data_1G5M
# 
_entry.id   1G5M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.355 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1G5M         pdb_00001g5m 10.2210/pdb1g5m/pdb 
RCSB  RCSB012262   ?            ?                   
WWPDB D_1000012262 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1BXL 'STRUCTURE OF BCL-XL/BAK PEPTIDE COMPLEX, NMR, MINIMIZED AVERAGE STRUCTURE' unspecified 
PDB 1G5J 'Complex of Bcl-xL with peptide from Bad'                                   unspecified 
PDB 1G5O 'Human Bcl-2, isoform 2'                                                    unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1G5M 
_pdbx_database_status.recvd_initial_deposition_date   2000-11-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Petros, A.M.'     1 
'Medek, A.'        2 
'Nettesheim, D.G.' 3 
'Kim, D.H.'        4 
'Yoon, H.S.'       5 
'Swift, K.'        6 
'Matayoshi, E.D.'  7 
'Oltersdorf, T.'   8 
'Fesik, S.W.'      9 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Solution structure of the antiapoptotic protein bcl-2.'                                                        
Proc.Natl.Acad.Sci.USA 98 3012 3017 2001 PNASA6 US 0027-8424 0040 ? 11248023 10.1073/pnas.041619798 
1       'Analysis of the structure, transcripts, and products of bcl-2, the gene involved in human follicular lymphoma' 
Proc.Natl.Acad.Sci.USA 83 5214 5218 1986 PNASA6 US 0027-8424 0040 ? ?        ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Petros, A.M.'     1  ? 
primary 'Medek, A.'        2  ? 
primary 'Nettesheim, D.G.' 3  ? 
primary 'Kim, D.H.'        4  ? 
primary 'Yoon, H.S.'       5  ? 
primary 'Swift, K.'        6  ? 
primary 'Matayoshi, E.D.'  7  ? 
primary 'Oltersdorf, T.'   8  ? 
primary 'Fesik, S.W.'      9  ? 
1       'Tsujimoto, Y.'    10 ? 
1       'Croce, C.M.'      11 ? 
# 
_cell.entry_id           1G5M 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1G5M 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           
'PROTEIN (APOPTOSIS REGULATOR BCL-2 WITH PUTATIVE FLEXIBLE LOOP REPLACED WITH A PORTION OF APOPTOSIS REGULATOR BCL-X PROTEIN)' 
_entity.formula_weight             19227.389 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDDVEENRTEAPEGTESEVVHLALRQAGDDFSRRYRGDFAEMSSQLHL
TPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVEL
YGPSMR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDDVEENRTEAPEGTESEVVHLALRQAGDDFSRRYRGDFAEMSSQLHL
TPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVEL
YGPSMR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   HIS n 
1 4   ALA n 
1 5   GLY n 
1 6   ARG n 
1 7   THR n 
1 8   GLY n 
1 9   TYR n 
1 10  ASP n 
1 11  ASN n 
1 12  ARG n 
1 13  GLU n 
1 14  ILE n 
1 15  VAL n 
1 16  MET n 
1 17  LYS n 
1 18  TYR n 
1 19  ILE n 
1 20  HIS n 
1 21  TYR n 
1 22  LYS n 
1 23  LEU n 
1 24  SER n 
1 25  GLN n 
1 26  ARG n 
1 27  GLY n 
1 28  TYR n 
1 29  GLU n 
1 30  TRP n 
1 31  ASP n 
1 32  ALA n 
1 33  GLY n 
1 34  ASP n 
1 35  ASP n 
1 36  VAL n 
1 37  GLU n 
1 38  GLU n 
1 39  ASN n 
1 40  ARG n 
1 41  THR n 
1 42  GLU n 
1 43  ALA n 
1 44  PRO n 
1 45  GLU n 
1 46  GLY n 
1 47  THR n 
1 48  GLU n 
1 49  SER n 
1 50  GLU n 
1 51  VAL n 
1 52  VAL n 
1 53  HIS n 
1 54  LEU n 
1 55  ALA n 
1 56  LEU n 
1 57  ARG n 
1 58  GLN n 
1 59  ALA n 
1 60  GLY n 
1 61  ASP n 
1 62  ASP n 
1 63  PHE n 
1 64  SER n 
1 65  ARG n 
1 66  ARG n 
1 67  TYR n 
1 68  ARG n 
1 69  GLY n 
1 70  ASP n 
1 71  PHE n 
1 72  ALA n 
1 73  GLU n 
1 74  MET n 
1 75  SER n 
1 76  SER n 
1 77  GLN n 
1 78  LEU n 
1 79  HIS n 
1 80  LEU n 
1 81  THR n 
1 82  PRO n 
1 83  PHE n 
1 84  THR n 
1 85  ALA n 
1 86  ARG n 
1 87  GLY n 
1 88  ARG n 
1 89  PHE n 
1 90  ALA n 
1 91  THR n 
1 92  VAL n 
1 93  VAL n 
1 94  GLU n 
1 95  GLU n 
1 96  LEU n 
1 97  PHE n 
1 98  ARG n 
1 99  ASP n 
1 100 GLY n 
1 101 VAL n 
1 102 ASN n 
1 103 TRP n 
1 104 GLY n 
1 105 ARG n 
1 106 ILE n 
1 107 VAL n 
1 108 ALA n 
1 109 PHE n 
1 110 PHE n 
1 111 GLU n 
1 112 PHE n 
1 113 GLY n 
1 114 GLY n 
1 115 VAL n 
1 116 MET n 
1 117 CYS n 
1 118 VAL n 
1 119 GLU n 
1 120 SER n 
1 121 VAL n 
1 122 ASN n 
1 123 ARG n 
1 124 GLU n 
1 125 MET n 
1 126 SER n 
1 127 PRO n 
1 128 LEU n 
1 129 VAL n 
1 130 ASP n 
1 131 ASN n 
1 132 ILE n 
1 133 ALA n 
1 134 LEU n 
1 135 TRP n 
1 136 MET n 
1 137 THR n 
1 138 GLU n 
1 139 TYR n 
1 140 LEU n 
1 141 ASN n 
1 142 ARG n 
1 143 HIS n 
1 144 LEU n 
1 145 HIS n 
1 146 THR n 
1 147 TRP n 
1 148 ILE n 
1 149 GLN n 
1 150 ASP n 
1 151 ASN n 
1 152 GLY n 
1 153 GLY n 
1 154 TRP n 
1 155 ASP n 
1 156 ALA n 
1 157 PHE n 
1 158 VAL n 
1 159 GLU n 
1 160 LEU n 
1 161 TYR n 
1 162 GLY n 
1 163 PRO n 
1 164 SER n 
1 165 MET n 
1 166 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP BCL2_HUMAN 1 ? ? P10415 ? 
2 UNP BCLX_HUMAN 1 ? ? Q07817 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1G5M A 1  ? 34  ? P10415 1  ? 34  ? 1  34  
2 2 1G5M A 35 ? 50  ? Q07817 29 ? 44  ? 35 50  
3 1 1G5M A 51 ? 166 ? P10415 92 ? 207 ? 92 207 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1G5M ALA A 55 ? UNP P10415 THR 96  ISOFORM 96  1 
1 1G5M GLY A 69 ? UNP P10415 ARG 110 ISOFORM 110 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY 
2 2 1 3D_13C-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.8 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '20 mM' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '15N-Bcl-2(1); 15N,13C-BCL-2(1)' H2O 
2 '15N,13C-Bcl-2(1)'               D2O 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker AVANCE 800 
2 ? Bruker AVANCE 600 
3 ? Bruker AVANCE 500 
# 
_pdbx_nmr_refine.entry_id           1G5M 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                             1G5M 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_software.name             CNX 
_pdbx_nmr_software.version          2000 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.authors          Brunger 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1G5M 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1G5M 
_struct.title                     'HUMAN BCL-2, ISOFORM 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1G5M 
_struct_keywords.pdbx_keywords   APOPTOSIS 
_struct_keywords.text            APOPTOSIS 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 10  ? GLN A 25  ? ASP A 10  GLN A 25  1 ? 16 
HELX_P HELX_P2 2 VAL A 51  ? ARG A 68  ? VAL A 92  ARG A 109 1 ? 18 
HELX_P HELX_P3 3 ALA A 72  ? GLN A 77  ? ALA A 113 GLN A 118 5 ? 6  
HELX_P HELX_P4 4 THR A 81  ? PHE A 97  ? THR A 122 PHE A 138 1 ? 17 
HELX_P HELX_P5 5 ASN A 102 ? ARG A 123 ? ASN A 143 ARG A 164 1 ? 22 
HELX_P HELX_P6 6 MET A 125 ? HIS A 143 ? MET A 166 HIS A 184 1 ? 19 
HELX_P HELX_P7 7 HIS A 143 ? GLY A 152 ? HIS A 184 GLY A 193 1 ? 10 
HELX_P HELX_P8 8 GLY A 153 ? GLY A 162 ? GLY A 194 GLY A 203 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1G5M 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1G5M 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N    . HIS A 1 3   ? -0.377  15.593  18.283  1.00 7.96  ? 3   HIS A N    1 
ATOM 2    C CA   . HIS A 1 3   ? -1.553  16.160  18.993  1.00 7.23  ? 3   HIS A CA   1 
ATOM 3    C C    . HIS A 1 3   ? -2.790  15.291  18.791  1.00 6.42  ? 3   HIS A C    1 
ATOM 4    O O    . HIS A 1 3   ? -3.896  15.800  18.608  1.00 6.57  ? 3   HIS A O    1 
ATOM 5    C CB   . HIS A 1 3   ? -1.808  17.572  18.463  1.00 7.71  ? 3   HIS A CB   1 
ATOM 6    C CG   . HIS A 1 3   ? -2.111  17.615  16.997  1.00 8.25  ? 3   HIS A CG   1 
ATOM 7    N ND1  . HIS A 1 3   ? -2.430  18.778  16.328  1.00 9.01  ? 3   HIS A ND1  1 
ATOM 8    C CD2  . HIS A 1 3   ? -2.141  16.629  16.069  1.00 8.41  ? 3   HIS A CD2  1 
ATOM 9    C CE1  . HIS A 1 3   ? -2.645  18.505  15.053  1.00 9.58  ? 3   HIS A CE1  1 
ATOM 10   N NE2  . HIS A 1 3   ? -2.475  17.209  14.870  1.00 9.25  ? 3   HIS A NE2  1 
ATOM 11   H H    . HIS A 1 3   ? 0.064   16.360  17.737  1.00 8.32  ? 3   HIS A H    1 
ATOM 12   H HA   . HIS A 1 3   ? -1.327  16.211  20.047  1.00 7.25  ? 3   HIS A HA   1 
ATOM 13   H HB2  . HIS A 1 3   ? -2.649  18.000  18.987  1.00 8.18  ? 3   HIS A HB2  1 
ATOM 14   H HB3  . HIS A 1 3   ? -0.932  18.178  18.640  1.00 7.52  ? 3   HIS A HB3  1 
ATOM 15   H HD1  . HIS A 1 3   ? -2.491  19.670  16.728  1.00 9.26  ? 3   HIS A HD1  1 
ATOM 16   H HD2  . HIS A 1 3   ? -1.939  15.581  16.240  1.00 8.14  ? 3   HIS A HD2  1 
ATOM 17   H HE1  . HIS A 1 3   ? -2.912  19.221  14.290  1.00 10.34 ? 3   HIS A HE1  1 
ATOM 18   N N    . ALA A 1 4   ? -2.596  13.976  18.826  1.00 5.87  ? 4   ALA A N    1 
ATOM 19   C CA   . ALA A 1 4   ? -3.695  13.036  18.647  1.00 5.31  ? 4   ALA A CA   1 
ATOM 20   C C    . ALA A 1 4   ? -4.275  13.131  17.240  1.00 4.79  ? 4   ALA A C    1 
ATOM 21   O O    . ALA A 1 4   ? -3.977  12.304  16.378  1.00 5.11  ? 4   ALA A O    1 
ATOM 22   C CB   . ALA A 1 4   ? -4.779  13.288  19.684  1.00 5.62  ? 4   ALA A CB   1 
ATOM 23   H H    . ALA A 1 4   ? -1.691  13.631  18.976  1.00 6.07  ? 4   ALA A H    1 
ATOM 24   H HA   . ALA A 1 4   ? -3.309  12.039  18.800  1.00 5.46  ? 4   ALA A HA   1 
ATOM 25   H HB1  . ALA A 1 4   ? -4.744  12.515  20.437  1.00 6.19  ? 4   ALA A HB1  1 
ATOM 26   H HB2  . ALA A 1 4   ? -5.747  13.279  19.204  1.00 5.82  ? 4   ALA A HB2  1 
ATOM 27   H HB3  . ALA A 1 4   ? -4.617  14.250  20.148  1.00 5.47  ? 4   ALA A HB3  1 
ATOM 28   N N    . GLY A 1 5   ? -5.103  14.146  17.013  1.00 4.36  ? 5   GLY A N    1 
ATOM 29   C CA   . GLY A 1 5   ? -5.711  14.330  15.709  1.00 4.16  ? 5   GLY A CA   1 
ATOM 30   C C    . GLY A 1 5   ? -6.327  13.053  15.173  1.00 3.56  ? 5   GLY A C    1 
ATOM 31   O O    . GLY A 1 5   ? -6.711  12.171  15.941  1.00 3.75  ? 5   GLY A O    1 
ATOM 32   H H    . GLY A 1 5   ? -5.303  14.774  17.738  1.00 4.48  ? 5   GLY A H    1 
ATOM 33   H HA2  . GLY A 1 5   ? -6.480  15.084  15.786  1.00 4.55  ? 5   GLY A HA2  1 
ATOM 34   H HA3  . GLY A 1 5   ? -4.955  14.670  15.016  1.00 4.48  ? 5   GLY A HA3  1 
ATOM 35   N N    . ARG A 1 6   ? -6.423  12.954  13.851  1.00 3.33  ? 6   ARG A N    1 
ATOM 36   C CA   . ARG A 1 6   ? -6.998  11.775  13.214  1.00 3.16  ? 6   ARG A CA   1 
ATOM 37   C C    . ARG A 1 6   ? -6.986  11.916  11.695  1.00 2.67  ? 6   ARG A C    1 
ATOM 38   O O    . ARG A 1 6   ? -7.488  12.899  11.149  1.00 3.16  ? 6   ARG A O    1 
ATOM 39   C CB   . ARG A 1 6   ? -8.429  11.549  13.705  1.00 3.87  ? 6   ARG A CB   1 
ATOM 40   C CG   . ARG A 1 6   ? -8.786  10.083  13.884  1.00 4.39  ? 6   ARG A CG   1 
ATOM 41   C CD   . ARG A 1 6   ? -8.656  9.652   15.335  1.00 5.13  ? 6   ARG A CD   1 
ATOM 42   N NE   . ARG A 1 6   ? -9.256  8.341   15.572  1.00 5.96  ? 6   ARG A NE   1 
ATOM 43   C CZ   . ARG A 1 6   ? -10.567 8.105   15.534  1.00 6.76  ? 6   ARG A CZ   1 
ATOM 44   N NH1  . ARG A 1 6   ? -11.422 9.087   15.270  1.00 6.95  ? 6   ARG A NH1  1 
ATOM 45   N NH2  . ARG A 1 6   ? -11.025 6.882   15.761  1.00 7.64  ? 6   ARG A NH2  1 
ATOM 46   H H    . ARG A 1 6   ? -6.100  13.690  13.291  1.00 3.64  ? 6   ARG A H    1 
ATOM 47   H HA   . ARG A 1 6   ? -6.395  10.923  13.488  1.00 3.38  ? 6   ARG A HA   1 
ATOM 48   H HB2  . ARG A 1 6   ? -8.554  12.047  14.655  1.00 4.28  ? 6   ARG A HB2  1 
ATOM 49   H HB3  . ARG A 1 6   ? -9.115  11.980  12.990  1.00 4.11  ? 6   ARG A HB3  1 
ATOM 50   H HG2  . ARG A 1 6   ? -9.806  9.929   13.563  1.00 4.46  ? 6   ARG A HG2  1 
ATOM 51   H HG3  . ARG A 1 6   ? -8.122  9.484   13.278  1.00 4.67  ? 6   ARG A HG3  1 
ATOM 52   H HD2  . ARG A 1 6   ? -7.609  9.609   15.592  1.00 5.24  ? 6   ARG A HD2  1 
ATOM 53   H HD3  . ARG A 1 6   ? -9.150  10.382  15.960  1.00 5.35  ? 6   ARG A HD3  1 
ATOM 54   H HE   . ARG A 1 6   ? -8.651  7.596   15.770  1.00 6.11  ? 6   ARG A HE   1 
ATOM 55   H HH11 . ARG A 1 6   ? -11.087 10.013  15.097  1.00 6.50  ? 6   ARG A HH11 1 
ATOM 56   H HH12 . ARG A 1 6   ? -12.403 8.899   15.243  1.00 7.70  ? 6   ARG A HH12 1 
ATOM 57   H HH21 . ARG A 1 6   ? -10.386 6.138   15.961  1.00 7.76  ? 6   ARG A HH21 1 
ATOM 58   H HH22 . ARG A 1 6   ? -12.008 6.703   15.733  1.00 8.31  ? 6   ARG A HH22 1 
ATOM 59   N N    . THR A 1 7   ? -6.411  10.927  11.019  1.00 2.23  ? 7   THR A N    1 
ATOM 60   C CA   . THR A 1 7   ? -6.334  10.939  9.563   1.00 1.93  ? 7   THR A CA   1 
ATOM 61   C C    . THR A 1 7   ? -5.682  9.662   9.042   1.00 1.81  ? 7   THR A C    1 
ATOM 62   O O    . THR A 1 7   ? -4.660  9.711   8.358   1.00 2.30  ? 7   THR A O    1 
ATOM 63   C CB   . THR A 1 7   ? -5.547  12.159  9.083   1.00 2.21  ? 7   THR A CB   1 
ATOM 64   O OG1  . THR A 1 7   ? -5.521  12.214  7.667   1.00 3.07  ? 7   THR A OG1  1 
ATOM 65   C CG2  . THR A 1 7   ? -4.114  12.176  9.570   1.00 2.74  ? 7   THR A CG2  1 
ATOM 66   H H    . THR A 1 7   ? -6.030  10.170  11.511  1.00 2.55  ? 7   THR A H    1 
ATOM 67   H HA   . THR A 1 7   ? -7.341  10.997  9.178   1.00 2.28  ? 7   THR A HA   1 
ATOM 68   H HB   . THR A 1 7   ? -6.031  13.054  9.448   1.00 2.34  ? 7   THR A HB   1 
ATOM 69   H HG1  . THR A 1 7   ? -6.045  11.494  7.309   1.00 3.39  ? 7   THR A HG1  1 
ATOM 70   H HG21 . THR A 1 7   ? -3.445  12.138  8.722   1.00 3.07  ? 7   THR A HG21 1 
ATOM 71   H HG22 . THR A 1 7   ? -3.940  11.320  10.205  1.00 3.07  ? 7   THR A HG22 1 
ATOM 72   H HG23 . THR A 1 7   ? -3.935  13.082  10.129  1.00 3.20  ? 7   THR A HG23 1 
ATOM 73   N N    . GLY A 1 8   ? -6.280  8.521   9.371   1.00 1.89  ? 8   GLY A N    1 
ATOM 74   C CA   . GLY A 1 8   ? -5.743  7.248   8.927   1.00 2.15  ? 8   GLY A CA   1 
ATOM 75   C C    . GLY A 1 8   ? -5.425  7.240   7.445   1.00 1.61  ? 8   GLY A C    1 
ATOM 76   O O    . GLY A 1 8   ? -6.021  7.992   6.673   1.00 2.30  ? 8   GLY A O    1 
ATOM 77   H H    . GLY A 1 8   ? -7.092  8.544   9.919   1.00 2.23  ? 8   GLY A H    1 
ATOM 78   H HA2  . GLY A 1 8   ? -4.838  7.039   9.479   1.00 2.58  ? 8   GLY A HA2  1 
ATOM 79   H HA3  . GLY A 1 8   ? -6.466  6.473   9.133   1.00 2.77  ? 8   GLY A HA3  1 
ATOM 80   N N    . TYR A 1 9   ? -4.483  6.393   7.045   1.00 1.09  ? 9   TYR A N    1 
ATOM 81   C CA   . TYR A 1 9   ? -4.090  6.298   5.644   1.00 0.60  ? 9   TYR A CA   1 
ATOM 82   C C    . TYR A 1 9   ? -4.487  4.951   5.042   1.00 0.75  ? 9   TYR A C    1 
ATOM 83   O O    . TYR A 1 9   ? -3.906  4.514   4.049   1.00 1.74  ? 9   TYR A O    1 
ATOM 84   C CB   . TYR A 1 9   ? -2.581  6.501   5.504   1.00 0.71  ? 9   TYR A CB   1 
ATOM 85   C CG   . TYR A 1 9   ? -2.140  7.940   5.653   1.00 0.65  ? 9   TYR A CG   1 
ATOM 86   C CD1  . TYR A 1 9   ? -2.508  8.690   6.763   1.00 1.37  ? 9   TYR A CD1  1 
ATOM 87   C CD2  . TYR A 1 9   ? -1.353  8.547   4.683   1.00 1.07  ? 9   TYR A CD2  1 
ATOM 88   C CE1  . TYR A 1 9   ? -2.105  10.005  6.902   1.00 1.41  ? 9   TYR A CE1  1 
ATOM 89   C CE2  . TYR A 1 9   ? -0.945  9.861   4.815   1.00 1.13  ? 9   TYR A CE2  1 
ATOM 90   C CZ   . TYR A 1 9   ? -1.324  10.585  5.925   1.00 0.80  ? 9   TYR A CZ   1 
ATOM 91   O OH   . TYR A 1 9   ? -0.920  11.894  6.060   1.00 0.96  ? 9   TYR A OH   1 
ATOM 92   H H    . TYR A 1 9   ? -4.042  5.820   7.706   1.00 1.69  ? 9   TYR A H    1 
ATOM 93   H HA   . TYR A 1 9   ? -4.600  7.080   5.105   1.00 0.81  ? 9   TYR A HA   1 
ATOM 94   H HB2  . TYR A 1 9   ? -2.076  5.921   6.262   1.00 0.95  ? 9   TYR A HB2  1 
ATOM 95   H HB3  . TYR A 1 9   ? -2.268  6.157   4.529   1.00 0.94  ? 9   TYR A HB3  1 
ATOM 96   H HD1  . TYR A 1 9   ? -3.119  8.233   7.527   1.00 2.13  ? 9   TYR A HD1  1 
ATOM 97   H HD2  . TYR A 1 9   ? -1.058  7.978   3.814   1.00 1.79  ? 9   TYR A HD2  1 
ATOM 98   H HE1  . TYR A 1 9   ? -2.402  10.572  7.772   1.00 2.17  ? 9   TYR A HE1  1 
ATOM 99   H HE2  . TYR A 1 9   ? -0.333  10.315  4.049   1.00 1.86  ? 9   TYR A HE2  1 
ATOM 100  H HH   . TYR A 1 9   ? -0.508  12.187  5.244   1.00 1.22  ? 9   TYR A HH   1 
ATOM 101  N N    . ASP A 1 10  ? -5.474  4.293   5.644   1.00 0.59  ? 10  ASP A N    1 
ATOM 102  C CA   . ASP A 1 10  ? -5.932  2.998   5.155   1.00 0.73  ? 10  ASP A CA   1 
ATOM 103  C C    . ASP A 1 10  ? -4.820  1.958   5.250   1.00 0.69  ? 10  ASP A C    1 
ATOM 104  O O    . ASP A 1 10  ? -4.369  1.422   4.238   1.00 0.95  ? 10  ASP A O    1 
ATOM 105  C CB   . ASP A 1 10  ? -6.413  3.117   3.708   1.00 1.04  ? 10  ASP A CB   1 
ATOM 106  C CG   . ASP A 1 10  ? -7.279  4.341   3.484   1.00 1.65  ? 10  ASP A CG   1 
ATOM 107  O OD1  . ASP A 1 10  ? -8.422  4.359   3.986   1.00 2.20  ? 10  ASP A OD1  1 
ATOM 108  O OD2  . ASP A 1 10  ? -6.813  5.282   2.807   1.00 2.17  ? 10  ASP A OD2  1 
ATOM 109  H H    . ASP A 1 10  ? -5.904  4.682   6.432   1.00 1.24  ? 10  ASP A H    1 
ATOM 110  H HA   . ASP A 1 10  ? -6.758  2.683   5.775   1.00 0.94  ? 10  ASP A HA   1 
ATOM 111  H HB2  . ASP A 1 10  ? -5.556  3.181   3.054   1.00 1.10  ? 10  ASP A HB2  1 
ATOM 112  H HB3  . ASP A 1 10  ? -6.990  2.239   3.454   1.00 1.25  ? 10  ASP A HB3  1 
ATOM 113  N N    . ASN A 1 11  ? -4.382  1.678   6.474   1.00 0.53  ? 11  ASN A N    1 
ATOM 114  C CA   . ASN A 1 11  ? -3.322  0.702   6.704   1.00 0.50  ? 11  ASN A CA   1 
ATOM 115  C C    . ASN A 1 11  ? -3.611  -0.601  5.964   1.00 0.47  ? 11  ASN A C    1 
ATOM 116  O O    . ASN A 1 11  ? -2.712  -1.210  5.384   1.00 0.46  ? 11  ASN A O    1 
ATOM 117  C CB   . ASN A 1 11  ? -3.165  0.428   8.201   1.00 0.57  ? 11  ASN A CB   1 
ATOM 118  C CG   . ASN A 1 11  ? -4.498  0.315   8.915   1.00 1.49  ? 11  ASN A CG   1 
ATOM 119  O OD1  . ASN A 1 11  ? -5.427  -0.325  8.423   1.00 2.39  ? 11  ASN A OD1  1 
ATOM 120  N ND2  . ASN A 1 11  ? -4.598  0.939   10.083  1.00 2.06  ? 11  ASN A ND2  1 
ATOM 121  H H    . ASN A 1 11  ? -4.782  2.138   7.241   1.00 0.62  ? 11  ASN A H    1 
ATOM 122  H HA   . ASN A 1 11  ? -2.400  1.118   6.326   1.00 0.48  ? 11  ASN A HA   1 
ATOM 123  H HB2  . ASN A 1 11  ? -2.626  -0.498  8.337   1.00 1.26  ? 11  ASN A HB2  1 
ATOM 124  H HB3  . ASN A 1 11  ? -2.604  1.235   8.651   1.00 1.05  ? 11  ASN A HB3  1 
ATOM 125  H HD21 . ASN A 1 11  ? -3.817  1.430   10.414  1.00 2.06  ? 11  ASN A HD21 1 
ATOM 126  H HD22 . ASN A 1 11  ? -5.449  0.882   10.567  1.00 2.84  ? 11  ASN A HD22 1 
ATOM 127  N N    . ARG A 1 12  ? -4.872  -1.022  5.989   1.00 0.46  ? 12  ARG A N    1 
ATOM 128  C CA   . ARG A 1 12  ? -5.279  -2.252  5.319   1.00 0.45  ? 12  ARG A CA   1 
ATOM 129  C C    . ARG A 1 12  ? -5.234  -2.085  3.805   1.00 0.42  ? 12  ARG A C    1 
ATOM 130  O O    . ARG A 1 12  ? -4.957  -3.035  3.073   1.00 0.42  ? 12  ARG A O    1 
ATOM 131  C CB   . ARG A 1 12  ? -6.688  -2.655  5.759   1.00 0.49  ? 12  ARG A CB   1 
ATOM 132  C CG   . ARG A 1 12  ? -7.184  -3.937  5.112   1.00 1.06  ? 12  ARG A CG   1 
ATOM 133  C CD   . ARG A 1 12  ? -8.051  -4.743  6.066   1.00 1.26  ? 12  ARG A CD   1 
ATOM 134  N NE   . ARG A 1 12  ? -9.149  -3.949  6.611   1.00 1.42  ? 12  ARG A NE   1 
ATOM 135  C CZ   . ARG A 1 12  ? -10.211 -3.565  5.906   1.00 1.72  ? 12  ARG A CZ   1 
ATOM 136  N NH1  . ARG A 1 12  ? -10.327 -3.899  4.625   1.00 2.23  ? 12  ARG A NH1  1 
ATOM 137  N NH2  . ARG A 1 12  ? -11.163 -2.845  6.484   1.00 2.27  ? 12  ARG A NH2  1 
ATOM 138  H H    . ARG A 1 12  ? -5.544  -0.493  6.467   1.00 0.47  ? 12  ARG A H    1 
ATOM 139  H HA   . ARG A 1 12  ? -4.586  -3.030  5.604   1.00 0.46  ? 12  ARG A HA   1 
ATOM 140  H HB2  . ARG A 1 12  ? -6.692  -2.793  6.830   1.00 0.81  ? 12  ARG A HB2  1 
ATOM 141  H HB3  . ARG A 1 12  ? -7.373  -1.860  5.505   1.00 0.93  ? 12  ARG A HB3  1 
ATOM 142  H HG2  . ARG A 1 12  ? -7.766  -3.686  4.238   1.00 1.61  ? 12  ARG A HG2  1 
ATOM 143  H HG3  . ARG A 1 12  ? -6.333  -4.535  4.820   1.00 1.72  ? 12  ARG A HG3  1 
ATOM 144  H HD2  . ARG A 1 12  ? -8.461  -5.588  5.533   1.00 1.91  ? 12  ARG A HD2  1 
ATOM 145  H HD3  . ARG A 1 12  ? -7.435  -5.096  6.879   1.00 1.68  ? 12  ARG A HD3  1 
ATOM 146  H HE   . ARG A 1 12  ? -9.092  -3.687  7.554   1.00 1.94  ? 12  ARG A HE   1 
ATOM 147  H HH11 . ARG A 1 12  ? -9.616  -4.442  4.180   1.00 2.27  ? 12  ARG A HH11 1 
ATOM 148  H HH12 . ARG A 1 12  ? -11.129 -3.605  4.105   1.00 2.92  ? 12  ARG A HH12 1 
ATOM 149  H HH21 . ARG A 1 12  ? -11.082 -2.590  7.448   1.00 2.52  ? 12  ARG A HH21 1 
ATOM 150  H HH22 . ARG A 1 12  ? -11.961 -2.555  5.956   1.00 2.74  ? 12  ARG A HH22 1 
ATOM 151  N N    . GLU A 1 13  ? -5.507  -0.870  3.342   1.00 0.42  ? 13  GLU A N    1 
ATOM 152  C CA   . GLU A 1 13  ? -5.495  -0.574  1.914   1.00 0.43  ? 13  GLU A CA   1 
ATOM 153  C C    . GLU A 1 13  ? -4.069  -0.374  1.412   1.00 0.40  ? 13  GLU A C    1 
ATOM 154  O O    . GLU A 1 13  ? -3.763  -0.656  0.254   1.00 0.42  ? 13  GLU A O    1 
ATOM 155  C CB   . GLU A 1 13  ? -6.330  0.674   1.623   1.00 0.47  ? 13  GLU A CB   1 
ATOM 156  C CG   . GLU A 1 13  ? -6.757  0.795   0.169   1.00 0.50  ? 13  GLU A CG   1 
ATOM 157  C CD   . GLU A 1 13  ? -8.095  1.490   0.010   1.00 1.35  ? 13  GLU A CD   1 
ATOM 158  O OE1  . GLU A 1 13  ? -8.936  1.376   0.926   1.00 2.04  ? 13  GLU A OE1  1 
ATOM 159  O OE2  . GLU A 1 13  ? -8.301  2.149   -1.031  1.00 2.12  ? 13  GLU A OE2  1 
ATOM 160  H H    . GLU A 1 13  ? -5.718  -0.153  3.976   1.00 0.44  ? 13  GLU A H    1 
ATOM 161  H HA   . GLU A 1 13  ? -5.931  -1.417  1.398   1.00 0.44  ? 13  GLU A HA   1 
ATOM 162  H HB2  . GLU A 1 13  ? -7.219  0.649   2.236   1.00 0.57  ? 13  GLU A HB2  1 
ATOM 163  H HB3  . GLU A 1 13  ? -5.751  1.548   1.880   1.00 0.61  ? 13  GLU A HB3  1 
ATOM 164  H HG2  . GLU A 1 13  ? -6.009  1.361   -0.366  1.00 0.94  ? 13  GLU A HG2  1 
ATOM 165  H HG3  . GLU A 1 13  ? -6.829  -0.196  -0.255  1.00 1.01  ? 13  GLU A HG3  1 
ATOM 166  N N    . ILE A 1 14  ? -3.199  0.115   2.291   1.00 0.38  ? 14  ILE A N    1 
ATOM 167  C CA   . ILE A 1 14  ? -1.806  0.352   1.936   1.00 0.38  ? 14  ILE A CA   1 
ATOM 168  C C    . ILE A 1 14  ? -1.075  -0.959  1.672   1.00 0.35  ? 14  ILE A C    1 
ATOM 169  O O    . ILE A 1 14  ? -0.334  -1.084  0.697   1.00 0.39  ? 14  ILE A O    1 
ATOM 170  C CB   . ILE A 1 14  ? -1.068  1.125   3.045   1.00 0.41  ? 14  ILE A CB   1 
ATOM 171  C CG1  . ILE A 1 14  ? -1.238  2.632   2.845   1.00 0.53  ? 14  ILE A CG1  1 
ATOM 172  C CG2  . ILE A 1 14  ? 0.406   0.749   3.062   1.00 0.46  ? 14  ILE A CG2  1 
ATOM 173  C CD1  . ILE A 1 14  ? -0.916  3.446   4.077   1.00 0.75  ? 14  ILE A CD1  1 
ATOM 174  H H    . ILE A 1 14  ? -3.501  0.322   3.200   1.00 0.39  ? 14  ILE A H    1 
ATOM 175  H HA   . ILE A 1 14  ? -1.788  0.949   1.036   1.00 0.40  ? 14  ILE A HA   1 
ATOM 176  H HB   . ILE A 1 14  ? -1.497  0.845   3.995   1.00 0.42  ? 14  ILE A HB   1 
ATOM 177  H HG12 . ILE A 1 14  ? -0.582  2.960   2.053   1.00 1.08  ? 14  ILE A HG12 1 
ATOM 178  H HG13 . ILE A 1 14  ? -2.261  2.839   2.568   1.00 0.98  ? 14  ILE A HG13 1 
ATOM 179  H HG21 . ILE A 1 14  ? 0.952   1.459   3.665   1.00 1.01  ? 14  ILE A HG21 1 
ATOM 180  H HG22 . ILE A 1 14  ? 0.792   0.760   2.053   1.00 1.10  ? 14  ILE A HG22 1 
ATOM 181  H HG23 . ILE A 1 14  ? 0.519   -0.241  3.479   1.00 1.23  ? 14  ILE A HG23 1 
ATOM 182  H HD11 . ILE A 1 14  ? -0.828  2.790   4.930   1.00 1.46  ? 14  ILE A HD11 1 
ATOM 183  H HD12 . ILE A 1 14  ? -1.706  4.161   4.253   1.00 1.17  ? 14  ILE A HD12 1 
ATOM 184  H HD13 . ILE A 1 14  ? 0.017   3.970   3.929   1.00 1.44  ? 14  ILE A HD13 1 
ATOM 185  N N    . VAL A 1 15  ? -1.290  -1.936  2.547   1.00 0.33  ? 15  VAL A N    1 
ATOM 186  C CA   . VAL A 1 15  ? -0.653  -3.240  2.407   1.00 0.31  ? 15  VAL A CA   1 
ATOM 187  C C    . VAL A 1 15  ? -1.250  -4.019  1.240   1.00 0.30  ? 15  VAL A C    1 
ATOM 188  O O    . VAL A 1 15  ? -0.526  -4.617  0.445   1.00 0.29  ? 15  VAL A O    1 
ATOM 189  C CB   . VAL A 1 15  ? -0.792  -4.074  3.695   1.00 0.32  ? 15  VAL A CB   1 
ATOM 190  C CG1  . VAL A 1 15  ? -1.068  -5.533  3.366   1.00 0.32  ? 15  VAL A CG1  1 
ATOM 191  C CG2  . VAL A 1 15  ? 0.456   -3.942  4.554   1.00 0.34  ? 15  VAL A CG2  1 
ATOM 192  H H    . VAL A 1 15  ? -1.892  -1.777  3.304   1.00 0.35  ? 15  VAL A H    1 
ATOM 193  H HA   . VAL A 1 15  ? 0.399   -3.079  2.219   1.00 0.30  ? 15  VAL A HA   1 
ATOM 194  H HB   . VAL A 1 15  ? -1.631  -3.691  4.258   1.00 0.36  ? 15  VAL A HB   1 
ATOM 195  H HG11 . VAL A 1 15  ? -0.350  -5.880  2.637   1.00 0.97  ? 15  VAL A HG11 1 
ATOM 196  H HG12 . VAL A 1 15  ? -2.066  -5.629  2.963   1.00 1.10  ? 15  VAL A HG12 1 
ATOM 197  H HG13 . VAL A 1 15  ? -0.985  -6.126  4.264   1.00 1.05  ? 15  VAL A HG13 1 
ATOM 198  H HG21 . VAL A 1 15  ? 1.025   -4.858  4.504   1.00 1.03  ? 15  VAL A HG21 1 
ATOM 199  H HG22 . VAL A 1 15  ? 0.170   -3.750  5.578   1.00 1.06  ? 15  VAL A HG22 1 
ATOM 200  H HG23 . VAL A 1 15  ? 1.059   -3.123  4.189   1.00 1.11  ? 15  VAL A HG23 1 
ATOM 201  N N    . MET A 1 16  ? -2.575  -4.007  1.143   1.00 0.32  ? 16  MET A N    1 
ATOM 202  C CA   . MET A 1 16  ? -3.269  -4.712  0.072   1.00 0.33  ? 16  MET A CA   1 
ATOM 203  C C    . MET A 1 16  ? -2.939  -4.099  -1.285  1.00 0.34  ? 16  MET A C    1 
ATOM 204  O O    . MET A 1 16  ? -2.767  -4.811  -2.274  1.00 0.36  ? 16  MET A O    1 
ATOM 205  C CB   . MET A 1 16  ? -4.780  -4.682  0.306   1.00 0.35  ? 16  MET A CB   1 
ATOM 206  C CG   . MET A 1 16  ? -5.331  -5.976  0.883   1.00 0.57  ? 16  MET A CG   1 
ATOM 207  S SD   . MET A 1 16  ? -6.527  -5.695  2.202   1.00 0.85  ? 16  MET A SD   1 
ATOM 208  C CE   . MET A 1 16  ? -6.578  -7.315  2.963   1.00 0.57  ? 16  MET A CE   1 
ATOM 209  H H    . MET A 1 16  ? -3.099  -3.512  1.807   1.00 0.35  ? 16  MET A H    1 
ATOM 210  H HA   . MET A 1 16  ? -2.933  -5.739  0.080   1.00 0.34  ? 16  MET A HA   1 
ATOM 211  H HB2  . MET A 1 16  ? -5.011  -3.880  0.992   1.00 0.40  ? 16  MET A HB2  1 
ATOM 212  H HB3  . MET A 1 16  ? -5.275  -4.493  -0.634  1.00 0.43  ? 16  MET A HB3  1 
ATOM 213  H HG2  . MET A 1 16  ? -5.813  -6.530  0.092   1.00 1.31  ? 16  MET A HG2  1 
ATOM 214  H HG3  . MET A 1 16  ? -4.510  -6.556  1.278   1.00 1.23  ? 16  MET A HG3  1 
ATOM 215  H HE1  . MET A 1 16  ? -6.169  -8.046  2.281   1.00 1.16  ? 16  MET A HE1  1 
ATOM 216  H HE2  . MET A 1 16  ? -7.601  -7.572  3.195   1.00 1.13  ? 16  MET A HE2  1 
ATOM 217  H HE3  . MET A 1 16  ? -5.995  -7.305  3.872   1.00 1.03  ? 16  MET A HE3  1 
ATOM 218  N N    . LYS A 1 17  ? -2.850  -2.773  -1.323  1.00 0.34  ? 17  LYS A N    1 
ATOM 219  C CA   . LYS A 1 17  ? -2.538  -2.063  -2.558  1.00 0.36  ? 17  LYS A CA   1 
ATOM 220  C C    . LYS A 1 17  ? -1.173  -2.481  -3.094  1.00 0.33  ? 17  LYS A C    1 
ATOM 221  O O    . LYS A 1 17  ? -1.026  -2.786  -4.278  1.00 0.34  ? 17  LYS A O    1 
ATOM 222  C CB   . LYS A 1 17  ? -2.566  -0.552  -2.323  1.00 0.40  ? 17  LYS A CB   1 
ATOM 223  C CG   . LYS A 1 17  ? -3.950  0.059   -2.464  1.00 1.11  ? 17  LYS A CG   1 
ATOM 224  C CD   . LYS A 1 17  ? -3.946  1.536   -2.106  1.00 1.07  ? 17  LYS A CD   1 
ATOM 225  C CE   . LYS A 1 17  ? -3.208  2.359   -3.149  1.00 1.25  ? 17  LYS A CE   1 
ATOM 226  N NZ   . LYS A 1 17  ? -4.138  2.956   -4.146  1.00 2.06  ? 17  LYS A NZ   1 
ATOM 227  H H    . LYS A 1 17  ? -2.996  -2.260  -0.501  1.00 0.34  ? 17  LYS A H    1 
ATOM 228  H HA   . LYS A 1 17  ? -3.292  -2.318  -3.287  1.00 0.38  ? 17  LYS A HA   1 
ATOM 229  H HB2  . LYS A 1 17  ? -2.204  -0.348  -1.327  1.00 0.89  ? 17  LYS A HB2  1 
ATOM 230  H HB3  . LYS A 1 17  ? -1.911  -0.077  -3.039  1.00 0.76  ? 17  LYS A HB3  1 
ATOM 231  H HG2  . LYS A 1 17  ? -4.280  -0.052  -3.487  1.00 1.84  ? 17  LYS A HG2  1 
ATOM 232  H HG3  . LYS A 1 17  ? -4.631  -0.460  -1.806  1.00 1.83  ? 17  LYS A HG3  1 
ATOM 233  H HD2  . LYS A 1 17  ? -4.966  1.885   -2.044  1.00 1.60  ? 17  LYS A HD2  1 
ATOM 234  H HD3  . LYS A 1 17  ? -3.461  1.664   -1.150  1.00 1.69  ? 17  LYS A HD3  1 
ATOM 235  H HE2  . LYS A 1 17  ? -2.672  3.153   -2.650  1.00 1.57  ? 17  LYS A HE2  1 
ATOM 236  H HE3  . LYS A 1 17  ? -2.506  1.719   -3.662  1.00 1.48  ? 17  LYS A HE3  1 
ATOM 237  H HZ1  . LYS A 1 17  ? -4.518  3.856   -3.788  1.00 2.48  ? 17  LYS A HZ1  1 
ATOM 238  H HZ2  . LYS A 1 17  ? -4.930  2.308   -4.330  1.00 2.37  ? 17  LYS A HZ2  1 
ATOM 239  H HZ3  . LYS A 1 17  ? -3.638  3.135   -5.040  1.00 2.55  ? 17  LYS A HZ3  1 
ATOM 240  N N    . TYR A 1 18  ? -0.177  -2.493  -2.215  1.00 0.32  ? 18  TYR A N    1 
ATOM 241  C CA   . TYR A 1 18  ? 1.178   -2.873  -2.599  1.00 0.33  ? 18  TYR A CA   1 
ATOM 242  C C    . TYR A 1 18  ? 1.192   -4.250  -3.255  1.00 0.30  ? 18  TYR A C    1 
ATOM 243  O O    . TYR A 1 18  ? 1.717   -4.419  -4.355  1.00 0.34  ? 18  TYR A O    1 
ATOM 244  C CB   . TYR A 1 18  ? 2.097   -2.868  -1.377  1.00 0.36  ? 18  TYR A CB   1 
ATOM 245  C CG   . TYR A 1 18  ? 3.544   -3.155  -1.707  1.00 0.38  ? 18  TYR A CG   1 
ATOM 246  C CD1  . TYR A 1 18  ? 4.412   -2.130  -2.062  1.00 0.82  ? 18  TYR A CD1  1 
ATOM 247  C CD2  . TYR A 1 18  ? 4.043   -4.451  -1.663  1.00 0.68  ? 18  TYR A CD2  1 
ATOM 248  C CE1  . TYR A 1 18  ? 5.735   -2.389  -2.365  1.00 0.88  ? 18  TYR A CE1  1 
ATOM 249  C CE2  . TYR A 1 18  ? 5.365   -4.718  -1.964  1.00 0.73  ? 18  TYR A CE2  1 
ATOM 250  C CZ   . TYR A 1 18  ? 6.207   -3.683  -2.314  1.00 0.57  ? 18  TYR A CZ   1 
ATOM 251  O OH   . TYR A 1 18  ? 7.524   -3.944  -2.615  1.00 0.70  ? 18  TYR A OH   1 
ATOM 252  H H    . TYR A 1 18  ? -0.356  -2.239  -1.286  1.00 0.33  ? 18  TYR A H    1 
ATOM 253  H HA   . TYR A 1 18  ? 1.537   -2.145  -3.311  1.00 0.35  ? 18  TYR A HA   1 
ATOM 254  H HB2  . TYR A 1 18  ? 2.051   -1.899  -0.904  1.00 0.39  ? 18  TYR A HB2  1 
ATOM 255  H HB3  . TYR A 1 18  ? 1.759   -3.620  -0.679  1.00 0.44  ? 18  TYR A HB3  1 
ATOM 256  H HD1  . TYR A 1 18  ? 4.040   -1.117  -2.100  1.00 1.26  ? 18  TYR A HD1  1 
ATOM 257  H HD2  . TYR A 1 18  ? 3.381   -5.260  -1.389  1.00 1.11  ? 18  TYR A HD2  1 
ATOM 258  H HE1  . TYR A 1 18  ? 6.395   -1.578  -2.638  1.00 1.35  ? 18  TYR A HE1  1 
ATOM 259  H HE2  . TYR A 1 18  ? 5.733   -5.733  -1.924  1.00 1.16  ? 18  TYR A HE2  1 
ATOM 260  H HH   . TYR A 1 18  ? 7.815   -3.355  -3.315  1.00 1.11  ? 18  TYR A HH   1 
ATOM 261  N N    . ILE A 1 19  ? 0.612   -5.232  -2.572  1.00 0.31  ? 19  ILE A N    1 
ATOM 262  C CA   . ILE A 1 19  ? 0.559   -6.594  -3.090  1.00 0.32  ? 19  ILE A CA   1 
ATOM 263  C C    . ILE A 1 19  ? -0.252  -6.660  -4.379  1.00 0.34  ? 19  ILE A C    1 
ATOM 264  O O    . ILE A 1 19  ? 0.099   -7.388  -5.308  1.00 0.39  ? 19  ILE A O    1 
ATOM 265  C CB   . ILE A 1 19  ? -0.050  -7.564  -2.060  1.00 0.34  ? 19  ILE A CB   1 
ATOM 266  C CG1  . ILE A 1 19  ? 1.008   -7.982  -1.037  1.00 0.41  ? 19  ILE A CG1  1 
ATOM 267  C CG2  . ILE A 1 19  ? -0.631  -8.784  -2.759  1.00 0.37  ? 19  ILE A CG2  1 
ATOM 268  C CD1  . ILE A 1 19  ? 0.493   -8.949  0.007   1.00 0.70  ? 19  ILE A CD1  1 
ATOM 269  H H    . ILE A 1 19  ? 0.210   -5.036  -1.700  1.00 0.36  ? 19  ILE A H    1 
ATOM 270  H HA   . ILE A 1 19  ? 1.571   -6.910  -3.297  1.00 0.34  ? 19  ILE A HA   1 
ATOM 271  H HB   . ILE A 1 19  ? -0.853  -7.055  -1.549  1.00 0.44  ? 19  ILE A HB   1 
ATOM 272  H HG12 . ILE A 1 19  ? 1.829   -8.458  -1.552  1.00 0.90  ? 19  ILE A HG12 1 
ATOM 273  H HG13 . ILE A 1 19  ? 1.372   -7.103  -0.525  1.00 0.89  ? 19  ILE A HG13 1 
ATOM 274  H HG21 . ILE A 1 19  ? -0.840  -9.552  -2.029  1.00 1.09  ? 19  ILE A HG21 1 
ATOM 275  H HG22 . ILE A 1 19  ? 0.079   -9.158  -3.482  1.00 1.00  ? 19  ILE A HG22 1 
ATOM 276  H HG23 . ILE A 1 19  ? -1.546  -8.508  -3.263  1.00 1.15  ? 19  ILE A HG23 1 
ATOM 277  H HD11 . ILE A 1 19  ? -0.493  -8.644  0.324   1.00 1.27  ? 19  ILE A HD11 1 
ATOM 278  H HD12 . ILE A 1 19  ? 1.160   -8.950  0.856   1.00 1.46  ? 19  ILE A HD12 1 
ATOM 279  H HD13 . ILE A 1 19  ? 0.445   -9.942  -0.415  1.00 0.96  ? 19  ILE A HD13 1 
ATOM 280  N N    . HIS A 1 20  ? -1.339  -5.897  -4.430  1.00 0.36  ? 20  HIS A N    1 
ATOM 281  C CA   . HIS A 1 20  ? -2.200  -5.869  -5.607  1.00 0.41  ? 20  HIS A CA   1 
ATOM 282  C C    . HIS A 1 20  ? -1.406  -5.481  -6.850  1.00 0.43  ? 20  HIS A C    1 
ATOM 283  O O    . HIS A 1 20  ? -1.639  -6.010  -7.938  1.00 0.50  ? 20  HIS A O    1 
ATOM 284  C CB   . HIS A 1 20  ? -3.355  -4.888  -5.397  1.00 0.47  ? 20  HIS A CB   1 
ATOM 285  C CG   . HIS A 1 20  ? -4.578  -5.224  -6.193  1.00 0.75  ? 20  HIS A CG   1 
ATOM 286  N ND1  . HIS A 1 20  ? -5.331  -4.275  -6.852  1.00 1.41  ? 20  HIS A ND1  1 
ATOM 287  C CD2  . HIS A 1 20  ? -5.179  -6.413  -6.436  1.00 0.91  ? 20  HIS A CD2  1 
ATOM 288  C CE1  . HIS A 1 20  ? -6.343  -4.865  -7.463  1.00 1.81  ? 20  HIS A CE1  1 
ATOM 289  N NE2  . HIS A 1 20  ? -6.273  -6.162  -7.227  1.00 1.47  ? 20  HIS A NE2  1 
ATOM 290  H H    . HIS A 1 20  ? -1.567  -5.338  -3.658  1.00 0.39  ? 20  HIS A H    1 
ATOM 291  H HA   . HIS A 1 20  ? -2.602  -6.861  -5.747  1.00 0.41  ? 20  HIS A HA   1 
ATOM 292  H HB2  . HIS A 1 20  ? -3.629  -4.884  -4.353  1.00 0.67  ? 20  HIS A HB2  1 
ATOM 293  H HB3  . HIS A 1 20  ? -3.032  -3.897  -5.683  1.00 0.76  ? 20  HIS A HB3  1 
ATOM 294  H HD1  . HIS A 1 20  ? -5.152  -3.312  -6.867  1.00 1.64  ? 20  HIS A HD1  1 
ATOM 295  H HD2  . HIS A 1 20  ? -4.857  -7.380  -6.074  1.00 0.95  ? 20  HIS A HD2  1 
ATOM 296  H HE1  . HIS A 1 20  ? -7.098  -4.371  -8.057  1.00 2.40  ? 20  HIS A HE1  1 
ATOM 297  N N    . TYR A 1 21  ? -0.467  -4.555  -6.682  1.00 0.43  ? 21  TYR A N    1 
ATOM 298  C CA   . TYR A 1 21  ? 0.362   -4.098  -7.790  1.00 0.47  ? 21  TYR A CA   1 
ATOM 299  C C    . TYR A 1 21  ? 1.477   -5.097  -8.081  1.00 0.51  ? 21  TYR A C    1 
ATOM 300  O O    . TYR A 1 21  ? 1.615   -5.578  -9.206  1.00 0.62  ? 21  TYR A O    1 
ATOM 301  C CB   . TYR A 1 21  ? 0.961   -2.726  -7.475  1.00 0.45  ? 21  TYR A CB   1 
ATOM 302  C CG   . TYR A 1 21  ? 2.338   -2.516  -8.064  1.00 0.46  ? 21  TYR A CG   1 
ATOM 303  C CD1  . TYR A 1 21  ? 2.558   -2.647  -9.429  1.00 1.19  ? 21  TYR A CD1  1 
ATOM 304  C CD2  . TYR A 1 21  ? 3.418   -2.187  -7.253  1.00 1.12  ? 21  TYR A CD2  1 
ATOM 305  C CE1  . TYR A 1 21  ? 3.816   -2.456  -9.970  1.00 1.23  ? 21  TYR A CE1  1 
ATOM 306  C CE2  . TYR A 1 21  ? 4.678   -1.994  -7.787  1.00 1.13  ? 21  TYR A CE2  1 
ATOM 307  C CZ   . TYR A 1 21  ? 4.871   -2.130  -9.146  1.00 0.56  ? 21  TYR A CZ   1 
ATOM 308  O OH   . TYR A 1 21  ? 6.124   -1.939  -9.681  1.00 0.64  ? 21  TYR A OH   1 
ATOM 309  H H    . TYR A 1 21  ? -0.328  -4.172  -5.791  1.00 0.42  ? 21  TYR A H    1 
ATOM 310  H HA   . TYR A 1 21  ? -0.268  -4.014  -8.663  1.00 0.56  ? 21  TYR A HA   1 
ATOM 311  H HB2  . TYR A 1 21  ? 0.312   -1.958  -7.870  1.00 0.55  ? 21  TYR A HB2  1 
ATOM 312  H HB3  . TYR A 1 21  ? 1.036   -2.611  -6.404  1.00 0.43  ? 21  TYR A HB3  1 
ATOM 313  H HD1  . TYR A 1 21  ? 1.729   -2.901  -10.073 1.00 1.97  ? 21  TYR A HD1  1 
ATOM 314  H HD2  . TYR A 1 21  ? 3.263   -2.082  -6.190  1.00 1.91  ? 21  TYR A HD2  1 
ATOM 315  H HE1  . TYR A 1 21  ? 3.967   -2.562  -11.035 1.00 2.03  ? 21  TYR A HE1  1 
ATOM 316  H HE2  . TYR A 1 21  ? 5.504   -1.740  -7.141  1.00 1.91  ? 21  TYR A HE2  1 
ATOM 317  H HH   . TYR A 1 21  ? 6.179   -2.376  -10.534 1.00 1.27  ? 21  TYR A HH   1 
ATOM 318  N N    . LYS A 1 22  ? 2.269   -5.406  -7.060  1.00 0.49  ? 22  LYS A N    1 
ATOM 319  C CA   . LYS A 1 22  ? 3.371   -6.349  -7.206  1.00 0.63  ? 22  LYS A CA   1 
ATOM 320  C C    . LYS A 1 22  ? 2.890   -7.654  -7.831  1.00 0.72  ? 22  LYS A C    1 
ATOM 321  O O    . LYS A 1 22  ? 3.636   -8.325  -8.544  1.00 0.83  ? 22  LYS A O    1 
ATOM 322  C CB   . LYS A 1 22  ? 4.014   -6.627  -5.846  1.00 0.66  ? 22  LYS A CB   1 
ATOM 323  C CG   . LYS A 1 22  ? 5.038   -7.750  -5.876  1.00 1.10  ? 22  LYS A CG   1 
ATOM 324  C CD   . LYS A 1 22  ? 6.071   -7.534  -6.970  1.00 1.30  ? 22  LYS A CD   1 
ATOM 325  C CE   . LYS A 1 22  ? 6.962   -6.340  -6.669  1.00 1.29  ? 22  LYS A CE   1 
ATOM 326  N NZ   . LYS A 1 22  ? 8.064   -6.691  -5.732  1.00 1.94  ? 22  LYS A NZ   1 
ATOM 327  H H    . LYS A 1 22  ? 2.109   -4.991  -6.187  1.00 0.44  ? 22  LYS A H    1 
ATOM 328  H HA   . LYS A 1 22  ? 4.106   -5.901  -7.857  1.00 0.70  ? 22  LYS A HA   1 
ATOM 329  H HB2  . LYS A 1 22  ? 4.506   -5.729  -5.503  1.00 0.94  ? 22  LYS A HB2  1 
ATOM 330  H HB3  . LYS A 1 22  ? 3.240   -6.894  -5.143  1.00 0.97  ? 22  LYS A HB3  1 
ATOM 331  H HG2  . LYS A 1 22  ? 5.542   -7.789  -4.922  1.00 1.80  ? 22  LYS A HG2  1 
ATOM 332  H HG3  . LYS A 1 22  ? 4.527   -8.684  -6.054  1.00 1.73  ? 22  LYS A HG3  1 
ATOM 333  H HD2  . LYS A 1 22  ? 6.687   -8.418  -7.049  1.00 1.88  ? 22  LYS A HD2  1 
ATOM 334  H HD3  . LYS A 1 22  ? 5.560   -7.364  -7.906  1.00 1.93  ? 22  LYS A HD3  1 
ATOM 335  H HE2  . LYS A 1 22  ? 7.388   -5.982  -7.594  1.00 1.68  ? 22  LYS A HE2  1 
ATOM 336  H HE3  . LYS A 1 22  ? 6.359   -5.560  -6.227  1.00 1.62  ? 22  LYS A HE3  1 
ATOM 337  H HZ1  . LYS A 1 22  ? 8.804   -5.961  -5.761  1.00 2.24  ? 22  LYS A HZ1  1 
ATOM 338  H HZ2  . LYS A 1 22  ? 8.483   -7.604  -5.999  1.00 2.38  ? 22  LYS A HZ2  1 
ATOM 339  H HZ3  . LYS A 1 22  ? 7.699   -6.760  -4.760  1.00 2.46  ? 22  LYS A HZ3  1 
ATOM 340  N N    . LEU A 1 23  ? 1.637   -8.007  -7.562  1.00 0.69  ? 23  LEU A N    1 
ATOM 341  C CA   . LEU A 1 23  ? 1.058   -9.231  -8.103  1.00 0.81  ? 23  LEU A CA   1 
ATOM 342  C C    . LEU A 1 23  ? 0.524   -8.999  -9.512  1.00 0.83  ? 23  LEU A C    1 
ATOM 343  O O    . LEU A 1 23  ? 0.688   -9.840  -10.395 1.00 0.89  ? 23  LEU A O    1 
ATOM 344  C CB   . LEU A 1 23  ? -0.064  -9.738  -7.197  1.00 0.86  ? 23  LEU A CB   1 
ATOM 345  C CG   . LEU A 1 23  ? -1.016  -10.739 -7.850  1.00 0.74  ? 23  LEU A CG   1 
ATOM 346  C CD1  . LEU A 1 23  ? -0.243  -11.927 -8.400  1.00 1.23  ? 23  LEU A CD1  1 
ATOM 347  C CD2  . LEU A 1 23  ? -2.068  -11.200 -6.853  1.00 1.00  ? 23  LEU A CD2  1 
ATOM 348  H H    . LEU A 1 23  ? 1.089   -7.431  -6.989  1.00 0.62  ? 23  LEU A H    1 
ATOM 349  H HA   . LEU A 1 23  ? 1.838   -9.976  -8.145  1.00 0.90  ? 23  LEU A HA   1 
ATOM 350  H HB2  . LEU A 1 23  ? 0.383   -10.210 -6.335  1.00 1.16  ? 23  LEU A HB2  1 
ATOM 351  H HB3  . LEU A 1 23  ? -0.643  -8.890  -6.864  1.00 1.01  ? 23  LEU A HB3  1 
ATOM 352  H HG   . LEU A 1 23  ? -1.523  -10.259 -8.675  1.00 0.78  ? 23  LEU A HG   1 
ATOM 353  H HD11 . LEU A 1 23  ? 0.750   -11.616 -8.683  1.00 1.62  ? 23  LEU A HD11 1 
ATOM 354  H HD12 . LEU A 1 23  ? -0.756  -12.318 -9.265  1.00 1.62  ? 23  LEU A HD12 1 
ATOM 355  H HD13 . LEU A 1 23  ? -0.177  -12.695 -7.644  1.00 1.85  ? 23  LEU A HD13 1 
ATOM 356  H HD21 . LEU A 1 23  ? -1.588  -11.473 -5.924  1.00 1.51  ? 23  LEU A HD21 1 
ATOM 357  H HD22 . LEU A 1 23  ? -2.592  -12.056 -7.252  1.00 1.54  ? 23  LEU A HD22 1 
ATOM 358  H HD23 . LEU A 1 23  ? -2.770  -10.399 -6.674  1.00 1.31  ? 23  LEU A HD23 1 
ATOM 359  N N    . SER A 1 24  ? -0.112  -7.849  -9.716  1.00 0.81  ? 24  SER A N    1 
ATOM 360  C CA   . SER A 1 24  ? -0.666  -7.501  -11.021 1.00 0.85  ? 24  SER A CA   1 
ATOM 361  C C    . SER A 1 24  ? 0.363   -7.711  -12.130 1.00 0.88  ? 24  SER A C    1 
ATOM 362  O O    . SER A 1 24  ? 0.006   -7.968  -13.279 1.00 0.93  ? 24  SER A O    1 
ATOM 363  C CB   . SER A 1 24  ? -1.146  -6.048  -11.022 1.00 0.85  ? 24  SER A CB   1 
ATOM 364  O OG   . SER A 1 24  ? -1.821  -5.735  -12.228 1.00 1.30  ? 24  SER A OG   1 
ATOM 365  H H    . SER A 1 24  ? -0.209  -7.219  -8.972  1.00 0.77  ? 24  SER A H    1 
ATOM 366  H HA   . SER A 1 24  ? -1.511  -8.148  -11.204 1.00 0.88  ? 24  SER A HA   1 
ATOM 367  H HB2  . SER A 1 24  ? -1.822  -5.894  -10.195 1.00 1.08  ? 24  SER A HB2  1 
ATOM 368  H HB3  . SER A 1 24  ? -0.295  -5.391  -10.918 1.00 1.11  ? 24  SER A HB3  1 
ATOM 369  H HG   . SER A 1 24  ? -2.220  -4.864  -12.154 1.00 1.50  ? 24  SER A HG   1 
ATOM 370  N N    . GLN A 1 25  ? 1.643   -7.608  -11.777 1.00 0.88  ? 25  GLN A N    1 
ATOM 371  C CA   . GLN A 1 25  ? 2.717   -7.795  -12.743 1.00 0.93  ? 25  GLN A CA   1 
ATOM 372  C C    . GLN A 1 25  ? 2.523   -9.093  -13.523 1.00 0.91  ? 25  GLN A C    1 
ATOM 373  O O    . GLN A 1 25  ? 2.932   -9.200  -14.679 1.00 0.95  ? 25  GLN A O    1 
ATOM 374  C CB   . GLN A 1 25  ? 4.073   -7.808  -12.035 1.00 1.00  ? 25  GLN A CB   1 
ATOM 375  C CG   . GLN A 1 25  ? 4.849   -6.511  -12.185 1.00 1.24  ? 25  GLN A CG   1 
ATOM 376  C CD   . GLN A 1 25  ? 5.992   -6.626  -13.175 1.00 2.05  ? 25  GLN A CD   1 
ATOM 377  O OE1  . GLN A 1 25  ? 6.606   -7.684  -13.312 1.00 2.76  ? 25  GLN A OE1  1 
ATOM 378  N NE2  . GLN A 1 25  ? 6.284   -5.534  -13.871 1.00 2.65  ? 25  GLN A NE2  1 
ATOM 379  H H    . GLN A 1 25  ? 1.864   -7.409  -10.845 1.00 0.85  ? 25  GLN A H    1 
ATOM 380  H HA   . GLN A 1 25  ? 2.689   -6.966  -13.435 1.00 0.97  ? 25  GLN A HA   1 
ATOM 381  H HB2  . GLN A 1 25  ? 3.914   -7.988  -10.982 1.00 1.11  ? 25  GLN A HB2  1 
ATOM 382  H HB3  . GLN A 1 25  ? 4.671   -8.610  -12.443 1.00 1.04  ? 25  GLN A HB3  1 
ATOM 383  H HG2  . GLN A 1 25  ? 4.175   -5.740  -12.526 1.00 1.49  ? 25  GLN A HG2  1 
ATOM 384  H HG3  . GLN A 1 25  ? 5.253   -6.234  -11.222 1.00 1.55  ? 25  GLN A HG3  1 
ATOM 385  H HE21 . GLN A 1 25  ? 5.753   -4.726  -13.710 1.00 2.76  ? 25  GLN A HE21 1 
ATOM 386  H HE22 . GLN A 1 25  ? 7.019   -5.580  -14.518 1.00 3.30  ? 25  GLN A HE22 1 
ATOM 387  N N    . ARG A 1 26  ? 1.896   -10.079 -12.884 1.00 0.89  ? 26  ARG A N    1 
ATOM 388  C CA   . ARG A 1 26  ? 1.648   -11.369 -13.520 1.00 0.92  ? 26  ARG A CA   1 
ATOM 389  C C    . ARG A 1 26  ? 0.273   -11.399 -14.181 1.00 0.86  ? 26  ARG A C    1 
ATOM 390  O O    . ARG A 1 26  ? 0.094   -12.008 -15.236 1.00 1.06  ? 26  ARG A O    1 
ATOM 391  C CB   . ARG A 1 26  ? 1.751   -12.497 -12.491 1.00 1.01  ? 26  ARG A CB   1 
ATOM 392  C CG   . ARG A 1 26  ? 3.170   -12.765 -12.020 1.00 1.26  ? 26  ARG A CG   1 
ATOM 393  C CD   . ARG A 1 26  ? 3.203   -13.147 -10.549 1.00 1.31  ? 26  ARG A CD   1 
ATOM 394  N NE   . ARG A 1 26  ? 4.298   -14.066 -10.247 1.00 1.98  ? 26  ARG A NE   1 
ATOM 395  C CZ   . ARG A 1 26  ? 5.586   -13.729 -10.294 1.00 2.73  ? 26  ARG A CZ   1 
ATOM 396  N NH1  . ARG A 1 26  ? 5.950   -12.496 -10.625 1.00 3.19  ? 26  ARG A NH1  1 
ATOM 397  N NH2  . ARG A 1 26  ? 6.516   -14.631 -10.006 1.00 3.49  ? 26  ARG A NH2  1 
ATOM 398  H H    . ARG A 1 26  ? 1.591   -9.939  -11.964 1.00 0.90  ? 26  ARG A H    1 
ATOM 399  H HA   . ARG A 1 26  ? 2.403   -11.516 -14.278 1.00 0.98  ? 26  ARG A HA   1 
ATOM 400  H HB2  . ARG A 1 26  ? 1.153   -12.238 -11.630 1.00 1.70  ? 26  ARG A HB2  1 
ATOM 401  H HB3  . ARG A 1 26  ? 1.363   -13.404 -12.929 1.00 1.44  ? 26  ARG A HB3  1 
ATOM 402  H HG2  . ARG A 1 26  ? 3.585   -13.575 -12.601 1.00 1.87  ? 26  ARG A HG2  1 
ATOM 403  H HG3  . ARG A 1 26  ? 3.763   -11.874 -12.166 1.00 1.94  ? 26  ARG A HG3  1 
ATOM 404  H HD2  . ARG A 1 26  ? 3.325   -12.250 -9.961  1.00 1.39  ? 26  ARG A HD2  1 
ATOM 405  H HD3  . ARG A 1 26  ? 2.266   -13.621 -10.292 1.00 1.63  ? 26  ARG A HD3  1 
ATOM 406  H HE   . ARG A 1 26  ? 4.062   -14.983 -9.996  1.00 2.34  ? 26  ARG A HE   1 
ATOM 407  H HH11 . ARG A 1 26  ? 5.258   -11.808 -10.843 1.00 2.97  ? 26  ARG A HH11 1 
ATOM 408  H HH12 . ARG A 1 26  ? 6.920   -12.254 -10.658 1.00 4.01  ? 26  ARG A HH12 1 
ATOM 409  H HH21 . ARG A 1 26  ? 6.249   -15.561 -9.754  1.00 3.62  ? 26  ARG A HH21 1 
ATOM 410  H HH22 . ARG A 1 26  ? 7.483   -14.380 -10.041 1.00 4.15  ? 26  ARG A HH22 1 
ATOM 411  N N    . GLY A 1 27  ? -0.695  -10.738 -13.553 1.00 0.95  ? 27  GLY A N    1 
ATOM 412  C CA   . GLY A 1 27  ? -2.041  -10.703 -14.096 1.00 1.00  ? 27  GLY A CA   1 
ATOM 413  C C    . GLY A 1 27  ? -3.036  -11.486 -13.257 1.00 1.03  ? 27  GLY A C    1 
ATOM 414  O O    . GLY A 1 27  ? -4.235  -11.209 -13.292 1.00 1.86  ? 27  GLY A O    1 
ATOM 415  H H    . GLY A 1 27  ? -0.492  -10.270 -12.717 1.00 1.19  ? 27  GLY A H    1 
ATOM 416  H HA2  . GLY A 1 27  ? -2.367  -9.675  -14.152 1.00 1.03  ? 27  GLY A HA2  1 
ATOM 417  H HA3  . GLY A 1 27  ? -2.025  -11.118 -15.094 1.00 1.06  ? 27  GLY A HA3  1 
ATOM 418  N N    . TYR A 1 28  ? -2.539  -12.466 -12.505 1.00 0.78  ? 28  TYR A N    1 
ATOM 419  C CA   . TYR A 1 28  ? -3.395  -13.291 -11.657 1.00 0.70  ? 28  TYR A CA   1 
ATOM 420  C C    . TYR A 1 28  ? -4.357  -12.426 -10.846 1.00 0.61  ? 28  TYR A C    1 
ATOM 421  O O    . TYR A 1 28  ? -3.958  -11.768 -9.885  1.00 0.98  ? 28  TYR A O    1 
ATOM 422  C CB   . TYR A 1 28  ? -2.539  -14.151 -10.723 1.00 0.86  ? 28  TYR A CB   1 
ATOM 423  C CG   . TYR A 1 28  ? -3.230  -14.539 -9.433  1.00 0.67  ? 28  TYR A CG   1 
ATOM 424  C CD1  . TYR A 1 28  ? -4.524  -15.048 -9.434  1.00 1.17  ? 28  TYR A CD1  1 
ATOM 425  C CD2  . TYR A 1 28  ? -2.584  -14.397 -8.213  1.00 1.13  ? 28  TYR A CD2  1 
ATOM 426  C CE1  . TYR A 1 28  ? -5.152  -15.401 -8.255  1.00 1.16  ? 28  TYR A CE1  1 
ATOM 427  C CE2  . TYR A 1 28  ? -3.203  -14.748 -7.030  1.00 1.16  ? 28  TYR A CE2  1 
ATOM 428  C CZ   . TYR A 1 28  ? -4.487  -15.249 -7.056  1.00 0.68  ? 28  TYR A CZ   1 
ATOM 429  O OH   . TYR A 1 28  ? -5.109  -15.600 -5.879  1.00 0.86  ? 28  TYR A OH   1 
ATOM 430  H H    . TYR A 1 28  ? -1.575  -12.640 -12.522 1.00 1.31  ? 28  TYR A H    1 
ATOM 431  H HA   . TYR A 1 28  ? -3.970  -13.939 -12.300 1.00 0.76  ? 28  TYR A HA   1 
ATOM 432  H HB2  . TYR A 1 28  ? -2.265  -15.061 -11.235 1.00 1.16  ? 28  TYR A HB2  1 
ATOM 433  H HB3  . TYR A 1 28  ? -1.643  -13.606 -10.467 1.00 1.01  ? 28  TYR A HB3  1 
ATOM 434  H HD1  . TYR A 1 28  ? -5.041  -15.166 -10.375 1.00 1.88  ? 28  TYR A HD1  1 
ATOM 435  H HD2  . TYR A 1 28  ? -1.579  -14.006 -8.195  1.00 1.81  ? 28  TYR A HD2  1 
ATOM 436  H HE1  . TYR A 1 28  ? -6.157  -15.795 -8.276  1.00 1.85  ? 28  TYR A HE1  1 
ATOM 437  H HE2  . TYR A 1 28  ? -2.681  -14.628 -6.093  1.00 1.87  ? 28  TYR A HE2  1 
ATOM 438  H HH   . TYR A 1 28  ? -6.051  -15.429 -5.951  1.00 1.26  ? 28  TYR A HH   1 
ATOM 439  N N    . GLU A 1 29  ? -5.627  -12.434 -11.242 1.00 0.79  ? 29  GLU A N    1 
ATOM 440  C CA   . GLU A 1 29  ? -6.650  -11.654 -10.554 1.00 0.76  ? 29  GLU A CA   1 
ATOM 441  C C    . GLU A 1 29  ? -6.851  -12.159 -9.129  1.00 0.72  ? 29  GLU A C    1 
ATOM 442  O O    . GLU A 1 29  ? -7.361  -13.258 -8.916  1.00 0.72  ? 29  GLU A O    1 
ATOM 443  C CB   . GLU A 1 29  ? -7.972  -11.718 -11.320 1.00 0.80  ? 29  GLU A CB   1 
ATOM 444  C CG   . GLU A 1 29  ? -7.857  -11.275 -12.769 1.00 1.32  ? 29  GLU A CG   1 
ATOM 445  C CD   . GLU A 1 29  ? -9.196  -10.892 -13.369 1.00 1.82  ? 29  GLU A CD   1 
ATOM 446  O OE1  . GLU A 1 29  ? -10.195 -10.860 -12.620 1.00 2.29  ? 29  GLU A OE1  1 
ATOM 447  O OE2  . GLU A 1 29  ? -9.245  -10.624 -14.588 1.00 2.45  ? 29  GLU A OE2  1 
ATOM 448  H H    . GLU A 1 29  ? -5.882  -12.979 -12.015 1.00 1.22  ? 29  GLU A H    1 
ATOM 449  H HA   . GLU A 1 29  ? -6.315  -10.628 -10.516 1.00 0.83  ? 29  GLU A HA   1 
ATOM 450  H HB2  . GLU A 1 29  ? -8.334  -12.736 -11.305 1.00 1.19  ? 29  GLU A HB2  1 
ATOM 451  H HB3  . GLU A 1 29  ? -8.692  -11.082 -10.827 1.00 1.18  ? 29  GLU A HB3  1 
ATOM 452  H HG2  . GLU A 1 29  ? -7.200  -10.420 -12.820 1.00 1.69  ? 29  GLU A HG2  1 
ATOM 453  H HG3  . GLU A 1 29  ? -7.438  -12.085 -13.348 1.00 1.87  ? 29  GLU A HG3  1 
ATOM 454  N N    . TRP A 1 30  ? -6.441  -11.351 -8.157  1.00 0.71  ? 30  TRP A N    1 
ATOM 455  C CA   . TRP A 1 30  ? -6.569  -11.716 -6.751  1.00 0.69  ? 30  TRP A CA   1 
ATOM 456  C C    . TRP A 1 30  ? -7.831  -11.115 -6.138  1.00 0.78  ? 30  TRP A C    1 
ATOM 457  O O    . TRP A 1 30  ? -8.753  -11.838 -5.759  1.00 1.17  ? 30  TRP A O    1 
ATOM 458  C CB   . TRP A 1 30  ? -5.336  -11.246 -5.978  1.00 0.66  ? 30  TRP A CB   1 
ATOM 459  C CG   . TRP A 1 30  ? -5.395  -11.551 -4.514  1.00 0.64  ? 30  TRP A CG   1 
ATOM 460  C CD1  . TRP A 1 30  ? -5.987  -12.631 -3.925  1.00 0.66  ? 30  TRP A CD1  1 
ATOM 461  C CD2  . TRP A 1 30  ? -4.840  -10.767 -3.452  1.00 0.64  ? 30  TRP A CD2  1 
ATOM 462  N NE1  . TRP A 1 30  ? -5.833  -12.566 -2.562  1.00 0.66  ? 30  TRP A NE1  1 
ATOM 463  C CE2  . TRP A 1 30  ? -5.133  -11.431 -2.246  1.00 0.64  ? 30  TRP A CE2  1 
ATOM 464  C CE3  . TRP A 1 30  ? -4.124  -9.568  -3.404  1.00 0.66  ? 30  TRP A CE3  1 
ATOM 465  C CZ2  . TRP A 1 30  ? -4.734  -10.936 -1.007  1.00 0.66  ? 30  TRP A CZ2  1 
ATOM 466  C CZ3  . TRP A 1 30  ? -3.728  -9.077  -2.174  1.00 0.69  ? 30  TRP A CZ3  1 
ATOM 467  C CH2  . TRP A 1 30  ? -4.034  -9.760  -0.990  1.00 0.69  ? 30  TRP A CH2  1 
ATOM 468  H H    . TRP A 1 30  ? -6.036  -10.489 -8.388  1.00 0.73  ? 30  TRP A H    1 
ATOM 469  H HA   . TRP A 1 30  ? -6.632  -12.792 -6.691  1.00 0.70  ? 30  TRP A HA   1 
ATOM 470  H HB2  . TRP A 1 30  ? -4.461  -11.731 -6.382  1.00 0.67  ? 30  TRP A HB2  1 
ATOM 471  H HB3  . TRP A 1 30  ? -5.234  -10.177 -6.093  1.00 0.69  ? 30  TRP A HB3  1 
ATOM 472  H HD1  . TRP A 1 30  ? -6.498  -13.414 -4.465  1.00 0.69  ? 30  TRP A HD1  1 
ATOM 473  H HE1  . TRP A 1 30  ? -6.170  -13.225 -1.920  1.00 0.68  ? 30  TRP A HE1  1 
ATOM 474  H HE3  . TRP A 1 30  ? -3.879  -9.027  -4.306  1.00 0.68  ? 30  TRP A HE3  1 
ATOM 475  H HZ2  . TRP A 1 30  ? -4.961  -11.450 -0.085  1.00 0.68  ? 30  TRP A HZ2  1 
ATOM 476  H HZ3  . TRP A 1 30  ? -3.174  -8.151  -2.117  1.00 0.74  ? 30  TRP A HZ3  1 
ATOM 477  H HH2  . TRP A 1 30  ? -3.705  -9.339  -0.051  1.00 0.72  ? 30  TRP A HH2  1 
ATOM 478  N N    . ASP A 1 31  ? -7.863  -9.791  -6.041  1.00 0.77  ? 31  ASP A N    1 
ATOM 479  C CA   . ASP A 1 31  ? -9.011  -9.092  -5.470  1.00 0.85  ? 31  ASP A CA   1 
ATOM 480  C C    . ASP A 1 31  ? -9.074  -9.277  -3.954  1.00 0.78  ? 31  ASP A C    1 
ATOM 481  O O    . ASP A 1 31  ? -10.145 -9.174  -3.355  1.00 0.80  ? 31  ASP A O    1 
ATOM 482  C CB   . ASP A 1 31  ? -10.307 -9.595  -6.110  1.00 0.94  ? 31  ASP A CB   1 
ATOM 483  C CG   . ASP A 1 31  ? -11.172 -8.463  -6.629  1.00 1.58  ? 31  ASP A CG   1 
ATOM 484  O OD1  . ASP A 1 31  ? -10.610 -7.423  -7.030  1.00 2.08  ? 31  ASP A OD1  1 
ATOM 485  O OD2  . ASP A 1 31  ? -12.411 -8.618  -6.634  1.00 2.38  ? 31  ASP A OD2  1 
ATOM 486  H H    . ASP A 1 31  ? -7.097  -9.270  -6.359  1.00 0.98  ? 31  ASP A H    1 
ATOM 487  H HA   . ASP A 1 31  ? -8.899  -8.041  -5.688  1.00 1.00  ? 31  ASP A HA   1 
ATOM 488  H HB2  . ASP A 1 31  ? -10.064 -10.246 -6.936  1.00 1.26  ? 31  ASP A HB2  1 
ATOM 489  H HB3  . ASP A 1 31  ? -10.872 -10.149 -5.375  1.00 1.23  ? 31  ASP A HB3  1 
ATOM 490  N N    . ALA A 1 32  ? -7.924  -9.552  -3.339  1.00 0.78  ? 32  ALA A N    1 
ATOM 491  C CA   . ALA A 1 32  ? -7.849  -9.751  -1.893  1.00 0.88  ? 32  ALA A CA   1 
ATOM 492  C C    . ALA A 1 32  ? -8.394  -11.121 -1.484  1.00 0.90  ? 32  ALA A C    1 
ATOM 493  O O    . ALA A 1 32  ? -7.684  -11.923 -0.878  1.00 1.28  ? 32  ALA A O    1 
ATOM 494  C CB   . ALA A 1 32  ? -8.601  -8.645  -1.166  1.00 1.04  ? 32  ALA A CB   1 
ATOM 495  H H    . ALA A 1 32  ? -7.108  -9.621  -3.876  1.00 0.79  ? 32  ALA A H    1 
ATOM 496  H HA   . ALA A 1 32  ? -6.810  -9.691  -1.605  1.00 0.94  ? 32  ALA A HA   1 
ATOM 497  H HB1  . ALA A 1 32  ? -8.163  -8.492  -0.191  1.00 1.55  ? 32  ALA A HB1  1 
ATOM 498  H HB2  . ALA A 1 32  ? -9.638  -8.927  -1.056  1.00 1.47  ? 32  ALA A HB2  1 
ATOM 499  H HB3  . ALA A 1 32  ? -8.536  -7.730  -1.738  1.00 1.38  ? 32  ALA A HB3  1 
ATOM 500  N N    . GLY A 1 33  ? -9.656  -11.382 -1.814  1.00 0.80  ? 33  GLY A N    1 
ATOM 501  C CA   . GLY A 1 33  ? -10.263 -12.654 -1.468  1.00 0.92  ? 33  GLY A CA   1 
ATOM 502  C C    . GLY A 1 33  ? -11.689 -12.504 -0.974  1.00 1.21  ? 33  GLY A C    1 
ATOM 503  O O    . GLY A 1 33  ? -11.971 -12.730 0.203   1.00 1.87  ? 33  GLY A O    1 
ATOM 504  H H    . GLY A 1 33  ? -10.176 -10.707 -2.293  1.00 0.94  ? 33  GLY A H    1 
ATOM 505  H HA2  . GLY A 1 33  ? -10.263 -13.290 -2.342  1.00 0.92  ? 33  GLY A HA2  1 
ATOM 506  H HA3  . GLY A 1 33  ? -9.674  -13.123 -0.695  1.00 1.17  ? 33  GLY A HA3  1 
ATOM 507  N N    . ASP A 1 34  ? -12.588 -12.124 -1.875  1.00 1.69  ? 34  ASP A N    1 
ATOM 508  C CA   . ASP A 1 34  ? -13.993 -11.945 -1.526  1.00 2.13  ? 34  ASP A CA   1 
ATOM 509  C C    . ASP A 1 34  ? -14.138 -11.112 -0.256  1.00 2.25  ? 34  ASP A C    1 
ATOM 510  O O    . ASP A 1 34  ? -15.083 -11.293 0.512   1.00 2.69  ? 34  ASP A O    1 
ATOM 511  C CB   . ASP A 1 34  ? -14.669 -13.305 -1.337  1.00 2.93  ? 34  ASP A CB   1 
ATOM 512  C CG   . ASP A 1 34  ? -16.182 -13.205 -1.342  1.00 3.35  ? 34  ASP A CG   1 
ATOM 513  O OD1  . ASP A 1 34  ? -16.775 -13.240 -2.440  1.00 3.65  ? 34  ASP A OD1  1 
ATOM 514  O OD2  . ASP A 1 34  ? -16.773 -13.091 -0.248  1.00 3.91  ? 34  ASP A OD2  1 
ATOM 515  H H    . ASP A 1 34  ? -12.301 -11.961 -2.798  1.00 2.19  ? 34  ASP A H    1 
ATOM 516  H HA   . ASP A 1 34  ? -14.473 -11.424 -2.340  1.00 2.17  ? 34  ASP A HA   1 
ATOM 517  H HB2  . ASP A 1 34  ? -14.368 -13.963 -2.138  1.00 3.46  ? 34  ASP A HB2  1 
ATOM 518  H HB3  . ASP A 1 34  ? -14.357 -13.727 -0.393  1.00 3.23  ? 34  ASP A HB3  1 
ATOM 519  N N    . ASP A 1 35  ? -13.195 -10.200 -0.041  1.00 2.37  ? 35  ASP A N    1 
ATOM 520  C CA   . ASP A 1 35  ? -13.219 -9.339  1.136   1.00 2.84  ? 35  ASP A CA   1 
ATOM 521  C C    . ASP A 1 35  ? -13.630 -7.919  0.763   1.00 3.10  ? 35  ASP A C    1 
ATOM 522  O O    . ASP A 1 35  ? -13.192 -6.951  1.385   1.00 3.71  ? 35  ASP A O    1 
ATOM 523  C CB   . ASP A 1 35  ? -11.847 -9.325  1.811   1.00 3.09  ? 35  ASP A CB   1 
ATOM 524  C CG   . ASP A 1 35  ? -11.930 -8.981  3.285   1.00 3.86  ? 35  ASP A CG   1 
ATOM 525  O OD1  . ASP A 1 35  ? -12.282 -9.874  4.085   1.00 4.32  ? 35  ASP A OD1  1 
ATOM 526  O OD2  . ASP A 1 35  ? -11.643 -7.818  3.641   1.00 4.47  ? 35  ASP A OD2  1 
ATOM 527  H H    . ASP A 1 35  ? -12.467 -10.102 -0.689  1.00 2.47  ? 35  ASP A H    1 
ATOM 528  H HA   . ASP A 1 35  ? -13.946 -9.742  1.826   1.00 3.33  ? 35  ASP A HA   1 
ATOM 529  H HB2  . ASP A 1 35  ? -11.395 -10.301 1.714   1.00 3.19  ? 35  ASP A HB2  1 
ATOM 530  H HB3  . ASP A 1 35  ? -11.220 -8.592  1.324   1.00 3.25  ? 35  ASP A HB3  1 
ATOM 531  N N    . VAL A 1 36  ? -14.476 -7.802  -0.256  1.00 3.12  ? 36  VAL A N    1 
ATOM 532  C CA   . VAL A 1 36  ? -14.947 -6.500  -0.713  1.00 3.71  ? 36  VAL A CA   1 
ATOM 533  C C    . VAL A 1 36  ? -15.884 -6.643  -1.907  1.00 3.85  ? 36  VAL A C    1 
ATOM 534  O O    . VAL A 1 36  ? -15.449 -6.958  -3.015  1.00 4.28  ? 36  VAL A O    1 
ATOM 535  C CB   . VAL A 1 36  ? -13.773 -5.583  -1.104  1.00 4.34  ? 36  VAL A CB   1 
ATOM 536  C CG1  . VAL A 1 36  ? -12.599 -6.404  -1.613  1.00 4.51  ? 36  VAL A CG1  1 
ATOM 537  C CG2  . VAL A 1 36  ? -14.214 -4.566  -2.146  1.00 4.85  ? 36  VAL A CG2  1 
ATOM 538  H H    . VAL A 1 36  ? -14.790 -8.610  -0.712  1.00 3.06  ? 36  VAL A H    1 
ATOM 539  H HA   . VAL A 1 36  ? -15.484 -6.035  0.101   1.00 4.09  ? 36  VAL A HA   1 
ATOM 540  H HB   . VAL A 1 36  ? -13.453 -5.046  -0.222  1.00 4.86  ? 36  VAL A HB   1 
ATOM 541  H HG11 . VAL A 1 36  ? -12.968 -7.277  -2.132  1.00 4.70  ? 36  VAL A HG11 1 
ATOM 542  H HG12 . VAL A 1 36  ? -11.987 -6.713  -0.778  1.00 4.91  ? 36  VAL A HG12 1 
ATOM 543  H HG13 . VAL A 1 36  ? -12.008 -5.806  -2.290  1.00 4.53  ? 36  VAL A HG13 1 
ATOM 544  H HG21 . VAL A 1 36  ? -14.276 -5.045  -3.112  1.00 5.04  ? 36  VAL A HG21 1 
ATOM 545  H HG22 . VAL A 1 36  ? -13.497 -3.760  -2.189  1.00 4.96  ? 36  VAL A HG22 1 
ATOM 546  H HG23 . VAL A 1 36  ? -15.183 -4.172  -1.877  1.00 5.36  ? 36  VAL A HG23 1 
ATOM 547  N N    . GLU A 1 37  ? -17.171 -6.409  -1.675  1.00 3.92  ? 37  GLU A N    1 
ATOM 548  C CA   . GLU A 1 37  ? -18.170 -6.512  -2.732  1.00 4.45  ? 37  GLU A CA   1 
ATOM 549  C C    . GLU A 1 37  ? -17.791 -5.640  -3.925  1.00 4.85  ? 37  GLU A C    1 
ATOM 550  O O    . GLU A 1 37  ? -17.649 -6.130  -5.045  1.00 5.41  ? 37  GLU A O    1 
ATOM 551  C CB   . GLU A 1 37  ? -19.546 -6.103  -2.205  1.00 4.91  ? 37  GLU A CB   1 
ATOM 552  C CG   . GLU A 1 37  ? -19.936 -6.805  -0.914  1.00 5.38  ? 37  GLU A CG   1 
ATOM 553  C CD   . GLU A 1 37  ? -20.446 -5.843  0.142   1.00 6.27  ? 37  GLU A CD   1 
ATOM 554  O OE1  . GLU A 1 37  ? -21.635 -5.466  0.076   1.00 6.73  ? 37  GLU A OE1  1 
ATOM 555  O OE2  . GLU A 1 37  ? -19.656 -5.467  1.033   1.00 6.72  ? 37  GLU A OE2  1 
ATOM 556  H H    . GLU A 1 37  ? -17.456 -6.161  -0.770  1.00 3.91  ? 37  GLU A H    1 
ATOM 557  H HA   . GLU A 1 37  ? -18.208 -7.542  -3.053  1.00 4.63  ? 37  GLU A HA   1 
ATOM 558  H HB2  . GLU A 1 37  ? -19.549 -5.038  -2.025  1.00 4.87  ? 37  GLU A HB2  1 
ATOM 559  H HB3  . GLU A 1 37  ? -20.290 -6.335  -2.953  1.00 5.35  ? 37  GLU A HB3  1 
ATOM 560  H HG2  . GLU A 1 37  ? -20.713 -7.523  -1.129  1.00 5.38  ? 37  GLU A HG2  1 
ATOM 561  H HG3  . GLU A 1 37  ? -19.070 -7.319  -0.523  1.00 5.43  ? 37  GLU A HG3  1 
ATOM 562  N N    . GLU A 1 38  ? -17.629 -4.344  -3.677  1.00 4.94  ? 38  GLU A N    1 
ATOM 563  C CA   . GLU A 1 38  ? -17.266 -3.403  -4.730  1.00 5.56  ? 38  GLU A CA   1 
ATOM 564  C C    . GLU A 1 38  ? -16.318 -2.332  -4.200  1.00 5.32  ? 38  GLU A C    1 
ATOM 565  O O    . GLU A 1 38  ? -15.961 -2.333  -3.022  1.00 5.51  ? 38  GLU A O    1 
ATOM 566  C CB   . GLU A 1 38  ? -18.521 -2.748  -5.310  1.00 6.28  ? 38  GLU A CB   1 
ATOM 567  C CG   . GLU A 1 38  ? -19.088 -1.640  -4.438  1.00 6.69  ? 38  GLU A CG   1 
ATOM 568  C CD   . GLU A 1 38  ? -20.589 -1.751  -4.257  1.00 7.53  ? 38  GLU A CD   1 
ATOM 569  O OE1  . GLU A 1 38  ? -21.108 -2.887  -4.282  1.00 8.22  ? 38  GLU A OE1  1 
ATOM 570  O OE2  . GLU A 1 38  ? -21.246 -0.702  -4.090  1.00 7.73  ? 38  GLU A OE2  1 
ATOM 571  H H    . GLU A 1 38  ? -17.756 -4.013  -2.763  1.00 4.82  ? 38  GLU A H    1 
ATOM 572  H HA   . GLU A 1 38  ? -16.766 -3.956  -5.511  1.00 6.04  ? 38  GLU A HA   1 
ATOM 573  H HB2  . GLU A 1 38  ? -18.280 -2.329  -6.276  1.00 6.32  ? 38  GLU A HB2  1 
ATOM 574  H HB3  . GLU A 1 38  ? -19.282 -3.504  -5.435  1.00 6.81  ? 38  GLU A HB3  1 
ATOM 575  H HG2  . GLU A 1 38  ? -18.619 -1.689  -3.466  1.00 6.71  ? 38  GLU A HG2  1 
ATOM 576  H HG3  . GLU A 1 38  ? -18.864 -0.688  -4.897  1.00 6.70  ? 38  GLU A HG3  1 
ATOM 577  N N    . ASN A 1 39  ? -15.914 -1.420  -5.079  1.00 5.31  ? 39  ASN A N    1 
ATOM 578  C CA   . ASN A 1 39  ? -15.008 -0.342  -4.700  1.00 5.45  ? 39  ASN A CA   1 
ATOM 579  C C    . ASN A 1 39  ? -15.569 1.012   -5.121  1.00 5.56  ? 39  ASN A C    1 
ATOM 580  O O    . ASN A 1 39  ? -14.886 1.805   -5.769  1.00 6.13  ? 39  ASN A O    1 
ATOM 581  C CB   . ASN A 1 39  ? -13.632 -0.558  -5.333  1.00 6.05  ? 39  ASN A CB   1 
ATOM 582  C CG   . ASN A 1 39  ? -13.717 -1.267  -6.671  1.00 6.37  ? 39  ASN A CG   1 
ATOM 583  O OD1  . ASN A 1 39  ? -13.114 -2.322  -6.866  1.00 6.63  ? 39  ASN A OD1  1 
ATOM 584  N ND2  . ASN A 1 39  ? -14.467 -0.688  -7.601  1.00 6.70  ? 39  ASN A ND2  1 
ATOM 585  H H    . ASN A 1 39  ? -16.234 -1.472  -6.004  1.00 5.49  ? 39  ASN A H    1 
ATOM 586  H HA   . ASN A 1 39  ? -14.906 -0.358  -3.625  1.00 5.44  ? 39  ASN A HA   1 
ATOM 587  H HB2  . ASN A 1 39  ? -13.158 0.400   -5.484  1.00 6.36  ? 39  ASN A HB2  1 
ATOM 588  H HB3  . ASN A 1 39  ? -13.026 -1.154  -4.668  1.00 6.33  ? 39  ASN A HB3  1 
ATOM 589  H HD21 . ASN A 1 39  ? -14.918 0.153   -7.376  1.00 6.74  ? 39  ASN A HD21 1 
ATOM 590  H HD22 . ASN A 1 39  ? -14.540 -1.125  -8.476  1.00 7.10  ? 39  ASN A HD22 1 
ATOM 591  N N    . ARG A 1 40  ? -16.819 1.270   -4.748  1.00 5.33  ? 40  ARG A N    1 
ATOM 592  C CA   . ARG A 1 40  ? -17.474 2.528   -5.087  1.00 5.69  ? 40  ARG A CA   1 
ATOM 593  C C    . ARG A 1 40  ? -17.680 3.393   -3.846  1.00 5.38  ? 40  ARG A C    1 
ATOM 594  O O    . ARG A 1 40  ? -17.709 4.620   -3.934  1.00 5.53  ? 40  ARG A O    1 
ATOM 595  C CB   . ARG A 1 40  ? -18.820 2.258   -5.763  1.00 6.50  ? 40  ARG A CB   1 
ATOM 596  C CG   . ARG A 1 40  ? -19.854 1.640   -4.835  1.00 6.82  ? 40  ARG A CG   1 
ATOM 597  C CD   . ARG A 1 40  ? -20.759 2.697   -4.225  1.00 7.59  ? 40  ARG A CD   1 
ATOM 598  N NE   . ARG A 1 40  ? -20.987 2.467   -2.801  1.00 8.20  ? 40  ARG A NE   1 
ATOM 599  C CZ   . ARG A 1 40  ? -21.806 3.201   -2.050  1.00 8.93  ? 40  ARG A CZ   1 
ATOM 600  N NH1  . ARG A 1 40  ? -22.480 4.216   -2.581  1.00 9.19  ? 40  ARG A NH1  1 
ATOM 601  N NH2  . ARG A 1 40  ? -21.954 2.920   -0.763  1.00 9.63  ? 40  ARG A NH2  1 
ATOM 602  H H    . ARG A 1 40  ? -17.312 0.598   -4.233  1.00 5.14  ? 40  ARG A H    1 
ATOM 603  H HA   . ARG A 1 40  ? -16.836 3.057   -5.778  1.00 5.95  ? 40  ARG A HA   1 
ATOM 604  H HB2  . ARG A 1 40  ? -19.216 3.192   -6.136  1.00 6.97  ? 40  ARG A HB2  1 
ATOM 605  H HB3  . ARG A 1 40  ? -18.665 1.586   -6.593  1.00 6.76  ? 40  ARG A HB3  1 
ATOM 606  H HG2  . ARG A 1 40  ? -20.458 0.945   -5.399  1.00 6.63  ? 40  ARG A HG2  1 
ATOM 607  H HG3  . ARG A 1 40  ? -19.342 1.114   -4.042  1.00 7.03  ? 40  ARG A HG3  1 
ATOM 608  H HD2  . ARG A 1 40  ? -20.297 3.665   -4.353  1.00 7.92  ? 40  ARG A HD2  1 
ATOM 609  H HD3  . ARG A 1 40  ? -21.708 2.681   -4.740  1.00 7.64  ? 40  ARG A HD3  1 
ATOM 610  H HE   . ARG A 1 40  ? -20.505 1.725   -2.380  1.00 8.22  ? 40  ARG A HE   1 
ATOM 611  H HH11 . ARG A 1 40  ? -22.376 4.437   -3.550  1.00 8.85  ? 40  ARG A HH11 1 
ATOM 612  H HH12 . ARG A 1 40  ? -23.092 4.762   -2.008  1.00 9.87  ? 40  ARG A HH12 1 
ATOM 613  H HH21 . ARG A 1 40  ? -21.450 2.157   -0.357  1.00 9.63  ? 40  ARG A HH21 1 
ATOM 614  H HH22 . ARG A 1 40  ? -22.568 3.471   -0.198  1.00 10.26 ? 40  ARG A HH22 1 
ATOM 615  N N    . THR A 1 41  ? -17.823 2.746   -2.692  1.00 5.30  ? 41  THR A N    1 
ATOM 616  C CA   . THR A 1 41  ? -18.027 3.458   -1.435  1.00 5.36  ? 41  THR A CA   1 
ATOM 617  C C    . THR A 1 41  ? -17.021 4.596   -1.282  1.00 4.97  ? 41  THR A C    1 
ATOM 618  O O    . THR A 1 41  ? -17.364 5.681   -0.813  1.00 5.23  ? 41  THR A O    1 
ATOM 619  C CB   . THR A 1 41  ? -17.908 2.494   -0.254  1.00 5.68  ? 41  THR A CB   1 
ATOM 620  O OG1  . THR A 1 41  ? -19.042 2.592   0.589   1.00 6.21  ? 41  THR A OG1  1 
ATOM 621  C CG2  . THR A 1 41  ? -16.681 2.739   0.598   1.00 6.06  ? 41  THR A CG2  1 
ATOM 622  H H    . THR A 1 41  ? -17.793 1.767   -2.685  1.00 5.46  ? 41  THR A H    1 
ATOM 623  H HA   . THR A 1 41  ? -19.023 3.875   -1.449  1.00 5.86  ? 41  THR A HA   1 
ATOM 624  H HB   . THR A 1 41  ? -17.852 1.483   -0.631  1.00 5.72  ? 41  THR A HB   1 
ATOM 625  H HG1  . THR A 1 41  ? -19.375 1.713   0.783   1.00 6.32  ? 41  THR A HG1  1 
ATOM 626  H HG21 . THR A 1 41  ? -15.797 2.682   -0.019  1.00 6.05  ? 41  THR A HG21 1 
ATOM 627  H HG22 . THR A 1 41  ? -16.627 1.990   1.375   1.00 6.30  ? 41  THR A HG22 1 
ATOM 628  H HG23 . THR A 1 41  ? -16.744 3.719   1.047   1.00 6.48  ? 41  THR A HG23 1 
ATOM 629  N N    . GLU A 1 42  ? -15.780 4.340   -1.683  1.00 4.77  ? 42  GLU A N    1 
ATOM 630  C CA   . GLU A 1 42  ? -14.726 5.345   -1.592  1.00 4.74  ? 42  GLU A CA   1 
ATOM 631  C C    . GLU A 1 42  ? -15.121 6.613   -2.342  1.00 4.19  ? 42  GLU A C    1 
ATOM 632  O O    . GLU A 1 42  ? -15.490 6.561   -3.515  1.00 4.37  ? 42  GLU A O    1 
ATOM 633  C CB   . GLU A 1 42  ? -13.416 4.792   -2.156  1.00 5.34  ? 42  GLU A CB   1 
ATOM 634  C CG   . GLU A 1 42  ? -13.435 4.602   -3.663  1.00 6.08  ? 42  GLU A CG   1 
ATOM 635  C CD   . GLU A 1 42  ? -12.813 3.288   -4.094  1.00 6.94  ? 42  GLU A CD   1 
ATOM 636  O OE1  . GLU A 1 42  ? -12.924 2.302   -3.334  1.00 7.39  ? 42  GLU A OE1  1 
ATOM 637  O OE2  . GLU A 1 42  ? -12.217 3.244   -5.190  1.00 7.43  ? 42  GLU A OE2  1 
ATOM 638  H H    . GLU A 1 42  ? -15.568 3.457   -2.050  1.00 4.93  ? 42  GLU A H    1 
ATOM 639  H HA   . GLU A 1 42  ? -14.587 5.586   -0.549  1.00 5.17  ? 42  GLU A HA   1 
ATOM 640  H HB2  . GLU A 1 42  ? -12.616 5.474   -1.910  1.00 5.45  ? 42  GLU A HB2  1 
ATOM 641  H HB3  . GLU A 1 42  ? -13.216 3.835   -1.697  1.00 5.58  ? 42  GLU A HB3  1 
ATOM 642  H HG2  . GLU A 1 42  ? -14.459 4.626   -4.004  1.00 6.19  ? 42  GLU A HG2  1 
ATOM 643  H HG3  . GLU A 1 42  ? -12.885 5.411   -4.122  1.00 6.24  ? 42  GLU A HG3  1 
ATOM 644  N N    . ALA A 1 43  ? -15.043 7.750   -1.658  1.00 4.01  ? 43  ALA A N    1 
ATOM 645  C CA   . ALA A 1 43  ? -15.395 9.028   -2.264  1.00 3.97  ? 43  ALA A CA   1 
ATOM 646  C C    . ALA A 1 43  ? -14.149 9.770   -2.745  1.00 3.66  ? 43  ALA A C    1 
ATOM 647  O O    . ALA A 1 43  ? -13.115 9.749   -2.078  1.00 3.42  ? 43  ALA A O    1 
ATOM 648  C CB   . ALA A 1 43  ? -16.170 9.884   -1.273  1.00 4.54  ? 43  ALA A CB   1 
ATOM 649  H H    . ALA A 1 43  ? -14.744 7.729   -0.725  1.00 4.25  ? 43  ALA A H    1 
ATOM 650  H HA   . ALA A 1 43  ? -16.036 8.825   -3.105  1.00 4.31  ? 43  ALA A HA   1 
ATOM 651  H HB1  . ALA A 1 43  ? -16.892 9.271   -0.755  1.00 4.69  ? 43  ALA A HB1  1 
ATOM 652  H HB2  . ALA A 1 43  ? -16.682 10.674  -1.803  1.00 5.06  ? 43  ALA A HB2  1 
ATOM 653  H HB3  . ALA A 1 43  ? -15.485 10.316  -0.558  1.00 4.74  ? 43  ALA A HB3  1 
ATOM 654  N N    . PRO A 1 44  ? -14.225 10.441  -3.913  1.00 4.17  ? 44  PRO A N    1 
ATOM 655  C CA   . PRO A 1 44  ? -13.089 11.188  -4.467  1.00 4.41  ? 44  PRO A CA   1 
ATOM 656  C C    . PRO A 1 44  ? -12.609 12.293  -3.528  1.00 4.25  ? 44  PRO A C    1 
ATOM 657  O O    . PRO A 1 44  ? -12.970 13.459  -3.686  1.00 4.93  ? 44  PRO A O    1 
ATOM 658  C CB   . PRO A 1 44  ? -13.643 11.794  -5.764  1.00 5.50  ? 44  PRO A CB   1 
ATOM 659  C CG   . PRO A 1 44  ? -14.842 10.975  -6.096  1.00 5.78  ? 44  PRO A CG   1 
ATOM 660  C CD   . PRO A 1 44  ? -15.412 10.524  -4.783  1.00 5.03  ? 44  PRO A CD   1 
ATOM 661  H HA   . PRO A 1 44  ? -12.262 10.533  -4.698  1.00 4.37  ? 44  PRO A HA   1 
ATOM 662  H HB2  . PRO A 1 44  ? -13.907 12.828  -5.599  1.00 5.89  ? 44  PRO A HB2  1 
ATOM 663  H HB3  . PRO A 1 44  ? -12.896 11.728  -6.541  1.00 5.88  ? 44  PRO A HB3  1 
ATOM 664  H HG2  . PRO A 1 44  ? -15.561 11.578  -6.629  1.00 6.24  ? 44  PRO A HG2  1 
ATOM 665  H HG3  . PRO A 1 44  ? -14.551 10.122  -6.691  1.00 6.31  ? 44  PRO A HG3  1 
ATOM 666  H HD2  . PRO A 1 44  ? -16.118 11.250  -4.407  1.00 5.32  ? 44  PRO A HD2  1 
ATOM 667  H HD3  . PRO A 1 44  ? -15.881 9.559   -4.892  1.00 5.13  ? 44  PRO A HD3  1 
ATOM 668  N N    . GLU A 1 45  ? -11.794 11.918  -2.548  1.00 3.68  ? 45  GLU A N    1 
ATOM 669  C CA   . GLU A 1 45  ? -11.268 12.879  -1.585  1.00 3.85  ? 45  GLU A CA   1 
ATOM 670  C C    . GLU A 1 45  ? -10.110 12.281  -0.792  1.00 3.58  ? 45  GLU A C    1 
ATOM 671  O O    . GLU A 1 45  ? -9.759  11.114  -0.970  1.00 3.85  ? 45  GLU A O    1 
ATOM 672  C CB   . GLU A 1 45  ? -12.373 13.334  -0.630  1.00 4.50  ? 45  GLU A CB   1 
ATOM 673  C CG   . GLU A 1 45  ? -13.160 14.531  -1.139  1.00 5.18  ? 45  GLU A CG   1 
ATOM 674  C CD   . GLU A 1 45  ? -13.683 15.405  -0.016  1.00 5.94  ? 45  GLU A CD   1 
ATOM 675  O OE1  . GLU A 1 45  ? -12.868 16.109  0.617   1.00 6.68  ? 45  GLU A OE1  1 
ATOM 676  O OE2  . GLU A 1 45  ? -14.907 15.385  0.232   1.00 6.04  ? 45  GLU A OE2  1 
ATOM 677  H H    . GLU A 1 45  ? -11.542 10.974  -2.470  1.00 3.45  ? 45  GLU A H    1 
ATOM 678  H HA   . GLU A 1 45  ? -10.906 13.734  -2.135  1.00 4.06  ? 45  GLU A HA   1 
ATOM 679  H HB2  . GLU A 1 45  ? -13.061 12.516  -0.478  1.00 4.65  ? 45  GLU A HB2  1 
ATOM 680  H HB3  . GLU A 1 45  ? -11.928 13.600  0.317   1.00 4.75  ? 45  GLU A HB3  1 
ATOM 681  H HG2  . GLU A 1 45  ? -12.517 15.127  -1.769  1.00 5.42  ? 45  GLU A HG2  1 
ATOM 682  H HG3  . GLU A 1 45  ? -13.999 14.173  -1.718  1.00 5.28  ? 45  GLU A HG3  1 
ATOM 683  N N    . GLY A 1 46  ? -9.520  13.088  0.084   1.00 3.41  ? 46  GLY A N    1 
ATOM 684  C CA   . GLY A 1 46  ? -8.408  12.623  0.891   1.00 3.37  ? 46  GLY A CA   1 
ATOM 685  C C    . GLY A 1 46  ? -7.155  13.451  0.682   1.00 2.71  ? 46  GLY A C    1 
ATOM 686  O O    . GLY A 1 46  ? -6.725  14.177  1.579   1.00 2.92  ? 46  GLY A O    1 
ATOM 687  H H    . GLY A 1 46  ? -9.843  14.009  0.182   1.00 3.56  ? 46  GLY A H    1 
ATOM 688  H HA2  . GLY A 1 46  ? -8.688  12.672  1.933   1.00 3.82  ? 46  GLY A HA2  1 
ATOM 689  H HA3  . GLY A 1 46  ? -8.195  11.596  0.634   1.00 3.88  ? 46  GLY A HA3  1 
ATOM 690  N N    . THR A 1 47  ? -6.569  13.344  -0.506  1.00 2.47  ? 47  THR A N    1 
ATOM 691  C CA   . THR A 1 47  ? -5.358  14.089  -0.833  1.00 2.41  ? 47  THR A CA   1 
ATOM 692  C C    . THR A 1 47  ? -4.267  13.841  0.204   1.00 2.10  ? 47  THR A C    1 
ATOM 693  O O    . THR A 1 47  ? -3.435  14.711  0.463   1.00 2.54  ? 47  THR A O    1 
ATOM 694  C CB   . THR A 1 47  ? -5.663  15.585  -0.921  1.00 3.05  ? 47  THR A CB   1 
ATOM 695  O OG1  . THR A 1 47  ? -5.686  16.168  0.370   1.00 3.87  ? 47  THR A OG1  1 
ATOM 696  C CG2  . THR A 1 47  ? -6.989  15.887  -1.585  1.00 3.37  ? 47  THR A CG2  1 
ATOM 697  H H    . THR A 1 47  ? -6.961  12.749  -1.180  1.00 2.77  ? 47  THR A H    1 
ATOM 698  H HA   . THR A 1 47  ? -5.008  13.745  -1.795  1.00 2.80  ? 47  THR A HA   1 
ATOM 699  H HB   . THR A 1 47  ? -4.886  16.066  -1.497  1.00 3.41  ? 47  THR A HB   1 
ATOM 700  H HG1  . THR A 1 47  ? -5.725  17.123  0.289   1.00 4.14  ? 47  THR A HG1  1 
ATOM 701  H HG21 . THR A 1 47  ? -6.935  16.848  -2.075  1.00 3.65  ? 47  THR A HG21 1 
ATOM 702  H HG22 . THR A 1 47  ? -7.769  15.906  -0.839  1.00 3.64  ? 47  THR A HG22 1 
ATOM 703  H HG23 . THR A 1 47  ? -7.208  15.123  -2.316  1.00 3.72  ? 47  THR A HG23 1 
ATOM 704  N N    . GLU A 1 48  ? -4.274  12.649  0.792   1.00 1.76  ? 48  GLU A N    1 
ATOM 705  C CA   . GLU A 1 48  ? -3.282  12.288  1.798   1.00 1.67  ? 48  GLU A CA   1 
ATOM 706  C C    . GLU A 1 48  ? -2.627  10.935  1.494   1.00 1.41  ? 48  GLU A C    1 
ATOM 707  O O    . GLU A 1 48  ? -1.825  10.443  2.286   1.00 2.00  ? 48  GLU A O    1 
ATOM 708  C CB   . GLU A 1 48  ? -3.927  12.250  3.185   1.00 2.00  ? 48  GLU A CB   1 
ATOM 709  C CG   . GLU A 1 48  ? -4.651  10.948  3.484   1.00 2.16  ? 48  GLU A CG   1 
ATOM 710  C CD   . GLU A 1 48  ? -5.739  11.112  4.527   1.00 2.75  ? 48  GLU A CD   1 
ATOM 711  O OE1  . GLU A 1 48  ? -6.742  11.798  4.236   1.00 3.33  ? 48  GLU A OE1  1 
ATOM 712  O OE2  . GLU A 1 48  ? -5.589  10.554  5.634   1.00 3.01  ? 48  GLU A OE2  1 
ATOM 713  H H    . GLU A 1 48  ? -4.961  11.996  0.542   1.00 1.94  ? 48  GLU A H    1 
ATOM 714  H HA   . GLU A 1 48  ? -2.517  13.049  1.793   1.00 1.81  ? 48  GLU A HA   1 
ATOM 715  H HB2  . GLU A 1 48  ? -3.159  12.389  3.931   1.00 2.21  ? 48  GLU A HB2  1 
ATOM 716  H HB3  . GLU A 1 48  ? -4.640  13.058  3.260   1.00 2.60  ? 48  GLU A HB3  1 
ATOM 717  H HG2  . GLU A 1 48  ? -5.100  10.583  2.572   1.00 2.40  ? 48  GLU A HG2  1 
ATOM 718  H HG3  . GLU A 1 48  ? -3.933  10.226  3.844   1.00 2.32  ? 48  GLU A HG3  1 
ATOM 719  N N    . SER A 1 49  ? -2.964  10.335  0.351   1.00 1.02  ? 49  SER A N    1 
ATOM 720  C CA   . SER A 1 49  ? -2.393  9.048   -0.027  1.00 0.87  ? 49  SER A CA   1 
ATOM 721  C C    . SER A 1 49  ? -2.244  8.946   -1.541  1.00 0.95  ? 49  SER A C    1 
ATOM 722  O O    . SER A 1 49  ? -2.465  7.886   -2.127  1.00 1.49  ? 49  SER A O    1 
ATOM 723  C CB   . SER A 1 49  ? -3.269  7.906   0.491   1.00 1.08  ? 49  SER A CB   1 
ATOM 724  O OG   . SER A 1 49  ? -4.271  8.389   1.369   1.00 1.52  ? 49  SER A OG   1 
ATOM 725  H H    . SER A 1 49  ? -3.604  10.762  -0.250  1.00 1.34  ? 49  SER A H    1 
ATOM 726  H HA   . SER A 1 49  ? -1.416  8.975   0.425   1.00 0.84  ? 49  SER A HA   1 
ATOM 727  H HB2  . SER A 1 49  ? -3.746  7.414   -0.343  1.00 1.49  ? 49  SER A HB2  1 
ATOM 728  H HB3  . SER A 1 49  ? -2.653  7.196   1.023   1.00 1.59  ? 49  SER A HB3  1 
ATOM 729  H HG   . SER A 1 49  ? -4.849  7.667   1.624   1.00 1.74  ? 49  SER A HG   1 
ATOM 730  N N    . GLU A 1 50  ? -1.869  10.055  -2.168  1.00 0.84  ? 50  GLU A N    1 
ATOM 731  C CA   . GLU A 1 50  ? -1.690  10.095  -3.615  1.00 1.01  ? 50  GLU A CA   1 
ATOM 732  C C    . GLU A 1 50  ? -0.215  9.988   -3.994  1.00 1.01  ? 50  GLU A C    1 
ATOM 733  O O    . GLU A 1 50  ? 0.121   9.543   -5.092  1.00 1.61  ? 50  GLU A O    1 
ATOM 734  C CB   . GLU A 1 50  ? -2.282  11.385  -4.186  1.00 1.21  ? 50  GLU A CB   1 
ATOM 735  C CG   . GLU A 1 50  ? -3.694  11.673  -3.702  1.00 1.61  ? 50  GLU A CG   1 
ATOM 736  C CD   . GLU A 1 50  ? -4.493  12.496  -4.693  1.00 2.27  ? 50  GLU A CD   1 
ATOM 737  O OE1  . GLU A 1 50  ? -3.894  13.366  -5.361  1.00 2.82  ? 50  GLU A OE1  1 
ATOM 738  O OE2  . GLU A 1 50  ? -5.716  12.272  -4.801  1.00 2.84  ? 50  GLU A OE2  1 
ATOM 739  H H    . GLU A 1 50  ? -1.709  10.868  -1.645  1.00 1.03  ? 50  GLU A H    1 
ATOM 740  H HA   . GLU A 1 50  ? -2.217  9.253   -4.035  1.00 1.14  ? 50  GLU A HA   1 
ATOM 741  H HB2  . GLU A 1 50  ? -1.651  12.214  -3.902  1.00 1.39  ? 50  GLU A HB2  1 
ATOM 742  H HB3  . GLU A 1 50  ? -2.302  11.311  -5.263  1.00 1.55  ? 50  GLU A HB3  1 
ATOM 743  H HG2  . GLU A 1 50  ? -4.204  10.735  -3.543  1.00 1.85  ? 50  GLU A HG2  1 
ATOM 744  H HG3  . GLU A 1 50  ? -3.637  12.213  -2.769  1.00 1.96  ? 50  GLU A HG3  1 
ATOM 745  N N    . VAL A 1 51  ? 0.663   10.400  -3.084  1.00 0.63  ? 92  VAL A N    1 
ATOM 746  C CA   . VAL A 1 51  ? 2.101   10.349  -3.334  1.00 0.64  ? 92  VAL A CA   1 
ATOM 747  C C    . VAL A 1 51  ? 2.803   9.369   -2.394  1.00 0.58  ? 92  VAL A C    1 
ATOM 748  O O    . VAL A 1 51  ? 3.873   8.851   -2.716  1.00 0.73  ? 92  VAL A O    1 
ATOM 749  C CB   . VAL A 1 51  ? 2.754   11.738  -3.190  1.00 0.73  ? 92  VAL A CB   1 
ATOM 750  C CG1  . VAL A 1 51  ? 3.088   12.316  -4.557  1.00 0.95  ? 92  VAL A CG1  1 
ATOM 751  C CG2  . VAL A 1 51  ? 1.851   12.681  -2.411  1.00 0.76  ? 92  VAL A CG2  1 
ATOM 752  H H    . VAL A 1 51  ? 0.338   10.747  -2.228  1.00 0.81  ? 92  VAL A H    1 
ATOM 753  H HA   . VAL A 1 51  ? 2.245   10.015  -4.351  1.00 0.73  ? 92  VAL A HA   1 
ATOM 754  H HB   . VAL A 1 51  ? 3.676   11.622  -2.641  1.00 0.75  ? 92  VAL A HB   1 
ATOM 755  H HG11 . VAL A 1 51  ? 3.395   11.520  -5.219  1.00 1.43  ? 92  VAL A HG11 1 
ATOM 756  H HG12 . VAL A 1 51  ? 3.889   13.033  -4.459  1.00 1.49  ? 92  VAL A HG12 1 
ATOM 757  H HG13 . VAL A 1 51  ? 2.215   12.805  -4.963  1.00 1.35  ? 92  VAL A HG13 1 
ATOM 758  H HG21 . VAL A 1 51  ? 1.516   12.193  -1.507  1.00 1.23  ? 92  VAL A HG21 1 
ATOM 759  H HG22 . VAL A 1 51  ? 0.995   12.942  -3.017  1.00 1.27  ? 92  VAL A HG22 1 
ATOM 760  H HG23 . VAL A 1 51  ? 2.399   13.576  -2.156  1.00 1.32  ? 92  VAL A HG23 1 
ATOM 761  N N    . VAL A 1 52  ? 2.196   9.107   -1.238  1.00 0.51  ? 93  VAL A N    1 
ATOM 762  C CA   . VAL A 1 52  ? 2.770   8.179   -0.272  1.00 0.46  ? 93  VAL A CA   1 
ATOM 763  C C    . VAL A 1 52  ? 2.859   6.777   -0.862  1.00 0.45  ? 93  VAL A C    1 
ATOM 764  O O    . VAL A 1 52  ? 3.851   6.073   -0.675  1.00 0.45  ? 93  VAL A O    1 
ATOM 765  C CB   . VAL A 1 52  ? 1.938   8.128   1.023   1.00 0.52  ? 93  VAL A CB   1 
ATOM 766  C CG1  . VAL A 1 52  ? 0.576   7.512   0.756   1.00 0.67  ? 93  VAL A CG1  1 
ATOM 767  C CG2  . VAL A 1 52  ? 2.675   7.353   2.102   1.00 0.59  ? 93  VAL A CG2  1 
ATOM 768  H H    . VAL A 1 52  ? 1.342   9.539   -1.036  1.00 0.59  ? 93  VAL A H    1 
ATOM 769  H HA   . VAL A 1 52  ? 3.766   8.522   -0.024  1.00 0.47  ? 93  VAL A HA   1 
ATOM 770  H HB   . VAL A 1 52  ? 1.790   9.139   1.373   1.00 0.59  ? 93  VAL A HB   1 
ATOM 771  H HG11 . VAL A 1 52  ? 0.172   7.919   -0.159  1.00 1.22  ? 93  VAL A HG11 1 
ATOM 772  H HG12 . VAL A 1 52  ? -0.089  7.740   1.576   1.00 1.07  ? 93  VAL A HG12 1 
ATOM 773  H HG13 . VAL A 1 52  ? 0.678   6.441   0.661   1.00 1.32  ? 93  VAL A HG13 1 
ATOM 774  H HG21 . VAL A 1 52  ? 3.731   7.568   2.042   1.00 1.19  ? 93  VAL A HG21 1 
ATOM 775  H HG22 . VAL A 1 52  ? 2.513   6.294   1.957   1.00 1.28  ? 93  VAL A HG22 1 
ATOM 776  H HG23 . VAL A 1 52  ? 2.301   7.644   3.072   1.00 1.11  ? 93  VAL A HG23 1 
ATOM 777  N N    . HIS A 1 53  ? 1.814   6.381   -1.585  1.00 0.51  ? 94  HIS A N    1 
ATOM 778  C CA   . HIS A 1 53  ? 1.773   5.066   -2.213  1.00 0.57  ? 94  HIS A CA   1 
ATOM 779  C C    . HIS A 1 53  ? 2.696   5.022   -3.425  1.00 0.57  ? 94  HIS A C    1 
ATOM 780  O O    . HIS A 1 53  ? 3.564   4.155   -3.527  1.00 0.58  ? 94  HIS A O    1 
ATOM 781  C CB   . HIS A 1 53  ? 0.344   4.721   -2.638  1.00 0.66  ? 94  HIS A CB   1 
ATOM 782  C CG   . HIS A 1 53  ? -0.609  4.588   -1.491  1.00 0.76  ? 94  HIS A CG   1 
ATOM 783  N ND1  . HIS A 1 53  ? -1.028  3.371   -0.997  1.00 1.02  ? 94  HIS A ND1  1 
ATOM 784  C CD2  . HIS A 1 53  ? -1.233  5.529   -0.743  1.00 0.85  ? 94  HIS A CD2  1 
ATOM 785  C CE1  . HIS A 1 53  ? -1.869  3.570   0.003   1.00 1.09  ? 94  HIS A CE1  1 
ATOM 786  N NE2  . HIS A 1 53  ? -2.008  4.870   0.177   1.00 0.98  ? 94  HIS A NE2  1 
ATOM 787  H H    . HIS A 1 53  ? 1.056   6.990   -1.702  1.00 0.55  ? 94  HIS A H    1 
ATOM 788  H HA   . HIS A 1 53  ? 2.111   4.340   -1.489  1.00 0.59  ? 94  HIS A HA   1 
ATOM 789  H HB2  . HIS A 1 53  ? -0.027  5.499   -3.288  1.00 0.66  ? 94  HIS A HB2  1 
ATOM 790  H HB3  . HIS A 1 53  ? 0.353   3.784   -3.174  1.00 0.73  ? 94  HIS A HB3  1 
ATOM 791  H HD1  . HIS A 1 53  ? -0.752  2.492   -1.331  1.00 1.22  ? 94  HIS A HD1  1 
ATOM 792  H HD2  . HIS A 1 53  ? -1.137  6.600   -0.852  1.00 0.97  ? 94  HIS A HD2  1 
ATOM 793  H HE1  . HIS A 1 53  ? -2.360  2.799   0.578   1.00 1.31  ? 94  HIS A HE1  1 
ATOM 794  N N    . LEU A 1 54  ? 2.503   5.968   -4.341  1.00 0.62  ? 95  LEU A N    1 
ATOM 795  C CA   . LEU A 1 54  ? 3.320   6.043   -5.546  1.00 0.65  ? 95  LEU A CA   1 
ATOM 796  C C    . LEU A 1 54  ? 4.799   5.942   -5.198  1.00 0.58  ? 95  LEU A C    1 
ATOM 797  O O    . LEU A 1 54  ? 5.555   5.224   -5.853  1.00 0.59  ? 95  LEU A O    1 
ATOM 798  C CB   . LEU A 1 54  ? 3.048   7.350   -6.293  1.00 0.75  ? 95  LEU A CB   1 
ATOM 799  C CG   . LEU A 1 54  ? 1.759   7.373   -7.114  1.00 1.39  ? 95  LEU A CG   1 
ATOM 800  C CD1  . LEU A 1 54  ? 1.551   8.742   -7.743  1.00 2.05  ? 95  LEU A CD1  1 
ATOM 801  C CD2  . LEU A 1 54  ? 1.791   6.292   -8.185  1.00 2.03  ? 95  LEU A CD2  1 
ATOM 802  H H    . LEU A 1 54  ? 1.797   6.632   -4.200  1.00 0.66  ? 95  LEU A H    1 
ATOM 803  H HA   . LEU A 1 54  ? 3.052   5.212   -6.182  1.00 0.72  ? 95  LEU A HA   1 
ATOM 804  H HB2  . LEU A 1 54  ? 3.004   8.151   -5.568  1.00 1.05  ? 95  LEU A HB2  1 
ATOM 805  H HB3  . LEU A 1 54  ? 3.876   7.538   -6.960  1.00 1.23  ? 95  LEU A HB3  1 
ATOM 806  H HG   . LEU A 1 54  ? 0.920   7.174   -6.462  1.00 2.14  ? 95  LEU A HG   1 
ATOM 807  H HD11 . LEU A 1 54  ? 1.747   8.685   -8.803  1.00 2.54  ? 95  LEU A HD11 1 
ATOM 808  H HD12 . LEU A 1 54  ? 2.227   9.452   -7.289  1.00 2.51  ? 95  LEU A HD12 1 
ATOM 809  H HD13 . LEU A 1 54  ? 0.532   9.061   -7.582  1.00 2.39  ? 95  LEU A HD13 1 
ATOM 810  H HD21 . LEU A 1 54  ? 1.650   5.325   -7.725  1.00 2.54  ? 95  LEU A HD21 1 
ATOM 811  H HD22 . LEU A 1 54  ? 2.746   6.314   -8.689  1.00 2.34  ? 95  LEU A HD22 1 
ATOM 812  H HD23 . LEU A 1 54  ? 1.002   6.470   -8.900  1.00 2.59  ? 95  LEU A HD23 1 
ATOM 813  N N    . ALA A 1 55  ? 5.203   6.664   -4.159  1.00 0.56  ? 96  ALA A N    1 
ATOM 814  C CA   . ALA A 1 55  ? 6.590   6.655   -3.716  1.00 0.55  ? 96  ALA A CA   1 
ATOM 815  C C    . ALA A 1 55  ? 6.961   5.301   -3.122  1.00 0.51  ? 96  ALA A C    1 
ATOM 816  O O    . ALA A 1 55  ? 7.856   4.618   -3.620  1.00 0.52  ? 96  ALA A O    1 
ATOM 817  C CB   . ALA A 1 55  ? 6.824   7.762   -2.700  1.00 0.61  ? 96  ALA A CB   1 
ATOM 818  H H    . ALA A 1 55  ? 4.551   7.213   -3.676  1.00 0.59  ? 96  ALA A H    1 
ATOM 819  H HA   . ALA A 1 55  ? 7.217   6.847   -4.575  1.00 0.59  ? 96  ALA A HA   1 
ATOM 820  H HB1  . ALA A 1 55  ? 7.884   7.911   -2.569  1.00 1.18  ? 96  ALA A HB1  1 
ATOM 821  H HB2  . ALA A 1 55  ? 6.380   7.484   -1.755  1.00 1.09  ? 96  ALA A HB2  1 
ATOM 822  H HB3  . ALA A 1 55  ? 6.373   8.678   -3.054  1.00 1.06  ? 96  ALA A HB3  1 
ATOM 823  N N    . LEU A 1 56  ? 6.265   4.922   -2.053  1.00 0.52  ? 97  LEU A N    1 
ATOM 824  C CA   . LEU A 1 56  ? 6.512   3.649   -1.384  1.00 0.57  ? 97  LEU A CA   1 
ATOM 825  C C    . LEU A 1 56  ? 6.619   2.512   -2.395  1.00 0.55  ? 97  LEU A C    1 
ATOM 826  O O    . LEU A 1 56  ? 7.493   1.651   -2.286  1.00 0.67  ? 97  LEU A O    1 
ATOM 827  C CB   . LEU A 1 56  ? 5.392   3.355   -0.384  1.00 0.68  ? 97  LEU A CB   1 
ATOM 828  C CG   . LEU A 1 56  ? 5.615   2.128   0.501   1.00 0.57  ? 97  LEU A CG   1 
ATOM 829  C CD1  . LEU A 1 56  ? 5.034   2.360   1.887   1.00 1.10  ? 97  LEU A CD1  1 
ATOM 830  C CD2  . LEU A 1 56  ? 4.997   0.893   -0.136  1.00 0.91  ? 97  LEU A CD2  1 
ATOM 831  H H    . LEU A 1 56  ? 5.566   5.514   -1.704  1.00 0.54  ? 97  LEU A H    1 
ATOM 832  H HA   . LEU A 1 56  ? 7.447   3.730   -0.850  1.00 0.61  ? 97  LEU A HA   1 
ATOM 833  H HB2  . LEU A 1 56  ? 5.275   4.218   0.256   1.00 1.11  ? 97  LEU A HB2  1 
ATOM 834  H HB3  . LEU A 1 56  ? 4.475   3.210   -0.936  1.00 1.11  ? 97  LEU A HB3  1 
ATOM 835  H HG   . LEU A 1 56  ? 6.676   1.956   0.608   1.00 1.04  ? 97  LEU A HG   1 
ATOM 836  H HD11 . LEU A 1 56  ? 5.081   3.413   2.126   1.00 1.65  ? 97  LEU A HD11 1 
ATOM 837  H HD12 . LEU A 1 56  ? 5.603   1.800   2.615   1.00 1.55  ? 97  LEU A HD12 1 
ATOM 838  H HD13 . LEU A 1 56  ? 4.005   2.033   1.906   1.00 1.63  ? 97  LEU A HD13 1 
ATOM 839  H HD21 . LEU A 1 56  ? 4.226   0.501   0.512   1.00 1.37  ? 97  LEU A HD21 1 
ATOM 840  H HD22 . LEU A 1 56  ? 5.760   0.143   -0.282  1.00 1.45  ? 97  LEU A HD22 1 
ATOM 841  H HD23 . LEU A 1 56  ? 4.564   1.158   -1.089  1.00 1.49  ? 97  LEU A HD23 1 
ATOM 842  N N    . ARG A 1 57  ? 5.727   2.517   -3.380  1.00 0.47  ? 98  ARG A N    1 
ATOM 843  C CA   . ARG A 1 57  ? 5.724   1.488   -4.413  1.00 0.49  ? 98  ARG A CA   1 
ATOM 844  C C    . ARG A 1 57  ? 6.946   1.621   -5.318  1.00 0.48  ? 98  ARG A C    1 
ATOM 845  O O    . ARG A 1 57  ? 7.444   0.630   -5.854  1.00 0.50  ? 98  ARG A O    1 
ATOM 846  C CB   . ARG A 1 57  ? 4.445   1.577   -5.248  1.00 0.51  ? 98  ARG A CB   1 
ATOM 847  C CG   . ARG A 1 57  ? 4.684   1.449   -6.743  1.00 0.91  ? 98  ARG A CG   1 
ATOM 848  C CD   . ARG A 1 57  ? 3.379   1.288   -7.504  1.00 1.29  ? 98  ARG A CD   1 
ATOM 849  N NE   . ARG A 1 57  ? 3.292   2.200   -8.642  1.00 1.76  ? 98  ARG A NE   1 
ATOM 850  C CZ   . ARG A 1 57  ? 3.994   2.057   -9.765  1.00 2.14  ? 98  ARG A CZ   1 
ATOM 851  N NH1  . ARG A 1 57  ? 4.838   1.042   -9.909  1.00 2.52  ? 98  ARG A NH1  1 
ATOM 852  N NH2  . ARG A 1 57  ? 3.852   2.934   -10.749 1.00 2.83  ? 98  ARG A NH2  1 
ATOM 853  H H    . ARG A 1 57  ? 5.057   3.231   -3.414  1.00 0.49  ? 98  ARG A H    1 
ATOM 854  H HA   . ARG A 1 57  ? 5.757   0.526   -3.923  1.00 0.52  ? 98  ARG A HA   1 
ATOM 855  H HB2  . ARG A 1 57  ? 3.774   0.787   -4.944  1.00 0.82  ? 98  ARG A HB2  1 
ATOM 856  H HB3  . ARG A 1 57  ? 3.973   2.530   -5.061  1.00 0.90  ? 98  ARG A HB3  1 
ATOM 857  H HG2  . ARG A 1 57  ? 5.187   2.338   -7.095  1.00 1.57  ? 98  ARG A HG2  1 
ATOM 858  H HG3  . ARG A 1 57  ? 5.307   0.586   -6.926  1.00 1.47  ? 98  ARG A HG3  1 
ATOM 859  H HD2  . ARG A 1 57  ? 3.310   0.272   -7.864  1.00 1.67  ? 98  ARG A HD2  1 
ATOM 860  H HD3  . ARG A 1 57  ? 2.558   1.487   -6.831  1.00 1.90  ? 98  ARG A HD3  1 
ATOM 861  H HE   . ARG A 1 57  ? 2.678   2.960   -8.566  1.00 2.33  ? 98  ARG A HE   1 
ATOM 862  H HH11 . ARG A 1 57  ? 4.953   0.375   -9.173  1.00 2.52  ? 98  ARG A HH11 1 
ATOM 863  H HH12 . ARG A 1 57  ? 5.360   0.944   -10.756 1.00 3.17  ? 98  ARG A HH12 1 
ATOM 864  H HH21 . ARG A 1 57  ? 3.218   3.701   -10.647 1.00 3.21  ? 98  ARG A HH21 1 
ATOM 865  H HH22 . ARG A 1 57  ? 4.379   2.829   -11.592 1.00 3.25  ? 98  ARG A HH22 1 
ATOM 866  N N    . GLN A 1 58  ? 7.427   2.850   -5.480  1.00 0.46  ? 99  GLN A N    1 
ATOM 867  C CA   . GLN A 1 58  ? 8.593   3.110   -6.316  1.00 0.47  ? 99  GLN A CA   1 
ATOM 868  C C    . GLN A 1 58  ? 9.878   2.735   -5.584  1.00 0.47  ? 99  GLN A C    1 
ATOM 869  O O    . GLN A 1 58  ? 10.721  2.013   -6.118  1.00 0.54  ? 99  GLN A O    1 
ATOM 870  C CB   . GLN A 1 58  ? 8.637   4.583   -6.725  1.00 0.47  ? 99  GLN A CB   1 
ATOM 871  C CG   . GLN A 1 58  ? 8.797   4.795   -8.222  1.00 0.96  ? 99  GLN A CG   1 
ATOM 872  C CD   . GLN A 1 58  ? 8.876   6.262   -8.597  1.00 1.12  ? 99  GLN A CD   1 
ATOM 873  O OE1  . GLN A 1 58  ? 7.993   7.050   -8.259  1.00 1.72  ? 99  GLN A OE1  1 
ATOM 874  N NE2  . GLN A 1 58  ? 9.938   6.636   -9.302  1.00 1.71  ? 99  GLN A NE2  1 
ATOM 875  H H    . GLN A 1 58  ? 6.989   3.598   -5.024  1.00 0.46  ? 99  GLN A H    1 
ATOM 876  H HA   . GLN A 1 58  ? 8.507   2.501   -7.204  1.00 0.50  ? 99  GLN A HA   1 
ATOM 877  H HB2  . GLN A 1 58  ? 7.720   5.059   -6.412  1.00 0.77  ? 99  GLN A HB2  1 
ATOM 878  H HB3  . GLN A 1 58  ? 9.468   5.059   -6.225  1.00 0.73  ? 99  GLN A HB3  1 
ATOM 879  H HG2  . GLN A 1 58  ? 9.704   4.307   -8.547  1.00 1.50  ? 99  GLN A HG2  1 
ATOM 880  H HG3  . GLN A 1 58  ? 7.951   4.354   -8.727  1.00 1.52  ? 99  GLN A HG3  1 
ATOM 881  H HE21 . GLN A 1 58  ? 10.602  5.955   -9.536  1.00 2.20  ? 99  GLN A HE21 1 
ATOM 882  H HE22 . GLN A 1 58  ? 10.015  7.579   -9.558  1.00 2.02  ? 99  GLN A HE22 1 
ATOM 883  N N    . ALA A 1 59  ? 10.019  3.230   -4.359  1.00 0.45  ? 100 ALA A N    1 
ATOM 884  C CA   . ALA A 1 59  ? 11.199  2.948   -3.551  1.00 0.46  ? 100 ALA A CA   1 
ATOM 885  C C    . ALA A 1 59  ? 11.521  1.458   -3.549  1.00 0.46  ? 100 ALA A C    1 
ATOM 886  O O    . ALA A 1 59  ? 12.684  1.063   -3.636  1.00 0.45  ? 100 ALA A O    1 
ATOM 887  C CB   . ALA A 1 59  ? 10.994  3.447   -2.128  1.00 0.50  ? 100 ALA A CB   1 
ATOM 888  H H    . ALA A 1 59  ? 9.311   3.798   -3.990  1.00 0.46  ? 100 ALA A H    1 
ATOM 889  H HA   . ALA A 1 59  ? 12.032  3.486   -3.979  1.00 0.47  ? 100 ALA A HA   1 
ATOM 890  H HB1  . ALA A 1 59  ? 10.333  2.774   -1.602  1.00 1.13  ? 100 ALA A HB1  1 
ATOM 891  H HB2  . ALA A 1 59  ? 10.558  4.434   -2.152  1.00 1.11  ? 100 ALA A HB2  1 
ATOM 892  H HB3  . ALA A 1 59  ? 11.946  3.486   -1.620  1.00 1.15  ? 100 ALA A HB3  1 
ATOM 893  N N    . GLY A 1 60  ? 10.483  0.633   -3.450  1.00 0.51  ? 101 GLY A N    1 
ATOM 894  C CA   . GLY A 1 60  ? 10.677  -0.805  -3.439  1.00 0.55  ? 101 GLY A CA   1 
ATOM 895  C C    . GLY A 1 60  ? 11.485  -1.291  -4.626  1.00 0.52  ? 101 GLY A C    1 
ATOM 896  O O    . GLY A 1 60  ? 12.442  -2.047  -4.465  1.00 0.55  ? 101 GLY A O    1 
ATOM 897  H H    . GLY A 1 60  ? 9.578   1.004   -3.384  1.00 0.53  ? 101 GLY A H    1 
ATOM 898  H HA2  . GLY A 1 60  ? 11.191  -1.081  -2.531  1.00 0.60  ? 101 GLY A HA2  1 
ATOM 899  H HA3  . GLY A 1 60  ? 9.711   -1.288  -3.454  1.00 0.60  ? 101 GLY A HA3  1 
ATOM 900  N N    . ASP A 1 61  ? 11.100  -0.854  -5.820  1.00 0.51  ? 102 ASP A N    1 
ATOM 901  C CA   . ASP A 1 61  ? 11.796  -1.249  -7.039  1.00 0.54  ? 102 ASP A CA   1 
ATOM 902  C C    . ASP A 1 61  ? 13.164  -0.581  -7.124  1.00 0.59  ? 102 ASP A C    1 
ATOM 903  O O    . ASP A 1 61  ? 14.167  -1.231  -7.419  1.00 0.65  ? 102 ASP A O    1 
ATOM 904  C CB   . ASP A 1 61  ? 10.961  -0.884  -8.268  1.00 0.55  ? 102 ASP A CB   1 
ATOM 905  C CG   . ASP A 1 61  ? 10.935  -1.994  -9.300  1.00 1.30  ? 102 ASP A CG   1 
ATOM 906  O OD1  . ASP A 1 61  ? 11.761  -2.926  -9.191  1.00 1.96  ? 102 ASP A OD1  1 
ATOM 907  O OD2  . ASP A 1 61  ? 10.090  -1.933  -10.217 1.00 2.06  ? 102 ASP A OD2  1 
ATOM 908  H H    . ASP A 1 61  ? 10.329  -0.251  -5.883  1.00 0.50  ? 102 ASP A H    1 
ATOM 909  H HA   . ASP A 1 61  ? 11.932  -2.319  -7.012  1.00 0.57  ? 102 ASP A HA   1 
ATOM 910  H HB2  . ASP A 1 61  ? 9.946   -0.682  -7.959  1.00 0.86  ? 102 ASP A HB2  1 
ATOM 911  H HB3  . ASP A 1 61  ? 11.376  0.001   -8.728  1.00 0.94  ? 102 ASP A HB3  1 
ATOM 912  N N    . ASP A 1 62  ? 13.197  0.722   -6.865  1.00 0.61  ? 103 ASP A N    1 
ATOM 913  C CA   . ASP A 1 62  ? 14.441  1.481   -6.913  1.00 0.70  ? 103 ASP A CA   1 
ATOM 914  C C    . ASP A 1 62  ? 15.459  0.931   -5.919  1.00 0.69  ? 103 ASP A C    1 
ATOM 915  O O    . ASP A 1 62  ? 16.667  1.012   -6.144  1.00 0.78  ? 103 ASP A O    1 
ATOM 916  C CB   . ASP A 1 62  ? 14.172  2.958   -6.619  1.00 0.75  ? 103 ASP A CB   1 
ATOM 917  C CG   . ASP A 1 62  ? 15.133  3.877   -7.347  1.00 1.24  ? 103 ASP A CG   1 
ATOM 918  O OD1  . ASP A 1 62  ? 14.939  4.098   -8.561  1.00 1.81  ? 103 ASP A OD1  1 
ATOM 919  O OD2  . ASP A 1 62  ? 16.080  4.375   -6.703  1.00 1.88  ? 103 ASP A OD2  1 
ATOM 920  H H    . ASP A 1 62  ? 12.363  1.184   -6.638  1.00 0.60  ? 103 ASP A H    1 
ATOM 921  H HA   . ASP A 1 62  ? 14.845  1.390   -7.910  1.00 0.78  ? 103 ASP A HA   1 
ATOM 922  H HB2  . ASP A 1 62  ? 13.166  3.202   -6.928  1.00 0.94  ? 103 ASP A HB2  1 
ATOM 923  H HB3  . ASP A 1 62  ? 14.270  3.131   -5.558  1.00 1.03  ? 103 ASP A HB3  1 
ATOM 924  N N    . PHE A 1 63  ? 14.966  0.373   -4.817  1.00 0.63  ? 104 PHE A N    1 
ATOM 925  C CA   . PHE A 1 63  ? 15.836  -0.188  -3.789  1.00 0.63  ? 104 PHE A CA   1 
ATOM 926  C C    . PHE A 1 63  ? 16.078  -1.675  -4.027  1.00 0.66  ? 104 PHE A C    1 
ATOM 927  O O    . PHE A 1 63  ? 17.219  -2.109  -4.187  1.00 0.90  ? 104 PHE A O    1 
ATOM 928  C CB   . PHE A 1 63  ? 15.227  0.024   -2.403  1.00 0.61  ? 104 PHE A CB   1 
ATOM 929  C CG   . PHE A 1 63  ? 15.915  -0.758  -1.321  1.00 0.67  ? 104 PHE A CG   1 
ATOM 930  C CD1  . PHE A 1 63  ? 17.065  -0.270  -0.722  1.00 1.34  ? 104 PHE A CD1  1 
ATOM 931  C CD2  . PHE A 1 63  ? 15.412  -1.979  -0.903  1.00 1.30  ? 104 PHE A CD2  1 
ATOM 932  C CE1  . PHE A 1 63  ? 17.701  -0.986  0.275   1.00 1.44  ? 104 PHE A CE1  1 
ATOM 933  C CE2  . PHE A 1 63  ? 16.044  -2.700  0.092   1.00 1.48  ? 104 PHE A CE2  1 
ATOM 934  C CZ   . PHE A 1 63  ? 17.190  -2.203  0.682   1.00 1.10  ? 104 PHE A CZ   1 
ATOM 935  H H    . PHE A 1 63  ? 13.995  0.338   -4.692  1.00 0.63  ? 104 PHE A H    1 
ATOM 936  H HA   . PHE A 1 63  ? 16.782  0.330   -3.839  1.00 0.66  ? 104 PHE A HA   1 
ATOM 937  H HB2  . PHE A 1 63  ? 15.287  1.071   -2.147  1.00 0.72  ? 104 PHE A HB2  1 
ATOM 938  H HB3  . PHE A 1 63  ? 14.190  -0.278  -2.424  1.00 0.63  ? 104 PHE A HB3  1 
ATOM 939  H HD1  . PHE A 1 63  ? 17.466  0.681   -1.039  1.00 2.09  ? 104 PHE A HD1  1 
ATOM 940  H HD2  . PHE A 1 63  ? 14.517  -2.369  -1.364  1.00 2.02  ? 104 PHE A HD2  1 
ATOM 941  H HE1  . PHE A 1 63  ? 18.597  -0.595  0.733   1.00 2.18  ? 104 PHE A HE1  1 
ATOM 942  H HE2  . PHE A 1 63  ? 15.642  -3.651  0.409   1.00 2.25  ? 104 PHE A HE2  1 
ATOM 943  H HZ   . PHE A 1 63  ? 17.685  -2.765  1.460   1.00 1.31  ? 104 PHE A HZ   1 
ATOM 944  N N    . SER A 1 64  ? 14.998  -2.451  -4.044  1.00 0.59  ? 105 SER A N    1 
ATOM 945  C CA   . SER A 1 64  ? 15.091  -3.891  -4.258  1.00 0.65  ? 105 SER A CA   1 
ATOM 946  C C    . SER A 1 64  ? 15.997  -4.210  -5.444  1.00 0.70  ? 105 SER A C    1 
ATOM 947  O O    . SER A 1 64  ? 16.730  -5.198  -5.429  1.00 0.75  ? 105 SER A O    1 
ATOM 948  C CB   . SER A 1 64  ? 13.701  -4.486  -4.489  1.00 0.70  ? 105 SER A CB   1 
ATOM 949  O OG   . SER A 1 64  ? 13.780  -5.870  -4.783  1.00 1.07  ? 105 SER A OG   1 
ATOM 950  H H    . SER A 1 64  ? 14.117  -2.044  -3.904  1.00 0.65  ? 105 SER A H    1 
ATOM 951  H HA   . SER A 1 64  ? 15.517  -4.331  -3.368  1.00 0.67  ? 105 SER A HA   1 
ATOM 952  H HB2  . SER A 1 64  ? 13.103  -4.354  -3.600  1.00 0.95  ? 105 SER A HB2  1 
ATOM 953  H HB3  . SER A 1 64  ? 13.229  -3.980  -5.319  1.00 0.95  ? 105 SER A HB3  1 
ATOM 954  H HG   . SER A 1 64  ? 13.517  -6.020  -5.694  1.00 1.40  ? 105 SER A HG   1 
ATOM 955  N N    . ARG A 1 65  ? 15.941  -3.366  -6.469  1.00 0.73  ? 106 ARG A N    1 
ATOM 956  C CA   . ARG A 1 65  ? 16.758  -3.557  -7.662  1.00 0.81  ? 106 ARG A CA   1 
ATOM 957  C C    . ARG A 1 65  ? 18.208  -3.159  -7.401  1.00 0.81  ? 106 ARG A C    1 
ATOM 958  O O    . ARG A 1 65  ? 19.129  -3.699  -8.015  1.00 0.86  ? 106 ARG A O    1 
ATOM 959  C CB   . ARG A 1 65  ? 16.196  -2.741  -8.827  1.00 0.89  ? 106 ARG A CB   1 
ATOM 960  C CG   . ARG A 1 65  ? 14.859  -3.251  -9.338  1.00 1.12  ? 106 ARG A CG   1 
ATOM 961  C CD   . ARG A 1 65  ? 14.354  -2.419  -10.506 1.00 1.58  ? 106 ARG A CD   1 
ATOM 962  N NE   . ARG A 1 65  ? 15.228  -2.525  -11.672 1.00 1.92  ? 106 ARG A NE   1 
ATOM 963  C CZ   . ARG A 1 65  ? 15.237  -1.651  -12.677 1.00 2.21  ? 106 ARG A CZ   1 
ATOM 964  N NH1  . ARG A 1 65  ? 14.422  -0.603  -12.667 1.00 2.24  ? 106 ARG A NH1  1 
ATOM 965  N NH2  . ARG A 1 65  ? 16.066  -1.826  -13.697 1.00 3.08  ? 106 ARG A NH2  1 
ATOM 966  H H    . ARG A 1 65  ? 15.337  -2.595  -6.422  1.00 0.70  ? 106 ARG A H    1 
ATOM 967  H HA   . ARG A 1 65  ? 16.726  -4.605  -7.920  1.00 0.86  ? 106 ARG A HA   1 
ATOM 968  H HB2  . ARG A 1 65  ? 16.068  -1.717  -8.506  1.00 0.92  ? 106 ARG A HB2  1 
ATOM 969  H HB3  . ARG A 1 65  ? 16.903  -2.766  -9.644  1.00 1.13  ? 106 ARG A HB3  1 
ATOM 970  H HG2  . ARG A 1 65  ? 14.975  -4.274  -9.663  1.00 1.25  ? 106 ARG A HG2  1 
ATOM 971  H HG3  . ARG A 1 65  ? 14.137  -3.205  -8.536  1.00 1.32  ? 106 ARG A HG3  1 
ATOM 972  H HD2  . ARG A 1 65  ? 13.367  -2.763  -10.776 1.00 2.06  ? 106 ARG A HD2  1 
ATOM 973  H HD3  . ARG A 1 65  ? 14.303  -1.385  -10.199 1.00 2.11  ? 106 ARG A HD3  1 
ATOM 974  H HE   . ARG A 1 65  ? 15.841  -3.289  -11.709 1.00 2.47  ? 106 ARG A HE   1 
ATOM 975  H HH11 . ARG A 1 65  ? 13.793  -0.461  -11.903 1.00 2.18  ? 106 ARG A HH11 1 
ATOM 976  H HH12 . ARG A 1 65  ? 14.437  0.048   -13.426 1.00 2.77  ? 106 ARG A HH12 1 
ATOM 977  H HH21 . ARG A 1 65  ? 16.682  -2.613  -13.711 1.00 3.57  ? 106 ARG A HH21 1 
ATOM 978  H HH22 . ARG A 1 65  ? 16.074  -1.170  -14.452 1.00 3.46  ? 106 ARG A HH22 1 
ATOM 979  N N    . ARG A 1 66  ? 18.406  -2.214  -6.487  1.00 0.79  ? 107 ARG A N    1 
ATOM 980  C CA   . ARG A 1 66  ? 19.746  -1.748  -6.148  1.00 0.83  ? 107 ARG A CA   1 
ATOM 981  C C    . ARG A 1 66  ? 20.603  -2.896  -5.625  1.00 0.82  ? 107 ARG A C    1 
ATOM 982  O O    . ARG A 1 66  ? 21.747  -3.069  -6.043  1.00 0.85  ? 107 ARG A O    1 
ATOM 983  C CB   . ARG A 1 66  ? 19.672  -0.633  -5.103  1.00 0.84  ? 107 ARG A CB   1 
ATOM 984  C CG   . ARG A 1 66  ? 20.964  0.156   -4.964  1.00 0.97  ? 107 ARG A CG   1 
ATOM 985  C CD   . ARG A 1 66  ? 21.371  0.306   -3.507  1.00 1.12  ? 107 ARG A CD   1 
ATOM 986  N NE   . ARG A 1 66  ? 22.472  1.251   -3.340  1.00 1.65  ? 107 ARG A NE   1 
ATOM 987  C CZ   . ARG A 1 66  ? 22.895  1.699   -2.159  1.00 2.22  ? 107 ARG A CZ   1 
ATOM 988  N NH1  . ARG A 1 66  ? 22.316  1.292   -1.036  1.00 2.62  ? 107 ARG A NH1  1 
ATOM 989  N NH2  . ARG A 1 66  ? 23.904  2.559   -2.102  1.00 3.04  ? 107 ARG A NH2  1 
ATOM 990  H H    . ARG A 1 66  ? 17.635  -1.821  -6.028  1.00 0.76  ? 107 ARG A H    1 
ATOM 991  H HA   . ARG A 1 66  ? 20.198  -1.358  -7.047  1.00 0.89  ? 107 ARG A HA   1 
ATOM 992  H HB2  . ARG A 1 66  ? 18.885  0.052   -5.379  1.00 0.92  ? 107 ARG A HB2  1 
ATOM 993  H HB3  . ARG A 1 66  ? 19.437  -1.070  -4.143  1.00 0.78  ? 107 ARG A HB3  1 
ATOM 994  H HG2  . ARG A 1 66  ? 21.749  -0.361  -5.495  1.00 1.11  ? 107 ARG A HG2  1 
ATOM 995  H HG3  . ARG A 1 66  ? 20.822  1.138   -5.392  1.00 1.15  ? 107 ARG A HG3  1 
ATOM 996  H HD2  . ARG A 1 66  ? 20.520  0.656   -2.943  1.00 1.47  ? 107 ARG A HD2  1 
ATOM 997  H HD3  . ARG A 1 66  ? 21.678  -0.660  -3.131  1.00 1.50  ? 107 ARG A HD3  1 
ATOM 998  H HE   . ARG A 1 66  ? 22.920  1.571   -4.151  1.00 2.19  ? 107 ARG A HE   1 
ATOM 999  H HH11 . ARG A 1 66  ? 21.555  0.644   -1.068  1.00 2.54  ? 107 ARG A HH11 1 
ATOM 1000 H HH12 . ARG A 1 66  ? 22.642  1.634   -0.155  1.00 3.38  ? 107 ARG A HH12 1 
ATOM 1001 H HH21 . ARG A 1 66  ? 24.345  2.869   -2.944  1.00 3.36  ? 107 ARG A HH21 1 
ATOM 1002 H HH22 . ARG A 1 66  ? 24.223  2.896   -1.216  1.00 3.59  ? 107 ARG A HH22 1 
ATOM 1003 N N    . TYR A 1 67  ? 20.042  -3.678  -4.708  1.00 0.80  ? 108 TYR A N    1 
ATOM 1004 C CA   . TYR A 1 67  ? 20.759  -4.810  -4.131  1.00 0.83  ? 108 TYR A CA   1 
ATOM 1005 C C    . TYR A 1 67  ? 20.747  -6.002  -5.082  1.00 0.88  ? 108 TYR A C    1 
ATOM 1006 O O    . TYR A 1 67  ? 21.776  -6.367  -5.650  1.00 0.93  ? 108 TYR A O    1 
ATOM 1007 C CB   . TYR A 1 67  ? 20.133  -5.207  -2.793  1.00 0.82  ? 108 TYR A CB   1 
ATOM 1008 C CG   . TYR A 1 67  ? 20.741  -4.498  -1.604  1.00 0.83  ? 108 TYR A CG   1 
ATOM 1009 C CD1  . TYR A 1 67  ? 21.983  -4.875  -1.109  1.00 1.31  ? 108 TYR A CD1  1 
ATOM 1010 C CD2  . TYR A 1 67  ? 20.073  -3.454  -0.978  1.00 1.19  ? 108 TYR A CD2  1 
ATOM 1011 C CE1  . TYR A 1 67  ? 22.542  -4.231  -0.022  1.00 1.35  ? 108 TYR A CE1  1 
ATOM 1012 C CE2  . TYR A 1 67  ? 20.627  -2.804  0.109   1.00 1.24  ? 108 TYR A CE2  1 
ATOM 1013 C CZ   . TYR A 1 67  ? 21.860  -3.197  0.583   1.00 0.95  ? 108 TYR A CZ   1 
ATOM 1014 O OH   . TYR A 1 67  ? 22.414  -2.552  1.665   1.00 1.05  ? 108 TYR A OH   1 
ATOM 1015 H H    . TYR A 1 67  ? 19.126  -3.491  -4.413  1.00 0.78  ? 108 TYR A H    1 
ATOM 1016 H HA   . TYR A 1 67  ? 21.782  -4.505  -3.965  1.00 0.85  ? 108 TYR A HA   1 
ATOM 1017 H HB2  . TYR A 1 67  ? 19.079  -4.974  -2.814  1.00 0.79  ? 108 TYR A HB2  1 
ATOM 1018 H HB3  . TYR A 1 67  ? 20.259  -6.270  -2.647  1.00 0.88  ? 108 TYR A HB3  1 
ATOM 1019 H HD1  . TYR A 1 67  ? 22.514  -5.685  -1.585  1.00 1.90  ? 108 TYR A HD1  1 
ATOM 1020 H HD2  . TYR A 1 67  ? 19.106  -3.149  -1.352  1.00 1.77  ? 108 TYR A HD2  1 
ATOM 1021 H HE1  . TYR A 1 67  ? 23.508  -4.539  0.349   1.00 1.96  ? 108 TYR A HE1  1 
ATOM 1022 H HE2  . TYR A 1 67  ? 20.092  -1.994  0.583   1.00 1.82  ? 108 TYR A HE2  1 
ATOM 1023 H HH   . TYR A 1 67  ? 21.973  -1.710  1.797   1.00 1.46  ? 108 TYR A HH   1 
ATOM 1024 N N    . ARG A 1 68  ? 19.575  -6.606  -5.247  1.00 0.90  ? 109 ARG A N    1 
ATOM 1025 C CA   . ARG A 1 68  ? 19.426  -7.761  -6.127  1.00 0.99  ? 109 ARG A CA   1 
ATOM 1026 C C    . ARG A 1 68  ? 20.208  -8.972  -5.611  1.00 1.01  ? 109 ARG A C    1 
ATOM 1027 O O    . ARG A 1 68  ? 20.403  -9.944  -6.341  1.00 1.08  ? 109 ARG A O    1 
ATOM 1028 C CB   . ARG A 1 68  ? 19.889  -7.408  -7.541  1.00 1.05  ? 109 ARG A CB   1 
ATOM 1029 C CG   . ARG A 1 68  ? 18.922  -7.853  -8.626  1.00 1.63  ? 109 ARG A CG   1 
ATOM 1030 C CD   . ARG A 1 68  ? 19.349  -7.350  -9.995  1.00 2.00  ? 109 ARG A CD   1 
ATOM 1031 N NE   . ARG A 1 68  ? 18.639  -8.034  -11.073 1.00 1.71  ? 109 ARG A NE   1 
ATOM 1032 C CZ   . ARG A 1 68  ? 19.023  -8.013  -12.348 1.00 2.17  ? 109 ARG A CZ   1 
ATOM 1033 N NH1  . ARG A 1 68  ? 20.109  -7.343  -12.715 1.00 2.98  ? 109 ARG A NH1  1 
ATOM 1034 N NH2  . ARG A 1 68  ? 18.318  -8.666  -13.262 1.00 2.38  ? 109 ARG A NH2  1 
ATOM 1035 H H    . ARG A 1 68  ? 18.793  -6.270  -4.761  1.00 0.86  ? 109 ARG A H    1 
ATOM 1036 H HA   . ARG A 1 68  ? 18.377  -8.015  -6.159  1.00 1.03  ? 109 ARG A HA   1 
ATOM 1037 H HB2  . ARG A 1 68  ? 20.009  -6.337  -7.612  1.00 1.32  ? 109 ARG A HB2  1 
ATOM 1038 H HB3  . ARG A 1 68  ? 20.843  -7.882  -7.724  1.00 1.23  ? 109 ARG A HB3  1 
ATOM 1039 H HG2  . ARG A 1 68  ? 18.888  -8.932  -8.645  1.00 2.10  ? 109 ARG A HG2  1 
ATOM 1040 H HG3  . ARG A 1 68  ? 17.940  -7.464  -8.400  1.00 2.11  ? 109 ARG A HG3  1 
ATOM 1041 H HD2  . ARG A 1 68  ? 19.144  -6.292  -10.057 1.00 2.57  ? 109 ARG A HD2  1 
ATOM 1042 H HD3  . ARG A 1 68  ? 20.410  -7.518  -10.112 1.00 2.58  ? 109 ARG A HD3  1 
ATOM 1043 H HE   . ARG A 1 68  ? 17.833  -8.537  -10.835 1.00 1.75  ? 109 ARG A HE   1 
ATOM 1044 H HH11 . ARG A 1 68  ? 20.648  -6.847  -12.035 1.00 3.25  ? 109 ARG A HH11 1 
ATOM 1045 H HH12 . ARG A 1 68  ? 20.389  -7.334  -13.675 1.00 3.55  ? 109 ARG A HH12 1 
ATOM 1046 H HH21 . ARG A 1 68  ? 17.499  -9.173  -12.992 1.00 2.40  ? 109 ARG A HH21 1 
ATOM 1047 H HH22 . ARG A 1 68  ? 18.604  -8.652  -14.219 1.00 2.90  ? 109 ARG A HH22 1 
ATOM 1048 N N    . GLY A 1 69  ? 20.654  -8.918  -4.355  1.00 0.97  ? 110 GLY A N    1 
ATOM 1049 C CA   . GLY A 1 69  ? 21.403  -10.025 -3.791  1.00 1.00  ? 110 GLY A CA   1 
ATOM 1050 C C    . GLY A 1 69  ? 20.591  -10.823 -2.789  1.00 0.93  ? 110 GLY A C    1 
ATOM 1051 O O    . GLY A 1 69  ? 20.613  -12.053 -2.801  1.00 1.05  ? 110 GLY A O    1 
ATOM 1052 H H    . GLY A 1 69  ? 20.474  -8.127  -3.809  1.00 0.92  ? 110 GLY A H    1 
ATOM 1053 H HA2  . GLY A 1 69  ? 21.713  -10.681 -4.590  1.00 1.15  ? 110 GLY A HA2  1 
ATOM 1054 H HA3  . GLY A 1 69  ? 22.281  -9.636  -3.297  1.00 1.02  ? 110 GLY A HA3  1 
ATOM 1055 N N    . ASP A 1 70  ? 19.871  -10.119 -1.922  1.00 0.89  ? 111 ASP A N    1 
ATOM 1056 C CA   . ASP A 1 70  ? 19.045  -10.765 -0.909  1.00 0.92  ? 111 ASP A CA   1 
ATOM 1057 C C    . ASP A 1 70  ? 17.568  -10.495 -1.162  1.00 0.98  ? 111 ASP A C    1 
ATOM 1058 O O    . ASP A 1 70  ? 17.197  -9.965  -2.210  1.00 1.89  ? 111 ASP A O    1 
ATOM 1059 C CB   . ASP A 1 70  ? 19.435  -10.273 0.486   1.00 0.95  ? 111 ASP A CB   1 
ATOM 1060 C CG   . ASP A 1 70  ? 20.936  -10.124 0.647   1.00 1.48  ? 111 ASP A CG   1 
ATOM 1061 O OD1  . ASP A 1 70  ? 21.519  -9.239  -0.013  1.00 2.26  ? 111 ASP A OD1  1 
ATOM 1062 O OD2  . ASP A 1 70  ? 21.528  -10.894 1.433   1.00 2.10  ? 111 ASP A OD2  1 
ATOM 1063 H H    . ASP A 1 70  ? 19.895  -9.140  -1.966  1.00 0.94  ? 111 ASP A H    1 
ATOM 1064 H HA   . ASP A 1 70  ? 19.218  -11.827 -0.967  1.00 0.99  ? 111 ASP A HA   1 
ATOM 1065 H HB2  . ASP A 1 70  ? 18.976  -9.312  0.663   1.00 1.47  ? 111 ASP A HB2  1 
ATOM 1066 H HB3  . ASP A 1 70  ? 19.080  -10.979 1.222   1.00 1.33  ? 111 ASP A HB3  1 
ATOM 1067 N N    . PHE A 1 71  ? 16.731  -10.867 -0.197  1.00 0.56  ? 112 PHE A N    1 
ATOM 1068 C CA   . PHE A 1 71  ? 15.289  -10.670 -0.299  1.00 0.53  ? 112 PHE A CA   1 
ATOM 1069 C C    . PHE A 1 71  ? 14.670  -11.564 -1.369  1.00 0.71  ? 112 PHE A C    1 
ATOM 1070 O O    . PHE A 1 71  ? 14.167  -12.644 -1.059  1.00 1.57  ? 112 PHE A O    1 
ATOM 1071 C CB   . PHE A 1 71  ? 14.961  -9.203  -0.571  1.00 0.48  ? 112 PHE A CB   1 
ATOM 1072 C CG   . PHE A 1 71  ? 14.641  -8.438  0.675   1.00 0.43  ? 112 PHE A CG   1 
ATOM 1073 C CD1  . PHE A 1 71  ? 13.346  -8.392  1.158   1.00 1.11  ? 112 PHE A CD1  1 
ATOM 1074 C CD2  . PHE A 1 71  ? 15.639  -7.774  1.366   1.00 1.19  ? 112 PHE A CD2  1 
ATOM 1075 C CE1  . PHE A 1 71  ? 13.049  -7.693  2.312   1.00 1.18  ? 112 PHE A CE1  1 
ATOM 1076 C CE2  . PHE A 1 71  ? 15.350  -7.071  2.520   1.00 1.20  ? 112 PHE A CE2  1 
ATOM 1077 C CZ   . PHE A 1 71  ? 14.052  -7.030  2.993   1.00 0.59  ? 112 PHE A CZ   1 
ATOM 1078 H H    . PHE A 1 71  ? 17.086  -11.293 0.611   1.00 1.09  ? 112 PHE A H    1 
ATOM 1079 H HA   . PHE A 1 71  ? 14.863  -10.943 0.654   1.00 0.52  ? 112 PHE A HA   1 
ATOM 1080 H HB2  . PHE A 1 71  ? 15.806  -8.727  -1.043  1.00 0.50  ? 112 PHE A HB2  1 
ATOM 1081 H HB3  . PHE A 1 71  ? 14.105  -9.145  -1.227  1.00 0.55  ? 112 PHE A HB3  1 
ATOM 1082 H HD1  . PHE A 1 71  ? 12.563  -8.911  0.622   1.00 1.89  ? 112 PHE A HD1  1 
ATOM 1083 H HD2  . PHE A 1 71  ? 16.654  -7.809  0.994   1.00 2.00  ? 112 PHE A HD2  1 
ATOM 1084 H HE1  . PHE A 1 71  ? 12.035  -7.665  2.681   1.00 1.99  ? 112 PHE A HE1  1 
ATOM 1085 H HE2  . PHE A 1 71  ? 16.136  -6.554  3.050   1.00 1.98  ? 112 PHE A HE2  1 
ATOM 1086 H HZ   . PHE A 1 71  ? 13.822  -6.483  3.895   1.00 0.70  ? 112 PHE A HZ   1 
ATOM 1087 N N    . ALA A 1 72  ? 14.692  -11.111 -2.621  1.00 0.61  ? 113 ALA A N    1 
ATOM 1088 C CA   . ALA A 1 72  ? 14.115  -11.880 -3.717  1.00 0.68  ? 113 ALA A CA   1 
ATOM 1089 C C    . ALA A 1 72  ? 14.559  -13.338 -3.664  1.00 0.77  ? 113 ALA A C    1 
ATOM 1090 O O    . ALA A 1 72  ? 13.758  -14.231 -3.386  1.00 0.92  ? 113 ALA A O    1 
ATOM 1091 C CB   . ALA A 1 72  ? 14.493  -11.258 -5.053  1.00 0.73  ? 113 ALA A CB   1 
ATOM 1092 H H    . ALA A 1 72  ? 15.093  -10.239 -2.816  1.00 1.17  ? 113 ALA A H    1 
ATOM 1093 H HA   . ALA A 1 72  ? 13.040  -11.837 -3.618  1.00 0.74  ? 113 ALA A HA   1 
ATOM 1094 H HB1  . ALA A 1 72  ? 15.559  -11.093 -5.084  1.00 1.39  ? 113 ALA A HB1  1 
ATOM 1095 H HB2  . ALA A 1 72  ? 13.978  -10.316 -5.169  1.00 1.11  ? 113 ALA A HB2  1 
ATOM 1096 H HB3  . ALA A 1 72  ? 14.208  -11.925 -5.854  1.00 1.28  ? 113 ALA A HB3  1 
ATOM 1097 N N    . GLU A 1 73  ? 15.841  -13.574 -3.925  1.00 0.91  ? 114 GLU A N    1 
ATOM 1098 C CA   . GLU A 1 73  ? 16.387  -14.926 -3.897  1.00 1.05  ? 114 GLU A CA   1 
ATOM 1099 C C    . GLU A 1 73  ? 16.379  -15.482 -2.476  1.00 1.01  ? 114 GLU A C    1 
ATOM 1100 O O    . GLU A 1 73  ? 16.249  -16.689 -2.272  1.00 1.12  ? 114 GLU A O    1 
ATOM 1101 C CB   . GLU A 1 73  ? 17.812  -14.939 -4.457  1.00 1.28  ? 114 GLU A CB   1 
ATOM 1102 C CG   . GLU A 1 73  ? 18.794  -14.107 -3.649  1.00 2.14  ? 114 GLU A CG   1 
ATOM 1103 C CD   . GLU A 1 73  ? 20.226  -14.574 -3.816  1.00 2.64  ? 114 GLU A CD   1 
ATOM 1104 O OE1  . GLU A 1 73  ? 20.717  -14.587 -4.964  1.00 2.92  ? 114 GLU A OE1  1 
ATOM 1105 O OE2  . GLU A 1 73  ? 20.858  -14.927 -2.798  1.00 3.21  ? 114 GLU A OE2  1 
ATOM 1106 H H    . GLU A 1 73  ? 16.433  -12.822 -4.135  1.00 1.02  ? 114 GLU A H    1 
ATOM 1107 H HA   . GLU A 1 73  ? 15.760  -15.549 -4.518  1.00 1.13  ? 114 GLU A HA   1 
ATOM 1108 H HB2  . GLU A 1 73  ? 18.169  -15.958 -4.476  1.00 1.72  ? 114 GLU A HB2  1 
ATOM 1109 H HB3  . GLU A 1 73  ? 17.793  -14.555 -5.466  1.00 1.27  ? 114 GLU A HB3  1 
ATOM 1110 H HG2  . GLU A 1 73  ? 18.726  -13.079 -3.972  1.00 2.47  ? 114 GLU A HG2  1 
ATOM 1111 H HG3  . GLU A 1 73  ? 18.529  -14.173 -2.605  1.00 2.64  ? 114 GLU A HG3  1 
ATOM 1112 N N    . MET A 1 74  ? 16.510  -14.593 -1.496  1.00 0.98  ? 115 MET A N    1 
ATOM 1113 C CA   . MET A 1 74  ? 16.510  -14.993 -0.093  1.00 1.08  ? 115 MET A CA   1 
ATOM 1114 C C    . MET A 1 74  ? 15.233  -15.753 0.264   1.00 1.05  ? 115 MET A C    1 
ATOM 1115 O O    . MET A 1 74  ? 15.205  -16.511 1.234   1.00 1.11  ? 115 MET A O    1 
ATOM 1116 C CB   . MET A 1 74  ? 16.654  -13.764 0.806   1.00 1.27  ? 115 MET A CB   1 
ATOM 1117 C CG   . MET A 1 74  ? 16.584  -14.082 2.290   1.00 1.30  ? 115 MET A CG   1 
ATOM 1118 S SD   . MET A 1 74  ? 16.502  -12.600 3.314   1.00 1.45  ? 115 MET A SD   1 
ATOM 1119 C CE   . MET A 1 74  ? 14.861  -12.004 2.917   1.00 0.90  ? 115 MET A CE   1 
ATOM 1120 H H    . MET A 1 74  ? 16.606  -13.644 -1.720  1.00 0.97  ? 115 MET A H    1 
ATOM 1121 H HA   . MET A 1 74  ? 17.357  -15.643 0.065   1.00 1.14  ? 115 MET A HA   1 
ATOM 1122 H HB2  . MET A 1 74  ? 17.606  -13.295 0.604   1.00 1.64  ? 115 MET A HB2  1 
ATOM 1123 H HB3  . MET A 1 74  ? 15.863  -13.067 0.572   1.00 1.75  ? 115 MET A HB3  1 
ATOM 1124 H HG2  . MET A 1 74  ? 15.704  -14.679 2.475   1.00 1.87  ? 115 MET A HG2  1 
ATOM 1125 H HG3  . MET A 1 74  ? 17.464  -14.645 2.565   1.00 1.84  ? 115 MET A HG3  1 
ATOM 1126 H HE1  . MET A 1 74  ? 14.506  -12.493 2.021   1.00 1.58  ? 115 MET A HE1  1 
ATOM 1127 H HE2  . MET A 1 74  ? 14.895  -10.937 2.755   1.00 1.30  ? 115 MET A HE2  1 
ATOM 1128 H HE3  . MET A 1 74  ? 14.191  -12.223 3.736   1.00 1.17  ? 115 MET A HE3  1 
ATOM 1129 N N    . SER A 1 75  ? 14.176  -15.550 -0.524  1.00 1.07  ? 116 SER A N    1 
ATOM 1130 C CA   . SER A 1 75  ? 12.901  -16.219 -0.286  1.00 1.20  ? 116 SER A CA   1 
ATOM 1131 C C    . SER A 1 75  ? 13.008  -17.738 -0.457  1.00 1.08  ? 116 SER A C    1 
ATOM 1132 O O    . SER A 1 75  ? 12.100  -18.472 -0.067  1.00 1.15  ? 116 SER A O    1 
ATOM 1133 C CB   . SER A 1 75  ? 11.834  -15.668 -1.234  1.00 1.46  ? 116 SER A CB   1 
ATOM 1134 O OG   . SER A 1 75  ? 11.623  -16.542 -2.328  1.00 2.14  ? 116 SER A OG   1 
ATOM 1135 H H    . SER A 1 75  ? 14.253  -14.936 -1.282  1.00 1.05  ? 116 SER A H    1 
ATOM 1136 H HA   . SER A 1 75  ? 12.604  -16.007 0.730   1.00 1.32  ? 116 SER A HA   1 
ATOM 1137 H HB2  . SER A 1 75  ? 10.904  -15.552 -0.697  1.00 1.69  ? 116 SER A HB2  1 
ATOM 1138 H HB3  . SER A 1 75  ? 12.153  -14.707 -1.612  1.00 1.66  ? 116 SER A HB3  1 
ATOM 1139 H HG   . SER A 1 75  ? 11.929  -16.124 -3.136  1.00 2.40  ? 116 SER A HG   1 
ATOM 1140 N N    . SER A 1 76  ? 14.115  -18.214 -1.031  1.00 0.97  ? 117 SER A N    1 
ATOM 1141 C CA   . SER A 1 76  ? 14.310  -19.645 -1.229  1.00 0.98  ? 117 SER A CA   1 
ATOM 1142 C C    . SER A 1 76  ? 14.451  -20.361 0.111   1.00 0.85  ? 117 SER A C    1 
ATOM 1143 O O    . SER A 1 76  ? 14.071  -21.524 0.246   1.00 0.90  ? 117 SER A O    1 
ATOM 1144 C CB   . SER A 1 76  ? 15.550  -19.899 -2.089  1.00 1.05  ? 117 SER A CB   1 
ATOM 1145 O OG   . SER A 1 76  ? 15.643  -21.264 -2.459  1.00 1.64  ? 117 SER A OG   1 
ATOM 1146 H H    . SER A 1 76  ? 14.816  -17.597 -1.319  1.00 0.94  ? 117 SER A H    1 
ATOM 1147 H HA   . SER A 1 76  ? 13.441  -20.030 -1.742  1.00 1.14  ? 117 SER A HA   1 
ATOM 1148 H HB2  . SER A 1 76  ? 15.492  -19.300 -2.986  1.00 1.37  ? 117 SER A HB2  1 
ATOM 1149 H HB3  . SER A 1 76  ? 16.434  -19.628 -1.531  1.00 1.56  ? 117 SER A HB3  1 
ATOM 1150 H HG   . SER A 1 76  ? 16.491  -21.425 -2.879  1.00 1.96  ? 117 SER A HG   1 
ATOM 1151 N N    . GLN A 1 77  ? 14.997  -19.659 1.099   1.00 0.75  ? 118 GLN A N    1 
ATOM 1152 C CA   . GLN A 1 77  ? 15.186  -20.228 2.429   1.00 0.74  ? 118 GLN A CA   1 
ATOM 1153 C C    . GLN A 1 77  ? 13.873  -20.783 2.971   1.00 0.78  ? 118 GLN A C    1 
ATOM 1154 O O    . GLN A 1 77  ? 13.758  -21.978 3.244   1.00 0.98  ? 118 GLN A O    1 
ATOM 1155 C CB   . GLN A 1 77  ? 15.739  -19.169 3.386   1.00 0.90  ? 118 GLN A CB   1 
ATOM 1156 C CG   . GLN A 1 77  ? 17.065  -19.557 4.021   1.00 1.07  ? 118 GLN A CG   1 
ATOM 1157 C CD   . GLN A 1 77  ? 16.968  -19.706 5.527   1.00 1.80  ? 118 GLN A CD   1 
ATOM 1158 O OE1  . GLN A 1 77  ? 15.887  -19.924 6.073   1.00 2.52  ? 118 GLN A OE1  1 
ATOM 1159 N NE2  . GLN A 1 77  ? 18.103  -19.587 6.207   1.00 2.42  ? 118 GLN A NE2  1 
ATOM 1160 H H    . GLN A 1 77  ? 15.280  -18.735 0.931   1.00 0.77  ? 118 GLN A H    1 
ATOM 1161 H HA   . GLN A 1 77  ? 15.898  -21.035 2.347   1.00 0.74  ? 118 GLN A HA   1 
ATOM 1162 H HB2  . GLN A 1 77  ? 15.881  -18.248 2.841   1.00 1.14  ? 118 GLN A HB2  1 
ATOM 1163 H HB3  . GLN A 1 77  ? 15.021  -19.003 4.175   1.00 0.89  ? 118 GLN A HB3  1 
ATOM 1164 H HG2  . GLN A 1 77  ? 17.389  -20.498 3.602   1.00 1.46  ? 118 GLN A HG2  1 
ATOM 1165 H HG3  . GLN A 1 77  ? 17.794  -18.793 3.795   1.00 1.41  ? 118 GLN A HG3  1 
ATOM 1166 H HE21 . GLN A 1 77  ? 18.927  -19.412 5.706   1.00 2.56  ? 118 GLN A HE21 1 
ATOM 1167 H HE22 . GLN A 1 77  ? 18.070  -19.679 7.182   1.00 3.09  ? 118 GLN A HE22 1 
ATOM 1168 N N    . LEU A 1 78  ? 12.885  -19.908 3.123   1.00 0.83  ? 119 LEU A N    1 
ATOM 1169 C CA   . LEU A 1 78  ? 11.578  -20.309 3.630   1.00 0.95  ? 119 LEU A CA   1 
ATOM 1170 C C    . LEU A 1 78  ? 11.048  -21.517 2.866   1.00 0.98  ? 119 LEU A C    1 
ATOM 1171 O O    . LEU A 1 78  ? 11.312  -21.675 1.674   1.00 1.67  ? 119 LEU A O    1 
ATOM 1172 C CB   . LEU A 1 78  ? 10.589  -19.146 3.522   1.00 1.14  ? 119 LEU A CB   1 
ATOM 1173 C CG   . LEU A 1 78  ? 9.174   -19.447 4.019   1.00 1.19  ? 119 LEU A CG   1 
ATOM 1174 C CD1  . LEU A 1 78  ? 8.471   -18.166 4.440   1.00 1.71  ? 119 LEU A CD1  1 
ATOM 1175 C CD2  . LEU A 1 78  ? 8.373   -20.167 2.944   1.00 1.84  ? 119 LEU A CD2  1 
ATOM 1176 H H    . LEU A 1 78  ? 13.038  -18.969 2.887   1.00 0.94  ? 119 LEU A H    1 
ATOM 1177 H HA   . LEU A 1 78  ? 11.693  -20.577 4.670   1.00 1.03  ? 119 LEU A HA   1 
ATOM 1178 H HB2  . LEU A 1 78  ? 10.980  -18.316 4.093   1.00 1.71  ? 119 LEU A HB2  1 
ATOM 1179 H HB3  . LEU A 1 78  ? 10.527  -18.850 2.486   1.00 1.75  ? 119 LEU A HB3  1 
ATOM 1180 H HG   . LEU A 1 78  ? 9.233   -20.094 4.883   1.00 1.83  ? 119 LEU A HG   1 
ATOM 1181 H HD11 . LEU A 1 78  ? 7.793   -18.377 5.253   1.00 2.21  ? 119 LEU A HD11 1 
ATOM 1182 H HD12 . LEU A 1 78  ? 7.917   -17.768 3.602   1.00 2.17  ? 119 LEU A HD12 1 
ATOM 1183 H HD13 . LEU A 1 78  ? 9.205   -17.442 4.762   1.00 2.17  ? 119 LEU A HD13 1 
ATOM 1184 H HD21 . LEU A 1 78  ? 8.961   -20.230 2.040   1.00 2.25  ? 119 LEU A HD21 1 
ATOM 1185 H HD22 . LEU A 1 78  ? 7.464   -19.619 2.746   1.00 2.25  ? 119 LEU A HD22 1 
ATOM 1186 H HD23 . LEU A 1 78  ? 8.127   -21.162 3.284   1.00 2.35  ? 119 LEU A HD23 1 
ATOM 1187 N N    . HIS A 1 79  ? 10.298  -22.368 3.559   1.00 1.27  ? 120 HIS A N    1 
ATOM 1188 C CA   . HIS A 1 79  ? 9.731   -23.561 2.944   1.00 1.36  ? 120 HIS A CA   1 
ATOM 1189 C C    . HIS A 1 79  ? 8.665   -23.173 1.899   1.00 1.34  ? 120 HIS A C    1 
ATOM 1190 O O    . HIS A 1 79  ? 8.971   -22.428 0.968   1.00 2.24  ? 120 HIS A O    1 
ATOM 1191 C CB   . HIS A 1 79  ? 9.177   -24.487 4.035   1.00 1.59  ? 120 HIS A CB   1 
ATOM 1192 C CG   . HIS A 1 79  ? 8.894   -25.879 3.559   1.00 1.78  ? 120 HIS A CG   1 
ATOM 1193 N ND1  . HIS A 1 79  ? 8.485   -26.894 4.399   1.00 2.29  ? 120 HIS A ND1  1 
ATOM 1194 C CD2  . HIS A 1 79  ? 8.961   -26.423 2.320   1.00 2.33  ? 120 HIS A CD2  1 
ATOM 1195 C CE1  . HIS A 1 79  ? 8.313   -28.001 3.698   1.00 2.68  ? 120 HIS A CE1  1 
ATOM 1196 N NE2  . HIS A 1 79  ? 8.594   -27.741 2.434   1.00 2.66  ? 120 HIS A NE2  1 
ATOM 1197 H H    . HIS A 1 79  ? 10.122  -22.188 4.506   1.00 1.90  ? 120 HIS A H    1 
ATOM 1198 H HA   . HIS A 1 79  ? 10.535  -24.072 2.433   1.00 1.56  ? 120 HIS A HA   1 
ATOM 1199 H HB2  . HIS A 1 79  ? 9.897   -24.553 4.837   1.00 1.92  ? 120 HIS A HB2  1 
ATOM 1200 H HB3  . HIS A 1 79  ? 8.258   -24.071 4.421   1.00 1.87  ? 120 HIS A HB3  1 
ATOM 1201 H HD1  . HIS A 1 79  ? 8.343   -26.815 5.365   1.00 2.75  ? 120 HIS A HD1  1 
ATOM 1202 H HD2  . HIS A 1 79  ? 9.248   -25.913 1.412   1.00 2.91  ? 120 HIS A HD2  1 
ATOM 1203 H HE1  . HIS A 1 79  ? 7.994   -28.955 4.091   1.00 3.31  ? 120 HIS A HE1  1 
ATOM 1204 N N    . LEU A 1 80  ? 7.425   -23.662 2.034   1.00 0.99  ? 121 LEU A N    1 
ATOM 1205 C CA   . LEU A 1 80  ? 6.373   -23.334 1.079   1.00 1.04  ? 121 LEU A CA   1 
ATOM 1206 C C    . LEU A 1 80  ? 5.074   -24.038 1.454   1.00 1.09  ? 121 LEU A C    1 
ATOM 1207 O O    . LEU A 1 80  ? 4.883   -25.210 1.137   1.00 1.88  ? 121 LEU A O    1 
ATOM 1208 C CB   . LEU A 1 80  ? 6.792   -23.735 -0.338  1.00 1.47  ? 121 LEU A CB   1 
ATOM 1209 C CG   . LEU A 1 80  ? 6.481   -22.703 -1.423  1.00 1.43  ? 121 LEU A CG   1 
ATOM 1210 C CD1  . LEU A 1 80  ? 5.020   -22.283 -1.357  1.00 1.91  ? 121 LEU A CD1  1 
ATOM 1211 C CD2  . LEU A 1 80  ? 7.392   -21.493 -1.284  1.00 1.93  ? 121 LEU A CD2  1 
ATOM 1212 H H    . LEU A 1 80  ? 7.207   -24.250 2.779   1.00 1.43  ? 121 LEU A H    1 
ATOM 1213 H HA   . LEU A 1 80  ? 6.215   -22.266 1.111   1.00 1.27  ? 121 LEU A HA   1 
ATOM 1214 H HB2  . LEU A 1 80  ? 7.857   -23.917 -0.338  1.00 2.14  ? 121 LEU A HB2  1 
ATOM 1215 H HB3  . LEU A 1 80  ? 6.288   -24.654 -0.592  1.00 2.03  ? 121 LEU A HB3  1 
ATOM 1216 H HG   . LEU A 1 80  ? 6.657   -23.146 -2.392  1.00 1.85  ? 121 LEU A HG   1 
ATOM 1217 H HD11 . LEU A 1 80  ? 4.391   -23.156 -1.445  1.00 2.25  ? 121 LEU A HD11 1 
ATOM 1218 H HD12 . LEU A 1 80  ? 4.805   -21.602 -2.167  1.00 2.21  ? 121 LEU A HD12 1 
ATOM 1219 H HD13 . LEU A 1 80  ? 4.829   -21.794 -0.414  1.00 2.49  ? 121 LEU A HD13 1 
ATOM 1220 H HD21 . LEU A 1 80  ? 7.146   -20.768 -2.046  1.00 2.34  ? 121 LEU A HD21 1 
ATOM 1221 H HD22 . LEU A 1 80  ? 8.420   -21.802 -1.400  1.00 2.45  ? 121 LEU A HD22 1 
ATOM 1222 H HD23 . LEU A 1 80  ? 7.256   -21.051 -0.309  1.00 2.29  ? 121 LEU A HD23 1 
ATOM 1223 N N    . THR A 1 81  ? 4.185   -23.311 2.129   1.00 1.15  ? 122 THR A N    1 
ATOM 1224 C CA   . THR A 1 81  ? 2.894   -23.852 2.557   1.00 1.32  ? 122 THR A CA   1 
ATOM 1225 C C    . THR A 1 81  ? 2.229   -22.916 3.560   1.00 0.98  ? 122 THR A C    1 
ATOM 1226 O O    . THR A 1 81  ? 2.876   -22.034 4.125   1.00 0.95  ? 122 THR A O    1 
ATOM 1227 C CB   . THR A 1 81  ? 3.048   -25.242 3.189   1.00 1.86  ? 122 THR A CB   1 
ATOM 1228 O OG1  . THR A 1 81  ? 4.372   -25.457 3.645   1.00 2.15  ? 122 THR A OG1  1 
ATOM 1229 C CG2  . THR A 1 81  ? 2.690   -26.373 2.249   1.00 2.79  ? 122 THR A CG2  1 
ATOM 1230 H H    . THR A 1 81  ? 4.397   -22.377 2.339   1.00 1.66  ? 122 THR A H    1 
ATOM 1231 H HA   . THR A 1 81  ? 2.263   -23.930 1.685   1.00 1.77  ? 122 THR A HA   1 
ATOM 1232 H HB   . THR A 1 81  ? 2.387   -25.306 4.042   1.00 2.05  ? 122 THR A HB   1 
ATOM 1233 H HG1  . THR A 1 81  ? 4.350   -25.886 4.503   1.00 2.62  ? 122 THR A HG1  1 
ATOM 1234 H HG21 . THR A 1 81  ? 3.580   -26.935 2.007   1.00 3.31  ? 122 THR A HG21 1 
ATOM 1235 H HG22 . THR A 1 81  ? 2.264   -25.967 1.343   1.00 3.25  ? 122 THR A HG22 1 
ATOM 1236 H HG23 . THR A 1 81  ? 1.971   -27.023 2.725   1.00 3.02  ? 122 THR A HG23 1 
ATOM 1237 N N    . PRO A 1 82  ? 0.923   -23.102 3.801   1.00 1.25  ? 123 PRO A N    1 
ATOM 1238 C CA   . PRO A 1 82  ? 0.172   -22.277 4.751   1.00 1.45  ? 123 PRO A CA   1 
ATOM 1239 C C    . PRO A 1 82  ? 0.634   -22.494 6.189   1.00 1.38  ? 123 PRO A C    1 
ATOM 1240 O O    . PRO A 1 82  ? 0.488   -21.614 7.038   1.00 2.04  ? 123 PRO A O    1 
ATOM 1241 C CB   . PRO A 1 82  ? -1.274  -22.748 4.574   1.00 1.99  ? 123 PRO A CB   1 
ATOM 1242 C CG   . PRO A 1 82  ? -1.162  -24.127 4.022   1.00 2.19  ? 123 PRO A CG   1 
ATOM 1243 C CD   . PRO A 1 82  ? 0.081   -24.135 3.175   1.00 1.77  ? 123 PRO A CD   1 
ATOM 1244 H HA   . PRO A 1 82  ? 0.245   -21.227 4.506   1.00 1.53  ? 123 PRO A HA   1 
ATOM 1245 H HB2  . PRO A 1 82  ? -1.775  -22.745 5.531   1.00 2.04  ? 123 PRO A HB2  1 
ATOM 1246 H HB3  . PRO A 1 82  ? -1.789  -22.090 3.890   1.00 2.35  ? 123 PRO A HB3  1 
ATOM 1247 H HG2  . PRO A 1 82  ? -1.071  -24.839 4.828   1.00 2.44  ? 123 PRO A HG2  1 
ATOM 1248 H HG3  . PRO A 1 82  ? -2.028  -24.352 3.417   1.00 2.64  ? 123 PRO A HG3  1 
ATOM 1249 H HD2  . PRO A 1 82  ? 0.559   -25.102 3.218   1.00 1.91  ? 123 PRO A HD2  1 
ATOM 1250 H HD3  . PRO A 1 82  ? -0.156  -23.874 2.155   1.00 1.97  ? 123 PRO A HD3  1 
ATOM 1251 N N    . PHE A 1 83  ? 1.195   -23.672 6.456   1.00 1.15  ? 124 PHE A N    1 
ATOM 1252 C CA   . PHE A 1 83  ? 1.682   -24.005 7.790   1.00 1.22  ? 124 PHE A CA   1 
ATOM 1253 C C    . PHE A 1 83  ? 3.179   -23.716 7.924   1.00 1.20  ? 124 PHE A C    1 
ATOM 1254 O O    . PHE A 1 83  ? 3.850   -24.278 8.791   1.00 1.52  ? 124 PHE A O    1 
ATOM 1255 C CB   . PHE A 1 83  ? 1.407   -25.479 8.092   1.00 1.39  ? 124 PHE A CB   1 
ATOM 1256 C CG   . PHE A 1 83  ? 1.729   -25.877 9.505   1.00 2.02  ? 124 PHE A CG   1 
ATOM 1257 C CD1  . PHE A 1 83  ? 0.902   -25.499 10.550  1.00 2.82  ? 124 PHE A CD1  1 
ATOM 1258 C CD2  . PHE A 1 83  ? 2.857   -26.632 9.786   1.00 2.65  ? 124 PHE A CD2  1 
ATOM 1259 C CE1  . PHE A 1 83  ? 1.195   -25.865 11.850  1.00 3.74  ? 124 PHE A CE1  1 
ATOM 1260 C CE2  . PHE A 1 83  ? 3.155   -27.000 11.084  1.00 3.58  ? 124 PHE A CE2  1 
ATOM 1261 C CZ   . PHE A 1 83  ? 2.323   -26.617 12.117  1.00 3.98  ? 124 PHE A CZ   1 
ATOM 1262 H H    . PHE A 1 83  ? 1.285   -24.332 5.738   1.00 1.48  ? 124 PHE A H    1 
ATOM 1263 H HA   . PHE A 1 83  ? 1.145   -23.395 8.500   1.00 1.38  ? 124 PHE A HA   1 
ATOM 1264 H HB2  . PHE A 1 83  ? 0.361   -25.685 7.921   1.00 1.86  ? 124 PHE A HB2  1 
ATOM 1265 H HB3  . PHE A 1 83  ? 2.001   -26.092 7.430   1.00 1.45  ? 124 PHE A HB3  1 
ATOM 1266 H HD1  . PHE A 1 83  ? 0.020   -24.912 10.342  1.00 3.12  ? 124 PHE A HD1  1 
ATOM 1267 H HD2  . PHE A 1 83  ? 3.508   -26.932 8.978   1.00 2.86  ? 124 PHE A HD2  1 
ATOM 1268 H HE1  . PHE A 1 83  ? 0.542   -25.564 12.656  1.00 4.53  ? 124 PHE A HE1  1 
ATOM 1269 H HE2  . PHE A 1 83  ? 4.037   -27.589 11.289  1.00 4.28  ? 124 PHE A HE2  1 
ATOM 1270 H HZ   . PHE A 1 83  ? 2.553   -26.904 13.132  1.00 4.81  ? 124 PHE A HZ   1 
ATOM 1271 N N    . THR A 1 84  ? 3.702   -22.840 7.067   1.00 1.14  ? 125 THR A N    1 
ATOM 1272 C CA   . THR A 1 84  ? 5.118   -22.491 7.106   1.00 1.32  ? 125 THR A CA   1 
ATOM 1273 C C    . THR A 1 84  ? 5.309   -20.978 7.157   1.00 1.00  ? 125 THR A C    1 
ATOM 1274 O O    . THR A 1 84  ? 5.961   -20.458 8.063   1.00 0.94  ? 125 THR A O    1 
ATOM 1275 C CB   . THR A 1 84  ? 5.841   -23.068 5.889   1.00 1.74  ? 125 THR A CB   1 
ATOM 1276 O OG1  . THR A 1 84  ? 4.945   -23.235 4.805   1.00 2.19  ? 125 THR A OG1  1 
ATOM 1277 C CG2  . THR A 1 84  ? 6.490   -24.409 6.158   1.00 2.26  ? 125 THR A CG2  1 
ATOM 1278 H H    . THR A 1 84  ? 3.122   -22.421 6.397   1.00 1.24  ? 125 THR A H    1 
ATOM 1279 H HA   . THR A 1 84  ? 5.539   -22.924 8.001   1.00 1.58  ? 125 THR A HA   1 
ATOM 1280 H HB   . THR A 1 84  ? 6.618   -22.380 5.584   1.00 1.95  ? 125 THR A HB   1 
ATOM 1281 H HG1  . THR A 1 84  ? 5.371   -23.745 4.112   1.00 2.71  ? 125 THR A HG1  1 
ATOM 1282 H HG21 . THR A 1 84  ? 6.587   -24.955 5.232   1.00 2.53  ? 125 THR A HG21 1 
ATOM 1283 H HG22 . THR A 1 84  ? 5.878   -24.973 6.846   1.00 2.68  ? 125 THR A HG22 1 
ATOM 1284 H HG23 . THR A 1 84  ? 7.468   -24.255 6.590   1.00 2.66  ? 125 THR A HG23 1 
ATOM 1285 N N    . ALA A 1 85  ? 4.744   -20.281 6.175   1.00 0.97  ? 126 ALA A N    1 
ATOM 1286 C CA   . ALA A 1 85  ? 4.854   -18.827 6.099   1.00 0.82  ? 126 ALA A CA   1 
ATOM 1287 C C    . ALA A 1 85  ? 4.603   -18.173 7.454   1.00 0.86  ? 126 ALA A C    1 
ATOM 1288 O O    . ALA A 1 85  ? 5.270   -17.206 7.819   1.00 1.77  ? 126 ALA A O    1 
ATOM 1289 C CB   . ALA A 1 85  ? 3.883   -18.282 5.063   1.00 0.80  ? 126 ALA A CB   1 
ATOM 1290 H H    . ALA A 1 85  ? 4.245   -20.757 5.479   1.00 1.17  ? 126 ALA A H    1 
ATOM 1291 H HA   . ALA A 1 85  ? 5.856   -18.587 5.776   1.00 0.91  ? 126 ALA A HA   1 
ATOM 1292 H HB1  . ALA A 1 85  ? 4.012   -18.814 4.132   1.00 1.12  ? 126 ALA A HB1  1 
ATOM 1293 H HB2  . ALA A 1 85  ? 4.076   -17.231 4.907   1.00 1.35  ? 126 ALA A HB2  1 
ATOM 1294 H HB3  . ALA A 1 85  ? 2.870   -18.413 5.415   1.00 1.40  ? 126 ALA A HB3  1 
ATOM 1295 N N    . ARG A 1 86  ? 3.636   -18.704 8.195   1.00 0.59  ? 127 ARG A N    1 
ATOM 1296 C CA   . ARG A 1 86  ? 3.298   -18.167 9.509   1.00 0.65  ? 127 ARG A CA   1 
ATOM 1297 C C    . ARG A 1 86  ? 4.548   -17.967 10.361  1.00 0.64  ? 127 ARG A C    1 
ATOM 1298 O O    . ARG A 1 86  ? 4.940   -16.836 10.648  1.00 0.84  ? 127 ARG A O    1 
ATOM 1299 C CB   . ARG A 1 86  ? 2.322   -19.101 10.228  1.00 0.87  ? 127 ARG A CB   1 
ATOM 1300 C CG   . ARG A 1 86  ? 1.103   -18.389 10.793  1.00 1.05  ? 127 ARG A CG   1 
ATOM 1301 C CD   . ARG A 1 86  ? 1.486   -17.091 11.485  1.00 0.62  ? 127 ARG A CD   1 
ATOM 1302 N NE   . ARG A 1 86  ? 0.614   -16.798 12.620  1.00 1.18  ? 127 ARG A NE   1 
ATOM 1303 C CZ   . ARG A 1 86  ? 0.698   -15.692 13.357  1.00 1.67  ? 127 ARG A CZ   1 
ATOM 1304 N NH1  . ARG A 1 86  ? 1.614   -14.768 13.086  1.00 2.22  ? 127 ARG A NH1  1 
ATOM 1305 N NH2  . ARG A 1 86  ? -0.137  -15.508 14.371  1.00 2.27  ? 127 ARG A NH2  1 
ATOM 1306 H H    . ARG A 1 86  ? 3.137   -19.474 7.850   1.00 1.19  ? 127 ARG A H    1 
ATOM 1307 H HA   . ARG A 1 86  ? 2.821   -17.210 9.362   1.00 0.74  ? 127 ARG A HA   1 
ATOM 1308 H HB2  . ARG A 1 86  ? 1.983   -19.854 9.532   1.00 1.23  ? 127 ARG A HB2  1 
ATOM 1309 H HB3  . ARG A 1 86  ? 2.840   -19.584 11.044  1.00 1.17  ? 127 ARG A HB3  1 
ATOM 1310 H HG2  . ARG A 1 86  ? 0.422   -18.167 9.985   1.00 1.72  ? 127 ARG A HG2  1 
ATOM 1311 H HG3  . ARG A 1 86  ? 0.619   -19.039 11.507  1.00 1.81  ? 127 ARG A HG3  1 
ATOM 1312 H HD2  . ARG A 1 86  ? 2.504   -17.172 11.837  1.00 1.08  ? 127 ARG A HD2  1 
ATOM 1313 H HD3  . ARG A 1 86  ? 1.416   -16.283 10.771  1.00 1.08  ? 127 ARG A HD3  1 
ATOM 1314 H HE   . ARG A 1 86  ? -0.072  -17.460 12.845  1.00 1.76  ? 127 ARG A HE   1 
ATOM 1315 H HH11 . ARG A 1 86  ? 2.248   -14.897 12.325  1.00 2.27  ? 127 ARG A HH11 1 
ATOM 1316 H HH12 . ARG A 1 86  ? 1.668   -13.941 13.646  1.00 2.90  ? 127 ARG A HH12 1 
ATOM 1317 H HH21 . ARG A 1 86  ? -0.829  -16.199 14.580  1.00 2.57  ? 127 ARG A HH21 1 
ATOM 1318 H HH22 . ARG A 1 86  ? -0.075  -14.678 14.926  1.00 2.71  ? 127 ARG A HH22 1 
ATOM 1319 N N    . GLY A 1 87  ? 5.167   -19.071 10.766  1.00 0.53  ? 128 GLY A N    1 
ATOM 1320 C CA   . GLY A 1 87  ? 6.363   -18.994 11.585  1.00 0.54  ? 128 GLY A CA   1 
ATOM 1321 C C    . GLY A 1 87  ? 7.496   -18.252 10.902  1.00 0.47  ? 128 GLY A C    1 
ATOM 1322 O O    . GLY A 1 87  ? 7.987   -17.247 11.418  1.00 0.65  ? 128 GLY A O    1 
ATOM 1323 H H    . GLY A 1 87  ? 4.807   -19.946 10.510  1.00 0.58  ? 128 GLY A H    1 
ATOM 1324 H HA2  . GLY A 1 87  ? 6.121   -18.486 12.507  1.00 0.62  ? 128 GLY A HA2  1 
ATOM 1325 H HA3  . GLY A 1 87  ? 6.692   -19.996 11.816  1.00 0.59  ? 128 GLY A HA3  1 
ATOM 1326 N N    . ARG A 1 88  ? 7.917   -18.750 9.743   1.00 0.46  ? 129 ARG A N    1 
ATOM 1327 C CA   . ARG A 1 88  ? 9.005   -18.132 8.992   1.00 0.43  ? 129 ARG A CA   1 
ATOM 1328 C C    . ARG A 1 88  ? 8.814   -16.622 8.884   1.00 0.39  ? 129 ARG A C    1 
ATOM 1329 O O    . ARG A 1 88  ? 9.764   -15.855 9.040   1.00 0.46  ? 129 ARG A O    1 
ATOM 1330 C CB   . ARG A 1 88  ? 9.103   -18.748 7.595   1.00 0.47  ? 129 ARG A CB   1 
ATOM 1331 C CG   . ARG A 1 88  ? 10.320  -19.639 7.409   1.00 0.84  ? 129 ARG A CG   1 
ATOM 1332 C CD   . ARG A 1 88  ? 10.087  -21.028 7.981   1.00 0.87  ? 129 ARG A CD   1 
ATOM 1333 N NE   . ARG A 1 88  ? 11.333  -21.777 8.125   1.00 1.42  ? 129 ARG A NE   1 
ATOM 1334 C CZ   . ARG A 1 88  ? 12.192  -21.607 9.128   1.00 1.85  ? 129 ARG A CZ   1 
ATOM 1335 N NH1  . ARG A 1 88  ? 11.948  -20.714 10.081  1.00 2.23  ? 129 ARG A NH1  1 
ATOM 1336 N NH2  . ARG A 1 88  ? 13.300  -22.333 9.179   1.00 2.65  ? 129 ARG A NH2  1 
ATOM 1337 H H    . ARG A 1 88  ? 7.488   -19.556 9.387   1.00 0.62  ? 129 ARG A H    1 
ATOM 1338 H HA   . ARG A 1 88  ? 9.924   -18.327 9.524   1.00 0.46  ? 129 ARG A HA   1 
ATOM 1339 H HB2  . ARG A 1 88  ? 8.218   -19.341 7.413   1.00 0.66  ? 129 ARG A HB2  1 
ATOM 1340 H HB3  . ARG A 1 88  ? 9.150   -17.953 6.866   1.00 0.66  ? 129 ARG A HB3  1 
ATOM 1341 H HG2  . ARG A 1 88  ? 10.533  -19.726 6.354   1.00 1.59  ? 129 ARG A HG2  1 
ATOM 1342 H HG3  . ARG A 1 88  ? 11.164  -19.188 7.912   1.00 1.58  ? 129 ARG A HG3  1 
ATOM 1343 H HD2  . ARG A 1 88  ? 9.623   -20.930 8.951   1.00 1.49  ? 129 ARG A HD2  1 
ATOM 1344 H HD3  . ARG A 1 88  ? 9.426   -21.569 7.319   1.00 1.55  ? 129 ARG A HD3  1 
ATOM 1345 H HE   . ARG A 1 88  ? 11.541  -22.444 7.437   1.00 2.10  ? 129 ARG A HE   1 
ATOM 1346 H HH11 . ARG A 1 88  ? 11.115  -20.162 10.052  1.00 2.24  ? 129 ARG A HH11 1 
ATOM 1347 H HH12 . ARG A 1 88  ? 12.600  -20.594 10.830  1.00 2.92  ? 129 ARG A HH12 1 
ATOM 1348 H HH21 . ARG A 1 88  ? 13.490  -23.007 8.466   1.00 3.09  ? 129 ARG A HH21 1 
ATOM 1349 H HH22 . ARG A 1 88  ? 13.947  -22.206 9.932   1.00 3.09  ? 129 ARG A HH22 1 
ATOM 1350 N N    . PHE A 1 89  ? 7.583   -16.201 8.615   1.00 0.37  ? 130 PHE A N    1 
ATOM 1351 C CA   . PHE A 1 89  ? 7.272   -14.782 8.488   1.00 0.40  ? 130 PHE A CA   1 
ATOM 1352 C C    . PHE A 1 89  ? 7.846   -13.991 9.659   1.00 0.40  ? 130 PHE A C    1 
ATOM 1353 O O    . PHE A 1 89  ? 8.438   -12.927 9.473   1.00 0.42  ? 130 PHE A O    1 
ATOM 1354 C CB   . PHE A 1 89  ? 5.759   -14.573 8.410   1.00 0.51  ? 130 PHE A CB   1 
ATOM 1355 C CG   . PHE A 1 89  ? 5.332   -13.162 8.698   1.00 0.52  ? 130 PHE A CG   1 
ATOM 1356 C CD1  . PHE A 1 89  ? 5.135   -12.736 10.001  1.00 1.24  ? 130 PHE A CD1  1 
ATOM 1357 C CD2  . PHE A 1 89  ? 5.127   -12.263 7.664   1.00 1.37  ? 130 PHE A CD2  1 
ATOM 1358 C CE1  . PHE A 1 89  ? 4.741   -11.438 10.268  1.00 1.35  ? 130 PHE A CE1  1 
ATOM 1359 C CE2  . PHE A 1 89  ? 4.733   -10.964 7.924   1.00 1.44  ? 130 PHE A CE2  1 
ATOM 1360 C CZ   . PHE A 1 89  ? 4.540   -10.551 9.228   1.00 0.87  ? 130 PHE A CZ   1 
ATOM 1361 H H    . PHE A 1 89  ? 6.866   -16.860 8.501   1.00 0.39  ? 130 PHE A H    1 
ATOM 1362 H HA   . PHE A 1 89  ? 7.723   -14.425 7.573   1.00 0.40  ? 130 PHE A HA   1 
ATOM 1363 H HB2  . PHE A 1 89  ? 5.418   -14.828 7.418   1.00 0.61  ? 130 PHE A HB2  1 
ATOM 1364 H HB3  . PHE A 1 89  ? 5.277   -15.220 9.128   1.00 0.65  ? 130 PHE A HB3  1 
ATOM 1365 H HD1  . PHE A 1 89  ? 5.292   -13.428 10.815  1.00 2.07  ? 130 PHE A HD1  1 
ATOM 1366 H HD2  . PHE A 1 89  ? 5.277   -12.586 6.644   1.00 2.23  ? 130 PHE A HD2  1 
ATOM 1367 H HE1  . PHE A 1 89  ? 4.591   -11.118 11.289  1.00 2.21  ? 130 PHE A HE1  1 
ATOM 1368 H HE2  . PHE A 1 89  ? 4.577   -10.273 7.109   1.00 2.30  ? 130 PHE A HE2  1 
ATOM 1369 H HZ   . PHE A 1 89  ? 4.233   -9.537  9.434   1.00 1.05  ? 130 PHE A HZ   1 
ATOM 1370 N N    . ALA A 1 90  ? 7.668   -14.517 10.867  1.00 0.44  ? 131 ALA A N    1 
ATOM 1371 C CA   . ALA A 1 90  ? 8.168   -13.860 12.068  1.00 0.48  ? 131 ALA A CA   1 
ATOM 1372 C C    . ALA A 1 90  ? 9.686   -13.719 12.027  1.00 0.43  ? 131 ALA A C    1 
ATOM 1373 O O    . ALA A 1 90  ? 10.232  -12.667 12.360  1.00 0.43  ? 131 ALA A O    1 
ATOM 1374 C CB   . ALA A 1 90  ? 7.742   -14.632 13.308  1.00 0.58  ? 131 ALA A CB   1 
ATOM 1375 H H    . ALA A 1 90  ? 7.188   -15.367 10.951  1.00 0.49  ? 131 ALA A H    1 
ATOM 1376 H HA   . ALA A 1 90  ? 7.727   -12.875 12.118  1.00 0.51  ? 131 ALA A HA   1 
ATOM 1377 H HB1  . ALA A 1 90  ? 6.684   -14.842 13.254  1.00 1.10  ? 131 ALA A HB1  1 
ATOM 1378 H HB2  . ALA A 1 90  ? 7.948   -14.042 14.188  1.00 1.26  ? 131 ALA A HB2  1 
ATOM 1379 H HB3  . ALA A 1 90  ? 8.291   -15.560 13.360  1.00 1.12  ? 131 ALA A HB3  1 
ATOM 1380 N N    . THR A 1 91  ? 10.364  -14.787 11.619  1.00 0.41  ? 132 THR A N    1 
ATOM 1381 C CA   . THR A 1 91  ? 11.820  -14.783 11.538  1.00 0.40  ? 132 THR A CA   1 
ATOM 1382 C C    . THR A 1 91  ? 12.309  -13.775 10.502  1.00 0.35  ? 132 THR A C    1 
ATOM 1383 O O    . THR A 1 91  ? 13.067  -12.859 10.821  1.00 0.37  ? 132 THR A O    1 
ATOM 1384 C CB   . THR A 1 91  ? 12.336  -16.180 11.188  1.00 0.44  ? 132 THR A CB   1 
ATOM 1385 O OG1  . THR A 1 91  ? 11.570  -17.175 11.844  1.00 0.73  ? 132 THR A OG1  1 
ATOM 1386 C CG2  . THR A 1 91  ? 13.786  -16.394 11.565  1.00 0.66  ? 132 THR A CG2  1 
ATOM 1387 H H    . THR A 1 91  ? 9.874   -15.598 11.369  1.00 0.42  ? 132 THR A H    1 
ATOM 1388 H HA   . THR A 1 91  ? 12.205  -14.500 12.506  1.00 0.43  ? 132 THR A HA   1 
ATOM 1389 H HB   . THR A 1 91  ? 12.245  -16.330 10.122  1.00 0.66  ? 132 THR A HB   1 
ATOM 1390 H HG1  . THR A 1 91  ? 11.781  -17.176 12.781  1.00 1.25  ? 132 THR A HG1  1 
ATOM 1391 H HG21 . THR A 1 91  ? 14.406  -16.279 10.688  1.00 1.28  ? 132 THR A HG21 1 
ATOM 1392 H HG22 . THR A 1 91  ? 13.911  -17.389 11.966  1.00 1.16  ? 132 THR A HG22 1 
ATOM 1393 H HG23 . THR A 1 91  ? 14.076  -15.667 12.309  1.00 1.14  ? 132 THR A HG23 1 
ATOM 1394 N N    . VAL A 1 92  ? 11.873  -13.952 9.259   1.00 0.37  ? 133 VAL A N    1 
ATOM 1395 C CA   . VAL A 1 92  ? 12.269  -13.061 8.176   1.00 0.34  ? 133 VAL A CA   1 
ATOM 1396 C C    . VAL A 1 92  ? 12.113  -11.597 8.577   1.00 0.32  ? 133 VAL A C    1 
ATOM 1397 O O    . VAL A 1 92  ? 13.059  -10.814 8.483   1.00 0.32  ? 133 VAL A O    1 
ATOM 1398 C CB   . VAL A 1 92  ? 11.443  -13.321 6.903   1.00 0.37  ? 133 VAL A CB   1 
ATOM 1399 C CG1  . VAL A 1 92  ? 11.902  -12.414 5.773   1.00 0.40  ? 133 VAL A CG1  1 
ATOM 1400 C CG2  . VAL A 1 92  ? 11.538  -14.784 6.495   1.00 0.47  ? 133 VAL A CG2  1 
ATOM 1401 H H    . VAL A 1 92  ? 11.273  -14.702 9.066   1.00 0.44  ? 133 VAL A H    1 
ATOM 1402 H HA   . VAL A 1 92  ? 13.308  -13.253 7.949   1.00 0.35  ? 133 VAL A HA   1 
ATOM 1403 H HB   . VAL A 1 92  ? 10.408  -13.096 7.117   1.00 0.44  ? 133 VAL A HB   1 
ATOM 1404 H HG11 . VAL A 1 92  ? 11.732  -12.904 4.825   1.00 1.06  ? 133 VAL A HG11 1 
ATOM 1405 H HG12 . VAL A 1 92  ? 12.956  -12.205 5.885   1.00 1.12  ? 133 VAL A HG12 1 
ATOM 1406 H HG13 . VAL A 1 92  ? 11.346  -11.489 5.805   1.00 1.08  ? 133 VAL A HG13 1 
ATOM 1407 H HG21 . VAL A 1 92  ? 12.566  -15.108 6.555   1.00 1.19  ? 133 VAL A HG21 1 
ATOM 1408 H HG22 . VAL A 1 92  ? 11.183  -14.898 5.482   1.00 0.97  ? 133 VAL A HG22 1 
ATOM 1409 H HG23 . VAL A 1 92  ? 10.932  -15.383 7.159   1.00 1.16  ? 133 VAL A HG23 1 
ATOM 1410 N N    . VAL A 1 93  ? 10.914  -11.233 9.022   1.00 0.32  ? 134 VAL A N    1 
ATOM 1411 C CA   . VAL A 1 93  ? 10.633  -9.862  9.434   1.00 0.32  ? 134 VAL A CA   1 
ATOM 1412 C C    . VAL A 1 93  ? 11.503  -9.447  10.615  1.00 0.31  ? 134 VAL A C    1 
ATOM 1413 O O    . VAL A 1 93  ? 12.009  -8.325  10.664  1.00 0.34  ? 134 VAL A O    1 
ATOM 1414 C CB   . VAL A 1 93  ? 9.152   -9.684  9.819   1.00 0.35  ? 134 VAL A CB   1 
ATOM 1415 C CG1  . VAL A 1 93  ? 8.937   -8.348  10.514  1.00 0.49  ? 134 VAL A CG1  1 
ATOM 1416 C CG2  . VAL A 1 93  ? 8.263   -9.804  8.591   1.00 0.40  ? 134 VAL A CG2  1 
ATOM 1417 H H    . VAL A 1 93  ? 10.201  -11.903 9.074   1.00 0.33  ? 134 VAL A H    1 
ATOM 1418 H HA   . VAL A 1 93  ? 10.846  -9.212  8.597   1.00 0.33  ? 134 VAL A HA   1 
ATOM 1419 H HB   . VAL A 1 93  ? 8.884   -10.470 10.509  1.00 0.51  ? 134 VAL A HB   1 
ATOM 1420 H HG11 . VAL A 1 93  ? 9.355   -7.557  9.910   1.00 1.16  ? 134 VAL A HG11 1 
ATOM 1421 H HG12 . VAL A 1 93  ? 9.423   -8.362  11.478  1.00 1.14  ? 134 VAL A HG12 1 
ATOM 1422 H HG13 . VAL A 1 93  ? 7.878   -8.179  10.646  1.00 1.07  ? 134 VAL A HG13 1 
ATOM 1423 H HG21 . VAL A 1 93  ? 7.743   -8.871  8.431   1.00 1.15  ? 134 VAL A HG21 1 
ATOM 1424 H HG22 . VAL A 1 93  ? 7.545   -10.596 8.743   1.00 1.01  ? 134 VAL A HG22 1 
ATOM 1425 H HG23 . VAL A 1 93  ? 8.871   -10.029 7.727   1.00 1.14  ? 134 VAL A HG23 1 
ATOM 1426 N N    . GLU A 1 94  ? 11.674  -10.355 11.567  1.00 0.33  ? 135 GLU A N    1 
ATOM 1427 C CA   . GLU A 1 94  ? 12.483  -10.077 12.746  1.00 0.34  ? 135 GLU A CA   1 
ATOM 1428 C C    . GLU A 1 94  ? 13.850  -9.528  12.349  1.00 0.33  ? 135 GLU A C    1 
ATOM 1429 O O    . GLU A 1 94  ? 14.334  -8.558  12.932  1.00 0.33  ? 135 GLU A O    1 
ATOM 1430 C CB   . GLU A 1 94  ? 12.652  -11.344 13.586  1.00 0.41  ? 135 GLU A CB   1 
ATOM 1431 C CG   . GLU A 1 94  ? 11.543  -11.552 14.604  1.00 0.67  ? 135 GLU A CG   1 
ATOM 1432 C CD   . GLU A 1 94  ? 11.942  -11.113 15.999  1.00 1.33  ? 135 GLU A CD   1 
ATOM 1433 O OE1  . GLU A 1 94  ? 12.759  -10.176 16.116  1.00 1.83  ? 135 GLU A OE1  1 
ATOM 1434 O OE2  . GLU A 1 94  ? 11.437  -11.707 16.975  1.00 2.14  ? 135 GLU A OE2  1 
ATOM 1435 H H    . GLU A 1 94  ? 11.246  -11.232 11.476  1.00 0.36  ? 135 GLU A H    1 
ATOM 1436 H HA   . GLU A 1 94  ? 11.965  -9.332  13.333  1.00 0.35  ? 135 GLU A HA   1 
ATOM 1437 H HB2  . GLU A 1 94  ? 12.671  -12.199 12.927  1.00 0.68  ? 135 GLU A HB2  1 
ATOM 1438 H HB3  . GLU A 1 94  ? 13.592  -11.288 14.116  1.00 0.73  ? 135 GLU A HB3  1 
ATOM 1439 H HG2  . GLU A 1 94  ? 10.679  -10.982 14.298  1.00 1.12  ? 135 GLU A HG2  1 
ATOM 1440 H HG3  . GLU A 1 94  ? 11.289  -12.602 14.631  1.00 1.18  ? 135 GLU A HG3  1 
ATOM 1441 N N    . GLU A 1 95  ? 14.471  -10.158 11.356  1.00 0.37  ? 136 GLU A N    1 
ATOM 1442 C CA   . GLU A 1 95  ? 15.786  -9.738  10.882  1.00 0.41  ? 136 GLU A CA   1 
ATOM 1443 C C    . GLU A 1 95  ? 15.701  -8.434  10.092  1.00 0.40  ? 136 GLU A C    1 
ATOM 1444 O O    . GLU A 1 95  ? 16.615  -7.611  10.137  1.00 0.45  ? 136 GLU A O    1 
ATOM 1445 C CB   . GLU A 1 95  ? 16.411  -10.832 10.015  1.00 0.51  ? 136 GLU A CB   1 
ATOM 1446 C CG   . GLU A 1 95  ? 17.913  -10.683 9.837   1.00 1.39  ? 136 GLU A CG   1 
ATOM 1447 C CD   . GLU A 1 95  ? 18.660  -11.979 10.083  1.00 1.92  ? 136 GLU A CD   1 
ATOM 1448 O OE1  . GLU A 1 95  ? 18.185  -13.036 9.616   1.00 2.43  ? 136 GLU A OE1  1 
ATOM 1449 O OE2  . GLU A 1 95  ? 19.721  -11.937 10.741  1.00 2.56  ? 136 GLU A OE2  1 
ATOM 1450 H H    . GLU A 1 95  ? 14.036  -10.929 10.933  1.00 0.39  ? 136 GLU A H    1 
ATOM 1451 H HA   . GLU A 1 95  ? 16.411  -9.578  11.747  1.00 0.42  ? 136 GLU A HA   1 
ATOM 1452 H HB2  . GLU A 1 95  ? 16.217  -11.791 10.471  1.00 1.00  ? 136 GLU A HB2  1 
ATOM 1453 H HB3  . GLU A 1 95  ? 15.950  -10.808 9.039   1.00 1.12  ? 136 GLU A HB3  1 
ATOM 1454 H HG2  . GLU A 1 95  ? 18.112  -10.356 8.828   1.00 2.05  ? 136 GLU A HG2  1 
ATOM 1455 H HG3  . GLU A 1 95  ? 18.273  -9.939  10.533  1.00 2.03  ? 136 GLU A HG3  1 
ATOM 1456 N N    . LEU A 1 96  ? 14.600  -8.251  9.368   1.00 0.39  ? 137 LEU A N    1 
ATOM 1457 C CA   . LEU A 1 96  ? 14.406  -7.044  8.571   1.00 0.44  ? 137 LEU A CA   1 
ATOM 1458 C C    . LEU A 1 96  ? 14.647  -5.795  9.412   1.00 0.44  ? 137 LEU A C    1 
ATOM 1459 O O    . LEU A 1 96  ? 15.460  -4.943  9.054   1.00 0.52  ? 137 LEU A O    1 
ATOM 1460 C CB   . LEU A 1 96  ? 12.996  -7.008  7.982   1.00 0.45  ? 137 LEU A CB   1 
ATOM 1461 C CG   . LEU A 1 96  ? 12.709  -8.042  6.889   1.00 0.49  ? 137 LEU A CG   1 
ATOM 1462 C CD1  . LEU A 1 96  ? 11.533  -7.592  6.049   1.00 1.08  ? 137 LEU A CD1  1 
ATOM 1463 C CD2  . LEU A 1 96  ? 13.929  -8.262  6.005   1.00 0.98  ? 137 LEU A CD2  1 
ATOM 1464 H H    . LEU A 1 96  ? 13.905  -8.942  9.374   1.00 0.37  ? 137 LEU A H    1 
ATOM 1465 H HA   . LEU A 1 96  ? 15.121  -7.059  7.766   1.00 0.52  ? 137 LEU A HA   1 
ATOM 1466 H HB2  . LEU A 1 96  ? 12.291  -7.161  8.784   1.00 0.68  ? 137 LEU A HB2  1 
ATOM 1467 H HB3  . LEU A 1 96  ? 12.831  -6.026  7.565   1.00 0.65  ? 137 LEU A HB3  1 
ATOM 1468 H HG   . LEU A 1 96  ? 12.451  -8.984  7.349   1.00 1.09  ? 137 LEU A HG   1 
ATOM 1469 H HD11 . LEU A 1 96  ? 11.431  -8.242  5.194   1.00 1.71  ? 137 LEU A HD11 1 
ATOM 1470 H HD12 . LEU A 1 96  ? 11.704  -6.579  5.715   1.00 1.64  ? 137 LEU A HD12 1 
ATOM 1471 H HD13 . LEU A 1 96  ? 10.632  -7.629  6.642   1.00 1.40  ? 137 LEU A HD13 1 
ATOM 1472 H HD21 . LEU A 1 96  ? 14.294  -7.308  5.652   1.00 1.44  ? 137 LEU A HD21 1 
ATOM 1473 H HD22 . LEU A 1 96  ? 13.656  -8.877  5.161   1.00 1.56  ? 137 LEU A HD22 1 
ATOM 1474 H HD23 . LEU A 1 96  ? 14.703  -8.754  6.575   1.00 1.57  ? 137 LEU A HD23 1 
ATOM 1475 N N    . PHE A 1 97  ? 13.934  -5.691  10.528  1.00 0.41  ? 138 PHE A N    1 
ATOM 1476 C CA   . PHE A 1 97  ? 14.074  -4.540  11.415  1.00 0.47  ? 138 PHE A CA   1 
ATOM 1477 C C    . PHE A 1 97  ? 14.895  -4.874  12.666  1.00 0.71  ? 138 PHE A C    1 
ATOM 1478 O O    . PHE A 1 97  ? 14.978  -4.059  13.585  1.00 1.31  ? 138 PHE A O    1 
ATOM 1479 C CB   . PHE A 1 97  ? 12.695  -4.022  11.822  1.00 0.67  ? 138 PHE A CB   1 
ATOM 1480 C CG   . PHE A 1 97  ? 11.786  -3.768  10.653  1.00 0.53  ? 138 PHE A CG   1 
ATOM 1481 C CD1  . PHE A 1 97  ? 12.071  -2.761  9.744   1.00 1.14  ? 138 PHE A CD1  1 
ATOM 1482 C CD2  . PHE A 1 97  ? 10.650  -4.537  10.462  1.00 1.35  ? 138 PHE A CD2  1 
ATOM 1483 C CE1  . PHE A 1 97  ? 11.239  -2.527  8.666   1.00 1.16  ? 138 PHE A CE1  1 
ATOM 1484 C CE2  . PHE A 1 97  ? 9.815   -4.308  9.385   1.00 1.36  ? 138 PHE A CE2  1 
ATOM 1485 C CZ   . PHE A 1 97  ? 10.110  -3.301  8.486   1.00 0.59  ? 138 PHE A CZ   1 
ATOM 1486 H H    . PHE A 1 97  ? 13.300  -6.402  10.760  1.00 0.38  ? 138 PHE A H    1 
ATOM 1487 H HA   . PHE A 1 97  ? 14.586  -3.765  10.866  1.00 0.65  ? 138 PHE A HA   1 
ATOM 1488 H HB2  . PHE A 1 97  ? 12.218  -4.748  12.462  1.00 0.94  ? 138 PHE A HB2  1 
ATOM 1489 H HB3  . PHE A 1 97  ? 12.811  -3.093  12.362  1.00 0.99  ? 138 PHE A HB3  1 
ATOM 1490 H HD1  . PHE A 1 97  ? 12.954  -2.155  9.885   1.00 2.00  ? 138 PHE A HD1  1 
ATOM 1491 H HD2  . PHE A 1 97  ? 10.419  -5.324  11.164  1.00 2.22  ? 138 PHE A HD2  1 
ATOM 1492 H HE1  . PHE A 1 97  ? 11.472  -1.740  7.964   1.00 2.02  ? 138 PHE A HE1  1 
ATOM 1493 H HE2  . PHE A 1 97  ? 8.932   -4.915  9.247   1.00 2.24  ? 138 PHE A HE2  1 
ATOM 1494 H HZ   . PHE A 1 97  ? 9.458   -3.120  7.644   1.00 0.71  ? 138 PHE A HZ   1 
ATOM 1495 N N    . ARG A 1 98  ? 15.490  -6.072  12.703  1.00 0.62  ? 139 ARG A N    1 
ATOM 1496 C CA   . ARG A 1 98  ? 16.292  -6.500  13.848  1.00 0.99  ? 139 ARG A CA   1 
ATOM 1497 C C    . ARG A 1 98  ? 17.221  -5.387  14.324  1.00 1.08  ? 139 ARG A C    1 
ATOM 1498 O O    . ARG A 1 98  ? 17.410  -5.198  15.526  1.00 1.31  ? 139 ARG A O    1 
ATOM 1499 C CB   . ARG A 1 98  ? 17.111  -7.740  13.484  1.00 1.35  ? 139 ARG A CB   1 
ATOM 1500 C CG   . ARG A 1 98  ? 18.341  -7.934  14.356  1.00 1.80  ? 139 ARG A CG   1 
ATOM 1501 C CD   . ARG A 1 98  ? 18.748  -9.397  14.425  1.00 2.54  ? 139 ARG A CD   1 
ATOM 1502 N NE   . ARG A 1 98  ? 20.066  -9.570  15.032  1.00 3.08  ? 139 ARG A NE   1 
ATOM 1503 C CZ   . ARG A 1 98  ? 20.598  -10.755 15.329  1.00 3.61  ? 139 ARG A CZ   1 
ATOM 1504 N NH1  . ARG A 1 98  ? 19.933  -11.876 15.076  1.00 3.79  ? 139 ARG A NH1  1 
ATOM 1505 N NH2  . ARG A 1 98  ? 21.803  -10.819 15.880  1.00 4.36  ? 139 ARG A NH2  1 
ATOM 1506 H H    . ARG A 1 98  ? 15.379  -6.687  11.951  1.00 0.72  ? 139 ARG A H    1 
ATOM 1507 H HA   . ARG A 1 98  ? 15.614  -6.753  14.649  1.00 1.11  ? 139 ARG A HA   1 
ATOM 1508 H HB2  . ARG A 1 98  ? 16.484  -8.614  13.583  1.00 1.37  ? 139 ARG A HB2  1 
ATOM 1509 H HB3  . ARG A 1 98  ? 17.434  -7.655  12.457  1.00 1.75  ? 139 ARG A HB3  1 
ATOM 1510 H HG2  . ARG A 1 98  ? 19.158  -7.363  13.942  1.00 2.26  ? 139 ARG A HG2  1 
ATOM 1511 H HG3  . ARG A 1 98  ? 18.122  -7.583  15.353  1.00 1.94  ? 139 ARG A HG3  1 
ATOM 1512 H HD2  . ARG A 1 98  ? 18.019  -9.933  15.014  1.00 2.91  ? 139 ARG A HD2  1 
ATOM 1513 H HD3  . ARG A 1 98  ? 18.767  -9.800  13.423  1.00 3.00  ? 139 ARG A HD3  1 
ATOM 1514 H HE   . ARG A 1 98  ? 20.582  -8.761  15.229  1.00 3.40  ? 139 ARG A HE   1 
ATOM 1515 H HH11 . ARG A 1 98  ? 19.024  -11.839 14.661  1.00 3.60  ? 139 ARG A HH11 1 
ATOM 1516 H HH12 . ARG A 1 98  ? 20.342  -12.760 15.303  1.00 4.37  ? 139 ARG A HH12 1 
ATOM 1517 H HH21 . ARG A 1 98  ? 22.310  -9.978  16.072  1.00 4.65  ? 139 ARG A HH21 1 
ATOM 1518 H HH22 . ARG A 1 98  ? 22.203  -11.707 16.103  1.00 4.84  ? 139 ARG A HH22 1 
ATOM 1519 N N    . ASP A 1 99  ? 17.798  -4.653  13.379  1.00 1.12  ? 140 ASP A N    1 
ATOM 1520 C CA   . ASP A 1 99  ? 18.705  -3.560  13.710  1.00 1.33  ? 140 ASP A CA   1 
ATOM 1521 C C    . ASP A 1 99  ? 18.044  -2.209  13.458  1.00 0.97  ? 140 ASP A C    1 
ATOM 1522 O O    . ASP A 1 99  ? 18.335  -1.541  12.466  1.00 1.61  ? 140 ASP A O    1 
ATOM 1523 C CB   . ASP A 1 99  ? 19.992  -3.672  12.892  1.00 1.81  ? 140 ASP A CB   1 
ATOM 1524 C CG   . ASP A 1 99  ? 21.135  -4.265  13.691  1.00 2.60  ? 140 ASP A CG   1 
ATOM 1525 O OD1  . ASP A 1 99  ? 21.643  -3.577  14.601  1.00 3.20  ? 140 ASP A OD1  1 
ATOM 1526 O OD2  . ASP A 1 99  ? 21.522  -5.418  13.407  1.00 3.14  ? 140 ASP A OD2  1 
ATOM 1527 H H    . ASP A 1 99  ? 17.612  -4.849  12.437  1.00 1.15  ? 140 ASP A H    1 
ATOM 1528 H HA   . ASP A 1 99  ? 18.948  -3.638  14.759  1.00 1.65  ? 140 ASP A HA   1 
ATOM 1529 H HB2  . ASP A 1 99  ? 19.812  -4.302  12.034  1.00 2.15  ? 140 ASP A HB2  1 
ATOM 1530 H HB3  . ASP A 1 99  ? 20.284  -2.688  12.556  1.00 1.88  ? 140 ASP A HB3  1 
ATOM 1531 N N    . GLY A 1 100 ? 17.153  -1.813  14.361  1.00 0.90  ? 141 GLY A N    1 
ATOM 1532 C CA   . GLY A 1 100 ? 16.465  -0.543  14.217  1.00 0.75  ? 141 GLY A CA   1 
ATOM 1533 C C    . GLY A 1 100 ? 15.605  -0.488  12.970  1.00 0.63  ? 141 GLY A C    1 
ATOM 1534 O O    . GLY A 1 100 ? 15.940  -1.091  11.950  1.00 0.90  ? 141 GLY A O    1 
ATOM 1535 H H    . GLY A 1 100 ? 16.961  -2.388  15.131  1.00 1.56  ? 141 GLY A H    1 
ATOM 1536 H HA2  . GLY A 1 100 ? 15.836  -0.387  15.081  1.00 1.00  ? 141 GLY A HA2  1 
ATOM 1537 H HA3  . GLY A 1 100 ? 17.198  0.248   14.171  1.00 0.81  ? 141 GLY A HA3  1 
ATOM 1538 N N    . VAL A 1 101 ? 14.491  0.232   13.052  1.00 0.47  ? 142 VAL A N    1 
ATOM 1539 C CA   . VAL A 1 101 ? 13.579  0.359   11.923  1.00 0.45  ? 142 VAL A CA   1 
ATOM 1540 C C    . VAL A 1 101 ? 13.782  1.680   11.188  1.00 0.55  ? 142 VAL A C    1 
ATOM 1541 O O    . VAL A 1 101 ? 14.047  2.713   11.802  1.00 1.24  ? 142 VAL A O    1 
ATOM 1542 C CB   . VAL A 1 101 ? 12.110  0.256   12.374  1.00 0.51  ? 142 VAL A CB   1 
ATOM 1543 C CG1  . VAL A 1 101 ? 11.216  -0.121  11.202  1.00 0.70  ? 142 VAL A CG1  1 
ATOM 1544 C CG2  . VAL A 1 101 ? 11.969  -0.748  13.507  1.00 0.47  ? 142 VAL A CG2  1 
ATOM 1545 H H    . VAL A 1 101 ? 14.276  0.686   13.893  1.00 0.62  ? 142 VAL A H    1 
ATOM 1546 H HA   . VAL A 1 101 ? 13.781  -0.454  11.241  1.00 0.44  ? 142 VAL A HA   1 
ATOM 1547 H HB   . VAL A 1 101 ? 11.798  1.224   12.738  1.00 0.61  ? 142 VAL A HB   1 
ATOM 1548 H HG11 . VAL A 1 101 ? 11.751  0.033   10.277  1.00 1.16  ? 142 VAL A HG11 1 
ATOM 1549 H HG12 . VAL A 1 101 ? 10.330  0.495   11.213  1.00 1.39  ? 142 VAL A HG12 1 
ATOM 1550 H HG13 . VAL A 1 101 ? 10.933  -1.160  11.286  1.00 1.24  ? 142 VAL A HG13 1 
ATOM 1551 H HG21 . VAL A 1 101 ? 11.096  -1.362  13.338  1.00 1.14  ? 142 VAL A HG21 1 
ATOM 1552 H HG22 . VAL A 1 101 ? 11.861  -0.221  14.444  1.00 1.07  ? 142 VAL A HG22 1 
ATOM 1553 H HG23 . VAL A 1 101 ? 12.848  -1.374  13.546  1.00 1.14  ? 142 VAL A HG23 1 
ATOM 1554 N N    . ASN A 1 102 ? 13.653  1.632   9.867   1.00 0.41  ? 143 ASN A N    1 
ATOM 1555 C CA   . ASN A 1 102 ? 13.816  2.816   9.030   1.00 0.41  ? 143 ASN A CA   1 
ATOM 1556 C C    . ASN A 1 102 ? 12.962  2.702   7.771   1.00 0.37  ? 143 ASN A C    1 
ATOM 1557 O O    . ASN A 1 102 ? 12.529  1.609   7.407   1.00 0.36  ? 143 ASN A O    1 
ATOM 1558 C CB   . ASN A 1 102 ? 15.286  3.001   8.649   1.00 0.45  ? 143 ASN A CB   1 
ATOM 1559 C CG   . ASN A 1 102 ? 15.990  4.010   9.536   1.00 1.16  ? 143 ASN A CG   1 
ATOM 1560 O OD1  . ASN A 1 102 ? 15.347  4.798   10.231  1.00 2.05  ? 143 ASN A OD1  1 
ATOM 1561 N ND2  . ASN A 1 102 ? 17.317  3.991   9.516   1.00 1.67  ? 143 ASN A ND2  1 
ATOM 1562 H H    . ASN A 1 102 ? 13.443  0.776   9.443   1.00 0.90  ? 143 ASN A H    1 
ATOM 1563 H HA   . ASN A 1 102 ? 13.489  3.672   9.598   1.00 0.45  ? 143 ASN A HA   1 
ATOM 1564 H HB2  . ASN A 1 102 ? 15.797  2.054   8.738   1.00 0.83  ? 143 ASN A HB2  1 
ATOM 1565 H HB3  . ASN A 1 102 ? 15.347  3.344   7.627   1.00 0.76  ? 143 ASN A HB3  1 
ATOM 1566 H HD21 . ASN A 1 102 ? 17.762  3.337   8.938   1.00 1.98  ? 143 ASN A HD21 1 
ATOM 1567 H HD22 . ASN A 1 102 ? 17.798  4.632   10.081  1.00 2.18  ? 143 ASN A HD22 1 
ATOM 1568 N N    . TRP A 1 103 ? 12.717  3.829   7.108   1.00 0.36  ? 144 TRP A N    1 
ATOM 1569 C CA   . TRP A 1 103 ? 11.909  3.835   5.894   1.00 0.35  ? 144 TRP A CA   1 
ATOM 1570 C C    . TRP A 1 103 ? 12.398  2.773   4.918   1.00 0.33  ? 144 TRP A C    1 
ATOM 1571 O O    . TRP A 1 103 ? 11.666  1.843   4.580   1.00 0.32  ? 144 TRP A O    1 
ATOM 1572 C CB   . TRP A 1 103 ? 11.948  5.213   5.230   1.00 0.36  ? 144 TRP A CB   1 
ATOM 1573 C CG   . TRP A 1 103 ? 11.114  6.239   5.937   1.00 0.33  ? 144 TRP A CG   1 
ATOM 1574 C CD1  . TRP A 1 103 ? 11.511  7.486   6.327   1.00 0.34  ? 144 TRP A CD1  1 
ATOM 1575 C CD2  . TRP A 1 103 ? 9.744   6.109   6.338   1.00 0.32  ? 144 TRP A CD2  1 
ATOM 1576 N NE1  . TRP A 1 103 ? 10.472  8.139   6.945   1.00 0.34  ? 144 TRP A NE1  1 
ATOM 1577 C CE2  . TRP A 1 103 ? 9.378   7.316   6.965   1.00 0.32  ? 144 TRP A CE2  1 
ATOM 1578 C CE3  . TRP A 1 103 ? 8.791   5.092   6.228   1.00 0.34  ? 144 TRP A CE3  1 
ATOM 1579 C CZ2  . TRP A 1 103 ? 8.102   7.530   7.479   1.00 0.33  ? 144 TRP A CZ2  1 
ATOM 1580 C CZ3  . TRP A 1 103 ? 7.525   5.307   6.740   1.00 0.35  ? 144 TRP A CZ3  1 
ATOM 1581 C CH2  . TRP A 1 103 ? 7.190   6.518   7.358   1.00 0.34  ? 144 TRP A CH2  1 
ATOM 1582 H H    . TRP A 1 103 ? 13.083  4.674   7.440   1.00 0.38  ? 144 TRP A H    1 
ATOM 1583 H HA   . TRP A 1 103 ? 10.892  3.608   6.174   1.00 0.35  ? 144 TRP A HA   1 
ATOM 1584 H HB2  . TRP A 1 103 ? 12.967  5.568   5.212   1.00 0.39  ? 144 TRP A HB2  1 
ATOM 1585 H HB3  . TRP A 1 103 ? 11.584  5.127   4.217   1.00 0.38  ? 144 TRP A HB3  1 
ATOM 1586 H HD1  . TRP A 1 103 ? 12.500  7.887   6.167   1.00 0.37  ? 144 TRP A HD1  1 
ATOM 1587 H HE1  . TRP A 1 103 ? 10.510  9.047   7.313   1.00 0.37  ? 144 TRP A HE1  1 
ATOM 1588 H HE3  . TRP A 1 103 ? 9.029   4.151   5.754   1.00 0.37  ? 144 TRP A HE3  1 
ATOM 1589 H HZ2  . TRP A 1 103 ? 7.827   8.459   7.959   1.00 0.35  ? 144 TRP A HZ2  1 
ATOM 1590 H HZ3  . TRP A 1 103 ? 6.776   4.532   6.664   1.00 0.39  ? 144 TRP A HZ3  1 
ATOM 1591 H HH2  . TRP A 1 103 ? 6.189   6.641   7.743   1.00 0.37  ? 144 TRP A HH2  1 
ATOM 1592 N N    . GLY A 1 104 ? 13.641  2.917   4.472   1.00 0.34  ? 145 GLY A N    1 
ATOM 1593 C CA   . GLY A 1 104 ? 14.211  1.960   3.542   1.00 0.34  ? 145 GLY A CA   1 
ATOM 1594 C C    . GLY A 1 104 ? 13.990  0.530   3.989   1.00 0.32  ? 145 GLY A C    1 
ATOM 1595 O O    . GLY A 1 104 ? 13.687  -0.345  3.177   1.00 0.32  ? 145 GLY A O    1 
ATOM 1596 H H    . GLY A 1 104 ? 14.174  3.679   4.779   1.00 0.35  ? 145 GLY A H    1 
ATOM 1597 H HA2  . GLY A 1 104 ? 13.756  2.099   2.572   1.00 0.35  ? 145 GLY A HA2  1 
ATOM 1598 H HA3  . GLY A 1 104 ? 15.273  2.141   3.460   1.00 0.37  ? 145 GLY A HA3  1 
ATOM 1599 N N    . ARG A 1 105 ? 14.129  0.296   5.290   1.00 0.31  ? 146 ARG A N    1 
ATOM 1600 C CA   . ARG A 1 105 ? 13.931  -1.032  5.852   1.00 0.31  ? 146 ARG A CA   1 
ATOM 1601 C C    . ARG A 1 105 ? 12.475  -1.456  5.707   1.00 0.29  ? 146 ARG A C    1 
ATOM 1602 O O    . ARG A 1 105 ? 12.179  -2.623  5.448   1.00 0.31  ? 146 ARG A O    1 
ATOM 1603 C CB   . ARG A 1 105 ? 14.338  -1.053  7.325   1.00 0.32  ? 146 ARG A CB   1 
ATOM 1604 C CG   . ARG A 1 105 ? 15.833  -1.214  7.542   1.00 0.63  ? 146 ARG A CG   1 
ATOM 1605 C CD   . ARG A 1 105 ? 16.217  -2.675  7.705   1.00 0.81  ? 146 ARG A CD   1 
ATOM 1606 N NE   . ARG A 1 105 ? 17.385  -3.026  6.900   1.00 1.38  ? 146 ARG A NE   1 
ATOM 1607 C CZ   . ARG A 1 105 ? 18.154  -4.090  7.126   1.00 1.66  ? 146 ARG A CZ   1 
ATOM 1608 N NH1  . ARG A 1 105 ? 17.887  -4.914  8.133   1.00 2.09  ? 146 ARG A NH1  1 
ATOM 1609 N NH2  . ARG A 1 105 ? 19.196  -4.330  6.342   1.00 2.22  ? 146 ARG A NH2  1 
ATOM 1610 H H    . ARG A 1 105 ? 14.360  1.038   5.887   1.00 0.32  ? 146 ARG A H    1 
ATOM 1611 H HA   . ARG A 1 105 ? 14.553  -1.723  5.303   1.00 0.33  ? 146 ARG A HA   1 
ATOM 1612 H HB2  . ARG A 1 105 ? 14.028  -0.126  7.783   1.00 0.62  ? 146 ARG A HB2  1 
ATOM 1613 H HB3  . ARG A 1 105 ? 13.834  -1.873  7.815   1.00 0.55  ? 146 ARG A HB3  1 
ATOM 1614 H HG2  . ARG A 1 105 ? 16.356  -0.807  6.690   1.00 1.37  ? 146 ARG A HG2  1 
ATOM 1615 H HG3  . ARG A 1 105 ? 16.117  -0.674  8.434   1.00 1.19  ? 146 ARG A HG3  1 
ATOM 1616 H HD2  . ARG A 1 105 ? 16.439  -2.862  8.745   1.00 1.13  ? 146 ARG A HD2  1 
ATOM 1617 H HD3  . ARG A 1 105 ? 15.382  -3.289  7.400   1.00 1.15  ? 146 ARG A HD3  1 
ATOM 1618 H HE   . ARG A 1 105 ? 17.609  -2.437  6.149   1.00 2.02  ? 146 ARG A HE   1 
ATOM 1619 H HH11 . ARG A 1 105 ? 17.104  -4.742  8.730   1.00 2.12  ? 146 ARG A HH11 1 
ATOM 1620 H HH12 . ARG A 1 105 ? 18.471  -5.710  8.294   1.00 2.73  ? 146 ARG A HH12 1 
ATOM 1621 H HH21 . ARG A 1 105 ? 19.402  -3.713  5.583   1.00 2.60  ? 146 ARG A HH21 1 
ATOM 1622 H HH22 . ARG A 1 105 ? 19.774  -5.128  6.510   1.00 2.56  ? 146 ARG A HH22 1 
ATOM 1623 N N    . ILE A 1 106 ? 11.567  -0.495  5.861   1.00 0.27  ? 147 ILE A N    1 
ATOM 1624 C CA   . ILE A 1 106 ? 10.143  -0.766  5.731   1.00 0.28  ? 147 ILE A CA   1 
ATOM 1625 C C    . ILE A 1 106 ? 9.822   -1.192  4.308   1.00 0.29  ? 147 ILE A C    1 
ATOM 1626 O O    . ILE A 1 106 ? 9.260   -2.263  4.079   1.00 0.30  ? 147 ILE A O    1 
ATOM 1627 C CB   . ILE A 1 106 ? 9.294   0.469   6.089   1.00 0.29  ? 147 ILE A CB   1 
ATOM 1628 C CG1  . ILE A 1 106 ? 9.153   0.598   7.606   1.00 0.44  ? 147 ILE A CG1  1 
ATOM 1629 C CG2  . ILE A 1 106 ? 7.926   0.379   5.431   1.00 0.46  ? 147 ILE A CG2  1 
ATOM 1630 C CD1  . ILE A 1 106 ? 9.483   1.980   8.128   1.00 0.70  ? 147 ILE A CD1  1 
ATOM 1631 H H    . ILE A 1 106 ? 11.863  0.419   6.052   1.00 0.27  ? 147 ILE A H    1 
ATOM 1632 H HA   . ILE A 1 106 ? 9.888   -1.569  6.408   1.00 0.29  ? 147 ILE A HA   1 
ATOM 1633 H HB   . ILE A 1 106 ? 9.794   1.345   5.705   1.00 0.36  ? 147 ILE A HB   1 
ATOM 1634 H HG12 . ILE A 1 106 ? 8.135   0.373   7.886   1.00 0.92  ? 147 ILE A HG12 1 
ATOM 1635 H HG13 . ILE A 1 106 ? 9.818   -0.106  8.085   1.00 0.90  ? 147 ILE A HG13 1 
ATOM 1636 H HG21 . ILE A 1 106 ? 7.576   -0.642  5.466   1.00 1.15  ? 147 ILE A HG21 1 
ATOM 1637 H HG22 . ILE A 1 106 ? 7.999   0.700   4.403   1.00 0.91  ? 147 ILE A HG22 1 
ATOM 1638 H HG23 . ILE A 1 106 ? 7.230   1.016   5.958   1.00 1.17  ? 147 ILE A HG23 1 
ATOM 1639 H HD11 . ILE A 1 106 ? 8.701   2.668   7.843   1.00 1.34  ? 147 ILE A HD11 1 
ATOM 1640 H HD12 . ILE A 1 106 ? 10.421  2.309   7.708   1.00 1.31  ? 147 ILE A HD12 1 
ATOM 1641 H HD13 . ILE A 1 106 ? 9.561   1.949   9.204   1.00 1.30  ? 147 ILE A HD13 1 
ATOM 1642 N N    . VAL A 1 107 ? 10.196  -0.346  3.353   1.00 0.29  ? 148 VAL A N    1 
ATOM 1643 C CA   . VAL A 1 107 ? 9.964   -0.632  1.946   1.00 0.30  ? 148 VAL A CA   1 
ATOM 1644 C C    . VAL A 1 107 ? 10.420  -2.046  1.610   1.00 0.30  ? 148 VAL A C    1 
ATOM 1645 O O    . VAL A 1 107 ? 9.798   -2.736  0.804   1.00 0.30  ? 148 VAL A O    1 
ATOM 1646 C CB   . VAL A 1 107 ? 10.705  0.372   1.042   1.00 0.31  ? 148 VAL A CB   1 
ATOM 1647 C CG1  . VAL A 1 107 ? 11.328  -0.337  -0.152  1.00 0.35  ? 148 VAL A CG1  1 
ATOM 1648 C CG2  . VAL A 1 107 ? 9.761   1.474   0.584   1.00 0.35  ? 148 VAL A CG2  1 
ATOM 1649 H H    . VAL A 1 107 ? 10.645  0.489   3.601   1.00 0.28  ? 148 VAL A H    1 
ATOM 1650 H HA   . VAL A 1 107 ? 8.904   -0.548  1.756   1.00 0.32  ? 148 VAL A HA   1 
ATOM 1651 H HB   . VAL A 1 107 ? 11.500  0.825   1.618   1.00 0.40  ? 148 VAL A HB   1 
ATOM 1652 H HG11 . VAL A 1 107 ? 10.585  -0.958  -0.630  1.00 0.99  ? 148 VAL A HG11 1 
ATOM 1653 H HG12 . VAL A 1 107 ? 12.150  -0.951  0.182   1.00 0.99  ? 148 VAL A HG12 1 
ATOM 1654 H HG13 . VAL A 1 107 ? 11.690  0.397   -0.857  1.00 0.89  ? 148 VAL A HG13 1 
ATOM 1655 H HG21 . VAL A 1 107 ? 10.233  2.435   0.728   1.00 1.01  ? 148 VAL A HG21 1 
ATOM 1656 H HG22 . VAL A 1 107 ? 8.850   1.431   1.162   1.00 1.12  ? 148 VAL A HG22 1 
ATOM 1657 H HG23 . VAL A 1 107 ? 9.531   1.339   -0.462  1.00 1.08  ? 148 VAL A HG23 1 
ATOM 1658 N N    . ALA A 1 108 ? 11.509  -2.474  2.244   1.00 0.30  ? 149 ALA A N    1 
ATOM 1659 C CA   . ALA A 1 108 ? 12.045  -3.810  2.022   1.00 0.31  ? 149 ALA A CA   1 
ATOM 1660 C C    . ALA A 1 108 ? 11.080  -4.869  2.539   1.00 0.31  ? 149 ALA A C    1 
ATOM 1661 O O    . ALA A 1 108 ? 10.894  -5.912  1.914   1.00 0.32  ? 149 ALA A O    1 
ATOM 1662 C CB   . ALA A 1 108 ? 13.403  -3.953  2.694   1.00 0.32  ? 149 ALA A CB   1 
ATOM 1663 H H    . ALA A 1 108 ? 11.961  -1.878  2.881   1.00 0.30  ? 149 ALA A H    1 
ATOM 1664 H HA   . ALA A 1 108 ? 12.178  -3.946  0.960   1.00 0.31  ? 149 ALA A HA   1 
ATOM 1665 H HB1  . ALA A 1 108 ? 13.764  -2.979  2.988   1.00 1.01  ? 149 ALA A HB1  1 
ATOM 1666 H HB2  . ALA A 1 108 ? 14.101  -4.402  2.002   1.00 1.11  ? 149 ALA A HB2  1 
ATOM 1667 H HB3  . ALA A 1 108 ? 13.308  -4.581  3.567   1.00 1.06  ? 149 ALA A HB3  1 
ATOM 1668 N N    . PHE A 1 109 ? 10.461  -4.588  3.681   1.00 0.30  ? 150 PHE A N    1 
ATOM 1669 C CA   . PHE A 1 109 ? 9.508   -5.513  4.282   1.00 0.30  ? 150 PHE A CA   1 
ATOM 1670 C C    . PHE A 1 109 ? 8.326   -5.754  3.351   1.00 0.29  ? 150 PHE A C    1 
ATOM 1671 O O    . PHE A 1 109 ? 7.775   -6.854  3.303   1.00 0.33  ? 150 PHE A O    1 
ATOM 1672 C CB   . PHE A 1 109 ? 9.020   -4.969  5.626   1.00 0.32  ? 150 PHE A CB   1 
ATOM 1673 C CG   . PHE A 1 109 ? 7.605   -5.347  5.953   1.00 0.36  ? 150 PHE A CG   1 
ATOM 1674 C CD1  . PHE A 1 109 ? 7.304   -6.614  6.427   1.00 1.18  ? 150 PHE A CD1  1 
ATOM 1675 C CD2  . PHE A 1 109 ? 6.575   -4.433  5.792   1.00 1.34  ? 150 PHE A CD2  1 
ATOM 1676 C CE1  . PHE A 1 109 ? 6.002   -6.963  6.732   1.00 1.19  ? 150 PHE A CE1  1 
ATOM 1677 C CE2  . PHE A 1 109 ? 5.272   -4.777  6.097   1.00 1.47  ? 150 PHE A CE2  1 
ATOM 1678 C CZ   . PHE A 1 109 ? 4.985   -6.043  6.568   1.00 0.71  ? 150 PHE A CZ   1 
ATOM 1679 H H    . PHE A 1 109 ? 10.646  -3.735  4.128   1.00 0.29  ? 150 PHE A H    1 
ATOM 1680 H HA   . PHE A 1 109 ? 10.016  -6.450  4.446   1.00 0.31  ? 150 PHE A HA   1 
ATOM 1681 H HB2  . PHE A 1 109 ? 9.655   -5.350  6.412   1.00 0.39  ? 150 PHE A HB2  1 
ATOM 1682 H HB3  . PHE A 1 109 ? 9.083   -3.891  5.613   1.00 0.39  ? 150 PHE A HB3  1 
ATOM 1683 H HD1  . PHE A 1 109 ? 8.099   -7.334  6.556   1.00 2.10  ? 150 PHE A HD1  1 
ATOM 1684 H HD2  . PHE A 1 109 ? 6.799   -3.443  5.423   1.00 2.20  ? 150 PHE A HD2  1 
ATOM 1685 H HE1  . PHE A 1 109 ? 5.781   -7.954  7.101   1.00 2.04  ? 150 PHE A HE1  1 
ATOM 1686 H HE2  . PHE A 1 109 ? 4.479   -4.055  5.967   1.00 2.40  ? 150 PHE A HE2  1 
ATOM 1687 H HZ   . PHE A 1 109 ? 3.968   -6.313  6.807   1.00 0.87  ? 150 PHE A HZ   1 
ATOM 1688 N N    . PHE A 1 110 ? 7.944   -4.721  2.607   1.00 0.27  ? 151 PHE A N    1 
ATOM 1689 C CA   . PHE A 1 110 ? 6.831   -4.826  1.673   1.00 0.26  ? 151 PHE A CA   1 
ATOM 1690 C C    . PHE A 1 110 ? 7.184   -5.759  0.520   1.00 0.25  ? 151 PHE A C    1 
ATOM 1691 O O    . PHE A 1 110 ? 6.544   -6.792  0.325   1.00 0.26  ? 151 PHE A O    1 
ATOM 1692 C CB   . PHE A 1 110 ? 6.457   -3.444  1.134   1.00 0.26  ? 151 PHE A CB   1 
ATOM 1693 C CG   . PHE A 1 110 ? 5.517   -2.686  2.028   1.00 0.27  ? 151 PHE A CG   1 
ATOM 1694 C CD1  . PHE A 1 110 ? 5.991   -2.016  3.144   1.00 1.24  ? 151 PHE A CD1  1 
ATOM 1695 C CD2  . PHE A 1 110 ? 4.160   -2.645  1.751   1.00 1.07  ? 151 PHE A CD2  1 
ATOM 1696 C CE1  . PHE A 1 110 ? 5.128   -1.318  3.968   1.00 1.28  ? 151 PHE A CE1  1 
ATOM 1697 C CE2  . PHE A 1 110 ? 3.293   -1.949  2.571   1.00 1.05  ? 151 PHE A CE2  1 
ATOM 1698 C CZ   . PHE A 1 110 ? 3.777   -1.285  3.681   1.00 0.34  ? 151 PHE A CZ   1 
ATOM 1699 H H    . PHE A 1 110 ? 8.425   -3.871  2.687   1.00 0.27  ? 151 PHE A H    1 
ATOM 1700 H HA   . PHE A 1 110 ? 5.986   -5.236  2.207   1.00 0.27  ? 151 PHE A HA   1 
ATOM 1701 H HB2  . PHE A 1 110 ? 7.355   -2.855  1.021   1.00 0.27  ? 151 PHE A HB2  1 
ATOM 1702 H HB3  . PHE A 1 110 ? 5.983   -3.557  0.171   1.00 0.28  ? 151 PHE A HB3  1 
ATOM 1703 H HD1  . PHE A 1 110 ? 7.047   -2.041  3.369   1.00 2.10  ? 151 PHE A HD1  1 
ATOM 1704 H HD2  . PHE A 1 110 ? 3.780   -3.164  0.884   1.00 1.95  ? 151 PHE A HD2  1 
ATOM 1705 H HE1  . PHE A 1 110 ? 5.510   -0.800  4.836   1.00 2.17  ? 151 PHE A HE1  1 
ATOM 1706 H HE2  . PHE A 1 110 ? 2.237   -1.925  2.345   1.00 1.90  ? 151 PHE A HE2  1 
ATOM 1707 H HZ   . PHE A 1 110 ? 3.101   -0.740  4.324   1.00 0.39  ? 151 PHE A HZ   1 
ATOM 1708 N N    . GLU A 1 111 ? 8.209   -5.386  -0.241  1.00 0.25  ? 152 GLU A N    1 
ATOM 1709 C CA   . GLU A 1 111 ? 8.655   -6.188  -1.375  1.00 0.25  ? 152 GLU A CA   1 
ATOM 1710 C C    . GLU A 1 111 ? 8.791   -7.656  -0.984  1.00 0.26  ? 152 GLU A C    1 
ATOM 1711 O O    . GLU A 1 111 ? 8.436   -8.549  -1.753  1.00 0.28  ? 152 GLU A O    1 
ATOM 1712 C CB   . GLU A 1 111 ? 9.992   -5.663  -1.901  1.00 0.27  ? 152 GLU A CB   1 
ATOM 1713 C CG   . GLU A 1 111 ? 10.046  -5.543  -3.414  1.00 0.95  ? 152 GLU A CG   1 
ATOM 1714 C CD   . GLU A 1 111 ? 10.914  -6.609  -4.053  1.00 1.57  ? 152 GLU A CD   1 
ATOM 1715 O OE1  . GLU A 1 111 ? 11.944  -6.976  -3.449  1.00 2.24  ? 152 GLU A OE1  1 
ATOM 1716 O OE2  . GLU A 1 111 ? 10.564  -7.078  -5.156  1.00 2.25  ? 152 GLU A OE2  1 
ATOM 1717 H H    . GLU A 1 111 ? 8.678   -4.551  -0.034  1.00 0.25  ? 152 GLU A H    1 
ATOM 1718 H HA   . GLU A 1 111 ? 7.913   -6.103  -2.154  1.00 0.26  ? 152 GLU A HA   1 
ATOM 1719 H HB2  . GLU A 1 111 ? 10.174  -4.686  -1.477  1.00 0.76  ? 152 GLU A HB2  1 
ATOM 1720 H HB3  . GLU A 1 111 ? 10.778  -6.334  -1.586  1.00 0.63  ? 152 GLU A HB3  1 
ATOM 1721 H HG2  . GLU A 1 111 ? 9.045   -5.634  -3.806  1.00 1.61  ? 152 GLU A HG2  1 
ATOM 1722 H HG3  . GLU A 1 111 ? 10.446  -4.572  -3.672  1.00 1.61  ? 152 GLU A HG3  1 
ATOM 1723 N N    . PHE A 1 112 ? 9.307   -7.899  0.217   1.00 0.25  ? 153 PHE A N    1 
ATOM 1724 C CA   . PHE A 1 112 ? 9.487   -9.259  0.709   1.00 0.27  ? 153 PHE A CA   1 
ATOM 1725 C C    . PHE A 1 112 ? 8.159   -10.009 0.724   1.00 0.28  ? 153 PHE A C    1 
ATOM 1726 O O    . PHE A 1 112 ? 8.034   -11.083 0.136   1.00 0.32  ? 153 PHE A O    1 
ATOM 1727 C CB   . PHE A 1 112 ? 10.093  -9.241  2.113   1.00 0.29  ? 153 PHE A CB   1 
ATOM 1728 C CG   . PHE A 1 112 ? 9.467   -10.235 3.050   1.00 0.28  ? 153 PHE A CG   1 
ATOM 1729 C CD1  . PHE A 1 112 ? 9.598   -11.596 2.825   1.00 1.13  ? 153 PHE A CD1  1 
ATOM 1730 C CD2  . PHE A 1 112 ? 8.748   -9.808  4.155   1.00 0.86  ? 153 PHE A CD2  1 
ATOM 1731 C CE1  . PHE A 1 112 ? 9.024   -12.513 3.685   1.00 1.15  ? 153 PHE A CE1  1 
ATOM 1732 C CE2  . PHE A 1 112 ? 8.171   -10.720 5.018   1.00 0.87  ? 153 PHE A CE2  1 
ATOM 1733 C CZ   . PHE A 1 112 ? 8.310   -12.074 4.783   1.00 0.37  ? 153 PHE A CZ   1 
ATOM 1734 H H    . PHE A 1 112 ? 9.570   -7.145  0.786   1.00 0.25  ? 153 PHE A H    1 
ATOM 1735 H HA   . PHE A 1 112 ? 10.165  -9.767  0.040   1.00 0.31  ? 153 PHE A HA   1 
ATOM 1736 H HB2  . PHE A 1 112 ? 11.147  -9.467  2.046   1.00 0.33  ? 153 PHE A HB2  1 
ATOM 1737 H HB3  . PHE A 1 112 ? 9.968   -8.256  2.539   1.00 0.30  ? 153 PHE A HB3  1 
ATOM 1738 H HD1  . PHE A 1 112 ? 10.157  -11.940 1.967   1.00 1.87  ? 153 PHE A HD1  1 
ATOM 1739 H HD2  . PHE A 1 112 ? 8.639   -8.749  4.339   1.00 1.59  ? 153 PHE A HD2  1 
ATOM 1740 H HE1  . PHE A 1 112 ? 9.133   -13.571 3.499   1.00 1.90  ? 153 PHE A HE1  1 
ATOM 1741 H HE2  . PHE A 1 112 ? 7.614   -10.374 5.876   1.00 1.60  ? 153 PHE A HE2  1 
ATOM 1742 H HZ   . PHE A 1 112 ? 7.860   -12.789 5.457   1.00 0.43  ? 153 PHE A HZ   1 
ATOM 1743 N N    . GLY A 1 113 ? 7.168   -9.433  1.398   1.00 0.30  ? 154 GLY A N    1 
ATOM 1744 C CA   . GLY A 1 113 ? 5.862   -10.060 1.472   1.00 0.34  ? 154 GLY A CA   1 
ATOM 1745 C C    . GLY A 1 113 ? 5.281   -10.346 0.102   1.00 0.33  ? 154 GLY A C    1 
ATOM 1746 O O    . GLY A 1 113 ? 4.585   -11.343 -0.090  1.00 0.37  ? 154 GLY A O    1 
ATOM 1747 H H    . GLY A 1 113 ? 7.325   -8.575  1.845   1.00 0.32  ? 154 GLY A H    1 
ATOM 1748 H HA2  . GLY A 1 113 ? 5.951   -10.990 2.015   1.00 0.36  ? 154 GLY A HA2  1 
ATOM 1749 H HA3  . GLY A 1 113 ? 5.190   -9.405  2.007   1.00 0.37  ? 154 GLY A HA3  1 
ATOM 1750 N N    . GLY A 1 114 ? 5.571   -9.470  -0.855  1.00 0.32  ? 155 GLY A N    1 
ATOM 1751 C CA   . GLY A 1 114 ? 5.068   -9.651  -2.203  1.00 0.35  ? 155 GLY A CA   1 
ATOM 1752 C C    . GLY A 1 114 ? 5.659   -10.872 -2.879  1.00 0.35  ? 155 GLY A C    1 
ATOM 1753 O O    . GLY A 1 114 ? 4.990   -11.540 -3.667  1.00 0.39  ? 155 GLY A O    1 
ATOM 1754 H H    . GLY A 1 114 ? 6.133   -8.695  -0.643  1.00 0.34  ? 155 GLY A H    1 
ATOM 1755 H HA2  . GLY A 1 114 ? 3.994   -9.758  -2.164  1.00 0.37  ? 155 GLY A HA2  1 
ATOM 1756 H HA3  . GLY A 1 114 ? 5.312   -8.776  -2.788  1.00 0.38  ? 155 GLY A HA3  1 
ATOM 1757 N N    . VAL A 1 115 ? 6.918   -11.165 -2.568  1.00 0.33  ? 156 VAL A N    1 
ATOM 1758 C CA   . VAL A 1 115 ? 7.600   -12.315 -3.147  1.00 0.36  ? 156 VAL A CA   1 
ATOM 1759 C C    . VAL A 1 115 ? 7.008   -13.620 -2.627  1.00 0.36  ? 156 VAL A C    1 
ATOM 1760 O O    . VAL A 1 115 ? 6.795   -14.564 -3.388  1.00 0.37  ? 156 VAL A O    1 
ATOM 1761 C CB   . VAL A 1 115 ? 9.108   -12.289 -2.834  1.00 0.39  ? 156 VAL A CB   1 
ATOM 1762 C CG1  . VAL A 1 115 ? 9.627   -13.696 -2.582  1.00 0.54  ? 156 VAL A CG1  1 
ATOM 1763 C CG2  . VAL A 1 115 ? 9.877   -11.624 -3.966  1.00 0.59  ? 156 VAL A CG2  1 
ATOM 1764 H H    . VAL A 1 115 ? 7.398   -10.595 -1.931  1.00 0.33  ? 156 VAL A H    1 
ATOM 1765 H HA   . VAL A 1 115 ? 7.474   -12.274 -4.219  1.00 0.39  ? 156 VAL A HA   1 
ATOM 1766 H HB   . VAL A 1 115 ? 9.259   -11.708 -1.936  1.00 0.45  ? 156 VAL A HB   1 
ATOM 1767 H HG11 . VAL A 1 115 ? 10.707  -13.685 -2.569  1.00 1.00  ? 156 VAL A HG11 1 
ATOM 1768 H HG12 . VAL A 1 115 ? 9.283   -14.353 -3.368  1.00 1.31  ? 156 VAL A HG12 1 
ATOM 1769 H HG13 . VAL A 1 115 ? 9.259   -14.050 -1.630  1.00 0.92  ? 156 VAL A HG13 1 
ATOM 1770 H HG21 . VAL A 1 115 ? 9.839   -12.252 -4.844  1.00 1.27  ? 156 VAL A HG21 1 
ATOM 1771 H HG22 . VAL A 1 115 ? 10.905  -11.483 -3.668  1.00 1.17  ? 156 VAL A HG22 1 
ATOM 1772 H HG23 . VAL A 1 115 ? 9.432   -10.666 -4.190  1.00 1.16  ? 156 VAL A HG23 1 
ATOM 1773 N N    . MET A 1 116 ? 6.742   -13.664 -1.326  1.00 0.36  ? 157 MET A N    1 
ATOM 1774 C CA   . MET A 1 116 ? 6.172   -14.852 -0.701  1.00 0.39  ? 157 MET A CA   1 
ATOM 1775 C C    . MET A 1 116 ? 4.776   -15.135 -1.246  1.00 0.37  ? 157 MET A C    1 
ATOM 1776 O O    . MET A 1 116 ? 4.421   -16.285 -1.504  1.00 0.38  ? 157 MET A O    1 
ATOM 1777 C CB   . MET A 1 116 ? 6.114   -14.676 0.818   1.00 0.44  ? 157 MET A CB   1 
ATOM 1778 C CG   . MET A 1 116 ? 5.206   -15.678 1.512   1.00 0.84  ? 157 MET A CG   1 
ATOM 1779 S SD   . MET A 1 116 ? 5.779   -16.103 3.168   1.00 1.15  ? 157 MET A SD   1 
ATOM 1780 C CE   . MET A 1 116 ? 4.819   -14.964 4.162   1.00 0.70  ? 157 MET A CE   1 
ATOM 1781 H H    . MET A 1 116 ? 6.934   -12.878 -0.772  1.00 0.36  ? 157 MET A H    1 
ATOM 1782 H HA   . MET A 1 116 ? 6.813   -15.688 -0.933  1.00 0.41  ? 157 MET A HA   1 
ATOM 1783 H HB2  . MET A 1 116 ? 7.110   -14.785 1.220   1.00 1.03  ? 157 MET A HB2  1 
ATOM 1784 H HB3  . MET A 1 116 ? 5.753   -13.682 1.040   1.00 1.03  ? 157 MET A HB3  1 
ATOM 1785 H HG2  . MET A 1 116 ? 4.216   -15.255 1.587   1.00 1.48  ? 157 MET A HG2  1 
ATOM 1786 H HG3  . MET A 1 116 ? 5.167   -16.579 0.917   1.00 1.44  ? 157 MET A HG3  1 
ATOM 1787 H HE1  . MET A 1 116 ? 5.277   -14.860 5.135   1.00 1.07  ? 157 MET A HE1  1 
ATOM 1788 H HE2  . MET A 1 116 ? 3.814   -15.345 4.277   1.00 1.18  ? 157 MET A HE2  1 
ATOM 1789 H HE3  . MET A 1 116 ? 4.785   -14.001 3.676   1.00 1.27  ? 157 MET A HE3  1 
ATOM 1790 N N    . CYS A 1 117 ? 3.988   -14.079 -1.421  1.00 0.37  ? 158 CYS A N    1 
ATOM 1791 C CA   . CYS A 1 117 ? 2.631   -14.214 -1.937  1.00 0.38  ? 158 CYS A CA   1 
ATOM 1792 C C    . CYS A 1 117 ? 2.641   -14.821 -3.336  1.00 0.37  ? 158 CYS A C    1 
ATOM 1793 O O    . CYS A 1 117 ? 2.098   -15.904 -3.557  1.00 0.45  ? 158 CYS A O    1 
ATOM 1794 C CB   . CYS A 1 117 ? 1.934   -12.852 -1.963  1.00 0.41  ? 158 CYS A CB   1 
ATOM 1795 S SG   . CYS A 1 117 ? 0.793   -12.633 -3.347  1.00 1.19  ? 158 CYS A SG   1 
ATOM 1796 H H    . CYS A 1 117 ? 4.328   -13.187 -1.198  1.00 0.39  ? 158 CYS A H    1 
ATOM 1797 H HA   . CYS A 1 117 ? 2.089   -14.873 -1.275  1.00 0.41  ? 158 CYS A HA   1 
ATOM 1798 H HB2  . CYS A 1 117 ? 1.370   -12.728 -1.051  1.00 0.85  ? 158 CYS A HB2  1 
ATOM 1799 H HB3  . CYS A 1 117 ? 2.682   -12.075 -2.026  1.00 0.86  ? 158 CYS A HB3  1 
ATOM 1800 H HG   . CYS A 1 117 ? 0.112   -12.013 -3.075  1.00 1.40  ? 158 CYS A HG   1 
ATOM 1801 N N    . VAL A 1 118 ? 3.264   -14.119 -4.277  1.00 0.38  ? 159 VAL A N    1 
ATOM 1802 C CA   . VAL A 1 118 ? 3.345   -14.591 -5.653  1.00 0.43  ? 159 VAL A CA   1 
ATOM 1803 C C    . VAL A 1 118 ? 3.806   -16.044 -5.702  1.00 0.45  ? 159 VAL A C    1 
ATOM 1804 O O    . VAL A 1 118 ? 3.378   -16.813 -6.563  1.00 0.49  ? 159 VAL A O    1 
ATOM 1805 C CB   . VAL A 1 118 ? 4.304   -13.718 -6.489  1.00 0.50  ? 159 VAL A CB   1 
ATOM 1806 C CG1  . VAL A 1 118 ? 5.334   -14.573 -7.215  1.00 0.77  ? 159 VAL A CG1  1 
ATOM 1807 C CG2  . VAL A 1 118 ? 3.520   -12.866 -7.477  1.00 0.73  ? 159 VAL A CG2  1 
ATOM 1808 H H    . VAL A 1 118 ? 3.679   -13.264 -4.039  1.00 0.41  ? 159 VAL A H    1 
ATOM 1809 H HA   . VAL A 1 118 ? 2.357   -14.523 -6.087  1.00 0.44  ? 159 VAL A HA   1 
ATOM 1810 H HB   . VAL A 1 118 ? 4.830   -13.056 -5.818  1.00 0.82  ? 159 VAL A HB   1 
ATOM 1811 H HG11 . VAL A 1 118 ? 5.954   -13.940 -7.832  1.00 1.36  ? 159 VAL A HG11 1 
ATOM 1812 H HG12 . VAL A 1 118 ? 4.830   -15.297 -7.838  1.00 1.15  ? 159 VAL A HG12 1 
ATOM 1813 H HG13 . VAL A 1 118 ? 5.953   -15.086 -6.492  1.00 1.37  ? 159 VAL A HG13 1 
ATOM 1814 H HG21 . VAL A 1 118 ? 2.891   -12.175 -6.936  1.00 1.29  ? 159 VAL A HG21 1 
ATOM 1815 H HG22 . VAL A 1 118 ? 2.906   -13.505 -8.094  1.00 1.22  ? 159 VAL A HG22 1 
ATOM 1816 H HG23 . VAL A 1 118 ? 4.208   -12.315 -8.101  1.00 1.29  ? 159 VAL A HG23 1 
ATOM 1817 N N    . GLU A 1 119 ? 4.678   -16.414 -4.770  1.00 0.44  ? 160 GLU A N    1 
ATOM 1818 C CA   . GLU A 1 119 ? 5.191   -17.776 -4.706  1.00 0.51  ? 160 GLU A CA   1 
ATOM 1819 C C    . GLU A 1 119 ? 4.056   -18.766 -4.472  1.00 0.49  ? 160 GLU A C    1 
ATOM 1820 O O    . GLU A 1 119 ? 4.033   -19.851 -5.054  1.00 0.56  ? 160 GLU A O    1 
ATOM 1821 C CB   . GLU A 1 119 ? 6.232   -17.902 -3.591  1.00 0.57  ? 160 GLU A CB   1 
ATOM 1822 C CG   . GLU A 1 119 ? 7.411   -18.788 -3.957  1.00 1.15  ? 160 GLU A CG   1 
ATOM 1823 C CD   . GLU A 1 119 ? 8.585   -18.617 -3.014  1.00 1.62  ? 160 GLU A CD   1 
ATOM 1824 O OE1  . GLU A 1 119 ? 8.350   -18.395 -1.808  1.00 2.33  ? 160 GLU A OE1  1 
ATOM 1825 O OE2  . GLU A 1 119 ? 9.740   -18.706 -3.481  1.00 2.13  ? 160 GLU A OE2  1 
ATOM 1826 H H    . GLU A 1 119 ? 4.978   -15.757 -4.108  1.00 0.42  ? 160 GLU A H    1 
ATOM 1827 H HA   . GLU A 1 119 ? 5.660   -18.000 -5.652  1.00 0.57  ? 160 GLU A HA   1 
ATOM 1828 H HB2  . GLU A 1 119 ? 6.609   -16.918 -3.354  1.00 1.10  ? 160 GLU A HB2  1 
ATOM 1829 H HB3  . GLU A 1 119 ? 5.756   -18.316 -2.715  1.00 1.04  ? 160 GLU A HB3  1 
ATOM 1830 H HG2  . GLU A 1 119 ? 7.092   -19.820 -3.927  1.00 1.77  ? 160 GLU A HG2  1 
ATOM 1831 H HG3  . GLU A 1 119 ? 7.733   -18.541 -4.959  1.00 1.83  ? 160 GLU A HG3  1 
ATOM 1832 N N    . SER A 1 120 ? 3.113   -18.382 -3.618  1.00 0.45  ? 161 SER A N    1 
ATOM 1833 C CA   . SER A 1 120 ? 1.970   -19.230 -3.308  1.00 0.46  ? 161 SER A CA   1 
ATOM 1834 C C    . SER A 1 120 ? 1.175   -19.549 -4.570  1.00 0.44  ? 161 SER A C    1 
ATOM 1835 O O    . SER A 1 120 ? 1.065   -20.707 -4.969  1.00 0.47  ? 161 SER A O    1 
ATOM 1836 C CB   . SER A 1 120 ? 1.068   -18.548 -2.278  1.00 0.48  ? 161 SER A CB   1 
ATOM 1837 O OG   . SER A 1 120 ? 1.769   -17.536 -1.577  1.00 1.17  ? 161 SER A OG   1 
ATOM 1838 H H    . SER A 1 120 ? 3.189   -17.504 -3.188  1.00 0.44  ? 161 SER A H    1 
ATOM 1839 H HA   . SER A 1 120 ? 2.345   -20.153 -2.890  1.00 0.52  ? 161 SER A HA   1 
ATOM 1840 H HB2  . SER A 1 120 ? 0.224   -18.101 -2.782  1.00 1.06  ? 161 SER A HB2  1 
ATOM 1841 H HB3  . SER A 1 120 ? 0.716   -19.283 -1.569  1.00 0.97  ? 161 SER A HB3  1 
ATOM 1842 H HG   . SER A 1 120 ? 1.453   -16.674 -1.858  1.00 1.65  ? 161 SER A HG   1 
ATOM 1843 N N    . VAL A 1 121 ? 0.631   -18.512 -5.199  1.00 0.42  ? 162 VAL A N    1 
ATOM 1844 C CA   . VAL A 1 121 ? -0.146  -18.687 -6.422  1.00 0.42  ? 162 VAL A CA   1 
ATOM 1845 C C    . VAL A 1 121 ? 0.641   -19.473 -7.469  1.00 0.41  ? 162 VAL A C    1 
ATOM 1846 O O    . VAL A 1 121 ? 0.059   -20.121 -8.338  1.00 0.48  ? 162 VAL A O    1 
ATOM 1847 C CB   . VAL A 1 121 ? -0.573  -17.334 -7.023  1.00 0.46  ? 162 VAL A CB   1 
ATOM 1848 C CG1  . VAL A 1 121 ? 0.469   -16.830 -8.009  1.00 0.73  ? 162 VAL A CG1  1 
ATOM 1849 C CG2  . VAL A 1 121 ? -1.932  -17.457 -7.694  1.00 0.91  ? 162 VAL A CG2  1 
ATOM 1850 H H    . VAL A 1 121 ? 0.763   -17.611 -4.837  1.00 0.40  ? 162 VAL A H    1 
ATOM 1851 H HA   . VAL A 1 121 ? -1.039  -19.241 -6.170  1.00 0.45  ? 162 VAL A HA   1 
ATOM 1852 H HB   . VAL A 1 121 ? -0.654  -16.616 -6.221  1.00 0.88  ? 162 VAL A HB   1 
ATOM 1853 H HG11 . VAL A 1 121 ? 0.414   -15.753 -8.073  1.00 1.30  ? 162 VAL A HG11 1 
ATOM 1854 H HG12 . VAL A 1 121 ? 0.280   -17.258 -8.983  1.00 1.47  ? 162 VAL A HG12 1 
ATOM 1855 H HG13 . VAL A 1 121 ? 1.453   -17.121 -7.674  1.00 1.24  ? 162 VAL A HG13 1 
ATOM 1856 H HG21 . VAL A 1 121 ? -1.974  -16.796 -8.546  1.00 1.53  ? 162 VAL A HG21 1 
ATOM 1857 H HG22 . VAL A 1 121 ? -2.705  -17.189 -6.991  1.00 1.43  ? 162 VAL A HG22 1 
ATOM 1858 H HG23 . VAL A 1 121 ? -2.081  -18.475 -8.021  1.00 1.42  ? 162 VAL A HG23 1 
ATOM 1859 N N    . ASN A 1 122 ? 1.968   -19.420 -7.375  1.00 0.48  ? 163 ASN A N    1 
ATOM 1860 C CA   . ASN A 1 122 ? 2.828   -20.134 -8.310  1.00 0.51  ? 163 ASN A CA   1 
ATOM 1861 C C    . ASN A 1 122 ? 2.785   -21.635 -8.039  1.00 0.60  ? 163 ASN A C    1 
ATOM 1862 O O    . ASN A 1 122 ? 2.737   -22.443 -8.967  1.00 0.96  ? 163 ASN A O    1 
ATOM 1863 C CB   . ASN A 1 122 ? 4.266   -19.625 -8.205  1.00 0.56  ? 163 ASN A CB   1 
ATOM 1864 C CG   . ASN A 1 122 ? 4.895   -19.388 -9.564  1.00 0.96  ? 163 ASN A CG   1 
ATOM 1865 O OD1  . ASN A 1 122 ? 4.819   -20.237 -10.453 1.00 1.65  ? 163 ASN A OD1  1 
ATOM 1866 N ND2  . ASN A 1 122 ? 5.522   -18.229 -9.732  1.00 1.36  ? 163 ASN A ND2  1 
ATOM 1867 H H    . ASN A 1 122 ? 2.374   -18.893 -6.656  1.00 0.59  ? 163 ASN A H    1 
ATOM 1868 H HA   . ASN A 1 122 ? 2.460   -19.949 -9.308  1.00 0.55  ? 163 ASN A HA   1 
ATOM 1869 H HB2  . ASN A 1 122 ? 4.273   -18.693 -7.659  1.00 0.76  ? 163 ASN A HB2  1 
ATOM 1870 H HB3  . ASN A 1 122 ? 4.862   -20.353 -7.675  1.00 0.86  ? 163 ASN A HB3  1 
ATOM 1871 H HD21 . ASN A 1 122 ? 5.542   -17.601 -8.981  1.00 1.66  ? 163 ASN A HD21 1 
ATOM 1872 H HD22 . ASN A 1 122 ? 5.938   -18.050 -10.601 1.00 1.73  ? 163 ASN A HD22 1 
ATOM 1873 N N    . ARG A 1 123 ? 2.810   -22.000 -6.760  1.00 0.54  ? 164 ARG A N    1 
ATOM 1874 C CA   . ARG A 1 123 ? 2.780   -23.405 -6.362  1.00 0.61  ? 164 ARG A CA   1 
ATOM 1875 C C    . ARG A 1 123 ? 1.354   -23.887 -6.087  1.00 0.56  ? 164 ARG A C    1 
ATOM 1876 O O    . ARG A 1 123 ? 1.153   -24.858 -5.359  1.00 0.65  ? 164 ARG A O    1 
ATOM 1877 C CB   . ARG A 1 123 ? 3.646   -23.618 -5.119  1.00 0.74  ? 164 ARG A CB   1 
ATOM 1878 C CG   . ARG A 1 123 ? 5.108   -23.889 -5.434  1.00 1.40  ? 164 ARG A CG   1 
ATOM 1879 C CD   . ARG A 1 123 ? 5.639   -25.070 -4.638  1.00 1.61  ? 164 ARG A CD   1 
ATOM 1880 N NE   . ARG A 1 123 ? 6.635   -25.832 -5.387  1.00 2.47  ? 164 ARG A NE   1 
ATOM 1881 C CZ   . ARG A 1 123 ? 7.098   -27.023 -5.012  1.00 3.10  ? 164 ARG A CZ   1 
ATOM 1882 N NH1  . ARG A 1 123 ? 6.660   -27.596 -3.896  1.00 3.26  ? 164 ARG A NH1  1 
ATOM 1883 N NH2  . ARG A 1 123 ? 8.004   -27.644 -5.755  1.00 4.01  ? 164 ARG A NH2  1 
ATOM 1884 H H    . ARG A 1 123 ? 2.858   -21.308 -6.068  1.00 0.69  ? 164 ARG A H    1 
ATOM 1885 H HA   . ARG A 1 123 ? 3.190   -23.985 -7.174  1.00 0.71  ? 164 ARG A HA   1 
ATOM 1886 H HB2  . ARG A 1 123 ? 3.591   -22.734 -4.500  1.00 1.07  ? 164 ARG A HB2  1 
ATOM 1887 H HB3  . ARG A 1 123 ? 3.257   -24.459 -4.564  1.00 0.83  ? 164 ARG A HB3  1 
ATOM 1888 H HG2  . ARG A 1 123 ? 5.205   -24.105 -6.487  1.00 2.02  ? 164 ARG A HG2  1 
ATOM 1889 H HG3  . ARG A 1 123 ? 5.687   -23.010 -5.189  1.00 2.01  ? 164 ARG A HG3  1 
ATOM 1890 H HD2  . ARG A 1 123 ? 6.092   -24.701 -3.729  1.00 2.00  ? 164 ARG A HD2  1 
ATOM 1891 H HD3  . ARG A 1 123 ? 4.814   -25.721 -4.389  1.00 1.71  ? 164 ARG A HD3  1 
ATOM 1892 H HE   . ARG A 1 123 ? 6.978   -25.435 -6.215  1.00 2.93  ? 164 ARG A HE   1 
ATOM 1893 H HH11 . ARG A 1 123 ? 5.978   -27.136 -3.329  1.00 2.94  ? 164 ARG A HH11 1 
ATOM 1894 H HH12 . ARG A 1 123 ? 7.014   -28.490 -3.623  1.00 3.98  ? 164 ARG A HH12 1 
ATOM 1895 H HH21 . ARG A 1 123 ? 8.338   -27.219 -6.596  1.00 4.32  ? 164 ARG A HH21 1 
ATOM 1896 H HH22 . ARG A 1 123 ? 8.353   -28.538 -5.474  1.00 4.56  ? 164 ARG A HH22 1 
ATOM 1897 N N    . GLU A 1 124 ? 0.367   -23.213 -6.675  1.00 0.60  ? 165 GLU A N    1 
ATOM 1898 C CA   . GLU A 1 124 ? -1.031  -23.591 -6.488  1.00 0.63  ? 165 GLU A CA   1 
ATOM 1899 C C    . GLU A 1 124 ? -1.499  -23.296 -5.066  1.00 0.53  ? 165 GLU A C    1 
ATOM 1900 O O    . GLU A 1 124 ? -2.334  -24.015 -4.516  1.00 0.64  ? 165 GLU A O    1 
ATOM 1901 C CB   . GLU A 1 124 ? -1.224  -25.076 -6.801  1.00 0.78  ? 165 GLU A CB   1 
ATOM 1902 C CG   . GLU A 1 124 ? -2.352  -25.350 -7.783  1.00 1.48  ? 165 GLU A CG   1 
ATOM 1903 C CD   . GLU A 1 124 ? -2.272  -26.737 -8.388  1.00 1.94  ? 165 GLU A CD   1 
ATOM 1904 O OE1  . GLU A 1 124 ? -2.041  -27.703 -7.631  1.00 2.49  ? 165 GLU A OE1  1 
ATOM 1905 O OE2  . GLU A 1 124 ? -2.439  -26.858 -9.620  1.00 2.57  ? 165 GLU A OE2  1 
ATOM 1906 H H    . GLU A 1 124 ? 0.580   -22.452 -7.250  1.00 0.71  ? 165 GLU A H    1 
ATOM 1907 H HA   . GLU A 1 124 ? -1.625  -23.009 -7.176  1.00 0.71  ? 165 GLU A HA   1 
ATOM 1908 H HB2  . GLU A 1 124 ? -0.308  -25.465 -7.221  1.00 1.01  ? 165 GLU A HB2  1 
ATOM 1909 H HB3  . GLU A 1 124 ? -1.440  -25.600 -5.883  1.00 1.00  ? 165 GLU A HB3  1 
ATOM 1910 H HG2  . GLU A 1 124 ? -3.294  -25.254 -7.265  1.00 2.08  ? 165 GLU A HG2  1 
ATOM 1911 H HG3  . GLU A 1 124 ? -2.304  -24.622 -8.579  1.00 2.10  ? 165 GLU A HG3  1 
ATOM 1912 N N    . MET A 1 125 ? -0.957  -22.237 -4.475  1.00 0.47  ? 166 MET A N    1 
ATOM 1913 C CA   . MET A 1 125 ? -1.320  -21.849 -3.117  1.00 0.44  ? 166 MET A CA   1 
ATOM 1914 C C    . MET A 1 125 ? -1.847  -20.415 -3.083  1.00 0.44  ? 166 MET A C    1 
ATOM 1915 O O    . MET A 1 125 ? -1.456  -19.616 -2.233  1.00 0.59  ? 166 MET A O    1 
ATOM 1916 C CB   . MET A 1 125 ? -0.110  -21.991 -2.189  1.00 0.49  ? 166 MET A CB   1 
ATOM 1917 C CG   . MET A 1 125 ? -0.032  -23.342 -1.499  1.00 0.87  ? 166 MET A CG   1 
ATOM 1918 S SD   . MET A 1 125 ? 0.027   -24.717 -2.664  1.00 1.06  ? 166 MET A SD   1 
ATOM 1919 C CE   . MET A 1 125 ? 1.591   -25.470 -2.222  1.00 0.90  ? 166 MET A CE   1 
ATOM 1920 H H    . MET A 1 125 ? -0.296  -21.704 -4.963  1.00 0.55  ? 166 MET A H    1 
ATOM 1921 H HA   . MET A 1 125 ? -2.100  -22.515 -2.780  1.00 0.46  ? 166 MET A HA   1 
ATOM 1922 H HB2  . MET A 1 125 ? 0.791   -21.854 -2.767  1.00 0.66  ? 166 MET A HB2  1 
ATOM 1923 H HB3  . MET A 1 125 ? -0.158  -21.227 -1.429  1.00 0.69  ? 166 MET A HB3  1 
ATOM 1924 H HG2  . MET A 1 125 ? 0.858   -23.368 -0.889  1.00 1.73  ? 166 MET A HG2  1 
ATOM 1925 H HG3  . MET A 1 125 ? -0.901  -23.459 -0.869  1.00 1.48  ? 166 MET A HG3  1 
ATOM 1926 H HE1  . MET A 1 125 ? 1.999   -24.970 -1.355  1.00 1.50  ? 166 MET A HE1  1 
ATOM 1927 H HE2  . MET A 1 125 ? 2.281   -25.379 -3.048  1.00 1.11  ? 166 MET A HE2  1 
ATOM 1928 H HE3  . MET A 1 125 ? 1.436   -26.514 -1.995  1.00 1.57  ? 166 MET A HE3  1 
ATOM 1929 N N    . SER A 1 126 ? -2.741  -20.096 -4.013  1.00 0.40  ? 167 SER A N    1 
ATOM 1930 C CA   . SER A 1 126 ? -3.323  -18.760 -4.088  1.00 0.43  ? 167 SER A CA   1 
ATOM 1931 C C    . SER A 1 126 ? -3.875  -18.321 -2.734  1.00 0.42  ? 167 SER A C    1 
ATOM 1932 O O    . SER A 1 126 ? -3.529  -17.253 -2.230  1.00 0.45  ? 167 SER A O    1 
ATOM 1933 C CB   . SER A 1 126 ? -4.433  -18.723 -5.140  1.00 0.51  ? 167 SER A CB   1 
ATOM 1934 O OG   . SER A 1 126 ? -5.654  -18.272 -4.578  1.00 1.41  ? 167 SER A OG   1 
ATOM 1935 H H    . SER A 1 126 ? -3.018  -20.774 -4.664  1.00 0.44  ? 167 SER A H    1 
ATOM 1936 H HA   . SER A 1 126 ? -2.541  -18.076 -4.382  1.00 0.47  ? 167 SER A HA   1 
ATOM 1937 H HB2  . SER A 1 126 ? -4.150  -18.051 -5.936  1.00 0.97  ? 167 SER A HB2  1 
ATOM 1938 H HB3  . SER A 1 126 ? -4.580  -19.715 -5.541  1.00 1.05  ? 167 SER A HB3  1 
ATOM 1939 H HG   . SER A 1 126 ? -6.384  -18.766 -4.959  1.00 1.64  ? 167 SER A HG   1 
ATOM 1940 N N    . PRO A 1 127 ? -4.747  -19.142 -2.126  1.00 0.45  ? 168 PRO A N    1 
ATOM 1941 C CA   . PRO A 1 127 ? -5.350  -18.833 -0.826  1.00 0.52  ? 168 PRO A CA   1 
ATOM 1942 C C    . PRO A 1 127 ? -4.323  -18.378 0.206   1.00 0.49  ? 168 PRO A C    1 
ATOM 1943 O O    . PRO A 1 127 ? -4.644  -17.618 1.120   1.00 0.52  ? 168 PRO A O    1 
ATOM 1944 C CB   . PRO A 1 127 ? -5.974  -20.163 -0.406  1.00 0.63  ? 168 PRO A CB   1 
ATOM 1945 C CG   . PRO A 1 127 ? -6.284  -20.855 -1.688  1.00 0.51  ? 168 PRO A CG   1 
ATOM 1946 C CD   . PRO A 1 127 ? -5.214  -20.435 -2.661  1.00 0.48  ? 168 PRO A CD   1 
ATOM 1947 H HA   . PRO A 1 127 ? -6.122  -18.083 -0.918  1.00 0.57  ? 168 PRO A HA   1 
ATOM 1948 H HB2  . PRO A 1 127 ? -5.267  -20.725 0.187   1.00 0.83  ? 168 PRO A HB2  1 
ATOM 1949 H HB3  . PRO A 1 127 ? -6.870  -19.979 0.168   1.00 0.82  ? 168 PRO A HB3  1 
ATOM 1950 H HG2  . PRO A 1 127 ? -6.259  -21.925 -1.543  1.00 0.71  ? 168 PRO A HG2  1 
ATOM 1951 H HG3  . PRO A 1 127 ? -7.256  -20.547 -2.046  1.00 0.68  ? 168 PRO A HG3  1 
ATOM 1952 H HD2  . PRO A 1 127 ? -4.412  -21.159 -2.673  1.00 0.54  ? 168 PRO A HD2  1 
ATOM 1953 H HD3  . PRO A 1 127 ? -5.631  -20.316 -3.649  1.00 0.61  ? 168 PRO A HD3  1 
ATOM 1954 N N    . LEU A 1 128 ? -3.089  -18.849 0.059   1.00 0.45  ? 169 LEU A N    1 
ATOM 1955 C CA   . LEU A 1 128 ? -2.019  -18.491 0.984   1.00 0.47  ? 169 LEU A CA   1 
ATOM 1956 C C    . LEU A 1 128 ? -1.702  -17.000 0.908   1.00 0.40  ? 169 LEU A C    1 
ATOM 1957 O O    . LEU A 1 128 ? -1.288  -16.394 1.897   1.00 0.38  ? 169 LEU A O    1 
ATOM 1958 C CB   . LEU A 1 128 ? -0.762  -19.309 0.684   1.00 0.54  ? 169 LEU A CB   1 
ATOM 1959 C CG   . LEU A 1 128 ? -0.171  -20.053 1.884   1.00 0.82  ? 169 LEU A CG   1 
ATOM 1960 C CD1  . LEU A 1 128 ? 0.962   -20.965 1.441   1.00 1.27  ? 169 LEU A CD1  1 
ATOM 1961 C CD2  . LEU A 1 128 ? 0.316   -19.067 2.935   1.00 1.64  ? 169 LEU A CD2  1 
ATOM 1962 H H    . LEU A 1 128 ? -2.894  -19.454 -0.687  1.00 0.44  ? 169 LEU A H    1 
ATOM 1963 H HA   . LEU A 1 128 ? -2.357  -18.723 1.983   1.00 0.51  ? 169 LEU A HA   1 
ATOM 1964 H HB2  . LEU A 1 128 ? -1.004  -20.034 -0.078  1.00 0.63  ? 169 LEU A HB2  1 
ATOM 1965 H HB3  . LEU A 1 128 ? -0.007  -18.642 0.296   1.00 0.58  ? 169 LEU A HB3  1 
ATOM 1966 H HG   . LEU A 1 128 ? -0.939  -20.668 2.331   1.00 1.61  ? 169 LEU A HG   1 
ATOM 1967 H HD11 . LEU A 1 128 ? 1.776   -20.897 2.148   1.00 1.73  ? 169 LEU A HD11 1 
ATOM 1968 H HD12 . LEU A 1 128 ? 1.308   -20.661 0.464   1.00 1.88  ? 169 LEU A HD12 1 
ATOM 1969 H HD13 . LEU A 1 128 ? 0.608   -21.984 1.397   1.00 1.70  ? 169 LEU A HD13 1 
ATOM 1970 H HD21 . LEU A 1 128 ? 1.396   -19.077 2.964   1.00 2.18  ? 169 LEU A HD21 1 
ATOM 1971 H HD22 . LEU A 1 128 ? -0.073  -19.350 3.901   1.00 2.06  ? 169 LEU A HD22 1 
ATOM 1972 H HD23 . LEU A 1 128 ? -0.028  -18.075 2.685   1.00 2.26  ? 169 LEU A HD23 1 
ATOM 1973 N N    . VAL A 1 129 ? -1.898  -16.413 -0.268  1.00 0.38  ? 170 VAL A N    1 
ATOM 1974 C CA   . VAL A 1 129 ? -1.630  -14.992 -0.465  1.00 0.36  ? 170 VAL A CA   1 
ATOM 1975 C C    . VAL A 1 129 ? -2.497  -14.134 0.454   1.00 0.30  ? 170 VAL A C    1 
ATOM 1976 O O    . VAL A 1 129 ? -2.110  -13.027 0.829   1.00 0.29  ? 170 VAL A O    1 
ATOM 1977 C CB   . VAL A 1 129 ? -1.873  -14.562 -1.925  1.00 0.39  ? 170 VAL A CB   1 
ATOM 1978 C CG1  . VAL A 1 129 ? -1.309  -15.590 -2.894  1.00 0.93  ? 170 VAL A CG1  1 
ATOM 1979 C CG2  . VAL A 1 129 ? -3.357  -14.338 -2.174  1.00 1.04  ? 170 VAL A CG2  1 
ATOM 1980 H H    . VAL A 1 129 ? -2.230  -16.947 -1.020  1.00 0.41  ? 170 VAL A H    1 
ATOM 1981 H HA   . VAL A 1 129 ? -0.591  -14.815 -0.229  1.00 0.38  ? 170 VAL A HA   1 
ATOM 1982 H HB   . VAL A 1 129 ? -1.359  -13.626 -2.091  1.00 0.96  ? 170 VAL A HB   1 
ATOM 1983 H HG11 . VAL A 1 129 ? -2.114  -16.027 -3.465  1.00 1.26  ? 170 VAL A HG11 1 
ATOM 1984 H HG12 . VAL A 1 129 ? -0.797  -16.364 -2.341  1.00 1.59  ? 170 VAL A HG12 1 
ATOM 1985 H HG13 . VAL A 1 129 ? -0.613  -15.108 -3.565  1.00 1.56  ? 170 VAL A HG13 1 
ATOM 1986 H HG21 . VAL A 1 129 ? -3.926  -15.114 -1.685  1.00 1.57  ? 170 VAL A HG21 1 
ATOM 1987 H HG22 . VAL A 1 129 ? -3.552  -14.363 -3.236  1.00 1.71  ? 170 VAL A HG22 1 
ATOM 1988 H HG23 . VAL A 1 129 ? -3.646  -13.376 -1.777  1.00 1.57  ? 170 VAL A HG23 1 
ATOM 1989 N N    . ASP A 1 130 ? -3.669  -14.650 0.814   1.00 0.27  ? 171 ASP A N    1 
ATOM 1990 C CA   . ASP A 1 130 ? -4.585  -13.927 1.689   1.00 0.25  ? 171 ASP A CA   1 
ATOM 1991 C C    . ASP A 1 130 ? -4.020  -13.826 3.102   1.00 0.23  ? 171 ASP A C    1 
ATOM 1992 O O    . ASP A 1 130 ? -3.966  -12.743 3.684   1.00 0.23  ? 171 ASP A O    1 
ATOM 1993 C CB   . ASP A 1 130 ? -5.948  -14.620 1.721   1.00 0.27  ? 171 ASP A CB   1 
ATOM 1994 C CG   . ASP A 1 130 ? -7.018  -13.761 2.366   1.00 0.92  ? 171 ASP A CG   1 
ATOM 1995 O OD1  . ASP A 1 130 ? -6.902  -13.479 3.577   1.00 1.75  ? 171 ASP A OD1  1 
ATOM 1996 O OD2  . ASP A 1 130 ? -7.971  -13.371 1.660   1.00 1.59  ? 171 ASP A OD2  1 
ATOM 1997 H H    . ASP A 1 130 ? -3.923  -15.537 0.485   1.00 0.29  ? 171 ASP A H    1 
ATOM 1998 H HA   . ASP A 1 130 ? -4.707  -12.931 1.291   1.00 0.25  ? 171 ASP A HA   1 
ATOM 1999 H HB2  . ASP A 1 130 ? -6.254  -14.846 0.711   1.00 0.71  ? 171 ASP A HB2  1 
ATOM 2000 H HB3  . ASP A 1 130 ? -5.863  -15.540 2.281   1.00 0.80  ? 171 ASP A HB3  1 
ATOM 2001 N N    . ASN A 1 131 ? -3.597  -14.962 3.646   1.00 0.25  ? 172 ASN A N    1 
ATOM 2002 C CA   . ASN A 1 131 ? -3.034  -15.001 4.990   1.00 0.27  ? 172 ASN A CA   1 
ATOM 2003 C C    . ASN A 1 131 ? -1.797  -14.114 5.085   1.00 0.24  ? 172 ASN A C    1 
ATOM 2004 O O    . ASN A 1 131 ? -1.523  -13.522 6.129   1.00 0.29  ? 172 ASN A O    1 
ATOM 2005 C CB   . ASN A 1 131 ? -2.677  -16.438 5.375   1.00 0.32  ? 172 ASN A CB   1 
ATOM 2006 C CG   . ASN A 1 131 ? -3.505  -16.947 6.538   1.00 0.74  ? 172 ASN A CG   1 
ATOM 2007 O OD1  . ASN A 1 131 ? -3.941  -16.173 7.390   1.00 1.69  ? 172 ASN A OD1  1 
ATOM 2008 N ND2  . ASN A 1 131 ? -3.726  -18.255 6.579   1.00 1.20  ? 172 ASN A ND2  1 
ATOM 2009 H H    . ASN A 1 131 ? -3.664  -15.794 3.131   1.00 0.27  ? 172 ASN A H    1 
ATOM 2010 H HA   . ASN A 1 131 ? -3.782  -14.630 5.674   1.00 0.27  ? 172 ASN A HA   1 
ATOM 2011 H HB2  . ASN A 1 131 ? -2.848  -17.084 4.526   1.00 0.52  ? 172 ASN A HB2  1 
ATOM 2012 H HB3  . ASN A 1 131 ? -1.634  -16.481 5.651   1.00 0.73  ? 172 ASN A HB3  1 
ATOM 2013 H HD21 . ASN A 1 131 ? -3.348  -18.811 5.866   1.00 1.80  ? 172 ASN A HD21 1 
ATOM 2014 H HD22 . ASN A 1 131 ? -4.259  -18.612 7.321   1.00 1.45  ? 172 ASN A HD22 1 
ATOM 2015 N N    . ILE A 1 132 ? -1.054  -14.025 3.986   1.00 0.22  ? 173 ILE A N    1 
ATOM 2016 C CA   . ILE A 1 132 ? 0.152   -13.208 3.944   1.00 0.21  ? 173 ILE A CA   1 
ATOM 2017 C C    . ILE A 1 132 ? -0.180  -11.733 4.142   1.00 0.20  ? 173 ILE A C    1 
ATOM 2018 O O    . ILE A 1 132 ? 0.268   -11.109 5.104   1.00 0.20  ? 173 ILE A O    1 
ATOM 2019 C CB   . ILE A 1 132 ? 0.902   -13.378 2.609   1.00 0.23  ? 173 ILE A CB   1 
ATOM 2020 C CG1  . ILE A 1 132 ? 1.855   -14.573 2.682   1.00 0.41  ? 173 ILE A CG1  1 
ATOM 2021 C CG2  . ILE A 1 132 ? 1.662   -12.107 2.262   1.00 0.32  ? 173 ILE A CG2  1 
ATOM 2022 C CD1  . ILE A 1 132 ? 1.675   -15.559 1.548   1.00 0.47  ? 173 ILE A CD1  1 
ATOM 2023 H H    . ILE A 1 132 ? -1.325  -14.519 3.184   1.00 0.25  ? 173 ILE A H    1 
ATOM 2024 H HA   . ILE A 1 132 ? 0.803   -13.531 4.743   1.00 0.23  ? 173 ILE A HA   1 
ATOM 2025 H HB   . ILE A 1 132 ? 0.172   -13.556 1.833   1.00 0.25  ? 173 ILE A HB   1 
ATOM 2026 H HG12 . ILE A 1 132 ? 2.873   -14.215 2.651   1.00 0.67  ? 173 ILE A HG12 1 
ATOM 2027 H HG13 . ILE A 1 132 ? 1.691   -15.100 3.611   1.00 0.84  ? 173 ILE A HG13 1 
ATOM 2028 H HG21 . ILE A 1 132 ? 2.144   -11.723 3.148   1.00 1.04  ? 173 ILE A HG21 1 
ATOM 2029 H HG22 . ILE A 1 132 ? 0.973   -11.370 1.878   1.00 1.13  ? 173 ILE A HG22 1 
ATOM 2030 H HG23 . ILE A 1 132 ? 2.408   -12.327 1.513   1.00 1.05  ? 173 ILE A HG23 1 
ATOM 2031 H HD11 . ILE A 1 132 ? 0.656   -15.519 1.194   1.00 1.18  ? 173 ILE A HD11 1 
ATOM 2032 H HD12 . ILE A 1 132 ? 1.895   -16.556 1.901   1.00 1.07  ? 173 ILE A HD12 1 
ATOM 2033 H HD13 . ILE A 1 132 ? 2.347   -15.306 0.741   1.00 1.20  ? 173 ILE A HD13 1 
ATOM 2034 N N    . ALA A 1 133 ? -0.972  -11.183 3.227   1.00 0.20  ? 174 ALA A N    1 
ATOM 2035 C CA   . ALA A 1 133 ? -1.368  -9.782  3.303   1.00 0.23  ? 174 ALA A CA   1 
ATOM 2036 C C    . ALA A 1 133 ? -1.885  -9.435  4.694   1.00 0.21  ? 174 ALA A C    1 
ATOM 2037 O O    . ALA A 1 133 ? -1.686  -8.323  5.182   1.00 0.22  ? 174 ALA A O    1 
ATOM 2038 C CB   . ALA A 1 133 ? -2.424  -9.475  2.252   1.00 0.26  ? 174 ALA A CB   1 
ATOM 2039 H H    . ALA A 1 133 ? -1.299  -11.732 2.484   1.00 0.21  ? 174 ALA A H    1 
ATOM 2040 H HA   . ALA A 1 133 ? -0.497  -9.177  3.093   1.00 0.25  ? 174 ALA A HA   1 
ATOM 2041 H HB1  . ALA A 1 133 ? -2.410  -8.419  2.026   1.00 1.00  ? 174 ALA A HB1  1 
ATOM 2042 H HB2  . ALA A 1 133 ? -3.398  -9.749  2.630   1.00 1.15  ? 174 ALA A HB2  1 
ATOM 2043 H HB3  . ALA A 1 133 ? -2.214  -10.038 1.355   1.00 0.99  ? 174 ALA A HB3  1 
ATOM 2044 N N    . LEU A 1 134 ? -2.548  -10.396 5.330   1.00 0.21  ? 175 LEU A N    1 
ATOM 2045 C CA   . LEU A 1 134 ? -3.091  -10.192 6.668   1.00 0.22  ? 175 LEU A CA   1 
ATOM 2046 C C    . LEU A 1 134 ? -1.967  -10.037 7.688   1.00 0.21  ? 175 LEU A C    1 
ATOM 2047 O O    . LEU A 1 134 ? -1.845  -8.997  8.335   1.00 0.20  ? 175 LEU A O    1 
ATOM 2048 C CB   . LEU A 1 134 ? -3.996  -11.362 7.059   1.00 0.25  ? 175 LEU A CB   1 
ATOM 2049 C CG   . LEU A 1 134 ? -4.314  -11.465 8.552   1.00 0.28  ? 175 LEU A CG   1 
ATOM 2050 C CD1  . LEU A 1 134 ? -5.807  -11.657 8.767   1.00 0.92  ? 175 LEU A CD1  1 
ATOM 2051 C CD2  . LEU A 1 134 ? -3.531  -12.606 9.185   1.00 0.84  ? 175 LEU A CD2  1 
ATOM 2052 H H    . LEU A 1 134 ? -2.673  -11.263 4.891   1.00 0.21  ? 175 LEU A H    1 
ATOM 2053 H HA   . LEU A 1 134 ? -3.676  -9.285  6.654   1.00 0.24  ? 175 LEU A HA   1 
ATOM 2054 H HB2  . LEU A 1 134 ? -4.927  -11.266 6.519   1.00 0.27  ? 175 LEU A HB2  1 
ATOM 2055 H HB3  . LEU A 1 134 ? -3.515  -12.279 6.752   1.00 0.27  ? 175 LEU A HB3  1 
ATOM 2056 H HG   . LEU A 1 134 ? -4.022  -10.547 9.039   1.00 0.82  ? 175 LEU A HG   1 
ATOM 2057 H HD11 . LEU A 1 134 ? -5.969  -12.270 9.641   1.00 1.52  ? 175 LEU A HD11 1 
ATOM 2058 H HD12 . LEU A 1 134 ? -6.235  -12.142 7.902   1.00 1.47  ? 175 LEU A HD12 1 
ATOM 2059 H HD13 . LEU A 1 134 ? -6.276  -10.695 8.909   1.00 1.44  ? 175 LEU A HD13 1 
ATOM 2060 H HD21 . LEU A 1 134 ? -4.210  -13.401 9.457   1.00 1.28  ? 175 LEU A HD21 1 
ATOM 2061 H HD22 . LEU A 1 134 ? -3.024  -12.248 10.068  1.00 1.29  ? 175 LEU A HD22 1 
ATOM 2062 H HD23 . LEU A 1 134 ? -2.805  -12.979 8.479   1.00 1.33  ? 175 LEU A HD23 1 
ATOM 2063 N N    . TRP A 1 135 ? -1.153  -11.082 7.822   1.00 0.21  ? 176 TRP A N    1 
ATOM 2064 C CA   . TRP A 1 135 ? -0.033  -11.071 8.761   1.00 0.22  ? 176 TRP A CA   1 
ATOM 2065 C C    . TRP A 1 135 ? 0.745   -9.763  8.661   1.00 0.21  ? 176 TRP A C    1 
ATOM 2066 O O    . TRP A 1 135 ? 0.995   -9.098  9.667   1.00 0.21  ? 176 TRP A O    1 
ATOM 2067 C CB   . TRP A 1 135 ? 0.902   -12.251 8.488   1.00 0.25  ? 176 TRP A CB   1 
ATOM 2068 C CG   . TRP A 1 135 ? 0.233   -13.586 8.614   1.00 0.26  ? 176 TRP A CG   1 
ATOM 2069 C CD1  . TRP A 1 135 ? -0.739  -13.935 9.505   1.00 0.31  ? 176 TRP A CD1  1 
ATOM 2070 C CD2  . TRP A 1 135 ? 0.491   -14.750 7.822   1.00 0.27  ? 176 TRP A CD2  1 
ATOM 2071 N NE1  . TRP A 1 135 ? -1.104  -15.247 9.315   1.00 0.35  ? 176 TRP A NE1  1 
ATOM 2072 C CE2  . TRP A 1 135 ? -0.363  -15.769 8.287   1.00 0.32  ? 176 TRP A CE2  1 
ATOM 2073 C CE3  . TRP A 1 135 ? 1.360   -15.031 6.763   1.00 0.28  ? 176 TRP A CE3  1 
ATOM 2074 C CZ2  . TRP A 1 135 ? -0.372  -17.045 7.730   1.00 0.36  ? 176 TRP A CZ2  1 
ATOM 2075 C CZ3  . TRP A 1 135 ? 1.350   -16.298 6.211   1.00 0.32  ? 176 TRP A CZ3  1 
ATOM 2076 C CH2  . TRP A 1 135 ? 0.489   -17.291 6.695   1.00 0.35  ? 176 TRP A CH2  1 
ATOM 2077 H H    . TRP A 1 135 ? -1.314  -11.881 7.277   1.00 0.23  ? 176 TRP A H    1 
ATOM 2078 H HA   . TRP A 1 135 ? -0.435  -11.163 9.759   1.00 0.23  ? 176 TRP A HA   1 
ATOM 2079 H HB2  . TRP A 1 135 ? 1.293   -12.168 7.485   1.00 0.25  ? 176 TRP A HB2  1 
ATOM 2080 H HB3  . TRP A 1 135 ? 1.722   -12.221 9.191   1.00 0.29  ? 176 TRP A HB3  1 
ATOM 2081 H HD1  . TRP A 1 135 ? -1.153  -13.268 10.247  1.00 0.34  ? 176 TRP A HD1  1 
ATOM 2082 H HE1  . TRP A 1 135 ? -1.783  -15.729 9.830   1.00 0.41  ? 176 TRP A HE1  1 
ATOM 2083 H HE3  . TRP A 1 135 ? 2.030   -14.278 6.376   1.00 0.29  ? 176 TRP A HE3  1 
ATOM 2084 H HZ2  . TRP A 1 135 ? -1.029  -17.822 8.091   1.00 0.41  ? 176 TRP A HZ2  1 
ATOM 2085 H HZ3  . TRP A 1 135 ? 2.014   -16.533 5.393   1.00 0.35  ? 176 TRP A HZ3  1 
ATOM 2086 H HH2  . TRP A 1 135 ? 0.515   -18.267 6.234   1.00 0.39  ? 176 TRP A HH2  1 
ATOM 2087 N N    . MET A 1 136 ? 1.120   -9.399  7.439   1.00 0.20  ? 177 MET A N    1 
ATOM 2088 C CA   . MET A 1 136 ? 1.865   -8.169  7.202   1.00 0.20  ? 177 MET A CA   1 
ATOM 2089 C C    . MET A 1 136 ? 1.149   -6.974  7.823   1.00 0.19  ? 177 MET A C    1 
ATOM 2090 O O    . MET A 1 136 ? 1.740   -6.210  8.585   1.00 0.20  ? 177 MET A O    1 
ATOM 2091 C CB   . MET A 1 136 ? 2.050   -7.945  5.700   1.00 0.20  ? 177 MET A CB   1 
ATOM 2092 C CG   . MET A 1 136 ? 2.797   -9.071  5.005   1.00 0.97  ? 177 MET A CG   1 
ATOM 2093 S SD   . MET A 1 136 ? 2.860   -8.861  3.215   1.00 1.50  ? 177 MET A SD   1 
ATOM 2094 C CE   . MET A 1 136 ? 3.996   -7.485  3.076   1.00 0.87  ? 177 MET A CE   1 
ATOM 2095 H H    . MET A 1 136 ? 0.890   -9.970  6.677   1.00 0.21  ? 177 MET A H    1 
ATOM 2096 H HA   . MET A 1 136 ? 2.835   -8.273  7.665   1.00 0.21  ? 177 MET A HA   1 
ATOM 2097 H HB2  . MET A 1 136 ? 1.078   -7.849  5.240   1.00 0.77  ? 177 MET A HB2  1 
ATOM 2098 H HB3  . MET A 1 136 ? 2.602   -7.029  5.549   1.00 0.74  ? 177 MET A HB3  1 
ATOM 2099 H HG2  . MET A 1 136 ? 3.808   -9.103  5.384   1.00 1.43  ? 177 MET A HG2  1 
ATOM 2100 H HG3  . MET A 1 136 ? 2.301   -10.005 5.227   1.00 1.57  ? 177 MET A HG3  1 
ATOM 2101 H HE1  . MET A 1 136 ? 4.486   -7.518  2.114   1.00 1.28  ? 177 MET A HE1  1 
ATOM 2102 H HE2  . MET A 1 136 ? 4.737   -7.549  3.859   1.00 1.23  ? 177 MET A HE2  1 
ATOM 2103 H HE3  . MET A 1 136 ? 3.452   -6.557  3.171   1.00 1.35  ? 177 MET A HE3  1 
ATOM 2104 N N    . THR A 1 137 ? -0.129  -6.821  7.490   1.00 0.21  ? 178 THR A N    1 
ATOM 2105 C CA   . THR A 1 137 ? -0.929  -5.720  8.015   1.00 0.22  ? 178 THR A CA   1 
ATOM 2106 C C    . THR A 1 137 ? -0.797  -5.629  9.532   1.00 0.22  ? 178 THR A C    1 
ATOM 2107 O O    . THR A 1 137 ? -0.629  -4.543  10.087  1.00 0.22  ? 178 THR A O    1 
ATOM 2108 C CB   . THR A 1 137 ? -2.398  -5.899  7.629   1.00 0.24  ? 178 THR A CB   1 
ATOM 2109 O OG1  . THR A 1 137 ? -2.603  -5.567  6.267   1.00 0.42  ? 178 THR A OG1  1 
ATOM 2110 C CG2  . THR A 1 137 ? -3.341  -5.052  8.455   1.00 0.39  ? 178 THR A CG2  1 
ATOM 2111 H H    . THR A 1 137 ? -0.545  -7.464  6.878   1.00 0.25  ? 178 THR A H    1 
ATOM 2112 H HA   . THR A 1 137 ? -0.560  -4.804  7.578   1.00 0.22  ? 178 THR A HA   1 
ATOM 2113 H HB   . THR A 1 137 ? -2.673  -6.935  7.771   1.00 0.42  ? 178 THR A HB   1 
ATOM 2114 H HG1  . THR A 1 137 ? -3.524  -5.336  6.129   1.00 0.99  ? 178 THR A HG1  1 
ATOM 2115 H HG21 . THR A 1 137 ? -3.036  -4.017  8.403   1.00 0.91  ? 178 THR A HG21 1 
ATOM 2116 H HG22 . THR A 1 137 ? -3.316  -5.383  9.483   1.00 0.96  ? 178 THR A HG22 1 
ATOM 2117 H HG23 . THR A 1 137 ? -4.345  -5.151  8.070   1.00 0.83  ? 178 THR A HG23 1 
ATOM 2118 N N    . GLU A 1 138 ? -0.875  -6.778  10.195  1.00 0.24  ? 179 GLU A N    1 
ATOM 2119 C CA   . GLU A 1 138 ? -0.765  -6.831  11.648  1.00 0.26  ? 179 GLU A CA   1 
ATOM 2120 C C    . GLU A 1 138 ? 0.512   -6.146  12.121  1.00 0.23  ? 179 GLU A C    1 
ATOM 2121 O O    . GLU A 1 138 ? 0.463   -5.094  12.755  1.00 0.33  ? 179 GLU A O    1 
ATOM 2122 C CB   . GLU A 1 138 ? -0.788  -8.283  12.129  1.00 0.33  ? 179 GLU A CB   1 
ATOM 2123 C CG   . GLU A 1 138 ? -2.113  -8.697  12.748  1.00 0.60  ? 179 GLU A CG   1 
ATOM 2124 C CD   . GLU A 1 138 ? -1.955  -9.790  13.787  1.00 1.46  ? 179 GLU A CD   1 
ATOM 2125 O OE1  . GLU A 1 138 ? -1.404  -9.503  14.871  1.00 2.08  ? 179 GLU A OE1  1 
ATOM 2126 O OE2  . GLU A 1 138 ? -2.382  -10.932 13.518  1.00 2.25  ? 179 GLU A OE2  1 
ATOM 2127 H H    . GLU A 1 138 ? -1.009  -7.610  9.696   1.00 0.25  ? 179 GLU A H    1 
ATOM 2128 H HA   . GLU A 1 138 ? -1.614  -6.310  12.064  1.00 0.28  ? 179 GLU A HA   1 
ATOM 2129 H HB2  . GLU A 1 138 ? -0.588  -8.932  11.289  1.00 0.71  ? 179 GLU A HB2  1 
ATOM 2130 H HB3  . GLU A 1 138 ? -0.012  -8.417  12.869  1.00 0.70  ? 179 GLU A HB3  1 
ATOM 2131 H HG2  . GLU A 1 138 ? -2.560  -7.835  13.220  1.00 1.18  ? 179 GLU A HG2  1 
ATOM 2132 H HG3  . GLU A 1 138 ? -2.764  -9.057  11.965  1.00 1.17  ? 179 GLU A HG3  1 
ATOM 2133 N N    . TYR A 1 139 ? 1.653   -6.752  11.810  1.00 0.26  ? 180 TYR A N    1 
ATOM 2134 C CA   . TYR A 1 139 ? 2.947   -6.202  12.203  1.00 0.25  ? 180 TYR A CA   1 
ATOM 2135 C C    . TYR A 1 139 ? 3.031   -4.713  11.880  1.00 0.23  ? 180 TYR A C    1 
ATOM 2136 O O    . TYR A 1 139 ? 3.591   -3.930  12.648  1.00 0.23  ? 180 TYR A O    1 
ATOM 2137 C CB   . TYR A 1 139 ? 4.076   -6.955  11.494  1.00 0.30  ? 180 TYR A CB   1 
ATOM 2138 C CG   . TYR A 1 139 ? 5.463   -6.526  11.922  1.00 0.33  ? 180 TYR A CG   1 
ATOM 2139 C CD1  . TYR A 1 139 ? 5.967   -5.280  11.570  1.00 0.73  ? 180 TYR A CD1  1 
ATOM 2140 C CD2  . TYR A 1 139 ? 6.268   -7.370  12.678  1.00 0.68  ? 180 TYR A CD2  1 
ATOM 2141 C CE1  . TYR A 1 139 ? 7.234   -4.888  11.958  1.00 0.77  ? 180 TYR A CE1  1 
ATOM 2142 C CE2  . TYR A 1 139 ? 7.536   -6.984  13.070  1.00 0.70  ? 180 TYR A CE2  1 
ATOM 2143 C CZ   . TYR A 1 139 ? 8.014   -5.743  12.708  1.00 0.45  ? 180 TYR A CZ   1 
ATOM 2144 O OH   . TYR A 1 139 ? 9.276   -5.355  13.097  1.00 0.52  ? 180 TYR A OH   1 
ATOM 2145 H H    . TYR A 1 139 ? 1.624   -7.590  11.302  1.00 0.36  ? 180 TYR A H    1 
ATOM 2146 H HA   . TYR A 1 139 ? 3.053   -6.334  13.270  1.00 0.26  ? 180 TYR A HA   1 
ATOM 2147 H HB2  . TYR A 1 139 ? 3.979   -8.010  11.699  1.00 0.31  ? 180 TYR A HB2  1 
ATOM 2148 H HB3  . TYR A 1 139 ? 3.992   -6.793  10.429  1.00 0.32  ? 180 TYR A HB3  1 
ATOM 2149 H HD1  . TYR A 1 139 ? 5.355   -4.611  10.982  1.00 1.16  ? 180 TYR A HD1  1 
ATOM 2150 H HD2  . TYR A 1 139 ? 5.893   -8.342  12.960  1.00 1.11  ? 180 TYR A HD2  1 
ATOM 2151 H HE1  . TYR A 1 139 ? 7.609   -3.916  11.675  1.00 1.21  ? 180 TYR A HE1  1 
ATOM 2152 H HE2  . TYR A 1 139 ? 8.147   -7.654  13.656  1.00 1.13  ? 180 TYR A HE2  1 
ATOM 2153 H HH   . TYR A 1 139 ? 9.756   -6.116  13.430  1.00 0.90  ? 180 TYR A HH   1 
ATOM 2154 N N    . LEU A 1 140 ? 2.477   -4.332  10.734  1.00 0.23  ? 181 LEU A N    1 
ATOM 2155 C CA   . LEU A 1 140 ? 2.492   -2.939  10.296  1.00 0.24  ? 181 LEU A CA   1 
ATOM 2156 C C    . LEU A 1 140 ? 1.967   -2.002  11.382  1.00 0.24  ? 181 LEU A C    1 
ATOM 2157 O O    . LEU A 1 140 ? 2.591   -0.989  11.695  1.00 0.26  ? 181 LEU A O    1 
ATOM 2158 C CB   . LEU A 1 140 ? 1.658   -2.780  9.024   1.00 0.27  ? 181 LEU A CB   1 
ATOM 2159 C CG   . LEU A 1 140 ? 2.300   -1.926  7.930   1.00 0.42  ? 181 LEU A CG   1 
ATOM 2160 C CD1  . LEU A 1 140 ? 1.386   -1.835  6.719   1.00 0.82  ? 181 LEU A CD1  1 
ATOM 2161 C CD2  . LEU A 1 140 ? 2.624   -0.539  8.462   1.00 0.37  ? 181 LEU A CD2  1 
ATOM 2162 H H    . LEU A 1 140 ? 2.054   -5.006  10.163  1.00 0.24  ? 181 LEU A H    1 
ATOM 2163 H HA   . LEU A 1 140 ? 3.515   -2.675  10.076  1.00 0.24  ? 181 LEU A HA   1 
ATOM 2164 H HB2  . LEU A 1 140 ? 1.466   -3.763  8.619   1.00 0.38  ? 181 LEU A HB2  1 
ATOM 2165 H HB3  . LEU A 1 140 ? 0.714   -2.330  9.292   1.00 0.50  ? 181 LEU A HB3  1 
ATOM 2166 H HG   . LEU A 1 140 ? 3.224   -2.390  7.617   1.00 0.66  ? 181 LEU A HG   1 
ATOM 2167 H HD11 . LEU A 1 140 ? 1.848   -2.335  5.880   1.00 1.43  ? 181 LEU A HD11 1 
ATOM 2168 H HD12 . LEU A 1 140 ? 1.219   -0.797  6.471   1.00 1.25  ? 181 LEU A HD12 1 
ATOM 2169 H HD13 . LEU A 1 140 ? 0.441   -2.308  6.944   1.00 1.31  ? 181 LEU A HD13 1 
ATOM 2170 H HD21 . LEU A 1 140 ? 3.345   -0.063  7.813   1.00 1.02  ? 181 LEU A HD21 1 
ATOM 2171 H HD22 . LEU A 1 140 ? 3.036   -0.622  9.457   1.00 1.13  ? 181 LEU A HD22 1 
ATOM 2172 H HD23 . LEU A 1 140 ? 1.722   0.054   8.493   1.00 1.09  ? 181 LEU A HD23 1 
ATOM 2173 N N    . ASN A 1 141 ? 0.809   -2.331  11.941  1.00 0.24  ? 182 ASN A N    1 
ATOM 2174 C CA   . ASN A 1 141 ? 0.202   -1.501  12.976  1.00 0.27  ? 182 ASN A CA   1 
ATOM 2175 C C    . ASN A 1 141 ? 0.723   -1.861  14.367  1.00 0.27  ? 182 ASN A C    1 
ATOM 2176 O O    . ASN A 1 141 ? 0.717   -1.031  15.275  1.00 0.29  ? 182 ASN A O    1 
ATOM 2177 C CB   . ASN A 1 141 ? -1.320  -1.643  12.941  1.00 0.30  ? 182 ASN A CB   1 
ATOM 2178 C CG   . ASN A 1 141 ? -2.029  -0.315  13.116  1.00 0.90  ? 182 ASN A CG   1 
ATOM 2179 O OD1  . ASN A 1 141 ? -1.512  0.734   12.731  1.00 1.64  ? 182 ASN A OD1  1 
ATOM 2180 N ND2  . ASN A 1 141 ? -3.221  -0.353  13.701  1.00 1.59  ? 182 ASN A ND2  1 
ATOM 2181 H H    . ASN A 1 141 ? 0.344   -3.141  11.642  1.00 0.24  ? 182 ASN A H    1 
ATOM 2182 H HA   . ASN A 1 141 ? 0.460   -0.474  12.766  1.00 0.28  ? 182 ASN A HA   1 
ATOM 2183 H HB2  . ASN A 1 141 ? -1.615  -2.064  11.992  1.00 0.81  ? 182 ASN A HB2  1 
ATOM 2184 H HB3  . ASN A 1 141 ? -1.632  -2.305  13.736  1.00 0.85  ? 182 ASN A HB3  1 
ATOM 2185 H HD21 . ASN A 1 141 ? -3.570  -1.224  13.983  1.00 1.91  ? 182 ASN A HD21 1 
ATOM 2186 H HD22 . ASN A 1 141 ? -3.702  0.491   13.827  1.00 2.11  ? 182 ASN A HD22 1 
ATOM 2187 N N    . ARG A 1 142 ? 1.144   -3.107  14.540  1.00 0.25  ? 183 ARG A N    1 
ATOM 2188 C CA   . ARG A 1 142 ? 1.635   -3.573  15.832  1.00 0.26  ? 183 ARG A CA   1 
ATOM 2189 C C    . ARG A 1 142 ? 2.931   -2.878  16.249  1.00 0.26  ? 183 ARG A C    1 
ATOM 2190 O O    . ARG A 1 142 ? 2.932   -2.048  17.158  1.00 0.29  ? 183 ARG A O    1 
ATOM 2191 C CB   . ARG A 1 142 ? 1.853   -5.086  15.793  1.00 0.26  ? 183 ARG A CB   1 
ATOM 2192 C CG   . ARG A 1 142 ? 1.084   -5.841  16.865  1.00 0.53  ? 183 ARG A CG   1 
ATOM 2193 C CD   . ARG A 1 142 ? 1.228   -7.345  16.697  1.00 0.44  ? 183 ARG A CD   1 
ATOM 2194 N NE   . ARG A 1 142 ? 0.642   -8.080  17.815  1.00 1.01  ? 183 ARG A NE   1 
ATOM 2195 C CZ   . ARG A 1 142 ? 0.600   -9.409  17.891  1.00 1.34  ? 183 ARG A CZ   1 
ATOM 2196 N NH1  . ARG A 1 142 ? 1.109   -10.157 16.918  1.00 1.82  ? 183 ARG A NH1  1 
ATOM 2197 N NH2  . ARG A 1 142 ? 0.047   -9.994  18.945  1.00 2.01  ? 183 ARG A NH2  1 
ATOM 2198 H H    . ARG A 1 142 ? 1.098   -3.737  13.791  1.00 0.24  ? 183 ARG A H    1 
ATOM 2199 H HA   . ARG A 1 142 ? 0.876   -3.354  16.567  1.00 0.29  ? 183 ARG A HA   1 
ATOM 2200 H HB2  . ARG A 1 142 ? 1.542   -5.458  14.828  1.00 0.34  ? 183 ARG A HB2  1 
ATOM 2201 H HB3  . ARG A 1 142 ? 2.906   -5.289  15.925  1.00 0.33  ? 183 ARG A HB3  1 
ATOM 2202 H HG2  . ARG A 1 142 ? 1.466   -5.558  17.834  1.00 0.83  ? 183 ARG A HG2  1 
ATOM 2203 H HG3  . ARG A 1 142 ? 0.039   -5.578  16.796  1.00 0.85  ? 183 ARG A HG3  1 
ATOM 2204 H HD2  . ARG A 1 142 ? 0.733   -7.641  15.785  1.00 0.80  ? 183 ARG A HD2  1 
ATOM 2205 H HD3  . ARG A 1 142 ? 2.279   -7.587  16.630  1.00 0.76  ? 183 ARG A HD3  1 
ATOM 2206 H HE   . ARG A 1 142 ? 0.259   -7.556  18.549  1.00 1.73  ? 183 ARG A HE   1 
ATOM 2207 H HH11 . ARG A 1 142 ? 1.528   -9.726  16.119  1.00 1.92  ? 183 ARG A HH11 1 
ATOM 2208 H HH12 . ARG A 1 142 ? 1.073   -11.154 16.984  1.00 2.47  ? 183 ARG A HH12 1 
ATOM 2209 H HH21 . ARG A 1 142 ? -0.337  -9.437  19.681  1.00 2.45  ? 183 ARG A HH21 1 
ATOM 2210 H HH22 . ARG A 1 142 ? 0.015   -10.992 19.003  1.00 2.38  ? 183 ARG A HH22 1 
ATOM 2211 N N    . HIS A 1 143 ? 4.037   -3.240  15.603  1.00 0.25  ? 184 HIS A N    1 
ATOM 2212 C CA   . HIS A 1 143 ? 5.340   -2.667  15.937  1.00 0.26  ? 184 HIS A CA   1 
ATOM 2213 C C    . HIS A 1 143 ? 5.695   -1.463  15.068  1.00 0.24  ? 184 HIS A C    1 
ATOM 2214 O O    . HIS A 1 143 ? 6.295   -0.500  15.546  1.00 0.25  ? 184 HIS A O    1 
ATOM 2215 C CB   . HIS A 1 143 ? 6.428   -3.732  15.802  1.00 0.28  ? 184 HIS A CB   1 
ATOM 2216 C CG   . HIS A 1 143 ? 5.965   -5.109  16.167  1.00 0.33  ? 184 HIS A CG   1 
ATOM 2217 N ND1  . HIS A 1 143 ? 6.219   -5.688  17.392  1.00 0.39  ? 184 HIS A ND1  1 
ATOM 2218 C CD2  . HIS A 1 143 ? 5.259   -6.023  15.460  1.00 0.35  ? 184 HIS A CD2  1 
ATOM 2219 C CE1  . HIS A 1 143 ? 5.690   -6.899  17.423  1.00 0.43  ? 184 HIS A CE1  1 
ATOM 2220 N NE2  . HIS A 1 143 ? 5.102   -7.125  16.263  1.00 0.41  ? 184 HIS A NE2  1 
ATOM 2221 H H    . HIS A 1 143 ? 3.981   -3.920  14.899  1.00 0.24  ? 184 HIS A H    1 
ATOM 2222 H HA   . HIS A 1 143 ? 5.300   -2.346  16.966  1.00 0.28  ? 184 HIS A HA   1 
ATOM 2223 H HB2  . HIS A 1 143 ? 6.771   -3.758  14.778  1.00 0.27  ? 184 HIS A HB2  1 
ATOM 2224 H HB3  . HIS A 1 143 ? 7.255   -3.476  16.447  1.00 0.30  ? 184 HIS A HB3  1 
ATOM 2225 H HD1  . HIS A 1 143 ? 6.714   -5.274  18.129  1.00 0.42  ? 184 HIS A HD1  1 
ATOM 2226 H HD2  . HIS A 1 143 ? 4.888   -5.906  14.451  1.00 0.35  ? 184 HIS A HD2  1 
ATOM 2227 H HE1  . HIS A 1 143 ? 5.731   -7.585  18.255  1.00 0.49  ? 184 HIS A HE1  1 
ATOM 2228 N N    . LEU A 1 144 ? 5.351   -1.530  13.788  1.00 0.24  ? 185 LEU A N    1 
ATOM 2229 C CA   . LEU A 1 144 ? 5.668   -0.453  12.856  1.00 0.24  ? 185 LEU A CA   1 
ATOM 2230 C C    . LEU A 1 144 ? 4.937   0.843   13.203  1.00 0.25  ? 185 LEU A C    1 
ATOM 2231 O O    . LEU A 1 144 ? 5.486   1.932   13.036  1.00 0.27  ? 185 LEU A O    1 
ATOM 2232 C CB   . LEU A 1 144 ? 5.336   -0.881  11.427  1.00 0.27  ? 185 LEU A CB   1 
ATOM 2233 C CG   . LEU A 1 144 ? 6.542   -1.273  10.574  1.00 0.32  ? 185 LEU A CG   1 
ATOM 2234 C CD1  . LEU A 1 144 ? 6.099   -1.657  9.171   1.00 0.30  ? 185 LEU A CD1  1 
ATOM 2235 C CD2  . LEU A 1 144 ? 7.555   -0.140  10.525  1.00 0.56  ? 185 LEU A CD2  1 
ATOM 2236 H H    . LEU A 1 144 ? 4.890   -2.328  13.455  1.00 0.24  ? 185 LEU A H    1 
ATOM 2237 H HA   . LEU A 1 144 ? 6.729   -0.272  12.923  1.00 0.26  ? 185 LEU A HA   1 
ATOM 2238 H HB2  . LEU A 1 144 ? 4.668   -1.728  11.475  1.00 0.31  ? 185 LEU A HB2  1 
ATOM 2239 H HB3  . LEU A 1 144 ? 4.825   -0.066  10.937  1.00 0.39  ? 185 LEU A HB3  1 
ATOM 2240 H HG   . LEU A 1 144 ? 7.022   -2.133  11.017  1.00 0.40  ? 185 LEU A HG   1 
ATOM 2241 H HD11 . LEU A 1 144 ? 5.472   -2.535  9.220   1.00 1.08  ? 185 LEU A HD11 1 
ATOM 2242 H HD12 . LEU A 1 144 ? 6.967   -1.868  8.564   1.00 1.04  ? 185 LEU A HD12 1 
ATOM 2243 H HD13 . LEU A 1 144 ? 5.543   -0.841  8.733   1.00 0.99  ? 185 LEU A HD13 1 
ATOM 2244 H HD21 . LEU A 1 144 ? 7.046   0.791   10.325  1.00 1.05  ? 185 LEU A HD21 1 
ATOM 2245 H HD22 . LEU A 1 144 ? 8.273   -0.334  9.744   1.00 1.09  ? 185 LEU A HD22 1 
ATOM 2246 H HD23 . LEU A 1 144 ? 8.067   -0.073  11.474  1.00 1.24  ? 185 LEU A HD23 1 
ATOM 2247 N N    . HIS A 1 145 ? 3.700   0.727   13.675  1.00 0.25  ? 186 HIS A N    1 
ATOM 2248 C CA   . HIS A 1 145 ? 2.909   1.903   14.030  1.00 0.29  ? 186 HIS A CA   1 
ATOM 2249 C C    . HIS A 1 145 ? 3.711   2.870   14.897  1.00 0.30  ? 186 HIS A C    1 
ATOM 2250 O O    . HIS A 1 145 ? 3.871   4.041   14.551  1.00 0.32  ? 186 HIS A O    1 
ATOM 2251 C CB   . HIS A 1 145 ? 1.634   1.489   14.764  1.00 0.32  ? 186 HIS A CB   1 
ATOM 2252 C CG   . HIS A 1 145 ? 0.779   2.646   15.178  1.00 0.55  ? 186 HIS A CG   1 
ATOM 2253 N ND1  . HIS A 1 145 ? -0.500  2.845   14.703  1.00 1.23  ? 186 HIS A ND1  1 
ATOM 2254 C CD2  . HIS A 1 145 ? 1.025   3.670   16.030  1.00 0.50  ? 186 HIS A CD2  1 
ATOM 2255 C CE1  . HIS A 1 145 ? -1.003  3.941   15.243  1.00 1.59  ? 186 HIS A CE1  1 
ATOM 2256 N NE2  . HIS A 1 145 ? -0.098  4.459   16.052  1.00 1.14  ? 186 HIS A NE2  1 
ATOM 2257 H H    . HIS A 1 145 ? 3.309   -0.164  13.781  1.00 0.25  ? 186 HIS A H    1 
ATOM 2258 H HA   . HIS A 1 145 ? 2.636   2.405   13.114  1.00 0.31  ? 186 HIS A HA   1 
ATOM 2259 H HB2  . HIS A 1 145 ? 1.045   0.858   14.117  1.00 0.62  ? 186 HIS A HB2  1 
ATOM 2260 H HB3  . HIS A 1 145 ? 1.901   0.936   15.652  1.00 0.63  ? 186 HIS A HB3  1 
ATOM 2261 H HD1  . HIS A 1 145 ? -0.969  2.269   14.064  1.00 1.43  ? 186 HIS A HD1  1 
ATOM 2262 H HD2  . HIS A 1 145 ? 1.936   3.835   16.588  1.00 0.28  ? 186 HIS A HD2  1 
ATOM 2263 H HE1  . HIS A 1 145 ? -1.988  4.343   15.055  1.00 2.16  ? 186 HIS A HE1  1 
ATOM 2264 N N    . THR A 1 146 ? 4.206   2.378   16.026  1.00 0.30  ? 187 THR A N    1 
ATOM 2265 C CA   . THR A 1 146 ? 4.985   3.204   16.941  1.00 0.32  ? 187 THR A CA   1 
ATOM 2266 C C    . THR A 1 146 ? 6.066   3.984   16.198  1.00 0.31  ? 187 THR A C    1 
ATOM 2267 O O    . THR A 1 146 ? 6.136   5.209   16.294  1.00 0.31  ? 187 THR A O    1 
ATOM 2268 C CB   . THR A 1 146 ? 5.624   2.334   18.025  1.00 0.34  ? 187 THR A CB   1 
ATOM 2269 O OG1  . THR A 1 146 ? 4.634   1.624   18.747  1.00 1.16  ? 187 THR A OG1  1 
ATOM 2270 C CG2  . THR A 1 146 ? 6.442   3.125   19.022  1.00 1.13  ? 187 THR A CG2  1 
ATOM 2271 H H    . THR A 1 146 ? 4.042   1.439   16.254  1.00 0.31  ? 187 THR A H    1 
ATOM 2272 H HA   . THR A 1 146 ? 4.311   3.905   17.409  1.00 0.34  ? 187 THR A HA   1 
ATOM 2273 H HB   . THR A 1 146 ? 6.281   1.616   17.554  1.00 0.98  ? 187 THR A HB   1 
ATOM 2274 H HG1  . THR A 1 146 ? 5.057   1.021   19.363  1.00 1.58  ? 187 THR A HG1  1 
ATOM 2275 H HG21 . THR A 1 146 ? 6.271   4.181   18.872  1.00 1.73  ? 187 THR A HG21 1 
ATOM 2276 H HG22 . THR A 1 146 ? 7.491   2.907   18.882  1.00 1.82  ? 187 THR A HG22 1 
ATOM 2277 H HG23 . THR A 1 146 ? 6.149   2.852   20.025  1.00 1.54  ? 187 THR A HG23 1 
ATOM 2278 N N    . TRP A 1 147 ? 6.912   3.267   15.466  1.00 0.31  ? 188 TRP A N    1 
ATOM 2279 C CA   . TRP A 1 147 ? 7.995   3.893   14.717  1.00 0.31  ? 188 TRP A CA   1 
ATOM 2280 C C    . TRP A 1 147 ? 7.463   4.823   13.630  1.00 0.33  ? 188 TRP A C    1 
ATOM 2281 O O    . TRP A 1 147 ? 8.014   5.901   13.403  1.00 0.35  ? 188 TRP A O    1 
ATOM 2282 C CB   . TRP A 1 147 ? 8.892   2.828   14.088  1.00 0.33  ? 188 TRP A CB   1 
ATOM 2283 C CG   . TRP A 1 147 ? 10.027  3.410   13.306  1.00 0.34  ? 188 TRP A CG   1 
ATOM 2284 C CD1  . TRP A 1 147 ? 11.326  3.523   13.708  1.00 0.37  ? 188 TRP A CD1  1 
ATOM 2285 C CD2  . TRP A 1 147 ? 9.964   3.968   11.989  1.00 0.48  ? 188 TRP A CD2  1 
ATOM 2286 N NE1  . TRP A 1 147 ? 12.075  4.118   12.722  1.00 0.48  ? 188 TRP A NE1  1 
ATOM 2287 C CE2  . TRP A 1 147 ? 11.261  4.400   11.656  1.00 0.55  ? 188 TRP A CE2  1 
ATOM 2288 C CE3  . TRP A 1 147 ? 8.936   4.143   11.058  1.00 0.63  ? 188 TRP A CE3  1 
ATOM 2289 C CZ2  . TRP A 1 147 ? 11.556  4.997   10.434  1.00 0.72  ? 188 TRP A CZ2  1 
ATOM 2290 C CZ3  . TRP A 1 147 ? 9.231   4.736   9.845   1.00 0.79  ? 188 TRP A CZ3  1 
ATOM 2291 C CH2  . TRP A 1 147 ? 10.531  5.156   9.542   1.00 0.83  ? 188 TRP A CH2  1 
ATOM 2292 H H    . TRP A 1 147 ? 6.812   2.293   15.435  1.00 0.31  ? 188 TRP A H    1 
ATOM 2293 H HA   . TRP A 1 147 ? 8.582   4.475   15.412  1.00 0.32  ? 188 TRP A HA   1 
ATOM 2294 H HB2  . TRP A 1 147 ? 9.307   2.207   14.867  1.00 0.34  ? 188 TRP A HB2  1 
ATOM 2295 H HB3  . TRP A 1 147 ? 8.303   2.217   13.420  1.00 0.40  ? 188 TRP A HB3  1 
ATOM 2296 H HD1  . TRP A 1 147 ? 11.696  3.189   14.666  1.00 0.39  ? 188 TRP A HD1  1 
ATOM 2297 H HE1  . TRP A 1 147 ? 13.035  4.309   12.774  1.00 0.55  ? 188 TRP A HE1  1 
ATOM 2298 H HE3  . TRP A 1 147 ? 7.928   3.824   11.274  1.00 0.64  ? 188 TRP A HE3  1 
ATOM 2299 H HZ2  . TRP A 1 147 ? 12.553  5.328   10.185  1.00 0.79  ? 188 TRP A HZ2  1 
ATOM 2300 H HZ3  . TRP A 1 147 ? 8.449   4.880   9.114   1.00 0.92  ? 188 TRP A HZ3  1 
ATOM 2301 H HH2  . TRP A 1 147 ? 10.716  5.615   8.583   1.00 0.97  ? 188 TRP A HH2  1 
ATOM 2302 N N    . ILE A 1 148 ? 6.399   4.398   12.955  1.00 0.36  ? 189 ILE A N    1 
ATOM 2303 C CA   . ILE A 1 148 ? 5.803   5.193   11.885  1.00 0.41  ? 189 ILE A CA   1 
ATOM 2304 C C    . ILE A 1 148 ? 5.627   6.647   12.307  1.00 0.42  ? 189 ILE A C    1 
ATOM 2305 O O    . ILE A 1 148 ? 6.159   7.555   11.669  1.00 0.46  ? 189 ILE A O    1 
ATOM 2306 C CB   . ILE A 1 148 ? 4.437   4.627   11.451  1.00 0.48  ? 189 ILE A CB   1 
ATOM 2307 C CG1  . ILE A 1 148 ? 4.628   3.456   10.485  1.00 0.60  ? 189 ILE A CG1  1 
ATOM 2308 C CG2  . ILE A 1 148 ? 3.594   5.719   10.809  1.00 0.43  ? 189 ILE A CG2  1 
ATOM 2309 C CD1  . ILE A 1 148 ? 3.335   2.770   10.102  1.00 0.57  ? 189 ILE A CD1  1 
ATOM 2310 H H    . ILE A 1 148 ? 6.009   3.527   13.177  1.00 0.38  ? 189 ILE A H    1 
ATOM 2311 H HA   . ILE A 1 148 ? 6.469   5.156   11.035  1.00 0.44  ? 189 ILE A HA   1 
ATOM 2312 H HB   . ILE A 1 148 ? 3.920   4.279   12.331  1.00 0.57  ? 189 ILE A HB   1 
ATOM 2313 H HG12 . ILE A 1 148 ? 5.092   3.817   9.579   1.00 0.87  ? 189 ILE A HG12 1 
ATOM 2314 H HG13 . ILE A 1 148 ? 5.272   2.721   10.945  1.00 0.98  ? 189 ILE A HG13 1 
ATOM 2315 H HG21 . ILE A 1 148 ? 4.218   6.331   10.175  1.00 0.99  ? 189 ILE A HG21 1 
ATOM 2316 H HG22 . ILE A 1 148 ? 3.152   6.333   11.580  1.00 1.11  ? 189 ILE A HG22 1 
ATOM 2317 H HG23 . ILE A 1 148 ? 2.812   5.268   10.216  1.00 1.06  ? 189 ILE A HG23 1 
ATOM 2318 H HD11 . ILE A 1 148 ? 3.556   1.848   9.586   1.00 1.21  ? 189 ILE A HD11 1 
ATOM 2319 H HD12 . ILE A 1 148 ? 2.762   3.417   9.454   1.00 1.26  ? 189 ILE A HD12 1 
ATOM 2320 H HD13 . ILE A 1 148 ? 2.764   2.556   10.993  1.00 1.13  ? 189 ILE A HD13 1 
ATOM 2321 N N    . GLN A 1 149 ? 4.880   6.862   13.384  1.00 0.48  ? 190 GLN A N    1 
ATOM 2322 C CA   . GLN A 1 149 ? 4.638   8.210   13.888  1.00 0.54  ? 190 GLN A CA   1 
ATOM 2323 C C    . GLN A 1 149 ? 5.921   8.831   14.433  1.00 0.46  ? 190 GLN A C    1 
ATOM 2324 O O    . GLN A 1 149 ? 6.094   10.050  14.399  1.00 0.50  ? 190 GLN A O    1 
ATOM 2325 C CB   . GLN A 1 149 ? 3.566   8.182   14.980  1.00 0.68  ? 190 GLN A CB   1 
ATOM 2326 C CG   . GLN A 1 149 ? 2.155   8.020   14.441  1.00 1.12  ? 190 GLN A CG   1 
ATOM 2327 C CD   . GLN A 1 149 ? 1.109   8.639   15.348  1.00 1.73  ? 190 GLN A CD   1 
ATOM 2328 O OE1  . GLN A 1 149 ? 1.069   9.857   15.527  1.00 2.42  ? 190 GLN A OE1  1 
ATOM 2329 N NE2  . GLN A 1 149 ? 0.256   7.802   15.926  1.00 2.21  ? 190 GLN A NE2  1 
ATOM 2330 H H    . GLN A 1 149 ? 4.484   6.098   13.853  1.00 0.53  ? 190 GLN A H    1 
ATOM 2331 H HA   . GLN A 1 149 ? 4.283   8.811   13.065  1.00 0.61  ? 190 GLN A HA   1 
ATOM 2332 H HB2  . GLN A 1 149 ? 3.771   7.359   15.648  1.00 1.03  ? 190 GLN A HB2  1 
ATOM 2333 H HB3  . GLN A 1 149 ? 3.612   9.107   15.536  1.00 1.26  ? 190 GLN A HB3  1 
ATOM 2334 H HG2  . GLN A 1 149 ? 2.096   8.495   13.473  1.00 1.58  ? 190 GLN A HG2  1 
ATOM 2335 H HG3  . GLN A 1 149 ? 1.942   6.966   14.337  1.00 1.47  ? 190 GLN A HG3  1 
ATOM 2336 H HE21 . GLN A 1 149 ? 0.348   6.845   15.738  1.00 2.45  ? 190 GLN A HE21 1 
ATOM 2337 H HE22 . GLN A 1 149 ? -0.430  8.176   16.518  1.00 2.67  ? 190 GLN A HE22 1 
ATOM 2338 N N    . ASP A 1 150 ? 6.817   7.988   14.936  1.00 0.44  ? 191 ASP A N    1 
ATOM 2339 C CA   . ASP A 1 150 ? 8.083   8.456   15.489  1.00 0.45  ? 191 ASP A CA   1 
ATOM 2340 C C    . ASP A 1 150 ? 8.952   9.098   14.411  1.00 0.42  ? 191 ASP A C    1 
ATOM 2341 O O    . ASP A 1 150 ? 9.527   10.166  14.619  1.00 0.90  ? 191 ASP A O    1 
ATOM 2342 C CB   . ASP A 1 150 ? 8.836   7.296   16.142  1.00 0.66  ? 191 ASP A CB   1 
ATOM 2343 C CG   . ASP A 1 150 ? 9.716   7.751   17.290  1.00 1.27  ? 191 ASP A CG   1 
ATOM 2344 O OD1  . ASP A 1 150 ? 10.844  8.217   17.025  1.00 1.96  ? 191 ASP A OD1  1 
ATOM 2345 O OD2  . ASP A 1 150 ? 9.276   7.641   18.454  1.00 1.95  ? 191 ASP A OD2  1 
ATOM 2346 H H    . ASP A 1 150 ? 6.623   7.028   14.937  1.00 0.48  ? 191 ASP A H    1 
ATOM 2347 H HA   . ASP A 1 150 ? 7.861   9.197   16.242  1.00 0.57  ? 191 ASP A HA   1 
ATOM 2348 H HB2  . ASP A 1 150 ? 8.123   6.580   16.522  1.00 1.11  ? 191 ASP A HB2  1 
ATOM 2349 H HB3  . ASP A 1 150 ? 9.461   6.819   15.401  1.00 1.02  ? 191 ASP A HB3  1 
ATOM 2350 N N    . ASN A 1 151 ? 9.048   8.437   13.262  1.00 0.56  ? 192 ASN A N    1 
ATOM 2351 C CA   . ASN A 1 151 ? 9.852   8.943   12.155  1.00 0.53  ? 192 ASN A CA   1 
ATOM 2352 C C    . ASN A 1 151 ? 9.187   10.139  11.471  1.00 0.53  ? 192 ASN A C    1 
ATOM 2353 O O    . ASN A 1 151 ? 9.844   10.889  10.749  1.00 0.84  ? 192 ASN A O    1 
ATOM 2354 C CB   . ASN A 1 151 ? 10.104  7.835   11.131  1.00 0.60  ? 192 ASN A CB   1 
ATOM 2355 C CG   . ASN A 1 151 ? 11.441  7.992   10.432  1.00 0.93  ? 192 ASN A CG   1 
ATOM 2356 O OD1  . ASN A 1 151 ? 11.509  8.466   9.298   1.00 1.86  ? 192 ASN A OD1  1 
ATOM 2357 N ND2  . ASN A 1 151 ? 12.513  7.595   11.108  1.00 1.04  ? 192 ASN A ND2  1 
ATOM 2358 H H    . ASN A 1 151 ? 8.569   7.588   13.157  1.00 0.98  ? 192 ASN A H    1 
ATOM 2359 H HA   . ASN A 1 151 ? 10.800  9.263   12.560  1.00 0.62  ? 192 ASN A HA   1 
ATOM 2360 H HB2  . ASN A 1 151 ? 10.092  6.880   11.633  1.00 0.82  ? 192 ASN A HB2  1 
ATOM 2361 H HB3  . ASN A 1 151 ? 9.323   7.857   10.386  1.00 0.72  ? 192 ASN A HB3  1 
ATOM 2362 H HD21 . ASN A 1 151 ? 12.383  7.227   12.007  1.00 1.55  ? 192 ASN A HD21 1 
ATOM 2363 H HD22 . ASN A 1 151 ? 13.389  7.685   10.679  1.00 1.23  ? 192 ASN A HD22 1 
ATOM 2364 N N    . GLY A 1 152 ? 7.886   10.321  11.698  1.00 0.53  ? 193 GLY A N    1 
ATOM 2365 C CA   . GLY A 1 152 ? 7.184   11.436  11.087  1.00 0.56  ? 193 GLY A CA   1 
ATOM 2366 C C    . GLY A 1 152 ? 5.857   11.045  10.454  1.00 0.59  ? 193 GLY A C    1 
ATOM 2367 O O    . GLY A 1 152 ? 5.134   11.907  9.954   1.00 1.14  ? 193 GLY A O    1 
ATOM 2368 H H    . GLY A 1 152 ? 7.404   9.702   12.282  1.00 0.74  ? 193 GLY A H    1 
ATOM 2369 H HA2  . GLY A 1 152 ? 6.998   12.182  11.844  1.00 0.64  ? 193 GLY A HA2  1 
ATOM 2370 H HA3  . GLY A 1 152 ? 7.818   11.867  10.326  1.00 0.57  ? 193 GLY A HA3  1 
ATOM 2371 N N    . GLY A 1 153 ? 5.524   9.755   10.474  1.00 0.37  ? 194 GLY A N    1 
ATOM 2372 C CA   . GLY A 1 153 ? 4.271   9.308   9.895   1.00 0.32  ? 194 GLY A CA   1 
ATOM 2373 C C    . GLY A 1 153 ? 4.303   9.250   8.379   1.00 0.27  ? 194 GLY A C    1 
ATOM 2374 O O    . GLY A 1 153 ? 5.308   9.595   7.753   1.00 0.27  ? 194 GLY A O    1 
ATOM 2375 H H    . GLY A 1 153 ? 6.121   9.101   10.889  1.00 0.73  ? 194 GLY A H    1 
ATOM 2376 H HA2  . GLY A 1 153 ? 4.046   8.322   10.275  1.00 0.35  ? 194 GLY A HA2  1 
ATOM 2377 H HA3  . GLY A 1 153 ? 3.486   9.984   10.201  1.00 0.36  ? 194 GLY A HA3  1 
ATOM 2378 N N    . TRP A 1 154 ? 3.196   8.808   7.791   1.00 0.28  ? 195 TRP A N    1 
ATOM 2379 C CA   . TRP A 1 154 ? 3.091   8.701   6.340   1.00 0.28  ? 195 TRP A CA   1 
ATOM 2380 C C    . TRP A 1 154 ? 3.585   9.980   5.673   1.00 0.29  ? 195 TRP A C    1 
ATOM 2381 O O    . TRP A 1 154 ? 4.348   9.932   4.708   1.00 0.28  ? 195 TRP A O    1 
ATOM 2382 C CB   . TRP A 1 154 ? 1.647   8.408   5.930   1.00 0.31  ? 195 TRP A CB   1 
ATOM 2383 C CG   . TRP A 1 154 ? 1.236   6.993   6.200   1.00 0.30  ? 195 TRP A CG   1 
ATOM 2384 C CD1  . TRP A 1 154 ? 0.216   6.574   7.004   1.00 0.32  ? 195 TRP A CD1  1 
ATOM 2385 C CD2  . TRP A 1 154 ? 1.842   5.808   5.668   1.00 0.34  ? 195 TRP A CD2  1 
ATOM 2386 N NE1  . TRP A 1 154 ? 0.150   5.201   7.005   1.00 0.35  ? 195 TRP A NE1  1 
ATOM 2387 C CE2  . TRP A 1 154 ? 1.137   4.708   6.193   1.00 0.36  ? 195 TRP A CE2  1 
ATOM 2388 C CE3  . TRP A 1 154 ? 2.910   5.569   4.799   1.00 0.40  ? 195 TRP A CE3  1 
ATOM 2389 C CZ2  . TRP A 1 154 ? 1.468   3.392   5.878   1.00 0.43  ? 195 TRP A CZ2  1 
ATOM 2390 C CZ3  . TRP A 1 154 ? 3.236   4.262   4.487   1.00 0.47  ? 195 TRP A CZ3  1 
ATOM 2391 C CH2  . TRP A 1 154 ? 2.517   3.188   5.025   1.00 0.47  ? 195 TRP A CH2  1 
ATOM 2392 H H    . TRP A 1 154 ? 2.436   8.546   8.352   1.00 0.32  ? 195 TRP A H    1 
ATOM 2393 H HA   . TRP A 1 154 ? 3.718   7.881   6.024   1.00 0.27  ? 195 TRP A HA   1 
ATOM 2394 H HB2  . TRP A 1 154 ? 0.983   9.060   6.479   1.00 0.33  ? 195 TRP A HB2  1 
ATOM 2395 H HB3  . TRP A 1 154 ? 1.534   8.595   4.872   1.00 0.34  ? 195 TRP A HB3  1 
ATOM 2396 H HD1  . TRP A 1 154 ? -0.436  7.236   7.554   1.00 0.34  ? 195 TRP A HD1  1 
ATOM 2397 H HE1  . TRP A 1 154 ? -0.499  4.663   7.505   1.00 0.39  ? 195 TRP A HE1  1 
ATOM 2398 H HE3  . TRP A 1 154 ? 3.477   6.384   4.374   1.00 0.42  ? 195 TRP A HE3  1 
ATOM 2399 H HZ2  . TRP A 1 154 ? 0.922   2.553   6.285   1.00 0.46  ? 195 TRP A HZ2  1 
ATOM 2400 H HZ3  . TRP A 1 154 ? 4.058   4.058   3.816   1.00 0.54  ? 195 TRP A HZ3  1 
ATOM 2401 H HH2  . TRP A 1 154 ? 2.807   2.184   4.753   1.00 0.54  ? 195 TRP A HH2  1 
ATOM 2402 N N    . ASP A 1 155 ? 3.154   11.124  6.201   1.00 0.32  ? 196 ASP A N    1 
ATOM 2403 C CA   . ASP A 1 155 ? 3.566   12.415  5.662   1.00 0.36  ? 196 ASP A CA   1 
ATOM 2404 C C    . ASP A 1 155 ? 5.079   12.457  5.480   1.00 0.34  ? 196 ASP A C    1 
ATOM 2405 O O    . ASP A 1 155 ? 5.589   13.088  4.553   1.00 0.35  ? 196 ASP A O    1 
ATOM 2406 C CB   . ASP A 1 155 ? 3.119   13.547  6.590   1.00 0.41  ? 196 ASP A CB   1 
ATOM 2407 C CG   . ASP A 1 155 ? 2.635   14.764  5.826   1.00 1.30  ? 196 ASP A CG   1 
ATOM 2408 O OD1  . ASP A 1 155 ? 2.134   14.595  4.694   1.00 1.85  ? 196 ASP A OD1  1 
ATOM 2409 O OD2  . ASP A 1 155 ? 2.756   15.887  6.360   1.00 2.16  ? 196 ASP A OD2  1 
ATOM 2410 H H    . ASP A 1 155 ? 2.551   11.099  6.972   1.00 0.34  ? 196 ASP A H    1 
ATOM 2411 H HA   . ASP A 1 155 ? 3.094   12.540  4.699   1.00 0.38  ? 196 ASP A HA   1 
ATOM 2412 H HB2  . ASP A 1 155 ? 2.313   13.194  7.215   1.00 0.93  ? 196 ASP A HB2  1 
ATOM 2413 H HB3  . ASP A 1 155 ? 3.950   13.842  7.213   1.00 1.01  ? 196 ASP A HB3  1 
ATOM 2414 N N    . ALA A 1 156 ? 5.792   11.763  6.364   1.00 0.32  ? 197 ALA A N    1 
ATOM 2415 C CA   . ALA A 1 156 ? 7.246   11.704  6.292   1.00 0.32  ? 197 ALA A CA   1 
ATOM 2416 C C    . ALA A 1 156 ? 7.676   10.809  5.141   1.00 0.29  ? 197 ALA A C    1 
ATOM 2417 O O    . ALA A 1 156 ? 8.629   11.113  4.424   1.00 0.31  ? 197 ALA A O    1 
ATOM 2418 C CB   . ALA A 1 156 ? 7.828   11.198  7.602   1.00 0.31  ? 197 ALA A CB   1 
ATOM 2419 H H    . ALA A 1 156 ? 5.325   11.268  7.068   1.00 0.32  ? 197 ALA A H    1 
ATOM 2420 H HA   . ALA A 1 156 ? 7.614   12.705  6.119   1.00 0.37  ? 197 ALA A HA   1 
ATOM 2421 H HB1  . ALA A 1 156 ? 8.427   11.975  8.054   1.00 0.93  ? 197 ALA A HB1  1 
ATOM 2422 H HB2  . ALA A 1 156 ? 8.446   10.333  7.410   1.00 0.86  ? 197 ALA A HB2  1 
ATOM 2423 H HB3  . ALA A 1 156 ? 7.027   10.926  8.270   1.00 0.90  ? 197 ALA A HB3  1 
ATOM 2424 N N    . PHE A 1 157 ? 6.953   9.709   4.963   1.00 0.27  ? 198 PHE A N    1 
ATOM 2425 C CA   . PHE A 1 157 ? 7.246   8.772   3.887   1.00 0.30  ? 198 PHE A CA   1 
ATOM 2426 C C    . PHE A 1 157 ? 7.059   9.446   2.535   1.00 0.36  ? 198 PHE A C    1 
ATOM 2427 O O    . PHE A 1 157 ? 8.003   9.576   1.755   1.00 0.57  ? 198 PHE A O    1 
ATOM 2428 C CB   . PHE A 1 157 ? 6.337   7.546   3.986   1.00 0.34  ? 198 PHE A CB   1 
ATOM 2429 C CG   . PHE A 1 157 ? 6.992   6.269   3.541   1.00 0.42  ? 198 PHE A CG   1 
ATOM 2430 C CD1  . PHE A 1 157 ? 8.109   6.292   2.721   1.00 1.10  ? 198 PHE A CD1  1 
ATOM 2431 C CD2  . PHE A 1 157 ? 6.489   5.044   3.946   1.00 1.22  ? 198 PHE A CD2  1 
ATOM 2432 C CE1  . PHE A 1 157 ? 8.712   5.117   2.314   1.00 1.16  ? 198 PHE A CE1  1 
ATOM 2433 C CE2  . PHE A 1 157 ? 7.087   3.865   3.542   1.00 1.28  ? 198 PHE A CE2  1 
ATOM 2434 C CZ   . PHE A 1 157 ? 8.200   3.902   2.725   1.00 0.67  ? 198 PHE A CZ   1 
ATOM 2435 H H    . PHE A 1 157 ? 6.196   9.529   5.563   1.00 0.27  ? 198 PHE A H    1 
ATOM 2436 H HA   . PHE A 1 157 ? 8.274   8.459   3.984   1.00 0.29  ? 198 PHE A HA   1 
ATOM 2437 H HB2  . PHE A 1 157 ? 6.028   7.418   5.012   1.00 0.38  ? 198 PHE A HB2  1 
ATOM 2438 H HB3  . PHE A 1 157 ? 5.463   7.704   3.370   1.00 0.38  ? 198 PHE A HB3  1 
ATOM 2439 H HD1  . PHE A 1 157 ? 8.510   7.240   2.397   1.00 1.87  ? 198 PHE A HD1  1 
ATOM 2440 H HD2  . PHE A 1 157 ? 5.618   5.014   4.584   1.00 2.00  ? 198 PHE A HD2  1 
ATOM 2441 H HE1  . PHE A 1 157 ? 9.582   5.149   1.675   1.00 1.94  ? 198 PHE A HE1  1 
ATOM 2442 H HE2  . PHE A 1 157 ? 6.685   2.917   3.866   1.00 2.06  ? 198 PHE A HE2  1 
ATOM 2443 H HZ   . PHE A 1 157 ? 8.670   2.982   2.409   1.00 0.79  ? 198 PHE A HZ   1 
ATOM 2444 N N    . VAL A 1 158 ? 5.830   9.873   2.268   1.00 0.35  ? 199 VAL A N    1 
ATOM 2445 C CA   . VAL A 1 158 ? 5.504   10.539  1.011   1.00 0.40  ? 199 VAL A CA   1 
ATOM 2446 C C    . VAL A 1 158 ? 6.529   11.612  0.662   1.00 0.40  ? 199 VAL A C    1 
ATOM 2447 O O    . VAL A 1 158 ? 7.032   11.651  -0.454  1.00 0.44  ? 199 VAL A O    1 
ATOM 2448 C CB   . VAL A 1 158 ? 4.099   11.183  1.037   1.00 0.47  ? 199 VAL A CB   1 
ATOM 2449 C CG1  . VAL A 1 158 ? 3.745   11.695  2.427   1.00 0.66  ? 199 VAL A CG1  1 
ATOM 2450 C CG2  . VAL A 1 158 ? 4.018   12.308  0.019   1.00 0.87  ? 199 VAL A CG2  1 
ATOM 2451 H H    . VAL A 1 158 ? 5.125   9.733   2.933   1.00 0.44  ? 199 VAL A H    1 
ATOM 2452 H HA   . VAL A 1 158 ? 5.515   9.790   0.232   1.00 0.42  ? 199 VAL A HA   1 
ATOM 2453 H HB   . VAL A 1 158 ? 3.376   10.429  0.763   1.00 0.83  ? 199 VAL A HB   1 
ATOM 2454 H HG11 . VAL A 1 158 ? 4.630   11.714  3.044   1.00 1.13  ? 199 VAL A HG11 1 
ATOM 2455 H HG12 . VAL A 1 158 ? 3.010   11.042  2.874   1.00 1.37  ? 199 VAL A HG12 1 
ATOM 2456 H HG13 . VAL A 1 158 ? 3.340   12.693  2.349   1.00 1.30  ? 199 VAL A HG13 1 
ATOM 2457 H HG21 . VAL A 1 158 ? 2.982   12.524  -0.196  1.00 1.41  ? 199 VAL A HG21 1 
ATOM 2458 H HG22 . VAL A 1 158 ? 4.521   12.010  -0.888  1.00 1.45  ? 199 VAL A HG22 1 
ATOM 2459 H HG23 . VAL A 1 158 ? 4.493   13.191  0.421   1.00 1.43  ? 199 VAL A HG23 1 
ATOM 2460 N N    . GLU A 1 159 ? 6.828   12.487  1.615   1.00 0.41  ? 200 GLU A N    1 
ATOM 2461 C CA   . GLU A 1 159 ? 7.789   13.560  1.385   1.00 0.45  ? 200 GLU A CA   1 
ATOM 2462 C C    . GLU A 1 159 ? 9.190   13.007  1.133   1.00 0.41  ? 200 GLU A C    1 
ATOM 2463 O O    . GLU A 1 159 ? 9.945   13.546  0.324   1.00 0.43  ? 200 GLU A O    1 
ATOM 2464 C CB   . GLU A 1 159 ? 7.814   14.511  2.582   1.00 0.48  ? 200 GLU A CB   1 
ATOM 2465 C CG   . GLU A 1 159 ? 8.607   15.784  2.334   1.00 1.32  ? 200 GLU A CG   1 
ATOM 2466 C CD   . GLU A 1 159 ? 8.308   16.865  3.354   1.00 1.68  ? 200 GLU A CD   1 
ATOM 2467 O OE1  . GLU A 1 159 ? 8.638   16.667  4.542   1.00 2.23  ? 200 GLU A OE1  1 
ATOM 2468 O OE2  . GLU A 1 159 ? 7.744   17.909  2.965   1.00 2.21  ? 200 GLU A OE2  1 
ATOM 2469 H H    . GLU A 1 159 ? 6.390   12.416  2.488   1.00 0.43  ? 200 GLU A H    1 
ATOM 2470 H HA   . GLU A 1 159 ? 7.470   14.107  0.511   1.00 0.49  ? 200 GLU A HA   1 
ATOM 2471 H HB2  . GLU A 1 159 ? 6.799   14.787  2.829   1.00 1.11  ? 200 GLU A HB2  1 
ATOM 2472 H HB3  . GLU A 1 159 ? 8.253   13.998  3.425   1.00 0.96  ? 200 GLU A HB3  1 
ATOM 2473 H HG2  . GLU A 1 159 ? 9.660   15.551  2.377   1.00 1.92  ? 200 GLU A HG2  1 
ATOM 2474 H HG3  . GLU A 1 159 ? 8.362   16.159  1.351   1.00 2.04  ? 200 GLU A HG3  1 
ATOM 2475 N N    . LEU A 1 160 ? 9.537   11.940  1.844   1.00 0.37  ? 201 LEU A N    1 
ATOM 2476 C CA   . LEU A 1 160 ? 10.854  11.324  1.715   1.00 0.36  ? 201 LEU A CA   1 
ATOM 2477 C C    . LEU A 1 160 ? 11.097  10.762  0.314   1.00 0.38  ? 201 LEU A C    1 
ATOM 2478 O O    . LEU A 1 160 ? 12.061  11.140  -0.351  1.00 0.44  ? 201 LEU A O    1 
ATOM 2479 C CB   . LEU A 1 160 ? 11.016  10.211  2.752   1.00 0.37  ? 201 LEU A CB   1 
ATOM 2480 C CG   . LEU A 1 160 ? 11.887  10.569  3.957   1.00 0.41  ? 201 LEU A CG   1 
ATOM 2481 C CD1  . LEU A 1 160 ? 11.127  10.335  5.254   1.00 0.93  ? 201 LEU A CD1  1 
ATOM 2482 C CD2  . LEU A 1 160 ? 13.177  9.763   3.940   1.00 0.91  ? 201 LEU A CD2  1 
ATOM 2483 H H    . LEU A 1 160 ? 8.898   11.565  2.486   1.00 0.37  ? 201 LEU A H    1 
ATOM 2484 H HA   . LEU A 1 160 ? 11.591  12.087  1.912   1.00 0.38  ? 201 LEU A HA   1 
ATOM 2485 H HB2  . LEU A 1 160 ? 10.034  9.937   3.111   1.00 0.37  ? 201 LEU A HB2  1 
ATOM 2486 H HB3  . LEU A 1 160 ? 11.454  9.353   2.263   1.00 0.42  ? 201 LEU A HB3  1 
ATOM 2487 H HG   . LEU A 1 160 ? 12.145  11.617  3.907   1.00 0.63  ? 201 LEU A HG   1 
ATOM 2488 H HD11 . LEU A 1 160 ? 10.367  9.584   5.095   1.00 1.55  ? 201 LEU A HD11 1 
ATOM 2489 H HD12 . LEU A 1 160 ? 10.662  11.257  5.570   1.00 1.21  ? 201 LEU A HD12 1 
ATOM 2490 H HD13 . LEU A 1 160 ? 11.813  9.998   6.017   1.00 1.53  ? 201 LEU A HD13 1 
ATOM 2491 H HD21 . LEU A 1 160 ? 13.644  9.852   2.970   1.00 1.48  ? 201 LEU A HD21 1 
ATOM 2492 H HD22 . LEU A 1 160 ? 12.955  8.725   4.138   1.00 1.41  ? 201 LEU A HD22 1 
ATOM 2493 H HD23 . LEU A 1 160 ? 13.847  10.139  4.698   1.00 1.49  ? 201 LEU A HD23 1 
ATOM 2494 N N    . TYR A 1 161 ? 10.239  9.844   -0.122  1.00 0.37  ? 202 TYR A N    1 
ATOM 2495 C CA   . TYR A 1 161 ? 10.396  9.223   -1.437  1.00 0.43  ? 202 TYR A CA   1 
ATOM 2496 C C    . TYR A 1 161 ? 9.468   9.833   -2.492  1.00 0.49  ? 202 TYR A C    1 
ATOM 2497 O O    . TYR A 1 161 ? 9.352   9.300   -3.596  1.00 0.50  ? 202 TYR A O    1 
ATOM 2498 C CB   . TYR A 1 161 ? 10.138  7.718   -1.338  1.00 0.48  ? 202 TYR A CB   1 
ATOM 2499 C CG   . TYR A 1 161 ? 11.022  7.016   -0.332  1.00 0.39  ? 202 TYR A CG   1 
ATOM 2500 C CD1  . TYR A 1 161 ? 10.855  7.224   1.032   1.00 1.05  ? 202 TYR A CD1  1 
ATOM 2501 C CD2  . TYR A 1 161 ? 12.020  6.143   -0.745  1.00 1.03  ? 202 TYR A CD2  1 
ATOM 2502 C CE1  . TYR A 1 161 ? 11.659  6.582   1.955   1.00 1.04  ? 202 TYR A CE1  1 
ATOM 2503 C CE2  . TYR A 1 161 ? 12.828  5.497   0.171   1.00 1.05  ? 202 TYR A CE2  1 
ATOM 2504 C CZ   . TYR A 1 161 ? 12.644  5.720   1.520   1.00 0.41  ? 202 TYR A CZ   1 
ATOM 2505 O OH   . TYR A 1 161 ? 13.446  5.079   2.435   1.00 0.51  ? 202 TYR A OH   1 
ATOM 2506 H H    . TYR A 1 161 ? 9.497   9.566   0.454   1.00 0.36  ? 202 TYR A H    1 
ATOM 2507 H HA   . TYR A 1 161 ? 11.417  9.376   -1.750  1.00 0.47  ? 202 TYR A HA   1 
ATOM 2508 H HB2  . TYR A 1 161 ? 9.112   7.555   -1.046  1.00 0.60  ? 202 TYR A HB2  1 
ATOM 2509 H HB3  . TYR A 1 161 ? 10.309  7.266   -2.304  1.00 0.58  ? 202 TYR A HB3  1 
ATOM 2510 H HD1  . TYR A 1 161 ? 10.083  7.899   1.369   1.00 1.80  ? 202 TYR A HD1  1 
ATOM 2511 H HD2  . TYR A 1 161 ? 12.163  5.971   -1.802  1.00 1.76  ? 202 TYR A HD2  1 
ATOM 2512 H HE1  . TYR A 1 161 ? 11.514  6.757   3.010   1.00 1.77  ? 202 TYR A HE1  1 
ATOM 2513 H HE2  . TYR A 1 161 ? 13.600  4.823   -0.170  1.00 1.80  ? 202 TYR A HE2  1 
ATOM 2514 H HH   . TYR A 1 161 ? 13.979  5.726   2.903   1.00 1.11  ? 202 TYR A HH   1 
ATOM 2515 N N    . GLY A 1 162 ? 8.807   10.938  -2.163  1.00 0.56  ? 203 GLY A N    1 
ATOM 2516 C CA   . GLY A 1 162 ? 7.907   11.565  -3.115  1.00 0.67  ? 203 GLY A CA   1 
ATOM 2517 C C    . GLY A 1 162 ? 8.642   12.376  -4.167  1.00 0.71  ? 203 GLY A C    1 
ATOM 2518 O O    . GLY A 1 162 ? 9.708   12.926  -3.893  1.00 0.89  ? 203 GLY A O    1 
ATOM 2519 H H    . GLY A 1 162 ? 8.922   11.329  -1.272  1.00 0.55  ? 203 GLY A H    1 
ATOM 2520 H HA2  . GLY A 1 162 ? 7.333   10.795  -3.604  1.00 0.71  ? 203 GLY A HA2  1 
ATOM 2521 H HA3  . GLY A 1 162 ? 7.232   12.217  -2.584  1.00 0.95  ? 203 GLY A HA3  1 
ATOM 2522 N N    . PRO A 1 163 ? 8.090   12.470  -5.389  1.00 0.75  ? 204 PRO A N    1 
ATOM 2523 C CA   . PRO A 1 163 ? 8.710   13.231  -6.481  1.00 1.05  ? 204 PRO A CA   1 
ATOM 2524 C C    . PRO A 1 163 ? 8.928   14.696  -6.113  1.00 1.46  ? 204 PRO A C    1 
ATOM 2525 O O    . PRO A 1 163 ? 8.969   15.052  -4.936  1.00 2.11  ? 204 PRO A O    1 
ATOM 2526 C CB   . PRO A 1 163 ? 7.698   13.120  -7.626  1.00 1.14  ? 204 PRO A CB   1 
ATOM 2527 C CG   . PRO A 1 163 ? 6.874   11.922  -7.303  1.00 0.83  ? 204 PRO A CG   1 
ATOM 2528 C CD   . PRO A 1 163 ? 6.822   11.845  -5.804  1.00 0.71  ? 204 PRO A CD   1 
ATOM 2529 H HA   . PRO A 1 163 ? 9.651   12.794  -6.783  1.00 1.14  ? 204 PRO A HA   1 
ATOM 2530 H HB2  . PRO A 1 163 ? 7.095   14.015  -7.663  1.00 1.46  ? 204 PRO A HB2  1 
ATOM 2531 H HB3  . PRO A 1 163 ? 8.223   12.996  -8.561  1.00 1.43  ? 204 PRO A HB3  1 
ATOM 2532 H HG2  . PRO A 1 163 ? 5.880   12.041  -7.706  1.00 0.98  ? 204 PRO A HG2  1 
ATOM 2533 H HG3  . PRO A 1 163 ? 7.340   11.036  -7.708  1.00 0.98  ? 204 PRO A HG3  1 
ATOM 2534 H HD2  . PRO A 1 163 ? 5.975   12.398  -5.425  1.00 0.92  ? 204 PRO A HD2  1 
ATOM 2535 H HD3  . PRO A 1 163 ? 6.777   10.815  -5.483  1.00 0.71  ? 204 PRO A HD3  1 
ATOM 2536 N N    . SER A 1 164 ? 9.063   15.541  -7.129  1.00 1.82  ? 205 SER A N    1 
ATOM 2537 C CA   . SER A 1 164 ? 9.274   16.968  -6.913  1.00 2.25  ? 205 SER A CA   1 
ATOM 2538 C C    . SER A 1 164 ? 8.131   17.783  -7.511  1.00 2.38  ? 205 SER A C    1 
ATOM 2539 O O    . SER A 1 164 ? 8.260   18.347  -8.597  1.00 2.68  ? 205 SER A O    1 
ATOM 2540 C CB   . SER A 1 164 ? 10.604  17.407  -7.527  1.00 2.82  ? 205 SER A CB   1 
ATOM 2541 O OG   . SER A 1 164 ? 11.677  17.193  -6.626  1.00 3.57  ? 205 SER A OG   1 
ATOM 2542 H H    . SER A 1 164 ? 9.019   15.198  -8.046  1.00 2.23  ? 205 SER A H    1 
ATOM 2543 H HA   . SER A 1 164 ? 9.304   17.141  -5.848  1.00 2.50  ? 205 SER A HA   1 
ATOM 2544 H HB2  . SER A 1 164 ? 10.788  16.839  -8.426  1.00 3.15  ? 205 SER A HB2  1 
ATOM 2545 H HB3  . SER A 1 164 ? 10.557  18.459  -7.768  1.00 2.96  ? 205 SER A HB3  1 
ATOM 2546 H HG   . SER A 1 164 ? 12.336  17.881  -6.743  1.00 4.01  ? 205 SER A HG   1 
ATOM 2547 N N    . MET A 1 165 ? 7.013   17.838  -6.795  1.00 2.76  ? 206 MET A N    1 
ATOM 2548 C CA   . MET A 1 165 ? 5.846   18.584  -7.255  1.00 3.29  ? 206 MET A CA   1 
ATOM 2549 C C    . MET A 1 165 ? 5.211   17.908  -8.465  1.00 3.54  ? 206 MET A C    1 
ATOM 2550 O O    . MET A 1 165 ? 5.024   18.532  -9.510  1.00 4.25  ? 206 MET A O    1 
ATOM 2551 C CB   . MET A 1 165 ? 6.238   20.021  -7.605  1.00 4.29  ? 206 MET A CB   1 
ATOM 2552 C CG   . MET A 1 165 ? 7.129   20.679  -6.565  1.00 4.97  ? 206 MET A CG   1 
ATOM 2553 S SD   . MET A 1 165 ? 6.815   22.447  -6.401  1.00 6.23  ? 206 MET A SD   1 
ATOM 2554 C CE   . MET A 1 165 ? 8.359   23.123  -7.009  1.00 6.74  ? 206 MET A CE   1 
ATOM 2555 H H    . MET A 1 165 ? 6.971   17.367  -5.937  1.00 3.00  ? 206 MET A H    1 
ATOM 2556 H HA   . MET A 1 165 ? 5.127   18.602  -6.450  1.00 3.28  ? 206 MET A HA   1 
ATOM 2557 H HB2  . MET A 1 165 ? 6.763   20.019  -8.549  1.00 4.56  ? 206 MET A HB2  1 
ATOM 2558 H HB3  . MET A 1 165 ? 5.339   20.612  -7.704  1.00 4.66  ? 206 MET A HB3  1 
ATOM 2559 H HG2  . MET A 1 165 ? 6.954   20.208  -5.610  1.00 5.03  ? 206 MET A HG2  1 
ATOM 2560 H HG3  . MET A 1 165 ? 8.161   20.536  -6.852  1.00 5.00  ? 206 MET A HG3  1 
ATOM 2561 H HE1  . MET A 1 165 ? 8.778   22.455  -7.747  1.00 6.76  ? 206 MET A HE1  1 
ATOM 2562 H HE2  . MET A 1 165 ? 9.051   23.234  -6.188  1.00 6.93  ? 206 MET A HE2  1 
ATOM 2563 H HE3  . MET A 1 165 ? 8.176   24.088  -7.459  1.00 7.15  ? 206 MET A HE3  1 
ATOM 2564 N N    . ARG A 1 166 ? 4.882   16.629  -8.318  1.00 3.35  ? 207 ARG A N    1 
ATOM 2565 C CA   . ARG A 1 166 ? 4.267   15.868  -9.399  1.00 4.05  ? 207 ARG A CA   1 
ATOM 2566 C C    . ARG A 1 166 ? 3.271   14.852  -8.852  1.00 4.49  ? 207 ARG A C    1 
ATOM 2567 O O    . ARG A 1 166 ? 2.794   15.045  -7.713  1.00 4.94  ? 207 ARG A O    1 
ATOM 2568 C CB   . ARG A 1 166 ? 5.341   15.155  -10.222 1.00 4.46  ? 207 ARG A CB   1 
ATOM 2569 C CG   . ARG A 1 166 ? 5.190   15.354  -11.722 1.00 5.13  ? 207 ARG A CG   1 
ATOM 2570 C CD   . ARG A 1 166 ? 5.417   16.804  -12.116 1.00 5.75  ? 207 ARG A CD   1 
ATOM 2571 N NE   . ARG A 1 166 ? 5.036   17.060  -13.503 1.00 6.27  ? 207 ARG A NE   1 
ATOM 2572 C CZ   . ARG A 1 166 ? 5.798   16.755  -14.552 1.00 6.82  ? 207 ARG A CZ   1 
ATOM 2573 N NH1  . ARG A 1 166 ? 6.984   16.181  -14.381 1.00 6.96  ? 207 ARG A NH1  1 
ATOM 2574 N NH2  . ARG A 1 166 ? 5.372   17.024  -15.779 1.00 7.51  ? 207 ARG A NH2  1 
ATOM 2575 O OXT  . ARG A 1 166 ? 2.974   13.871  -9.566  1.00 4.76  ? 207 ARG A OXT  1 
ATOM 2576 H H    . ARG A 1 166 ? 5.056   16.186  -7.461  1.00 3.02  ? 207 ARG A H    1 
ATOM 2577 H HA   . ARG A 1 166 ? 3.741   16.564  -10.036 1.00 4.40  ? 207 ARG A HA   1 
ATOM 2578 H HB2  . ARG A 1 166 ? 6.311   15.526  -9.927  1.00 4.45  ? 207 ARG A HB2  1 
ATOM 2579 H HB3  . ARG A 1 166 ? 5.292   14.096  -10.015 1.00 4.74  ? 207 ARG A HB3  1 
ATOM 2580 H HG2  . ARG A 1 166 ? 5.914   14.735  -12.232 1.00 5.29  ? 207 ARG A HG2  1 
ATOM 2581 H HG3  . ARG A 1 166 ? 4.193   15.062  -12.015 1.00 5.41  ? 207 ARG A HG3  1 
ATOM 2582 H HD2  . ARG A 1 166 ? 4.829   17.437  -11.469 1.00 5.97  ? 207 ARG A HD2  1 
ATOM 2583 H HD3  . ARG A 1 166 ? 6.465   17.038  -11.991 1.00 5.98  ? 207 ARG A HD3  1 
ATOM 2584 H HE   . ARG A 1 166 ? 4.167   17.483  -13.662 1.00 6.44  ? 207 ARG A HE   1 
ATOM 2585 H HH11 . ARG A 1 166 ? 7.314   15.974  -13.461 1.00 6.67  ? 207 ARG A HH11 1 
ATOM 2586 H HH12 . ARG A 1 166 ? 7.547   15.956  -15.176 1.00 7.55  ? 207 ARG A HH12 1 
ATOM 2587 H HH21 . ARG A 1 166 ? 4.480   17.455  -15.915 1.00 7.66  ? 207 ARG A HH21 1 
ATOM 2588 H HH22 . ARG A 1 166 ? 5.942   16.795  -16.567 1.00 8.04  ? 207 ARG A HH22 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   3   HIS HIS A . n 
A 1 4   ALA 4   4   4   ALA ALA A . n 
A 1 5   GLY 5   5   5   GLY GLY A . n 
A 1 6   ARG 6   6   6   ARG ARG A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   GLY 8   8   8   GLY GLY A . n 
A 1 9   TYR 9   9   9   TYR TYR A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  ASN 11  11  11  ASN ASN A . n 
A 1 12  ARG 12  12  12  ARG ARG A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  TYR 18  18  18  TYR TYR A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  HIS 20  20  20  HIS HIS A . n 
A 1 21  TYR 21  21  21  TYR TYR A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  GLN 25  25  25  GLN GLN A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  TRP 30  30  30  TRP TRP A . n 
A 1 31  ASP 31  31  31  ASP ASP A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  ARG 40  40  40  ARG ARG A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  ALA 43  43  43  ALA ALA A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  SER 49  49  49  SER SER A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  VAL 51  92  92  VAL VAL A . n 
A 1 52  VAL 52  93  93  VAL VAL A . n 
A 1 53  HIS 53  94  94  HIS HIS A . n 
A 1 54  LEU 54  95  95  LEU LEU A . n 
A 1 55  ALA 55  96  96  ALA ALA A . n 
A 1 56  LEU 56  97  97  LEU LEU A . n 
A 1 57  ARG 57  98  98  ARG ARG A . n 
A 1 58  GLN 58  99  99  GLN GLN A . n 
A 1 59  ALA 59  100 100 ALA ALA A . n 
A 1 60  GLY 60  101 101 GLY GLY A . n 
A 1 61  ASP 61  102 102 ASP ASP A . n 
A 1 62  ASP 62  103 103 ASP ASP A . n 
A 1 63  PHE 63  104 104 PHE PHE A . n 
A 1 64  SER 64  105 105 SER SER A . n 
A 1 65  ARG 65  106 106 ARG ARG A . n 
A 1 66  ARG 66  107 107 ARG ARG A . n 
A 1 67  TYR 67  108 108 TYR TYR A . n 
A 1 68  ARG 68  109 109 ARG ARG A . n 
A 1 69  GLY 69  110 110 GLY GLY A . n 
A 1 70  ASP 70  111 111 ASP ASP A . n 
A 1 71  PHE 71  112 112 PHE PHE A . n 
A 1 72  ALA 72  113 113 ALA ALA A . n 
A 1 73  GLU 73  114 114 GLU GLU A . n 
A 1 74  MET 74  115 115 MET MET A . n 
A 1 75  SER 75  116 116 SER SER A . n 
A 1 76  SER 76  117 117 SER SER A . n 
A 1 77  GLN 77  118 118 GLN GLN A . n 
A 1 78  LEU 78  119 119 LEU LEU A . n 
A 1 79  HIS 79  120 120 HIS HIS A . n 
A 1 80  LEU 80  121 121 LEU LEU A . n 
A 1 81  THR 81  122 122 THR THR A . n 
A 1 82  PRO 82  123 123 PRO PRO A . n 
A 1 83  PHE 83  124 124 PHE PHE A . n 
A 1 84  THR 84  125 125 THR THR A . n 
A 1 85  ALA 85  126 126 ALA ALA A . n 
A 1 86  ARG 86  127 127 ARG ARG A . n 
A 1 87  GLY 87  128 128 GLY GLY A . n 
A 1 88  ARG 88  129 129 ARG ARG A . n 
A 1 89  PHE 89  130 130 PHE PHE A . n 
A 1 90  ALA 90  131 131 ALA ALA A . n 
A 1 91  THR 91  132 132 THR THR A . n 
A 1 92  VAL 92  133 133 VAL VAL A . n 
A 1 93  VAL 93  134 134 VAL VAL A . n 
A 1 94  GLU 94  135 135 GLU GLU A . n 
A 1 95  GLU 95  136 136 GLU GLU A . n 
A 1 96  LEU 96  137 137 LEU LEU A . n 
A 1 97  PHE 97  138 138 PHE PHE A . n 
A 1 98  ARG 98  139 139 ARG ARG A . n 
A 1 99  ASP 99  140 140 ASP ASP A . n 
A 1 100 GLY 100 141 141 GLY GLY A . n 
A 1 101 VAL 101 142 142 VAL VAL A . n 
A 1 102 ASN 102 143 143 ASN ASN A . n 
A 1 103 TRP 103 144 144 TRP TRP A . n 
A 1 104 GLY 104 145 145 GLY GLY A . n 
A 1 105 ARG 105 146 146 ARG ARG A . n 
A 1 106 ILE 106 147 147 ILE ILE A . n 
A 1 107 VAL 107 148 148 VAL VAL A . n 
A 1 108 ALA 108 149 149 ALA ALA A . n 
A 1 109 PHE 109 150 150 PHE PHE A . n 
A 1 110 PHE 110 151 151 PHE PHE A . n 
A 1 111 GLU 111 152 152 GLU GLU A . n 
A 1 112 PHE 112 153 153 PHE PHE A . n 
A 1 113 GLY 113 154 154 GLY GLY A . n 
A 1 114 GLY 114 155 155 GLY GLY A . n 
A 1 115 VAL 115 156 156 VAL VAL A . n 
A 1 116 MET 116 157 157 MET MET A . n 
A 1 117 CYS 117 158 158 CYS CYS A . n 
A 1 118 VAL 118 159 159 VAL VAL A . n 
A 1 119 GLU 119 160 160 GLU GLU A . n 
A 1 120 SER 120 161 161 SER SER A . n 
A 1 121 VAL 121 162 162 VAL VAL A . n 
A 1 122 ASN 122 163 163 ASN ASN A . n 
A 1 123 ARG 123 164 164 ARG ARG A . n 
A 1 124 GLU 124 165 165 GLU GLU A . n 
A 1 125 MET 125 166 166 MET MET A . n 
A 1 126 SER 126 167 167 SER SER A . n 
A 1 127 PRO 127 168 168 PRO PRO A . n 
A 1 128 LEU 128 169 169 LEU LEU A . n 
A 1 129 VAL 129 170 170 VAL VAL A . n 
A 1 130 ASP 130 171 171 ASP ASP A . n 
A 1 131 ASN 131 172 172 ASN ASN A . n 
A 1 132 ILE 132 173 173 ILE ILE A . n 
A 1 133 ALA 133 174 174 ALA ALA A . n 
A 1 134 LEU 134 175 175 LEU LEU A . n 
A 1 135 TRP 135 176 176 TRP TRP A . n 
A 1 136 MET 136 177 177 MET MET A . n 
A 1 137 THR 137 178 178 THR THR A . n 
A 1 138 GLU 138 179 179 GLU GLU A . n 
A 1 139 TYR 139 180 180 TYR TYR A . n 
A 1 140 LEU 140 181 181 LEU LEU A . n 
A 1 141 ASN 141 182 182 ASN ASN A . n 
A 1 142 ARG 142 183 183 ARG ARG A . n 
A 1 143 HIS 143 184 184 HIS HIS A . n 
A 1 144 LEU 144 185 185 LEU LEU A . n 
A 1 145 HIS 145 186 186 HIS HIS A . n 
A 1 146 THR 146 187 187 THR THR A . n 
A 1 147 TRP 147 188 188 TRP TRP A . n 
A 1 148 ILE 148 189 189 ILE ILE A . n 
A 1 149 GLN 149 190 190 GLN GLN A . n 
A 1 150 ASP 150 191 191 ASP ASP A . n 
A 1 151 ASN 151 192 192 ASN ASN A . n 
A 1 152 GLY 152 193 193 GLY GLY A . n 
A 1 153 GLY 153 194 194 GLY GLY A . n 
A 1 154 TRP 154 195 195 TRP TRP A . n 
A 1 155 ASP 155 196 196 ASP ASP A . n 
A 1 156 ALA 156 197 197 ALA ALA A . n 
A 1 157 PHE 157 198 198 PHE PHE A . n 
A 1 158 VAL 158 199 199 VAL VAL A . n 
A 1 159 GLU 159 200 200 GLU GLU A . n 
A 1 160 LEU 160 201 201 LEU LEU A . n 
A 1 161 TYR 161 202 202 TYR TYR A . n 
A 1 162 GLY 162 203 203 GLY GLY A . n 
A 1 163 PRO 163 204 204 PRO PRO A . n 
A 1 164 SER 164 205 205 SER SER A . n 
A 1 165 MET 165 206 206 MET MET A . n 
A 1 166 ARG 166 207 207 ARG ARG A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-03-21 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-02-23 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2            
2 4 'Structure model' pdbx_nmr_spectrometer 
3 4 'Structure model' pdbx_struct_assembly  
4 4 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_pdbx_nmr_spectrometer.model'        
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 4   ? ? 65.43   -78.91  
2  1 ARG A 6   ? ? -179.88 126.26  
3  1 THR A 7   ? ? -177.52 58.70   
4  1 ASP A 10  ? ? 63.13   62.91   
5  1 TYR A 28  ? ? -47.21  106.11  
6  1 TRP A 30  ? ? -96.38  -66.27  
7  1 ALA A 32  ? ? 75.77   -58.70  
8  1 VAL A 36  ? ? 178.95  107.83  
9  1 PRO A 44  ? ? -59.75  82.04   
10 1 SER A 49  ? ? -147.25 38.10   
11 1 TYR A 108 ? ? -78.95  -70.05  
12 1 PHE A 112 ? ? 68.54   -84.95  
13 1 HIS A 120 ? ? -67.38  -123.10 
14 1 LEU A 121 ? ? 179.06  98.07   
15 1 THR A 122 ? ? 167.37  164.50  
16 1 THR A 125 ? ? -128.17 -56.22  
17 1 ASP A 140 ? ? -106.95 76.38   
18 1 ARG A 183 ? ? -65.89  -73.51  
19 1 PRO A 204 ? ? -57.86  -158.80 
20 1 SER A 205 ? ? -118.26 79.10   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1 ? A MET 1 
2 1 Y 1 A ALA 2 ? A ALA 2 
#