ? 59.547  38.763  74.130 1.00 48.59  ? 2372 LEU C CB  1 
ATOM   4472 C CG  . LEU C 1 69  ? 60.174  39.733  75.132 1.00 48.51  ? 2372 LEU C CG  1 
ATOM   4473 C CD1 . LEU C 1 69  ? 61.017  38.961  76.124 1.00 48.10  ? 2372 LEU C CD1 1 
ATOM   4474 C CD2 . LEU C 1 69  ? 61.020  40.754  74.391 1.00 49.48  ? 2372 LEU C CD2 1 
ATOM   4475 N N   . HIS C 1 70  ? 57.179  37.806  72.441 1.00 49.03  ? 2373 HIS C N   1 
ATOM   4476 C CA  . HIS C 1 70  ? 56.574  36.835  71.549 1.00 49.84  ? 2373 HIS C CA  1 
ATOM   4477 C C   . HIS C 1 70  ? 56.108  37.391  70.211 1.00 50.35  ? 2373 HIS C C   1 
ATOM   4478 O O   . HIS C 1 70  ? 56.179  36.698  69.197 1.00 50.31  ? 2373 HIS C O   1 
ATOM   4479 C CB  . HIS C 1 70  ? 55.418  36.121  72.244 1.00 51.21  ? 2373 HIS C CB  1 
ATOM   4480 C CG  . HIS C 1 70  ? 55.858  35.015  73.152 1.00 52.56  ? 2373 HIS C CG  1 
ATOM   4481 N ND1 . HIS C 1 70  ? 56.082  35.198  74.500 1.00 53.88  ? 2373 HIS C ND1 1 
ATOM   4482 C CD2 . HIS C 1 70  ? 56.157  33.719  72.894 1.00 51.75  ? 2373 HIS C CD2 1 
ATOM   4483 C CE1 . HIS C 1 70  ? 56.500  34.063  75.031 1.00 53.41  ? 2373 HIS C CE1 1 
ATOM   4484 N NE2 . HIS C 1 70  ? 56.557  33.151  74.077 1.00 52.40  ? 2373 HIS C NE2 1 
ATOM   4485 N N   . ASP C 1 71  ? 55.630  38.632  70.198 1.00 51.55  ? 2374 ASP C N   1 
ATOM   4486 C CA  . ASP C 1 71  ? 55.162  39.235  68.955 1.00 51.49  ? 2374 ASP C CA  1 
ATOM   4487 C C   . ASP C 1 71  ? 56.348  39.617  68.101 1.00 50.35  ? 2374 ASP C C   1 
ATOM   4488 O O   . ASP C 1 71  ? 56.279  39.563  66.877 1.00 49.96  ? 2374 ASP C O   1 
ATOM   4489 C CB  . ASP C 1 71  ? 54.281  40.457  69.227 1.00 53.22  ? 2374 ASP C CB  1 
ATOM   4490 C CG  . ASP C 1 71  ? 52.863  40.072  69.638 1.00 56.08  ? 2374 ASP C CG  1 
ATOM   4491 O OD1 . ASP C 1 71  ? 52.703  39.438  70.699 1.00 57.94  ? 2374 ASP C OD1 1 
ATOM   4492 O OD2 . ASP C 1 71  ? 51.902  40.391  68.901 1.00 57.92  ? 2374 ASP C OD2 1 
ATOM   4493 N N   . GLN C 1 72  ? 57.440  39.997  68.753 1.00 49.59  ? 2375 GLN C N   1 
ATOM   4494 C CA  . GLN C 1 72  ? 58.662  40.355  68.041 1.00 49.03  ? 2375 GLN C CA  1 
ATOM   4495 C C   . GLN C 1 72  ? 59.123  39.105  67.304 1.00 48.87  ? 2375 GLN C C   1 
ATOM   4496 O O   . GLN C 1 72  ? 59.466  39.154  66.124 1.00 47.53  ? 2375 GLN C O   1 
ATOM   4497 C CB  . GLN C 1 72  ? 59.747  40.799  69.024 1.00 49.23  ? 2375 GLN C CB  1 
ATOM   4498 C CG  . GLN C 1 72  ? 59.414  42.067  69.782 1.00 48.53  ? 2375 GLN C CG  1 
ATOM   4499 C CD  . GLN C 1 72  ? 60.512  42.469  70.722 1.00 46.54  ? 2375 GLN C CD  1 
ATOM   4500 O OE1 . GLN C 1 72  ? 61.664  42.584  70.329 1.00 47.77  ? 2375 GLN C OE1 1 
ATOM   4501 N NE2 . GLN C 1 72  ? 60.165  42.689  71.971 1.00 46.57  ? 2375 GLN C NE2 1 
ATOM   4502 N N   . VAL C 1 73  ? 59.134  37.983  68.018 1.00 49.08  ? 2376 VAL C N   1 
ATOM   4503 C CA  . VAL C 1 73  ? 59.524  36.715  67.425 1.00 49.18  ? 2376 VAL C CA  1 
ATOM   4504 C C   . VAL C 1 73  ? 58.563  36.505  66.248 1.00 49.57  ? 2376 VAL C C   1 
ATOM   4505 O O   . VAL C 1 73  ? 58.983  36.449  65.087 1.00 50.43  ? 2376 VAL C O   1 
ATOM   4506 C CB  . VAL C 1 73  ? 59.370  35.555  68.439 1.00 48.94  ? 2376 VAL C CB  1 
ATOM   4507 C CG1 . VAL C 1 73  ? 60.085  34.316  67.935 1.00 49.02  ? 2376 VAL C CG1 1 
ATOM   4508 C CG2 . VAL C 1 73  ? 59.938  35.958  69.774 1.00 49.18  ? 2376 VAL C CG2 1 
ATOM   4509 N N   . HIS C 1 74  ? 57.272  36.418  66.556 1.00 49.04  ? 2377 HIS C N   1 
ATOM   4510 C CA  . HIS C 1 74  ? 56.226  36.238  65.550 1.00 49.91  ? 2377 HIS C CA  1 
ATOM   4511 C C   . HIS C 1 74  ? 56.481  37.038  64.263 1.00 50.29  ? 2377 HIS C C   1 
ATOM   4512 O O   . HIS C 1 74  ? 56.490  36.478  63.161 1.00 50.23  ? 2377 HIS C O   1 
ATOM   4513 C CB  . HIS C 1 74  ? 54.879  36.646  66.149 1.00 52.26  ? 2377 HIS C CB  1 
ATOM   4514 C CG  . HIS C 1 74  ? 53.740  36.566  65.186 1.00 53.80  ? 2377 HIS C CG  1 
ATOM   4515 N ND1 . HIS C 1 74  ? 53.674  37.339  64.047 1.00 53.75  ? 2377 HIS C ND1 1 
ATOM   4516 C CD2 . HIS C 1 74  ? 52.633  35.787  65.178 1.00 54.88  ? 2377 HIS C CD2 1 
ATOM   4517 C CE1 . HIS C 1 74  ? 52.578  37.036  63.375 1.00 55.47  ? 2377 HIS C CE1 1 
ATOM   4518 N NE2 . HIS C 1 74  ? 51.927  36.098  64.040 1.00 55.86  ? 2377 HIS C NE2 1 
ATOM   4519 N N   . LEU C 1 75  ? 56.680  38.350  64.401 1.00 50.17  ? 2378 LEU C N   1 
ATOM   4520 C CA  . LEU C 1 75  ? 56.939  39.202  63.241 1.00 48.70  ? 2378 LEU C CA  1 
ATOM   4521 C C   . LEU C 1 75  ? 58.080  38.646  62.417 1.00 48.23  ? 2378 LEU C C   1 
ATOM   4522 O O   . LEU C 1 75  ? 57.977  38.530  61.196 1.00 49.28  ? 2378 LEU C O   1 
ATOM   4523 C CB  . LEU C 1 75  ? 57.292  40.622  63.672 1.00 47.84  ? 2378 LEU C CB  1 
ATOM   4524 C CG  . LEU C 1 75  ? 56.163  41.519  64.170 1.00 46.87  ? 2378 LEU C CG  1 
ATOM   4525 C CD1 . LEU C 1 75  ? 56.722  42.908  64.454 1.00 47.00  ? 2378 LEU C CD1 1 
ATOM   4526 C CD2 . LEU C 1 75  ? 55.062  41.598  63.127 1.00 47.01  ? 2378 LEU C CD2 1 
ATOM   4527 N N   . LEU C 1 76  ? 59.163  38.305  63.102 1.00 46.76  ? 2379 LEU C N   1 
ATOM   4528 C CA  . LEU C 1 76  ? 60.339  37.768  62.458 1.00 46.78  ? 2379 LEU C CA  1 
ATOM   4529 C C   . LEU C 1 76  ? 60.081  36.491  61.703 1.00 46.97  ? 2379 LEU C C   1 
ATOM   4530 O O   . LEU C 1 76  ? 60.215  36.458  60.489 1.00 46.45  ? 2379 LEU C O   1 
ATOM   4531 C CB  . LEU C 1 76  ? 61.430  37.529  63.487 1.00 48.62  ? 2379 LEU C CB  1 
ATOM   4532 C CG  . LEU C 1 76  ? 62.139  38.796  63.975 1.00 50.59  ? 2379 LEU C CG  1 
ATOM   4533 C CD1 . LEU C 1 76  ? 62.795  38.554  65.339 1.00 49.19  ? 2379 LEU C CD1 1 
ATOM   4534 C CD2 . LEU C 1 76  ? 63.149  39.231  62.923 1.00 49.47  ? 2379 LEU C CD2 1 
ATOM   4535 N N   . GLU C 1 77  ? 59.707  35.433  62.405 1.00 47.48  ? 2380 GLU C N   1 
ATOM   4536 C CA  . GLU C 1 77  ? 59.480  34.178  61.715 1.00 49.29  ? 2380 GLU C CA  1 
ATOM   4537 C C   . GLU C 1 77  ? 58.386  34.314  60.686 1.00 50.16  ? 2380 GLU C C   1 
ATOM   4538 O O   . GLU C 1 77  ? 58.273  33.482  59.792 1.00 51.51  ? 2380 GLU C O   1 
ATOM   4539 C CB  . GLU C 1 77  ? 59.141  33.059  62.693 1.00 49.66  ? 2380 GLU C CB  1 
ATOM   4540 C CG  . GLU C 1 77  ? 57.818  33.214  63.380 1.00 53.54  ? 2380 GLU C CG  1 
ATOM   4541 C CD  . GLU C 1 77  ? 57.806  32.531  64.733 1.00 55.21  ? 2380 GLU C CD  1 
ATOM   4542 O OE1 . GLU C 1 77  ? 56.747  32.527  65.390 1.00 57.01  ? 2380 GLU C OE1 1 
ATOM   4543 O OE2 . GLU C 1 77  ? 58.863  32.005  65.142 1.00 55.28  ? 2380 GLU C OE2 1 
ATOM   4544 N N   . CYS C 1 78  ? 57.583  35.365  60.784 1.00 50.91  ? 2381 CYS C N   1 
ATOM   4545 C CA  . CYS C 1 78  ? 56.524  35.527  59.803 1.00 51.76  ? 2381 CYS C CA  1 
ATOM   4546 C C   . CYS C 1 78  ? 57.012  36.239  58.540 1.00 51.17  ? 2381 CYS C C   1 
ATOM   4547 O O   . CYS C 1 78  ? 56.361  36.180  57.496 1.00 50.82  ? 2381 CYS C O   1 
ATOM   4548 C CB  . CYS C 1 78  ? 55.339  36.284  60.398 1.00 51.62  ? 2381 CYS C CB  1 
ATOM   4549 S SG  . CYS C 1 78  ? 53.862  36.143  59.355 1.00 60.31  ? 2381 CYS C SG  1 
ATOM   4550 N N   . ALA C 1 79  ? 58.169  36.892  58.627 1.00 51.11  ? 2382 ALA C N   1 
ATOM   4551 C CA  . ALA C 1 79  ? 58.712  37.622  57.479 1.00 50.80  ? 2382 ALA C CA  1 
ATOM   4552 C C   . ALA C 1 79  ? 60.189  37.373  57.183 1.00 50.01  ? 2382 ALA C C   1 
ATOM   4553 O O   . ALA C 1 79  ? 60.731  37.939  56.246 1.00 49.43  ? 2382 ALA C O   1 
ATOM   4554 C CB  . ALA C 1 79  ? 58.477  39.118  57.667 1.00 50.66  ? 2382 ALA C CB  1 
ATOM   4555 N N   . TRP C 1 80  ? 60.831  36.521  57.972 1.00 50.15  ? 2383 TRP C N   1 
ATOM   4556 C CA  . TRP C 1 80  ? 62.247  36.216  57.797 1.00 50.01  ? 2383 TRP C CA  1 
ATOM   4557 C C   . TRP C 1 80  ? 62.691  35.990  56.353 1.00 48.84  ? 2383 TRP C C   1 
ATOM   4558 O O   . TRP C 1 80  ? 63.667  36.578  55.898 1.00 48.64  ? 2383 TRP C O   1 
ATOM   4559 C CB  . TRP C 1 80  ? 62.634  34.992  58.631 1.00 51.28  ? 2383 TRP C CB  1 
ATOM   4560 C CG  . TRP C 1 80  ? 62.087  33.705  58.095 1.00 53.40  ? 2383 TRP C CG  1 
ATOM   4561 C CD1 . TRP C 1 80  ? 60.814  33.226  58.230 1.00 52.69  ? 2383 TRP C CD1 1 
ATOM   4562 C CD2 . TRP C 1 80  ? 62.788  32.756  57.279 1.00 54.40  ? 2383 TRP C CD2 1 
ATOM   4563 N NE1 . TRP C 1 80  ? 60.678  32.041  57.547 1.00 52.70  ? 2383 TRP C NE1 1 
ATOM   4564 C CE2 . TRP C 1 80  ? 61.874  31.731  56.954 1.00 54.07  ? 2383 TRP C CE2 1 
ATOM   4565 C CE3 . TRP C 1 80  ? 64.101  32.677  56.788 1.00 54.07  ? 2383 TRP C CE3 1 
ATOM   4566 C CZ2 . TRP C 1 80  ? 62.232  30.637  56.160 1.00 54.31  ? 2383 TRP C CZ2 1 
ATOM   4567 C CZ3 . TRP C 1 80  ? 64.455  31.592  56.002 1.00 53.99  ? 2383 TRP C CZ3 1 
ATOM   4568 C CH2 . TRP C 1 80  ? 63.523  30.586  55.697 1.00 54.23  ? 2383 TRP C CH2 1 
ATOM   4569 N N   . LEU C 1 81  ? 61.990  35.133  55.629 1.00 48.89  ? 2384 LEU C N   1 
ATOM   4570 C CA  . LEU C 1 81  ? 62.374  34.866  54.248 1.00 50.04  ? 2384 LEU C CA  1 
ATOM   4571 C C   . LEU C 1 81  ? 62.118  36.101  53.389 1.00 50.05  ? 2384 LEU C C   1 
ATOM   4572 O O   . LEU C 1 81  ? 62.946  36.471  52.554 1.00 50.17  ? 2384 LEU C O   1 
ATOM   4573 C CB  . LEU C 1 81  ? 61.594  33.673  53.687 1.00 49.72  ? 2384 LEU C CB  1 
ATOM   4574 C CG  . LEU C 1 81  ? 61.949  33.330  52.239 1.00 50.19  ? 2384 LEU C CG  1 
ATOM   4575 C CD1 . LEU C 1 81  ? 63.406  32.920  52.189 1.00 51.00  ? 2384 LEU C CD1 1 
ATOM   4576 C CD2 . LEU C 1 81  ? 61.058  32.215  51.694 1.00 49.91  ? 2384 LEU C CD2 1 
ATOM   4577 N N   . GLU C 1 82  ? 60.968  36.733  53.616 1.00 49.88  ? 2385 GLU C N   1 
ATOM   4578 C CA  . GLU C 1 82  ? 60.547  37.940  52.898 1.00 48.68  ? 2385 GLU C CA  1 
ATOM   4579 C C   . GLU C 1 82  ? 61.631  39.024  52.998 1.00 47.26  ? 2385 GLU C C   1 
ATOM   4580 O O   . GLU C 1 82  ? 61.845  39.809  52.076 1.00 44.98  ? 2385 GLU C O   1 
ATOM   4581 C CB  . GLU C 1 82  ? 59.226  38.435  53.499 1.00 48.90  ? 2385 GLU C CB  1 
ATOM   4582 C CG  . GLU C 1 82  ? 58.338  39.249  52.571 1.00 51.41  ? 2385 GLU C CG  1 
ATOM   4583 C CD  . GLU C 1 82  ? 56.963  39.494  53.179 1.00 54.58  ? 2385 GLU C CD  1 
ATOM   4584 O OE1 . GLU C 1 82  ? 56.177  40.289  52.618 1.00 55.36  ? 2385 GLU C OE1 1 
ATOM   4585 O OE2 . GLU C 1 82  ? 56.666  38.880  54.229 1.00 56.71  ? 2385 GLU C OE2 1 
ATOM   4586 N N   . ILE C 1 83  ? 62.308  39.060  54.136 1.00 47.30  ? 2386 ILE C N   1 
ATOM   4587 C CA  . ILE C 1 83  ? 63.383  40.008  54.342 1.00 48.53  ? 2386 ILE C CA  1 
ATOM   4588 C C   . ILE C 1 83  ? 64.625  39.444  53.648 1.00 50.02  ? 2386 ILE C C   1 
ATOM   4589 O O   . ILE C 1 83  ? 65.233  40.120  52.822 1.00 50.87  ? 2386 ILE C O   1 
ATOM   4590 C CB  . ILE C 1 83  ? 63.666  40.215  55.840 1.00 47.72  ? 2386 ILE C CB  1 
ATOM   4591 C CG1 . ILE C 1 83  ? 62.408  40.743  56.528 1.00 46.95  ? 2386 ILE C CG1 1 
ATOM   4592 C CG2 . ILE C 1 83  ? 64.810  41.200  56.026 1.00 46.84  ? 2386 ILE C CG2 1 
ATOM   4593 C CD1 . ILE C 1 83  ? 62.537  40.869  58.022 1.00 45.65  ? 2386 ILE C CD1 1 
ATOM   4594 N N   . LEU C 1 84  ? 64.992  38.205  53.965 1.00 50.67  ? 2387 LEU C N   1 
ATOM   4595 C CA  . LEU C 1 84  ? 66.156  37.580  53.331 1.00 51.84  ? 2387 LEU C CA  1 
ATOM   4596 C C   . LEU C 1 84  ? 66.229  37.840  51.825 1.00 52.67  ? 2387 LEU C C   1 
ATOM   4597 O O   . LEU C 1 84  ? 67.319  37.987  51.274 1.00 53.30  ? 2387 LEU C O   1 
ATOM   4598 C CB  . LEU C 1 84  ? 66.156  36.064  53.556 1.00 51.85  ? 2387 LEU C CB  1 
ATOM   4599 C CG  . LEU C 1 84  ? 66.953  35.529  54.749 1.00 51.61  ? 2387 LEU C CG  1 
ATOM   4600 C CD1 . LEU C 1 84  ? 66.788  34.016  54.854 1.00 50.72  ? 2387 LEU C CD1 1 
ATOM   4601 C CD2 . LEU C 1 84  ? 68.407  35.894  54.576 1.00 51.10  ? 2387 LEU C CD2 1 
ATOM   4602 N N   . MET C 1 85  ? 65.077  37.900  51.161 1.00 52.93  ? 2388 MET C N   1 
ATOM   4603 C CA  . MET C 1 85  ? 65.053  38.125  49.716 1.00 53.04  ? 2388 MET C CA  1 
ATOM   4604 C C   . MET C 1 85  ? 65.233  39.588  49.287 1.00 53.94  ? 2388 MET C C   1 
ATOM   4605 O O   . MET C 1 85  ? 65.993  39.854  48.359 1.00 56.09  ? 2388 MET C O   1 
ATOM   4606 C CB  . MET C 1 85  ? 63.757  37.572  49.099 1.00 52.36  ? 2388 MET C CB  1 
ATOM   4607 C CG  . MET C 1 85  ? 63.563  36.061  49.200 1.00 50.63  ? 2388 MET C CG  1 
ATOM   4608 S SD  . MET C 1 85  ? 62.011  35.518  48.407 1.00 52.18  ? 2388 MET C SD  1 
ATOM   4609 C CE  . MET C 1 85  ? 62.245  33.753  48.279 1.00 50.44  ? 2388 MET C CE  1 
ATOM   4610 N N   . ILE C 1 86  ? 64.550  40.538  49.930 1.00 53.29  ? 2389 ILE C N   1 
ATOM   4611 C CA  . ILE C 1 86  ? 64.700  41.943  49.528 1.00 52.11  ? 2389 ILE C CA  1 
ATOM   4612 C C   . ILE C 1 86  ? 66.159  42.364  49.614 1.00 51.97  ? 2389 ILE C C   1 
ATOM   4613 O O   . ILE C 1 86  ? 66.606  43.221  48.866 1.00 50.94  ? 2389 ILE C O   1 
ATOM   4614 C CB  . ILE C 1 86  ? 63.872  42.914  50.403 1.00 51.95  ? 2389 ILE C CB  1 
ATOM   4615 C CG1 . ILE C 1 86  ? 63.843  44.292  49.740 1.00 50.62  ? 2389 ILE C CG1 1 
ATOM   4616 C CG2 . ILE C 1 86  ? 64.496  43.054  51.786 1.00 49.70  ? 2389 ILE C CG2 1 
ATOM   4617 C CD1 . ILE C 1 86  ? 63.135  45.349  50.550 1.00 50.28  ? 2389 ILE C CD1 1 
ATOM   4618 N N   . GLY C 1 87  ? 66.888  41.761  50.546 1.00 52.93  ? 2390 GLY C N   1 
ATOM   4619 C CA  . GLY C 1 87  ? 68.298  42.061  50.691 1.00 54.61  ? 2390 GLY C CA  1 
ATOM   4620 C C   . GLY C 1 87  ? 69.026  41.502  49.483 1.00 55.78  ? 2390 GLY C C   1 
ATOM   4621 O O   . GLY C 1 87  ? 69.663  42.244  48.740 1.00 56.62  ? 2390 GLY C O   1 
ATOM   4622 N N   . LEU C 1 88  ? 68.926  40.190  49.283 1.00 56.40  ? 2391 LEU C N   1 
ATOM   4623 C CA  . LEU C 1 88  ? 69.558  39.517  48.145 1.00 57.27  ? 2391 LEU C CA  1 
ATOM   4624 C C   . LEU C 1 88  ? 69.372  40.317  46.865 1.00 58.79  ? 2391 LEU C C   1 
ATOM   4625 O O   . LEU C 1 88  ? 70.319  40.539  46.110 1.00 58.90  ? 2391 LEU C O   1 
ATOM   4626 C CB  . LEU C 1 88  ? 68.943  38.128  47.950 1.00 56.52  ? 2391 LEU C CB  1 
ATOM   4627 C CG  . LEU C 1 88  ? 69.193  37.451  46.602 1.00 55.54  ? 2391 LEU C CG  1 
ATOM   4628 C CD1 . LEU C 1 88  ? 70.662  37.119  46.468 1.00 55.72  ? 2391 LEU C CD1 1 
ATOM   4629 C CD2 . LEU C 1 88  ? 68.360  36.192  46.495 1.00 54.90  ? 2391 LEU C CD2 1 
ATOM   4630 N N   . VAL C 1 89  ? 68.130  40.727  46.628 1.00 60.97  ? 2392 VAL C N   1 
ATOM   4631 C CA  . VAL C 1 89  ? 67.750  41.510  45.460 1.00 62.68  ? 2392 VAL C CA  1 
ATOM   4632 C C   . VAL C 1 89  ? 68.494  42.851  45.445 1.00 63.55  ? 2392 VAL C C   1 
ATOM   4633 O O   . VAL C 1 89  ? 68.909  43.333  44.397 1.00 62.70  ? 2392 VAL C O   1 
ATOM   4634 C CB  . VAL C 1 89  ? 66.221  41.735  45.466 1.00 62.50  ? 2392 VAL C CB  1 
ATOM   4635 C CG1 . VAL C 1 89  ? 65.811  42.692  44.364 1.00 63.83  ? 2392 VAL C CG1 1 
ATOM   4636 C CG2 . VAL C 1 89  ? 65.518  40.396  45.298 1.00 61.71  ? 2392 VAL C CG2 1 
ATOM   4637 N N   . TRP C 1 90  ? 68.663  43.445  46.618 1.00 65.87  ? 2393 TRP C N   1 
ATOM   4638 C CA  . TRP C 1 90  ? 69.372  44.710  46.734 1.00 68.70  ? 2393 TRP C CA  1 
ATOM   4639 C C   . TRP C 1 90  ? 70.837  44.493  46.370 1.00 70.59  ? 2393 TRP C C   1 
ATOM   4640 O O   . TRP C 1 90  ? 71.421  45.283  45.631 1.00 71.88  ? 2393 TRP C O   1 
ATOM   4641 C CB  . TRP C 1 90  ? 69.252  45.252  48.161 1.00 69.29  ? 2393 TRP C CB  1 
ATOM   4642 C CG  . TRP C 1 90  ? 70.097  46.456  48.431 1.00 70.83  ? 2393 TRP C CG  1 
ATOM   4643 C CD1 . TRP C 1 90  ? 71.281  46.490  49.111 1.00 70.77  ? 2393 TRP C CD1 1 
ATOM   4644 C CD2 . TRP C 1 90  ? 69.832  47.806  48.017 1.00 71.87  ? 2393 TRP C CD2 1 
ATOM   4645 N NE1 . TRP C 1 90  ? 71.770  47.774  49.149 1.00 71.15  ? 2393 TRP C NE1 1 
ATOM   4646 C CE2 . TRP C 1 90  ? 70.903  48.604  48.486 1.00 71.52  ? 2393 TRP C CE2 1 
ATOM   4647 C CE3 . TRP C 1 90  ? 68.795  48.419  47.294 1.00 72.09  ? 2393 TRP C CE3 1 
ATOM   4648 C CZ2 . TRP C 1 90  ? 70.968  49.988  48.257 1.00 70.56  ? 2393 TRP C CZ2 1 
ATOM   4649 C CZ3 . TRP C 1 90  ? 68.862  49.799  47.067 1.00 72.01  ? 2393 TRP C CZ3 1 
ATOM   4650 C CH2 . TRP C 1 90  ? 69.943  50.564  47.549 1.00 70.81  ? 2393 TRP C CH2 1 
ATOM   4651 N N   . ARG C 1 91  ? 71.427  43.418  46.885 1.00 71.78  ? 2394 ARG C N   1 
ATOM   4652 C CA  . ARG C 1 91  ? 72.822  43.100  46.590 1.00 73.07  ? 2394 ARG C CA  1 
ATOM   4653 C C   . ARG C 1 91  ? 72.999  42.765  45.114 1.00 73.98  ? 2394 ARG C C   1 
ATOM   4654 O O   . ARG C 1 91  ? 74.121  42.620  44.635 1.00 74.90  ? 2394 ARG C O   1 
ATOM   4655 C CB  . ARG C 1 91  ? 73.294  41.897  47.413 1.00 73.11  ? 2394 ARG C CB  1 
ATOM   4656 C CG  . ARG C 1 91  ? 73.333  42.116  48.917 1.00 74.20  ? 2394 ARG C CG  1 
ATOM   4657 C CD  . ARG C 1 91  ? 73.959  40.913  49.628 1.00 74.36  ? 2394 ARG C CD  1 
ATOM   4658 N NE  . ARG C 1 91  ? 73.081  39.745  49.678 1.00 75.11  ? 2394 ARG C NE  1 
ATOM   4659 C CZ  . ARG C 1 91  ? 71.989  39.660  50.436 1.00 76.07  ? 2394 ARG C CZ  1 
ATOM   4660 N NH1 . ARG C 1 91  ? 71.633  40.675  51.210 1.00 75.99  ? 2394 ARG C NH1 1 
ATOM   4661 N NH2 . ARG C 1 91  ? 71.256  38.556  50.432 1.00 76.81  ? 2394 ARG C NH2 1 
ATOM   4662 N N   . SER C 1 92  ? 71.890  42.648  44.394 1.00 74.76  ? 2395 SER C N   1 
ATOM   4663 C CA  . SER C 1 92  ? 71.936  42.304  42.980 1.00 75.56  ? 2395 SER C CA  1 
ATOM   4664 C C   . SER C 1 92  ? 71.622  43.474  42.045 1.00 76.72  ? 2395 SER C C   1 
ATOM   4665 O O   . SER C 1 92  ? 71.859  43.384  40.836 1.00 76.94  ? 2395 SER C O   1 
ATOM   4666 C CB  . SER C 1 92  ? 70.975  41.145  42.714 1.00 75.22  ? 2395 SER C CB  1 
ATOM   4667 O OG  . SER C 1 92  ? 71.246  40.064  43.593 1.00 74.42  ? 2395 SER C OG  1 
ATOM   4668 N N   . MET C 1 93  ? 71.083  44.558  42.606 1.00 77.81  ? 2396 MET C N   1 
ATOM   4669 C CA  . MET C 1 93  ? 70.738  45.763  41.844 1.00 78.66  ? 2396 MET C CA  1 
ATOM   4670 C C   . MET C 1 93  ? 71.614  45.936  40.602 1.00 79.83  ? 2396 MET C C   1 
ATOM   4671 O O   . MET C 1 93  ? 71.152  45.796  39.469 1.00 79.59  ? 2396 MET C O   1 
ATOM   4672 C CB  . MET C 1 93  ? 70.899  46.999  42.736 1.00 78.23  ? 2396 MET C CB  1 
ATOM   4673 C CG  . MET C 1 93  ? 69.645  47.475  43.434 1.00 78.00  ? 2396 MET C CG  1 
ATOM   4674 S SD  . MET C 1 93  ? 68.741  48.636  42.403 1.00 79.00  ? 2396 MET C SD  1 
ATOM   4675 C CE  . MET C 1 93  ? 69.431  50.210  42.942 1.00 78.60  ? 2396 MET C CE  1 
ATOM   4676 N N   . GLU C 1 94  ? 72.888  46.232  40.837 1.00 81.26  ? 2397 GLU C N   1 
ATOM   4677 C CA  . GLU C 1 94  ? 73.858  46.451  39.774 1.00 82.07  ? 2397 GLU C CA  1 
ATOM   4678 C C   . GLU C 1 94  ? 74.087  45.246  38.871 1.00 82.00  ? 2397 GLU C C   1 
ATOM   4679 O O   . GLU C 1 94  ? 73.673  45.258  37.715 1.00 82.27  ? 2397 GLU C O   1 
ATOM   4680 C CB  . GLU C 1 94  ? 75.176  46.912  40.387 1.00 82.67  ? 2397 GLU C CB  1 
ATOM   4681 C CG  . GLU C 1 94  ? 75.035  48.222  41.135 1.00 84.96  ? 2397 GLU C CG  1 
ATOM   4682 C CD  . GLU C 1 94  ? 76.290  48.605  41.882 1.00 87.11  ? 2397 GLU C CD  1 
ATOM   4683 O OE1 . GLU C 1 94  ? 76.725  47.813  42.750 1.00 88.21  ? 2397 GLU C OE1 1 
ATOM   4684 O OE2 . GLU C 1 94  ? 76.839  49.695  41.604 1.00 87.70  ? 2397 GLU C OE2 1 
ATOM   4685 N N   . HIS C 1 95  ? 74.744  44.216  39.395 1.00 81.77  ? 2398 HIS C N   1 
ATOM   4686 C CA  . HIS C 1 95  ? 75.029  43.001  38.630 1.00 82.21  ? 2398 HIS C CA  1 
ATOM   4687 C C   . HIS C 1 95  ? 73.766  42.444  37.972 1.00 81.64  ? 2398 HIS C C   1 
ATOM   4688 O O   . HIS C 1 95  ? 73.005  41.698  38.592 1.00 81.66  ? 2398 HIS C O   1 
ATOM   4689 C CB  . HIS C 1 95  ? 75.636  41.955  39.559 1.00 83.14  ? 2398 HIS C CB  1 
ATOM   4690 C CG  . HIS C 1 95  ? 76.658  42.520  40.489 1.00 84.54  ? 2398 HIS C CG  1 
ATOM   4691 N ND1 . HIS C 1 95  ? 76.400  43.604  41.301 1.00 85.38  ? 2398 HIS C ND1 1 
ATOM   4692 C CD2 . HIS C 1 95  ? 77.945  42.174  40.720 1.00 84.81  ? 2398 HIS C CD2 1 
ATOM   4693 C CE1 . HIS C 1 95  ? 77.484  43.903  41.992 1.00 85.02  ? 2398 HIS C CE1 1 
ATOM   4694 N NE2 . HIS C 1 95  ? 78.437  43.050  41.658 1.00 86.35  ? 2398 HIS C NE2 1 
ATOM   4695 N N   . PRO C 1 96  ? 73.539  42.785  36.690 1.00 80.83  ? 2399 PRO C N   1 
ATOM   4696 C CA  . PRO C 1 96  ? 72.356  42.319  35.959 1.00 79.35  ? 2399 PRO C CA  1 
ATOM   4697 C C   . PRO C 1 96  ? 72.339  40.823  35.651 1.00 77.97  ? 2399 PRO C C   1 
ATOM   4698 O O   . PRO C 1 96  ? 73.384  40.204  35.453 1.00 77.26  ? 2399 PRO C O   1 
ATOM   4699 C CB  . PRO C 1 96  ? 72.385  43.175  34.699 1.00 79.23  ? 2399 PRO C CB  1 
ATOM   4700 C CG  . PRO C 1 96  ? 73.849  43.278  34.430 1.00 79.80  ? 2399 PRO C CG  1 
ATOM   4701 C CD  . PRO C 1 96  ? 74.435  43.552  35.800 1.00 80.03  ? 2399 PRO C CD  1 
ATOM   4702 N N   . GLY C 1 97  ? 71.139  40.252  35.613 1.00 77.01  ? 2400 GLY C N   1 
ATOM   4703 C CA  . GLY C 1 97  ? 70.997  38.835  35.323 1.00 76.34  ? 2400 GLY C CA  1 
ATOM   4704 C C   . GLY C 1 97  ? 71.698  37.921  36.316 1.00 75.51  ? 2400 GLY C C   1 
ATOM   4705 O O   . GLY C 1 97  ? 71.860  36.723  36.072 1.00 73.80  ? 2400 GLY C O   1 
ATOM   4706 N N   . LYS C 1 98  ? 72.106  38.485  37.447 1.00 75.19  ? 2401 LYS C N   1 
ATOM   4707 C CA  . LYS C 1 98  ? 72.793  37.711  38.467 1.00 74.52  ? 2401 LYS C CA  1 
ATOM   4708 C C   . LYS C 1 98  ? 72.306  38.065  39.867 1.00 73.69  ? 2401 LYS C C   1 
ATOM   4709 O O   . LYS C 1 98  ? 72.127  39.238  40.191 1.00 74.04  ? 2401 LYS C O   1 
ATOM   4710 C CB  . LYS C 1 98  ? 74.296  37.959  38.366 1.00 75.50  ? 2401 LYS C CB  1 
ATOM   4711 C CG  . LYS C 1 98  ? 74.858  37.665  36.991 1.00 77.42  ? 2401 LYS C CG  1 
ATOM   4712 C CD  . LYS C 1 98  ? 76.360  37.905  36.922 1.00 78.51  ? 2401 LYS C CD  1 
ATOM   4713 C CE  . LYS C 1 98  ? 76.882  37.694  35.504 1.00 78.87  ? 2401 LYS C CE  1 
ATOM   4714 N NZ  . LYS C 1 98  ? 76.571  36.331  34.972 1.00 80.03  ? 2401 LYS C NZ  1 
ATOM   4715 N N   . LEU C 1 99  ? 72.085  37.043  40.689 1.00 72.45  ? 2402 LEU C N   1 
ATOM   4716 C CA  . LEU C 1 99  ? 71.635  37.242  42.064 1.00 71.75  ? 2402 LEU C CA  1 
ATOM   4717 C C   . LEU C 1 99  ? 72.865  37.129  42.955 1.00 71.08  ? 2402 LEU C C   1 
ATOM   4718 O O   . LEU C 1 99  ? 73.397  36.037  43.168 1.00 70.87  ? 2402 LEU C O   1 
ATOM   4719 C CB  . LEU C 1 99  ? 70.594  36.178  42.440 1.00 71.62  ? 2402 LEU C CB  1 
ATOM   4720 C CG  . LEU C 1 99  ? 69.299  36.152  41.608 1.00 71.05  ? 2402 LEU C CG  1 
ATOM   4721 C CD1 . LEU C 1 99  ? 68.498  34.909  41.951 1.00 70.00  ? 2402 LEU C CD1 1 
ATOM   4722 C CD2 . LEU C 1 99  ? 68.474  37.410  41.867 1.00 70.17  ? 2402 LEU C CD2 1 
ATOM   4723 N N   . LEU C 1 100 ? 73.319  38.265  43.471 1.00 70.01  ? 2403 LEU C N   1 
ATOM   4724 C CA  . LEU C 1 100 ? 74.513  38.291  44.301 1.00 70.07  ? 2403 LEU C CA  1 
ATOM   4725 C C   . LEU C 1 100 ? 74.258  37.811  45.723 1.00 70.08  ? 2403 LEU C C   1 
ATOM   4726 O O   . LEU C 1 100 ? 74.145  38.620  46.647 1.00 71.33  ? 2403 LEU C O   1 
ATOM   4727 C CB  . LEU C 1 100 ? 75.093  39.710  44.318 1.00 69.63  ? 2403 LEU C CB  1 
ATOM   4728 C CG  . LEU C 1 100 ? 76.594  39.883  44.573 1.00 68.58  ? 2403 LEU C CG  1 
ATOM   4729 C CD1 . LEU C 1 100 ? 76.975  41.315  44.276 1.00 68.71  ? 2403 LEU C CD1 1 
ATOM   4730 C CD2 . LEU C 1 100 ? 76.947  39.527  45.998 1.00 68.00  ? 2403 LEU C CD2 1 
ATOM   4731 N N   . PHE C 1 101 ? 74.164  36.497  45.905 1.00 69.60  ? 2404 PHE C N   1 
ATOM   4732 C CA  . PHE C 1 101 ? 73.935  35.962  47.238 1.00 69.54  ? 2404 PHE C CA  1 
ATOM   4733 C C   . PHE C 1 101 ? 75.023  36.493  48.135 1.00 70.23  ? 2404 PHE C C   1 
ATOM   4734 O O   . PHE C 1 101 ? 74.745  37.176  49.116 1.00 69.76  ? 2404 PHE C O   1 
ATOM   4735 C CB  . PHE C 1 101 ? 73.933  34.435  47.221 1.00 68.43  ? 2404 PHE C CB  1 
ATOM   4736 C CG  . PHE C 1 101 ? 72.659  33.864  46.700 1.00 67.88  ? 2404 PHE C CG  1 
ATOM   4737 C CD1 . PHE C 1 101 ? 72.322  33.999  45.358 1.00 67.89  ? 2404 PHE C CD1 1 
ATOM   4738 C CD2 . PHE C 1 101 ? 71.746  33.280  47.563 1.00 67.17  ? 2404 PHE C CD2 1 
ATOM   4739 C CE1 . PHE C 1 101 ? 71.091  33.567  44.886 1.00 67.51  ? 2404 PHE C CE1 1 
ATOM   4740 C CE2 . PHE C 1 101 ? 70.510  32.843  47.103 1.00 66.69  ? 2404 PHE C CE2 1 
ATOM   4741 C CZ  . PHE C 1 101 ? 70.181  32.989  45.763 1.00 67.08  ? 2404 PHE C CZ  1 
ATOM   4742 N N   . ALA C 1 102 ? 76.264  36.192  47.775 1.00 71.75  ? 2405 ALA C N   1 
ATOM   4743 C CA  . ALA C 1 102 ? 77.427  36.660  48.520 1.00 73.39  ? 2405 ALA C CA  1 
ATOM   4744 C C   . ALA C 1 102 ? 78.426  37.220  47.507 1.00 74.74  ? 2405 ALA C C   1 
ATOM   4745 O O   . ALA C 1 102 ? 78.307  36.957  46.306 1.00 74.27  ? 2405 ALA C O   1 
ATOM   4746 C CB  . ALA C 1 102 ? 78.051  35.512  49.299 1.00 72.23  ? 2405 ALA C CB  1 
ATOM   4747 N N   . PRO C 1 103 ? 79.402  38.027  47.966 1.00 76.40  ? 2406 PRO C N   1 
ATOM   4748 C CA  . PRO C 1 103 ? 80.362  38.559  46.995 1.00 77.76  ? 2406 PRO C CA  1 
ATOM   4749 C C   . PRO C 1 103 ? 81.133  37.403  46.355 1.00 78.82  ? 2406 PRO C C   1 
ATOM   4750 O O   . PRO C 1 103 ? 81.460  37.435  45.162 1.00 78.58  ? 2406 PRO C O   1 
ATOM   4751 C CB  . PRO C 1 103 ? 81.253  39.461  47.849 1.00 78.07  ? 2406 PRO C CB  1 
ATOM   4752 C CG  . PRO C 1 103 ? 80.318  39.941  48.915 1.00 77.35  ? 2406 PRO C CG  1 
ATOM   4753 C CD  . PRO C 1 103 ? 79.595  38.658  49.284 1.00 77.06  ? 2406 PRO C CD  1 
ATOM   4754 N N   . ASN C 1 104 ? 81.409  36.377  47.158 1.00 79.13  ? 2407 ASN C N   1 
ATOM   4755 C CA  . ASN C 1 104 ? 82.125  35.203  46.678 1.00 79.91  ? 2407 ASN C CA  1 
ATOM   4756 C C   . ASN C 1 104 ? 81.169  34.128  46.164 1.00 79.53  ? 2407 ASN C C   1 
ATOM   4757 O O   . ASN C 1 104 ? 81.598  33.065  45.721 1.00 79.60  ? 2407 ASN C O   1 
ATOM   4758 C CB  . ASN C 1 104 ? 82.997  34.622  47.787 1.00 81.46  ? 2407 ASN C CB  1 
ATOM   4759 C CG  . ASN C 1 104 ? 82.226  34.392  49.070 1.00 83.17  ? 2407 ASN C CG  1 
ATOM   4760 O OD1 . ASN C 1 104 ? 81.089  33.917  49.050 1.00 84.35  ? 2407 ASN C OD1 1 
ATOM   4761 N ND2 . ASN C 1 104 ? 82.847  34.718  50.198 1.00 84.12  ? 2407 ASN C ND2 1 
ATOM   4762 N N   . LEU C 1 105 ? 79.872  34.403  46.237 1.00 79.25  ? 2408 LEU C N   1 
ATOM   4763 C CA  . LEU C 1 105 ? 78.871  33.463  45.752 1.00 79.12  ? 2408 LEU C CA  1 
ATOM   4764 C C   . LEU C 1 105 ? 77.888  34.220  44.869 1.00 79.56  ? 2408 LEU C C   1 
ATOM   4765 O O   . LEU C 1 105 ? 76.860  34.715  45.339 1.00 80.50  ? 2408 LEU C O   1 
ATOM   4766 C CB  . LEU C 1 105 ? 78.140  32.807  46.922 1.00 79.20  ? 2408 LEU C CB  1 
ATOM   4767 C CG  . LEU C 1 105 ? 77.103  31.739  46.562 1.00 79.68  ? 2408 LEU C CG  1 
ATOM   4768 C CD1 . LEU C 1 105 ? 77.730  30.700  45.648 1.00 78.67  ? 2408 LEU C CD1 1 
ATOM   4769 C CD2 . LEU C 1 105 ? 76.571  31.088  47.836 1.00 79.51  ? 2408 LEU C CD2 1 
ATOM   4770 N N   . LEU C 1 106 ? 78.231  34.315  43.587 1.00 79.42  ? 2409 LEU C N   1 
ATOM   4771 C CA  . LEU C 1 106 ? 77.416  35.010  42.598 1.00 79.20  ? 2409 LEU C CA  1 
ATOM   4772 C C   . LEU C 1 106 ? 76.773  33.948  41.703 1.00 78.43  ? 2409 LEU C C   1 
ATOM   4773 O O   . LEU C 1 106 ? 77.442  33.009  41.276 1.00 77.63  ? 2409 LEU C O   1 
ATOM   4774 C CB  . LEU C 1 106 ? 78.313  35.951  41.775 1.00 79.35  ? 2409 LEU C CB  1 
ATOM   4775 C CG  . LEU C 1 106 ? 77.719  37.037  40.866 1.00 79.45  ? 2409 LEU C CG  1 
ATOM   4776 C CD1 . LEU C 1 106 ? 76.845  36.399  39.795 1.00 79.03  ? 2409 LEU C CD1 1 
ATOM   4777 C CD2 . LEU C 1 106 ? 76.928  38.029  41.699 1.00 79.61  ? 2409 LEU C CD2 1 
ATOM   4778 N N   . LEU C 1 107 ? 75.478  34.091  41.427 1.00 78.31  ? 2410 LEU C N   1 
ATOM   4779 C CA  . LEU C 1 107 ? 74.770  33.119  40.590 1.00 78.74  ? 2410 LEU C CA  1 
ATOM   4780 C C   . LEU C 1 107 ? 73.960  33.772  39.473 1.00 79.05  ? 2410 LEU C C   1 
ATOM   4781 O O   . LEU C 1 107 ? 73.621  34.954  39.546 1.00 79.14  ? 2410 LEU C O   1 
ATOM   4782 C CB  . LEU C 1 107 ? 73.828  32.269  41.450 1.00 77.69  ? 2410 LEU C CB  1 
ATOM   4783 C CG  . LEU C 1 107 ? 74.449  31.539  42.640 1.00 77.54  ? 2410 LEU C CG  1 
ATOM   4784 C CD1 . LEU C 1 107 ? 73.377  30.778  43.415 1.00 76.19  ? 2410 LEU C CD1 1 
ATOM   4785 C CD2 . LEU C 1 107 ? 75.525  30.598  42.132 1.00 77.22  ? 2410 LEU C CD2 1 
ATOM   4786 N N   . ASP C 1 108 ? 73.651  32.996  38.437 1.00 79.29  ? 2411 ASP C N   1 
ATOM   4787 C CA  . ASP C 1 108 ? 72.865  33.513  37.327 1.00 79.78  ? 2411 ASP C CA  1 
ATOM   4788 C C   . ASP C 1 108 ? 71.674  32.613  37.004 1.00 79.44  ? 2411 ASP C C   1 
ATOM   4789 O O   . ASP C 1 108 ? 71.593  31.464  37.452 1.00 78.65  ? 2411 ASP C O   1 
ATOM   4790 C CB  . ASP C 1 108 ? 73.740  33.702  36.084 1.00 81.27  ? 2411 ASP C CB  1 
ATOM   4791 C CG  . ASP C 1 108 ? 74.377  32.413  35.615 1.00 83.72  ? 2411 ASP C CG  1 
ATOM   4792 O OD1 . ASP C 1 108 ? 75.035  32.433  34.551 1.00 84.99  ? 2411 ASP C OD1 1 
ATOM   4793 O OD2 . ASP C 1 108 ? 74.225  31.383  36.310 1.00 85.44  ? 2411 ASP C OD2 1 
ATOM   4794 N N   . ARG C 1 109 ? 70.752  33.160  36.222 1.00 79.09  ? 2412 ARG C N   1 
ATOM   4795 C CA  . ARG C 1 109 ? 69.536  32.465  35.830 1.00 79.50  ? 2412 ARG C CA  1 
ATOM   4796 C C   . ARG C 1 109 ? 69.736  30.990  35.511 1.00 79.58  ? 2412 ARG C C   1 
ATOM   4797 O O   . ARG C 1 109 ? 68.855  30.164  35.761 1.00 79.38  ? 2412 ARG C O   1 
ATOM   4798 C CB  . ARG C 1 109 ? 68.920  33.175  34.628 1.00 80.41  ? 2412 ARG C CB  1 
ATOM   4799 C CG  . ARG C 1 109 ? 67.435  32.922  34.448 1.00 81.81  ? 2412 ARG C CG  1 
ATOM   4800 C CD  . ARG C 1 109 ? 67.151  31.677  33.639 1.00 82.52  ? 2412 ARG C CD  1 
ATOM   4801 N NE  . ARG C 1 109 ? 65.717  31.409  33.580 1.00 84.04  ? 2412 ARG C NE  1 
ATOM   4802 C CZ  . ARG C 1 109 ? 65.134  30.643  32.663 1.00 83.80  ? 2412 ARG C CZ  1 
ATOM   4803 N NH1 . ARG C 1 109 ? 65.863  30.065  31.713 1.00 83.14  ? 2412 ARG C NH1 1 
ATOM   4804 N NH2 . ARG C 1 109 ? 63.823  30.451  32.704 1.00 82.84  ? 2412 ARG C NH2 1 
ATOM   4805 N N   . ASN C 1 110 ? 70.896  30.657  34.963 1.00 79.71  ? 2413 ASN C N   1 
ATOM   4806 C CA  . ASN C 1 110 ? 71.176  29.276  34.606 1.00 80.25  ? 2413 ASN C CA  1 
ATOM   4807 C C   . ASN C 1 110 ? 71.555  28.416  35.801 1.00 79.57  ? 2413 ASN C C   1 
ATOM   4808 O O   . ASN C 1 110 ? 71.110  27.275  35.919 1.00 79.13  ? 2413 ASN C O   1 
ATOM   4809 C CB  . ASN C 1 110 ? 72.278  29.225  33.549 1.00 81.53  ? 2413 ASN C CB  1 
ATOM   4810 C CG  . ASN C 1 110 ? 71.783  28.674  32.223 1.00 83.20  ? 2413 ASN C CG  1 
ATOM   4811 O OD1 . ASN C 1 110 ? 70.695  29.022  31.758 1.00 82.40  ? 2413 ASN C OD1 1 
ATOM   4812 N ND2 . ASN C 1 110 ? 72.586  27.815  31.603 1.00 84.62  ? 2413 ASN C ND2 1 
ATOM   4813 N N   . GLN C 1 111 ? 72.377  28.963  36.686 1.00 79.16  ? 2414 GLN C N   1 
ATOM   4814 C CA  . GLN C 1 111 ? 72.801  28.223  37.864 1.00 78.87  ? 2414 GLN C CA  1 
ATOM   4815 C C   . GLN C 1 111 ? 71.609  27.605  38.588 1.00 78.39  ? 2414 GLN C C   1 
ATOM   4816 O O   . GLN C 1 111 ? 71.608  26.412  38.899 1.00 78.33  ? 2414 GLN C O   1 
ATOM   4817 C CB  . GLN C 1 111 ? 73.559  29.142  38.823 1.00 79.33  ? 2414 GLN C CB  1 
ATOM   4818 C CG  . GLN C 1 111 ? 75.050  28.854  38.918 1.00 79.10  ? 2414 GLN C CG  1 
ATOM   4819 C CD  . GLN C 1 111 ? 75.819  29.351  37.718 1.00 78.65  ? 2414 GLN C CD  1 
ATOM   4820 O OE1 . GLN C 1 111 ? 75.519  28.997  36.578 1.00 78.76  ? 2414 GLN C OE1 1 
ATOM   4821 N NE2 . GLN C 1 111 ? 76.824  30.179  37.968 1.00 78.70  ? 2414 GLN C NE2 1 
ATOM   4822 N N   . GLY C 1 112 ? 70.593  28.420  38.850 1.00 77.59  ? 2415 GLY C N   1 
ATOM   4823 C CA  . GLY C 1 112 ? 69.418  27.932  39.549 1.00 76.97  ? 2415 GLY C CA  1 
ATOM   4824 C C   . GLY C 1 112 ? 68.817  26.671  38.959 1.00 76.50  ? 2415 GLY C C   1 
ATOM   4825 O O   . GLY C 1 112 ? 68.074  25.956  39.633 1.00 75.28  ? 2415 GLY C O   1 
ATOM   4826 N N   . LYS C 1 113 ? 69.129  26.397  37.697 1.00 76.54  ? 2416 LYS C N   1 
ATOM   4827 C CA  . LYS C 1 113 ? 68.608  25.212  37.036 1.00 76.31  ? 2416 LYS C CA  1 
ATOM   4828 C C   . LYS C 1 113 ? 69.257  23.971  37.638 1.00 76.24  ? 2416 LYS C C   1 
ATOM   4829 O O   . LYS C 1 113 ? 68.804  22.853  37.405 1.00 75.80  ? 2416 LYS C O   1 
ATOM   4830 C CB  . LYS C 1 113 ? 68.869  25.294  35.530 1.00 76.40  ? 2416 LYS C CB  1 
ATOM   4831 C CG  . LYS C 1 113 ? 68.364  26.595  34.902 1.00 77.18  ? 2416 LYS C CG  1 
ATOM   4832 C CD  . LYS C 1 113 ? 68.691  26.689  33.421 1.00 77.83  ? 2416 LYS C CD  1 
ATOM   4833 C CE  . LYS C 1 113 ? 67.931  25.652  32.605 1.00 79.16  ? 2416 LYS C CE  1 
ATOM   4834 N NZ  . LYS C 1 113 ? 68.285  25.728  31.152 1.00 80.07  ? 2416 LYS C NZ  1 
ATOM   4835 N N   . CYS C 1 114 ? 70.312  24.182  38.422 1.00 76.78  ? 2417 CYS C N   1 
ATOM   4836 C CA  . CYS C 1 114 ? 71.018  23.086  39.087 1.00 77.81  ? 2417 CYS C CA  1 
ATOM   4837 C C   . CYS C 1 114 ? 70.088  22.408  40.089 1.00 76.86  ? 2417 CYS C C   1 
ATOM   4838 O O   . CYS C 1 114 ? 70.258  21.233  40.421 1.00 76.43  ? 2417 CYS C O   1 
ATOM   4839 C CB  . CYS C 1 114 ? 72.257  23.602  39.833 1.00 79.03  ? 2417 CYS C CB  1 
ATOM   4840 S SG  . CYS C 1 114 ? 73.665  24.072  38.794 1.00 83.26  ? 2417 CYS C SG  1 
ATOM   4841 N N   . VAL C 1 115 ? 69.107  23.161  40.574 1.00 76.38  ? 2418 VAL C N   1 
ATOM   4842 C CA  . VAL C 1 115 ? 68.150  22.629  41.538 1.00 75.54  ? 2418 VAL C CA  1 
ATOM   4843 C C   . VAL C 1 115 ? 66.719  22.637  40.998 1.00 75.00  ? 2418 VAL C C   1 
ATOM   4844 O O   . VAL C 1 115 ? 66.234  23.637  40.455 1.00 74.48  ? 2418 VAL C O   1 
ATOM   4845 C CB  . VAL C 1 115 ? 68.207  23.416  42.870 1.00 74.87  ? 2418 VAL C CB  1 
ATOM   4846 C CG1 . VAL C 1 115 ? 67.179  22.864  43.849 1.00 73.53  ? 2418 VAL C CG1 1 
ATOM   4847 C CG2 . VAL C 1 115 ? 69.613  23.327  43.459 1.00 73.99  ? 2418 VAL C CG2 1 
ATOM   4848 N N   . GLU C 1 116 ? 66.057  21.496  41.152 1.00 73.64  ? 2419 GLU C N   1 
ATOM   4849 C CA  . GLU C 1 116 ? 64.696  21.318  40.691 1.00 72.53  ? 2419 GLU C CA  1 
ATOM   4850 C C   . GLU C 1 116 ? 63.763  22.399  41.210 1.00 71.22  ? 2419 GLU C C   1 
ATOM   4851 O O   . GLU C 1 116 ? 63.771  22.711  42.392 1.00 70.70  ? 2419 GLU C O   1 
ATOM   4852 C CB  . GLU C 1 116 ? 64.192  19.952  41.132 1.00 73.26  ? 2419 GLU C CB  1 
ATOM   4853 C CG  . GLU C 1 116 ? 62.711  19.768  40.941 1.00 76.37  ? 2419 GLU C CG  1 
ATOM   4854 C CD  . GLU C 1 116 ? 62.218  18.484  41.556 1.00 78.62  ? 2419 GLU C CD  1 
ATOM   4855 O OE1 . GLU C 1 116 ? 62.552  18.228  42.735 1.00 79.41  ? 2419 GLU C OE1 1 
ATOM   4856 O OE2 . GLU C 1 116 ? 61.495  17.734  40.863 1.00 79.99  ? 2419 GLU C OE2 1 
ATOM   4857 N N   . GLY C 1 117 ? 62.959  22.964  40.316 1.00 71.12  ? 2420 GLY C N   1 
ATOM   4858 C CA  . GLY C 1 117 ? 62.017  24.004  40.700 1.00 71.34  ? 2420 GLY C CA  1 
ATOM   4859 C C   . GLY C 1 117 ? 62.644  25.306  41.177 1.00 71.56  ? 2420 GLY C C   1 
ATOM   4860 O O   . GLY C 1 117 ? 61.936  26.261  41.496 1.00 70.77  ? 2420 GLY C O   1 
ATOM   4861 N N   . MET C 1 118 ? 63.973  25.352  41.207 1.00 71.64  ? 2421 MET C N   1 
ATOM   4862 C CA  . MET C 1 118 ? 64.709  26.527  41.662 1.00 70.99  ? 2421 MET C CA  1 
ATOM   4863 C C   . MET C 1 118 ? 64.688  27.710  40.690 1.00 70.54  ? 2421 MET C C   1 
ATOM   4864 O O   . MET C 1 118 ? 64.660  28.870  41.108 1.00 70.50  ? 2421 MET C O   1 
ATOM   4865 C CB  . MET C 1 118 ? 66.159  26.138  41.929 1.00 71.63  ? 2421 MET C CB  1 
ATOM   4866 C CG  . MET C 1 118 ? 67.001  27.239  42.529 1.00 73.74  ? 2421 MET C CG  1 
ATOM   4867 S SD  . MET C 1 118 ? 66.721  27.406  44.285 1.00 75.94  ? 2421 MET C SD  1 
ATOM   4868 C CE  . MET C 1 118 ? 65.287  28.491  44.286 1.00 76.37  ? 2421 MET C CE  1 
ATOM   4869 N N   . VAL C 1 119 ? 64.715  27.409  39.395 1.00 69.22  ? 2422 VAL C N   1 
ATOM   4870 C CA  . VAL C 1 119 ? 64.729  28.435  38.356 1.00 67.88  ? 2422 VAL C CA  1 
ATOM   4871 C C   . VAL C 1 119 ? 63.682  29.539  38.499 1.00 67.49  ? 2422 VAL C C   1 
ATOM   4872 O O   . VAL C 1 119 ? 64.023  30.700  38.739 1.00 66.55  ? 2422 VAL C O   1 
ATOM   4873 C CB  . VAL C 1 119 ? 64.573  27.797  36.967 1.00 67.08  ? 2422 VAL C CB  1 
ATOM   4874 C CG1 . VAL C 1 119 ? 64.555  28.871  35.893 1.00 66.75  ? 2422 VAL C CG1 1 
ATOM   4875 C CG2 . VAL C 1 119 ? 65.704  26.835  36.727 1.00 65.93  ? 2422 VAL C CG2 1 
ATOM   4876 N N   . GLU C 1 120 ? 62.415  29.171  38.336 1.00 67.01  ? 2423 GLU C N   1 
ATOM   4877 C CA  . GLU C 1 120 ? 61.312  30.118  38.425 1.00 67.01  ? 2423 GLU C CA  1 
ATOM   4878 C C   . GLU C 1 120 ? 61.524  31.161  39.511 1.00 65.92  ? 2423 GLU C C   1 
ATOM   4879 O O   . GLU C 1 120 ? 61.218  32.333  39.314 1.00 66.05  ? 2423 GLU C O   1 
ATOM   4880 C CB  . GLU C 1 120 ? 59.995  29.388  38.689 1.00 68.97  ? 2423 GLU C CB  1 
ATOM   4881 C CG  . GLU C 1 120 ? 59.723  28.188  37.794 1.00 72.26  ? 2423 GLU C CG  1 
ATOM   4882 C CD  . GLU C 1 120 ? 60.508  26.956  38.215 1.00 74.12  ? 2423 GLU C CD  1 
ATOM   4883 O OE1 . GLU C 1 120 ? 61.735  26.923  37.990 1.00 74.97  ? 2423 GLU C OE1 1 
ATOM   4884 O OE2 . GLU C 1 120 ? 59.896  26.022  38.782 1.00 75.69  ? 2423 GLU C OE2 1 
ATOM   4885 N N   . ILE C 1 121 ? 62.044  30.745  40.659 1.00 65.02  ? 2424 ILE C N   1 
ATOM   4886 C CA  . ILE C 1 121 ? 62.271  31.691  41.740 1.00 63.94  ? 2424 ILE C CA  1 
ATOM   4887 C C   . ILE C 1 121 ? 63.342  32.707  41.362 1.00 64.68  ? 2424 ILE C C   1 
ATOM   4888 O O   . ILE C 1 121 ? 63.152  33.911  41.544 1.00 65.16  ? 2424 ILE C O   1 
ATOM   4889 C CB  . ILE C 1 121 ? 62.669  30.979  43.033 1.00 62.22  ? 2424 ILE C CB  1 
ATOM   4890 C CG1 . ILE C 1 121 ? 61.566  29.999  43.424 1.00 60.12  ? 2424 ILE C CG1 1 
ATOM   4891 C CG2 . ILE C 1 121 ? 62.878  32.000  44.143 1.00 61.69  ? 2424 ILE C CG2 1 
ATOM   4892 C CD1 . ILE C 1 121 ? 61.846  29.248  44.677 1.00 59.97  ? 2424 ILE C CD1 1 
ATOM   4893 N N   . PHE C 1 122 ? 64.465  32.234  40.833 1.00 64.78  ? 2425 PHE C N   1 
ATOM   4894 C CA  . PHE C 1 122 ? 65.527  33.144  40.427 1.00 64.78  ? 2425 PHE C CA  1 
ATOM   4895 C C   . PHE C 1 122 ? 64.937  34.203  39.518 1.00 65.00  ? 2425 PHE C C   1 
ATOM   4896 O O   . PHE C 1 122 ? 65.204  35.390  39.680 1.00 65.52  ? 2425 PHE C O   1 
ATOM   4897 C CB  . PHE C 1 122 ? 66.627  32.383  39.698 1.00 64.74  ? 2425 PHE C CB  1 
ATOM   4898 C CG  . PHE C 1 122 ? 67.596  31.694  40.616 1.00 65.28  ? 2425 PHE C CG  1 
ATOM   4899 C CD1 . PHE C 1 122 ? 67.167  31.126  41.812 1.00 66.39  ? 2425 PHE C CD1 1 
ATOM   4900 C CD2 . PHE C 1 122 ? 68.935  31.587  40.270 1.00 65.19  ? 2425 PHE C CD2 1 
ATOM   4901 C CE1 . PHE C 1 122 ? 68.060  30.460  42.648 1.00 66.65  ? 2425 PHE C CE1 1 
ATOM   4902 C CE2 . PHE C 1 122 ? 69.836  30.922  41.096 1.00 65.98  ? 2425 PHE C CE2 1 
ATOM   4903 C CZ  . PHE C 1 122 ? 69.398  30.357  42.287 1.00 66.74  ? 2425 PHE C CZ  1 
ATOM   4904 N N   . ASP C 1 123 ? 64.123  33.766  38.567 1.00 65.41  ? 2426 ASP C N   1 
ATOM   4905 C CA  . ASP C 1 123 ? 63.488  34.690  37.642 1.00 66.87  ? 2426 ASP C CA  1 
ATOM   4906 C C   . ASP C 1 123 ? 62.756  35.775  38.435 1.00 66.88  ? 2426 ASP C C   1 
ATOM   4907 O O   . ASP C 1 123 ? 63.058  36.966  38.296 1.00 67.04  ? 2426 ASP C O   1 
ATOM   4908 C CB  . ASP C 1 123 ? 62.515  33.935  36.719 1.00 68.70  ? 2426 ASP C CB  1 
ATOM   4909 C CG  . ASP C 1 123 ? 63.235  33.058  35.687 1.00 69.98  ? 2426 ASP C CG  1 
ATOM   4910 O OD1 . ASP C 1 123 ? 64.161  32.316  36.069 1.00 72.24  ? 2426 ASP C OD1 1 
ATOM   4911 O OD2 . ASP C 1 123 ? 62.871  33.099  34.494 1.00 69.72  ? 2426 ASP C OD2 1 
ATOM   4912 N N   . MET C 1 124 ? 61.805  35.368  39.275 1.00 66.14  ? 2427 MET C N   1 
ATOM   4913 C CA  . MET C 1 124 ? 61.061  36.330  40.085 1.00 65.77  ? 2427 MET C CA  1 
ATOM   4914 C C   . MET C 1 124 ? 62.033  37.237  40.840 1.00 65.04  ? 2427 MET C C   1 
ATOM   4915 O O   . MET C 1 124 ? 61.768  38.429  41.012 1.00 65.91  ? 2427 MET C O   1 
ATOM   4916 C CB  . MET C 1 124 ? 60.140  35.619  41.097 1.00 65.90  ? 2427 MET C CB  1 
ATOM   4917 C CG  . MET C 1 124 ? 59.008  34.801  40.481 1.00 65.68  ? 2427 MET C CG  1 
ATOM   4918 S SD  . MET C 1 124 ? 57.745  34.279  41.674 1.00 64.51  ? 2427 MET C SD  1 
ATOM   4919 C CE  . MET C 1 124 ? 58.573  32.959  42.504 1.00 63.18  ? 2427 MET C CE  1 
ATOM   4920 N N   . LEU C 1 125 ? 63.156  36.670  41.286 1.00 62.81  ? 2428 LEU C N   1 
ATOM   4921 C CA  . LEU C 1 125 ? 64.156  37.436  42.023 1.00 60.86  ? 2428 LEU C CA  1 
ATOM   4922 C C   . LEU C 1 125 ? 64.908  38.433  41.143 1.00 60.18  ? 2428 LEU C C   1 
ATOM   4923 O O   . LEU C 1 125 ? 65.207  39.542  41.581 1.00 61.58  ? 2428 LEU C O   1 
ATOM   4924 C CB  . LEU C 1 125 ? 65.144  36.498  42.729 1.00 59.70  ? 2428 LEU C CB  1 
ATOM   4925 C CG  . LEU C 1 125 ? 64.647  35.873  44.041 1.00 59.31  ? 2428 LEU C CG  1 
ATOM   4926 C CD1 . LEU C 1 125 ? 65.734  35.006  44.645 1.00 58.67  ? 2428 LEU C CD1 1 
ATOM   4927 C CD2 . LEU C 1 125 ? 64.262  36.972  45.024 1.00 59.47  ? 2428 LEU C CD2 1 
ATOM   4928 N N   . LEU C 1 126 ? 65.208  38.047  39.907 1.00 58.07  ? 2429 LEU C N   1 
ATOM   4929 C CA  . LEU C 1 126 ? 65.907  38.933  38.989 1.00 55.65  ? 2429 LEU C CA  1 
ATOM   4930 C C   . LEU C 1 126 ? 64.915  39.953  38.484 1.00 55.71  ? 2429 LEU C C   1 
ATOM   4931 O O   . LEU C 1 126 ? 65.252  41.104  38.236 1.00 55.01  ? 2429 LEU C O   1 
ATOM   4932 C CB  . LEU C 1 126 ? 66.460  38.132  37.825 1.00 54.53  ? 2429 LEU C CB  1 
ATOM   4933 C CG  . LEU C 1 126 ? 67.562  37.164  38.237 1.00 55.57  ? 2429 LEU C CG  1 
ATOM   4934 C CD1 . LEU C 1 126 ? 67.816  36.168  37.125 1.00 54.67  ? 2429 LEU C CD1 1 
ATOM   4935 C CD2 . LEU C 1 126 ? 68.824  37.951  38.578 1.00 55.37  ? 2429 LEU C CD2 1 
ATOM   4936 N N   . ALA C 1 127 ? 63.677  39.504  38.340 1.00 56.68  ? 2430 ALA C N   1 
ATOM   4937 C CA  . ALA C 1 127 ? 62.588  40.347  37.875 1.00 57.64  ? 2430 ALA C CA  1 
ATOM   4938 C C   . ALA C 1 127 ? 62.408  41.507  38.830 1.00 57.96  ? 2430 ALA C C   1 
ATOM   4939 O O   . ALA C 1 127 ? 61.947  42.580  38.445 1.00 58.45  ? 2430 ALA C O   1 
ATOM   4940 C CB  . ALA C 1 127 ? 61.306  39.536  37.807 1.00 58.79  ? 2430 ALA C CB  1 
ATOM   4941 N N   . THR C 1 128 ? 62.756  41.269  40.087 1.00 58.03  ? 2431 THR C N   1 
ATOM   4942 C CA  . THR C 1 128 ? 62.638  42.285  41.106 1.00 59.05  ? 2431 THR C CA  1 
ATOM   4943 C C   . THR C 1 128 ? 63.973  42.975  41.256 1.00 60.47  ? 2431 THR C C   1 
ATOM   4944 O O   . THR C 1 128 ? 64.032  44.166  41.552 1.00 62.32  ? 2431 THR C O   1 
ATOM   4945 C CB  . THR C 1 128 ? 62.230  41.681  42.447 1.00 58.41  ? 2431 THR C CB  1 
ATOM   4946 O OG1 . THR C 1 128 ? 60.909  41.142  42.339 1.00 58.22  ? 2431 THR C OG1 1 
ATOM   4947 C CG2 . THR C 1 128 ? 62.260  42.741  43.533 1.00 57.64  ? 2431 THR C CG2 1 
ATOM   4948 N N   . SER C 1 129 ? 65.050  42.228  41.052 1.00 60.91  ? 2432 SER C N   1 
ATOM   4949 C CA  . SER C 1 129 ? 66.376  42.813  41.159 1.00 61.78  ? 2432 SER C CA  1 
ATOM   4950 C C   . SER C 1 129 ? 66.448  43.908  40.108 1.00 63.61  ? 2432 SER C C   1 
ATOM   4951 O O   . SER C 1 129 ? 66.939  45.008  40.373 1.00 64.37  ? 2432 SER C O   1 
ATOM   4952 C CB  . SER C 1 129 ? 67.452  41.764  40.896 1.00 60.86  ? 2432 SER C CB  1 
ATOM   4953 O OG  . SER C 1 129 ? 68.740  42.293  41.132 1.00 59.21  ? 2432 SER C OG  1 
ATOM   4954 N N   . SER C 1 130 ? 65.942  43.600  38.917 1.00 64.20  ? 2433 SER C N   1 
ATOM   4955 C CA  . SER C 1 130 ? 65.934  44.557  37.824 1.00 65.07  ? 2433 SER C CA  1 
ATOM   4956 C C   . SER C 1 130 ? 65.063  45.747  38.179 1.00 67.42  ? 2433 SER C C   1 
ATOM   4957 O O   . SER C 1 130 ? 65.557  46.866  38.332 1.00 68.34  ? 2433 SER C O   1 
ATOM   4958 C CB  . SER C 1 130 ? 65.393  43.918  36.551 1.00 64.08  ? 2433 SER C CB  1 
ATOM   4959 O OG  . SER C 1 130 ? 64.919  44.918  35.658 1.00 63.35  ? 2433 SER C OG  1 
ATOM   4960 N N   . ARG C 1 131 ? 63.763  45.494  38.311 1.00 68.59  ? 2434 ARG C N   1 
ATOM   4961 C CA  . ARG C 1 131 ? 62.801  46.536  38.633 1.00 68.85  ? 2434 ARG C CA  1 
ATOM   4962 C C   . ARG C 1 131 ? 63.353  47.573  39.607 1.00 70.00  ? 2434 ARG C C   1 
ATOM   4963 O O   . ARG C 1 131 ? 63.088  48.766  39.461 1.00 70.29  ? 2434 ARG C O   1 
ATOM   4964 C CB  . ARG C 1 131 ? 61.523  45.918  39.192 1.00 67.96  ? 2434 ARG C CB  1 
ATOM   4965 C CG  . ARG C 1 131 ? 60.437  46.936  39.442 1.00 69.02  ? 2434 ARG C CG  1 
ATOM   4966 C CD  . ARG C 1 131 ? 60.255  47.821  38.227 1.00 72.14  ? 2434 ARG C CD  1 
ATOM   4967 N NE  . ARG C 1 131 ? 59.375  48.952  38.486 1.00 73.90  ? 2434 ARG C NE  1 
ATOM   4968 C CZ  . ARG C 1 131 ? 58.102  48.836  38.848 1.00 75.56  ? 2434 ARG C CZ  1 
ATOM   4969 N NH1 . ARG C 1 131 ? 57.564  47.630  38.998 1.00 76.40  ? 2434 ARG C NH1 1 
ATOM   4970 N NH2 . ARG C 1 131 ? 57.361  49.922  39.041 1.00 75.72  ? 2434 ARG C NH2 1 
ATOM   4971 N N   . PHE C 1 132 ? 64.117  47.122  40.598 1.00 70.97  ? 2435 PHE C N   1 
ATOM   4972 C CA  . PHE C 1 132 ? 64.725  48.033  41.573 1.00 72.79  ? 2435 PHE C CA  1 
ATOM   4973 C C   . PHE C 1 132 ? 65.676  48.993  40.856 1.00 74.37  ? 2435 PHE C C   1 
ATOM   4974 O O   . PHE C 1 132 ? 65.549  50.224  40.951 1.00 73.95  ? 2435 PHE C O   1 
ATOM   4975 C CB  . PHE C 1 132 ? 65.529  47.247  42.617 1.00 71.81  ? 2435 PHE C CB  1 
ATOM   4976 C CG  . PHE C 1 132 ? 64.759  46.894  43.856 1.00 70.99  ? 2435 PHE C CG  1 
ATOM   4977 C CD1 . PHE C 1 132 ? 65.384  46.201  44.891 1.00 70.54  ? 2435 PHE C CD1 1 
ATOM   4978 C CD2 . PHE C 1 132 ? 63.427  47.260  44.000 1.00 70.04  ? 2435 PHE C CD2 1 
ATOM   4979 C CE1 . PHE C 1 132 ? 64.699  45.880  46.048 1.00 69.06  ? 2435 PHE C CE1 1 
ATOM   4980 C CE2 . PHE C 1 132 ? 62.733  46.943  45.155 1.00 70.23  ? 2435 PHE C CE2 1 
ATOM   4981 C CZ  . PHE C 1 132 ? 63.374  46.250  46.183 1.00 69.19  ? 2435 PHE C CZ  1 
ATOM   4982 N N   . ARG C 1 133 ? 66.641  48.393  40.159 1.00 75.67  ? 2436 ARG C N   1 
ATOM   4983 C CA  . ARG C 1 133 ? 67.664  49.095  39.389 1.00 76.38  ? 2436 ARG C CA  1 
ATOM   4984 C C   . ARG C 1 133 ? 67.007  50.020  38.378 1.00 76.92  ? 2436 ARG C C   1 
ATOM   4985 O O   . ARG C 1 133 ? 67.380  51.187  38.246 1.00 76.02  ? 2436 ARG C O   1 
ATOM   4986 C CB  . ARG C 1 133 ? 68.526  48.063  38.667 1.00 76.54  ? 2436 ARG C CB  1 
ATOM   4987 C CG  . ARG C 1 133 ? 69.646  48.626  37.833 1.00 77.59  ? 2436 ARG C CG  1 
ATOM   4988 C CD  . ARG C 1 133 ? 70.376  47.490  37.153 1.00 78.96  ? 2436 ARG C CD  1 
ATOM   4989 N NE  . ARG C 1 133 ? 69.453  46.638  36.403 1.00 80.49  ? 2436 ARG C NE  1 
ATOM   4990 C CZ  . ARG C 1 133 ? 69.177  45.372  36.708 1.00 80.76  ? 2436 ARG C CZ  1 
ATOM   4991 N NH1 . ARG C 1 133 ? 69.750  44.792  37.754 1.00 80.55  ? 2436 ARG C NH1 1 
ATOM   4992 N NH2 . ARG C 1 133 ? 68.329  44.682  35.958 1.00 81.10  ? 2436 ARG C NH2 1 
ATOM   4993 N N   . MET C 1 134 ? 66.019  49.475  37.673 1.00 78.21  ? 2437 MET C N   1 
ATOM   4994 C CA  . MET C 1 134 ? 65.263  50.206  36.667 1.00 79.66  ? 2437 MET C CA  1 
ATOM   4995 C C   . MET C 1 134 ? 64.337  51.220  37.345 1.00 80.23  ? 2437 MET C C   1 
ATOM   4996 O O   . MET C 1 134 ? 63.297  51.594  36.797 1.00 81.02  ? 2437 MET C O   1 
ATOM   4997 C CB  . MET C 1 134 ? 64.435  49.222  35.840 1.00 81.16  ? 2437 MET C CB  1 
ATOM   4998 C CG  . MET C 1 134 ? 63.694  49.857  34.684 1.00 84.41  ? 2437 MET C CG  1 
ATOM   4999 S SD  . MET C 1 134 ? 62.463  48.751  33.995 1.00 89.20  ? 2437 MET C SD  1 
ATOM   5000 C CE  . MET C 1 134 ? 61.011  49.131  35.046 1.00 86.51  ? 2437 MET C CE  1 
ATOM   5001 N N   . MET C 1 135 ? 64.723  51.660  38.542 1.00 80.11  ? 2438 MET C N   1 
ATOM   5002 C CA  . MET C 1 135 ? 63.940  52.624  39.314 1.00 79.35  ? 2438 MET C CA  1 
ATOM   5003 C C   . MET C 1 135 ? 64.897  53.405  40.207 1.00 79.50  ? 2438 MET C C   1 
ATOM   5004 O O   . MET C 1 135 ? 64.498  54.312  40.947 1.00 78.20  ? 2438 MET C O   1 
ATOM   5005 C CB  . MET C 1 135 ? 62.903  51.888  40.166 1.00 78.37  ? 2438 MET C CB  1 
ATOM   5006 C CG  . MET C 1 135 ? 61.817  52.775  40.737 1.00 76.91  ? 2438 MET C CG  1 
ATOM   5007 S SD  . MET C 1 135 ? 60.420  51.791  41.271 1.00 75.88  ? 2438 MET C SD  1 
ATOM   5008 C CE  . MET C 1 135 ? 60.313  52.209  42.998 1.00 75.54  ? 2438 MET C CE  1 
ATOM   5009 N N   . ASN C 1 136 ? 66.168  53.031  40.118 1.00 80.12  ? 2439 ASN C N   1 
ATOM   5010 C CA  . ASN C 1 136 ? 67.220  53.664  40.891 1.00 81.37  ? 2439 ASN C CA  1 
ATOM   5011 C C   . ASN C 1 136 ? 66.775  53.761  42.350 1.00 81.07  ? 2439 ASN C C   1 
ATOM   5012 O O   . ASN C 1 136 ? 66.309  54.812  42.806 1.00 80.69  ? 2439 ASN C O   1 
ATOM   5013 C CB  . ASN C 1 136 ? 67.520  55.060  40.320 1.00 82.88  ? 2439 ASN C CB  1 
ATOM   5014 C CG  . ASN C 1 136 ? 68.979  55.486  40.518 1.00 84.21  ? 2439 ASN C CG  1 
ATOM   5015 O OD1 . ASN C 1 136 ? 69.377  56.582  40.106 1.00 84.26  ? 2439 ASN C OD1 1 
ATOM   5016 N ND2 . ASN C 1 136 ? 69.777  54.620  41.144 1.00 84.25  ? 2439 ASN C ND2 1 
ATOM   5017 N N   . LEU C 1 137 ? 66.898  52.646  43.068 1.00 80.26  ? 2440 LEU C N   1 
ATOM   5018 C CA  . LEU C 1 137 ? 66.531  52.599  44.479 1.00 78.84  ? 2440 LEU C CA  1 
ATOM   5019 C C   . LEU C 1 137 ? 67.777  52.933  45.290 1.00 78.15  ? 2440 LEU C C   1 
ATOM   5020 O O   . LEU C 1 137 ? 68.780  52.214  45.236 1.00 78.16  ? 2440 LEU C O   1 
ATOM   5021 C CB  . LEU C 1 137 ? 66.014  51.205  44.858 1.00 78.36  ? 2440 LEU C CB  1 
ATOM   5022 C CG  . LEU C 1 137 ? 65.454  51.002  46.273 1.00 78.63  ? 2440 LEU C CG  1 
ATOM   5023 C CD1 . LEU C 1 137 ? 64.258  51.913  46.496 1.00 78.11  ? 2440 LEU C CD1 1 
ATOM   5024 C CD2 . LEU C 1 137 ? 65.043  49.547  46.460 1.00 77.66  ? 2440 LEU C CD2 1 
ATOM   5025 N N   . GLN C 1 138 ? 67.710  54.035  46.029 1.00 77.12  ? 2441 GLN C N   1 
ATOM   5026 C CA  . GLN C 1 138 ? 68.830  54.479  46.841 1.00 75.84  ? 2441 GLN C CA  1 
ATOM   5027 C C   . GLN C 1 138 ? 68.868  53.813  48.208 1.00 74.66  ? 2441 GLN C C   1 
ATOM   5028 O O   . GLN C 1 138 ? 67.847  53.689  48.875 1.00 73.59  ? 2441 GLN C O   1 
ATOM   5029 C CB  . GLN C 1 138 ? 68.797  56.005  46.988 1.00 75.91  ? 2441 GLN C CB  1 
ATOM   5030 C CG  . GLN C 1 138 ? 69.395  56.741  45.798 1.00 74.43  ? 2441 GLN C CG  1 
ATOM   5031 C CD  . GLN C 1 138 ? 70.806  56.264  45.494 1.00 74.30  ? 2441 GLN C CD  1 
ATOM   5032 O OE1 . GLN C 1 138 ? 71.645  56.167  46.395 1.00 74.38  ? 2441 GLN C OE1 1 
ATOM   5033 N NE2 . GLN C 1 138 ? 71.075  55.962  44.225 1.00 73.13  ? 2441 GLN C NE2 1 
ATOM   5034 N N   . GLY C 1 139 ? 70.064  53.386  48.602 1.00 74.38  ? 2442 GLY C N   1 
ATOM   5035 C CA  . GLY C 1 139 ? 70.264  52.724  49.877 1.00 73.57  ? 2442 GLY C CA  1 
ATOM   5036 C C   . GLY C 1 139 ? 69.282  53.068  50.973 1.00 73.43  ? 2442 GLY C C   1 
ATOM   5037 O O   . GLY C 1 139 ? 68.805  52.174  51.658 1.00 73.41  ? 2442 GLY C O   1 
ATOM   5038 N N   . GLU C 1 140 ? 68.973  54.353  51.133 1.00 74.15  ? 2443 GLU C N   1 
ATOM   5039 C CA  . GLU C 1 140 ? 68.048  54.818  52.174 1.00 74.65  ? 2443 GLU C CA  1 
ATOM   5040 C C   . GLU C 1 140 ? 66.620  54.284  52.007 1.00 72.74  ? 2443 GLU C C   1 
ATOM   5041 O O   . GLU C 1 140 ? 66.011  53.830  52.972 1.00 71.87  ? 2443 GLU C O   1 
ATOM   5042 C CB  . GLU C 1 140 ? 67.996  56.358  52.215 1.00 77.51  ? 2443 GLU C CB  1 
ATOM   5043 C CG  . GLU C 1 140 ? 69.340  57.099  52.131 1.00 80.74  ? 2443 GLU C CG  1 
ATOM   5044 C CD  . GLU C 1 140 ? 69.712  57.518  50.699 1.00 83.31  ? 2443 GLU C CD  1 
ATOM   5045 O OE1 . GLU C 1 140 ? 68.882  58.179  50.025 1.00 83.59  ? 2443 GLU C OE1 1 
ATOM   5046 O OE2 . GLU C 1 140 ? 70.838  57.194  50.248 1.00 84.89  ? 2443 GLU C OE2 1 
ATOM   5047 N N   . GLU C 1 141 ? 66.078  54.364  50.793 1.00 71.16  ? 2444 GLU C N   1 
ATOM   5048 C CA  . GLU C 1 141 ? 64.728  53.870  50.533 1.00 70.14  ? 2444 GLU C CA  1 
ATOM   5049 C C   . GLU C 1 141 ? 64.688  52.393  50.924 1.00 69.37  ? 2444 GLU C C   1 
ATOM   5050 O O   . GLU C 1 141 ? 63.701  51.904  51.474 1.00 69.93  ? 2444 GLU C O   1 
ATOM   5051 C CB  . GLU C 1 141 ? 64.378  54.023  49.041 1.00 70.47  ? 2444 GLU C CB  1 
ATOM   5052 C CG  . GLU C 1 141 ? 64.320  55.474  48.539 1.00 71.20  ? 2444 GLU C CG  1 
ATOM   5053 C CD  . GLU C 1 141 ? 64.225  55.591  47.016 1.00 70.99  ? 2444 GLU C CD  1 
ATOM   5054 O OE1 . GLU C 1 141 ? 65.199  55.221  46.324 1.00 70.44  ? 2444 GLU C OE1 1 
ATOM   5055 O OE2 . GLU C 1 141 ? 63.179  56.059  46.513 1.00 69.83  ? 2444 GLU C OE2 1 
ATOM   5056 N N   . PHE C 1 142 ? 65.788  51.699  50.644 1.00 67.92  ? 2445 PHE C N   1 
ATOM   5057 C CA  . PHE C 1 142 ? 65.928  50.277  50.934 1.00 66.08  ? 2445 PHE C CA  1 
ATOM   5058 C C   . PHE C 1 142 ? 65.647  49.920  52.386 1.00 65.39  ? 2445 PHE C C   1 
ATOM   5059 O O   . PHE C 1 142 ? 64.786  49.087  52.670 1.00 65.13  ? 2445 PHE C O   1 
ATOM   5060 C CB  . PHE C 1 142 ? 67.336  49.807  50.560 1.00 65.29  ? 2445 PHE C CB  1 
ATOM   5061 C CG  . PHE C 1 142 ? 67.619  48.390  50.950 1.00 64.14  ? 2445 PHE C CG  1 
ATOM   5062 C CD1 . PHE C 1 142 ? 66.778  47.364  50.540 1.00 64.16  ? 2445 PHE C CD1 1 
ATOM   5063 C CD2 . PHE C 1 142 ? 68.717  48.081  51.736 1.00 63.75  ? 2445 PHE C CD2 1 
ATOM   5064 C CE1 . PHE C 1 142 ? 67.026  46.052  50.908 1.00 63.96  ? 2445 PHE C CE1 1 
ATOM   5065 C CE2 . PHE C 1 142 ? 68.976  46.773  52.111 1.00 64.02  ? 2445 PHE C CE2 1 
ATOM   5066 C CZ  . PHE C 1 142 ? 68.128  45.754  51.696 1.00 64.33  ? 2445 PHE C CZ  1 
ATOM   5067 N N   . VAL C 1 143 ? 66.384  50.542  53.302 1.00 65.38  ? 2446 VAL C N   1 
ATOM   5068 C CA  . VAL C 1 143 ? 66.207  50.274  54.729 1.00 64.60  ? 2446 VAL C CA  1 
ATOM   5069 C C   . VAL C 1 143 ? 64.768  50.512  55.162 1.00 64.23  ? 2446 VAL C C   1 
ATOM   5070 O O   . VAL C 1 143 ? 64.264  49.824  56.044 1.00 63.94  ? 2446 VAL C O   1 
ATOM   5071 C CB  . VAL C 1 143 ? 67.167  51.128  55.626 1.00 63.86  ? 2446 VAL C CB  1 
ATOM   5072 C CG1 . VAL C 1 143 ? 68.581  50.561  55.566 1.00 62.14  ? 2446 VAL C CG1 1 
ATOM   5073 C CG2 . VAL C 1 143 ? 67.155  52.582  55.189 1.00 62.43  ? 2446 VAL C CG2 1 
ATOM   5074 N N   . CYS C 1 144 ? 64.105  51.485  54.549 1.00 64.33  ? 2447 CYS C N   1 
ATOM   5075 C CA  . CYS C 1 144 ? 62.715  51.743  54.892 1.00 64.72  ? 2447 CYS C CA  1 
ATOM   5076 C C   . CYS C 1 144 ? 61.944  50.494  54.496 1.00 64.35  ? 2447 CYS C C   1 
ATOM   5077 O O   . CYS C 1 144 ? 61.241  49.891  55.311 1.00 64.55  ? 2447 CYS C O   1 
ATOM   5078 C CB  . CYS C 1 144 ? 62.163  52.936  54.114 1.00 65.30  ? 2447 CYS C CB  1 
ATOM   5079 S SG  . CYS C 1 144 ? 62.759  54.536  54.646 1.00 68.11  ? 2447 CYS C SG  1 
ATOM   5080 N N   . LEU C 1 145 ? 62.088  50.115  53.231 1.00 63.32  ? 2448 LEU C N   1 
ATOM   5081 C CA  . LEU C 1 145 ? 61.419  48.943  52.695 1.00 62.29  ? 2448 LEU C CA  1 
ATOM   5082 C C   . LEU C 1 145 ? 61.678  47.722  53.568 1.00 62.92  ? 2448 LEU C C   1 
ATOM   5083 O O   . LEU C 1 145 ? 60.745  47.101  54.072 1.00 64.71  ? 2448 LEU C O   1 
ATOM   5084 C CB  . LEU C 1 145 ? 61.901  48.681  51.267 1.00 60.45  ? 2448 LEU C CB  1 
ATOM   5085 C CG  . LEU C 1 145 ? 61.276  49.575  50.198 1.00 59.14  ? 2448 LEU C CG  1 
ATOM   5086 C CD1 . LEU C 1 145 ? 61.958  49.357  48.849 1.00 58.33  ? 2448 LEU C CD1 1 
ATOM   5087 C CD2 . LEU C 1 145 ? 59.792  49.259  50.112 1.00 58.99  ? 2448 LEU C CD2 1 
ATOM   5088 N N   . LYS C 1 146 ? 62.949  47.388  53.750 1.00 62.18  ? 2449 LYS C N   1 
ATOM   5089 C CA  . LYS C 1 146 ? 63.338  46.238  54.554 1.00 61.98  ? 2449 LYS C CA  1 
ATOM   5090 C C   . LYS C 1 146 ? 62.788  46.274  55.994 1.00 61.94  ? 2449 LYS C C   1 
ATOM   5091 O O   . LYS C 1 146 ? 62.751  45.251  56.679 1.00 62.13  ? 2449 LYS C O   1 
ATOM   5092 C CB  . LYS C 1 146 ? 64.869  46.143  54.563 1.00 62.46  ? 2449 LYS C CB  1 
ATOM   5093 C CG  . LYS C 1 146 ? 65.458  45.039  55.432 1.00 62.96  ? 2449 LYS C CG  1 
ATOM   5094 C CD  . LYS C 1 146 ? 66.981  45.042  55.340 1.00 63.74  ? 2449 LYS C CD  1 
ATOM   5095 C CE  . LYS C 1 146 ? 67.613  44.081  56.338 1.00 65.80  ? 2449 LYS C CE  1 
ATOM   5096 N NZ  . LYS C 1 146 ? 69.102  44.104  56.257 1.00 66.69  ? 2449 LYS C NZ  1 
ATOM   5097 N N   . SER C 1 147 ? 62.350  47.443  56.447 1.00 61.10  ? 2450 SER C N   1 
ATOM   5098 C CA  . SER C 1 147 ? 61.835  47.574  57.802 1.00 60.72  ? 2450 SER C CA  1 
ATOM   5099 C C   . SER C 1 147 ? 60.322  47.549  57.859 1.00 59.40  ? 2450 SER C C   1 
ATOM   5100 O O   . SER C 1 147 ? 59.733  47.430  58.927 1.00 60.33  ? 2450 SER C O   1 
ATOM   5101 C CB  . SER C 1 147 ? 62.350  48.866  58.428 1.00 62.57  ? 2450 SER C CB  1 
ATOM   5102 O OG  . SER C 1 147 ? 63.762  48.819  58.574 1.00 65.59  ? 2450 SER C OG  1 
ATOM   5103 N N   . ILE C 1 148 ? 59.690  47.667  56.704 1.00 57.87  ? 2451 ILE C N   1 
ATOM   5104 C CA  . ILE C 1 148 ? 58.242  47.650  56.638 1.00 55.50  ? 2451 ILE C CA  1 
ATOM   5105 C C   . ILE C 1 148 ? 57.802  46.207  56.512 1.00 56.27  ? 2451 ILE C C   1 
ATOM   5106 O O   . ILE C 1 148 ? 56.730  45.828  56.988 1.00 57.67  ? 2451 ILE C O   1 
ATOM   5107 C CB  . ILE C 1 148 ? 57.761  48.437  55.438 1.00 53.01  ? 2451 ILE C CB  1 
ATOM   5108 C CG1 . ILE C 1 148 ? 58.312  49.854  55.537 1.00 51.23  ? 2451 ILE C CG1 1 
ATOM   5109 C CG2 . ILE C 1 148 ? 56.247  48.415  55.372 1.00 50.09  ? 2451 ILE C CG2 1 
ATOM   5110 C CD1 . ILE C 1 148 ? 58.184  50.629  54.271 1.00 52.82  ? 2451 ILE C CD1 1 
ATOM   5111 N N   . ILE C 1 149 ? 58.643  45.405  55.866 1.00 55.24  ? 2452 ILE C N   1 
ATOM   5112 C CA  . ILE C 1 149 ? 58.360  43.985  55.687 1.00 54.91  ? 2452 ILE C CA  1 
ATOM   5113 C C   . ILE C 1 149 ? 58.400  43.318  57.063 1.00 55.09  ? 2452 ILE C C   1 
ATOM   5114 O O   . ILE C 1 149 ? 57.648  42.384  57.352 1.00 54.93  ? 2452 ILE C O   1 
ATOM   5115 C CB  . ILE C 1 149 ? 59.418  43.313  54.788 1.00 53.71  ? 2452 ILE C CB  1 
ATOM   5116 C CG1 . ILE C 1 149 ? 59.268  43.797  53.348 1.00 51.22  ? 2452 ILE C CG1 1 
ATOM   5117 C CG2 . ILE C 1 149 ? 59.287  41.801  54.870 1.00 53.61  ? 2452 ILE C CG2 1 
ATOM   5118 C CD1 . ILE C 1 149 ? 60.349  43.277  52.428 1.00 51.59  ? 2452 ILE C CD1 1 
ATOM   5119 N N   . LEU C 1 150 ? 59.295  43.819  57.906 1.00 55.19  ? 2453 LEU C N   1 
ATOM   5120 C CA  . LEU C 1 150 ? 59.470  43.299  59.249 1.00 54.53  ? 2453 LEU C CA  1 
ATOM   5121 C C   . LEU C 1 150 ? 58.230  43.524  60.099 1.00 55.15  ? 2453 LEU C C   1 
ATOM   5122 O O   . LEU C 1 150 ? 57.818  42.646  60.854 1.00 57.43  ? 2453 LEU C O   1 
ATOM   5123 C CB  . LEU C 1 150 ? 60.671  43.972  59.920 1.00 52.51  ? 2453 LEU C CB  1 
ATOM   5124 C CG  . LEU C 1 150 ? 60.920  43.574  61.373 1.00 52.45  ? 2453 LEU C CG  1 
ATOM   5125 C CD1 . LEU C 1 150 ? 61.263  42.096  61.445 1.00 53.09  ? 2453 LEU C CD1 1 
ATOM   5126 C CD2 . LEU C 1 150 ? 62.040  44.399  61.949 1.00 52.38  ? 2453 LEU C CD2 1 
ATOM   5127 N N   . LEU C 1 151 ? 57.621  44.694  59.951 1.00 54.58  ? 2454 LEU C N   1 
ATOM   5128 C CA  . LEU C 1 151 ? 56.455  45.054  60.748 1.00 53.56  ? 2454 LEU C CA  1 
ATOM   5129 C C   . LEU C 1 151 ? 55.076  44.837  60.132 1.00 53.28  ? 2454 LEU C C   1 
ATOM   5130 O O   . LEU C 1 151 ? 54.100  44.694  60.854 1.00 51.69  ? 2454 LEU C O   1 
ATOM   5131 C CB  . LEU C 1 151 ? 56.581  46.517  61.158 1.00 54.06  ? 2454 LEU C CB  1 
ATOM   5132 C CG  . LEU C 1 151 ? 57.838  46.857  61.943 1.00 53.47  ? 2454 LEU C CG  1 
ATOM   5133 C CD1 . LEU C 1 151 ? 58.004  48.359  61.961 1.00 54.09  ? 2454 LEU C CD1 1 
ATOM   5134 C CD2 . LEU C 1 151 ? 57.744  46.281  63.349 1.00 52.68  ? 2454 LEU C CD2 1 
ATOM   5135 N N   . ASN C 1 152 ? 54.985  44.820  58.809 1.00 54.04  ? 2455 ASN C N   1 
ATOM   5136 C CA  . ASN C 1 152 ? 53.693  44.654  58.160 1.00 54.80  ? 2455 ASN C CA  1 
ATOM   5137 C C   . ASN C 1 152 ? 53.318  43.213  57.827 1.00 56.32  ? 2455 ASN C C   1 
ATOM   5138 O O   . ASN C 1 152 ? 52.138  42.843  57.822 1.00 56.63  ? 2455 ASN C O   1 
ATOM   5139 C CB  . ASN C 1 152 ? 53.652  45.497  56.894 1.00 53.10  ? 2455 ASN C CB  1 
ATOM   5140 C CG  . ASN C 1 152 ? 52.369  45.328  56.148 1.00 52.15  ? 2455 ASN C CG  1 
ATOM   5141 O OD1 . ASN C 1 152 ? 51.308  45.207  56.756 1.00 52.31  ? 2455 ASN C OD1 1 
ATOM   5142 N ND2 . ASN C 1 152 ? 52.445  45.320  54.821 1.00 52.04  ? 2455 ASN C ND2 1 
ATOM   5143 N N   . SER C 1 153 ? 54.328  42.404  57.539 1.00 57.03  ? 2456 SER C N   1 
ATOM   5144 C CA  . SER C 1 153 ? 54.105  41.013  57.200 1.00 57.33  ? 2456 SER C CA  1 
ATOM   5145 C C   . SER C 1 153 ? 53.716  40.264  58.448 1.00 57.56  ? 2456 SER C C   1 
ATOM   5146 O O   . SER C 1 153 ? 54.513  40.124  59.375 1.00 55.89  ? 2456 SER C O   1 
ATOM   5147 C CB  . SER C 1 153 ? 55.370  40.416  56.586 1.00 58.16  ? 2456 SER C CB  1 
ATOM   5148 O OG  . SER C 1 153 ? 55.677  41.056  55.353 1.00 56.84  ? 2456 SER C OG  1 
ATOM   5149 N N   . GLY C 1 154 ? 52.478  39.790  58.463 1.00 59.22  ? 2457 GLY C N   1 
ATOM   5150 C CA  . GLY C 1 154 ? 51.993  39.070  59.618 1.00 62.16  ? 2457 GLY C CA  1 
ATOM   5151 C C   . GLY C 1 154 ? 51.788  40.002  60.799 1.00 63.60  ? 2457 GLY C C   1 
ATOM   5152 O O   . GLY C 1 154 ? 52.242  39.735  61.915 1.00 62.62  ? 2457 GLY C O   1 
ATOM   5153 N N   . VAL C 1 155 ? 51.118  41.119  60.543 1.00 65.35  ? 2458 VAL C N   1 
ATOM   5154 C CA  . VAL C 1 155 ? 50.832  42.085  61.592 1.00 66.77  ? 2458 VAL C CA  1 
ATOM   5155 C C   . VAL C 1 155 ? 49.390  41.866  61.998 1.00 68.45  ? 2458 VAL C C   1 
ATOM   5156 O O   . VAL C 1 155 ? 49.031  42.052  63.156 1.00 68.99  ? 2458 VAL C O   1 
ATOM   5157 C CB  . VAL C 1 155 ? 51.016  43.545  61.104 1.00 66.44  ? 2458 VAL C CB  1 
ATOM   5158 C CG1 . VAL C 1 155 ? 50.240  43.772  59.820 1.00 65.86  ? 2458 VAL C CG1 1 
ATOM   5159 C CG2 . VAL C 1 155 ? 50.557  44.521  62.188 1.00 64.78  ? 2458 VAL C CG2 1 
ATOM   5160 N N   . TYR C 1 156 ? 48.564  41.466  61.036 1.00 70.24  ? 2459 TYR C N   1 
ATOM   5161 C CA  . TYR C 1 156 ? 47.161  41.205  61.308 1.00 72.22  ? 2459 TYR C CA  1 
ATOM   5162 C C   . TYR C 1 156 ? 47.201  39.869  61.997 1.00 73.74  ? 2459 TYR C C   1 
ATOM   5163 O O   . TYR C 1 156 ? 46.594  39.656  63.055 1.00 73.26  ? 2459 TYR C O   1 
ATOM   5164 C CB  . TYR C 1 156 ? 46.399  41.114  60.001 1.00 73.33  ? 2459 TYR C CB  1 
ATOM   5165 C CG  . TYR C 1 156 ? 46.808  42.202  59.045 1.00 75.21  ? 2459 TYR C CG  1 
ATOM   5166 C CD1 . TYR C 1 156 ? 47.602  41.912  57.935 1.00 76.00  ? 2459 TYR C CD1 1 
ATOM   5167 C CD2 . TYR C 1 156 ? 46.453  43.532  59.275 1.00 74.58  ? 2459 TYR C CD2 1 
ATOM   5168 C CE1 . TYR C 1 156 ? 48.037  42.912  57.073 1.00 74.76  ? 2459 TYR C CE1 1 
ATOM   5169 C CE2 . TYR C 1 156 ? 46.883  44.541  58.421 1.00 74.83  ? 2459 TYR C CE2 1 
ATOM   5170 C CZ  . TYR C 1 156 ? 47.676  44.222  57.322 1.00 74.38  ? 2459 TYR C CZ  1 
ATOM   5171 O OH  . TYR C 1 156 ? 48.117  45.205  56.473 1.00 73.86  ? 2459 TYR C OH  1 
ATOM   5172 N N   . THR C 1 157 ? 47.949  38.978  61.359 1.00 75.67  ? 2460 THR C N   1 
ATOM   5173 C CA  . THR C 1 157 ? 48.193  37.641  61.861 1.00 76.87  ? 2460 THR C CA  1 
ATOM   5174 C C   . THR C 1 157 ? 49.192  37.945  62.956 1.00 78.20  ? 2460 THR C C   1 
ATOM   5175 O O   . THR C 1 157 ? 50.324  38.307  62.662 1.00 78.33  ? 2460 THR C O   1 
ATOM   5176 C CB  . THR C 1 157 ? 48.881  36.784  60.788 1.00 77.17  ? 2460 THR C CB  1 
ATOM   5177 O OG1 . THR C 1 157 ? 50.126  36.281  61.301 1.00 76.21  ? 2460 THR C OG1 1 
ATOM   5178 C CG2 . THR C 1 157 ? 49.139  37.627  59.515 1.00 76.47  ? 2460 THR C CG2 1 
ATOM   5179 N N   . PHE C 1 158 ? 48.782  37.839  64.213 1.00 80.59  ? 2461 PHE C N   1 
ATOM   5180 C CA  . PHE C 1 158 ? 49.705  38.152  65.299 1.00 83.42  ? 2461 PHE C CA  1 
ATOM   5181 C C   . PHE C 1 158 ? 49.840  37.111  66.404 1.00 85.38  ? 2461 PHE C C   1 
ATOM   5182 O O   . PHE C 1 158 ? 49.812  35.905  66.148 1.00 86.56  ? 2461 PHE C O   1 
ATOM   5183 C CB  . PHE C 1 158 ? 49.343  39.498  65.926 1.00 82.44  ? 2461 PHE C CB  1 
ATOM   5184 C CG  . PHE C 1 158 ? 50.484  40.462  65.957 1.00 82.54  ? 2461 PHE C CG  1 
ATOM   5185 C CD1 . PHE C 1 158 ? 50.350  41.699  66.564 1.00 82.22  ? 2461 PHE C CD1 1 
ATOM   5186 C CD2 . PHE C 1 158 ? 51.697  40.137  65.357 1.00 83.29  ? 2461 PHE C CD2 1 
ATOM   5187 C CE1 . PHE C 1 158 ? 51.407  42.602  66.572 1.00 82.66  ? 2461 PHE C CE1 1 
ATOM   5188 C CE2 . PHE C 1 158 ? 52.754  41.030  65.361 1.00 83.56  ? 2461 PHE C CE2 1 
ATOM   5189 C CZ  . PHE C 1 158 ? 52.609  42.267  65.971 1.00 82.81  ? 2461 PHE C CZ  1 
ATOM   5190 N N   . LEU C 1 159 ? 50.014  37.585  67.634 1.00 86.51  ? 2462 LEU C N   1 
ATOM   5191 C CA  . LEU C 1 159 ? 50.150  36.687  68.770 1.00 87.29  ? 2462 LEU C CA  1 
ATOM   5192 C C   . LEU C 1 159 ? 48.850  36.764  69.550 1.00 88.16  ? 2462 LEU C C   1 
ATOM   5193 O O   . LEU C 1 159 ? 47.907  36.028  69.257 1.00 89.25  ? 2462 LEU C O   1 
ATOM   5194 C CB  . LEU C 1 159 ? 51.331  37.105  69.652 1.00 86.61  ? 2462 LEU C CB  1 
ATOM   5195 C CG  . LEU C 1 159 ? 52.074  35.993  70.400 1.00 85.64  ? 2462 LEU C CG  1 
ATOM   5196 C CD1 . LEU C 1 159 ? 51.103  35.239  71.296 1.00 84.84  ? 2462 LEU C CD1 1 
ATOM   5197 C CD2 . LEU C 1 159 ? 52.737  35.050  69.396 1.00 85.09  ? 2462 LEU C CD2 1 
ATOM   5198 N N   . SER C 1 160 ? 48.787  37.662  70.528 1.00 88.15  ? 2463 SER C N   1 
ATOM   5199 C CA  . SER C 1 160 ? 47.574  37.817  71.324 1.00 88.07  ? 2463 SER C CA  1 
ATOM   5200 C C   . SER C 1 160 ? 46.425  38.250  70.388 1.00 89.08  ? 2463 SER C C   1 
ATOM   5201 O O   . SER C 1 160 ? 46.671  38.618  69.232 1.00 89.38  ? 2463 SER C O   1 
ATOM   5202 C CB  . SER C 1 160 ? 47.814  38.862  72.419 1.00 86.78  ? 2463 SER C CB  1 
ATOM   5203 O OG  . SER C 1 160 ? 46.761  38.878  73.361 1.00 84.86  ? 2463 SER C OG  1 
ATOM   5204 N N   . SER C 1 161 ? 45.183  38.172  70.876 1.00 89.41  ? 2464 SER C N   1 
ATOM   5205 C CA  . SER C 1 161 ? 43.981  38.562  70.114 1.00 88.74  ? 2464 SER C CA  1 
ATOM   5206 C C   . SER C 1 161 ? 43.121  39.394  71.060 1.00 87.97  ? 2464 SER C C   1 
ATOM   5207 O O   . SER C 1 161 ? 41.910  39.568  70.873 1.00 87.01  ? 2464 SER C O   1 
ATOM   5208 C CB  . SER C 1 161 ? 43.188  37.329  69.658 1.00 89.34  ? 2464 SER C CB  1 
ATOM   5209 O OG  . SER C 1 161 ? 43.909  36.553  68.717 1.00 88.95  ? 2464 SER C OG  1 
ATOM   5210 N N   . THR C 1 162 ? 43.787  39.901  72.085 1.00 86.98  ? 2465 THR C N   1 
ATOM   5211 C CA  . THR C 1 162 ? 43.157  40.709  73.102 1.00 86.25  ? 2465 THR C CA  1 
ATOM   5212 C C   . THR C 1 162 ? 43.390  42.197  72.868 1.00 85.54  ? 2465 THR C C   1 
ATOM   5213 O O   . THR C 1 162 ? 43.937  42.608  71.841 1.00 84.57  ? 2465 THR C O   1 
ATOM   5214 C CB  . THR C 1 162 ? 43.712  40.336  74.479 1.00 86.95  ? 2465 THR C CB  1 
ATOM   5215 O OG1 . THR C 1 162 ? 45.131  40.552  74.496 1.00 86.92  ? 2465 THR C OG1 1 
ATOM   5216 C CG2 . THR C 1 162 ? 43.416  38.874  74.782 1.00 86.10  ? 2465 THR C CG2 1 
ATOM   5217 N N   . LEU C 1 163 ? 42.954  43.000  73.833 1.00 84.84  ? 2466 LEU C N   1 
ATOM   5218 C CA  . LEU C 1 163 ? 43.122  44.437  73.757 1.00 85.00  ? 2466 LEU C CA  1 
ATOM   5219 C C   . LEU C 1 163 ? 44.587  44.671  73.464 1.00 84.80  ? 2466 LEU C C   1 
ATOM   5220 O O   . LEU C 1 163 ? 44.955  45.443  72.580 1.00 85.43  ? 2466 LEU C O   1 
ATOM   5221 C CB  . LEU C 1 163 ? 42.713  45.091  75.088 1.00 85.52  ? 2466 LEU C CB  1 
ATOM   5222 C CG  . LEU C 1 163 ? 43.016  44.486  76.476 1.00 86.16  ? 2466 LEU C CG  1 
ATOM   5223 C CD1 . LEU C 1 163 ? 42.419  43.088  76.559 1.00 85.90  ? 2466 LEU C CD1 1 
ATOM   5224 C CD2 . LEU C 1 163 ? 44.509  44.459  76.760 1.00 85.98  ? 2466 LEU C CD2 1 
ATOM   5225 N N   . LYS C 1 164 ? 45.407  43.941  74.203 1.00 84.51  ? 2467 LYS C N   1 
ATOM   5226 C CA  . LYS C 1 164 ? 46.855  43.984  74.112 1.00 83.60  ? 2467 LYS C CA  1 
ATOM   5227 C C   . LYS C 1 164 ? 47.344  43.768  72.686 1.00 82.34  ? 2467 LYS C C   1 
ATOM   5228 O O   . LYS C 1 164 ? 48.216  44.490  72.197 1.00 82.29  ? 2467 LYS C O   1 
ATOM   5229 C CB  . LYS C 1 164 ? 47.431  42.908  75.027 1.00 84.30  ? 2467 LYS C CB  1 
ATOM   5230 C CG  . LYS C 1 164 ? 48.941  42.820  75.017 1.00 85.71  ? 2467 LYS C CG  1 
ATOM   5231 C CD  . LYS C 1 164 ? 49.552  44.176  75.252 1.00 85.78  ? 2467 LYS C CD  1 
ATOM   5232 C CE  . LYS C 1 164 ? 50.802  44.075  76.088 1.00 86.91  ? 2467 LYS C CE  1 
ATOM   5233 N NZ  . LYS C 1 164 ? 51.376  45.437  76.270 1.00 88.34  ? 2467 LYS C NZ  1 
ATOM   5234 N N   . SER C 1 165 ? 46.789  42.761  72.025 1.00 80.40  ? 2468 SER C N   1 
ATOM   5235 C CA  . SER C 1 165 ? 47.176  42.482  70.661 1.00 78.57  ? 2468 SER C CA  1 
ATOM   5236 C C   . SER C 1 165 ? 46.807  43.704  69.832 1.00 77.72  ? 2468 SER C C   1 
ATOM   5237 O O   . SER C 1 165 ? 47.489  44.039  68.865 1.00 77.58  ? 2468 SER C O   1 
ATOM   5238 C CB  . SER C 1 165 ? 46.432  41.259  70.150 1.00 78.50  ? 2468 SER C CB  1 
ATOM   5239 O OG  . SER C 1 165 ? 46.927  40.867  68.883 1.00 79.92  ? 2468 SER C OG  1 
ATOM   5240 N N   . LEU C 1 166 ? 45.729  44.374  70.232 1.00 76.53  ? 2469 LEU C N   1 
ATOM   5241 C CA  . LEU C 1 166 ? 45.258  45.558  69.533 1.00 75.43  ? 2469 LEU C CA  1 
ATOM   5242 C C   . LEU C 1 166 ? 46.060  46.811  69.848 1.00 75.15  ? 2469 LEU C C   1 
ATOM   5243 O O   . LEU C 1 166 ? 46.125  47.717  69.021 1.00 74.95  ? 2469 LEU C O   1 
ATOM   5244 C CB  . LEU C 1 166 ? 43.780  45.781  69.835 1.00 76.36  ? 2469 LEU C CB  1 
ATOM   5245 C CG  . LEU C 1 166 ? 42.834  45.033  68.889 1.00 78.17  ? 2469 LEU C CG  1 
ATOM   5246 C CD1 . LEU C 1 166 ? 42.860  45.701  67.522 1.00 79.28  ? 2469 LEU C CD1 1 
ATOM   5247 C CD2 . LEU C 1 166 ? 43.243  43.564  68.771 1.00 79.07  ? 2469 LEU C CD2 1 
ATOM   5248 N N   . GLU C 1 167 ? 46.664  46.871  71.035 1.00 74.89  ? 2470 GLU C N   1 
ATOM   5249 C CA  . GLU C 1 167 ? 47.489  48.021  71.404 1.00 73.61  ? 2470 GLU C CA  1 
ATOM   5250 C C   . GLU C 1 167 ? 48.636  48.012  70.420 1.00 72.15  ? 2470 GLU C C   1 
ATOM   5251 O O   . GLU C 1 167 ? 49.001  49.039  69.865 1.00 71.63  ? 2470 GLU C O   1 
ATOM   5252 C CB  . GLU C 1 167 ? 48.094  47.870  72.798 1.00 75.44  ? 2470 GLU C CB  1 
ATOM   5253 C CG  . GLU C 1 167 ? 47.139  47.807  73.966 1.00 78.33  ? 2470 GLU C CG  1 
ATOM   5254 C CD  . GLU C 1 167 ? 47.875  47.564  75.288 1.00 80.15  ? 2470 GLU C CD  1 
ATOM   5255 O OE1 . GLU C 1 167 ? 47.184  47.384  76.313 1.00 81.60  ? 2470 GLU C OE1 1 
ATOM   5256 O OE2 . GLU C 1 167 ? 49.136  47.551  75.307 1.00 79.13  ? 2470 GLU C OE2 1 
ATOM   5257 N N   . GLU C 1 168 ? 49.202  46.823  70.227 1.00 71.63  ? 2471 GLU C N   1 
ATOM   5258 C CA  . GLU C 1 168 ? 50.328  46.617  69.328 1.00 71.22  ? 2471 GLU C CA  1 
ATOM   5259 C C   . GLU C 1 168 ? 49.964  46.851  67.862 1.00 71.99  ? 2471 GLU C C   1 
ATOM   5260 O O   . GLU C 1 168 ? 50.604  47.655  67.184 1.00 73.03  ? 2471 GLU C O   1 
ATOM   5261 C CB  . GLU C 1 168 ? 50.897  45.209  69.519 1.00 69.07  ? 2471 GLU C CB  1 
ATOM   5262 C CG  . GLU C 1 168 ? 51.373  44.938  70.941 1.00 66.97  ? 2471 GLU C CG  1 
ATOM   5263 C CD  . GLU C 1 168 ? 52.425  43.843  71.022 1.00 65.74  ? 2471 GLU C CD  1 
ATOM   5264 O OE1 . GLU C 1 168 ? 52.167  42.733  70.533 1.00 64.91  ? 2471 GLU C OE1 1 
ATOM   5265 O OE2 . GLU C 1 168 ? 53.514  44.087  71.579 1.00 65.96  ? 2471 GLU C OE2 1 
ATOM   5266 N N   . LYS C 1 169 ? 48.949  46.150  67.368 1.00 72.09  ? 2472 LYS C N   1 
ATOM   5267 C CA  . LYS C 1 169 ? 48.519  46.330  65.986 1.00 72.30  ? 2472 LYS C CA  1 
ATOM   5268 C C   . LYS C 1 169 ? 48.578  47.837  65.739 1.00 72.42  ? 2472 LYS C C   1 
ATOM   5269 O O   . LYS C 1 169 ? 49.106  48.301  64.727 1.00 72.51  ? 2472 LYS C O   1 
ATOM   5270 C CB  . LYS C 1 169 ? 47.080  45.805  65.814 1.00 72.89  ? 2472 LYS C CB  1 
ATOM   5271 C CG  . LYS C 1 169 ? 46.486  45.917  64.404 1.00 72.77  ? 2472 LYS C CG  1 
ATOM   5272 C CD  . LYS C 1 169 ? 45.041  45.396  64.342 1.00 72.26  ? 2472 LYS C CD  1 
ATOM   5273 C CE  . LYS C 1 169 ? 44.440  45.558  62.945 1.00 72.13  ? 2472 LYS C CE  1 
ATOM   5274 N NZ  . LYS C 1 169 ? 43.045  45.042  62.844 1.00 71.07  ? 2472 LYS C NZ  1 
ATOM   5275 N N   . ASP C 1 170 ? 48.065  48.587  66.711 1.00 72.42  ? 2473 ASP C N   1 
ATOM   5276 C CA  . ASP C 1 170 ? 48.019  50.047  66.673 1.00 72.76  ? 2473 ASP C CA  1 
ATOM   5277 C C   . ASP C 1 170 ? 49.398  50.668  66.564 1.00 71.17  ? 2473 ASP C C   1 
ATOM   5278 O O   . ASP C 1 170 ? 49.678  51.439  65.649 1.00 71.25  ? 2473 ASP C O   1 
ATOM   5279 C CB  . ASP C 1 170 ? 47.356  50.570  67.943 1.00 76.41  ? 2473 ASP C CB  1 
ATOM   5280 C CG  . ASP C 1 170 ? 46.082  51.339  67.667 1.00 79.56  ? 2473 ASP C CG  1 
ATOM   5281 O OD1 . ASP C 1 170 ? 45.131  50.747  67.098 1.00 79.91  ? 2473 ASP C OD1 1 
ATOM   5282 O OD2 . ASP C 1 170 ? 46.038  52.539  68.031 1.00 81.75  ? 2473 ASP C OD2 1 
ATOM   5283 N N   . HIS C 1 171 ? 50.249  50.338  67.524 1.00 69.54  ? 2474 HIS C N   1 
ATOM   5284 C CA  . HIS C 1 171 ? 51.604  50.856  67.558 1.00 68.97  ? 2474 HIS C CA  1 
ATOM   5285 C C   . HIS C 1 171 ? 52.319  50.676  66.222 1.00 69.91  ? 2474 HIS C C   1 
ATOM   5286 O O   . HIS C 1 171 ? 52.931  51.609  65.702 1.00 71.11  ? 2474 HIS C O   1 
ATOM   5287 C CB  . HIS C 1 171 ? 52.403  50.159  68.651 1.00 67.32  ? 2474 HIS C CB  1 
ATOM   5288 C CG  . HIS C 1 171 ? 53.820  50.627  68.749 1.00 67.55  ? 2474 HIS C CG  1 
ATOM   5289 N ND1 . HIS C 1 171 ? 54.895  49.766  68.699 1.00 68.06  ? 2474 HIS C ND1 1 
ATOM   5290 C CD2 . HIS C 1 171 ? 54.340  51.866  68.912 1.00 68.14  ? 2474 HIS C CD2 1 
ATOM   5291 C CE1 . HIS C 1 171 ? 56.016  50.454  68.830 1.00 67.82  ? 2474 HIS C CE1 1 
ATOM   5292 N NE2 . HIS C 1 171 ? 55.707  51.731  68.961 1.00 68.06  ? 2474 HIS C NE2 1 
ATOM   5293 N N   . ILE C 1 172 ? 52.249  49.476  65.663 1.00 69.81  ? 2475 ILE C N   1 
ATOM   5294 C CA  . ILE C 1 172 ? 52.908  49.214  64.392 1.00 69.08  ? 2475 ILE C CA  1 
ATOM   5295 C C   . ILE C 1 172 ? 52.334  50.130  63.314 1.00 68.65  ? 2475 ILE C C   1 
ATOM   5296 O O   . ILE C 1 172 ? 53.070  50.870  62.659 1.00 67.34  ? 2475 ILE C O   1 
ATOM   5297 C CB  . ILE C 1 172 ? 52.724  47.743  63.970 1.00 69.28  ? 2475 ILE C CB  1 
ATOM   5298 C CG1 . ILE C 1 172 ? 53.190  46.816  65.100 1.00 69.75  ? 2475 ILE C CG1 1 
ATOM   5299 C CG2 . ILE C 1 172 ? 53.508  47.470  62.693 1.00 68.57  ? 2475 ILE C CG2 1 
ATOM   5300 C CD1 . ILE C 1 172 ? 52.896  45.344  64.861 1.00 70.27  ? 2475 ILE C CD1 1 
ATOM   5301 N N   . HIS C 1 173 ? 51.014  50.073  63.142 1.00 69.13  ? 2476 HIS C N   1 
ATOM   5302 C CA  . HIS C 1 173 ? 50.327  50.888  62.150 1.00 69.24  ? 2476 HIS C CA  1 
ATOM   5303 C C   . HIS C 1 173 ? 50.843  52.308  62.277 1.00 68.99  ? 2476 HIS C C   1 
ATOM   5304 O O   . HIS C 1 173 ? 51.016  53.009  61.281 1.00 68.97  ? 2476 HIS C O   1 
ATOM   5305 C CB  . HIS C 1 173 ? 48.815  50.850  62.392 1.00 70.13  ? 2476 HIS C CB  1 
ATOM   5306 C CG  . HIS C 1 173 ? 48.166  49.553  62.009 1.00 73.19  ? 2476 HIS C CG  1 
ATOM   5307 N ND1 . HIS C 1 173 ? 46.908  49.192  62.445 1.00 73.90  ? 2476 HIS C ND1 1 
ATOM   5308 C CD2 . HIS C 1 173 ? 48.579  48.553  61.192 1.00 74.83  ? 2476 HIS C CD2 1 
ATOM   5309 C CE1 . HIS C 1 173 ? 46.573  48.030  61.912 1.00 73.92  ? 2476 HIS C CE1 1 
ATOM   5310 N NE2 . HIS C 1 173 ? 47.569  47.620  61.147 1.00 74.51  ? 2476 HIS C NE2 1 
ATOM   5311 N N   . ARG C 1 174 ? 51.110  52.709  63.518 1.00 68.60  ? 2477 ARG C N   1 
ATOM   5312 C CA  . ARG C 1 174 ? 51.612  54.043  63.836 1.00 67.48  ? 2477 ARG C CA  1 
ATOM   5313 C C   . ARG C 1 174 ? 53.080  54.216  63.406 1.00 66.41  ? 2477 ARG C C   1 
ATOM   5314 O O   . ARG C 1 174 ? 53.426  55.194  62.738 1.00 66.09  ? 2477 ARG C O   1 
ATOM   5315 C CB  . ARG C 1 174 ? 51.451  54.288  65.338 1.00 67.44  ? 2477 ARG C CB  1 
ATOM   5316 C CG  . ARG C 1 174 ? 51.618  55.724  65.787 1.00 70.54  ? 2477 ARG C CG  1 
ATOM   5317 C CD  . ARG C 1 174 ? 51.246  55.872  67.263 1.00 72.76  ? 2477 ARG C CD  1 
ATOM   5318 N NE  . ARG C 1 174 ? 49.871  55.444  67.522 1.00 75.73  ? 2477 ARG C NE  1 
ATOM   5319 C CZ  . ARG C 1 174 ? 48.783  56.129  67.167 1.00 76.73  ? 2477 ARG C CZ  1 
ATOM   5320 N NH1 . ARG C 1 174 ? 48.894  57.296  66.537 1.00 76.56  ? 2477 ARG C NH1 1 
ATOM   5321 N NH2 . ARG C 1 174 ? 47.577  55.632  67.421 1.00 76.76  ? 2477 ARG C NH2 1 
ATOM   5322 N N   . VAL C 1 175 ? 53.940  53.269  63.777 1.00 65.23  ? 2478 VAL C N   1 
ATOM   5323 C CA  . VAL C 1 175 ? 55.348  53.345  63.393 1.00 63.43  ? 2478 VAL C CA  1 
ATOM   5324 C C   . VAL C 1 175 ? 55.466  53.194  61.890 1.00 62.36  ? 2478 VAL C C   1 
ATOM   5325 O O   . VAL C 1 175 ? 56.249  53.886  61.247 1.00 61.50  ? 2478 VAL C O   1 
ATOM   5326 C CB  . VAL C 1 175 ? 56.201  52.239  64.043 1.00 62.77  ? 2478 VAL C CB  1 
ATOM   5327 C CG1 . VAL C 1 175 ? 57.572  52.216  63.400 1.00 63.81  ? 2478 VAL C CG1 1 
ATOM   5328 C CG2 . VAL C 1 175 ? 56.346  52.487  65.536 1.00 62.96  ? 2478 VAL C CG2 1 
ATOM   5329 N N   . LEU C 1 176 ? 54.694  52.270  61.333 1.00 62.16  ? 2479 LEU C N   1 
ATOM   5330 C CA  . LEU C 1 176 ? 54.728  52.063  59.898 1.00 62.65  ? 2479 LEU C CA  1 
ATOM   5331 C C   . LEU C 1 176 ? 54.332  53.382  59.254 1.00 62.88  ? 2479 LEU C C   1 
ATOM   5332 O O   . LEU C 1 176 ? 54.878  53.773  58.220 1.00 63.07  ? 2479 LEU C O   1 
ATOM   5333 C CB  . LEU C 1 176 ? 53.760  50.947  59.472 1.00 63.09  ? 2479 LEU C CB  1 
ATOM   5334 C CG  . LEU C 1 176 ? 54.185  49.472  59.634 1.00 63.98  ? 2479 LEU C CG  1 
ATOM   5335 C CD1 . LEU C 1 176 ? 53.103  48.563  59.079 1.00 62.69  ? 2479 LEU C CD1 1 
ATOM   5336 C CD2 . LEU C 1 176 ? 55.497  49.201  58.899 1.00 64.49  ? 2479 LEU C CD2 1 
ATOM   5337 N N   . ASP C 1 177 ? 53.390  54.078  59.887 1.00 62.48  ? 2480 ASP C N   1 
ATOM   5338 C CA  . ASP C 1 177 ? 52.917  55.360  59.378 1.00 60.84  ? 2480 ASP C CA  1 
ATOM   5339 C C   . ASP C 1 177 ? 54.031  56.374  59.280 1.00 60.52  ? 2480 ASP C C   1 
ATOM   5340 O O   . ASP C 1 177 ? 54.062  57.160  58.343 1.00 60.94  ? 2480 ASP C O   1 
ATOM   5341 C CB  . ASP C 1 177 ? 51.823  55.928  60.265 1.00 60.08  ? 2480 ASP C CB  1 
ATOM   5342 C CG  . ASP C 1 177 ? 50.456  55.790  59.653 1.00 59.93  ? 2480 ASP C CG  1 
ATOM   5343 O OD1 . ASP C 1 177 ? 50.323  56.058  58.438 1.00 59.03  ? 2480 ASP C OD1 1 
ATOM   5344 O OD2 . ASP C 1 177 ? 49.513  55.426  60.386 1.00 61.21  ? 2480 ASP C OD2 1 
ATOM   5345 N N   . LYS C 1 178 ? 54.933  56.369  60.255 1.00 59.95  ? 2481 LYS C N   1 
ATOM   5346 C CA  . LYS C 1 178 ? 56.053  57.296  60.244 1.00 59.33  ? 2481 LYS C CA  1 
ATOM   5347 C C   . LYS C 1 178 ? 57.028  56.945  59.129 1.00 60.14  ? 2481 LYS C C   1 
ATOM   5348 O O   . LYS C 1 178 ? 57.515  57.831  58.424 1.00 60.88  ? 2481 LYS C O   1 
ATOM   5349 C CB  . LYS C 1 178 ? 56.783  57.279  61.586 1.00 58.82  ? 2481 LYS C CB  1 
ATOM   5350 C CG  . LYS C 1 178 ? 58.207  57.827  61.513 1.00 59.28  ? 2481 LYS C CG  1 
ATOM   5351 C CD  . LYS C 1 178 ? 58.866  57.961  62.888 1.00 59.41  ? 2481 LYS C CD  1 
ATOM   5352 C CE  . LYS C 1 178 ? 58.382  59.197  63.625 1.00 59.02  ? 2481 LYS C CE  1 
ATOM   5353 N NZ  . LYS C 1 178 ? 58.743  60.443  62.880 1.00 60.66  ? 2481 LYS C NZ  1 
ATOM   5354 N N   . ILE C 1 179 ? 57.313  55.655  58.968 1.00 60.78  ? 2482 ILE C N   1 
ATOM   5355 C CA  . ILE C 1 179 ? 58.235  55.204  57.931 1.00 61.29  ? 2482 ILE C CA  1 
ATOM   5356 C C   . ILE C 1 179 ? 57.768  55.684  56.566 1.00 62.93  ? 2482 ILE C C   1 
ATOM   5357 O O   . ILE C 1 179 ? 58.585  55.912  55.670 1.00 63.92  ? 2482 ILE C O   1 
ATOM   5358 C CB  . ILE C 1 179 ? 58.341  53.688  57.912 1.00 60.37  ? 2482 ILE C CB  1 
ATOM   5359 C CG1 . ILE C 1 179 ? 58.653  53.184  59.324 1.00 61.37  ? 2482 ILE C CG1 1 
ATOM   5360 C CG2 . ILE C 1 179 ? 59.426  53.266  56.947 1.00 60.21  ? 2482 ILE C CG2 1 
ATOM   5361 C CD1 . ILE C 1 179 ? 58.498  51.682  59.511 1.00 61.47  ? 2482 ILE C CD1 1 
ATOM   5362 N N   . THR C 1 180 ? 56.451  55.833  56.413 1.00 64.64  ? 2483 THR C N   1 
ATOM   5363 C CA  . THR C 1 180 ? 55.854  56.320  55.165 1.00 65.55  ? 2483 THR C CA  1 
ATOM   5364 C C   . THR C 1 180 ? 56.387  57.730  54.964 1.00 66.35  ? 2483 THR C C   1 
ATOM   5365 O O   . THR C 1 180 ? 56.755  58.114  53.857 1.00 67.42  ? 2483 THR C O   1 
ATOM   5366 C CB  . THR C 1 180 ? 54.306  56.418  55.258 1.00 65.73  ? 2483 THR C CB  1 
ATOM   5367 O OG1 . THR C 1 180 ? 53.758  55.150  55.641 1.00 66.56  ? 2483 THR C OG1 1 
ATOM   5368 C CG2 . THR C 1 180 ? 53.711  56.849  53.919 1.00 65.77  ? 2483 THR C CG2 1 
ATOM   5369 N N   . ASP C 1 181 ? 56.431  58.483  56.061 1.00 66.86  ? 2484 ASP C N   1 
ATOM   5370 C CA  . ASP C 1 181 ? 56.907  59.856  56.063 1.00 67.15  ? 2484 ASP C CA  1 
ATOM   5371 C C   . ASP C 1 181 ? 58.407  59.936  55.836 1.00 67.31  ? 2484 ASP C C   1 
ATOM   5372 O O   . ASP C 1 181 ? 58.888  60.841  55.162 1.00 67.39  ? 2484 ASP C O   1 
ATOM   5373 C CB  . ASP C 1 181 ? 56.554  60.535  57.385 1.00 67.83  ? 2484 ASP C CB  1 
ATOM   5374 C CG  . ASP C 1 181 ? 55.085  60.370  57.755 1.00 69.63  ? 2484 ASP C CG  1 
ATOM   5375 O OD1 . ASP C 1 181 ? 54.238  60.253  56.835 1.00 69.89  ? 2484 ASP C OD1 1 
ATOM   5376 O OD2 . ASP C 1 181 ? 54.779  60.370  58.972 1.00 69.63  ? 2484 ASP C OD2 1 
ATOM   5377 N N   . THR C 1 182 ? 59.151  58.994  56.402 1.00 67.66  ? 2485 THR C N   1 
ATOM   5378 C CA  . THR C 1 182 ? 60.595  58.989  56.215 1.00 68.24  ? 2485 THR C CA  1 
ATOM   5379 C C   . THR C 1 182 ? 60.919  58.783  54.736 1.00 69.74  ? 2485 THR C C   1 
ATOM   5380 O O   . THR C 1 182 ? 61.983  59.194  54.261 1.00 70.50  ? 2485 THR C O   1 
ATOM   5381 C CB  . THR C 1 182 ? 61.263  57.871  57.017 1.00 66.75  ? 2485 THR C CB  1 
ATOM   5382 O OG1 . THR C 1 182 ? 60.889  57.985  58.393 1.00 66.35  ? 2485 THR C OG1 1 
ATOM   5383 C CG2 . THR C 1 182 ? 62.770  57.975  56.900 1.00 65.98  ? 2485 THR C CG2 1 
ATOM   5384 N N   . LEU C 1 183 ? 59.997  58.146  54.015 1.00 69.86  ? 2486 LEU C N   1 
ATOM   5385 C CA  . LEU C 1 183 ? 60.181  57.898  52.591 1.00 70.53  ? 2486 LEU C CA  1 
ATOM   5386 C C   . LEU C 1 183 ? 59.732  59.092  51.760 1.00 71.61  ? 2486 LEU C C   1 
ATOM   5387 O O   . LEU C 1 183 ? 60.481  59.565  50.903 1.00 71.31  ? 2486 LEU C O   1 
ATOM   5388 C CB  . LEU C 1 183 ? 59.413  56.650  52.158 1.00 69.62  ? 2486 LEU C CB  1 
ATOM   5389 C CG  . LEU C 1 183 ? 60.084  55.314  52.470 1.00 69.10  ? 2486 LEU C CG  1 
ATOM   5390 C CD1 . LEU C 1 183 ? 59.202  54.184  51.964 1.00 68.08  ? 2486 LEU C CD1 1 
ATOM   5391 C CD2 . LEU C 1 183 ? 61.463  55.257  51.814 1.00 67.96  ? 2486 LEU C CD2 1 
ATOM   5392 N N   . ILE C 1 184 ? 58.509  59.563  52.006 1.00 72.59  ? 2487 ILE C N   1 
ATOM   5393 C CA  . ILE C 1 184 ? 57.969  60.720  51.290 1.00 74.24  ? 2487 ILE C CA  1 
ATOM   5394 C C   . ILE C 1 184 ? 58.990  61.843  51.395 1.00 76.43  ? 2487 ILE C C   1 
ATOM   5395 O O   . ILE C 1 184 ? 59.270  62.549  50.422 1.00 76.67  ? 2487 ILE C O   1 
ATOM   5396 C CB  . ILE C 1 184 ? 56.650  61.223  51.920 1.00 73.46  ? 2487 ILE C CB  1 
ATOM   5397 C CG1 . ILE C 1 184 ? 55.520  60.223  51.658 1.00 73.47  ? 2487 ILE C CG1 1 
ATOM   5398 C CG2 . ILE C 1 184 ? 56.307  62.599  51.371 1.00 72.25  ? 2487 ILE C CG2 1 
ATOM   5399 C CD1 . ILE C 1 184 ? 55.123  60.094  50.205 1.00 73.35  ? 2487 ILE C CD1 1 
ATOM   5400 N N   . HIS C 1 185 ? 59.533  62.000  52.598 1.00 78.67  ? 2488 HIS C N   1 
ATOM   5401 C CA  . HIS C 1 185 ? 60.545  63.010  52.876 1.00 80.30  ? 2488 HIS C CA  1 
ATOM   5402 C C   . HIS C 1 185 ? 61.702  62.805  51.917 1.00 80.58  ? 2488 HIS C C   1 
ATOM   5403 O O   . HIS C 1 185 ? 61.907  63.595  50.995 1.00 80.96  ? 2488 HIS C O   1 
ATOM   5404 C CB  . HIS C 1 185 ? 61.046  62.864  54.314 1.00 81.83  ? 2488 HIS C CB  1 
ATOM   5405 C CG  . HIS C 1 185 ? 62.182  63.779  54.660 1.00 84.20  ? 2488 HIS C CG  1 
ATOM   5406 N ND1 . HIS C 1 185 ? 63.369  63.795  53.957 1.00 84.91  ? 2488 HIS C ND1 1 
ATOM   5407 C CD2 . HIS C 1 185 ? 62.325  64.682  55.660 1.00 84.57  ? 2488 HIS C CD2 1 
ATOM   5408 C CE1 . HIS C 1 185 ? 64.194  64.666  54.510 1.00 85.28  ? 2488 HIS C CE1 1 
ATOM   5409 N NE2 . HIS C 1 185 ? 63.585  65.217  55.546 1.00 85.37  ? 2488 HIS C NE2 1 
ATOM   5410 N N   . LEU C 1 186 ? 62.447  61.725  52.138 1.00 80.83  ? 2489 LEU C N   1 
ATOM   5411 C CA  . LEU C 1 186 ? 63.598  61.396  51.312 1.00 81.23  ? 2489 LEU C CA  1 
ATOM   5412 C C   . LEU C 1 186 ? 63.307  61.440  49.807 1.00 81.72  ? 2489 LEU C C   1 
ATOM   5413 O O   . LEU C 1 186 ? 64.223  61.350  48.993 1.00 80.60  ? 2489 LEU C O   1 
ATOM   5414 C CB  . LEU C 1 186 ? 64.127  60.028  51.715 1.00 80.79  ? 2489 LEU C CB  1 
ATOM   5415 C CG  . LEU C 1 186 ? 65.649  59.931  51.672 1.00 81.39  ? 2489 LEU C CG  1 
ATOM   5416 C CD1 . LEU C 1 186 ? 66.093  58.834  52.621 1.00 81.70  ? 2489 LEU C CD1 1 
ATOM   5417 C CD2 . LEU C 1 186 ? 66.135  59.685  50.246 1.00 81.09  ? 2489 LEU C CD2 1 
ATOM   5418 N N   . MET C 1 187 ? 62.031  61.574  49.444 1.00 83.18  ? 2490 MET C N   1 
ATOM   5419 C CA  . MET C 1 187 ? 61.632  61.667  48.037 1.00 84.62  ? 2490 MET C CA  1 
ATOM   5420 C C   . MET C 1 187 ? 61.400  63.128  47.629 1.00 85.49  ? 2490 MET C C   1 
ATOM   5421 O O   . MET C 1 187 ? 61.510  63.473  46.450 1.00 86.23  ? 2490 MET C O   1 
ATOM   5422 C CB  . MET C 1 187 ? 60.356  60.867  47.758 1.00 84.68  ? 2490 MET C CB  1 
ATOM   5423 C CG  . MET C 1 187 ? 60.549  59.374  47.606 1.00 84.39  ? 2490 MET C CG  1 
ATOM   5424 S SD  . MET C 1 187 ? 59.109  58.658  46.782 1.00 85.14  ? 2490 MET C SD  1 
ATOM   5425 C CE  . MET C 1 187 ? 57.837  59.017  47.961 1.00 84.65  ? 2490 MET C CE  1 
ATOM   5426 N N   . ALA C 1 188 ? 61.059  63.980  48.594 1.00 85.38  ? 2491 ALA C N   1 
ATOM   5427 C CA  . ALA C 1 188 ? 60.855  65.402  48.316 1.00 85.17  ? 2491 ALA C CA  1 
ATOM   5428 C C   . ALA C 1 188 ? 62.227  66.066  48.444 1.00 84.89  ? 2491 ALA C C   1 
ATOM   5429 O O   . ALA C 1 188 ? 62.513  67.067  47.789 1.00 84.25  ? 2491 ALA C O   1 
ATOM   5430 C CB  . ALA C 1 188 ? 59.876  66.007  49.313 1.00 84.86  ? 2491 ALA C CB  1 
ATOM   5431 N N   . LYS C 1 189 ? 63.067  65.477  49.294 1.00 84.58  ? 2492 LYS C N   1 
ATOM   5432 C CA  . LYS C 1 189 ? 64.435  65.938  49.538 1.00 84.55  ? 2492 LYS C CA  1 
ATOM   5433 C C   . LYS C 1 189 ? 65.262  65.520  48.322 1.00 83.24  ? 2492 LYS C C   1 
ATOM   5434 O O   . LYS C 1 189 ? 66.419  65.110  48.445 1.00 82.73  ? 2492 LYS C O   1 
ATOM   5435 C CB  . LYS C 1 189 ? 64.993  65.255  50.798 1.00 86.16  ? 2492 LYS C CB  1 
ATOM   5436 C CG  . LYS C 1 189 ? 65.691  66.164  51.824 1.00 88.04  ? 2492 LYS C CG  1 
ATOM   5437 C CD  . LYS C 1 189 ? 67.088  66.627  51.394 1.00 89.51  ? 2492 LYS C CD  1 
ATOM   5438 C CE  . LYS C 1 189 ? 67.024  67.799  50.423 1.00 91.10  ? 2492 LYS C CE  1 
ATOM   5439 N NZ  . LYS C 1 189 ? 68.381  68.289  50.035 1.00 91.58  ? 2492 LYS C NZ  1 
ATOM   5440 N N   . ALA C 1 190 ? 64.640  65.618  47.152 1.00 82.40  ? 2493 ALA C N   1 
ATOM   5441 C CA  . ALA C 1 190 ? 65.265  65.249  45.891 1.00 82.68  ? 2493 ALA C CA  1 
ATOM   5442 C C   . ALA C 1 190 ? 64.565  65.996  44.767 1.00 83.40  ? 2493 ALA C C   1 
ATOM   5443 O O   . ALA C 1 190 ? 64.939  65.884  43.598 1.00 82.80  ? 2493 ALA C O   1 
ATOM   5444 C CB  . ALA C 1 190 ? 65.150  63.754  45.672 1.00 82.27  ? 2493 ALA C CB  1 
ATOM   5445 N N   . GLY C 1 191 ? 63.536  66.753  45.129 1.00 84.26  ? 2494 GLY C N   1 
ATOM   5446 C CA  . GLY C 1 191 ? 62.811  67.525  44.140 1.00 84.82  ? 2494 GLY C CA  1 
ATOM   5447 C C   . GLY C 1 191 ? 61.455  66.947  43.824 1.00 85.15  ? 2494 GLY C C   1 
ATOM   5448 O O   . GLY C 1 191 ? 60.684  67.543  43.074 1.00 85.39  ? 2494 GLY C O   1 
ATOM   5449 N N   . LEU C 1 192 ? 61.180  65.778  44.394 1.00 85.64  ? 2495 LEU C N   1 
ATOM   5450 C CA  . LEU C 1 192 ? 60.239  65.071  42.803 1.00 85.68  ? 2495 LEU C CA  1 
ATOM   5451 C C   . LEU C 1 192 ? 58.928  65.766  43.190 1.00 84.34  ? 2495 LEU C C   1 
ATOM   5452 O O   . LEU C 1 192 ? 58.621  65.952  44.369 1.00 84.22  ? 2495 LEU C O   1 
ATOM   5453 C CB  . LEU C 1 192 ? 60.266  63.646  43.390 1.00 86.70  ? 2495 LEU C CB  1 
ATOM   5454 C CG  . LEU C 1 192 ? 60.969  62.525  42.610 1.00 87.15  ? 2495 LEU C CG  1 
ATOM   5455 C CD1 . LEU C 1 192 ? 62.263  63.035  41.976 1.00 87.36  ? 2495 LEU C CD1 1 
ATOM   5456 C CD2 . LEU C 1 192 ? 61.230  61.349  43.549 1.00 86.74  ? 2495 LEU C CD2 1 
ATOM   5457 N N   . THR C 1 193 ? 58.157  66.144  42.179 1.00 82.96  ? 2496 THR C N   1 
ATOM   5458 C CA  . THR C 1 193 ? 56.882  66.800  42.406 1.00 82.63  ? 2496 THR C CA  1 
ATOM   5459 C C   . THR C 1 193 ? 56.057  65.965  43.391 1.00 82.06  ? 2496 THR C C   1 
ATOM   5460 O O   . THR C 1 193 ? 56.167  64.738  43.429 1.00 81.90  ? 2496 THR C O   1 
ATOM   5461 C CB  . THR C 1 193 ? 56.100  66.950  41.075 1.00 82.64  ? 2496 THR C CB  1 
ATOM   5462 O OG1 . THR C 1 193 ? 55.425  65.726  40.766 1.00 82.57  ? 2496 THR C OG1 1 
ATOM   5463 C CG2 . THR C 1 193 ? 57.057  67.267  39.935 1.00 81.53  ? 2496 THR C CG2 1 
ATOM   5464 N N   . LEU C 1 194 ? 55.240  66.628  44.199 1.00 81.35  ? 2497 LEU C N   1 
ATOM   5465 C CA  . LEU C 1 194 ? 54.412  65.916  45.154 1.00 81.18  ? 2497 LEU C CA  1 
ATOM   5466 C C   . LEU C 1 194 ? 53.783  64.712  44.469 1.00 80.91  ? 2497 LEU C C   1 
ATOM   5467 O O   . LEU C 1 194 ? 53.664  63.648  45.068 1.00 81.91  ? 2497 LEU C O   1 
ATOM   5468 C CB  . LEU C 1 194 ? 53.329  66.839  45.709 1.00 81.02  ? 2497 LEU C CB  1 
ATOM   5469 C CG  . LEU C 1 194 ? 53.884  68.028  46.500 1.00 81.27  ? 2497 LEU C CG  1 
ATOM   5470 C CD1 . LEU C 1 194 ? 52.741  68.864  47.055 1.00 81.41  ? 2497 LEU C CD1 1 
ATOM   5471 C CD2 . LEU C 1 194 ? 54.772  67.515  47.624 1.00 81.08  ? 2497 LEU C CD2 1 
ATOM   5472 N N   . GLN C 1 195 ? 53.394  64.874  43.210 1.00 79.74  ? 2498 GLN C N   1 
ATOM   5473 C CA  . GLN C 1 195 ? 52.801  63.765  42.481 1.00 79.50  ? 2498 GLN C CA  1 
ATOM   5474 C C   . GLN C 1 195 ? 53.814  62.625  42.357 1.00 78.82  ? 2498 GLN C C   1 
ATOM   5475 O O   . GLN C 1 195 ? 53.462  61.453  42.524 1.00 79.53  ? 2498 GLN C O   1 
ATOM   5476 C CB  . GLN C 1 195 ? 52.349  64.205  41.081 1.00 79.67  ? 2498 GLN C CB  1 
ATOM   5477 C CG  . GLN C 1 195 ? 51.640  63.100  40.283 1.00 79.20  ? 2498 GLN C CG  1 
ATOM   5478 C CD  . GLN C 1 195 ? 51.239  63.524  38.876 1.00 79.01  ? 2498 GLN C CD  1 
ATOM   5479 O OE1 . GLN C 1 195 ? 52.082  63.815  38.035 1.00 78.33  ? 2498 GLN C OE1 1 
ATOM   5480 N NE2 . GLN C 1 195 ? 49.941  63.554  38.617 1.00 80.28  ? 2498 GLN C NE2 1 
ATOM   5481 N N   . GLN C 1 196 ? 55.068  62.974  42.079 1.00 77.41  ? 2499 GLN C N   1 
ATOM   5482 C CA  . GLN C 1 196 ? 56.132  61.985  41.912 1.00 77.12  ? 2499 GLN C CA  1 
ATOM   5483 C C   . GLN C 1 196 ? 56.434  61.188  43.173 1.00 77.06  ? 2499 GLN C C   1 
ATOM   5484 O O   . GLN C 1 196 ? 56.828  60.022  43.093 1.00 77.97  ? 2499 GLN C O   1 
ATOM   5485 C CB  . GLN C 1 196 ? 57.413  62.656  41.404 1.00 76.72  ? 2499 GLN C CB  1 
ATOM   5486 C CG  . GLN C 1 196 ? 57.219  63.416  40.093 1.00 76.92  ? 2499 GLN C CG  1 
ATOM   5487 C CD  . GLN C 1 196 ? 58.523  63.849  39.442 1.00 76.12  ? 2499 GLN C CD  1 
ATOM   5488 O OE1 . GLN C 1 196 ? 59.389  64.438  40.088 1.00 76.22  ? 2499 GLN C OE1 1 
ATOM   5489 N NE2 . GLN C 1 196 ? 58.662  63.565  38.147 1.00 75.53  ? 2499 GLN C NE2 1 
ATOM   5490 N N   . GLN C 1 197 ? 56.264  61.809  44.336 1.00 76.78  ? 2500 GLN C N   1 
ATOM   5491 C CA  . GLN C 1 197 ? 56.500  61.112  45.599 1.00 77.11  ? 2500 GLN C CA  1 
ATOM   5492 C C   . GLN C 1 197 ? 55.394  60.071  45.748 1.00 77.20  ? 2500 GLN C C   1 
ATOM   5493 O O   . GLN C 1 197 ? 55.653  58.909  46.069 1.00 77.23  ? 2500 GLN C O   1 
ATOM   5494 C CB  . GLN C 1 197 ? 56.460  62.097  46.767 1.00 77.64  ? 2500 GLN C CB  1 
ATOM   5495 C CG  . GLN C 1 197 ? 57.581  63.132  46.748 1.00 77.55  ? 2500 GLN C CG  1 
ATOM   5496 C CD  . GLN C 1 197 ? 57.229  64.387  47.531 1.00 76.89  ? 2500 GLN C CD  1 
ATOM   5497 O OE1 . GLN C 1 197 ? 57.039  64.351  48.749 1.00 76.20  ? 2500 GLN C OE1 1 
ATOM   5498 N NE2 . GLN C 1 197 ? 57.128  65.504  46.825 1.00 75.67  ? 2500 GLN C NE2 1 
ATOM   5499 N N   . HIS C 1 198 ? 54.160  60.502  45.502 1.00 77.12  ? 2501 HIS C N   1 
ATOM   5500 C CA  . HIS C 1 198 ? 53.005  59.618  45.558 1.00 77.03  ? 2501 HIS C CA  1 
ATOM   5501 C C   . HIS C 1 198 ? 53.310  58.416  44.688 1.00 75.90  ? 2501 HIS C C   1 
ATOM   5502 O O   . HIS C 1 198 ? 53.614  57.333  45.184 1.00 76.78  ? 2501 HIS C O   1 
ATOM   5503 C CB  . HIS C 1 198 ? 51.769  60.311  44.990 1.00 79.06  ? 2501 HIS C CB  1 
ATOM   5504 C CG  . HIS C 1 198 ? 51.323  61.492  45.786 1.00 82.32  ? 2501 HIS C CG  1 
ATOM   5505 N ND1 . HIS C 1 198 ? 50.431  62.425  45.300 1.00 83.36  ? 2501 HIS C ND1 1 
ATOM   5506 C CD2 . HIS C 1 198 ? 51.645  61.894  47.039 1.00 83.18  ? 2501 HIS C CD2 1 
ATOM   5507 C CE1 . HIS C 1 198 ? 50.226  63.352  46.219 1.00 83.81  ? 2501 HIS C CE1 1 
ATOM   5508 N NE2 . HIS C 1 198 ? 50.950  63.053  47.284 1.00 84.04  ? 2501 HIS C NE2 1 
ATOM   5509 N N   . GLN C 1 199 ? 53.236  58.630  43.380 1.00 73.45  ? 2502 GLN C N   1 
ATOM   5510 C CA  . GLN C 1 199 ? 53.488  57.576  42.412 1.00 71.70  ? 2502 GLN C CA  1 
ATOM   5511 C C   . GLN C 1 199 ? 54.666  56.672  42.756 1.00 71.03  ? 2502 GLN C C   1 
ATOM   5512 O O   . GLN C 1 199 ? 54.567  55.450  42.592 1.00 71.94  ? 2502 GLN C O   1 
ATOM   5513 C CB  . GLN C 1 199 ? 53.706  58.173  41.027 1.00 70.56  ? 2502 GLN C CB  1 
ATOM   5514 C CG  . GLN C 1 199 ? 52.595  59.090  40.585 1.00 70.23  ? 2502 GLN C CG  1 
ATOM   5515 C CD  . GLN C 1 199 ? 52.624  59.329  39.102 1.00 68.89  ? 2502 GLN C CD  1 
ATOM   5516 O OE1 . GLN C 1 199 ? 53.691  59.477  38.513 1.00 69.38  ? 2502 GLN C OE1 1 
ATOM   5517 N NE2 . GLN C 1 199 ? 51.455  59.377  38.487 1.00 67.45  ? 2502 GLN C NE2 1 
ATOM   5518 N N   . ARG C 1 200 ? 55.774  57.252  43.224 1.00 67.97  ? 2503 ARG C N   1 
ATOM   5519 C CA  . ARG C 1 200 ? 56.936  56.439  43.556 1.00 66.21  ? 2503 ARG C CA  1 
ATOM   5520 C C   . ARG C 1 200 ? 56.663  55.634  44.810 1.00 66.59  ? 2503 ARG C C   1 
ATOM   5521 O O   . ARG C 1 200 ? 57.085  54.480  44.917 1.00 67.29  ? 2503 ARG C O   1 
ATOM   5522 C CB  . ARG C 1 200 ? 58.190  57.297  43.748 1.00 63.77  ? 2503 ARG C CB  1 
ATOM   5523 C CG  . ARG C 1 200 ? 59.472  56.469  43.910 1.00 60.53  ? 2503 ARG C CG  1 
ATOM   5524 C CD  . ARG C 1 200 ? 60.676  57.367  44.136 1.00 58.47  ? 2503 ARG C CD  1 
ATOM   5525 N NE  . ARG C 1 200 ? 61.921  56.664  44.465 1.00 55.65  ? 2503 ARG C NE  1 
ATOM   5526 C CZ  . ARG C 1 200 ? 62.672  55.985  43.599 1.00 55.03  ? 2503 ARG C CZ  1 
ATOM   5527 N NH1 . ARG C 1 200 ? 62.318  55.889  42.320 1.00 53.66  ? 2503 ARG C NH1 1 
ATOM   5528 N NH2 . ARG C 1 200 ? 63.805  55.428  44.007 1.00 53.48  ? 2503 ARG C NH2 1 
ATOM   5529 N N   . LEU C 1 201 ? 55.960  56.238  45.764 1.00 66.20  ? 2504 LEU C N   1 
ATOM   5530 C CA  . LEU C 1 201 ? 55.629  55.526  46.994 1.00 66.81  ? 2504 LEU C CA  1 
ATOM   5531 C C   . LEU C 1 201 ? 54.912  54.259  46.561 1.00 65.89  ? 2504 LEU C C   1 
ATOM   5532 O O   . LEU C 1 201 ? 55.283  53.148  46.941 1.00 64.51  ? 2504 LEU C O   1 
ATOM   5533 C CB  . LEU C 1 201 ? 54.691  56.359  47.882 1.00 67.84  ? 2504 LEU C CB  1 
ATOM   5534 C CG  . LEU C 1 201 ? 54.181  55.702  49.182 1.00 67.93  ? 2504 LEU C CG  1 
ATOM   5535 C CD1 . LEU C 1 201 ? 55.353  55.502  50.137 1.00 67.36  ? 2504 LEU C CD1 1 
ATOM   5536 C CD2 . LEU C 1 201 ? 53.098  56.564  49.844 1.00 66.76  ? 2504 LEU C CD2 1 
ATOM   5537 N N   . ALA C 1 202 ? 53.884  54.457  45.744 1.00 65.64  ? 2505 ALA C N   1 
ATOM   5538 C CA  . ALA C 1 202 ? 53.076  53.373  45.221 1.00 65.87  ? 2505 ALA C CA  1 
ATOM   5539 C C   . ALA C 1 202 ? 53.945  52.287  44.581 1.00 66.08  ? 2505 ALA C C   1 
ATOM   5540 O O   . ALA C 1 202 ? 53.784  51.096  44.860 1.00 66.92  ? 2505 ALA C O   1 
ATOM   5541 C CB  . ALA C 1 202 ? 52.087  53.923  44.208 1.00 65.98  ? 2505 ALA C CB  1 
ATOM   5542 N N   . GLN C 1 203 ? 54.874  52.699  43.729 1.00 65.03  ? 2506 GLN C N   1 
ATOM   5543 C CA  . GLN C 1 203 ? 55.752  51.757  43.051 1.00 63.43  ? 2506 GLN C CA  1 
ATOM   5544 C C   . GLN C 1 203 ? 56.579  50.907  44.007 1.00 62.29  ? 2506 GLN C C   1 
ATOM   5545 O O   . GLN C 1 203 ? 56.874  49.750  43.720 1.00 62.90  ? 2506 GLN C O   1 
ATOM   5546 C CB  . GLN C 1 203 ? 56.682  52.514  42.107 1.00 63.85  ? 2506 GLN C CB  1 
ATOM   5547 C CG  . GLN C 1 203 ? 55.948  53.312  41.053 1.00 64.34  ? 2506 GLN C CG  1 
ATOM   5548 C CD  . GLN C 1 203 ? 56.889  53.951  40.077 1.00 65.32  ? 2506 GLN C CD  1 
ATOM   5549 O OE1 . GLN C 1 203 ? 57.826  54.637  40.478 1.00 68.17  ? 2506 GLN C OE1 1 
ATOM   5550 N NE2 . GLN C 1 203 ? 56.653  53.734  38.785 1.00 65.89  ? 2506 GLN C NE2 1 
ATOM   5551 N N   . LEU C 1 204 ? 56.956  51.482  45.141 1.00 60.71  ? 2507 LEU C N   1 
ATOM   5552 C CA  . LEU C 1 204 ? 57.755  50.764  46.124 1.00 59.88  ? 2507 LEU C CA  1 
ATOM   5553 C C   . LEU C 1 204 ? 56.926  49.790  46.938 1.00 58.93  ? 2507 LEU C C   1 
ATOM   5554 O O   . LEU C 1 204 ? 57.286  48.626  47.095 1.00 59.08  ? 2507 LEU C O   1 
ATOM   5555 C CB  . LEU C 1 204 ? 58.443  51.759  47.058 1.00 59.64  ? 2507 LEU C CB  1 
ATOM   5556 C CG  . LEU C 1 204 ? 59.621  52.487  46.407 1.00 60.07  ? 2507 LEU C CG  1 
ATOM   5557 C CD1 . LEU C 1 204 ? 59.658  53.939  46.847 1.00 59.16  ? 2507 LEU C CD1 1 
ATOM   5558 C CD2 . LEU C 1 204 ? 60.909  51.746  46.745 1.00 58.75  ? 2507 LEU C CD2 1 
ATOM   5559 N N   . LEU C 1 205 ? 55.808  50.275  47.456 1.00 58.53  ? 2508 LEU C N   1 
ATOM   5560 C CA  . LEU C 1 205 ? 54.933  49.440  48.260 1.00 57.86  ? 2508 LEU C CA  1 
ATOM   5561 C C   . LEU C 1 205 ? 54.351  48.275  47.469 1.00 57.68  ? 2508 LEU C C   1 
ATOM   5562 O O   . LEU C 1 205 ? 53.943  47.261  48.046 1.00 57.55  ? 2508 LEU C O   1 
ATOM   5563 C CB  . LEU C 1 205 ? 53.815  50.292  48.857 1.00 56.32  ? 2508 LEU C CB  1 
ATOM   5564 C CG  . LEU C 1 205 ? 54.368  51.407  49.744 1.00 55.40  ? 2508 LEU C CG  1 
ATOM   5565 C CD1 . LEU C 1 205 ? 53.216  52.165  50.382 1.00 56.51  ? 2508 LEU C CD1 1 
ATOM   5566 C CD2 . LEU C 1 205 ? 55.285  50.816  50.811 1.00 53.58  ? 2508 LEU C CD2 1 
ATOM   5567 N N   . LEU C 1 206 ? 54.310  48.415  46.150 1.00 56.96  ? 2509 LEU C N   1 
ATOM   5568 C CA  . LEU C 1 206 ? 53.791  47.340  45.327 1.00 57.09  ? 2509 LEU C CA  1 
ATOM   5569 C C   . LEU C 1 206 ? 54.852  46.261  45.117 1.00 57.73  ? 2509 LEU C C   1 
ATOM   5570 O O   . LEU C 1 206 ? 54.523  45.090  44.922 1.00 58.87  ? 2509 LEU C O   1 
ATOM   5571 C CB  . LEU C 1 206 ? 53.287  47.882  43.994 1.00 55.52  ? 2509 LEU C CB  1 
ATOM   5572 C CG  . LEU C 1 206 ? 51.966  48.645  44.108 1.00 53.46  ? 2509 LEU C CG  1 
ATOM   5573 C CD1 . LEU C 1 206 ? 51.465  49.005  42.720 1.00 54.16  ? 2509 LEU C CD1 1 
ATOM   5574 C CD2 . LEU C 1 206 ? 50.944  47.800  44.816 1.00 50.30  ? 2509 LEU C CD2 1 
ATOM   5575 N N   . ILE C 1 207 ? 56.122  46.648  45.166 1.00 56.67  ? 2510 ILE C N   1 
ATOM   5576 C CA  . ILE C 1 207 ? 57.186  45.674  45.013 1.00 56.48  ? 2510 ILE C CA  1 
ATOM   5577 C C   . ILE C 1 207 ? 57.024  44.707  46.181 1.00 56.28  ? 2510 ILE C C   1 
ATOM   5578 O O   . ILE C 1 207 ? 57.240  43.496  46.049 1.00 56.54  ? 2510 ILE C O   1 
ATOM   5579 C CB  . ILE C 1 207 ? 58.589  46.331  45.093 1.00 57.19  ? 2510 ILE C CB  1 
ATOM   5580 C CG1 . ILE C 1 207 ? 58.716  47.446  44.055 1.00 58.10  ? 2510 ILE C CG1 1 
ATOM   5581 C CG2 . ILE C 1 207 ? 59.664  45.293  44.824 1.00 57.87  ? 2510 ILE C CG2 1 
ATOM   5582 C CD1 . ILE C 1 207 ? 58.421  46.996  42.637 1.00 58.28  ? 2510 ILE C CD1 1 
ATOM   5583 N N   . LEU C 1 208 ? 56.621  45.256  47.323 1.00 55.19  ? 2511 LEU C N   1 
ATOM   5584 C CA  . LEU C 1 208 ? 56.428  44.458  48.526 1.00 55.18  ? 2511 LEU C CA  1 
ATOM   5585 C C   . LEU C 1 208 ? 55.362  43.400  48.322 1.00 55.31  ? 2511 LEU C C   1 
ATOM   5586 O O   . LEU C 1 208 ? 55.374  42.367  48.981 1.00 56.77  ? 2511 LEU C O   1 
ATOM   5587 C CB  . LEU C 1 208 ? 56.028  45.343  49.700 1.00 54.69  ? 2511 LEU C CB  1 
ATOM   5588 C CG  . LEU C 1 208 ? 56.982  46.486  50.018 1.00 54.69  ? 2511 LEU C CG  1 
ATOM   5589 C CD1 . LEU C 1 208 ? 56.528  47.135  51.296 1.00 55.25  ? 2511 LEU C CD1 1 
ATOM   5590 C CD2 . LEU C 1 208 ? 58.401  45.976  50.163 1.00 56.17  ? 2511 LEU C CD2 1 
ATOM   5591 N N   . SER C 1 209 ? 54.424  43.663  47.424 1.00 54.24  ? 2512 SER C N   1 
ATOM   5592 C CA  . SER C 1 209 ? 53.384  42.695  47.162 1.00 53.19  ? 2512 SER C CA  1 
ATOM   5593 C C   . SER C 1 209 ? 54.012  41.445  46.558 1.00 52.93  ? 2512 SER C C   1 
ATOM   5594 O O   . SER C 1 209 ? 53.787  40.336  47.028 1.00 53.05  ? 2512 SER C O   1 
ATOM   5595 C CB  . SER C 1 209 ? 52.364  43.277  46.197 1.00 53.43  ? 2512 SER C CB  1 
ATOM   5596 O OG  . SER C 1 209 ? 51.473  42.266  45.739 1.00 55.31  ? 2512 SER C OG  1 
ATOM   5597 N N   . HIS C 1 210 ? 54.822  41.634  45.526 1.00 53.95  ? 2513 HIS C N   1 
ATOM   5598 C CA  . HIS C 1 210 ? 55.468  40.522  44.844 1.00 55.69  ? 2513 HIS C CA  1 
ATOM   5599 C C   . HIS C 1 210 ? 56.550  39.881  45.713 1.00 54.08  ? 2513 HIS C C   1 
ATOM   5600 O O   . HIS C 1 210 ? 56.751  38.666  45.675 1.00 54.97  ? 2513 HIS C O   1 
ATOM   5601 C CB  . HIS C 1 210 ? 56.049  41.011  43.512 1.00 59.82  ? 2513 HIS C CB  1 
ATOM   5602 C CG  . HIS C 1 210 ? 56.381  39.912  42.546 1.00 64.84  ? 2513 HIS C CG  1 
ATOM   5603 N ND1 . HIS C 1 210 ? 57.566  39.207  42.596 1.00 66.49  ? 2513 HIS C ND1 1 
ATOM   5604 C CD2 . HIS C 1 210 ? 55.694  39.419  41.486 1.00 67.16  ? 2513 HIS C CD2 1 
ATOM   5605 C CE1 . HIS C 1 210 ? 57.597  38.332  41.604 1.00 68.69  ? 2513 HIS C CE1 1 
ATOM   5606 N NE2 . HIS C 1 210 ? 56.474  38.440  40.916 1.00 69.58  ? 2513 HIS C NE2 1 
ATOM   5607 N N   . ILE C 1 211 ? 57.246  40.687  46.505 1.00 51.46  ? 2514 ILE C N   1 
ATOM   5608 C CA  . ILE C 1 211 ? 58.280  40.136  47.376 1.00 49.00  ? 2514 ILE C CA  1 
ATOM   5609 C C   . ILE C 1 211 ? 57.639  39.145  48.333 1.00 47.44  ? 2514 ILE C C   1 
ATOM   5610 O O   . ILE C 1 211 ? 58.242  38.148  48.717 1.00 46.00  ? 2514 ILE C O   1 
ATOM   5611 C CB  . ILE C 1 211 ? 58.954  41.220  48.218 1.00 49.13  ? 2514 ILE C CB  1 
ATOM   5612 C CG1 . ILE C 1 211 ? 59.646  42.239  47.314 1.00 47.63  ? 2514 ILE C CG1 1 
ATOM   5613 C CG2 . ILE C 1 211 ? 59.948  40.570  49.176 1.00 49.15  ? 2514 ILE C CG2 1 
ATOM   5614 C CD1 . ILE C 1 211 ? 60.267  43.373  48.076 1.00 48.36  ? 2514 ILE C CD1 1 
ATOM   5615 N N   . ARG C 1 212 ? 56.407  39.455  48.724 1.00 47.43  ? 2515 ARG C N   1 
ATOM   5616 C CA  . ARG C 1 212 ? 55.625  38.621  49.630 1.00 46.35  ? 2515 ARG C CA  1 
ATOM   5617 C C   . ARG C 1 212 ? 55.428  37.322  48.894 1.00 45.43  ? 2515 ARG C C   1 
ATOM   5618 O O   . ARG C 1 212 ? 55.665  36.235  49.423 1.00 43.83  ? 2515 ARG C O   1 
ATOM   5619 C CB  . ARG C 1 212 ? 54.257  39.263  49.890 1.00 46.15  ? 2515 ARG C CB  1 
ATOM   5620 C CG  . ARG C 1 212 ? 53.838  39.311  51.351 1.00 46.56  ? 2515 ARG C CG  1 
ATOM   5621 C CD  . ARG C 1 212 ? 53.386  37.976  51.866 1.00 46.26  ? 2515 ARG C CD  1 
ATOM   5622 N NE  . ARG C 1 212 ? 53.222  37.970  53.319 1.00 47.91  ? 2515 ARG C NE  1 
ATOM   5623 C CZ  . ARG C 1 212 ? 52.574  38.902  54.011 1.00 48.78  ? 2515 ARG C CZ  1 
ATOM   5624 N NH1 . ARG C 1 212 ? 52.028  39.934  53.389 1.00 50.52  ? 2515 ARG C NH1 1 
ATOM   5625 N NH2 . ARG C 1 212 ? 52.451  38.790  55.328 1.00 49.34  ? 2515 ARG C NH2 1 
ATOM   5626 N N   . HIS C 1 213 ? 55.005  37.469  47.648 1.00 44.28  ? 2516 HIS C N   1 
ATOM   5627 C CA  . HIS C 1 213 ? 54.749  36.350  46.782 1.00 45.10  ? 2516 HIS C CA  1 
ATOM   5628 C C   . HIS C 1 213 ? 55.967  35.443  46.627 1.00 45.37  ? 2516 HIS C C   1 
ATOM   5629 O O   . HIS C 1 213 ? 55.858  34.227  46.756 1.00 45.28  ? 2516 HIS C O   1 
ATOM   5630 C CB  . HIS C 1 213 ? 54.283  36.873  45.429 1.00 45.54  ? 2516 HIS C CB  1 
ATOM   5631 C CG  . HIS C 1 213 ? 53.766  35.808  44.516 1.00 47.86  ? 2516 HIS C CG  1 
ATOM   5632 N ND1 . HIS C 1 213 ? 52.801  34.901  44.903 1.00 47.00  ? 2516 HIS C ND1 1 
ATOM   5633 C CD2 . HIS C 1 213 ? 54.071  35.510  43.231 1.00 48.03  ? 2516 HIS C CD2 1 
ATOM   5634 C CE1 . HIS C 1 213 ? 52.535  34.091  43.895 1.00 48.13  ? 2516 HIS C CE1 1 
ATOM   5635 N NE2 . HIS C 1 213 ? 53.292  34.439  42.869 1.00 48.45  ? 2516 HIS C NE2 1 
ATOM   5636 N N   . MET C 1 214 ? 57.128  36.020  46.353 1.00 46.06  ? 2517 MET C N   1 
ATOM   5637 C CA  . MET C 1 214 ? 58.326  35.203  46.194 1.00 49.26  ? 2517 MET C CA  1 
ATOM   5638 C C   . MET C 1 214 ? 58.612  34.418  47.453 1.00 49.94  ? 2517 MET C C   1 
ATOM   5639 O O   . MET C 1 214 ? 58.999  33.249  47.402 1.00 49.15  ? 2517 MET C O   1 
ATOM   5640 C CB  . MET C 1 214 ? 59.536  36.066  45.879 1.00 50.93  ? 2517 MET C CB  1 
ATOM   5641 C CG  . MET C 1 214 ? 59.573  36.547  44.463 1.00 54.78  ? 2517 MET C CG  1 
ATOM   5642 S SD  . MET C 1 214 ? 61.029  37.531  44.246 1.00 59.49  ? 2517 MET C SD  1 
ATOM   5643 C CE  . MET C 1 214 ? 60.358  39.155  44.442 1.00 56.45  ? 2517 MET C CE  1 
ATOM   5644 N N   . SER C 1 215 ? 58.431  35.084  48.586 1.00 50.38  ? 2518 SER C N   1 
ATOM   5645 C CA  . SER C 1 215 ? 58.661  34.463  49.871 1.00 50.64  ? 2518 SER C CA  1 
ATOM   5646 C C   . SER C 1 215 ? 57.746  33.264  50.038 1.00 51.35  ? 2518 SER C C   1 
ATOM   5647 O O   . SER C 1 215 ? 58.190  32.205  50.481 1.00 52.11  ? 2518 SER C O   1 
ATOM   5648 C CB  . SER C 1 215 ? 58.404  35.460  50.988 1.00 51.25  ? 2518 SER C CB  1 
ATOM   5649 O OG  . SER C 1 215 ? 58.537  34.830  52.253 1.00 52.03  ? 2518 SER C OG  1 
ATOM   5650 N N   . ASN C 1 216 ? 56.468  33.433  49.692 1.00 51.37  ? 2519 ASN C N   1 
ATOM   5651 C CA  . ASN C 1 216 ? 55.504  32.344  49.799 1.00 50.99  ? 2519 ASN C CA  1 
ATOM   5652 C C   . ASN C 1 216 ? 55.931  31.162  48.933 1.00 51.99  ? 2519 ASN C C   1 
ATOM   5653 O O   . ASN C 1 216 ? 56.055  30.041  49.420 1.00 51.75  ? 2519 ASN C O   1 
ATOM   5654 C CB  . ASN C 1 216 ? 54.107  32.811  49.395 1.00 50.63  ? 2519 ASN C CB  1 
ATOM   5655 C CG  . ASN C 1 216 ? 53.425  33.615  50.489 1.00 52.67  ? 2519 ASN C CG  1 
ATOM   5656 O OD1 . ASN C 1 216 ? 53.538  33.294  51.677 1.00 52.53  ? 2519 ASN C OD1 1 
ATOM   5657 N ND2 . ASN C 1 216 ? 52.696  34.656  50.094 1.00 51.90  ? 2519 ASN C ND2 1 
ATOM   5658 N N   . LYS C 1 217 ? 56.166  31.406  47.649 1.00 53.03  ? 2520 LYS C N   1 
ATOM   5659 C CA  . LYS C 1 217 ? 56.597  30.330  46.769 1.00 54.40  ? 2520 LYS C CA  1 
ATOM   5660 C C   . LYS C 1 217 ? 57.929  29.756  47.250 1.00 55.02  ? 2520 LYS C C   1 
ATOM   5661 O O   . LYS C 1 217 ? 58.101  28.544  47.321 1.00 55.11  ? 2520 LYS C O   1 
ATOM   5662 C CB  . LYS C 1 217 ? 56.747  30.831  45.324 1.00 55.10  ? 2520 LYS C CB  1 
ATOM   5663 C CG  . LYS C 1 217 ? 55.439  31.240  44.644 1.00 56.54  ? 2520 LYS C CG  1 
ATOM   5664 C CD  . LYS C 1 217 ? 54.396  30.116  44.668 1.00 57.12  ? 2520 LYS C CD  1 
ATOM   5665 C CE  . LYS C 1 217 ? 53.045  30.620  44.182 1.00 57.58  ? 2520 LYS C CE  1 
ATOM   5666 N NZ  . LYS C 1 217 ? 51.934  29.693  44.514 1.00 58.74  ? 2520 LYS C NZ  1 
ATOM   5667 N N   . GLY C 1 218 ? 58.865  30.635  47.591 1.00 56.02  ? 2521 GLY C N   1 
ATOM   5668 C CA  . GLY C 1 218 ? 60.174  30.196  48.049 1.00 56.67  ? 2521 GLY C CA  1 
ATOM   5669 C C   . GLY C 1 218 ? 60.184  29.351  49.311 1.00 57.11  ? 2521 GLY C C   1 
ATOM   5670 O O   . GLY C 1 218 ? 61.102  28.554  49.519 1.00 56.89  ? 2521 GLY C O   1 
ATOM   5671 N N   . MET C 1 219 ? 59.174  29.528  50.159 1.00 57.03  ? 2522 MET C N   1 
ATOM   5672 C CA  . MET C 1 219 ? 59.080  28.773  51.404 1.00 55.80  ? 2522 MET C CA  1 
ATOM   5673 C C   . MET C 1 219 ? 58.565  27.381  51.081 1.00 56.35  ? 2522 MET C C   1 
ATOM   5674 O O   . MET C 1 219 ? 59.070  26.382  51.594 1.00 56.51  ? 2522 MET C O   1 
ATOM   5675 C CB  . MET C 1 219 ? 58.128  29.467  52.363 1.00 53.82  ? 2522 MET C CB  1 
ATOM   5676 C CG  . MET C 1 219 ? 58.234  28.994  53.791 1.00 53.16  ? 2522 MET C CG  1 
ATOM   5677 S SD  . MET C 1 219 ? 59.178  30.146  54.789 1.00 51.76  ? 2522 MET C SD  1 
ATOM   5678 C CE  . MET C 1 219 ? 58.214  31.654  54.518 1.00 50.19  ? 2522 MET C CE  1 
ATOM   5679 N N   . GLU C 1 220 ? 57.552  27.324  50.224 1.00 57.39  ? 2523 GLU C N   1 
ATOM   5680 C CA  . GLU C 1 220 ? 56.988  26.049  49.797 1.00 58.64  ? 2523 GLU C CA  1 
ATOM   5681 C C   . GLU C 1 220 ? 58.119  25.221  49.196 1.00 58.02  ? 2523 GLU C C   1 
ATOM   5682 O O   . GLU C 1 220 ? 58.165  24.000  49.341 1.00 57.13  ? 2523 GLU C O   1 
ATOM   5683 C CB  . GLU C 1 220 ? 55.903  26.271  48.736 1.00 59.72  ? 2523 GLU C CB  1 
ATOM   5684 C CG  . GLU C 1 220 ? 54.491  26.387  49.284 1.00 62.49  ? 2523 GLU C CG  1 
ATOM   5685 C CD  . GLU C 1 220 ? 54.134  25.231  50.213 1.00 64.97  ? 2523 GLU C CD  1 
ATOM   5686 O OE1 . GLU C 1 220 ? 54.663  24.105  50.004 1.00 64.45  ? 2523 GLU C OE1 1 
ATOM   5687 O OE2 . GLU C 1 220 ? 53.316  25.452  51.142 1.00 66.19  ? 2523 GLU C OE2 1 
ATOM   5688 N N   . HIS C 1 221 ? 59.029  25.917  48.520 1.00 57.99  ? 2524 HIS C N   1 
ATOM   5689 C CA  . HIS C 1 221 ? 60.175  25.298  47.871 1.00 57.15  ? 2524 HIS C CA  1 
ATOM   5690 C C   . HIS C 1 221 ? 61.131  24.691  48.882 1.00 56.15  ? 2524 HIS C C   1 
ATOM   5691 O O   . HIS C 1 221 ? 61.508  23.531  48.768 1.00 53.97  ? 2524 HIS C O   1 
ATOM   5692 C CB  . HIS C 1 221 ? 60.915  26.327  47.010 1.00 57.42  ? 2524 HIS C CB  1 
ATOM   5693 C CG  . HIS C 1 221 ? 62.101  25.766  46.289 1.00 58.97  ? 2524 HIS C CG  1 
ATOM   5694 N ND1 . HIS C 1 221 ? 63.254  25.382  46.939 1.00 59.11  ? 2524 HIS C ND1 1 
ATOM   5695 C CD2 . HIS C 1 221 ? 62.300  25.495  44.977 1.00 60.11  ? 2524 HIS C CD2 1 
ATOM   5696 C CE1 . HIS C 1 221 ? 64.113  24.898  46.058 1.00 59.78  ? 2524 HIS C CE1 1 
ATOM   5697 N NE2 . HIS C 1 221 ? 63.558  24.954  44.861 1.00 60.82  ? 2524 HIS C NE2 1 
ATOM   5698 N N   . LEU C 1 222 ? 61.528  25.475  49.874 1.00 56.70  ? 2525 LEU C N   1 
ATOM   5699 C CA  . LEU C 1 222 ? 62.440  24.961  50.871 1.00 57.68  ? 2525 LEU C CA  1 
ATOM   5700 C C   . LEU C 1 222 ? 61.804  23.766  51.554 1.00 58.50  ? 2525 LEU C C   1 
ATOM   5701 O O   . LEU C 1 222 ? 62.460  22.752  51.767 1.00 58.89  ? 2525 LEU C O   1 
ATOM   5702 C CB  . LEU C 1 222 ? 62.775  26.024  51.909 1.00 58.22  ? 2525 LEU C CB  1 
ATOM   5703 C CG  . LEU C 1 222 ? 63.888  25.573  52.858 1.00 59.34  ? 2525 LEU C CG  1 
ATOM   5704 C CD1 . LEU C 1 222 ? 65.166  25.381  52.052 1.00 60.21  ? 2525 LEU C CD1 1 
ATOM   5705 C CD2 . LEU C 1 222 ? 64.103  26.596  53.971 1.00 59.51  ? 2525 LEU C CD2 1 
ATOM   5706 N N   . TYR C 1 223 ? 60.522  23.878  51.891 1.00 59.84  ? 2526 TYR C N   1 
ATOM   5707 C CA  . TYR C 1 223 ? 59.820  22.778  52.549 1.00 60.54  ? 2526 TYR C CA  1 
ATOM   5708 C C   . TYR C 1 223 ? 59.924  21.522  51.714 1.00 61.18  ? 2526 TYR C C   1 
ATOM   5709 O O   . TYR C 1 223 ? 59.925  20.413  52.234 1.00 61.00  ? 2526 TYR C O   1 
ATOM   5710 C CB  . TYR C 1 223 ? 58.350  23.116  52.761 1.00 60.69  ? 2526 TYR C CB  1 
ATOM   5711 C CG  . TYR C 1 223 ? 57.580  21.991  53.409 1.00 61.41  ? 2526 TYR C CG  1 
ATOM   5712 C CD1 . TYR C 1 223 ? 56.877  21.063  52.642 1.00 61.93  ? 2526 TYR C CD1 1 
ATOM   5713 C CD2 . TYR C 1 223 ? 57.576  21.837  54.793 1.00 62.02  ? 2526 TYR C CD2 1 
ATOM   5714 C CE1 . TYR C 1 223 ? 56.187  20.010  53.238 1.00 61.60  ? 2526 TYR C CE1 1 
ATOM   5715 C CE2 . TYR C 1 223 ? 56.894  20.787  55.399 1.00 61.64  ? 2526 TYR C CE2 1 
ATOM   5716 C CZ  . TYR C 1 223 ? 56.203  19.879  54.615 1.00 62.04  ? 2526 TYR C CZ  1 
ATOM   5717 O OH  . TYR C 1 223 ? 55.532  18.837  55.206 1.00 62.38  ? 2526 TYR C OH  1 
ATOM   5718 N N   . SER C 1 224 ? 60.009  21.714  50.406 1.00 63.04  ? 2527 SER C N   1 
ATOM   5719 C CA  . SER C 1 224 ? 60.130  20.612  49.468 1.00 64.78  ? 2527 SER C CA  1 
ATOM   5720 C C   . SER C 1 224 ? 61.506  19.945  49.538 1.00 65.79  ? 2527 SER C C   1 
ATOM   5721 O O   . SER C 1 224 ? 61.607  18.723  49.627 1.00 65.32  ? 2527 SER C O   1 
ATOM   5722 C CB  . SER C 1 224 ? 59.890  21.117  48.056 1.00 64.62  ? 2527 SER C CB  1 
ATOM   5723 O OG  . SER C 1 224 ? 60.531  20.265  47.129 1.00 67.51  ? 2527 SER C OG  1 
ATOM   5724 N N   . MET C 1 225 ? 62.559  20.756  49.484 1.00 67.73  ? 2528 MET C N   1 
ATOM   5725 C CA  . MET C 1 225 ? 63.930  20.255  49.546 1.00 68.97  ? 2528 MET C CA  1 
ATOM   5726 C C   . MET C 1 225 ? 64.162  19.575  50.887 1.00 70.41  ? 2528 MET C C   1 
ATOM   5727 O O   . MET C 1 225 ? 65.077  18.768  51.031 1.00 70.42  ? 2528 MET C O   1 
ATOM   5728 C CB  . MET C 1 225 ? 64.928  21.406  49.363 1.00 68.23  ? 2528 MET C CB  1 
ATOM   5729 C CG  . MET C 1 225 ? 64.780  22.157  48.040 1.00 67.98  ? 2528 MET C CG  1 
ATOM   5730 S SD  . MET C 1 225 ? 65.056  21.140  46.546 1.00 69.70  ? 2528 MET C SD  1 
ATOM   5731 C CE  . MET C 1 225 ? 63.446  20.447  46.270 1.00 66.55  ? 2528 MET C CE  1 
ATOM   5732 N N   . LYS C 1 226 ? 63.331  19.921  51.869 1.00 72.19  ? 2529 LYS C N   1 
ATOM   5733 C CA  . LYS C 1 226 ? 63.410  19.325  53.197 1.00 74.23  ? 2529 LYS C CA  1 
ATOM   5734 C C   . LYS C 1 226 ? 62.836  17.918  53.083 1.00 75.46  ? 2529 LYS C C   1 
ATOM   5735 O O   . LYS C 1 226 ? 63.377  16.966  53.648 1.00 75.77  ? 2529 LYS C O   1 
ATOM   5736 C CB  . LYS C 1 226 ? 62.596  20.146  54.205 1.00 74.19  ? 2529 LYS C CB  1 
ATOM   5737 C CG  . LYS C 1 226 ? 62.410  19.492  55.585 1.00 75.18  ? 2529 LYS C CG  1 
ATOM   5738 C CD  . LYS C 1 226 ? 61.462  20.320  56.469 1.00 74.72  ? 2529 LYS C CD  1 
ATOM   5739 C CE  . LYS C 1 226 ? 61.183  19.665  57.821 1.00 74.07  ? 2529 LYS C CE  1 
ATOM   5740 N NZ  . LYS C 1 226 ? 60.432  18.381  57.707 1.00 72.86  ? 2529 LYS C NZ  1 
ATOM   5741 N N   . CYS C 1 227 ? 61.741  17.796  52.336 1.00 76.41  ? 2530 CYS C N   1 
ATOM   5742 C CA  . CYS C 1 227 ? 61.092  16.507  52.131 1.00 78.69  ? 2530 CYS C CA  1 
ATOM   5743 C C   . CYS C 1 227 ? 61.897  15.580  51.219 1.00 79.66  ? 2530 CYS C C   1 
ATOM   5744 O O   . CYS C 1 227 ? 61.633  14.374  51.149 1.00 79.44  ? 2530 CYS C O   1 
ATOM   5745 C CB  . CYS C 1 227 ? 59.693  16.710  51.559 1.00 78.23  ? 2530 CYS C CB  1 
ATOM   5746 S SG  . CYS C 1 227 ? 58.542  17.351  52.768 1.00 82.47  ? 2530 CYS C SG  1 
ATOM   5747 N N   . LYS C 1 228 ? 62.873  16.147  50.515 1.00 80.80  ? 2531 LYS C N   1 
ATOM   5748 C CA  . LYS C 1 228 ? 63.728  15.364  49.629 1.00 81.96  ? 2531 LYS C CA  1 
ATOM   5749 C C   . LYS C 1 228 ? 65.093  15.169  50.284 1.00 82.46  ? 2531 LYS C C   1 
ATOM   5750 O O   . LYS C 1 228 ? 66.027  14.658  49.664 1.00 82.64  ? 2531 LYS C O   1 
ATOM   5751 C CB  . LYS C 1 228 ? 63.894  16.062  48.269 1.00 82.43  ? 2531 LYS C CB  1 
ATOM   5752 C CG  . LYS C 1 228 ? 62.652  16.007  47.377 1.00 83.21  ? 2531 LYS C CG  1 
ATOM   5753 C CD  . LYS C 1 228 ? 63.007  16.162  45.893 1.00 82.67  ? 2531 LYS C CD  1 
ATOM   5754 C CE  . LYS C 1 228 ? 61.825  15.787  44.997 1.00 82.35  ? 2531 LYS C CE  1 
ATOM   5755 N NZ  . LYS C 1 228 ? 62.180  15.744  43.552 1.00 80.53  ? 2531 LYS C NZ  1 
ATOM   5756 N N   . ASN C 1 229 ? 65.197  15.577  51.546 1.00 82.79  ? 2532 ASN C N   1 
ATOM   5757 C CA  . ASN C 1 229 ? 66.441  15.455  52.292 1.00 83.09  ? 2532 ASN C CA  1 
ATOM   5758 C C   . ASN C 1 229 ? 67.591  15.973  51.428 1.00 83.03  ? 2532 ASN C C   1 
ATOM   5759 O O   . ASN C 1 229 ? 68.503  15.232  51.069 1.00 83.60  ? 2532 ASN C O   1 
ATOM   5760 C CB  . ASN C 1 229 ? 66.670  13.988  52.684 1.00 83.58  ? 2532 ASN C CB  1 
ATOM   5761 C CG  . ASN C 1 229 ? 65.585  13.450  53.614 1.00 83.71  ? 2532 ASN C CG  1 
ATOM   5762 O OD1 . ASN C 1 229 ? 65.584  13.726  54.817 1.00 84.01  ? 2532 ASN C OD1 1 
ATOM   5763 N ND2 . ASN C 1 229 ? 64.652  12.685  53.055 1.00 82.61  ? 2532 ASN C ND2 1 
ATOM   5764 N N   . VAL C 1 230 ? 67.522  17.253  51.086 1.00 82.85  ? 2533 VAL C N   1 
ATOM   5765 C CA  . VAL C 1 230 ? 68.541  17.900  50.269 1.00 82.81  ? 2533 VAL C CA  1 
ATOM   5766 C C   . VAL C 1 230 ? 69.103  19.051  51.103 1.00 83.37  ? 2533 VAL C C   1 
ATOM   5767 O O   . VAL C 1 230 ? 70.220  19.523  50.894 1.00 83.32  ? 2533 VAL C O   1 
ATOM   5768 C CB  . VAL C 1 230 ? 67.919  18.471  48.972 1.00 82.11  ? 2533 VAL C CB  1 
ATOM   5769 C CG1 . VAL C 1 230 ? 69.007  18.878  48.001 1.00 81.87  ? 2533 VAL C CG1 1 
ATOM   5770 C CG2 . VAL C 1 230 ? 66.998  17.450  48.346 1.00 81.18  ? 2533 VAL C CG2 1 
ATOM   5771 N N   . VAL C 1 231 ? 68.301  19.486  52.062 1.00 83.92  ? 2534 VAL C N   1 
ATOM   5772 C CA  . VAL C 1 231 ? 68.667  20.577  52.940 1.00 85.13  ? 2534 VAL C CA  1 
ATOM   5773 C C   . VAL C 1 231 ? 69.288  20.084  54.244 1.00 84.84  ? 2534 VAL C C   1 
ATOM   5774 O O   . VAL C 1 231 ? 68.769  19.172  54.886 1.00 84.83  ? 2534 VAL C O   1 
ATOM   5775 C CB  . VAL C 1 231 ? 67.420  21.431  53.273 1.00 86.71  ? 2534 VAL C CB  1 
ATOM   5776 C CG1 . VAL C 1 231 ? 66.281  20.522  53.709 1.00 87.03  ? 2534 VAL C CG1 1 
ATOM   5777 C CG2 . VAL C 1 231 ? 67.740  22.439  54.379 1.00 86.86  ? 2534 VAL C CG2 1 
ATOM   5778 N N   . PRO C 1 232 ? 70.420  20.681  54.645 1.00 84.52  ? 2535 PRO C N   1 
ATOM   5779 C CA  . PRO C 1 232 ? 71.104  20.305  55.882 1.00 84.49  ? 2535 PRO C CA  1 
ATOM   5780 C C   . PRO C 1 232 ? 70.173  20.505  57.078 1.00 84.36  ? 2535 PRO C C   1 
ATOM   5781 O O   . PRO C 1 232 ? 69.070  21.035  56.942 1.00 84.25  ? 2535 PRO C O   1 
ATOM   5782 C CB  . PRO C 1 232 ? 72.297  21.257  55.919 1.00 84.73  ? 2535 PRO C CB  1 
ATOM   5783 C CG  . PRO C 1 232 ? 72.606  21.456  54.478 1.00 84.94  ? 2535 PRO C CG  1 
ATOM   5784 C CD  . PRO C 1 232 ? 71.231  21.638  53.872 1.00 84.84  ? 2535 PRO C CD  1 
ATOM   5785 N N   . LEU C 1 233 ? 70.625  20.100  58.255 1.00 84.13  ? 2536 LEU C N   1 
ATOM   5786 C CA  . LEU C 1 233 ? 69.805  20.227  59.444 1.00 84.04  ? 2536 LEU C CA  1 
ATOM   5787 C C   . LEU C 1 233 ? 70.050  21.510  60.232 1.00 83.70  ? 2536 LEU C C   1 
ATOM   5788 O O   . LEU C 1 233 ? 70.104  21.477  61.461 1.00 84.80  ? 2536 LEU C O   1 
ATOM   5789 C CB  . LEU C 1 233 ? 70.013  19.008  60.356 1.00 84.59  ? 2536 LEU C CB  1 
ATOM   5790 C CG  . LEU C 1 233 ? 69.639  17.629  59.794 1.00 84.81  ? 2536 LEU C CG  1 
ATOM   5791 C CD1 . LEU C 1 233 ? 70.640  17.197  58.720 1.00 84.24  ? 2536 LEU C CD1 1 
ATOM   5792 C CD2 . LEU C 1 233 ? 69.613  16.617  60.931 1.00 84.52  ? 2536 LEU C CD2 1 
ATOM   5793 N N   . TYR C 1 234 ? 70.197  22.637  59.537 1.00 82.41  ? 2537 TYR C N   1 
ATOM   5794 C CA  . TYR C 1 234 ? 70.414  23.914  60.223 1.00 81.11  ? 2537 TYR C CA  1 
ATOM   5795 C C   . TYR C 1 234 ? 69.133  24.231  60.974 1.00 78.30  ? 2537 TYR C C   1 
ATOM   5796 O O   . TYR C 1 234 ? 68.139  24.608  60.372 1.00 77.43  ? 2537 TYR C O   1 
ATOM   5797 C CB  . TYR C 1 234 ? 70.712  25.030  59.219 1.00 83.22  ? 2537 TYR C CB  1 
ATOM   5798 C CG  . TYR C 1 234 ? 71.921  24.776  58.346 1.00 86.28  ? 2537 TYR C CG  1 
ATOM   5799 C CD1 . TYR C 1 234 ? 71.942  25.217  57.021 1.00 87.73  ? 2537 TYR C CD1 1 
ATOM   5800 C CD2 . TYR C 1 234 ? 73.032  24.074  58.826 1.00 87.32  ? 2537 TYR C CD2 1 
ATOM   5801 C CE1 . TYR C 1 234 ? 73.030  24.961  56.189 1.00 88.89  ? 2537 TYR C CE1 1 
ATOM   5802 C CE2 . TYR C 1 234 ? 74.134  23.815  57.999 1.00 89.05  ? 2537 TYR C CE2 1 
ATOM   5803 C CZ  . TYR C 1 234 ? 74.120  24.262  56.679 1.00 89.69  ? 2537 TYR C CZ  1 
ATOM   5804 O OH  . TYR C 1 234 ? 75.180  24.009  55.836 1.00 90.51  ? 2537 TYR C OH  1 
ATOM   5805 N N   . ASP C 1 235 ? 69.160  24.076  62.290 1.00 76.86  ? 2538 ASP C N   1 
ATOM   5806 C CA  . ASP C 1 235 ? 67.978  24.316  63.107 1.00 75.68  ? 2538 ASP C CA  1 
ATOM   5807 C C   . ASP C 1 235 ? 67.440  25.752  63.175 1.00 73.58  ? 2538 ASP C C   1 
ATOM   5808 O O   . ASP C 1 235 ? 66.223  25.954  63.249 1.00 72.41  ? 2538 ASP C O   1 
ATOM   5809 C CB  . ASP C 1 235 ? 68.187  23.751  64.528 1.00 77.37  ? 2538 ASP C CB  1 
ATOM   5810 C CG  . ASP C 1 235 ? 69.654  23.730  64.968 1.00 79.43  ? 2538 ASP C CG  1 
ATOM   5811 O OD1 . ASP C 1 235 ? 69.915  23.257  66.104 1.00 79.89  ? 2538 ASP C OD1 1 
ATOM   5812 O OD2 . ASP C 1 235 ? 70.542  24.175  64.199 1.00 80.60  ? 2538 ASP C OD2 1 
ATOM   5813 N N   . LEU C 1 236 ? 68.324  26.746  63.143 1.00 71.40  ? 2539 LEU C N   1 
ATOM   5814 C CA  . LEU C 1 236 ? 67.876  28.138  63.190 1.00 69.20  ? 2539 LEU C CA  1 
ATOM   5815 C C   . LEU C 1 236 ? 66.955  28.374  61.998 1.00 68.50  ? 2539 LEU C C   1 
ATOM   5816 O O   . LEU C 1 236 ? 65.933  29.048  62.117 1.00 68.25  ? 2539 LEU C O   1 
ATOM   5817 C CB  . LEU C 1 236 ? 69.082  29.088  63.135 1.00 69.56  ? 2539 LEU C CB  1 
ATOM   5818 C CG  . LEU C 1 236 ? 68.930  30.619  63.202 1.00 68.45  ? 2539 LEU C CG  1 
ATOM   5819 C CD1 . LEU C 1 236 ? 68.506  31.169  61.850 1.00 69.29  ? 2539 LEU C CD1 1 
ATOM   5820 C CD2 . LEU C 1 236 ? 67.944  30.996  64.283 1.00 67.41  ? 2539 LEU C CD2 1 
ATOM   5821 N N   . LEU C 1 237 ? 67.327  27.796  60.855 1.00 67.06  ? 2540 LEU C N   1 
ATOM   5822 C CA  . LEU C 1 237 ? 66.562  27.907  59.614 1.00 64.92  ? 2540 LEU C CA  1 
ATOM   5823 C C   . LEU C 1 237 ? 65.381  26.937  59.633 1.00 64.44  ? 2540 LEU C C   1 
ATOM   5824 O O   . LEU C 1 237 ? 64.310  27.245  59.119 1.00 65.39  ? 2540 LEU C O   1 
ATOM   5825 C CB  . LEU C 1 237 ? 67.460  27.592  58.409 1.00 62.67  ? 2540 LEU C CB  1 
ATOM   5826 C CG  . LEU C 1 237 ? 66.877  27.672  56.993 1.00 61.10  ? 2540 LEU C CG  1 
ATOM   5827 C CD1 . LEU C 1 237 ? 66.687  29.127  56.590 1.00 60.63  ? 2540 LEU C CD1 1 
ATOM   5828 C CD2 . LEU C 1 237 ? 67.811  26.981  56.022 1.00 59.36  ? 2540 LEU C CD2 1 
ATOM   5829 N N   . LEU C 1 238 ? 65.577  25.764  60.223 1.00 63.58  ? 2541 LEU C N   1 
ATOM   5830 C CA  . LEU C 1 238 ? 64.516  24.770  60.285 1.00 64.14  ? 2541 LEU C CA  1 
ATOM   5831 C C   . LEU C 1 238 ? 63.380  25.318  61.133 1.00 64.96  ? 2541 LEU C C   1 
ATOM   5832 O O   . LEU C 1 238 ? 62.210  25.016  60.884 1.00 65.35  ? 2541 LEU C O   1 
ATOM   5833 C CB  . LEU C 1 238 ? 65.036  23.471  60.905 1.00 64.68  ? 2541 LEU C CB  1 
ATOM   5834 C CG  . LEU C 1 238 ? 64.677  22.145  60.220 1.00 64.84  ? 2541 LEU C CG  1 
ATOM   5835 C CD1 . LEU C 1 238 ? 63.164  22.029  60.022 1.00 64.25  ? 2541 LEU C CD1 1 
ATOM   5836 C CD2 . LEU C 1 238 ? 65.400  22.061  58.885 1.00 64.24  ? 2541 LEU C CD2 1 
ATOM   5837 N N   . GLU C 1 239 ? 63.743  26.120  62.135 1.00 64.74  ? 2542 GLU C N   1 
ATOM   5838 C CA  . GLU C 1 239 ? 62.786  26.753  63.047 1.00 64.91  ? 2542 GLU C CA  1 
ATOM   5839 C C   . GLU C 1 239 ? 61.861  27.731  62.299 1.00 64.22  ? 2542 GLU C C   1 
ATOM   5840 O O   . GLU C 1 239 ? 60.634  27.638  62.385 1.00 64.68  ? 2542 GLU C O   1 
ATOM   5841 C CB  . GLU C 1 239 ? 63.562  27.487  64.154 1.00 67.23  ? 2542 GLU C CB  1 
ATOM   5842 C CG  . GLU C 1 239 ? 62.747  28.425  65.063 1.00 69.51  ? 2542 GLU C CG  1 
ATOM   5843 C CD  . GLU C 1 239 ? 63.598  29.097  66.162 1.00 70.16  ? 2542 GLU C CD  1 
ATOM   5844 O OE1 . GLU C 1 239 ? 63.076  29.988  66.872 1.00 71.72  ? 2542 GLU C OE1 1 
ATOM   5845 O OE2 . GLU C 1 239 ? 64.782  28.733  66.327 1.00 69.67  ? 2542 GLU C OE2 1 
ATOM   5846 N N   . MET C 1 240 ? 62.460  28.659  61.560 1.00 62.80  ? 2543 MET C N   1 
ATOM   5847 C CA  . MET C 1 240 ? 61.707  29.645  60.800 1.00 62.20  ? 2543 MET C CA  1 
ATOM   5848 C C   . MET C 1 240 ? 60.799  28.993  59.786 1.00 62.50  ? 2543 MET C C   1 
ATOM   5849 O O   . MET C 1 240 ? 59.727  29.504  59.494 1.00 64.23  ? 2543 MET C O   1 
ATOM   5850 C CB  . MET C 1 240 ? 62.656  30.590  60.067 1.00 62.10  ? 2543 MET C CB  1 
ATOM   5851 C CG  . MET C 1 240 ? 63.527  31.422  60.984 1.00 61.65  ? 2543 MET C CG  1 
ATOM   5852 S SD  . MET C 1 240 ? 62.556  32.471  62.068 1.00 60.69  ? 2543 MET C SD  1 
ATOM   5853 C CE  . MET C 1 240 ? 62.382  31.404  63.492 1.00 61.10  ? 2543 MET C CE  1 
ATOM   5854 N N   . LEU C 1 241 ? 61.236  27.866  59.241 1.00 62.90  ? 2544 LEU C N   1 
ATOM   5855 C CA  . LEU C 1 241 ? 60.461  27.143  58.239 1.00 62.61  ? 2544 LEU C CA  1 
ATOM   5856 C C   . LEU C 1 241 ? 59.282  26.408  58.858 1.00 61.85  ? 2544 LEU C C   1 
ATOM   5857 O O   . LEU C 1 241 ? 58.176  26.445  58.338 1.00 60.58  ? 2544 LEU C O   1 
ATOM   5858 C CB  . LEU C 1 241 ? 61.357  26.147  57.502 1.00 63.21  ? 2544 LEU C CB  1 
ATOM   5859 C CG  . LEU C 1 241 ? 60.730  25.460  56.288 1.00 64.57  ? 2544 LEU C CG  1 
ATOM   5860 C CD1 . LEU C 1 241 ? 60.295  26.514  55.284 1.00 65.33  ? 2544 LEU C CD1 1 
ATOM   5861 C CD2 . LEU C 1 241 ? 61.727  24.515  55.651 1.00 64.80  ? 2544 LEU C CD2 1 
ATOM   5862 N N   . ASP C 1 242 ? 59.515  25.731  59.968 1.00 62.43  ? 2545 ASP C N   1 
ATOM   5863 C CA  . ASP C 1 242 ? 58.429  25.020  60.602 1.00 65.24  ? 2545 ASP C CA  1 
ATOM   5864 C C   . ASP C 1 242 ? 57.442  26.021  61.182 1.00 64.53  ? 2545 ASP C C   1 
ATOM   5865 O O   . ASP C 1 242 ? 56.315  25.672  61.547 1.00 65.12  ? 2545 ASP C O   1 
ATOM   5866 C CB  . ASP C 1 242 ? 58.965  24.077  61.686 1.00 68.17  ? 2545 ASP C CB  1 
ATOM   5867 C CG  . ASP C 1 242 ? 59.498  22.763  61.104 1.00 71.97  ? 2545 ASP C CG  1 
ATOM   5868 O OD1 . ASP C 1 242 ? 59.986  21.918  61.894 1.00 73.30  ? 2545 ASP C OD1 1 
ATOM   5869 O OD2 . ASP C 1 242 ? 59.423  22.577  59.857 1.00 72.96  ? 2545 ASP C OD2 1 
ATOM   5870 N N   . ALA C 1 243 ? 57.861  27.277  61.238 1.00 63.16  ? 2546 ALA C N   1 
ATOM   5871 C CA  . ALA C 1 243 ? 57.007  28.327  61.770 1.00 62.12  ? 2546 ALA C CA  1 
ATOM   5872 C C   . ALA C 1 243 ? 55.836  28.654  60.839 1.00 60.89  ? 2546 ALA C C   1 
ATOM   5873 O O   . ALA C 1 243 ? 54.951  29.420  61.204 1.00 60.65  ? 2546 ALA C O   1 
ATOM   5874 C CB  . ALA C 1 243 ? 57.838  29.584  62.046 1.00 62.56  ? 2546 ALA C CB  1 
ATOM   5875 N N   . HIS C 1 244 ? 55.814  28.064  59.649 1.00 59.73  ? 2547 HIS C N   1 
ATOM   5876 C CA  . HIS C 1 244 ? 54.728  28.317  58.705 1.00 59.76  ? 2547 HIS C CA  1 
ATOM   5877 C C   . HIS C 1 244 ? 53.739  27.158  58.577 1.00 60.73  ? 2547 HIS C C   1 
ATOM   5878 O O   . HIS C 1 244 ? 52.652  27.389  58.010 1.00 61.69  ? 2547 HIS C O   1 
ATOM   5879 C CB  . HIS C 1 244 ? 55.283  28.656  57.324 1.00 59.26  ? 2547 HIS C CB  1 
ATOM   5880 C CG  . HIS C 1 244 ? 55.834  30.042  57.218 1.00 59.07  ? 2547 HIS C CG  1 
ATOM   5881 N ND1 . HIS C 1 244 ? 56.826  30.515  58.049 1.00 58.69  ? 2547 HIS C ND1 1 
ATOM   5882 C CD2 . HIS C 1 244 ? 55.538  31.055  56.370 1.00 58.85  ? 2547 HIS C CD2 1 
ATOM   5883 C CE1 . HIS C 1 244 ? 57.118  31.760  57.719 1.00 58.74  ? 2547 HIS C CE1 1 
ATOM   5884 N NE2 . HIS C 1 244 ? 56.350  32.112  56.703 1.00 58.73  ? 2547 HIS C NE2 1 
HETATM 5885 C C1  . EST D 2 .   ? 104.010 17.378  24.929 1.00 30.74  ? 600  EST A C1  1 
HETATM 5886 C C2  . EST D 2 .   ? 102.846 17.987  25.511 1.00 32.05  ? 600  EST A C2  1 
HETATM 5887 C C3  . EST D 2 .   ? 101.529 17.488  25.179 1.00 32.80  ? 600  EST A C3  1 
HETATM 5888 O O3  . EST D 2 .   ? 100.378 18.069  25.729 1.00 33.61  ? 600  EST A O3  1 
HETATM 5889 C C4  . EST D 2 .   ? 101.386 16.398  24.275 1.00 32.17  ? 600  EST A C4  1 
HETATM 5890 C C5  . EST D 2 .   ? 102.517 15.781  23.685 1.00 31.57  ? 600  EST A C5  1 
HETATM 5891 C C6  . EST D 2 .   ? 102.281 14.627  22.718 1.00 33.45  ? 600  EST A C6  1 
HETATM 5892 C C7  . EST D 2 .   ? 103.562 13.987  22.072 1.00 34.24  ? 600  EST A C7  1 
HETATM 5893 C C8  . EST D 2 .   ? 104.812 14.054  22.954 1.00 32.96  ? 600  EST A C8  1 
HETATM 5894 C C9  . EST D 2 .   ? 105.119 15.565  23.338 1.00 33.59  ? 600  EST A C9  1 
HETATM 5895 C C10 . EST D 2 .   ? 103.878 16.262  24.008 1.00 32.60  ? 600  EST A C10 1 
HETATM 5896 C C11 . EST D 2 .   ? 106.409 15.588  24.205 1.00 34.97  ? 600  EST A C11 1 
HETATM 5897 C C12 . EST D 2 .   ? 107.647 14.914  23.537 1.00 35.07  ? 600  EST A C12 1 
HETATM 5898 C C13 . EST D 2 .   ? 107.365 13.459  23.130 1.00 34.55  ? 600  EST A C13 1 
HETATM 5899 C C14 . EST D 2 .   ? 106.061 13.428  22.236 1.00 34.21  ? 600  EST A C14 1 
HETATM 5900 C C15 . EST D 2 .   ? 106.062 11.982  21.725 1.00 34.30  ? 600  EST A C15 1 
HETATM 5901 C C16 . EST D 2 .   ? 107.571 11.749  21.341 1.00 34.52  ? 600  EST A C16 1 
HETATM 5902 C C17 . EST D 2 .   ? 108.352 12.845  22.112 1.00 34.65  ? 600  EST A C17 1 
HETATM 5903 O O17 . EST D 2 .   ? 109.547 12.275  22.674 1.00 39.81  ? 600  EST A O17 1 
HETATM 5904 C C18 . EST D 2 .   ? 107.314 12.555  24.426 1.00 34.08  ? 600  EST A C18 1 
HETATM 5905 C C1  . EST E 2 .   ? 35.151  32.218  46.861 1.00 34.42  ? 1600 EST B C1  1 
HETATM 5906 C C2  . EST E 2 .   ? 34.598  33.396  46.260 1.00 35.01  ? 1600 EST B C2  1 
HETATM 5907 C C3  . EST E 2 .   ? 35.224  34.686  46.503 1.00 36.22  ? 1600 EST B C3  1 
HETATM 5908 O O3  . EST E 2 .   ? 34.714  35.840  45.924 1.00 37.53  ? 1600 EST B O3  1 
HETATM 5909 C C4  . EST E 2 .   ? 36.369  34.789  47.336 1.00 35.97  ? 1600 EST B C4  1 
HETATM 5910 C C5  . EST E 2 .   ? 36.936  33.630  47.951 1.00 36.79  ? 1600 EST B C5  1 
HETATM 5911 C C6  . EST E 2 .   ? 38.174  33.812  48.853 1.00 38.04  ? 1600 EST B C6  1 
HETATM 5912 C C7  . EST E 2 .   ? 38.748  32.520  49.517 1.00 36.99  ? 1600 EST B C7  1 
HETATM 5913 C C8  . EST E 2 .   ? 38.528  31.242  48.674 1.00 37.16  ? 1600 EST B C8  1 
HETATM 5914 C C9  . EST E 2 .   ? 36.969  31.036  48.394 1.00 37.21  ? 1600 EST B C9  1 
HETATM 5915 C C10 . EST E 2 .   ? 36.331  32.297  47.713 1.00 36.53  ? 1600 EST B C10 1 
HETATM 5916 C C11 . EST E 2 .   ? 36.800  29.726  47.577 1.00 38.12  ? 1600 EST B C11 1 
HETATM 5917 C C12 . EST E 2 .   ? 37.421  28.476  48.265 1.00 37.77  ? 1600 EST B C12 1 
HETATM 5918 C C13 . EST E 2 .   ? 38.923  28.660  48.556 1.00 36.27  ? 1600 EST B C13 1 
HETATM 5919 C C14 . EST E 2 .   ? 39.111  29.968  49.389 1.00 35.85  ? 1600 EST B C14 1 
HETATM 5920 C C15 . EST E 2 .   ? 40.593  29.879  49.766 1.00 36.32  ? 1600 EST B C15 1 
HETATM 5921 C C16 . EST E 2 .   ? 40.757  28.385  50.193 1.00 37.17  ? 1600 EST B C16 1 
HETATM 5922 C C17 . EST E 2 .   ? 39.532  27.671  49.566 1.00 36.62  ? 1600 EST B C17 1 
HETATM 5923 O O17 . EST E 2 .   ? 39.929  26.397  49.046 1.00 39.22  ? 1600 EST B O17 1 
HETATM 5924 C C18 . EST E 2 .   ? 39.738  28.602  47.206 1.00 36.17  ? 1600 EST B C18 1 
HETATM 5925 C C1  . EST F 2 .   ? 69.626  32.462  50.715 1.00 33.85  ? 2600 EST C C1  1 
HETATM 5926 C C2  . EST F 2 .   ? 70.280  33.619  51.257 1.00 34.51  ? 2600 EST C C2  1 
HETATM 5927 C C3  . EST F 2 .   ? 69.719  34.943  51.023 1.00 34.97  ? 2600 EST C C3  1 
HETATM 5928 O O3  . EST F 2 .   ? 70.346  36.086  51.542 1.00 31.47  ? 2600 EST C O3  1 
HETATM 5929 C C4  . EST F 2 .   ? 68.520  35.086  50.252 1.00 34.78  ? 2600 EST C C4  1 
HETATM 5930 C C5  . EST F 2 .   ? 67.853  33.946  49.699 1.00 35.24  ? 2600 EST C C5  1 
HETATM 5931 C C6  . EST F 2 .   ? 66.582  34.177  48.861 1.00 37.52  ? 2600 EST C C6  1 
HETATM 5932 C C7  . EST F 2 .   ? 65.916  32.905  48.249 1.00 37.22  ? 2600 EST C C7  1 
HETATM 5933 C C8  . EST F 2 .   ? 66.117  31.632  49.099 1.00 36.58  ? 2600 EST C C8  1 
HETATM 5934 C C9  . EST F 2 .   ? 67.658  31.345  49.308 1.00 35.94  ? 2600 EST C C9  1 
HETATM 5935 C C10 . EST F 2 .   ? 68.400  32.589  49.929 1.00 35.59  ? 2600 EST C C10 1 
HETATM 5936 C C11 . EST F 2 .   ? 67.792  30.051  50.144 1.00 36.14  ? 2600 EST C C11 1 
HETATM 5937 C C12 . EST F 2 .   ? 67.082  28.824  49.527 1.00 37.23  ? 2600 EST C C12 1 
HETATM 5938 C C13 . EST F 2 .   ? 65.594  29.074  49.305 1.00 37.60  ? 2600 EST C C13 1 
HETATM 5939 C C14 . EST F 2 .   ? 65.439  30.381  48.437 1.00 37.44  ? 2600 EST C C14 1 
HETATM 5940 C C15 . EST F 2 .   ? 63.928  30.367  48.108 1.00 38.77  ? 2600 EST C C15 1 
HETATM 5941 C C16 . EST F 2 .   ? 63.667  28.867  47.741 1.00 38.13  ? 2600 EST C C16 1 
HETATM 5942 C C17 . EST F 2 .   ? 64.868  28.079  48.360 1.00 38.08  ? 2600 EST C C17 1 
HETATM 5943 O O17 . EST F 2 .   ? 64.378  26.850  48.967 1.00 38.08  ? 2600 EST C O17 1 
HETATM 5944 C C18 . EST F 2 .   ? 64.846  29.088  50.709 1.00 38.02  ? 2600 EST C C18 1 
HETATM 5945 O O   . HOH G 3 .   ? 76.771  11.843  20.461 1.00 23.37  ? 3001 HOH A O   1 
HETATM 5946 O O   . HOH G 3 .   ? 83.212  2.443   48.515 1.00 32.91  ? 3006 HOH A O   1 
HETATM 5947 O O   . HOH G 3 .   ? 71.711  11.679  33.735 1.00 36.76  ? 3008 HOH A O   1 
HETATM 5948 O O   . HOH G 3 .   ? 92.448  20.136  41.237 1.00 30.94  ? 3010 HOH A O   1 
HETATM 5949 O O   . HOH G 3 .   ? 81.848  -0.944  48.413 1.00 37.52  ? 3012 HOH A O   1 
HETATM 5950 O O   . HOH G 3 .   ? 100.709 6.715   29.331 1.00 20.83  ? 3014 HOH A O   1 
HETATM 5951 O O   . HOH G 3 .   ? 95.054  -3.653  43.922 1.00 51.12  ? 3019 HOH A O   1 
HETATM 5952 O O   . HOH G 3 .   ? 78.252  14.822  21.733 1.00 29.35  ? 3020 HOH A O   1 
HETATM 5953 O O   . HOH G 3 .   ? 113.462 10.021  11.752 1.00 53.44  ? 3025 HOH A O   1 
HETATM 5954 O O   . HOH G 3 .   ? 124.751 16.830  24.689 1.00 28.87  ? 3028 HOH A O   1 
HETATM 5955 O O   . HOH G 3 .   ? 72.693  8.504   37.822 1.00 32.09  ? 3032 HOH A O   1 
HETATM 5956 O O   . HOH G 3 .   ? 88.486  0.210   47.034 1.00 26.90  ? 3033 HOH A O   1 
HETATM 5957 O O   . HOH G 3 .   ? 96.844  -8.287  38.283 1.00 36.17  ? 3034 HOH A O   1 
HETATM 5958 O O   . HOH G 3 .   ? 94.657  2.989   25.723 1.00 35.79  ? 3035 HOH A O   1 
HETATM 5959 O O   . HOH G 3 .   ? 103.505 10.397  3.891  1.00 52.62  ? 3036 HOH A O   1 
HETATM 5960 O O   . HOH G 3 .   ? 99.224  22.993  25.720 1.00 34.56  ? 3039 HOH A O   1 
HETATM 5961 O O   . HOH G 3 .   ? 77.866  13.901  18.771 1.00 10.85  ? 3044 HOH A O   1 
HETATM 5962 O O   . HOH G 3 .   ? 94.155  -8.233  37.585 1.00 42.73  ? 3045 HOH A O   1 
HETATM 5963 O O   . HOH G 3 .   ? 106.614 24.872  27.278 1.00 36.29  ? 3048 HOH A O   1 
HETATM 5964 O O   . HOH G 3 .   ? 103.549 29.269  16.359 1.00 42.93  ? 3049 HOH A O   1 
HETATM 5965 O O   . HOH G 3 .   ? 103.516 2.016   34.701 1.00 31.74  ? 3055 HOH A O   1 
HETATM 5966 O O   . HOH G 3 .   ? 116.516 16.984  10.023 1.00 61.08  ? 3057 HOH A O   1 
HETATM 5967 O O   . HOH G 3 .   ? 81.699  -7.816  43.218 1.00 41.02  ? 3059 HOH A O   1 
HETATM 5968 O O   . HOH G 3 .   ? 116.705 4.685   36.089 1.00 36.09  ? 3061 HOH A O   1 
HETATM 5969 O O   . HOH G 3 .   ? 97.109  0.082   51.863 1.00 36.90  ? 3065 HOH A O   1 
HETATM 5970 O O   . HOH G 3 .   ? 96.957  -5.862  49.345 1.00 59.77  ? 3066 HOH A O   1 
HETATM 5971 O O   . HOH G 3 .   ? 67.461  5.563   22.560 1.00 43.53  ? 3069 HOH A O   1 
HETATM 5972 O O   . HOH G 3 .   ? 94.925  16.399  30.833 1.00 29.04  ? 3075 HOH A O   1 
HETATM 5973 O O   . HOH G 3 .   ? 84.080  26.951  36.438 1.00 63.86  ? 3077 HOH A O   1 
HETATM 5974 O O   . HOH G 3 .   ? 84.356  -4.269  49.887 1.00 42.60  ? 3083 HOH A O   1 
HETATM 5975 O O   . HOH G 3 .   ? 105.498 33.071  26.727 1.00 34.25  ? 3084 HOH A O   1 
HETATM 5976 O O   . HOH G 3 .   ? 85.173  -8.413  44.287 1.00 42.91  ? 3089 HOH A O   1 
HETATM 5977 O O   . HOH G 3 .   ? 112.510 3.505   31.574 1.00 40.33  ? 3090 HOH A O   1 
HETATM 5978 O O   . HOH G 3 .   ? 120.885 18.786  26.308 1.00 32.44  ? 3091 HOH A O   1 
HETATM 5979 O O   . HOH G 3 .   ? 85.188  11.030  46.536 1.00 24.93  ? 3095 HOH A O   1 
HETATM 5980 O O   . HOH G 3 .   ? 77.026  2.612   52.158 1.00 58.61  ? 3097 HOH A O   1 
HETATM 5981 O O   . HOH G 3 .   ? 113.282 -3.433  30.060 1.00 51.96  ? 3099 HOH A O   1 
HETATM 5982 O O   . HOH G 3 .   ? 75.906  20.492  22.111 1.00 53.39  ? 3107 HOH A O   1 
HETATM 5983 O O   . HOH G 3 .   ? 85.099  -5.741  52.067 1.00 33.62  ? 3113 HOH A O   1 
HETATM 5984 O O   . HOH G 3 .   ? 95.244  22.627  42.394 1.00 34.84  ? 3114 HOH A O   1 
HETATM 5985 O O   . HOH G 3 .   ? 94.998  21.406  36.768 1.00 27.12  ? 3115 HOH A O   1 
HETATM 5986 O O   . HOH G 3 .   ? 106.855 26.927  14.433 1.00 34.80  ? 3117 HOH A O   1 
HETATM 5987 O O   . HOH G 3 .   ? 113.791 13.447  41.447 1.00 32.22  ? 3118 HOH A O   1 
HETATM 5988 O O   . HOH G 3 .   ? 87.314  15.162  45.345 1.00 46.90  ? 3119 HOH A O   1 
HETATM 5989 O O   . HOH G 3 .   ? 102.572 0.930   41.322 1.00 51.02  ? 3121 HOH A O   1 
HETATM 5990 O O   . HOH G 3 .   ? 92.631  6.649   49.041 1.00 43.29  ? 3122 HOH A O   1 
HETATM 5991 O O   . HOH G 3 .   ? 94.453  -10.659 39.195 1.00 55.61  ? 3124 HOH A O   1 
HETATM 5992 O O   . HOH G 3 .   ? 95.775  17.704  12.422 1.00 39.49  ? 3126 HOH A O   1 
HETATM 5993 O O   . HOH G 3 .   ? 81.877  -10.213 44.703 1.00 38.23  ? 3130 HOH A O   1 
HETATM 5994 O O   . HOH G 3 .   ? 114.222 -5.412  27.362 1.00 28.65  ? 3131 HOH A O   1 
HETATM 5995 O O   . HOH G 3 .   ? 104.768 34.265  29.178 1.00 41.73  ? 3134 HOH A O   1 
HETATM 5996 O O   . HOH G 3 .   ? 78.290  13.772  16.022 1.00 24.51  ? 3135 HOH A O   1 
HETATM 5997 O O   . HOH G 3 .   ? 83.890  -3.215  47.404 1.00 41.00  ? 3141 HOH A O   1 
HETATM 5998 O O   . HOH G 3 .   ? 112.447 37.766  20.273 1.00 43.06  ? 3145 HOH A O   1 
HETATM 5999 O O   . HOH G 3 .   ? 106.206 9.945   4.702  1.00 51.72  ? 3149 HOH A O   1 
HETATM 6000 O O   . HOH G 3 .   ? 102.516 12.650  3.765  1.00 59.76  ? 3150 HOH A O   1 
HETATM 6001 O O   . HOH G 3 .   ? 120.681 18.419  28.931 1.00 32.85  ? 3158 HOH A O   1 
HETATM 6002 O O   . HOH H 3 .   ? 51.572  47.793  25.262 1.00 28.40  ? 3009 HOH B O   1 
HETATM 6003 O O   . HOH H 3 .   ? 53.185  27.772  46.662 1.00 38.15  ? 3015 HOH B O   1 
HETATM 6004 O O   . HOH H 3 .   ? 51.836  53.617  27.915 1.00 50.67  ? 3017 HOH B O   1 
HETATM 6005 O O   . HOH H 3 .   ? 40.726  36.992  26.091 1.00 48.53  ? 3021 HOH B O   1 
HETATM 6006 O O   . HOH H 3 .   ? 42.709  44.014  22.467 1.00 27.27  ? 3022 HOH B O   1 
HETATM 6007 O O   . HOH H 3 .   ? 31.931  49.476  57.473 1.00 35.38  ? 3024 HOH B O   1 
HETATM 6008 O O   . HOH H 3 .   ? 49.722  52.824  22.405 1.00 36.99  ? 3026 HOH B O   1 
HETATM 6009 O O   . HOH H 3 .   ? 53.269  65.063  53.375 1.00 24.28  ? 3027 HOH B O   1 
HETATM 6010 O O   . HOH H 3 .   ? 45.430  27.484  32.986 1.00 27.32  ? 3029 HOH B O   1 
HETATM 6011 O O   . HOH H 3 .   ? 31.866  52.648  53.052 1.00 51.78  ? 3037 HOH B O   1 
HETATM 6012 O O   . HOH H 3 .   ? 51.670  27.945  51.792 1.00 30.01  ? 3041 HOH B O   1 
HETATM 6013 O O   . HOH H 3 .   ? 49.830  69.359  53.378 1.00 33.22  ? 3042 HOH B O   1 
HETATM 6014 O O   . HOH H 3 .   ? 30.838  55.870  45.788 1.00 47.76  ? 3043 HOH B O   1 
HETATM 6015 O O   . HOH H 3 .   ? 27.105  31.843  65.858 1.00 30.73  ? 3046 HOH B O   1 
HETATM 6016 O O   . HOH H 3 .   ? 24.662  32.860  40.527 1.00 35.16  ? 3047 HOH B O   1 
HETATM 6017 O O   . HOH H 3 .   ? 54.636  19.739  42.189 1.00 38.33  ? 3050 HOH B O   1 
HETATM 6018 O O   . HOH H 3 .   ? 35.993  64.123  33.581 1.00 55.10  ? 3053 HOH B O   1 
HETATM 6019 O O   . HOH H 3 .   ? 35.633  17.845  58.861 1.00 32.20  ? 3056 HOH B O   1 
HETATM 6020 O O   . HOH H 3 .   ? 38.178  41.706  24.838 1.00 51.13  ? 3058 HOH B O   1 
HETATM 6021 O O   . HOH H 3 .   ? 55.808  50.203  22.328 1.00 38.64  ? 3060 HOH B O   1 
HETATM 6022 O O   . HOH H 3 .   ? 50.286  32.254  36.562 1.00 38.25  ? 3062 HOH B O   1 
HETATM 6023 O O   . HOH H 3 .   ? 49.293  36.301  43.483 1.00 34.46  ? 3064 HOH B O   1 
HETATM 6024 O O   . HOH H 3 .   ? 52.466  21.286  46.316 1.00 36.11  ? 3068 HOH B O   1 
HETATM 6025 O O   . HOH H 3 .   ? 27.458  52.180  31.719 1.00 43.35  ? 3070 HOH B O   1 
HETATM 6026 O O   . HOH H 3 .   ? 43.176  30.878  67.709 1.00 43.90  ? 3073 HOH B O   1 
HETATM 6027 O O   . HOH H 3 .   ? 38.952  27.082  66.869 1.00 42.54  ? 3074 HOH B O   1 
HETATM 6028 O O   . HOH H 3 .   ? 32.760  26.834  69.451 1.00 45.28  ? 3078 HOH B O   1 
HETATM 6029 O O   . HOH H 3 .   ? 33.792  17.260  44.405 1.00 46.07  ? 3080 HOH B O   1 
HETATM 6030 O O   . HOH H 3 .   ? 39.159  20.498  60.701 1.00 25.81  ? 3081 HOH B O   1 
HETATM 6031 O O   . HOH H 3 .   ? 39.283  58.364  51.054 1.00 46.05  ? 3082 HOH B O   1 
HETATM 6032 O O   . HOH H 3 .   ? 63.832  34.871  29.245 1.00 65.26  ? 3092 HOH B O   1 
HETATM 6033 O O   . HOH H 3 .   ? 24.254  31.465  56.436 1.00 49.14  ? 3093 HOH B O   1 
HETATM 6034 O O   . HOH H 3 .   ? 55.843  24.715  40.983 1.00 38.17  ? 3094 HOH B O   1 
HETATM 6035 O O   . HOH H 3 .   ? 27.198  35.057  65.026 1.00 45.17  ? 3098 HOH B O   1 
HETATM 6036 O O   . HOH H 3 .   ? 47.964  18.614  40.603 1.00 27.65  ? 3103 HOH B O   1 
HETATM 6037 O O   . HOH H 3 .   ? 56.449  21.779  39.943 1.00 45.23  ? 3104 HOH B O   1 
HETATM 6038 O O   . HOH H 3 .   ? 23.039  44.450  55.181 1.00 24.77  ? 3106 HOH B O   1 
HETATM 6039 O O   . HOH H 3 .   ? 24.866  24.952  40.749 1.00 70.52  ? 3109 HOH B O   1 
HETATM 6040 O O   . HOH H 3 .   ? 49.465  62.040  61.444 1.00 39.92  ? 3111 HOH B O   1 
HETATM 6041 O O   . HOH H 3 .   ? 49.534  50.230  24.133 1.00 33.05  ? 3112 HOH B O   1 
HETATM 6042 O O   . HOH H 3 .   ? 23.358  32.748  54.325 1.00 43.46  ? 3116 HOH B O   1 
HETATM 6043 O O   . HOH H 3 .   ? 33.362  42.397  43.212 1.00 38.51  ? 3120 HOH B O   1 
HETATM 6044 O O   . HOH H 3 .   ? 22.632  48.144  55.160 1.00 24.32  ? 3132 HOH B O   1 
HETATM 6045 O O   . HOH H 3 .   ? 21.458  16.780  53.410 1.00 60.29  ? 3138 HOH B O   1 
HETATM 6046 O O   . HOH H 3 .   ? 55.248  22.029  33.136 1.00 62.19  ? 3142 HOH B O   1 
HETATM 6047 O O   . HOH H 3 .   ? 29.300  48.660  59.404 1.00 40.21  ? 3143 HOH B O   1 
HETATM 6048 O O   . HOH H 3 .   ? 47.135  64.405  63.312 1.00 41.65  ? 3144 HOH B O   1 
HETATM 6049 O O   . HOH H 3 .   ? 38.139  48.339  64.201 1.00 41.50  ? 3147 HOH B O   1 
HETATM 6050 O O   . HOH H 3 .   ? 56.404  52.680  23.287 1.00 42.14  ? 3148 HOH B O   1 
HETATM 6051 O O   . HOH H 3 .   ? 35.661  18.119  61.568 1.00 47.01  ? 3153 HOH B O   1 
HETATM 6052 O O   . HOH H 3 .   ? 42.314  13.520  41.165 1.00 45.83  ? 3157 HOH B O   1 
HETATM 6053 O O   . HOH H 3 .   ? 20.498  47.788  52.958 1.00 48.93  ? 3163 HOH B O   1 
HETATM 6054 O O   . HOH H 3 .   ? 39.888  16.554  55.450 1.00 35.83  ? 3165 HOH B O   1 
HETATM 6055 O O   . HOH I 3 .   ? 55.157  25.567  54.343 1.00 30.99  ? 3002 HOH C O   1 
HETATM 6056 O O   . HOH I 3 .   ? 61.159  52.820  70.065 1.00 37.61  ? 3003 HOH C O   1 
HETATM 6057 O O   . HOH I 3 .   ? 66.269  58.495  47.690 1.00 31.58  ? 3004 HOH C O   1 
HETATM 6058 O O   . HOH I 3 .   ? 74.623  58.821  60.136 1.00 38.68  ? 3005 HOH C O   1 
HETATM 6059 O O   . HOH I 3 .   ? 45.711  42.032  77.585 1.00 47.40  ? 3007 HOH C O   1 
HETATM 6060 O O   . HOH I 3 .   ? 53.373  57.598  76.730 1.00 52.18  ? 3011 HOH C O   1 
HETATM 6061 O O   . HOH I 3 .   ? 58.885  34.745  54.732 1.00 38.08  ? 3013 HOH C O   1 
HETATM 6062 O O   . HOH I 3 .   ? 73.235  24.019  64.078 1.00 32.12  ? 3016 HOH C O   1 
HETATM 6063 O O   . HOH I 3 .   ? 83.981  24.315  54.692 1.00 50.12  ? 3018 HOH C O   1 
HETATM 6064 O O   . HOH I 3 .   ? 54.873  51.680  73.730 1.00 32.09  ? 3023 HOH C O   1 
HETATM 6065 O O   . HOH I 3 .   ? 52.559  34.655  39.739 1.00 26.63  ? 3030 HOH C O   1 
HETATM 6066 O O   . HOH I 3 .   ? 87.051  17.213  50.579 1.00 30.98  ? 3031 HOH C O   1 
HETATM 6067 O O   . HOH I 3 .   ? 71.960  54.914  64.654 1.00 41.61  ? 3038 HOH C O   1 
HETATM 6068 O O   . HOH I 3 .   ? 54.292  33.029  60.509 1.00 36.98  ? 3040 HOH C O   1 
HETATM 6069 O O   . HOH I 3 .   ? 60.048  29.987  66.298 1.00 39.00  ? 3051 HOH C O   1 
HETATM 6070 O O   . HOH I 3 .   ? 41.762  46.381  65.073 1.00 41.58  ? 3052 HOH C O   1 
HETATM 6071 O O   . HOH I 3 .   ? 73.608  42.520  55.006 1.00 38.30  ? 3054 HOH C O   1 
HETATM 6072 O O   . HOH I 3 .   ? 72.799  55.216  41.759 1.00 47.12  ? 3063 HOH C O   1 
HETATM 6073 O O   . HOH I 3 .   ? 60.372  34.889  32.522 1.00 37.81  ? 3067 HOH C O   1 
HETATM 6074 O O   . HOH I 3 .   ? 62.353  63.099  71.120 1.00 42.63  ? 3071 HOH C O   1 
HETATM 6075 O O   . HOH I 3 .   ? 77.919  45.897  57.975 1.00 65.27  ? 3072 HOH C O   1 
HETATM 6076 O O   . HOH I 3 .   ? 52.587  20.034  57.033 1.00 47.61  ? 3076 HOH C O   1 
HETATM 6077 O O   . HOH I 3 .   ? 64.788  59.335  45.548 1.00 40.99  ? 3079 HOH C O   1 
HETATM 6078 O O   . HOH I 3 .   ? 69.992  63.785  64.930 1.00 29.66  ? 3085 HOH C O   1 
HETATM 6079 O O   . HOH I 3 .   ? 76.499  46.099  68.686 1.00 51.35  ? 3086 HOH C O   1 
HETATM 6080 O O   . HOH I 3 .   ? 81.199  38.148  56.789 1.00 41.38  ? 3087 HOH C O   1 
HETATM 6081 O O   . HOH I 3 .   ? 57.691  56.895  77.355 1.00 47.89  ? 3088 HOH C O   1 
HETATM 6082 O O   . HOH I 3 .   ? 65.549  47.413  33.488 1.00 50.40  ? 3096 HOH C O   1 
HETATM 6083 O O   . HOH I 3 .   ? 87.078  24.327  46.954 1.00 54.38  ? 3100 HOH C O   1 
HETATM 6084 O O   . HOH I 3 .   ? 71.130  66.364  51.239 1.00 62.03  ? 3101 HOH C O   1 
HETATM 6085 O O   . HOH I 3 .   ? 73.538  40.466  69.382 1.00 30.73  ? 3102 HOH C O   1 
HETATM 6086 O O   . HOH I 3 .   ? 83.913  15.302  48.938 1.00 39.35  ? 3105 HOH C O   1 
HETATM 6087 O O   . HOH I 3 .   ? 87.967  21.700  47.367 1.00 38.27  ? 3108 HOH C O   1 
HETATM 6088 O O   . HOH I 3 .   ? 71.676  15.224  52.039 1.00 43.18  ? 3110 HOH C O   1 
HETATM 6089 O O   . HOH I 3 .   ? 87.765  21.431  39.694 1.00 45.07  ? 3123 HOH C O   1 
HETATM 6090 O O   . HOH I 3 .   ? 46.228  36.686  64.439 1.00 51.98  ? 3125 HOH C O   1 
HETATM 6091 O O   . HOH I 3 .   ? 80.679  19.257  48.229 1.00 44.71  ? 3127 HOH C O   1 
HETATM 6092 O O   . HOH I 3 .   ? 46.972  51.211  71.127 1.00 42.23  ? 3128 HOH C O   1 
HETATM 6093 O O   . HOH I 3 .   ? 53.024  23.863  55.539 1.00 17.84  ? 3129 HOH C O   1 
HETATM 6094 O O   . HOH I 3 .   ? 72.327  54.149  51.453 1.00 41.84  ? 3133 HOH C O   1 
HETATM 6095 O O   . HOH I 3 .   ? 57.982  60.133  78.665 1.00 58.79  ? 3136 HOH C O   1 
HETATM 6096 O O   . HOH I 3 .   ? 52.906  21.259  52.197 1.00 39.02  ? 3137 HOH C O   1 
HETATM 6097 O O   . HOH I 3 .   ? 73.072  20.289  64.363 1.00 34.78  ? 3139 HOH C O   1 
HETATM 6098 O O   . HOH I 3 .   ? 54.175  52.870  75.945 1.00 54.95  ? 3140 HOH C O   1 
HETATM 6099 O O   . HOH I 3 .   ? 85.043  21.495  55.801 1.00 35.35  ? 3146 HOH C O   1 
HETATM 6100 O O   . HOH I 3 .   ? 50.294  20.996  55.848 1.00 51.03  ? 3151 HOH C O   1 
HETATM 6101 O O   . HOH I 3 .   ? 79.123  46.447  71.041 1.00 41.33  ? 3152 HOH C O   1 
HETATM 6102 O O   . HOH I 3 .   ? 47.722  67.279  42.000 1.00 49.26  ? 3154 HOH C O   1 
HETATM 6103 O O   . HOH I 3 .   ? 71.756  63.412  51.591 1.00 49.03  ? 3155 HOH C O   1 
HETATM 6104 O O   . HOH I 3 .   ? 74.485  26.062  65.235 1.00 49.85  ? 3156 HOH C O   1 
HETATM 6105 O O   . HOH I 3 .   ? 65.197  69.332  46.514 1.00 30.30  ? 3159 HOH C O   1 
HETATM 6106 O O   . HOH I 3 .   ? 72.617  29.078  66.509 1.00 29.36  ? 3160 HOH C O   1 
HETATM 6107 O O   . HOH I 3 .   ? 48.723  69.517  43.201 1.00 45.21  ? 3161 HOH C O   1 
HETATM 6108 O O   . HOH I 3 .   ? 81.826  19.435  55.586 1.00 45.19  ? 3162 HOH C O   1 
HETATM 6109 O O   . HOH I 3 .   ? 80.594  20.062  52.546 1.00 40.65  ? 3164 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASN 1   304  304  ASN ASN A . n 
A 1 2   SER 2   305  305  SER SER A . n 
A 1 3   LEU 3   306  306  LEU LEU A . n 
A 1 4   ALA 4   307  307  ALA ALA A . n 
A 1 5   LEU 5   308  308  LEU LEU A . n 
A 1 6   SER 6   309  309  SER SER A . n 
A 1 7   LEU 7   310  310  LEU LEU A . n 
A 1 8   THR 8   311  311  THR THR A . n 
A 1 9   ALA 9   312  312  ALA ALA A . n 
A 1 10  ASP 10  313  313  ASP ASP A . n 
A 1 11  GLN 11  314  314  GLN GLN A . n 
A 1 12  MET 12  315  315  MET MET A . n 
A 1 13  VAL 13  316  316  VAL VAL A . n 
A 1 14  SER 14  317  317  SER SER A . n 
A 1 15  ALA 15  318  318  ALA ALA A . n 
A 1 16  LEU 16  319  319  LEU LEU A . n 
A 1 17  LEU 17  320  320  LEU LEU A . n 
A 1 18  ASP 18  321  321  ASP ASP A . n 
A 1 19  ALA 19  322  322  ALA ALA A . n 
A 1 20  GLU 20  323  323  GLU GLU A . n 
A 1 21  PRO 21  324  324  PRO PRO A . n 
A 1 22  PRO 22  325  325  PRO PRO A . n 
A 1 23  ILE 23  326  326  ILE ILE A . n 
A 1 24  LEU 24  327  327  LEU LEU A . n 
A 1 25  TYR 25  328  328  TYR TYR A . n 
A 1 26  SER 26  329  329  SER SER A . n 
A 1 27  GLU 27  330  330  GLU GLU A . n 
A 1 28  TYR 28  331  331  TYR TYR A . n 
A 1 29  ASP 29  332  332  ASP ASP A . n 
A 1 30  PRO 30  333  333  PRO PRO A . n 
A 1 31  THR 31  334  334  THR THR A . n 
A 1 32  ARG 32  335  335  ARG ARG A . n 
A 1 33  PRO 33  336  336  PRO PRO A . n 
A 1 34  PHE 34  337  337  PHE PHE A . n 
A 1 35  SER 35  338  338  SER SER A . n 
A 1 36  GLU 36  339  339  GLU GLU A . n 
A 1 37  ALA 37  340  340  ALA ALA A . n 
A 1 38  SER 38  341  341  SER SER A . n 
A 1 39  MET 39  342  342  MET MET A . n 
A 1 40  MET 40  343  343  MET MET A . n 
A 1 41  GLY 41  344  344  GLY GLY A . n 
A 1 42  LEU 42  345  345  LEU LEU A . n 
A 1 43  LEU 43  346  346  LEU LEU A . n 
A 1 44  THR 44  347  347  THR THR A . n 
A 1 45  ASN 45  348  348  ASN ASN A . n 
A 1 46  LEU 46  349  349  LEU LEU A . n 
A 1 47  ALA 47  350  350  ALA ALA A . n 
A 1 48  ASP 48  351  351  ASP ASP A . n 
A 1 49  ARG 49  352  352  ARG ARG A . n 
A 1 50  GLU 50  353  353  GLU GLU A . n 
A 1 51  LEU 51  354  354  LEU LEU A . n 
A 1 52  VAL 52  355  355  VAL VAL A . n 
A 1 53  HIS 53  356  356  HIS HIS A . n 
A 1 54  MET 54  357  357  MET MET A . n 
A 1 55  ILE 55  358  358  ILE ILE A . n 
A 1 56  ASN 56  359  359  ASN ASN A . n 
A 1 57  TRP 57  360  360  TRP TRP A . n 
A 1 58  ALA 58  361  361  ALA ALA A . n 
A 1 59  LYS 59  362  362  LYS LYS A . n 
A 1 60  ARG 60  363  363  ARG ARG A . n 
A 1 61  VAL 61  364  364  VAL VAL A . n 
A 1 62  PRO 62  365  365  PRO PRO A . n 
A 1 63  GLY 63  366  366  GLY GLY A . n 
A 1 64  PHE 64  367  367  PHE PHE A . n 
A 1 65  VAL 65  368  368  VAL VAL A . n 
A 1 66  ASP 66  369  369  ASP ASP A . n 
A 1 67  LEU 67  370  370  LEU LEU A . n 
A 1 68  THR 68  371  371  THR THR A . n 
A 1 69  LEU 69  372  372  LEU LEU A . n 
A 1 70  HIS 70  373  373  HIS HIS A . n 
A 1 71  ASP 71  374  374  ASP ASP A . n 
A 1 72  GLN 72  375  375  GLN GLN A . n 
A 1 73  VAL 73  376  376  VAL VAL A . n 
A 1 74  HIS 74  377  377  HIS HIS A . n 
A 1 75  LEU 75  378  378  LEU LEU A . n 
A 1 76  LEU 76  379  379  LEU LEU A . n 
A 1 77  GLU 77  380  380  GLU GLU A . n 
A 1 78  CYS 78  381  381  CYS CYS A . n 
A 1 79  ALA 79  382  382  ALA ALA A . n 
A 1 80  TRP 80  383  383  TRP TRP A . n 
A 1 81  LEU 81  384  384  LEU LEU A . n 
A 1 82  GLU 82  385  385  GLU GLU A . n 
A 1 83  ILE 83  386  386  ILE ILE A . n 
A 1 84  LEU 84  387  387  LEU LEU A . n 
A 1 85  MET 85  388  388  MET MET A . n 
A 1 86  ILE 86  389  389  ILE ILE A . n 
A 1 87  GLY 87  390  390  GLY GLY A . n 
A 1 88  LEU 88  391  391  LEU LEU A . n 
A 1 89  VAL 89  392  392  VAL VAL A . n 
A 1 90  TRP 90  393  393  TRP TRP A . n 
A 1 91  ARG 91  394  394  ARG ARG A . n 
A 1 92  SER 92  395  395  SER SER A . n 
A 1 93  MET 93  396  396  MET MET A . n 
A 1 94  GLU 94  397  397  GLU GLU A . n 
A 1 95  HIS 95  398  398  HIS HIS A . n 
A 1 96  PRO 96  399  399  PRO PRO A . n 
A 1 97  GLY 97  400  400  GLY GLY A . n 
A 1 98  LYS 98  401  401  LYS LYS A . n 
A 1 99  LEU 99  402  402  LEU LEU A . n 
A 1 100 LEU 100 403  403  LEU LEU A . n 
A 1 101 PHE 101 404  404  PHE PHE A . n 
A 1 102 ALA 102 405  405  ALA ALA A . n 
A 1 103 PRO 103 406  406  PRO PRO A . n 
A 1 104 ASN 104 407  407  ASN ASN A . n 
A 1 105 LEU 105 408  408  LEU LEU A . n 
A 1 106 LEU 106 409  409  LEU LEU A . n 
A 1 107 LEU 107 410  410  LEU LEU A . n 
A 1 108 ASP 108 411  411  ASP ASP A . n 
A 1 109 ARG 109 412  412  ARG ARG A . n 
A 1 110 ASN 110 413  413  ASN ASN A . n 
A 1 111 GLN 111 414  414  GLN GLN A . n 
A 1 112 GLY 112 415  415  GLY GLY A . n 
A 1 113 LYS 113 416  416  LYS LYS A . n 
A 1 114 CYS 114 417  417  CYS CYS A . n 
A 1 115 VAL 115 418  418  VAL VAL A . n 
A 1 116 GLU 116 419  419  GLU GLU A . n 
A 1 117 GLY 117 420  420  GLY GLY A . n 
A 1 118 MET 118 421  421  MET MET A . n 
A 1 119 VAL 119 422  422  VAL VAL A . n 
A 1 120 GLU 120 423  423  GLU GLU A . n 
A 1 121 ILE 121 424  424  ILE ILE A . n 
A 1 122 PHE 122 425  425  PHE PHE A . n 
A 1 123 ASP 123 426  426  ASP ASP A . n 
A 1 124 MET 124 427  427  MET MET A . n 
A 1 125 LEU 125 428  428  LEU LEU A . n 
A 1 126 LEU 126 429  429  LEU LEU A . n 
A 1 127 ALA 127 430  430  ALA ALA A . n 
A 1 128 THR 128 431  431  THR THR A . n 
A 1 129 SER 129 432  432  SER SER A . n 
A 1 130 SER 130 433  433  SER SER A . n 
A 1 131 ARG 131 434  434  ARG ARG A . n 
A 1 132 PHE 132 435  435  PHE PHE A . n 
A 1 133 ARG 133 436  436  ARG ARG A . n 
A 1 134 MET 134 437  437  MET MET A . n 
A 1 135 MET 135 438  438  MET MET A . n 
A 1 136 ASN 136 439  439  ASN ASN A . n 
A 1 137 LEU 137 440  440  LEU LEU A . n 
A 1 138 GLN 138 441  441  GLN GLN A . n 
A 1 139 GLY 139 442  442  GLY GLY A . n 
A 1 140 GLU 140 443  443  GLU GLU A . n 
A 1 141 GLU 141 444  444  GLU GLU A . n 
A 1 142 PHE 142 445  445  PHE PHE A . n 
A 1 143 VAL 143 446  446  VAL VAL A . n 
A 1 144 CYS 144 447  447  CYS CYS A . n 
A 1 145 LEU 145 448  448  LEU LEU A . n 
A 1 146 LYS 146 449  449  LYS LYS A . n 
A 1 147 SER 147 450  450  SER SER A . n 
A 1 148 ILE 148 451  451  ILE ILE A . n 
A 1 149 ILE 149 452  452  ILE ILE A . n 
A 1 150 LEU 150 453  453  LEU LEU A . n 
A 1 151 LEU 151 454  454  LEU LEU A . n 
A 1 152 ASN 152 455  455  ASN ASN A . n 
A 1 153 SER 153 456  456  SER SER A . n 
A 1 154 GLY 154 457  457  GLY GLY A . n 
A 1 155 VAL 155 458  458  VAL VAL A . n 
A 1 156 TYR 156 459  459  TYR TYR A . n 
A 1 157 THR 157 460  460  THR THR A . n 
A 1 158 PHE 158 461  461  PHE PHE A . n 
A 1 159 LEU 159 462  462  LEU LEU A . n 
A 1 160 SER 160 463  463  SER SER A . n 
A 1 161 SER 161 464  464  SER SER A . n 
A 1 162 THR 162 465  465  THR THR A . n 
A 1 163 LEU 163 466  466  LEU LEU A . n 
A 1 164 LYS 164 467  467  LYS LYS A . n 
A 1 165 SER 165 468  468  SER SER A . n 
A 1 166 LEU 166 469  469  LEU LEU A . n 
A 1 167 GLU 167 470  470  GLU GLU A . n 
A 1 168 GLU 168 471  471  GLU GLU A . n 
A 1 169 LYS 169 472  472  LYS LYS A . n 
A 1 170 ASP 170 473  473  ASP ASP A . n 
A 1 171 HIS 171 474  474  HIS HIS A . n 
A 1 172 ILE 172 475  475  ILE ILE A . n 
A 1 173 HIS 173 476  476  HIS HIS A . n 
A 1 174 ARG 174 477  477  ARG ARG A . n 
A 1 175 VAL 175 478  478  VAL VAL A . n 
A 1 176 LEU 176 479  479  LEU LEU A . n 
A 1 177 ASP 177 480  480  ASP ASP A . n 
A 1 178 LYS 178 481  481  LYS LYS A . n 
A 1 179 ILE 179 482  482  ILE ILE A . n 
A 1 180 THR 180 483  483  THR THR A . n 
A 1 181 ASP 181 484  484  ASP ASP A . n 
A 1 182 THR 182 485  485  THR THR A . n 
A 1 183 LEU 183 486  486  LEU LEU A . n 
A 1 184 ILE 184 487  487  ILE ILE A . n 
A 1 185 HIS 185 488  488  HIS HIS A . n 
A 1 186 LEU 186 489  489  LEU LEU A . n 
A 1 187 MET 187 490  490  MET MET A . n 
A 1 188 ALA 188 491  491  ALA ALA A . n 
A 1 189 LYS 189 492  492  LYS LYS A . n 
A 1 190 ALA 190 493  493  ALA ALA A . n 
A 1 191 GLY 191 494  494  GLY GLY A . n 
A 1 192 LEU 192 495  495  LEU LEU A . n 
A 1 193 THR 193 496  496  THR THR A . n 
A 1 194 LEU 194 497  497  LEU LEU A . n 
A 1 195 GLN 195 498  498  GLN GLN A . n 
A 1 196 GLN 196 499  499  GLN GLN A . n 
A 1 197 GLN 197 500  500  GLN GLN A . n 
A 1 198 HIS 198 501  501  HIS HIS A . n 
A 1 199 GLN 199 502  502  GLN GLN A . n 
A 1 200 ARG 200 503  503  ARG ARG A . n 
A 1 201 LEU 201 504  504  LEU LEU A . n 
A 1 202 ALA 202 505  505  ALA ALA A . n 
A 1 203 GLN 203 506  506  GLN GLN A . n 
A 1 204 LEU 204 507  507  LEU LEU A . n 
A 1 205 LEU 205 508  508  LEU LEU A . n 
A 1 206 LEU 206 509  509  LEU LEU A . n 
A 1 207 ILE 207 510  510  ILE ILE A . n 
A 1 208 LEU 208 511  511  LEU LEU A . n 
A 1 209 SER 209 512  512  SER SER A . n 
A 1 210 HIS 210 513  513  HIS HIS A . n 
A 1 211 ILE 211 514  514  ILE ILE A . n 
A 1 212 ARG 212 515  515  ARG ARG A . n 
A 1 213 HIS 213 516  516  HIS HIS A . n 
A 1 214 MET 214 517  517  MET MET A . n 
A 1 215 SER 215 518  518  SER SER A . n 
A 1 216 ASN 216 519  519  ASN ASN A . n 
A 1 217 LYS 217 520  520  LYS LYS A . n 
A 1 218 GLY 218 521  521  GLY GLY A . n 
A 1 219 MET 219 522  522  MET MET A . n 
A 1 220 GLU 220 523  523  GLU GLU A . n 
A 1 221 HIS 221 524  524  HIS HIS A . n 
A 1 222 LEU 222 525  525  LEU LEU A . n 
A 1 223 TYR 223 526  526  TYR TYR A . n 
A 1 224 SER 224 527  527  SER SER A . n 
A 1 225 MET 225 528  528  MET MET A . n 
A 1 226 LYS 226 529  529  LYS LYS A . n 
A 1 227 CYS 227 530  530  CYS CYS A . n 
A 1 228 LYS 228 531  531  LYS LYS A . n 
A 1 229 ASN 229 532  532  ASN ASN A . n 
A 1 230 VAL 230 533  533  VAL VAL A . n 
A 1 231 VAL 231 534  534  VAL VAL A . n 
A 1 232 PRO 232 535  535  PRO PRO A . n 
A 1 233 LEU 233 536  536  LEU LEU A . n 
A 1 234 TYR 234 537  537  TYR TYR A . n 
A 1 235 ASP 235 538  538  ASP ASP A . n 
A 1 236 LEU 236 539  539  LEU LEU A . n 
A 1 237 LEU 237 540  540  LEU LEU A . n 
A 1 238 LEU 238 541  541  LEU LEU A . n 
A 1 239 GLU 239 542  542  GLU GLU A . n 
A 1 240 MET 240 543  543  MET MET A . n 
A 1 241 LEU 241 544  544  LEU LEU A . n 
A 1 242 ASP 242 545  545  ASP ASP A . n 
A 1 243 ALA 243 546  546  ALA ALA A . n 
A 1 244 HIS 244 547  547  HIS HIS A . n 
A 1 245 ARG 245 548  548  ARG ARG A . n 
A 1 246 LEU 246 549  549  LEU LEU A . n 
A 1 247 HIS 247 550  550  HIS HIS A . n 
B 1 1   ASN 1   1304 1304 ASN ASN B . n 
B 1 2   SER 2   1305 1305 SER SER B . n 
B 1 3   LEU 3   1306 1306 LEU LEU B . n 
B 1 4   ALA 4   1307 1307 ALA ALA B . n 
B 1 5   LEU 5   1308 1308 LEU LEU B . n 
B 1 6   SER 6   1309 1309 SER SER B . n 
B 1 7   LEU 7   1310 1310 LEU LEU B . n 
B 1 8   THR 8   1311 1311 THR THR B . n 
B 1 9   ALA 9   1312 1312 ALA ALA B . n 
B 1 10  ASP 10  1313 1313 ASP ASP B . n 
B 1 11  GLN 11  1314 1314 GLN GLN B . n 
B 1 12  MET 12  1315 1315 MET MET B . n 
B 1 13  VAL 13  1316 1316 VAL VAL B . n 
B 1 14  SER 14  1317 1317 SER SER B . n 
B 1 15  ALA 15  1318 1318 ALA ALA B . n 
B 1 16  LEU 16  1319 1319 LEU LEU B . n 
B 1 17  LEU 17  1320 1320 LEU LEU B . n 
B 1 18  ASP 18  1321 1321 ASP ASP B . n 
B 1 19  ALA 19  1322 1322 ALA ALA B . n 
B 1 20  GLU 20  1323 1323 GLU GLU B . n 
B 1 21  PRO 21  1324 1324 PRO PRO B . n 
B 1 22  PRO 22  1325 1325 PRO PRO B . n 
B 1 23  ILE 23  1326 1326 ILE ILE B . n 
B 1 24  LEU 24  1327 1327 LEU LEU B . n 
B 1 25  TYR 25  1328 1328 TYR TYR B . n 
B 1 26  SER 26  1329 1329 SER SER B . n 
B 1 27  GLU 27  1330 1330 GLU GLU B . n 
B 1 28  TYR 28  1331 1331 TYR TYR B . n 
B 1 29  ASP 29  1332 1332 ASP ASP B . n 
B 1 30  PRO 30  1333 1333 PRO PRO B . n 
B 1 31  THR 31  1334 1334 THR THR B . n 
B 1 32  ARG 32  1335 1335 ARG ARG B . n 
B 1 33  PRO 33  1336 1336 PRO PRO B . n 
B 1 34  PHE 34  1337 1337 PHE PHE B . n 
B 1 35  SER 35  1338 1338 SER SER B . n 
B 1 36  GLU 36  1339 1339 GLU GLU B . n 
B 1 37  ALA 37  1340 1340 ALA ALA B . n 
B 1 38  SER 38  1341 1341 SER SER B . n 
B 1 39  MET 39  1342 1342 MET MET B . n 
B 1 40  MET 40  1343 1343 MET MET B . n 
B 1 41  GLY 41  1344 1344 GLY GLY B . n 
B 1 42  LEU 42  1345 1345 LEU LEU B . n 
B 1 43  LEU 43  1346 1346 LEU LEU B . n 
B 1 44  THR 44  1347 1347 THR THR B . n 
B 1 45  ASN 45  1348 1348 ASN ASN B . n 
B 1 46  LEU 46  1349 1349 LEU LEU B . n 
B 1 47  ALA 47  1350 1350 ALA ALA B . n 
B 1 48  ASP 48  1351 1351 ASP ASP B . n 
B 1 49  ARG 49  1352 1352 ARG ARG B . n 
B 1 50  GLU 50  1353 1353 GLU GLU B . n 
B 1 51  LEU 51  1354 1354 LEU LEU B . n 
B 1 52  VAL 52  1355 1355 VAL VAL B . n 
B 1 53  HIS 53  1356 1356 HIS HIS B . n 
B 1 54  MET 54  1357 1357 MET MET B . n 
B 1 55  ILE 55  1358 1358 ILE ILE B . n 
B 1 56  ASN 56  1359 1359 ASN ASN B . n 
B 1 57  TRP 57  1360 1360 TRP TRP B . n 
B 1 58  ALA 58  1361 1361 ALA ALA B . n 
B 1 59  LYS 59  1362 1362 LYS LYS B . n 
B 1 60  ARG 60  1363 1363 ARG ARG B . n 
B 1 61  VAL 61  1364 1364 VAL VAL B . n 
B 1 62  PRO 62  1365 1365 PRO PRO B . n 
B 1 63  GLY 63  1366 1366 GLY GLY B . n 
B 1 64  PHE 64  1367 1367 PHE PHE B . n 
B 1 65  VAL 65  1368 1368 VAL VAL B . n 
B 1 66  ASP 66  1369 1369 ASP ASP B . n 
B 1 67  LEU 67  1370 1370 LEU LEU B . n 
B 1 68  THR 68  1371 1371 THR THR B . n 
B 1 69  LEU 69  1372 1372 LEU LEU B . n 
B 1 70  HIS 70  1373 1373 HIS HIS B . n 
B 1 71  ASP 71  1374 1374 ASP ASP B . n 
B 1 72  GLN 72  1375 1375 GLN GLN B . n 
B 1 73  VAL 73  1376 1376 VAL VAL B . n 
B 1 74  HIS 74  1377 1377 HIS HIS B . n 
B 1 75  LEU 75  1378 1378 LEU LEU B . n 
B 1 76  LEU 76  1379 1379 LEU LEU B . n 
B 1 77  GLU 77  1380 1380 GLU GLU B . n 
B 1 78  CYS 78  1381 1381 CYS CYS B . n 
B 1 79  ALA 79  1382 1382 ALA ALA B . n 
B 1 80  TRP 80  1383 1383 TRP TRP B . n 
B 1 81  LEU 81  1384 1384 LEU LEU B . n 
B 1 82  GLU 82  1385 1385 GLU GLU B . n 
B 1 83  ILE 83  1386 1386 ILE ILE B . n 
B 1 84  LEU 84  1387 1387 LEU LEU B . n 
B 1 85  MET 85  1388 1388 MET MET B . n 
B 1 86  ILE 86  1389 1389 ILE ILE B . n 
B 1 87  GLY 87  1390 1390 GLY GLY B . n 
B 1 88  LEU 88  1391 1391 LEU LEU B . n 
B 1 89  VAL 89  1392 1392 VAL VAL B . n 
B 1 90  TRP 90  1393 1393 TRP TRP B . n 
B 1 91  ARG 91  1394 1394 ARG ARG B . n 
B 1 92  SER 92  1395 1395 SER SER B . n 
B 1 93  MET 93  1396 1396 MET MET B . n 
B 1 94  GLU 94  1397 1397 GLU GLU B . n 
B 1 95  HIS 95  1398 1398 HIS HIS B . n 
B 1 96  PRO 96  1399 1399 PRO PRO B . n 
B 1 97  GLY 97  1400 1400 GLY GLY B . n 
B 1 98  LYS 98  1401 1401 LYS LYS B . n 
B 1 99  LEU 99  1402 1402 LEU LEU B . n 
B 1 100 LEU 100 1403 1403 LEU LEU B . n 
B 1 101 PHE 101 1404 1404 PHE PHE B . n 
B 1 102 ALA 102 1405 1405 ALA ALA B . n 
B 1 103 PRO 103 1406 1406 PRO PRO B . n 
B 1 104 ASN 104 1407 1407 ASN ASN B . n 
B 1 105 LEU 105 1408 1408 LEU LEU B . n 
B 1 106 LEU 106 1409 1409 LEU LEU B . n 
B 1 107 LEU 107 1410 1410 LEU LEU B . n 
B 1 108 ASP 108 1411 1411 ASP ASP B . n 
B 1 109 ARG 109 1412 1412 ARG ARG B . n 
B 1 110 ASN 110 1413 1413 ASN ASN B . n 
B 1 111 GLN 111 1414 1414 GLN GLN B . n 
B 1 112 GLY 112 1415 1415 GLY GLY B . n 
B 1 113 LYS 113 1416 1416 LYS LYS B . n 
B 1 114 CYS 114 1417 1417 CYS CYS B . n 
B 1 115 VAL 115 1418 1418 VAL VAL B . n 
B 1 116 GLU 116 1419 1419 GLU GLU B . n 
B 1 117 GLY 117 1420 1420 GLY GLY B . n 
B 1 118 MET 118 1421 1421 MET MET B . n 
B 1 119 VAL 119 1422 1422 VAL VAL B . n 
B 1 120 GLU 120 1423 1423 GLU GLU B . n 
B 1 121 ILE 121 1424 1424 ILE ILE B . n 
B 1 122 PHE 122 1425 1425 PHE PHE B . n 
B 1 123 ASP 123 1426 1426 ASP ASP B . n 
B 1 124 MET 124 1427 1427 MET MET B . n 
B 1 125 LEU 125 1428 1428 LEU LEU B . n 
B 1 126 LEU 126 1429 1429 LEU LEU B . n 
B 1 127 ALA 127 1430 1430 ALA ALA B . n 
B 1 128 THR 128 1431 1431 THR THR B . n 
B 1 129 SER 129 1432 1432 SER SER B . n 
B 1 130 SER 130 1433 1433 SER SER B . n 
B 1 131 ARG 131 1434 1434 ARG ARG B . n 
B 1 132 PHE 132 1435 1435 PHE PHE B . n 
B 1 133 ARG 133 1436 1436 ARG ARG B . n 
B 1 134 MET 134 1437 1437 MET MET B . n 
B 1 135 MET 135 1438 1438 MET MET B . n 
B 1 136 ASN 136 1439 1439 ASN ASN B . n 
B 1 137 LEU 137 1440 1440 LEU LEU B . n 
B 1 138 GLN 138 1441 1441 GLN GLN B . n 
B 1 139 GLY 139 1442 1442 GLY GLY B . n 
B 1 140 GLU 140 1443 1443 GLU GLU B . n 
B 1 141 GLU 141 1444 1444 GLU GLU B . n 
B 1 142 PHE 142 1445 1445 PHE PHE B . n 
B 1 143 VAL 143 1446 1446 VAL VAL B . n 
B 1 144 CYS 144 1447 1447 CYS CYS B . n 
B 1 145 LEU 145 1448 1448 LEU LEU B . n 
B 1 146 LYS 146 1449 1449 LYS LYS B . n 
B 1 147 SER 147 1450 1450 SER SER B . n 
B 1 148 ILE 148 1451 1451 ILE ILE B . n 
B 1 149 ILE 149 1452 1452 ILE ILE B . n 
B 1 150 LEU 150 1453 1453 LEU LEU B . n 
B 1 151 LEU 151 1454 1454 LEU LEU B . n 
B 1 152 ASN 152 1455 1455 ASN ASN B . n 
B 1 153 SER 153 1456 1456 SER SER B . n 
B 1 154 GLY 154 1457 1457 GLY GLY B . n 
B 1 155 VAL 155 1458 1458 VAL VAL B . n 
B 1 156 TYR 156 1459 1459 TYR TYR B . n 
B 1 157 THR 157 1460 1460 THR THR B . n 
B 1 158 PHE 158 1461 1461 PHE PHE B . n 
B 1 159 LEU 159 1462 1462 LEU LEU B . n 
B 1 160 SER 160 1463 1463 SER SER B . n 
B 1 161 SER 161 1464 1464 SER SER B . n 
B 1 162 THR 162 1465 1465 THR THR B . n 
B 1 163 LEU 163 1466 1466 LEU LEU B . n 
B 1 164 LYS 164 1467 1467 LYS LYS B . n 
B 1 165 SER 165 1468 1468 SER SER B . n 
B 1 166 LEU 166 1469 1469 LEU LEU B . n 
B 1 167 GLU 167 1470 1470 GLU GLU B . n 
B 1 168 GLU 168 1471 1471 GLU GLU B . n 
B 1 169 LYS 169 1472 1472 LYS LYS B . n 
B 1 170 ASP 170 1473 1473 ASP ASP B . n 
B 1 171 HIS 171 1474 1474 HIS HIS B . n 
B 1 172 ILE 172 1475 1475 ILE ILE B . n 
B 1 173 HIS 173 1476 1476 HIS HIS B . n 
B 1 174 ARG 174 1477 1477 ARG ARG B . n 
B 1 175 VAL 175 1478 1478 VAL VAL B . n 
B 1 176 LEU 176 1479 1479 LEU LEU B . n 
B 1 177 ASP 177 1480 1480 ASP ASP B . n 
B 1 178 LYS 178 1481 1481 LYS LYS B . n 
B 1 179 ILE 179 1482 1482 ILE ILE B . n 
B 1 180 THR 180 1483 1483 THR THR B . n 
B 1 181 ASP 181 1484 1484 ASP ASP B . n 
B 1 182 THR 182 1485 1485 THR THR B . n 
B 1 183 LEU 183 1486 1486 LEU LEU B . n 
B 1 184 ILE 184 1487 1487 ILE ILE B . n 
B 1 185 HIS 185 1488 1488 HIS HIS B . n 
B 1 186 LEU 186 1489 1489 LEU LEU B . n 
B 1 187 MET 187 1490 1490 MET MET B . n 
B 1 188 ALA 188 1491 1491 ALA ALA B . n 
B 1 189 LYS 189 1492 1492 LYS LYS B . n 
B 1 190 ALA 190 1493 1493 ALA ALA B . n 
B 1 191 GLY 191 1494 1494 GLY GLY B . n 
B 1 192 LEU 192 1495 1495 LEU LEU B . n 
B 1 193 THR 193 1496 1496 THR THR B . n 
B 1 194 LEU 194 1497 1497 LEU LEU B . n 
B 1 195 GLN 195 1498 1498 GLN GLN B . n 
B 1 196 GLN 196 1499 1499 GLN GLN B . n 
B 1 197 GLN 197 1500 1500 GLN GLN B . n 
B 1 198 HIS 198 1501 1501 HIS HIS B . n 
B 1 199 GLN 199 1502 1502 GLN GLN B . n 
B 1 200 ARG 200 1503 1503 ARG ARG B . n 
B 1 201 LEU 201 1504 1504 LEU LEU B . n 
B 1 202 ALA 202 1505 1505 ALA ALA B . n 
B 1 203 GLN 203 1506 1506 GLN GLN B . n 
B 1 204 LEU 204 1507 1507 LEU LEU B . n 
B 1 205 LEU 205 1508 1508 LEU LEU B . n 
B 1 206 LEU 206 1509 1509 LEU LEU B . n 
B 1 207 ILE 207 1510 1510 ILE ILE B . n 
B 1 208 LEU 208 1511 1511 LEU LEU B . n 
B 1 209 SER 209 1512 1512 SER SER B . n 
B 1 210 HIS 210 1513 1513 HIS HIS B . n 
B 1 211 ILE 211 1514 1514 ILE ILE B . n 
B 1 212 ARG 212 1515 1515 ARG ARG B . n 
B 1 213 HIS 213 1516 1516 HIS HIS B . n 
B 1 214 MET 214 1517 1517 MET MET B . n 
B 1 215 SER 215 1518 1518 SER SER B . n 
B 1 216 ASN 216 1519 1519 ASN ASN B . n 
B 1 217 LYS 217 1520 1520 LYS LYS B . n 
B 1 218 GLY 218 1521 1521 GLY GLY B . n 
B 1 219 MET 219 1522 1522 MET MET B . n 
B 1 220 GLU 220 1523 1523 GLU GLU B . n 
B 1 221 HIS 221 1524 1524 HIS HIS B . n 
B 1 222 LEU 222 1525 1525 LEU LEU B . n 
B 1 223 TYR 223 1526 1526 TYR TYR B . n 
B 1 224 SER 224 1527 1527 SER SER B . n 
B 1 225 MET 225 1528 1528 MET MET B . n 
B 1 226 LYS 226 1529 1529 LYS LYS B . n 
B 1 227 CYS 227 1530 1530 CYS CYS B . n 
B 1 228 LYS 228 1531 1531 LYS LYS B . n 
B 1 229 ASN 229 1532 1532 ASN ASN B . n 
B 1 230 VAL 230 1533 1533 VAL VAL B . n 
B 1 231 VAL 231 1534 1534 VAL VAL B . n 
B 1 232 PRO 232 1535 1535 PRO PRO B . n 
B 1 233 LEU 233 1536 1536 LEU LEU B . n 
B 1 234 TYR 234 1537 1537 TYR TYR B . n 
B 1 235 ASP 235 1538 1538 ASP ASP B . n 
B 1 236 LEU 236 1539 1539 LEU LEU B . n 
B 1 237 LEU 237 1540 1540 LEU LEU B . n 
B 1 238 LEU 238 1541 1541 LEU LEU B . n 
B 1 239 GLU 239 1542 1542 GLU GLU B . n 
B 1 240 MET 240 1543 1543 MET MET B . n 
B 1 241 LEU 241 1544 1544 LEU LEU B . n 
B 1 242 ASP 242 1545 1545 ASP ASP B . n 
B 1 243 ALA 243 1546 1546 ALA ALA B . n 
B 1 244 HIS 244 1547 1547 HIS HIS B . n 
B 1 245 ARG 245 1548 1548 ARG ARG B . n 
B 1 246 LEU 246 1549 1549 LEU LEU B . n 
B 1 247 HIS 247 1550 ?    ?   ?   B . n 
C 1 1   ASN 1   2304 2304 ASN ASN C . n 
C 1 2   SER 2   2305 2305 SER SER C . n 
C 1 3   LEU 3   2306 2306 LEU LEU C . n 
C 1 4   ALA 4   2307 2307 ALA ALA C . n 
C 1 5   LEU 5   2308 2308 LEU LEU C . n 
C 1 6   SER 6   2309 2309 SER SER C . n 
C 1 7   LEU 7   2310 2310 LEU LEU C . n 
C 1 8   THR 8   2311 2311 THR THR C . n 
C 1 9   ALA 9   2312 2312 ALA ALA C . n 
C 1 10  ASP 10  2313 2313 ASP ASP C . n 
C 1 11  GLN 11  2314 2314 GLN GLN C . n 
C 1 12  MET 12  2315 2315 MET MET C . n 
C 1 13  VAL 13  2316 2316 VAL VAL C . n 
C 1 14  SER 14  2317 2317 SER SER C . n 
C 1 15  ALA 15  2318 2318 ALA ALA C . n 
C 1 16  LEU 16  2319 2319 LEU LEU C . n 
C 1 17  LEU 17  2320 2320 LEU LEU C . n 
C 1 18  ASP 18  2321 2321 ASP ASP C . n 
C 1 19  ALA 19  2322 2322 ALA ALA C . n 
C 1 20  GLU 20  2323 2323 GLU GLU C . n 
C 1 21  PRO 21  2324 2324 PRO PRO C . n 
C 1 22  PRO 22  2325 2325 PRO PRO C . n 
C 1 23  ILE 23  2326 2326 ILE ILE C . n 
C 1 24  LEU 24  2327 2327 LEU LEU C . n 
C 1 25  TYR 25  2328 2328 TYR TYR C . n 
C 1 26  SER 26  2329 2329 SER SER C . n 
C 1 27  GLU 27  2330 2330 GLU GLU C . n 
C 1 28  TYR 28  2331 2331 TYR TYR C . n 
C 1 29  ASP 29  2332 2332 ASP ASP C . n 
C 1 30  PRO 30  2333 2333 PRO PRO C . n 
C 1 31  THR 31  2334 2334 THR THR C . n 
C 1 32  ARG 32  2335 2335 ARG ARG C . n 
C 1 33  PRO 33  2336 2336 PRO PRO C . n 
C 1 34  PHE 34  2337 2337 PHE PHE C . n 
C 1 35  SER 35  2338 2338 SER SER C . n 
C 1 36  GLU 36  2339 2339 GLU GLU C . n 
C 1 37  ALA 37  2340 2340 ALA ALA C . n 
C 1 38  SER 38  2341 2341 SER SER C . n 
C 1 39  MET 39  2342 2342 MET MET C . n 
C 1 40  MET 40  2343 2343 MET MET C . n 
C 1 41  GLY 41  2344 2344 GLY GLY C . n 
C 1 42  LEU 42  2345 2345 LEU LEU C . n 
C 1 43  LEU 43  2346 2346 LEU LEU C . n 
C 1 44  THR 44  2347 2347 THR THR C . n 
C 1 45  ASN 45  2348 2348 ASN ASN C . n 
C 1 46  LEU 46  2349 2349 LEU LEU C . n 
C 1 47  ALA 47  2350 2350 ALA ALA C . n 
C 1 48  ASP 48  2351 2351 ASP ASP C . n 
C 1 49  ARG 49  2352 2352 ARG ARG C . n 
C 1 50  GLU 50  2353 2353 GLU GLU C . n 
C 1 51  LEU 51  2354 2354 LEU LEU C . n 
C 1 52  VAL 52  2355 2355 VAL VAL C . n 
C 1 53  HIS 53  2356 2356 HIS HIS C . n 
C 1 54  MET 54  2357 2357 MET MET C . n 
C 1 55  ILE 55  2358 2358 ILE ILE C . n 
C 1 56  ASN 56  2359 2359 ASN ASN C . n 
C 1 57  TRP 57  2360 2360 TRP TRP C . n 
C 1 58  ALA 58  2361 2361 ALA ALA C . n 
C 1 59  LYS 59  2362 2362 LYS LYS C . n 
C 1 60  ARG 60  2363 2363 ARG ARG C . n 
C 1 61  VAL 61  2364 2364 VAL VAL C . n 
C 1 62  PRO 62  2365 2365 PRO PRO C . n 
C 1 63  GLY 63  2366 2366 GLY GLY C . n 
C 1 64  PHE 64  2367 2367 PHE PHE C . n 
C 1 65  VAL 65  2368 2368 VAL VAL C . n 
C 1 66  ASP 66  2369 2369 ASP ASP C . n 
C 1 67  LEU 67  2370 2370 LEU LEU C . n 
C 1 68  THR 68  2371 2371 THR THR C . n 
C 1 69  LEU 69  2372 2372 LEU LEU C . n 
C 1 70  HIS 70  2373 2373 HIS HIS C . n 
C 1 71  ASP 71  2374 2374 ASP ASP C . n 
C 1 72  GLN 72  2375 2375 GLN GLN C . n 
C 1 73  VAL 73  2376 2376 VAL VAL C . n 
C 1 74  HIS 74  2377 2377 HIS HIS C . n 
C 1 75  LEU 75  2378 2378 LEU LEU C . n 
C 1 76  LEU 76  2379 2379 LEU LEU C . n 
C 1 77  GLU 77  2380 2380 GLU GLU C . n 
C 1 78  CYS 78  2381 2381 CYS CYS C . n 
C 1 79  ALA 79  2382 2382 ALA ALA C . n 
C 1 80  TRP 80  2383 2383 TRP TRP C . n 
C 1 81  LEU 81  2384 2384 LEU LEU C . n 
C 1 82  GLU 82  2385 2385 GLU GLU C . n 
C 1 83  ILE 83  2386 2386 ILE ILE C . n 
C 1 84  LEU 84  2387 2387 LEU LEU C . n 
C 1 85  MET 85  2388 2388 MET MET C . n 
C 1 86  ILE 86  2389 2389 ILE ILE C . n 
C 1 87  GLY 87  2390 2390 GLY GLY C . n 
C 1 88  LEU 88  2391 2391 LEU LEU C . n 
C 1 89  VAL 89  2392 2392 VAL VAL C . n 
C 1 90  TRP 90  2393 2393 TRP TRP C . n 
C 1 91  ARG 91  2394 2394 ARG ARG C . n 
C 1 92  SER 92  2395 2395 SER SER C . n 
C 1 93  MET 93  2396 2396 MET MET C . n 
C 1 94  GLU 94  2397 2397 GLU GLU C . n 
C 1 95  HIS 95  2398 2398 HIS HIS C . n 
C 1 96  PRO 96  2399 2399 PRO PRO C . n 
C 1 97  GLY 97  2400 2400 GLY GLY C . n 
C 1 98  LYS 98  2401 2401 LYS LYS C . n 
C 1 99  LEU 99  2402 2402 LEU LEU C . n 
C 1 100 LEU 100 2403 2403 LEU LEU C . n 
C 1 101 PHE 101 2404 2404 PHE PHE C . n 
C 1 102 ALA 102 2405 2405 ALA ALA C . n 
C 1 103 PRO 103 2406 2406 PRO PRO C . n 
C 1 104 ASN 104 2407 2407 ASN ASN C . n 
C 1 105 LEU 105 2408 2408 LEU LEU C . n 
C 1 106 LEU 106 2409 2409 LEU LEU C . n 
C 1 107 LEU 107 2410 2410 LEU LEU C . n 
C 1 108 ASP 108 2411 2411 ASP ASP C . n 
C 1 109 ARG 109 2412 2412 ARG ARG C . n 
C 1 110 ASN 110 2413 2413 ASN ASN C . n 
C 1 111 GLN 111 2414 2414 GLN GLN C . n 
C 1 112 GLY 112 2415 2415 GLY GLY C . n 
C 1 113 LYS 113 2416 2416 LYS LYS C . n 
C 1 114 CYS 114 2417 2417 CYS CYS C . n 
C 1 115 VAL 115 2418 2418 VAL VAL C . n 
C 1 116 GLU 116 2419 2419 GLU GLU C . n 
C 1 117 GLY 117 2420 2420 GLY GLY C . n 
C 1 118 MET 118 2421 2421 MET MET C . n 
C 1 119 VAL 119 2422 2422 VAL VAL C . n 
C 1 120 GLU 120 2423 2423 GLU GLU C . n 
C 1 121 ILE 121 2424 2424 ILE ILE C . n 
C 1 122 PHE 122 2425 2425 PHE PHE C . n 
C 1 123 ASP 123 2426 2426 ASP ASP C . n 
C 1 124 MET 124 2427 2427 MET MET C . n 
C 1 125 LEU 125 2428 2428 LEU LEU C . n 
C 1 126 LEU 126 2429 2429 LEU LEU C . n 
C 1 127 ALA 127 2430 2430 ALA ALA C . n 
C 1 128 THR 128 2431 2431 THR THR C . n 
C 1 129 SER 129 2432 2432 SER SER C . n 
C 1 130 SER 130 2433 2433 SER SER C . n 
C 1 131 ARG 131 2434 2434 ARG ARG C . n 
C 1 132 PHE 132 2435 2435 PHE PHE C . n 
C 1 133 ARG 133 2436 2436 ARG ARG C . n 
C 1 134 MET 134 2437 2437 MET MET C . n 
C 1 135 MET 135 2438 2438 MET MET C . n 
C 1 136 ASN 136 2439 2439 ASN ASN C . n 
C 1 137 LEU 137 2440 2440 LEU LEU C . n 
C 1 138 GLN 138 2441 2441 GLN GLN C . n 
C 1 139 GLY 139 2442 2442 GLY GLY C . n 
C 1 140 GLU 140 2443 2443 GLU GLU C . n 
C 1 141 GLU 141 2444 2444 GLU GLU C . n 
C 1 142 PHE 142 2445 2445 PHE PHE C . n 
C 1 143 VAL 143 2446 2446 VAL VAL C . n 
C 1 144 CYS 144 2447 2447 CYS CYS C . n 
C 1 145 LEU 145 2448 2448 LEU LEU C . n 
C 1 146 LYS 146 2449 2449 LYS LYS C . n 
C 1 147 SER 147 2450 2450 SER SER C . n 
C 1 148 ILE 148 2451 2451 ILE ILE C . n 
C 1 149 ILE 149 2452 2452 ILE ILE C . n 
C 1 150 LEU 150 2453 2453 LEU LEU C . n 
C 1 151 LEU 151 2454 2454 LEU LEU C . n 
C 1 152 ASN 152 2455 2455 ASN ASN C . n 
C 1 153 SER 153 2456 2456 SER SER C . n 
C 1 154 GLY 154 2457 2457 GLY GLY C . n 
C 1 155 VAL 155 2458 2458 VAL VAL C . n 
C 1 156 TYR 156 2459 2459 TYR TYR C . n 
C 1 157 THR 157 2460 2460 THR THR C . n 
C 1 158 PHE 158 2461 2461 PHE PHE C . n 
C 1 159 LEU 159 2462 2462 LEU LEU C . n 
C 1 160 SER 160 2463 2463 SER SER C . n 
C 1 161 SER 161 2464 2464 SER SER C . n 
C 1 162 THR 162 2465 2465 THR THR C . n 
C 1 163 LEU 163 2466 2466 LEU LEU C . n 
C 1 164 LYS 164 2467 2467 LYS LYS C . n 
C 1 165 SER 165 2468 2468 SER SER C . n 
C 1 166 LEU 166 2469 2469 LEU LEU C . n 
C 1 167 GLU 167 2470 2470 GLU GLU C . n 
C 1 168 GLU 168 2471 2471 GLU GLU C . n 
C 1 169 LYS 169 2472 2472 LYS LYS C . n 
C 1 170 ASP 170 2473 2473 ASP ASP C . n 
C 1 171 HIS 171 2474 2474 HIS HIS C . n 
C 1 172 ILE 172 2475 2475 ILE ILE C . n 
C 1 173 HIS 173 2476 2476 HIS HIS C . n 
C 1 174 ARG 174 2477 2477 ARG ARG C . n 
C 1 175 VAL 175 2478 2478 VAL VAL C . n 
C 1 176 LEU 176 2479 2479 LEU LEU C . n 
C 1 177 ASP 177 2480 2480 ASP ASP C . n 
C 1 178 LYS 178 2481 2481 LYS LYS C . n 
C 1 179 ILE 179 2482 2482 ILE ILE C . n 
C 1 180 THR 180 2483 2483 THR THR C . n 
C 1 181 ASP 181 2484 2484 ASP ASP C . n 
C 1 182 THR 182 2485 2485 THR THR C . n 
C 1 183 LEU 183 2486 2486 LEU LEU C . n 
C 1 184 ILE 184 2487 2487 ILE ILE C . n 
C 1 185 HIS 185 2488 2488 HIS HIS C . n 
C 1 186 LEU 186 2489 2489 LEU LEU C . n 
C 1 187 MET 187 2490 2490 MET MET C . n 
C 1 188 ALA 188 2491 2491 ALA ALA C . n 
C 1 189 LYS 189 2492 2492 LYS LYS C . n 
C 1 190 ALA 190 2493 2493 ALA ALA C . n 
C 1 191 GLY 191 2494 2494 GLY GLY C . n 
C 1 192 LEU 192 2495 2495 LEU LEU C . n 
C 1 193 THR 193 2496 2496 THR THR C . n 
C 1 194 LEU 194 2497 2497 LEU LEU C . n 
C 1 195 GLN 195 2498 2498 GLN GLN C . n 
C 1 196 GLN 196 2499 2499 GLN GLN C . n 
C 1 197 GLN 197 2500 2500 GLN GLN C . n 
C 1 198 HIS 198 2501 2501 HIS HIS C . n 
C 1 199 GLN 199 2502 2502 GLN GLN C . n 
C 1 200 ARG 200 2503 2503 ARG ARG C . n 
C 1 201 LEU 201 2504 2504 LEU LEU C . n 
C 1 202 ALA 202 2505 2505 ALA ALA C . n 
C 1 203 GLN 203 2506 2506 GLN GLN C . n 
C 1 204 LEU 204 2507 2507 LEU LEU C . n 
C 1 205 LEU 205 2508 2508 LEU LEU C . n 
C 1 206 LEU 206 2509 2509 LEU LEU C . n 
C 1 207 ILE 207 2510 2510 ILE ILE C . n 
C 1 208 LEU 208 2511 2511 LEU LEU C . n 
C 1 209 SER 209 2512 2512 SER SER C . n 
C 1 210 HIS 210 2513 2513 HIS HIS C . n 
C 1 211 ILE 211 2514 2514 ILE ILE C . n 
C 1 212 ARG 212 2515 2515 ARG ARG C . n 
C 1 213 HIS 213 2516 2516 HIS HIS C . n 
C 1 214 MET 214 2517 2517 MET MET C . n 
C 1 215 SER 215 2518 2518 SER SER C . n 
C 1 216 ASN 216 2519 2519 ASN ASN C . n 
C 1 217 LYS 217 2520 2520 LYS LYS C . n 
C 1 218 GLY 218 2521 2521 GLY GLY C . n 
C 1 219 MET 219 2522 2522 MET MET C . n 
C 1 220 GLU 220 2523 2523 GLU GLU C . n 
C 1 221 HIS 221 2524 2524 HIS HIS C . n 
C 1 222 LEU 222 2525 2525 LEU LEU C . n 
C 1 223 TYR 223 2526 2526 TYR TYR C . n 
C 1 224 SER 224 2527 2527 SER SER C . n 
C 1 225 MET 225 2528 2528 MET MET C . n 
C 1 226 LYS 226 2529 2529 LYS LYS C . n 
C 1 227 CYS 227 2530 2530 CYS CYS C . n 
C 1 228 LYS 228 2531 2531 LYS LYS C . n 
C 1 229 ASN 229 2532 2532 ASN ASN C . n 
C 1 230 VAL 230 2533 2533 VAL VAL C . n 
C 1 231 VAL 231 2534 2534 VAL VAL C . n 
C 1 232 PRO 232 2535 2535 PRO PRO C . n 
C 1 233 LEU 233 2536 2536 LEU LEU C . n 
C 1 234 TYR 234 2537 2537 TYR TYR C . n 
C 1 235 ASP 235 2538 2538 ASP ASP C . n 
C 1 236 LEU 236 2539 2539 LEU LEU C . n 
C 1 237 LEU 237 2540 2540 LEU LEU C . n 
C 1 238 LEU 238 2541 2541 LEU LEU C . n 
C 1 239 GLU 239 2542 2542 GLU GLU C . n 
C 1 240 MET 240 2543 2543 MET MET C . n 
C 1 241 LEU 241 2544 2544 LEU LEU C . n 
C 1 242 ASP 242 2545 2545 ASP ASP C . n 
C 1 243 ALA 243 2546 2546 ALA ALA C . n 
C 1 244 HIS 244 2547 2547 HIS HIS C . n 
C 1 245 ARG 245 2548 ?    ?   ?   C . n 
C 1 246 LEU 246 2549 ?    ?   ?   C . n 
C 1 247 HIS 247 2550 ?    ?   ?   C . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Proteomics in Europe' 
_pdbx_SG_project.initial_of_center     SPINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly              ?    dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2 A,D,G       
2 1   B,C,E,F,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 4790  ? 
2 MORE         -15   ? 
2 'SSA (A^2)'  19900 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 5_555 x-y,-y,-z+1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 45.3600000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-02-06 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          . ? 1 
CNS       refinement       . ? 2 
DENZO     'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 N A ARG 548  ? ? CA A ARG 548  ? ? 1.592 1.459 0.133 0.020 N 
2 1 N B LEU 1310 ? ? CA B LEU 1310 ? ? 1.919 1.459 0.460 0.020 N 
3 1 N B LEU 1327 ? ? CA B LEU 1327 ? ? 1.835 1.459 0.376 0.020 N 
4 1 N C LEU 2495 ? ? CA C LEU 2495 ? ? 1.979 1.459 0.520 0.020 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N A ARG 548  ? ? CA A ARG 548  ? ? CB A ARG 548  ? ? 130.62 110.60 20.02  1.80 N 
2 1 C B SER 1309 ? ? N  B LEU 1310 ? ? CA B LEU 1310 ? ? 95.86  121.70 -25.84 2.50 Y 
3 1 N B LEU 1310 ? ? CA B LEU 1310 ? ? C  B LEU 1310 ? ? 86.94  111.00 -24.06 2.70 N 
4 1 C B ILE 1326 ? ? N  B LEU 1327 ? ? CA B LEU 1327 ? ? 100.46 121.70 -21.24 2.50 Y 
5 1 N B LEU 1327 ? ? CA B LEU 1327 ? ? C  B LEU 1327 ? ? 90.02  111.00 -20.98 2.70 N 
6 1 C C GLY 2494 ? ? N  C LEU 2495 ? ? CA C LEU 2495 ? ? 93.89  121.70 -27.81 2.50 Y 
7 1 N C LEU 2495 ? ? CA C LEU 2495 ? ? CB C LEU 2495 ? ? 90.90  110.40 -19.50 2.00 N 
8 1 N C LEU 2495 ? ? CA C LEU 2495 ? ? C  C LEU 2495 ? ? 92.39  111.00 -18.61 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 305  ? ? -121.51 -141.95 
2  1 LEU A 306  ? ? -58.99  -83.62  
3  1 ALA A 307  ? ? -17.94  -67.94  
4  1 LEU A 308  ? ? -43.69  -5.88   
5  1 LEU A 310  ? ? -24.45  128.67  
6  1 ALA A 312  ? ? -40.98  -74.51  
7  1 GLU A 330  ? ? -68.06  37.76   
8  1 TYR A 331  ? ? -37.54  130.45  
9  1 GLU A 339  ? ? -62.47  21.73   
10 1 ALA A 340  ? ? -141.43 -37.00  
11 1 MET A 396  ? ? -41.91  -73.61  
12 1 LEU A 403  ? ? -60.02  75.49   
13 1 PRO A 406  ? ? -51.19  -7.92   
14 1 GLU A 423  ? ? -33.20  -75.63  
15 1 LEU A 440  ? ? -53.10  174.47  
16 1 PHE A 445  ? ? -45.41  -74.26  
17 1 ASN A 455  ? ? -80.45  -82.15  
18 1 SER A 456  ? ? -24.96  98.21   
19 1 PHE A 461  ? ? -95.19  -144.94 
20 1 SER A 464  ? ? -165.56 27.06   
21 1 THR A 465  ? ? -108.23 -160.93 
22 1 HIS A 501  ? ? -61.20  -76.44  
23 1 GLN A 502  ? ? -33.54  -35.35  
24 1 ALA A 505  ? ? -57.12  -72.16  
25 1 GLN A 506  ? ? -28.88  -48.18  
26 1 ASP A 538  ? ? -28.72  -75.76  
27 1 LEU B 1308 ? ? -30.96  -21.74  
28 1 SER B 1317 ? ? -58.61  -7.95   
29 1 GLU B 1323 ? ? -35.74  130.68  
30 1 TYR B 1331 ? ? 178.71  129.17  
31 1 PRO B 1333 ? ? -59.30  0.68    
32 1 ARG B 1335 ? ? 177.84  139.96  
33 1 MET B 1396 ? ? -27.32  -69.90  
34 1 GLU B 1397 ? ? -60.98  -71.42  
35 1 HIS B 1398 ? ? -51.48  96.16   
36 1 GLU B 1423 ? ? -38.19  -39.73  
37 1 ARG B 1434 ? ? -36.62  -39.01  
38 1 MET B 1437 ? ? -71.86  26.77   
39 1 MET B 1438 ? ? -152.52 -1.36   
40 1 ASN B 1439 ? ? 48.01   79.49   
41 1 LEU B 1462 ? ? -62.58  -84.74  
42 1 THR B 1465 ? ? -88.96  -150.49 
43 1 HIS B 1488 ? ? -56.35  -70.65  
44 1 LEU B 1489 ? ? -49.37  -9.94   
45 1 LYS B 1492 ? ? -75.77  36.57   
46 1 ALA B 1493 ? ? -160.04 15.24   
47 1 HIS B 1501 ? ? -53.73  -73.55  
48 1 PRO B 1535 ? ? -59.90  175.61  
49 1 LEU B 1536 ? ? -94.33  42.59   
50 1 ARG B 1548 ? ? 37.90   77.08   
51 1 LEU C 2306 ? ? -39.49  -39.17  
52 1 SER C 2317 ? ? -58.06  -9.21   
53 1 GLU C 2323 ? ? -35.23  130.68  
54 1 ILE C 2326 ? ? -83.72  48.59   
55 1 LEU C 2327 ? ? -25.25  128.04  
56 1 TYR C 2328 ? ? -66.87  -175.52 
57 1 SER C 2329 ? ? -109.48 -152.00 
58 1 GLU C 2330 ? ? -156.23 31.72   
59 1 PRO C 2336 ? ? -42.59  166.80  
60 1 MET C 2396 ? ? -27.64  -69.09  
61 1 GLU C 2397 ? ? -61.74  -71.09  
62 1 HIS C 2398 ? ? -51.40  96.05   
63 1 ARG C 2412 ? ? -39.69  -33.33  
64 1 ARG C 2434 ? ? -36.63  -39.47  
65 1 MET C 2437 ? ? -72.04  26.38   
66 1 MET C 2438 ? ? -152.38 -1.65   
67 1 ASN C 2439 ? ? 47.98   79.69   
68 1 PHE C 2461 ? ? -129.35 -144.14 
69 1 LEU C 2462 ? ? -106.43 -91.46  
70 1 HIS C 2488 ? ? -56.05  -71.02  
71 1 LEU C 2489 ? ? -49.28  -9.41   
72 1 LYS C 2492 ? ? -75.07  37.92   
73 1 ALA C 2493 ? ? -156.50 -2.76   
74 1 HIS C 2501 ? ? -51.98  -75.25  
75 1 PRO C 2535 ? ? -59.37  174.66  
76 1 LEU C 2536 ? ? -93.63  42.00   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 SER B 1309 ? ? LEU B 1310 ? ? -143.59 
2 1 ILE B 1326 ? ? LEU B 1327 ? ? -143.68 
3 1 GLY C 2494 ? ? LEU C 2495 ? ? -141.51 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B HIS 1550 ? B HIS 247 
2 1 Y 1 C ARG 2548 ? C ARG 245 
3 1 Y 1 C LEU 2549 ? C LEU 246 
4 1 Y 1 C HIS 2550 ? C HIS 247 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 ESTRADIOL EST 
3 water     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 EST 1  600  600  EST MOL A . 
E 2 EST 1  1600 1600 EST MOL B . 
F 2 EST 1  2600 2600 EST MOL C . 
G 3 HOH 1  3001 3001 HOH WAT A . 
G 3 HOH 2  3006 3006 HOH WAT A . 
G 3 HOH 3  3008 3008 HOH WAT A . 
G 3 HOH 4  3010 3010 HOH WAT A . 
G 3 HOH 5  3012 3012 HOH WAT A . 
G 3 HOH 6  3014 3014 HOH WAT A . 
G 3 HOH 7  3019 3019 HOH WAT A . 
G 3 HOH 8  3020 3020 HOH WAT A . 
G 3 HOH 9  3025 3025 HOH WAT A . 
G 3 HOH 10 3028 3028 HOH WAT A . 
G 3 HOH 11 3032 3032 HOH WAT A . 
G 3 HOH 12 3033 3033 HOH WAT A . 
G 3 HOH 13 3034 3034 HOH WAT A . 
G 3 HOH 14 3035 3035 HOH WAT A . 
G 3 HOH 15 3036 3036 HOH WAT A . 
G 3 HOH 16 3039 3039 HOH WAT A . 
G 3 HOH 17 3044 3044 HOH WAT A . 
G 3 HOH 18 3045 3045 HOH WAT A . 
G 3 HOH 19 3048 3048 HOH WAT A . 
G 3 HOH 20 3049 3049 HOH WAT A . 
G 3 HOH 21 3055 3055 HOH WAT A . 
G 3 HOH 22 3057 3057 HOH WAT A . 
G 3 HOH 23 3059 3059 HOH WAT A . 
G 3 HOH 24 3061 3061 HOH WAT A . 
G 3 HOH 25 3065 3065 HOH WAT A . 
G 3 HOH 26 3066 3066 HOH WAT A . 
G 3 HOH 27 3069 3069 HOH WAT A . 
G 3 HOH 28 3075 3075 HOH WAT A . 
G 3 HOH 29 3077 3077 HOH WAT A . 
G 3 HOH 30 3083 3083 HOH WAT A . 
G 3 HOH 31 3084 3084 HOH WAT A . 
G 3 HOH 32 3089 3089 HOH WAT A . 
G 3 HOH 33 3090 3090 HOH WAT A . 
G 3 HOH 34 3091 3091 HOH WAT A . 
G 3 HOH 35 3095 3095 HOH WAT A . 
G 3 HOH 36 3097 3097 HOH WAT A . 
G 3 HOH 37 3099 3099 HOH WAT A . 
G 3 HOH 38 3107 3107 HOH WAT A . 
G 3 HOH 39 3113 3113 HOH WAT A . 
G 3 HOH 40 3114 3114 HOH WAT A . 
G 3 HOH 41 3115 3115 HOH WAT A . 
G 3 HOH 42 3117 3117 HOH WAT A . 
G 3 HOH 43 3118 3118 HOH WAT A . 
G 3 HOH 44 3119 3119 HOH WAT A . 
G 3 HOH 45 3121 3121 HOH WAT A . 
G 3 HOH 46 3122 3122 HOH WAT A . 
G 3 HOH 47 3124 3124 HOH WAT A . 
G 3 HOH 48 3126 3126 HOH WAT A . 
G 3 HOH 49 3130 3130 HOH WAT A . 
G 3 HOH 50 3131 3131 HOH WAT A . 
G 3 HOH 51 3134 3134 HOH WAT A . 
G 3 HOH 52 3135 3135 HOH WAT A . 
G 3 HOH 53 3141 3141 HOH WAT A . 
G 3 HOH 54 3145 3145 HOH WAT A . 
G 3 HOH 55 3149 3149 HOH WAT A . 
G 3 HOH 56 3150 3150 HOH WAT A . 
G 3 HOH 57 3158 3158 HOH WAT A . 
H 3 HOH 1  3009 3009 HOH WAT B . 
H 3 HOH 2  3015 3015 HOH WAT B . 
H 3 HOH 3  3017 3017 HOH WAT B . 
H 3 HOH 4  3021 3021 HOH WAT B . 
H 3 HOH 5  3022 3022 HOH WAT B . 
H 3 HOH 6  3024 3024 HOH WAT B . 
H 3 HOH 7  3026 3026 HOH WAT B . 
H 3 HOH 8  3027 3027 HOH WAT B . 
H 3 HOH 9  3029 3029 HOH WAT B . 
H 3 HOH 10 3037 3037 HOH WAT B . 
H 3 HOH 11 3041 3041 HOH WAT B . 
H 3 HOH 12 3042 3042 HOH WAT B . 
H 3 HOH 13 3043 3043 HOH WAT B . 
H 3 HOH 14 3046 3046 HOH WAT B . 
H 3 HOH 15 3047 3047 HOH WAT B . 
H 3 HOH 16 3050 3050 HOH WAT B . 
H 3 HOH 17 3053 3053 HOH WAT B . 
H 3 HOH 18 3056 3056 HOH WAT B . 
H 3 HOH 19 3058 3058 HOH WAT B . 
H 3 HOH 20 3060 3060 HOH WAT B . 
H 3 HOH 21 3062 3062 HOH WAT B . 
H 3 HOH 22 3064 3064 HOH WAT B . 
H 3 HOH 23 3068 3068 HOH WAT B . 
H 3 HOH 24 3070 3070 HOH WAT B . 
H 3 HOH 25 3073 3073 HOH WAT B . 
H 3 HOH 26 3074 3074 HOH WAT B . 
H 3 HOH 27 3078 3078 HOH WAT B . 
H 3 HOH 28 3080 3080 HOH WAT B . 
H 3 HOH 29 3081 3081 HOH WAT B . 
H 3 HOH 30 3082 3082 HOH WAT B . 
H 3 HOH 31 3092 3092 HOH WAT B . 
H 3 HOH 32 3093 3093 HOH WAT B . 
H 3 HOH 33 3094 3094 HOH WAT B . 
H 3 HOH 34 3098 3098 HOH WAT B . 
H 3 HOH 35 3103 3103 HOH WAT B . 
H 3 HOH 36 3104 3104 HOH WAT B . 
H 3 HOH 37 3106 3106 HOH WAT B . 
H 3 HOH 38 3109 3109 HOH WAT B . 
H 3 HOH 39 3111 3111 HOH WAT B . 
H 3 HOH 40 3112 3112 HOH WAT B . 
H 3 HOH 41 3116 3116 HOH WAT B . 
H 3 HOH 42 3120 3120 HOH WAT B . 
H 3 HOH 43 3132 3132 HOH WAT B . 
H 3 HOH 44 3138 3138 HOH WAT B . 
H 3 HOH 45 3142 3142 HOH WAT B . 
H 3 HOH 46 3143 3143 HOH WAT B . 
H 3 HOH 47 3144 3144 HOH WAT B . 
H 3 HOH 48 3147 3147 HOH WAT B . 
H 3 HOH 49 3148 3148 HOH WAT B . 
H 3 HOH 50 3153 3153 HOH WAT B . 
H 3 HOH 51 3157 3157 HOH WAT B . 
H 3 HOH 52 3163 3163 HOH WAT B . 
H 3 HOH 53 3165 3165 HOH WAT B . 
I 3 HOH 1  3002 3002 HOH WAT C . 
I 3 HOH 2  3003 3003 HOH WAT C . 
I 3 HOH 3  3004 3004 HOH WAT C . 
I 3 HOH 4  3005 3005 HOH WAT C . 
I 3 HOH 5  3007 3007 HOH WAT C . 
I 3 HOH 6  3011 3011 HOH WAT C . 
I 3 HOH 7  3013 3013 HOH WAT C . 
I 3 HOH 8  3016 3016 HOH WAT C . 
I 3 HOH 9  3018 3018 HOH WAT C . 
I 3 HOH 10 3023 3023 HOH WAT C . 
I 3 HOH 11 3030 3030 HOH WAT C . 
I 3 HOH 12 3031 3031 HOH WAT C . 
I 3 HOH 13 3038 3038 HOH WAT C . 
I 3 HOH 14 3040 3040 HOH WAT C . 
I 3 HOH 15 3051 3051 HOH WAT C . 
I 3 HOH 16 3052 3052 HOH WAT C . 
I 3 HOH 17 3054 3054 HOH WAT C . 
I 3 HOH 18 3063 3063 HOH WAT C . 
I 3 HOH 19 3067 3067 HOH WAT C . 
I 3 HOH 20 3071 3071 HOH WAT C . 
I 3 HOH 21 3072 3072 HOH WAT C . 
I 3 HOH 22 3076 3076 HOH WAT C . 
I 3 HOH 23 3079 3079 HOH WAT C . 
I 3 HOH 24 3085 3085 HOH WAT C . 
I 3 HOH 25 3086 3086 HOH WAT C . 
I 3 HOH 26 3087 3087 HOH WAT C . 
I 3 HOH 27 3088 3088 HOH WAT C . 
I 3 HOH 28 3096 3096 HOH WAT C . 
I 3 HOH 29 3100 3100 HOH WAT C . 
I 3 HOH 30 3101 3101 HOH WAT C . 
I 3 HOH 31 3102 3102 HOH WAT C . 
I 3 HOH 32 3105 3105 HOH WAT C . 
I 3 HOH 33 3108 3108 HOH WAT C . 
I 3 HOH 34 3110 3110 HOH WAT C . 
I 3 HOH 35 3123 3123 HOH WAT C . 
I 3 HOH 36 3125 3125 HOH WAT C . 
I 3 HOH 37 3127 3127 HOH WAT C . 
I 3 HOH 38 3128 3128 HOH WAT C . 
I 3 HOH 39 3129 3129 HOH WAT C . 
I 3 HOH 40 3133 3133 HOH WAT C . 
I 3 HOH 41 3136 3136 HOH WAT C . 
I 3 HOH 42 3137 3137 HOH WAT C . 
I 3 HOH 43 3139 3139 HOH WAT C . 
I 3 HOH 44 3140 3140 HOH WAT C . 
I 3 HOH 45 3146 3146 HOH WAT C . 
I 3 HOH 46 3151 3151 HOH WAT C . 
I 3 HOH 47 3152 3152 HOH WAT C . 
I 3 HOH 48 3154 3154 HOH WAT C . 
I 3 HOH 49 3155 3155 HOH WAT C . 
I 3 HOH 50 3156 3156 HOH WAT C . 
I 3 HOH 51 3159 3159 HOH WAT C . 
I 3 HOH 52 3160 3160 HOH WAT C . 
I 3 HOH 53 3161 3161 HOH WAT C . 
I 3 HOH 54 3162 3162 HOH WAT C . 
I 3 HOH 55 3164 3164 HOH WAT C . 
#