data_1G7B
# 
_entry.id   1G7B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.318 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1G7B         
RCSB  RCSB012323   
WWPDB D_1000012323 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1g7a '1.2 A Structure of T3R3 Human Insulin at 100 K'     unspecified 
PDB 1trz 'Room Temperature Structure of T3R3 Human Insulin'   unspecified 
PDB 1tci 'Room Temperature Structure of T3R3 Porcine Insulin' unspecified 
PDB 1zni 'Room Temperature Structure of T3R3 Porcine Insulin' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1G7B 
_pdbx_database_status.recvd_initial_deposition_date   2000-11-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Smith, G.D.'    1 
'Pangborn, W.A.' 2 
'Blessing, R.H.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Phase changes in T(3)R(3)(f) human insulin: temperature or pressure induced?' 'Acta Crystallogr.,Sect.D' 57  1091  1100  
2001 ABCRE6 DK 0907-4449 0766 ? 11468392 10.1107/S0907444901007685 
1       
;X-ray Crystallographic Studies on Hexameric Insulins in the Presence of Helix-Stabilizing Agents, Thiocyanate, Methylparaben, and Phenol
;
Biochemistry               34  15553 15563 1995 BICHAW US 0006-2960 0033 ? ?        ?                         
2       'Crystallographic Evidence for Dual Coordination around Zinc in the T3R3 Human Insulin Hexamer' Biochemistry               
33  1512  1517  1994 BICHAW US 0006-2960 0033 ? ?        ?                         
3       'Structural stability in the 4-zinc human insulin hexamer' Proc.Natl.Acad.Sci.USA     81  7093  7097  1984 PNASA6 US 
0027-8424 0040 ? ?        ?                         
4       'Structure of 4-zinc insulin' Nature                     261 166   168   1976 NATUAS UK 0028-0836 0006 ? ?        ? 
5       
;The First Protein Crystal Structure Determined from High Resolution X-Ray Powder Diffraction Data: A Variant of T3R3 Human Insulin Zinc Complex Produced by Grinding
;
'Acta Crystallogr.,Sect.D' 56  1549  ?     2000 ABCRE6 DK 0907-4449 0766 ? ?        10.1107/S0907444900013901 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Smith, G.D.'       1  ? 
primary 'Pangborn, W.A.'    2  ? 
primary 'Blessing, R.H.'    3  ? 
1       'Whittingham, J.L.' 4  ? 
1       'Chaudhuri, S.'     5  ? 
1       'Dodson, E.J.'      6  ? 
1       'Moody, P.C.E.'     7  ? 
1       'Dodson, G.G.'      8  ? 
2       'Ciszak, E.'        9  ? 
2       'Smith, G.D.'       10 ? 
3       'Smith, G.D.'       11 ? 
3       'Swenson, D.C.'     12 ? 
3       'Dodson, E.J.'      13 ? 
3       'Dodson, G.G.'      14 ? 
3       'Reynolds, C.D.'    15 ? 
4       'Bentley, G.'       16 ? 
4       'Dodson, E.'        17 ? 
4       'Dodson, G.G.'      18 ? 
4       'Hodgkin, D.'       19 ? 
4       'Mercola, D.'       20 ? 
5       'Von Dreele, R.B.'  21 ? 
5       'Stephens, P.W.'    22 ? 
5       'Smith, G.D.'       23 ? 
5       'Blessing, R.H.'    24 ? 
# 
_cell.entry_id           1G7B 
_cell.length_a           80.050 
_cell.length_b           80.050 
_cell.length_c           71.459 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              36 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1G7B 
_symmetry.space_group_name_H-M             'H 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     rhombohedral 
_symmetry.Int_Tables_number                146 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'INSULIN A-CHAIN' 2383.698 4   ? ? A-CHAIN ? 
2 polymer     syn 'INSULIN B-CHAIN' 3433.953 4   ? ? B-CHAIN ? 
3 non-polymer syn 'ZINC ION'        65.409   7   ? ? ?       ? 
4 non-polymer syn 'CHLORIDE ION'    35.453   7   ? ? ?       ? 
5 non-polymer syn GLYCEROL          92.094   1   ? ? ?       ? 
6 non-polymer syn ACETONE           58.079   1   ? ? ?       ? 
7 water       nat water             18.015   212 ? ? ?       ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCN          GIVEQCCTSICSLYQLENYCN          A,C,E,G ? 
2 'polypeptide(L)' no no FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFFYTPKT B,D,F,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ILE n 
1 3  VAL n 
1 4  GLU n 
1 5  GLN n 
1 6  CYS n 
1 7  CYS n 
1 8  THR n 
1 9  SER n 
1 10 ILE n 
1 11 CYS n 
1 12 SER n 
1 13 LEU n 
1 14 TYR n 
1 15 GLN n 
1 16 LEU n 
1 17 GLU n 
1 18 ASN n 
1 19 TYR n 
1 20 CYS n 
1 21 ASN n 
2 1  PHE n 
2 2  VAL n 
2 3  ASN n 
2 4  GLN n 
2 5  HIS n 
2 6  LEU n 
2 7  CYS n 
2 8  GLY n 
2 9  SER n 
2 10 HIS n 
2 11 LEU n 
2 12 VAL n 
2 13 GLU n 
2 14 ALA n 
2 15 LEU n 
2 16 TYR n 
2 17 LEU n 
2 18 VAL n 
2 19 CYS n 
2 20 GLY n 
2 21 GLU n 
2 22 ARG n 
2 23 GLY n 
2 24 PHE n 
2 25 PHE n 
2 26 TYR n 
2 27 THR n 
2 28 PRO n 
2 29 LYS n 
2 30 THR n 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? ? ? ? 'This sequence occurs naturally in homo sapiens (Human)' 
2 1 sample ? ? ? ? ? 'This sequence occurs naturally in homo sapiens (Human)' 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 1 UNP INS_HUMAN P01308 87 GIVEQCCTSICSLYQLENYCN          ? 
2 2 UNP INS_HUMAN P01308 25 FVNQHLCGSHLVEALYLVCGERGFFYTPKT ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1G7B A 1 ? 21 ? P01308 87 ? 107 ? 1 21 
2 1 1G7B C 1 ? 21 ? P01308 87 ? 107 ? 1 21 
3 1 1G7B E 1 ? 21 ? P01308 87 ? 107 ? 1 21 
4 1 1G7B G 1 ? 21 ? P01308 87 ? 107 ? 1 21 
5 2 1G7B B 1 ? 30 ? P01308 25 ? 54  ? 1 30 
6 2 1G7B D 1 ? 30 ? P01308 25 ? 54  ? 1 30 
7 2 1G7B F 1 ? 30 ? P01308 25 ? 54  ? 1 30 
8 2 1G7B H 1 ? 30 ? P01308 25 ? 54  ? 1 30 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACN non-polymer         . ACETONE         ?                               'C3 H6 O'        58.079  
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
CL  non-polymer         . 'CHLORIDE ION'  ?                               'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ?                               'Zn 2'           65.409  
# 
_exptl.entry_id          1G7B 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.89 
_exptl_crystal.density_percent_sol   35.03 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'SLOW COOLING' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.3 
_exptl_crystal_grow.pdbx_details    
;5 mg/ml human insulin, 0.01 M HCl, 0.007 M zinc acetate, 0.05 M sodium citrate, 
17% acetone, 1.0 M NaCl. pH 6.3, SLOW COOLING at 298K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   1999-03-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Silicon 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X8C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X8C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.8000 
# 
_reflns.entry_id                     1G7B 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             31.8 
_reflns.d_resolution_high            1.3 
_reflns.number_obs                   41901 
_reflns.number_all                   41901 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        48.8 
_reflns.B_iso_Wilson_estimate        19.4 
_reflns.pdbx_redundancy              12.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.30 
_reflns_shell.d_res_low              1.33 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.393 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    8.6 
_reflns_shell.pdbx_redundancy        7.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2792 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1G7B 
_refine.ls_number_reflns_obs                     41901 
_refine.ls_number_reflns_all                     41901 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             31.8 
_refine.ls_d_res_high                            1.3 
_refine.ls_percent_reflns_obs                    100 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.176 
_refine.ls_R_factor_R_free                       0.204 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10 
_refine.ls_number_reflns_R_free                  4231 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               18.2 
_refine.aniso_B[1][1]                            -0.50 
_refine.aniso_B[2][2]                            -0.50 
_refine.aniso_B[3][3]                            1.01 
_refine.aniso_B[1][2]                            0.18 
_refine.aniso_B[1][3]                            0 
_refine.aniso_B[2][3]                            0 
_refine.solvent_model_details                    'flat model' 
_refine.solvent_model_param_ksol                 0.42 
_refine.solvent_model_param_bsol                 55.0 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1trz' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Restrained 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1G7B 
_refine_analyze.Luzzati_coordinate_error_obs    0.13 
_refine_analyze.Luzzati_sigma_a_obs             0.08 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.15 
_refine_analyze.Luzzati_sigma_a_free            0.09 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1573 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         24 
_refine_hist.number_atoms_solvent             212 
_refine_hist.number_atoms_total               1809 
_refine_hist.d_res_high                       1.3 
_refine_hist.d_res_low                        31.8 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.010 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.92  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 20.4  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.89  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.87  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.66  2.50 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.16  2.50 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.73  3.00 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.30 
_refine_ls_shell.d_res_low                        1.38 
_refine_ls_shell.number_reflns_R_work             6219 
_refine_ls_shell.R_factor_R_work                  0.209 
_refine_ls_shell.percent_reflns_obs               100 
_refine_ls_shell.R_factor_R_free                  0.236 
_refine_ls_shell.R_factor_R_free_error            0.009 
_refine_ls_shell.percent_reflns_R_free            11.1 
_refine_ls_shell.number_reflns_R_free             688 
_refine_ls_shell.number_reflns_obs                6219 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1G7B 
_struct.title                     '1.3 A STRUCTURE OF T3R3 HUMAN INSULIN AT 100 K' 
_struct.pdbx_descriptor           INSULIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1G7B 
_struct_keywords.pdbx_keywords   'hormone/growth factor' 
_struct_keywords.text            'T3R3 Human Insulin Hexamer, hormone-growth factor COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 1 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 3 ? 
K  N N 3 ? 
L  N N 4 ? 
M  N N 3 ? 
N  N N 3 ? 
O  N N 4 ? 
P  N N 4 ? 
Q  N N 4 ? 
R  N N 4 ? 
S  N N 3 ? 
T  N N 4 ? 
U  N N 5 ? 
V  N N 6 ? 
W  N N 3 ? 
X  N N 4 ? 
Y  N N 7 ? 
Z  N N 7 ? 
AA N N 7 ? 
BA N N 7 ? 
CA N N 7 ? 
DA N N 7 ? 
EA N N 7 ? 
FA N N 7 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'The second dimer of the T3R3 insulin hexamer is generated by the crystallographic three-fold axis: -y, x-y, z' ? 
2 'The third dimer of the T3R3 insulin hexamer is generated by the crystallographic three-fold axis: y-x, -x, z'  ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 1  ? CYS A 7  ? GLY A 1  CYS A 7  1 ? 7  
HELX_P HELX_P2  2  SER A 12 ? GLU A 17 ? SER A 12 GLU A 17 1 ? 6  
HELX_P HELX_P3  3  CYS B 7  ? GLY B 20 ? CYS B 7  GLY B 20 1 ? 14 
HELX_P HELX_P4  4  GLU B 21 ? GLY B 23 ? GLU B 21 GLY B 23 5 ? 3  
HELX_P HELX_P5  5  GLY C 1  ? CYS C 7  ? GLY C 1  CYS C 7  1 ? 7  
HELX_P HELX_P6  6  SER C 12 ? GLU C 17 ? SER C 12 GLU C 17 1 ? 6  
HELX_P HELX_P7  7  ASN D 3  ? GLY D 20 ? ASN D 3  GLY D 20 1 ? 18 
HELX_P HELX_P8  8  GLU D 21 ? GLY D 23 ? GLU D 21 GLY D 23 5 ? 3  
HELX_P HELX_P9  9  GLY E 1  ? CYS E 7  ? GLY E 1  CYS E 7  1 ? 7  
HELX_P HELX_P10 10 SER E 12 ? GLU E 17 ? SER E 12 GLU E 17 1 ? 6  
HELX_P HELX_P11 11 CYS F 7  ? GLY F 20 ? CYS F 7  GLY F 20 1 ? 14 
HELX_P HELX_P12 12 GLU F 21 ? GLY F 23 ? GLU F 21 GLY F 23 5 ? 3  
HELX_P HELX_P13 13 GLY G 1  ? CYS G 7  ? GLY G 1  CYS G 7  1 ? 7  
HELX_P HELX_P14 14 SER G 12 ? GLU G 17 ? SER G 12 GLU G 17 1 ? 6  
HELX_P HELX_P15 15 ASN H 3  ? GLY H 20 ? ASN H 3  GLY H 20 1 ? 18 
HELX_P HELX_P16 16 GLU H 21 ? GLY H 23 ? GLU H 21 GLY H 23 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 6  SG  ? ? ? 1_555 A  CYS 11 SG ? ? A CYS 6   A CYS 11   1_555 ? ? ? ? ? ? ? 2.005 ? 
disulf2  disulf ? ? A CYS 7  SG  ? ? ? 1_555 B  CYS 7  SG ? ? A CYS 7   B CYS 7    1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf3  disulf ? ? A CYS 20 SG  ? ? ? 1_555 B  CYS 19 SG ? ? A CYS 20  B CYS 19   1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf4  disulf ? ? C CYS 6  SG  ? ? ? 1_555 C  CYS 11 SG ? ? C CYS 6   C CYS 11   1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf5  disulf ? ? C CYS 7  SG  ? ? ? 1_555 D  CYS 7  SG ? ? C CYS 7   D CYS 7    1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf6  disulf ? ? C CYS 20 SG  ? ? ? 1_555 D  CYS 19 SG ? ? C CYS 20  D CYS 19   1_555 ? ? ? ? ? ? ? 2.016 ? 
disulf7  disulf ? ? E CYS 6  SG  ? ? ? 1_555 E  CYS 11 SG ? ? E CYS 6   E CYS 11   1_555 ? ? ? ? ? ? ? 1.974 ? 
disulf8  disulf ? ? E CYS 7  SG  ? ? ? 1_555 F  CYS 7  SG ? ? E CYS 7   F CYS 7    1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf9  disulf ? ? E CYS 20 SG  ? ? ? 1_555 F  CYS 19 SG ? ? E CYS 20  F CYS 19   1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf10 disulf ? ? G CYS 6  SG  ? ? ? 1_555 G  CYS 11 SG ? ? G CYS 6   G CYS 11   1_555 ? ? ? ? ? ? ? 2.010 ? 
disulf11 disulf ? ? G CYS 7  SG  ? ? ? 1_555 H  CYS 7  SG ? ? G CYS 7   H CYS 7    1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf12 disulf ? ? G CYS 20 SG  ? ? ? 1_555 H  CYS 19 SG ? ? G CYS 20  H CYS 19   1_555 ? ? ? ? ? ? ? 2.017 ? 
metalc1  metalc ? ? B HIS 5  ND1 B ? ? 1_555 K  ZN  .  ZN ? ? B HIS 5   B ZN  961  1_555 ? ? ? ? ? ? ? 1.917 ? 
metalc2  metalc ? ? B HIS 5  NE2 A ? ? 1_555 J  ZN  .  ZN ? ? B HIS 5   B ZN  951  1_555 ? ? ? ? ? ? ? 1.903 ? 
metalc3  metalc ? ? B HIS 5  NE2 B ? ? 1_555 J  ZN  .  ZN ? ? B HIS 5   B ZN  951  1_555 ? ? ? ? ? ? ? 2.345 ? 
metalc4  metalc ? ? B HIS 10 NE2 ? ? ? 1_555 I  ZN  .  ZN ? ? B HIS 10  B ZN  901  1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc5  metalc ? ? D HIS 10 NE2 A ? ? 1_555 N  ZN  .  ZN ? ? D HIS 10  D ZN  921  1_555 ? ? ? ? ? ? ? 2.003 ? 
metalc6  metalc ? ? D HIS 10 NE2 B ? ? 1_555 M  ZN  .  ZN ? ? D HIS 10  D ZN  911  1_555 ? ? ? ? ? ? ? 2.008 ? 
metalc7  metalc ? ? F HIS 10 NE2 ? ? ? 1_555 S  ZN  .  ZN ? ? F HIS 10  F ZN  931  1_555 ? ? ? ? ? ? ? 1.983 ? 
metalc8  metalc ? ? H HIS 10 NE2 ? ? ? 1_555 W  ZN  .  ZN ? ? H HIS 10  H ZN  941  1_555 ? ? ? ? ? ? ? 1.926 ? 
metalc9  metalc ? ? J ZN  .  ZN  ? ? ? 1_555 Z  HOH .  O  ? ? B ZN  951 B HOH 952  1_555 ? ? ? ? ? ? ? 2.422 ? 
metalc10 metalc ? ? J ZN  .  ZN  ? ? ? 1_555 Z  HOH .  O  ? ? B ZN  951 B HOH 953  1_555 ? ? ? ? ? ? ? 2.548 ? 
metalc11 metalc ? ? K ZN  .  ZN  ? ? ? 1_555 Z  HOH .  O  ? ? B ZN  961 B HOH 962  1_555 ? ? ? ? ? ? ? 1.837 ? 
metalc12 metalc ? ? K ZN  .  ZN  ? ? ? 1_555 Z  HOH .  O  ? ? B ZN  961 B HOH 963  1_555 ? ? ? ? ? ? ? 2.160 ? 
metalc13 metalc ? ? K ZN  .  ZN  ? ? ? 1_555 Z  HOH .  O  ? ? B ZN  961 B HOH 964  1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc14 metalc ? ? K ZN  .  ZN  ? ? ? 1_555 Z  HOH .  O  ? ? B ZN  961 B HOH 1811 1_555 ? ? ? ? ? ? ? 2.436 ? 
metalc15 metalc ? ? K ZN  .  ZN  ? ? ? 1_555 Z  HOH .  O  ? ? B ZN  961 B HOH 1810 1_555 ? ? ? ? ? ? ? 2.644 ? 
metalc16 metalc ? ? M ZN  .  ZN  ? ? ? 1_555 BA HOH .  O  ? ? D ZN  911 D HOH 971  1_555 ? ? ? ? ? ? ? 2.449 ? 
metalc17 metalc ? ? S ZN  .  ZN  ? ? ? 1_555 DA HOH .  O  B ? F ZN  931 F HOH 933  1_555 ? ? ? ? ? ? ? 2.436 ? 
metalc18 metalc ? ? B HIS 10 NE2 ? ? ? 1_555 I  ZN  .  ZN ? ? B HIS 10  B ZN  901  2_555 ? ? ? ? ? ? ? 2.031 ? 
metalc19 metalc ? ? D HIS 5  NE2 ? ? ? 1_555 N  ZN  .  ZN ? ? D HIS 5   D ZN  921  3_555 ? ? ? ? ? ? ? 2.030 ? 
metalc20 metalc ? ? D HIS 10 NE2 B ? ? 1_555 M  ZN  .  ZN ? ? D HIS 10  D ZN  911  2_555 ? ? ? ? ? ? ? 2.008 ? 
metalc21 metalc ? ? F HIS 10 NE2 ? ? ? 1_555 S  ZN  .  ZN ? ? F HIS 10  F ZN  931  2_555 ? ? ? ? ? ? ? 1.983 ? 
metalc22 metalc ? ? H HIS 5  NE2 ? ? ? 1_555 J  ZN  .  ZN ? ? H HIS 5   B ZN  951  1_556 ? ? ? ? ? ? ? 1.871 ? 
metalc23 metalc ? ? H HIS 10 NE2 ? ? ? 1_555 W  ZN  .  ZN ? ? H HIS 10  H ZN  941  2_555 ? ? ? ? ? ? ? 1.926 ? 
metalc24 metalc ? ? M ZN  .  ZN  ? ? ? 1_555 BA HOH .  O  ? ? D ZN  911 D HOH 971  2_555 ? ? ? ? ? ? ? 2.449 ? 
metalc25 metalc ? ? S ZN  .  ZN  ? ? ? 1_555 DA HOH .  O  B ? F ZN  931 F HOH 933  3_555 ? ? ? ? ? ? ? 2.436 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE B 24 ? TYR B 26 ? PHE B 24 TYR B 26 
A 2 PHE D 24 ? TYR D 26 ? PHE D 24 TYR D 26 
B 1 PHE F 24 ? TYR F 26 ? PHE F 24 TYR F 26 
B 2 PHE H 24 ? TYR H 26 ? PHE H 24 TYR H 26 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR B 26 ? N TYR B 26 O PHE D 24 ? O PHE D 24 
B 1 2 N TYR F 26 ? N TYR F 26 O PHE H 24 ? O PHE H 24 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE ZN B 901'  
AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE ZN D 911'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 921'  
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE ZN F 931'  
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE ZN H 941'  
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 951'  
AC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ZN B 961'  
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CL B 902'  
AC9 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CL D 912'  
BC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL D 922'  
BC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL D 923'  
BC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CL F 932'  
BC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CL H 942'  
BC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CL E 1101' 
BC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL G 995' 
BC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACN G 991' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  HIS B  10 ? HIS B 10   . ? 1_555 ? 
2   AC1 6  HIS B  10 ? HIS B 10   . ? 2_555 ? 
3   AC1 6  HIS B  10 ? HIS B 10   . ? 3_555 ? 
4   AC1 6  CL  L  .  ? CL  B 902  . ? 2_555 ? 
5   AC1 6  CL  L  .  ? CL  B 902  . ? 3_555 ? 
6   AC1 6  CL  L  .  ? CL  B 902  . ? 1_555 ? 
7   AC2 12 HIS D  10 ? HIS D 10   . ? 1_555 ? 
8   AC2 12 HIS D  10 ? HIS D 10   . ? 3_555 ? 
9   AC2 12 HIS D  10 ? HIS D 10   . ? 2_555 ? 
10  AC2 12 CL  O  .  ? CL  D 912  . ? 1_555 ? 
11  AC2 12 CL  O  .  ? CL  D 912  . ? 3_555 ? 
12  AC2 12 CL  O  .  ? CL  D 912  . ? 2_555 ? 
13  AC2 12 HOH BA .  ? HOH D 971  . ? 3_555 ? 
14  AC2 12 HOH BA .  ? HOH D 971  . ? 2_555 ? 
15  AC2 12 HOH BA .  ? HOH D 971  . ? 1_555 ? 
16  AC2 12 HOH BA .  ? HOH D 1814 . ? 2_555 ? 
17  AC2 12 HOH BA .  ? HOH D 1814 . ? 3_555 ? 
18  AC2 12 HOH BA .  ? HOH D 1814 . ? 1_555 ? 
19  AC3 4  HIS D  5  ? HIS D 5    . ? 2_555 ? 
20  AC3 4  HIS D  10 ? HIS D 10   . ? 1_555 ? 
21  AC3 4  CL  P  .  ? CL  D 922  . ? 1_555 ? 
22  AC3 4  CL  Q  .  ? CL  D 923  . ? 1_555 ? 
23  AC4 9  HIS F  10 ? HIS F 10   . ? 2_555 ? 
24  AC4 9  HIS F  10 ? HIS F 10   . ? 1_555 ? 
25  AC4 9  HIS F  10 ? HIS F 10   . ? 3_555 ? 
26  AC4 9  CL  T  .  ? CL  F 932  . ? 3_555 ? 
27  AC4 9  CL  T  .  ? CL  F 932  . ? 1_555 ? 
28  AC4 9  CL  T  .  ? CL  F 932  . ? 2_555 ? 
29  AC4 9  HOH DA .  ? HOH F 933  . ? 1_555 ? 
30  AC4 9  HOH DA .  ? HOH F 933  . ? 3_555 ? 
31  AC4 9  HOH DA .  ? HOH F 933  . ? 2_555 ? 
32  AC5 6  HIS H  10 ? HIS H 10   . ? 1_555 ? 
33  AC5 6  HIS H  10 ? HIS H 10   . ? 3_555 ? 
34  AC5 6  HIS H  10 ? HIS H 10   . ? 2_555 ? 
35  AC5 6  CL  X  .  ? CL  H 942  . ? 2_555 ? 
36  AC5 6  CL  X  .  ? CL  H 942  . ? 3_555 ? 
37  AC5 6  CL  X  .  ? CL  H 942  . ? 1_555 ? 
38  AC6 4  HIS B  5  ? HIS B 5    . ? 1_555 ? 
39  AC6 4  HOH Z  .  ? HOH B 952  . ? 1_555 ? 
40  AC6 4  HOH Z  .  ? HOH B 953  . ? 1_555 ? 
41  AC6 4  HIS H  5  ? HIS H 5    . ? 1_554 ? 
42  AC7 7  HIS B  5  ? HIS B 5    . ? 1_555 ? 
43  AC7 7  HOH Z  .  ? HOH B 962  . ? 1_555 ? 
44  AC7 7  HOH Z  .  ? HOH B 963  . ? 1_555 ? 
45  AC7 7  HOH Z  .  ? HOH B 964  . ? 1_555 ? 
46  AC7 7  HOH Z  .  ? HOH B 1810 . ? 1_555 ? 
47  AC7 7  HOH Z  .  ? HOH B 1811 . ? 1_555 ? 
48  AC7 7  HOH EA .  ? HOH G 1900 . ? 1_555 ? 
49  AC8 6  HIS B  10 ? HIS B 10   . ? 1_555 ? 
50  AC8 6  HIS B  10 ? HIS B 10   . ? 2_555 ? 
51  AC8 6  HIS B  10 ? HIS B 10   . ? 3_555 ? 
52  AC8 6  ZN  I  .  ? ZN  B 901  . ? 2_555 ? 
53  AC8 6  ZN  I  .  ? ZN  B 901  . ? 3_555 ? 
54  AC8 6  ZN  I  .  ? ZN  B 901  . ? 1_555 ? 
55  AC9 12 LEU D  6  ? LEU D 6    . ? 2_555 ? 
56  AC9 12 LEU D  6  ? LEU D 6    . ? 1_555 ? 
57  AC9 12 LEU D  6  ? LEU D 6    . ? 3_555 ? 
58  AC9 12 HIS D  10 ? HIS D 10   . ? 2_555 ? 
59  AC9 12 HIS D  10 ? HIS D 10   . ? 3_555 ? 
60  AC9 12 HIS D  10 ? HIS D 10   . ? 1_555 ? 
61  AC9 12 ZN  M  .  ? ZN  D 911  . ? 2_555 ? 
62  AC9 12 ZN  M  .  ? ZN  D 911  . ? 3_555 ? 
63  AC9 12 ZN  M  .  ? ZN  D 911  . ? 1_555 ? 
64  AC9 12 HOH BA .  ? HOH D 1814 . ? 2_555 ? 
65  AC9 12 HOH BA .  ? HOH D 1814 . ? 3_555 ? 
66  AC9 12 HOH BA .  ? HOH D 1814 . ? 1_555 ? 
67  BC1 3  HIS D  5  ? HIS D 5    . ? 2_555 ? 
68  BC1 3  HIS D  10 ? HIS D 10   . ? 1_555 ? 
69  BC1 3  ZN  N  .  ? ZN  D 921  . ? 1_555 ? 
70  BC2 4  LEU B  17 ? LEU B 17   . ? 2_555 ? 
71  BC2 4  HIS D  5  ? HIS D 5    . ? 2_555 ? 
72  BC2 4  HIS D  10 ? HIS D 10   . ? 1_555 ? 
73  BC2 4  ZN  N  .  ? ZN  D 921  . ? 1_555 ? 
74  BC3 12 HOH BA .  ? HOH D 1803 . ? 1_555 ? 
75  BC3 12 HOH BA .  ? HOH D 1803 . ? 2_555 ? 
76  BC3 12 HOH BA .  ? HOH D 1803 . ? 3_555 ? 
77  BC3 12 HIS F  10 ? HIS F 10   . ? 1_555 ? 
78  BC3 12 HIS F  10 ? HIS F 10   . ? 2_555 ? 
79  BC3 12 HIS F  10 ? HIS F 10   . ? 3_555 ? 
80  BC3 12 ZN  S  .  ? ZN  F 931  . ? 1_555 ? 
81  BC3 12 ZN  S  .  ? ZN  F 931  . ? 2_555 ? 
82  BC3 12 ZN  S  .  ? ZN  F 931  . ? 3_555 ? 
83  BC3 12 HOH DA .  ? HOH F 933  . ? 1_555 ? 
84  BC3 12 HOH DA .  ? HOH F 933  . ? 3_555 ? 
85  BC3 12 HOH DA .  ? HOH F 933  . ? 2_555 ? 
86  BC4 9  LEU H  6  ? LEU H 6    . ? 2_555 ? 
87  BC4 9  LEU H  6  ? LEU H 6    . ? 1_555 ? 
88  BC4 9  LEU H  6  ? LEU H 6    . ? 3_555 ? 
89  BC4 9  HIS H  10 ? HIS H 10   . ? 2_555 ? 
90  BC4 9  HIS H  10 ? HIS H 10   . ? 3_555 ? 
91  BC4 9  HIS H  10 ? HIS H 10   . ? 1_555 ? 
92  BC4 9  ZN  W  .  ? ZN  H 941  . ? 2_555 ? 
93  BC4 9  ZN  W  .  ? ZN  H 941  . ? 3_555 ? 
94  BC4 9  ZN  W  .  ? ZN  H 941  . ? 1_555 ? 
95  BC5 6  GLY E  1  ? GLY E 1    . ? 1_555 ? 
96  BC5 6  ILE E  2  ? ILE E 2    . ? 1_555 ? 
97  BC5 6  VAL E  3  ? VAL E 3    . ? 1_555 ? 
98  BC5 6  GLU E  4  ? GLU E 4    . ? 1_555 ? 
99  BC5 6  LYS F  29 ? LYS F 29   . ? 1_555 ? 
100 BC5 6  THR F  30 ? THR F 30   . ? 1_555 ? 
101 BC6 6  CYS G  11 ? CYS G 11   . ? 1_555 ? 
102 BC6 6  LEU G  16 ? LEU G 16   . ? 1_555 ? 
103 BC6 6  HOH EA .  ? HOH G 1866 . ? 1_555 ? 
104 BC6 6  HOH EA .  ? HOH G 1866 . ? 2_555 ? 
105 BC6 6  HOH EA .  ? HOH G 2141 . ? 1_555 ? 
106 BC6 6  CYS H  7  ? CYS H 7    . ? 1_555 ? 
107 BC7 4  PHE F  1  ? PHE F 1    . ? 2_555 ? 
108 BC7 4  HOH DA .  ? HOH F 1127 . ? 2_555 ? 
109 BC7 4  LEU G  13 ? LEU G 13   . ? 1_555 ? 
110 BC7 4  TYR G  14 ? TYR G 14   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1G7B 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1G7B 
_atom_sites.fract_transf_matrix[1][1]   0.012492 
_atom_sites.fract_transf_matrix[1][2]   0.007212 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014425 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013994 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . GLY A  1 1  ? -19.474 8.813   4.786  1.00 18.60 ? 1    GLY A N    1 
ATOM   2    C  CA   . GLY A  1 1  ? -18.962 8.180   6.025  1.00 16.03 ? 1    GLY A CA   1 
ATOM   3    C  C    . GLY A  1 1  ? -17.485 8.439   6.207  1.00 15.39 ? 1    GLY A C    1 
ATOM   4    O  O    . GLY A  1 1  ? -16.830 9.024   5.347  1.00 15.46 ? 1    GLY A O    1 
ATOM   5    H  H1   . GLY A  1 1  ? -20.486 8.620   4.652  1.00 20.03 ? 1    GLY A H1   1 
ATOM   6    H  H2   . GLY A  1 1  ? -18.936 8.403   3.985  1.00 18.57 ? 1    GLY A H2   1 
ATOM   7    H  H3   . GLY A  1 1  ? -19.309 9.842   4.796  1.00 18.09 ? 1    GLY A H3   1 
ATOM   8    H  HA2  . GLY A  1 1  ? -19.484 8.616   6.871  1.00 16.21 ? 1    GLY A HA2  1 
ATOM   9    H  HA3  . GLY A  1 1  ? -19.115 7.112   6.015  1.00 17.69 ? 1    GLY A HA3  1 
ATOM   10   N  N    . ILE A  1 2  ? -16.948 7.974   7.335  1.00 14.54 ? 2    ILE A N    1 
ATOM   11   C  CA   . ILE A  1 2  ? -15.554 8.218   7.656  1.00 13.52 ? 2    ILE A CA   1 
ATOM   12   C  C    . ILE A  1 2  ? -14.539 7.601   6.680  1.00 12.17 ? 2    ILE A C    1 
ATOM   13   O  O    . ILE A  1 2  ? -13.499 8.172   6.469  1.00 13.48 ? 2    ILE A O    1 
ATOM   14   C  CB   . ILE A  1 2  ? -15.268 7.769   9.125  1.00 15.19 ? 2    ILE A CB   1 
ATOM   15   C  CG1  . ILE A  1 2  ? -13.980 8.389   9.618  1.00 13.10 ? 2    ILE A CG1  1 
ATOM   16   C  CG2  . ILE A  1 2  ? -15.201 6.238   9.221  1.00 16.08 ? 2    ILE A CG2  1 
ATOM   17   C  CD1  . ILE A  1 2  ? -13.730 8.133   11.057 1.00 14.66 ? 2    ILE A CD1  1 
ATOM   18   H  H    . ILE A  1 2  ? -17.508 7.434   7.922  1.00 15.72 ? 2    ILE A H    1 
ATOM   19   H  HA   . ILE A  1 2  ? -15.349 9.270   7.612  1.00 13.65 ? 2    ILE A HA   1 
ATOM   20   H  HB   . ILE A  1 2  ? -16.085 8.114   9.739  1.00 15.79 ? 2    ILE A HB   1 
ATOM   21   H  HG12 . ILE A  1 2  ? -13.144 7.949   9.111  1.00 14.96 ? 2    ILE A HG12 1 
ATOM   22   H  HG13 . ILE A  1 2  ? -13.935 9.452   9.475  1.00 15.61 ? 2    ILE A HG13 1 
ATOM   23   H  HG21 . ILE A  1 2  ? -15.357 5.943   10.242 1.00 16.03 ? 2    ILE A HG21 1 
ATOM   24   H  HG22 . ILE A  1 2  ? -15.968 5.788   8.627  1.00 16.34 ? 2    ILE A HG22 1 
ATOM   25   H  HG23 . ILE A  1 2  ? -14.228 5.895   8.918  1.00 15.98 ? 2    ILE A HG23 1 
ATOM   26   H  HD11 . ILE A  1 2  ? -14.701 8.142   11.527 1.00 13.94 ? 2    ILE A HD11 1 
ATOM   27   H  HD12 . ILE A  1 2  ? -13.062 8.868   11.439 1.00 13.46 ? 2    ILE A HD12 1 
ATOM   28   H  HD13 . ILE A  1 2  ? -13.307 7.146   11.137 1.00 14.05 ? 2    ILE A HD13 1 
ATOM   29   N  N    . VAL A  1 3  ? -14.844 6.449   6.100  1.00 14.84 ? 3    VAL A N    1 
ATOM   30   C  CA   . VAL A  1 3  ? -13.876 5.838   5.193  1.00 14.72 ? 3    VAL A CA   1 
ATOM   31   C  C    . VAL A  1 3  ? -13.682 6.717   3.939  1.00 16.24 ? 3    VAL A C    1 
ATOM   32   O  O    . VAL A  1 3  ? -12.567 7.012   3.544  1.00 17.31 ? 3    VAL A O    1 
ATOM   33   C  CB   . VAL A  1 3  ? -14.290 4.405   4.807  1.00 15.70 ? 3    VAL A CB   1 
ATOM   34   C  CG1  . VAL A  1 3  ? -13.364 3.868   3.695  1.00 16.95 ? 3    VAL A CG1  1 
ATOM   35   C  CG2  . VAL A  1 3  ? -14.206 3.500   6.033  1.00 17.10 ? 3    VAL A CG2  1 
ATOM   36   H  H    . VAL A  1 3  ? -15.736 6.080   6.228  1.00 12.60 ? 3    VAL A H    1 
ATOM   37   H  HA   . VAL A  1 3  ? -12.924 5.820   5.692  1.00 13.52 ? 3    VAL A HA   1 
ATOM   38   H  HB   . VAL A  1 3  ? -15.303 4.415   4.453  1.00 15.54 ? 3    VAL A HB   1 
ATOM   39   H  HG11 . VAL A  1 3  ? -12.325 3.891   3.973  1.00 16.05 ? 3    VAL A HG11 1 
ATOM   40   H  HG12 . VAL A  1 3  ? -13.669 2.849   3.486  1.00 17.86 ? 3    VAL A HG12 1 
ATOM   41   H  HG13 . VAL A  1 3  ? -13.519 4.450   2.799  1.00 17.71 ? 3    VAL A HG13 1 
ATOM   42   H  HG21 . VAL A  1 3  ? -14.364 2.471   5.753  1.00 18.30 ? 3    VAL A HG21 1 
ATOM   43   H  HG22 . VAL A  1 3  ? -13.237 3.599   6.512  1.00 15.99 ? 3    VAL A HG22 1 
ATOM   44   H  HG23 . VAL A  1 3  ? -14.987 3.791   6.720  1.00 18.29 ? 3    VAL A HG23 1 
ATOM   45   N  N    . GLU A  1 4  ? -14.786 7.147   3.342  1.00 16.39 ? 4    GLU A N    1 
ATOM   46   C  CA   . GLU A  1 4  ? -14.730 7.997   2.172  1.00 19.04 ? 4    GLU A CA   1 
ATOM   47   C  C    . GLU A  1 4  ? -14.041 9.324   2.492  1.00 19.11 ? 4    GLU A C    1 
ATOM   48   O  O    . GLU A  1 4  ? -13.265 9.833   1.692  1.00 19.62 ? 4    GLU A O    1 
ATOM   49   C  CB   . GLU A  1 4  ? -16.148 8.285   1.664  1.00 22.67 ? 4    GLU A CB   1 
ATOM   50   C  CG   . GLU A  1 4  ? -16.978 7.052   1.286  1.00 27.50 ? 4    GLU A CG   1 
ATOM   51   C  CD   . GLU A  1 4  ? -17.193 6.062   2.433  1.00 31.00 ? 4    GLU A CD   1 
ATOM   52   O  OE1  . GLU A  1 4  ? -17.522 6.485   3.558  1.00 29.88 ? 4    GLU A OE1  1 
ATOM   53   O  OE2  . GLU A  1 4  ? -17.060 4.844   2.208  1.00 40.88 ? 4    GLU A OE2  1 
ATOM   54   H  H    . GLU A  1 4  ? -15.644 6.857   3.708  1.00 18.07 ? 4    GLU A H    1 
ATOM   55   H  HA   . GLU A  1 4  ? -14.191 7.462   1.408  1.00 19.53 ? 4    GLU A HA   1 
ATOM   56   H  HB2  . GLU A  1 4  ? -16.665 8.848   2.421  1.00 21.89 ? 4    GLU A HB2  1 
ATOM   57   H  HB3  . GLU A  1 4  ? -16.028 8.911   0.787  1.00 22.15 ? 4    GLU A HB3  1 
ATOM   58   H  HG2  . GLU A  1 4  ? -17.934 7.360   0.897  1.00 27.44 ? 4    GLU A HG2  1 
ATOM   59   H  HG3  . GLU A  1 4  ? -16.448 6.560   0.505  1.00 27.19 ? 4    GLU A HG3  1 
ATOM   60   N  N    . GLN A  1 5  ? -14.325 9.898   3.657  1.00 17.33 ? 5    GLN A N    1 
ATOM   61   C  CA   . GLN A  1 5  ? -13.733 11.185  4.003  1.00 16.10 ? 5    GLN A CA   1 
ATOM   62   C  C    . GLN A  1 5  ? -12.275 11.158  4.441  1.00 15.61 ? 5    GLN A C    1 
ATOM   63   O  O    . GLN A  1 5  ? -11.490 11.989  4.006  1.00 16.14 ? 5    GLN A O    1 
ATOM   64   C  CB   . GLN A  1 5  ? -14.528 11.878  5.125  1.00 17.21 ? 5    GLN A CB   1 
ATOM   65   C  CG   . GLN A  1 5  ? -15.920 12.341  4.753  1.00 18.92 ? 5    GLN A CG   1 
ATOM   66   C  CD   . GLN A  1 5  ? -16.428 13.379  5.738  1.00 22.84 ? 5    GLN A CD   1 
ATOM   67   O  OE1  . GLN A  1 5  ? -16.178 13.287  6.930  1.00 22.47 ? 5    GLN A OE1  1 
ATOM   68   N  NE2  . GLN A  1 5  ? -17.150 14.383  5.238  1.00 26.19 ? 5    GLN A NE2  1 
ATOM   69   H  H    . GLN A  1 5  ? -14.969 9.449   4.235  1.00 16.83 ? 5    GLN A H    1 
ATOM   70   H  HA   . GLN A  1 5  ? -13.765 11.856  3.163  1.00 17.01 ? 5    GLN A HA   1 
ATOM   71   H  HB2  . GLN A  1 5  ? -14.632 11.169  5.922  1.00 17.29 ? 5    GLN A HB2  1 
ATOM   72   H  HB3  . GLN A  1 5  ? -13.963 12.730  5.467  1.00 18.25 ? 5    GLN A HB3  1 
ATOM   73   H  HG2  . GLN A  1 5  ? -15.849 12.784  3.767  1.00 19.73 ? 5    GLN A HG2  1 
ATOM   74   H  HG3  . GLN A  1 5  ? -16.616 11.519  4.683  1.00 19.28 ? 5    GLN A HG3  1 
ATOM   75   H  HE21 . GLN A  1 5  ? -17.276 14.349  4.281  1.00 24.16 ? 5    GLN A HE21 1 
ATOM   76   H  HE22 . GLN A  1 5  ? -17.563 15.106  5.772  1.00 23.46 ? 5    GLN A HE22 1 
ATOM   77   N  N    . CYS A  1 6  ? -11.903 10.159  5.246  1.00 14.39 ? 6    CYS A N    1 
ATOM   78   C  CA   . CYS A  1 6  ? -10.589 10.146  5.864  1.00 14.08 ? 6    CYS A CA   1 
ATOM   79   C  C    . CYS A  1 6  ? -9.591  9.056   5.457  1.00 13.72 ? 6    CYS A C    1 
ATOM   80   O  O    . CYS A  1 6  ? -8.413  9.134   5.779  1.00 14.76 ? 6    CYS A O    1 
ATOM   81   C  CB   . CYS A  1 6  ? -10.796 10.062  7.399  1.00 15.65 ? 6    CYS A CB   1 
ATOM   82   S  SG   . CYS A  1 6  ? -11.976 11.255  8.169  1.00 18.51 ? 6    CYS A SG   1 
ATOM   83   H  H    . CYS A  1 6  ? -12.500 9.399   5.370  1.00 15.12 ? 6    CYS A H    1 
ATOM   84   H  HA   . CYS A  1 6  ? -10.081 11.075  5.722  1.00 13.74 ? 6    CYS A HA   1 
ATOM   85   H  HB2  . CYS A  1 6  ? -11.178 9.060   7.565  1.00 16.60 ? 6    CYS A HB2  1 
ATOM   86   H  HB3  . CYS A  1 6  ? -9.833  10.134  7.835  1.00 16.96 ? 6    CYS A HB3  1 
ATOM   87   N  N    . CYS A  1 7  ? -10.097 7.987   4.852  1.00 14.28 ? 7    CYS A N    1 
ATOM   88   C  CA   . CYS A  1 7  ? -9.264  6.891   4.413  1.00 13.63 ? 7    CYS A CA   1 
ATOM   89   C  C    . CYS A  1 7  ? -9.005  6.959   2.905  1.00 16.98 ? 7    CYS A C    1 
ATOM   90   O  O    . CYS A  1 7  ? -7.863  6.925   2.519  1.00 18.03 ? 7    CYS A O    1 
ATOM   91   C  CB   . CYS A  1 7  ? -9.894  5.565   4.826  1.00 13.19 ? 7    CYS A CB   1 
ATOM   92   S  SG   . CYS A  1 7  ? -9.108  4.104   4.089  1.00 16.90 ? 7    CYS A SG   1 
ATOM   93   H  H    . CYS A  1 7  ? -11.059 7.957   4.697  1.00 12.13 ? 7    CYS A H    1 
ATOM   94   H  HA   . CYS A  1 7  ? -8.272  6.943   4.800  1.00 13.56 ? 7    CYS A HA   1 
ATOM   95   H  HB2  . CYS A  1 7  ? -9.821  5.430   5.897  1.00 15.60 ? 7    CYS A HB2  1 
ATOM   96   H  HB3  . CYS A  1 7  ? -10.940 5.507   4.556  1.00 12.56 ? 7    CYS A HB3  1 
ATOM   97   N  N    . THR A  1 8  ? -10.032 7.072   2.073  1.00 18.12 ? 8    THR A N    1 
ATOM   98   C  CA   . THR A  1 8  ? -9.743  7.162   0.635  1.00 19.64 ? 8    THR A CA   1 
ATOM   99   C  C    . THR A  1 8  ? -9.532  8.626   0.219  1.00 22.12 ? 8    THR A C    1 
ATOM   100  O  O    . THR A  1 8  ? -9.135  8.897   -0.925 1.00 25.66 ? 8    THR A O    1 
ATOM   101  C  CB   . THR A  1 8  ? -10.827 6.478   -0.197 1.00 24.99 ? 8    THR A CB   1 
ATOM   102  O  OG1  . THR A  1 8  ? -12.090 7.062   0.095  1.00 24.79 ? 8    THR A OG1  1 
ATOM   103  C  CG2  . THR A  1 8  ? -10.868 4.973   0.126  1.00 24.96 ? 8    THR A CG2  1 
ATOM   104  H  H    . THR A  1 8  ? -10.954 7.104   2.389  1.00 19.40 ? 8    THR A H    1 
ATOM   105  H  HA   . THR A  1 8  ? -8.799  6.668   0.462  1.00 20.94 ? 8    THR A HA   1 
ATOM   106  H  HB   . THR A  1 8  ? -10.631 6.603   -1.250 1.00 24.50 ? 8    THR A HB   1 
ATOM   107  H  HG1  . THR A  1 8  ? -12.072 8.003   -0.102 1.00 26.75 ? 8    THR A HG1  1 
ATOM   108  H  HG21 . THR A  1 8  ? -9.892  4.523   0.051  1.00 24.47 ? 8    THR A HG21 1 
ATOM   109  H  HG22 . THR A  1 8  ? -11.270 4.832   1.121  1.00 25.84 ? 8    THR A HG22 1 
ATOM   110  H  HG23 . THR A  1 8  ? -11.529 4.498   -0.581 1.00 25.99 ? 8    THR A HG23 1 
ATOM   111  N  N    . SER A  1 9  ? -9.833  9.558   1.128  1.00 20.17 ? 9    SER A N    1 
ATOM   112  C  CA   . SER A  1 9  ? -9.591  10.999  0.961  1.00 23.44 ? 9    SER A CA   1 
ATOM   113  C  C    . SER A  1 9  ? -8.918  11.407  2.272  1.00 22.35 ? 9    SER A C    1 
ATOM   114  O  O    . SER A  1 9  ? -8.782  10.567  3.153  1.00 18.80 ? 9    SER A O    1 
ATOM   115  C  CB   . SER A  1 9  ? -10.885 11.800  0.796  1.00 19.96 ? 9    SER A CB   1 
ATOM   116  O  OG   . SER A  1 9  ? -11.425 11.659  -0.516 1.00 28.12 ? 9    SER A OG   1 
ATOM   117  H  H    . SER A  1 9  ? -10.278 9.266   1.954  1.00 23.38 ? 9    SER A H    1 
ATOM   118  H  HA   . SER A  1 9  ? -8.897  11.179  0.160  1.00 22.43 ? 9    SER A HA   1 
ATOM   119  H  HB2  . SER A  1 9  ? -11.627 11.505  1.517  1.00 22.22 ? 9    SER A HB2  1 
ATOM   120  H  HB3  . SER A  1 9  ? -10.646 12.845  0.941  1.00 23.08 ? 9    SER A HB3  1 
ATOM   121  H  HG   . SER A  1 9  ? -10.745 11.964  -1.121 1.00 25.22 ? 9    SER A HG   1 
ATOM   122  N  N    . ILE A  1 10 ? -8.512  12.668  2.414  1.00 22.83 ? 10   ILE A N    1 
ATOM   123  C  CA   . ILE A  1 10 ? -7.836  13.141  3.631  1.00 20.51 ? 10   ILE A CA   1 
ATOM   124  C  C    . ILE A  1 10 ? -8.671  14.046  4.522  1.00 21.22 ? 10   ILE A C    1 
ATOM   125  O  O    . ILE A  1 10 ? -9.297  15.017  4.057  1.00 22.72 ? 10   ILE A O    1 
ATOM   126  C  CB   . ILE A  1 10 ? -6.514  13.852  3.280  1.00 21.29 ? 10   ILE A CB   1 
ATOM   127  C  CG1  . ILE A  1 10 ? -5.552  12.827  2.689  1.00 23.93 ? 10   ILE A CG1  1 
ATOM   128  C  CG2  . ILE A  1 10 ? -5.883  14.466  4.533  1.00 20.67 ? 10   ILE A CG2  1 
ATOM   129  C  CD1  . ILE A  1 10 ? -4.269  13.397  2.192  1.00 25.95 ? 10   ILE A CD1  1 
ATOM   130  H  H    . ILE A  1 10 ? -8.670  13.303  1.680  1.00 23.43 ? 10   ILE A H    1 
ATOM   131  H  HA   . ILE A  1 10 ? -7.583  12.277  4.205  1.00 22.04 ? 10   ILE A HA   1 
ATOM   132  H  HB   . ILE A  1 10 ? -6.696  14.614  2.544  1.00 21.03 ? 10   ILE A HB   1 
ATOM   133  H  HG12 . ILE A  1 10 ? -5.320  12.061  3.416  1.00 23.81 ? 10   ILE A HG12 1 
ATOM   134  H  HG13 . ILE A  1 10 ? -6.067  12.385  1.864  1.00 23.99 ? 10   ILE A HG13 1 
ATOM   135  H  HG21 . ILE A  1 10 ? -4.826  14.584  4.378  1.00 20.66 ? 10   ILE A HG21 1 
ATOM   136  H  HG22 . ILE A  1 10 ? -6.283  15.457  4.727  1.00 21.14 ? 10   ILE A HG22 1 
ATOM   137  H  HG23 . ILE A  1 10 ? -6.022  13.840  5.406  1.00 22.17 ? 10   ILE A HG23 1 
ATOM   138  H  HD11 . ILE A  1 10 ? -3.503  13.322  2.949  1.00 25.10 ? 10   ILE A HD11 1 
ATOM   139  H  HD12 . ILE A  1 10 ? -4.424  14.436  1.928  1.00 23.64 ? 10   ILE A HD12 1 
ATOM   140  H  HD13 . ILE A  1 10 ? -3.963  12.853  1.313  1.00 24.49 ? 10   ILE A HD13 1 
ATOM   141  N  N    . CYS A  1 11 ? -8.693  13.700  5.809  1.00 20.50 ? 11   CYS A N    1 
ATOM   142  C  CA   . CYS A  1 11 ? -9.440  14.439  6.836  1.00 18.66 ? 11   CYS A CA   1 
ATOM   143  C  C    . CYS A  1 11 ? -8.553  15.395  7.575  1.00 19.97 ? 11   CYS A C    1 
ATOM   144  O  O    . CYS A  1 11 ? -7.456  15.015  8.006  1.00 19.39 ? 11   CYS A O    1 
ATOM   145  C  CB   . CYS A  1 11 ? -10.114 13.488  7.894  1.00 14.15 ? 11   CYS A CB   1 
ATOM   146  S  SG   . CYS A  1 11 ? -11.671 12.963  7.164  1.00 19.18 ? 11   CYS A SG   1 
ATOM   147  H  H    . CYS A  1 11 ? -8.166  12.906  6.031  1.00 21.28 ? 11   CYS A H    1 
ATOM   148  H  HA   . CYS A  1 11 ? -10.229 14.997  6.347  1.00 19.45 ? 11   CYS A HA   1 
ATOM   149  H  HB2  . CYS A  1 11 ? -9.490  12.652  8.110  1.00 16.38 ? 11   CYS A HB2  1 
ATOM   150  H  HB3  . CYS A  1 11 ? -10.346 14.085  8.753  1.00 18.29 ? 11   CYS A HB3  1 
ATOM   151  N  N    . SER A  1 12 ? -9.004  16.640  7.685  1.00 18.57 ? 12   SER A N    1 
ATOM   152  C  CA   . SER A  1 12 ? -8.298  17.616  8.501  1.00 19.55 ? 12   SER A CA   1 
ATOM   153  C  C    . SER A  1 12 ? -8.633  17.221  9.948  1.00 17.74 ? 12   SER A C    1 
ATOM   154  O  O    . SER A  1 12 ? -9.511  16.376  10.218 1.00 16.04 ? 12   SER A O    1 
ATOM   155  C  CB   . SER A  1 12 ? -8.841  19.024  8.256  1.00 18.50 ? 12   SER A CB   1 
ATOM   156  O  OG   . SER A  1 12 ? -10.196 19.086  8.661  1.00 20.98 ? 12   SER A OG   1 
ATOM   157  H  H    . SER A  1 12 ? -9.809  16.909  7.193  1.00 19.11 ? 12   SER A H    1 
ATOM   158  H  HA   . SER A  1 12 ? -7.239  17.562  8.327  1.00 19.48 ? 12   SER A HA   1 
ATOM   159  H  HB2  . SER A  1 12 ? -8.295  19.722  8.878  1.00 20.49 ? 12   SER A HB2  1 
ATOM   160  H  HB3  . SER A  1 12 ? -8.776  19.288  7.212  1.00 19.66 ? 12   SER A HB3  1 
ATOM   161  H  HG   . SER A  1 12 ? -10.503 19.985  8.479  1.00 21.68 ? 12   SER A HG   1 
ATOM   162  N  N    . LEU A  1 13 ? -7.939  17.813  10.907 1.00 16.09 ? 13   LEU A N    1 
ATOM   163  C  CA   . LEU A  1 13 ? -8.243  17.546  12.297 1.00 14.39 ? 13   LEU A CA   1 
ATOM   164  C  C    . LEU A  1 13 ? -9.730  17.852  12.573 1.00 14.98 ? 13   LEU A C    1 
ATOM   165  O  O    . LEU A  1 13 ? -10.407 17.088  13.262 1.00 15.47 ? 13   LEU A O    1 
ATOM   166  C  CB   . LEU A  1 13 ? -7.344  18.412  13.193 1.00 16.34 ? 13   LEU A CB   1 
ATOM   167  C  CG   . LEU A  1 13 ? -7.690  18.448  14.674 1.00 14.34 ? 13   LEU A CG   1 
ATOM   168  C  CD1  . LEU A  1 13 ? -7.666  17.043  15.217 1.00 16.83 ? 13   LEU A CD1  1 
ATOM   169  C  CD2  . LEU A  1 13 ? -6.707  19.347  15.446 1.00 18.66 ? 13   LEU A CD2  1 
ATOM   170  H  H    . LEU A  1 13 ? -7.210  18.418  10.632 1.00 16.68 ? 13   LEU A H    1 
ATOM   171  H  HA   . LEU A  1 13 ? -8.074  16.504  12.527 1.00 14.58 ? 13   LEU A HA   1 
ATOM   172  H  HB2  . LEU A  1 13 ? -6.317  18.060  13.106 1.00 16.69 ? 13   LEU A HB2  1 
ATOM   173  H  HB3  . LEU A  1 13 ? -7.332  19.434  12.836 1.00 15.33 ? 13   LEU A HB3  1 
ATOM   174  H  HG   . LEU A  1 13 ? -8.685  18.833  14.812 1.00 17.58 ? 13   LEU A HG   1 
ATOM   175  H  HD11 . LEU A  1 13 ? -8.482  16.474  14.805 1.00 16.94 ? 13   LEU A HD11 1 
ATOM   176  H  HD12 . LEU A  1 13 ? -6.737  16.546  14.993 1.00 17.03 ? 13   LEU A HD12 1 
ATOM   177  H  HD13 . LEU A  1 13 ? -7.822  17.109  16.281 1.00 15.72 ? 13   LEU A HD13 1 
ATOM   178  H  HD21 . LEU A  1 13 ? -6.299  20.037  14.728 1.00 18.13 ? 13   LEU A HD21 1 
ATOM   179  H  HD22 . LEU A  1 13 ? -7.245  19.868  16.221 1.00 17.40 ? 13   LEU A HD22 1 
ATOM   180  H  HD23 . LEU A  1 13 ? -5.907  18.763  15.880 1.00 18.02 ? 13   LEU A HD23 1 
ATOM   181  N  N    . TYR A  1 14 ? -10.215 18.989  12.057 1.00 16.38 ? 14   TYR A N    1 
ATOM   182  C  CA   . TYR A  1 14 ? -11.610 19.398  12.250 1.00 15.37 ? 14   TYR A CA   1 
ATOM   183  C  C    . TYR A  1 14 ? -12.564 18.356  11.686 1.00 15.11 ? 14   TYR A C    1 
ATOM   184  O  O    . TYR A  1 14 ? -13.606 18.084  12.286 1.00 15.99 ? 14   TYR A O    1 
ATOM   185  C  CB   . TYR A  1 14 ? -11.891 20.775  11.605 1.00 21.07 ? 14   TYR A CB   1 
ATOM   186  C  CG   . TYR A  1 14 ? -13.337 21.221  11.730 1.00 25.75 ? 14   TYR A CG   1 
ATOM   187  C  CD1  . TYR A  1 14 ? -13.779 21.905  12.853 1.00 28.46 ? 14   TYR A CD1  1 
ATOM   188  C  CD2  . TYR A  1 14 ? -14.266 20.922  10.739 1.00 27.78 ? 14   TYR A CD2  1 
ATOM   189  C  CE1  . TYR A  1 14 ? -15.122 22.288  12.982 1.00 27.54 ? 14   TYR A CE1  1 
ATOM   190  C  CE2  . TYR A  1 14 ? -15.596 21.286  10.867 1.00 30.70 ? 14   TYR A CE2  1 
ATOM   191  C  CZ   . TYR A  1 14 ? -16.019 21.970  11.990 1.00 26.72 ? 14   TYR A CZ   1 
ATOM   192  O  OH   . TYR A  1 14 ? -17.347 22.336  12.132 1.00 34.52 ? 14   TYR A OH   1 
ATOM   193  H  H    . TYR A  1 14 ? -9.605  19.583  11.574 1.00 16.20 ? 14   TYR A H    1 
ATOM   194  H  HA   . TYR A  1 14 ? -11.835 19.467  13.306 1.00 17.32 ? 14   TYR A HA   1 
ATOM   195  H  HB2  . TYR A  1 14 ? -11.279 21.507  12.104 1.00 20.26 ? 14   TYR A HB2  1 
ATOM   196  H  HB3  . TYR A  1 14 ? -11.626 20.766  10.564 1.00 19.24 ? 14   TYR A HB3  1 
ATOM   197  H  HD1  . TYR A  1 14 ? -13.056 22.140  13.625 1.00 26.75 ? 14   TYR A HD1  1 
ATOM   198  H  HD2  . TYR A  1 14 ? -13.928 20.385  9.861  1.00 27.14 ? 14   TYR A HD2  1 
ATOM   199  H  HE1  . TYR A  1 14 ? -15.485 22.825  13.854 1.00 27.30 ? 14   TYR A HE1  1 
ATOM   200  H  HE2  . TYR A  1 14 ? -16.302 21.038  10.094 1.00 28.38 ? 14   TYR A HE2  1 
ATOM   201  H  HH   . TYR A  1 14 ? -17.842 22.041  11.363 1.00 29.68 ? 14   TYR A HH   1 
ATOM   202  N  N    . GLN A  1 15 ? -12.197 17.747  10.566 1.00 16.01 ? 15   GLN A N    1 
ATOM   203  C  CA   . GLN A  1 15 ? -13.048 16.716  9.981  1.00 15.45 ? 15   GLN A CA   1 
ATOM   204  C  C    . GLN A  1 15 ? -13.000 15.436  10.824 1.00 15.93 ? 15   GLN A C    1 
ATOM   205  O  O    . GLN A  1 15 ? -14.008 14.745  10.927 1.00 15.71 ? 15   GLN A O    1 
ATOM   206  C  CB   . GLN A  1 15 ? -12.660 16.462  8.523  1.00 16.52 ? 15   GLN A CB   1 
ATOM   207  C  CG   . GLN A  1 15 ? -13.029 17.648  7.619  1.00 21.56 ? 15   GLN A CG   1 
ATOM   208  C  CD   . GLN A  1 15 ? -12.559 17.487  6.189  1.00 25.88 ? 15   GLN A CD   1 
ATOM   209  O  OE1  . GLN A  1 15 ? -11.411 17.151  5.938  1.00 19.64 ? 15   GLN A OE1  1 
ATOM   210  N  NE2  . GLN A  1 15 ? -13.454 17.757  5.233  1.00 28.78 ? 15   GLN A NE2  1 
ATOM   211  H  H    . GLN A  1 15 ? -11.325 17.963  10.170 1.00 15.71 ? 15   GLN A H    1 
ATOM   212  H  HA   . GLN A  1 15 ? -14.059 17.084  10.017 1.00 16.46 ? 15   GLN A HA   1 
ATOM   213  H  HB2  . GLN A  1 15 ? -11.593 16.282  8.451  1.00 19.57 ? 15   GLN A HB2  1 
ATOM   214  H  HB3  . GLN A  1 15 ? -13.186 15.595  8.162  1.00 19.09 ? 15   GLN A HB3  1 
ATOM   215  H  HG2  . GLN A  1 15 ? -14.099 17.808  7.590  1.00 20.38 ? 15   GLN A HG2  1 
ATOM   216  H  HG3  . GLN A  1 15 ? -12.573 18.546  8.006  1.00 20.68 ? 15   GLN A HG3  1 
ATOM   217  H  HE21 . GLN A  1 15 ? -13.186 17.667  4.292  1.00 26.52 ? 15   GLN A HE21 1 
ATOM   218  H  HE22 . GLN A  1 15 ? -14.344 18.029  5.530  1.00 26.26 ? 15   GLN A HE22 1 
ATOM   219  N  N    . LEU A  1 16 ? -11.845 15.092  11.407 1.00 14.03 ? 16   LEU A N    1 
ATOM   220  C  CA   . LEU A  1 16 ? -11.826 13.897  12.256 1.00 13.44 ? 16   LEU A CA   1 
ATOM   221  C  C    . LEU A  1 16 ? -12.723 14.119  13.459 1.00 12.57 ? 16   LEU A C    1 
ATOM   222  O  O    . LEU A  1 16 ? -13.422 13.191  13.898 1.00 13.21 ? 16   LEU A O    1 
ATOM   223  C  CB   . LEU A  1 16 ? -10.417 13.585  12.775 1.00 14.79 ? 16   LEU A CB   1 
ATOM   224  C  CG   . LEU A  1 16 ? -9.467  13.032  11.731 1.00 14.31 ? 16   LEU A CG   1 
ATOM   225  C  CD1  . LEU A  1 16 ? -8.054  13.085  12.292 1.00 17.57 ? 16   LEU A CD1  1 
ATOM   226  C  CD2  . LEU A  1 16 ? -9.835  11.558  11.375 1.00 16.37 ? 16   LEU A CD2  1 
ATOM   227  H  H    . LEU A  1 16 ? -11.056 15.653  11.265 1.00 14.01 ? 16   LEU A H    1 
ATOM   228  H  HA   . LEU A  1 16 ? -12.204 13.032  11.740 1.00 14.01 ? 16   LEU A HA   1 
ATOM   229  H  HB2  . LEU A  1 16 ? -9.996  14.484  13.172 1.00 15.04 ? 16   LEU A HB2  1 
ATOM   230  H  HB3  . LEU A  1 16 ? -10.487 12.865  13.560 1.00 13.84 ? 16   LEU A HB3  1 
ATOM   231  H  HG   . LEU A  1 16 ? -9.518  13.626  10.828 1.00 15.87 ? 16   LEU A HG   1 
ATOM   232  H  HD11 . LEU A  1 16 ? -7.793  14.118  12.480 1.00 17.68 ? 16   LEU A HD11 1 
ATOM   233  H  HD12 . LEU A  1 16 ? -8.014  12.491  13.183 1.00 16.17 ? 16   LEU A HD12 1 
ATOM   234  H  HD13 . LEU A  1 16 ? -7.401  12.688  11.527 1.00 17.55 ? 16   LEU A HD13 1 
ATOM   235  H  HD21 . LEU A  1 16 ? -10.894 11.357  11.496 1.00 15.78 ? 16   LEU A HD21 1 
ATOM   236  H  HD22 . LEU A  1 16 ? -9.558  11.308  10.369 1.00 15.62 ? 16   LEU A HD22 1 
ATOM   237  H  HD23 . LEU A  1 16 ? -9.312  10.900  12.044 1.00 17.74 ? 16   LEU A HD23 1 
ATOM   238  N  N    . GLU A  1 17 ? -12.756 15.351  13.960 1.00 12.90 ? 17   GLU A N    1 
ATOM   239  C  CA   . GLU A  1 17 ? -13.528 15.673  15.126 1.00 14.52 ? 17   GLU A CA   1 
ATOM   240  C  C    . GLU A  1 17 ? -15.025 15.508  14.880 1.00 13.00 ? 17   GLU A C    1 
ATOM   241  O  O    . GLU A  1 17 ? -15.768 15.412  15.848 1.00 14.31 ? 17   GLU A O    1 
ATOM   242  C  CB   . GLU A  1 17 ? -13.207 17.100  15.619 1.00 15.70 ? 17   GLU A CB   1 
ATOM   243  C  CG   . GLU A  1 17 ? -11.792 17.266  16.156 1.00 21.47 ? 17   GLU A CG   1 
ATOM   244  C  CD   . GLU A  1 17 ? -11.515 18.661  16.693 1.00 28.63 ? 17   GLU A CD   1 
ATOM   245  O  OE1  . GLU A  1 17 ? -12.136 19.629  16.208 1.00 30.95 ? 17   GLU A OE1  1 
ATOM   246  O  OE2  . GLU A  1 17 ? -10.669 18.785  17.605 1.00 32.62 ? 17   GLU A OE2  1 
ATOM   247  H  H    . GLU A  1 17 ? -12.218 16.023  13.512 1.00 13.24 ? 17   GLU A H    1 
ATOM   248  H  HA   . GLU A  1 17 ? -13.254 14.993  15.920 1.00 13.00 ? 17   GLU A HA   1 
ATOM   249  H  HB2  . GLU A  1 17 ? -13.255 17.748  14.759 1.00 17.15 ? 17   GLU A HB2  1 
ATOM   250  H  HB3  . GLU A  1 17 ? -13.900 17.412  16.379 1.00 16.35 ? 17   GLU A HB3  1 
ATOM   251  H  HG2  . GLU A  1 17 ? -11.789 16.642  17.033 1.00 22.51 ? 17   GLU A HG2  1 
ATOM   252  H  HG3  . GLU A  1 17 ? -11.022 16.972  15.470 1.00 22.77 ? 17   GLU A HG3  1 
ATOM   253  N  N    . ASN A  1 18 ? -15.448 15.468  13.615 1.00 13.38 ? 18   ASN A N    1 
ATOM   254  C  CA   . ASN A  1 18 ? -16.872 15.266  13.346 1.00 13.45 ? 18   ASN A CA   1 
ATOM   255  C  C    . ASN A  1 18 ? -17.325 13.863  13.782 1.00 13.04 ? 18   ASN A C    1 
ATOM   256  O  O    . ASN A  1 18 ? -18.524 13.608  13.868 1.00 13.77 ? 18   ASN A O    1 
ATOM   257  C  CB   . ASN A  1 18 ? -17.171 15.461  11.857 1.00 14.48 ? 18   ASN A CB   1 
ATOM   258  C  CG   . ASN A  1 18 ? -17.213 16.934  11.415 1.00 14.72 ? 18   ASN A CG   1 
ATOM   259  O  OD1  . ASN A  1 18 ? -16.859 17.246  10.281 1.00 18.42 ? 18   ASN A OD1  1 
ATOM   260  N  ND2  . ASN A  1 18 ? -17.666 17.802  12.278 1.00 17.46 ? 18   ASN A ND2  1 
ATOM   261  H  H    . ASN A  1 18 ? -14.878 15.560  12.835 1.00 10.31 ? 18   ASN A H    1 
ATOM   262  H  HA   . ASN A  1 18 ? -17.425 15.989  13.908 1.00 13.55 ? 18   ASN A HA   1 
ATOM   263  H  HB2  . ASN A  1 18 ? -16.450 14.941  11.238 1.00 12.63 ? 18   ASN A HB2  1 
ATOM   264  H  HB3  . ASN A  1 18 ? -18.148 15.039  11.700 1.00 14.89 ? 18   ASN A HB3  1 
ATOM   265  H  HD21 . ASN A  1 18 ? -17.668 18.741  11.981 1.00 19.21 ? 18   ASN A HD21 1 
ATOM   266  H  HD22 . ASN A  1 18 ? -18.020 17.531  13.146 1.00 18.16 ? 18   ASN A HD22 1 
ATOM   267  N  N    . TYR A  1 19 ? -16.376 12.940  14.018 1.00 12.09 ? 19   TYR A N    1 
ATOM   268  C  CA   . TYR A  1 19 ? -16.721 11.581  14.419 1.00 11.31 ? 19   TYR A CA   1 
ATOM   269  C  C    . TYR A  1 19 ? -16.634 11.357  15.904 1.00 11.81 ? 19   TYR A C    1 
ATOM   270  O  O    . TYR A  1 19 ? -16.823 10.241  16.373 1.00 12.76 ? 19   TYR A O    1 
ATOM   271  C  CB   . TYR A  1 19 ? -15.883 10.601  13.614 1.00 12.47 ? 19   TYR A CB   1 
ATOM   272  C  CG   . TYR A  1 19 ? -16.161 10.736  12.143 1.00 10.62 ? 19   TYR A CG   1 
ATOM   273  C  CD1  . TYR A  1 19 ? -17.294 10.160  11.561 1.00 11.13 ? 19   TYR A CD1  1 
ATOM   274  C  CD2  . TYR A  1 19 ? -15.341 11.501  11.345 1.00 11.90 ? 19   TYR A CD2  1 
ATOM   275  C  CE1  . TYR A  1 19 ? -17.587 10.354  10.229 1.00 13.02 ? 19   TYR A CE1  1 
ATOM   276  C  CE2  . TYR A  1 19 ? -15.633 11.700  10.000 1.00 14.11 ? 19   TYR A CE2  1 
ATOM   277  C  CZ   . TYR A  1 19 ? -16.765 11.119  9.457  1.00 11.51 ? 19   TYR A CZ   1 
ATOM   278  O  OH   . TYR A  1 19 ? -17.086 11.282  8.125  1.00 15.25 ? 19   TYR A OH   1 
ATOM   279  H  H    . TYR A  1 19 ? -15.434 13.173  13.925 1.00 12.31 ? 19   TYR A H    1 
ATOM   280  H  HA   . TYR A  1 19 ? -17.751 11.431  14.115 1.00 13.19 ? 19   TYR A HA   1 
ATOM   281  H  HB2  . TYR A  1 19 ? -14.830 10.805  13.793 1.00 11.69 ? 19   TYR A HB2  1 
ATOM   282  H  HB3  . TYR A  1 19 ? -16.146 9.604   13.926 1.00 10.88 ? 19   TYR A HB3  1 
ATOM   283  H  HD1  . TYR A  1 19 ? -17.974 9.550   12.126 1.00 11.84 ? 19   TYR A HD1  1 
ATOM   284  H  HD2  . TYR A  1 19 ? -14.466 11.944  11.803 1.00 14.31 ? 19   TYR A HD2  1 
ATOM   285  H  HE1  . TYR A  1 19 ? -18.467 9.916   9.759  1.00 11.86 ? 19   TYR A HE1  1 
ATOM   286  H  HE2  . TYR A  1 19 ? -14.991 12.308  9.375  1.00 13.67 ? 19   TYR A HE2  1 
ATOM   287  H  HH   . TYR A  1 19 ? -17.869 10.772  7.951  1.00 14.62 ? 19   TYR A HH   1 
ATOM   288  N  N    . CYS A  1 20 ? -16.383 12.426  16.651 1.00 12.19 ? 20   CYS A N    1 
ATOM   289  C  CA   . CYS A  1 20 ? -16.402 12.309  18.093 1.00 13.35 ? 20   CYS A CA   1 
ATOM   290  C  C    . CYS A  1 20 ? -17.835 12.370  18.619 1.00 13.65 ? 20   CYS A C    1 
ATOM   291  O  O    . CYS A  1 20 ? -18.710 12.972  17.978 1.00 16.44 ? 20   CYS A O    1 
ATOM   292  C  CB   . CYS A  1 20 ? -15.685 13.463  18.750 1.00 14.89 ? 20   CYS A CB   1 
ATOM   293  S  SG   . CYS A  1 20 ? -13.951 13.679  18.276 1.00 14.07 ? 20   CYS A SG   1 
ATOM   294  H  H    . CYS A  1 20 ? -16.136 13.277  16.241 1.00 13.26 ? 20   CYS A H    1 
ATOM   295  H  HA   . CYS A  1 20 ? -15.964 11.393  18.443 1.00 15.12 ? 20   CYS A HA   1 
ATOM   296  H  HB2  . CYS A  1 20 ? -16.229 14.371  18.558 1.00 16.11 ? 20   CYS A HB2  1 
ATOM   297  H  HB3  . CYS A  1 20 ? -15.729 13.334  19.807 1.00 14.71 ? 20   CYS A HB3  1 
ATOM   298  N  N    . ASN A  1 21 ? -18.078 11.757  19.769 1.00 13.09 ? 21   ASN A N    1 
ATOM   299  C  CA   . ASN A  1 21 ? -19.395 11.824  20.403 1.00 19.83 ? 21   ASN A CA   1 
ATOM   300  C  C    . ASN A  1 21 ? -19.516 13.152  21.184 1.00 22.95 ? 21   ASN A C    1 
ATOM   301  O  O    . ASN A  1 21 ? -18.561 13.956  21.227 1.00 21.36 ? 21   ASN A O    1 
ATOM   302  C  CB   . ASN A  1 21 ? -19.601 10.688  21.412 1.00 22.41 ? 21   ASN A CB   1 
ATOM   303  C  CG   . ASN A  1 21 ? -19.530 9.327   20.791 1.00 23.94 ? 21   ASN A CG   1 
ATOM   304  O  OD1  . ASN A  1 21 ? -20.099 9.089   19.733 1.00 24.81 ? 21   ASN A OD1  1 
ATOM   305  N  ND2  . ASN A  1 21 ? -18.847 8.402   21.465 1.00 23.62 ? 21   ASN A ND2  1 
ATOM   306  O  OXT  . ASN A  1 21 ? -20.605 13.370  21.776 1.00 26.14 ? 21   ASN A OXT  1 
ATOM   307  H  H    . ASN A  1 21 ? -17.365 11.244  20.191 1.00 16.38 ? 21   ASN A H    1 
ATOM   308  H  HA   . ASN A  1 21 ? -20.144 11.763  19.633 1.00 19.54 ? 21   ASN A HA   1 
ATOM   309  H  HB2  . ASN A  1 21 ? -18.845 10.772  22.160 1.00 22.33 ? 21   ASN A HB2  1 
ATOM   310  H  HB3  . ASN A  1 21 ? -20.576 10.833  21.853 1.00 23.51 ? 21   ASN A HB3  1 
ATOM   311  H  HD21 . ASN A  1 21 ? -18.781 7.513   21.058 1.00 24.23 ? 21   ASN A HD21 1 
ATOM   312  H  HD22 . ASN A  1 21 ? -18.470 8.623   22.341 1.00 24.13 ? 21   ASN A HD22 1 
ATOM   313  N  N    . PHE B  2 1  ? -1.367  18.903  12.987 1.00 17.42 ? 1    PHE B N    1 
ATOM   314  C  CA   . PHE B  2 1  ? -1.814  17.480  12.942 1.00 16.40 ? 1    PHE B CA   1 
ATOM   315  C  C    . PHE B  2 1  ? -1.456  16.928  11.562 1.00 16.30 ? 1    PHE B C    1 
ATOM   316  O  O    . PHE B  2 1  ? -1.340  17.682  10.583 1.00 19.68 ? 1    PHE B O    1 
ATOM   317  C  CB   . PHE B  2 1  ? -3.328  17.411  13.154 1.00 16.97 ? 1    PHE B CB   1 
ATOM   318  C  CG   . PHE B  2 1  ? -3.818  16.089  13.699 1.00 15.68 ? 1    PHE B CG   1 
ATOM   319  C  CD1  . PHE B  2 1  ? -3.740  15.808  15.061 1.00 15.11 ? 1    PHE B CD1  1 
ATOM   320  C  CD2  . PHE B  2 1  ? -4.306  15.100  12.848 1.00 19.01 ? 1    PHE B CD2  1 
ATOM   321  C  CE1  . PHE B  2 1  ? -4.119  14.594  15.549 1.00 15.49 ? 1    PHE B CE1  1 
ATOM   322  C  CE2  . PHE B  2 1  ? -4.693  13.869  13.345 1.00 17.59 ? 1    PHE B CE2  1 
ATOM   323  C  CZ   . PHE B  2 1  ? -4.599  13.609  14.691 1.00 16.41 ? 1    PHE B CZ   1 
ATOM   324  H  H1   . PHE B  2 1  ? -1.574  19.286  13.921 1.00 16.55 ? 1    PHE B H1   1 
ATOM   325  H  H2   . PHE B  2 1  ? -1.902  19.449  12.284 1.00 16.41 ? 1    PHE B H2   1 
ATOM   326  H  H3   . PHE B  2 1  ? -0.350  18.980  12.795 1.00 17.62 ? 1    PHE B H3   1 
ATOM   327  H  HA   . PHE B  2 1  ? -1.305  16.867  13.675 1.00 17.51 ? 1    PHE B HA   1 
ATOM   328  H  HB2  . PHE B  2 1  ? -3.518  18.238  13.832 1.00 17.31 ? 1    PHE B HB2  1 
ATOM   329  H  HB3  . PHE B  2 1  ? -3.777  17.665  12.209 1.00 16.78 ? 1    PHE B HB3  1 
ATOM   330  H  HD1  . PHE B  2 1  ? -3.366  16.564  15.740 1.00 15.06 ? 1    PHE B HD1  1 
ATOM   331  H  HD2  . PHE B  2 1  ? -4.390  15.286  11.788 1.00 18.84 ? 1    PHE B HD2  1 
ATOM   332  H  HE1  . PHE B  2 1  ? -4.057  14.391  16.611 1.00 15.93 ? 1    PHE B HE1  1 
ATOM   333  H  HE2  . PHE B  2 1  ? -5.060  13.137  12.645 1.00 18.78 ? 1    PHE B HE2  1 
ATOM   334  H  HZ   . PHE B  2 1  ? -4.900  12.643  15.069 1.00 16.55 ? 1    PHE B HZ   1 
ATOM   335  N  N    . VAL B  2 2  ? -1.242  15.622  11.461 1.00 15.64 ? 2    VAL B N    1 
ATOM   336  C  CA   . VAL B  2 2  ? -0.932  15.033  10.175 1.00 16.73 ? 2    VAL B CA   1 
ATOM   337  C  C    . VAL B  2 2  ? -2.050  15.324  9.186  1.00 16.49 ? 2    VAL B C    1 
ATOM   338  O  O    . VAL B  2 2  ? -3.211  15.521  9.529  1.00 18.45 ? 2    VAL B O    1 
ATOM   339  C  CB   . VAL B  2 2  ? -0.767  13.485  10.229 1.00 17.60 ? 2    VAL B CB   1 
ATOM   340  C  CG1  . VAL B  2 2  ? 0.514   13.112  10.919 1.00 17.39 ? 2    VAL B CG1  1 
ATOM   341  C  CG2  . VAL B  2 2  ? -1.920  12.828  10.923 1.00 14.69 ? 2    VAL B CG2  1 
ATOM   342  H  H    . VAL B  2 2  ? -1.300  15.126  12.302 1.00 18.52 ? 2    VAL B H    1 
ATOM   343  H  HA   . VAL B  2 2  ? 0.006   15.462  9.856  1.00 19.12 ? 2    VAL B HA   1 
ATOM   344  H  HB   . VAL B  2 2  ? -0.715  13.111  9.219  1.00 18.32 ? 2    VAL B HB   1 
ATOM   345  H  HG11 . VAL B  2 2  ? 0.631   13.735  11.797 1.00 19.44 ? 2    VAL B HG11 1 
ATOM   346  H  HG12 . VAL B  2 2  ? 0.499   12.065  11.205 1.00 19.34 ? 2    VAL B HG12 1 
ATOM   347  H  HG13 . VAL B  2 2  ? 1.358   13.289  10.263 1.00 19.89 ? 2    VAL B HG13 1 
ATOM   348  H  HG21 . VAL B  2 2  ? -2.818  12.937  10.333 1.00 15.98 ? 2    VAL B HG21 1 
ATOM   349  H  HG22 . VAL B  2 2  ? -1.697  11.775  10.984 1.00 17.05 ? 2    VAL B HG22 1 
ATOM   350  H  HG23 . VAL B  2 2  ? -2.089  13.228  11.906 1.00 15.76 ? 2    VAL B HG23 1 
ATOM   351  N  N    . ASN B  2 3  ? -1.647  15.339  7.925  1.00 21.38 ? 3    ASN B N    1 
ATOM   352  C  CA   . ASN B  2 3  ? -2.558  15.521  6.812  1.00 23.39 ? 3    ASN B CA   1 
ATOM   353  C  C    . ASN B  2 3  ? -2.255  14.319  5.942  1.00 21.76 ? 3    ASN B C    1 
ATOM   354  O  O    . ASN B  2 3  ? -1.410  14.371  5.035  1.00 24.08 ? 3    ASN B O    1 
ATOM   355  C  CB   . ASN B  2 3  ? -2.242  16.802  6.047  1.00 26.21 ? 3    ASN B CB   1 
ATOM   356  C  CG   . ASN B  2 3  ? -3.167  16.998  4.856  1.00 28.43 ? 3    ASN B CG   1 
ATOM   357  O  OD1  . ASN B  2 3  ? -4.353  17.270  5.020  1.00 36.75 ? 3    ASN B OD1  1 
ATOM   358  N  ND2  . ASN B  2 3  ? -2.625  16.842  3.649  1.00 35.63 ? 3    ASN B ND2  1 
ATOM   359  H  H    . ASN B  2 3  ? -0.696  15.199  7.744  1.00 20.20 ? 3    ASN B H    1 
ATOM   360  H  HA   . ASN B  2 3  ? -3.595  15.476  7.115  1.00 21.56 ? 3    ASN B HA   1 
ATOM   361  H  HB2  . ASN B  2 3  ? -2.365  17.622  6.740  1.00 23.39 ? 3    ASN B HB2  1 
ATOM   362  H  HB3  . ASN B  2 3  ? -1.215  16.763  5.715  1.00 23.04 ? 3    ASN B HB3  1 
ATOM   363  H  HD21 . ASN B  2 3  ? -3.209  16.964  2.866  1.00 27.08 ? 3    ASN B HD21 1 
ATOM   364  H  HD22 . ASN B  2 3  ? -1.667  16.619  3.577  1.00 26.55 ? 3    ASN B HD22 1 
ATOM   365  N  N    . GLN B  2 4  ? -2.921  13.211  6.242  1.00 19.97 ? 4    GLN B N    1 
ATOM   366  C  CA   . GLN B  2 4  ? -2.656  12.002  5.485  1.00 20.67 ? 4    GLN B CA   1 
ATOM   367  C  C    . GLN B  2 4  ? -3.836  11.074  5.535  1.00 17.38 ? 4    GLN B C    1 
ATOM   368  O  O    . GLN B  2 4  ? -4.761  11.270  6.315  1.00 19.61 ? 4    GLN B O    1 
ATOM   369  C  CB   . GLN B  2 4  ? -1.465  11.251  6.080  1.00 22.29 ? 4    GLN B CB   1 
ATOM   370  C  CG   . GLN B  2 4  ? -1.743  10.684  7.470  1.00 23.44 ? 4    GLN B CG   1 
ATOM   371  C  CD   . GLN B  2 4  ? -0.618  9.803   8.007  1.00 26.89 ? 4    GLN B CD   1 
ATOM   372  O  OE1  . GLN B  2 4  ? 0.497   10.265  8.236  1.00 26.32 ? 4    GLN B OE1  1 
ATOM   373  N  NE2  . GLN B  2 4  ? -0.920  8.524   8.215  1.00 30.64 ? 4    GLN B NE2  1 
ATOM   374  H  H    . GLN B  2 4  ? -3.601  13.219  6.937  1.00 21.00 ? 4    GLN B H    1 
ATOM   375  H  HA   . GLN B  2 4  ? -2.418  12.256  4.466  1.00 20.49 ? 4    GLN B HA   1 
ATOM   376  H  HB2  . GLN B  2 4  ? -1.239  10.399  5.466  1.00 22.39 ? 4    GLN B HB2  1 
ATOM   377  H  HB3  . GLN B  2 4  ? -0.627  11.928  6.166  1.00 23.23 ? 4    GLN B HB3  1 
ATOM   378  H  HG2  . GLN B  2 4  ? -1.939  11.474  8.182  1.00 24.70 ? 4    GLN B HG2  1 
ATOM   379  H  HG3  . GLN B  2 4  ? -2.631  10.073  7.430  1.00 24.96 ? 4    GLN B HG3  1 
ATOM   380  H  HE21 . GLN B  2 4  ? -0.200  7.958   8.569  1.00 28.20 ? 4    GLN B HE21 1 
ATOM   381  H  HE22 . GLN B  2 4  ? -1.820  8.199   8.004  1.00 28.20 ? 4    GLN B HE22 1 
ATOM   382  N  N    A HIS B  2 5  ? -3.822  10.056  4.679  0.50 16.51 ? 5    HIS B N    1 
ATOM   383  N  N    B HIS B  2 5  ? -3.803  10.058  4.688  0.50 16.59 ? 5    HIS B N    1 
ATOM   384  C  CA   A HIS B  2 5  ? -4.889  9.059   4.658  0.50 13.85 ? 5    HIS B CA   1 
ATOM   385  C  CA   B HIS B  2 5  ? -4.852  9.066   4.696  0.50 14.45 ? 5    HIS B CA   1 
ATOM   386  C  C    A HIS B  2 5  ? -4.755  8.179   5.916  0.50 15.70 ? 5    HIS B C    1 
ATOM   387  C  C    B HIS B  2 5  ? -4.736  8.355   6.044  0.50 12.64 ? 5    HIS B C    1 
ATOM   388  O  O    A HIS B  2 5  ? -3.676  7.687   6.229  0.50 15.88 ? 5    HIS B O    1 
ATOM   389  O  O    B HIS B  2 5  ? -3.639  8.200   6.571  0.50 14.82 ? 5    HIS B O    1 
ATOM   390  C  CB   A HIS B  2 5  ? -4.787  8.220   3.380  0.50 15.03 ? 5    HIS B CB   1 
ATOM   391  C  CB   B HIS B  2 5  ? -4.631  8.047   3.577  0.50 16.70 ? 5    HIS B CB   1 
ATOM   392  C  CG   A HIS B  2 5  ? -4.996  9.006   2.120  0.50 15.45 ? 5    HIS B CG   1 
ATOM   393  C  CG   B HIS B  2 5  ? -4.612  8.647   2.210  0.50 20.16 ? 5    HIS B CG   1 
ATOM   394  N  ND1  A HIS B  2 5  ? -6.231  9.475   1.731  0.50 17.64 ? 5    HIS B ND1  1 
ATOM   395  N  ND1  B HIS B  2 5  ? -3.453  9.077   1.599  0.50 20.92 ? 5    HIS B ND1  1 
ATOM   396  C  CD2  A HIS B  2 5  ? -4.120  9.446   1.185  0.50 18.01 ? 5    HIS B CD2  1 
ATOM   397  C  CD2  B HIS B  2 5  ? -5.621  8.940   1.358  0.50 19.99 ? 5    HIS B CD2  1 
ATOM   398  C  CE1  A HIS B  2 5  ? -6.110  10.165  0.610  0.50 20.57 ? 5    HIS B CE1  1 
ATOM   399  C  CE1  B HIS B  2 5  ? -3.752  9.615   0.429  0.50 23.00 ? 5    HIS B CE1  1 
ATOM   400  N  NE2  A HIS B  2 5  ? -4.838  10.165  0.259  0.50 13.97 ? 5    HIS B NE2  1 
ATOM   401  N  NE2  B HIS B  2 5  ? -5.059  9.544   0.258  0.50 21.39 ? 5    HIS B NE2  1 
ATOM   402  H  H    A HIS B  2 5  ? -3.070  9.954   4.061  0.50 17.17 ? 5    HIS B H    1 
ATOM   403  H  H    B HIS B  2 5  ? -3.065  9.954   4.059  0.50 17.19 ? 5    HIS B H    1 
ATOM   404  H  HA   A HIS B  2 5  ? -5.841  9.569   4.690  0.50 15.89 ? 5    HIS B HA   1 
ATOM   405  H  HA   B HIS B  2 5  ? -5.814  9.539   4.600  0.50 15.68 ? 5    HIS B HA   1 
ATOM   406  H  HB2  A HIS B  2 5  ? -3.847  7.698   3.334  0.50 16.02 ? 5    HIS B HB2  1 
ATOM   407  H  HB2  B HIS B  2 5  ? -3.721  7.495   3.733  0.50 17.25 ? 5    HIS B HB2  1 
ATOM   408  H  HB3  A HIS B  2 5  ? -5.574  7.478   3.437  0.50 17.06 ? 5    HIS B HB3  1 
ATOM   409  H  HB3  B HIS B  2 5  ? -5.459  7.355   3.619  0.50 18.41 ? 5    HIS B HB3  1 
ATOM   410  H  HD1  A HIS B  2 5  ? -7.067  9.323   2.220  0.50 18.92 ? 5    HIS B HD1  1 
ATOM   411  H  HD2  A HIS B  2 5  ? -3.046  9.262   1.183  0.50 18.23 ? 5    HIS B HD2  1 
ATOM   412  H  HD2  B HIS B  2 5  ? -6.670  8.735   1.506  0.50 20.53 ? 5    HIS B HD2  1 
ATOM   413  H  HE1  A HIS B  2 5  ? -6.890  10.702  0.105  0.50 19.65 ? 5    HIS B HE1  1 
ATOM   414  H  HE1  B HIS B  2 5  ? -3.170  10.437  0.034  0.50 22.81 ? 5    HIS B HE1  1 
ATOM   415  H  HE2  B HIS B  2 5  ? -5.545  9.873   -0.527 0.50 21.16 ? 5    HIS B HE2  1 
ATOM   416  N  N    . LEU B  2 6  ? -5.880  7.961   6.596  1.00 13.99 ? 6    LEU B N    1 
ATOM   417  C  CA   . LEU B  2 6  ? -5.925  7.194   7.847  1.00 13.07 ? 6    LEU B CA   1 
ATOM   418  C  C    . LEU B  2 6  ? -6.974  6.136   7.633  1.00 12.35 ? 6    LEU B C    1 
ATOM   419  O  O    . LEU B  2 6  ? -8.137  6.433   7.391  1.00 13.44 ? 6    LEU B O    1 
ATOM   420  C  CB   . LEU B  2 6  ? -6.304  8.120   9.015  1.00 12.76 ? 6    LEU B CB   1 
ATOM   421  C  CG   . LEU B  2 6  ? -5.224  9.115   9.373  1.00 12.76 ? 6    LEU B CG   1 
ATOM   422  C  CD1  . LEU B  2 6  ? -5.752  10.130  10.363 1.00 14.15 ? 6    LEU B CD1  1 
ATOM   423  C  CD2  . LEU B  2 6  ? -4.051  8.394   9.956  1.00 15.15 ? 6    LEU B CD2  1 
ATOM   424  H  H    . LEU B  2 6  ? -6.721  8.273   6.222  1.00 15.13 ? 6    LEU B H    1 
ATOM   425  H  HA   . LEU B  2 6  ? -4.964  6.758   7.976  1.00 11.89 ? 6    LEU B HA   1 
ATOM   426  H  HB2  . LEU B  2 6  ? -7.211  8.639   8.754  1.00 12.93 ? 6    LEU B HB2  1 
ATOM   427  H  HB3  . LEU B  2 6  ? -6.490  7.491   9.880  1.00 14.43 ? 6    LEU B HB3  1 
ATOM   428  H  HG   . LEU B  2 6  ? -4.890  9.660   8.508  1.00 14.20 ? 6    LEU B HG   1 
ATOM   429  H  HD11 . LEU B  2 6  ? -4.919  10.572  10.896 1.00 12.99 ? 6    LEU B HD11 1 
ATOM   430  H  HD12 . LEU B  2 6  ? -6.305  10.880  9.802  1.00 13.86 ? 6    LEU B HD12 1 
ATOM   431  H  HD13 . LEU B  2 6  ? -6.445  9.685   11.069 1.00 15.13 ? 6    LEU B HD13 1 
ATOM   432  H  HD21 . LEU B  2 6  ? -4.343  8.001   10.917 1.00 14.99 ? 6    LEU B HD21 1 
ATOM   433  H  HD22 . LEU B  2 6  ? -3.731  7.572   9.332  1.00 11.85 ? 6    LEU B HD22 1 
ATOM   434  H  HD23 . LEU B  2 6  ? -3.210  9.056   10.125 1.00 13.59 ? 6    LEU B HD23 1 
ATOM   435  N  N    . CYS B  2 7  ? -6.550  4.876   7.715  1.00 13.52 ? 7    CYS B N    1 
ATOM   436  C  CA   . CYS B  2 7  ? -7.442  3.761   7.493  1.00 13.95 ? 7    CYS B CA   1 
ATOM   437  C  C    . CYS B  2 7  ? -7.322  2.711   8.576  1.00 13.80 ? 7    CYS B C    1 
ATOM   438  O  O    . CYS B  2 7  ? -6.285  2.571   9.211  1.00 13.78 ? 7    CYS B O    1 
ATOM   439  C  CB   . CYS B  2 7  ? -7.121  3.084   6.163  1.00 15.67 ? 7    CYS B CB   1 
ATOM   440  S  SG   . CYS B  2 7  ? -7.158  4.167   4.692  1.00 17.49 ? 7    CYS B SG   1 
ATOM   441  H  H    . CYS B  2 7  ? -5.599  4.740   7.920  1.00 12.50 ? 7    CYS B H    1 
ATOM   442  H  HA   . CYS B  2 7  ? -8.484  4.024   7.458  1.00 13.87 ? 7    CYS B HA   1 
ATOM   443  H  HB2  . CYS B  2 7  ? -6.112  2.711   6.226  1.00 13.97 ? 7    CYS B HB2  1 
ATOM   444  H  HB3  . CYS B  2 7  ? -7.842  2.292   6.026  1.00 15.59 ? 7    CYS B HB3  1 
ATOM   445  N  N    . GLY B  2 8  ? -8.403  1.980   8.754  1.00 14.26 ? 8    GLY B N    1 
ATOM   446  C  CA   . GLY B  2 8  ? -8.396  0.877   9.684  1.00 14.10 ? 8    GLY B CA   1 
ATOM   447  C  C    . GLY B  2 8  ? -7.985  1.225   11.081 1.00 12.57 ? 8    GLY B C    1 
ATOM   448  O  O    . GLY B  2 8  ? -8.454  2.207   11.649 1.00 12.57 ? 8    GLY B O    1 
ATOM   449  H  H    . GLY B  2 8  ? -9.208  2.173   8.232  1.00 14.02 ? 8    GLY B H    1 
ATOM   450  H  HA2  . GLY B  2 8  ? -9.360  0.425   9.736  1.00 14.75 ? 8    GLY B HA2  1 
ATOM   451  H  HA3  . GLY B  2 8  ? -7.682  0.166   9.292  1.00 14.54 ? 8    GLY B HA3  1 
ATOM   452  N  N    . SER B  2 9  ? -7.086  0.429   11.650 1.00 12.81 ? 9    SER B N    1 
ATOM   453  C  CA   . SER B  2 9  ? -6.682  0.666   13.016 1.00 12.53 ? 9    SER B CA   1 
ATOM   454  C  C    . SER B  2 9  ? -5.991  1.989   13.209 1.00 10.87 ? 9    SER B C    1 
ATOM   455  O  O    . SER B  2 9  ? -6.063  2.547   14.268 1.00 12.12 ? 9    SER B O    1 
ATOM   456  C  CB   . SER B  2 9  ? -5.839  -0.497  13.559 1.00 16.56 ? 9    SER B CB   1 
ATOM   457  O  OG   . SER B  2 9  ? -4.622  -0.580  12.880 1.00 20.74 ? 9    SER B OG   1 
ATOM   458  H  H    . SER B  2 9  ? -6.745  -0.345  11.152 1.00 14.83 ? 9    SER B H    1 
ATOM   459  H  HA   . SER B  2 9  ? -7.592  0.698   13.592 1.00 14.37 ? 9    SER B HA   1 
ATOM   460  H  HB2  . SER B  2 9  ? -5.663  -0.363  14.619 1.00 16.04 ? 9    SER B HB2  1 
ATOM   461  H  HB3  . SER B  2 9  ? -6.402  -1.399  13.394 1.00 16.74 ? 9    SER B HB3  1 
ATOM   462  H  HG   . SER B  2 9  ? -4.103  -1.302  13.258 1.00 21.48 ? 9    SER B HG   1 
ATOM   463  N  N    . HIS B  2 10 ? -5.338  2.516   12.172 1.00 10.62 ? 10   HIS B N    1 
ATOM   464  C  CA   . HIS B  2 10 ? -4.696  3.809   12.302 1.00 10.36 ? 10   HIS B CA   1 
ATOM   465  C  C    . HIS B  2 10 ? -5.727  4.930   12.377 1.00 9.41  ? 10   HIS B C    1 
ATOM   466  O  O    . HIS B  2 10 ? -5.513  5.905   13.086 1.00 11.45 ? 10   HIS B O    1 
ATOM   467  C  CB   . HIS B  2 10 ? -3.741  4.034   11.140 1.00 12.92 ? 10   HIS B CB   1 
ATOM   468  C  CG   . HIS B  2 10 ? -2.598  3.064   11.149 1.00 12.36 ? 10   HIS B CG   1 
ATOM   469  N  ND1  . HIS B  2 10 ? -1.719  2.966   12.214 1.00 14.85 ? 10   HIS B ND1  1 
ATOM   470  C  CD2  . HIS B  2 10 ? -2.185  2.160   10.235 1.00 11.47 ? 10   HIS B CD2  1 
ATOM   471  C  CE1  . HIS B  2 10 ? -0.803  2.044   11.938 1.00 12.69 ? 10   HIS B CE1  1 
ATOM   472  N  NE2  . HIS B  2 10 ? -1.062  1.547   10.739 1.00 12.10 ? 10   HIS B NE2  1 
ATOM   473  H  H    . HIS B  2 10 ? -5.363  2.013   11.339 1.00 9.01  ? 10   HIS B H    1 
ATOM   474  H  HA   . HIS B  2 10 ? -4.115  3.840   13.221 1.00 10.14 ? 10   HIS B HA   1 
ATOM   475  H  HB2  . HIS B  2 10 ? -4.280  3.898   10.235 1.00 11.86 ? 10   HIS B HB2  1 
ATOM   476  H  HB3  . HIS B  2 10 ? -3.372  5.008   11.249 1.00 9.37  ? 10   HIS B HB3  1 
ATOM   477  H  HD1  . HIS B  2 10 ? -1.719  3.543   13.000 1.00 12.81 ? 10   HIS B HD1  1 
ATOM   478  H  HD2  . HIS B  2 10 ? -2.611  1.933   9.284  1.00 12.01 ? 10   HIS B HD2  1 
ATOM   479  H  HE1  . HIS B  2 10 ? 0.207   2.153   12.318 1.00 15.73 ? 10   HIS B HE1  1 
ATOM   480  N  N    . LEU B  2 11 ? -6.850  4.754   11.696 1.00 9.93  ? 11   LEU B N    1 
ATOM   481  C  CA   . LEU B  2 11 ? -7.945  5.731   11.760 1.00 10.24 ? 11   LEU B CA   1 
ATOM   482  C  C    . LEU B  2 11 ? -8.572  5.704   13.159 1.00 9.80  ? 11   LEU B C    1 
ATOM   483  O  O    . LEU B  2 11 ? -8.813  6.735   13.764 1.00 9.92  ? 11   LEU B O    1 
ATOM   484  C  CB   . LEU B  2 11 ? -8.968  5.420   10.651 1.00 10.82 ? 11   LEU B CB   1 
ATOM   485  C  CG   . LEU B  2 11 ? -10.222 6.279   10.554 1.00 10.90 ? 11   LEU B CG   1 
ATOM   486  C  CD1  . LEU B  2 11 ? -9.887  7.741   10.539 1.00 10.67 ? 11   LEU B CD1  1 
ATOM   487  C  CD2  . LEU B  2 11 ? -10.995 5.895   9.328  1.00 12.38 ? 11   LEU B CD2  1 
ATOM   488  H  H    . LEU B  2 11 ? -6.946  3.979   11.107 1.00 9.15  ? 11   LEU B H    1 
ATOM   489  H  HA   . LEU B  2 11 ? -7.550  6.718   11.649 1.00 9.10  ? 11   LEU B HA   1 
ATOM   490  H  HB2  . LEU B  2 11 ? -8.385  5.507   9.767  1.00 11.33 ? 11   LEU B HB2  1 
ATOM   491  H  HB3  . LEU B  2 11 ? -9.236  4.379   10.769 1.00 10.67 ? 11   LEU B HB3  1 
ATOM   492  H  HG   . LEU B  2 11 ? -10.872 6.113   11.414 1.00 13.33 ? 11   LEU B HG   1 
ATOM   493  H  HD11 . LEU B  2 11 ? -9.406  8.126   11.440 1.00 9.98  ? 11   LEU B HD11 1 
ATOM   494  H  HD12 . LEU B  2 11 ? -9.260  7.963   9.682  1.00 12.50 ? 11   LEU B HD12 1 
ATOM   495  H  HD13 . LEU B  2 11 ? -10.803 8.286   10.392 1.00 11.13 ? 11   LEU B HD13 1 
ATOM   496  H  HD21 . LEU B  2 11 ? -10.525 6.321   8.461  1.00 13.45 ? 11   LEU B HD21 1 
ATOM   497  H  HD22 . LEU B  2 11 ? -11.103 4.832   9.209  1.00 12.03 ? 11   LEU B HD22 1 
ATOM   498  H  HD23 . LEU B  2 11 ? -11.959 6.340   9.419  1.00 13.62 ? 11   LEU B HD23 1 
ATOM   499  N  N    . VAL B  2 12 ? -8.792  4.501   13.688 1.00 10.90 ? 12   VAL B N    1 
ATOM   500  C  CA   . VAL B  2 12 ? -9.360  4.351   15.025 1.00 9.86  ? 12   VAL B CA   1 
ATOM   501  C  C    . VAL B  2 12 ? -8.432  4.951   16.061 1.00 10.39 ? 12   VAL B C    1 
ATOM   502  O  O    . VAL B  2 12 ? -8.881  5.629   16.977 1.00 11.40 ? 12   VAL B O    1 
ATOM   503  C  CB   . VAL B  2 12 ? -9.660  2.865   15.296 1.00 13.13 ? 12   VAL B CB   1 
ATOM   504  C  CG1  . VAL B  2 12 ? -9.862  2.638   16.788 1.00 13.21 ? 12   VAL B CG1  1 
ATOM   505  C  CG2  . VAL B  2 12 ? -10.838 2.433   14.435 1.00 12.35 ? 12   VAL B CG2  1 
ATOM   506  H  H    . VAL B  2 12 ? -8.534  3.712   13.183 1.00 7.62  ? 12   VAL B H    1 
ATOM   507  H  HA   . VAL B  2 12 ? -10.283 4.897   15.054 1.00 6.93  ? 12   VAL B HA   1 
ATOM   508  H  HB   . VAL B  2 12 ? -8.787  2.308   15.009 1.00 11.53 ? 12   VAL B HB   1 
ATOM   509  H  HG11 . VAL B  2 12 ? -10.505 1.784   16.911 1.00 14.22 ? 12   VAL B HG11 1 
ATOM   510  H  HG12 . VAL B  2 12 ? -8.904  2.435   17.245 1.00 13.93 ? 12   VAL B HG12 1 
ATOM   511  H  HG13 . VAL B  2 12 ? -10.318 3.500   17.232 1.00 15.49 ? 12   VAL B HG13 1 
ATOM   512  H  HG21 . VAL B  2 12 ? -11.080 1.383   14.536 1.00 11.64 ? 12   VAL B HG21 1 
ATOM   513  H  HG22 . VAL B  2 12 ? -11.682 3.053   14.645 1.00 10.09 ? 12   VAL B HG22 1 
ATOM   514  H  HG23 . VAL B  2 12 ? -10.536 2.603   13.393 1.00 10.29 ? 12   VAL B HG23 1 
ATOM   515  N  N    . GLU B  2 13 ? -7.138  4.711   15.943 1.00 10.78 ? 13   GLU B N    1 
ATOM   516  C  CA   . GLU B  2 13 ? -6.235  5.321   16.909 1.00 11.04 ? 13   GLU B CA   1 
ATOM   517  C  C    . GLU B  2 13 ? -6.267  6.858   16.842 1.00 10.95 ? 13   GLU B C    1 
ATOM   518  O  O    . GLU B  2 13 ? -6.202  7.523   17.859 1.00 11.22 ? 13   GLU B O    1 
ATOM   519  C  CB   . GLU B  2 13 ? -4.811  4.797   16.735 1.00 16.89 ? 13   GLU B CB   1 
ATOM   520  C  CG   . GLU B  2 13 ? -3.854  5.274   17.846 1.00 24.33 ? 13   GLU B CG   1 
ATOM   521  C  CD   . GLU B  2 13 ? -4.398  5.032   19.259 1.00 32.32 ? 13   GLU B CD   1 
ATOM   522  O  OE1  . GLU B  2 13 ? -4.893  3.911   19.537 1.00 35.65 ? 13   GLU B OE1  1 
ATOM   523  O  OE2  . GLU B  2 13 ? -4.320  5.971   20.090 1.00 38.58 ? 13   GLU B OE2  1 
ATOM   524  H  H    . GLU B  2 13 ? -6.778  4.196   15.199 1.00 12.78 ? 13   GLU B H    1 
ATOM   525  H  HA   . GLU B  2 13 ? -6.599  4.996   17.868 1.00 13.23 ? 13   GLU B HA   1 
ATOM   526  H  HB2  . GLU B  2 13 ? -4.853  3.718   16.773 1.00 15.68 ? 13   GLU B HB2  1 
ATOM   527  H  HB3  . GLU B  2 13 ? -4.424  5.128   15.787 1.00 13.00 ? 13   GLU B HB3  1 
ATOM   528  H  HG2  . GLU B  2 13 ? -3.011  4.648   17.752 1.00 24.74 ? 13   GLU B HG2  1 
ATOM   529  H  HG3  . GLU B  2 13 ? -3.616  6.312   17.716 1.00 23.99 ? 13   GLU B HG3  1 
ATOM   530  N  N    . ALA B  2 14 ? -6.330  7.419   15.640 1.00 10.38 ? 14   ALA B N    1 
ATOM   531  C  CA   . ALA B  2 14 ? -6.426  8.865   15.482 1.00 10.27 ? 14   ALA B CA   1 
ATOM   532  C  C    . ALA B  2 14 ? -7.696  9.411   16.165 1.00 11.32 ? 14   ALA B C    1 
ATOM   533  O  O    . ALA B  2 14 ? -7.654  10.424  16.846 1.00 10.88 ? 14   ALA B O    1 
ATOM   534  C  CB   . ALA B  2 14 ? -6.424  9.247   13.982 1.00 10.94 ? 14   ALA B CB   1 
ATOM   535  H  H    . ALA B  2 14 ? -6.236  6.827   14.867 1.00 9.68  ? 14   ALA B H    1 
ATOM   536  H  HA   . ALA B  2 14 ? -5.567  9.336   15.947 1.00 11.10 ? 14   ALA B HA   1 
ATOM   537  H  HB1  . ALA B  2 14 ? -6.762  10.265  13.902 1.00 10.43 ? 14   ALA B HB1  1 
ATOM   538  H  HB2  . ALA B  2 14 ? -5.419  9.134   13.632 1.00 8.97  ? 14   ALA B HB2  1 
ATOM   539  H  HB3  . ALA B  2 14 ? -7.056  8.598   13.394 1.00 10.57 ? 14   ALA B HB3  1 
ATOM   540  N  N    . LEU B  2 15 ? -8.818  8.706   16.016 1.00 10.20 ? 15   LEU B N    1 
ATOM   541  C  CA   . LEU B  2 15 ? -10.069 9.142   16.649 1.00 9.52  ? 15   LEU B CA   1 
ATOM   542  C  C    . LEU B  2 15 ? -9.941  9.083   18.176 1.00 9.19  ? 15   LEU B C    1 
ATOM   543  O  O    . LEU B  2 15 ? -10.455 9.939   18.884 1.00 10.76 ? 15   LEU B O    1 
ATOM   544  C  CB   . LEU B  2 15 ? -11.263 8.289   16.230 1.00 11.04 ? 15   LEU B CB   1 
ATOM   545  C  CG   . LEU B  2 15 ? -11.648 8.447   14.747 1.00 10.77 ? 15   LEU B CG   1 
ATOM   546  C  CD1  . LEU B  2 15 ? -12.720 7.424   14.397 1.00 14.26 ? 15   LEU B CD1  1 
ATOM   547  C  CD2  . LEU B  2 15 ? -12.150 9.867   14.447 1.00 13.58 ? 15   LEU B CD2  1 
ATOM   548  H  H    . LEU B  2 15 ? -8.879  7.931   15.441 1.00 7.44  ? 15   LEU B H    1 
ATOM   549  H  HA   . LEU B  2 15 ? -10.255 10.165  16.381 1.00 10.54 ? 15   LEU B HA   1 
ATOM   550  H  HB2  . LEU B  2 15 ? -11.056 7.250   16.456 1.00 12.30 ? 15   LEU B HB2  1 
ATOM   551  H  HB3  . LEU B  2 15 ? -12.104 8.590   16.824 1.00 11.55 ? 15   LEU B HB3  1 
ATOM   552  H  HG   . LEU B  2 15 ? -10.743 8.258   14.207 1.00 11.58 ? 15   LEU B HG   1 
ATOM   553  H  HD11 . LEU B  2 15 ? -12.860 7.432   13.345 1.00 15.75 ? 15   LEU B HD11 1 
ATOM   554  H  HD12 . LEU B  2 15 ? -12.455 6.408   14.660 1.00 11.38 ? 15   LEU B HD12 1 
ATOM   555  H  HD13 . LEU B  2 15 ? -13.647 7.719   14.841 1.00 12.18 ? 15   LEU B HD13 1 
ATOM   556  H  HD21 . LEU B  2 15 ? -12.627 9.886   13.477 1.00 12.20 ? 15   LEU B HD21 1 
ATOM   557  H  HD22 . LEU B  2 15 ? -12.840 10.183  15.217 1.00 14.49 ? 15   LEU B HD22 1 
ATOM   558  H  HD23 . LEU B  2 15 ? -11.333 10.567  14.440 1.00 14.22 ? 15   LEU B HD23 1 
ATOM   559  N  N    . TYR B  2 16 ? -9.294  8.039   18.692 1.00 10.00 ? 16   TYR B N    1 
ATOM   560  C  CA   . TYR B  2 16 ? -9.128  7.916   20.130 1.00 10.87 ? 16   TYR B CA   1 
ATOM   561  C  C    . TYR B  2 16 ? -8.398  9.118   20.679 1.00 10.22 ? 16   TYR B C    1 
ATOM   562  O  O    . TYR B  2 16 ? -8.794  9.713   21.685 1.00 11.87 ? 16   TYR B O    1 
ATOM   563  C  CB   . TYR B  2 16 ? -8.328  6.644   20.411 1.00 10.53 ? 16   TYR B CB   1 
ATOM   564  C  CG   . TYR B  2 16 ? -8.167  6.360   21.891 1.00 10.82 ? 16   TYR B CG   1 
ATOM   565  C  CD1  . TYR B  2 16 ? -9.198  5.801   22.614 1.00 11.89 ? 16   TYR B CD1  1 
ATOM   566  C  CD2  . TYR B  2 16 ? -7.015  6.703   22.576 1.00 11.15 ? 16   TYR B CD2  1 
ATOM   567  C  CE1  . TYR B  2 16 ? -9.080  5.581   24.011 1.00 10.84 ? 16   TYR B CE1  1 
ATOM   568  C  CE2  . TYR B  2 16 ? -6.911  6.504   23.977 1.00 11.24 ? 16   TYR B CE2  1 
ATOM   569  C  CZ   . TYR B  2 16 ? -7.956  5.927   24.662 1.00 10.61 ? 16   TYR B CZ   1 
ATOM   570  O  OH   . TYR B  2 16 ? -7.875  5.676   26.029 1.00 11.09 ? 16   TYR B OH   1 
ATOM   571  H  H    . TYR B  2 16 ? -9.003  7.280   18.159 1.00 9.78  ? 16   TYR B H    1 
ATOM   572  H  HA   . TYR B  2 16 ? -10.091 7.804   20.568 1.00 8.63  ? 16   TYR B HA   1 
ATOM   573  H  HB2  . TYR B  2 16 ? -8.917  5.864   19.994 1.00 8.36  ? 16   TYR B HB2  1 
ATOM   574  H  HB3  . TYR B  2 16 ? -7.363  6.626   19.931 1.00 9.29  ? 16   TYR B HB3  1 
ATOM   575  H  HD1  . TYR B  2 16 ? -10.129 5.511   22.135 1.00 13.33 ? 16   TYR B HD1  1 
ATOM   576  H  HD2  . TYR B  2 16 ? -6.189  7.158   22.050 1.00 11.85 ? 16   TYR B HD2  1 
ATOM   577  H  HE1  . TYR B  2 16 ? -9.901  5.140   24.547 1.00 11.84 ? 16   TYR B HE1  1 
ATOM   578  H  HE2  . TYR B  2 16 ? -6.009  6.781   24.495 1.00 13.63 ? 16   TYR B HE2  1 
ATOM   579  H  HH   . TYR B  2 16 ? -7.058  6.001   26.390 1.00 12.80 ? 16   TYR B HH   1 
ATOM   580  N  N    . LEU B  2 17 ? -7.300  9.480   20.013 1.00 11.57 ? 17   LEU B N    1 
ATOM   581  C  CA   . LEU B  2 17 ? -6.510  10.638  20.407 1.00 12.10 ? 17   LEU B CA   1 
ATOM   582  C  C    . LEU B  2 17 ? -7.281  11.969  20.279 1.00 11.57 ? 17   LEU B C    1 
ATOM   583  O  O    . LEU B  2 17 ? -7.348  12.774  21.198 1.00 12.77 ? 17   LEU B O    1 
ATOM   584  C  CB   . LEU B  2 17 ? -5.226  10.692  19.547 1.00 12.05 ? 17   LEU B CB   1 
ATOM   585  C  CG   . LEU B  2 17 ? -4.383  11.955  19.580 1.00 16.74 ? 17   LEU B CG   1 
ATOM   586  C  CD1  . LEU B  2 17 ? -3.895  12.236  20.973 1.00 22.71 ? 17   LEU B CD1  1 
ATOM   587  C  CD2  . LEU B  2 17 ? -3.209  11.768  18.629 1.00 20.02 ? 17   LEU B CD2  1 
ATOM   588  H  H    . LEU B  2 17 ? -7.006  8.888   19.295 1.00 10.26 ? 17   LEU B H    1 
ATOM   589  H  HA   . LEU B  2 17 ? -6.246  10.507  21.424 1.00 11.50 ? 17   LEU B HA   1 
ATOM   590  H  HB2  . LEU B  2 17 ? -4.606  9.880   19.904 1.00 13.45 ? 17   LEU B HB2  1 
ATOM   591  H  HB3  . LEU B  2 17 ? -5.473  10.453  18.536 1.00 13.44 ? 17   LEU B HB3  1 
ATOM   592  H  HG   . LEU B  2 17 ? -4.962  12.779  19.218 1.00 19.10 ? 17   LEU B HG   1 
ATOM   593  H  HD11 . LEU B  2 17 ? -3.348  11.378  21.325 1.00 20.71 ? 17   LEU B HD11 1 
ATOM   594  H  HD12 . LEU B  2 17 ? -3.238  13.092  20.931 1.00 20.84 ? 17   LEU B HD12 1 
ATOM   595  H  HD13 . LEU B  2 17 ? -4.720  12.430  21.637 1.00 20.60 ? 17   LEU B HD13 1 
ATOM   596  H  HD21 . LEU B  2 17 ? -3.493  12.052  17.629 1.00 18.68 ? 17   LEU B HD21 1 
ATOM   597  H  HD22 . LEU B  2 17 ? -2.393  12.394  18.971 1.00 20.86 ? 17   LEU B HD22 1 
ATOM   598  H  HD23 . LEU B  2 17 ? -2.892  10.743  18.635 1.00 19.97 ? 17   LEU B HD23 1 
ATOM   599  N  N    . VAL B  2 18 ? -7.876  12.197  19.126 1.00 10.75 ? 18   VAL B N    1 
ATOM   600  C  CA   . VAL B  2 18 ? -8.583  13.431  18.872 1.00 11.65 ? 18   VAL B CA   1 
ATOM   601  C  C    . VAL B  2 18 ? -9.795  13.644  19.752 1.00 11.67 ? 18   VAL B C    1 
ATOM   602  O  O    . VAL B  2 18 ? -10.047 14.769  20.212 1.00 14.83 ? 18   VAL B O    1 
ATOM   603  C  CB   . VAL B  2 18 ? -9.017  13.521  17.370 1.00 13.90 ? 18   VAL B CB   1 
ATOM   604  C  CG1  . VAL B  2 18 ? -10.035 14.678  17.161 1.00 14.40 ? 18   VAL B CG1  1 
ATOM   605  C  CG2  . VAL B  2 18 ? -7.774  13.704  16.521 1.00 15.93 ? 18   VAL B CG2  1 
ATOM   606  H  H    . VAL B  2 18 ? -7.775  11.506  18.435 1.00 10.62 ? 18   VAL B H    1 
ATOM   607  H  HA   . VAL B  2 18 ? -7.827  14.214  19.017 1.00 11.31 ? 18   VAL B HA   1 
ATOM   608  H  HB   . VAL B  2 18 ? -9.513  12.617  17.095 1.00 12.14 ? 18   VAL B HB   1 
ATOM   609  H  HG11 . VAL B  2 18 ? -9.590  15.588  17.546 1.00 13.21 ? 18   VAL B HG11 1 
ATOM   610  H  HG12 . VAL B  2 18 ? -10.328 14.770  16.126 1.00 13.60 ? 18   VAL B HG12 1 
ATOM   611  H  HG13 . VAL B  2 18 ? -10.926 14.474  17.736 1.00 14.03 ? 18   VAL B HG13 1 
ATOM   612  H  HG21 . VAL B  2 18 ? -8.047  13.652  15.470 1.00 15.41 ? 18   VAL B HG21 1 
ATOM   613  H  HG22 . VAL B  2 18 ? -7.305  14.637  16.771 1.00 15.59 ? 18   VAL B HG22 1 
ATOM   614  H  HG23 . VAL B  2 18 ? -7.043  12.923  16.723 1.00 14.63 ? 18   VAL B HG23 1 
ATOM   615  N  N    . CYS B  2 19 ? -10.527 12.564  20.017 1.00 11.72 ? 19   CYS B N    1 
ATOM   616  C  CA   . CYS B  2 19 ? -11.792 12.695  20.733 1.00 13.60 ? 19   CYS B CA   1 
ATOM   617  C  C    . CYS B  2 19 ? -11.731 12.673  22.243 1.00 14.98 ? 19   CYS B C    1 
ATOM   618  O  O    . CYS B  2 19 ? -12.677 13.093  22.913 1.00 16.55 ? 19   CYS B O    1 
ATOM   619  C  CB   . CYS B  2 19 ? -12.779 11.654  20.217 1.00 12.27 ? 19   CYS B CB   1 
ATOM   620  S  SG   . CYS B  2 19 ? -13.124 11.832  18.443 1.00 12.33 ? 19   CYS B SG   1 
ATOM   621  H  H    . CYS B  2 19 ? -10.219 11.700  19.691 1.00 12.18 ? 19   CYS B H    1 
ATOM   622  H  HA   . CYS B  2 19 ? -12.134 13.641  20.369 1.00 11.75 ? 19   CYS B HA   1 
ATOM   623  H  HB2  . CYS B  2 19 ? -12.397 10.663  20.358 1.00 11.97 ? 19   CYS B HB2  1 
ATOM   624  H  HB3  . CYS B  2 19 ? -13.717 11.743  20.724 1.00 13.92 ? 19   CYS B HB3  1 
ATOM   625  N  N    . GLY B  2 20 ? -10.639 12.199  22.806 1.00 14.62 ? 20   GLY B N    1 
ATOM   626  C  CA   . GLY B  2 20 ? -10.541 12.248  24.250 1.00 17.64 ? 20   GLY B CA   1 
ATOM   627  C  C    . GLY B  2 20 ? -11.684 11.594  25.003 1.00 18.79 ? 20   GLY B C    1 
ATOM   628  O  O    . GLY B  2 20 ? -12.239 10.573  24.595 1.00 17.93 ? 20   GLY B O    1 
ATOM   629  H  H    . GLY B  2 20 ? -9.883  11.879  22.267 1.00 17.14 ? 20   GLY B H    1 
ATOM   630  H  HA2  . GLY B  2 20 ? -9.607  11.792  24.532 1.00 18.68 ? 20   GLY B HA2  1 
ATOM   631  H  HA3  . GLY B  2 20 ? -10.478 13.291  24.515 1.00 16.93 ? 20   GLY B HA3  1 
ATOM   632  N  N    . GLU B  2 21 ? -12.056 12.204  26.127 1.00 19.36 ? 21   GLU B N    1 
ATOM   633  C  CA   . GLU B  2 21 ? -13.089 11.618  26.975 1.00 20.77 ? 21   GLU B CA   1 
ATOM   634  C  C    . GLU B  2 21 ? -14.451 11.528  26.337 1.00 22.01 ? 21   GLU B C    1 
ATOM   635  O  O    . GLU B  2 21 ? -15.320 10.823  26.834 1.00 24.24 ? 21   GLU B O    1 
ATOM   636  C  CB   . GLU B  2 21 ? -13.212 12.369  28.306 1.00 24.82 ? 21   GLU B CB   1 
ATOM   637  C  CG   . GLU B  2 21 ? -13.941 13.678  28.206 1.00 28.58 ? 21   GLU B CG   1 
ATOM   638  C  CD   . GLU B  2 21 ? -14.159 14.294  29.572 1.00 33.22 ? 21   GLU B CD   1 
ATOM   639  O  OE1  . GLU B  2 21 ? -13.196 14.314  30.373 1.00 39.63 ? 21   GLU B OE1  1 
ATOM   640  O  OE2  . GLU B  2 21 ? -15.293 14.745  29.841 1.00 38.98 ? 21   GLU B OE2  1 
ATOM   641  H  H    . GLU B  2 21 ? -11.649 13.071  26.317 1.00 18.36 ? 21   GLU B H    1 
ATOM   642  H  HA   . GLU B  2 21 ? -12.775 10.613  27.229 1.00 21.82 ? 21   GLU B HA   1 
ATOM   643  H  HB2  . GLU B  2 21 ? -13.763 11.720  28.982 1.00 22.41 ? 21   GLU B HB2  1 
ATOM   644  H  HB3  . GLU B  2 21 ? -12.241 12.535  28.753 1.00 22.22 ? 21   GLU B HB3  1 
ATOM   645  H  HG2  . GLU B  2 21 ? -13.453 14.365  27.547 1.00 25.30 ? 21   GLU B HG2  1 
ATOM   646  H  HG3  . GLU B  2 21 ? -14.923 13.496  27.792 1.00 25.82 ? 21   GLU B HG3  1 
ATOM   647  N  N    . ARG B  2 22 ? -14.638 12.255  25.246 1.00 21.24 ? 22   ARG B N    1 
ATOM   648  C  CA   . ARG B  2 22 ? -15.903 12.229  24.513 1.00 22.63 ? 22   ARG B CA   1 
ATOM   649  C  C    . ARG B  2 22 ? -16.132 10.892  23.814 1.00 18.69 ? 22   ARG B C    1 
ATOM   650  O  O    . ARG B  2 22 ? -17.273 10.507  23.571 1.00 22.48 ? 22   ARG B O    1 
ATOM   651  C  CB   . ARG B  2 22 ? -15.926 13.294  23.406 1.00 24.59 ? 22   ARG B CB   1 
ATOM   652  C  CG   . ARG B  2 22 ? -15.860 14.735  23.854 1.00 26.30 ? 22   ARG B CG   1 
ATOM   653  C  CD   . ARG B  2 22 ? -15.734 15.654  22.647 1.00 27.43 ? 22   ARG B CD   1 
ATOM   654  N  NE   . ARG B  2 22 ? -14.354 15.755  22.169 1.00 30.13 ? 22   ARG B NE   1 
ATOM   655  C  CZ   . ARG B  2 22 ? -13.991 16.381  21.053 1.00 28.99 ? 22   ARG B CZ   1 
ATOM   656  N  NH1  . ARG B  2 22 ? -14.906 16.957  20.279 1.00 30.05 ? 22   ARG B NH1  1 
ATOM   657  N  NH2  . ARG B  2 22 ? -12.707 16.457  20.721 1.00 30.26 ? 22   ARG B NH2  1 
ATOM   658  H  H    . ARG B  2 22 ? -13.919 12.845  24.932 1.00 22.65 ? 22   ARG B H    1 
ATOM   659  H  HA   . ARG B  2 22 ? -16.709 12.446  25.195 1.00 21.84 ? 22   ARG B HA   1 
ATOM   660  H  HB2  . ARG B  2 22 ? -15.065 13.118  22.772 1.00 24.21 ? 22   ARG B HB2  1 
ATOM   661  H  HB3  . ARG B  2 22 ? -16.791 13.164  22.782 1.00 24.73 ? 22   ARG B HB3  1 
ATOM   662  H  HG2  . ARG B  2 22 ? -16.762 14.986  24.385 1.00 25.90 ? 22   ARG B HG2  1 
ATOM   663  H  HG3  . ARG B  2 22 ? -14.987 14.877  24.486 1.00 26.48 ? 22   ARG B HG3  1 
ATOM   664  H  HD2  . ARG B  2 22 ? -16.400 15.340  21.861 1.00 26.61 ? 22   ARG B HD2  1 
ATOM   665  H  HD3  . ARG B  2 22 ? -16.057 16.632  22.973 1.00 27.71 ? 22   ARG B HD3  1 
ATOM   666  H  HE   . ARG B  2 22 ? -13.647 15.308  22.678 1.00 28.48 ? 22   ARG B HE   1 
ATOM   667  H  HH11 . ARG B  2 22 ? -15.877 16.916  20.531 1.00 27.65 ? 22   ARG B HH11 1 
ATOM   668  H  HH12 . ARG B  2 22 ? -14.619 17.426  19.441 1.00 27.90 ? 22   ARG B HH12 1 
ATOM   669  H  HH21 . ARG B  2 22 ? -12.011 16.051  21.304 1.00 28.42 ? 22   ARG B HH21 1 
ATOM   670  H  HH22 . ARG B  2 22 ? -12.432 16.925  19.879 1.00 28.32 ? 22   ARG B HH22 1 
ATOM   671  N  N    . GLY B  2 23 ? -15.068 10.163  23.490 1.00 16.87 ? 23   GLY B N    1 
ATOM   672  C  CA   . GLY B  2 23 ? -15.274 8.958   22.704 1.00 16.21 ? 23   GLY B CA   1 
ATOM   673  C  C    . GLY B  2 23 ? -15.638 9.309   21.259 1.00 13.39 ? 23   GLY B C    1 
ATOM   674  O  O    . GLY B  2 23 ? -15.688 10.470  20.846 1.00 13.10 ? 23   GLY B O    1 
ATOM   675  H  H    . GLY B  2 23 ? -14.170 10.403  23.798 1.00 18.64 ? 23   GLY B H    1 
ATOM   676  H  HA2  . GLY B  2 23 ? -14.396 8.339   22.674 1.00 15.10 ? 23   GLY B HA2  1 
ATOM   677  H  HA3  . GLY B  2 23 ? -16.090 8.373   23.095 1.00 15.59 ? 23   GLY B HA3  1 
ATOM   678  N  N    . PHE B  2 24 ? -15.938 8.274   20.507 1.00 12.42 ? 24   PHE B N    1 
ATOM   679  C  CA   . PHE B  2 24 ? -16.191 8.423   19.063 1.00 11.79 ? 24   PHE B CA   1 
ATOM   680  C  C    . PHE B  2 24 ? -16.966 7.235   18.571 1.00 12.25 ? 24   PHE B C    1 
ATOM   681  O  O    . PHE B  2 24 ? -17.248 6.295   19.322 1.00 13.08 ? 24   PHE B O    1 
ATOM   682  C  CB   . PHE B  2 24 ? -14.827 8.496   18.318 1.00 10.18 ? 24   PHE B CB   1 
ATOM   683  C  CG   . PHE B  2 24 ? -13.984 7.248   18.454 1.00 10.90 ? 24   PHE B CG   1 
ATOM   684  C  CD1  . PHE B  2 24 ? -14.115 6.199   17.568 1.00 10.48 ? 24   PHE B CD1  1 
ATOM   685  C  CD2  . PHE B  2 24 ? -13.049 7.160   19.487 1.00 9.92  ? 24   PHE B CD2  1 
ATOM   686  C  CE1  . PHE B  2 24 ? -13.313 5.071   17.719 1.00 9.77  ? 24   PHE B CE1  1 
ATOM   687  C  CE2  . PHE B  2 24 ? -12.256 6.052   19.636 1.00 10.60 ? 24   PHE B CE2  1 
ATOM   688  C  CZ   . PHE B  2 24 ? -12.376 5.024   18.779 1.00 11.74 ? 24   PHE B CZ   1 
ATOM   689  H  H    . PHE B  2 24 ? -16.101 7.382   20.877 1.00 9.95  ? 24   PHE B H    1 
ATOM   690  H  HA   . PHE B  2 24 ? -16.744 9.324   18.842 1.00 12.62 ? 24   PHE B HA   1 
ATOM   691  H  HB2  . PHE B  2 24 ? -15.020 8.784   17.277 1.00 11.68 ? 24   PHE B HB2  1 
ATOM   692  H  HB3  . PHE B  2 24 ? -14.300 9.345   18.698 1.00 9.71  ? 24   PHE B HB3  1 
ATOM   693  H  HD1  . PHE B  2 24 ? -14.827 6.227   16.753 1.00 11.19 ? 24   PHE B HD1  1 
ATOM   694  H  HD2  . PHE B  2 24 ? -12.923 7.964   20.191 1.00 7.51  ? 24   PHE B HD2  1 
ATOM   695  H  HE1  . PHE B  2 24 ? -13.413 4.254   17.033 1.00 11.06 ? 24   PHE B HE1  1 
ATOM   696  H  HE2  . PHE B  2 24 ? -11.541 6.016   20.445 1.00 11.46 ? 24   PHE B HE2  1 
ATOM   697  H  HZ   . PHE B  2 24 ? -11.758 4.151   18.897 1.00 12.62 ? 24   PHE B HZ   1 
ATOM   698  N  N    . PHE B  2 25 ? -17.308 7.283   17.287 1.00 11.93 ? 25   PHE B N    1 
ATOM   699  C  CA   . PHE B  2 25 ? -17.926 6.142   16.633 1.00 11.22 ? 25   PHE B CA   1 
ATOM   700  C  C    . PHE B  2 25 ? -17.155 5.869   15.331 1.00 11.96 ? 25   PHE B C    1 
ATOM   701  O  O    . PHE B  2 25 ? -16.717 6.797   14.655 1.00 13.41 ? 25   PHE B O    1 
ATOM   702  C  CB   . PHE B  2 25 ? -19.431 6.358   16.355 1.00 13.14 ? 25   PHE B CB   1 
ATOM   703  C  CG   . PHE B  2 25 ? -19.754 7.655   15.660 1.00 14.95 ? 25   PHE B CG   1 
ATOM   704  C  CD1  . PHE B  2 25 ? -19.873 8.819   16.387 1.00 15.86 ? 25   PHE B CD1  1 
ATOM   705  C  CD2  . PHE B  2 25 ? -19.905 7.721   14.276 1.00 19.07 ? 25   PHE B CD2  1 
ATOM   706  C  CE1  . PHE B  2 25 ? -20.135 10.044  15.782 1.00 19.79 ? 25   PHE B CE1  1 
ATOM   707  C  CE2  . PHE B  2 25 ? -20.173 8.965   13.665 1.00 17.63 ? 25   PHE B CE2  1 
ATOM   708  C  CZ   . PHE B  2 25 ? -20.281 10.098  14.436 1.00 19.24 ? 25   PHE B CZ   1 
ATOM   709  H  H    . PHE B  2 25 ? -17.047 8.065   16.775 1.00 12.88 ? 25   PHE B H    1 
ATOM   710  H  HA   . PHE B  2 25 ? -17.794 5.238   17.217 1.00 13.27 ? 25   PHE B HA   1 
ATOM   711  H  HB2  . PHE B  2 25 ? -19.817 5.435   15.968 1.00 12.56 ? 25   PHE B HB2  1 
ATOM   712  H  HB3  . PHE B  2 25 ? -19.816 6.355   17.355 1.00 14.72 ? 25   PHE B HB3  1 
ATOM   713  H  HD1  . PHE B  2 25 ? -19.760 8.807   17.455 1.00 17.39 ? 25   PHE B HD1  1 
ATOM   714  H  HD2  . PHE B  2 25 ? -19.812 6.809   13.709 1.00 12.88 ? 25   PHE B HD2  1 
ATOM   715  H  HE1  . PHE B  2 25 ? -20.218 10.931  16.389 1.00 17.57 ? 25   PHE B HE1  1 
ATOM   716  H  HE2  . PHE B  2 25 ? -20.291 9.044   12.606 1.00 19.52 ? 25   PHE B HE2  1 
ATOM   717  H  HZ   . PHE B  2 25 ? -20.484 11.064  13.974 1.00 20.65 ? 25   PHE B HZ   1 
ATOM   718  N  N    . TYR B  2 26 ? -16.907 4.593   15.051 1.00 11.33 ? 26   TYR B N    1 
ATOM   719  C  CA   . TYR B  2 26 ? -16.224 4.152   13.849 1.00 11.34 ? 26   TYR B CA   1 
ATOM   720  C  C    . TYR B  2 26 ? -17.241 3.271   13.158 1.00 12.80 ? 26   TYR B C    1 
ATOM   721  O  O    . TYR B  2 26 ? -17.538 2.150   13.583 1.00 13.63 ? 26   TYR B O    1 
ATOM   722  C  CB   . TYR B  2 26 ? -14.961 3.352   14.187 1.00 12.33 ? 26   TYR B CB   1 
ATOM   723  C  CG   . TYR B  2 26 ? -14.317 2.778   12.969 1.00 12.78 ? 26   TYR B CG   1 
ATOM   724  C  CD1  . TYR B  2 26 ? -13.770 3.597   11.997 1.00 14.09 ? 26   TYR B CD1  1 
ATOM   725  C  CD2  . TYR B  2 26 ? -14.265 1.406   12.763 1.00 14.37 ? 26   TYR B CD2  1 
ATOM   726  C  CE1  . TYR B  2 26 ? -13.191 3.072   10.839 1.00 14.12 ? 26   TYR B CE1  1 
ATOM   727  C  CE2  . TYR B  2 26 ? -13.695 0.876   11.641 1.00 15.74 ? 26   TYR B CE2  1 
ATOM   728  C  CZ   . TYR B  2 26 ? -13.162 1.712   10.685 1.00 15.96 ? 26   TYR B CZ   1 
ATOM   729  O  OH   . TYR B  2 26 ? -12.591 1.183   9.544  1.00 20.90 ? 26   TYR B OH   1 
ATOM   730  H  H    . TYR B  2 26 ? -17.272 3.895   15.624 1.00 8.60  ? 26   TYR B H    1 
ATOM   731  H  HA   . TYR B  2 26 ? -15.987 5.014   13.245 1.00 12.26 ? 26   TYR B HA   1 
ATOM   732  H  HB2  . TYR B  2 26 ? -14.280 4.062   14.606 1.00 13.13 ? 26   TYR B HB2  1 
ATOM   733  H  HB3  . TYR B  2 26 ? -15.176 2.568   14.898 1.00 13.39 ? 26   TYR B HB3  1 
ATOM   734  H  HD1  . TYR B  2 26 ? -13.791 4.676   12.130 1.00 12.60 ? 26   TYR B HD1  1 
ATOM   735  H  HD2  . TYR B  2 26 ? -14.676 0.728   13.497 1.00 14.16 ? 26   TYR B HD2  1 
ATOM   736  H  HE1  . TYR B  2 26 ? -12.776 3.738   10.107 1.00 15.00 ? 26   TYR B HE1  1 
ATOM   737  H  HE2  . TYR B  2 26 ? -13.665 -0.191  11.509 1.00 14.89 ? 26   TYR B HE2  1 
ATOM   738  H  HH   . TYR B  2 26 ? -12.781 0.248   9.448  1.00 19.78 ? 26   TYR B HH   1 
ATOM   739  N  N    A THR B  2 27 ? -17.765 3.825   12.067 0.50 12.82 ? 27   THR B N    1 
ATOM   740  N  N    B THR B  2 27 ? -17.787 3.748   12.056 0.50 11.29 ? 27   THR B N    1 
ATOM   741  C  CA   A THR B  2 27 ? -18.788 3.210   11.222 0.50 14.11 ? 27   THR B CA   1 
ATOM   742  C  CA   B THR B  2 27 ? -18.832 2.986   11.350 0.50 13.94 ? 27   THR B CA   1 
ATOM   743  C  C    A THR B  2 27 ? -18.240 3.150   9.797  0.50 17.04 ? 27   THR B C    1 
ATOM   744  C  C    B THR B  2 27 ? -18.436 3.002   9.871  0.50 12.38 ? 27   THR B C    1 
ATOM   745  O  O    A THR B  2 27 ? -18.398 4.090   9.014  0.50 15.82 ? 27   THR B O    1 
ATOM   746  O  O    B THR B  2 27 ? -18.937 3.832   9.101  0.50 17.24 ? 27   THR B O    1 
ATOM   747  C  CB   A THR B  2 27 ? -20.085 4.045   11.207 0.50 16.06 ? 27   THR B CB   1 
ATOM   748  C  CB   B THR B  2 27 ? -20.179 3.664   11.620 0.50 12.16 ? 27   THR B CB   1 
ATOM   749  O  OG1  A THR B  2 27 ? -20.577 4.192   12.540 0.50 15.92 ? 27   THR B OG1  1 
ATOM   750  O  OG1  B THR B  2 27 ? -20.018 5.079   11.503 0.50 17.04 ? 27   THR B OG1  1 
ATOM   751  C  CG2  A THR B  2 27 ? -21.151 3.359   10.357 0.50 18.96 ? 27   THR B CG2  1 
ATOM   752  C  CG2  B THR B  2 27 ? -20.647 3.344   13.053 0.50 14.34 ? 27   THR B CG2  1 
ATOM   753  H  H    A THR B  2 27 ? -17.419 4.697   11.815 0.50 14.57 ? 27   THR B H    1 
ATOM   754  H  H    B THR B  2 27 ? -17.443 4.650   11.813 0.50 14.49 ? 27   THR B H    1 
ATOM   755  H  HA   A THR B  2 27 ? -19.004 2.216   11.597 0.50 15.53 ? 27   THR B HA   1 
ATOM   756  H  HA   B THR B  2 27 ? -18.856 1.965   11.740 0.50 13.23 ? 27   THR B HA   1 
ATOM   757  H  HB   A THR B  2 27 ? -19.868 5.016   10.789 0.50 17.95 ? 27   THR B HB   1 
ATOM   758  H  HB   B THR B  2 27 ? -20.930 3.314   10.924 0.50 16.00 ? 27   THR B HB   1 
ATOM   759  H  HG1  A THR B  2 27 ? -20.746 3.327   12.920 0.50 17.68 ? 27   THR B HG1  1 
ATOM   760  H  HG1  B THR B  2 27 ? -19.695 5.315   10.627 0.50 18.13 ? 27   THR B HG1  1 
ATOM   761  H  HG21 A THR B  2 27 ? -21.354 2.393   10.785 0.50 19.57 ? 27   THR B HG21 1 
ATOM   762  H  HG21 B THR B  2 27 ? -20.483 4.175   13.719 0.50 15.89 ? 27   THR B HG21 1 
ATOM   763  H  HG22 A THR B  2 27 ? -22.056 3.952   10.378 0.50 19.74 ? 27   THR B HG22 1 
ATOM   764  H  HG22 B THR B  2 27 ? -21.709 3.133   12.996 0.50 15.96 ? 27   THR B HG22 1 
ATOM   765  H  HG23 A THR B  2 27 ? -20.817 3.229   9.335  0.50 19.27 ? 27   THR B HG23 1 
ATOM   766  H  HG23 B THR B  2 27 ? -20.132 2.469   13.412 0.50 15.55 ? 27   THR B HG23 1 
ATOM   767  N  N    . PRO B  2 28 ? -17.535 2.070   9.457  1.00 15.92 ? 28   PRO B N    1 
ATOM   768  C  CA   . PRO B  2 28 ? -16.978 1.932   8.101  1.00 17.67 ? 28   PRO B CA   1 
ATOM   769  C  C    . PRO B  2 28 ? -17.890 1.656   6.938  1.00 21.02 ? 28   PRO B C    1 
ATOM   770  O  O    . PRO B  2 28 ? -17.524 1.921   5.786  1.00 26.21 ? 28   PRO B O    1 
ATOM   771  C  CB   . PRO B  2 28 ? -15.902 0.878   8.274  1.00 19.88 ? 28   PRO B CB   1 
ATOM   772  C  CG   . PRO B  2 28 ? -16.467 -0.014  9.303  1.00 16.77 ? 28   PRO B CG   1 
ATOM   773  C  CD   . PRO B  2 28 ? -17.152 0.914   10.298 1.00 17.25 ? 28   PRO B CD   1 
ATOM   774  H  HA   . PRO B  2 28 ? -16.470 2.851   7.870  1.00 18.47 ? 28   PRO B HA   1 
ATOM   775  H  HB2  . PRO B  2 28 ? -15.762 0.330   7.344  1.00 19.64 ? 28   PRO B HB2  1 
ATOM   776  H  HB3  . PRO B  2 28 ? -14.984 1.330   8.617  1.00 19.31 ? 28   PRO B HB3  1 
ATOM   777  H  HG2  . PRO B  2 28 ? -17.142 -0.737  8.853  1.00 18.79 ? 28   PRO B HG2  1 
ATOM   778  H  HG3  . PRO B  2 28 ? -15.636 -0.520  9.773  1.00 18.01 ? 28   PRO B HG3  1 
ATOM   779  H  HD2  . PRO B  2 28 ? -17.988 0.406   10.738 1.00 16.68 ? 28   PRO B HD2  1 
ATOM   780  H  HD3  . PRO B  2 28 ? -16.480 1.204   11.087 1.00 17.85 ? 28   PRO B HD3  1 
ATOM   781  N  N    A LYS B  2 29 ? -19.078 1.141   7.216  0.60 20.12 ? 29   LYS B N    1 
ATOM   782  N  N    B LYS B  2 29 ? -19.076 1.137   7.216  0.40 20.52 ? 29   LYS B N    1 
ATOM   783  C  CA   A LYS B  2 29 ? -20.014 0.840   6.143  0.60 22.29 ? 29   LYS B CA   1 
ATOM   784  C  CA   B LYS B  2 29 ? -20.019 0.854   6.147  0.40 21.93 ? 29   LYS B CA   1 
ATOM   785  C  C    A LYS B  2 29 ? -20.952 1.999   5.851  0.60 24.38 ? 29   LYS B C    1 
ATOM   786  C  C    B LYS B  2 29 ? -20.979 2.020   6.001  0.40 23.55 ? 29   LYS B C    1 
ATOM   787  O  O    A LYS B  2 29 ? -21.880 1.860   5.049  0.60 26.95 ? 29   LYS B O    1 
ATOM   788  O  O    B LYS B  2 29 ? -21.845 2.230   6.854  0.40 25.88 ? 29   LYS B O    1 
ATOM   789  C  CB   A LYS B  2 29 ? -20.816 -0.402  6.492  0.60 23.81 ? 29   LYS B CB   1 
ATOM   790  C  CB   B LYS B  2 29 ? -20.787 -0.419  6.453  0.40 22.91 ? 29   LYS B CB   1 
ATOM   791  H  H    A LYS B  2 29 ? -19.324 0.934   8.137  0.60 21.01 ? 29   LYS B H    1 
ATOM   792  H  H    B LYS B  2 29 ? -19.322 0.934   8.139  0.40 21.01 ? 29   LYS B H    1 
ATOM   793  H  HA   A LYS B  2 29 ? -19.448 0.626   5.253  0.60 22.72 ? 29   LYS B HA   1 
ATOM   794  H  HA   B LYS B  2 29 ? -19.483 0.728   5.217  0.40 22.10 ? 29   LYS B HA   1 
ATOM   795  N  N    A THR B  2 30 ? -20.724 3.138   6.499  0.60 25.58 ? 30   THR B N    1 
ATOM   796  N  N    B THR B  2 30 ? -20.813 2.773   4.916  0.40 24.94 ? 30   THR B N    1 
ATOM   797  C  CA   A THR B  2 30 ? -21.571 4.304   6.261  0.60 27.33 ? 30   THR B CA   1 
ATOM   798  C  CA   B THR B  2 30 ? -21.655 3.921   4.622  0.40 27.11 ? 30   THR B CA   1 
ATOM   799  C  C    A THR B  2 30 ? -21.044 5.116   5.076  0.60 30.48 ? 30   THR B C    1 
ATOM   800  C  C    B THR B  2 30 ? -21.914 3.955   3.120  0.40 29.78 ? 30   THR B C    1 
ATOM   801  O  O    A THR B  2 30 ? -21.084 6.360   5.157  0.60 33.25 ? 30   THR B O    1 
ATOM   802  O  O    B THR B  2 30 ? -21.540 4.962   2.485  0.40 32.43 ? 30   THR B O    1 
ATOM   803  C  CB   A THR B  2 30 ? -21.625 5.178   7.506  0.60 26.77 ? 30   THR B CB   1 
ATOM   804  C  CB   B THR B  2 30 ? -20.962 5.206   5.065  0.40 26.53 ? 30   THR B CB   1 
ATOM   805  O  OXT  A THR B  2 30 ? -20.613 4.501   4.074  0.60 34.05 ? 30   THR B OXT  1 
ATOM   806  O  OXT  B THR B  2 30 ? -22.483 2.970   2.598  0.40 32.41 ? 30   THR B OXT  1 
ATOM   807  H  H    A THR B  2 30 ? -20.005 3.180   7.164  0.60 25.40 ? 30   THR B H    1 
ATOM   808  H  H    B THR B  2 30 ? -20.098 2.548   4.281  0.40 25.01 ? 30   THR B H    1 
ATOM   809  H  HA   A THR B  2 30 ? -22.571 3.968   6.026  0.60 27.13 ? 30   THR B HA   1 
ATOM   810  H  HA   B THR B  2 30 ? -22.600 3.820   5.139  0.40 27.13 ? 30   THR B HA   1 
ATOM   811  N  N    . GLY C  1 1  ? -20.027 -0.316  31.603 1.00 27.48 ? 1    GLY C N    1 
ATOM   812  C  CA   . GLY C  1 1  ? -19.376 0.241   30.372 1.00 24.11 ? 1    GLY C CA   1 
ATOM   813  C  C    . GLY C  1 1  ? -18.163 -0.585  30.015 1.00 21.79 ? 1    GLY C C    1 
ATOM   814  O  O    . GLY C  1 1  ? -17.698 -1.395  30.826 1.00 21.01 ? 1    GLY C O    1 
ATOM   815  H  H1   . GLY C  1 1  ? -20.327 -1.292  31.404 1.00 25.74 ? 1    GLY C H1   1 
ATOM   816  H  H2   . GLY C  1 1  ? -19.361 -0.298  32.401 1.00 26.11 ? 1    GLY C H2   1 
ATOM   817  H  H3   . GLY C  1 1  ? -20.873 0.250   31.826 1.00 26.66 ? 1    GLY C H3   1 
ATOM   818  H  HA2  . GLY C  1 1  ? -20.076 0.196   29.555 1.00 24.10 ? 1    GLY C HA2  1 
ATOM   819  H  HA3  . GLY C  1 1  ? -19.074 1.267   30.523 1.00 24.37 ? 1    GLY C HA3  1 
ATOM   820  N  N    . ILE C  1 2  ? -17.628 -0.371  28.816 1.00 20.64 ? 2    ILE C N    1 
ATOM   821  C  CA   . ILE C  1 2  ? -16.479 -1.148  28.372 1.00 17.85 ? 2    ILE C CA   1 
ATOM   822  C  C    . ILE C  1 2  ? -15.241 -0.938  29.232 1.00 17.65 ? 2    ILE C C    1 
ATOM   823  O  O    . ILE C  1 2  ? -14.499 -1.876  29.446 1.00 16.84 ? 2    ILE C O    1 
ATOM   824  C  CB   . ILE C  1 2  ? -16.118 -0.867  26.880 1.00 18.66 ? 2    ILE C CB   1 
ATOM   825  C  CG1  . ILE C  1 2  ? -15.171 -1.946  26.359 1.00 18.17 ? 2    ILE C CG1  1 
ATOM   826  C  CG2  . ILE C  1 2  ? -15.537 0.535   26.727 1.00 20.57 ? 2    ILE C CG2  1 
ATOM   827  C  CD1  . ILE C  1 2  ? -14.809 -1.776  24.881 1.00 17.32 ? 2    ILE C CD1  1 
ATOM   828  H  H    . ILE C  1 2  ? -17.990 0.307   28.208 1.00 20.13 ? 2    ILE C H    1 
ATOM   829  H  HA   . ILE C  1 2  ? -16.725 -2.201  28.443 1.00 19.48 ? 2    ILE C HA   1 
ATOM   830  H  HB   . ILE C  1 2  ? -17.033 -0.889  26.293 1.00 19.79 ? 2    ILE C HB   1 
ATOM   831  H  HG12 . ILE C  1 2  ? -14.250 -1.902  26.922 1.00 18.09 ? 2    ILE C HG12 1 
ATOM   832  H  HG13 . ILE C  1 2  ? -15.600 -2.919  26.487 1.00 17.65 ? 2    ILE C HG13 1 
ATOM   833  H  HG21 . ILE C  1 2  ? -14.558 0.585   27.184 1.00 21.17 ? 2    ILE C HG21 1 
ATOM   834  H  HG22 . ILE C  1 2  ? -15.428 0.769   25.677 1.00 20.56 ? 2    ILE C HG22 1 
ATOM   835  H  HG23 . ILE C  1 2  ? -16.169 1.275   27.190 1.00 19.16 ? 2    ILE C HG23 1 
ATOM   836  H  HD11 . ILE C  1 2  ? -15.670 -1.358  24.368 1.00 17.85 ? 2    ILE C HD11 1 
ATOM   837  H  HD12 . ILE C  1 2  ? -14.541 -2.721  24.430 1.00 16.88 ? 2    ILE C HD12 1 
ATOM   838  H  HD13 . ILE C  1 2  ? -13.987 -1.059  24.819 1.00 17.01 ? 2    ILE C HD13 1 
ATOM   839  N  N    . VAL C  1 3  ? -15.011 0.287   29.705 1.00 18.07 ? 3    VAL C N    1 
ATOM   840  C  CA   . VAL C  1 3  ? -13.839 0.532   30.547 1.00 19.78 ? 3    VAL C CA   1 
ATOM   841  C  C    . VAL C  1 3  ? -13.993 -0.247  31.858 1.00 18.33 ? 3    VAL C C    1 
ATOM   842  O  O    . VAL C  1 3  ? -13.078 -0.931  32.287 1.00 20.41 ? 3    VAL C O    1 
ATOM   843  C  CB   . VAL C  1 3  ? -13.657 2.023   30.873 1.00 21.65 ? 3    VAL C CB   1 
ATOM   844  C  CG1  . VAL C  1 3  ? -12.497 2.194   31.875 1.00 22.07 ? 3    VAL C CG1  1 
ATOM   845  C  CG2  . VAL C  1 3  ? -13.354 2.791   29.602 1.00 24.42 ? 3    VAL C CG2  1 
ATOM   846  H  H    . VAL C  1 3  ? -15.660 0.999   29.539 1.00 19.08 ? 3    VAL C H    1 
ATOM   847  H  HA   . VAL C  1 3  ? -12.958 0.164   30.044 1.00 19.22 ? 3    VAL C HA   1 
ATOM   848  H  HB   . VAL C  1 3  ? -14.593 2.376   31.282 1.00 22.55 ? 3    VAL C HB   1 
ATOM   849  H  HG11 . VAL C  1 3  ? -11.581 1.790   31.497 1.00 22.13 ? 3    VAL C HG11 1 
ATOM   850  H  HG12 . VAL C  1 3  ? -12.364 3.254   32.046 1.00 23.30 ? 3    VAL C HG12 1 
ATOM   851  H  HG13 . VAL C  1 3  ? -12.730 1.738   32.823 1.00 21.73 ? 3    VAL C HG13 1 
ATOM   852  H  HG21 . VAL C  1 3  ? -14.244 2.855   28.987 1.00 22.89 ? 3    VAL C HG21 1 
ATOM   853  H  HG22 . VAL C  1 3  ? -13.041 3.789   29.884 1.00 23.48 ? 3    VAL C HG22 1 
ATOM   854  H  HG23 . VAL C  1 3  ? -12.566 2.303   29.041 1.00 21.59 ? 3    VAL C HG23 1 
ATOM   855  N  N    . GLU C  1 4  ? -15.171 -0.166  32.471 1.00 22.13 ? 4    GLU C N    1 
ATOM   856  C  CA   . GLU C  1 4  ? -15.415 -0.896  33.712 1.00 22.36 ? 4    GLU C CA   1 
ATOM   857  C  C    . GLU C  1 4  ? -15.286 -2.408  33.544 1.00 23.88 ? 4    GLU C C    1 
ATOM   858  O  O    . GLU C  1 4  ? -14.770 -3.102  34.412 1.00 28.53 ? 4    GLU C O    1 
ATOM   859  C  CB   . GLU C  1 4  ? -16.808 -0.582  34.250 1.00 25.23 ? 4    GLU C CB   1 
ATOM   860  C  CG   . GLU C  1 4  ? -16.959 0.839   34.778 1.00 29.06 ? 4    GLU C CG   1 
ATOM   861  C  CD   . GLU C  1 4  ? -17.070 1.883   33.693 1.00 31.20 ? 4    GLU C CD   1 
ATOM   862  O  OE1  . GLU C  1 4  ? -16.893 3.080   34.013 1.00 33.41 ? 4    GLU C OE1  1 
ATOM   863  O  OE2  . GLU C  1 4  ? -17.348 1.513   32.535 1.00 30.58 ? 4    GLU C OE2  1 
ATOM   864  H  H    . GLU C  1 4  ? -15.841 0.424   32.077 1.00 18.77 ? 4    GLU C H    1 
ATOM   865  H  HA   . GLU C  1 4  ? -14.697 -0.541  34.426 1.00 19.97 ? 4    GLU C HA   1 
ATOM   866  H  HB2  . GLU C  1 4  ? -17.566 -0.762  33.505 1.00 19.74 ? 4    GLU C HB2  1 
ATOM   867  H  HB3  . GLU C  1 4  ? -16.969 -1.258  35.086 1.00 20.26 ? 4    GLU C HB3  1 
ATOM   868  H  HG2  . GLU C  1 4  ? -17.886 0.942   35.329 1.00 20.79 ? 4    GLU C HG2  1 
ATOM   869  H  HG3  . GLU C  1 4  ? -16.078 1.064   35.371 1.00 20.90 ? 4    GLU C HG3  1 
ATOM   870  N  N    . GLN C  1 5  ? -15.726 -2.931  32.407 1.00 20.36 ? 5    GLN C N    1 
ATOM   871  C  CA   . GLN C  1 5  ? -15.659 -4.358  32.218 1.00 19.17 ? 5    GLN C CA   1 
ATOM   872  C  C    . GLN C  1 5  ? -14.386 -4.916  31.599 1.00 20.40 ? 5    GLN C C    1 
ATOM   873  O  O    . GLN C  1 5  ? -13.981 -6.042  31.909 1.00 25.17 ? 5    GLN C O    1 
ATOM   874  C  CB   . GLN C  1 5  ? -16.805 -4.833  31.344 1.00 22.07 ? 5    GLN C CB   1 
ATOM   875  C  CG   . GLN C  1 5  ? -16.791 -6.337  31.243 1.00 25.35 ? 5    GLN C CG   1 
ATOM   876  C  CD   . GLN C  1 5  ? -17.651 -6.875  30.140 1.00 27.05 ? 5    GLN C CD   1 
ATOM   877  O  OE1  . GLN C  1 5  ? -17.820 -8.091  30.015 1.00 32.28 ? 5    GLN C OE1  1 
ATOM   878  N  NE2  . GLN C  1 5  ? -18.194 -5.985  29.321 1.00 29.82 ? 5    GLN C NE2  1 
ATOM   879  H  H    . GLN C  1 5  ? -16.099 -2.354  31.707 1.00 19.12 ? 5    GLN C H    1 
ATOM   880  H  HA   . GLN C  1 5  ? -15.825 -4.850  33.178 1.00 19.29 ? 5    GLN C HA   1 
ATOM   881  H  HB2  . GLN C  1 5  ? -17.805 -4.474  31.659 1.00 19.01 ? 5    GLN C HB2  1 
ATOM   882  H  HB3  . GLN C  1 5  ? -16.658 -4.445  30.357 1.00 19.31 ? 5    GLN C HB3  1 
ATOM   883  H  HG2  . GLN C  1 5  ? -15.830 -6.784  31.073 1.00 19.98 ? 5    GLN C HG2  1 
ATOM   884  H  HG3  . GLN C  1 5  ? -17.224 -6.711  32.163 1.00 20.44 ? 5    GLN C HG3  1 
ATOM   885  H  HE21 . GLN C  1 5  ? -17.986 -5.045  29.506 1.00 19.99 ? 5    GLN C HE21 1 
ATOM   886  H  HE22 . GLN C  1 5  ? -18.786 -6.210  28.589 1.00 19.88 ? 5    GLN C HE22 1 
ATOM   887  N  N    . CYS C  1 6  ? -13.745 -4.139  30.730 1.00 14.81 ? 6    CYS C N    1 
ATOM   888  C  CA   . CYS C  1 6  ? -12.613 -4.674  29.998 1.00 13.18 ? 6    CYS C CA   1 
ATOM   889  C  C    . CYS C  1 6  ? -11.235 -4.079  30.284 1.00 14.06 ? 6    CYS C C    1 
ATOM   890  O  O    . CYS C  1 6  ? -10.261 -4.433  29.608 1.00 15.36 ? 6    CYS C O    1 
ATOM   891  C  CB   . CYS C  1 6  ? -12.935 -4.617  28.501 1.00 13.15 ? 6    CYS C CB   1 
ATOM   892  S  SG   . CYS C  1 6  ? -14.467 -5.519  28.051 1.00 15.23 ? 6    CYS C SG   1 
ATOM   893  H  H    . CYS C  1 6  ? -14.040 -3.220  30.649 1.00 14.96 ? 6    CYS C H    1 
ATOM   894  H  HA   . CYS C  1 6  ? -12.502 -5.719  30.215 1.00 14.90 ? 6    CYS C HA   1 
ATOM   895  H  HB2  . CYS C  1 6  ? -13.023 -3.572  28.266 1.00 14.37 ? 6    CYS C HB2  1 
ATOM   896  H  HB3  . CYS C  1 6  ? -12.104 -5.035  27.972 1.00 14.61 ? 6    CYS C HB3  1 
ATOM   897  N  N    . CYS C  1 7  ? -11.184 -3.171  31.248 1.00 15.85 ? 7    CYS C N    1 
ATOM   898  C  CA   . CYS C  1 7  ? -9.893  -2.646  31.703 1.00 15.26 ? 7    CYS C CA   1 
ATOM   899  C  C    . CYS C  1 7  ? -9.509  -3.378  32.981 1.00 20.28 ? 7    CYS C C    1 
ATOM   900  O  O    . CYS C  1 7  ? -8.352  -3.759  33.142 1.00 23.99 ? 7    CYS C O    1 
ATOM   901  C  CB   . CYS C  1 7  ? -9.904  -1.143  31.938 1.00 14.71 ? 7    CYS C CB   1 
ATOM   902  S  SG   . CYS C  1 7  ? -10.046 -0.276  30.355 1.00 15.67 ? 7    CYS C SG   1 
ATOM   903  H  H    . CYS C  1 7  ? -11.999 -2.796  31.630 1.00 15.96 ? 7    CYS C H    1 
ATOM   904  H  HA   . CYS C  1 7  ? -9.116  -2.925  31.013 1.00 16.13 ? 7    CYS C HA   1 
ATOM   905  H  HB2  . CYS C  1 7  ? -10.736 -0.851  32.563 1.00 16.49 ? 7    CYS C HB2  1 
ATOM   906  H  HB3  . CYS C  1 7  ? -8.969  -0.827  32.381 1.00 17.41 ? 7    CYS C HB3  1 
ATOM   907  N  N    . THR C  1 8  ? -10.502 -3.591  33.846 1.00 19.55 ? 8    THR C N    1 
ATOM   908  C  CA   . THR C  1 8  ? -10.334 -4.297  35.124 1.00 24.62 ? 8    THR C CA   1 
ATOM   909  C  C    . THR C  1 8  ? -9.944  -5.753  34.844 1.00 23.58 ? 8    THR C C    1 
ATOM   910  O  O    . THR C  1 8  ? -8.975  -6.267  35.404 1.00 29.64 ? 8    THR C O    1 
ATOM   911  C  CB   . THR C  1 8  ? -11.650 -4.262  35.937 1.00 23.58 ? 8    THR C CB   1 
ATOM   912  O  OG1  . THR C  1 8  ? -12.072 -2.900  36.094 1.00 30.47 ? 8    THR C OG1  1 
ATOM   913  C  CG2  . THR C  1 8  ? -11.441 -4.868  37.326 1.00 27.35 ? 8    THR C CG2  1 
ATOM   914  H  H    . THR C  1 8  ? -11.394 -3.270  33.597 1.00 20.91 ? 8    THR C H    1 
ATOM   915  H  HA   . THR C  1 8  ? -9.544  -3.837  35.686 1.00 23.53 ? 8    THR C HA   1 
ATOM   916  H  HB   . THR C  1 8  ? -12.411 -4.826  35.417 1.00 25.49 ? 8    THR C HB   1 
ATOM   917  H  HG1  . THR C  1 8  ? -12.915 -2.852  36.553 1.00 27.96 ? 8    THR C HG1  1 
ATOM   918  H  HG21 . THR C  1 8  ? -12.070 -4.323  38.013 1.00 25.02 ? 8    THR C HG21 1 
ATOM   919  H  HG22 . THR C  1 8  ? -11.740 -5.909  37.313 1.00 24.71 ? 8    THR C HG22 1 
ATOM   920  H  HG23 . THR C  1 8  ? -10.410 -4.751  37.628 1.00 24.74 ? 8    THR C HG23 1 
ATOM   921  N  N    . SER C  1 9  ? -10.705 -6.421  33.982 1.00 21.23 ? 9    SER C N    1 
ATOM   922  C  CA   . SER C  1 9  ? -10.420 -7.796  33.592 1.00 20.59 ? 9    SER C CA   1 
ATOM   923  C  C    . SER C  1 9  ? -10.213 -7.865  32.085 1.00 20.45 ? 9    SER C C    1 
ATOM   924  O  O    . SER C  1 9  ? -10.597 -6.928  31.351 1.00 20.88 ? 9    SER C O    1 
ATOM   925  C  CB   . SER C  1 9  ? -11.569 -8.736  33.975 1.00 26.35 ? 9    SER C CB   1 
ATOM   926  O  OG   . SER C  1 9  ? -11.662 -8.899  35.366 1.00 30.94 ? 9    SER C OG   1 
ATOM   927  H  H    . SER C  1 9  ? -11.522 -5.989  33.649 1.00 22.27 ? 9    SER C H    1 
ATOM   928  H  HA   . SER C  1 9  ? -9.511  -8.139  34.058 1.00 22.83 ? 9    SER C HA   1 
ATOM   929  H  HB2  . SER C  1 9  ? -12.510 -8.328  33.629 1.00 24.71 ? 9    SER C HB2  1 
ATOM   930  H  HB3  . SER C  1 9  ? -11.414 -9.709  33.525 1.00 24.99 ? 9    SER C HB3  1 
ATOM   931  H  HG   . SER C  1 9  ? -11.852 -8.055  35.780 1.00 28.31 ? 9    SER C HG   1 
ATOM   932  N  N    . ILE C  1 10 ? -9.620  -8.946  31.606 1.00 17.56 ? 10   ILE C N    1 
ATOM   933  C  CA   . ILE C  1 10 ? -9.410  -9.108  30.180 1.00 18.50 ? 10   ILE C CA   1 
ATOM   934  C  C    . ILE C  1 10 ? -10.706 -9.640  29.601 1.00 18.28 ? 10   ILE C C    1 
ATOM   935  O  O    . ILE C  1 10 ? -11.239 -10.651 30.085 1.00 21.91 ? 10   ILE C O    1 
ATOM   936  C  CB   . ILE C  1 10 ? -8.319  -10.148 29.839 1.00 19.03 ? 10   ILE C CB   1 
ATOM   937  C  CG1  . ILE C  1 10 ? -6.990  -9.710  30.440 1.00 22.80 ? 10   ILE C CG1  1 
ATOM   938  C  CG2  . ILE C  1 10 ? -8.195  -10.305 28.322 1.00 23.38 ? 10   ILE C CG2  1 
ATOM   939  C  CD1  . ILE C  1 10 ? -5.923  -10.777 30.397 1.00 23.04 ? 10   ILE C CD1  1 
ATOM   940  H  H    . ILE C  1 10 ? -9.319  -9.645  32.214 1.00 21.04 ? 10   ILE C H    1 
ATOM   941  H  HA   . ILE C  1 10 ? -9.137  -8.139  29.781 1.00 19.04 ? 10   ILE C HA   1 
ATOM   942  H  HB   . ILE C  1 10 ? -8.597  -11.102 30.266 1.00 21.65 ? 10   ILE C HB   1 
ATOM   943  H  HG12 . ILE C  1 10 ? -6.661  -8.847  29.880 1.00 22.56 ? 10   ILE C HG12 1 
ATOM   944  H  HG13 . ILE C  1 10 ? -7.153  -9.403  31.461 1.00 21.83 ? 10   ILE C HG13 1 
ATOM   945  H  HG21 . ILE C  1 10 ? -7.353  -10.930 28.070 1.00 22.82 ? 10   ILE C HG21 1 
ATOM   946  H  HG22 . ILE C  1 10 ? -9.100  -10.739 27.917 1.00 22.31 ? 10   ILE C HG22 1 
ATOM   947  H  HG23 . ILE C  1 10 ? -8.024  -9.316  27.923 1.00 21.84 ? 10   ILE C HG23 1 
ATOM   948  H  HD11 . ILE C  1 10 ? -6.341  -11.733 30.699 1.00 22.75 ? 10   ILE C HD11 1 
ATOM   949  H  HD12 . ILE C  1 10 ? -5.129  -10.516 31.096 1.00 22.47 ? 10   ILE C HD12 1 
ATOM   950  H  HD13 . ILE C  1 10 ? -5.518  -10.858 29.402 1.00 23.71 ? 10   ILE C HD13 1 
ATOM   951  N  N    . CYS C  1 11 ? -11.222 -8.962  28.590 1.00 16.06 ? 11   CYS C N    1 
ATOM   952  C  CA   . CYS C  1 11 ? -12.429 -9.390  27.907 1.00 15.86 ? 11   CYS C CA   1 
ATOM   953  C  C    . CYS C  1 11 ? -12.029 -10.310 26.776 1.00 16.87 ? 11   CYS C C    1 
ATOM   954  O  O    . CYS C  1 11 ? -11.062 -10.025 26.056 1.00 19.59 ? 11   CYS C O    1 
ATOM   955  C  CB   . CYS C  1 11 ? -13.177 -8.175  27.340 1.00 13.92 ? 11   CYS C CB   1 
ATOM   956  S  SG   . CYS C  1 11 ? -14.120 -7.421  28.681 1.00 16.23 ? 11   CYS C SG   1 
ATOM   957  H  H    . CYS C  1 11 ? -10.803 -8.132  28.303 1.00 18.65 ? 11   CYS C H    1 
ATOM   958  H  HA   . CYS C  1 11 ? -13.043 -9.886  28.632 1.00 17.03 ? 11   CYS C HA   1 
ATOM   959  H  HB2  . CYS C  1 11 ? -12.443 -7.488  26.937 1.00 17.25 ? 11   CYS C HB2  1 
ATOM   960  H  HB3  . CYS C  1 11 ? -13.859 -8.497  26.569 1.00 15.94 ? 11   CYS C HB3  1 
ATOM   961  N  N    . SER C  1 12 ? -12.744 -11.416 26.607 1.00 14.96 ? 12   SER C N    1 
ATOM   962  C  CA   . SER C  1 12 ? -12.487 -12.314 25.490 1.00 15.87 ? 12   SER C CA   1 
ATOM   963  C  C    . SER C  1 12 ? -13.032 -11.656 24.221 1.00 12.51 ? 12   SER C C    1 
ATOM   964  O  O    . SER C  1 12 ? -13.745 -10.643 24.283 1.00 12.77 ? 12   SER C O    1 
ATOM   965  C  CB   . SER C  1 12 ? -13.243 -13.626 25.691 1.00 14.69 ? 12   SER C CB   1 
ATOM   966  O  OG   . SER C  1 12 ? -14.653 -13.379 25.624 1.00 13.76 ? 12   SER C OG   1 
ATOM   967  H  H    . SER C  1 12 ? -13.408 -11.610 27.282 1.00 16.35 ? 12   SER C H    1 
ATOM   968  H  HA   . SER C  1 12 ? -11.435 -12.507 25.352 1.00 15.57 ? 12   SER C HA   1 
ATOM   969  H  HB2  . SER C  1 12 ? -12.921 -14.342 24.965 1.00 13.23 ? 12   SER C HB2  1 
ATOM   970  H  HB3  . SER C  1 12 ? -13.008 -13.975 26.679 1.00 12.32 ? 12   SER C HB3  1 
ATOM   971  H  HG   . SER C  1 12 ? -14.886 -13.073 24.746 1.00 17.22 ? 12   SER C HG   1 
ATOM   972  N  N    . LEU C  1 13 ? -12.749 -12.256 23.075 1.00 13.88 ? 13   LEU C N    1 
ATOM   973  C  CA   . LEU C  1 13 ? -13.305 -11.760 21.820 1.00 13.21 ? 13   LEU C CA   1 
ATOM   974  C  C    . LEU C  1 13 ? -14.832 -11.666 21.917 1.00 12.02 ? 13   LEU C C    1 
ATOM   975  O  O    . LEU C  1 13 ? -15.461 -10.732 21.392 1.00 12.65 ? 13   LEU C O    1 
ATOM   976  C  CB   . LEU C  1 13 ? -12.960 -12.736 20.683 1.00 17.81 ? 13   LEU C CB   1 
ATOM   977  C  CG   . LEU C  1 13 ? -11.517 -13.169 20.459 1.00 21.55 ? 13   LEU C CG   1 
ATOM   978  C  CD1  . LEU C  1 13 ? -11.453 -14.248 19.401 1.00 26.36 ? 13   LEU C CD1  1 
ATOM   979  C  CD2  . LEU C  1 13 ? -10.724 -11.963 20.030 1.00 25.26 ? 13   LEU C CD2  1 
ATOM   980  H  H    . LEU C  1 13 ? -12.207 -13.063 23.090 1.00 13.11 ? 13   LEU C H    1 
ATOM   981  H  HA   . LEU C  1 13 ? -12.951 -10.782 21.573 1.00 13.75 ? 13   LEU C HA   1 
ATOM   982  H  HB2  . LEU C  1 13 ? -13.496 -13.652 20.784 1.00 16.91 ? 13   LEU C HB2  1 
ATOM   983  H  HB3  . LEU C  1 13 ? -13.274 -12.297 19.738 1.00 16.60 ? 13   LEU C HB3  1 
ATOM   984  H  HG   . LEU C  1 13 ? -11.104 -13.526 21.387 1.00 22.87 ? 13   LEU C HG   1 
ATOM   985  H  HD11 . LEU C  1 13 ? -12.438 -14.641 19.183 1.00 23.87 ? 13   LEU C HD11 1 
ATOM   986  H  HD12 . LEU C  1 13 ? -11.027 -13.849 18.497 1.00 23.78 ? 13   LEU C HD12 1 
ATOM   987  H  HD13 . LEU C  1 13 ? -10.845 -15.057 19.804 1.00 23.53 ? 13   LEU C HD13 1 
ATOM   988  H  HD21 . LEU C  1 13 ? -11.039 -11.728 19.020 1.00 22.11 ? 13   LEU C HD21 1 
ATOM   989  H  HD22 . LEU C  1 13 ? -10.882 -11.122 20.688 1.00 23.16 ? 13   LEU C HD22 1 
ATOM   990  H  HD23 . LEU C  1 13 ? -9.679  -12.236 19.985 1.00 22.96 ? 13   LEU C HD23 1 
ATOM   991  N  N    . TYR C  1 14 ? -15.419 -12.676 22.556 1.00 11.62 ? 14   TYR C N    1 
ATOM   992  C  CA   . TYR C  1 14 ? -16.885 -12.768 22.679 1.00 11.11 ? 14   TYR C CA   1 
ATOM   993  C  C    . TYR C  1 14 ? -17.423 -11.644 23.560 1.00 9.97  ? 14   TYR C C    1 
ATOM   994  O  O    . TYR C  1 14 ? -18.476 -11.083 23.258 1.00 11.92 ? 14   TYR C O    1 
ATOM   995  C  CB   . TYR C  1 14 ? -17.261 -14.156 23.214 1.00 12.90 ? 14   TYR C CB   1 
ATOM   996  C  CG   . TYR C  1 14 ? -16.676 -15.257 22.372 1.00 14.73 ? 14   TYR C CG   1 
ATOM   997  C  CD1  . TYR C  1 14 ? -17.238 -15.617 21.149 1.00 17.44 ? 14   TYR C CD1  1 
ATOM   998  C  CD2  . TYR C  1 14 ? -15.509 -15.888 22.764 1.00 17.16 ? 14   TYR C CD2  1 
ATOM   999  C  CE1  . TYR C  1 14 ? -16.639 -16.570 20.350 1.00 18.22 ? 14   TYR C CE1  1 
ATOM   1000 C  CE2  . TYR C  1 14 ? -14.905 -16.841 21.958 1.00 18.17 ? 14   TYR C CE2  1 
ATOM   1001 C  CZ   . TYR C  1 14 ? -15.478 -17.168 20.761 1.00 19.06 ? 14   TYR C CZ   1 
ATOM   1002 O  OH   . TYR C  1 14 ? -14.913 -18.133 19.950 1.00 21.77 ? 14   TYR C OH   1 
ATOM   1003 H  H    . TYR C  1 14 ? -14.879 -13.389 22.938 1.00 12.88 ? 14   TYR C H    1 
ATOM   1004 H  HA   . TYR C  1 14 ? -17.315 -12.643 21.704 1.00 11.06 ? 14   TYR C HA   1 
ATOM   1005 H  HB2  . TYR C  1 14 ? -16.970 -14.220 24.249 1.00 11.72 ? 14   TYR C HB2  1 
ATOM   1006 H  HB3  . TYR C  1 14 ? -18.336 -14.207 23.164 1.00 13.34 ? 14   TYR C HB3  1 
ATOM   1007 H  HD1  . TYR C  1 14 ? -18.146 -15.159 20.790 1.00 15.81 ? 14   TYR C HD1  1 
ATOM   1008 H  HD2  . TYR C  1 14 ? -15.084 -15.602 23.721 1.00 16.00 ? 14   TYR C HD2  1 
ATOM   1009 H  HE1  . TYR C  1 14 ? -17.083 -16.843 19.403 1.00 19.34 ? 14   TYR C HE1  1 
ATOM   1010 H  HE2  . TYR C  1 14 ? -13.990 -17.319 22.274 1.00 21.22 ? 14   TYR C HE2  1 
ATOM   1011 H  HH   . TYR C  1 14 ? -14.202 -18.527 20.454 1.00 21.52 ? 14   TYR C HH   1 
ATOM   1012 N  N    . GLN C  1 15 ? -16.717 -11.319 24.625 1.00 10.10 ? 15   GLN C N    1 
ATOM   1013 C  CA   . GLN C  1 15 ? -17.132 -10.209 25.476 1.00 12.03 ? 15   GLN C CA   1 
ATOM   1014 C  C    . GLN C  1 15 ? -16.948 -8.852  24.754 1.00 12.79 ? 15   GLN C C    1 
ATOM   1015 O  O    . GLN C  1 15 ? -17.745 -7.932  24.877 1.00 13.41 ? 15   GLN C O    1 
ATOM   1016 C  CB   . GLN C  1 15 ? -16.367 -10.212 26.796 1.00 11.78 ? 15   GLN C CB   1 
ATOM   1017 C  CG   . GLN C  1 15 ? -16.764 -11.394 27.642 1.00 14.81 ? 15   GLN C CG   1 
ATOM   1018 C  CD   . GLN C  1 15 ? -15.895 -11.593 28.848 1.00 15.38 ? 15   GLN C CD   1 
ATOM   1019 O  OE1  . GLN C  1 15 ? -14.678 -11.677 28.755 1.00 16.68 ? 15   GLN C OE1  1 
ATOM   1020 N  NE2  . GLN C  1 15 ? -16.530 -11.726 30.008 1.00 20.30 ? 15   GLN C NE2  1 
ATOM   1021 H  H    . GLN C  1 15 ? -15.873 -11.798 24.797 1.00 7.70  ? 15   GLN C H    1 
ATOM   1022 H  HA   . GLN C  1 15 ? -18.172 -10.368 25.673 1.00 12.91 ? 15   GLN C HA   1 
ATOM   1023 H  HB2  . GLN C  1 15 ? -15.309 -10.208 26.586 1.00 14.23 ? 15   GLN C HB2  1 
ATOM   1024 H  HB3  . GLN C  1 15 ? -16.617 -9.309  27.313 1.00 13.32 ? 15   GLN C HB3  1 
ATOM   1025 H  HG2  . GLN C  1 15 ? -17.775 -11.207 27.979 1.00 14.59 ? 15   GLN C HG2  1 
ATOM   1026 H  HG3  . GLN C  1 15 ? -16.733 -12.279 27.015 1.00 14.44 ? 15   GLN C HG3  1 
ATOM   1027 H  HE21 . GLN C  1 15 ? -17.505 -11.694 30.050 1.00 18.85 ? 15   GLN C HE21 1 
ATOM   1028 H  HE22 . GLN C  1 15 ? -15.932 -11.868 30.768 1.00 19.86 ? 15   GLN C HE22 1 
ATOM   1029 N  N    . LEU C  1 16 ? -15.866 -8.732  23.987 1.00 12.93 ? 16   LEU C N    1 
ATOM   1030 C  CA   . LEU C  1 16 ? -15.642 -7.507  23.230 1.00 11.30 ? 16   LEU C CA   1 
ATOM   1031 C  C    . LEU C  1 16 ? -16.735 -7.275  22.174 1.00 11.62 ? 16   LEU C C    1 
ATOM   1032 O  O    . LEU C  1 16 ? -17.130 -6.130  21.899 1.00 11.94 ? 16   LEU C O    1 
ATOM   1033 C  CB   . LEU C  1 16 ? -14.254 -7.559  22.561 1.00 13.43 ? 16   LEU C CB   1 
ATOM   1034 C  CG   . LEU C  1 16 ? -13.064 -7.470  23.517 1.00 12.93 ? 16   LEU C CG   1 
ATOM   1035 C  CD1  . LEU C  1 16 ? -11.816 -7.758  22.695 1.00 13.68 ? 16   LEU C CD1  1 
ATOM   1036 C  CD2  . LEU C  1 16 ? -12.937 -6.093  24.171 1.00 15.74 ? 16   LEU C CD2  1 
ATOM   1037 H  H    . LEU C  1 16 ? -15.260 -9.491  23.932 1.00 12.11 ? 16   LEU C H    1 
ATOM   1038 H  HA   . LEU C  1 16 ? -15.658 -6.687  23.919 1.00 11.89 ? 16   LEU C HA   1 
ATOM   1039 H  HB2  . LEU C  1 16 ? -14.191 -8.525  22.067 1.00 11.23 ? 16   LEU C HB2  1 
ATOM   1040 H  HB3  . LEU C  1 16 ? -14.165 -6.801  21.813 1.00 13.50 ? 16   LEU C HB3  1 
ATOM   1041 H  HG   . LEU C  1 16 ? -13.141 -8.230  24.272 1.00 14.62 ? 16   LEU C HG   1 
ATOM   1042 H  HD11 . LEU C  1 16 ? -11.758 -7.002  21.932 1.00 13.74 ? 16   LEU C HD11 1 
ATOM   1043 H  HD12 . LEU C  1 16 ? -10.968 -7.713  23.370 1.00 14.30 ? 16   LEU C HD12 1 
ATOM   1044 H  HD13 . LEU C  1 16 ? -11.821 -8.735  22.258 1.00 12.58 ? 16   LEU C HD13 1 
ATOM   1045 H  HD21 . LEU C  1 16 ? -12.486 -5.401  23.469 1.00 16.23 ? 16   LEU C HD21 1 
ATOM   1046 H  HD22 . LEU C  1 16 ? -13.901 -5.719  24.470 1.00 15.41 ? 16   LEU C HD22 1 
ATOM   1047 H  HD23 . LEU C  1 16 ? -12.281 -6.158  25.034 1.00 15.89 ? 16   LEU C HD23 1 
ATOM   1048 N  N    A GLU C  1 17 ? -17.234 -8.361  21.597 0.70 12.51 ? 17   GLU C N    1 
ATOM   1049 N  N    B GLU C  1 17 ? -17.244 -8.357  21.581 0.30 13.06 ? 17   GLU C N    1 
ATOM   1050 C  CA   A GLU C  1 17 ? -18.253 -8.242  20.549 0.70 14.19 ? 17   GLU C CA   1 
ATOM   1051 C  CA   B GLU C  1 17 ? -18.285 -8.229  20.542 0.30 14.24 ? 17   GLU C CA   1 
ATOM   1052 C  C    A GLU C  1 17 ? -19.522 -7.492  20.997 0.70 11.22 ? 17   GLU C C    1 
ATOM   1053 C  C    B GLU C  1 17 ? -19.522 -7.458  21.005 0.30 13.40 ? 17   GLU C C    1 
ATOM   1054 O  O    A GLU C  1 17 ? -20.238 -6.928  20.173 0.70 13.69 ? 17   GLU C O    1 
ATOM   1055 O  O    B GLU C  1 17 ? -20.222 -6.842  20.201 0.30 14.68 ? 17   GLU C O    1 
ATOM   1056 C  CB   A GLU C  1 17 ? -18.614 -9.627  20.032 0.70 13.71 ? 17   GLU C CB   1 
ATOM   1057 C  CB   B GLU C  1 17 ? -18.734 -9.603  20.026 0.30 14.22 ? 17   GLU C CB   1 
ATOM   1058 C  CG   A GLU C  1 17 ? -19.365 -9.618  18.743 0.70 16.62 ? 17   GLU C CG   1 
ATOM   1059 C  CG   B GLU C  1 17 ? -17.750 -10.271 19.083 0.30 14.14 ? 17   GLU C CG   1 
ATOM   1060 C  CD   A GLU C  1 17 ? -19.687 -11.014 18.257 0.70 15.72 ? 17   GLU C CD   1 
ATOM   1061 C  CD   B GLU C  1 17 ? -18.249 -11.598 18.521 0.30 15.74 ? 17   GLU C CD   1 
ATOM   1062 O  OE1  A GLU C  1 17 ? -19.444 -11.973 19.001 0.70 15.74 ? 17   GLU C OE1  1 
ATOM   1063 O  OE1  B GLU C  1 17 ? -18.909 -12.378 19.259 0.30 14.96 ? 17   GLU C OE1  1 
ATOM   1064 O  OE2  A GLU C  1 17 ? -20.176 -11.124 17.122 0.70 20.22 ? 17   GLU C OE2  1 
ATOM   1065 O  OE2  B GLU C  1 17 ? -17.958 -11.872 17.333 0.30 14.96 ? 17   GLU C OE2  1 
ATOM   1066 H  H    A GLU C  1 17 ? -16.872 -9.217  21.878 0.70 12.95 ? 17   GLU C H    1 
ATOM   1067 H  H    B GLU C  1 17 ? -16.880 -9.218  21.872 0.30 13.00 ? 17   GLU C H    1 
ATOM   1068 H  HA   A GLU C  1 17 ? -17.840 -7.688  19.715 0.70 12.82 ? 17   GLU C HA   1 
ATOM   1069 H  HA   B GLU C  1 17 ? -17.863 -7.692  19.703 0.30 14.08 ? 17   GLU C HA   1 
ATOM   1070 H  HB2  A GLU C  1 17 ? -17.720 -10.214 19.910 0.70 14.22 ? 17   GLU C HB2  1 
ATOM   1071 H  HB2  B GLU C  1 17 ? -18.824 -10.239 20.892 0.30 15.22 ? 17   GLU C HB2  1 
ATOM   1072 H  HB3  A GLU C  1 17 ? -19.239 -10.102 20.781 0.70 15.36 ? 17   GLU C HB3  1 
ATOM   1073 H  HB3  B GLU C  1 17 ? -19.694 -9.521  19.536 0.30 14.63 ? 17   GLU C HB3  1 
ATOM   1074 H  HG2  A GLU C  1 17 ? -20.264 -9.036  18.874 0.70 16.11 ? 17   GLU C HG2  1 
ATOM   1075 H  HG2  B GLU C  1 17 ? -17.673 -9.597  18.239 0.30 15.27 ? 17   GLU C HG2  1 
ATOM   1076 H  HG3  A GLU C  1 17 ? -18.725 -9.131  18.023 0.70 16.25 ? 17   GLU C HG3  1 
ATOM   1077 H  HG3  B GLU C  1 17 ? -16.785 -10.401 19.535 0.30 15.50 ? 17   GLU C HG3  1 
ATOM   1078 N  N    . ASN C  1 18 ? -19.800 -7.513  22.302 1.00 14.13 ? 18   ASN C N    1 
ATOM   1079 C  CA   . ASN C  1 18 ? -20.940 -6.795  22.866 1.00 16.03 ? 18   ASN C CA   1 
ATOM   1080 C  C    . ASN C  1 18 ? -20.921 -5.321  22.475 1.00 16.13 ? 18   ASN C C    1 
ATOM   1081 O  O    . ASN C  1 18 ? -21.972 -4.694  22.211 1.00 17.65 ? 18   ASN C O    1 
ATOM   1082 C  CB   . ASN C  1 18 ? -20.891 -6.872  24.388 1.00 18.53 ? 18   ASN C CB   1 
ATOM   1083 C  CG   . ASN C  1 18 ? -22.051 -6.125  25.064 1.00 19.00 ? 18   ASN C CG   1 
ATOM   1084 O  OD1  . ASN C  1 18 ? -23.156 -6.038  24.535 1.00 18.23 ? 18   ASN C OD1  1 
ATOM   1085 N  ND2  . ASN C  1 18 ? -21.790 -5.602  26.246 1.00 22.75 ? 18   ASN C ND2  1 
ATOM   1086 H  H    . ASN C  1 18 ? -19.232 -8.074  22.883 1.00 12.04 ? 18   ASN C H    1 
ATOM   1087 H  HA   . ASN C  1 18 ? -21.846 -7.270  22.521 1.00 16.63 ? 18   ASN C HA   1 
ATOM   1088 H  HB2  . ASN C  1 18 ? -20.878 -7.859  24.743 1.00 17.82 ? 18   ASN C HB2  1 
ATOM   1089 H  HB3  . ASN C  1 18 ? -20.001 -6.379  24.697 1.00 17.98 ? 18   ASN C HB3  1 
ATOM   1090 H  HD21 . ASN C  1 18 ? -22.492 -5.107  26.722 1.00 19.20 ? 18   ASN C HD21 1 
ATOM   1091 H  HD22 . ASN C  1 18 ? -20.898 -5.789  26.575 1.00 18.80 ? 18   ASN C HD22 1 
ATOM   1092 N  N    . TYR C  1 19 ? -19.719 -4.762  22.380 1.00 13.98 ? 19   TYR C N    1 
ATOM   1093 C  CA   . TYR C  1 19 ? -19.585 -3.360  22.079 1.00 13.94 ? 19   TYR C CA   1 
ATOM   1094 C  C    . TYR C  1 19 ? -19.661 -2.958  20.640 1.00 12.86 ? 19   TYR C C    1 
ATOM   1095 O  O    . TYR C  1 19 ? -19.629 -1.767  20.334 1.00 16.71 ? 19   TYR C O    1 
ATOM   1096 C  CB   . TYR C  1 19 ? -18.313 -2.831  22.747 1.00 15.53 ? 19   TYR C CB   1 
ATOM   1097 C  CG   . TYR C  1 19 ? -18.383 -3.048  24.222 1.00 15.82 ? 19   TYR C CG   1 
ATOM   1098 C  CD1  . TYR C  1 19 ? -19.161 -2.214  25.040 1.00 17.64 ? 19   TYR C CD1  1 
ATOM   1099 C  CD2  . TYR C  1 19 ? -17.774 -4.141  24.803 1.00 18.33 ? 19   TYR C CD2  1 
ATOM   1100 C  CE1  . TYR C  1 19 ? -19.305 -2.486  26.397 1.00 17.92 ? 19   TYR C CE1  1 
ATOM   1101 C  CE2  . TYR C  1 19 ? -17.920 -4.413  26.128 1.00 16.93 ? 19   TYR C CE2  1 
ATOM   1102 C  CZ   . TYR C  1 19 ? -18.678 -3.586  26.934 1.00 19.15 ? 19   TYR C CZ   1 
ATOM   1103 O  OH   . TYR C  1 19 ? -18.770 -3.882  28.273 1.00 22.87 ? 19   TYR C OH   1 
ATOM   1104 H  H    . TYR C  1 19 ? -18.968 -5.352  22.595 1.00 13.29 ? 19   TYR C H    1 
ATOM   1105 H  HA   . TYR C  1 19 ? -20.390 -2.805  22.565 1.00 14.51 ? 19   TYR C HA   1 
ATOM   1106 H  HB2  . TYR C  1 19 ? -17.444 -3.328  22.347 1.00 16.23 ? 19   TYR C HB2  1 
ATOM   1107 H  HB3  . TYR C  1 19 ? -18.268 -1.774  22.564 1.00 15.77 ? 19   TYR C HB3  1 
ATOM   1108 H  HD1  . TYR C  1 19 ? -19.649 -1.355  24.623 1.00 18.11 ? 19   TYR C HD1  1 
ATOM   1109 H  HD2  . TYR C  1 19 ? -17.166 -4.821  24.215 1.00 16.50 ? 19   TYR C HD2  1 
ATOM   1110 H  HE1  . TYR C  1 19 ? -19.906 -1.834  27.020 1.00 18.61 ? 19   TYR C HE1  1 
ATOM   1111 H  HE2  . TYR C  1 19 ? -17.438 -5.274  26.579 1.00 19.66 ? 19   TYR C HE2  1 
ATOM   1112 H  HH   . TYR C  1 19 ? -19.148 -3.122  28.727 1.00 21.77 ? 19   TYR C HH   1 
ATOM   1113 N  N    . CYS C  1 20 ? -19.702 -3.934  19.736 1.00 13.11 ? 20   CYS C N    1 
ATOM   1114 C  CA   . CYS C  1 20 ? -19.843 -3.649  18.323 1.00 12.17 ? 20   CYS C CA   1 
ATOM   1115 C  C    . CYS C  1 20 ? -21.250 -3.122  18.024 1.00 14.38 ? 20   CYS C C    1 
ATOM   1116 O  O    . CYS C  1 20 ? -22.193 -3.332  18.795 1.00 16.39 ? 20   CYS C O    1 
ATOM   1117 C  CB   . CYS C  1 20 ? -19.649 -4.916  17.500 1.00 13.65 ? 20   CYS C CB   1 
ATOM   1118 S  SG   . CYS C  1 20 ? -18.059 -5.745  17.743 1.00 13.05 ? 20   CYS C SG   1 
ATOM   1119 H  H    . CYS C  1 20 ? -19.657 -4.855  20.067 1.00 10.98 ? 20   CYS C H    1 
ATOM   1120 H  HA   . CYS C  1 20 ? -19.176 -2.892  17.948 1.00 12.24 ? 20   CYS C HA   1 
ATOM   1121 H  HB2  . CYS C  1 20 ? -20.433 -5.619  17.753 1.00 12.97 ? 20   CYS C HB2  1 
ATOM   1122 H  HB3  . CYS C  1 20 ? -19.773 -4.743  16.446 1.00 9.82  ? 20   CYS C HB3  1 
ATOM   1123 N  N    . ASN C  1 21 ? -21.383 -2.498  16.871 1.00 16.15 ? 21   ASN C N    1 
ATOM   1124 C  CA   . ASN C  1 21 ? -22.700 -2.052  16.397 1.00 18.08 ? 21   ASN C CA   1 
ATOM   1125 C  C    . ASN C  1 21 ? -23.495 -3.293  15.985 1.00 22.11 ? 21   ASN C C    1 
ATOM   1126 O  O    . ASN C  1 21 ? -24.742 -3.187  15.896 1.00 25.31 ? 21   ASN C O    1 
ATOM   1127 C  CB   . ASN C  1 21 ? -22.546 -1.173  15.176 1.00 23.11 ? 21   ASN C CB   1 
ATOM   1128 C  CG   . ASN C  1 21 ? -22.033 0.192   15.501 1.00 23.83 ? 21   ASN C CG   1 
ATOM   1129 O  OD1  . ASN C  1 21 ? -21.388 0.830   14.669 1.00 24.93 ? 21   ASN C OD1  1 
ATOM   1130 N  ND2  . ASN C  1 21 ? -22.324 0.668   16.700 1.00 26.28 ? 21   ASN C ND2  1 
ATOM   1131 O  OXT  . ASN C  1 21 ? -22.876 -4.347  15.716 1.00 20.55 ? 21   ASN C OXT  1 
ATOM   1132 H  H    . ASN C  1 21 ? -20.588 -2.330  16.324 1.00 17.38 ? 21   ASN C H    1 
ATOM   1133 H  HA   . ASN C  1 21 ? -23.184 -1.526  17.192 1.00 19.50 ? 21   ASN C HA   1 
ATOM   1134 H  HB2  . ASN C  1 21 ? -21.844 -1.685  14.545 1.00 22.15 ? 21   ASN C HB2  1 
ATOM   1135 H  HB3  . ASN C  1 21 ? -23.493 -1.104  14.652 1.00 23.21 ? 21   ASN C HB3  1 
ATOM   1136 H  HD21 . ASN C  1 21 ? -21.976 1.560   16.878 1.00 26.14 ? 21   ASN C HD21 1 
ATOM   1137 H  HD22 . ASN C  1 21 ? -22.839 0.136   17.346 1.00 26.23 ? 21   ASN C HD22 1 
ATOM   1138 N  N    . PHE D  2 1  ? -3.965  -1.151  39.938 1.00 30.99 ? 1    PHE D N    1 
ATOM   1139 C  CA   . PHE D  2 1  ? -5.078  -0.728  39.056 1.00 27.45 ? 1    PHE D CA   1 
ATOM   1140 C  C    . PHE D  2 1  ? -4.589  -0.452  37.645 1.00 27.65 ? 1    PHE D C    1 
ATOM   1141 O  O    . PHE D  2 1  ? -3.413  -0.172  37.406 1.00 29.38 ? 1    PHE D O    1 
ATOM   1142 C  CB   . PHE D  2 1  ? -5.772  0.505   39.638 1.00 28.32 ? 1    PHE D CB   1 
ATOM   1143 C  CG   . PHE D  2 1  ? -6.534  0.213   40.904 1.00 27.69 ? 1    PHE D CG   1 
ATOM   1144 C  CD1  . PHE D  2 1  ? -7.852  -0.212  40.861 1.00 27.52 ? 1    PHE D CD1  1 
ATOM   1145 C  CD2  . PHE D  2 1  ? -5.916  0.335   42.125 1.00 25.10 ? 1    PHE D CD2  1 
ATOM   1146 C  CE1  . PHE D  2 1  ? -8.544  -0.513  42.027 1.00 31.13 ? 1    PHE D CE1  1 
ATOM   1147 C  CE2  . PHE D  2 1  ? -6.591  0.038   43.297 1.00 26.90 ? 1    PHE D CE2  1 
ATOM   1148 C  CZ   . PHE D  2 1  ? -7.909  -0.386  43.249 1.00 28.76 ? 1    PHE D CZ   1 
ATOM   1149 H  H1   . PHE D  2 1  ? -4.275  -1.329  40.914 1.00 29.33 ? 1    PHE D H1   1 
ATOM   1150 H  H2   . PHE D  2 1  ? -3.564  -2.025  39.533 1.00 29.25 ? 1    PHE D H2   1 
ATOM   1151 H  H3   . PHE D  2 1  ? -3.250  -0.395  39.932 1.00 28.91 ? 1    PHE D H3   1 
ATOM   1152 H  HA   . PHE D  2 1  ? -5.797  -1.535  39.023 1.00 27.57 ? 1    PHE D HA   1 
ATOM   1153 H  HB2  . PHE D  2 1  ? -4.944  1.195   39.732 1.00 26.44 ? 1    PHE D HB2  1 
ATOM   1154 H  HB3  . PHE D  2 1  ? -6.390  0.892   38.849 1.00 26.69 ? 1    PHE D HB3  1 
ATOM   1155 H  HD1  . PHE D  2 1  ? -8.353  -0.312  39.913 1.00 28.52 ? 1    PHE D HD1  1 
ATOM   1156 H  HD2  . PHE D  2 1  ? -4.883  0.666   42.151 1.00 26.16 ? 1    PHE D HD2  1 
ATOM   1157 H  HE1  . PHE D  2 1  ? -9.575  -0.843  41.966 1.00 28.39 ? 1    PHE D HE1  1 
ATOM   1158 H  HE2  . PHE D  2 1  ? -6.069  0.145   44.238 1.00 26.51 ? 1    PHE D HE2  1 
ATOM   1159 H  HZ   . PHE D  2 1  ? -8.437  -0.618  44.161 1.00 27.45 ? 1    PHE D HZ   1 
ATOM   1160 N  N    . VAL D  2 2  ? -5.524  -0.510  36.714 1.00 26.92 ? 2    VAL D N    1 
ATOM   1161 C  CA   . VAL D  2 2  ? -5.219  -0.334  35.310 1.00 22.08 ? 2    VAL D CA   1 
ATOM   1162 C  C    . VAL D  2 2  ? -5.250  1.136   34.860 1.00 22.95 ? 2    VAL D C    1 
ATOM   1163 O  O    . VAL D  2 2  ? -6.057  1.927   35.320 1.00 24.72 ? 2    VAL D O    1 
ATOM   1164 C  CB   . VAL D  2 2  ? -6.227  -1.193  34.476 1.00 23.14 ? 2    VAL D CB   1 
ATOM   1165 C  CG1  . VAL D  2 2  ? -5.939  -1.039  32.993 1.00 23.98 ? 2    VAL D CG1  1 
ATOM   1166 C  CG2  . VAL D  2 2  ? -6.126  -2.680  34.868 1.00 24.39 ? 2    VAL D CG2  1 
ATOM   1167 H  H    . VAL D  2 2  ? -6.459  -0.669  36.961 1.00 25.99 ? 2    VAL D H    1 
ATOM   1168 H  HA   . VAL D  2 2  ? -4.236  -0.713  35.114 1.00 23.34 ? 2    VAL D HA   1 
ATOM   1169 H  HB   . VAL D  2 2  ? -7.217  -0.840  34.721 1.00 23.26 ? 2    VAL D HB   1 
ATOM   1170 H  HG11 . VAL D  2 2  ? -6.273  -0.070  32.654 1.00 22.50 ? 2    VAL D HG11 1 
ATOM   1171 H  HG12 . VAL D  2 2  ? -4.866  -1.133  32.821 1.00 21.78 ? 2    VAL D HG12 1 
ATOM   1172 H  HG13 . VAL D  2 2  ? -6.440  -1.803  32.408 1.00 23.12 ? 2    VAL D HG13 1 
ATOM   1173 H  HG21 . VAL D  2 2  ? -5.667  -2.796  35.845 1.00 24.58 ? 2    VAL D HG21 1 
ATOM   1174 H  HG22 . VAL D  2 2  ? -7.131  -3.067  34.933 1.00 24.14 ? 2    VAL D HG22 1 
ATOM   1175 H  HG23 . VAL D  2 2  ? -5.561  -3.235  34.141 1.00 23.09 ? 2    VAL D HG23 1 
ATOM   1176 N  N    . ASN D  2 3  ? -4.308  1.496   33.991 1.00 17.57 ? 3    ASN D N    1 
ATOM   1177 C  CA   . ASN D  2 3  ? -4.203  2.833   33.399 1.00 16.73 ? 3    ASN D CA   1 
ATOM   1178 C  C    . ASN D  2 3  ? -5.325  2.875   32.344 1.00 14.55 ? 3    ASN D C    1 
ATOM   1179 O  O    . ASN D  2 3  ? -5.249  2.237   31.296 1.00 14.76 ? 3    ASN D O    1 
ATOM   1180 C  CB   . ASN D  2 3  ? -2.819  2.959   32.760 1.00 19.01 ? 3    ASN D CB   1 
ATOM   1181 C  CG   . ASN D  2 3  ? -2.609  4.265   32.029 1.00 19.84 ? 3    ASN D CG   1 
ATOM   1182 O  OD1  . ASN D  2 3  ? -3.536  4.843   31.435 1.00 17.30 ? 3    ASN D OD1  1 
ATOM   1183 N  ND2  . ASN D  2 3  ? -1.349  4.730   32.027 1.00 22.27 ? 3    ASN D ND2  1 
ATOM   1184 H  H    . ASN D  2 3  ? -3.634  0.816   33.783 1.00 19.80 ? 3    ASN D H    1 
ATOM   1185 H  HA   . ASN D  2 3  ? -4.389  3.601   34.121 1.00 18.96 ? 3    ASN D HA   1 
ATOM   1186 H  HB2  . ASN D  2 3  ? -2.135  2.974   33.604 1.00 19.33 ? 3    ASN D HB2  1 
ATOM   1187 H  HB3  . ASN D  2 3  ? -2.547  2.131   32.127 1.00 18.86 ? 3    ASN D HB3  1 
ATOM   1188 H  HD21 . ASN D  2 3  ? -1.184  5.585   31.565 1.00 22.66 ? 3    ASN D HD21 1 
ATOM   1189 H  HD22 . ASN D  2 3  ? -0.631  4.212   32.442 1.00 22.55 ? 3    ASN D HD22 1 
ATOM   1190 N  N    . GLN D  2 4  ? -6.363  3.631   32.623 1.00 13.25 ? 4    GLN D N    1 
ATOM   1191 C  CA   . GLN D  2 4  ? -7.494  3.700   31.741 1.00 14.52 ? 4    GLN D CA   1 
ATOM   1192 C  C    . GLN D  2 4  ? -7.181  4.260   30.341 1.00 12.37 ? 4    GLN D C    1 
ATOM   1193 O  O    . GLN D  2 4  ? -7.757  3.819   29.339 1.00 12.46 ? 4    GLN D O    1 
ATOM   1194 C  CB   . GLN D  2 4  ? -8.596  4.527   32.418 1.00 18.34 ? 4    GLN D CB   1 
ATOM   1195 C  CG   . GLN D  2 4  ? -9.813  4.779   31.571 1.00 22.34 ? 4    GLN D CG   1 
ATOM   1196 C  CD   . GLN D  2 4  ? -10.907 5.538   32.330 1.00 22.34 ? 4    GLN D CD   1 
ATOM   1197 O  OE1  . GLN D  2 4  ? -11.466 5.042   33.311 1.00 27.86 ? 4    GLN D OE1  1 
ATOM   1198 N  NE2  . GLN D  2 4  ? -11.186 6.743   31.894 1.00 23.45 ? 4    GLN D NE2  1 
ATOM   1199 H  H    . GLN D  2 4  ? -6.313  4.198   33.417 1.00 14.86 ? 4    GLN D H    1 
ATOM   1200 H  HA   . GLN D  2 4  ? -7.883  2.699   31.626 1.00 12.06 ? 4    GLN D HA   1 
ATOM   1201 H  HB2  . GLN D  2 4  ? -8.965  3.978   33.281 1.00 18.73 ? 4    GLN D HB2  1 
ATOM   1202 H  HB3  . GLN D  2 4  ? -8.176  5.470   32.714 1.00 18.23 ? 4    GLN D HB3  1 
ATOM   1203 H  HG2  . GLN D  2 4  ? -9.504  5.392   30.720 1.00 21.70 ? 4    GLN D HG2  1 
ATOM   1204 H  HG3  . GLN D  2 4  ? -10.205 3.838   31.215 1.00 22.21 ? 4    GLN D HG3  1 
ATOM   1205 H  HE21 . GLN D  2 4  ? -10.697 7.103   31.117 1.00 24.36 ? 4    GLN D HE21 1 
ATOM   1206 H  HE22 . GLN D  2 4  ? -11.876 7.240   32.389 1.00 23.50 ? 4    GLN D HE22 1 
ATOM   1207 N  N    . HIS D  2 5  ? -6.298  5.239   30.263 1.00 11.92 ? 5    HIS D N    1 
ATOM   1208 C  CA   . HIS D  2 5  ? -5.975  5.835   28.989 1.00 10.60 ? 5    HIS D CA   1 
ATOM   1209 C  C    . HIS D  2 5  ? -5.255  4.830   28.101 1.00 10.33 ? 5    HIS D C    1 
ATOM   1210 O  O    . HIS D  2 5  ? -5.574  4.716   26.901 1.00 12.04 ? 5    HIS D O    1 
ATOM   1211 C  CB   . HIS D  2 5  ? -5.128  7.083   29.211 1.00 12.09 ? 5    HIS D CB   1 
ATOM   1212 C  CG   . HIS D  2 5  ? -4.853  7.816   27.949 1.00 13.63 ? 5    HIS D CG   1 
ATOM   1213 N  ND1  . HIS D  2 5  ? -5.827  8.507   27.265 1.00 15.14 ? 5    HIS D ND1  1 
ATOM   1214 C  CD2  . HIS D  2 5  ? -3.729  7.907   27.199 1.00 15.15 ? 5    HIS D CD2  1 
ATOM   1215 C  CE1  . HIS D  2 5  ? -5.319  8.987   26.139 1.00 15.14 ? 5    HIS D CE1  1 
ATOM   1216 N  NE2  . HIS D  2 5  ? -4.045  8.633   26.076 1.00 15.25 ? 5    HIS D NE2  1 
ATOM   1217 H  H    . HIS D  2 5  ? -5.826  5.568   31.068 1.00 15.00 ? 5    HIS D H    1 
ATOM   1218 H  HA   . HIS D  2 5  ? -6.905  6.126   28.544 1.00 11.12 ? 5    HIS D HA   1 
ATOM   1219 H  HB2  . HIS D  2 5  ? -5.686  7.736   29.864 1.00 12.89 ? 5    HIS D HB2  1 
ATOM   1220 H  HB3  . HIS D  2 5  ? -4.203  6.822   29.682 1.00 12.90 ? 5    HIS D HB3  1 
ATOM   1221 H  HD1  . HIS D  2 5  ? -6.754  8.626   27.574 1.00 15.16 ? 5    HIS D HD1  1 
ATOM   1222 H  HD2  . HIS D  2 5  ? -2.783  7.461   27.466 1.00 14.76 ? 5    HIS D HD2  1 
ATOM   1223 H  HE1  . HIS D  2 5  ? -5.906  9.348   25.298 1.00 14.65 ? 5    HIS D HE1  1 
ATOM   1224 N  N    . LEU D  2 6  ? -4.296  4.112   28.633 1.00 9.31  ? 6    LEU D N    1 
ATOM   1225 C  CA   . LEU D  2 6  ? -3.605  3.084   27.851 1.00 10.09 ? 6    LEU D CA   1 
ATOM   1226 C  C    . LEU D  2 6  ? -4.534  1.913   27.564 1.00 10.38 ? 6    LEU D C    1 
ATOM   1227 O  O    . LEU D  2 6  ? -4.527  1.339   26.458 1.00 11.66 ? 6    LEU D O    1 
ATOM   1228 C  CB   . LEU D  2 6  ? -2.357  2.624   28.599 1.00 11.34 ? 6    LEU D CB   1 
ATOM   1229 C  CG   . LEU D  2 6  ? -1.272  3.693   28.713 1.00 13.86 ? 6    LEU D CG   1 
ATOM   1230 C  CD1  . LEU D  2 6  ? -0.026  3.049   29.360 1.00 15.41 ? 6    LEU D CD1  1 
ATOM   1231 C  CD2  . LEU D  2 6  ? -0.877  4.258   27.327 1.00 13.63 ? 6    LEU D CD2  1 
ATOM   1232 H  H    . LEU D  2 6  ? -4.012  4.260   29.558 1.00 10.78 ? 6    LEU D H    1 
ATOM   1233 H  HA   . LEU D  2 6  ? -3.333  3.563   26.946 1.00 8.36  ? 6    LEU D HA   1 
ATOM   1234 H  HB2  . LEU D  2 6  ? -2.628  2.261   29.564 1.00 12.17 ? 6    LEU D HB2  1 
ATOM   1235 H  HB3  . LEU D  2 6  ? -1.953  1.818   28.025 1.00 12.55 ? 6    LEU D HB3  1 
ATOM   1236 H  HG   . LEU D  2 6  ? -1.618  4.507   29.337 1.00 14.58 ? 6    LEU D HG   1 
ATOM   1237 H  HD11 . LEU D  2 6  ? 0.606   2.634   28.590 1.00 15.85 ? 6    LEU D HD11 1 
ATOM   1238 H  HD12 . LEU D  2 6  ? 0.505   3.856   29.842 1.00 15.80 ? 6    LEU D HD12 1 
ATOM   1239 H  HD13 . LEU D  2 6  ? -0.319  2.299   30.065 1.00 14.47 ? 6    LEU D HD13 1 
ATOM   1240 H  HD21 . LEU D  2 6  ? 0.192   4.404   27.226 1.00 14.70 ? 6    LEU D HD21 1 
ATOM   1241 H  HD22 . LEU D  2 6  ? -1.196  3.550   26.597 1.00 15.45 ? 6    LEU D HD22 1 
ATOM   1242 H  HD23 . LEU D  2 6  ? -1.390  5.205   27.242 1.00 13.71 ? 6    LEU D HD23 1 
ATOM   1243 N  N    . CYS D  2 7  ? -5.349  1.534   28.527 1.00 10.38 ? 7    CYS D N    1 
ATOM   1244 C  CA   . CYS D  2 7  ? -6.289  0.465   28.314 1.00 10.93 ? 7    CYS D CA   1 
ATOM   1245 C  C    . CYS D  2 7  ? -7.243  0.812   27.147 1.00 10.99 ? 7    CYS D C    1 
ATOM   1246 O  O    . CYS D  2 7  ? -7.441  0.007   26.252 1.00 11.70 ? 7    CYS D O    1 
ATOM   1247 C  CB   . CYS D  2 7  ? -7.117  0.211   29.581 1.00 11.44 ? 7    CYS D CB   1 
ATOM   1248 S  SG   . CYS D  2 7  ? -8.477  -0.993  29.284 1.00 15.32 ? 7    CYS D SG   1 
ATOM   1249 H  H    . CYS D  2 7  ? -5.342  2.057   29.359 1.00 10.08 ? 7    CYS D H    1 
ATOM   1250 H  HA   . CYS D  2 7  ? -5.751  -0.416  28.054 1.00 9.22  ? 7    CYS D HA   1 
ATOM   1251 H  HB2  . CYS D  2 7  ? -6.479  -0.088  30.400 1.00 13.13 ? 7    CYS D HB2  1 
ATOM   1252 H  HB3  . CYS D  2 7  ? -7.564  1.144   29.875 1.00 9.80  ? 7    CYS D HB3  1 
ATOM   1253 N  N    . GLY D  2 8  ? -7.805  2.015   27.161 1.00 10.46 ? 8    GLY D N    1 
ATOM   1254 C  CA   . GLY D  2 8  ? -8.737  2.389   26.105 1.00 9.67  ? 8    GLY D CA   1 
ATOM   1255 C  C    . GLY D  2 8  ? -8.116  2.372   24.723 1.00 10.44 ? 8    GLY D C    1 
ATOM   1256 O  O    . GLY D  2 8  ? -8.769  1.944   23.747 1.00 11.09 ? 8    GLY D O    1 
ATOM   1257 H  H    . GLY D  2 8  ? -7.531  2.684   27.825 1.00 11.00 ? 8    GLY D H    1 
ATOM   1258 H  HA2  . GLY D  2 8  ? -9.589  1.725   26.133 1.00 9.49  ? 8    GLY D HA2  1 
ATOM   1259 H  HA3  . GLY D  2 8  ? -9.086  3.388   26.318 1.00 8.94  ? 8    GLY D HA3  1 
ATOM   1260 N  N    . SER D  2 9  ? -6.868  2.802   24.610 1.00 11.23 ? 9    SER D N    1 
ATOM   1261 C  CA   . SER D  2 9  ? -6.174  2.816   23.344 1.00 11.57 ? 9    SER D CA   1 
ATOM   1262 C  C    . SER D  2 9  ? -6.102  1.393   22.793 1.00 12.20 ? 9    SER D C    1 
ATOM   1263 O  O    . SER D  2 9  ? -6.310  1.129   21.592 1.00 13.97 ? 9    SER D O    1 
ATOM   1264 C  CB   . SER D  2 9  ? -4.782  3.397   23.580 1.00 14.25 ? 9    SER D CB   1 
ATOM   1265 O  OG   . SER D  2 9  ? -4.029  3.351   22.394 1.00 19.26 ? 9    SER D OG   1 
ATOM   1266 H  H    . SER D  2 9  ? -6.401  3.160   25.403 1.00 12.08 ? 9    SER D H    1 
ATOM   1267 H  HA   . SER D  2 9  ? -6.724  3.452   22.681 1.00 14.21 ? 9    SER D HA   1 
ATOM   1268 H  HB2  . SER D  2 9  ? -4.826  4.418   23.924 1.00 14.84 ? 9    SER D HB2  1 
ATOM   1269 H  HB3  . SER D  2 9  ? -4.257  2.820   24.324 1.00 13.97 ? 9    SER D HB3  1 
ATOM   1270 H  HG   . SER D  2 9  ? -4.551  3.861   21.781 1.00 19.03 ? 9    SER D HG   1 
ATOM   1271 N  N    A HIS D  2 10 ? -5.793  0.481   23.689 0.55 10.27 ? 10   HIS D N    1 
ATOM   1272 N  N    B HIS D  2 10 ? -5.795  0.428   23.664 0.45 10.73 ? 10   HIS D N    1 
ATOM   1273 C  CA   A HIS D  2 10 ? -5.715  -0.907  23.335 0.55 9.41  ? 10   HIS D CA   1 
ATOM   1274 C  CA   B HIS D  2 10 ? -5.740  -0.983  23.227 0.45 9.17  ? 10   HIS D CA   1 
ATOM   1275 C  C    A HIS D  2 10 ? -7.095  -1.468  22.938 0.55 10.57 ? 10   HIS D C    1 
ATOM   1276 C  C    B HIS D  2 10 ? -7.133  -1.556  22.940 0.45 9.87  ? 10   HIS D C    1 
ATOM   1277 O  O    A HIS D  2 10 ? -7.226  -2.142  21.908 0.55 12.94 ? 10   HIS D O    1 
ATOM   1278 O  O    B HIS D  2 10 ? -7.319  -2.348  22.001 0.45 10.08 ? 10   HIS D O    1 
ATOM   1279 C  CB   A HIS D  2 10 ? -5.180  -1.658  24.537 0.55 10.11 ? 10   HIS D CB   1 
ATOM   1280 C  CB   B HIS D  2 10 ? -5.045  -1.854  24.282 0.45 11.28 ? 10   HIS D CB   1 
ATOM   1281 C  CG   A HIS D  2 10 ? -5.127  -3.127  24.335 0.55 7.68  ? 10   HIS D CG   1 
ATOM   1282 C  CG   B HIS D  2 10 ? -3.566  -1.679  24.302 0.45 13.78 ? 10   HIS D CG   1 
ATOM   1283 N  ND1  A HIS D  2 10 ? -4.034  -3.773  23.801 0.55 10.40 ? 10   HIS D ND1  1 
ATOM   1284 N  ND1  B HIS D  2 10 ? -2.716  -2.439  23.532 0.45 17.69 ? 10   HIS D ND1  1 
ATOM   1285 C  CD2  A HIS D  2 10 ? -6.045  -4.093  24.577 0.55 7.21  ? 10   HIS D CD2  1 
ATOM   1286 C  CD2  B HIS D  2 10 ? -2.787  -0.813  24.985 0.45 13.20 ? 10   HIS D CD2  1 
ATOM   1287 C  CE1  A HIS D  2 10 ? -4.285  -5.070  23.714 0.55 9.68  ? 10   HIS D CE1  1 
ATOM   1288 C  CE1  B HIS D  2 10 ? -1.472  -2.051  23.746 0.45 14.78 ? 10   HIS D CE1  1 
ATOM   1289 N  NE2  A HIS D  2 10 ? -5.500  -5.293  24.179 0.55 8.01  ? 10   HIS D NE2  1 
ATOM   1290 N  NE2  B HIS D  2 10 ? -1.489  -1.065  24.624 0.45 10.70 ? 10   HIS D NE2  1 
ATOM   1291 H  H    A HIS D  2 10 ? -5.617  0.772   24.602 0.55 11.54 ? 10   HIS D H    1 
ATOM   1292 H  H    B HIS D  2 10 ? -5.620  0.750   24.579 0.45 11.57 ? 10   HIS D H    1 
ATOM   1293 H  HA   A HIS D  2 10 ? -5.032  -1.046  22.526 0.55 10.20 ? 10   HIS D HA   1 
ATOM   1294 H  HA   B HIS D  2 10 ? -5.164  -1.043  22.312 0.45 11.16 ? 10   HIS D HA   1 
ATOM   1295 H  HB2  A HIS D  2 10 ? -4.174  -1.300  24.693 0.55 10.26 ? 10   HIS D HB2  1 
ATOM   1296 H  HB2  B HIS D  2 10 ? -5.429  -1.594  25.254 0.45 11.72 ? 10   HIS D HB2  1 
ATOM   1297 H  HB3  A HIS D  2 10 ? -5.763  -1.440  25.417 0.55 10.77 ? 10   HIS D HB3  1 
ATOM   1298 H  HB3  B HIS D  2 10 ? -5.262  -2.890  24.093 0.45 10.68 ? 10   HIS D HB3  1 
ATOM   1299 H  HD1  A HIS D  2 10 ? -3.196  -3.337  23.538 0.55 9.65  ? 10   HIS D HD1  1 
ATOM   1300 H  HD1  B HIS D  2 10 ? -2.982  -3.131  22.896 0.45 15.76 ? 10   HIS D HD1  1 
ATOM   1301 H  HD2  A HIS D  2 10 ? -7.036  -3.979  24.997 0.55 8.96  ? 10   HIS D HD2  1 
ATOM   1302 H  HD2  B HIS D  2 10 ? -3.093  -0.068  25.691 0.45 12.66 ? 10   HIS D HD2  1 
ATOM   1303 H  HE1  A HIS D  2 10 ? -3.727  -5.737  23.080 0.55 9.09  ? 10   HIS D HE1  1 
ATOM   1304 H  HE1  B HIS D  2 10 ? -0.624  -2.694  23.615 0.45 15.45 ? 10   HIS D HE1  1 
ATOM   1305 N  N    . LEU D  2 11 ? -8.114  -1.156  23.735 1.00 8.68  ? 11   LEU D N    1 
ATOM   1306 C  CA   . LEU D  2 11 ? -9.478  -1.634  23.520 1.00 9.16  ? 11   LEU D CA   1 
ATOM   1307 C  C    . LEU D  2 11 ? -10.019 -1.234  22.164 1.00 10.08 ? 11   LEU D C    1 
ATOM   1308 O  O    . LEU D  2 11 ? -10.680 -2.040  21.499 1.00 9.93  ? 11   LEU D O    1 
ATOM   1309 C  CB   . LEU D  2 11 ? -10.416 -1.098  24.598 1.00 11.21 ? 11   LEU D CB   1 
ATOM   1310 C  CG   . LEU D  2 11 ? -10.254 -1.696  25.987 1.00 13.06 ? 11   LEU D CG   1 
ATOM   1311 C  CD1  . LEU D  2 11 ? -11.244 -1.006  26.885 1.00 14.55 ? 11   LEU D CD1  1 
ATOM   1312 C  CD2  . LEU D  2 11 ? -10.514 -3.202  26.013 1.00 14.77 ? 11   LEU D CD2  1 
ATOM   1313 H  H    . LEU D  2 11 ? -7.945  -0.545  24.470 1.00 10.64 ? 11   LEU D H    1 
ATOM   1314 H  HA   . LEU D  2 11 ? -9.485  -2.704  23.563 1.00 8.52  ? 11   LEU D HA   1 
ATOM   1315 H  HB2  . LEU D  2 11 ? -10.221 -0.036  24.657 1.00 11.73 ? 11   LEU D HB2  1 
ATOM   1316 H  HB3  . LEU D  2 11 ? -11.446 -1.215  24.291 1.00 9.66  ? 11   LEU D HB3  1 
ATOM   1317 H  HG   . LEU D  2 11 ? -9.233  -1.502  26.299 1.00 13.57 ? 11   LEU D HG   1 
ATOM   1318 H  HD11 . LEU D  2 11 ? -11.489 -1.656  27.711 1.00 14.86 ? 11   LEU D HD11 1 
ATOM   1319 H  HD12 . LEU D  2 11 ? -10.856 -0.053  27.249 1.00 14.93 ? 11   LEU D HD12 1 
ATOM   1320 H  HD13 . LEU D  2 11 ? -12.149 -0.827  26.321 1.00 12.61 ? 11   LEU D HD13 1 
ATOM   1321 H  HD21 . LEU D  2 11 ? -11.294 -3.444  25.292 1.00 14.71 ? 11   LEU D HD21 1 
ATOM   1322 H  HD22 . LEU D  2 11 ? -9.622  -3.761  25.776 1.00 15.82 ? 11   LEU D HD22 1 
ATOM   1323 H  HD23 . LEU D  2 11 ? -10.878 -3.489  26.991 1.00 15.78 ? 11   LEU D HD23 1 
ATOM   1324 N  N    . VAL D  2 12 ? -9.775  0.018   21.744 1.00 9.76  ? 12   VAL D N    1 
ATOM   1325 C  CA   . VAL D  2 12 ? -10.345 0.392   20.451 1.00 9.67  ? 12   VAL D CA   1 
ATOM   1326 C  C    . VAL D  2 12 ? -9.667  -0.336  19.299 1.00 8.53  ? 12   VAL D C    1 
ATOM   1327 O  O    . VAL D  2 12 ? -10.295 -0.568  18.261 1.00 10.18 ? 12   VAL D O    1 
ATOM   1328 C  CB   . VAL D  2 12 ? -10.415 1.912   20.225 1.00 12.78 ? 12   VAL D CB   1 
ATOM   1329 C  CG1  . VAL D  2 12 ? -11.331 2.544   21.281 1.00 13.95 ? 12   VAL D CG1  1 
ATOM   1330 C  CG2  . VAL D  2 12 ? -9.064  2.528   20.241 1.00 11.72 ? 12   VAL D CG2  1 
ATOM   1331 H  H    . VAL D  2 12 ? -9.247  0.648   22.274 1.00 10.00 ? 12   VAL D H    1 
ATOM   1332 H  HA   . VAL D  2 12 ? -11.348 0.014   20.529 1.00 10.46 ? 12   VAL D HA   1 
ATOM   1333 H  HB   . VAL D  2 12 ? -10.873 2.058   19.260 1.00 13.26 ? 12   VAL D HB   1 
ATOM   1334 H  HG11 . VAL D  2 12 ? -11.280 3.615   21.167 1.00 14.99 ? 12   VAL D HG11 1 
ATOM   1335 H  HG12 . VAL D  2 12 ? -12.338 2.209   21.177 1.00 13.76 ? 12   VAL D HG12 1 
ATOM   1336 H  HG13 . VAL D  2 12 ? -10.973 2.310   22.273 1.00 15.63 ? 12   VAL D HG13 1 
ATOM   1337 H  HG21 . VAL D  2 12 ? -9.204  3.558   19.939 1.00 14.08 ? 12   VAL D HG21 1 
ATOM   1338 H  HG22 . VAL D  2 12 ? -8.616  2.510   21.231 1.00 13.73 ? 12   VAL D HG22 1 
ATOM   1339 H  HG23 . VAL D  2 12 ? -8.418  2.069   19.505 1.00 14.46 ? 12   VAL D HG23 1 
ATOM   1340 N  N    A GLU D  2 13 ? -8.394  -0.683  19.429 0.50 9.37  ? 13   GLU D N    1 
ATOM   1341 N  N    B GLU D  2 13 ? -8.388  -0.667  19.432 0.50 9.51  ? 13   GLU D N    1 
ATOM   1342 C  CA   A GLU D  2 13 ? -7.765  -1.473  18.388 0.50 8.31  ? 13   GLU D CA   1 
ATOM   1343 C  CA   B GLU D  2 13 ? -7.724  -1.446  18.406 0.50 10.13 ? 13   GLU D CA   1 
ATOM   1344 C  C    A GLU D  2 13 ? -8.385  -2.872  18.364 0.50 9.91  ? 13   GLU D C    1 
ATOM   1345 C  C    B GLU D  2 13 ? -8.303  -2.877  18.378 0.50 9.91  ? 13   GLU D C    1 
ATOM   1346 O  O    A GLU D  2 13 ? -8.646  -3.445  17.294 0.50 11.67 ? 13   GLU D O    1 
ATOM   1347 O  O    B GLU D  2 13 ? -8.458  -3.472  17.307 0.50 12.09 ? 13   GLU D O    1 
ATOM   1348 C  CB   A GLU D  2 13 ? -6.275  -1.588  18.661 0.50 10.70 ? 13   GLU D CB   1 
ATOM   1349 C  CB   B GLU D  2 13 ? -6.216  -1.445  18.681 0.50 12.20 ? 13   GLU D CB   1 
ATOM   1350 C  CG   A GLU D  2 13 ? -5.538  -2.461  17.660 0.50 15.43 ? 13   GLU D CG   1 
ATOM   1351 C  CG   B GLU D  2 13 ? -5.496  -0.159  18.200 0.50 17.76 ? 13   GLU D CG   1 
ATOM   1352 C  CD   A GLU D  2 13 ? -4.048  -2.165  17.626 0.50 22.89 ? 13   GLU D CD   1 
ATOM   1353 C  CD   B GLU D  2 13 ? -4.077  -0.014  18.734 0.50 22.24 ? 13   GLU D CD   1 
ATOM   1354 O  OE1  A GLU D  2 13 ? -3.674  -0.970  17.624 0.50 29.18 ? 13   GLU D OE1  1 
ATOM   1355 O  OE1  B GLU D  2 13 ? -3.331  -1.017  18.727 0.50 24.18 ? 13   GLU D OE1  1 
ATOM   1356 O  OE2  A GLU D  2 13 ? -3.250  -3.120  17.579 0.50 26.85 ? 13   GLU D OE2  1 
ATOM   1357 O  OE2  B GLU D  2 13 ? -3.706  1.112   19.145 0.50 25.18 ? 13   GLU D OE2  1 
ATOM   1358 H  H    A GLU D  2 13 ? -7.877  -0.411  20.214 0.50 9.37  ? 13   GLU D H    1 
ATOM   1359 H  H    B GLU D  2 13 ? -7.875  -0.407  20.220 0.50 9.43  ? 13   GLU D H    1 
ATOM   1360 H  HA   A GLU D  2 13 ? -7.906  -0.952  17.448 0.50 9.39  ? 13   GLU D HA   1 
ATOM   1361 H  HA   B GLU D  2 13 ? -7.905  -0.940  17.466 0.50 10.40 ? 13   GLU D HA   1 
ATOM   1362 H  HB2  A GLU D  2 13 ? -5.853  -0.593  18.681 0.50 12.46 ? 13   GLU D HB2  1 
ATOM   1363 H  HB2  B GLU D  2 13 ? -6.109  -1.527  19.760 0.50 13.23 ? 13   GLU D HB2  1 
ATOM   1364 H  HB3  A GLU D  2 13 ? -6.171  -2.025  19.650 0.50 11.89 ? 13   GLU D HB3  1 
ATOM   1365 H  HB3  B GLU D  2 13 ? -5.757  -2.309  18.226 0.50 13.15 ? 13   GLU D HB3  1 
ATOM   1366 H  HG2  A GLU D  2 13 ? -5.683  -3.501  17.924 0.50 16.47 ? 13   GLU D HG2  1 
ATOM   1367 H  HG2  B GLU D  2 13 ? -5.446  -0.185  17.126 0.50 18.15 ? 13   GLU D HG2  1 
ATOM   1368 H  HG3  A GLU D  2 13 ? -5.954  -2.282  16.687 0.50 17.63 ? 13   GLU D HG3  1 
ATOM   1369 H  HG3  B GLU D  2 13 ? -6.072  0.697   18.505 0.50 18.31 ? 13   GLU D HG3  1 
ATOM   1370 N  N    . ALA D  2 14 ? -8.644  -3.427  19.547 1.00 9.11  ? 14   ALA D N    1 
ATOM   1371 C  CA   . ALA D  2 14 ? -9.249  -4.751  19.620 1.00 10.16 ? 14   ALA D CA   1 
ATOM   1372 C  C    . ALA D  2 14 ? -10.663 -4.703  19.016 1.00 9.69  ? 14   ALA D C    1 
ATOM   1373 O  O    . ALA D  2 14 ? -11.034 -5.607  18.282 1.00 10.18 ? 14   ALA D O    1 
ATOM   1374 C  CB   . ALA D  2 14 ? -9.290  -5.249  21.077 1.00 10.88 ? 14   ALA D CB   1 
ATOM   1375 H  H    . ALA D  2 14 ? -8.528  -2.915  20.367 1.00 7.89  ? 14   ALA D H    1 
ATOM   1376 H  HA   . ALA D  2 14 ? -8.691  -5.455  19.012 1.00 9.36  ? 14   ALA D HA   1 
ATOM   1377 H  HB1  . ALA D  2 14 ? -9.776  -4.544  21.700 1.00 8.23  ? 14   ALA D HB1  1 
ATOM   1378 H  HB2  . ALA D  2 14 ? -9.794  -6.189  21.109 1.00 8.35  ? 14   ALA D HB2  1 
ATOM   1379 H  HB3  . ALA D  2 14 ? -8.266  -5.351  21.364 1.00 10.47 ? 14   ALA D HB3  1 
ATOM   1380 N  N    . LEU D  2 15 ? -11.418 -3.655  19.309 1.00 8.86  ? 15   LEU D N    1 
ATOM   1381 C  CA   . LEU D  2 15 ? -12.754 -3.523  18.728 1.00 8.90  ? 15   LEU D CA   1 
ATOM   1382 C  C    . LEU D  2 15 ? -12.679 -3.376  17.223 1.00 8.37  ? 15   LEU D C    1 
ATOM   1383 O  O    . LEU D  2 15 ? -13.566 -3.889  16.529 1.00 9.86  ? 15   LEU D O    1 
ATOM   1384 C  CB   . LEU D  2 15 ? -13.519 -2.341  19.353 1.00 8.78  ? 15   LEU D CB   1 
ATOM   1385 C  CG   . LEU D  2 15 ? -13.927 -2.503  20.815 1.00 9.59  ? 15   LEU D CG   1 
ATOM   1386 C  CD1  . LEU D  2 15 ? -14.515 -1.225  21.313 1.00 11.25 ? 15   LEU D CD1  1 
ATOM   1387 C  CD2  . LEU D  2 15 ? -14.913 -3.686  20.964 1.00 10.80 ? 15   LEU D CD2  1 
ATOM   1388 H  H    . LEU D  2 15 ? -11.088 -2.912  19.848 1.00 10.33 ? 15   LEU D H    1 
ATOM   1389 H  HA   . LEU D  2 15 ? -13.302 -4.430  18.901 1.00 7.99  ? 15   LEU D HA   1 
ATOM   1390 H  HB2  . LEU D  2 15 ? -12.941 -1.439  19.253 1.00 9.59  ? 15   LEU D HB2  1 
ATOM   1391 H  HB3  . LEU D  2 15 ? -14.438 -2.141  18.808 1.00 6.04  ? 15   LEU D HB3  1 
ATOM   1392 H  HG   . LEU D  2 15 ? -13.040 -2.732  21.379 1.00 10.81 ? 15   LEU D HG   1 
ATOM   1393 H  HD11 . LEU D  2 15 ? -13.773 -0.446  21.394 1.00 10.25 ? 15   LEU D HD11 1 
ATOM   1394 H  HD12 . LEU D  2 15 ? -15.283 -0.913  20.630 1.00 9.42  ? 15   LEU D HD12 1 
ATOM   1395 H  HD13 . LEU D  2 15 ? -14.939 -1.405  22.290 1.00 12.68 ? 15   LEU D HD13 1 
ATOM   1396 H  HD21 . LEU D  2 15 ? -14.311 -4.579  20.893 1.00 11.56 ? 15   LEU D HD21 1 
ATOM   1397 H  HD22 . LEU D  2 15 ? -15.345 -3.659  21.947 1.00 11.90 ? 15   LEU D HD22 1 
ATOM   1398 H  HD23 . LEU D  2 15 ? -15.643 -3.701  20.169 1.00 11.26 ? 15   LEU D HD23 1 
ATOM   1399 N  N    . TYR D  2 16 ? -11.691 -2.644  16.700 1.00 9.04  ? 16   TYR D N    1 
ATOM   1400 C  CA   . TYR D  2 16 ? -11.557 -2.564  15.247 1.00 8.86  ? 16   TYR D CA   1 
ATOM   1401 C  C    . TYR D  2 16 ? -11.527 -3.988  14.661 1.00 8.82  ? 16   TYR D C    1 
ATOM   1402 O  O    . TYR D  2 16 ? -12.223 -4.315  13.689 1.00 10.04 ? 16   TYR D O    1 
ATOM   1403 C  CB   . TYR D  2 16 ? -10.257 -1.846  14.874 1.00 9.50  ? 16   TYR D CB   1 
ATOM   1404 C  CG   . TYR D  2 16 ? -9.979  -1.928  13.418 1.00 9.84  ? 16   TYR D CG   1 
ATOM   1405 C  CD1  . TYR D  2 16 ? -10.730 -1.210  12.529 1.00 12.21 ? 16   TYR D CD1  1 
ATOM   1406 C  CD2  . TYR D  2 16 ? -9.056  -2.811  12.916 1.00 13.28 ? 16   TYR D CD2  1 
ATOM   1407 C  CE1  . TYR D  2 16 ? -10.594 -1.366  11.150 1.00 14.58 ? 16   TYR D CE1  1 
ATOM   1408 C  CE2  . TYR D  2 16 ? -8.892  -2.969  11.537 1.00 12.49 ? 16   TYR D CE2  1 
ATOM   1409 C  CZ   . TYR D  2 16 ? -9.667  -2.250  10.683 1.00 13.68 ? 16   TYR D CZ   1 
ATOM   1410 O  OH   . TYR D  2 16 ? -9.538  -2.391  9.305  1.00 19.19 ? 16   TYR D OH   1 
ATOM   1411 H  H    . TYR D  2 16 ? -11.060 -2.217  17.290 1.00 6.60  ? 16   TYR D H    1 
ATOM   1412 H  HA   . TYR D  2 16 ? -12.395 -2.041  14.821 1.00 9.57  ? 16   TYR D HA   1 
ATOM   1413 H  HB2  . TYR D  2 16 ? -10.401 -0.820  15.168 1.00 11.26 ? 16   TYR D HB2  1 
ATOM   1414 H  HB3  . TYR D  2 16 ? -9.432  -2.253  15.438 1.00 6.15  ? 16   TYR D HB3  1 
ATOM   1415 H  HD1  . TYR D  2 16 ? -11.462 -0.509  12.904 1.00 12.34 ? 16   TYR D HD1  1 
ATOM   1416 H  HD2  . TYR D  2 16 ? -8.449  -3.363  13.615 1.00 12.54 ? 16   TYR D HD2  1 
ATOM   1417 H  HE1  . TYR D  2 16 ? -11.203 -0.789  10.476 1.00 15.51 ? 16   TYR D HE1  1 
ATOM   1418 H  HE2  . TYR D  2 16 ? -8.152  -3.671  11.185 1.00 14.02 ? 16   TYR D HE2  1 
ATOM   1419 H  HH   . TYR D  2 16 ? -8.788  -2.980  9.142  1.00 15.72 ? 16   TYR D HH   1 
ATOM   1420 N  N    . LEU D  2 17 ? -10.692 -4.850  15.235 1.00 9.00  ? 17   LEU D N    1 
ATOM   1421 C  CA   . LEU D  2 17 ? -10.554 -6.209  14.710 1.00 9.19  ? 17   LEU D CA   1 
ATOM   1422 C  C    . LEU D  2 17 ? -11.782 -7.091  14.928 1.00 9.60  ? 17   LEU D C    1 
ATOM   1423 O  O    . LEU D  2 17 ? -12.204 -7.822  14.032 1.00 10.75 ? 17   LEU D O    1 
ATOM   1424 C  CB   . LEU D  2 17 ? -9.316  -6.892  15.314 1.00 11.06 ? 17   LEU D CB   1 
ATOM   1425 C  CG   . LEU D  2 17 ? -7.954  -6.281  14.902 1.00 11.70 ? 17   LEU D CG   1 
ATOM   1426 C  CD1  . LEU D  2 17 ? -6.852  -6.874  15.771 1.00 14.51 ? 17   LEU D CD1  1 
ATOM   1427 C  CD2  . LEU D  2 17 ? -7.637  -6.571  13.441 1.00 15.17 ? 17   LEU D CD2  1 
ATOM   1428 H  H    . LEU D  2 17 ? -10.219 -4.586  16.040 1.00 8.55  ? 17   LEU D H    1 
ATOM   1429 H  HA   . LEU D  2 17 ? -10.413 -6.185  13.651 1.00 8.19  ? 17   LEU D HA   1 
ATOM   1430 H  HB2  . LEU D  2 17 ? -9.359  -6.834  16.390 1.00 8.19  ? 17   LEU D HB2  1 
ATOM   1431 H  HB3  . LEU D  2 17 ? -9.304  -7.934  14.997 1.00 9.81  ? 17   LEU D HB3  1 
ATOM   1432 H  HG   . LEU D  2 17 ? -7.988  -5.217  15.057 1.00 13.68 ? 17   LEU D HG   1 
ATOM   1433 H  HD11 . LEU D  2 17 ? -6.812  -7.937  15.640 1.00 13.42 ? 17   LEU D HD11 1 
ATOM   1434 H  HD12 . LEU D  2 17 ? -5.905  -6.436  15.442 1.00 13.91 ? 17   LEU D HD12 1 
ATOM   1435 H  HD13 . LEU D  2 17 ? -7.024  -6.622  16.801 1.00 12.56 ? 17   LEU D HD13 1 
ATOM   1436 H  HD21 . LEU D  2 17 ? -8.156  -5.897  12.780 1.00 13.57 ? 17   LEU D HD21 1 
ATOM   1437 H  HD22 . LEU D  2 17 ? -6.565  -6.475  13.302 1.00 14.98 ? 17   LEU D HD22 1 
ATOM   1438 H  HD23 . LEU D  2 17 ? -7.951  -7.586  13.242 1.00 13.59 ? 17   LEU D HD23 1 
ATOM   1439 N  N    . VAL D  2 18 ? -12.341 -7.035  16.124 1.00 9.34  ? 18   VAL D N    1 
ATOM   1440 C  CA   . VAL D  2 18 ? -13.490 -7.851  16.453 1.00 9.44  ? 18   VAL D CA   1 
ATOM   1441 C  C    . VAL D  2 18 ? -14.747 -7.436  15.701 1.00 10.78 ? 18   VAL D C    1 
ATOM   1442 O  O    . VAL D  2 18 ? -15.487 -8.285  15.206 1.00 11.57 ? 18   VAL D O    1 
ATOM   1443 C  CB   . VAL D  2 18 ? -13.755 -7.804  17.972 1.00 10.23 ? 18   VAL D CB   1 
ATOM   1444 C  CG1  . VAL D  2 18 ? -15.064 -8.539  18.290 1.00 11.23 ? 18   VAL D CG1  1 
ATOM   1445 C  CG2  . VAL D  2 18 ? -12.605 -8.446  18.706 1.00 11.32 ? 18   VAL D CG2  1 
ATOM   1446 H  H    . VAL D  2 18 ? -12.038 -6.455  16.848 1.00 4.57  ? 18   VAL D H    1 
ATOM   1447 H  HA   . VAL D  2 18 ? -13.261 -8.879  16.198 1.00 11.46 ? 18   VAL D HA   1 
ATOM   1448 H  HB   . VAL D  2 18 ? -13.843 -6.769  18.272 1.00 6.38  ? 18   VAL D HB   1 
ATOM   1449 H  HG11 . VAL D  2 18 ? -15.082 -8.644  19.356 1.00 10.37 ? 18   VAL D HG11 1 
ATOM   1450 H  HG12 . VAL D  2 18 ? -15.933 -7.982  18.005 1.00 9.45  ? 18   VAL D HG12 1 
ATOM   1451 H  HG13 . VAL D  2 18 ? -15.078 -9.515  17.872 1.00 8.11  ? 18   VAL D HG13 1 
ATOM   1452 H  HG21 . VAL D  2 18 ? -12.642 -9.478  18.427 1.00 9.77  ? 18   VAL D HG21 1 
ATOM   1453 H  HG22 . VAL D  2 18 ? -11.661 -7.973  18.439 1.00 12.67 ? 18   VAL D HG22 1 
ATOM   1454 H  HG23 . VAL D  2 18 ? -12.765 -8.362  19.775 1.00 13.49 ? 18   VAL D HG23 1 
ATOM   1455 N  N    . CYS D  2 19 ? -14.995 -6.133  15.605 1.00 9.57  ? 19   CYS D N    1 
ATOM   1456 C  CA   . CYS D  2 19 ? -16.222 -5.633  14.996 1.00 10.68 ? 19   CYS D CA   1 
ATOM   1457 C  C    . CYS D  2 19 ? -16.193 -5.586  13.494 1.00 11.66 ? 19   CYS D C    1 
ATOM   1458 O  O    . CYS D  2 19 ? -17.258 -5.676  12.862 1.00 13.81 ? 19   CYS D O    1 
ATOM   1459 C  CB   . CYS D  2 19 ? -16.554 -4.268  15.574 1.00 10.24 ? 19   CYS D CB   1 
ATOM   1460 S  SG   . CYS D  2 19 ? -16.689 -4.308  17.393 1.00 10.82 ? 19   CYS D SG   1 
ATOM   1461 H  H    . CYS D  2 19 ? -14.345 -5.504  15.960 1.00 11.50 ? 19   CYS D H    1 
ATOM   1462 H  HA   . CYS D  2 19 ? -16.997 -6.303  15.338 1.00 11.16 ? 19   CYS D HA   1 
ATOM   1463 H  HB2  . CYS D  2 19 ? -15.842 -3.516  15.255 1.00 9.80  ? 19   CYS D HB2  1 
ATOM   1464 H  HB3  . CYS D  2 19 ? -17.519 -3.960  15.187 1.00 11.08 ? 19   CYS D HB3  1 
ATOM   1465 N  N    . GLY D  2 20 ? -15.022 -5.429  12.907 1.00 12.40 ? 20   GLY D N    1 
ATOM   1466 C  CA   . GLY D  2 20 ? -14.970 -5.397  11.466 1.00 13.91 ? 20   GLY D CA   1 
ATOM   1467 C  C    . GLY D  2 20 ? -15.905 -4.365  10.864 1.00 14.91 ? 20   GLY D C    1 
ATOM   1468 O  O    . GLY D  2 20 ? -16.032 -3.236  11.330 1.00 14.43 ? 20   GLY D O    1 
ATOM   1469 H  H    . GLY D  2 20 ? -14.180 -5.347  13.406 1.00 13.47 ? 20   GLY D H    1 
ATOM   1470 H  HA2  . GLY D  2 20 ? -13.995 -5.016  11.207 1.00 14.59 ? 20   GLY D HA2  1 
ATOM   1471 H  HA3  . GLY D  2 20 ? -15.184 -6.352  11.061 1.00 14.30 ? 20   GLY D HA3  1 
ATOM   1472 N  N    . GLU D  2 21 ? -16.575 -4.788  9.804  1.00 15.91 ? 21   GLU D N    1 
ATOM   1473 C  CA   . GLU D  2 21 ? -17.475 -3.902  9.072  1.00 16.19 ? 21   GLU D CA   1 
ATOM   1474 C  C    . GLU D  2 21 ? -18.654 -3.370  9.847  1.00 16.47 ? 21   GLU D C    1 
ATOM   1475 O  O    . GLU D  2 21 ? -19.261 -2.381  9.421  1.00 18.75 ? 21   GLU D O    1 
ATOM   1476 C  CB   . GLU D  2 21 ? -17.968 -4.597  7.789  1.00 21.26 ? 21   GLU D CB   1 
ATOM   1477 C  CG   . GLU D  2 21 ? -19.014 -5.670  8.017  0.50 22.19 ? 21   GLU D CG   1 
ATOM   1478 C  CD   . GLU D  2 21 ? -19.397 -6.376  6.726  0.50 27.89 ? 21   GLU D CD   1 
ATOM   1479 O  OE1  . GLU D  2 21 ? -19.207 -5.775  5.642  0.50 27.89 ? 21   GLU D OE1  1 
ATOM   1480 O  OE2  . GLU D  2 21 ? -19.887 -7.524  6.796  0.50 27.13 ? 21   GLU D OE2  1 
ATOM   1481 H  H    . GLU D  2 21 ? -16.453 -5.715  9.522  1.00 16.50 ? 21   GLU D H    1 
ATOM   1482 H  HA   . GLU D  2 21 ? -16.910 -3.052  8.745  1.00 16.26 ? 21   GLU D HA   1 
ATOM   1483 H  HB2  . GLU D  2 21 ? -18.371 -3.847  7.133  1.00 20.17 ? 21   GLU D HB2  1 
ATOM   1484 H  HB3  . GLU D  2 21 ? -17.126 -5.052  7.278  1.00 19.67 ? 21   GLU D HB3  1 
ATOM   1485 H  HG2  . GLU D  2 21 ? -18.534 -6.392  8.668  1.00 23.27 ? 21   GLU D HG2  1 
ATOM   1486 H  HG3  . GLU D  2 21 ? -19.891 -5.282  8.507  1.00 22.37 ? 21   GLU D HG3  1 
ATOM   1487 N  N    . ARG D  2 22 ? -18.975 -3.981  10.983 1.00 15.28 ? 22   ARG D N    1 
ATOM   1488 C  CA   . ARG D  2 22 ? -20.067 -3.519  11.815 1.00 15.69 ? 22   ARG D CA   1 
ATOM   1489 C  C    . ARG D  2 22 ? -19.720 -2.211  12.499 1.00 15.37 ? 22   ARG D C    1 
ATOM   1490 O  O    . ARG D  2 22 ? -20.609 -1.410  12.809 1.00 18.31 ? 22   ARG D O    1 
ATOM   1491 C  CB   . ARG D  2 22 ? -20.381 -4.550  12.904 1.00 16.52 ? 22   ARG D CB   1 
ATOM   1492 C  CG   . ARG D  2 22 ? -21.038 -5.835  12.402 1.00 23.06 ? 22   ARG D CG   1 
ATOM   1493 C  CD   . ARG D  2 22 ? -21.136 -6.921  13.486 1.00 23.45 ? 22   ARG D CD   1 
ATOM   1494 N  NE   . ARG D  2 22 ? -19.815 -7.400  13.903 1.00 28.69 ? 22   ARG D NE   1 
ATOM   1495 C  CZ   . ARG D  2 22 ? -19.611 -8.432  14.725 1.00 30.16 ? 22   ARG D CZ   1 
ATOM   1496 N  NH1  . ARG D  2 22 ? -20.640 -9.104  15.226 1.00 31.27 ? 22   ARG D NH1  1 
ATOM   1497 N  NH2  . ARG D  2 22 ? -18.375 -8.793  15.052 1.00 25.33 ? 22   ARG D NH2  1 
ATOM   1498 H  H    . ARG D  2 22 ? -18.436 -4.762  11.236 1.00 16.71 ? 22   ARG D H    1 
ATOM   1499 H  HA   . ARG D  2 22 ? -20.958 -3.367  11.231 1.00 16.78 ? 22   ARG D HA   1 
ATOM   1500 H  HB2  . ARG D  2 22 ? -19.463 -4.830  13.409 1.00 19.34 ? 22   ARG D HB2  1 
ATOM   1501 H  HB3  . ARG D  2 22 ? -21.034 -4.105  13.641 1.00 18.67 ? 22   ARG D HB3  1 
ATOM   1502 H  HG2  . ARG D  2 22 ? -22.038 -5.605  12.069 1.00 20.14 ? 22   ARG D HG2  1 
ATOM   1503 H  HG3  . ARG D  2 22 ? -20.464 -6.231  11.572 1.00 19.55 ? 22   ARG D HG3  1 
ATOM   1504 H  HD2  . ARG D  2 22 ? -21.659 -6.551  14.355 1.00 22.66 ? 22   ARG D HD2  1 
ATOM   1505 H  HD3  . ARG D  2 22 ? -21.687 -7.763  13.097 1.00 22.40 ? 22   ARG D HD3  1 
ATOM   1506 H  HE   . ARG D  2 22 ? -19.027 -6.918  13.562 1.00 24.98 ? 22   ARG D HE   1 
ATOM   1507 H  HH11 . ARG D  2 22 ? -21.582 -8.850  14.997 1.00 25.13 ? 22   ARG D HH11 1 
ATOM   1508 H  HH12 . ARG D  2 22 ? -20.453 -9.868  15.839 1.00 25.26 ? 22   ARG D HH12 1 
ATOM   1509 H  HH21 . ARG D  2 22 ? -17.579 -8.297  14.690 1.00 23.63 ? 22   ARG D HH21 1 
ATOM   1510 H  HH22 . ARG D  2 22 ? -18.219 -9.568  15.667 1.00 24.01 ? 22   ARG D HH22 1 
ATOM   1511 N  N    . GLY D  2 23 ? -18.428 -1.997  12.752 1.00 12.97 ? 23   GLY D N    1 
ATOM   1512 C  CA   . GLY D  2 23 ? -18.045 -0.795  13.470 1.00 12.50 ? 23   GLY D CA   1 
ATOM   1513 C  C    . GLY D  2 23 ? -18.416 -0.849  14.952 1.00 12.25 ? 23   GLY D C    1 
ATOM   1514 O  O    . GLY D  2 23 ? -18.938 -1.876  15.459 1.00 12.87 ? 23   GLY D O    1 
ATOM   1515 H  H    . GLY D  2 23 ? -17.765 -2.637  12.444 1.00 13.66 ? 23   GLY D H    1 
ATOM   1516 H  HA2  . GLY D  2 23 ? -16.970 -0.692  13.477 1.00 13.86 ? 23   GLY D HA2  1 
ATOM   1517 H  HA3  . GLY D  2 23 ? -18.525 0.051   13.039 1.00 11.70 ? 23   GLY D HA3  1 
ATOM   1518 N  N    . PHE D  2 24 ? -18.218 0.259   15.645 1.00 11.19 ? 24   PHE D N    1 
ATOM   1519 C  CA   . PHE D  2 24 ? -18.522 0.348   17.062 1.00 11.70 ? 24   PHE D CA   1 
ATOM   1520 C  C    . PHE D  2 24 ? -18.547 1.781   17.522 1.00 11.80 ? 24   PHE D C    1 
ATOM   1521 O  O    . PHE D  2 24 ? -18.021 2.669   16.879 1.00 12.04 ? 24   PHE D O    1 
ATOM   1522 C  CB   . PHE D  2 24 ? -17.444 -0.393  17.907 1.00 11.71 ? 24   PHE D CB   1 
ATOM   1523 C  CG   . PHE D  2 24 ? -16.029 0.126   17.704 1.00 10.93 ? 24   PHE D CG   1 
ATOM   1524 C  CD1  . PHE D  2 24 ? -15.260 -0.330  16.671 1.00 10.69 ? 24   PHE D CD1  1 
ATOM   1525 C  CD2  . PHE D  2 24 ? -15.507 1.073   18.559 1.00 10.64 ? 24   PHE D CD2  1 
ATOM   1526 C  CE1  . PHE D  2 24 ? -13.976 0.151   16.473 1.00 12.22 ? 24   PHE D CE1  1 
ATOM   1527 C  CE2  . PHE D  2 24 ? -14.216 1.551   18.353 1.00 11.62 ? 24   PHE D CE2  1 
ATOM   1528 C  CZ   . PHE D  2 24 ? -13.474 1.086   17.312 1.00 11.85 ? 24   PHE D CZ   1 
ATOM   1529 H  H    . PHE D  2 24 ? -17.878 1.037   15.158 1.00 11.16 ? 24   PHE D H    1 
ATOM   1530 H  HA   . PHE D  2 24 ? -19.469 -0.107  17.268 1.00 13.03 ? 24   PHE D HA   1 
ATOM   1531 H  HB2  . PHE D  2 24 ? -17.796 -0.304  18.914 1.00 10.88 ? 24   PHE D HB2  1 
ATOM   1532 H  HB3  . PHE D  2 24 ? -17.506 -1.453  17.699 1.00 13.49 ? 24   PHE D HB3  1 
ATOM   1533 H  HD1  . PHE D  2 24 ? -15.701 -1.076  16.026 1.00 12.60 ? 24   PHE D HD1  1 
ATOM   1534 H  HD2  . PHE D  2 24 ? -16.046 1.467   19.386 1.00 9.00  ? 24   PHE D HD2  1 
ATOM   1535 H  HE1  . PHE D  2 24 ? -13.389 -0.229  15.643 1.00 13.11 ? 24   PHE D HE1  1 
ATOM   1536 H  HE2  . PHE D  2 24 ? -13.889 2.299   19.071 1.00 9.44  ? 24   PHE D HE2  1 
ATOM   1537 H  HZ   . PHE D  2 24 ? -12.464 1.453   17.143 1.00 10.26 ? 24   PHE D HZ   1 
ATOM   1538 N  N    . PHE D  2 25 ? -19.177 2.000   18.675 1.00 13.94 ? 25   PHE D N    1 
ATOM   1539 C  CA   . PHE D  2 25 ? -19.134 3.262   19.371 1.00 14.85 ? 25   PHE D CA   1 
ATOM   1540 C  C    . PHE D  2 25 ? -18.172 3.022   20.544 1.00 15.46 ? 25   PHE D C    1 
ATOM   1541 O  O    . PHE D  2 25 ? -18.170 1.952   21.157 1.00 17.79 ? 25   PHE D O    1 
ATOM   1542 C  CB   . PHE D  2 25 ? -20.485 3.673   19.973 1.00 15.71 ? 25   PHE D CB   1 
ATOM   1543 C  CG   . PHE D  2 25 ? -21.345 4.443   19.042 1.00 19.34 ? 25   PHE D CG   1 
ATOM   1544 C  CD1  . PHE D  2 25 ? -21.899 3.825   17.954 1.00 19.41 ? 25   PHE D CD1  1 
ATOM   1545 C  CD2  . PHE D  2 25 ? -21.598 5.793   19.259 1.00 20.52 ? 25   PHE D CD2  1 
ATOM   1546 C  CE1  . PHE D  2 25 ? -22.710 4.539   17.073 1.00 22.35 ? 25   PHE D CE1  1 
ATOM   1547 C  CE2  . PHE D  2 25 ? -22.397 6.501   18.389 1.00 23.21 ? 25   PHE D CE2  1 
ATOM   1548 C  CZ   . PHE D  2 25 ? -22.946 5.865   17.300 1.00 21.30 ? 25   PHE D CZ   1 
ATOM   1549 H  H    . PHE D  2 25 ? -19.677 1.250   19.069 1.00 15.19 ? 25   PHE D H    1 
ATOM   1550 H  HA   . PHE D  2 25 ? -18.747 4.027   18.721 1.00 15.17 ? 25   PHE D HA   1 
ATOM   1551 H  HB2  . PHE D  2 25 ? -20.900 2.733   20.304 1.00 16.76 ? 25   PHE D HB2  1 
ATOM   1552 H  HB3  . PHE D  2 25 ? -20.247 4.220   20.863 1.00 16.34 ? 25   PHE D HB3  1 
ATOM   1553 H  HD1  . PHE D  2 25 ? -21.697 2.785   17.798 1.00 20.57 ? 25   PHE D HD1  1 
ATOM   1554 H  HD2  . PHE D  2 25 ? -21.191 6.328   20.095 1.00 20.83 ? 25   PHE D HD2  1 
ATOM   1555 H  HE1  . PHE D  2 25 ? -23.129 4.015   16.225 1.00 21.86 ? 25   PHE D HE1  1 
ATOM   1556 H  HE2  . PHE D  2 25 ? -22.588 7.548   18.557 1.00 22.45 ? 25   PHE D HE2  1 
ATOM   1557 H  HZ   . PHE D  2 25 ? -23.574 6.403   16.606 1.00 23.59 ? 25   PHE D HZ   1 
ATOM   1558 N  N    . TYR D  2 26 ? -17.328 3.987   20.832 1.00 13.08 ? 26   TYR D N    1 
ATOM   1559 C  CA   . TYR D  2 26 ? -16.455 3.893   21.994 1.00 14.67 ? 26   TYR D CA   1 
ATOM   1560 C  C    . TYR D  2 26 ? -16.919 4.989   22.891 1.00 14.15 ? 26   TYR D C    1 
ATOM   1561 O  O    . TYR D  2 26 ? -16.785 6.157   22.599 1.00 14.46 ? 26   TYR D O    1 
ATOM   1562 C  CB   . TYR D  2 26 ? -15.000 4.107   21.626 1.00 13.11 ? 26   TYR D CB   1 
ATOM   1563 C  CG   . TYR D  2 26 ? -14.123 4.134   22.860 1.00 15.31 ? 26   TYR D CG   1 
ATOM   1564 C  CD1  . TYR D  2 26 ? -14.031 3.015   23.683 1.00 16.62 ? 26   TYR D CD1  1 
ATOM   1565 C  CD2  . TYR D  2 26 ? -13.402 5.259   23.210 1.00 14.15 ? 26   TYR D CD2  1 
ATOM   1566 C  CE1  . TYR D  2 26 ? -13.242 3.026   24.835 1.00 18.23 ? 26   TYR D CE1  1 
ATOM   1567 C  CE2  . TYR D  2 26 ? -12.607 5.276   24.368 1.00 14.65 ? 26   TYR D CE2  1 
ATOM   1568 C  CZ   . TYR D  2 26 ? -12.539 4.162   25.159 1.00 16.76 ? 26   TYR D CZ   1 
ATOM   1569 O  OH   . TYR D  2 26 ? -11.775 4.167   26.321 1.00 21.09 ? 26   TYR D OH   1 
ATOM   1570 H  H    . TYR D  2 26 ? -17.342 4.788   20.274 1.00 16.40 ? 26   TYR D H    1 
ATOM   1571 H  HA   . TYR D  2 26 ? -16.592 2.947   22.498 1.00 14.03 ? 26   TYR D HA   1 
ATOM   1572 H  HB2  . TYR D  2 26 ? -14.676 3.321   20.969 1.00 14.76 ? 26   TYR D HB2  1 
ATOM   1573 H  HB3  . TYR D  2 26 ? -14.918 5.076   21.145 1.00 13.08 ? 26   TYR D HB3  1 
ATOM   1574 H  HD1  . TYR D  2 26 ? -14.583 2.116   23.433 1.00 17.97 ? 26   TYR D HD1  1 
ATOM   1575 H  HD2  . TYR D  2 26 ? -13.454 6.142   22.590 1.00 13.99 ? 26   TYR D HD2  1 
ATOM   1576 H  HE1  . TYR D  2 26 ? -13.178 2.149   25.459 1.00 18.40 ? 26   TYR D HE1  1 
ATOM   1577 H  HE2  . TYR D  2 26 ? -12.050 6.170   24.622 1.00 17.75 ? 26   TYR D HE2  1 
ATOM   1578 H  HH   . TYR D  2 26 ? -11.684 3.247   26.587 1.00 17.05 ? 26   TYR D HH   1 
ATOM   1579 N  N    . THR D  2 27 ? -17.526 4.570   23.999 1.00 17.57 ? 27   THR D N    1 
ATOM   1580 C  CA   . THR D  2 27 ? -18.064 5.504   24.993 1.00 21.53 ? 27   THR D CA   1 
ATOM   1581 C  C    . THR D  2 27 ? -17.466 5.146   26.346 1.00 22.95 ? 27   THR D C    1 
ATOM   1582 O  O    . THR D  2 27 ? -18.040 4.359   27.109 1.00 27.38 ? 27   THR D O    1 
ATOM   1583 C  CB   . THR D  2 27 ? -19.612 5.419   25.081 1.00 25.15 ? 27   THR D CB   1 
ATOM   1584 O  OG1  . THR D  2 27 ? -20.006 4.121   25.533 1.00 31.77 ? 27   THR D OG1  1 
ATOM   1585 C  CG2  . THR D  2 27 ? -20.229 5.684   23.723 1.00 22.34 ? 27   THR D CG2  1 
ATOM   1586 H  H    . THR D  2 27 ? -17.617 3.607   24.110 1.00 17.86 ? 27   THR D H    1 
ATOM   1587 H  HA   . THR D  2 27 ? -17.790 6.508   24.712 1.00 21.71 ? 27   THR D HA   1 
ATOM   1588 H  HB   . THR D  2 27 ? -19.998 6.135   25.794 1.00 23.76 ? 27   THR D HB   1 
ATOM   1589 H  HG1  . THR D  2 27 ? -19.708 3.450   24.913 1.00 28.38 ? 27   THR D HG1  1 
ATOM   1590 H  HG21 . THR D  2 27 ? -19.821 5.003   23.001 1.00 23.82 ? 27   THR D HG21 1 
ATOM   1591 H  HG22 . THR D  2 27 ? -21.306 5.565   23.769 1.00 24.39 ? 27   THR D HG22 1 
ATOM   1592 H  HG23 . THR D  2 27 ? -19.996 6.695   23.410 1.00 23.61 ? 27   THR D HG23 1 
ATOM   1593 N  N    . PRO D  2 28 ? -16.300 5.723   26.662 1.00 22.32 ? 28   PRO D N    1 
ATOM   1594 C  CA   . PRO D  2 28 ? -15.584 5.478   27.917 1.00 25.11 ? 28   PRO D CA   1 
ATOM   1595 C  C    . PRO D  2 28 ? -16.299 5.919   29.189 1.00 27.64 ? 28   PRO D C    1 
ATOM   1596 O  O    . PRO D  2 28 ? -16.221 5.229   30.207 1.00 30.37 ? 28   PRO D O    1 
ATOM   1597 C  CB   . PRO D  2 28 ? -14.266 6.214   27.704 1.00 25.86 ? 28   PRO D CB   1 
ATOM   1598 C  CG   . PRO D  2 28 ? -14.665 7.348   26.846 1.00 24.43 ? 28   PRO D CG   1 
ATOM   1599 C  CD   . PRO D  2 28 ? -15.563 6.696   25.838 1.00 23.51 ? 28   PRO D CD   1 
ATOM   1600 H  HA   . PRO D  2 28 ? -15.371 4.424   28.008 1.00 25.01 ? 28   PRO D HA   1 
ATOM   1601 H  HB2  . PRO D  2 28 ? -13.886 6.564   28.654 1.00 25.14 ? 28   PRO D HB2  1 
ATOM   1602 H  HB3  . PRO D  2 28 ? -13.529 5.600   27.220 1.00 25.26 ? 28   PRO D HB3  1 
ATOM   1603 H  HG2  . PRO D  2 28 ? -15.253 8.057   27.429 1.00 23.99 ? 28   PRO D HG2  1 
ATOM   1604 H  HG3  . PRO D  2 28 ? -13.841 7.840   26.350 1.00 24.52 ? 28   PRO D HG3  1 
ATOM   1605 H  HD2  . PRO D  2 28 ? -16.207 7.456   25.433 1.00 22.76 ? 28   PRO D HD2  1 
ATOM   1606 H  HD3  . PRO D  2 28 ? -14.998 6.220   25.066 1.00 23.63 ? 28   PRO D HD3  1 
ATOM   1607 N  N    . LYS D  2 29 ? -16.975 7.063   29.149 1.00 26.70 ? 29   LYS D N    1 
ATOM   1608 C  CA   . LYS D  2 29 ? -17.681 7.531   30.336 1.00 30.50 ? 29   LYS D CA   1 
ATOM   1609 C  C    . LYS D  2 29 ? -19.114 7.019   30.286 1.00 34.12 ? 29   LYS D C    1 
ATOM   1610 O  O    . LYS D  2 29 ? -20.045 7.832   30.453 1.00 39.12 ? 29   LYS D O    1 
ATOM   1611 C  CB   . LYS D  2 29 ? -17.661 9.052   30.399 1.00 29.17 ? 29   LYS D CB   1 
ATOM   1612 H  H    . LYS D  2 29 ? -17.017 7.600   28.333 1.00 27.33 ? 29   LYS D H    1 
ATOM   1613 H  HA   . LYS D  2 29 ? -17.177 7.126   31.200 1.00 28.99 ? 29   LYS D HA   1 
ATOM   1614 N  N    . GLY E  1 1  ? -17.591 10.698  40.888 1.00 18.07 ? 1    GLY E N    1 
ATOM   1615 C  CA   . GLY E  1 1  ? -17.175 10.434  42.307 1.00 15.16 ? 1    GLY E CA   1 
ATOM   1616 C  C    . GLY E  1 1  ? -15.678 10.482  42.511 1.00 13.71 ? 1    GLY E C    1 
ATOM   1617 O  O    . GLY E  1 1  ? -14.906 10.892  41.634 1.00 14.61 ? 1    GLY E O    1 
ATOM   1618 H  H1   . GLY E  1 1  ? -18.625 10.596  40.899 1.00 18.25 ? 1    GLY E H1   1 
ATOM   1619 H  H2   . GLY E  1 1  ? -17.186 9.992   40.242 1.00 16.48 ? 1    GLY E H2   1 
ATOM   1620 H  H3   . GLY E  1 1  ? -17.308 11.661  40.648 1.00 17.50 ? 1    GLY E H3   1 
ATOM   1621 H  HA2  . GLY E  1 1  ? -17.618 11.218  42.900 1.00 14.84 ? 1    GLY E HA2  1 
ATOM   1622 H  HA3  . GLY E  1 1  ? -17.545 9.491   42.643 1.00 15.08 ? 1    GLY E HA3  1 
ATOM   1623 N  N    . ILE E  1 2  ? -15.271 10.081  43.698 1.00 12.25 ? 2    ILE E N    1 
ATOM   1624 C  CA   . ILE E  1 2  ? -13.886 10.135  44.088 1.00 10.41 ? 2    ILE E CA   1 
ATOM   1625 C  C    . ILE E  1 2  ? -12.954 9.332   43.207 1.00 11.28 ? 2    ILE E C    1 
ATOM   1626 O  O    . ILE E  1 2  ? -11.814 9.740   43.013 1.00 11.44 ? 2    ILE E O    1 
ATOM   1627 C  CB   . ILE E  1 2  ? -13.752 9.713   45.575 1.00 10.51 ? 2    ILE E CB   1 
ATOM   1628 C  CG1  . ILE E  1 2  ? -12.382 10.111  46.128 1.00 11.34 ? 2    ILE E CG1  1 
ATOM   1629 C  CG2  . ILE E  1 2  ? -14.037 8.221   45.735 1.00 11.53 ? 2    ILE E CG2  1 
ATOM   1630 C  CD1  . ILE E  1 2  ? -12.272 9.792   47.603 1.00 11.73 ? 2    ILE E CD1  1 
ATOM   1631 H  H    . ILE E  1 2  ? -15.898 9.673   44.318 1.00 14.30 ? 2    ILE E H    1 
ATOM   1632 H  HA   . ILE E  1 2  ? -13.514 11.141  44.010 1.00 10.84 ? 2    ILE E HA   1 
ATOM   1633 H  HB   . ILE E  1 2  ? -14.516 10.273  46.125 1.00 12.43 ? 2    ILE E HB   1 
ATOM   1634 H  HG12 . ILE E  1 2  ? -11.623 9.545   45.618 1.00 14.60 ? 2    ILE E HG12 1 
ATOM   1635 H  HG13 . ILE E  1 2  ? -12.174 11.151  45.999 1.00 11.28 ? 2    ILE E HG13 1 
ATOM   1636 H  HG21 . ILE E  1 2  ? -13.174 7.608   45.465 1.00 10.68 ? 2    ILE E HG21 1 
ATOM   1637 H  HG22 . ILE E  1 2  ? -14.245 8.026   46.776 1.00 12.99 ? 2    ILE E HG22 1 
ATOM   1638 H  HG23 . ILE E  1 2  ? -14.875 7.923   45.144 1.00 12.02 ? 2    ILE E HG23 1 
ATOM   1639 H  HD11 . ILE E  1 2  ? -13.135 10.212  48.110 1.00 13.24 ? 2    ILE E HD11 1 
ATOM   1640 H  HD12 . ILE E  1 2  ? -11.363 10.245  47.991 1.00 12.32 ? 2    ILE E HD12 1 
ATOM   1641 H  HD13 . ILE E  1 2  ? -12.241 8.734   47.733 1.00 12.30 ? 2    ILE E HD13 1 
ATOM   1642 N  N    . VAL E  1 3  ? -13.403 8.199   42.702 1.00 11.27 ? 3    VAL E N    1 
ATOM   1643 C  CA   . VAL E  1 3  ? -12.508 7.396   41.857 1.00 12.77 ? 3    VAL E CA   1 
ATOM   1644 C  C    . VAL E  1 3  ? -12.231 8.138   40.552 1.00 14.12 ? 3    VAL E C    1 
ATOM   1645 O  O    . VAL E  1 3  ? -11.085 8.286   40.137 1.00 13.79 ? 3    VAL E O    1 
ATOM   1646 C  CB   . VAL E  1 3  ? -13.098 5.994   41.619 1.00 14.72 ? 3    VAL E CB   1 
ATOM   1647 C  CG1  . VAL E  1 3  ? -12.212 5.216   40.667 1.00 14.38 ? 3    VAL E CG1  1 
ATOM   1648 C  CG2  . VAL E  1 3  ? -13.177 5.251   42.942 1.00 15.58 ? 3    VAL E CG2  1 
ATOM   1649 H  H    . VAL E  1 3  ? -14.312 7.896   42.905 1.00 12.33 ? 3    VAL E H    1 
ATOM   1650 H  HA   . VAL E  1 3  ? -11.602 7.320   42.429 1.00 14.06 ? 3    VAL E HA   1 
ATOM   1651 H  HB   . VAL E  1 3  ? -14.072 6.042   41.191 1.00 15.71 ? 3    VAL E HB   1 
ATOM   1652 H  HG11 . VAL E  1 3  ? -12.260 5.665   39.679 1.00 12.51 ? 3    VAL E HG11 1 
ATOM   1653 H  HG12 . VAL E  1 3  ? -11.180 5.234   40.995 1.00 13.65 ? 3    VAL E HG12 1 
ATOM   1654 H  HG13 . VAL E  1 3  ? -12.597 4.214   40.600 1.00 14.89 ? 3    VAL E HG13 1 
ATOM   1655 H  HG21 . VAL E  1 3  ? -12.264 5.316   43.500 1.00 14.25 ? 3    VAL E HG21 1 
ATOM   1656 H  HG22 . VAL E  1 3  ? -13.968 5.681   43.524 1.00 16.35 ? 3    VAL E HG22 1 
ATOM   1657 H  HG23 . VAL E  1 3  ? -13.412 4.200   42.789 1.00 16.46 ? 3    VAL E HG23 1 
ATOM   1658 N  N    . GLU E  1 4  ? -13.272 8.652   39.923 1.00 12.81 ? 4    GLU E N    1 
ATOM   1659 C  CA   . GLU E  1 4  ? -13.083 9.391   38.679 1.00 13.70 ? 4    GLU E CA   1 
ATOM   1660 C  C    . GLU E  1 4  ? -12.202 10.605  38.918 1.00 14.64 ? 4    GLU E C    1 
ATOM   1661 O  O    . GLU E  1 4  ? -11.290 10.899  38.136 1.00 16.83 ? 4    GLU E O    1 
ATOM   1662 C  CB   . GLU E  1 4  ? -14.459 9.830   38.169 1.00 16.73 ? 4    GLU E CB   1 
ATOM   1663 C  CG   . GLU E  1 4  ? -14.401 10.825  37.027 1.00 22.91 ? 4    GLU E CG   1 
ATOM   1664 C  CD   . GLU E  1 4  ? -15.741 11.008  36.319 1.00 30.78 ? 4    GLU E CD   1 
ATOM   1665 O  OE1  . GLU E  1 4  ? -16.798 11.053  36.995 1.00 35.06 ? 4    GLU E OE1  1 
ATOM   1666 O  OE2  . GLU E  1 4  ? -15.730 11.125  35.072 1.00 38.58 ? 4    GLU E OE2  1 
ATOM   1667 H  H    . GLU E  1 4  ? -14.174 8.519   40.277 1.00 15.94 ? 4    GLU E H    1 
ATOM   1668 H  HA   . GLU E  1 4  ? -12.635 8.758   37.933 1.00 15.76 ? 4    GLU E HA   1 
ATOM   1669 H  HB2  . GLU E  1 4  ? -15.000 8.950   37.849 1.00 16.43 ? 4    GLU E HB2  1 
ATOM   1670 H  HB3  . GLU E  1 4  ? -14.970 10.284  39.007 1.00 17.55 ? 4    GLU E HB3  1 
ATOM   1671 H  HG2  . GLU E  1 4  ? -14.041 11.791  37.354 1.00 20.90 ? 4    GLU E HG2  1 
ATOM   1672 H  HG3  . GLU E  1 4  ? -13.707 10.428  36.299 1.00 21.79 ? 4    GLU E HG3  1 
ATOM   1673 N  N    . GLN E  1 5  ? -12.418 11.317  40.024 1.00 13.21 ? 5    GLN E N    1 
ATOM   1674 C  CA   . GLN E  1 5  ? -11.641 12.504  40.275 1.00 13.28 ? 5    GLN E CA   1 
ATOM   1675 C  C    . GLN E  1 5  ? -10.214 12.345  40.782 1.00 12.44 ? 5    GLN E C    1 
ATOM   1676 O  O    . GLN E  1 5  ? -9.319  13.091  40.372 1.00 13.82 ? 5    GLN E O    1 
ATOM   1677 C  CB   . GLN E  1 5  ? -12.344 13.429  41.269 1.00 13.55 ? 5    GLN E CB   1 
ATOM   1678 C  CG   . GLN E  1 5  ? -13.699 13.918  40.812 1.00 16.06 ? 5    GLN E CG   1 
ATOM   1679 C  CD   . GLN E  1 5  ? -13.679 14.594  39.453 1.00 24.10 ? 5    GLN E CD   1 
ATOM   1680 O  OE1  . GLN E  1 5  ? -14.383 14.176  38.523 1.00 32.13 ? 5    GLN E OE1  1 
ATOM   1681 N  NE2  . GLN E  1 5  ? -12.881 15.647  39.335 1.00 26.76 ? 5    GLN E NE2  1 
ATOM   1682 H  H    . GLN E  1 5  ? -13.148 11.076  40.624 1.00 13.22 ? 5    GLN E H    1 
ATOM   1683 H  HA   . GLN E  1 5  ? -11.544 13.101  39.383 1.00 12.41 ? 5    GLN E HA   1 
ATOM   1684 H  HB2  . GLN E  1 5  ? -12.487 12.836  42.152 1.00 15.17 ? 5    GLN E HB2  1 
ATOM   1685 H  HB3  . GLN E  1 5  ? -11.732 14.266  41.529 1.00 12.86 ? 5    GLN E HB3  1 
ATOM   1686 H  HG2  . GLN E  1 5  ? -14.405 13.111  40.804 1.00 17.73 ? 5    GLN E HG2  1 
ATOM   1687 H  HG3  . GLN E  1 5  ? -14.020 14.656  41.547 1.00 16.39 ? 5    GLN E HG3  1 
ATOM   1688 H  HE21 . GLN E  1 5  ? -12.375 15.884  40.136 1.00 25.12 ? 5    GLN E HE21 1 
ATOM   1689 H  HE22 . GLN E  1 5  ? -12.825 16.157  38.494 1.00 25.74 ? 5    GLN E HE22 1 
ATOM   1690 N  N    . CYS E  1 6  ? -10.005 11.346  41.630 1.00 12.19 ? 6    CYS E N    1 
ATOM   1691 C  CA   . CYS E  1 6  ? -8.723  11.186  42.322 1.00 10.94 ? 6    CYS E CA   1 
ATOM   1692 C  C    . CYS E  1 6  ? -7.880  9.988   41.957 1.00 10.89 ? 6    CYS E C    1 
ATOM   1693 O  O    . CYS E  1 6  ? -6.689  9.983   42.285 1.00 12.07 ? 6    CYS E O    1 
ATOM   1694 C  CB   . CYS E  1 6  ? -8.966  11.176  43.841 1.00 11.20 ? 6    CYS E CB   1 
ATOM   1695 S  SG   . CYS E  1 6  ? -9.824  12.620  44.558 1.00 13.45 ? 6    CYS E SG   1 
ATOM   1696 H  H    . CYS E  1 6  ? -10.675 10.656  41.751 1.00 12.63 ? 6    CYS E H    1 
ATOM   1697 H  HA   . CYS E  1 6  ? -8.119  12.045  42.139 1.00 12.36 ? 6    CYS E HA   1 
ATOM   1698 H  HB2  . CYS E  1 6  ? -9.553  10.308  44.085 1.00 11.24 ? 6    CYS E HB2  1 
ATOM   1699 H  HB3  . CYS E  1 6  ? -8.008  11.092  44.294 1.00 11.21 ? 6    CYS E HB3  1 
ATOM   1700 N  N    . CYS E  1 7  ? -8.516  8.974   41.386 1.00 11.08 ? 7    CYS E N    1 
ATOM   1701 C  CA   . CYS E  1 7  ? -7.830  7.771   40.975 1.00 10.67 ? 7    CYS E CA   1 
ATOM   1702 C  C    . CYS E  1 7  ? -7.600  7.798   39.447 1.00 12.98 ? 7    CYS E C    1 
ATOM   1703 O  O    . CYS E  1 7  ? -6.453  7.668   38.990 1.00 14.93 ? 7    CYS E O    1 
ATOM   1704 C  CB   . CYS E  1 7  ? -8.625  6.545   41.404 1.00 11.20 ? 7    CYS E CB   1 
ATOM   1705 S  SG   . CYS E  1 7  ? -8.023  4.992   40.713 1.00 14.16 ? 7    CYS E SG   1 
ATOM   1706 H  H    . CYS E  1 7  ? -9.468  9.075   41.197 1.00 10.54 ? 7    CYS E H    1 
ATOM   1707 H  HA   . CYS E  1 7  ? -6.856  7.749   41.436 1.00 12.07 ? 7    CYS E HA   1 
ATOM   1708 H  HB2  . CYS E  1 7  ? -8.582  6.423   42.477 1.00 14.01 ? 7    CYS E HB2  1 
ATOM   1709 H  HB3  . CYS E  1 7  ? -9.642  6.664   41.095 1.00 13.49 ? 7    CYS E HB3  1 
ATOM   1710 N  N    . THR E  1 8  ? -8.654  7.970   38.653 1.00 12.73 ? 8    THR E N    1 
ATOM   1711 C  CA   . THR E  1 8  ? -8.532  8.028   37.189 1.00 14.77 ? 8    THR E CA   1 
ATOM   1712 C  C    . THR E  1 8  ? -7.817  9.316   36.816 1.00 16.37 ? 8    THR E C    1 
ATOM   1713 O  O    . THR E  1 8  ? -6.942  9.329   35.947 1.00 20.91 ? 8    THR E O    1 
ATOM   1714 C  CB   . THR E  1 8  ? -9.909  7.915   36.566 1.00 18.47 ? 8    THR E CB   1 
ATOM   1715 O  OG1  . THR E  1 8  ? -10.476 6.687   37.018 1.00 19.98 ? 8    THR E OG1  1 
ATOM   1716 C  CG2  . THR E  1 8  ? -9.824  7.927   35.030 1.00 21.06 ? 8    THR E CG2  1 
ATOM   1717 H  H    . THR E  1 8  ? -9.533  7.970   39.079 1.00 12.89 ? 8    THR E H    1 
ATOM   1718 H  HA   . THR E  1 8  ? -7.946  7.158   36.931 1.00 16.18 ? 8    THR E HA   1 
ATOM   1719 H  HB   . THR E  1 8  ? -10.520 8.739   36.903 1.00 17.72 ? 8    THR E HB   1 
ATOM   1720 H  HG1  . THR E  1 8  ? -11.360 6.598   36.646 1.00 21.90 ? 8    THR E HG1  1 
ATOM   1721 H  HG21 . THR E  1 8  ? -10.740 7.534   34.632 1.00 20.91 ? 8    THR E HG21 1 
ATOM   1722 H  HG22 . THR E  1 8  ? -9.694  8.947   34.686 1.00 20.20 ? 8    THR E HG22 1 
ATOM   1723 H  HG23 . THR E  1 8  ? -9.001  7.316   34.702 1.00 19.79 ? 8    THR E HG23 1 
ATOM   1724 N  N    A SER E  1 9  ? -8.173  10.408  37.466 0.50 15.31 ? 9    SER E N    1 
ATOM   1725 N  N    B SER E  1 9  ? -8.222  10.412  37.449 0.50 14.14 ? 9    SER E N    1 
ATOM   1726 C  CA   A SER E  1 9  ? -7.478  11.668  37.252 0.50 15.86 ? 9    SER E CA   1 
ATOM   1727 C  CA   B SER E  1 9  ? -7.604  11.729  37.288 0.50 16.03 ? 9    SER E CA   1 
ATOM   1728 C  C    A SER E  1 9  ? -6.678  11.915  38.539 0.50 14.38 ? 9    SER E C    1 
ATOM   1729 C  C    B SER E  1 9  ? -6.910  12.016  38.631 0.50 15.65 ? 9    SER E C    1 
ATOM   1730 O  O    A SER E  1 9  ? -6.450  10.988  39.334 0.50 14.88 ? 9    SER E O    1 
ATOM   1731 O  O    B SER E  1 9  ? -7.026  11.230  39.581 0.50 16.20 ? 9    SER E O    1 
ATOM   1732 C  CB   A SER E  1 9  ? -8.482  12.797  37.027 0.50 16.49 ? 9    SER E CB   1 
ATOM   1733 C  CB   B SER E  1 9  ? -8.664  12.801  37.018 0.50 15.77 ? 9    SER E CB   1 
ATOM   1734 O  OG   A SER E  1 9  ? -9.195  12.610  35.817 0.50 21.74 ? 9    SER E OG   1 
ATOM   1735 O  OG   B SER E  1 9  ? -8.050  14.071  36.858 0.50 23.39 ? 9    SER E OG   1 
ATOM   1736 H  H    A SER E  1 9  ? -8.920  10.376  38.098 0.50 17.13 ? 9    SER E H    1 
ATOM   1737 H  H    B SER E  1 9  ? -8.938  10.370  38.106 0.50 17.07 ? 9    SER E H    1 
ATOM   1738 H  HA   A SER E  1 9  ? -6.789  11.590  36.421 0.50 17.04 ? 9    SER E HA   1 
ATOM   1739 H  HA   B SER E  1 9  ? -6.865  11.703  36.508 0.50 17.01 ? 9    SER E HA   1 
ATOM   1740 H  HB2  A SER E  1 9  ? -9.195  12.813  37.840 0.50 17.94 ? 9    SER E HB2  1 
ATOM   1741 H  HB2  B SER E  1 9  ? -9.162  12.546  36.095 0.50 18.99 ? 9    SER E HB2  1 
ATOM   1742 H  HB3  A SER E  1 9  ? -7.945  13.735  36.977 0.50 19.05 ? 9    SER E HB3  1 
ATOM   1743 H  HB3  B SER E  1 9  ? -9.385  12.847  37.821 0.50 17.58 ? 9    SER E HB3  1 
ATOM   1744 H  HG   A SER E  1 9  ? -9.820  13.327  35.710 0.50 20.32 ? 9    SER E HG   1 
ATOM   1745 H  HG   B SER E  1 9  ? -7.442  14.024  36.120 0.50 21.15 ? 9    SER E HG   1 
ATOM   1746 N  N    . ILE E  1 10 ? -6.222  13.143  38.732 1.00 16.29 ? 10   ILE E N    1 
ATOM   1747 C  CA   . ILE E  1 10 ? -5.500  13.505  39.958 1.00 15.20 ? 10   ILE E CA   1 
ATOM   1748 C  C    . ILE E  1 10 ? -6.248  14.599  40.705 1.00 16.80 ? 10   ILE E C    1 
ATOM   1749 O  O    . ILE E  1 10 ? -6.725  15.551  40.069 1.00 19.62 ? 10   ILE E O    1 
ATOM   1750 C  CB   . ILE E  1 10 ? -4.057  13.997  39.637 1.00 16.65 ? 10   ILE E CB   1 
ATOM   1751 C  CG1  . ILE E  1 10 ? -3.246  12.832  39.041 1.00 17.83 ? 10   ILE E CG1  1 
ATOM   1752 C  CG2  . ILE E  1 10 ? -3.377  14.536  40.934 1.00 17.33 ? 10   ILE E CG2  1 
ATOM   1753 C  CD1  . ILE E  1 10 ? -1.814  13.159  38.705 1.00 19.02 ? 10   ILE E CD1  1 
ATOM   1754 H  H    . ILE E  1 10 ? -6.258  13.800  38.006 1.00 18.34 ? 10   ILE E H    1 
ATOM   1755 H  HA   . ILE E  1 10 ? -5.436  12.635  40.586 1.00 16.70 ? 10   ILE E HA   1 
ATOM   1756 H  HB   . ILE E  1 10 ? -4.105  14.811  38.935 1.00 18.13 ? 10   ILE E HB   1 
ATOM   1757 H  HG12 . ILE E  1 10 ? -3.226  12.061  39.802 1.00 19.08 ? 10   ILE E HG12 1 
ATOM   1758 H  HG13 . ILE E  1 10 ? -3.742  12.432  38.177 1.00 18.68 ? 10   ILE E HG13 1 
ATOM   1759 H  HG21 . ILE E  1 10 ? -3.835  15.472  41.223 1.00 17.27 ? 10   ILE E HG21 1 
ATOM   1760 H  HG22 . ILE E  1 10 ? -3.484  13.824  41.730 1.00 18.38 ? 10   ILE E HG22 1 
ATOM   1761 H  HG23 . ILE E  1 10 ? -2.308  14.717  40.807 1.00 17.09 ? 10   ILE E HG23 1 
ATOM   1762 H  HD11 . ILE E  1 10 ? -1.193  13.207  39.599 1.00 19.81 ? 10   ILE E HD11 1 
ATOM   1763 H  HD12 . ILE E  1 10 ? -1.808  14.129  38.238 1.00 20.11 ? 10   ILE E HD12 1 
ATOM   1764 H  HD13 . ILE E  1 10 ? -1.428  12.399  38.031 1.00 20.49 ? 10   ILE E HD13 1 
ATOM   1765 N  N    . CYS E  1 11 ? -6.353  14.441  42.030 1.00 15.53 ? 11   CYS E N    1 
ATOM   1766 C  CA   . CYS E  1 11 ? -7.027  15.369  42.959 1.00 16.40 ? 11   CYS E CA   1 
ATOM   1767 C  C    . CYS E  1 11 ? -6.057  16.279  43.664 1.00 16.23 ? 11   CYS E C    1 
ATOM   1768 O  O    . CYS E  1 11 ? -5.023  15.840  44.089 1.00 16.07 ? 11   CYS E O    1 
ATOM   1769 C  CB   . CYS E  1 11 ? -7.836  14.614  44.114 1.00 15.38 ? 11   CYS E CB   1 
ATOM   1770 S  SG   . CYS E  1 11 ? -9.412  14.179  43.420 1.00 18.48 ? 11   CYS E SG   1 
ATOM   1771 H  H    . CYS E  1 11 ? -5.924  13.644  42.390 1.00 17.62 ? 11   CYS E H    1 
ATOM   1772 H  HA   . CYS E  1 11 ? -7.735  15.958  42.415 1.00 16.76 ? 11   CYS E HA   1 
ATOM   1773 H  HB2  . CYS E  1 11 ? -7.482  13.710  44.524 1.00 14.46 ? 11   CYS E HB2  1 
ATOM   1774 H  HB3  . CYS E  1 11 ? -8.108  15.260  44.920 1.00 18.59 ? 11   CYS E HB3  1 
ATOM   1775 N  N    . SER E  1 12 ? -6.426  17.538  43.793 1.00 17.33 ? 12   SER E N    1 
ATOM   1776 C  CA   . SER E  1 12 ? -5.653  18.437  44.615 1.00 14.03 ? 12   SER E CA   1 
ATOM   1777 C  C    . SER E  1 12 ? -6.137  18.100  46.035 1.00 15.22 ? 12   SER E C    1 
ATOM   1778 O  O    . SER E  1 12 ? -7.147  17.391  46.232 1.00 14.28 ? 12   SER E O    1 
ATOM   1779 C  CB   . SER E  1 12 ? -6.027  19.890  44.327 1.00 17.44 ? 12   SER E CB   1 
ATOM   1780 O  OG   . SER E  1 12 ? -7.386  20.129  44.683 1.00 17.33 ? 12   SER E OG   1 
ATOM   1781 H  H    . SER E  1 12 ? -7.214  17.898  43.347 1.00 16.48 ? 12   SER E H    1 
ATOM   1782 H  HA   . SER E  1 12 ? -4.588  18.264  44.589 1.00 15.71 ? 12   SER E HA   1 
ATOM   1783 H  HB2  . SER E  1 12 ? -5.363  20.532  44.879 1.00 17.16 ? 12   SER E HB2  1 
ATOM   1784 H  HB3  . SER E  1 12 ? -5.896  20.070  43.273 1.00 17.06 ? 12   SER E HB3  1 
ATOM   1785 H  HG   . SER E  1 12 ? -7.518  20.001  45.621 1.00 18.95 ? 12   SER E HG   1 
ATOM   1786 N  N    . LEU E  1 13 ? -5.439  18.593  47.041 1.00 14.73 ? 13   LEU E N    1 
ATOM   1787 C  CA   . LEU E  1 13 ? -5.860  18.394  48.429 1.00 14.18 ? 13   LEU E CA   1 
ATOM   1788 C  C    . LEU E  1 13 ? -7.303  18.868  48.624 1.00 14.05 ? 13   LEU E C    1 
ATOM   1789 O  O    . LEU E  1 13 ? -8.107  18.204  49.290 1.00 13.71 ? 13   LEU E O    1 
ATOM   1790 C  CB   . LEU E  1 13 ? -4.950  19.195  49.375 1.00 14.82 ? 13   LEU E CB   1 
ATOM   1791 C  CG   . LEU E  1 13 ? -5.355  19.245  50.848 1.00 13.26 ? 13   LEU E CG   1 
ATOM   1792 C  CD1  . LEU E  1 13 ? -5.332  17.847  51.510 1.00 14.33 ? 13   LEU E CD1  1 
ATOM   1793 C  CD2  . LEU E  1 13 ? -4.391  20.197  51.559 1.00 16.68 ? 13   LEU E CD2  1 
ATOM   1794 H  H    . LEU E  1 13 ? -4.570  19.024  46.867 1.00 14.56 ? 13   LEU E H    1 
ATOM   1795 H  HA   . LEU E  1 13 ? -5.771  17.350  48.664 1.00 13.62 ? 13   LEU E HA   1 
ATOM   1796 H  HB2  . LEU E  1 13 ? -3.939  18.843  49.321 1.00 16.56 ? 13   LEU E HB2  1 
ATOM   1797 H  HB3  . LEU E  1 13 ? -4.994  20.213  49.005 1.00 15.59 ? 13   LEU E HB3  1 
ATOM   1798 H  HG   . LEU E  1 13 ? -6.334  19.685  50.910 1.00 13.58 ? 13   LEU E HG   1 
ATOM   1799 H  HD11 . LEU E  1 13 ? -4.318  17.477  51.552 1.00 16.44 ? 13   LEU E HD11 1 
ATOM   1800 H  HD12 . LEU E  1 13 ? -5.704  17.889  52.518 1.00 13.71 ? 13   LEU E HD12 1 
ATOM   1801 H  HD13 . LEU E  1 13 ? -5.915  17.162  50.909 1.00 15.61 ? 13   LEU E HD13 1 
ATOM   1802 H  HD21 . LEU E  1 13 ? -3.372  19.962  51.303 1.00 14.72 ? 13   LEU E HD21 1 
ATOM   1803 H  HD22 . LEU E  1 13 ? -4.669  21.186  51.242 1.00 17.25 ? 13   LEU E HD22 1 
ATOM   1804 H  HD23 . LEU E  1 13 ? -4.527  20.187  52.625 1.00 16.25 ? 13   LEU E HD23 1 
ATOM   1805 N  N    . TYR E  1 14 ? -7.637  20.029  48.065 1.00 14.95 ? 14   TYR E N    1 
ATOM   1806 C  CA   . TYR E  1 14 ? -8.977  20.567  48.223 1.00 14.88 ? 14   TYR E CA   1 
ATOM   1807 C  C    . TYR E  1 14 ? -10.032 19.714  47.568 1.00 14.59 ? 14   TYR E C    1 
ATOM   1808 O  O    . TYR E  1 14 ? -11.128 19.568  48.103 1.00 14.94 ? 14   TYR E O    1 
ATOM   1809 C  CB   . TYR E  1 14 ? -9.025  22.007  47.728 1.00 19.14 ? 14   TYR E CB   1 
ATOM   1810 C  CG   . TYR E  1 14 ? -7.885  22.809  48.314 1.00 23.23 ? 14   TYR E CG   1 
ATOM   1811 C  CD1  . TYR E  1 14 ? -7.738  22.938  49.694 1.00 22.58 ? 14   TYR E CD1  1 
ATOM   1812 C  CD2  . TYR E  1 14 ? -6.902  23.356  47.495 1.00 27.05 ? 14   TYR E CD2  1 
ATOM   1813 C  CE1  . TYR E  1 14 ? -6.634  23.582  50.235 1.00 25.75 ? 14   TYR E CE1  1 
ATOM   1814 C  CE2  . TYR E  1 14 ? -5.800  24.003  48.032 1.00 27.40 ? 14   TYR E CE2  1 
ATOM   1815 C  CZ   . TYR E  1 14 ? -5.674  24.109  49.400 1.00 28.87 ? 14   TYR E CZ   1 
ATOM   1816 O  OH   . TYR E  1 14 ? -4.575  24.745  49.929 1.00 32.97 ? 14   TYR E OH   1 
ATOM   1817 H  H    . TYR E  1 14 ? -6.950  20.487  47.552 1.00 16.05 ? 14   TYR E H    1 
ATOM   1818 H  HA   . TYR E  1 14 ? -9.246  20.581  49.273 1.00 15.00 ? 14   TYR E HA   1 
ATOM   1819 H  HB2  . TYR E  1 14 ? -8.916  21.944  46.652 1.00 18.45 ? 14   TYR E HB2  1 
ATOM   1820 H  HB3  . TYR E  1 14 ? -9.971  22.461  47.973 1.00 18.25 ? 14   TYR E HB3  1 
ATOM   1821 H  HD1  . TYR E  1 14 ? -8.493  22.518  50.338 1.00 23.29 ? 14   TYR E HD1  1 
ATOM   1822 H  HD2  . TYR E  1 14 ? -6.996  23.275  46.425 1.00 25.63 ? 14   TYR E HD2  1 
ATOM   1823 H  HE1  . TYR E  1 14 ? -6.518  23.680  51.303 1.00 25.92 ? 14   TYR E HE1  1 
ATOM   1824 H  HE2  . TYR E  1 14 ? -5.049  24.415  47.374 1.00 26.73 ? 14   TYR E HE2  1 
ATOM   1825 H  HH   . TYR E  1 14 ? -4.712  24.861  50.873 1.00 30.52 ? 14   TYR E HH   1 
ATOM   1826 N  N    . GLN E  1 15 ? -9.701  19.117  46.432 1.00 13.83 ? 15   GLN E N    1 
ATOM   1827 C  CA   . GLN E  1 15 ? -10.670 18.223  45.777 1.00 13.33 ? 15   GLN E CA   1 
ATOM   1828 C  C    . GLN E  1 15 ? -10.861 16.955  46.610 1.00 13.58 ? 15   GLN E C    1 
ATOM   1829 O  O    . GLN E  1 15 ? -11.970 16.442  46.734 1.00 15.59 ? 15   GLN E O    1 
ATOM   1830 C  CB   . GLN E  1 15 ? -10.208 17.869  44.365 1.00 15.12 ? 15   GLN E CB   1 
ATOM   1831 C  CG   . GLN E  1 15 ? -10.348 19.067  43.400 1.00 16.96 ? 15   GLN E CG   1 
ATOM   1832 C  CD   . GLN E  1 15 ? -9.676  18.826  42.057 1.00 21.14 ? 15   GLN E CD   1 
ATOM   1833 O  OE1  . GLN E  1 15 ? -8.612  18.225  41.973 1.00 18.61 ? 15   GLN E OE1  1 
ATOM   1834 N  NE2  . GLN E  1 15 ? -10.304 19.326  40.986 1.00 28.29 ? 15   GLN E NE2  1 
ATOM   1835 H  H    . GLN E  1 15 ? -8.804  19.269  46.073 1.00 16.49 ? 15   GLN E H    1 
ATOM   1836 H  HA   . GLN E  1 15 ? -11.622 18.728  45.729 1.00 13.67 ? 15   GLN E HA   1 
ATOM   1837 H  HB2  . GLN E  1 15 ? -9.181  17.537  44.389 1.00 15.23 ? 15   GLN E HB2  1 
ATOM   1838 H  HB3  . GLN E  1 15 ? -10.801 17.058  43.969 1.00 14.91 ? 15   GLN E HB3  1 
ATOM   1839 H  HG2  . GLN E  1 15 ? -11.387 19.277  43.222 1.00 17.78 ? 15   GLN E HG2  1 
ATOM   1840 H  HG3  . GLN E  1 15 ? -9.890  19.913  43.869 1.00 17.39 ? 15   GLN E HG3  1 
ATOM   1841 H  HE21 . GLN E  1 15 ? -11.149 19.804  41.146 1.00 24.67 ? 15   GLN E HE21 1 
ATOM   1842 H  HE22 . GLN E  1 15 ? -9.896  19.210  40.099 1.00 24.11 ? 15   GLN E HE22 1 
ATOM   1843 N  N    . LEU E  1 16 ? -9.780  16.435  47.174 1.00 12.00 ? 16   LEU E N    1 
ATOM   1844 C  CA   . LEU E  1 16 ? -9.880  15.277  48.032 1.00 11.65 ? 16   LEU E CA   1 
ATOM   1845 C  C    . LEU E  1 16 ? -10.750 15.597  49.255 1.00 11.88 ? 16   LEU E C    1 
ATOM   1846 O  O    . LEU E  1 16 ? -11.554 14.755  49.719 1.00 12.73 ? 16   LEU E O    1 
ATOM   1847 C  CB   . LEU E  1 16 ? -8.488  14.830  48.473 1.00 12.66 ? 16   LEU E CB   1 
ATOM   1848 C  CG   . LEU E  1 16 ? -8.463  13.552  49.299 1.00 12.02 ? 16   LEU E CG   1 
ATOM   1849 C  CD1  . LEU E  1 16 ? -8.887  12.350  48.487 1.00 12.88 ? 16   LEU E CD1  1 
ATOM   1850 C  CD2  . LEU E  1 16 ? -7.055  13.318  49.818 1.00 15.37 ? 16   LEU E CD2  1 
ATOM   1851 H  H    . LEU E  1 16 ? -8.909  16.867  47.044 1.00 12.03 ? 16   LEU E H    1 
ATOM   1852 H  HA   . LEU E  1 16 ? -10.317 14.506  47.421 1.00 13.47 ? 16   LEU E HA   1 
ATOM   1853 H  HB2  . LEU E  1 16 ? -7.933  14.644  47.558 1.00 13.33 ? 16   LEU E HB2  1 
ATOM   1854 H  HB3  . LEU E  1 16 ? -7.991  15.612  49.020 1.00 15.33 ? 16   LEU E HB3  1 
ATOM   1855 H  HG   . LEU E  1 16 ? -9.094  13.704  50.171 1.00 15.19 ? 16   LEU E HG   1 
ATOM   1856 H  HD11 . LEU E  1 16 ? -9.939  12.459  48.261 1.00 14.01 ? 16   LEU E HD11 1 
ATOM   1857 H  HD12 . LEU E  1 16 ? -8.366  12.341  47.551 1.00 12.69 ? 16   LEU E HD12 1 
ATOM   1858 H  HD13 . LEU E  1 16 ? -8.763  11.434  49.049 1.00 11.46 ? 16   LEU E HD13 1 
ATOM   1859 H  HD21 . LEU E  1 16 ? -6.393  13.285  48.965 1.00 13.37 ? 16   LEU E HD21 1 
ATOM   1860 H  HD22 . LEU E  1 16 ? -6.837  14.143  50.487 1.00 13.91 ? 16   LEU E HD22 1 
ATOM   1861 H  HD23 . LEU E  1 16 ? -7.031  12.396  50.366 1.00 15.36 ? 16   LEU E HD23 1 
ATOM   1862 N  N    . GLU E  1 17 ? -10.630 16.809  49.790 1.00 12.13 ? 17   GLU E N    1 
ATOM   1863 C  CA   . GLU E  1 17 ? -11.419 17.188  50.974 1.00 11.92 ? 17   GLU E CA   1 
ATOM   1864 C  C    . GLU E  1 17 ? -12.929 17.286  50.726 1.00 13.14 ? 17   GLU E C    1 
ATOM   1865 O  O    . GLU E  1 17 ? -13.709 17.350  51.690 1.00 13.55 ? 17   GLU E O    1 
ATOM   1866 C  CB   . GLU E  1 17 ? -10.893 18.474  51.569 1.00 13.11 ? 17   GLU E CB   1 
ATOM   1867 C  CG   . GLU E  1 17 ? -9.538  18.291  52.211 1.00 15.12 ? 17   GLU E CG   1 
ATOM   1868 C  CD   . GLU E  1 17 ? -9.075  19.551  52.876 1.00 18.24 ? 17   GLU E CD   1 
ATOM   1869 O  OE1  . GLU E  1 17 ? -9.015  20.609  52.202 1.00 21.89 ? 17   GLU E OE1  1 
ATOM   1870 O  OE2  . GLU E  1 17 ? -8.775  19.500  54.077 1.00 19.16 ? 17   GLU E OE2  1 
ATOM   1871 H  H    . GLU E  1 17 ? -10.008 17.438  49.376 1.00 13.40 ? 17   GLU E H    1 
ATOM   1872 H  HA   . GLU E  1 17 ? -11.312 16.425  51.733 1.00 13.56 ? 17   GLU E HA   1 
ATOM   1873 H  HB2  . GLU E  1 17 ? -10.774 19.196  50.782 1.00 13.15 ? 17   GLU E HB2  1 
ATOM   1874 H  HB3  . GLU E  1 17 ? -11.573 18.825  52.329 1.00 13.22 ? 17   GLU E HB3  1 
ATOM   1875 H  HG2  . GLU E  1 17 ? -9.618  17.537  52.970 1.00 16.13 ? 17   GLU E HG2  1 
ATOM   1876 H  HG3  . GLU E  1 17 ? -8.786  17.989  51.496 1.00 15.07 ? 17   GLU E HG3  1 
ATOM   1877 N  N    . ASN E  1 18 ? -13.359 17.298  49.468 1.00 12.20 ? 18   ASN E N    1 
ATOM   1878 C  CA   . ASN E  1 18 ? -14.793 17.245  49.181 1.00 12.77 ? 18   ASN E CA   1 
ATOM   1879 C  C    . ASN E  1 18 ? -15.382 15.909  49.646 1.00 12.84 ? 18   ASN E C    1 
ATOM   1880 O  O    . ASN E  1 18 ? -16.589 15.783  49.716 1.00 12.29 ? 18   ASN E O    1 
ATOM   1881 C  CB   . ASN E  1 18 ? -15.065 17.377  47.683 1.00 14.23 ? 18   ASN E CB   1 
ATOM   1882 C  CG   . ASN E  1 18 ? -14.848 18.790  47.161 1.00 18.26 ? 18   ASN E CG   1 
ATOM   1883 O  OD1  . ASN E  1 18 ? -14.463 18.968  46.005 1.00 21.87 ? 18   ASN E OD1  1 
ATOM   1884 N  ND2  . ASN E  1 18 ? -15.112 19.773  47.987 1.00 19.91 ? 18   ASN E ND2  1 
ATOM   1885 H  H    . ASN E  1 18 ? -12.721 17.388  48.739 1.00 11.92 ? 18   ASN E H    1 
ATOM   1886 H  HA   . ASN E  1 18 ? -15.291 18.042  49.704 1.00 13.66 ? 18   ASN E HA   1 
ATOM   1887 H  HB2  . ASN E  1 18 ? -14.471 16.654  47.143 1.00 15.02 ? 18   ASN E HB2  1 
ATOM   1888 H  HB3  . ASN E  1 18 ? -16.096 17.109  47.580 1.00 14.12 ? 18   ASN E HB3  1 
ATOM   1889 H  HD21 . ASN E  1 18 ? -15.429 19.621  48.899 1.00 20.02 ? 18   ASN E HD21 1 
ATOM   1890 H  HD22 . ASN E  1 18 ? -14.991 20.677  47.614 1.00 21.49 ? 18   ASN E HD22 1 
ATOM   1891 N  N    . TYR E  1 19 ? -14.531 14.919  49.970 1.00 11.56 ? 19   TYR E N    1 
ATOM   1892 C  CA   . TYR E  1 19 ? -15.032 13.623  50.424 1.00 10.93 ? 19   TYR E CA   1 
ATOM   1893 C  C    . TYR E  1 19 ? -14.888 13.445  51.930 1.00 11.84 ? 19   TYR E C    1 
ATOM   1894 O  O    . TYR E  1 19 ? -15.191 12.373  52.475 1.00 12.10 ? 19   TYR E O    1 
ATOM   1895 C  CB   . TYR E  1 19 ? -14.398 12.490  49.608 1.00 12.08 ? 19   TYR E CB   1 
ATOM   1896 C  CG   . TYR E  1 19 ? -14.612 12.711  48.104 1.00 10.65 ? 19   TYR E CG   1 
ATOM   1897 C  CD1  . TYR E  1 19 ? -15.850 12.469  47.510 1.00 10.26 ? 19   TYR E CD1  1 
ATOM   1898 C  CD2  . TYR E  1 19 ? -13.617 13.257  47.302 1.00 9.86  ? 19   TYR E CD2  1 
ATOM   1899 C  CE1  . TYR E  1 19 ? -16.065 12.769  46.182 1.00 11.08 ? 19   TYR E CE1  1 
ATOM   1900 C  CE2  . TYR E  1 19 ? -13.832 13.553  45.979 1.00 11.93 ? 19   TYR E CE2  1 
ATOM   1901 C  CZ   . TYR E  1 19 ? -15.052 13.311  45.428 1.00 10.79 ? 19   TYR E CZ   1 
ATOM   1902 O  OH   . TYR E  1 19 ? -15.212 13.599  44.085 1.00 14.73 ? 19   TYR E OH   1 
ATOM   1903 H  H    . TYR E  1 19 ? -13.570 15.066  49.924 1.00 11.12 ? 19   TYR E H    1 
ATOM   1904 H  HA   . TYR E  1 19 ? -16.087 13.611  50.204 1.00 10.35 ? 19   TYR E HA   1 
ATOM   1905 H  HB2  . TYR E  1 19 ? -13.337 12.522  49.857 1.00 10.63 ? 19   TYR E HB2  1 
ATOM   1906 H  HB3  . TYR E  1 19 ? -14.815 11.558  49.918 1.00 11.94 ? 19   TYR E HB3  1 
ATOM   1907 H  HD1  . TYR E  1 19 ? -16.634 12.047  48.115 1.00 11.36 ? 19   TYR E HD1  1 
ATOM   1908 H  HD2  . TYR E  1 19 ? -12.642 13.453  47.727 1.00 10.37 ? 19   TYR E HD2  1 
ATOM   1909 H  HE1  . TYR E  1 19 ? -17.032 12.584  45.705 1.00 7.68  ? 19   TYR E HE1  1 
ATOM   1910 H  HE2  . TYR E  1 19 ? -13.048 13.980  45.361 1.00 13.46 ? 19   TYR E HE2  1 
ATOM   1911 H  HH   . TYR E  1 19 ? -14.365 13.826  43.726 1.00 11.53 ? 19   TYR E HH   1 
ATOM   1912 N  N    . CYS E  1 20 ? -14.507 14.522  52.618 1.00 12.27 ? 20   CYS E N    1 
ATOM   1913 C  CA   . CYS E  1 20 ? -14.510 14.496  54.085 1.00 12.20 ? 20   CYS E CA   1 
ATOM   1914 C  C    . CYS E  1 20 ? -15.950 14.821  54.515 1.00 15.97 ? 20   CYS E C    1 
ATOM   1915 O  O    . CYS E  1 20 ? -16.683 15.469  53.763 1.00 17.99 ? 20   CYS E O    1 
ATOM   1916 C  CB   . CYS E  1 20 ? -13.617 15.584  54.673 1.00 12.99 ? 20   CYS E CB   1 
ATOM   1917 S  SG   . CYS E  1 20 ? -11.854 15.438  54.288 1.00 13.14 ? 20   CYS E SG   1 
ATOM   1918 H  H    . CYS E  1 20 ? -14.219 15.320  52.136 1.00 13.07 ? 20   CYS E H    1 
ATOM   1919 H  HA   . CYS E  1 20 ? -14.230 13.533  54.458 1.00 13.77 ? 20   CYS E HA   1 
ATOM   1920 H  HB2  . CYS E  1 20 ? -13.968 16.554  54.377 1.00 13.71 ? 20   CYS E HB2  1 
ATOM   1921 H  HB3  . CYS E  1 20 ? -13.711 15.543  55.752 1.00 11.83 ? 20   CYS E HB3  1 
ATOM   1922 N  N    . ASN E  1 21 ? -16.358 14.379  55.701 1.00 16.72 ? 21   ASN E N    1 
ATOM   1923 C  CA   . ASN E  1 21 ? -17.721 14.683  56.191 1.00 19.78 ? 21   ASN E CA   1 
ATOM   1924 C  C    . ASN E  1 21 ? -17.701 16.123  56.704 1.00 19.90 ? 21   ASN E C    1 
ATOM   1925 O  O    . ASN E  1 21 ? -16.614 16.706  56.897 1.00 21.07 ? 21   ASN E O    1 
ATOM   1926 C  CB   . ASN E  1 21 ? -18.171 13.771  57.362 1.00 21.49 ? 21   ASN E CB   1 
ATOM   1927 C  CG   . ASN E  1 21 ? -18.149 12.284  57.037 1.00 25.36 ? 21   ASN E CG   1 
ATOM   1928 O  OD1  . ASN E  1 21 ? -18.531 11.842  55.949 1.00 25.80 ? 21   ASN E OD1  1 
ATOM   1929 N  ND2  . ASN E  1 21 ? -17.718 11.495  58.009 1.00 27.86 ? 21   ASN E ND2  1 
ATOM   1930 O  OXT  . ASN E  1 21 ? -18.806 16.659  56.922 1.00 26.39 ? 21   ASN E OXT  1 
ATOM   1931 H  H    . ASN E  1 21 ? -15.745 13.863  56.260 1.00 18.28 ? 21   ASN E H    1 
ATOM   1932 H  HA   . ASN E  1 21 ? -18.404 14.586  55.352 1.00 20.02 ? 21   ASN E HA   1 
ATOM   1933 H  HB2  . ASN E  1 21 ? -17.534 13.965  58.201 1.00 22.96 ? 21   ASN E HB2  1 
ATOM   1934 H  HB3  . ASN E  1 21 ? -19.181 14.058  57.634 1.00 23.11 ? 21   ASN E HB3  1 
ATOM   1935 H  HD21 . ASN E  1 21 ? -17.437 11.904  58.852 1.00 26.45 ? 21   ASN E HD21 1 
ATOM   1936 H  HD22 . ASN E  1 21 ? -17.722 10.528  57.845 1.00 26.75 ? 21   ASN E HD22 1 
ATOM   1937 N  N    . PHE F  2 1  ? 1.574   18.667  49.224 1.00 15.54 ? 1    PHE F N    1 
ATOM   1938 C  CA   . PHE F  2 1  ? 0.715   17.457  49.221 1.00 14.86 ? 1    PHE F CA   1 
ATOM   1939 C  C    . PHE F  2 1  ? 1.041   16.745  47.929 1.00 15.92 ? 1    PHE F C    1 
ATOM   1940 O  O    . PHE F  2 1  ? 1.277   17.390  46.897 1.00 18.34 ? 1    PHE F O    1 
ATOM   1941 C  CB   . PHE F  2 1  ? -0.758  17.848  49.210 1.00 16.80 ? 1    PHE F CB   1 
ATOM   1942 C  CG   . PHE F  2 1  ? -1.675  16.702  49.415 1.00 17.45 ? 1    PHE F CG   1 
ATOM   1943 C  CD1  . PHE F  2 1  ? -1.720  16.067  50.640 1.00 15.31 ? 1    PHE F CD1  1 
ATOM   1944 C  CD2  . PHE F  2 1  ? -2.484  16.248  48.393 1.00 19.57 ? 1    PHE F CD2  1 
ATOM   1945 C  CE1  . PHE F  2 1  ? -2.551  15.006  50.839 1.00 18.94 ? 1    PHE F CE1  1 
ATOM   1946 C  CE2  . PHE F  2 1  ? -3.326  15.163  48.597 1.00 20.57 ? 1    PHE F CE2  1 
ATOM   1947 C  CZ   . PHE F  2 1  ? -3.353  14.548  49.815 1.00 17.85 ? 1    PHE F CZ   1 
ATOM   1948 H  H1   . PHE F  2 1  ? 2.567   18.352  49.208 1.00 17.07 ? 1    PHE F H1   1 
ATOM   1949 H  H2   . PHE F  2 1  ? 1.346   19.205  48.380 1.00 16.07 ? 1    PHE F H2   1 
ATOM   1950 H  H3   . PHE F  2 1  ? 1.396   19.219  50.075 1.00 15.31 ? 1    PHE F H3   1 
ATOM   1951 H  HA   . PHE F  2 1  ? 0.956   16.836  50.067 1.00 17.04 ? 1    PHE F HA   1 
ATOM   1952 H  HB2  . PHE F  2 1  ? -0.870  18.657  49.933 1.00 16.91 ? 1    PHE F HB2  1 
ATOM   1953 H  HB3  . PHE F  2 1  ? -0.900  18.297  48.242 1.00 17.14 ? 1    PHE F HB3  1 
ATOM   1954 H  HD1  . PHE F  2 1  ? -1.096  16.415  51.437 1.00 16.93 ? 1    PHE F HD1  1 
ATOM   1955 H  HD2  . PHE F  2 1  ? -2.456  16.742  47.436 1.00 18.80 ? 1    PHE F HD2  1 
ATOM   1956 H  HE1  . PHE F  2 1  ? -2.531  14.559  51.830 1.00 17.52 ? 1    PHE F HE1  1 
ATOM   1957 H  HE2  . PHE F  2 1  ? -3.949  14.810  47.802 1.00 20.34 ? 1    PHE F HE2  1 
ATOM   1958 H  HZ   . PHE F  2 1  ? -4.006  13.705  49.990 1.00 18.74 ? 1    PHE F HZ   1 
ATOM   1959 N  N    . VAL F  2 2  ? 1.087   15.420  47.976 1.00 14.73 ? 2    VAL F N    1 
ATOM   1960 C  CA   . VAL F  2 2  ? 1.398   14.646  46.782 1.00 16.71 ? 2    VAL F CA   1 
ATOM   1961 C  C    . VAL F  2 2  ? 0.506   14.976  45.637 1.00 16.63 ? 2    VAL F C    1 
ATOM   1962 O  O    . VAL F  2 2  ? -0.633  15.377  45.820 1.00 18.89 ? 2    VAL F O    1 
ATOM   1963 C  CB   . VAL F  2 2  ? 1.283   13.104  46.989 1.00 19.16 ? 2    VAL F CB   1 
ATOM   1964 C  CG1  . VAL F  2 2  ? 2.371   12.632  47.868 1.00 21.10 ? 2    VAL F CG1  1 
ATOM   1965 C  CG2  . VAL F  2 2  ? -0.066  12.728  47.530 1.00 18.19 ? 2    VAL F CG2  1 
ATOM   1966 H  H    . VAL F  2 2  ? 0.939   14.962  48.827 1.00 16.45 ? 2    VAL F H    1 
ATOM   1967 H  HA   . VAL F  2 2  ? 2.413   14.864  46.499 1.00 17.52 ? 2    VAL F HA   1 
ATOM   1968 H  HB   . VAL F  2 2  ? 1.419   12.620  46.027 1.00 18.70 ? 2    VAL F HB   1 
ATOM   1969 H  HG11 . VAL F  2 2  ? 2.080   11.726  48.366 1.00 21.36 ? 2    VAL F HG11 1 
ATOM   1970 H  HG12 . VAL F  2 2  ? 3.223   12.420  47.234 1.00 22.10 ? 2    VAL F HG12 1 
ATOM   1971 H  HG13 . VAL F  2 2  ? 2.631   13.385  48.610 1.00 20.82 ? 2    VAL F HG13 1 
ATOM   1972 H  HG21 . VAL F  2 2  ? -0.103  11.673  47.738 1.00 19.36 ? 2    VAL F HG21 1 
ATOM   1973 H  HG22 . VAL F  2 2  ? -0.231  13.295  48.438 1.00 18.95 ? 2    VAL F HG22 1 
ATOM   1974 H  HG23 . VAL F  2 2  ? -0.843  12.982  46.824 1.00 18.93 ? 2    VAL F HG23 1 
ATOM   1975 N  N    . ASN F  2 3  ? 1.074   14.808  44.450 1.00 18.35 ? 3    ASN F N    1 
ATOM   1976 C  CA   . ASN F  2 3  ? 0.379   15.032  43.194 1.00 18.16 ? 3    ASN F CA   1 
ATOM   1977 C  C    . ASN F  2 3  ? 0.502   13.685  42.486 1.00 19.26 ? 3    ASN F C    1 
ATOM   1978 O  O    . ASN F  2 3  ? 1.490   13.409  41.787 1.00 21.06 ? 3    ASN F O    1 
ATOM   1979 C  CB   . ASN F  2 3  ? 1.073   16.122  42.390 1.00 20.89 ? 3    ASN F CB   1 
ATOM   1980 C  CG   . ASN F  2 3  ? 0.399   16.375  41.066 1.00 25.22 ? 3    ASN F CG   1 
ATOM   1981 O  OD1  . ASN F  2 3  ? -0.784  16.716  41.017 1.00 26.95 ? 3    ASN F OD1  1 
ATOM   1982 N  ND2  . ASN F  2 3  ? 1.148   16.205  39.978 1.00 32.57 ? 3    ASN F ND2  1 
ATOM   1983 H  H    . ASN F  2 3  ? 1.995   14.465  44.438 1.00 17.84 ? 3    ASN F H    1 
ATOM   1984 H  HA   . ASN F  2 3  ? -0.658  15.268  43.394 1.00 18.10 ? 3    ASN F HA   1 
ATOM   1985 H  HB2  . ASN F  2 3  ? 1.058   17.042  42.960 1.00 21.63 ? 3    ASN F HB2  1 
ATOM   1986 H  HB3  . ASN F  2 3  ? 2.094   15.822  42.212 1.00 22.12 ? 3    ASN F HB3  1 
ATOM   1987 H  HD21 . ASN F  2 3  ? 0.743   16.361  39.098 1.00 29.39 ? 3    ASN F HD21 1 
ATOM   1988 H  HD22 . ASN F  2 3  ? 2.078   15.931  40.111 1.00 27.72 ? 3    ASN F HD22 1 
ATOM   1989 N  N    . GLN F  2 4  ? -0.482  12.809  42.690 1.00 15.80 ? 4    GLN F N    1 
ATOM   1990 C  CA   . GLN F  2 4  ? -0.423  11.490  42.096 1.00 16.13 ? 4    GLN F CA   1 
ATOM   1991 C  C    . GLN F  2 4  ? -1.817  10.879  42.046 1.00 14.58 ? 4    GLN F C    1 
ATOM   1992 O  O    . GLN F  2 4  ? -2.733  11.371  42.689 1.00 14.77 ? 4    GLN F O    1 
ATOM   1993 C  CB   . GLN F  2 4  ? 0.483   10.595  42.930 1.00 17.74 ? 4    GLN F CB   1 
ATOM   1994 C  CG   . GLN F  2 4  ? -0.179  10.106  44.211 1.00 20.99 ? 4    GLN F CG   1 
ATOM   1995 C  CD   . GLN F  2 4  ? 0.706   9.174   44.998 1.00 25.50 ? 4    GLN F CD   1 
ATOM   1996 O  OE1  . GLN F  2 4  ? 1.727   9.588   45.537 1.00 31.11 ? 4    GLN F OE1  1 
ATOM   1997 N  NE2  . GLN F  2 4  ? 0.320   7.903   45.066 1.00 26.54 ? 4    GLN F NE2  1 
ATOM   1998 H  H    . GLN F  2 4  ? -1.267  13.076  43.202 1.00 17.67 ? 4    GLN F H    1 
ATOM   1999 H  HA   . GLN F  2 4  ? -0.017  11.572  41.099 1.00 17.46 ? 4    GLN F HA   1 
ATOM   2000 H  HB2  . GLN F  2 4  ? 0.806   9.739   42.362 1.00 18.82 ? 4    GLN F HB2  1 
ATOM   2001 H  HB3  . GLN F  2 4  ? 1.362   11.150  43.213 1.00 18.44 ? 4    GLN F HB3  1 
ATOM   2002 H  HG2  . GLN F  2 4  ? -0.426  10.956  44.836 1.00 22.74 ? 4    GLN F HG2  1 
ATOM   2003 H  HG3  . GLN F  2 4  ? -1.108  9.587   43.998 1.00 21.50 ? 4    GLN F HG3  1 
ATOM   2004 H  HE21 . GLN F  2 4  ? 0.872   7.250   45.565 1.00 27.06 ? 4    GLN F HE21 1 
ATOM   2005 H  HE22 . GLN F  2 4  ? -0.526  7.657   44.636 1.00 26.70 ? 4    GLN F HE22 1 
ATOM   2006 N  N    . HIS F  2 5  ? -1.949  9.786   41.303 1.00 14.07 ? 5    HIS F N    1 
ATOM   2007 C  CA   . HIS F  2 5  ? -3.221  9.082   41.240 1.00 13.69 ? 5    HIS F CA   1 
ATOM   2008 C  C    . HIS F  2 5  ? -3.289  8.334   42.558 1.00 14.61 ? 5    HIS F C    1 
ATOM   2009 O  O    . HIS F  2 5  ? -2.302  7.726   42.973 1.00 14.96 ? 5    HIS F O    1 
ATOM   2010 C  CB   . HIS F  2 5  ? -3.227  8.114   40.061 1.00 14.09 ? 5    HIS F CB   1 
ATOM   2011 C  CG   . HIS F  2 5  ? -3.193  8.791   38.728 1.00 14.73 ? 5    HIS F CG   1 
ATOM   2012 N  ND1  . HIS F  2 5  ? -4.317  9.267   38.107 1.00 16.92 ? 5    HIS F ND1  1 
ATOM   2013 C  CD2  . HIS F  2 5  ? -2.158  9.078   37.910 1.00 19.67 ? 5    HIS F CD2  1 
ATOM   2014 C  CE1  . HIS F  2 5  ? -3.985  9.822   36.952 1.00 19.46 ? 5    HIS F CE1  1 
ATOM   2015 N  NE2  . HIS F  2 5  ? -2.678  9.716   36.811 1.00 21.28 ? 5    HIS F NE2  1 
ATOM   2016 H  H    . HIS F  2 5  ? -1.183  9.392   40.838 1.00 15.09 ? 5    HIS F H    1 
ATOM   2017 H  HA   . HIS F  2 5  ? -4.005  9.826   41.140 1.00 13.01 ? 5    HIS F HA   1 
ATOM   2018 H  HB2  . HIS F  2 5  ? -2.343  7.510   40.202 1.00 14.51 ? 5    HIS F HB2  1 
ATOM   2019 H  HB3  . HIS F  2 5  ? -4.066  7.445   40.130 1.00 15.00 ? 5    HIS F HB3  1 
ATOM   2020 H  HD1  . HIS F  2 5  ? -5.225  9.199   38.464 1.00 19.05 ? 5    HIS F HD1  1 
ATOM   2021 H  HD2  . HIS F  2 5  ? -1.123  8.841   38.098 1.00 20.64 ? 5    HIS F HD2  1 
ATOM   2022 H  HE1  . HIS F  2 5  ? -4.554  10.607  36.490 1.00 18.57 ? 5    HIS F HE1  1 
ATOM   2023 N  N    . LEU F  2 6  ? -4.450  8.382   43.197 1.00 11.90 ? 6    LEU F N    1 
ATOM   2024 C  CA   . LEU F  2 6  ? -4.694  7.716   44.496 1.00 10.87 ? 6    LEU F CA   1 
ATOM   2025 C  C    . LEU F  2 6  ? -5.857  6.804   44.272 1.00 10.61 ? 6    LEU F C    1 
ATOM   2026 O  O    . LEU F  2 6  ? -6.973  7.261   44.011 1.00 11.74 ? 6    LEU F O    1 
ATOM   2027 C  CB   . LEU F  2 6  ? -5.033  8.752   45.565 1.00 11.42 ? 6    LEU F CB   1 
ATOM   2028 C  CG   . LEU F  2 6  ? -3.856  9.644   45.971 1.00 12.34 ? 6    LEU F CG   1 
ATOM   2029 C  CD1  . LEU F  2 6  ? -4.363  10.754  46.885 1.00 13.52 ? 6    LEU F CD1  1 
ATOM   2030 C  CD2  . LEU F  2 6  ? -2.802  8.814   46.743 1.00 14.26 ? 6    LEU F CD2  1 
ATOM   2031 H  H    . LEU F  2 6  ? -5.161  8.905   42.795 1.00 11.95 ? 6    LEU F H    1 
ATOM   2032 H  HA   . LEU F  2 6  ? -3.822  7.132   44.782 1.00 11.25 ? 6    LEU F HA   1 
ATOM   2033 H  HB2  . LEU F  2 6  ? -5.837  9.384   45.234 1.00 11.18 ? 6    LEU F HB2  1 
ATOM   2034 H  HB3  . LEU F  2 6  ? -5.320  8.191   46.424 1.00 12.07 ? 6    LEU F HB3  1 
ATOM   2035 H  HG   . LEU F  2 6  ? -3.384  10.108  45.131 1.00 15.03 ? 6    LEU F HG   1 
ATOM   2036 H  HD11 . LEU F  2 6  ? -5.190  11.293  46.462 1.00 14.36 ? 6    LEU F HD11 1 
ATOM   2037 H  HD12 . LEU F  2 6  ? -4.678  10.346  47.829 1.00 15.35 ? 6    LEU F HD12 1 
ATOM   2038 H  HD13 . LEU F  2 6  ? -3.560  11.459  47.058 1.00 11.81 ? 6    LEU F HD13 1 
ATOM   2039 H  HD21 . LEU F  2 6  ? -2.393  7.993   46.166 1.00 12.39 ? 6    LEU F HD21 1 
ATOM   2040 H  HD22 . LEU F  2 6  ? -2.004  9.478   47.042 1.00 14.04 ? 6    LEU F HD22 1 
ATOM   2041 H  HD23 . LEU F  2 6  ? -3.271  8.431   47.638 1.00 12.48 ? 6    LEU F HD23 1 
ATOM   2042 N  N    . CYS F  2 7  ? -5.630  5.507   44.407 1.00 10.98 ? 7    CYS F N    1 
ATOM   2043 C  CA   . CYS F  2 7  ? -6.633  4.490   44.164 1.00 12.34 ? 7    CYS F CA   1 
ATOM   2044 C  C    . CYS F  2 7  ? -6.709  3.457   45.271 1.00 12.06 ? 7    CYS F C    1 
ATOM   2045 O  O    . CYS F  2 7  ? -5.738  3.200   45.978 1.00 12.15 ? 7    CYS F O    1 
ATOM   2046 C  CB   . CYS F  2 7  ? -6.308  3.736   42.871 1.00 13.50 ? 7    CYS F CB   1 
ATOM   2047 S  SG   . CYS F  2 7  ? -6.125  4.766   41.377 1.00 13.98 ? 7    CYS F SG   1 
ATOM   2048 H  H    . CYS F  2 7  ? -4.729  5.251   44.717 1.00 12.65 ? 7    CYS F H    1 
ATOM   2049 H  HA   . CYS F  2 7  ? -7.608  4.939   44.024 1.00 12.31 ? 7    CYS F HA   1 
ATOM   2050 H  HB2  . CYS F  2 7  ? -5.366  3.226   42.993 1.00 13.71 ? 7    CYS F HB2  1 
ATOM   2051 H  HB3  . CYS F  2 7  ? -7.067  2.999   42.670 1.00 13.82 ? 7    CYS F HB3  1 
ATOM   2052 N  N    . GLY F  2 8  ? -7.879  2.853   45.394 1.00 12.14 ? 8    GLY F N    1 
ATOM   2053 C  CA   . GLY F  2 8  ? -8.066  1.792   46.348 1.00 12.83 ? 8    GLY F CA   1 
ATOM   2054 C  C    . GLY F  2 8  ? -7.638  2.092   47.755 1.00 11.43 ? 8    GLY F C    1 
ATOM   2055 O  O    . GLY F  2 8  ? -7.992  3.127   48.308 1.00 11.71 ? 8    GLY F O    1 
ATOM   2056 H  H    . GLY F  2 8  ? -8.667  3.128   44.888 1.00 12.84 ? 8    GLY F H    1 
ATOM   2057 H  HA2  . GLY F  2 8  ? -9.151  1.714   46.419 1.00 12.62 ? 8    GLY F HA2  1 
ATOM   2058 H  HA3  . GLY F  2 8  ? -7.673  0.838   46.032 1.00 13.05 ? 8    GLY F HA3  1 
ATOM   2059 N  N    . SER F  2 9  ? -6.882  1.187   48.358 1.00 10.97 ? 9    SER F N    1 
ATOM   2060 C  CA   . SER F  2 9  ? -6.516  1.384   49.740 1.00 11.86 ? 9    SER F CA   1 
ATOM   2061 C  C    . SER F  2 9  ? -5.677  2.646   49.940 1.00 9.79  ? 9    SER F C    1 
ATOM   2062 O  O    . SER F  2 9  ? -5.710  3.248   51.002 1.00 10.69 ? 9    SER F O    1 
ATOM   2063 C  CB   . SER F  2 9  ? -5.789  0.154   50.277 1.00 14.54 ? 9    SER F CB   1 
ATOM   2064 O  OG   . SER F  2 9  ? -4.593  -0.074  49.589 1.00 14.18 ? 9    SER F OG   1 
ATOM   2065 H  H    . SER F  2 9  ? -6.573  0.408   47.842 1.00 13.72 ? 9    SER F H    1 
ATOM   2066 H  HA   . SER F  2 9  ? -7.427  1.491   50.281 1.00 11.07 ? 9    SER F HA   1 
ATOM   2067 H  HB2  . SER F  2 9  ? -5.536  0.309   51.315 1.00 13.93 ? 9    SER F HB2  1 
ATOM   2068 H  HB3  . SER F  2 9  ? -6.414  -0.708  50.193 1.00 13.34 ? 9    SER F HB3  1 
ATOM   2069 H  HG   . SER F  2 9  ? -4.808  -0.288  48.685 1.00 11.09 ? 9    SER F HG   1 
ATOM   2070 N  N    . HIS F  2 10 ? -4.920  3.064   48.938 1.00 9.30  ? 10   HIS F N    1 
ATOM   2071 C  CA   . HIS F  2 10 ? -4.136  4.299   49.051 1.00 9.42  ? 10   HIS F CA   1 
ATOM   2072 C  C    . HIS F  2 10 ? -5.044  5.522   49.115 1.00 9.30  ? 10   HIS F C    1 
ATOM   2073 O  O    . HIS F  2 10 ? -4.755  6.483   49.835 1.00 10.38 ? 10   HIS F O    1 
ATOM   2074 C  CB   . HIS F  2 10 ? -3.166  4.428   47.873 1.00 10.50 ? 10   HIS F CB   1 
ATOM   2075 C  CG   . HIS F  2 10 ? -2.130  3.341   47.848 1.00 8.85  ? 10   HIS F CG   1 
ATOM   2076 N  ND1  . HIS F  2 10 ? -1.169  3.169   48.833 1.00 13.63 ? 10   HIS F ND1  1 
ATOM   2077 C  CD2  . HIS F  2 10 ? -1.902  2.364   46.943 1.00 9.77  ? 10   HIS F CD2  1 
ATOM   2078 C  CE1  . HIS F  2 10 ? -0.392  2.136   48.510 1.00 14.17 ? 10   HIS F CE1  1 
ATOM   2079 N  NE2  . HIS F  2 10 ? -0.810  1.633   47.362 1.00 10.91 ? 10   HIS F NE2  1 
ATOM   2080 H  H    . HIS F  2 10 ? -4.923  2.617   48.070 1.00 9.89  ? 10   HIS F H    1 
ATOM   2081 H  HA   . HIS F  2 10 ? -3.568  4.261   49.973 1.00 9.29  ? 10   HIS F HA   1 
ATOM   2082 H  HB2  . HIS F  2 10 ? -3.741  4.318   46.982 1.00 5.80  ? 10   HIS F HB2  1 
ATOM   2083 H  HB3  . HIS F  2 10 ? -2.665  5.377   47.904 1.00 9.82  ? 10   HIS F HB3  1 
ATOM   2084 H  HD1  . HIS F  2 10 ? -1.082  3.715   49.643 1.00 12.86 ? 10   HIS F HD1  1 
ATOM   2085 H  HD2  . HIS F  2 10 ? -2.477  2.145   46.050 1.00 8.36  ? 10   HIS F HD2  1 
ATOM   2086 H  HE1  . HIS F  2 10 ? 0.656   2.136   48.770 1.00 15.05 ? 10   HIS F HE1  1 
ATOM   2087 N  N    . LEU F  2 11 ? -6.132  5.486   48.342 1.00 9.42  ? 11   LEU F N    1 
ATOM   2088 C  CA   . LEU F  2 11 ? -7.098  6.593   48.327 1.00 10.10 ? 11   LEU F CA   1 
ATOM   2089 C  C    . LEU F  2 11 ? -7.788  6.682   49.697 1.00 9.01  ? 11   LEU F C    1 
ATOM   2090 O  O    . LEU F  2 11 ? -7.924  7.769   50.261 1.00 9.26  ? 11   LEU F O    1 
ATOM   2091 C  CB   . LEU F  2 11 ? -8.077  6.361   47.177 1.00 10.24 ? 11   LEU F CB   1 
ATOM   2092 C  CG   . LEU F  2 11 ? -9.208  7.383   47.040 1.00 10.33 ? 11   LEU F CG   1 
ATOM   2093 C  CD1  . LEU F  2 11 ? -8.647  8.796   46.906 1.00 10.88 ? 11   LEU F CD1  1 
ATOM   2094 C  CD2  . LEU F  2 11 ? -10.016 7.011   45.802 1.00 10.86 ? 11   LEU F CD2  1 
ATOM   2095 H  H    . LEU F  2 11 ? -6.382  4.681   47.855 1.00 11.52 ? 11   LEU F H    1 
ATOM   2096 H  HA   . LEU F  2 11 ? -6.568  7.515   48.193 1.00 11.05 ? 11   LEU F HA   1 
ATOM   2097 H  HB2  . LEU F  2 11 ? -7.490  6.385   46.291 1.00 9.90  ? 11   LEU F HB2  1 
ATOM   2098 H  HB3  . LEU F  2 11 ? -8.501  5.385   47.294 1.00 8.19  ? 11   LEU F HB3  1 
ATOM   2099 H  HG   . LEU F  2 11 ? -9.848  7.294   47.897 1.00 9.25  ? 11   LEU F HG   1 
ATOM   2100 H  HD11 . LEU F  2 11 ? -8.091  8.873   45.981 1.00 12.81 ? 11   LEU F HD11 1 
ATOM   2101 H  HD12 . LEU F  2 11 ? -9.471  9.496   46.842 1.00 9.60  ? 11   LEU F HD12 1 
ATOM   2102 H  HD13 . LEU F  2 11 ? -8.028  9.147   47.709 1.00 9.92  ? 11   LEU F HD13 1 
ATOM   2103 H  HD21 . LEU F  2 11 ? -10.110 5.956   45.719 1.00 8.68  ? 11   LEU F HD21 1 
ATOM   2104 H  HD22 . LEU F  2 11 ? -10.997 7.448   45.909 1.00 10.90 ? 11   LEU F HD22 1 
ATOM   2105 H  HD23 . LEU F  2 11 ? -9.528  7.411   44.924 1.00 9.76  ? 11   LEU F HD23 1 
ATOM   2106 N  N    A VAL F  2 12 ? -8.211  5.543   50.208 0.50 9.87  ? 12   VAL F N    1 
ATOM   2107 N  N    B VAL F  2 12 ? -8.260  5.562   50.240 0.50 9.69  ? 12   VAL F N    1 
ATOM   2108 C  CA   A VAL F  2 12 ? -8.853  5.489   51.496 0.50 8.51  ? 12   VAL F CA   1 
ATOM   2109 C  CA   B VAL F  2 12 ? -8.921  5.634   51.550 0.50 10.18 ? 12   VAL F CA   1 
ATOM   2110 C  C    A VAL F  2 12 ? -7.918  5.994   52.591 0.50 8.97  ? 12   VAL F C    1 
ATOM   2111 C  C    B VAL F  2 12 ? -7.917  5.992   52.664 0.50 10.69 ? 12   VAL F C    1 
ATOM   2112 O  O    A VAL F  2 12 ? -8.329  6.772   53.462 0.50 10.72 ? 12   VAL F O    1 
ATOM   2113 O  O    B VAL F  2 12 ? -8.277  6.649   53.644 0.50 10.03 ? 12   VAL F O    1 
ATOM   2114 C  CB   A VAL F  2 12 ? -9.321  4.043   51.773 0.50 9.81  ? 12   VAL F CB   1 
ATOM   2115 C  CB   B VAL F  2 12 ? -9.728  4.333   51.898 0.50 9.99  ? 12   VAL F CB   1 
ATOM   2116 C  CG1  A VAL F  2 12 ? -9.772  3.914   53.211 0.50 9.27  ? 12   VAL F CG1  1 
ATOM   2117 C  CG1  B VAL F  2 12 ? -10.858 4.131   50.896 0.50 11.91 ? 12   VAL F CG1  1 
ATOM   2118 C  CG2  A VAL F  2 12 ? -10.430 3.685   50.774 0.50 11.53 ? 12   VAL F CG2  1 
ATOM   2119 C  CG2  B VAL F  2 12 ? -8.819  3.141   51.915 0.50 14.08 ? 12   VAL F CG2  1 
ATOM   2120 H  H    A VAL F  2 12 ? -8.096  4.721   49.689 0.50 8.57  ? 12   VAL F H    1 
ATOM   2121 H  H    B VAL F  2 12 ? -8.108  4.739   49.712 0.50 8.61  ? 12   VAL F H    1 
ATOM   2122 H  HA   A VAL F  2 12 ? -9.723  6.126   51.481 0.50 6.82  ? 12   VAL F HA   1 
ATOM   2123 H  HA   B VAL F  2 12 ? -9.619  6.467   51.503 0.50 8.73  ? 12   VAL F HA   1 
ATOM   2124 H  HB   A VAL F  2 12 ? -8.492  3.367   51.614 0.50 11.46 ? 12   VAL F HB   1 
ATOM   2125 H  HB   B VAL F  2 12 ? -10.174 4.455   52.881 0.50 12.53 ? 12   VAL F HB   1 
ATOM   2126 H  HG11 A VAL F  2 12 ? -10.414 3.047   53.278 0.50 10.53 ? 12   VAL F HG11 1 
ATOM   2127 H  HG11 B VAL F  2 12 ? -11.418 5.047   50.796 0.50 11.88 ? 12   VAL F HG11 1 
ATOM   2128 H  HG12 A VAL F  2 12 ? -8.931  3.785   53.885 0.50 10.58 ? 12   VAL F HG12 1 
ATOM   2129 H  HG12 B VAL F  2 12 ? -10.410 3.851   49.958 0.50 12.50 ? 12   VAL F HG12 1 
ATOM   2130 H  HG13 A VAL F  2 12 ? -10.361 4.779   53.496 0.50 9.50  ? 12   VAL F HG13 1 
ATOM   2131 H  HG13 B VAL F  2 12 ? -11.512 3.344   51.240 0.50 12.97 ? 12   VAL F HG13 1 
ATOM   2132 H  HG21 A VAL F  2 12 ? -11.283 4.331   50.935 0.50 11.47 ? 12   VAL F HG21 1 
ATOM   2133 H  HG21 B VAL F  2 12 ? -8.263  3.109   52.838 0.50 12.94 ? 12   VAL F HG21 1 
ATOM   2134 H  HG22 A VAL F  2 12 ? -10.024 3.852   49.789 0.50 11.27 ? 12   VAL F HG22 1 
ATOM   2135 H  HG22 B VAL F  2 12 ? -9.391  2.236   51.795 0.50 14.59 ? 12   VAL F HG22 1 
ATOM   2136 H  HG23 A VAL F  2 12 ? -10.725 2.655   50.858 0.50 12.00 ? 12   VAL F HG23 1 
ATOM   2137 H  HG23 B VAL F  2 12 ? -8.120  3.250   51.104 0.50 14.55 ? 12   VAL F HG23 1 
ATOM   2138 N  N    . GLU F  2 13 ? -6.660  5.570   52.558 1.00 9.49  ? 13   GLU F N    1 
ATOM   2139 C  CA   . GLU F  2 13 ? -5.695  5.989   53.568 1.00 9.53  ? 13   GLU F CA   1 
ATOM   2140 C  C    . GLU F  2 13 ? -5.487  7.502   53.470 1.00 9.77  ? 13   GLU F C    1 
ATOM   2141 O  O    . GLU F  2 13 ? -5.382  8.170   54.494 1.00 10.85 ? 13   GLU F O    1 
ATOM   2142 C  CB   . GLU F  2 13 ? -4.373  5.240   53.397 1.00 10.92 ? 13   GLU F CB   1 
ATOM   2143 C  CG   . GLU F  2 13 ? -3.233  5.710   54.320 1.00 14.48 ? 13   GLU F CG   1 
ATOM   2144 C  CD   . GLU F  2 13 ? -3.450  5.414   55.785 1.00 20.80 ? 13   GLU F CD   1 
ATOM   2145 O  OE1  . GLU F  2 13 ? -4.394  4.697   56.134 1.00 25.26 ? 13   GLU F OE1  1 
ATOM   2146 O  OE2  . GLU F  2 13 ? -2.642  5.898   56.609 1.00 28.10 ? 13   GLU F OE2  1 
ATOM   2147 H  H    . GLU F  2 13 ? -6.354  4.978   51.844 1.00 9.89  ? 13   GLU F H    1 
ATOM   2148 H  HA   . GLU F  2 13 ? -6.116  5.767   54.529 1.00 10.66 ? 13   GLU F HA   1 
ATOM   2149 H  HB2  . GLU F  2 13 ? -4.529  4.184   53.555 1.00 11.85 ? 13   GLU F HB2  1 
ATOM   2150 H  HB3  . GLU F  2 13 ? -4.058  5.384   52.377 1.00 11.76 ? 13   GLU F HB3  1 
ATOM   2151 H  HG2  . GLU F  2 13 ? -2.322  5.180   54.060 1.00 16.73 ? 13   GLU F HG2  1 
ATOM   2152 H  HG3  . GLU F  2 13 ? -3.058  6.778   54.219 1.00 16.25 ? 13   GLU F HG3  1 
ATOM   2153 N  N    . ALA F  2 14 ? -5.387  8.031   52.255 1.00 9.98  ? 14   ALA F N    1 
ATOM   2154 C  CA   . ALA F  2 14 ? -5.228  9.481   52.104 1.00 9.75  ? 14   ALA F CA   1 
ATOM   2155 C  C    . ALA F  2 14 ? -6.415  10.227  52.724 1.00 10.40 ? 14   ALA F C    1 
ATOM   2156 O  O    . ALA F  2 14 ? -6.236  11.261  53.393 1.00 9.90  ? 14   ALA F O    1 
ATOM   2157 C  CB   . ALA F  2 14 ? -5.080  9.808   50.632 1.00 10.91 ? 14   ALA F CB   1 
ATOM   2158 H  H    . ALA F  2 14 ? -5.413  7.467   51.477 1.00 8.05  ? 14   ALA F H    1 
ATOM   2159 H  HA   . ALA F  2 14 ? -4.324  9.788   52.624 1.00 8.87  ? 14   ALA F HA   1 
ATOM   2160 H  HB1  . ALA F  2 14 ? -4.111  9.499   50.326 1.00 11.26 ? 14   ALA F HB1  1 
ATOM   2161 H  HB2  . ALA F  2 14 ? -5.836  9.276   50.092 1.00 9.61  ? 14   ALA F HB2  1 
ATOM   2162 H  HB3  . ALA F  2 14 ? -5.177  10.883  50.500 1.00 10.73 ? 14   ALA F HB3  1 
ATOM   2163 N  N    . LEU F  2 15 ? -7.638  9.751   52.465 1.00 10.65 ? 15   LEU F N    1 
ATOM   2164 C  CA   . LEU F  2 15 ? -8.822  10.368  53.075 1.00 9.65  ? 15   LEU F CA   1 
ATOM   2165 C  C    . LEU F  2 15 ? -8.761  10.274  54.579 1.00 9.98  ? 15   LEU F C    1 
ATOM   2166 O  O    . LEU F  2 15 ? -9.088  11.237  55.323 1.00 11.56 ? 15   LEU F O    1 
ATOM   2167 C  CB   . LEU F  2 15 ? -10.081 9.649   52.668 1.00 13.04 ? 15   LEU F CB   1 
ATOM   2168 C  CG   . LEU F  2 15 ? -10.593 9.958   51.281 1.00 14.92 ? 15   LEU F CG   1 
ATOM   2169 C  CD1  . LEU F  2 15 ? -11.832 9.085   51.037 1.00 14.92 ? 15   LEU F CD1  1 
ATOM   2170 C  CD2  . LEU F  2 15 ? -11.026 11.449  51.162 1.00 13.09 ? 15   LEU F CD2  1 
ATOM   2171 H  H    . LEU F  2 15 ? -7.739  9.065   51.796 1.00 8.93  ? 15   LEU F H    1 
ATOM   2172 H  HA   . LEU F  2 15 ? -8.836  11.377  52.698 1.00 10.37 ? 15   LEU F HA   1 
ATOM   2173 H  HB2  . LEU F  2 15 ? -9.933  8.602   52.837 1.00 10.32 ? 15   LEU F HB2  1 
ATOM   2174 H  HB3  . LEU F  2 15 ? -10.827 9.963   53.383 1.00 12.76 ? 15   LEU F HB3  1 
ATOM   2175 H  HG   . LEU F  2 15 ? -9.824  9.750   50.565 1.00 15.84 ? 15   LEU F HG   1 
ATOM   2176 H  HD11 . LEU F  2 15 ? -11.972 8.894   49.992 1.00 15.54 ? 15   LEU F HD11 1 
ATOM   2177 H  HD12 . LEU F  2 15 ? -11.670 8.125   51.525 1.00 16.61 ? 15   LEU F HD12 1 
ATOM   2178 H  HD13 . LEU F  2 15 ? -12.702 9.559   51.447 1.00 14.51 ? 15   LEU F HD13 1 
ATOM   2179 H  HD21 . LEU F  2 15 ? -11.710 11.754  51.911 1.00 13.04 ? 15   LEU F HD21 1 
ATOM   2180 H  HD22 . LEU F  2 15 ? -10.155 12.080  51.187 1.00 16.02 ? 15   LEU F HD22 1 
ATOM   2181 H  HD23 . LEU F  2 15 ? -11.500 11.543  50.189 1.00 15.33 ? 15   LEU F HD23 1 
ATOM   2182 N  N    . TYR F  2 16 ? -8.392  9.103   55.083 1.00 10.46 ? 16   TYR F N    1 
ATOM   2183 C  CA   . TYR F  2 16 ? -8.292  8.933   56.521 1.00 11.77 ? 16   TYR F CA   1 
ATOM   2184 C  C    . TYR F  2 16 ? -7.363  10.009  57.131 1.00 11.38 ? 16   TYR F C    1 
ATOM   2185 O  O    . TYR F  2 16 ? -7.686  10.676  58.142 1.00 12.82 ? 16   TYR F O    1 
ATOM   2186 C  CB   . TYR F  2 16 ? -7.726  7.548   56.824 1.00 11.91 ? 16   TYR F CB   1 
ATOM   2187 C  CG   . TYR F  2 16 ? -7.382  7.346   58.266 1.00 11.00 ? 16   TYR F CG   1 
ATOM   2188 C  CD1  . TYR F  2 16 ? -8.391  7.265   59.207 1.00 15.90 ? 16   TYR F CD1  1 
ATOM   2189 C  CD2  . TYR F  2 16 ? -6.069  7.281   58.720 1.00 13.66 ? 16   TYR F CD2  1 
ATOM   2190 C  CE1  . TYR F  2 16 ? -8.120  7.126   60.546 1.00 18.05 ? 16   TYR F CE1  1 
ATOM   2191 C  CE2  . TYR F  2 16 ? -5.782  7.137   60.092 1.00 17.47 ? 16   TYR F CE2  1 
ATOM   2192 C  CZ   . TYR F  2 16 ? -6.830  7.058   60.992 1.00 16.62 ? 16   TYR F CZ   1 
ATOM   2193 O  OH   . TYR F  2 16 ? -6.592  6.868   62.340 1.00 24.88 ? 16   TYR F OH   1 
ATOM   2194 H  H    . TYR F  2 16 ? -8.198  8.375   54.468 1.00 10.91 ? 16   TYR F H    1 
ATOM   2195 H  HA   . TYR F  2 16 ? -9.286  9.003   56.921 1.00 11.49 ? 16   TYR F HA   1 
ATOM   2196 H  HB2  . TYR F  2 16 ? -8.554  6.911   56.574 1.00 12.13 ? 16   TYR F HB2  1 
ATOM   2197 H  HB3  . TYR F  2 16 ? -6.897  7.256   56.200 1.00 11.56 ? 16   TYR F HB3  1 
ATOM   2198 H  HD1  . TYR F  2 16 ? -9.407  7.315   58.857 1.00 17.16 ? 16   TYR F HD1  1 
ATOM   2199 H  HD2  . TYR F  2 16 ? -5.249  7.343   58.022 1.00 15.03 ? 16   TYR F HD2  1 
ATOM   2200 H  HE1  . TYR F  2 16 ? -8.933  7.064   61.252 1.00 18.68 ? 16   TYR F HE1  1 
ATOM   2201 H  HE2  . TYR F  2 16 ? -4.756  7.086   60.412 1.00 17.25 ? 16   TYR F HE2  1 
ATOM   2202 H  HH   . TYR F  2 16 ? -7.409  6.589   62.760 1.00 21.71 ? 16   TYR F HH   1 
ATOM   2203 N  N    . LEU F  2 17 ? -6.193  10.195  56.533 1.00 10.83 ? 17   LEU F N    1 
ATOM   2204 C  CA   . LEU F  2 17 ? -5.233  11.144  57.067 1.00 11.36 ? 17   LEU F CA   1 
ATOM   2205 C  C    . LEU F  2 17 ? -5.643  12.582  56.917 1.00 11.88 ? 17   LEU F C    1 
ATOM   2206 O  O    . LEU F  2 17 ? -5.534  13.374  57.866 1.00 13.18 ? 17   LEU F O    1 
ATOM   2207 C  CB   . LEU F  2 17 ? -3.870  10.904  56.418 1.00 11.91 ? 17   LEU F CB   1 
ATOM   2208 C  CG   . LEU F  2 17 ? -3.194  9.589   56.816 1.00 11.93 ? 17   LEU F CG   1 
ATOM   2209 C  CD1  . LEU F  2 17 ? -1.925  9.396   55.982 1.00 14.97 ? 17   LEU F CD1  1 
ATOM   2210 C  CD2  . LEU F  2 17 ? -2.848  9.584   58.288 1.00 15.43 ? 17   LEU F CD2  1 
ATOM   2211 H  H    . LEU F  2 17 ? -5.972  9.692   55.726 1.00 11.39 ? 17   LEU F H    1 
ATOM   2212 H  HA   . LEU F  2 17 ? -5.119  10.898  58.115 1.00 13.62 ? 17   LEU F HA   1 
ATOM   2213 H  HB2  . LEU F  2 17 ? -3.977  10.947  55.346 1.00 9.74  ? 17   LEU F HB2  1 
ATOM   2214 H  HB3  . LEU F  2 17 ? -3.220  11.721  56.717 1.00 12.27 ? 17   LEU F HB3  1 
ATOM   2215 H  HG   . LEU F  2 17 ? -3.863  8.774   56.610 1.00 13.53 ? 17   LEU F HG   1 
ATOM   2216 H  HD11 . LEU F  2 17 ? -1.403  8.536   56.371 1.00 15.95 ? 17   LEU F HD11 1 
ATOM   2217 H  HD12 . LEU F  2 17 ? -2.174  9.164   54.954 1.00 13.61 ? 17   LEU F HD12 1 
ATOM   2218 H  HD13 . LEU F  2 17 ? -1.268  10.246  56.051 1.00 14.96 ? 17   LEU F HD13 1 
ATOM   2219 H  HD21 . LEU F  2 17 ? -2.183  10.405  58.514 1.00 15.30 ? 17   LEU F HD21 1 
ATOM   2220 H  HD22 . LEU F  2 17 ? -3.733  9.633   58.888 1.00 15.08 ? 17   LEU F HD22 1 
ATOM   2221 H  HD23 . LEU F  2 17 ? -2.334  8.671   58.534 1.00 16.17 ? 17   LEU F HD23 1 
ATOM   2222 N  N    . VAL F  2 18 ? -6.146  12.931  55.750 1.00 10.24 ? 18   VAL F N    1 
ATOM   2223 C  CA   . VAL F  2 18 ? -6.488  14.318  55.488 1.00 11.78 ? 18   VAL F CA   1 
ATOM   2224 C  C    . VAL F  2 18 ? -7.742  14.752  56.227 1.00 12.54 ? 18   VAL F C    1 
ATOM   2225 O  O    . VAL F  2 18 ? -7.812  15.867  56.756 1.00 12.70 ? 18   VAL F O    1 
ATOM   2226 C  CB   . VAL F  2 18 ? -6.666  14.538  53.968 1.00 11.56 ? 18   VAL F CB   1 
ATOM   2227 C  CG1  . VAL F  2 18 ? -7.361  15.858  53.679 1.00 12.66 ? 18   VAL F CG1  1 
ATOM   2228 C  CG2  . VAL F  2 18 ? -5.310  14.474  53.298 1.00 12.49 ? 18   VAL F CG2  1 
ATOM   2229 H  H    . VAL F  2 18 ? -6.205  12.272  55.040 1.00 9.06  ? 18   VAL F H    1 
ATOM   2230 H  HA   . VAL F  2 18 ? -5.686  14.948  55.828 1.00 12.74 ? 18   VAL F HA   1 
ATOM   2231 H  HB   . VAL F  2 18 ? -7.306  13.789  53.540 1.00 10.78 ? 18   VAL F HB   1 
ATOM   2232 H  HG11 . VAL F  2 18 ? -7.526  15.896  52.607 1.00 12.80 ? 18   VAL F HG11 1 
ATOM   2233 H  HG12 . VAL F  2 18 ? -8.297  15.909  54.207 1.00 13.23 ? 18   VAL F HG12 1 
ATOM   2234 H  HG13 . VAL F  2 18 ? -6.731  16.693  53.954 1.00 13.35 ? 18   VAL F HG13 1 
ATOM   2235 H  HG21 . VAL F  2 18 ? -5.141  15.405  52.810 1.00 14.52 ? 18   VAL F HG21 1 
ATOM   2236 H  HG22 . VAL F  2 18 ? -4.552  14.316  54.053 1.00 13.14 ? 18   VAL F HG22 1 
ATOM   2237 H  HG23 . VAL F  2 18 ? -5.289  13.681  52.579 1.00 13.44 ? 18   VAL F HG23 1 
ATOM   2238 N  N    . CYS F  2 19 ? -8.735  13.880  56.290 1.00 11.98 ? 19   CYS F N    1 
ATOM   2239 C  CA   . CYS F  2 19 ? -9.976  14.259  56.911 1.00 12.94 ? 19   CYS F CA   1 
ATOM   2240 C  C    . CYS F  2 19 ? -9.922  14.259  58.420 1.00 13.21 ? 19   CYS F C    1 
ATOM   2241 O  O    . CYS F  2 19 ? -10.689 15.013  59.042 1.00 15.01 ? 19   CYS F O    1 
ATOM   2242 C  CB   . CYS F  2 19 ? -11.125 13.378  56.413 1.00 10.50 ? 19   CYS F CB   1 
ATOM   2243 S  SG   . CYS F  2 19 ? -11.401 13.481  54.606 1.00 11.20 ? 19   CYS F SG   1 
ATOM   2244 H  H    . CYS F  2 19 ? -8.595  13.005  55.867 1.00 14.23 ? 19   CYS F H    1 
ATOM   2245 H  HA   . CYS F  2 19 ? -10.193 15.258  56.603 1.00 12.02 ? 19   CYS F HA   1 
ATOM   2246 H  HB2  . CYS F  2 19 ? -10.888 12.360  56.687 1.00 11.80 ? 19   CYS F HB2  1 
ATOM   2247 H  HB3  . CYS F  2 19 ? -12.033 13.647  56.928 1.00 13.51 ? 19   CYS F HB3  1 
ATOM   2248 N  N    . GLY F  2 20 ? -9.053  13.429  58.999 1.00 14.54 ? 20   GLY F N    1 
ATOM   2249 C  CA   . GLY F  2 20 ? -8.908  13.368  60.442 1.00 16.11 ? 20   GLY F CA   1 
ATOM   2250 C  C    . GLY F  2 20 ? -10.209 13.138  61.187 1.00 16.76 ? 20   GLY F C    1 
ATOM   2251 O  O    . GLY F  2 20 ? -11.028 12.289  60.838 1.00 16.41 ? 20   GLY F O    1 
ATOM   2252 H  H    . GLY F  2 20 ? -8.511  12.826  58.459 1.00 15.76 ? 20   GLY F H    1 
ATOM   2253 H  HA2  . GLY F  2 20 ? -8.293  12.513  60.667 1.00 16.90 ? 20   GLY F HA2  1 
ATOM   2254 H  HA3  . GLY F  2 20 ? -8.431  14.249  60.841 1.00 16.88 ? 20   GLY F HA3  1 
ATOM   2255 N  N    . GLU F  2 21 ? -10.403 13.924  62.245 1.00 18.18 ? 21   GLU F N    1 
ATOM   2256 C  CA   . GLU F  2 21 ? -11.600 13.782  63.074 1.00 19.79 ? 21   GLU F CA   1 
ATOM   2257 C  C    . GLU F  2 21 ? -12.916 14.038  62.336 1.00 20.00 ? 21   GLU F C    1 
ATOM   2258 O  O    . GLU F  2 21 ? -13.991 13.680  62.811 1.00 22.94 ? 21   GLU F O    1 
ATOM   2259 C  CB   . GLU F  2 21 ? -11.504 14.700  64.301 1.00 23.43 ? 21   GLU F CB   1 
ATOM   2260 C  CG   . GLU F  2 21 ? -10.261 14.498  65.185 1.00 27.98 ? 21   GLU F CG   1 
ATOM   2261 C  CD   . GLU F  2 21 ? -9.109  15.449  64.847 1.00 33.46 ? 21   GLU F CD   1 
ATOM   2262 O  OE1  . GLU F  2 21 ? -8.496  15.298  63.768 1.00 37.77 ? 21   GLU F OE1  1 
ATOM   2263 O  OE2  . GLU F  2 21 ? -8.811  16.356  65.665 1.00 38.27 ? 21   GLU F OE2  1 
ATOM   2264 H  H    . GLU F  2 21 ? -9.702  14.562  62.467 1.00 18.39 ? 21   GLU F H    1 
ATOM   2265 H  HA   . GLU F  2 21 ? -11.616 12.774  63.434 1.00 19.39 ? 21   GLU F HA   1 
ATOM   2266 H  HB2  . GLU F  2 21 ? -11.517 15.726  63.955 1.00 20.63 ? 21   GLU F HB2  1 
ATOM   2267 H  HB3  . GLU F  2 21 ? -12.389 14.485  64.878 1.00 21.85 ? 21   GLU F HB3  1 
ATOM   2268 H  HG2  . GLU F  2 21 ? -10.563 14.656  66.214 1.00 24.72 ? 21   GLU F HG2  1 
ATOM   2269 H  HG3  . GLU F  2 21 ? -9.925  13.482  65.098 1.00 24.00 ? 21   GLU F HG3  1 
ATOM   2270 N  N    . ARG F  2 22 ? -12.847 14.671  61.179 1.00 16.56 ? 22   ARG F N    1 
ATOM   2271 C  CA   . ARG F  2 22 ? -14.074 14.912  60.425 1.00 19.06 ? 22   ARG F CA   1 
ATOM   2272 C  C    . ARG F  2 22 ? -14.669 13.630  59.875 1.00 15.51 ? 22   ARG F C    1 
ATOM   2273 O  O    . ARG F  2 22 ? -15.877 13.551  59.628 1.00 19.34 ? 22   ARG F O    1 
ATOM   2274 C  CB   . ARG F  2 22 ? -13.804 15.798  59.224 1.00 17.43 ? 22   ARG F CB   1 
ATOM   2275 C  CG   . ARG F  2 22 ? -13.312 17.195  59.528 1.00 20.07 ? 22   ARG F CG   1 
ATOM   2276 C  CD   . ARG F  2 22 ? -12.967 17.938  58.249 1.00 18.61 ? 22   ARG F CD   1 
ATOM   2277 N  NE   . ARG F  2 22 ? -11.628 17.606  57.755 1.00 18.73 ? 22   ARG F NE   1 
ATOM   2278 C  CZ   . ARG F  2 22 ? -11.088 18.153  56.668 1.00 17.15 ? 22   ARG F CZ   1 
ATOM   2279 N  NH1  . ARG F  2 22 ? -11.794 19.019  55.961 1.00 21.10 ? 22   ARG F NH1  1 
ATOM   2280 N  NH2  . ARG F  2 22 ? -9.816  17.944  56.353 1.00 16.50 ? 22   ARG F NH2  1 
ATOM   2281 H  H    . ARG F  2 22 ? -12.007 15.036  60.845 1.00 18.15 ? 22   ARG F H    1 
ATOM   2282 H  HA   . ARG F  2 22 ? -14.794 15.399  61.041 1.00 18.75 ? 22   ARG F HA   1 
ATOM   2283 H  HB2  . ARG F  2 22 ? -13.108 15.309  58.548 1.00 20.19 ? 22   ARG F HB2  1 
ATOM   2284 H  HB3  . ARG F  2 22 ? -14.771 15.880  58.722 1.00 20.01 ? 22   ARG F HB3  1 
ATOM   2285 H  HG2  . ARG F  2 22 ? -14.125 17.715  60.019 1.00 19.61 ? 22   ARG F HG2  1 
ATOM   2286 H  HG3  . ARG F  2 22 ? -12.450 17.154  60.171 1.00 19.51 ? 22   ARG F HG3  1 
ATOM   2287 H  HD2  . ARG F  2 22 ? -13.686 17.717  57.473 1.00 18.89 ? 22   ARG F HD2  1 
ATOM   2288 H  HD3  . ARG F  2 22 ? -12.997 19.005  58.417 1.00 19.28 ? 22   ARG F HD3  1 
ATOM   2289 H  HE   . ARG F  2 22 ? -11.122 16.910  58.220 1.00 19.58 ? 22   ARG F HE   1 
ATOM   2290 H  HH11 . ARG F  2 22 ? -12.720 19.238  56.261 1.00 21.25 ? 22   ARG F HH11 1 
ATOM   2291 H  HH12 . ARG F  2 22 ? -11.410 19.451  55.146 1.00 18.92 ? 22   ARG F HH12 1 
ATOM   2292 H  HH21 . ARG F  2 22 ? -9.280  17.368  56.962 1.00 17.52 ? 22   ARG F HH21 1 
ATOM   2293 H  HH22 . ARG F  2 22 ? -9.404  18.341  55.544 1.00 15.00 ? 22   ARG F HH22 1 
ATOM   2294 N  N    . GLY F  2 23 ? -13.827 12.629  59.658 1.00 15.73 ? 23   GLY F N    1 
ATOM   2295 C  CA   . GLY F  2 23 ? -14.277 11.401  59.012 1.00 15.27 ? 23   GLY F CA   1 
ATOM   2296 C  C    . GLY F  2 23 ? -14.462 11.673  57.511 1.00 12.83 ? 23   GLY F C    1 
ATOM   2297 O  O    . GLY F  2 23 ? -14.262 12.784  57.015 1.00 12.92 ? 23   GLY F O    1 
ATOM   2298 H  H    . GLY F  2 23 ? -12.911 12.707  60.008 1.00 15.51 ? 23   GLY F H    1 
ATOM   2299 H  HA2  . GLY F  2 23 ? -13.534 10.634  59.160 1.00 13.39 ? 23   GLY F HA2  1 
ATOM   2300 H  HA3  . GLY F  2 23 ? -15.209 11.064  59.431 1.00 14.29 ? 23   GLY F HA3  1 
ATOM   2301 N  N    . PHE F  2 24 ? -14.933 10.664  56.794 1.00 11.84 ? 24   PHE F N    1 
ATOM   2302 C  CA   . PHE F  2 24 ? -15.079 10.770  55.346 1.00 10.22 ? 24   PHE F CA   1 
ATOM   2303 C  C    . PHE F  2 24 ? -16.112 9.789   54.871 1.00 11.19 ? 24   PHE F C    1 
ATOM   2304 O  O    . PHE F  2 24 ? -16.639 8.969   55.638 1.00 11.23 ? 24   PHE F O    1 
ATOM   2305 C  CB   . PHE F  2 24 ? -13.716 10.485  54.649 1.00 10.55 ? 24   PHE F CB   1 
ATOM   2306 C  CG   . PHE F  2 24 ? -13.155 9.109   54.900 1.00 9.11  ? 24   PHE F CG   1 
ATOM   2307 C  CD1  . PHE F  2 24 ? -13.551 8.039   54.117 1.00 11.07 ? 24   PHE F CD1  1 
ATOM   2308 C  CD2  . PHE F  2 24 ? -12.204 8.904   55.893 1.00 9.41  ? 24   PHE F CD2  1 
ATOM   2309 C  CE1  . PHE F  2 24 ? -13.012 6.766   54.312 1.00 11.06 ? 24   PHE F CE1  1 
ATOM   2310 C  CE2  . PHE F  2 24 ? -11.660 7.629   56.090 1.00 11.60 ? 24   PHE F CE2  1 
ATOM   2311 C  CZ   . PHE F  2 24 ? -12.068 6.565   55.300 1.00 11.47 ? 24   PHE F CZ   1 
ATOM   2312 H  H    . PHE F  2 24 ? -15.303 9.847   57.191 1.00 10.86 ? 24   PHE F H    1 
ATOM   2313 H  HA   . PHE F  2 24 ? -15.365 11.787  55.128 1.00 9.08  ? 24   PHE F HA   1 
ATOM   2314 H  HB2  . PHE F  2 24 ? -13.874 10.740  53.618 1.00 11.18 ? 24   PHE F HB2  1 
ATOM   2315 H  HB3  . PHE F  2 24 ? -13.084 11.256  55.038 1.00 10.39 ? 24   PHE F HB3  1 
ATOM   2316 H  HD1  . PHE F  2 24 ? -14.284 8.165   53.340 1.00 8.91  ? 24   PHE F HD1  1 
ATOM   2317 H  HD2  . PHE F  2 24 ? -11.876 9.730   56.516 1.00 7.29  ? 24   PHE F HD2  1 
ATOM   2318 H  HE1  . PHE F  2 24 ? -13.322 5.946   53.700 1.00 9.48  ? 24   PHE F HE1  1 
ATOM   2319 H  HE2  . PHE F  2 24 ? -10.922 7.478   56.868 1.00 11.46 ? 24   PHE F HE2  1 
ATOM   2320 H  HZ   . PHE F  2 24 ? -11.669 5.569   55.429 1.00 11.14 ? 24   PHE F HZ   1 
ATOM   2321 N  N    . PHE F  2 25 ? -16.395 9.865   53.583 1.00 10.88 ? 25   PHE F N    1 
ATOM   2322 C  CA   . PHE F  2 25 ? -17.294 8.913   52.941 1.00 10.75 ? 25   PHE F CA   1 
ATOM   2323 C  C    . PHE F  2 25 ? -16.554 8.442   51.672 1.00 11.15 ? 25   PHE F C    1 
ATOM   2324 O  O    . PHE F  2 25 ? -16.027 9.248   50.880 1.00 11.87 ? 25   PHE F O    1 
ATOM   2325 C  CB   . PHE F  2 25 ? -18.695 9.513   52.640 1.00 12.03 ? 25   PHE F CB   1 
ATOM   2326 C  CG   . PHE F  2 25 ? -18.669 10.753  51.808 1.00 12.36 ? 25   PHE F CG   1 
ATOM   2327 C  CD1  . PHE F  2 25 ? -18.468 11.984  52.390 1.00 12.72 ? 25   PHE F CD1  1 
ATOM   2328 C  CD2  . PHE F  2 25 ? -18.918 10.685  50.439 1.00 12.57 ? 25   PHE F CD2  1 
ATOM   2329 C  CE1  . PHE F  2 25 ? -18.515 13.147  51.618 1.00 13.56 ? 25   PHE F CE1  1 
ATOM   2330 C  CE2  . PHE F  2 25 ? -18.964 11.847  49.661 1.00 16.62 ? 25   PHE F CE2  1 
ATOM   2331 C  CZ   . PHE F  2 25 ? -18.764 13.049  50.247 1.00 14.58 ? 25   PHE F CZ   1 
ATOM   2332 H  H    . PHE F  2 25 ? -15.972 10.577  53.073 1.00 12.20 ? 25   PHE F H    1 
ATOM   2333 H  HA   . PHE F  2 25 ? -17.376 8.020   53.559 1.00 12.41 ? 25   PHE F HA   1 
ATOM   2334 H  HB2  . PHE F  2 25 ? -19.182 8.666   52.196 1.00 11.36 ? 25   PHE F HB2  1 
ATOM   2335 H  HB3  . PHE F  2 25 ? -19.149 9.654   53.606 1.00 11.03 ? 25   PHE F HB3  1 
ATOM   2336 H  HD1  . PHE F  2 25 ? -18.277 12.043  53.452 1.00 14.76 ? 25   PHE F HD1  1 
ATOM   2337 H  HD2  . PHE F  2 25 ? -19.077 9.737   49.946 1.00 9.31  ? 25   PHE F HD2  1 
ATOM   2338 H  HE1  . PHE F  2 25 ? -18.363 14.125  52.040 1.00 13.51 ? 25   PHE F HE1  1 
ATOM   2339 H  HE2  . PHE F  2 25 ? -19.159 11.740  48.609 1.00 16.86 ? 25   PHE F HE2  1 
ATOM   2340 H  HZ   . PHE F  2 25 ? -18.795 13.970  49.674 1.00 16.62 ? 25   PHE F HZ   1 
ATOM   2341 N  N    . TYR F  2 26 ? -16.443 7.120   51.532 1.00 11.43 ? 26   TYR F N    1 
ATOM   2342 C  CA   . TYR F  2 26 ? -15.835 6.490   50.352 1.00 10.31 ? 26   TYR F CA   1 
ATOM   2343 C  C    . TYR F  2 26 ? -16.979 5.818   49.619 1.00 11.70 ? 26   TYR F C    1 
ATOM   2344 O  O    . TYR F  2 26 ? -17.463 4.747   50.000 1.00 12.47 ? 26   TYR F O    1 
ATOM   2345 C  CB   . TYR F  2 26 ? -14.762 5.467   50.767 1.00 11.89 ? 26   TYR F CB   1 
ATOM   2346 C  CG   . TYR F  2 26 ? -14.151 4.793   49.574 1.00 11.76 ? 26   TYR F CG   1 
ATOM   2347 C  CD1  . TYR F  2 26 ? -13.378 5.525   48.676 1.00 11.58 ? 26   TYR F CD1  1 
ATOM   2348 C  CD2  . TYR F  2 26 ? -14.375 3.443   49.303 1.00 12.42 ? 26   TYR F CD2  1 
ATOM   2349 C  CE1  . TYR F  2 26 ? -12.857 4.930   47.536 1.00 12.55 ? 26   TYR F CE1  1 
ATOM   2350 C  CE2  . TYR F  2 26 ? -13.861 2.850   48.195 1.00 14.23 ? 26   TYR F CE2  1 
ATOM   2351 C  CZ   . TYR F  2 26 ? -13.101 3.592   47.308 1.00 15.14 ? 26   TYR F CZ   1 
ATOM   2352 O  OH   . TYR F  2 26 ? -12.601 2.983   46.175 1.00 16.78 ? 26   TYR F OH   1 
ATOM   2353 H  H    . TYR F  2 26 ? -16.827 6.566   52.236 1.00 12.44 ? 26   TYR F H    1 
ATOM   2354 H  HA   . TYR F  2 26 ? -15.429 7.248   49.717 1.00 11.95 ? 26   TYR F HA   1 
ATOM   2355 H  HB2  . TYR F  2 26 ? -14.053 5.978   51.385 1.00 11.28 ? 26   TYR F HB2  1 
ATOM   2356 H  HB3  . TYR F  2 26 ? -15.248 4.730   51.394 1.00 12.24 ? 26   TYR F HB3  1 
ATOM   2357 H  HD1  . TYR F  2 26 ? -13.190 6.568   48.861 1.00 11.98 ? 26   TYR F HD1  1 
ATOM   2358 H  HD2  . TYR F  2 26 ? -14.977 2.859   49.999 1.00 12.60 ? 26   TYR F HD2  1 
ATOM   2359 H  HE1  . TYR F  2 26 ? -12.260 5.488   46.840 1.00 13.97 ? 26   TYR F HE1  1 
ATOM   2360 H  HE2  . TYR F  2 26 ? -14.026 1.800   47.971 1.00 14.06 ? 26   TYR F HE2  1 
ATOM   2361 H  HH   . TYR F  2 26 ? -11.969 3.577   45.761 1.00 16.84 ? 26   TYR F HH   1 
ATOM   2362 N  N    . THR F  2 27 ? -17.448 6.483   48.577 1.00 12.51 ? 27   THR F N    1 
ATOM   2363 C  CA   . THR F  2 27 ? -18.608 6.020   47.849 1.00 13.47 ? 27   THR F CA   1 
ATOM   2364 C  C    . THR F  2 27 ? -18.289 6.070   46.386 1.00 14.84 ? 27   THR F C    1 
ATOM   2365 O  O    . THR F  2 27 ? -18.703 6.974   45.666 1.00 15.30 ? 27   THR F O    1 
ATOM   2366 C  CB   . THR F  2 27 ? -19.837 6.875   48.191 1.00 13.62 ? 27   THR F CB   1 
ATOM   2367 O  OG1  . THR F  2 27 ? -19.602 8.233   47.818 1.00 15.94 ? 27   THR F OG1  1 
ATOM   2368 C  CG2  . THR F  2 27 ? -20.093 6.840   49.684 1.00 14.64 ? 27   THR F CG2  1 
ATOM   2369 H  H    . THR F  2 27 ? -17.014 7.306   48.294 1.00 10.60 ? 27   THR F H    1 
ATOM   2370 H  HA   . THR F  2 27 ? -18.821 4.990   48.107 1.00 13.89 ? 27   THR F HA   1 
ATOM   2371 H  HB   . THR F  2 27 ? -20.697 6.455   47.685 1.00 15.22 ? 27   THR F HB   1 
ATOM   2372 H  HG1  . THR F  2 27 ? -20.372 8.744   48.054 1.00 16.15 ? 27   THR F HG1  1 
ATOM   2373 H  HG21 . THR F  2 27 ? -19.200 7.156   50.199 1.00 15.13 ? 27   THR F HG21 1 
ATOM   2374 H  HG22 . THR F  2 27 ? -20.932 7.489   49.916 1.00 14.20 ? 27   THR F HG22 1 
ATOM   2375 H  HG23 . THR F  2 27 ? -20.342 5.829   49.994 1.00 14.23 ? 27   THR F HG23 1 
ATOM   2376 N  N    . PRO F  2 28 ? -17.510 5.102   45.922 1.00 13.94 ? 28   PRO F N    1 
ATOM   2377 C  CA   . PRO F  2 28 ? -17.124 5.038   44.506 1.00 15.26 ? 28   PRO F CA   1 
ATOM   2378 C  C    . PRO F  2 28 ? -18.325 4.788   43.606 1.00 16.98 ? 28   PRO F C    1 
ATOM   2379 O  O    . PRO F  2 28 ? -19.204 4.017   43.941 1.00 16.51 ? 28   PRO F O    1 
ATOM   2380 C  CB   . PRO F  2 28 ? -16.132 3.884   44.473 1.00 17.63 ? 28   PRO F CB   1 
ATOM   2381 C  CG   . PRO F  2 28 ? -16.622 2.988   45.631 1.00 17.38 ? 28   PRO F CG   1 
ATOM   2382 C  CD   . PRO F  2 28 ? -16.918 3.999   46.701 1.00 16.37 ? 28   PRO F CD   1 
ATOM   2383 H  HA   . PRO F  2 28 ? -16.647 5.948   44.208 1.00 15.81 ? 28   PRO F HA   1 
ATOM   2384 H  HB2  . PRO F  2 28 ? -16.172 3.385   43.522 1.00 18.11 ? 28   PRO F HB2  1 
ATOM   2385 H  HB3  . PRO F  2 28 ? -15.134 4.224   44.668 1.00 18.15 ? 28   PRO F HB3  1 
ATOM   2386 H  HG2  . PRO F  2 28 ? -17.514 2.449   45.346 1.00 18.70 ? 28   PRO F HG2  1 
ATOM   2387 H  HG3  . PRO F  2 28 ? -15.866 2.287   45.969 1.00 18.65 ? 28   PRO F HG3  1 
ATOM   2388 H  HD2  . PRO F  2 28 ? -17.551 3.574   47.432 1.00 14.98 ? 28   PRO F HD2  1 
ATOM   2389 H  HD3  . PRO F  2 28 ? -15.995 4.320   47.166 1.00 15.23 ? 28   PRO F HD3  1 
ATOM   2390 N  N    . LYS F  2 29 ? -18.319 5.440   42.450 1.00 18.20 ? 29   LYS F N    1 
ATOM   2391 C  CA   . LYS F  2 29 ? -19.395 5.316   41.474 1.00 17.87 ? 29   LYS F CA   1 
ATOM   2392 C  C    . LYS F  2 29 ? -18.825 4.810   40.149 1.00 21.66 ? 29   LYS F C    1 
ATOM   2393 O  O    . LYS F  2 29 ? -19.550 4.696   39.168 1.00 26.71 ? 29   LYS F O    1 
ATOM   2394 C  CB   . LYS F  2 29 ? -20.062 6.678   41.265 1.00 22.81 ? 29   LYS F CB   1 
ATOM   2395 C  CG   . LYS F  2 29 ? -20.422 7.402   42.566 1.00 22.56 ? 29   LYS F CG   1 
ATOM   2396 C  CD   . LYS F  2 29 ? -21.313 6.591   43.504 1.00 25.54 ? 29   LYS F CD   1 
ATOM   2397 C  CE   . LYS F  2 29 ? -22.625 6.174   42.848 1.00 25.72 ? 29   LYS F CE   1 
ATOM   2398 N  NZ   . LYS F  2 29 ? -23.443 5.368   43.815 1.00 26.13 ? 29   LYS F NZ   1 
ATOM   2399 H  H    . LYS F  2 29 ? -17.547 5.998   42.242 1.00 18.89 ? 29   LYS F H    1 
ATOM   2400 H  HA   . LYS F  2 29 ? -20.135 4.613   41.812 1.00 20.06 ? 29   LYS F HA   1 
ATOM   2401 H  HB2  . LYS F  2 29 ? -19.365 7.316   40.738 1.00 20.73 ? 29   LYS F HB2  1 
ATOM   2402 H  HB3  . LYS F  2 29 ? -20.962 6.584   40.674 1.00 21.38 ? 29   LYS F HB3  1 
ATOM   2403 H  HG2  . LYS F  2 29 ? -19.512 7.660   43.086 1.00 23.86 ? 29   LYS F HG2  1 
ATOM   2404 H  HG3  . LYS F  2 29 ? -20.915 8.318   42.304 1.00 24.77 ? 29   LYS F HG3  1 
ATOM   2405 H  HD2  . LYS F  2 29 ? -20.815 5.717   43.892 1.00 24.08 ? 29   LYS F HD2  1 
ATOM   2406 H  HD3  . LYS F  2 29 ? -21.560 7.224   44.345 1.00 24.65 ? 29   LYS F HD3  1 
ATOM   2407 H  HE2  . LYS F  2 29 ? -23.157 7.072   42.562 1.00 26.71 ? 29   LYS F HE2  1 
ATOM   2408 H  HE3  . LYS F  2 29 ? -22.440 5.590   41.963 1.00 25.67 ? 29   LYS F HE3  1 
ATOM   2409 H  HZ1  . LYS F  2 29 ? -22.906 4.521   44.098 1.00 26.03 ? 29   LYS F HZ1  1 
ATOM   2410 H  HZ2  . LYS F  2 29 ? -23.608 5.962   44.653 1.00 25.28 ? 29   LYS F HZ2  1 
ATOM   2411 H  HZ3  . LYS F  2 29 ? -24.336 5.049   43.396 1.00 25.17 ? 29   LYS F HZ3  1 
ATOM   2412 N  N    . THR F  2 30 ? -17.515 4.556   40.118 1.00 22.49 ? 30   THR F N    1 
ATOM   2413 C  CA   . THR F  2 30 ? -16.825 4.030   38.931 1.00 26.06 ? 30   THR F CA   1 
ATOM   2414 C  C    . THR F  2 30 ? -15.721 3.096   39.424 1.00 26.79 ? 30   THR F C    1 
ATOM   2415 O  O    . THR F  2 30 ? -15.239 2.261   38.627 1.00 32.48 ? 30   THR F O    1 
ATOM   2416 C  CB   . THR F  2 30 ? -16.170 5.147   38.065 1.00 24.32 ? 30   THR F CB   1 
ATOM   2417 O  OG1  . THR F  2 30 ? -15.208 5.865   38.841 1.00 26.48 ? 30   THR F OG1  1 
ATOM   2418 C  CG2  . THR F  2 30 ? -17.212 6.119   37.532 1.00 25.30 ? 30   THR F CG2  1 
ATOM   2419 O  OXT  . THR F  2 30 ? -15.352 3.219   40.608 1.00 25.93 ? 30   THR F OXT  1 
ATOM   2420 H  H    . THR F  2 30 ? -16.980 4.745   40.912 1.00 24.17 ? 30   THR F H    1 
ATOM   2421 H  HA   . THR F  2 30 ? -17.525 3.458   38.333 1.00 24.89 ? 30   THR F HA   1 
ATOM   2422 H  HB   . THR F  2 30 ? -15.667 4.664   37.231 1.00 25.25 ? 30   THR F HB   1 
ATOM   2423 H  HG1  . THR F  2 30 ? -15.658 6.234   39.596 1.00 26.21 ? 30   THR F HG1  1 
ATOM   2424 H  HG21 . THR F  2 30 ? -17.969 5.566   36.999 1.00 25.20 ? 30   THR F HG21 1 
ATOM   2425 H  HG22 . THR F  2 30 ? -17.645 6.676   38.358 1.00 25.03 ? 30   THR F HG22 1 
ATOM   2426 H  HG23 . THR F  2 30 ? -16.736 6.813   36.853 1.00 25.30 ? 30   THR F HG23 1 
ATOM   2427 N  N    . GLY G  1 1  ? -18.971 4.311   68.944 1.00 28.16 ? 1    GLY G N    1 
ATOM   2428 C  CA   . GLY G  1 1  ? -18.713 4.374   67.480 1.00 26.62 ? 1    GLY G CA   1 
ATOM   2429 C  C    . GLY G  1 1  ? -17.832 3.225   67.032 1.00 23.82 ? 1    GLY G C    1 
ATOM   2430 O  O    . GLY G  1 1  ? -17.374 2.425   67.853 1.00 23.33 ? 1    GLY G O    1 
ATOM   2431 H  H1   . GLY G  1 1  ? -18.058 4.333   69.439 1.00 26.73 ? 1    GLY G H1   1 
ATOM   2432 H  H2   . GLY G  1 1  ? -19.584 5.091   69.265 1.00 27.45 ? 1    GLY G H2   1 
ATOM   2433 H  H3   . GLY G  1 1  ? -19.451 3.414   69.156 1.00 27.36 ? 1    GLY G H3   1 
ATOM   2434 H  HA2  . GLY G  1 1  ? -19.668 4.312   66.967 1.00 26.92 ? 1    GLY G HA2  1 
ATOM   2435 H  HA3  . GLY G  1 1  ? -18.246 5.320   67.247 1.00 26.77 ? 1    GLY G HA3  1 
ATOM   2436 N  N    . ILE G  1 2  ? -17.553 3.157   65.731 1.00 25.28 ? 2    ILE G N    1 
ATOM   2437 C  CA   . ILE G  1 2  ? -16.736 2.080   65.187 1.00 23.30 ? 2    ILE G CA   1 
ATOM   2438 C  C    . ILE G  1 2  ? -15.361 1.995   65.843 1.00 19.06 ? 2    ILE G C    1 
ATOM   2439 O  O    . ILE G  1 2  ? -14.821 0.916   65.985 1.00 21.33 ? 2    ILE G O    1 
ATOM   2440 C  CB   . ILE G  1 2  ? -16.617 2.221   63.620 1.00 20.27 ? 2    ILE G CB   1 
ATOM   2441 C  CG1  . ILE G  1 2  ? -16.057 0.930   62.989 1.00 22.43 ? 2    ILE G CG1  1 
ATOM   2442 C  CG2  . ILE G  1 2  ? -15.786 3.434   63.262 1.00 21.14 ? 2    ILE G CG2  1 
ATOM   2443 C  CD1  . ILE G  1 2  ? -15.959 0.996   61.436 1.00 22.96 ? 2    ILE G CD1  1 
ATOM   2444 H  H    . ILE G  1 2  ? -17.865 3.889   65.167 1.00 24.98 ? 2    ILE G H    1 
ATOM   2445 H  HA   . ILE G  1 2  ? -17.278 1.167   65.391 1.00 22.95 ? 2    ILE G HA   1 
ATOM   2446 H  HB   . ILE G  1 2  ? -17.621 2.390   63.240 1.00 21.68 ? 2    ILE G HB   1 
ATOM   2447 H  HG12 . ILE G  1 2  ? -15.069 0.708   63.368 1.00 21.79 ? 2    ILE G HG12 1 
ATOM   2448 H  HG13 . ILE G  1 2  ? -16.716 0.112   63.233 1.00 22.06 ? 2    ILE G HG13 1 
ATOM   2449 H  HG21 . ILE G  1 2  ? -16.066 4.285   63.874 1.00 20.90 ? 2    ILE G HG21 1 
ATOM   2450 H  HG22 . ILE G  1 2  ? -14.741 3.188   63.397 1.00 21.12 ? 2    ILE G HG22 1 
ATOM   2451 H  HG23 . ILE G  1 2  ? -15.961 3.676   62.222 1.00 21.98 ? 2    ILE G HG23 1 
ATOM   2452 H  HD11 . ILE G  1 2  ? -16.798 1.535   61.022 1.00 22.63 ? 2    ILE G HD11 1 
ATOM   2453 H  HD12 . ILE G  1 2  ? -15.936 0.000   61.031 1.00 22.35 ? 2    ILE G HD12 1 
ATOM   2454 H  HD13 . ILE G  1 2  ? -15.041 1.500   61.172 1.00 22.83 ? 2    ILE G HD13 1 
ATOM   2455 N  N    . VAL G  1 3  ? -14.780 3.127   66.225 1.00 23.58 ? 3    VAL G N    1 
ATOM   2456 C  CA   . VAL G  1 3  ? -13.468 3.102   66.856 1.00 22.96 ? 3    VAL G CA   1 
ATOM   2457 C  C    . VAL G  1 3  ? -13.475 2.385   68.215 1.00 24.03 ? 3    VAL G C    1 
ATOM   2458 O  O    . VAL G  1 3  ? -12.581 1.593   68.533 1.00 25.90 ? 3    VAL G O    1 
ATOM   2459 C  CB   . VAL G  1 3  ? -12.904 4.531   67.020 1.00 22.96 ? 3    VAL G CB   1 
ATOM   2460 C  CG1  . VAL G  1 3  ? -11.519 4.471   67.632 1.00 22.02 ? 3    VAL G CG1  1 
ATOM   2461 C  CG2  . VAL G  1 3  ? -12.854 5.222   65.654 1.00 24.00 ? 3    VAL G CG2  1 
ATOM   2462 H  H    . VAL G  1 3  ? -15.257 3.968   66.103 1.00 22.44 ? 3    VAL G H    1 
ATOM   2463 H  HA   . VAL G  1 3  ? -12.798 2.546   66.223 1.00 22.49 ? 3    VAL G HA   1 
ATOM   2464 H  HB   . VAL G  1 3  ? -13.530 5.122   67.675 1.00 23.21 ? 3    VAL G HB   1 
ATOM   2465 H  HG11 . VAL G  1 3  ? -10.944 3.680   67.176 1.00 21.75 ? 3    VAL G HG11 1 
ATOM   2466 H  HG12 . VAL G  1 3  ? -11.016 5.426   67.486 1.00 21.30 ? 3    VAL G HG12 1 
ATOM   2467 H  HG13 . VAL G  1 3  ? -11.600 4.274   68.692 1.00 22.80 ? 3    VAL G HG13 1 
ATOM   2468 H  HG21 . VAL G  1 3  ? -12.854 6.293   65.765 1.00 23.38 ? 3    VAL G HG21 1 
ATOM   2469 H  HG22 . VAL G  1 3  ? -11.968 4.912   65.126 1.00 23.99 ? 3    VAL G HG22 1 
ATOM   2470 H  HG23 . VAL G  1 3  ? -13.729 4.935   65.079 1.00 23.70 ? 3    VAL G HG23 1 
ATOM   2471 N  N    . GLU G  1 4  ? -14.493 2.640   69.015 1.00 23.03 ? 4    GLU G N    1 
ATOM   2472 C  CA   . GLU G  1 4  ? -14.566 1.970   70.306 1.00 26.45 ? 4    GLU G CA   1 
ATOM   2473 C  C    . GLU G  1 4  ? -14.907 0.494   70.118 1.00 27.32 ? 4    GLU G C    1 
ATOM   2474 O  O    . GLU G  1 4  ? -14.395 -0.377  70.821 1.00 30.02 ? 4    GLU G O    1 
ATOM   2475 C  CB   . GLU G  1 4  ? -15.600 2.660   71.192 1.00 28.16 ? 4    GLU G CB   1 
ATOM   2476 C  CG   . GLU G  1 4  ? -15.193 4.064   71.616 1.00 27.40 ? 4    GLU G CG   1 
ATOM   2477 C  CD   . GLU G  1 4  ? -15.297 5.104   70.507 1.00 26.69 ? 4    GLU G CD   1 
ATOM   2478 O  OE1  . GLU G  1 4  ? -16.247 5.040   69.697 1.00 29.23 ? 4    GLU G OE1  1 
ATOM   2479 O  OE2  . GLU G  1 4  ? -14.432 6.017   70.466 1.00 27.84 ? 4    GLU G OE2  1 
ATOM   2480 H  H    . GLU G  1 4  ? -15.166 3.301   68.760 1.00 24.31 ? 4    GLU G H    1 
ATOM   2481 H  HA   . GLU G  1 4  ? -13.603 2.037   70.779 1.00 26.84 ? 4    GLU G HA   1 
ATOM   2482 H  HB2  . GLU G  1 4  ? -16.569 2.710   70.709 1.00 27.75 ? 4    GLU G HB2  1 
ATOM   2483 H  HB3  . GLU G  1 4  ? -15.672 2.053   72.079 1.00 27.87 ? 4    GLU G HB3  1 
ATOM   2484 H  HG2  . GLU G  1 4  ? -15.684 4.381   72.469 1.00 27.23 ? 4    GLU G HG2  1 
ATOM   2485 H  HG3  . GLU G  1 4  ? -14.143 3.995   71.872 1.00 27.01 ? 4    GLU G HG3  1 
ATOM   2486 N  N    . GLN G  1 5  ? -15.747 0.211   69.136 1.00 26.75 ? 5    GLN G N    1 
ATOM   2487 C  CA   . GLN G  1 5  ? -16.146 -1.157  68.840 1.00 28.42 ? 5    GLN G CA   1 
ATOM   2488 C  C    . GLN G  1 5  ? -15.055 -1.997  68.195 1.00 26.89 ? 5    GLN G C    1 
ATOM   2489 O  O    . GLN G  1 5  ? -14.993 -3.211  68.404 1.00 31.58 ? 5    GLN G O    1 
ATOM   2490 C  CB   . GLN G  1 5  ? -17.338 -1.172  67.884 1.00 28.91 ? 5    GLN G CB   1 
ATOM   2491 C  CG   . GLN G  1 5  ? -18.648 -0.724  68.504 1.00 29.41 ? 5    GLN G CG   1 
ATOM   2492 C  CD   . GLN G  1 5  ? -19.118 -1.671  69.590 1.00 33.62 ? 5    GLN G CD   1 
ATOM   2493 O  OE1  . GLN G  1 5  ? -19.730 -1.246  70.569 1.00 38.08 ? 5    GLN G OE1  1 
ATOM   2494 N  NE2  . GLN G  1 5  ? -18.848 -2.965  69.415 1.00 34.13 ? 5    GLN G NE2  1 
ATOM   2495 H  H    . GLN G  1 5  ? -16.105 0.960   68.618 1.00 26.94 ? 5    GLN G H    1 
ATOM   2496 H  HA   . GLN G  1 5  ? -16.471 -1.631  69.756 1.00 27.97 ? 5    GLN G HA   1 
ATOM   2497 H  HB2  . GLN G  1 5  ? -17.117 -0.532  67.046 1.00 28.78 ? 5    GLN G HB2  1 
ATOM   2498 H  HB3  . GLN G  1 5  ? -17.455 -2.175  67.509 1.00 27.52 ? 5    GLN G HB3  1 
ATOM   2499 H  HG2  . GLN G  1 5  ? -18.510 0.258   68.912 1.00 29.40 ? 5    GLN G HG2  1 
ATOM   2500 H  HG3  . GLN G  1 5  ? -19.408 -0.668  67.726 1.00 29.54 ? 5    GLN G HG3  1 
ATOM   2501 H  HE21 . GLN G  1 5  ? -18.372 -3.223  68.598 1.00 32.19 ? 5    GLN G HE21 1 
ATOM   2502 H  HE22 . GLN G  1 5  ? -19.123 -3.617  70.086 1.00 31.42 ? 5    GLN G HE22 1 
ATOM   2503 N  N    . CYS G  1 6  ? -14.197 -1.360  67.401 1.00 24.53 ? 6    CYS G N    1 
ATOM   2504 C  CA   . CYS G  1 6  ? -13.192 -2.110  66.670 1.00 22.44 ? 6    CYS G CA   1 
ATOM   2505 C  C    . CYS G  1 6  ? -11.726 -1.843  66.976 1.00 18.35 ? 6    CYS G C    1 
ATOM   2506 O  O    . CYS G  1 6  ? -10.889 -2.622  66.537 1.00 18.80 ? 6    CYS G O    1 
ATOM   2507 C  CB   . CYS G  1 6  ? -13.477 -1.958  65.169 1.00 18.81 ? 6    CYS G CB   1 
ATOM   2508 S  SG   . CYS G  1 6  ? -15.149 -2.527  64.742 1.00 24.78 ? 6    CYS G SG   1 
ATOM   2509 H  H    . CYS G  1 6  ? -14.226 -0.384  67.361 1.00 24.03 ? 6    CYS G H    1 
ATOM   2510 H  HA   . CYS G  1 6  ? -13.294 -3.157  66.863 1.00 21.59 ? 6    CYS G HA   1 
ATOM   2511 H  HB2  . CYS G  1 6  ? -13.349 -0.928  64.865 1.00 23.12 ? 6    CYS G HB2  1 
ATOM   2512 H  HB3  . CYS G  1 6  ? -12.777 -2.575  64.631 1.00 21.49 ? 6    CYS G HB3  1 
ATOM   2513 N  N    . CYS G  1 7  ? -11.435 -0.780  67.720 1.00 20.87 ? 7    CYS G N    1 
ATOM   2514 C  CA   . CYS G  1 7  ? -10.069 -0.489  68.134 1.00 23.07 ? 7    CYS G CA   1 
ATOM   2515 C  C    . CYS G  1 7  ? -9.874  -0.943  69.564 1.00 23.31 ? 7    CYS G C    1 
ATOM   2516 O  O    . CYS G  1 7  ? -8.829  -1.483  69.891 1.00 27.86 ? 7    CYS G O    1 
ATOM   2517 C  CB   . CYS G  1 7  ? -9.734  1.000   67.990 1.00 23.30 ? 7    CYS G CB   1 
ATOM   2518 S  SG   . CYS G  1 7  ? -9.683  1.339   66.246 1.00 30.06 ? 7    CYS G SG   1 
ATOM   2519 H  H    . CYS G  1 7  ? -12.156 -0.204  68.018 1.00 20.98 ? 7    CYS G H    1 
ATOM   2520 H  HA   . CYS G  1 7  ? -9.413  -1.068  67.516 1.00 23.14 ? 7    CYS G HA   1 
ATOM   2521 H  HB2  . CYS G  1 7  ? -10.471 1.650   68.408 1.00 26.53 ? 7    CYS G HB2  1 
ATOM   2522 H  HB3  . CYS G  1 7  ? -8.765  1.287   68.341 1.00 24.85 ? 7    CYS G HB3  1 
ATOM   2523 N  N    . THR G  1 8  ? -10.881 -0.741  70.414 1.00 22.26 ? 8    THR G N    1 
ATOM   2524 C  CA   . THR G  1 8  ? -10.770 -1.179  71.815 1.00 26.63 ? 8    THR G CA   1 
ATOM   2525 C  C    . THR G  1 8  ? -10.919 -2.702  71.963 1.00 28.42 ? 8    THR G C    1 
ATOM   2526 O  O    . THR G  1 8  ? -10.386 -3.284  72.908 1.00 30.28 ? 8    THR G O    1 
ATOM   2527 C  CB   . THR G  1 8  ? -11.783 -0.452  72.721 1.00 27.35 ? 8    THR G CB   1 
ATOM   2528 O  OG1  . THR G  1 8  ? -13.087 -0.992  72.519 1.00 32.68 ? 8    THR G OG1  1 
ATOM   2529 C  CG2  . THR G  1 8  ? -11.790 1.029   72.402 1.00 29.89 ? 8    THR G CG2  1 
ATOM   2530 H  H    . THR G  1 8  ? -11.666 -0.274  70.064 1.00 22.56 ? 8    THR G H    1 
ATOM   2531 H  HA   . THR G  1 8  ? -9.771  -0.910  72.138 1.00 24.80 ? 8    THR G HA   1 
ATOM   2532 H  HB   . THR G  1 8  ? -11.482 -0.587  73.752 1.00 27.42 ? 8    THR G HB   1 
ATOM   2533 H  HG1  . THR G  1 8  ? -13.058 -1.939  72.684 1.00 27.58 ? 8    THR G HG1  1 
ATOM   2534 H  HG21 . THR G  1 8  ? -11.761 1.203   71.347 1.00 26.74 ? 8    THR G HG21 1 
ATOM   2535 H  HG22 . THR G  1 8  ? -12.676 1.470   72.831 1.00 27.52 ? 8    THR G HG22 1 
ATOM   2536 H  HG23 . THR G  1 8  ? -10.904 1.472   72.857 1.00 26.15 ? 8    THR G HG23 1 
ATOM   2537 N  N    . SER G  1 9  ? -11.657 -3.330  71.043 1.00 29.57 ? 9    SER G N    1 
ATOM   2538 C  CA   . SER G  1 9  ? -11.824 -4.796  70.948 1.00 28.76 ? 9    SER G CA   1 
ATOM   2539 C  C    . SER G  1 9  ? -11.705 -5.044  69.425 1.00 30.76 ? 9    SER G C    1 
ATOM   2540 O  O    . SER G  1 9  ? -11.898 -4.122  68.667 1.00 26.83 ? 9    SER G O    1 
ATOM   2541 C  CB   . SER G  1 9  ? -13.189 -5.253  71.509 1.00 31.20 ? 9    SER G CB   1 
ATOM   2542 O  OG   . SER G  1 9  ? -14.210 -4.289  71.306 1.00 35.04 ? 9    SER G OG   1 
ATOM   2543 H  H    . SER G  1 9  ? -12.153 -2.779  70.399 1.00 27.17 ? 9    SER G H    1 
ATOM   2544 H  HA   . SER G  1 9  ? -10.982 -5.278  71.436 1.00 28.68 ? 9    SER G HA   1 
ATOM   2545 H  HB2  . SER G  1 9  ? -13.423 -6.184  71.019 1.00 28.91 ? 9    SER G HB2  1 
ATOM   2546 H  HB3  . SER G  1 9  ? -13.083 -5.471  72.573 1.00 27.91 ? 9    SER G HB3  1 
ATOM   2547 H  HG   . SER G  1 9  ? -14.415 -4.135  70.381 1.00 29.53 ? 9    SER G HG   1 
ATOM   2548 N  N    A ILE G  1 10 ? -11.385 -6.264  68.993 0.50 27.14 ? 10   ILE G N    1 
ATOM   2549 N  N    B ILE G  1 10 ? -11.387 -6.265  68.993 0.50 27.15 ? 10   ILE G N    1 
ATOM   2550 C  CA   A ILE G  1 10 ? -11.223 -6.547  67.561 0.50 28.70 ? 10   ILE G CA   1 
ATOM   2551 C  CA   B ILE G  1 10 ? -11.229 -6.545  67.561 0.50 28.74 ? 10   ILE G CA   1 
ATOM   2552 C  C    A ILE G  1 10 ? -12.554 -6.766  66.853 0.50 26.64 ? 10   ILE G C    1 
ATOM   2553 C  C    B ILE G  1 10 ? -12.561 -6.753  66.856 0.50 26.70 ? 10   ILE G C    1 
ATOM   2554 O  O    A ILE G  1 10 ? -13.508 -7.255  67.456 0.50 29.43 ? 10   ILE G O    1 
ATOM   2555 O  O    B ILE G  1 10 ? -13.522 -7.221  67.464 0.50 29.47 ? 10   ILE G O    1 
ATOM   2556 C  CB   A ILE G  1 10 ? -10.347 -7.810  67.338 0.50 26.79 ? 10   ILE G CB   1 
ATOM   2557 C  CB   B ILE G  1 10 ? -10.369 -7.817  67.313 0.50 26.86 ? 10   ILE G CB   1 
ATOM   2558 C  CG1  A ILE G  1 10 ? -9.841  -7.867  65.892 0.50 27.65 ? 10   ILE G CG1  1 
ATOM   2559 C  CG1  B ILE G  1 10 ? -9.736  -7.745  65.909 0.50 28.28 ? 10   ILE G CG1  1 
ATOM   2560 C  CG2  A ILE G  1 10 ? -11.155 -9.066  67.670 0.50 25.42 ? 10   ILE G CG2  1 
ATOM   2561 C  CG2  B ILE G  1 10 ? -11.217 -9.077  67.558 0.50 25.70 ? 10   ILE G CG2  1 
ATOM   2562 C  CD1  A ILE G  1 10 ? -8.791  -6.804  65.559 0.50 22.80 ? 10   ILE G CD1  1 
ATOM   2563 C  CD1  B ILE G  1 10 ? -9.771  -9.032  65.061 0.50 26.29 ? 10   ILE G CD1  1 
ATOM   2564 H  H    A ILE G  1 10 ? -11.265 -6.985  69.646 0.50 27.89 ? 10   ILE G H    1 
ATOM   2565 H  H    B ILE G  1 10 ? -11.264 -6.986  69.646 0.50 27.89 ? 10   ILE G H    1 
ATOM   2566 H  HA   A ILE G  1 10 ? -10.724 -5.708  67.105 0.50 26.75 ? 10   ILE G HA   1 
ATOM   2567 H  HA   B ILE G  1 10 ? -10.720 -5.709  67.104 0.50 26.76 ? 10   ILE G HA   1 
ATOM   2568 H  HB   A ILE G  1 10 ? -9.496  -7.757  68.012 0.50 27.06 ? 10   ILE G HB   1 
ATOM   2569 H  HB   B ILE G  1 10 ? -9.583  -7.812  68.065 0.50 27.09 ? 10   ILE G HB   1 
ATOM   2570 H  HG12 A ILE G  1 10 ? -9.406  -8.845  65.723 0.50 25.77 ? 10   ILE G HG12 1 
ATOM   2571 H  HG12 B ILE G  1 10 ? -10.113 -6.909  65.347 0.50 26.10 ? 10   ILE G HG12 1 
ATOM   2572 H  HG13 A ILE G  1 10 ? -10.676 -7.746  65.223 0.50 26.50 ? 10   ILE G HG13 1 
ATOM   2573 H  HG13 B ILE G  1 10 ? -8.690  -7.525  66.120 0.50 26.70 ? 10   ILE G HG13 1 
ATOM   2574 H  HG21 A ILE G  1 10 ? -11.634 -8.978  68.636 0.50 23.49 ? 10   ILE G HG21 1 
ATOM   2575 H  HG21 B ILE G  1 10 ? -11.747 -9.027  68.504 0.50 23.47 ? 10   ILE G HG21 1 
ATOM   2576 H  HG22 A ILE G  1 10 ? -11.908 -9.232  66.907 0.50 25.15 ? 10   ILE G HG22 1 
ATOM   2577 H  HG22 B ILE G  1 10 ? -11.946 -9.179  66.762 0.50 25.17 ? 10   ILE G HG22 1 
ATOM   2578 H  HG23 A ILE G  1 10 ? -10.504 -9.927  67.685 0.50 24.38 ? 10   ILE G HG23 1 
ATOM   2579 H  HG23 B ILE G  1 10 ? -10.599 -9.964  67.556 0.50 24.38 ? 10   ILE G HG23 1 
ATOM   2580 H  HD11 A ILE G  1 10 ? -8.189  -7.136  64.729 0.50 25.02 ? 10   ILE G HD11 1 
ATOM   2581 H  HD11 B ILE G  1 10 ? -9.546  -8.763  64.038 0.50 25.23 ? 10   ILE G HD11 1 
ATOM   2582 H  HD12 A ILE G  1 10 ? -8.158  -6.656  66.421 0.50 24.41 ? 10   ILE G HD12 1 
ATOM   2583 H  HD12 B ILE G  1 10 ? -10.759 -9.476  65.030 0.50 24.90 ? 10   ILE G HD12 1 
ATOM   2584 H  HD13 A ILE G  1 10 ? -9.284  -5.876  65.310 0.50 24.72 ? 10   ILE G HD13 1 
ATOM   2585 H  HD13 B ILE G  1 10 ? -9.035  -9.749  65.390 0.50 25.07 ? 10   ILE G HD13 1 
ATOM   2586 N  N    . CYS G  1 11 ? -12.607 -6.393  65.578 1.00 25.55 ? 11   CYS G N    1 
ATOM   2587 C  CA   . CYS G  1 11 ? -13.818 -6.573  64.777 1.00 24.13 ? 11   CYS G CA   1 
ATOM   2588 C  C    . CYS G  1 11 ? -13.483 -7.553  63.707 1.00 20.42 ? 11   CYS G C    1 
ATOM   2589 O  O    . CYS G  1 11 ? -12.493 -7.378  62.994 1.00 25.52 ? 11   CYS G O    1 
ATOM   2590 C  CB   . CYS G  1 11 ? -14.325 -5.246  64.138 1.00 14.29 ? 11   CYS G CB   1 
ATOM   2591 S  SG   . CYS G  1 11 ? -15.174 -4.387  65.504 1.00 23.87 ? 11   CYS G SG   1 
ATOM   2592 H  H    . CYS G  1 11 ? -11.808 -5.982  65.175 1.00 25.19 ? 11   CYS G H    1 
ATOM   2593 H  HA   . CYS G  1 11 ? -14.599 -7.008  65.388 1.00 20.82 ? 11   CYS G HA   1 
ATOM   2594 H  HB2  . CYS G  1 11 ? -13.513 -4.653  63.781 1.00 20.94 ? 11   CYS G HB2  1 
ATOM   2595 H  HB3  . CYS G  1 11 ? -15.044 -5.412  63.377 1.00 20.57 ? 11   CYS G HB3  1 
ATOM   2596 N  N    . SER G  1 12 ? -14.316 -8.593  63.605 1.00 22.24 ? 12   SER G N    1 
ATOM   2597 C  CA   . SER G  1 12 ? -14.124 -9.562  62.539 1.00 18.94 ? 12   SER G CA   1 
ATOM   2598 C  C    . SER G  1 12 ? -14.501 -8.823  61.261 1.00 16.45 ? 12   SER G C    1 
ATOM   2599 O  O    . SER G  1 12 ? -15.216 -7.819  61.300 1.00 15.56 ? 12   SER G O    1 
ATOM   2600 C  CB   . SER G  1 12 ? -15.062 -10.766 62.693 1.00 19.41 ? 12   SER G CB   1 
ATOM   2601 O  OG   . SER G  1 12 ? -16.399 -10.431 62.387 1.00 19.82 ? 12   SER G OG   1 
ATOM   2602 H  H    . SER G  1 12 ? -15.060 -8.707  64.213 1.00 19.88 ? 12   SER G H    1 
ATOM   2603 H  HA   . SER G  1 12 ? -13.087 -9.875  62.471 1.00 19.53 ? 12   SER G HA   1 
ATOM   2604 H  HB2  . SER G  1 12 ? -14.763 -11.519 61.993 1.00 20.24 ? 12   SER G HB2  1 
ATOM   2605 H  HB3  . SER G  1 12 ? -15.019 -11.135 63.705 1.00 20.78 ? 12   SER G HB3  1 
ATOM   2606 H  HG   . SER G  1 12 ? -16.988 -11.157 62.598 1.00 21.67 ? 12   SER G HG   1 
ATOM   2607 N  N    . LEU G  1 13 ? -14.021 -9.310  60.128 1.00 15.07 ? 13   LEU G N    1 
ATOM   2608 C  CA   . LEU G  1 13 ? -14.371 -8.684  58.858 1.00 14.69 ? 13   LEU G CA   1 
ATOM   2609 C  C    . LEU G  1 13 ? -15.880 -8.764  58.629 1.00 13.34 ? 13   LEU G C    1 
ATOM   2610 O  O    . LEU G  1 13 ? -16.442 -7.914  57.952 1.00 12.16 ? 13   LEU G O    1 
ATOM   2611 C  CB   . LEU G  1 13 ? -13.668 -9.359  57.681 1.00 12.36 ? 13   LEU G CB   1 
ATOM   2612 C  CG   . LEU G  1 13 ? -12.129 -9.252  57.712 1.00 14.68 ? 13   LEU G CG   1 
ATOM   2613 C  CD1  . LEU G  1 13 ? -11.592 -9.793  56.429 1.00 16.17 ? 13   LEU G CD1  1 
ATOM   2614 C  CD2  . LEU G  1 13 ? -11.644 -7.798  57.940 1.00 15.13 ? 13   LEU G CD2  1 
ATOM   2615 H  H    . LEU G  1 13 ? -13.437 -10.092 60.108 1.00 17.42 ? 13   LEU G H    1 
ATOM   2616 H  HA   . LEU G  1 13 ? -14.077 -7.637  58.892 1.00 14.90 ? 13   LEU G HA   1 
ATOM   2617 H  HB2  . LEU G  1 13 ? -13.882 -10.410 57.723 1.00 14.84 ? 13   LEU G HB2  1 
ATOM   2618 H  HB3  . LEU G  1 13 ? -13.985 -8.998  56.709 1.00 12.03 ? 13   LEU G HB3  1 
ATOM   2619 H  HG   . LEU G  1 13 ? -11.794 -9.859  58.529 1.00 16.39 ? 13   LEU G HG   1 
ATOM   2620 H  HD11 . LEU G  1 13 ? -11.900 -10.820 56.288 1.00 16.79 ? 13   LEU G HD11 1 
ATOM   2621 H  HD12 . LEU G  1 13 ? -11.973 -9.196  55.621 1.00 17.51 ? 13   LEU G HD12 1 
ATOM   2622 H  HD13 . LEU G  1 13 ? -10.507 -9.751  56.402 1.00 17.98 ? 13   LEU G HD13 1 
ATOM   2623 H  HD21 . LEU G  1 13 ? -11.919 -7.459  58.916 1.00 13.98 ? 13   LEU G HD21 1 
ATOM   2624 H  HD22 . LEU G  1 13 ? -10.566 -7.756  57.824 1.00 17.61 ? 13   LEU G HD22 1 
ATOM   2625 H  HD23 . LEU G  1 13 ? -12.093 -7.163  57.196 1.00 15.35 ? 13   LEU G HD23 1 
ATOM   2626 N  N    . TYR G  1 14 ? -16.513 -9.837  59.152 1.00 13.04 ? 14   TYR G N    1 
ATOM   2627 C  CA   . TYR G  1 14 ? -17.941 -10.005 59.009 1.00 11.81 ? 14   TYR G CA   1 
ATOM   2628 C  C    . TYR G  1 14 ? -18.700 -8.954  59.827 1.00 11.20 ? 14   TYR G C    1 
ATOM   2629 O  O    . TYR G  1 14 ? -19.706 -8.441  59.384 1.00 12.29 ? 14   TYR G O    1 
ATOM   2630 C  CB   . TYR G  1 14 ? -18.315 -11.438 59.392 1.00 11.66 ? 14   TYR G CB   1 
ATOM   2631 C  CG   . TYR G  1 14 ? -17.817 -12.407 58.350 1.00 11.71 ? 14   TYR G CG   1 
ATOM   2632 C  CD1  . TYR G  1 14 ? -16.533 -12.908 58.391 1.00 12.00 ? 14   TYR G CD1  1 
ATOM   2633 C  CD2  . TYR G  1 14 ? -18.590 -12.723 57.264 1.00 12.34 ? 14   TYR G CD2  1 
ATOM   2634 C  CE1  . TYR G  1 14 ? -16.017 -13.709 57.353 1.00 11.68 ? 14   TYR G CE1  1 
ATOM   2635 C  CE2  . TYR G  1 14 ? -18.109 -13.510 56.252 1.00 13.82 ? 14   TYR G CE2  1 
ATOM   2636 C  CZ   . TYR G  1 14 ? -16.819 -14.002 56.298 1.00 12.76 ? 14   TYR G CZ   1 
ATOM   2637 O  OH   . TYR G  1 14 ? -16.395 -14.836 55.265 1.00 16.60 ? 14   TYR G OH   1 
ATOM   2638 H  H    . TYR G  1 14 ? -16.016 -10.494 59.684 1.00 11.79 ? 14   TYR G H    1 
ATOM   2639 H  HA   . TYR G  1 14 ? -18.184 -9.857  57.975 1.00 8.85  ? 14   TYR G HA   1 
ATOM   2640 H  HB2  . TYR G  1 14 ? -18.030 -11.726 60.383 1.00 10.80 ? 14   TYR G HB2  1 
ATOM   2641 H  HB3  . TYR G  1 14 ? -19.386 -11.463 59.339 1.00 12.04 ? 14   TYR G HB3  1 
ATOM   2642 H  HD1  . TYR G  1 14 ? -15.932 -12.657 59.251 1.00 11.50 ? 14   TYR G HD1  1 
ATOM   2643 H  HD2  . TYR G  1 14 ? -19.589 -12.345 57.227 1.00 12.59 ? 14   TYR G HD2  1 
ATOM   2644 H  HE1  . TYR G  1 14 ? -15.005 -14.097 57.404 1.00 13.01 ? 14   TYR G HE1  1 
ATOM   2645 H  HE2  . TYR G  1 14 ? -18.763 -13.730 55.423 1.00 13.68 ? 14   TYR G HE2  1 
ATOM   2646 H  HH   . TYR G  1 14 ? -17.125 -14.888 54.645 1.00 14.44 ? 14   TYR G HH   1 
ATOM   2647 N  N    . GLN G  1 15 ? -18.210 -8.637  61.017 1.00 14.55 ? 15   GLN G N    1 
ATOM   2648 C  CA   . GLN G  1 15 ? -18.820 -7.563  61.803 1.00 16.00 ? 15   GLN G CA   1 
ATOM   2649 C  C    . GLN G  1 15 ? -18.570 -6.224  61.084 1.00 14.34 ? 15   GLN G C    1 
ATOM   2650 O  O    . GLN G  1 15 ? -19.460 -5.388  60.997 1.00 15.62 ? 15   GLN G O    1 
ATOM   2651 C  CB   . GLN G  1 15 ? -18.218 -7.501  63.195 1.00 18.44 ? 15   GLN G CB   1 
ATOM   2652 C  CG   . GLN G  1 15 ? -18.746 -8.600  64.080 1.00 22.78 ? 15   GLN G CG   1 
ATOM   2653 C  CD   . GLN G  1 15 ? -18.029 -8.683  65.383 1.00 25.71 ? 15   GLN G CD   1 
ATOM   2654 O  OE1  . GLN G  1 15 ? -16.812 -8.535  65.441 1.00 28.47 ? 15   GLN G OE1  1 
ATOM   2655 N  NE2  . GLN G  1 15 ? -18.778 -8.958  66.447 1.00 26.15 ? 15   GLN G NE2  1 
ATOM   2656 H  H    . GLN G  1 15 ? -17.364 -9.045  61.300 1.00 12.24 ? 15   GLN G H    1 
ATOM   2657 H  HA   . GLN G  1 15 ? -19.885 -7.751  61.861 1.00 15.74 ? 15   GLN G HA   1 
ATOM   2658 H  HB2  . GLN G  1 15 ? -17.147 -7.560  63.133 1.00 16.89 ? 15   GLN G HB2  1 
ATOM   2659 H  HB3  . GLN G  1 15 ? -18.511 -6.550  63.626 1.00 19.17 ? 15   GLN G HB3  1 
ATOM   2660 H  HG2  . GLN G  1 15 ? -19.786 -8.410  64.284 1.00 21.76 ? 15   GLN G HG2  1 
ATOM   2661 H  HG3  . GLN G  1 15 ? -18.647 -9.547  63.570 1.00 22.14 ? 15   GLN G HG3  1 
ATOM   2662 H  HE21 . GLN G  1 15 ? -19.739 -9.087  66.324 1.00 24.50 ? 15   GLN G HE21 1 
ATOM   2663 H  HE22 . GLN G  1 15 ? -18.320 -9.033  67.312 1.00 26.48 ? 15   GLN G HE22 1 
ATOM   2664 N  N    . LEU G  1 16 ? -17.358 -6.030  60.553 1.00 15.08 ? 16   LEU G N    1 
ATOM   2665 C  CA   . LEU G  1 16 ? -17.066 -4.791  59.815 1.00 13.47 ? 16   LEU G CA   1 
ATOM   2666 C  C    . LEU G  1 16 ? -18.000 -4.595  58.625 1.00 13.33 ? 16   LEU G C    1 
ATOM   2667 O  O    . LEU G  1 16 ? -18.344 -3.453  58.301 1.00 13.34 ? 16   LEU G O    1 
ATOM   2668 C  CB   . LEU G  1 16 ? -15.620 -4.771  59.314 1.00 17.35 ? 16   LEU G CB   1 
ATOM   2669 C  CG   . LEU G  1 16 ? -14.474 -4.456  60.266 1.00 20.06 ? 16   LEU G CG   1 
ATOM   2670 C  CD1  . LEU G  1 16 ? -13.209 -4.355  59.437 1.00 20.16 ? 16   LEU G CD1  1 
ATOM   2671 C  CD2  . LEU G  1 16 ? -14.735 -3.158  60.989 1.00 20.01 ? 16   LEU G CD2  1 
ATOM   2672 H  H    . LEU G  1 16 ? -16.632 -6.674  60.687 1.00 12.25 ? 16   LEU G H    1 
ATOM   2673 H  HA   . LEU G  1 16 ? -17.210 -3.964  60.481 1.00 15.68 ? 16   LEU G HA   1 
ATOM   2674 H  HB2  . LEU G  1 16 ? -15.367 -5.745  58.915 1.00 17.90 ? 16   LEU G HB2  1 
ATOM   2675 H  HB3  . LEU G  1 16 ? -15.573 -4.057  58.509 1.00 17.38 ? 16   LEU G HB3  1 
ATOM   2676 H  HG   . LEU G  1 16 ? -14.351 -5.252  60.983 1.00 20.29 ? 16   LEU G HG   1 
ATOM   2677 H  HD11 . LEU G  1 16 ? -12.386 -4.021  60.021 1.00 20.86 ? 16   LEU G HD11 1 
ATOM   2678 H  HD12 . LEU G  1 16 ? -13.012 -5.331  59.017 1.00 21.36 ? 16   LEU G HD12 1 
ATOM   2679 H  HD13 . LEU G  1 16 ? -13.367 -3.681  58.613 1.00 19.81 ? 16   LEU G HD13 1 
ATOM   2680 H  HD21 . LEU G  1 16 ? -14.806 -2.401  60.224 1.00 19.00 ? 16   LEU G HD21 1 
ATOM   2681 H  HD22 . LEU G  1 16 ? -15.648 -3.187  61.584 1.00 19.50 ? 16   LEU G HD22 1 
ATOM   2682 H  HD23 . LEU G  1 16 ? -13.880 -2.912  61.613 1.00 19.49 ? 16   LEU G HD23 1 
ATOM   2683 N  N    . GLU G  1 17 ? -18.427 -5.691  57.983 1.00 11.39 ? 17   GLU G N    1 
ATOM   2684 C  CA   . GLU G  1 17 ? -19.299 -5.616  56.847 1.00 11.30 ? 17   GLU G CA   1 
ATOM   2685 C  C    . GLU G  1 17 ? -20.594 -4.883  57.175 1.00 12.19 ? 17   GLU G C    1 
ATOM   2686 O  O    . GLU G  1 17 ? -21.247 -4.350  56.265 1.00 14.62 ? 17   GLU G O    1 
ATOM   2687 C  CB   . GLU G  1 17 ? -19.609 -7.042  56.302 1.00 12.15 ? 17   GLU G CB   1 
ATOM   2688 C  CG   . GLU G  1 17 ? -20.216 -7.022  54.904 1.00 14.33 ? 17   GLU G CG   1 
ATOM   2689 C  CD   . GLU G  1 17 ? -20.556 -8.386  54.358 1.00 15.24 ? 17   GLU G CD   1 
ATOM   2690 O  OE1  . GLU G  1 17 ? -20.445 -9.393  55.086 1.00 14.88 ? 17   GLU G OE1  1 
ATOM   2691 O  OE2  . GLU G  1 17 ? -20.959 -8.445  53.163 1.00 17.70 ? 17   GLU G OE2  1 
ATOM   2692 H  H    . GLU G  1 17 ? -18.113 -6.547  58.339 1.00 12.64 ? 17   GLU G H    1 
ATOM   2693 H  HA   . GLU G  1 17 ? -18.781 -5.088  56.059 1.00 14.23 ? 17   GLU G HA   1 
ATOM   2694 H  HB2  . GLU G  1 17 ? -18.670 -7.580  56.281 1.00 13.07 ? 17   GLU G HB2  1 
ATOM   2695 H  HB3  . GLU G  1 17 ? -20.280 -7.545  56.988 1.00 15.09 ? 17   GLU G HB3  1 
ATOM   2696 H  HG2  . GLU G  1 17 ? -21.073 -6.394  54.853 1.00 14.83 ? 17   GLU G HG2  1 
ATOM   2697 H  HG3  . GLU G  1 17 ? -19.443 -6.606  54.265 1.00 13.11 ? 17   GLU G HG3  1 
ATOM   2698 N  N    . ASN G  1 18 ? -20.976 -4.890  58.455 1.00 13.45 ? 18   ASN G N    1 
ATOM   2699 C  CA   . ASN G  1 18 ? -22.201 -4.183  58.848 1.00 15.37 ? 18   ASN G CA   1 
ATOM   2700 C  C    . ASN G  1 18 ? -22.094 -2.680  58.616 1.00 15.77 ? 18   ASN G C    1 
ATOM   2701 O  O    . ASN G  1 18 ? -23.113 -1.990  58.501 1.00 17.95 ? 18   ASN G O    1 
ATOM   2702 C  CB   . ASN G  1 18 ? -22.548 -4.492  60.314 1.00 16.93 ? 18   ASN G CB   1 
ATOM   2703 C  CG   . ASN G  1 18 ? -22.941 -5.949  60.511 1.00 17.14 ? 18   ASN G CG   1 
ATOM   2704 O  OD1  . ASN G  1 18 ? -23.628 -6.527  59.672 1.00 23.55 ? 18   ASN G OD1  1 
ATOM   2705 N  ND2  . ASN G  1 18 ? -22.487 -6.539  61.591 1.00 19.76 ? 18   ASN G ND2  1 
ATOM   2706 H  H    . ASN G  1 18 ? -20.438 -5.350  59.118 1.00 12.08 ? 18   ASN G H    1 
ATOM   2707 H  HA   . ASN G  1 18 ? -23.020 -4.507  58.225 1.00 15.45 ? 18   ASN G HA   1 
ATOM   2708 H  HB2  . ASN G  1 18 ? -21.707 -4.257  60.937 1.00 16.36 ? 18   ASN G HB2  1 
ATOM   2709 H  HB3  . ASN G  1 18 ? -23.383 -3.867  60.593 1.00 17.73 ? 18   ASN G HB3  1 
ATOM   2710 H  HD21 . ASN G  1 18 ? -21.925 -6.040  62.226 1.00 19.66 ? 18   ASN G HD21 1 
ATOM   2711 H  HD22 . ASN G  1 18 ? -22.756 -7.474  61.743 1.00 21.20 ? 18   ASN G HD22 1 
ATOM   2712 N  N    . TYR G  1 19 ? -20.873 -2.166  58.509 1.00 15.55 ? 19   TYR G N    1 
ATOM   2713 C  CA   . TYR G  1 19 ? -20.673 -0.739  58.273 1.00 15.62 ? 19   TYR G CA   1 
ATOM   2714 C  C    . TYR G  1 19 ? -20.618 -0.363  56.807 1.00 14.85 ? 19   TYR G C    1 
ATOM   2715 O  O    . TYR G  1 19 ? -20.456 0.823   56.490 1.00 17.88 ? 19   TYR G O    1 
ATOM   2716 C  CB   . TYR G  1 19 ? -19.399 -0.272  58.978 1.00 17.36 ? 19   TYR G CB   1 
ATOM   2717 C  CG   . TYR G  1 19 ? -19.442 -0.358  60.484 1.00 20.07 ? 19   TYR G CG   1 
ATOM   2718 C  CD1  . TYR G  1 19 ? -19.955 0.695   61.238 1.00 22.93 ? 19   TYR G CD1  1 
ATOM   2719 C  CD2  . TYR G  1 19 ? -18.988 -1.485  61.157 1.00 24.51 ? 19   TYR G CD2  1 
ATOM   2720 C  CE1  . TYR G  1 19 ? -20.007 0.632   62.608 1.00 25.02 ? 19   TYR G CE1  1 
ATOM   2721 C  CE2  . TYR G  1 19 ? -19.044 -1.566  62.537 1.00 25.40 ? 19   TYR G CE2  1 
ATOM   2722 C  CZ   . TYR G  1 19 ? -19.554 -0.494  63.260 1.00 27.80 ? 19   TYR G CZ   1 
ATOM   2723 O  OH   . TYR G  1 19 ? -19.585 -0.536  64.638 1.00 31.40 ? 19   TYR G OH   1 
ATOM   2724 H  H    . TYR G  1 19 ? -20.114 -2.765  58.646 1.00 16.72 ? 19   TYR G H    1 
ATOM   2725 H  HA   . TYR G  1 19 ? -21.494 -0.200  58.730 1.00 16.77 ? 19   TYR G HA   1 
ATOM   2726 H  HB2  . TYR G  1 19 ? -18.548 -0.808  58.605 1.00 18.87 ? 19   TYR G HB2  1 
ATOM   2727 H  HB3  . TYR G  1 19 ? -19.286 0.770   58.708 1.00 18.00 ? 19   TYR G HB3  1 
ATOM   2728 H  HD1  . TYR G  1 19 ? -20.307 1.573   60.713 1.00 22.28 ? 19   TYR G HD1  1 
ATOM   2729 H  HD2  . TYR G  1 19 ? -18.595 -2.319  60.597 1.00 23.53 ? 19   TYR G HD2  1 
ATOM   2730 H  HE1  . TYR G  1 19 ? -20.411 1.466   63.168 1.00 25.09 ? 19   TYR G HE1  1 
ATOM   2731 H  HE2  . TYR G  1 19 ? -18.686 -2.457  63.041 1.00 25.73 ? 19   TYR G HE2  1 
ATOM   2732 H  HH   . TYR G  1 19 ? -19.129 -1.315  64.959 1.00 29.13 ? 19   TYR G HH   1 
ATOM   2733 N  N    . CYS G  1 20 ? -20.698 -1.319  55.889 1.00 13.47 ? 20   CYS G N    1 
ATOM   2734 C  CA   . CYS G  1 20 ? -20.682 -0.999  54.472 1.00 14.65 ? 20   CYS G CA   1 
ATOM   2735 C  C    . CYS G  1 20 ? -22.001 -0.355  54.087 1.00 16.78 ? 20   CYS G C    1 
ATOM   2736 O  O    . CYS G  1 20 ? -23.024 -0.595  54.744 1.00 18.76 ? 20   CYS G O    1 
ATOM   2737 C  CB   . CYS G  1 20 ? -20.534 -2.237  53.614 1.00 12.52 ? 20   CYS G CB   1 
ATOM   2738 S  SG   . CYS G  1 20 ? -19.048 -3.231  53.919 1.00 13.97 ? 20   CYS G SG   1 
ATOM   2739 H  H    . CYS G  1 20 ? -20.768 -2.269  56.134 1.00 16.19 ? 20   CYS G H    1 
ATOM   2740 H  HA   . CYS G  1 20 ? -19.894 -0.305  54.241 1.00 15.39 ? 20   CYS G HA   1 
ATOM   2741 H  HB2  . CYS G  1 20 ? -21.383 -2.889  53.649 1.00 14.99 ? 20   CYS G HB2  1 
ATOM   2742 H  HB3  . CYS G  1 20 ? -20.455 -1.901  52.581 1.00 13.62 ? 20   CYS G HB3  1 
ATOM   2743 N  N    . ASN G  1 21 ? -22.005 0.405   52.999 1.00 18.50 ? 21   ASN G N    1 
ATOM   2744 C  CA   . ASN G  1 21 ? -23.241 1.031   52.548 1.00 21.59 ? 21   ASN G CA   1 
ATOM   2745 C  C    . ASN G  1 21 ? -24.013 0.121   51.607 1.00 27.34 ? 21   ASN G C    1 
ATOM   2746 O  O    . ASN G  1 21 ? -23.543 -1.004  51.388 1.00 24.83 ? 21   ASN G O    1 
ATOM   2747 C  CB   . ASN G  1 21 ? -22.929 2.360   51.879 1.00 24.42 ? 21   ASN G CB   1 
ATOM   2748 C  CG   . ASN G  1 21 ? -22.588 3.436   52.883 1.00 21.35 ? 21   ASN G CG   1 
ATOM   2749 O  OD1  . ASN G  1 21 ? -21.873 4.384   52.558 1.00 22.40 ? 21   ASN G OD1  1 
ATOM   2750 N  ND2  . ASN G  1 21 ? -23.106 3.306   54.105 1.00 26.45 ? 21   ASN G ND2  1 
ATOM   2751 O  OXT  . ASN G  1 21 ? -25.089 0.540   51.124 1.00 33.20 ? 21   ASN G OXT  1 
ATOM   2752 H  H    . ASN G  1 21 ? -21.188 0.571   52.503 1.00 20.30 ? 21   ASN G H    1 
ATOM   2753 H  HA   . ASN G  1 21 ? -23.882 1.207   53.396 1.00 22.86 ? 21   ASN G HA   1 
ATOM   2754 H  HB2  . ASN G  1 21 ? -22.039 2.211   51.277 1.00 23.30 ? 21   ASN G HB2  1 
ATOM   2755 H  HB3  . ASN G  1 21 ? -23.748 2.686   51.269 1.00 23.68 ? 21   ASN G HB3  1 
ATOM   2756 H  HD21 . ASN G  1 21 ? -22.887 3.995   54.770 1.00 25.79 ? 21   ASN G HD21 1 
ATOM   2757 H  HD22 . ASN G  1 21 ? -23.700 2.554   54.308 1.00 25.44 ? 21   ASN G HD22 1 
ATOM   2758 N  N    . VAL H  2 2  ? -4.840  0.517   73.599 1.00 36.12 ? 2    VAL H N    1 
ATOM   2759 C  CA   . VAL H  2 2  ? -4.514  0.422   72.151 1.00 34.05 ? 2    VAL H CA   1 
ATOM   2760 C  C    . VAL H  2 2  ? -4.045  1.780   71.641 1.00 36.51 ? 2    VAL H C    1 
ATOM   2761 O  O    . VAL H  2 2  ? -3.617  2.638   72.424 1.00 33.76 ? 2    VAL H O    1 
ATOM   2762 C  CB   . VAL H  2 2  ? -5.756  -0.045  71.365 1.00 34.50 ? 2    VAL H CB   1 
ATOM   2763 H  HA   . VAL H  2 2  ? -3.718  -0.299  72.016 1.00 33.72 ? 2    VAL H HA   1 
ATOM   2764 N  N    . ASN H  2 3  ? -4.128  1.971   70.329 1.00 35.90 ? 3    ASN H N    1 
ATOM   2765 C  CA   . ASN H  2 3  ? -3.719  3.220   69.709 1.00 34.02 ? 3    ASN H CA   1 
ATOM   2766 C  C    . ASN H  2 3  ? -4.746  3.580   68.648 1.00 33.05 ? 3    ASN H C    1 
ATOM   2767 O  O    . ASN H  2 3  ? -4.722  3.049   67.529 1.00 34.62 ? 3    ASN H O    1 
ATOM   2768 C  CB   . ASN H  2 3  ? -2.339  3.072   69.077 1.00 35.41 ? 3    ASN H CB   1 
ATOM   2769 C  CG   . ASN H  2 3  ? -1.710  4.406   68.759 1.00 38.00 ? 3    ASN H CG   1 
ATOM   2770 O  OD1  . ASN H  2 3  ? -0.603  4.694   69.211 1.00 41.51 ? 3    ASN H OD1  1 
ATOM   2771 N  ND2  . ASN H  2 3  ? -2.418  5.239   67.987 1.00 39.37 ? 3    ASN H ND2  1 
ATOM   2772 H  H    . ASN H  2 3  ? -4.504  1.271   69.750 1.00 34.09 ? 3    ASN H H    1 
ATOM   2773 H  HA   . ASN H  2 3  ? -3.683  3.988   70.470 1.00 33.14 ? 3    ASN H HA   1 
ATOM   2774 H  HB2  . ASN H  2 3  ? -1.719  2.537   69.763 1.00 34.13 ? 3    ASN H HB2  1 
ATOM   2775 H  HB3  . ASN H  2 3  ? -2.425  2.499   68.158 1.00 33.58 ? 3    ASN H HB3  1 
ATOM   2776 H  HD21 . ASN H  2 3  ? -2.022  6.097   67.764 1.00 35.61 ? 3    ASN H HD21 1 
ATOM   2777 H  HD22 . ASN H  2 3  ? -3.309  4.945   67.683 1.00 34.42 ? 3    ASN H HD22 1 
ATOM   2778 N  N    . GLN H  2 4  ? -5.644  4.493   69.006 1.00 29.35 ? 4    GLN H N    1 
ATOM   2779 C  CA   . GLN H  2 4  ? -6.712  4.912   68.118 1.00 31.18 ? 4    GLN H CA   1 
ATOM   2780 C  C    . GLN H  2 4  ? -6.222  5.425   66.773 1.00 26.63 ? 4    GLN H C    1 
ATOM   2781 O  O    . GLN H  2 4  ? -6.818  5.114   65.732 1.00 29.27 ? 4    GLN H O    1 
ATOM   2782 C  CB   . GLN H  2 4  ? -7.552  5.979   68.798 1.00 29.88 ? 4    GLN H CB   1 
ATOM   2783 H  H    . GLN H  2 4  ? -5.554  4.939   69.877 1.00 30.89 ? 4    GLN H H    1 
ATOM   2784 H  HA   . GLN H  2 4  ? -7.343  4.055   67.963 1.00 28.70 ? 4    GLN H HA   1 
ATOM   2785 N  N    . HIS H  2 5  ? -5.142  6.209   66.790 1.00 22.51 ? 5    HIS H N    1 
ATOM   2786 C  CA   . HIS H  2 5  ? -4.619  6.788   65.550 1.00 21.52 ? 5    HIS H CA   1 
ATOM   2787 C  C    . HIS H  2 5  ? -4.105  5.743   64.559 1.00 18.18 ? 5    HIS H C    1 
ATOM   2788 O  O    . HIS H  2 5  ? -4.354  5.856   63.344 1.00 22.37 ? 5    HIS H O    1 
ATOM   2789 C  CB   . HIS H  2 5  ? -3.505  7.796   65.866 1.00 21.31 ? 5    HIS H CB   1 
ATOM   2790 C  CG   . HIS H  2 5  ? -3.912  8.866   66.835 1.00 21.56 ? 5    HIS H CG   1 
ATOM   2791 N  ND1  . HIS H  2 5  ? -4.836  9.840   66.531 1.00 28.27 ? 5    HIS H ND1  1 
ATOM   2792 C  CD2  . HIS H  2 5  ? -3.525  9.103   68.114 1.00 22.19 ? 5    HIS H CD2  1 
ATOM   2793 C  CE1  . HIS H  2 5  ? -5.003  10.629  67.580 1.00 25.97 ? 5    HIS H CE1  1 
ATOM   2794 N  NE2  . HIS H  2 5  ? -4.221  10.201  68.555 1.00 20.53 ? 5    HIS H NE2  1 
ATOM   2795 H  H    . HIS H  2 5  ? -4.686  6.351   67.643 1.00 22.21 ? 5    HIS H H    1 
ATOM   2796 H  HA   . HIS H  2 5  ? -5.426  7.334   65.085 1.00 20.97 ? 5    HIS H HA   1 
ATOM   2797 H  HB2  . HIS H  2 5  ? -2.661  7.258   66.263 1.00 22.36 ? 5    HIS H HB2  1 
ATOM   2798 H  HB3  . HIS H  2 5  ? -3.182  8.274   64.950 1.00 22.11 ? 5    HIS H HB3  1 
ATOM   2799 H  HD1  . HIS H  2 5  ? -5.330  9.943   65.689 1.00 25.61 ? 5    HIS H HD1  1 
ATOM   2800 H  HD2  . HIS H  2 5  ? -2.796  8.540   68.678 1.00 23.36 ? 5    HIS H HD2  1 
ATOM   2801 H  HE1  . HIS H  2 5  ? -5.426  11.631  67.526 1.00 26.86 ? 5    HIS H HE1  1 
ATOM   2802 N  N    . LEU H  2 6  ? -3.383  4.739   65.042 1.00 17.75 ? 6    LEU H N    1 
ATOM   2803 C  CA   . LEU H  2 6  ? -2.888  3.700   64.146 1.00 20.17 ? 6    LEU H CA   1 
ATOM   2804 C  C    . LEU H  2 6  ? -3.979  2.677   63.829 1.00 20.60 ? 6    LEU H C    1 
ATOM   2805 O  O    . LEU H  2 6  ? -4.104  2.244   62.688 1.00 18.76 ? 6    LEU H O    1 
ATOM   2806 C  CB   . LEU H  2 6  ? -1.660  3.037   64.759 1.00 21.73 ? 6    LEU H CB   1 
ATOM   2807 C  CG   . LEU H  2 6  ? -0.510  3.993   65.141 1.00 21.67 ? 6    LEU H CG   1 
ATOM   2808 C  CD1  . LEU H  2 6  ? 0.720   3.188   65.500 1.00 23.24 ? 6    LEU H CD1  1 
ATOM   2809 C  CD2  . LEU H  2 6  ? -0.176  4.945   63.979 1.00 25.48 ? 6    LEU H CD2  1 
ATOM   2810 H  H    . LEU H  2 6  ? -3.190  4.664   66.001 1.00 18.99 ? 6    LEU H H    1 
ATOM   2811 H  HA   . LEU H  2 6  ? -2.625  4.126   63.198 1.00 21.05 ? 6    LEU H HA   1 
ATOM   2812 H  HB2  . LEU H  2 6  ? -2.004  2.465   65.615 1.00 19.09 ? 6    LEU H HB2  1 
ATOM   2813 H  HB3  . LEU H  2 6  ? -1.329  2.374   63.975 1.00 21.55 ? 6    LEU H HB3  1 
ATOM   2814 H  HG   . LEU H  2 6  ? -0.797  4.579   65.996 1.00 23.71 ? 6    LEU H HG   1 
ATOM   2815 H  HD11 . LEU H  2 6  ? 1.494   3.889   65.779 1.00 22.99 ? 6    LEU H HD11 1 
ATOM   2816 H  HD12 . LEU H  2 6  ? 0.469   2.541   66.327 1.00 22.42 ? 6    LEU H HD12 1 
ATOM   2817 H  HD13 . LEU H  2 6  ? 1.050   2.606   64.650 1.00 23.27 ? 6    LEU H HD13 1 
ATOM   2818 H  HD21 . LEU H  2 6  ? 0.848   5.303   64.076 1.00 20.64 ? 6    LEU H HD21 1 
ATOM   2819 H  HD22 . LEU H  2 6  ? -0.331  4.438   63.041 1.00 22.74 ? 6    LEU H HD22 1 
ATOM   2820 H  HD23 . LEU H  2 6  ? -0.845  5.797   64.028 1.00 23.58 ? 6    LEU H HD23 1 
ATOM   2821 N  N    . CYS H  2 7  ? -4.794  2.310   64.816 1.00 18.85 ? 7    CYS H N    1 
ATOM   2822 C  CA   . CYS H  2 7  ? -5.879  1.359   64.570 1.00 20.36 ? 7    CYS H CA   1 
ATOM   2823 C  C    . CYS H  2 7  ? -6.769  1.836   63.427 1.00 15.75 ? 7    CYS H C    1 
ATOM   2824 O  O    . CYS H  2 7  ? -7.111  1.050   62.551 1.00 21.73 ? 7    CYS H O    1 
ATOM   2825 C  CB   . CYS H  2 7  ? -6.709  1.203   65.820 1.00 15.19 ? 7    CYS H CB   1 
ATOM   2826 S  SG   . CYS H  2 7  ? -8.174  0.127   65.639 1.00 23.30 ? 7    CYS H SG   1 
ATOM   2827 H  H    . CYS H  2 7  ? -4.651  2.675   65.711 1.00 20.89 ? 7    CYS H H    1 
ATOM   2828 H  HA   . CYS H  2 7  ? -5.491  0.392   64.294 1.00 18.02 ? 7    CYS H HA   1 
ATOM   2829 H  HB2  . CYS H  2 7  ? -6.047  0.774   66.562 1.00 19.91 ? 7    CYS H HB2  1 
ATOM   2830 H  HB3  . CYS H  2 7  ? -7.012  2.174   66.166 1.00 18.50 ? 7    CYS H HB3  1 
ATOM   2831 N  N    . GLY H  2 8  ? -7.195  3.096   63.494 1.00 15.95 ? 8    GLY H N    1 
ATOM   2832 C  CA   . GLY H  2 8  ? -7.998  3.695   62.445 1.00 20.97 ? 8    GLY H CA   1 
ATOM   2833 C  C    . GLY H  2 8  ? -7.459  3.441   61.029 1.00 14.30 ? 8    GLY H C    1 
ATOM   2834 O  O    . GLY H  2 8  ? -8.218  3.112   60.161 1.00 17.36 ? 8    GLY H O    1 
ATOM   2835 H  H    . GLY H  2 8  ? -6.984  3.622   64.286 1.00 18.46 ? 8    GLY H H    1 
ATOM   2836 H  HA2  . GLY H  2 8  ? -9.034  3.416   62.539 1.00 18.21 ? 8    GLY H HA2  1 
ATOM   2837 H  HA3  . GLY H  2 8  ? -7.956  4.771   62.621 1.00 17.19 ? 8    GLY H HA3  1 
ATOM   2838 N  N    . SER H  2 9  ? -6.168  3.636   60.776 1.00 15.31 ? 9    SER H N    1 
ATOM   2839 C  CA   . SER H  2 9  ? -5.640  3.371   59.446 1.00 12.91 ? 9    SER H CA   1 
ATOM   2840 C  C    . SER H  2 9  ? -5.923  1.911   58.991 1.00 12.36 ? 9    SER H C    1 
ATOM   2841 O  O    . SER H  2 9  ? -6.370  1.619   57.887 1.00 12.81 ? 9    SER H O    1 
ATOM   2842 C  CB   . SER H  2 9  ? -4.150  3.628   59.497 1.00 17.80 ? 9    SER H CB   1 
ATOM   2843 O  OG   . SER H  2 9  ? -3.558  3.226   58.327 1.00 17.98 ? 9    SER H OG   1 
ATOM   2844 H  H    . SER H  2 9  ? -5.566  4.002   61.452 1.00 17.21 ? 9    SER H H    1 
ATOM   2845 H  HA   . SER H  2 9  ? -6.087  4.029   58.723 1.00 16.01 ? 9    SER H HA   1 
ATOM   2846 H  HB2  . SER H  2 9  ? -3.986  4.704   59.589 1.00 17.13 ? 9    SER H HB2  1 
ATOM   2847 H  HB3  . SER H  2 9  ? -3.709  3.108   60.332 1.00 18.61 ? 9    SER H HB3  1 
ATOM   2848 H  HG   . SER H  2 9  ? -3.648  2.281   58.159 1.00 19.76 ? 9    SER H HG   1 
ATOM   2849 N  N    . HIS H  2 10 ? -5.702  0.974   59.904 1.00 10.72 ? 10   HIS H N    1 
ATOM   2850 C  CA   . HIS H  2 10 ? -5.958  -0.430  59.612 1.00 10.23 ? 10   HIS H CA   1 
ATOM   2851 C  C    . HIS H  2 10 ? -7.455  -0.695  59.537 1.00 9.88  ? 10   HIS H C    1 
ATOM   2852 O  O    . HIS H  2 10 ? -7.871  -1.523  58.740 1.00 12.35 ? 10   HIS H O    1 
ATOM   2853 C  CB   . HIS H  2 10 ? -5.325  -1.308  60.686 1.00 10.53 ? 10   HIS H CB   1 
ATOM   2854 C  CG   . HIS H  2 10 ? -3.826  -1.219  60.715 1.00 12.44 ? 10   HIS H CG   1 
ATOM   2855 N  ND1  . HIS H  2 10 ? -3.017  -1.926  59.852 1.00 17.03 ? 10   HIS H ND1  1 
ATOM   2856 C  CD2  . HIS H  2 10 ? -2.992  -0.483  61.484 1.00 12.73 ? 10   HIS H CD2  1 
ATOM   2857 C  CE1  . HIS H  2 10 ? -1.741  -1.627  60.092 1.00 16.82 ? 10   HIS H CE1  1 
ATOM   2858 N  NE2  . HIS H  2 10 ? -1.691  -0.758  61.084 1.00 13.05 ? 10   HIS H NE2  1 
ATOM   2859 H  H    . HIS H  2 10 ? -5.394  1.231   60.783 1.00 11.77 ? 10   HIS H H    1 
ATOM   2860 H  HA   . HIS H  2 10 ? -5.551  -0.687  58.655 1.00 10.14 ? 10   HIS H HA   1 
ATOM   2861 H  HB2  . HIS H  2 10 ? -5.686  -0.976  61.628 1.00 8.68  ? 10   HIS H HB2  1 
ATOM   2862 H  HB3  . HIS H  2 10 ? -5.602  -2.323  60.485 1.00 10.65 ? 10   HIS H HB3  1 
ATOM   2863 H  HD1  . HIS H  2 10 ? -3.346  -2.594  59.210 1.00 17.53 ? 10   HIS H HD1  1 
ATOM   2864 H  HD2  . HIS H  2 10 ? -3.238  0.193   62.282 1.00 13.55 ? 10   HIS H HD2  1 
ATOM   2865 H  HE1  . HIS H  2 10 ? -0.895  -2.248  59.808 1.00 17.31 ? 10   HIS H HE1  1 
ATOM   2866 N  N    . LEU H  2 11 ? -8.232  0.047   60.303 1.00 10.26 ? 11   LEU H N    1 
ATOM   2867 C  CA   . LEU H  2 11 ? -9.662  -0.088  60.250 1.00 9.81  ? 11   LEU H CA   1 
ATOM   2868 C  C    . LEU H  2 11 ? -10.223 0.301   58.882 1.00 10.27 ? 11   LEU H C    1 
ATOM   2869 O  O    . LEU H  2 11 ? -11.035 -0.439  58.303 1.00 10.27 ? 11   LEU H O    1 
ATOM   2870 C  CB   . LEU H  2 11 ? -10.276 0.757   61.349 1.00 12.51 ? 11   LEU H CB   1 
ATOM   2871 C  CG   . LEU H  2 11 ? -11.786 0.761   61.494 1.00 12.94 ? 11   LEU H CG   1 
ATOM   2872 C  CD1  . LEU H  2 11 ? -12.299 -0.653  61.631 1.00 14.74 ? 11   LEU H CD1  1 
ATOM   2873 C  CD2  . LEU H  2 11 ? -12.138 1.600   62.739 1.00 15.30 ? 11   LEU H CD2  1 
ATOM   2874 H  H    . LEU H  2 11 ? -7.907  0.696   60.945 1.00 10.10 ? 11   LEU H H    1 
ATOM   2875 H  HA   . LEU H  2 11 ? -9.911  -1.112  60.409 1.00 11.89 ? 11   LEU H HA   1 
ATOM   2876 H  HB2  . LEU H  2 11 ? -9.845  0.495   62.300 1.00 11.26 ? 11   LEU H HB2  1 
ATOM   2877 H  HB3  . LEU H  2 11 ? -9.971  1.770   61.150 1.00 14.28 ? 11   LEU H HB3  1 
ATOM   2878 H  HG   . LEU H  2 11 ? -12.272 1.212   60.642 1.00 15.45 ? 11   LEU H HG   1 
ATOM   2879 H  HD11 . LEU H  2 11 ? -11.797 -1.124  62.473 1.00 13.21 ? 11   LEU H HD11 1 
ATOM   2880 H  HD12 . LEU H  2 11 ? -13.372 -0.601  61.807 1.00 15.32 ? 11   LEU H HD12 1 
ATOM   2881 H  HD13 . LEU H  2 11 ? -12.114 -1.226  60.739 1.00 13.64 ? 11   LEU H HD13 1 
ATOM   2882 H  HD21 . LEU H  2 11 ? -11.824 1.075   63.630 1.00 15.47 ? 11   LEU H HD21 1 
ATOM   2883 H  HD22 . LEU H  2 11 ? -11.655 2.573   62.707 1.00 15.64 ? 11   LEU H HD22 1 
ATOM   2884 H  HD23 . LEU H  2 11 ? -13.197 1.724   62.768 1.00 16.47 ? 11   LEU H HD23 1 
ATOM   2885 N  N    . VAL H  2 12 ? -9.755  1.452   58.378 1.00 10.57 ? 12   VAL H N    1 
ATOM   2886 C  CA   . VAL H  2 12 ? -10.278 1.914   57.092 1.00 10.63 ? 12   VAL H CA   1 
ATOM   2887 C  C    . VAL H  2 12 ? -9.798  1.024   55.958 1.00 11.22 ? 12   VAL H C    1 
ATOM   2888 O  O    . VAL H  2 12 ? -10.523 0.830   54.998 1.00 11.36 ? 12   VAL H O    1 
ATOM   2889 C  CB   . VAL H  2 12 ? -9.994  3.438   56.828 1.00 14.72 ? 12   VAL H CB   1 
ATOM   2890 C  CG1  . VAL H  2 12 ? -10.626 4.282   57.926 1.00 18.34 ? 12   VAL H CG1  1 
ATOM   2891 C  CG2  . VAL H  2 12 ? -8.557  3.701   56.752 1.00 17.41 ? 12   VAL H CG2  1 
ATOM   2892 H  H    . VAL H  2 12 ? -9.043  1.919   58.842 1.00 12.50 ? 12   VAL H H    1 
ATOM   2893 H  HA   . VAL H  2 12 ? -11.352 1.766   57.087 1.00 12.20 ? 12   VAL H HA   1 
ATOM   2894 H  HB   . VAL H  2 12 ? -10.469 3.706   55.904 1.00 15.50 ? 12   VAL H HB   1 
ATOM   2895 H  HG11 . VAL H  2 12 ? -10.730 5.303   57.580 1.00 18.21 ? 12   VAL H HG11 1 
ATOM   2896 H  HG12 . VAL H  2 12 ? -11.620 3.916   58.141 1.00 14.64 ? 12   VAL H HG12 1 
ATOM   2897 H  HG13 . VAL H  2 12 ? -10.015 4.283   58.817 1.00 17.24 ? 12   VAL H HG13 1 
ATOM   2898 H  HG21 . VAL H  2 12 ? -8.377  4.617   56.219 1.00 17.49 ? 12   VAL H HG21 1 
ATOM   2899 H  HG22 . VAL H  2 12 ? -8.127  3.741   57.763 1.00 16.90 ? 12   VAL H HG22 1 
ATOM   2900 H  HG23 . VAL H  2 12 ? -8.112  2.891   56.204 1.00 16.62 ? 12   VAL H HG23 1 
ATOM   2901 N  N    A GLU H  2 13 ? -8.583  0.488   56.036 0.40 10.33 ? 13   GLU H N    1 
ATOM   2902 N  N    B GLU H  2 13 ? -8.587  0.496   56.052 0.60 9.37  ? 13   GLU H N    1 
ATOM   2903 C  CA   A GLU H  2 13 ? -8.136  -0.402  54.970 0.40 11.34 ? 13   GLU H CA   1 
ATOM   2904 C  CA   B GLU H  2 13 ? -8.139  -0.411  55.021 0.60 9.15  ? 13   GLU H CA   1 
ATOM   2905 C  C    A GLU H  2 13 ? -8.957  -1.710  54.974 0.40 10.83 ? 13   GLU H C    1 
ATOM   2906 C  C    B GLU H  2 13 ? -8.999  -1.676  54.980 0.60 9.66  ? 13   GLU H C    1 
ATOM   2907 O  O    A GLU H  2 13 ? -9.247  -2.268  53.920 0.40 10.43 ? 13   GLU H O    1 
ATOM   2908 O  O    B GLU H  2 13 ? -9.324  -2.185  53.910 0.60 11.80 ? 13   GLU H O    1 
ATOM   2909 C  CB   A GLU H  2 13 ? -6.628  -0.673  55.096 0.40 14.15 ? 13   GLU H CB   1 
ATOM   2910 C  CB   B GLU H  2 13 ? -6.695  -0.800  55.260 0.60 10.28 ? 13   GLU H CB   1 
ATOM   2911 C  CG   A GLU H  2 13 ? -5.735  0.578   54.988 0.40 18.60 ? 13   GLU H CG   1 
ATOM   2912 C  CG   B GLU H  2 13 ? -6.202  -1.736  54.185 0.60 12.62 ? 13   GLU H CG   1 
ATOM   2913 C  CD   A GLU H  2 13 ? -5.913  1.380   53.694 0.40 23.78 ? 13   GLU H CD   1 
ATOM   2914 C  CD   B GLU H  2 13 ? -5.002  -2.494  54.619 0.60 20.02 ? 13   GLU H CD   1 
ATOM   2915 O  OE1  A GLU H  2 13 ? -7.051  1.761   53.346 0.40 22.75 ? 13   GLU H OE1  1 
ATOM   2916 O  OE1  B GLU H  2 13 ? -5.158  -3.323  55.533 0.60 19.18 ? 13   GLU H OE1  1 
ATOM   2917 O  OE2  A GLU H  2 13 ? -4.896  1.654   53.029 0.40 25.89 ? 13   GLU H OE2  1 
ATOM   2918 O  OE2  B GLU H  2 13 ? -3.920  -2.268  54.057 0.60 21.07 ? 13   GLU H OE2  1 
ATOM   2919 H  H    A GLU H  2 13 ? -8.000  0.678   56.798 0.40 10.33 ? 13   GLU H H    1 
ATOM   2920 H  H    B GLU H  2 13 ? -7.999  0.683   56.804 0.60 10.21 ? 13   GLU H H    1 
ATOM   2921 H  HA   A GLU H  2 13 ? -8.334  0.065   54.025 0.40 11.88 ? 13   GLU H HA   1 
ATOM   2922 H  HA   B GLU H  2 13 ? -8.206  0.062   54.062 0.60 10.98 ? 13   GLU H HA   1 
ATOM   2923 H  HB2  A GLU H  2 13 ? -6.457  -1.123  56.065 0.40 13.97 ? 13   GLU H HB2  1 
ATOM   2924 H  HB2  B GLU H  2 13 ? -6.087  0.085   55.275 0.60 12.45 ? 13   GLU H HB2  1 
ATOM   2925 H  HB3  A GLU H  2 13 ? -6.321  -1.383  54.339 0.40 13.90 ? 13   GLU H HB3  1 
ATOM   2926 H  HB3  B GLU H  2 13 ? -6.610  -1.309  56.212 0.60 11.86 ? 13   GLU H HB3  1 
ATOM   2927 H  HG2  A GLU H  2 13 ? -5.925  1.167   55.843 0.40 19.28 ? 13   GLU H HG2  1 
ATOM   2928 H  HG2  B GLU H  2 13 ? -6.955  -2.468  53.942 0.60 16.95 ? 13   GLU H HG2  1 
ATOM   2929 H  HG3  A GLU H  2 13 ? -4.703  0.256   55.065 0.40 19.35 ? 13   GLU H HG3  1 
ATOM   2930 H  HG3  B GLU H  2 13 ? -5.940  -1.159  53.316 0.60 17.03 ? 13   GLU H HG3  1 
ATOM   2931 N  N    . ALA H  2 14 ? -9.317  -2.207  56.157 1.00 9.48  ? 14   ALA H N    1 
ATOM   2932 C  CA   . ALA H  2 14 ? -10.159 -3.404  56.250 1.00 9.73  ? 14   ALA H CA   1 
ATOM   2933 C  C    . ALA H  2 14 ? -11.567 -3.100  55.712 1.00 10.35 ? 14   ALA H C    1 
ATOM   2934 O  O    . ALA H  2 14 ? -12.154 -3.913  54.987 1.00 11.26 ? 14   ALA H O    1 
ATOM   2935 C  CB   . ALA H  2 14 ? -10.230 -3.874  57.669 1.00 11.96 ? 14   ALA H CB   1 
ATOM   2936 H  H    . ALA H  2 14 ? -8.990  -1.783  56.980 1.00 8.22  ? 14   ALA H H    1 
ATOM   2937 H  HA   . ALA H  2 14 ? -9.722  -4.166  55.635 1.00 10.01 ? 14   ALA H HA   1 
ATOM   2938 H  HB1  . ALA H  2 14 ? -10.891 -4.730  57.730 1.00 14.14 ? 14   ALA H HB1  1 
ATOM   2939 H  HB2  . ALA H  2 14 ? -9.230  -4.125  57.958 1.00 14.30 ? 14   ALA H HB2  1 
ATOM   2940 H  HB3  . ALA H  2 14 ? -10.620 -3.072  58.261 1.00 11.85 ? 14   ALA H HB3  1 
ATOM   2941 N  N    . LEU H  2 15 ? -12.114 -1.932  56.028 1.00 9.52  ? 15   LEU H N    1 
ATOM   2942 C  CA   . LEU H  2 15 ? -13.422 -1.542  55.461 1.00 10.05 ? 15   LEU H CA   1 
ATOM   2943 C  C    . LEU H  2 15 ? -13.354 -1.479  53.948 1.00 9.60  ? 15   LEU H C    1 
ATOM   2944 O  O    . LEU H  2 15 ? -14.280 -1.888  53.241 1.00 11.59 ? 15   LEU H O    1 
ATOM   2945 C  CB   . LEU H  2 15 ? -13.855 -0.195  56.021 1.00 10.93 ? 15   LEU H CB   1 
ATOM   2946 C  CG   . LEU H  2 15 ? -14.382 -0.230  57.448 1.00 11.92 ? 15   LEU H CG   1 
ATOM   2947 C  CD1  . LEU H  2 15 ? -14.392 1.173   58.065 1.00 12.74 ? 15   LEU H CD1  1 
ATOM   2948 C  CD2  . LEU H  2 15 ? -15.799 -0.846  57.433 1.00 12.03 ? 15   LEU H CD2  1 
ATOM   2949 H  H    . LEU H  2 15 ? -11.690 -1.310  56.646 1.00 9.50  ? 15   LEU H H    1 
ATOM   2950 H  HA   . LEU H  2 15 ? -14.181 -2.276  55.704 1.00 11.67 ? 15   LEU H HA   1 
ATOM   2951 H  HB2  . LEU H  2 15 ? -13.047 0.512   55.936 1.00 11.72 ? 15   LEU H HB2  1 
ATOM   2952 H  HB3  . LEU H  2 15 ? -14.674 0.098   55.380 1.00 10.14 ? 15   LEU H HB3  1 
ATOM   2953 H  HG   . LEU H  2 15 ? -13.736 -0.897  58.006 1.00 14.13 ? 15   LEU H HG   1 
ATOM   2954 H  HD11 . LEU H  2 15 ? -13.606 1.820   57.722 1.00 10.05 ? 15   LEU H HD11 1 
ATOM   2955 H  HD12 . LEU H  2 15 ? -15.320 1.633   57.757 1.00 12.36 ? 15   LEU H HD12 1 
ATOM   2956 H  HD13 . LEU H  2 15 ? -14.375 1.103   59.140 1.00 12.94 ? 15   LEU H HD13 1 
ATOM   2957 H  HD21 . LEU H  2 15 ? -16.499 -0.209  56.926 1.00 12.95 ? 15   LEU H HD21 1 
ATOM   2958 H  HD22 . LEU H  2 15 ? -15.782 -1.822  57.015 1.00 9.42  ? 15   LEU H HD22 1 
ATOM   2959 H  HD23 . LEU H  2 15 ? -16.084 -0.878  58.476 1.00 12.29 ? 15   LEU H HD23 1 
ATOM   2960 N  N    . TYR H  2 16 ? -12.253 -0.958  53.416 1.00 10.37 ? 16   TYR H N    1 
ATOM   2961 C  CA   . TYR H  2 16 ? -12.097 -0.911  51.982 1.00 9.48  ? 16   TYR H CA   1 
ATOM   2962 C  C    . TYR H  2 16 ? -12.128 -2.324  51.399 1.00 10.46 ? 16   TYR H C    1 
ATOM   2963 O  O    . TYR H  2 16 ? -12.830 -2.580  50.402 1.00 10.70 ? 16   TYR H O    1 
ATOM   2964 C  CB   . TYR H  2 16 ? -10.797 -0.199  51.611 1.00 10.71 ? 16   TYR H CB   1 
ATOM   2965 C  CG   . TYR H  2 16 ? -10.466 -0.362  50.167 1.00 10.77 ? 16   TYR H CG   1 
ATOM   2966 C  CD1  . TYR H  2 16 ? -11.146 0.347   49.197 1.00 13.00 ? 16   TYR H CD1  1 
ATOM   2967 C  CD2  . TYR H  2 16 ? -9.542  -1.314  49.752 1.00 12.25 ? 16   TYR H CD2  1 
ATOM   2968 C  CE1  . TYR H  2 16 ? -10.935 0.110   47.858 1.00 13.39 ? 16   TYR H CE1  1 
ATOM   2969 C  CE2  . TYR H  2 16 ? -9.320  -1.563  48.422 1.00 12.90 ? 16   TYR H CE2  1 
ATOM   2970 C  CZ   . TYR H  2 16 ? -10.032 -0.850  47.479 1.00 12.08 ? 16   TYR H CZ   1 
ATOM   2971 O  OH   . TYR H  2 16 ? -9.890  -1.097  46.136 1.00 16.98 ? 16   TYR H OH   1 
ATOM   2972 H  H    . TYR H  2 16 ? -11.587 -0.644  54.058 1.00 8.73  ? 16   TYR H H    1 
ATOM   2973 H  HA   . TYR H  2 16 ? -12.931 -0.348  51.556 1.00 11.94 ? 16   TYR H HA   1 
ATOM   2974 H  HB2  . TYR H  2 16 ? -10.917 0.841   51.831 1.00 11.12 ? 16   TYR H HB2  1 
ATOM   2975 H  HB3  . TYR H  2 16 ? -9.957  -0.544  52.201 1.00 10.51 ? 16   TYR H HB3  1 
ATOM   2976 H  HD1  . TYR H  2 16 ? -11.872 1.101   49.471 1.00 10.69 ? 16   TYR H HD1  1 
ATOM   2977 H  HD2  . TYR H  2 16 ? -8.972  -1.881  50.472 1.00 13.73 ? 16   TYR H HD2  1 
ATOM   2978 H  HE1  . TYR H  2 16 ? -11.488 0.684   47.139 1.00 14.26 ? 16   TYR H HE1  1 
ATOM   2979 H  HE2  . TYR H  2 16 ? -8.610  -2.322  48.169 1.00 11.82 ? 16   TYR H HE2  1 
ATOM   2980 H  HH   . TYR H  2 16 ? -9.069  -1.556  46.030 1.00 12.77 ? 16   TYR H HH   1 
ATOM   2981 N  N    . LEU H  2 17 ? -11.352 -3.229  51.988 1.00 10.08 ? 17   LEU H N    1 
ATOM   2982 C  CA   . LEU H  2 17 ? -11.308 -4.590  51.485 1.00 10.72 ? 17   LEU H CA   1 
ATOM   2983 C  C    . LEU H  2 17 ? -12.669 -5.313  51.527 1.00 11.58 ? 17   LEU H C    1 
ATOM   2984 O  O    . LEU H  2 17 ? -13.026 -6.014  50.579 1.00 11.84 ? 17   LEU H O    1 
ATOM   2985 C  CB   . LEU H  2 17 ? -10.280 -5.374  52.300 1.00 12.87 ? 17   LEU H CB   1 
ATOM   2986 C  CG   . LEU H  2 17 ? -9.989  -6.784  51.805 1.00 16.82 ? 17   LEU H CG   1 
ATOM   2987 C  CD1  . LEU H  2 17 ? -9.123  -6.693  50.564 1.00 18.04 ? 17   LEU H CD1  1 
ATOM   2988 C  CD2  . LEU H  2 17 ? -9.266  -7.563  52.873 1.00 19.64 ? 17   LEU H CD2  1 
ATOM   2989 H  H    . LEU H  2 17 ? -10.810 -2.970  52.756 1.00 13.59 ? 17   LEU H H    1 
ATOM   2990 H  HA   . LEU H  2 17 ? -10.942 -4.536  50.485 1.00 10.98 ? 17   LEU H HA   1 
ATOM   2991 H  HB2  . LEU H  2 17 ? -9.365  -4.795  52.188 1.00 15.07 ? 17   LEU H HB2  1 
ATOM   2992 H  HB3  . LEU H  2 17 ? -10.513 -5.403  53.352 1.00 13.40 ? 17   LEU H HB3  1 
ATOM   2993 H  HG   . LEU H  2 17 ? -10.921 -7.276  51.586 1.00 18.08 ? 17   LEU H HG   1 
ATOM   2994 H  HD11 . LEU H  2 17 ? -9.321  -5.830  49.952 1.00 19.70 ? 17   LEU H HD11 1 
ATOM   2995 H  HD12 . LEU H  2 17 ? -8.098  -6.628  50.908 1.00 18.23 ? 17   LEU H HD12 1 
ATOM   2996 H  HD13 . LEU H  2 17 ? -9.251  -7.600  49.983 1.00 19.31 ? 17   LEU H HD13 1 
ATOM   2997 H  HD21 . LEU H  2 17 ? -8.537  -6.949  53.390 1.00 19.54 ? 17   LEU H HD21 1 
ATOM   2998 H  HD22 . LEU H  2 17 ? -9.997  -7.926  53.564 1.00 19.23 ? 17   LEU H HD22 1 
ATOM   2999 H  HD23 . LEU H  2 17 ? -8.754  -8.390  52.384 1.00 19.41 ? 17   LEU H HD23 1 
ATOM   3000 N  N    . VAL H  2 18 ? -13.379 -5.156  52.635 1.00 9.94  ? 18   VAL H N    1 
ATOM   3001 C  CA   . VAL H  2 18 ? -14.656 -5.809  52.796 1.00 10.67 ? 18   VAL H CA   1 
ATOM   3002 C  C    . VAL H  2 18 ? -15.754 -5.164  51.967 1.00 10.75 ? 18   VAL H C    1 
ATOM   3003 O  O    . VAL H  2 18 ? -16.490 -5.852  51.259 1.00 12.60 ? 18   VAL H O    1 
ATOM   3004 C  CB   . VAL H  2 18 ? -15.039 -5.794  54.280 1.00 10.76 ? 18   VAL H CB   1 
ATOM   3005 C  CG1  . VAL H  2 18 ? -16.449 -6.257  54.469 1.00 11.73 ? 18   VAL H CG1  1 
ATOM   3006 C  CG2  . VAL H  2 18 ? -14.045 -6.656  55.076 1.00 11.26 ? 18   VAL H CG2  1 
ATOM   3007 H  H    . VAL H  2 18 ? -13.060 -4.614  53.362 1.00 7.42  ? 18   VAL H H    1 
ATOM   3008 H  HA   . VAL H  2 18 ? -14.531 -6.830  52.496 1.00 6.54  ? 18   VAL H HA   1 
ATOM   3009 H  HB   . VAL H  2 18 ? -15.021 -4.802  54.691 1.00 10.26 ? 18   VAL H HB   1 
ATOM   3010 H  HG11 . VAL H  2 18 ? -16.613 -6.191  55.533 1.00 13.88 ? 18   VAL H HG11 1 
ATOM   3011 H  HG12 . VAL H  2 18 ? -17.129 -5.617  53.951 1.00 14.09 ? 18   VAL H HG12 1 
ATOM   3012 H  HG13 . VAL H  2 18 ? -16.559 -7.296  54.178 1.00 12.93 ? 18   VAL H HG13 1 
ATOM   3013 H  HG21 . VAL H  2 18 ? -14.175 -7.705  54.910 1.00 10.01 ? 18   VAL H HG21 1 
ATOM   3014 H  HG22 . VAL H  2 18 ? -13.005 -6.365  54.931 1.00 12.20 ? 18   VAL H HG22 1 
ATOM   3015 H  HG23 . VAL H  2 18 ? -14.263 -6.467  56.113 1.00 9.82  ? 18   VAL H HG23 1 
ATOM   3016 N  N    . CYS H  2 19 ? -15.839 -3.840  52.022 1.00 10.85 ? 19   CYS H N    1 
ATOM   3017 C  CA   . CYS H  2 19 ? -16.930 -3.149  51.360 1.00 11.30 ? 19   CYS H CA   1 
ATOM   3018 C  C    . CYS H  2 19 ? -16.779 -2.999  49.862 1.00 14.92 ? 19   CYS H C    1 
ATOM   3019 O  O    . CYS H  2 19 ? -17.763 -3.076  49.141 1.00 15.26 ? 19   CYS H O    1 
ATOM   3020 C  CB   . CYS H  2 19 ? -17.157 -1.794  52.007 1.00 10.07 ? 19   CYS H CB   1 
ATOM   3021 S  SG   . CYS H  2 19 ? -17.515 -1.927  53.786 1.00 11.65 ? 19   CYS H SG   1 
ATOM   3022 H  H    . CYS H  2 19 ? -15.140 -3.338  52.464 1.00 12.44 ? 19   CYS H H    1 
ATOM   3023 H  HA   . CYS H  2 19 ? -17.851 -3.715  51.520 1.00 11.75 ? 19   CYS H HA   1 
ATOM   3024 H  HB2  . CYS H  2 19 ? -16.274 -1.180  51.893 1.00 12.18 ? 19   CYS H HB2  1 
ATOM   3025 H  HB3  . CYS H  2 19 ? -17.981 -1.266  51.552 1.00 12.79 ? 19   CYS H HB3  1 
ATOM   3026 N  N    . GLY H  2 20 ? -15.552 -2.785  49.410 1.00 16.38 ? 20   GLY H N    1 
ATOM   3027 C  CA   . GLY H  2 20 ? -15.296 -2.621  47.994 1.00 20.31 ? 20   GLY H CA   1 
ATOM   3028 C  C    . GLY H  2 20 ? -16.178 -1.546  47.388 1.00 17.82 ? 20   GLY H C    1 
ATOM   3029 O  O    . GLY H  2 20 ? -16.321 -0.453  47.937 1.00 18.59 ? 20   GLY H O    1 
ATOM   3030 H  H    . GLY H  2 20 ? -14.800 -2.663  50.023 1.00 18.18 ? 20   GLY H H    1 
ATOM   3031 H  HA2  . GLY H  2 20 ? -14.272 -2.354  47.859 1.00 17.25 ? 20   GLY H HA2  1 
ATOM   3032 H  HA3  . GLY H  2 20 ? -15.538 -3.570  47.530 1.00 17.66 ? 20   GLY H HA3  1 
ATOM   3033 N  N    . GLU H  2 21 ? -16.791 -1.897  46.253 1.00 23.27 ? 21   GLU H N    1 
ATOM   3034 C  CA   . GLU H  2 21 ? -17.643 -0.975  45.493 1.00 21.59 ? 21   GLU H CA   1 
ATOM   3035 C  C    . GLU H  2 21 ? -18.859 -0.493  46.261 1.00 19.36 ? 21   GLU H C    1 
ATOM   3036 O  O    . GLU H  2 21 ? -19.470 0.519   45.889 1.00 19.77 ? 21   GLU H O    1 
ATOM   3037 C  CB   . GLU H  2 21 ? -18.113 -1.621  44.175 1.00 24.75 ? 21   GLU H CB   1 
ATOM   3038 C  CG   . GLU H  2 21 ? -19.195 -2.673  44.382 1.00 28.96 ? 21   GLU H CG   1 
ATOM   3039 C  CD   . GLU H  2 21 ? -19.778 -3.210  43.085 1.00 32.59 ? 21   GLU H CD   1 
ATOM   3040 O  OE1  . GLU H  2 21 ? -19.212 -2.928  42.004 1.00 40.22 ? 21   GLU H OE1  1 
ATOM   3041 O  OE2  . GLU H  2 21 ? -20.807 -3.922  43.160 1.00 40.81 ? 21   GLU H OE2  1 
ATOM   3042 H  H    . GLU H  2 21 ? -16.694 -2.828  45.952 1.00 21.13 ? 21   GLU H H    1 
ATOM   3043 H  HA   . GLU H  2 21 ? -17.068 -0.107  45.239 1.00 22.25 ? 21   GLU H HA   1 
ATOM   3044 H  HB2  . GLU H  2 21 ? -18.480 -0.845  43.523 1.00 23.84 ? 21   GLU H HB2  1 
ATOM   3045 H  HB3  . GLU H  2 21 ? -17.265 -2.098  43.698 1.00 24.13 ? 21   GLU H HB3  1 
ATOM   3046 H  HG2  . GLU H  2 21 ? -18.793 -3.489  44.955 1.00 28.06 ? 21   GLU H HG2  1 
ATOM   3047 H  HG3  . GLU H  2 21 ? -20.013 -2.253  44.963 1.00 27.79 ? 21   GLU H HG3  1 
ATOM   3048 N  N    . ARG H  2 22 ? -19.249 -1.211  47.312 1.00 16.50 ? 22   ARG H N    1 
ATOM   3049 C  CA   . ARG H  2 22 ? -20.386 -0.766  48.093 1.00 14.63 ? 22   ARG H CA   1 
ATOM   3050 C  C    . ARG H  2 22 ? -20.084 0.563   48.771 1.00 14.41 ? 22   ARG H C    1 
ATOM   3051 O  O    . ARG H  2 22 ? -20.994 1.374   49.007 1.00 17.08 ? 22   ARG H O    1 
ATOM   3052 C  CB   . ARG H  2 22 ? -20.742 -1.766  49.180 1.00 15.02 ? 22   ARG H CB   1 
ATOM   3053 C  CG   . ARG H  2 22 ? -21.482 -2.985  48.710 1.00 16.80 ? 22   ARG H CG   1 
ATOM   3054 C  CD   . ARG H  2 22 ? -21.753 -3.929  49.854 1.00 17.10 ? 22   ARG H CD   1 
ATOM   3055 N  NE   . ARG H  2 22 ? -20.539 -4.655  50.233 1.00 17.74 ? 22   ARG H NE   1 
ATOM   3056 C  CZ   . ARG H  2 22 ? -20.529 -5.679  51.083 1.00 17.22 ? 22   ARG H CZ   1 
ATOM   3057 N  NH1  . ARG H  2 22 ? -21.664 -6.070  51.648 1.00 18.45 ? 22   ARG H NH1  1 
ATOM   3058 N  NH2  . ARG H  2 22 ? -19.408 -6.351  51.335 1.00 15.22 ? 22   ARG H NH2  1 
ATOM   3059 H  H    . ARG H  2 22 ? -18.769 -2.023  47.557 1.00 17.21 ? 22   ARG H H    1 
ATOM   3060 H  HA   . ARG H  2 22 ? -21.258 -0.630  47.453 1.00 16.70 ? 22   ARG H HA   1 
ATOM   3061 H  HB2  . ARG H  2 22 ? -19.834 -2.067  49.669 1.00 16.17 ? 22   ARG H HB2  1 
ATOM   3062 H  HB3  . ARG H  2 22 ? -21.350 -1.243  49.903 1.00 14.75 ? 22   ARG H HB3  1 
ATOM   3063 H  HG2  . ARG H  2 22 ? -22.445 -2.727  48.270 1.00 16.19 ? 22   ARG H HG2  1 
ATOM   3064 H  HG3  . ARG H  2 22 ? -20.872 -3.508  47.982 1.00 15.00 ? 22   ARG H HG3  1 
ATOM   3065 H  HD2  . ARG H  2 22 ? -22.246 -3.444  50.691 1.00 15.41 ? 22   ARG H HD2  1 
ATOM   3066 H  HD3  . ARG H  2 22 ? -22.470 -4.653  49.484 1.00 18.02 ? 22   ARG H HD3  1 
ATOM   3067 H  HE   . ARG H  2 22 ? -19.698 -4.381  49.829 1.00 19.63 ? 22   ARG H HE   1 
ATOM   3068 H  HH11 . ARG H  2 22 ? -22.516 -5.595  51.439 1.00 19.35 ? 22   ARG H HH11 1 
ATOM   3069 H  HH12 . ARG H  2 22 ? -21.657 -6.842  52.280 1.00 18.69 ? 22   ARG H HH12 1 
ATOM   3070 H  HH21 . ARG H  2 22 ? -18.569 -6.069  50.872 1.00 17.94 ? 22   ARG H HH21 1 
ATOM   3071 H  HH22 . ARG H  2 22 ? -19.392 -7.113  51.976 1.00 17.94 ? 22   ARG H HH22 1 
ATOM   3072 N  N    . GLY H  2 23 ? -18.820 0.773   49.111 1.00 12.31 ? 23   GLY H N    1 
ATOM   3073 C  CA   . GLY H  2 23 ? -18.424 1.984   49.813 1.00 15.15 ? 23   GLY H CA   1 
ATOM   3074 C  C    . GLY H  2 23 ? -18.783 1.917   51.286 1.00 13.10 ? 23   GLY H C    1 
ATOM   3075 O  O    . GLY H  2 23 ? -19.390 0.937   51.783 1.00 13.49 ? 23   GLY H O    1 
ATOM   3076 H  H    . GLY H  2 23 ? -18.097 0.181   48.812 1.00 12.33 ? 23   GLY H H    1 
ATOM   3077 H  HA2  . GLY H  2 23 ? -17.370 2.103   49.685 1.00 12.61 ? 23   GLY H HA2  1 
ATOM   3078 H  HA3  . GLY H  2 23 ? -18.951 2.787   49.353 1.00 13.80 ? 23   GLY H HA3  1 
ATOM   3079 N  N    . PHE H  2 24 ? -18.427 2.962   52.012 1.00 12.12 ? 24   PHE H N    1 
ATOM   3080 C  CA   . PHE H  2 24 ? -18.704 3.047   53.431 1.00 11.17 ? 24   PHE H CA   1 
ATOM   3081 C  C    . PHE H  2 24 ? -18.466 4.466   53.921 1.00 11.22 ? 24   PHE H C    1 
ATOM   3082 O  O    . PHE H  2 24 ? -17.766 5.268   53.259 1.00 12.13 ? 24   PHE H O    1 
ATOM   3083 C  CB   . PHE H  2 24 ? -17.781 2.069   54.230 1.00 12.36 ? 24   PHE H CB   1 
ATOM   3084 C  CG   . PHE H  2 24 ? -16.302 2.362   54.090 1.00 11.79 ? 24   PHE H CG   1 
ATOM   3085 C  CD1  . PHE H  2 24 ? -15.603 1.841   53.036 1.00 11.27 ? 24   PHE H CD1  1 
ATOM   3086 C  CD2  . PHE H  2 24 ? -15.639 3.148   55.027 1.00 12.14 ? 24   PHE H CD2  1 
ATOM   3087 C  CE1  . PHE H  2 24 ? -14.219 2.096   52.902 1.00 11.10 ? 24   PHE H CE1  1 
ATOM   3088 C  CE2  . PHE H  2 24 ? -14.296 3.402   54.899 1.00 12.00 ? 24   PHE H CE2  1 
ATOM   3089 C  CZ   . PHE H  2 24 ? -13.580 2.879   53.846 1.00 12.61 ? 24   PHE H CZ   1 
ATOM   3090 H  H    . PHE H  2 24 ? -17.937 3.720   51.625 1.00 14.19 ? 24   PHE H H    1 
ATOM   3091 H  HA   . PHE H  2 24 ? -19.720 2.753   53.585 1.00 11.83 ? 24   PHE H HA   1 
ATOM   3092 H  HB2  . PHE H  2 24 ? -18.144 2.136   55.231 1.00 13.08 ? 24   PHE H HB2  1 
ATOM   3093 H  HB3  . PHE H  2 24 ? -18.027 1.093   53.857 1.00 12.16 ? 24   PHE H HB3  1 
ATOM   3094 H  HD1  . PHE H  2 24 ? -16.095 1.237   52.306 1.00 10.68 ? 24   PHE H HD1  1 
ATOM   3095 H  HD2  . PHE H  2 24 ? -16.150 3.584   55.862 1.00 9.69  ? 24   PHE H HD2  1 
ATOM   3096 H  HE1  . PHE H  2 24 ? -13.655 1.691   52.065 1.00 10.56 ? 24   PHE H HE1  1 
ATOM   3097 H  HE2  . PHE H  2 24 ? -13.822 4.015   55.652 1.00 11.48 ? 24   PHE H HE2  1 
ATOM   3098 H  HZ   . PHE H  2 24 ? -12.529 3.088   53.768 1.00 12.97 ? 24   PHE H HZ   1 
ATOM   3099 N  N    . PHE H  2 25 ? -19.018 4.766   55.094 1.00 12.08 ? 25   PHE H N    1 
ATOM   3100 C  CA   . PHE H  2 25 ? -18.802 6.032   55.772 1.00 13.35 ? 25   PHE H CA   1 
ATOM   3101 C  C    . PHE H  2 25 ? -17.863 5.698   56.933 1.00 13.99 ? 25   PHE H C    1 
ATOM   3102 O  O    . PHE H  2 25 ? -17.969 4.626   57.550 1.00 15.44 ? 25   PHE H O    1 
ATOM   3103 C  CB   . PHE H  2 25 ? -20.097 6.600   56.386 1.00 15.51 ? 25   PHE H CB   1 
ATOM   3104 C  CG   . PHE H  2 25 ? -21.219 6.838   55.408 1.00 16.96 ? 25   PHE H CG   1 
ATOM   3105 C  CD1  . PHE H  2 25 ? -20.981 7.250   54.110 1.00 19.44 ? 25   PHE H CD1  1 
ATOM   3106 C  CD2  . PHE H  2 25 ? -22.544 6.680   55.814 1.00 25.02 ? 25   PHE H CD2  1 
ATOM   3107 C  CE1  . PHE H  2 25 ? -22.038 7.508   53.233 1.00 20.17 ? 25   PHE H CE1  1 
ATOM   3108 C  CE2  . PHE H  2 25 ? -23.606 6.937   54.939 1.00 25.77 ? 25   PHE H CE2  1 
ATOM   3109 C  CZ   . PHE H  2 25 ? -23.342 7.352   53.648 1.00 24.49 ? 25   PHE H CZ   1 
ATOM   3110 H  H    . PHE H  2 25 ? -19.573 4.090   55.535 1.00 13.79 ? 25   PHE H H    1 
ATOM   3111 H  HA   . PHE H  2 25 ? -18.306 6.769   55.158 1.00 13.12 ? 25   PHE H HA   1 
ATOM   3112 H  HB2  . PHE H  2 25 ? -20.354 5.859   57.135 1.00 17.67 ? 25   PHE H HB2  1 
ATOM   3113 H  HB3  . PHE H  2 25 ? -19.802 7.484   56.905 1.00 16.84 ? 25   PHE H HB3  1 
ATOM   3114 H  HD1  . PHE H  2 25 ? -19.970 7.387   53.745 1.00 20.14 ? 25   PHE H HD1  1 
ATOM   3115 H  HD2  . PHE H  2 25 ? -22.764 6.355   56.823 1.00 21.88 ? 25   PHE H HD2  1 
ATOM   3116 H  HE1  . PHE H  2 25 ? -21.845 7.829   52.220 1.00 22.75 ? 25   PHE H HE1  1 
ATOM   3117 H  HE2  . PHE H  2 25 ? -24.620 6.808   55.284 1.00 24.45 ? 25   PHE H HE2  1 
ATOM   3118 H  HZ   . PHE H  2 25 ? -24.150 7.552   52.963 1.00 24.19 ? 25   PHE H HZ   1 
ATOM   3119 N  N    . TYR H  2 26 ? -16.947 6.602   57.227 1.00 14.61 ? 26   TYR H N    1 
ATOM   3120 C  CA   . TYR H  2 26 ? -16.072 6.451   58.379 1.00 14.80 ? 26   TYR H CA   1 
ATOM   3121 C  C    . TYR H  2 26 ? -16.323 7.684   59.222 1.00 14.54 ? 26   TYR H C    1 
ATOM   3122 O  O    . TYR H  2 26 ? -15.992 8.798   58.837 1.00 15.61 ? 26   TYR H O    1 
ATOM   3123 C  CB   . TYR H  2 26 ? -14.600 6.365   57.974 1.00 12.54 ? 26   TYR H CB   1 
ATOM   3124 C  CG   . TYR H  2 26 ? -13.665 6.260   59.150 1.00 13.27 ? 26   TYR H CG   1 
ATOM   3125 C  CD1  . TYR H  2 26 ? -13.674 5.130   59.960 1.00 15.19 ? 26   TYR H CD1  1 
ATOM   3126 C  CD2  . TYR H  2 26 ? -12.821 7.283   59.468 1.00 15.12 ? 26   TYR H CD2  1 
ATOM   3127 C  CE1  . TYR H  2 26 ? -12.848 5.039   61.052 1.00 18.42 ? 26   TYR H CE1  1 
ATOM   3128 C  CE2  . TYR H  2 26 ? -11.987 7.201   60.571 1.00 18.40 ? 26   TYR H CE2  1 
ATOM   3129 C  CZ   . TYR H  2 26 ? -12.017 6.065   61.346 1.00 19.61 ? 26   TYR H CZ   1 
ATOM   3130 O  OH   . TYR H  2 26 ? -11.196 5.925   62.439 1.00 25.56 ? 26   TYR H OH   1 
ATOM   3131 H  H    . TYR H  2 26 ? -16.827 7.353   56.613 1.00 16.33 ? 26   TYR H H    1 
ATOM   3132 H  HA   . TYR H  2 26 ? -16.380 5.575   58.935 1.00 15.59 ? 26   TYR H HA   1 
ATOM   3133 H  HB2  . TYR H  2 26 ? -14.495 5.476   57.357 1.00 14.20 ? 26   TYR H HB2  1 
ATOM   3134 H  HB3  . TYR H  2 26 ? -14.385 7.259   57.407 1.00 14.69 ? 26   TYR H HB3  1 
ATOM   3135 H  HD1  . TYR H  2 26 ? -14.330 4.319   59.719 1.00 15.48 ? 26   TYR H HD1  1 
ATOM   3136 H  HD2  . TYR H  2 26 ? -12.817 8.161   58.849 1.00 15.60 ? 26   TYR H HD2  1 
ATOM   3137 H  HE1  . TYR H  2 26 ? -12.908 4.134   61.637 1.00 19.11 ? 26   TYR H HE1  1 
ATOM   3138 H  HE2  . TYR H  2 26 ? -11.339 8.034   60.779 1.00 16.44 ? 26   TYR H HE2  1 
ATOM   3139 H  HH   . TYR H  2 26 ? -10.651 6.704   62.451 1.00 21.28 ? 26   TYR H HH   1 
ATOM   3140 N  N    A THR H  2 27 ? -16.937 7.459   60.384 0.50 16.42 ? 27   THR H N    1 
ATOM   3141 N  N    B THR H  2 27 ? -16.930 7.459   60.387 0.50 16.30 ? 27   THR H N    1 
ATOM   3142 C  CA   A THR H  2 27 ? -17.314 8.519   61.311 0.50 18.83 ? 27   THR H CA   1 
ATOM   3143 C  CA   B THR H  2 27 ? -17.295 8.529   61.304 0.50 18.63 ? 27   THR H CA   1 
ATOM   3144 C  C    A THR H  2 27 ? -16.725 8.232   62.692 0.50 18.12 ? 27   THR H C    1 
ATOM   3145 C  C    B THR H  2 27 ? -16.720 8.236   62.685 0.50 18.10 ? 27   THR H C    1 
ATOM   3146 O  O    A THR H  2 27 ? -17.378 7.638   63.557 0.50 21.03 ? 27   THR H O    1 
ATOM   3147 O  O    B THR H  2 27 ? -17.383 7.642   63.544 0.50 21.13 ? 27   THR H O    1 
ATOM   3148 C  CB   A THR H  2 27 ? -18.860 8.609   61.398 0.50 18.91 ? 27   THR H CB   1 
ATOM   3149 C  CB   B THR H  2 27 ? -18.826 8.643   61.393 0.50 18.62 ? 27   THR H CB   1 
ATOM   3150 O  OG1  A THR H  2 27 ? -19.390 7.359   61.854 0.50 22.24 ? 27   THR H OG1  1 
ATOM   3151 O  OG1  B THR H  2 27 ? -19.383 8.582   60.067 0.50 19.69 ? 27   THR H OG1  1 
ATOM   3152 C  CG2  A THR H  2 27 ? -19.452 8.920   60.011 0.50 19.89 ? 27   THR H CG2  1 
ATOM   3153 C  CG2  B THR H  2 27 ? -19.215 9.964   62.059 0.50 18.93 ? 27   THR H CG2  1 
ATOM   3154 H  H    A THR H  2 27 ? -17.155 6.532   60.588 0.50 16.50 ? 27   THR H H    1 
ATOM   3155 H  H    B THR H  2 27 ? -17.155 6.533   60.589 0.50 16.49 ? 27   THR H H    1 
ATOM   3156 H  HA   A THR H  2 27 ? -16.943 9.468   60.947 0.50 18.51 ? 27   THR H HA   1 
ATOM   3157 H  HA   B THR H  2 27 ? -16.910 9.472   60.936 0.50 18.53 ? 27   THR H HA   1 
ATOM   3158 H  HB   A THR H  2 27 ? -19.155 9.388   62.088 0.50 20.31 ? 27   THR H HB   1 
ATOM   3159 H  HB   B THR H  2 27 ? -19.227 7.821   61.965 0.50 20.09 ? 27   THR H HB   1 
ATOM   3160 H  HG1  A THR H  2 27 ? -20.344 7.411   61.945 0.50 22.90 ? 27   THR H HG1  1 
ATOM   3161 H  HG1  B THR H  2 27 ? -20.338 8.668   60.116 0.50 22.48 ? 27   THR H HG1  1 
ATOM   3162 H  HG21 A THR H  2 27 ? -20.478 9.245   60.103 0.50 20.26 ? 27   THR H HG21 1 
ATOM   3163 H  HG21 B THR H  2 27 ? -20.230 9.874   62.417 0.50 20.36 ? 27   THR H HG21 1 
ATOM   3164 H  HG22 A THR H  2 27 ? -18.874 9.687   59.520 0.50 19.75 ? 27   THR H HG22 1 
ATOM   3165 H  HG22 B THR H  2 27 ? -18.554 10.165  62.887 0.50 19.85 ? 27   THR H HG22 1 
ATOM   3166 H  HG23 A THR H  2 27 ? -19.433 8.013   59.425 0.50 19.48 ? 27   THR H HG23 1 
ATOM   3167 H  HG23 B THR H  2 27 ? -19.171 10.779  61.346 0.50 19.60 ? 27   THR H HG23 1 
ATOM   3168 N  N    . PRO H  2 28 ? -15.477 8.660   62.922 1.00 18.33 ? 28   PRO H N    1 
ATOM   3169 C  CA   . PRO H  2 28 ? -14.835 8.415   64.218 1.00 22.66 ? 28   PRO H CA   1 
ATOM   3170 C  C    . PRO H  2 28 ? -15.390 9.154   65.426 1.00 27.74 ? 28   PRO H C    1 
ATOM   3171 O  O    . PRO H  2 28 ? -15.460 8.591   66.522 1.00 31.76 ? 28   PRO H O    1 
ATOM   3172 C  CB   . PRO H  2 28 ? -13.368 8.749   63.945 1.00 23.95 ? 28   PRO H CB   1 
ATOM   3173 C  CG   . PRO H  2 28 ? -13.440 9.794   62.881 1.00 22.09 ? 28   PRO H CG   1 
ATOM   3174 C  CD   . PRO H  2 28 ? -14.555 9.332   61.990 1.00 17.90 ? 28   PRO H CD   1 
ATOM   3175 H  HA   . PRO H  2 28 ? -14.895 7.362   64.427 1.00 23.15 ? 28   PRO H HA   1 
ATOM   3176 H  HB2  . PRO H  2 28 ? -12.919 9.123   64.854 1.00 23.71 ? 28   PRO H HB2  1 
ATOM   3177 H  HB3  . PRO H  2 28 ? -12.862 7.858   63.596 1.00 23.39 ? 28   PRO H HB3  1 
ATOM   3178 H  HG2  . PRO H  2 28 ? -13.649 10.746  63.351 1.00 22.20 ? 28   PRO H HG2  1 
ATOM   3179 H  HG3  . PRO H  2 28 ? -12.504 9.850   62.347 1.00 22.15 ? 28   PRO H HG3  1 
ATOM   3180 H  HD2  . PRO H  2 28 ? -15.025 10.163  61.489 1.00 20.46 ? 28   PRO H HD2  1 
ATOM   3181 H  HD3  . PRO H  2 28 ? -14.210 8.642   61.239 1.00 20.55 ? 28   PRO H HD3  1 
ATOM   3182 N  N    . LYS H  2 29 ? -15.777 10.408  65.235 1.00 28.25 ? 29   LYS H N    1 
ATOM   3183 C  CA   . LYS H  2 29 ? -16.291 11.227  66.333 1.00 33.66 ? 29   LYS H CA   1 
ATOM   3184 C  C    . LYS H  2 29 ? -17.811 11.150  66.451 1.00 37.00 ? 29   LYS H C    1 
ATOM   3185 O  O    . LYS H  2 29 ? -18.378 10.055  66.219 1.00 40.73 ? 29   LYS H O    1 
ATOM   3186 C  CB   . LYS H  2 29 ? -15.848 12.670  66.137 1.00 33.33 ? 29   LYS H CB   1 
ATOM   3187 H  H    . LYS H  2 29 ? -15.726 10.770  64.331 1.00 28.64 ? 29   LYS H H    1 
ATOM   3188 H  HA   . LYS H  2 29 ? -15.856 10.871  67.255 1.00 31.85 ? 29   LYS H HA   1 
HETATM 3189 ZN ZN   . ZN  I  3 .  ? 0.000   0.000   9.961  0.33 11.88 ? 901  ZN  B ZN   1 
HETATM 3190 ZN ZN   . ZN  J  3 .  ? -4.270  11.129  -1.280 0.50 20.25 ? 951  ZN  B ZN   1 
HETATM 3191 ZN ZN   . ZN  K  3 .  ? -1.741  8.218   1.676  0.50 21.30 ? 961  ZN  B ZN   1 
HETATM 3192 CL CL   . CL  L  4 .  ? 0.000   0.000   7.761  0.33 19.93 ? 902  CL  B CL   1 
HETATM 3193 ZN ZN   . ZN  M  3 .  ? 0.000   0.000   25.450 0.15 11.96 ? 911  ZN  D ZN   1 
HETATM 3194 ZN ZN   . ZN  N  3 .  ? -6.415  -7.053  24.460 0.55 10.04 ? 921  ZN  D ZN   1 
HETATM 3195 CL CL   . CL  O  4 .  ? 0.000   0.000   27.603 0.15 14.49 ? 912  CL  D CL   1 
HETATM 3196 CL CL   . CL  P  4 .  ? -8.554  -6.560  24.865 0.55 10.82 ? 922  CL  D CL   1 
HETATM 3197 CL CL   . CL  Q  4 .  ? -6.006  -8.346  22.692 0.55 19.17 ? 923  CL  D CL   1 
HETATM 3198 CL CL   . CL  R  4 .  ? -16.253 7.594   41.196 1.00 18.32 ? 1101 CL  E CL   1 
HETATM 3199 ZN ZN   . ZN  S  3 .  ? 0.000   0.000   46.582 0.33 10.81 ? 931  ZN  F ZN   1 
HETATM 3200 CL CL   A CL  T  4 .  ? 0.000   0.000   44.462 0.17 16.70 ? 932  CL  F CL   1 
HETATM 3201 C  C1   . GOL U  5 .  ? -9.381  -2.996  62.961 0.50 12.64 ? 995  GOL G C1   1 
HETATM 3202 O  O1   . GOL U  5 .  ? -8.291  -2.651  63.801 0.50 18.97 ? 995  GOL G O1   1 
HETATM 3203 C  C2   . GOL U  5 .  ? -9.228  -4.373  62.367 0.50 14.89 ? 995  GOL G C2   1 
HETATM 3204 O  O2   . GOL U  5 .  ? -8.136  -4.397  61.452 0.50 18.25 ? 995  GOL G O2   1 
HETATM 3205 C  C3   . GOL U  5 .  ? -10.515 -4.744  61.677 0.50 17.61 ? 995  GOL G C3   1 
HETATM 3206 O  O3   . GOL U  5 .  ? -10.513 -6.080  61.216 0.50 22.69 ? 995  GOL G O3   1 
HETATM 3207 H  H11  . GOL U  5 .  ? -9.386  -2.325  62.114 0.50 16.70 ? 995  GOL G H11  1 
HETATM 3208 H  H12  . GOL U  5 .  ? -10.321 -2.903  63.473 0.50 16.25 ? 995  GOL G H12  1 
HETATM 3209 H  HO1  . GOL U  5 .  ? -8.285  -3.248  64.557 0.50 17.37 ? 995  GOL G HO1  1 
HETATM 3210 H  H2   . GOL U  5 .  ? -9.037  -5.076  63.160 0.50 16.42 ? 995  GOL G H2   1 
HETATM 3211 H  HO2  . GOL U  5 .  ? -8.318  -3.787  60.735 0.50 17.04 ? 995  GOL G HO2  1 
HETATM 3212 H  H31  . GOL U  5 .  ? -11.348 -4.567  62.341 0.50 18.24 ? 995  GOL G H31  1 
HETATM 3213 H  H32  . GOL U  5 .  ? -10.579 -4.086  60.826 0.50 18.00 ? 995  GOL G H32  1 
HETATM 3214 H  HO3  . GOL U  5 .  ? -11.362 -6.257  60.801 0.50 18.73 ? 995  GOL G HO3  1 
HETATM 3215 C  C    . ACN V  6 .  ? -15.652 -10.470 54.192 1.00 14.76 ? 991  ACN G C    1 
HETATM 3216 O  O    . ACN V  6 .  ? -15.536 -9.789  53.173 1.00 18.09 ? 991  ACN G O    1 
HETATM 3217 C  C1   . ACN V  6 .  ? -14.650 -11.553 54.478 1.00 15.44 ? 991  ACN G C1   1 
HETATM 3218 C  C2   . ACN V  6 .  ? -16.804 -10.247 55.146 1.00 16.52 ? 991  ACN G C2   1 
HETATM 3219 H  H11  . ACN V  6 .  ? -14.946 -12.426 53.933 1.00 15.18 ? 991  ACN G H11  1 
HETATM 3220 H  H12  . ACN V  6 .  ? -14.697 -11.789 55.543 1.00 17.71 ? 991  ACN G H12  1 
HETATM 3221 H  H13  . ACN V  6 .  ? -13.651 -11.262 54.195 1.00 16.41 ? 991  ACN G H13  1 
HETATM 3222 H  H21  . ACN V  6 .  ? -17.740 -10.097 54.637 1.00 16.90 ? 991  ACN G H21  1 
HETATM 3223 H  H22  . ACN V  6 .  ? -16.560 -9.388  55.762 1.00 16.39 ? 991  ACN G H22  1 
HETATM 3224 H  H23  . ACN V  6 .  ? -16.867 -11.114 55.777 1.00 17.05 ? 991  ACN G H23  1 
HETATM 3225 ZN ZN   . ZN  W  3 .  ? 0.000   0.000   61.609 0.33 14.19 ? 941  ZN  H ZN   1 
HETATM 3226 CL CL   . CL  X  4 .  ? 0.000   0.000   63.860 0.33 19.81 ? 942  CL  H CL   1 
HETATM 3227 O  O    . HOH Y  7 .  ? -19.364 11.294  6.585  1.00 17.75 ? 1108 HOH A O    1 
HETATM 3228 O  O    . HOH Y  7 .  ? -7.471  11.462  7.005  1.00 17.33 ? 1111 HOH A O    1 
HETATM 3229 O  O    . HOH Y  7 .  ? -15.707 15.126  8.570  1.00 20.22 ? 1131 HOH A O    1 
HETATM 3230 O  O    . HOH Y  7 .  ? -5.039  13.556  8.456  1.00 22.30 ? 1133 HOH A O    1 
HETATM 3231 O  O    . HOH Y  7 .  ? -5.718  19.712  10.150 1.00 23.55 ? 1151 HOH A O    1 
HETATM 3232 O  O    . HOH Y  7 .  ? -17.493 5.011   6.065  1.00 25.79 ? 1155 HOH A O    1 
HETATM 3233 O  O    . HOH Y  7 .  ? -11.464 21.278  7.566  1.00 25.71 ? 1164 HOH A O    1 
HETATM 3234 O  O    . HOH Y  7 .  ? -15.654 18.987  14.054 1.00 26.71 ? 1176 HOH A O    1 
HETATM 3235 O  O    . HOH Y  7 .  ? -12.094 14.600  3.226  1.00 30.05 ? 1180 HOH A O    1 
HETATM 3236 O  O    . HOH Y  7 .  ? -20.155 17.753  13.606 1.00 32.25 ? 1198 HOH A O    1 
HETATM 3237 O  O    . HOH Y  7 .  ? -23.632 8.456   20.978 1.00 40.44 ? 1235 HOH A O    1 
HETATM 3238 O  O    . HOH Y  7 .  ? -14.661 20.670  16.046 1.00 36.94 ? 1249 HOH A O    1 
HETATM 3239 O  O    . HOH Y  7 .  ? -16.721 19.666  8.347  1.00 35.01 ? 1251 HOH A O    1 
HETATM 3240 O  O    . HOH Y  7 .  ? -6.221  21.218  8.025  1.00 39.69 ? 1256 HOH A O    1 
HETATM 3241 O  O    . HOH Y  7 .  ? -18.806 19.901  10.655 1.00 35.76 ? 1270 HOH A O    1 
HETATM 3242 O  O    . HOH Y  7 .  ? -19.164 15.763  23.578 1.00 38.58 ? 1292 HOH A O    1 
HETATM 3243 O  O    . HOH Y  7 .  ? -18.801 10.690  2.735  1.00 31.76 ? 1315 HOH A O    1 
HETATM 3244 O  O    . HOH Y  7 .  ? -18.780 7.119   9.525  1.00 18.87 ? 1316 HOH A O    1 
HETATM 3245 O  O    . HOH Y  7 .  ? -10.140 21.941  15.374 1.00 43.61 ? 1453 HOH A O    1 
HETATM 3246 O  O    . HOH Y  7 .  ? -20.196 13.199  15.801 0.50 14.03 ? 1826 HOH A O    1 
HETATM 3247 O  O    A HOH Y  7 .  ? -16.331 18.537  5.972  0.60 27.14 ? 1830 HOH A O    1 
HETATM 3248 O  O    B HOH Y  7 .  ? -16.996 -17.098 54.115 0.40 20.09 ? 1830 HOH A O    1 
HETATM 3249 O  O    A HOH Y  7 .  ? -10.889 16.706  3.568  0.67 24.77 ? 1836 HOH A O    1 
HETATM 3250 O  O    B HOH Y  7 .  ? -10.036 17.870  4.115  0.33 21.41 ? 1836 HOH A O    1 
HETATM 3251 O  O    A HOH Y  7 .  ? -8.614  22.625  13.268 0.50 28.51 ? 1842 HOH A O    1 
HETATM 3252 O  O    B HOH Y  7 .  ? -8.491  21.500  11.006 0.50 20.69 ? 1842 HOH A O    1 
HETATM 3253 O  O    . HOH Y  7 .  ? -13.720 10.368  -0.778 0.70 23.73 ? 1856 HOH A O    1 
HETATM 3254 O  O    . HOH Z  7 .  ? -1.929  11.314  -0.689 0.50 17.30 ? 952  HOH B O    1 
HETATM 3255 O  O    . HOH Z  7 .  ? -6.200  12.744  -1.679 0.50 21.33 ? 953  HOH B O    1 
HETATM 3256 O  O    . HOH Z  7 .  ? -0.931  8.656   0.087  0.50 15.16 ? 962  HOH B O    1 
HETATM 3257 O  O    . HOH Z  7 .  ? -0.849  9.331   3.298  0.50 16.06 ? 963  HOH B O    1 
HETATM 3258 O  O    . HOH Z  7 .  ? -1.161  6.311   2.430  0.50 24.32 ? 964  HOH B O    1 
HETATM 3259 O  O    . HOH Z  7 .  ? -17.191 6.609   11.854 1.00 13.79 ? 1105 HOH B O    1 
HETATM 3260 O  O    . HOH Z  7 .  ? -11.623 8.934   22.429 1.00 16.91 ? 1112 HOH B O    1 
HETATM 3261 O  O    . HOH Z  7 .  ? -11.032 2.381   7.483  1.00 18.34 ? 1119 HOH B O    1 
HETATM 3262 O  O    . HOH Z  7 .  ? -7.773  10.288  24.241 1.00 17.88 ? 1123 HOH B O    1 
HETATM 3263 O  O    . HOH Z  7 .  ? -1.691  19.120  15.752 1.00 22.12 ? 1134 HOH B O    1 
HETATM 3264 O  O    . HOH Z  7 .  ? -4.007  12.691  24.227 1.00 22.42 ? 1138 HOH B O    1 
HETATM 3265 O  O    . HOH Z  7 .  ? -6.526  12.891  23.710 1.00 22.07 ? 1139 HOH B O    1 
HETATM 3266 O  O    . HOH Z  7 .  ? -2.700  6.409   13.572 1.00 23.82 ? 1142 HOH B O    1 
HETATM 3267 O  O    . HOH Z  7 .  ? 1.815   14.998  7.541  1.00 24.86 ? 1144 HOH B O    1 
HETATM 3268 O  O    . HOH Z  7 .  ? 1.424   19.267  12.086 1.00 25.73 ? 1147 HOH B O    1 
HETATM 3269 O  O    . HOH Z  7 .  ? -13.076 -2.075  9.399  1.00 27.18 ? 1169 HOH B O    1 
HETATM 3270 O  O    . HOH Z  7 .  ? -17.534 9.000   27.043 1.00 28.03 ? 1175 HOH B O    1 
HETATM 3271 O  O    . HOH Z  7 .  ? -5.963  -1.907  9.859  1.00 28.55 ? 1177 HOH B O    1 
HETATM 3272 O  O    . HOH Z  7 .  ? -0.929  6.583   10.813 1.00 25.90 ? 1182 HOH B O    1 
HETATM 3273 O  O    . HOH Z  7 .  ? -2.692  0.113   14.470 1.00 28.33 ? 1185 HOH B O    1 
HETATM 3274 O  O    . HOH Z  7 .  ? 0.000   0.000   14.207 0.33 29.47 ? 1214 HOH B O    1 
HETATM 3275 O  O    . HOH Z  7 .  ? -3.962  17.928  8.738  1.00 36.22 ? 1227 HOH B O    1 
HETATM 3276 O  O    . HOH Z  7 .  ? -17.717 16.558  20.008 1.00 34.57 ? 1232 HOH B O    1 
HETATM 3277 O  O    . HOH Z  7 .  ? -3.530  20.578  11.744 1.00 35.38 ? 1239 HOH B O    1 
HETATM 3278 O  O    . HOH Z  7 .  ? -18.243 -1.263  3.820  1.00 39.91 ? 1260 HOH B O    1 
HETATM 3279 O  O    . HOH Z  7 .  ? -4.740  0.318   8.217  1.00 40.13 ? 1271 HOH B O    1 
HETATM 3280 O  O    . HOH Z  7 .  ? -7.140  18.447  4.761  1.00 38.46 ? 1280 HOH B O    1 
HETATM 3281 O  O    . HOH Z  7 .  ? -9.241  11.936  28.056 1.00 40.13 ? 1283 HOH B O    1 
HETATM 3282 O  O    . HOH Z  7 .  ? -5.770  17.964  2.491  1.00 39.07 ? 1285 HOH B O    1 
HETATM 3283 O  O    . HOH Z  7 .  ? -17.766 13.612  29.438 1.00 41.43 ? 1289 HOH B O    1 
HETATM 3284 O  O    . HOH Z  7 .  ? -8.892  15.593  22.738 1.00 41.28 ? 1291 HOH B O    1 
HETATM 3285 O  O    . HOH Z  7 .  ? -10.818 14.706  26.781 1.00 34.42 ? 1321 HOH B O    1 
HETATM 3286 O  O    . HOH Z  7 .  ? -0.690  19.204  8.668  1.00 41.32 ? 1451 HOH B O    1 
HETATM 3287 O  O    . HOH Z  7 .  ? -17.951 18.264  22.011 1.00 43.50 ? 1455 HOH B O    1 
HETATM 3288 O  O    . HOH Z  7 .  ? -16.156 19.581  23.693 1.00 38.82 ? 1457 HOH B O    1 
HETATM 3289 O  O    . HOH Z  7 .  ? -23.355 4.415   3.471  0.80 31.72 ? 1802 HOH B O    1 
HETATM 3290 O  O    . HOH Z  7 .  ? -22.369 4.487   9.083  0.40 20.87 ? 1809 HOH B O    1 
HETATM 3291 O  O    . HOH Z  7 .  ? -1.548  10.705  2.552  0.60 25.94 ? 1810 HOH B O    1 
HETATM 3292 O  O    . HOH Z  7 .  ? -2.117  5.826   1.409  0.60 25.88 ? 1811 HOH B O    1 
HETATM 3293 O  O    A HOH Z  7 .  ? -3.615  4.354   7.656  0.50 15.09 ? 1820 HOH B O    1 
HETATM 3294 O  O    B HOH Z  7 .  ? -3.386  4.261   5.561  0.50 26.82 ? 1820 HOH B O    1 
HETATM 3295 O  O    A HOH Z  7 .  ? -2.246  3.998   14.787 0.50 18.43 ? 1822 HOH B O    1 
HETATM 3296 O  O    B HOH Z  7 .  ? -2.610  2.472   15.892 0.50 27.82 ? 1822 HOH B O    1 
HETATM 3297 O  O    . HOH AA 7 .  ? -9.984  -6.582  27.859 1.00 15.21 ? 1114 HOH C O    1 
HETATM 3298 O  O    . HOH AA 7 .  ? -21.203 0.173   19.457 1.00 21.35 ? 1128 HOH C O    1 
HETATM 3299 O  O    . HOH AA 7 .  ? -24.883 -5.453  22.500 1.00 22.70 ? 1132 HOH C O    1 
HETATM 3300 O  O    . HOH AA 7 .  ? -8.109  -10.249 34.242 1.00 22.95 ? 1148 HOH C O    1 
HETATM 3301 O  O    . HOH AA 7 .  ? -25.650 -6.267  25.983 1.00 29.29 ? 1159 HOH C O    1 
HETATM 3302 O  O    . HOH AA 7 .  ? -19.079 1.508   27.084 1.00 27.66 ? 1162 HOH C O    1 
HETATM 3303 O  O    . HOH AA 7 .  ? -11.415 -14.956 23.015 1.00 27.52 ? 1170 HOH C O    1 
HETATM 3304 O  O    . HOH AA 7 .  ? -17.006 2.584   30.254 1.00 30.27 ? 1188 HOH C O    1 
HETATM 3305 O  O    . HOH AA 7 .  ? -15.865 -12.283 32.708 1.00 30.92 ? 1200 HOH C O    1 
HETATM 3306 O  O    . HOH AA 7 .  ? -12.009 -17.330 24.235 1.00 34.43 ? 1222 HOH C O    1 
HETATM 3307 O  O    . HOH AA 7 .  ? -20.916 -2.838  29.689 1.00 33.03 ? 1224 HOH C O    1 
HETATM 3308 O  O    . HOH AA 7 .  ? -26.565 -1.229  15.421 1.00 41.02 ? 1237 HOH C O    1 
HETATM 3309 O  O    . HOH AA 7 .  ? -16.117 -18.624 17.502 1.00 29.37 ? 1238 HOH C O    1 
HETATM 3310 O  O    . HOH AA 7 .  ? -24.159 -6.427  13.964 1.00 40.06 ? 1247 HOH C O    1 
HETATM 3311 O  O    . HOH AA 7 .  ? -13.804 -13.341 30.471 1.00 38.58 ? 1254 HOH C O    1 
HETATM 3312 O  O    . HOH AA 7 .  ? -20.240 0.628   34.438 1.00 40.83 ? 1290 HOH C O    1 
HETATM 3313 O  O    . HOH AA 7 .  ? -20.358 2.988   14.989 0.50 21.35 ? 1800 HOH C O    1 
HETATM 3314 O  O    A HOH AA 7 .  ? -17.865 -16.413 16.940 0.70 25.11 ? 1844 HOH C O    1 
HETATM 3315 O  O    B HOH AA 7 .  ? -18.193 -14.177 16.184 0.30 22.78 ? 1844 HOH C O    1 
HETATM 3316 O  O    . HOH AA 7 .  ? -13.739 -10.353 31.686 0.50 22.10 ? 1846 HOH C O    1 
HETATM 3317 O  O    . HOH AA 7 .  ? -14.885 -6.999  34.534 0.50 37.40 ? 1862 HOH C O    1 
HETATM 3318 O  O    . HOH AA 7 .  ? -19.300 -7.199  27.236 0.70 22.98 ? 1927 HOH C O    1 
HETATM 3319 O  O    A HOH AA 7 .  ? -5.896  -3.846  29.843 0.33 15.39 ? 1935 HOH C O    1 
HETATM 3320 O  O    B HOH AA 7 .  ? -7.121  -4.079  28.233 0.33 15.24 ? 1935 HOH C O    1 
HETATM 3321 O  O    C HOH AA 7 .  ? -6.890  -5.203  29.742 0.33 29.74 ? 1935 HOH C O    1 
HETATM 3322 O  O    . HOH AA 7 .  ? -24.607 1.094   11.912 0.50 35.56 ? 2122 HOH C O    1 
HETATM 3323 O  O    . HOH BA 7 .  ? -2.275  0.813   25.050 0.55 12.39 ? 971  HOH D O    1 
HETATM 3324 O  O    . HOH BA 7 .  ? -20.205 0.172   9.775  1.00 20.24 ? 1122 HOH D O    1 
HETATM 3325 O  O    . HOH BA 7 .  ? -2.327  -0.723  33.338 1.00 20.99 ? 1125 HOH D O    1 
HETATM 3326 O  O    . HOH BA 7 .  ? -6.515  5.346   34.934 1.00 20.47 ? 1129 HOH D O    1 
HETATM 3327 O  O    . HOH BA 7 .  ? -17.849 1.691   24.407 1.00 21.71 ? 1130 HOH D O    1 
HETATM 3328 O  O    . HOH BA 7 .  ? 0.000   0.000   31.794 0.33 23.75 ? 1150 HOH D O    1 
HETATM 3329 O  O    . HOH BA 7 .  ? -16.068 -7.435  8.724  1.00 23.22 ? 1152 HOH D O    1 
HETATM 3330 O  O    . HOH BA 7 .  ? -8.836  8.027   31.412 1.00 26.13 ? 1158 HOH D O    1 
HETATM 3331 O  O    . HOH BA 7 .  ? -19.828 0.320   22.569 1.00 25.06 ? 1161 HOH D O    1 
HETATM 3332 O  O    . HOH BA 7 .  ? -6.398  7.362   32.586 1.00 27.39 ? 1163 HOH D O    1 
HETATM 3333 O  O    . HOH BA 7 .  ? -10.378 6.169   27.122 1.00 28.04 ? 1178 HOH D O    1 
HETATM 3334 O  O    . HOH BA 7 .  ? -5.445  -4.411  20.901 1.00 29.03 ? 1179 HOH D O    1 
HETATM 3335 O  O    . HOH BA 7 .  ? 0.695   -2.729  21.794 1.00 36.30 ? 1225 HOH D O    1 
HETATM 3336 O  O    . HOH BA 7 .  ? -11.087 2.810   34.753 1.00 35.59 ? 1233 HOH D O    1 
HETATM 3337 O  O    . HOH BA 7 .  ? -20.719 3.843   29.702 1.00 42.15 ? 1273 HOH D O    1 
HETATM 3338 O  O    . HOH BA 7 .  ? -3.891  -3.613  37.982 1.00 37.68 ? 1281 HOH D O    1 
HETATM 3339 O  O    . HOH BA 7 .  ? -23.562 -9.172  13.825 1.00 36.27 ? 1299 HOH D O    1 
HETATM 3340 O  O    . HOH BA 7 .  ? -1.867  -1.773  23.208 0.55 18.85 ? 1801 HOH D O    1 
HETATM 3341 O  O    . HOH BA 7 .  ? -2.462  0.746   43.140 0.50 28.53 ? 1803 HOH D O    1 
HETATM 3342 O  O    . HOH BA 7 .  ? 0.000   0.000   26.278 0.18 14.93 ? 1814 HOH D O    1 
HETATM 3343 O  O    A HOH BA 7 .  ? -13.738 -2.497  12.170 0.60 14.61 ? 1824 HOH D O    1 
HETATM 3344 O  O    B HOH BA 7 .  ? -14.487 -2.248  13.388 0.40 12.59 ? 1824 HOH D O    1 
HETATM 3345 O  O    A HOH BA 7 .  ? -7.198  3.149   37.289 0.50 23.05 ? 1832 HOH D O    1 
HETATM 3346 O  O    B HOH BA 7 .  ? -8.173  2.470   38.160 0.50 29.02 ? 1832 HOH D O    1 
HETATM 3347 O  O    . HOH BA 7 .  ? -3.341  7.736   33.075 0.50 23.89 ? 1860 HOH D O    1 
HETATM 3348 O  O    A HOH BA 7 .  ? -6.406  -2.982  15.393 0.50 18.02 ? 1864 HOH D O    1 
HETATM 3349 O  O    B HOH BA 7 .  ? -4.017  -2.117  16.130 0.50 25.01 ? 1864 HOH D O    1 
HETATM 3350 O  O    A HOH BA 7 .  ? -8.494  10.088  26.726 0.60 19.89 ? 1905 HOH D O    1 
HETATM 3351 O  O    B HOH BA 7 .  ? -9.885  8.371   27.834 0.40 19.63 ? 1905 HOH D O    1 
HETATM 3352 O  O    C HOH BA 7 .  ? -8.400  8.101   28.623 0.60 20.07 ? 1905 HOH D O    1 
HETATM 3353 O  O    D HOH BA 7 .  ? -9.384  8.873   26.507 0.50 21.94 ? 1905 HOH D O    1 
HETATM 3354 O  O    A HOH BA 7 .  ? 0.000   0.000   17.880 0.17 31.13 ? 1950 HOH D O    1 
HETATM 3355 O  O    B HOH BA 7 .  ? 1.552   0.020   18.060 0.50 31.62 ? 1950 HOH D O    1 
HETATM 3356 O  O    . HOH CA 7 .  ? -5.367  12.144  43.383 1.00 14.43 ? 1104 HOH E O    1 
HETATM 3357 O  O    . HOH CA 7 .  ? -18.639 17.313  50.480 1.00 16.81 ? 1110 HOH E O    1 
HETATM 3358 O  O    . HOH CA 7 .  ? -2.902  19.933  46.407 1.00 19.62 ? 1124 HOH E O    1 
HETATM 3359 O  O    . HOH CA 7 .  ? -17.284 13.569  42.483 1.00 20.46 ? 1137 HOH E O    1 
HETATM 3360 O  O    . HOH CA 7 .  ? -9.582  15.564  39.349 1.00 25.81 ? 1153 HOH E O    1 
HETATM 3361 O  O    . HOH CA 7 .  ? -16.838 12.579  39.083 1.00 25.32 ? 1154 HOH E O    1 
HETATM 3362 O  O    . HOH CA 7 .  ? -13.218 6.350   36.869 1.00 28.14 ? 1165 HOH E O    1 
HETATM 3363 O  O    . HOH CA 7 .  ? -8.209  22.480  43.643 1.00 27.39 ? 1171 HOH E O    1 
HETATM 3364 O  O    . HOH CA 7 .  ? -18.845 17.314  53.114 1.00 30.29 ? 1174 HOH E O    1 
HETATM 3365 O  O    . HOH CA 7 .  ? -13.077 20.958  49.797 1.00 29.04 ? 1187 HOH E O    1 
HETATM 3366 O  O    . HOH CA 7 .  ? -9.020  4.693   36.239 1.00 30.80 ? 1190 HOH E O    1 
HETATM 3367 O  O    . HOH CA 7 .  ? -11.136 22.202  51.464 1.00 31.27 ? 1191 HOH E O    1 
HETATM 3368 O  O    . HOH CA 7 .  ? -15.014 19.018  55.558 1.00 33.11 ? 1207 HOH E O    1 
HETATM 3369 O  O    . HOH CA 7 .  ? -11.402 11.314  35.367 1.00 32.10 ? 1240 HOH E O    1 
HETATM 3370 O  O    . HOH CA 7 .  ? -5.529  5.017   37.707 1.00 38.37 ? 1244 HOH E O    1 
HETATM 3371 O  O    . HOH CA 7 .  ? -13.996 21.721  44.858 1.00 35.85 ? 1248 HOH E O    1 
HETATM 3372 O  O    . HOH CA 7 .  ? -22.488 10.866  57.589 1.00 36.06 ? 1253 HOH E O    1 
HETATM 3373 O  O    . HOH CA 7 .  ? -20.859 13.056  59.549 1.00 35.61 ? 1255 HOH E O    1 
HETATM 3374 O  O    . HOH CA 7 .  ? -6.494  19.082  40.262 1.00 38.91 ? 1261 HOH E O    1 
HETATM 3375 O  O    . HOH CA 7 .  ? -3.018  22.585  45.224 1.00 39.53 ? 1263 HOH E O    1 
HETATM 3376 O  O    . HOH CA 7 .  ? -12.605 21.265  53.376 1.00 42.62 ? 1274 HOH E O    1 
HETATM 3377 O  O    . HOH CA 7 .  ? -15.688 23.451  52.878 1.00 42.24 ? 1298 HOH E O    1 
HETATM 3378 O  O    . HOH CA 7 .  ? -5.035  14.822  36.168 1.00 31.99 ? 1319 HOH E O    1 
HETATM 3379 O  O    . HOH CA 7 .  ? -9.083  16.190  36.576 1.00 39.37 ? 1320 HOH E O    1 
HETATM 3380 O  O    . HOH CA 7 .  ? -1.740  21.423  48.218 1.00 30.46 ? 1322 HOH E O    1 
HETATM 3381 O  O    . HOH CA 7 .  ? -13.446 17.638  41.805 0.60 23.96 ? 1807 HOH E O    1 
HETATM 3382 O  O    A HOH CA 7 .  ? -13.495 17.058  44.792 0.60 22.49 ? 1848 HOH E O    1 
HETATM 3383 O  O    B HOH CA 7 .  ? -13.572 16.157  44.231 0.40 16.99 ? 1848 HOH E O    1 
HETATM 3384 O  O    A HOH CA 7 .  ? -1.127  21.676  50.605 0.60 28.50 ? 1868 HOH E O    1 
HETATM 3385 O  O    B HOH CA 7 .  ? -18.263 -12.414 52.721 0.40 28.56 ? 1868 HOH E O    1 
HETATM 3386 O  O    . HOH CA 7 .  ? -20.656 10.592  55.664 0.50 24.49 ? 1926 HOH E O    1 
HETATM 3387 O  O    A HOH CA 7 .  ? -15.209 19.205  52.823 0.33 17.57 ? 1945 HOH E O    1 
HETATM 3388 O  O    B HOH CA 7 .  ? -16.247 17.983  52.468 0.33 18.57 ? 1945 HOH E O    1 
HETATM 3389 O  O    B HOH DA 7 .  ? 0.686   1.120   44.530 0.50 14.23 ? 933  HOH F O    1 
HETATM 3390 O  O    . HOH DA 7 .  ? -17.441 9.571   45.569 1.00 12.73 ? 1102 HOH F O    1 
HETATM 3391 O  O    . HOH DA 7 .  ? -16.176 8.990   48.129 1.00 12.66 ? 1103 HOH F O    1 
HETATM 3392 O  O    . HOH DA 7 .  ? -19.249 11.658  45.329 1.00 14.82 ? 1106 HOH F O    1 
HETATM 3393 O  O    . HOH DA 7 .  ? 1.743   5.780   46.876 1.00 16.83 ? 1107 HOH F O    1 
HETATM 3394 O  O    . HOH DA 7 .  ? -20.281 3.420   46.421 1.00 16.75 ? 1109 HOH F O    1 
HETATM 3395 O  O    . HOH DA 7 .  ? -10.392 3.487   44.223 1.00 17.91 ? 1115 HOH F O    1 
HETATM 3396 O  O    . HOH DA 7 .  ? -10.615 10.421  58.871 1.00 19.14 ? 1118 HOH F O    1 
HETATM 3397 O  O    . HOH DA 7 .  ? 0.681   8.789   39.651 1.00 20.53 ? 1120 HOH F O    1 
HETATM 3398 O  O    . HOH DA 7 .  ? -6.097  3.240   55.568 1.00 21.31 ? 1126 HOH F O    1 
HETATM 3399 O  O    . HOH DA 7 .  ? 1.067   19.939  51.687 1.00 19.45 ? 1127 HOH F O    1 
HETATM 3400 O  O    . HOH DA 7 .  ? -2.500  13.976  44.496 1.00 21.78 ? 1135 HOH F O    1 
HETATM 3401 O  O    . HOH DA 7 .  ? -1.037  18.210  45.214 1.00 21.97 ? 1136 HOH F O    1 
HETATM 3402 O  O    . HOH DA 7 .  ? -0.003  7.155   58.017 1.00 21.98 ? 1140 HOH F O    1 
HETATM 3403 O  O    . HOH DA 7 .  ? 4.268   18.534  48.252 1.00 23.89 ? 1143 HOH F O    1 
HETATM 3404 O  O    . HOH DA 7 .  ? -2.566  17.228  43.179 1.00 23.72 ? 1145 HOH F O    1 
HETATM 3405 O  O    . HOH DA 7 .  ? 0.031   6.815   41.819 1.00 27.62 ? 1149 HOH F O    1 
HETATM 3406 O  O    . HOH DA 7 .  ? -1.599  3.896   51.609 1.00 26.44 ? 1156 HOH F O    1 
HETATM 3407 O  O    . HOH DA 7 .  ? -6.156  15.214  59.714 1.00 31.60 ? 1172 HOH F O    1 
HETATM 3408 O  O    . HOH DA 7 .  ? 0.774   20.726  47.401 1.00 26.06 ? 1173 HOH F O    1 
HETATM 3409 O  O    . HOH DA 7 .  ? 0.000   0.000   51.835 0.33 31.59 ? 1181 HOH F O    1 
HETATM 3410 O  O    . HOH DA 7 .  ? -2.600  0.665   51.238 1.00 36.39 ? 1193 HOH F O    1 
HETATM 3411 O  O    . HOH DA 7 .  ? -1.796  6.934   50.589 1.00 28.77 ? 1199 HOH F O    1 
HETATM 3412 O  O    . HOH DA 7 .  ? -14.166 1.366   42.298 1.00 32.30 ? 1203 HOH F O    1 
HETATM 3413 O  O    . HOH DA 7 .  ? -21.321 10.258  48.404 1.00 36.39 ? 1231 HOH F O    1 
HETATM 3414 O  O    . HOH DA 7 .  ? -8.268  17.196  59.525 1.00 38.23 ? 1266 HOH F O    1 
HETATM 3415 O  O    . HOH DA 7 .  ? -13.885 2.352   35.985 1.00 44.86 ? 1297 HOH F O    1 
HETATM 3416 O  O    . HOH DA 7 .  ? -11.095 1.841   42.305 1.00 27.21 ? 1317 HOH F O    1 
HETATM 3417 O  O    . HOH DA 7 .  ? -10.050 1.741   39.715 1.00 41.83 ? 1318 HOH F O    1 
HETATM 3418 O  O    . HOH DA 7 .  ? -3.617  19.227  41.825 1.00 41.54 ? 1323 HOH F O    1 
HETATM 3419 O  O    . HOH DA 7 .  ? -2.815  4.847   44.391 1.00 17.27 ? 1452 HOH F O    1 
HETATM 3420 O  O    . HOH DA 7 .  ? -11.559 18.624  62.379 1.00 37.74 ? 1456 HOH F O    1 
HETATM 3421 O  O    . HOH DA 7 .  ? -8.852  16.919  62.156 0.50 28.11 ? 1808 HOH F O    1 
HETATM 3422 O  O    A HOH DA 7 .  ? 0.000   0.000   54.549 0.17 20.19 ? 1870 HOH F O    1 
HETATM 3423 O  O    B HOH DA 7 .  ? 0.000   0.000   55.779 0.17 22.54 ? 1870 HOH F O    1 
HETATM 3424 O  O    . HOH DA 7 .  ? 1.371   19.473  44.880 0.50 27.93 ? 1910 HOH F O    1 
HETATM 3425 O  O    A HOH DA 7 .  ? 3.663   17.681  45.628 0.50 23.61 ? 1911 HOH F O    1 
HETATM 3426 O  O    B HOH DA 7 .  ? -15.944 -4.334  44.746 0.50 21.70 ? 1911 HOH F O    1 
HETATM 3427 O  O    C HOH DA 7 .  ? 4.135   14.734  44.481 0.50 18.03 ? 1911 HOH F O    1 
HETATM 3428 O  O    . HOH DA 7 .  ? -13.735 0.861   45.210 0.60 19.05 ? 1930 HOH F O    1 
HETATM 3429 O  O    . HOH DA 7 .  ? -6.377  10.532  61.004 0.67 25.38 ? 2142 HOH F O    1 
HETATM 3430 O  O    . HOH EA 7 .  ? -21.546 -9.636  57.543 1.00 17.61 ? 1116 HOH G O    1 
HETATM 3431 O  O    . HOH EA 7 .  ? -21.302 3.245   56.043 1.00 18.31 ? 1117 HOH G O    1 
HETATM 3432 O  O    . HOH EA 7 .  ? -12.397 -13.740 56.999 1.00 20.44 ? 1121 HOH G O    1 
HETATM 3433 O  O    . HOH EA 7 .  ? -15.807 5.717   66.892 1.00 26.10 ? 1146 HOH G O    1 
HETATM 3434 O  O    . HOH EA 7 .  ? -13.810 -15.268 55.127 1.00 26.20 ? 1160 HOH G O    1 
HETATM 3435 O  O    . HOH EA 7 .  ? -18.235 -9.231  69.327 1.00 27.26 ? 1168 HOH G O    1 
HETATM 3436 O  O    . HOH EA 7 .  ? -20.776 -4.915  63.678 1.00 29.20 ? 1186 HOH G O    1 
HETATM 3437 O  O    . HOH EA 7 .  ? -23.821 -3.157  52.714 1.00 31.32 ? 1194 HOH G O    1 
HETATM 3438 O  O    . HOH EA 7 .  ? -18.941 4.914   63.810 1.00 31.31 ? 1196 HOH G O    1 
HETATM 3439 O  O    . HOH EA 7 .  ? -16.121 -5.392  69.283 1.00 33.12 ? 1204 HOH G O    1 
HETATM 3440 O  O    . HOH EA 7 .  ? -19.665 1.698   70.369 1.00 37.50 ? 1242 HOH G O    1 
HETATM 3441 O  O    . HOH EA 7 .  ? -22.320 5.229   66.901 1.00 39.96 ? 1246 HOH G O    1 
HETATM 3442 O  O    . HOH EA 7 .  ? -13.144 -11.724 65.876 1.00 40.85 ? 1257 HOH G O    1 
HETATM 3443 O  O    . HOH EA 7 .  ? -25.496 2.669   48.598 1.00 39.53 ? 1276 HOH G O    1 
HETATM 3444 O  O    . HOH EA 7 .  ? -27.176 0.353   49.642 1.00 38.83 ? 1293 HOH G O    1 
HETATM 3445 O  O    . HOH EA 7 .  ? -24.275 0.556   57.316 1.00 42.78 ? 1296 HOH G O    1 
HETATM 3446 O  O    . HOH EA 7 .  ? -14.849 -5.009  75.743 1.00 43.52 ? 1454 HOH G O    1 
HETATM 3447 O  O    A HOH EA 7 .  ? -13.066 -12.376 59.703 0.70 15.14 ? 1828 HOH G O    1 
HETATM 3448 O  O    B HOH EA 7 .  ? -12.288 -11.554 60.995 0.30 24.73 ? 1828 HOH G O    1 
HETATM 3449 O  O    A HOH EA 7 .  ? -24.656 2.316   46.346 0.60 18.02 ? 1834 HOH G O    1 
HETATM 3450 O  O    B HOH EA 7 .  ? -23.263 1.252   47.364 0.50 23.97 ? 1834 HOH G O    1 
HETATM 3451 O  O    A HOH EA 7 .  ? -11.195 0.784   76.609 0.50 29.94 ? 1840 HOH G O    1 
HETATM 3452 O  O    B HOH EA 7 .  ? -10.634 -0.476  5.973  0.50 27.14 ? 1840 HOH G O    1 
HETATM 3453 O  O    A HOH EA 7 .  ? -8.414  -3.227  65.353 0.50 17.64 ? 1866 HOH G O    1 
HETATM 3454 O  O    B HOH EA 7 .  ? -0.325  7.859   65.037 0.50 17.44 ? 1866 HOH G O    1 
HETATM 3455 O  O    A HOH EA 7 .  ? -8.101  -4.019  69.776 0.50 18.57 ? 1900 HOH G O    1 
HETATM 3456 O  O    B HOH EA 7 .  ? 0.235   9.279   -0.077 0.50 20.36 ? 1900 HOH G O    1 
HETATM 3457 O  O    C HOH EA 7 .  ? 0.176   7.675   67.776 0.50 22.09 ? 1900 HOH G O    1 
HETATM 3458 O  O    D HOH EA 7 .  ? -0.645  7.219   70.377 0.50 30.48 ? 1900 HOH G O    1 
HETATM 3459 O  O    . HOH EA 7 .  ? -24.001 -3.588  55.441 0.40 29.70 ? 2123 HOH G O    1 
HETATM 3460 O  O    . HOH EA 7 .  ? -9.010  -8.454  61.589 0.67 33.12 ? 2141 HOH G O    1 
HETATM 3461 O  O    . HOH FA 7 .  ? -4.326  -4.563  59.185 1.00 20.97 ? 1113 HOH H O    1 
HETATM 3462 O  O    . HOH FA 7 .  ? -17.777 4.769   61.043 1.00 27.93 ? 1157 HOH H O    1 
HETATM 3463 O  O    . HOH FA 7 .  ? -16.292 11.712  62.767 1.00 28.25 ? 1189 HOH H O    1 
HETATM 3464 O  O    . HOH FA 7 .  ? -11.025 8.264   66.801 1.00 40.99 ? 1284 HOH H O    1 
HETATM 3465 O  O    A HOH FA 7 .  ? -9.819  7.646   63.652 0.50 26.20 ? 1838 HOH H O    1 
HETATM 3466 O  O    B HOH FA 7 .  ? -9.732  9.325   62.477 0.50 26.41 ? 1838 HOH H O    1 
HETATM 3467 O  O    . HOH FA 7 .  ? -6.105  1.800   53.224 0.60 18.74 ? 1955 HOH H O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  1  GLY GLY A . n 
A 1 2  ILE 2  2  2  ILE ILE A . n 
A 1 3  VAL 3  3  3  VAL VAL A . n 
A 1 4  GLU 4  4  4  GLU GLU A . n 
A 1 5  GLN 5  5  5  GLN GLN A . n 
A 1 6  CYS 6  6  6  CYS CYS A . n 
A 1 7  CYS 7  7  7  CYS CYS A . n 
A 1 8  THR 8  8  8  THR THR A . n 
A 1 9  SER 9  9  9  SER SER A . n 
A 1 10 ILE 10 10 10 ILE ILE A . n 
A 1 11 CYS 11 11 11 CYS CYS A . n 
A 1 12 SER 12 12 12 SER SER A . n 
A 1 13 LEU 13 13 13 LEU LEU A . n 
A 1 14 TYR 14 14 14 TYR TYR A . n 
A 1 15 GLN 15 15 15 GLN GLN A . n 
A 1 16 LEU 16 16 16 LEU LEU A . n 
A 1 17 GLU 17 17 17 GLU GLU A . n 
A 1 18 ASN 18 18 18 ASN ASN A . n 
A 1 19 TYR 19 19 19 TYR TYR A . n 
A 1 20 CYS 20 20 20 CYS CYS A . n 
A 1 21 ASN 21 21 21 ASN ASN A . n 
B 2 1  PHE 1  1  1  PHE PHE B . n 
B 2 2  VAL 2  2  2  VAL VAL B . n 
B 2 3  ASN 3  3  3  ASN ASN B . n 
B 2 4  GLN 4  4  4  GLN GLN B . n 
B 2 5  HIS 5  5  5  HIS HIS B . n 
B 2 6  LEU 6  6  6  LEU LEU B . n 
B 2 7  CYS 7  7  7  CYS CYS B . n 
B 2 8  GLY 8  8  8  GLY GLY B . n 
B 2 9  SER 9  9  9  SER SER B . n 
B 2 10 HIS 10 10 10 HIS HIS B . n 
B 2 11 LEU 11 11 11 LEU LEU B . n 
B 2 12 VAL 12 12 12 VAL VAL B . n 
B 2 13 GLU 13 13 13 GLU GLU B . n 
B 2 14 ALA 14 14 14 ALA ALA B . n 
B 2 15 LEU 15 15 15 LEU LEU B . n 
B 2 16 TYR 16 16 16 TYR TYR B . n 
B 2 17 LEU 17 17 17 LEU LEU B . n 
B 2 18 VAL 18 18 18 VAL VAL B . n 
B 2 19 CYS 19 19 19 CYS CYS B . n 
B 2 20 GLY 20 20 20 GLY GLY B . n 
B 2 21 GLU 21 21 21 GLU GLU B . n 
B 2 22 ARG 22 22 22 ARG ARG B . n 
B 2 23 GLY 23 23 23 GLY GLY B . n 
B 2 24 PHE 24 24 24 PHE PHE B . n 
B 2 25 PHE 25 25 25 PHE PHE B . n 
B 2 26 TYR 26 26 26 TYR TYR B . n 
B 2 27 THR 27 27 27 THR THR B . n 
B 2 28 PRO 28 28 28 PRO PRO B . n 
B 2 29 LYS 29 29 29 LYS LYS B . n 
B 2 30 THR 30 30 30 THR THR B . n 
C 1 1  GLY 1  1  1  GLY GLY C . n 
C 1 2  ILE 2  2  2  ILE ILE C . n 
C 1 3  VAL 3  3  3  VAL VAL C . n 
C 1 4  GLU 4  4  4  GLU GLU C . n 
C 1 5  GLN 5  5  5  GLN GLN C . n 
C 1 6  CYS 6  6  6  CYS CYS C . n 
C 1 7  CYS 7  7  7  CYS CYS C . n 
C 1 8  THR 8  8  8  THR THR C . n 
C 1 9  SER 9  9  9  SER SER C . n 
C 1 10 ILE 10 10 10 ILE ILE C . n 
C 1 11 CYS 11 11 11 CYS CYS C . n 
C 1 12 SER 12 12 12 SER SER C . n 
C 1 13 LEU 13 13 13 LEU LEU C . n 
C 1 14 TYR 14 14 14 TYR TYR C . n 
C 1 15 GLN 15 15 15 GLN GLN C . n 
C 1 16 LEU 16 16 16 LEU LEU C . n 
C 1 17 GLU 17 17 17 GLU GLU C . n 
C 1 18 ASN 18 18 18 ASN ASN C . n 
C 1 19 TYR 19 19 19 TYR TYR C . n 
C 1 20 CYS 20 20 20 CYS CYS C . n 
C 1 21 ASN 21 21 21 ASN ASN C . n 
D 2 1  PHE 1  1  1  PHE PHE D . n 
D 2 2  VAL 2  2  2  VAL VAL D . n 
D 2 3  ASN 3  3  3  ASN ASN D . n 
D 2 4  GLN 4  4  4  GLN GLN D . n 
D 2 5  HIS 5  5  5  HIS HIS D . n 
D 2 6  LEU 6  6  6  LEU LEU D . n 
D 2 7  CYS 7  7  7  CYS CYS D . n 
D 2 8  GLY 8  8  8  GLY GLY D . n 
D 2 9  SER 9  9  9  SER SER D . n 
D 2 10 HIS 10 10 10 HIS HIS D . n 
D 2 11 LEU 11 11 11 LEU LEU D . n 
D 2 12 VAL 12 12 12 VAL VAL D . n 
D 2 13 GLU 13 13 13 GLU GLU D . n 
D 2 14 ALA 14 14 14 ALA ALA D . n 
D 2 15 LEU 15 15 15 LEU LEU D . n 
D 2 16 TYR 16 16 16 TYR TYR D . n 
D 2 17 LEU 17 17 17 LEU LEU D . n 
D 2 18 VAL 18 18 18 VAL VAL D . n 
D 2 19 CYS 19 19 19 CYS CYS D . n 
D 2 20 GLY 20 20 20 GLY GLY D . n 
D 2 21 GLU 21 21 21 GLU GLU D . n 
D 2 22 ARG 22 22 22 ARG ARG D . n 
D 2 23 GLY 23 23 23 GLY GLY D . n 
D 2 24 PHE 24 24 24 PHE PHE D . n 
D 2 25 PHE 25 25 25 PHE PHE D . n 
D 2 26 TYR 26 26 26 TYR TYR D . n 
D 2 27 THR 27 27 27 THR THR D . n 
D 2 28 PRO 28 28 28 PRO PRO D . n 
D 2 29 LYS 29 29 29 LYS LYS D . n 
D 2 30 THR 30 30 ?  ?   ?   D . n 
E 1 1  GLY 1  1  1  GLY GLY E . n 
E 1 2  ILE 2  2  2  ILE ILE E . n 
E 1 3  VAL 3  3  3  VAL VAL E . n 
E 1 4  GLU 4  4  4  GLU GLU E . n 
E 1 5  GLN 5  5  5  GLN GLN E . n 
E 1 6  CYS 6  6  6  CYS CYS E . n 
E 1 7  CYS 7  7  7  CYS CYS E . n 
E 1 8  THR 8  8  8  THR THR E . n 
E 1 9  SER 9  9  9  SER SER E . n 
E 1 10 ILE 10 10 10 ILE ILE E . n 
E 1 11 CYS 11 11 11 CYS CYS E . n 
E 1 12 SER 12 12 12 SER SER E . n 
E 1 13 LEU 13 13 13 LEU LEU E . n 
E 1 14 TYR 14 14 14 TYR TYR E . n 
E 1 15 GLN 15 15 15 GLN GLN E . n 
E 1 16 LEU 16 16 16 LEU LEU E . n 
E 1 17 GLU 17 17 17 GLU GLU E . n 
E 1 18 ASN 18 18 18 ASN ASN E . n 
E 1 19 TYR 19 19 19 TYR TYR E . n 
E 1 20 CYS 20 20 20 CYS CYS E . n 
E 1 21 ASN 21 21 21 ASN ASN E . n 
F 2 1  PHE 1  1  1  PHE PHE F . n 
F 2 2  VAL 2  2  2  VAL VAL F . n 
F 2 3  ASN 3  3  3  ASN ASN F . n 
F 2 4  GLN 4  4  4  GLN GLN F . n 
F 2 5  HIS 5  5  5  HIS HIS F . n 
F 2 6  LEU 6  6  6  LEU LEU F . n 
F 2 7  CYS 7  7  7  CYS CYS F . n 
F 2 8  GLY 8  8  8  GLY GLY F . n 
F 2 9  SER 9  9  9  SER SER F . n 
F 2 10 HIS 10 10 10 HIS HIS F . n 
F 2 11 LEU 11 11 11 LEU LEU F . n 
F 2 12 VAL 12 12 12 VAL VAL F . n 
F 2 13 GLU 13 13 13 GLU GLU F . n 
F 2 14 ALA 14 14 14 ALA ALA F . n 
F 2 15 LEU 15 15 15 LEU LEU F . n 
F 2 16 TYR 16 16 16 TYR TYR F . n 
F 2 17 LEU 17 17 17 LEU LEU F . n 
F 2 18 VAL 18 18 18 VAL VAL F . n 
F 2 19 CYS 19 19 19 CYS CYS F . n 
F 2 20 GLY 20 20 20 GLY GLY F . n 
F 2 21 GLU 21 21 21 GLU GLU F . n 
F 2 22 ARG 22 22 22 ARG ARG F . n 
F 2 23 GLY 23 23 23 GLY GLY F . n 
F 2 24 PHE 24 24 24 PHE PHE F . n 
F 2 25 PHE 25 25 25 PHE PHE F . n 
F 2 26 TYR 26 26 26 TYR TYR F . n 
F 2 27 THR 27 27 27 THR THR F . n 
F 2 28 PRO 28 28 28 PRO PRO F . n 
F 2 29 LYS 29 29 29 LYS LYS F . n 
F 2 30 THR 30 30 30 THR THR F . n 
G 1 1  GLY 1  1  1  GLY GLY G . n 
G 1 2  ILE 2  2  2  ILE ILE G . n 
G 1 3  VAL 3  3  3  VAL VAL G . n 
G 1 4  GLU 4  4  4  GLU GLU G . n 
G 1 5  GLN 5  5  5  GLN GLN G . n 
G 1 6  CYS 6  6  6  CYS CYS G . n 
G 1 7  CYS 7  7  7  CYS CYS G . n 
G 1 8  THR 8  8  8  THR THR G . n 
G 1 9  SER 9  9  9  SER SER G . n 
G 1 10 ILE 10 10 10 ILE ILE G . n 
G 1 11 CYS 11 11 11 CYS CYS G . n 
G 1 12 SER 12 12 12 SER SER G . n 
G 1 13 LEU 13 13 13 LEU LEU G . n 
G 1 14 TYR 14 14 14 TYR TYR G . n 
G 1 15 GLN 15 15 15 GLN GLN G . n 
G 1 16 LEU 16 16 16 LEU LEU G . n 
G 1 17 GLU 17 17 17 GLU GLU G . n 
G 1 18 ASN 18 18 18 ASN ASN G . n 
G 1 19 TYR 19 19 19 TYR TYR G . n 
G 1 20 CYS 20 20 20 CYS CYS G . n 
G 1 21 ASN 21 21 21 ASN ASN G . n 
H 2 1  PHE 1  1  ?  ?   ?   H . n 
H 2 2  VAL 2  2  2  VAL VAL H . n 
H 2 3  ASN 3  3  3  ASN ASN H . n 
H 2 4  GLN 4  4  4  GLN GLN H . n 
H 2 5  HIS 5  5  5  HIS HIS H . n 
H 2 6  LEU 6  6  6  LEU LEU H . n 
H 2 7  CYS 7  7  7  CYS CYS H . n 
H 2 8  GLY 8  8  8  GLY GLY H . n 
H 2 9  SER 9  9  9  SER SER H . n 
H 2 10 HIS 10 10 10 HIS HIS H . n 
H 2 11 LEU 11 11 11 LEU LEU H . n 
H 2 12 VAL 12 12 12 VAL VAL H . n 
H 2 13 GLU 13 13 13 GLU GLU H . n 
H 2 14 ALA 14 14 14 ALA ALA H . n 
H 2 15 LEU 15 15 15 LEU LEU H . n 
H 2 16 TYR 16 16 16 TYR TYR H . n 
H 2 17 LEU 17 17 17 LEU LEU H . n 
H 2 18 VAL 18 18 18 VAL VAL H . n 
H 2 19 CYS 19 19 19 CYS CYS H . n 
H 2 20 GLY 20 20 20 GLY GLY H . n 
H 2 21 GLU 21 21 21 GLU GLU H . n 
H 2 22 ARG 22 22 22 ARG ARG H . n 
H 2 23 GLY 23 23 23 GLY GLY H . n 
H 2 24 PHE 24 24 24 PHE PHE H . n 
H 2 25 PHE 25 25 25 PHE PHE H . n 
H 2 26 TYR 26 26 26 TYR TYR H . n 
H 2 27 THR 27 27 27 THR THR H . n 
H 2 28 PRO 28 28 28 PRO PRO H . n 
H 2 29 LYS 29 29 29 LYS LYS H . n 
H 2 30 THR 30 30 ?  ?   ?   H . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I  3 ZN  1  901  901  ZN  ZN  B . 
J  3 ZN  1  951  951  ZN  ZN  B . 
K  3 ZN  1  961  961  ZN  ZN  B . 
L  4 CL  1  902  902  CL  CL  B . 
M  3 ZN  1  911  911  ZN  ZN  D . 
N  3 ZN  1  921  921  ZN  ZN  D . 
O  4 CL  1  912  912  CL  CL  D . 
P  4 CL  1  922  922  CL  CL  D . 
Q  4 CL  1  923  923  CL  CL  D . 
R  4 CL  1  1101 1101 CL  CL  E . 
S  3 ZN  1  931  931  ZN  ZN  F . 
T  4 CL  1  932  932  CL  CL  F . 
U  5 GOL 1  995  995  GOL CRY G . 
V  6 ACN 1  991  991  ACN ACN G . 
W  3 ZN  1  941  941  ZN  ZN  H . 
X  4 CL  1  942  942  CL  CL  H . 
Y  7 HOH 1  1108 1108 HOH HOH A . 
Y  7 HOH 2  1111 1111 HOH HOH A . 
Y  7 HOH 3  1131 1131 HOH HOH A . 
Y  7 HOH 4  1133 1133 HOH HOH A . 
Y  7 HOH 5  1151 1151 HOH HOH A . 
Y  7 HOH 6  1155 1155 HOH HOH A . 
Y  7 HOH 7  1164 1164 HOH HOH A . 
Y  7 HOH 8  1176 1176 HOH HOH A . 
Y  7 HOH 9  1180 1180 HOH HOH A . 
Y  7 HOH 10 1198 1198 HOH HOH A . 
Y  7 HOH 11 1235 1235 HOH HOH A . 
Y  7 HOH 12 1249 1249 HOH HOH A . 
Y  7 HOH 13 1251 1251 HOH HOH A . 
Y  7 HOH 14 1256 1256 HOH HOH A . 
Y  7 HOH 15 1270 1270 HOH HOH A . 
Y  7 HOH 16 1292 1292 HOH HOH A . 
Y  7 HOH 17 1315 1315 HOH HOH A . 
Y  7 HOH 18 1316 1316 HOH HOH A . 
Y  7 HOH 19 1453 1453 HOH HOH A . 
Y  7 HOH 20 1826 1826 HOH HOH A . 
Y  7 HOH 21 1830 1830 HOH HOH A . 
Y  7 HOH 22 1836 1836 HOH HOH A . 
Y  7 HOH 23 1842 1842 HOH HOH A . 
Y  7 HOH 24 1856 1856 HOH HOH A . 
Z  7 HOH 1  952  952  HOH HOH B . 
Z  7 HOH 2  953  953  HOH HOH B . 
Z  7 HOH 3  962  962  HOH HOH B . 
Z  7 HOH 4  963  963  HOH HOH B . 
Z  7 HOH 5  964  964  HOH HOH B . 
Z  7 HOH 6  1105 1105 HOH HOH B . 
Z  7 HOH 7  1112 1112 HOH HOH B . 
Z  7 HOH 8  1119 1119 HOH HOH B . 
Z  7 HOH 9  1123 1123 HOH HOH B . 
Z  7 HOH 10 1134 1134 HOH HOH B . 
Z  7 HOH 11 1138 1138 HOH HOH B . 
Z  7 HOH 12 1139 1139 HOH HOH B . 
Z  7 HOH 13 1142 1142 HOH HOH B . 
Z  7 HOH 14 1144 1144 HOH HOH B . 
Z  7 HOH 15 1147 1147 HOH HOH B . 
Z  7 HOH 16 1169 1169 HOH HOH B . 
Z  7 HOH 17 1175 1175 HOH HOH B . 
Z  7 HOH 18 1177 1177 HOH HOH B . 
Z  7 HOH 19 1182 1182 HOH HOH B . 
Z  7 HOH 20 1185 1185 HOH HOH B . 
Z  7 HOH 21 1214 1214 HOH HOH B . 
Z  7 HOH 22 1227 1227 HOH HOH B . 
Z  7 HOH 23 1232 1232 HOH HOH B . 
Z  7 HOH 24 1239 1239 HOH HOH B . 
Z  7 HOH 25 1260 1260 HOH HOH B . 
Z  7 HOH 26 1271 1271 HOH HOH B . 
Z  7 HOH 27 1280 1280 HOH HOH B . 
Z  7 HOH 28 1283 1283 HOH HOH B . 
Z  7 HOH 29 1285 1285 HOH HOH B . 
Z  7 HOH 30 1289 1289 HOH HOH B . 
Z  7 HOH 31 1291 1291 HOH HOH B . 
Z  7 HOH 32 1321 1321 HOH HOH B . 
Z  7 HOH 33 1451 1451 HOH HOH B . 
Z  7 HOH 34 1455 1455 HOH HOH B . 
Z  7 HOH 35 1457 1457 HOH HOH B . 
Z  7 HOH 36 1802 1802 HOH HOH B . 
Z  7 HOH 37 1809 1809 HOH HOH B . 
Z  7 HOH 38 1810 1810 HOH HOH B . 
Z  7 HOH 39 1811 1811 HOH HOH B . 
Z  7 HOH 40 1820 1820 HOH HOH B . 
Z  7 HOH 41 1822 1822 HOH HOH B . 
AA 7 HOH 1  1114 1114 HOH HOH C . 
AA 7 HOH 2  1128 1128 HOH HOH C . 
AA 7 HOH 3  1132 1132 HOH HOH C . 
AA 7 HOH 4  1148 1148 HOH HOH C . 
AA 7 HOH 5  1159 1159 HOH HOH C . 
AA 7 HOH 6  1162 1162 HOH HOH C . 
AA 7 HOH 7  1170 1170 HOH HOH C . 
AA 7 HOH 8  1188 1188 HOH HOH C . 
AA 7 HOH 9  1200 1200 HOH HOH C . 
AA 7 HOH 10 1222 1222 HOH HOH C . 
AA 7 HOH 11 1224 1224 HOH HOH C . 
AA 7 HOH 12 1237 1237 HOH HOH C . 
AA 7 HOH 13 1238 1238 HOH HOH C . 
AA 7 HOH 14 1247 1247 HOH HOH C . 
AA 7 HOH 15 1254 1254 HOH HOH C . 
AA 7 HOH 16 1290 1290 HOH HOH C . 
AA 7 HOH 17 1800 1800 HOH HOH C . 
AA 7 HOH 18 1844 1844 HOH HOH C . 
AA 7 HOH 19 1846 1846 HOH HOH C . 
AA 7 HOH 20 1862 1862 HOH HOH C . 
AA 7 HOH 21 1927 1927 HOH HOH C . 
AA 7 HOH 22 1935 1935 HOH HOH C . 
AA 7 HOH 23 2122 2122 HOH HOH C . 
BA 7 HOH 1  971  971  HOH HOH D . 
BA 7 HOH 2  1122 1122 HOH HOH D . 
BA 7 HOH 3  1125 1125 HOH HOH D . 
BA 7 HOH 4  1129 1129 HOH HOH D . 
BA 7 HOH 5  1130 1130 HOH HOH D . 
BA 7 HOH 6  1150 1150 HOH HOH D . 
BA 7 HOH 7  1152 1152 HOH HOH D . 
BA 7 HOH 8  1158 1158 HOH HOH D . 
BA 7 HOH 9  1161 1161 HOH HOH D . 
BA 7 HOH 10 1163 1163 HOH HOH D . 
BA 7 HOH 11 1178 1178 HOH HOH D . 
BA 7 HOH 12 1179 1179 HOH HOH D . 
BA 7 HOH 13 1225 1225 HOH HOH D . 
BA 7 HOH 14 1233 1233 HOH HOH D . 
BA 7 HOH 15 1273 1273 HOH HOH D . 
BA 7 HOH 16 1281 1281 HOH HOH D . 
BA 7 HOH 17 1299 1299 HOH HOH D . 
BA 7 HOH 18 1801 1801 HOH HOH D . 
BA 7 HOH 19 1803 1803 HOH HOH D . 
BA 7 HOH 20 1814 1814 HOH HOH D . 
BA 7 HOH 21 1824 1824 HOH HOH D . 
BA 7 HOH 22 1832 1832 HOH HOH D . 
BA 7 HOH 23 1860 1860 HOH HOH D . 
BA 7 HOH 24 1864 1864 HOH HOH D . 
BA 7 HOH 25 1905 1905 HOH HOH D . 
BA 7 HOH 26 1950 1950 HOH HOH D . 
CA 7 HOH 1  1104 1104 HOH HOH E . 
CA 7 HOH 2  1110 1110 HOH HOH E . 
CA 7 HOH 3  1124 1124 HOH HOH E . 
CA 7 HOH 4  1137 1137 HOH HOH E . 
CA 7 HOH 5  1153 1153 HOH HOH E . 
CA 7 HOH 6  1154 1154 HOH HOH E . 
CA 7 HOH 7  1165 1165 HOH HOH E . 
CA 7 HOH 8  1171 1171 HOH HOH E . 
CA 7 HOH 9  1174 1174 HOH HOH E . 
CA 7 HOH 10 1187 1187 HOH HOH E . 
CA 7 HOH 11 1190 1190 HOH HOH E . 
CA 7 HOH 12 1191 1191 HOH HOH E . 
CA 7 HOH 13 1207 1207 HOH HOH E . 
CA 7 HOH 14 1240 1240 HOH HOH E . 
CA 7 HOH 15 1244 1244 HOH HOH E . 
CA 7 HOH 16 1248 1248 HOH HOH E . 
CA 7 HOH 17 1253 1253 HOH HOH E . 
CA 7 HOH 18 1255 1255 HOH HOH E . 
CA 7 HOH 19 1261 1261 HOH HOH E . 
CA 7 HOH 20 1263 1263 HOH HOH E . 
CA 7 HOH 21 1274 1274 HOH HOH E . 
CA 7 HOH 22 1298 1298 HOH HOH E . 
CA 7 HOH 23 1319 1319 HOH HOH E . 
CA 7 HOH 24 1320 1320 HOH HOH E . 
CA 7 HOH 25 1322 1322 HOH HOH E . 
CA 7 HOH 26 1807 1807 HOH HOH E . 
CA 7 HOH 27 1848 1848 HOH HOH E . 
CA 7 HOH 28 1868 1868 HOH HOH E . 
CA 7 HOH 29 1926 1926 HOH HOH E . 
CA 7 HOH 30 1945 1945 HOH HOH E . 
DA 7 HOH 1  933  932  HOH HOH F . 
DA 7 HOH 2  1102 1102 HOH HOH F . 
DA 7 HOH 3  1103 1103 HOH HOH F . 
DA 7 HOH 4  1106 1106 HOH HOH F . 
DA 7 HOH 5  1107 1107 HOH HOH F . 
DA 7 HOH 6  1109 1109 HOH HOH F . 
DA 7 HOH 7  1115 1115 HOH HOH F . 
DA 7 HOH 8  1118 1118 HOH HOH F . 
DA 7 HOH 9  1120 1120 HOH HOH F . 
DA 7 HOH 10 1126 1126 HOH HOH F . 
DA 7 HOH 11 1127 1127 HOH HOH F . 
DA 7 HOH 12 1135 1135 HOH HOH F . 
DA 7 HOH 13 1136 1136 HOH HOH F . 
DA 7 HOH 14 1140 1140 HOH HOH F . 
DA 7 HOH 15 1143 1143 HOH HOH F . 
DA 7 HOH 16 1145 1145 HOH HOH F . 
DA 7 HOH 17 1149 1149 HOH HOH F . 
DA 7 HOH 18 1156 1156 HOH HOH F . 
DA 7 HOH 19 1172 1172 HOH HOH F . 
DA 7 HOH 20 1173 1173 HOH HOH F . 
DA 7 HOH 21 1181 1181 HOH HOH F . 
DA 7 HOH 22 1193 1193 HOH HOH F . 
DA 7 HOH 23 1199 1199 HOH HOH F . 
DA 7 HOH 24 1203 1203 HOH HOH F . 
DA 7 HOH 25 1231 1231 HOH HOH F . 
DA 7 HOH 26 1266 1266 HOH HOH F . 
DA 7 HOH 27 1297 1297 HOH HOH F . 
DA 7 HOH 28 1317 1317 HOH HOH F . 
DA 7 HOH 29 1318 1318 HOH HOH F . 
DA 7 HOH 30 1323 1323 HOH HOH F . 
DA 7 HOH 31 1452 1452 HOH HOH F . 
DA 7 HOH 32 1456 1456 HOH HOH F . 
DA 7 HOH 33 1808 1808 HOH HOH F . 
DA 7 HOH 34 1870 1870 HOH HOH F . 
DA 7 HOH 35 1910 1910 HOH HOH F . 
DA 7 HOH 36 1911 1911 HOH HOH F . 
DA 7 HOH 37 1930 1930 HOH HOH F . 
DA 7 HOH 38 2142 2142 HOH HOH F . 
EA 7 HOH 1  1116 1116 HOH HOH G . 
EA 7 HOH 2  1117 1117 HOH HOH G . 
EA 7 HOH 3  1121 1121 HOH HOH G . 
EA 7 HOH 4  1146 1146 HOH HOH G . 
EA 7 HOH 5  1160 1160 HOH HOH G . 
EA 7 HOH 6  1168 1168 HOH HOH G . 
EA 7 HOH 7  1186 1186 HOH HOH G . 
EA 7 HOH 8  1194 1194 HOH HOH G . 
EA 7 HOH 9  1196 1196 HOH HOH G . 
EA 7 HOH 10 1204 1204 HOH HOH G . 
EA 7 HOH 11 1242 1242 HOH HOH G . 
EA 7 HOH 12 1246 1246 HOH HOH G . 
EA 7 HOH 13 1257 1257 HOH HOH G . 
EA 7 HOH 14 1276 1276 HOH HOH G . 
EA 7 HOH 15 1293 1293 HOH HOH G . 
EA 7 HOH 16 1296 1296 HOH HOH G . 
EA 7 HOH 17 1454 1454 HOH HOH G . 
EA 7 HOH 18 1828 1828 HOH HOH G . 
EA 7 HOH 19 1834 1834 HOH HOH G . 
EA 7 HOH 20 1840 1840 HOH HOH G . 
EA 7 HOH 21 1866 1866 HOH HOH G . 
EA 7 HOH 22 1900 1900 HOH HOH G . 
EA 7 HOH 23 2123 2123 HOH HOH G . 
EA 7 HOH 24 2141 2141 HOH HOH G . 
FA 7 HOH 1  1113 1113 HOH HOH H . 
FA 7 HOH 2  1157 1157 HOH HOH H . 
FA 7 HOH 3  1189 1189 HOH HOH H . 
FA 7 HOH 4  1284 1284 HOH HOH H . 
FA 7 HOH 5  1838 1838 HOH HOH H . 
FA 7 HOH 6  1955 1955 HOH HOH H . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? dodecameric 12 
2 author_defined_assembly ? dodecameric 12 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2,3 A,B,C,D,I,J,K,L,M,N,O,P,Q,Y,Z,AA,BA 
2 1,2,3 E,F,G,H,R,S,T,U,V,W,X,CA,DA,EA,FA   
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_555 -y,x-y,z  -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038  -0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038  0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1  1 B ZN  901  ? I  ZN  . 
2  1 B CL  902  ? L  CL  . 
3  1 D ZN  911  ? M  ZN  . 
4  1 D CL  912  ? O  CL  . 
5  1 F ZN  931  ? S  ZN  . 
6  1 F CL  932  ? T  CL  . 
7  1 H ZN  941  ? W  ZN  . 
8  1 H CL  942  ? X  CL  . 
9  1 B HOH 1214 ? Z  HOH . 
10 1 D HOH 1150 ? BA HOH . 
11 1 D HOH 1814 ? BA HOH . 
12 1 D HOH 1950 ? BA HOH . 
13 1 F HOH 1181 ? DA HOH . 
14 1 F HOH 1870 ? DA HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  ND1 B B  HIS 5  ? B HIS 5    ? 1_555 ZN ? K ZN . ? B ZN 961 ? 1_555 O   ? Z  HOH .  ? B HOH 962  ? 1_555 104.6 ? 
2  ND1 B B  HIS 5  ? B HIS 5    ? 1_555 ZN ? K ZN . ? B ZN 961 ? 1_555 O   ? Z  HOH .  ? B HOH 963  ? 1_555 99.7  ? 
3  O   ? Z  HOH .  ? B HOH 962  ? 1_555 ZN ? K ZN . ? B ZN 961 ? 1_555 O   ? Z  HOH .  ? B HOH 963  ? 1_555 110.2 ? 
4  ND1 B B  HIS 5  ? B HIS 5    ? 1_555 ZN ? K ZN . ? B ZN 961 ? 1_555 O   ? Z  HOH .  ? B HOH 964  ? 1_555 131.2 ? 
5  O   ? Z  HOH .  ? B HOH 962  ? 1_555 ZN ? K ZN . ? B ZN 961 ? 1_555 O   ? Z  HOH .  ? B HOH 964  ? 1_555 113.5 ? 
6  O   ? Z  HOH .  ? B HOH 963  ? 1_555 ZN ? K ZN . ? B ZN 961 ? 1_555 O   ? Z  HOH .  ? B HOH 964  ? 1_555 94.8  ? 
7  ND1 B B  HIS 5  ? B HIS 5    ? 1_555 ZN ? K ZN . ? B ZN 961 ? 1_555 O   ? Z  HOH .  ? B HOH 1811 ? 1_555 107.3 ? 
8  O   ? Z  HOH .  ? B HOH 962  ? 1_555 ZN ? K ZN . ? B ZN 961 ? 1_555 O   ? Z  HOH .  ? B HOH 1811 ? 1_555 102.0 ? 
9  O   ? Z  HOH .  ? B HOH 963  ? 1_555 ZN ? K ZN . ? B ZN 961 ? 1_555 O   ? Z  HOH .  ? B HOH 1811 ? 1_555 130.7 ? 
10 O   ? Z  HOH .  ? B HOH 964  ? 1_555 ZN ? K ZN . ? B ZN 961 ? 1_555 O   ? Z  HOH .  ? B HOH 1811 ? 1_555 37.1  ? 
11 ND1 B B  HIS 5  ? B HIS 5    ? 1_555 ZN ? K ZN . ? B ZN 961 ? 1_555 O   ? Z  HOH .  ? B HOH 1810 ? 1_555 69.9  ? 
12 O   ? Z  HOH .  ? B HOH 962  ? 1_555 ZN ? K ZN . ? B ZN 961 ? 1_555 O   ? Z  HOH .  ? B HOH 1810 ? 1_555 91.7  ? 
13 O   ? Z  HOH .  ? B HOH 963  ? 1_555 ZN ? K ZN . ? B ZN 961 ? 1_555 O   ? Z  HOH .  ? B HOH 1810 ? 1_555 40.2  ? 
14 O   ? Z  HOH .  ? B HOH 964  ? 1_555 ZN ? K ZN . ? B ZN 961 ? 1_555 O   ? Z  HOH .  ? B HOH 1810 ? 1_555 134.8 ? 
15 O   ? Z  HOH .  ? B HOH 1811 ? 1_555 ZN ? K ZN . ? B ZN 961 ? 1_555 O   ? Z  HOH .  ? B HOH 1810 ? 1_555 166.2 ? 
16 NE2 A B  HIS 5  ? B HIS 5    ? 1_555 ZN ? J ZN . ? B ZN 951 ? 1_555 NE2 B B  HIS 5  ? B HIS 5    ? 1_555 13.3  ? 
17 NE2 A B  HIS 5  ? B HIS 5    ? 1_555 ZN ? J ZN . ? B ZN 951 ? 1_555 O   ? Z  HOH .  ? B HOH 952  ? 1_555 97.5  ? 
18 NE2 B B  HIS 5  ? B HIS 5    ? 1_555 ZN ? J ZN . ? B ZN 951 ? 1_555 O   ? Z  HOH .  ? B HOH 952  ? 1_555 102.5 ? 
19 NE2 A B  HIS 5  ? B HIS 5    ? 1_555 ZN ? J ZN . ? B ZN 951 ? 1_555 O   ? Z  HOH .  ? B HOH 953  ? 1_555 102.8 ? 
20 NE2 B B  HIS 5  ? B HIS 5    ? 1_555 ZN ? J ZN . ? B ZN 951 ? 1_555 O   ? Z  HOH .  ? B HOH 953  ? 1_555 106.0 ? 
21 O   ? Z  HOH .  ? B HOH 952  ? 1_555 ZN ? J ZN . ? B ZN 951 ? 1_555 O   ? Z  HOH .  ? B HOH 953  ? 1_555 136.2 ? 
22 NE2 A B  HIS 5  ? B HIS 5    ? 1_555 ZN ? J ZN . ? B ZN 951 ? 1_555 NE2 ? H  HIS 5  ? H HIS 5    ? 1_555 35.4  ? 
23 NE2 B B  HIS 5  ? B HIS 5    ? 1_555 ZN ? J ZN . ? B ZN 951 ? 1_555 NE2 ? H  HIS 5  ? H HIS 5    ? 1_555 48.4  ? 
24 O   ? Z  HOH .  ? B HOH 952  ? 1_555 ZN ? J ZN . ? B ZN 951 ? 1_555 NE2 ? H  HIS 5  ? H HIS 5    ? 1_555 75.9  ? 
25 O   ? Z  HOH .  ? B HOH 953  ? 1_555 ZN ? J ZN . ? B ZN 951 ? 1_555 NE2 ? H  HIS 5  ? H HIS 5    ? 1_555 99.5  ? 
26 NE2 ? B  HIS 10 ? B HIS 10   ? 1_555 ZN ? I ZN . ? B ZN 901 ? 1_555 NE2 ? B  HIS 10 ? B HIS 10   ? 1_555 0.0   ? 
27 NE2 A D  HIS 10 ? D HIS 10   ? 1_555 ZN ? N ZN . ? D ZN 921 ? 1_555 NE2 ? D  HIS 5  ? D HIS 5    ? 1_555 23.4  ? 
28 NE2 B D  HIS 10 ? D HIS 10   ? 1_555 ZN ? M ZN . ? D ZN 911 ? 1_555 O   ? BA HOH .  ? D HOH 971  ? 1_555 54.6  ? 
29 NE2 B D  HIS 10 ? D HIS 10   ? 1_555 ZN ? M ZN . ? D ZN 911 ? 1_555 NE2 B D  HIS 10 ? D HIS 10   ? 1_555 0.0   ? 
30 O   ? BA HOH .  ? D HOH 971  ? 1_555 ZN ? M ZN . ? D ZN 911 ? 1_555 NE2 B D  HIS 10 ? D HIS 10   ? 1_555 54.6  ? 
31 NE2 B D  HIS 10 ? D HIS 10   ? 1_555 ZN ? M ZN . ? D ZN 911 ? 1_555 O   ? BA HOH .  ? D HOH 971  ? 2_555 63.2  ? 
32 O   ? BA HOH .  ? D HOH 971  ? 1_555 ZN ? M ZN . ? D ZN 911 ? 1_555 O   ? BA HOH .  ? D HOH 971  ? 2_555 117.4 ? 
33 NE2 B D  HIS 10 ? D HIS 10   ? 1_555 ZN ? M ZN . ? D ZN 911 ? 1_555 O   ? BA HOH .  ? D HOH 971  ? 2_555 63.2  ? 
34 NE2 ? F  HIS 10 ? F HIS 10   ? 1_555 ZN ? S ZN . ? F ZN 931 ? 1_555 O   B DA HOH .  ? F HOH 933  ? 1_555 93.9  ? 
35 NE2 ? F  HIS 10 ? F HIS 10   ? 1_555 ZN ? S ZN . ? F ZN 931 ? 1_555 NE2 ? F  HIS 10 ? F HIS 10   ? 1_555 0.0   ? 
36 O   B DA HOH .  ? F HOH 933  ? 1_555 ZN ? S ZN . ? F ZN 931 ? 1_555 NE2 ? F  HIS 10 ? F HIS 10   ? 1_555 93.9  ? 
37 NE2 ? F  HIS 10 ? F HIS 10   ? 1_555 ZN ? S ZN . ? F ZN 931 ? 1_555 O   B DA HOH .  ? F HOH 933  ? 3_555 145.8 ? 
38 O   B DA HOH .  ? F HOH 933  ? 1_555 ZN ? S ZN . ? F ZN 931 ? 1_555 O   B DA HOH .  ? F HOH 933  ? 3_555 55.7  ? 
39 NE2 ? F  HIS 10 ? F HIS 10   ? 1_555 ZN ? S ZN . ? F ZN 931 ? 1_555 O   B DA HOH .  ? F HOH 933  ? 3_555 145.8 ? 
40 NE2 ? H  HIS 10 ? H HIS 10   ? 1_555 ZN ? W ZN . ? H ZN 941 ? 1_555 NE2 ? H  HIS 10 ? H HIS 10   ? 1_555 0.0   ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-08-03 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-11-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_struct_conn_angle 
2 4 'Structure model' struct_conn            
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    SER 
_pdbx_validate_torsion.auth_asym_id    E 
_pdbx_validate_torsion.auth_seq_id     9 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    A 
_pdbx_validate_torsion.phi             -108.99 
_pdbx_validate_torsion.psi             -163.89 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B LYS 29 ? CG  ? B LYS 29 CG  
2  1 Y 1 B LYS 29 ? CD  ? B LYS 29 CD  
3  1 Y 1 B LYS 29 ? CE  ? B LYS 29 CE  
4  1 Y 1 B LYS 29 ? NZ  ? B LYS 29 NZ  
5  1 Y 1 B THR 30 ? OG1 ? B THR 30 OG1 
6  1 Y 1 B THR 30 ? CG2 ? B THR 30 CG2 
7  1 Y 1 D LYS 29 ? CG  ? D LYS 29 CG  
8  1 Y 1 D LYS 29 ? CD  ? D LYS 29 CD  
9  1 Y 1 D LYS 29 ? CE  ? D LYS 29 CE  
10 1 Y 1 D LYS 29 ? NZ  ? D LYS 29 NZ  
11 1 Y 1 H VAL 2  ? CG1 ? H VAL 2  CG1 
12 1 Y 1 H VAL 2  ? CG2 ? H VAL 2  CG2 
13 1 Y 1 H GLN 4  ? CG  ? H GLN 4  CG  
14 1 Y 1 H GLN 4  ? CD  ? H GLN 4  CD  
15 1 Y 1 H GLN 4  ? OE1 ? H GLN 4  OE1 
16 1 Y 1 H GLN 4  ? NE2 ? H GLN 4  NE2 
17 1 Y 1 H LYS 29 ? CG  ? H LYS 29 CG  
18 1 Y 1 H LYS 29 ? CD  ? H LYS 29 CD  
19 1 Y 1 H LYS 29 ? CE  ? H LYS 29 CE  
20 1 Y 1 H LYS 29 ? NZ  ? H LYS 29 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 D THR 30 ? D THR 30 
2 1 Y 1 H PHE 1  ? H PHE 1  
3 1 Y 1 H THR 30 ? H THR 30 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ZINC ION'     ZN  
4 'CHLORIDE ION' CL  
5 GLYCEROL       GOL 
6 ACETONE        ACN 
7 water          HOH 
#