data_1GFW
# 
_entry.id   1GFW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GFW         
RCSB  RCSB001476   
WWPDB D_1000001476 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2000-06-23 
_pdbx_database_PDB_obs_spr.pdb_id           1GFW 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1QA8 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1pau 'Crystal structure of the complex of apopain with the tetrapeptide aldehyde inhibitor AC-DEVD-CHO' unspecified 
PDB 1cp3 'Crystal structure of the complex of apopain with the tetrapeptide inhibitor AC- DVAD-FMC'         unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GFW 
_pdbx_database_status.recvd_initial_deposition_date   2000-06-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Concha, N.O.' 1 
'Janson, C.A.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Potent and selective nonpeptide inhibitors of caspases 3 and 7 inhibit apoptosis and maintain cell functionality.' 
J.Biol.Chem. 275 16007 16014 2000 JBCHA3 US 0021-9258 0071 ? 10821855 10.1074/jbc.275.21.16007 
1       
;CPP32, a novel human apoptotic protein with homology to Caenorhabditis elegans cell death protein ced-3 and mammalian interleukin-1-b-converting enzyme
;
J.Biol.Chem. 269 30761 30764 1994 JBCHA3 US 0021-9258 0071 ? ?        ?                        
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lee, D.'               1  ? 
primary 'Long, S.A.'            2  ? 
primary 'Adams, J.L.'           3  ? 
primary 'Chan, G.'              4  ? 
primary 'Vaidya, K.S.'          5  ? 
primary 'Francis, T.A.'         6  ? 
primary 'Kikly, K.'             7  ? 
primary 'Winkler, J.D.'         8  ? 
primary 'Sung, C.M.'            9  ? 
primary 'Debouck, C.'           10 ? 
primary 'Richardson, S.'        11 ? 
primary 'Levy, M.A.'            12 ? 
primary 'DeWolf Jr., W.E.'      13 ? 
primary 'Keller, P.M.'          14 ? 
primary 'Tomaszek, T.'          15 ? 
primary 'Head, M.S.'            16 ? 
primary 'Ryan, M.D.'            17 ? 
primary 'Haltiwanger, R.C.'     18 ? 
primary 'Liang, P.H.'           19 ? 
primary 'Janson, C.A.'          20 ? 
primary 'McDevitt, P.J.'        21 ? 
primary 'Johanson, K.'          22 ? 
primary 'Concha, N.O.'          23 ? 
primary 'Chan, W.'              24 ? 
primary 'Abdel-Meguid, S.S.'    25 ? 
primary 'Badger, A.M.'          26 ? 
primary 'Lark, M.W.'            27 ? 
primary 'Nadeau, D.P.'          28 ? 
primary 'Suva, L.J.'            29 ? 
primary 'Gowen, M.'             30 ? 
primary 'Nuttall, M.E.'         31 ? 
1       'Fernandes-Alnemri, T.' 32 ? 
1       'Litwack, G.'           33 ? 
1       'Alnemri, E.S.'         34 ? 
# 
_cell.entry_id           1GFW 
_cell.length_a           67.200 
_cell.length_b           83.300 
_cell.length_c           96.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GFW 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CASPASE-3 (APOPAIN, P20)'                                                16639.902 1  ? ? 
'ACTIVATED MATURE CASPASE-3 (P20) WITHOUT PRO-DOMAIN OR LINKER (RESIDUES 29-175)'  ? 
2 polymer     man 'CASPASE-3 (APOPAIN, P10)'                                                11423.142 1  ? ? 
'ACTIVATED MATURE CASPASE-3 (P10) WITHOUT PRO-DOMAIN OR LINKER (RESIDUES 181-277)' ? 
3 non-polymer syn '1-METHYL-5-(2-PHENOXYMETHYL-PYRROLIDINE-1-SULFONYL)-1H-INDOLE-2,3-DIONE' 400.448   1  ? ? ? ? 
4 water       nat water                                                                     18.015    45 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDH
SKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
;
;SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDH
SKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
;
A ? 
2 'polypeptide(L)' no no 
;DMACHKIPVDADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKK
QIPCIVSMLTKELYFYH
;
;DMACHKIPVDADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKK
QIPCIVSMLTKELYFYH
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLY n 
1 3   ILE n 
1 4   SER n 
1 5   LEU n 
1 6   ASP n 
1 7   ASN n 
1 8   SER n 
1 9   TYR n 
1 10  LYS n 
1 11  MET n 
1 12  ASP n 
1 13  TYR n 
1 14  PRO n 
1 15  GLU n 
1 16  MET n 
1 17  GLY n 
1 18  LEU n 
1 19  CYS n 
1 20  ILE n 
1 21  ILE n 
1 22  ILE n 
1 23  ASN n 
1 24  ASN n 
1 25  LYS n 
1 26  ASN n 
1 27  PHE n 
1 28  HIS n 
1 29  LYS n 
1 30  SER n 
1 31  THR n 
1 32  GLY n 
1 33  MET n 
1 34  THR n 
1 35  SER n 
1 36  ARG n 
1 37  SER n 
1 38  GLY n 
1 39  THR n 
1 40  ASP n 
1 41  VAL n 
1 42  ASP n 
1 43  ALA n 
1 44  ALA n 
1 45  ASN n 
1 46  LEU n 
1 47  ARG n 
1 48  GLU n 
1 49  THR n 
1 50  PHE n 
1 51  ARG n 
1 52  ASN n 
1 53  LEU n 
1 54  LYS n 
1 55  TYR n 
1 56  GLU n 
1 57  VAL n 
1 58  ARG n 
1 59  ASN n 
1 60  LYS n 
1 61  ASN n 
1 62  ASP n 
1 63  LEU n 
1 64  THR n 
1 65  ARG n 
1 66  GLU n 
1 67  GLU n 
1 68  ILE n 
1 69  VAL n 
1 70  GLU n 
1 71  LEU n 
1 72  MET n 
1 73  ARG n 
1 74  ASP n 
1 75  VAL n 
1 76  SER n 
1 77  LYS n 
1 78  GLU n 
1 79  ASP n 
1 80  HIS n 
1 81  SER n 
1 82  LYS n 
1 83  ARG n 
1 84  SER n 
1 85  SER n 
1 86  PHE n 
1 87  VAL n 
1 88  CYS n 
1 89  VAL n 
1 90  LEU n 
1 91  LEU n 
1 92  SER n 
1 93  HIS n 
1 94  GLY n 
1 95  GLU n 
1 96  GLU n 
1 97  GLY n 
1 98  ILE n 
1 99  ILE n 
1 100 PHE n 
1 101 GLY n 
1 102 THR n 
1 103 ASN n 
1 104 GLY n 
1 105 PRO n 
1 106 VAL n 
1 107 ASP n 
1 108 LEU n 
1 109 LYS n 
1 110 LYS n 
1 111 ILE n 
1 112 THR n 
1 113 ASN n 
1 114 PHE n 
1 115 PHE n 
1 116 ARG n 
1 117 GLY n 
1 118 ASP n 
1 119 ARG n 
1 120 CYS n 
1 121 ARG n 
1 122 SER n 
1 123 LEU n 
1 124 THR n 
1 125 GLY n 
1 126 LYS n 
1 127 PRO n 
1 128 LYS n 
1 129 LEU n 
1 130 PHE n 
1 131 ILE n 
1 132 ILE n 
1 133 GLN n 
1 134 ALA n 
1 135 CYS n 
1 136 ARG n 
1 137 GLY n 
1 138 THR n 
1 139 GLU n 
1 140 LEU n 
1 141 ASP n 
1 142 CYS n 
1 143 GLY n 
1 144 ILE n 
1 145 GLU n 
1 146 THR n 
1 147 ASP n 
2 1   ASP n 
2 2   MET n 
2 3   ALA n 
2 4   CYS n 
2 5   HIS n 
2 6   LYS n 
2 7   ILE n 
2 8   PRO n 
2 9   VAL n 
2 10  ASP n 
2 11  ALA n 
2 12  ASP n 
2 13  PHE n 
2 14  LEU n 
2 15  TYR n 
2 16  ALA n 
2 17  TYR n 
2 18  SER n 
2 19  THR n 
2 20  ALA n 
2 21  PRO n 
2 22  GLY n 
2 23  TYR n 
2 24  TYR n 
2 25  SER n 
2 26  TRP n 
2 27  ARG n 
2 28  ASN n 
2 29  SER n 
2 30  LYS n 
2 31  ASP n 
2 32  GLY n 
2 33  SER n 
2 34  TRP n 
2 35  PHE n 
2 36  ILE n 
2 37  GLN n 
2 38  SER n 
2 39  LEU n 
2 40  CYS n 
2 41  ALA n 
2 42  MET n 
2 43  LEU n 
2 44  LYS n 
2 45  GLN n 
2 46  TYR n 
2 47  ALA n 
2 48  ASP n 
2 49  LYS n 
2 50  LEU n 
2 51  GLU n 
2 52  PHE n 
2 53  MET n 
2 54  HIS n 
2 55  ILE n 
2 56  LEU n 
2 57  THR n 
2 58  ARG n 
2 59  VAL n 
2 60  ASN n 
2 61  ARG n 
2 62  LYS n 
2 63  VAL n 
2 64  ALA n 
2 65  THR n 
2 66  GLU n 
2 67  PHE n 
2 68  GLU n 
2 69  SER n 
2 70  PHE n 
2 71  SER n 
2 72  PHE n 
2 73  ASP n 
2 74  ALA n 
2 75  THR n 
2 76  PHE n 
2 77  HIS n 
2 78  ALA n 
2 79  LYS n 
2 80  LYS n 
2 81  GLN n 
2 82  ILE n 
2 83  PRO n 
2 84  CYS n 
2 85  ILE n 
2 86  VAL n 
2 87  SER n 
2 88  MET n 
2 89  LEU n 
2 90  THR n 
2 91  LYS n 
2 92  GLU n 
2 93  LEU n 
2 94  TYR n 
2 95  PHE n 
2 96  TYR n 
2 97  HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 
'Escherichia coli' ? ? 'BL21 (DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? 'HUMAN T-LYMPHOCYTE CELL LINE JURKAT' 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 
'Escherichia coli' ? ? 'BL21 (DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ?                                     
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP CASP3_HUMAN P42574 1 29  ? ? 
2 UNP CASP3_HUMAN P42574 2 181 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1GFW A 1 ? 147 ? P42574 29  ? 175 ? 29  175 
2 2 1GFW B 1 ? 97  ? P42574 181 ? 277 ? 181 277 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                   ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                  ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                           ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                  ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                 ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                           ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                   ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                 ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                     ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                                   ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                                    ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                ? 'C5 H11 N O2 S'   149.211 
MSI non-polymer         . '1-METHYL-5-(2-PHENOXYMETHYL-PYRROLIDINE-1-SULFONYL)-1H-INDOLE-2,3-DIONE' ? 'C20 H20 N2 O5 S' 400.448 
PHE 'L-peptide linking' y PHENYLALANINE                                                             ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                                   ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                                    ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                                 ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                  ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                                    ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1GFW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.39 
_exptl_crystal.density_percent_sol   48.60 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.9 
_exptl_crystal_grow.pdbx_details    
;4 ul hanging drops were prepared by mixing equal volumes of protein (10 mg/ml in 20 mM HEPES, pH 7.0) and reservoir solution. The drops equilibrated against 500 ul of 15-18% PEG6000, 0.1M sodium citrate, pH 5.9, 20 mM L-cysteine, and 5% glycerol., VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   1998-01-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.100 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12B 
_diffrn_source.pdbx_wavelength             1.100 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1GFW 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   6775 
_reflns.number_all                   7014 
_reflns.percent_possible_obs         96.6 
_reflns.pdbx_Rmerge_I_obs            0.174 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        4.3 
_reflns.B_iso_Wilson_estimate        47.0 
_reflns.pdbx_redundancy              4.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.8 
_reflns_shell.d_res_low              2.9 
_reflns_shell.percent_possible_all   82.4 
_reflns_shell.Rmerge_I_obs           0.267 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        3.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      692 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1GFW 
_refine.ls_number_reflns_obs                     6386 
_refine.ls_number_reflns_all                     7014 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               1413969.37 
_refine.pdbx_data_cutoff_low_absF                0.0 
_refine.ls_d_res_low                             40.0 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    92.3 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2 
_refine.ls_R_factor_R_free                       0.285 
_refine.ls_R_factor_R_free_error                 0.011 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.8 
_refine.ls_number_reflns_R_free                  687 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 33.276 
_refine.solvent_model_param_bsol                 0.363132 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;Data collection proceeded in the presence of "ice-rings"
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'see Engh & Huber (1991) Acta Cryst A 47, 392-400.' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_SU_ML                            ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1GFW 
_refine_analyze.Luzzati_coordinate_error_obs    0.32 
_refine_analyze.Luzzati_sigma_a_obs             0.42 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.43 
_refine_analyze.Luzzati_sigma_a_free            0.44 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1922 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.number_atoms_solvent             45 
_refine_hist.number_atoms_total               1995 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        40.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.013 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.7   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      25.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.89  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.56  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.50  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.29  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.25  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.9 
_refine_ls_shell.number_reflns_R_work             824 
_refine_ls_shell.R_factor_R_work                  0.28 
_refine_ls_shell.percent_reflns_obs               80.4 
_refine_ls_shell.R_factor_R_free                  0.345 
_refine_ls_shell.R_factor_R_free_error            0.038 
_refine_ls_shell.percent_reflns_R_free            9.3 
_refine_ls_shell.number_reflns_R_free             84 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.pdbx_refine_id 
protein.top 1 protein_rep.param 'X-RAY DIFFRACTION' 
277.top     2 protein_rep.param 'X-RAY DIFFRACTION' 
water.top   3 water_rep.param   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1GFW 
_struct.title                     
'THE 2.8 ANGSTROM CRYSTAL STRUCTURE OF CASPASE-3 (APOPAIN OR CPP32)IN COMPLEX WITH AN ISATIN SULFONAMIDE INHIBITOR.' 
_struct.pdbx_descriptor           'CASPASE-3 (APOPAIN OR CPP32)IN COMPLEX WITH AN ISATIN SULFONAMIDE INHIBITOR.' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GFW 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'CASPASE INHIBITOR, CASPASE-3, APOPAIN, ISTIN SULFONAMIDE, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 HIS A 28  ? GLY A 32  ? HIS A 56  GLY A 60  5 ? 5  
HELX_P HELX_P2 2 GLY A 38  ? LEU A 53  ? GLY A 66  LEU A 81  1 ? 16 
HELX_P HELX_P3 3 THR A 64  ? GLU A 78  ? THR A 92  GLU A 106 1 ? 15 
HELX_P HELX_P4 4 LEU A 108 ? ASN A 113 ? LEU A 136 ASN A 141 1 ? 6  
HELX_P HELX_P5 5 CYS A 120 ? THR A 124 ? CYS A 148 THR A 152 5 ? 5  
HELX_P HELX_P6 6 TRP B 34  ? ALA B 47  ? TRP B 214 ALA B 227 1 ? 14 
HELX_P HELX_P7 7 GLU B 51  ? PHE B 67  ? GLU B 231 PHE B 247 1 ? 17 
HELX_P HELX_P8 8 ASP B 73  ? HIS B 77  ? ASP B 253 HIS B 257 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        none 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           C 
_struct_conn.ptnr1_label_comp_id           MSI 
_struct_conn.ptnr1_label_seq_id            . 
_struct_conn.ptnr1_label_atom_id           C3 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            135 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            MSI 
_struct_conn.ptnr1_auth_seq_id             1 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             163 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.829 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 56  ? ASN A 61  ? GLU A 84  ASN A 89  
A 2 LEU A 18  ? ASN A 23  ? LEU A 46  ASN A 51  
A 3 PHE A 86  ? LEU A 91  ? PHE A 114 LEU A 119 
A 4 LYS A 128 ? GLN A 133 ? LYS A 156 GLN A 161 
A 5 PHE B 13  ? TYR B 17  ? PHE B 193 TYR B 197 
A 6 CYS B 84  ? SER B 87  ? CYS B 264 SER B 267 
B 1 GLY A 94  ? GLU A 95  ? GLY A 122 GLU A 123 
B 2 ILE A 98  ? PHE A 100 ? ILE A 126 PHE A 128 
B 3 PRO A 105 ? ASP A 107 ? PRO A 133 ASP A 135 
C 1 ARG B 27  ? ASN B 28  ? ARG B 207 ASN B 208 
C 2 GLY B 32  ? SER B 33  ? GLY B 212 SER B 213 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 58  ? N ARG A 86  O CYS A 19  ? O CYS A 47  
A 2 3 N ILE A 20  ? N ILE A 48  O VAL A 87  ? O VAL A 115 
A 3 4 O PHE A 86  ? O PHE A 114 N LEU A 129 ? N LEU A 157 
A 4 5 N PHE A 130 ? N PHE A 158 O LEU B 14  ? O LEU B 194 
A 5 6 O TYR B 17  ? O TYR B 197 N CYS B 84  ? N CYS B 264 
B 1 2 O GLU A 95  ? O GLU A 123 N ILE A 98  ? N ILE A 126 
B 2 3 O ILE A 99  ? O ILE A 127 N VAL A 106 ? N VAL A 134 
C 1 2 N ASN B 28  ? N ASN B 208 O GLY B 32  ? O GLY B 212 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    13 
_struct_site.details              'BINDING SITE FOR RESIDUE MSI A 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 LYS A 29  ? LYS A 57  . ? 2_665 ? 
2  AC1 13 SER A 30  ? SER A 58  . ? 2_665 ? 
3  AC1 13 MET A 33  ? MET A 61  . ? 1_555 ? 
4  AC1 13 HIS A 93  ? HIS A 121 . ? 1_555 ? 
5  AC1 13 GLY A 94  ? GLY A 122 . ? 1_555 ? 
6  AC1 13 CYS A 135 ? CYS A 163 . ? 1_555 ? 
7  AC1 13 HOH D .   ? HOH A 184 . ? 1_555 ? 
8  AC1 13 HOH E .   ? HOH B 44  . ? 1_555 ? 
9  AC1 13 TYR B 24  ? TYR B 204 . ? 1_555 ? 
10 AC1 13 SER B 25  ? SER B 205 . ? 1_555 ? 
11 AC1 13 TRP B 26  ? TRP B 206 . ? 1_555 ? 
12 AC1 13 ARG B 27  ? ARG B 207 . ? 1_555 ? 
13 AC1 13 PHE B 76  ? PHE B 256 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1GFW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GFW 
_atom_sites.fract_transf_matrix[1][1]   0.014881 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012005 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010417 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1   ? 12.342 -6.061 59.242 1.00 33.21 ? 29  SER A N   1 
ATOM   2    C CA  . SER A 1 1   ? 13.477 -5.847 58.299 1.00 32.88 ? 29  SER A CA  1 
ATOM   3    C C   . SER A 1 1   ? 14.821 -5.978 59.031 1.00 32.99 ? 29  SER A C   1 
ATOM   4    O O   . SER A 1 1   ? 14.889 -6.465 60.166 1.00 32.00 ? 29  SER A O   1 
ATOM   5    C CB  . SER A 1 1   ? 13.361 -4.454 57.660 1.00 33.50 ? 29  SER A CB  1 
ATOM   6    O OG  . SER A 1 1   ? 13.537 -3.426 58.629 1.00 31.98 ? 29  SER A OG  1 
ATOM   7    N N   . GLY A 1 2   ? 15.891 -5.547 58.375 1.00 32.26 ? 30  GLY A N   1 
ATOM   8    C CA  . GLY A 1 2   ? 17.199 -5.618 58.996 1.00 34.04 ? 30  GLY A CA  1 
ATOM   9    C C   . GLY A 1 2   ? 17.697 -4.228 59.332 1.00 34.54 ? 30  GLY A C   1 
ATOM   10   O O   . GLY A 1 2   ? 16.957 -3.265 59.172 1.00 34.45 ? 30  GLY A O   1 
ATOM   11   N N   . ILE A 1 3   ? 18.939 -4.122 59.794 1.00 36.34 ? 31  ILE A N   1 
ATOM   12   C CA  . ILE A 1 3   ? 19.525 -2.829 60.133 1.00 37.99 ? 31  ILE A CA  1 
ATOM   13   C C   . ILE A 1 3   ? 19.368 -1.875 58.938 1.00 38.23 ? 31  ILE A C   1 
ATOM   14   O O   . ILE A 1 3   ? 19.623 -2.255 57.798 1.00 37.97 ? 31  ILE A O   1 
ATOM   15   C CB  . ILE A 1 3   ? 21.036 -2.978 60.470 1.00 39.10 ? 31  ILE A CB  1 
ATOM   16   C CG1 . ILE A 1 3   ? 21.289 -4.330 61.157 1.00 39.27 ? 31  ILE A CG1 1 
ATOM   17   C CG2 . ILE A 1 3   ? 21.493 -1.813 61.364 1.00 38.18 ? 31  ILE A CG2 1 
ATOM   18   C CD1 . ILE A 1 3   ? 22.774 -4.772 61.148 1.00 41.13 ? 31  ILE A CD1 1 
ATOM   19   N N   . SER A 1 4   ? 18.951 -0.636 59.195 1.00 40.09 ? 32  SER A N   1 
ATOM   20   C CA  . SER A 1 4   ? 18.766 0.326  58.110 1.00 41.17 ? 32  SER A CA  1 
ATOM   21   C C   . SER A 1 4   ? 19.699 1.535  58.149 1.00 41.81 ? 32  SER A C   1 
ATOM   22   O O   . SER A 1 4   ? 19.450 2.504  58.878 1.00 41.87 ? 32  SER A O   1 
ATOM   23   C CB  . SER A 1 4   ? 17.317 0.824  58.063 1.00 39.50 ? 32  SER A CB  1 
ATOM   24   O OG  . SER A 1 4   ? 16.959 1.446  59.276 1.00 38.92 ? 32  SER A OG  1 
ATOM   25   N N   . LEU A 1 5   ? 20.775 1.460  57.361 1.00 42.49 ? 33  LEU A N   1 
ATOM   26   C CA  . LEU A 1 5   ? 21.737 2.559  57.234 1.00 41.56 ? 33  LEU A CA  1 
ATOM   27   C C   . LEU A 1 5   ? 21.045 3.535  56.251 1.00 40.39 ? 33  LEU A C   1 
ATOM   28   O O   . LEU A 1 5   ? 19.930 3.283  55.785 1.00 37.73 ? 33  LEU A O   1 
ATOM   29   C CB  . LEU A 1 5   ? 23.084 2.050  56.643 1.00 40.55 ? 33  LEU A CB  1 
ATOM   30   C CG  . LEU A 1 5   ? 23.745 0.766  57.196 1.00 41.77 ? 33  LEU A CG  1 
ATOM   31   C CD1 . LEU A 1 5   ? 25.104 0.483  56.538 1.00 38.79 ? 33  LEU A CD1 1 
ATOM   32   C CD2 . LEU A 1 5   ? 23.948 0.915  58.691 1.00 40.76 ? 33  LEU A CD2 1 
ATOM   33   N N   . ASP A 1 6   ? 21.679 4.649  55.937 1.00 39.90 ? 34  ASP A N   1 
ATOM   34   C CA  . ASP A 1 6   ? 21.067 5.563  54.989 1.00 40.05 ? 34  ASP A CA  1 
ATOM   35   C C   . ASP A 1 6   ? 22.081 6.634  54.741 1.00 36.49 ? 34  ASP A C   1 
ATOM   36   O O   . ASP A 1 6   ? 21.882 7.804  55.040 1.00 36.22 ? 34  ASP A O   1 
ATOM   37   C CB  . ASP A 1 6   ? 19.753 6.145  55.537 1.00 43.04 ? 34  ASP A CB  1 
ATOM   38   C CG  . ASP A 1 6   ? 18.867 6.732  54.437 1.00 46.29 ? 34  ASP A CG  1 
ATOM   39   O OD1 . ASP A 1 6   ? 17.641 6.885  54.678 1.00 47.17 ? 34  ASP A OD1 1 
ATOM   40   O OD2 . ASP A 1 6   ? 19.403 7.042  53.337 1.00 46.71 ? 34  ASP A OD2 1 
ATOM   41   N N   . ASN A 1 7   ? 23.189 6.180  54.182 1.00 33.92 ? 35  ASN A N   1 
ATOM   42   C CA  . ASN A 1 7   ? 24.318 7.026  53.871 1.00 30.86 ? 35  ASN A CA  1 
ATOM   43   C C   . ASN A 1 7   ? 24.306 7.491  52.415 1.00 27.57 ? 35  ASN A C   1 
ATOM   44   O O   . ASN A 1 7   ? 25.266 8.057  51.937 1.00 27.95 ? 35  ASN A O   1 
ATOM   45   C CB  . ASN A 1 7   ? 25.591 6.246  54.191 1.00 32.87 ? 35  ASN A CB  1 
ATOM   46   C CG  . ASN A 1 7   ? 25.554 5.637  55.582 1.00 35.41 ? 35  ASN A CG  1 
ATOM   47   O OD1 . ASN A 1 7   ? 26.400 4.821  55.956 1.00 34.75 ? 35  ASN A OD1 1 
ATOM   48   N ND2 . ASN A 1 7   ? 24.559 6.037  56.362 1.00 38.67 ? 35  ASN A ND2 1 
ATOM   49   N N   . SER A 1 8   ? 23.211 7.251  51.709 1.00 25.26 ? 36  SER A N   1 
ATOM   50   C CA  . SER A 1 8   ? 23.103 7.660  50.316 1.00 20.05 ? 36  SER A CA  1 
ATOM   51   C C   . SER A 1 8   ? 21.660 8.027  50.027 1.00 16.87 ? 36  SER A C   1 
ATOM   52   O O   . SER A 1 8   ? 20.737 7.400  50.575 1.00 11.51 ? 36  SER A O   1 
ATOM   53   C CB  . SER A 1 8   ? 23.533 6.527  49.398 1.00 22.22 ? 36  SER A CB  1 
ATOM   54   O OG  . SER A 1 8   ? 22.638 5.439  49.513 1.00 21.05 ? 36  SER A OG  1 
ATOM   55   N N   . TYR A 1 9   ? 21.494 9.037  49.166 1.00 13.46 ? 37  TYR A N   1 
ATOM   56   C CA  . TYR A 1 9   ? 20.188 9.570  48.775 1.00 11.36 ? 37  TYR A CA  1 
ATOM   57   C C   . TYR A 1 9   ? 19.313 8.602  48.034 1.00 11.47 ? 37  TYR A C   1 
ATOM   58   O O   . TYR A 1 9   ? 19.774 7.904  47.172 1.00 11.84 ? 37  TYR A O   1 
ATOM   59   C CB  . TYR A 1 9   ? 20.339 10.779 47.868 1.00 9.27  ? 37  TYR A CB  1 
ATOM   60   C CG  . TYR A 1 9   ? 20.856 12.021 48.511 1.00 8.19  ? 37  TYR A CG  1 
ATOM   61   C CD1 . TYR A 1 9   ? 20.027 12.828 49.255 1.00 8.10  ? 37  TYR A CD1 1 
ATOM   62   C CD2 . TYR A 1 9   ? 22.181 12.415 48.340 1.00 9.02  ? 37  TYR A CD2 1 
ATOM   63   C CE1 . TYR A 1 9   ? 20.500 14.013 49.816 1.00 9.30  ? 37  TYR A CE1 1 
ATOM   64   C CE2 . TYR A 1 9   ? 22.647 13.577 48.887 1.00 7.33  ? 37  TYR A CE2 1 
ATOM   65   C CZ  . TYR A 1 9   ? 21.804 14.372 49.624 1.00 7.44  ? 37  TYR A CZ  1 
ATOM   66   O OH  . TYR A 1 9   ? 22.277 15.523 50.185 1.00 11.40 ? 37  TYR A OH  1 
ATOM   67   N N   . LYS A 1 10  ? 18.032 8.600  48.356 1.00 12.76 ? 38  LYS A N   1 
ATOM   68   C CA  . LYS A 1 10  ? 17.099 7.727  47.684 1.00 14.56 ? 38  LYS A CA  1 
ATOM   69   C C   . LYS A 1 10  ? 16.997 8.218  46.239 1.00 15.64 ? 38  LYS A C   1 
ATOM   70   O O   . LYS A 1 10  ? 16.394 9.263  45.953 1.00 16.59 ? 38  LYS A O   1 
ATOM   71   C CB  . LYS A 1 10  ? 15.734 7.785  48.365 1.00 14.26 ? 38  LYS A CB  1 
ATOM   72   C CG  . LYS A 1 10  ? 14.711 6.927  47.682 1.00 19.87 ? 38  LYS A CG  1 
ATOM   73   C CD  . LYS A 1 10  ? 13.322 7.174  48.229 1.00 21.96 ? 38  LYS A CD  1 
ATOM   74   C CE  . LYS A 1 10  ? 12.318 6.224  47.607 1.00 20.65 ? 38  LYS A CE  1 
ATOM   75   N NZ  . LYS A 1 10  ? 10.957 6.618  48.001 1.00 25.95 ? 38  LYS A NZ  1 
ATOM   76   N N   . MET A 1 11  ? 17.590 7.442  45.340 1.00 15.40 ? 39  MET A N   1 
ATOM   77   C CA  . MET A 1 11  ? 17.624 7.758  43.928 1.00 16.30 ? 39  MET A CA  1 
ATOM   78   C C   . MET A 1 11  ? 16.745 6.859  43.115 1.00 17.98 ? 39  MET A C   1 
ATOM   79   O O   . MET A 1 11  ? 16.969 6.737  41.912 1.00 18.17 ? 39  MET A O   1 
ATOM   80   C CB  . MET A 1 11  ? 19.048 7.643  43.396 1.00 17.68 ? 39  MET A CB  1 
ATOM   81   C CG  . MET A 1 11  ? 20.017 8.647  44.005 1.00 17.54 ? 39  MET A CG  1 
ATOM   82   S SD  . MET A 1 11  ? 19.460 10.290 43.653 1.00 19.08 ? 39  MET A SD  1 
ATOM   83   C CE  . MET A 1 11  ? 19.987 10.415 42.006 1.00 17.65 ? 39  MET A CE  1 
ATOM   84   N N   . ASP A 1 12  ? 15.763 6.224  43.769 1.00 19.26 ? 40  ASP A N   1 
ATOM   85   C CA  . ASP A 1 12  ? 14.820 5.320  43.094 1.00 19.78 ? 40  ASP A CA  1 
ATOM   86   C C   . ASP A 1 12  ? 13.409 5.909  42.924 1.00 18.84 ? 40  ASP A C   1 
ATOM   87   O O   . ASP A 1 12  ? 12.427 5.175  42.762 1.00 17.29 ? 40  ASP A O   1 
ATOM   88   C CB  . ASP A 1 12  ? 14.731 3.958  43.812 1.00 22.29 ? 40  ASP A CB  1 
ATOM   89   C CG  . ASP A 1 12  ? 14.311 4.072  45.283 1.00 27.34 ? 40  ASP A CG  1 
ATOM   90   O OD1 . ASP A 1 12  ? 13.331 4.774  45.589 1.00 30.69 ? 40  ASP A OD1 1 
ATOM   91   O OD2 . ASP A 1 12  ? 14.951 3.437  46.149 1.00 32.20 ? 40  ASP A OD2 1 
ATOM   92   N N   . TYR A 1 13  ? 13.291 7.227  42.971 1.00 16.42 ? 41  TYR A N   1 
ATOM   93   C CA  . TYR A 1 13  ? 11.973 7.797  42.750 1.00 19.73 ? 41  TYR A CA  1 
ATOM   94   C C   . TYR A 1 13  ? 11.569 7.571  41.286 1.00 19.52 ? 41  TYR A C   1 
ATOM   95   O O   . TYR A 1 13  ? 12.432 7.436  40.398 1.00 20.32 ? 41  TYR A O   1 
ATOM   96   C CB  . TYR A 1 13  ? 11.935 9.299  43.054 1.00 21.66 ? 41  TYR A CB  1 
ATOM   97   C CG  . TYR A 1 13  ? 11.912 9.641  44.523 1.00 24.75 ? 41  TYR A CG  1 
ATOM   98   C CD1 . TYR A 1 13  ? 13.094 9.671  45.275 1.00 26.77 ? 41  TYR A CD1 1 
ATOM   99   C CD2 . TYR A 1 13  ? 10.709 9.943  45.168 1.00 24.98 ? 41  TYR A CD2 1 
ATOM   100  C CE1 . TYR A 1 13  ? 13.074 10.000 46.631 1.00 26.49 ? 41  TYR A CE1 1 
ATOM   101  C CE2 . TYR A 1 13  ? 10.681 10.267 46.517 1.00 25.99 ? 41  TYR A CE2 1 
ATOM   102  C CZ  . TYR A 1 13  ? 11.865 10.295 47.240 1.00 26.56 ? 41  TYR A CZ  1 
ATOM   103  O OH  . TYR A 1 13  ? 11.837 10.633 48.568 1.00 26.68 ? 41  TYR A OH  1 
ATOM   104  N N   . PRO A 1 14  ? 10.251 7.520  41.015 1.00 18.21 ? 42  PRO A N   1 
ATOM   105  C CA  . PRO A 1 14  ? 9.772  7.311  39.652 1.00 17.23 ? 42  PRO A CA  1 
ATOM   106  C C   . PRO A 1 14  ? 10.553 8.044  38.586 1.00 16.02 ? 42  PRO A C   1 
ATOM   107  O O   . PRO A 1 14  ? 10.652 7.551  37.478 1.00 16.56 ? 42  PRO A O   1 
ATOM   108  C CB  . PRO A 1 14  ? 8.307  7.744  39.716 1.00 17.05 ? 42  PRO A CB  1 
ATOM   109  C CG  . PRO A 1 14  ? 8.107  8.263  41.113 1.00 17.57 ? 42  PRO A CG  1 
ATOM   110  C CD  . PRO A 1 14  ? 9.112  7.544  41.936 1.00 15.77 ? 42  PRO A CD  1 
ATOM   111  N N   . GLU A 1 15  ? 11.121 9.196  38.928 1.00 14.73 ? 43  GLU A N   1 
ATOM   112  C CA  . GLU A 1 15  ? 11.894 9.983  37.976 1.00 15.63 ? 43  GLU A CA  1 
ATOM   113  C C   . GLU A 1 15  ? 13.230 10.410 38.570 1.00 16.66 ? 43  GLU A C   1 
ATOM   114  O O   . GLU A 1 15  ? 13.308 10.721 39.744 1.00 18.10 ? 43  GLU A O   1 
ATOM   115  C CB  . GLU A 1 15  ? 11.130 11.239 37.579 1.00 13.22 ? 43  GLU A CB  1 
ATOM   116  C CG  . GLU A 1 15  ? 9.653  11.078 37.539 1.00 13.93 ? 43  GLU A CG  1 
ATOM   117  C CD  . GLU A 1 15  ? 8.956  12.310 37.010 1.00 17.25 ? 43  GLU A CD  1 
ATOM   118  O OE1 . GLU A 1 15  ? 9.496  13.406 37.180 1.00 22.68 ? 43  GLU A OE1 1 
ATOM   119  O OE2 . GLU A 1 15  ? 7.860  12.203 36.437 1.00 18.55 ? 43  GLU A OE2 1 
ATOM   120  N N   . MET A 1 16  ? 14.276 10.445 37.752 1.00 17.33 ? 44  MET A N   1 
ATOM   121  C CA  . MET A 1 16  ? 15.599 10.850 38.222 1.00 16.70 ? 44  MET A CA  1 
ATOM   122  C C   . MET A 1 16  ? 15.750 12.334 38.504 1.00 17.11 ? 44  MET A C   1 
ATOM   123  O O   . MET A 1 16  ? 16.681 12.736 39.179 1.00 19.48 ? 44  MET A O   1 
ATOM   124  C CB  . MET A 1 16  ? 16.666 10.449 37.223 1.00 17.38 ? 44  MET A CB  1 
ATOM   125  C CG  . MET A 1 16  ? 17.138 9.039  37.405 1.00 17.31 ? 44  MET A CG  1 
ATOM   126  S SD  . MET A 1 16  ? 17.945 8.802  38.983 1.00 19.69 ? 44  MET A SD  1 
ATOM   127  C CE  . MET A 1 16  ? 19.615 9.471  38.674 1.00 10.19 ? 44  MET A CE  1 
ATOM   128  N N   . GLY A 1 17  ? 14.832 13.138 37.985 1.00 16.39 ? 45  GLY A N   1 
ATOM   129  C CA  . GLY A 1 17  ? 14.872 14.579 38.183 1.00 14.44 ? 45  GLY A CA  1 
ATOM   130  C C   . GLY A 1 17  ? 15.047 15.351 36.884 1.00 15.01 ? 45  GLY A C   1 
ATOM   131  O O   . GLY A 1 17  ? 15.683 14.868 35.947 1.00 14.05 ? 45  GLY A O   1 
ATOM   132  N N   . LEU A 1 18  ? 14.480 16.549 36.804 1.00 15.20 ? 46  LEU A N   1 
ATOM   133  C CA  . LEU A 1 18  ? 14.655 17.322 35.582 1.00 16.59 ? 46  LEU A CA  1 
ATOM   134  C C   . LEU A 1 18  ? 15.970 18.086 35.629 1.00 13.65 ? 46  LEU A C   1 
ATOM   135  O O   . LEU A 1 18  ? 16.306 18.608 36.655 1.00 15.24 ? 46  LEU A O   1 
ATOM   136  C CB  . LEU A 1 18  ? 13.457 18.254 35.350 1.00 19.63 ? 46  LEU A CB  1 
ATOM   137  C CG  . LEU A 1 18  ? 12.878 19.211 36.377 1.00 19.97 ? 46  LEU A CG  1 
ATOM   138  C CD1 . LEU A 1 18  ? 13.706 20.461 36.486 1.00 22.36 ? 46  LEU A CD1 1 
ATOM   139  C CD2 . LEU A 1 18  ? 11.522 19.570 35.932 1.00 21.16 ? 46  LEU A CD2 1 
ATOM   140  N N   . CYS A 1 19  ? 16.722 18.105 34.530 1.00 12.99 ? 47  CYS A N   1 
ATOM   141  C CA  . CYS A 1 19  ? 18.022 18.793 34.463 1.00 12.18 ? 47  CYS A CA  1 
ATOM   142  C C   . CYS A 1 19  ? 18.018 20.075 33.592 1.00 10.88 ? 47  CYS A C   1 
ATOM   143  O O   . CYS A 1 19  ? 17.884 20.013 32.371 1.00 12.30 ? 47  CYS A O   1 
ATOM   144  C CB  . CYS A 1 19  ? 19.085 17.812 33.948 1.00 12.02 ? 47  CYS A CB  1 
ATOM   145  S SG  . CYS A 1 19  ? 20.614 18.549 33.263 1.00 10.59 ? 47  CYS A SG  1 
ATOM   146  N N   . ILE A 1 20  ? 18.184 21.234 34.209 1.00 8.71  ? 48  ILE A N   1 
ATOM   147  C CA  . ILE A 1 20  ? 18.159 22.463 33.434 1.00 10.12 ? 48  ILE A CA  1 
ATOM   148  C C   . ILE A 1 20  ? 19.538 22.916 32.971 1.00 9.52  ? 48  ILE A C   1 
ATOM   149  O O   . ILE A 1 20  ? 20.454 23.040 33.757 1.00 10.83 ? 48  ILE A O   1 
ATOM   150  C CB  . ILE A 1 20  ? 17.414 23.619 34.229 1.00 10.11 ? 48  ILE A CB  1 
ATOM   151  C CG1 . ILE A 1 20  ? 15.896 23.455 34.087 1.00 7.08  ? 48  ILE A CG1 1 
ATOM   152  C CG2 . ILE A 1 20  ? 17.803 25.010 33.695 1.00 9.25  ? 48  ILE A CG2 1 
ATOM   153  C CD1 . ILE A 1 20  ? 15.400 22.102 34.374 1.00 8.34  ? 48  ILE A CD1 1 
ATOM   154  N N   . ILE A 1 21  ? 19.675 23.133 31.671 1.00 9.77  ? 49  ILE A N   1 
ATOM   155  C CA  . ILE A 1 21  ? 20.924 23.595 31.101 1.00 12.58 ? 49  ILE A CA  1 
ATOM   156  C C   . ILE A 1 21  ? 20.722 24.953 30.398 1.00 15.08 ? 49  ILE A C   1 
ATOM   157  O O   . ILE A 1 21  ? 19.957 25.076 29.426 1.00 16.42 ? 49  ILE A O   1 
ATOM   158  C CB  . ILE A 1 21  ? 21.475 22.582 30.084 1.00 11.99 ? 49  ILE A CB  1 
ATOM   159  C CG1 . ILE A 1 21  ? 21.708 21.234 30.775 1.00 11.25 ? 49  ILE A CG1 1 
ATOM   160  C CG2 . ILE A 1 21  ? 22.754 23.134 29.434 1.00 11.68 ? 49  ILE A CG2 1 
ATOM   161  C CD1 . ILE A 1 21  ? 22.257 20.138 29.858 1.00 9.30  ? 49  ILE A CD1 1 
ATOM   162  N N   . ILE A 1 22  ? 21.404 25.971 30.906 1.00 13.63 ? 50  ILE A N   1 
ATOM   163  C CA  . ILE A 1 22  ? 21.328 27.315 30.341 1.00 14.36 ? 50  ILE A CA  1 
ATOM   164  C C   . ILE A 1 22  ? 22.593 27.575 29.533 1.00 14.43 ? 50  ILE A C   1 
ATOM   165  O O   . ILE A 1 22  ? 23.673 27.727 30.099 1.00 13.03 ? 50  ILE A O   1 
ATOM   166  C CB  . ILE A 1 22  ? 21.198 28.348 31.465 1.00 14.46 ? 50  ILE A CB  1 
ATOM   167  C CG1 . ILE A 1 22  ? 19.812 28.219 32.097 1.00 13.75 ? 50  ILE A CG1 1 
ATOM   168  C CG2 . ILE A 1 22  ? 21.443 29.739 30.935 1.00 13.58 ? 50  ILE A CG2 1 
ATOM   169  C CD1 . ILE A 1 22  ? 19.702 28.794 33.469 1.00 11.29 ? 50  ILE A CD1 1 
ATOM   170  N N   . ASN A 1 23  ? 22.433 27.640 28.212 1.00 14.33 ? 51  ASN A N   1 
ATOM   171  C CA  . ASN A 1 23  ? 23.536 27.820 27.268 1.00 17.39 ? 51  ASN A CA  1 
ATOM   172  C C   . ASN A 1 23  ? 23.714 29.227 26.687 1.00 18.94 ? 51  ASN A C   1 
ATOM   173  O O   . ASN A 1 23  ? 23.424 29.463 25.509 1.00 21.63 ? 51  ASN A O   1 
ATOM   174  C CB  . ASN A 1 23  ? 23.369 26.822 26.104 1.00 17.61 ? 51  ASN A CB  1 
ATOM   175  C CG  . ASN A 1 23  ? 24.628 26.671 25.257 1.00 18.40 ? 51  ASN A CG  1 
ATOM   176  O OD1 . ASN A 1 23  ? 24.563 26.263 24.100 1.00 18.56 ? 51  ASN A OD1 1 
ATOM   177  N ND2 . ASN A 1 23  ? 25.777 26.975 25.840 1.00 16.20 ? 51  ASN A ND2 1 
ATOM   178  N N   . ASN A 1 24  ? 24.221 30.155 27.485 1.00 18.62 ? 52  ASN A N   1 
ATOM   179  C CA  . ASN A 1 24  ? 24.427 31.498 26.974 1.00 18.07 ? 52  ASN A CA  1 
ATOM   180  C C   . ASN A 1 24  ? 25.658 31.577 26.092 1.00 17.60 ? 52  ASN A C   1 
ATOM   181  O O   . ASN A 1 24  ? 26.769 31.348 26.556 1.00 16.11 ? 52  ASN A O   1 
ATOM   182  C CB  . ASN A 1 24  ? 24.545 32.514 28.111 1.00 17.82 ? 52  ASN A CB  1 
ATOM   183  C CG  . ASN A 1 24  ? 23.241 32.717 28.842 1.00 17.73 ? 52  ASN A CG  1 
ATOM   184  O OD1 . ASN A 1 24  ? 22.177 32.549 28.270 1.00 16.65 ? 52  ASN A OD1 1 
ATOM   185  N ND2 . ASN A 1 24  ? 23.320 33.099 30.112 1.00 19.31 ? 52  ASN A ND2 1 
ATOM   186  N N   . LYS A 1 25  ? 25.437 31.898 24.815 1.00 18.61 ? 53  LYS A N   1 
ATOM   187  C CA  . LYS A 1 25  ? 26.512 32.033 23.832 1.00 20.81 ? 53  LYS A CA  1 
ATOM   188  C C   . LYS A 1 25  ? 26.703 33.479 23.354 1.00 21.62 ? 53  LYS A C   1 
ATOM   189  O O   . LYS A 1 25  ? 27.838 33.935 23.198 1.00 19.72 ? 53  LYS A O   1 
ATOM   190  C CB  . LYS A 1 25  ? 26.248 31.143 22.610 1.00 22.15 ? 53  LYS A CB  1 
ATOM   191  C CG  . LYS A 1 25  ? 27.426 31.106 21.629 1.00 26.22 ? 53  LYS A CG  1 
ATOM   192  C CD  . LYS A 1 25  ? 27.113 30.400 20.310 1.00 27.34 ? 53  LYS A CD  1 
ATOM   193  C CE  . LYS A 1 25  ? 28.240 30.581 19.305 0.00 27.04 ? 53  LYS A CE  1 
ATOM   194  N NZ  . LYS A 1 25  ? 27.915 29.968 17.988 0.00 27.04 ? 53  LYS A NZ  1 
ATOM   195  N N   . ASN A 1 26  ? 25.589 34.188 23.146 1.00 22.25 ? 54  ASN A N   1 
ATOM   196  C CA  . ASN A 1 26  ? 25.578 35.570 22.644 1.00 21.96 ? 54  ASN A CA  1 
ATOM   197  C C   . ASN A 1 26  ? 25.105 36.631 23.640 1.00 23.37 ? 54  ASN A C   1 
ATOM   198  O O   . ASN A 1 26  ? 24.037 36.505 24.218 1.00 25.91 ? 54  ASN A O   1 
ATOM   199  C CB  . ASN A 1 26  ? 24.674 35.641 21.420 1.00 21.26 ? 54  ASN A CB  1 
ATOM   200  C CG  . ASN A 1 26  ? 25.057 34.646 20.355 1.00 21.88 ? 54  ASN A CG  1 
ATOM   201  O OD1 . ASN A 1 26  ? 26.072 34.805 19.679 1.00 23.99 ? 54  ASN A OD1 1 
ATOM   202  N ND2 . ASN A 1 26  ? 24.252 33.605 20.205 1.00 16.90 ? 54  ASN A ND2 1 
ATOM   203  N N   . PHE A 1 27  ? 25.878 37.700 23.787 1.00 24.32 ? 55  PHE A N   1 
ATOM   204  C CA  . PHE A 1 27  ? 25.558 38.787 24.710 1.00 25.88 ? 55  PHE A CA  1 
ATOM   205  C C   . PHE A 1 27  ? 25.241 40.122 24.032 1.00 26.45 ? 55  PHE A C   1 
ATOM   206  O O   . PHE A 1 27  ? 25.788 40.446 22.986 1.00 25.08 ? 55  PHE A O   1 
ATOM   207  C CB  . PHE A 1 27  ? 26.716 38.945 25.691 1.00 27.36 ? 55  PHE A CB  1 
ATOM   208  C CG  . PHE A 1 27  ? 27.078 37.661 26.375 1.00 30.07 ? 55  PHE A CG  1 
ATOM   209  C CD1 . PHE A 1 27  ? 27.743 36.651 25.676 1.00 31.77 ? 55  PHE A CD1 1 
ATOM   210  C CD2 . PHE A 1 27  ? 26.644 37.402 27.672 1.00 29.24 ? 55  PHE A CD2 1 
ATOM   211  C CE1 . PHE A 1 27  ? 27.959 35.408 26.248 1.00 30.81 ? 55  PHE A CE1 1 
ATOM   212  C CE2 . PHE A 1 27  ? 26.853 36.162 28.254 1.00 30.33 ? 55  PHE A CE2 1 
ATOM   213  C CZ  . PHE A 1 27  ? 27.509 35.160 27.543 1.00 31.86 ? 55  PHE A CZ  1 
ATOM   214  N N   . HIS A 1 28  ? 24.346 40.889 24.642 1.00 28.39 ? 56  HIS A N   1 
ATOM   215  C CA  . HIS A 1 28  ? 23.921 42.172 24.110 1.00 30.18 ? 56  HIS A CA  1 
ATOM   216  C C   . HIS A 1 28  ? 25.068 43.149 23.927 1.00 33.02 ? 56  HIS A C   1 
ATOM   217  O O   . HIS A 1 28  ? 25.796 43.447 24.879 1.00 34.11 ? 56  HIS A O   1 
ATOM   218  C CB  . HIS A 1 28  ? 22.879 42.796 25.026 1.00 31.22 ? 56  HIS A CB  1 
ATOM   219  C CG  . HIS A 1 28  ? 21.592 42.037 25.081 1.00 32.66 ? 56  HIS A CG  1 
ATOM   220  N ND1 . HIS A 1 28  ? 20.448 42.555 25.649 1.00 32.51 ? 56  HIS A ND1 1 
ATOM   221  C CD2 . HIS A 1 28  ? 21.271 40.794 24.655 1.00 32.05 ? 56  HIS A CD2 1 
ATOM   222  C CE1 . HIS A 1 28  ? 19.476 41.665 25.572 1.00 32.28 ? 56  HIS A CE1 1 
ATOM   223  N NE2 . HIS A 1 28  ? 19.949 40.586 24.973 1.00 33.49 ? 56  HIS A NE2 1 
ATOM   224  N N   . LYS A 1 29  ? 25.207 43.666 22.702 1.00 34.40 ? 57  LYS A N   1 
ATOM   225  C CA  . LYS A 1 29  ? 26.269 44.602 22.368 1.00 32.58 ? 57  LYS A CA  1 
ATOM   226  C C   . LYS A 1 29  ? 26.684 45.407 23.590 1.00 34.03 ? 57  LYS A C   1 
ATOM   227  O O   . LYS A 1 29  ? 27.868 45.621 23.836 1.00 34.78 ? 57  LYS A O   1 
ATOM   228  C CB  . LYS A 1 29  ? 25.808 45.550 21.257 0.00 32.87 ? 57  LYS A CB  1 
ATOM   229  C CG  . LYS A 1 29  ? 25.414 44.867 19.947 0.00 31.76 ? 57  LYS A CG  1 
ATOM   230  C CD  . LYS A 1 29  ? 26.604 44.244 19.218 0.00 31.21 ? 57  LYS A CD  1 
ATOM   231  C CE  . LYS A 1 29  ? 27.051 42.932 19.850 0.00 30.81 ? 57  LYS A CE  1 
ATOM   232  N NZ  . LYS A 1 29  ? 25.953 41.926 19.867 0.00 30.42 ? 57  LYS A NZ  1 
ATOM   233  N N   . SER A 1 30  ? 25.699 45.817 24.379 1.00 34.51 ? 58  SER A N   1 
ATOM   234  C CA  . SER A 1 30  ? 25.920 46.657 25.562 1.00 34.02 ? 58  SER A CA  1 
ATOM   235  C C   . SER A 1 30  ? 26.788 46.113 26.702 1.00 33.25 ? 58  SER A C   1 
ATOM   236  O O   . SER A 1 30  ? 27.639 46.825 27.252 1.00 32.54 ? 58  SER A O   1 
ATOM   237  C CB  . SER A 1 30  ? 24.557 47.085 26.100 1.00 33.51 ? 58  SER A CB  1 
ATOM   238  O OG  . SER A 1 30  ? 23.765 47.592 25.040 1.00 31.78 ? 58  SER A OG  1 
ATOM   239  N N   . THR A 1 31  ? 26.561 44.856 27.057 1.00 32.22 ? 59  THR A N   1 
ATOM   240  C CA  . THR A 1 31  ? 27.305 44.199 28.126 1.00 31.28 ? 59  THR A CA  1 
ATOM   241  C C   . THR A 1 31  ? 28.820 44.326 27.938 1.00 31.71 ? 59  THR A C   1 
ATOM   242  O O   . THR A 1 31  ? 29.587 44.262 28.908 1.00 31.01 ? 59  THR A O   1 
ATOM   243  C CB  . THR A 1 31  ? 26.921 42.718 28.190 1.00 30.54 ? 59  THR A CB  1 
ATOM   244  O OG1 . THR A 1 31  ? 27.212 42.098 26.931 1.00 28.80 ? 59  THR A OG1 1 
ATOM   245  C CG2 . THR A 1 31  ? 25.431 42.575 28.498 1.00 28.64 ? 59  THR A CG2 1 
ATOM   246  N N   . GLY A 1 32  ? 29.232 44.509 26.683 1.00 31.73 ? 60  GLY A N   1 
ATOM   247  C CA  . GLY A 1 32  ? 30.635 44.659 26.358 1.00 31.22 ? 60  GLY A CA  1 
ATOM   248  C C   . GLY A 1 32  ? 31.339 43.341 26.549 1.00 33.06 ? 60  GLY A C   1 
ATOM   249  O O   . GLY A 1 32  ? 32.481 43.286 27.020 1.00 32.16 ? 60  GLY A O   1 
ATOM   250  N N   . MET A 1 33  ? 30.638 42.269 26.201 1.00 33.07 ? 61  MET A N   1 
ATOM   251  C CA  . MET A 1 33  ? 31.185 40.935 26.332 1.00 33.35 ? 61  MET A CA  1 
ATOM   252  C C   . MET A 1 33  ? 31.072 40.227 25.010 1.00 32.34 ? 61  MET A C   1 
ATOM   253  O O   . MET A 1 33  ? 30.139 40.473 24.243 1.00 31.05 ? 61  MET A O   1 
ATOM   254  C CB  . MET A 1 33  ? 30.442 40.141 27.399 1.00 37.23 ? 61  MET A CB  1 
ATOM   255  C CG  . MET A 1 33  ? 31.011 40.288 28.807 1.00 43.97 ? 61  MET A CG  1 
ATOM   256  S SD  . MET A 1 33  ? 32.752 39.732 29.032 1.00 49.77 ? 61  MET A SD  1 
ATOM   257  C CE  . MET A 1 33  ? 33.039 40.406 30.699 1.00 48.53 ? 61  MET A CE  1 
ATOM   258  N N   . THR A 1 34  ? 32.023 39.338 24.747 1.00 29.72 ? 62  THR A N   1 
ATOM   259  C CA  . THR A 1 34  ? 32.022 38.612 23.501 1.00 26.23 ? 62  THR A CA  1 
ATOM   260  C C   . THR A 1 34  ? 31.309 37.291 23.645 1.00 25.59 ? 62  THR A C   1 
ATOM   261  O O   . THR A 1 34  ? 31.072 36.792 24.743 1.00 23.35 ? 62  THR A O   1 
ATOM   262  C CB  . THR A 1 34  ? 33.424 38.330 23.038 1.00 26.95 ? 62  THR A CB  1 
ATOM   263  O OG1 . THR A 1 34  ? 33.974 37.271 23.835 1.00 27.30 ? 62  THR A OG1 1 
ATOM   264  C CG2 . THR A 1 34  ? 34.285 39.592 23.200 1.00 29.27 ? 62  THR A CG2 1 
ATOM   265  N N   . SER A 1 35  ? 30.952 36.735 22.505 1.00 24.53 ? 63  SER A N   1 
ATOM   266  C CA  . SER A 1 35  ? 30.294 35.469 22.487 1.00 23.62 ? 63  SER A CA  1 
ATOM   267  C C   . SER A 1 35  ? 31.294 34.366 22.845 1.00 23.44 ? 63  SER A C   1 
ATOM   268  O O   . SER A 1 35  ? 32.495 34.427 22.564 1.00 21.71 ? 63  SER A O   1 
ATOM   269  C CB  . SER A 1 35  ? 29.710 35.242 21.113 1.00 24.87 ? 63  SER A CB  1 
ATOM   270  O OG  . SER A 1 35  ? 30.655 35.679 20.169 1.00 26.59 ? 63  SER A OG  1 
ATOM   271  N N   . ARG A 1 36  ? 30.758 33.350 23.489 1.00 22.56 ? 64  ARG A N   1 
ATOM   272  C CA  . ARG A 1 36  ? 31.532 32.229 23.913 1.00 21.25 ? 64  ARG A CA  1 
ATOM   273  C C   . ARG A 1 36  ? 31.390 31.237 22.788 1.00 23.82 ? 64  ARG A C   1 
ATOM   274  O O   . ARG A 1 36  ? 30.300 31.018 22.277 1.00 25.47 ? 64  ARG A O   1 
ATOM   275  C CB  . ARG A 1 36  ? 30.938 31.689 25.208 1.00 18.00 ? 64  ARG A CB  1 
ATOM   276  C CG  . ARG A 1 36  ? 30.662 32.771 26.234 1.00 14.34 ? 64  ARG A CG  1 
ATOM   277  C CD  . ARG A 1 36  ? 29.848 32.262 27.380 1.00 12.06 ? 64  ARG A CD  1 
ATOM   278  N NE  . ARG A 1 36  ? 30.593 31.263 28.121 1.00 16.85 ? 64  ARG A NE  1 
ATOM   279  C CZ  . ARG A 1 36  ? 30.216 29.999 28.281 1.00 14.85 ? 64  ARG A CZ  1 
ATOM   280  N NH1 . ARG A 1 36  ? 29.069 29.574 27.757 1.00 8.91  ? 64  ARG A NH1 1 
ATOM   281  N NH2 . ARG A 1 36  ? 31.023 29.166 28.930 1.00 13.32 ? 64  ARG A NH2 1 
ATOM   282  N N   . SER A 1 37  ? 32.499 30.658 22.375 1.00 24.53 ? 65  SER A N   1 
ATOM   283  C CA  . SER A 1 37  ? 32.450 29.685 21.318 1.00 26.33 ? 65  SER A CA  1 
ATOM   284  C C   . SER A 1 37  ? 32.845 28.359 21.926 1.00 28.35 ? 65  SER A C   1 
ATOM   285  O O   . SER A 1 37  ? 33.650 28.298 22.851 1.00 29.12 ? 65  SER A O   1 
ATOM   286  C CB  . SER A 1 37  ? 33.398 30.084 20.186 1.00 26.04 ? 65  SER A CB  1 
ATOM   287  O OG  . SER A 1 37  ? 34.524 30.790 20.681 1.00 30.94 ? 65  SER A OG  1 
ATOM   288  N N   . GLY A 1 38  ? 32.250 27.296 21.417 1.00 29.16 ? 66  GLY A N   1 
ATOM   289  C CA  . GLY A 1 38  ? 32.558 25.980 21.927 1.00 28.63 ? 66  GLY A CA  1 
ATOM   290  C C   . GLY A 1 38  ? 31.444 25.557 22.851 1.00 29.50 ? 66  GLY A C   1 
ATOM   291  O O   . GLY A 1 38  ? 31.181 24.362 23.018 1.00 29.90 ? 66  GLY A O   1 
ATOM   292  N N   . THR A 1 39  ? 30.774 26.546 23.434 1.00 27.81 ? 67  THR A N   1 
ATOM   293  C CA  . THR A 1 39  ? 29.694 26.284 24.368 1.00 27.41 ? 67  THR A CA  1 
ATOM   294  C C   . THR A 1 39  ? 28.580 25.397 23.853 1.00 26.69 ? 67  THR A C   1 
ATOM   295  O O   . THR A 1 39  ? 27.945 24.693 24.640 1.00 27.40 ? 67  THR A O   1 
ATOM   296  C CB  . THR A 1 39  ? 29.050 27.578 24.870 1.00 29.06 ? 67  THR A CB  1 
ATOM   297  O OG1 . THR A 1 39  ? 27.848 27.247 25.581 1.00 26.05 ? 67  THR A OG1 1 
ATOM   298  C CG2 . THR A 1 39  ? 28.746 28.526 23.707 1.00 27.29 ? 67  THR A CG2 1 
ATOM   299  N N   . ASP A 1 40  ? 28.340 25.430 22.543 1.00 26.26 ? 68  ASP A N   1 
ATOM   300  C CA  . ASP A 1 40  ? 27.283 24.618 21.949 1.00 24.40 ? 68  ASP A CA  1 
ATOM   301  C C   . ASP A 1 40  ? 27.641 23.159 21.963 1.00 21.64 ? 68  ASP A C   1 
ATOM   302  O O   . ASP A 1 40  ? 26.775 22.314 21.991 1.00 22.55 ? 68  ASP A O   1 
ATOM   303  C CB  . ASP A 1 40  ? 26.977 25.100 20.543 1.00 27.30 ? 68  ASP A CB  1 
ATOM   304  C CG  . ASP A 1 40  ? 26.097 26.346 20.545 1.00 31.72 ? 68  ASP A CG  1 
ATOM   305  O OD1 . ASP A 1 40  ? 24.974 26.231 21.075 1.00 32.56 ? 68  ASP A OD1 1 
ATOM   306  O OD2 . ASP A 1 40  ? 26.512 27.423 20.039 1.00 32.64 ? 68  ASP A OD2 1 
ATOM   307  N N   . VAL A 1 41  ? 28.933 22.868 21.947 1.00 20.75 ? 69  VAL A N   1 
ATOM   308  C CA  . VAL A 1 41  ? 29.413 21.495 22.032 1.00 18.79 ? 69  VAL A CA  1 
ATOM   309  C C   . VAL A 1 41  ? 29.181 21.074 23.495 1.00 17.40 ? 69  VAL A C   1 
ATOM   310  O O   . VAL A 1 41  ? 28.677 19.997 23.774 1.00 16.28 ? 69  VAL A O   1 
ATOM   311  C CB  . VAL A 1 41  ? 30.915 21.426 21.720 1.00 19.29 ? 69  VAL A CB  1 
ATOM   312  C CG1 . VAL A 1 41  ? 31.450 20.020 21.958 1.00 18.10 ? 69  VAL A CG1 1 
ATOM   313  C CG2 . VAL A 1 41  ? 31.146 21.856 20.327 1.00 18.85 ? 69  VAL A CG2 1 
ATOM   314  N N   . ASP A 1 42  ? 29.568 21.945 24.421 1.00 15.65 ? 70  ASP A N   1 
ATOM   315  C CA  . ASP A 1 42  ? 29.371 21.710 25.841 1.00 14.40 ? 70  ASP A CA  1 
ATOM   316  C C   . ASP A 1 42  ? 27.932 21.379 26.132 1.00 13.50 ? 70  ASP A C   1 
ATOM   317  O O   . ASP A 1 42  ? 27.639 20.411 26.820 1.00 14.43 ? 70  ASP A O   1 
ATOM   318  C CB  . ASP A 1 42  ? 29.696 22.954 26.641 1.00 16.54 ? 70  ASP A CB  1 
ATOM   319  C CG  . ASP A 1 42  ? 31.119 23.034 27.007 1.00 19.16 ? 70  ASP A CG  1 
ATOM   320  O OD1 . ASP A 1 42  ? 31.869 22.107 26.643 1.00 19.94 ? 70  ASP A OD1 1 
ATOM   321  O OD2 . ASP A 1 42  ? 31.480 24.029 27.661 1.00 22.31 ? 70  ASP A OD2 1 
ATOM   322  N N   . ALA A 1 43  ? 27.045 22.229 25.633 1.00 9.33  ? 71  ALA A N   1 
ATOM   323  C CA  . ALA A 1 43  ? 25.634 22.060 25.843 1.00 7.36  ? 71  ALA A CA  1 
ATOM   324  C C   . ALA A 1 43  ? 25.078 20.776 25.244 1.00 6.27  ? 71  ALA A C   1 
ATOM   325  O O   . ALA A 1 43  ? 24.218 20.140 25.838 1.00 6.34  ? 71  ALA A O   1 
ATOM   326  C CB  . ALA A 1 43  ? 24.905 23.271 25.305 1.00 7.62  ? 71  ALA A CB  1 
ATOM   327  N N   . ALA A 1 44  ? 25.558 20.395 24.069 1.00 6.30  ? 72  ALA A N   1 
ATOM   328  C CA  . ALA A 1 44  ? 25.079 19.183 23.410 1.00 9.61  ? 72  ALA A CA  1 
ATOM   329  C C   . ALA A 1 44  ? 25.492 17.969 24.221 1.00 10.46 ? 72  ALA A C   1 
ATOM   330  O O   . ALA A 1 44  ? 24.734 17.015 24.421 1.00 10.50 ? 72  ALA A O   1 
ATOM   331  C CB  . ALA A 1 44  ? 25.675 19.085 22.014 1.00 9.25  ? 72  ALA A CB  1 
ATOM   332  N N   . ASN A 1 45  ? 26.731 18.057 24.681 1.00 12.10 ? 73  ASN A N   1 
ATOM   333  C CA  . ASN A 1 45  ? 27.425 17.051 25.478 1.00 13.60 ? 73  ASN A CA  1 
ATOM   334  C C   . ASN A 1 45  ? 26.710 16.654 26.761 1.00 14.16 ? 73  ASN A C   1 
ATOM   335  O O   . ASN A 1 45  ? 26.549 15.470 27.060 1.00 14.84 ? 73  ASN A O   1 
ATOM   336  C CB  . ASN A 1 45  ? 28.785 17.607 25.830 1.00 14.47 ? 73  ASN A CB  1 
ATOM   337  C CG  . ASN A 1 45  ? 29.834 16.587 25.808 1.00 17.42 ? 73  ASN A CG  1 
ATOM   338  O OD1 . ASN A 1 45  ? 29.566 15.425 25.544 1.00 20.78 ? 73  ASN A OD1 1 
ATOM   339  N ND2 . ASN A 1 45  ? 31.062 17.000 26.089 1.00 19.55 ? 73  ASN A ND2 1 
ATOM   340  N N   . LEU A 1 46  ? 26.308 17.664 27.526 1.00 13.31 ? 74  LEU A N   1 
ATOM   341  C CA  . LEU A 1 46  ? 25.626 17.464 28.791 1.00 13.67 ? 74  LEU A CA  1 
ATOM   342  C C   . LEU A 1 46  ? 24.274 16.788 28.558 1.00 14.20 ? 74  LEU A C   1 
ATOM   343  O O   . LEU A 1 46  ? 23.858 15.912 29.317 1.00 14.80 ? 74  LEU A O   1 
ATOM   344  C CB  . LEU A 1 46  ? 25.427 18.811 29.489 1.00 11.67 ? 74  LEU A CB  1 
ATOM   345  C CG  . LEU A 1 46  ? 26.658 19.650 29.851 1.00 12.83 ? 74  LEU A CG  1 
ATOM   346  C CD1 . LEU A 1 46  ? 26.370 21.184 29.739 1.00 14.30 ? 74  LEU A CD1 1 
ATOM   347  C CD2 . LEU A 1 46  ? 27.065 19.297 31.245 1.00 12.89 ? 74  LEU A CD2 1 
ATOM   348  N N   . ARG A 1 47  ? 23.596 17.217 27.504 1.00 14.05 ? 75  ARG A N   1 
ATOM   349  C CA  . ARG A 1 47  ? 22.292 16.695 27.138 1.00 13.74 ? 75  ARG A CA  1 
ATOM   350  C C   . ARG A 1 47  ? 22.425 15.181 26.881 1.00 13.14 ? 75  ARG A C   1 
ATOM   351  O O   . ARG A 1 47  ? 21.677 14.354 27.419 1.00 9.65  ? 75  ARG A O   1 
ATOM   352  C CB  . ARG A 1 47  ? 21.824 17.453 25.894 1.00 12.26 ? 75  ARG A CB  1 
ATOM   353  C CG  . ARG A 1 47  ? 20.469 17.061 25.352 1.00 10.66 ? 75  ARG A CG  1 
ATOM   354  C CD  . ARG A 1 47  ? 20.370 17.588 23.924 1.00 11.97 ? 75  ARG A CD  1 
ATOM   355  N NE  . ARG A 1 47  ? 19.071 17.415 23.292 1.00 10.42 ? 75  ARG A NE  1 
ATOM   356  C CZ  . ARG A 1 47  ? 17.924 17.901 23.748 1.00 10.17 ? 75  ARG A CZ  1 
ATOM   357  N NH1 . ARG A 1 47  ? 17.883 18.604 24.861 1.00 6.77  ? 75  ARG A NH1 1 
ATOM   358  N NH2 . ARG A 1 47  ? 16.808 17.659 23.078 1.00 12.61 ? 75  ARG A NH2 1 
ATOM   359  N N   . GLU A 1 48  ? 23.402 14.820 26.066 1.00 13.41 ? 76  GLU A N   1 
ATOM   360  C CA  . GLU A 1 48  ? 23.627 13.414 25.781 1.00 14.88 ? 76  GLU A CA  1 
ATOM   361  C C   . GLU A 1 48  ? 23.981 12.641 27.048 1.00 15.04 ? 76  GLU A C   1 
ATOM   362  O O   . GLU A 1 48  ? 23.512 11.534 27.273 1.00 15.66 ? 76  GLU A O   1 
ATOM   363  C CB  . GLU A 1 48  ? 24.748 13.253 24.766 1.00 13.30 ? 76  GLU A CB  1 
ATOM   364  C CG  . GLU A 1 48  ? 25.111 11.828 24.522 1.00 15.46 ? 76  GLU A CG  1 
ATOM   365  C CD  . GLU A 1 48  ? 23.922 10.914 24.228 1.00 16.29 ? 76  GLU A CD  1 
ATOM   366  O OE1 . GLU A 1 48  ? 24.104 9.680  24.327 1.00 20.05 ? 76  GLU A OE1 1 
ATOM   367  O OE2 . GLU A 1 48  ? 22.828 11.396 23.892 1.00 12.55 ? 76  GLU A OE2 1 
ATOM   368  N N   . THR A 1 49  ? 24.804 13.252 27.883 1.00 15.60 ? 77  THR A N   1 
ATOM   369  C CA  . THR A 1 49  ? 25.251 12.626 29.110 1.00 15.49 ? 77  THR A CA  1 
ATOM   370  C C   . THR A 1 49  ? 24.170 12.461 30.146 1.00 15.32 ? 77  THR A C   1 
ATOM   371  O O   . THR A 1 49  ? 24.064 11.413 30.778 1.00 15.17 ? 77  THR A O   1 
ATOM   372  C CB  . THR A 1 49  ? 26.387 13.427 29.724 1.00 14.44 ? 77  THR A CB  1 
ATOM   373  O OG1 . THR A 1 49  ? 27.343 13.711 28.707 1.00 14.99 ? 77  THR A OG1 1 
ATOM   374  C CG2 . THR A 1 49  ? 27.068 12.629 30.818 1.00 15.88 ? 77  THR A CG2 1 
ATOM   375  N N   . PHE A 1 50  ? 23.371 13.500 30.327 1.00 16.14 ? 78  PHE A N   1 
ATOM   376  C CA  . PHE A 1 50  ? 22.324 13.448 31.316 1.00 17.68 ? 78  PHE A CA  1 
ATOM   377  C C   . PHE A 1 50  ? 21.164 12.661 30.785 1.00 19.31 ? 78  PHE A C   1 
ATOM   378  O O   . PHE A 1 50  ? 20.410 12.058 31.556 1.00 20.53 ? 78  PHE A O   1 
ATOM   379  C CB  . PHE A 1 50  ? 21.960 14.868 31.772 1.00 20.14 ? 78  PHE A CB  1 
ATOM   380  C CG  . PHE A 1 50  ? 22.949 15.429 32.780 1.00 21.73 ? 78  PHE A CG  1 
ATOM   381  C CD1 . PHE A 1 50  ? 22.772 15.209 34.148 1.00 22.22 ? 78  PHE A CD1 1 
ATOM   382  C CD2 . PHE A 1 50  ? 24.143 16.002 32.360 1.00 20.65 ? 78  PHE A CD2 1 
ATOM   383  C CE1 . PHE A 1 50  ? 23.766 15.530 35.068 1.00 19.28 ? 78  PHE A CE1 1 
ATOM   384  C CE2 . PHE A 1 50  ? 25.147 16.325 33.292 1.00 21.29 ? 78  PHE A CE2 1 
ATOM   385  C CZ  . PHE A 1 50  ? 24.949 16.082 34.640 1.00 20.33 ? 78  PHE A CZ  1 
ATOM   386  N N   . ARG A 1 51  ? 21.034 12.612 29.462 1.00 19.68 ? 79  ARG A N   1 
ATOM   387  C CA  . ARG A 1 51  ? 19.963 11.808 28.894 1.00 18.08 ? 79  ARG A CA  1 
ATOM   388  C C   . ARG A 1 51  ? 20.257 10.344 29.257 1.00 19.38 ? 79  ARG A C   1 
ATOM   389  O O   . ARG A 1 51  ? 19.336 9.591  29.566 1.00 21.43 ? 79  ARG A O   1 
ATOM   390  C CB  . ARG A 1 51  ? 19.888 11.962 27.379 1.00 15.00 ? 79  ARG A CB  1 
ATOM   391  C CG  . ARG A 1 51  ? 18.776 11.148 26.756 1.00 11.07 ? 79  ARG A CG  1 
ATOM   392  C CD  . ARG A 1 51  ? 18.900 11.163 25.242 1.00 9.60  ? 79  ARG A CD  1 
ATOM   393  N NE  . ARG A 1 51  ? 20.183 10.638 24.788 1.00 8.18  ? 79  ARG A NE  1 
ATOM   394  C CZ  . ARG A 1 51  ? 20.435 9.355  24.502 1.00 5.34  ? 79  ARG A CZ  1 
ATOM   395  N NH1 . ARG A 1 51  ? 19.500 8.430  24.600 1.00 2.82  ? 79  ARG A NH1 1 
ATOM   396  N NH2 . ARG A 1 51  ? 21.647 9.005  24.143 1.00 2.00  ? 79  ARG A NH2 1 
ATOM   397  N N   . ASN A 1 52  ? 21.533 9.946  29.218 1.00 17.58 ? 80  ASN A N   1 
ATOM   398  C CA  . ASN A 1 52  ? 21.908 8.574  29.563 1.00 17.30 ? 80  ASN A CA  1 
ATOM   399  C C   . ASN A 1 52  ? 21.705 8.363  31.045 1.00 19.48 ? 80  ASN A C   1 
ATOM   400  O O   . ASN A 1 52  ? 21.615 7.217  31.502 1.00 21.51 ? 80  ASN A O   1 
ATOM   401  C CB  . ASN A 1 52  ? 23.386 8.255  29.278 1.00 14.62 ? 80  ASN A CB  1 
ATOM   402  C CG  . ASN A 1 52  ? 23.725 8.230  27.801 1.00 14.44 ? 80  ASN A CG  1 
ATOM   403  O OD1 . ASN A 1 52  ? 22.960 7.732  26.977 1.00 10.07 ? 80  ASN A OD1 1 
ATOM   404  N ND2 . ASN A 1 52  ? 24.897 8.762  27.466 1.00 14.54 ? 80  ASN A ND2 1 
ATOM   405  N N   . LEU A 1 53  ? 21.668 9.451  31.809 1.00 18.40 ? 81  LEU A N   1 
ATOM   406  C CA  . LEU A 1 53  ? 21.491 9.308  33.243 1.00 18.28 ? 81  LEU A CA  1 
ATOM   407  C C   . LEU A 1 53  ? 20.028 9.396  33.643 1.00 18.87 ? 81  LEU A C   1 
ATOM   408  O O   . LEU A 1 53  ? 19.696 9.666  34.793 1.00 17.57 ? 81  LEU A O   1 
ATOM   409  C CB  . LEU A 1 53  ? 22.341 10.332 34.005 1.00 21.29 ? 81  LEU A CB  1 
ATOM   410  C CG  . LEU A 1 53  ? 23.853 10.018 34.084 1.00 20.66 ? 81  LEU A CG  1 
ATOM   411  C CD1 . LEU A 1 53  ? 24.598 11.082 34.861 1.00 18.29 ? 81  LEU A CD1 1 
ATOM   412  C CD2 . LEU A 1 53  ? 24.042 8.679  34.746 1.00 22.19 ? 81  LEU A CD2 1 
ATOM   413  N N   . LYS A 1 54  ? 19.154 9.151  32.672 1.00 18.24 ? 82  LYS A N   1 
ATOM   414  C CA  . LYS A 1 54  ? 17.727 9.150  32.918 1.00 16.22 ? 82  LYS A CA  1 
ATOM   415  C C   . LYS A 1 54  ? 17.174 10.472 33.421 1.00 14.73 ? 82  LYS A C   1 
ATOM   416  O O   . LYS A 1 54  ? 16.119 10.508 34.067 1.00 10.10 ? 82  LYS A O   1 
ATOM   417  C CB  . LYS A 1 54  ? 17.419 8.032  33.900 1.00 19.51 ? 82  LYS A CB  1 
ATOM   418  C CG  . LYS A 1 54  ? 16.447 6.997  33.357 1.00 25.15 ? 82  LYS A CG  1 
ATOM   419  C CD  . LYS A 1 54  ? 16.784 6.587  31.928 1.00 25.75 ? 82  LYS A CD  1 
ATOM   420  C CE  . LYS A 1 54  ? 18.140 5.906  31.844 1.00 26.56 ? 82  LYS A CE  1 
ATOM   421  N NZ  . LYS A 1 54  ? 18.368 5.330  30.486 1.00 27.11 ? 82  LYS A NZ  1 
ATOM   422  N N   . TYR A 1 55  ? 17.898 11.552 33.120 1.00 14.40 ? 83  TYR A N   1 
ATOM   423  C CA  . TYR A 1 55  ? 17.492 12.891 33.509 1.00 14.41 ? 83  TYR A CA  1 
ATOM   424  C C   . TYR A 1 55  ? 16.652 13.535 32.429 1.00 15.15 ? 83  TYR A C   1 
ATOM   425  O O   . TYR A 1 55  ? 16.913 13.363 31.252 1.00 15.33 ? 83  TYR A O   1 
ATOM   426  C CB  . TYR A 1 55  ? 18.699 13.772 33.794 1.00 17.12 ? 83  TYR A CB  1 
ATOM   427  C CG  . TYR A 1 55  ? 19.197 13.666 35.225 1.00 19.88 ? 83  TYR A CG  1 
ATOM   428  C CD1 . TYR A 1 55  ? 20.126 12.687 35.605 1.00 19.68 ? 83  TYR A CD1 1 
ATOM   429  C CD2 . TYR A 1 55  ? 18.717 14.521 36.200 1.00 16.95 ? 83  TYR A CD2 1 
ATOM   430  C CE1 . TYR A 1 55  ? 20.548 12.578 36.928 1.00 18.92 ? 83  TYR A CE1 1 
ATOM   431  C CE2 . TYR A 1 55  ? 19.130 14.418 37.498 1.00 16.55 ? 83  TYR A CE2 1 
ATOM   432  C CZ  . TYR A 1 55  ? 20.036 13.456 37.865 1.00 18.13 ? 83  TYR A CZ  1 
ATOM   433  O OH  . TYR A 1 55  ? 20.409 13.376 39.182 1.00 14.80 ? 83  TYR A OH  1 
ATOM   434  N N   . GLU A 1 56  ? 15.631 14.264 32.846 1.00 14.66 ? 84  GLU A N   1 
ATOM   435  C CA  . GLU A 1 56  ? 14.747 14.943 31.931 1.00 16.32 ? 84  GLU A CA  1 
ATOM   436  C C   . GLU A 1 56  ? 15.379 16.300 31.574 1.00 16.21 ? 84  GLU A C   1 
ATOM   437  O O   . GLU A 1 56  ? 15.091 17.315 32.213 1.00 16.80 ? 84  GLU A O   1 
ATOM   438  C CB  . GLU A 1 56  ? 13.401 15.144 32.613 1.00 20.89 ? 84  GLU A CB  1 
ATOM   439  C CG  . GLU A 1 56  ? 12.247 15.375 31.676 1.00 25.33 ? 84  GLU A CG  1 
ATOM   440  C CD  . GLU A 1 56  ? 11.319 16.426 32.197 1.00 29.27 ? 84  GLU A CD  1 
ATOM   441  O OE1 . GLU A 1 56  ? 11.791 17.559 32.403 1.00 32.04 ? 84  GLU A OE1 1 
ATOM   442  O OE2 . GLU A 1 56  ? 10.125 16.136 32.410 1.00 31.98 ? 84  GLU A OE2 1 
ATOM   443  N N   . VAL A 1 57  ? 16.229 16.307 30.545 1.00 15.17 ? 85  VAL A N   1 
ATOM   444  C CA  . VAL A 1 57  ? 16.955 17.506 30.105 1.00 13.89 ? 85  VAL A CA  1 
ATOM   445  C C   . VAL A 1 57  ? 16.152 18.580 29.360 1.00 14.08 ? 85  VAL A C   1 
ATOM   446  O O   . VAL A 1 57  ? 15.381 18.278 28.448 1.00 15.01 ? 85  VAL A O   1 
ATOM   447  C CB  . VAL A 1 57  ? 18.140 17.133 29.191 1.00 13.52 ? 85  VAL A CB  1 
ATOM   448  C CG1 . VAL A 1 57  ? 18.899 18.401 28.808 1.00 11.62 ? 85  VAL A CG1 1 
ATOM   449  C CG2 . VAL A 1 57  ? 19.044 16.100 29.871 1.00 10.62 ? 85  VAL A CG2 1 
ATOM   450  N N   . ARG A 1 58  ? 16.350 19.835 29.758 1.00 12.82 ? 86  ARG A N   1 
ATOM   451  C CA  . ARG A 1 58  ? 15.679 20.968 29.137 1.00 12.09 ? 86  ARG A CA  1 
ATOM   452  C C   . ARG A 1 58  ? 16.714 22.021 28.818 1.00 11.35 ? 86  ARG A C   1 
ATOM   453  O O   . ARG A 1 58  ? 17.094 22.779 29.687 1.00 13.20 ? 86  ARG A O   1 
ATOM   454  C CB  . ARG A 1 58  ? 14.630 21.578 30.073 1.00 11.60 ? 86  ARG A CB  1 
ATOM   455  C CG  . ARG A 1 58  ? 13.507 20.631 30.495 1.00 12.47 ? 86  ARG A CG  1 
ATOM   456  C CD  . ARG A 1 58  ? 12.440 21.412 31.284 1.00 16.36 ? 86  ARG A CD  1 
ATOM   457  N NE  . ARG A 1 58  ? 11.488 20.577 32.035 1.00 18.70 ? 86  ARG A NE  1 
ATOM   458  C CZ  . ARG A 1 58  ? 10.593 21.053 32.909 1.00 18.08 ? 86  ARG A CZ  1 
ATOM   459  N NH1 . ARG A 1 58  ? 10.510 22.363 33.151 1.00 15.64 ? 86  ARG A NH1 1 
ATOM   460  N NH2 . ARG A 1 58  ? 9.797  20.221 33.560 1.00 14.21 ? 86  ARG A NH2 1 
ATOM   461  N N   . ASN A 1 59  ? 17.187 22.053 27.577 1.00 12.40 ? 87  ASN A N   1 
ATOM   462  C CA  . ASN A 1 59  ? 18.177 23.050 27.159 1.00 14.25 ? 87  ASN A CA  1 
ATOM   463  C C   . ASN A 1 59  ? 17.486 24.406 27.000 1.00 17.88 ? 87  ASN A C   1 
ATOM   464  O O   . ASN A 1 59  ? 16.383 24.515 26.426 1.00 18.51 ? 87  ASN A O   1 
ATOM   465  C CB  . ASN A 1 59  ? 18.844 22.670 25.826 1.00 11.33 ? 87  ASN A CB  1 
ATOM   466  C CG  . ASN A 1 59  ? 19.998 21.648 25.988 1.00 12.15 ? 87  ASN A CG  1 
ATOM   467  O OD1 . ASN A 1 59  ? 19.799 20.453 25.874 1.00 6.92  ? 87  ASN A OD1 1 
ATOM   468  N ND2 . ASN A 1 59  ? 21.208 22.144 26.248 1.00 12.56 ? 87  ASN A ND2 1 
ATOM   469  N N   . LYS A 1 60  ? 18.125 25.445 27.516 1.00 17.79 ? 88  LYS A N   1 
ATOM   470  C CA  . LYS A 1 60  ? 17.554 26.765 27.411 1.00 18.20 ? 88  LYS A CA  1 
ATOM   471  C C   . LYS A 1 60  ? 18.653 27.689 26.924 1.00 19.71 ? 88  LYS A C   1 
ATOM   472  O O   . LYS A 1 60  ? 19.550 28.039 27.679 1.00 23.20 ? 88  LYS A O   1 
ATOM   473  C CB  . LYS A 1 60  ? 17.024 27.196 28.774 1.00 18.72 ? 88  LYS A CB  1 
ATOM   474  C CG  . LYS A 1 60  ? 15.847 26.378 29.284 0.00 19.50 ? 88  LYS A CG  1 
ATOM   475  C CD  . LYS A 1 60  ? 14.611 26.582 28.420 0.00 20.09 ? 88  LYS A CD  1 
ATOM   476  C CE  . LYS A 1 60  ? 13.417 25.819 28.972 0.00 20.43 ? 88  LYS A CE  1 
ATOM   477  N NZ  . LYS A 1 60  ? 12.200 26.024 28.139 0.00 20.56 ? 88  LYS A NZ  1 
ATOM   478  N N   . ASN A 1 61  ? 18.585 28.079 25.654 1.00 20.93 ? 89  ASN A N   1 
ATOM   479  C CA  . ASN A 1 61  ? 19.601 28.951 25.038 1.00 21.48 ? 89  ASN A CA  1 
ATOM   480  C C   . ASN A 1 61  ? 19.469 30.463 25.202 1.00 21.10 ? 89  ASN A C   1 
ATOM   481  O O   . ASN A 1 61  ? 18.373 31.003 25.251 1.00 20.34 ? 89  ASN A O   1 
ATOM   482  C CB  . ASN A 1 61  ? 19.694 28.654 23.544 1.00 22.03 ? 89  ASN A CB  1 
ATOM   483  C CG  . ASN A 1 61  ? 20.317 27.324 23.262 1.00 24.95 ? 89  ASN A CG  1 
ATOM   484  O OD1 . ASN A 1 61  ? 21.507 27.135 23.507 1.00 27.06 ? 89  ASN A OD1 1 
ATOM   485  N ND2 . ASN A 1 61  ? 19.525 26.383 22.755 1.00 21.52 ? 89  ASN A ND2 1 
ATOM   486  N N   . ASP A 1 62  ? 20.621 31.127 25.256 1.00 22.51 ? 90  ASP A N   1 
ATOM   487  C CA  . ASP A 1 62  ? 20.740 32.582 25.391 1.00 21.86 ? 90  ASP A CA  1 
ATOM   488  C C   . ASP A 1 62  ? 19.661 33.289 26.182 1.00 22.52 ? 90  ASP A C   1 
ATOM   489  O O   . ASP A 1 62  ? 18.881 34.043 25.632 1.00 24.06 ? 90  ASP A O   1 
ATOM   490  C CB  . ASP A 1 62  ? 20.844 33.207 24.019 1.00 21.23 ? 90  ASP A CB  1 
ATOM   491  C CG  . ASP A 1 62  ? 22.183 32.972 23.395 1.00 24.95 ? 90  ASP A CG  1 
ATOM   492  O OD1 . ASP A 1 62  ? 22.359 31.921 22.749 1.00 25.27 ? 90  ASP A OD1 1 
ATOM   493  O OD2 . ASP A 1 62  ? 23.068 33.839 23.577 1.00 26.17 ? 90  ASP A OD2 1 
ATOM   494  N N   . LEU A 1 63  ? 19.656 33.066 27.489 1.00 23.57 ? 91  LEU A N   1 
ATOM   495  C CA  . LEU A 1 63  ? 18.658 33.635 28.379 1.00 23.15 ? 91  LEU A CA  1 
ATOM   496  C C   . LEU A 1 63  ? 19.109 34.938 28.999 1.00 22.58 ? 91  LEU A C   1 
ATOM   497  O O   . LEU A 1 63  ? 20.283 35.075 29.347 1.00 23.02 ? 91  LEU A O   1 
ATOM   498  C CB  . LEU A 1 63  ? 18.351 32.645 29.507 1.00 23.19 ? 91  LEU A CB  1 
ATOM   499  C CG  . LEU A 1 63  ? 17.721 31.301 29.170 1.00 23.67 ? 91  LEU A CG  1 
ATOM   500  C CD1 . LEU A 1 63  ? 17.305 30.625 30.466 1.00 24.98 ? 91  LEU A CD1 1 
ATOM   501  C CD2 . LEU A 1 63  ? 16.511 31.492 28.296 1.00 23.50 ? 91  LEU A CD2 1 
ATOM   502  N N   . THR A 1 64  ? 18.183 35.885 29.160 1.00 21.01 ? 92  THR A N   1 
ATOM   503  C CA  . THR A 1 64  ? 18.532 37.157 29.781 1.00 21.26 ? 92  THR A CA  1 
ATOM   504  C C   . THR A 1 64  ? 18.531 37.008 31.286 1.00 21.89 ? 92  THR A C   1 
ATOM   505  O O   . THR A 1 64  ? 17.907 36.111 31.843 1.00 22.44 ? 92  THR A O   1 
ATOM   506  C CB  . THR A 1 64  ? 17.571 38.332 29.400 1.00 20.35 ? 92  THR A CB  1 
ATOM   507  O OG1 . THR A 1 64  ? 16.212 38.003 29.718 1.00 16.34 ? 92  THR A OG1 1 
ATOM   508  C CG2 . THR A 1 64  ? 17.713 38.665 27.926 1.00 20.42 ? 92  THR A CG2 1 
ATOM   509  N N   . ARG A 1 65  ? 19.248 37.892 31.952 1.00 22.59 ? 93  ARG A N   1 
ATOM   510  C CA  . ARG A 1 65  ? 19.309 37.812 33.382 1.00 21.99 ? 93  ARG A CA  1 
ATOM   511  C C   . ARG A 1 65  ? 17.874 37.681 33.920 1.00 20.79 ? 93  ARG A C   1 
ATOM   512  O O   . ARG A 1 65  ? 17.648 37.069 34.959 1.00 21.09 ? 93  ARG A O   1 
ATOM   513  C CB  . ARG A 1 65  ? 20.035 39.051 33.926 1.00 23.80 ? 93  ARG A CB  1 
ATOM   514  C CG  . ARG A 1 65  ? 19.387 40.377 33.538 1.00 28.18 ? 93  ARG A CG  1 
ATOM   515  C CD  . ARG A 1 65  ? 19.403 41.394 34.699 1.00 31.17 ? 93  ARG A CD  1 
ATOM   516  N NE  . ARG A 1 65  ? 20.450 42.403 34.587 1.00 34.13 ? 93  ARG A NE  1 
ATOM   517  C CZ  . ARG A 1 65  ? 20.210 43.689 34.340 1.00 38.98 ? 93  ARG A CZ  1 
ATOM   518  N NH1 . ARG A 1 65  ? 18.954 44.098 34.186 1.00 39.98 ? 93  ARG A NH1 1 
ATOM   519  N NH2 . ARG A 1 65  ? 21.212 44.574 34.249 1.00 39.95 ? 93  ARG A NH2 1 
ATOM   520  N N   . GLU A 1 66  ? 16.900 38.224 33.195 1.00 18.98 ? 94  GLU A N   1 
ATOM   521  C CA  . GLU A 1 66  ? 15.505 38.146 33.640 1.00 17.84 ? 94  GLU A CA  1 
ATOM   522  C C   . GLU A 1 66  ? 14.834 36.792 33.412 1.00 17.17 ? 94  GLU A C   1 
ATOM   523  O O   . GLU A 1 66  ? 14.069 36.328 34.243 1.00 17.37 ? 94  GLU A O   1 
ATOM   524  C CB  . GLU A 1 66  ? 14.648 39.225 32.971 1.00 17.11 ? 94  GLU A CB  1 
ATOM   525  C CG  . GLU A 1 66  ? 14.832 40.620 33.509 1.00 18.84 ? 94  GLU A CG  1 
ATOM   526  C CD  . GLU A 1 66  ? 16.027 41.335 32.912 1.00 22.34 ? 94  GLU A CD  1 
ATOM   527  O OE1 . GLU A 1 66  ? 16.697 40.755 32.037 1.00 25.58 ? 94  GLU A OE1 1 
ATOM   528  O OE2 . GLU A 1 66  ? 16.298 42.487 33.309 1.00 23.55 ? 94  GLU A OE2 1 
ATOM   529  N N   . GLU A 1 67  ? 15.118 36.169 32.277 1.00 16.92 ? 95  GLU A N   1 
ATOM   530  C CA  . GLU A 1 67  ? 14.528 34.890 31.931 1.00 15.34 ? 95  GLU A CA  1 
ATOM   531  C C   . GLU A 1 67  ? 15.115 33.768 32.759 1.00 15.16 ? 95  GLU A C   1 
ATOM   532  O O   . GLU A 1 67  ? 14.438 32.772 33.043 1.00 13.83 ? 95  GLU A O   1 
ATOM   533  C CB  . GLU A 1 67  ? 14.724 34.629 30.453 1.00 15.62 ? 95  GLU A CB  1 
ATOM   534  C CG  . GLU A 1 67  ? 14.141 35.733 29.580 1.00 15.06 ? 95  GLU A CG  1 
ATOM   535  C CD  . GLU A 1 67  ? 14.514 35.564 28.124 1.00 15.83 ? 95  GLU A CD  1 
ATOM   536  O OE1 . GLU A 1 67  ? 15.721 35.472 27.822 1.00 17.17 ? 95  GLU A OE1 1 
ATOM   537  O OE2 . GLU A 1 67  ? 13.604 35.519 27.277 1.00 15.64 ? 95  GLU A OE2 1 
ATOM   538  N N   . ILE A 1 68  ? 16.375 33.932 33.150 1.00 14.90 ? 96  ILE A N   1 
ATOM   539  C CA  . ILE A 1 68  ? 17.062 32.949 34.000 1.00 13.54 ? 96  ILE A CA  1 
ATOM   540  C C   . ILE A 1 68  ? 16.290 32.896 35.315 1.00 15.45 ? 96  ILE A C   1 
ATOM   541  O O   . ILE A 1 68  ? 15.854 31.843 35.770 1.00 17.79 ? 96  ILE A O   1 
ATOM   542  C CB  . ILE A 1 68  ? 18.491 33.403 34.268 1.00 10.96 ? 96  ILE A CB  1 
ATOM   543  C CG1 . ILE A 1 68  ? 19.304 33.253 32.988 1.00 10.62 ? 96  ILE A CG1 1 
ATOM   544  C CG2 . ILE A 1 68  ? 19.075 32.664 35.420 1.00 7.92  ? 96  ILE A CG2 1 
ATOM   545  C CD1 . ILE A 1 68  ? 20.685 33.867 33.062 1.00 13.20 ? 96  ILE A CD1 1 
ATOM   546  N N   . VAL A 1 69  ? 16.105 34.067 35.901 1.00 15.90 ? 97  VAL A N   1 
ATOM   547  C CA  . VAL A 1 69  ? 15.365 34.220 37.144 1.00 15.50 ? 97  VAL A CA  1 
ATOM   548  C C   . VAL A 1 69  ? 13.917 33.704 37.080 1.00 14.05 ? 97  VAL A C   1 
ATOM   549  O O   . VAL A 1 69  ? 13.447 33.060 38.003 1.00 14.11 ? 97  VAL A O   1 
ATOM   550  C CB  . VAL A 1 69  ? 15.371 35.713 37.565 1.00 14.03 ? 97  VAL A CB  1 
ATOM   551  C CG1 . VAL A 1 69  ? 14.442 35.952 38.706 1.00 13.32 ? 97  VAL A CG1 1 
ATOM   552  C CG2 . VAL A 1 69  ? 16.775 36.128 37.927 1.00 13.99 ? 97  VAL A CG2 1 
ATOM   553  N N   . GLU A 1 70  ? 13.209 33.991 36.001 1.00 13.92 ? 98  GLU A N   1 
ATOM   554  C CA  . GLU A 1 70  ? 11.827 33.536 35.892 1.00 15.88 ? 98  GLU A CA  1 
ATOM   555  C C   . GLU A 1 70  ? 11.819 32.016 35.749 1.00 13.04 ? 98  GLU A C   1 
ATOM   556  O O   . GLU A 1 70  ? 11.037 31.327 36.377 1.00 9.35  ? 98  GLU A O   1 
ATOM   557  C CB  . GLU A 1 70  ? 11.147 34.189 34.680 1.00 18.06 ? 98  GLU A CB  1 
ATOM   558  C CG  . GLU A 1 70  ? 9.663  33.857 34.522 1.00 23.88 ? 98  GLU A CG  1 
ATOM   559  C CD  . GLU A 1 70  ? 9.141  34.116 33.095 1.00 29.40 ? 98  GLU A CD  1 
ATOM   560  O OE1 . GLU A 1 70  ? 9.682  35.019 32.417 1.00 30.54 ? 98  GLU A OE1 1 
ATOM   561  O OE2 . GLU A 1 70  ? 8.185  33.427 32.650 1.00 28.92 ? 98  GLU A OE2 1 
ATOM   562  N N   . LEU A 1 71  ? 12.708 31.525 34.895 1.00 12.85 ? 99  LEU A N   1 
ATOM   563  C CA  . LEU A 1 71  ? 12.880 30.100 34.622 1.00 11.53 ? 99  LEU A CA  1 
ATOM   564  C C   . LEU A 1 71  ? 13.013 29.342 35.915 1.00 11.14 ? 99  LEU A C   1 
ATOM   565  O O   . LEU A 1 71  ? 12.317 28.353 36.165 1.00 9.95  ? 99  LEU A O   1 
ATOM   566  C CB  . LEU A 1 71  ? 14.151 29.893 33.820 1.00 10.28 ? 99  LEU A CB  1 
ATOM   567  C CG  . LEU A 1 71  ? 14.490 28.456 33.500 1.00 10.43 ? 99  LEU A CG  1 
ATOM   568  C CD1 . LEU A 1 71  ? 13.426 27.932 32.632 1.00 11.14 ? 99  LEU A CD1 1 
ATOM   569  C CD2 . LEU A 1 71  ? 15.840 28.346 32.803 1.00 12.76 ? 99  LEU A CD2 1 
ATOM   570  N N   . MET A 1 72  ? 13.944 29.827 36.722 1.00 10.81 ? 100 MET A N   1 
ATOM   571  C CA  . MET A 1 72  ? 14.246 29.263 38.009 1.00 12.75 ? 100 MET A CA  1 
ATOM   572  C C   . MET A 1 72  ? 13.057 29.387 38.939 1.00 14.40 ? 100 MET A C   1 
ATOM   573  O O   . MET A 1 72  ? 12.561 28.386 39.458 1.00 17.06 ? 100 MET A O   1 
ATOM   574  C CB  . MET A 1 72  ? 15.470 29.967 38.579 1.00 16.82 ? 100 MET A CB  1 
ATOM   575  C CG  . MET A 1 72  ? 16.738 29.750 37.737 1.00 19.50 ? 100 MET A CG  1 
ATOM   576  S SD  . MET A 1 72  ? 17.231 28.013 37.587 1.00 21.48 ? 100 MET A SD  1 
ATOM   577  C CE  . MET A 1 72  ? 16.142 27.399 36.338 1.00 15.65 ? 100 MET A CE  1 
ATOM   578  N N   . ARG A 1 73  ? 12.579 30.604 39.151 1.00 14.40 ? 101 ARG A N   1 
ATOM   579  C CA  . ARG A 1 73  ? 11.424 30.778 40.009 1.00 14.38 ? 101 ARG A CA  1 
ATOM   580  C C   . ARG A 1 73  ? 10.325 29.803 39.569 1.00 14.62 ? 101 ARG A C   1 
ATOM   581  O O   . ARG A 1 73  ? 9.774  29.106 40.380 1.00 13.64 ? 101 ARG A O   1 
ATOM   582  C CB  . ARG A 1 73  ? 10.943 32.222 39.950 1.00 13.34 ? 101 ARG A CB  1 
ATOM   583  C CG  . ARG A 1 73  ? 9.696  32.510 40.760 1.00 15.73 ? 101 ARG A CG  1 
ATOM   584  C CD  . ARG A 1 73  ? 9.545  34.002 40.927 1.00 17.52 ? 101 ARG A CD  1 
ATOM   585  N NE  . ARG A 1 73  ? 9.798  34.708 39.669 1.00 20.27 ? 101 ARG A NE  1 
ATOM   586  C CZ  . ARG A 1 73  ? 10.229 35.963 39.590 0.00 20.97 ? 101 ARG A CZ  1 
ATOM   587  N NH1 . ARG A 1 73  ? 10.458 36.660 40.696 0.00 21.85 ? 101 ARG A NH1 1 
ATOM   588  N NH2 . ARG A 1 73  ? 10.439 36.520 38.406 0.00 21.85 ? 101 ARG A NH2 1 
ATOM   589  N N   . ASP A 1 74  ? 10.047 29.740 38.274 1.00 17.24 ? 102 ASP A N   1 
ATOM   590  C CA  . ASP A 1 74  ? 9.040  28.842 37.717 1.00 20.91 ? 102 ASP A CA  1 
ATOM   591  C C   . ASP A 1 74  ? 9.342  27.360 37.915 1.00 23.00 ? 102 ASP A C   1 
ATOM   592  O O   . ASP A 1 74  ? 8.459  26.600 38.316 1.00 22.78 ? 102 ASP A O   1 
ATOM   593  C CB  . ASP A 1 74  ? 8.867  29.104 36.221 1.00 23.09 ? 102 ASP A CB  1 
ATOM   594  C CG  . ASP A 1 74  ? 7.829  30.171 35.926 1.00 28.92 ? 102 ASP A CG  1 
ATOM   595  O OD1 . ASP A 1 74  ? 7.947  30.823 34.866 1.00 31.20 ? 102 ASP A OD1 1 
ATOM   596  O OD2 . ASP A 1 74  ? 6.883  30.351 36.740 1.00 32.52 ? 102 ASP A OD2 1 
ATOM   597  N N   . VAL A 1 75  ? 10.576 26.943 37.615 1.00 24.71 ? 103 VAL A N   1 
ATOM   598  C CA  . VAL A 1 75  ? 10.951 25.532 37.766 1.00 27.12 ? 103 VAL A CA  1 
ATOM   599  C C   . VAL A 1 75  ? 10.904 25.126 39.226 1.00 28.16 ? 103 VAL A C   1 
ATOM   600  O O   . VAL A 1 75  ? 10.502 23.999 39.551 1.00 28.07 ? 103 VAL A O   1 
ATOM   601  C CB  . VAL A 1 75  ? 12.388 25.219 37.224 1.00 27.95 ? 103 VAL A CB  1 
ATOM   602  C CG1 . VAL A 1 75  ? 12.964 23.988 37.914 1.00 27.45 ? 103 VAL A CG1 1 
ATOM   603  C CG2 . VAL A 1 75  ? 12.336 24.943 35.748 1.00 26.61 ? 103 VAL A CG2 1 
ATOM   604  N N   . SER A 1 76  ? 11.321 26.042 40.103 1.00 27.38 ? 104 SER A N   1 
ATOM   605  C CA  . SER A 1 76  ? 11.322 25.746 41.526 1.00 25.41 ? 104 SER A CA  1 
ATOM   606  C C   . SER A 1 76  ? 9.897  25.571 42.010 1.00 23.43 ? 104 SER A C   1 
ATOM   607  O O   . SER A 1 76  ? 9.654  24.811 42.939 1.00 23.77 ? 104 SER A O   1 
ATOM   608  C CB  . SER A 1 76  ? 12.073 26.844 42.341 1.00 25.19 ? 104 SER A CB  1 
ATOM   609  O OG  . SER A 1 76  ? 11.320 28.012 42.638 1.00 21.76 ? 104 SER A OG  1 
ATOM   610  N N   . LYS A 1 77  ? 8.959  26.245 41.356 1.00 21.82 ? 105 LYS A N   1 
ATOM   611  C CA  . LYS A 1 77  ? 7.564  26.181 41.756 1.00 23.58 ? 105 LYS A CA  1 
ATOM   612  C C   . LYS A 1 77  ? 6.904  24.860 41.363 1.00 23.63 ? 105 LYS A C   1 
ATOM   613  O O   . LYS A 1 77  ? 5.842  24.493 41.891 1.00 23.09 ? 105 LYS A O   1 
ATOM   614  C CB  . LYS A 1 77  ? 6.802  27.375 41.179 1.00 23.26 ? 105 LYS A CB  1 
ATOM   615  C CG  . LYS A 1 77  ? 6.903  28.661 42.004 1.00 23.47 ? 105 LYS A CG  1 
ATOM   616  C CD  . LYS A 1 77  ? 5.739  28.831 42.987 1.00 26.95 ? 105 LYS A CD  1 
ATOM   617  C CE  . LYS A 1 77  ? 5.827  27.883 44.198 1.00 27.48 ? 105 LYS A CE  1 
ATOM   618  N NZ  . LYS A 1 77  ? 4.483  27.599 44.787 1.00 25.00 ? 105 LYS A NZ  1 
ATOM   619  N N   . GLU A 1 78  ? 7.552  24.143 40.451 1.00 22.78 ? 106 GLU A N   1 
ATOM   620  C CA  . GLU A 1 78  ? 7.064  22.846 40.008 1.00 22.53 ? 106 GLU A CA  1 
ATOM   621  C C   . GLU A 1 78  ? 7.003  21.860 41.189 1.00 23.27 ? 106 GLU A C   1 
ATOM   622  O O   . GLU A 1 78  ? 7.642  22.061 42.235 1.00 21.45 ? 106 GLU A O   1 
ATOM   623  C CB  . GLU A 1 78  ? 7.982  22.268 38.927 1.00 20.35 ? 106 GLU A CB  1 
ATOM   624  C CG  . GLU A 1 78  ? 7.665  22.654 37.498 1.00 17.20 ? 106 GLU A CG  1 
ATOM   625  C CD  . GLU A 1 78  ? 8.392  21.760 36.506 1.00 20.01 ? 106 GLU A CD  1 
ATOM   626  O OE1 . GLU A 1 78  ? 8.939  20.737 36.948 1.00 18.52 ? 106 GLU A OE1 1 
ATOM   627  O OE2 . GLU A 1 78  ? 8.420  22.049 35.292 1.00 20.71 ? 106 GLU A OE2 1 
ATOM   628  N N   . ASP A 1 79  ? 6.222  20.797 41.011 1.00 23.47 ? 107 ASP A N   1 
ATOM   629  C CA  . ASP A 1 79  ? 6.094  19.762 42.030 1.00 24.43 ? 107 ASP A CA  1 
ATOM   630  C C   . ASP A 1 79  ? 7.149  18.664 41.774 1.00 23.24 ? 107 ASP A C   1 
ATOM   631  O O   . ASP A 1 79  ? 6.960  17.803 40.923 1.00 24.19 ? 107 ASP A O   1 
ATOM   632  C CB  . ASP A 1 79  ? 4.702  19.145 41.969 1.00 25.46 ? 107 ASP A CB  1 
ATOM   633  C CG  . ASP A 1 79  ? 4.454  18.185 43.094 1.00 28.76 ? 107 ASP A CG  1 
ATOM   634  O OD1 . ASP A 1 79  ? 4.076  18.646 44.190 1.00 29.20 ? 107 ASP A OD1 1 
ATOM   635  O OD2 . ASP A 1 79  ? 4.656  16.973 42.890 1.00 30.70 ? 107 ASP A OD2 1 
ATOM   636  N N   . HIS A 1 80  ? 8.256  18.679 42.500 1.00 20.55 ? 108 HIS A N   1 
ATOM   637  C CA  . HIS A 1 80  ? 9.274  17.666 42.259 1.00 19.97 ? 108 HIS A CA  1 
ATOM   638  C C   . HIS A 1 80  ? 9.082  16.425 43.098 1.00 20.97 ? 108 HIS A C   1 
ATOM   639  O O   . HIS A 1 80  ? 10.026 15.690 43.318 1.00 21.85 ? 108 HIS A O   1 
ATOM   640  C CB  . HIS A 1 80  ? 10.653 18.249 42.525 1.00 15.84 ? 108 HIS A CB  1 
ATOM   641  C CG  . HIS A 1 80  ? 10.979 19.417 41.654 1.00 13.28 ? 108 HIS A CG  1 
ATOM   642  N ND1 . HIS A 1 80  ? 11.861 19.338 40.596 1.00 10.62 ? 108 HIS A ND1 1 
ATOM   643  C CD2 . HIS A 1 80  ? 10.500 20.684 41.654 1.00 8.85  ? 108 HIS A CD2 1 
ATOM   644  C CE1 . HIS A 1 80  ? 11.913 20.506 39.984 1.00 11.12 ? 108 HIS A CE1 1 
ATOM   645  N NE2 . HIS A 1 80  ? 11.096 21.339 40.608 1.00 10.84 ? 108 HIS A NE2 1 
ATOM   646  N N   . SER A 1 81  ? 7.853  16.181 43.541 1.00 22.03 ? 109 SER A N   1 
ATOM   647  C CA  . SER A 1 81  ? 7.540  15.043 44.399 1.00 19.74 ? 109 SER A CA  1 
ATOM   648  C C   . SER A 1 81  ? 7.969  13.678 43.911 1.00 20.12 ? 109 SER A C   1 
ATOM   649  O O   . SER A 1 81  ? 8.541  12.897 44.678 1.00 22.71 ? 109 SER A O   1 
ATOM   650  C CB  . SER A 1 81  ? 6.052  15.028 44.704 1.00 17.77 ? 109 SER A CB  1 
ATOM   651  O OG  . SER A 1 81  ? 5.690  16.252 45.295 1.00 17.00 ? 109 SER A OG  1 
ATOM   652  N N   . LYS A 1 82  ? 7.710  13.362 42.655 1.00 18.84 ? 110 LYS A N   1 
ATOM   653  C CA  . LYS A 1 82  ? 8.113  12.051 42.174 1.00 20.95 ? 110 LYS A CA  1 
ATOM   654  C C   . LYS A 1 82  ? 9.550  12.007 41.608 1.00 21.42 ? 110 LYS A C   1 
ATOM   655  O O   . LYS A 1 82  ? 9.907  11.083 40.878 1.00 22.98 ? 110 LYS A O   1 
ATOM   656  C CB  . LYS A 1 82  ? 7.090  11.546 41.147 1.00 22.65 ? 110 LYS A CB  1 
ATOM   657  C CG  . LYS A 1 82  ? 5.660  11.542 41.691 1.00 25.25 ? 110 LYS A CG  1 
ATOM   658  C CD  . LYS A 1 82  ? 5.572  10.709 42.981 1.00 28.40 ? 110 LYS A CD  1 
ATOM   659  C CE  . LYS A 1 82  ? 4.492  11.199 43.933 1.00 25.98 ? 110 LYS A CE  1 
ATOM   660  N NZ  . LYS A 1 82  ? 3.212  11.100 43.231 1.00 27.08 ? 110 LYS A NZ  1 
ATOM   661  N N   . ARG A 1 83  ? 10.375 12.988 41.988 1.00 20.11 ? 111 ARG A N   1 
ATOM   662  C CA  . ARG A 1 83  ? 11.762 13.089 41.520 1.00 19.09 ? 111 ARG A CA  1 
ATOM   663  C C   . ARG A 1 83  ? 12.829 12.942 42.606 1.00 18.79 ? 111 ARG A C   1 
ATOM   664  O O   . ARG A 1 83  ? 12.694 13.461 43.713 1.00 16.18 ? 111 ARG A O   1 
ATOM   665  C CB  . ARG A 1 83  ? 11.969 14.418 40.811 1.00 19.31 ? 111 ARG A CB  1 
ATOM   666  C CG  . ARG A 1 83  ? 11.012 14.648 39.678 1.00 18.54 ? 111 ARG A CG  1 
ATOM   667  C CD  . ARG A 1 83  ? 10.898 16.138 39.340 1.00 18.39 ? 111 ARG A CD  1 
ATOM   668  N NE  . ARG A 1 83  ? 10.023 16.302 38.194 1.00 16.89 ? 111 ARG A NE  1 
ATOM   669  C CZ  . ARG A 1 83  ? 9.609  17.452 37.690 1.00 15.43 ? 111 ARG A CZ  1 
ATOM   670  N NH1 . ARG A 1 83  ? 9.995  18.589 38.231 1.00 14.76 ? 111 ARG A NH1 1 
ATOM   671  N NH2 . ARG A 1 83  ? 8.797  17.447 36.637 1.00 13.01 ? 111 ARG A NH2 1 
ATOM   672  N N   . SER A 1 84  ? 13.902 12.243 42.251 1.00 16.78 ? 112 SER A N   1 
ATOM   673  C CA  . SER A 1 84  ? 15.015 11.984 43.147 1.00 16.19 ? 112 SER A CA  1 
ATOM   674  C C   . SER A 1 84  ? 15.919 13.201 43.290 1.00 16.27 ? 112 SER A C   1 
ATOM   675  O O   . SER A 1 84  ? 16.511 13.415 44.349 1.00 18.48 ? 112 SER A O   1 
ATOM   676  C CB  . SER A 1 84  ? 15.875 10.809 42.632 1.00 14.89 ? 112 SER A CB  1 
ATOM   677  O OG  . SER A 1 84  ? 15.119 9.637  42.378 1.00 13.06 ? 112 SER A OG  1 
ATOM   678  N N   . SER A 1 85  ? 16.039 14.000 42.238 1.00 13.64 ? 113 SER A N   1 
ATOM   679  C CA  . SER A 1 85  ? 16.937 15.139 42.327 1.00 12.81 ? 113 SER A CA  1 
ATOM   680  C C   . SER A 1 85  ? 16.640 16.302 41.407 1.00 12.80 ? 113 SER A C   1 
ATOM   681  O O   . SER A 1 85  ? 15.542 16.438 40.882 1.00 16.41 ? 113 SER A O   1 
ATOM   682  C CB  . SER A 1 85  ? 18.380 14.673 42.092 1.00 13.17 ? 113 SER A CB  1 
ATOM   683  O OG  . SER A 1 85  ? 18.586 14.179 40.778 1.00 10.01 ? 113 SER A OG  1 
ATOM   684  N N   . PHE A 1 86  ? 17.641 17.155 41.245 1.00 12.31 ? 114 PHE A N   1 
ATOM   685  C CA  . PHE A 1 86  ? 17.564 18.338 40.396 1.00 12.24 ? 114 PHE A CA  1 
ATOM   686  C C   . PHE A 1 86  ? 18.971 18.792 40.015 1.00 12.19 ? 114 PHE A C   1 
ATOM   687  O O   . PHE A 1 86  ? 19.783 19.096 40.886 1.00 11.92 ? 114 PHE A O   1 
ATOM   688  C CB  . PHE A 1 86  ? 16.874 19.499 41.115 1.00 12.12 ? 114 PHE A CB  1 
ATOM   689  C CG  . PHE A 1 86  ? 16.863 20.782 40.313 1.00 14.10 ? 114 PHE A CG  1 
ATOM   690  C CD1 . PHE A 1 86  ? 15.848 21.044 39.397 1.00 13.78 ? 114 PHE A CD1 1 
ATOM   691  C CD2 . PHE A 1 86  ? 17.867 21.743 40.483 1.00 15.05 ? 114 PHE A CD2 1 
ATOM   692  C CE1 . PHE A 1 86  ? 15.832 22.251 38.664 1.00 13.89 ? 114 PHE A CE1 1 
ATOM   693  C CE2 . PHE A 1 86  ? 17.857 22.951 39.751 1.00 12.34 ? 114 PHE A CE2 1 
ATOM   694  C CZ  . PHE A 1 86  ? 16.847 23.207 38.853 1.00 9.89  ? 114 PHE A CZ  1 
ATOM   695  N N   . VAL A 1 87  ? 19.257 18.817 38.718 1.00 11.54 ? 115 VAL A N   1 
ATOM   696  C CA  . VAL A 1 87  ? 20.543 19.272 38.242 1.00 13.33 ? 115 VAL A CA  1 
ATOM   697  C C   . VAL A 1 87  ? 20.310 20.597 37.527 1.00 17.00 ? 115 VAL A C   1 
ATOM   698  O O   . VAL A 1 87  ? 19.216 20.862 37.024 1.00 19.73 ? 115 VAL A O   1 
ATOM   699  C CB  . VAL A 1 87  ? 21.161 18.323 37.240 1.00 12.53 ? 115 VAL A CB  1 
ATOM   700  C CG1 . VAL A 1 87  ? 22.471 18.938 36.735 1.00 13.79 ? 115 VAL A CG1 1 
ATOM   701  C CG2 . VAL A 1 87  ? 21.411 16.954 37.876 1.00 9.34  ? 115 VAL A CG2 1 
ATOM   702  N N   . CYS A 1 88  ? 21.317 21.452 37.498 1.00 17.66 ? 116 CYS A N   1 
ATOM   703  C CA  . CYS A 1 88  ? 21.167 22.728 36.807 1.00 18.09 ? 116 CYS A CA  1 
ATOM   704  C C   . CYS A 1 88  ? 22.534 23.162 36.327 1.00 17.00 ? 116 CYS A C   1 
ATOM   705  O O   . CYS A 1 88  ? 23.462 23.367 37.115 1.00 16.26 ? 116 CYS A O   1 
ATOM   706  C CB  . CYS A 1 88  ? 20.575 23.797 37.704 1.00 18.40 ? 116 CYS A CB  1 
ATOM   707  S SG  . CYS A 1 88  ? 20.532 25.385 36.842 1.00 27.10 ? 116 CYS A SG  1 
ATOM   708  N N   . VAL A 1 89  ? 22.657 23.275 35.018 1.00 14.16 ? 117 VAL A N   1 
ATOM   709  C CA  . VAL A 1 89  ? 23.915 23.634 34.432 1.00 12.76 ? 117 VAL A CA  1 
ATOM   710  C C   . VAL A 1 89  ? 23.817 25.012 33.833 1.00 13.51 ? 117 VAL A C   1 
ATOM   711  O O   . VAL A 1 89  ? 22.968 25.282 32.983 1.00 14.61 ? 117 VAL A O   1 
ATOM   712  C CB  . VAL A 1 89  ? 24.317 22.599 33.374 1.00 10.77 ? 117 VAL A CB  1 
ATOM   713  C CG1 . VAL A 1 89  ? 25.718 22.825 32.924 1.00 9.18  ? 117 VAL A CG1 1 
ATOM   714  C CG2 . VAL A 1 89  ? 24.175 21.208 33.951 1.00 9.62  ? 117 VAL A CG2 1 
ATOM   715  N N   . LEU A 1 90  ? 24.701 25.874 34.323 1.00 11.47 ? 118 LEU A N   1 
ATOM   716  C CA  . LEU A 1 90  ? 24.805 27.245 33.897 1.00 12.10 ? 118 LEU A CA  1 
ATOM   717  C C   . LEU A 1 90  ? 26.098 27.400 33.098 1.00 14.95 ? 118 LEU A C   1 
ATOM   718  O O   . LEU A 1 90  ? 27.187 27.338 33.662 1.00 16.63 ? 118 LEU A O   1 
ATOM   719  C CB  . LEU A 1 90  ? 24.837 28.139 35.126 1.00 10.02 ? 118 LEU A CB  1 
ATOM   720  C CG  . LEU A 1 90  ? 23.564 28.007 35.958 1.00 9.81  ? 118 LEU A CG  1 
ATOM   721  C CD1 . LEU A 1 90  ? 23.881 28.173 37.427 1.00 7.50  ? 118 LEU A CD1 1 
ATOM   722  C CD2 . LEU A 1 90  ? 22.533 29.010 35.481 1.00 5.99  ? 118 LEU A CD2 1 
ATOM   723  N N   . LEU A 1 91  ? 25.972 27.578 31.781 1.00 16.08 ? 119 LEU A N   1 
ATOM   724  C CA  . LEU A 1 91  ? 27.134 27.754 30.892 1.00 16.19 ? 119 LEU A CA  1 
ATOM   725  C C   . LEU A 1 91  ? 27.210 29.216 30.498 1.00 15.83 ? 119 LEU A C   1 
ATOM   726  O O   . LEU A 1 91  ? 26.382 29.704 29.743 1.00 16.06 ? 119 LEU A O   1 
ATOM   727  C CB  . LEU A 1 91  ? 26.970 26.920 29.625 1.00 14.64 ? 119 LEU A CB  1 
ATOM   728  C CG  . LEU A 1 91  ? 26.675 25.455 29.835 1.00 12.45 ? 119 LEU A CG  1 
ATOM   729  C CD1 . LEU A 1 91  ? 26.449 24.811 28.509 1.00 13.60 ? 119 LEU A CD1 1 
ATOM   730  C CD2 . LEU A 1 91  ? 27.829 24.811 30.566 1.00 11.98 ? 119 LEU A CD2 1 
ATOM   731  N N   . SER A 1 92  ? 28.211 29.923 30.980 1.00 15.22 ? 120 SER A N   1 
ATOM   732  C CA  . SER A 1 92  ? 28.267 31.327 30.642 1.00 15.27 ? 120 SER A CA  1 
ATOM   733  C C   . SER A 1 92  ? 29.516 32.010 31.103 1.00 16.78 ? 120 SER A C   1 
ATOM   734  O O   . SER A 1 92  ? 30.493 31.358 31.468 1.00 16.97 ? 120 SER A O   1 
ATOM   735  C CB  . SER A 1 92  ? 27.080 32.042 31.259 1.00 11.29 ? 120 SER A CB  1 
ATOM   736  O OG  . SER A 1 92  ? 27.101 33.392 30.896 1.00 7.36  ? 120 SER A OG  1 
ATOM   737  N N   . HIS A 1 93  ? 29.467 33.341 31.048 1.00 17.60 ? 121 HIS A N   1 
ATOM   738  C CA  . HIS A 1 93  ? 30.549 34.212 31.508 1.00 18.33 ? 121 HIS A CA  1 
ATOM   739  C C   . HIS A 1 93  ? 30.250 34.331 32.995 1.00 16.54 ? 121 HIS A C   1 
ATOM   740  O O   . HIS A 1 93  ? 29.132 34.099 33.405 1.00 18.50 ? 121 HIS A O   1 
ATOM   741  C CB  . HIS A 1 93  ? 30.431 35.616 30.892 1.00 19.81 ? 121 HIS A CB  1 
ATOM   742  C CG  . HIS A 1 93  ? 31.052 35.759 29.539 1.00 21.91 ? 121 HIS A CG  1 
ATOM   743  N ND1 . HIS A 1 93  ? 32.405 35.606 29.317 1.00 24.60 ? 121 HIS A ND1 1 
ATOM   744  C CD2 . HIS A 1 93  ? 30.505 36.071 28.339 1.00 20.26 ? 121 HIS A CD2 1 
ATOM   745  C CE1 . HIS A 1 93  ? 32.663 35.815 28.037 1.00 23.30 ? 121 HIS A CE1 1 
ATOM   746  N NE2 . HIS A 1 93  ? 31.527 36.098 27.423 1.00 23.15 ? 121 HIS A NE2 1 
ATOM   747  N N   . GLY A 1 94  ? 31.226 34.696 33.804 1.00 15.62 ? 122 GLY A N   1 
ATOM   748  C CA  . GLY A 1 94  ? 30.941 34.840 35.209 1.00 15.23 ? 122 GLY A CA  1 
ATOM   749  C C   . GLY A 1 94  ? 31.972 35.639 35.982 1.00 15.88 ? 122 GLY A C   1 
ATOM   750  O O   . GLY A 1 94  ? 32.890 36.250 35.424 1.00 13.25 ? 122 GLY A O   1 
ATOM   751  N N   . GLU A 1 95  ? 31.775 35.607 37.295 1.00 15.53 ? 123 GLU A N   1 
ATOM   752  C CA  . GLU A 1 95  ? 32.607 36.252 38.285 1.00 15.18 ? 123 GLU A CA  1 
ATOM   753  C C   . GLU A 1 95  ? 32.154 35.620 39.575 1.00 12.41 ? 123 GLU A C   1 
ATOM   754  O O   . GLU A 1 95  ? 31.032 35.144 39.669 1.00 11.12 ? 123 GLU A O   1 
ATOM   755  C CB  . GLU A 1 95  ? 32.311 37.733 38.382 1.00 19.88 ? 123 GLU A CB  1 
ATOM   756  C CG  . GLU A 1 95  ? 32.925 38.623 37.358 1.00 25.17 ? 123 GLU A CG  1 
ATOM   757  C CD  . GLU A 1 95  ? 32.293 39.991 37.443 1.00 28.93 ? 123 GLU A CD  1 
ATOM   758  O OE1 . GLU A 1 95  ? 32.040 40.420 38.602 1.00 28.90 ? 123 GLU A OE1 1 
ATOM   759  O OE2 . GLU A 1 95  ? 32.053 40.618 36.379 1.00 26.67 ? 123 GLU A OE2 1 
ATOM   760  N N   . GLU A 1 96  ? 33.018 35.648 40.576 1.00 10.86 ? 124 GLU A N   1 
ATOM   761  C CA  . GLU A 1 96  ? 32.695 35.061 41.854 1.00 10.36 ? 124 GLU A CA  1 
ATOM   762  C C   . GLU A 1 96  ? 31.316 35.419 42.334 1.00 10.04 ? 124 GLU A C   1 
ATOM   763  O O   . GLU A 1 96  ? 31.067 36.567 42.671 1.00 12.33 ? 124 GLU A O   1 
ATOM   764  C CB  . GLU A 1 96  ? 33.689 35.483 42.921 1.00 10.01 ? 124 GLU A CB  1 
ATOM   765  C CG  . GLU A 1 96  ? 33.626 34.585 44.150 1.00 10.18 ? 124 GLU A CG  1 
ATOM   766  C CD  . GLU A 1 96  ? 34.001 33.165 43.813 1.00 11.24 ? 124 GLU A CD  1 
ATOM   767  O OE1 . GLU A 1 96  ? 35.113 33.008 43.284 1.00 9.45  ? 124 GLU A OE1 1 
ATOM   768  O OE2 . GLU A 1 96  ? 33.203 32.222 44.056 1.00 12.45 ? 124 GLU A OE2 1 
ATOM   769  N N   . GLY A 1 97  ? 30.431 34.429 42.376 1.00 9.36  ? 125 GLY A N   1 
ATOM   770  C CA  . GLY A 1 97  ? 29.079 34.650 42.843 1.00 10.52 ? 125 GLY A CA  1 
ATOM   771  C C   . GLY A 1 97  ? 28.033 34.939 41.793 1.00 11.89 ? 125 GLY A C   1 
ATOM   772  O O   . GLY A 1 97  ? 26.861 34.726 42.029 1.00 11.28 ? 125 GLY A O   1 
ATOM   773  N N   . ILE A 1 98  ? 28.453 35.408 40.628 1.00 14.74 ? 126 ILE A N   1 
ATOM   774  C CA  . ILE A 1 98  ? 27.504 35.750 39.579 1.00 17.59 ? 126 ILE A CA  1 
ATOM   775  C C   . ILE A 1 98  ? 27.767 35.123 38.235 1.00 18.08 ? 126 ILE A C   1 
ATOM   776  O O   . ILE A 1 98  ? 28.912 34.884 37.836 1.00 18.62 ? 126 ILE A O   1 
ATOM   777  C CB  . ILE A 1 98  ? 27.424 37.321 39.294 1.00 19.17 ? 126 ILE A CB  1 
ATOM   778  C CG1 . ILE A 1 98  ? 28.761 37.845 38.766 1.00 18.77 ? 126 ILE A CG1 1 
ATOM   779  C CG2 . ILE A 1 98  ? 27.066 38.094 40.557 1.00 18.53 ? 126 ILE A CG2 1 
ATOM   780  C CD1 . ILE A 1 98  ? 29.775 38.122 39.853 1.00 20.09 ? 126 ILE A CD1 1 
ATOM   781  N N   . ILE A 1 99  ? 26.678 34.862 37.533 1.00 17.69 ? 127 ILE A N   1 
ATOM   782  C CA  . ILE A 1 99  ? 26.768 34.347 36.184 1.00 18.56 ? 127 ILE A CA  1 
ATOM   783  C C   . ILE A 1 99  ? 25.892 35.299 35.400 1.00 19.11 ? 127 ILE A C   1 
ATOM   784  O O   . ILE A 1 99  ? 24.850 35.753 35.885 1.00 17.73 ? 127 ILE A O   1 
ATOM   785  C CB  . ILE A 1 99  ? 26.295 32.874 36.033 1.00 16.89 ? 127 ILE A CB  1 
ATOM   786  C CG1 . ILE A 1 99  ? 24.886 32.690 36.586 1.00 15.52 ? 127 ILE A CG1 1 
ATOM   787  C CG2 . ILE A 1 99  ? 27.291 31.968 36.689 1.00 18.17 ? 127 ILE A CG2 1 
ATOM   788  C CD1 . ILE A 1 99  ? 23.818 33.003 35.612 1.00 13.80 ? 127 ILE A CD1 1 
ATOM   789  N N   . PHE A 1 100 ? 26.358 35.614 34.198 1.00 20.65 ? 128 PHE A N   1 
ATOM   790  C CA  . PHE A 1 100 ? 25.697 36.548 33.312 1.00 21.87 ? 128 PHE A CA  1 
ATOM   791  C C   . PHE A 1 100 ? 24.550 36.028 32.455 1.00 20.78 ? 128 PHE A C   1 
ATOM   792  O O   . PHE A 1 100 ? 24.652 34.974 31.806 1.00 18.64 ? 128 PHE A O   1 
ATOM   793  C CB  . PHE A 1 100 ? 26.750 37.196 32.419 1.00 22.49 ? 128 PHE A CB  1 
ATOM   794  C CG  . PHE A 1 100 ? 27.686 38.101 33.161 1.00 27.68 ? 128 PHE A CG  1 
ATOM   795  C CD1 . PHE A 1 100 ? 27.358 39.444 33.376 1.00 28.20 ? 128 PHE A CD1 1 
ATOM   796  C CD2 . PHE A 1 100 ? 28.884 37.614 33.681 1.00 28.42 ? 128 PHE A CD2 1 
ATOM   797  C CE1 . PHE A 1 100 ? 28.205 40.285 34.096 1.00 25.53 ? 128 PHE A CE1 1 
ATOM   798  C CE2 . PHE A 1 100 ? 29.740 38.452 34.405 1.00 27.52 ? 128 PHE A CE2 1 
ATOM   799  C CZ  . PHE A 1 100 ? 29.393 39.787 34.609 1.00 28.74 ? 128 PHE A CZ  1 
ATOM   800  N N   . GLY A 1 101 ? 23.445 36.772 32.508 1.00 18.68 ? 129 GLY A N   1 
ATOM   801  C CA  . GLY A 1 101 ? 22.295 36.485 31.684 1.00 18.64 ? 129 GLY A CA  1 
ATOM   802  C C   . GLY A 1 101 ? 22.806 37.091 30.393 1.00 18.56 ? 129 GLY A C   1 
ATOM   803  O O   . GLY A 1 101 ? 23.917 37.622 30.391 1.00 18.31 ? 129 GLY A O   1 
ATOM   804  N N   . THR A 1 102 ? 22.046 37.050 29.310 1.00 19.59 ? 130 THR A N   1 
ATOM   805  C CA  . THR A 1 102 ? 22.557 37.605 28.061 1.00 21.02 ? 130 THR A CA  1 
ATOM   806  C C   . THR A 1 102 ? 22.648 39.130 28.054 1.00 25.45 ? 130 THR A C   1 
ATOM   807  O O   . THR A 1 102 ? 23.267 39.729 27.166 1.00 25.46 ? 130 THR A O   1 
ATOM   808  C CB  . THR A 1 102 ? 21.718 37.164 26.875 1.00 18.75 ? 130 THR A CB  1 
ATOM   809  O OG1 . THR A 1 102 ? 20.388 37.670 27.016 1.00 15.24 ? 130 THR A OG1 1 
ATOM   810  C CG2 . THR A 1 102 ? 21.713 35.652 26.782 1.00 18.43 ? 130 THR A CG2 1 
ATOM   811  N N   . ASN A 1 103 ? 22.028 39.757 29.047 1.00 28.26 ? 131 ASN A N   1 
ATOM   812  C CA  . ASN A 1 103 ? 22.062 41.197 29.146 1.00 29.04 ? 131 ASN A CA  1 
ATOM   813  C C   . ASN A 1 103 ? 22.730 41.668 30.428 1.00 30.58 ? 131 ASN A C   1 
ATOM   814  O O   . ASN A 1 103 ? 23.289 42.754 30.467 1.00 33.66 ? 131 ASN A O   1 
ATOM   815  C CB  . ASN A 1 103 ? 20.640 41.789 29.008 1.00 29.32 ? 131 ASN A CB  1 
ATOM   816  C CG  . ASN A 1 103 ? 19.637 41.207 29.999 1.00 29.07 ? 131 ASN A CG  1 
ATOM   817  O OD1 . ASN A 1 103 ? 19.707 40.035 30.371 1.00 30.55 ? 131 ASN A OD1 1 
ATOM   818  N ND2 . ASN A 1 103 ? 18.675 42.027 30.401 1.00 24.67 ? 131 ASN A ND2 1 
ATOM   819  N N   . GLY A 1 104 ? 22.711 40.852 31.471 1.00 31.61 ? 132 GLY A N   1 
ATOM   820  C CA  . GLY A 1 104 ? 23.320 41.292 32.708 1.00 32.17 ? 132 GLY A CA  1 
ATOM   821  C C   . GLY A 1 104 ? 23.729 40.170 33.619 1.00 32.38 ? 132 GLY A C   1 
ATOM   822  O O   . GLY A 1 104 ? 23.639 39.013 33.249 1.00 33.88 ? 132 GLY A O   1 
ATOM   823  N N   . PRO A 1 105 ? 24.170 40.486 34.839 1.00 32.73 ? 133 PRO A N   1 
ATOM   824  C CA  . PRO A 1 105 ? 24.592 39.444 35.770 1.00 31.63 ? 133 PRO A CA  1 
ATOM   825  C C   . PRO A 1 105 ? 23.483 38.932 36.678 1.00 30.33 ? 133 PRO A C   1 
ATOM   826  O O   . PRO A 1 105 ? 22.541 39.647 37.015 1.00 31.11 ? 133 PRO A O   1 
ATOM   827  C CB  . PRO A 1 105 ? 25.665 40.149 36.572 1.00 32.66 ? 133 PRO A CB  1 
ATOM   828  C CG  . PRO A 1 105 ? 24.993 41.495 36.793 1.00 33.39 ? 133 PRO A CG  1 
ATOM   829  C CD  . PRO A 1 105 ? 24.427 41.823 35.408 1.00 33.44 ? 133 PRO A CD  1 
ATOM   830  N N   . VAL A 1 106 ? 23.609 37.676 37.066 1.00 26.98 ? 134 VAL A N   1 
ATOM   831  C CA  . VAL A 1 106 ? 22.674 37.084 37.969 1.00 25.43 ? 134 VAL A CA  1 
ATOM   832  C C   . VAL A 1 106 ? 23.519 36.515 39.098 1.00 25.53 ? 134 VAL A C   1 
ATOM   833  O O   . VAL A 1 106 ? 24.583 35.955 38.860 1.00 24.50 ? 134 VAL A O   1 
ATOM   834  C CB  . VAL A 1 106 ? 21.851 35.989 37.277 1.00 25.69 ? 134 VAL A CB  1 
ATOM   835  C CG1 . VAL A 1 106 ? 21.154 35.138 38.311 1.00 27.65 ? 134 VAL A CG1 1 
ATOM   836  C CG2 . VAL A 1 106 ? 20.803 36.628 36.376 1.00 25.67 ? 134 VAL A CG2 1 
ATOM   837  N N   . ASP A 1 107 ? 23.056 36.710 40.327 1.00 25.79 ? 135 ASP A N   1 
ATOM   838  C CA  . ASP A 1 107 ? 23.732 36.218 41.517 1.00 25.80 ? 135 ASP A CA  1 
ATOM   839  C C   . ASP A 1 107 ? 23.426 34.739 41.705 1.00 25.10 ? 135 ASP A C   1 
ATOM   840  O O   . ASP A 1 107 ? 22.265 34.340 41.713 1.00 21.73 ? 135 ASP A O   1 
ATOM   841  C CB  . ASP A 1 107 ? 23.227 36.976 42.743 1.00 29.89 ? 135 ASP A CB  1 
ATOM   842  C CG  . ASP A 1 107 ? 24.113 38.127 43.124 1.00 34.61 ? 135 ASP A CG  1 
ATOM   843  O OD1 . ASP A 1 107 ? 23.594 39.136 43.653 1.00 37.20 ? 135 ASP A OD1 1 
ATOM   844  O OD2 . ASP A 1 107 ? 25.337 38.021 42.920 1.00 37.83 ? 135 ASP A OD2 1 
ATOM   845  N N   . LEU A 1 108 ? 24.469 33.932 41.871 1.00 25.37 ? 136 LEU A N   1 
ATOM   846  C CA  . LEU A 1 108 ? 24.300 32.502 42.080 1.00 25.45 ? 136 LEU A CA  1 
ATOM   847  C C   . LEU A 1 108 ? 23.339 32.230 43.238 1.00 26.27 ? 136 LEU A C   1 
ATOM   848  O O   . LEU A 1 108 ? 22.571 31.260 43.208 1.00 26.07 ? 136 LEU A O   1 
ATOM   849  C CB  . LEU A 1 108 ? 25.641 31.845 42.392 1.00 26.47 ? 136 LEU A CB  1 
ATOM   850  C CG  . LEU A 1 108 ? 26.595 31.444 41.268 1.00 28.73 ? 136 LEU A CG  1 
ATOM   851  C CD1 . LEU A 1 108 ? 27.937 31.017 41.863 1.00 27.75 ? 136 LEU A CD1 1 
ATOM   852  C CD2 . LEU A 1 108 ? 25.970 30.331 40.442 1.00 29.40 ? 136 LEU A CD2 1 
ATOM   853  N N   . LYS A 1 109 ? 23.387 33.086 44.258 1.00 24.97 ? 137 LYS A N   1 
ATOM   854  C CA  . LYS A 1 109 ? 22.530 32.923 45.425 1.00 23.35 ? 137 LYS A CA  1 
ATOM   855  C C   . LYS A 1 109 ? 21.100 33.254 45.066 1.00 21.87 ? 137 LYS A C   1 
ATOM   856  O O   . LYS A 1 109 ? 20.184 32.601 45.535 1.00 18.92 ? 137 LYS A O   1 
ATOM   857  C CB  . LYS A 1 109 ? 22.999 33.827 46.574 1.00 24.11 ? 137 LYS A CB  1 
ATOM   858  C CG  . LYS A 1 109 ? 22.795 33.247 47.993 1.00 25.64 ? 137 LYS A CG  1 
ATOM   859  C CD  . LYS A 1 109 ? 23.786 32.117 48.315 1.00 26.63 ? 137 LYS A CD  1 
ATOM   860  C CE  . LYS A 1 109 ? 23.608 31.572 49.737 1.00 26.83 ? 137 LYS A CE  1 
ATOM   861  N NZ  . LYS A 1 109 ? 24.589 30.481 50.111 1.00 27.70 ? 137 LYS A NZ  1 
ATOM   862  N N   . LYS A 1 110 ? 20.910 34.255 44.213 1.00 23.38 ? 138 LYS A N   1 
ATOM   863  C CA  . LYS A 1 110 ? 19.557 34.672 43.820 1.00 24.73 ? 138 LYS A CA  1 
ATOM   864  C C   . LYS A 1 110 ? 18.788 33.571 43.138 1.00 25.25 ? 138 LYS A C   1 
ATOM   865  O O   . LYS A 1 110 ? 17.565 33.481 43.267 1.00 25.74 ? 138 LYS A O   1 
ATOM   866  C CB  . LYS A 1 110 ? 19.580 35.890 42.887 1.00 24.52 ? 138 LYS A CB  1 
ATOM   867  C CG  . LYS A 1 110 ? 18.341 36.000 41.977 1.00 25.68 ? 138 LYS A CG  1 
ATOM   868  C CD  . LYS A 1 110 ? 17.290 36.982 42.468 1.00 25.20 ? 138 LYS A CD  1 
ATOM   869  C CE  . LYS A 1 110 ? 17.799 38.421 42.392 1.00 24.74 ? 138 LYS A CE  1 
ATOM   870  N NZ  . LYS A 1 110 ? 16.818 39.402 42.949 1.00 24.17 ? 138 LYS A NZ  1 
ATOM   871  N N   . ILE A 1 111 ? 19.482 32.720 42.407 1.00 24.52 ? 139 ILE A N   1 
ATOM   872  C CA  . ILE A 1 111 ? 18.727 31.695 41.756 1.00 25.83 ? 139 ILE A CA  1 
ATOM   873  C C   . ILE A 1 111 ? 18.687 30.376 42.518 1.00 25.38 ? 139 ILE A C   1 
ATOM   874  O O   . ILE A 1 111 ? 17.635 29.762 42.583 1.00 25.95 ? 139 ILE A O   1 
ATOM   875  C CB  . ILE A 1 111 ? 19.150 31.568 40.243 1.00 27.43 ? 139 ILE A CB  1 
ATOM   876  C CG1 . ILE A 1 111 ? 20.652 31.378 40.067 1.00 25.16 ? 139 ILE A CG1 1 
ATOM   877  C CG2 . ILE A 1 111 ? 18.774 32.884 39.509 1.00 28.44 ? 139 ILE A CG2 1 
ATOM   878  C CD1 . ILE A 1 111 ? 21.103 31.588 38.610 1.00 19.86 ? 139 ILE A CD1 1 
ATOM   879  N N   . THR A 1 112 ? 19.793 29.972 43.143 1.00 24.34 ? 140 THR A N   1 
ATOM   880  C CA  . THR A 1 112 ? 19.827 28.734 43.913 1.00 21.54 ? 140 THR A CA  1 
ATOM   881  C C   . THR A 1 112 ? 19.006 28.883 45.167 1.00 22.09 ? 140 THR A C   1 
ATOM   882  O O   . THR A 1 112 ? 18.885 27.947 45.940 1.00 24.10 ? 140 THR A O   1 
ATOM   883  C CB  . THR A 1 112 ? 21.217 28.394 44.405 1.00 21.28 ? 140 THR A CB  1 
ATOM   884  O OG1 . THR A 1 112 ? 21.596 29.298 45.449 1.00 17.84 ? 140 THR A OG1 1 
ATOM   885  C CG2 . THR A 1 112 ? 22.193 28.493 43.290 1.00 24.72 ? 140 THR A CG2 1 
ATOM   886  N N   . ASN A 1 113 ? 18.449 30.061 45.385 1.00 20.20 ? 141 ASN A N   1 
ATOM   887  C CA  . ASN A 1 113 ? 17.674 30.289 46.584 1.00 19.26 ? 141 ASN A CA  1 
ATOM   888  C C   . ASN A 1 113 ? 16.229 29.903 46.440 1.00 19.11 ? 141 ASN A C   1 
ATOM   889  O O   . ASN A 1 113 ? 15.510 29.811 47.429 1.00 17.15 ? 141 ASN A O   1 
ATOM   890  C CB  . ASN A 1 113 ? 17.782 31.751 46.995 1.00 20.60 ? 141 ASN A CB  1 
ATOM   891  C CG  . ASN A 1 113 ? 18.859 31.980 48.002 1.00 20.60 ? 141 ASN A CG  1 
ATOM   892  O OD1 . ASN A 1 113 ? 19.762 31.166 48.145 1.00 24.02 ? 141 ASN A OD1 1 
ATOM   893  N ND2 . ASN A 1 113 ? 18.778 33.088 48.711 1.00 22.64 ? 141 ASN A ND2 1 
ATOM   894  N N   . PHE A 1 114 ? 15.800 29.699 45.199 1.00 20.20 ? 142 PHE A N   1 
ATOM   895  C CA  . PHE A 1 114 ? 14.417 29.317 44.917 1.00 19.88 ? 142 PHE A CA  1 
ATOM   896  C C   . PHE A 1 114 ? 14.264 27.869 45.324 1.00 20.66 ? 142 PHE A C   1 
ATOM   897  O O   . PHE A 1 114 ? 13.156 27.377 45.524 1.00 22.51 ? 142 PHE A O   1 
ATOM   898  C CB  . PHE A 1 114 ? 14.111 29.423 43.422 1.00 15.77 ? 142 PHE A CB  1 
ATOM   899  C CG  . PHE A 1 114 ? 13.969 30.819 42.919 1.00 13.32 ? 142 PHE A CG  1 
ATOM   900  C CD1 . PHE A 1 114 ? 12.807 31.539 43.158 1.00 10.08 ? 142 PHE A CD1 1 
ATOM   901  C CD2 . PHE A 1 114 ? 15.003 31.415 42.174 1.00 14.02 ? 142 PHE A CD2 1 
ATOM   902  C CE1 . PHE A 1 114 ? 12.667 32.848 42.657 1.00 14.05 ? 142 PHE A CE1 1 
ATOM   903  C CE2 . PHE A 1 114 ? 14.881 32.724 41.664 1.00 13.98 ? 142 PHE A CE2 1 
ATOM   904  C CZ  . PHE A 1 114 ? 13.712 33.452 41.901 1.00 12.94 ? 142 PHE A CZ  1 
ATOM   905  N N   . PHE A 1 115 ? 15.400 27.200 45.467 1.00 19.87 ? 143 PHE A N   1 
ATOM   906  C CA  . PHE A 1 115 ? 15.402 25.799 45.780 1.00 20.61 ? 143 PHE A CA  1 
ATOM   907  C C   . PHE A 1 115 ? 15.780 25.457 47.210 1.00 21.71 ? 143 PHE A C   1 
ATOM   908  O O   . PHE A 1 115 ? 15.959 24.287 47.530 1.00 22.57 ? 143 PHE A O   1 
ATOM   909  C CB  . PHE A 1 115 ? 16.332 25.103 44.793 1.00 23.06 ? 143 PHE A CB  1 
ATOM   910  C CG  . PHE A 1 115 ? 16.056 25.447 43.338 1.00 24.18 ? 143 PHE A CG  1 
ATOM   911  C CD1 . PHE A 1 115 ? 15.011 24.843 42.644 1.00 25.18 ? 143 PHE A CD1 1 
ATOM   912  C CD2 . PHE A 1 115 ? 16.823 26.391 42.674 1.00 23.26 ? 143 PHE A CD2 1 
ATOM   913  C CE1 . PHE A 1 115 ? 14.738 25.181 41.310 1.00 26.09 ? 143 PHE A CE1 1 
ATOM   914  C CE2 . PHE A 1 115 ? 16.551 26.731 41.344 1.00 25.24 ? 143 PHE A CE2 1 
ATOM   915  C CZ  . PHE A 1 115 ? 15.506 26.125 40.665 1.00 25.36 ? 143 PHE A CZ  1 
ATOM   916  N N   . ARG A 1 116 ? 15.885 26.461 48.077 1.00 23.02 ? 144 ARG A N   1 
ATOM   917  C CA  . ARG A 1 116 ? 16.231 26.213 49.474 1.00 24.17 ? 144 ARG A CA  1 
ATOM   918  C C   . ARG A 1 116 ? 15.197 25.334 50.135 1.00 27.07 ? 144 ARG A C   1 
ATOM   919  O O   . ARG A 1 116 ? 13.997 25.461 49.839 1.00 27.04 ? 144 ARG A O   1 
ATOM   920  C CB  . ARG A 1 116 ? 16.332 27.504 50.247 1.00 23.15 ? 144 ARG A CB  1 
ATOM   921  C CG  . ARG A 1 116 ? 17.467 28.354 49.811 1.00 22.69 ? 144 ARG A CG  1 
ATOM   922  C CD  . ARG A 1 116 ? 17.586 29.492 50.755 1.00 21.53 ? 144 ARG A CD  1 
ATOM   923  N NE  . ARG A 1 116 ? 16.331 29.684 51.455 1.00 16.64 ? 144 ARG A NE  1 
ATOM   924  C CZ  . ARG A 1 116 ? 16.095 30.703 52.264 1.00 19.06 ? 144 ARG A CZ  1 
ATOM   925  N NH1 . ARG A 1 116 ? 17.042 31.627 52.468 1.00 19.70 ? 144 ARG A NH1 1 
ATOM   926  N NH2 . ARG A 1 116 ? 14.918 30.792 52.871 1.00 16.82 ? 144 ARG A NH2 1 
ATOM   927  N N   . GLY A 1 117 ? 15.676 24.465 51.036 1.00 27.27 ? 145 GLY A N   1 
ATOM   928  C CA  . GLY A 1 117 ? 14.835 23.509 51.731 1.00 27.53 ? 145 GLY A CA  1 
ATOM   929  C C   . GLY A 1 117 ? 13.465 23.988 52.173 1.00 29.01 ? 145 GLY A C   1 
ATOM   930  O O   . GLY A 1 117 ? 12.568 23.188 52.381 1.00 29.62 ? 145 GLY A O   1 
ATOM   931  N N   . ASP A 1 118 ? 13.299 25.295 52.314 1.00 30.32 ? 146 ASP A N   1 
ATOM   932  C CA  . ASP A 1 118 ? 12.034 25.881 52.753 1.00 30.88 ? 146 ASP A CA  1 
ATOM   933  C C   . ASP A 1 118 ? 11.276 26.613 51.630 1.00 31.13 ? 146 ASP A C   1 
ATOM   934  O O   . ASP A 1 118 ? 10.149 27.091 51.830 1.00 30.14 ? 146 ASP A O   1 
ATOM   935  C CB  . ASP A 1 118 ? 12.318 26.852 53.898 1.00 32.39 ? 146 ASP A CB  1 
ATOM   936  C CG  . ASP A 1 118 ? 13.204 28.020 53.467 1.00 34.22 ? 146 ASP A CG  1 
ATOM   937  O OD1 . ASP A 1 118 ? 13.939 27.886 52.466 1.00 35.54 ? 146 ASP A OD1 1 
ATOM   938  O OD2 . ASP A 1 118 ? 13.174 29.074 54.133 1.00 35.75 ? 146 ASP A OD2 1 
ATOM   939  N N   . ARG A 1 119 ? 11.891 26.706 50.455 1.00 30.42 ? 147 ARG A N   1 
ATOM   940  C CA  . ARG A 1 119 ? 11.257 27.398 49.348 1.00 30.73 ? 147 ARG A CA  1 
ATOM   941  C C   . ARG A 1 119 ? 10.950 26.453 48.208 1.00 29.67 ? 147 ARG A C   1 
ATOM   942  O O   . ARG A 1 119 ? 10.249 26.818 47.274 1.00 30.03 ? 147 ARG A O   1 
ATOM   943  C CB  . ARG A 1 119 ? 12.137 28.556 48.878 1.00 33.01 ? 147 ARG A CB  1 
ATOM   944  C CG  . ARG A 1 119 ? 12.386 29.616 49.963 1.00 34.12 ? 147 ARG A CG  1 
ATOM   945  C CD  . ARG A 1 119 ? 13.350 30.680 49.470 1.00 38.15 ? 147 ARG A CD  1 
ATOM   946  N NE  . ARG A 1 119 ? 13.605 31.755 50.432 1.00 41.33 ? 147 ARG A NE  1 
ATOM   947  C CZ  . ARG A 1 119 ? 14.525 32.704 50.255 1.00 44.44 ? 147 ARG A CZ  1 
ATOM   948  N NH1 . ARG A 1 119 ? 15.275 32.707 49.156 1.00 45.70 ? 147 ARG A NH1 1 
ATOM   949  N NH2 . ARG A 1 119 ? 14.707 33.649 51.171 1.00 45.35 ? 147 ARG A NH2 1 
ATOM   950  N N   . CYS A 1 120 ? 11.489 25.240 48.271 1.00 27.16 ? 148 CYS A N   1 
ATOM   951  C CA  . CYS A 1 120 ? 11.194 24.236 47.258 1.00 23.98 ? 148 CYS A CA  1 
ATOM   952  C C   . CYS A 1 120 ? 10.845 22.993 48.032 1.00 21.36 ? 148 CYS A C   1 
ATOM   953  O O   . CYS A 1 120 ? 11.595 22.032 48.048 1.00 20.71 ? 148 CYS A O   1 
ATOM   954  C CB  . CYS A 1 120 ? 12.386 23.944 46.337 1.00 24.93 ? 148 CYS A CB  1 
ATOM   955  S SG  . CYS A 1 120 ? 11.958 22.914 44.844 1.00 27.19 ? 148 CYS A SG  1 
ATOM   956  N N   . ARG A 1 121 ? 9.696  23.034 48.688 1.00 20.42 ? 149 ARG A N   1 
ATOM   957  C CA  . ARG A 1 121 ? 9.213  21.912 49.489 1.00 19.89 ? 149 ARG A CA  1 
ATOM   958  C C   . ARG A 1 121 ? 9.410  20.511 48.881 1.00 19.04 ? 149 ARG A C   1 
ATOM   959  O O   . ARG A 1 121 ? 9.912  19.616 49.548 1.00 19.01 ? 149 ARG A O   1 
ATOM   960  C CB  . ARG A 1 121 ? 7.733  22.125 49.823 1.00 18.38 ? 149 ARG A CB  1 
ATOM   961  C CG  . ARG A 1 121 ? 7.463  23.398 50.614 0.00 19.78 ? 149 ARG A CG  1 
ATOM   962  C CD  . ARG A 1 121 ? 6.009  23.495 51.045 0.00 20.45 ? 149 ARG A CD  1 
ATOM   963  N NE  . ARG A 1 121 ? 5.623  22.392 51.921 0.00 21.29 ? 149 ARG A NE  1 
ATOM   964  C CZ  . ARG A 1 121 ? 4.424  22.269 52.481 0.00 21.73 ? 149 ARG A CZ  1 
ATOM   965  N NH1 . ARG A 1 121 ? 3.489  23.183 52.257 0.00 21.95 ? 149 ARG A NH1 1 
ATOM   966  N NH2 . ARG A 1 121 ? 4.158  21.233 53.265 0.00 21.95 ? 149 ARG A NH2 1 
ATOM   967  N N   . SER A 1 122 ? 9.032  20.320 47.619 1.00 17.95 ? 150 SER A N   1 
ATOM   968  C CA  . SER A 1 122 ? 9.164  19.013 47.010 1.00 16.26 ? 150 SER A CA  1 
ATOM   969  C C   . SER A 1 122 ? 10.593 18.643 46.639 1.00 16.24 ? 150 SER A C   1 
ATOM   970  O O   . SER A 1 122 ? 10.812 17.687 45.900 1.00 18.49 ? 150 SER A O   1 
ATOM   971  C CB  . SER A 1 122 ? 8.273  18.903 45.785 1.00 15.07 ? 150 SER A CB  1 
ATOM   972  O OG  . SER A 1 122 ? 8.825  19.636 44.724 1.00 17.75 ? 150 SER A OG  1 
ATOM   973  N N   . LEU A 1 123 ? 11.568 19.382 47.142 1.00 12.58 ? 151 LEU A N   1 
ATOM   974  C CA  . LEU A 1 123 ? 12.938 19.035 46.856 1.00 11.71 ? 151 LEU A CA  1 
ATOM   975  C C   . LEU A 1 123 ? 13.717 18.992 48.129 1.00 14.57 ? 151 LEU A C   1 
ATOM   976  O O   . LEU A 1 123 ? 14.902 18.675 48.115 1.00 16.54 ? 151 LEU A O   1 
ATOM   977  C CB  . LEU A 1 123 ? 13.596 20.007 45.895 1.00 8.77  ? 151 LEU A CB  1 
ATOM   978  C CG  . LEU A 1 123 ? 13.488 19.680 44.408 1.00 8.66  ? 151 LEU A CG  1 
ATOM   979  C CD1 . LEU A 1 123 ? 14.231 20.719 43.666 1.00 9.14  ? 151 LEU A CD1 1 
ATOM   980  C CD2 . LEU A 1 123 ? 14.062 18.329 44.082 1.00 7.50  ? 151 LEU A CD2 1 
ATOM   981  N N   . THR A 1 124 ? 13.056 19.296 49.238 1.00 14.44 ? 152 THR A N   1 
ATOM   982  C CA  . THR A 1 124 ? 13.727 19.252 50.534 1.00 16.16 ? 152 THR A CA  1 
ATOM   983  C C   . THR A 1 124 ? 14.147 17.804 50.816 1.00 18.69 ? 152 THR A C   1 
ATOM   984  O O   . THR A 1 124 ? 13.345 16.874 50.667 1.00 20.42 ? 152 THR A O   1 
ATOM   985  C CB  . THR A 1 124 ? 12.801 19.713 51.684 1.00 15.30 ? 152 THR A CB  1 
ATOM   986  O OG1 . THR A 1 124 ? 12.117 20.906 51.299 1.00 16.79 ? 152 THR A OG1 1 
ATOM   987  C CG2 . THR A 1 124 ? 13.596 19.990 52.928 1.00 10.69 ? 152 THR A CG2 1 
ATOM   988  N N   . GLY A 1 125 ? 15.405 17.611 51.205 1.00 18.24 ? 153 GLY A N   1 
ATOM   989  C CA  . GLY A 1 125 ? 15.877 16.275 51.512 1.00 16.07 ? 153 GLY A CA  1 
ATOM   990  C C   . GLY A 1 125 ? 16.434 15.616 50.285 1.00 16.18 ? 153 GLY A C   1 
ATOM   991  O O   . GLY A 1 125 ? 17.027 14.528 50.350 1.00 15.76 ? 153 GLY A O   1 
ATOM   992  N N   . LYS A 1 126 ? 16.238 16.297 49.161 1.00 14.88 ? 154 LYS A N   1 
ATOM   993  C CA  . LYS A 1 126 ? 16.710 15.811 47.881 1.00 14.12 ? 154 LYS A CA  1 
ATOM   994  C C   . LYS A 1 126 ? 17.912 16.633 47.442 1.00 13.44 ? 154 LYS A C   1 
ATOM   995  O O   . LYS A 1 126 ? 18.020 17.814 47.778 1.00 13.89 ? 154 LYS A O   1 
ATOM   996  C CB  . LYS A 1 126 ? 15.583 15.903 46.862 1.00 12.56 ? 154 LYS A CB  1 
ATOM   997  C CG  . LYS A 1 126 ? 14.337 15.207 47.345 1.00 10.49 ? 154 LYS A CG  1 
ATOM   998  C CD  . LYS A 1 126 ? 13.297 15.080 46.253 1.00 9.51  ? 154 LYS A CD  1 
ATOM   999  C CE  . LYS A 1 126 ? 12.175 14.218 46.730 1.00 7.75  ? 154 LYS A CE  1 
ATOM   1000 N NZ  . LYS A 1 126 ? 11.180 14.079 45.686 1.00 7.91  ? 154 LYS A NZ  1 
ATOM   1001 N N   . PRO A 1 127 ? 18.832 16.014 46.686 1.00 12.15 ? 155 PRO A N   1 
ATOM   1002 C CA  . PRO A 1 127 ? 20.031 16.692 46.206 1.00 12.43 ? 155 PRO A CA  1 
ATOM   1003 C C   . PRO A 1 127 ? 19.860 17.613 45.000 1.00 12.62 ? 155 PRO A C   1 
ATOM   1004 O O   . PRO A 1 127 ? 19.509 17.162 43.910 1.00 12.46 ? 155 PRO A O   1 
ATOM   1005 C CB  . PRO A 1 127 ? 20.988 15.532 45.939 1.00 13.55 ? 155 PRO A CB  1 
ATOM   1006 C CG  . PRO A 1 127 ? 20.098 14.479 45.475 1.00 13.53 ? 155 PRO A CG  1 
ATOM   1007 C CD  . PRO A 1 127 ? 18.904 14.575 46.398 1.00 13.62 ? 155 PRO A CD  1 
ATOM   1008 N N   . LYS A 1 128 ? 20.110 18.906 45.241 1.00 11.93 ? 156 LYS A N   1 
ATOM   1009 C CA  . LYS A 1 128 ? 20.047 19.974 44.258 1.00 9.83  ? 156 LYS A CA  1 
ATOM   1010 C C   . LYS A 1 128 ? 21.469 20.185 43.737 1.00 10.90 ? 156 LYS A C   1 
ATOM   1011 O O   . LYS A 1 128 ? 22.346 20.632 44.471 1.00 11.88 ? 156 LYS A O   1 
ATOM   1012 C CB  . LYS A 1 128 ? 19.530 21.252 44.920 1.00 9.28  ? 156 LYS A CB  1 
ATOM   1013 C CG  . LYS A 1 128 ? 18.028 21.291 45.138 1.00 10.74 ? 156 LYS A CG  1 
ATOM   1014 C CD  . LYS A 1 128 ? 17.590 20.520 46.361 1.00 12.21 ? 156 LYS A CD  1 
ATOM   1015 C CE  . LYS A 1 128 ? 17.831 21.294 47.655 1.00 14.77 ? 156 LYS A CE  1 
ATOM   1016 N NZ  . LYS A 1 128 ? 17.368 20.565 48.853 1.00 11.56 ? 156 LYS A NZ  1 
ATOM   1017 N N   . LEU A 1 129 ? 21.703 19.874 42.467 1.00 10.52 ? 157 LEU A N   1 
ATOM   1018 C CA  . LEU A 1 129 ? 23.041 19.993 41.923 1.00 11.53 ? 157 LEU A CA  1 
ATOM   1019 C C   . LEU A 1 129 ? 23.206 21.103 40.902 1.00 11.50 ? 157 LEU A C   1 
ATOM   1020 O O   . LEU A 1 129 ? 22.500 21.125 39.909 1.00 13.10 ? 157 LEU A O   1 
ATOM   1021 C CB  . LEU A 1 129 ? 23.456 18.649 41.324 1.00 11.63 ? 157 LEU A CB  1 
ATOM   1022 C CG  . LEU A 1 129 ? 22.993 17.459 42.185 1.00 15.10 ? 157 LEU A CG  1 
ATOM   1023 C CD1 . LEU A 1 129 ? 23.257 16.123 41.492 1.00 12.67 ? 157 LEU A CD1 1 
ATOM   1024 C CD2 . LEU A 1 129 ? 23.685 17.527 43.528 1.00 14.17 ? 157 LEU A CD2 1 
ATOM   1025 N N   . PHE A 1 130 ? 24.145 22.015 41.162 1.00 11.46 ? 158 PHE A N   1 
ATOM   1026 C CA  . PHE A 1 130 ? 24.459 23.137 40.279 1.00 11.39 ? 158 PHE A CA  1 
ATOM   1027 C C   . PHE A 1 130 ? 25.885 23.019 39.733 1.00 13.67 ? 158 PHE A C   1 
ATOM   1028 O O   . PHE A 1 130 ? 26.875 23.043 40.479 1.00 13.78 ? 158 PHE A O   1 
ATOM   1029 C CB  . PHE A 1 130 ? 24.307 24.480 41.015 1.00 11.39 ? 158 PHE A CB  1 
ATOM   1030 C CG  . PHE A 1 130 ? 22.898 24.774 41.456 1.00 10.51 ? 158 PHE A CG  1 
ATOM   1031 C CD1 . PHE A 1 130 ? 22.387 24.208 42.613 1.00 12.74 ? 158 PHE A CD1 1 
ATOM   1032 C CD2 . PHE A 1 130 ? 22.059 25.526 40.662 1.00 8.65  ? 158 PHE A CD2 1 
ATOM   1033 C CE1 . PHE A 1 130 ? 21.077 24.378 42.963 1.00 11.48 ? 158 PHE A CE1 1 
ATOM   1034 C CE2 . PHE A 1 130 ? 20.743 25.702 41.002 1.00 9.27  ? 158 PHE A CE2 1 
ATOM   1035 C CZ  . PHE A 1 130 ? 20.248 25.128 42.150 1.00 12.55 ? 158 PHE A CZ  1 
ATOM   1036 N N   . ILE A 1 131 ? 25.977 22.882 38.416 1.00 14.13 ? 159 ILE A N   1 
ATOM   1037 C CA  . ILE A 1 131 ? 27.262 22.752 37.737 1.00 13.09 ? 159 ILE A CA  1 
ATOM   1038 C C   . ILE A 1 131 ? 27.478 24.100 37.080 1.00 12.88 ? 159 ILE A C   1 
ATOM   1039 O O   . ILE A 1 131 ? 26.611 24.630 36.407 1.00 11.65 ? 159 ILE A O   1 
ATOM   1040 C CB  . ILE A 1 131 ? 27.217 21.581 36.721 1.00 11.76 ? 159 ILE A CB  1 
ATOM   1041 C CG1 . ILE A 1 131 ? 26.827 20.306 37.469 1.00 9.12  ? 159 ILE A CG1 1 
ATOM   1042 C CG2 . ILE A 1 131 ? 28.578 21.364 36.076 1.00 12.45 ? 159 ILE A CG2 1 
ATOM   1043 C CD1 . ILE A 1 131 ? 26.030 19.337 36.651 1.00 10.62 ? 159 ILE A CD1 1 
ATOM   1044 N N   . ILE A 1 132 ? 28.657 24.652 37.276 1.00 13.04 ? 160 ILE A N   1 
ATOM   1045 C CA  . ILE A 1 132 ? 28.925 25.978 36.795 1.00 12.43 ? 160 ILE A CA  1 
ATOM   1046 C C   . ILE A 1 132 ? 30.149 26.162 35.919 1.00 14.73 ? 160 ILE A C   1 
ATOM   1047 O O   . ILE A 1 132 ? 31.275 26.088 36.400 1.00 14.85 ? 160 ILE A O   1 
ATOM   1048 C CB  . ILE A 1 132 ? 29.042 26.891 38.004 1.00 11.89 ? 160 ILE A CB  1 
ATOM   1049 C CG1 . ILE A 1 132 ? 27.835 26.660 38.911 1.00 11.46 ? 160 ILE A CG1 1 
ATOM   1050 C CG2 . ILE A 1 132 ? 29.134 28.346 37.572 1.00 11.88 ? 160 ILE A CG2 1 
ATOM   1051 C CD1 . ILE A 1 132 ? 28.103 26.959 40.373 1.00 11.22 ? 160 ILE A CD1 1 
ATOM   1052 N N   . GLN A 1 133 ? 29.926 26.426 34.635 1.00 14.60 ? 161 GLN A N   1 
ATOM   1053 C CA  . GLN A 1 133 ? 31.024 26.669 33.712 1.00 16.15 ? 161 GLN A CA  1 
ATOM   1054 C C   . GLN A 1 133 ? 31.009 28.180 33.394 1.00 17.81 ? 161 GLN A C   1 
ATOM   1055 O O   . GLN A 1 133 ? 30.248 28.635 32.526 1.00 19.39 ? 161 GLN A O   1 
ATOM   1056 C CB  . GLN A 1 133 ? 30.858 25.811 32.440 1.00 16.51 ? 161 GLN A CB  1 
ATOM   1057 C CG  . GLN A 1 133 ? 31.801 26.142 31.267 1.00 16.82 ? 161 GLN A CG  1 
ATOM   1058 C CD  . GLN A 1 133 ? 33.260 26.150 31.672 1.00 16.00 ? 161 GLN A CD  1 
ATOM   1059 O OE1 . GLN A 1 133 ? 33.727 25.207 32.287 1.00 18.34 ? 161 GLN A OE1 1 
ATOM   1060 N NE2 . GLN A 1 133 ? 33.984 27.212 31.329 1.00 13.91 ? 161 GLN A NE2 1 
ATOM   1061 N N   . ALA A 1 134 ? 31.850 28.932 34.120 1.00 16.80 ? 162 ALA A N   1 
ATOM   1062 C CA  . ALA A 1 134 ? 31.972 30.383 33.995 1.00 18.83 ? 162 ALA A CA  1 
ATOM   1063 C C   . ALA A 1 134 ? 33.171 30.891 34.823 1.00 20.18 ? 162 ALA A C   1 
ATOM   1064 O O   . ALA A 1 134 ? 33.680 30.162 35.652 1.00 20.24 ? 162 ALA A O   1 
ATOM   1065 C CB  . ALA A 1 134 ? 30.689 31.030 34.466 1.00 15.80 ? 162 ALA A CB  1 
ATOM   1066 N N   . CYS A 1 135 ? 33.630 32.123 34.602 1.00 22.25 ? 163 CYS A N   1 
ATOM   1067 C CA  . CYS A 1 135 ? 34.773 32.635 35.367 1.00 25.09 ? 163 CYS A CA  1 
ATOM   1068 C C   . CYS A 1 135 ? 34.330 33.013 36.765 1.00 25.79 ? 163 CYS A C   1 
ATOM   1069 O O   . CYS A 1 135 ? 33.181 33.363 36.985 1.00 26.58 ? 163 CYS A O   1 
ATOM   1070 C CB  . CYS A 1 135 ? 35.460 33.830 34.642 1.00 28.56 ? 163 CYS A CB  1 
ATOM   1071 S SG  . CYS A 1 135 ? 36.272 33.192 33.142 1.00 32.40 ? 163 CYS A SG  1 
ATOM   1072 N N   . ARG A 1 136 ? 35.233 32.883 37.726 1.00 25.34 ? 164 ARG A N   1 
ATOM   1073 C CA  . ARG A 1 136 ? 34.905 33.228 39.104 1.00 24.58 ? 164 ARG A CA  1 
ATOM   1074 C C   . ARG A 1 136 ? 35.826 34.377 39.461 1.00 24.15 ? 164 ARG A C   1 
ATOM   1075 O O   . ARG A 1 136 ? 36.096 34.671 40.612 1.00 22.03 ? 164 ARG A O   1 
ATOM   1076 C CB  . ARG A 1 136 ? 35.126 32.012 40.027 1.00 23.89 ? 164 ARG A CB  1 
ATOM   1077 C CG  . ARG A 1 136 ? 34.038 30.915 39.922 1.00 17.46 ? 164 ARG A CG  1 
ATOM   1078 C CD  . ARG A 1 136 ? 34.384 29.694 40.723 1.00 15.06 ? 164 ARG A CD  1 
ATOM   1079 N NE  . ARG A 1 136 ? 34.082 29.849 42.136 1.00 16.03 ? 164 ARG A NE  1 
ATOM   1080 C CZ  . ARG A 1 136 ? 34.561 29.059 43.086 1.00 16.98 ? 164 ARG A CZ  1 
ATOM   1081 N NH1 . ARG A 1 136 ? 35.366 28.069 42.758 1.00 20.18 ? 164 ARG A NH1 1 
ATOM   1082 N NH2 . ARG A 1 136 ? 34.234 29.244 44.357 1.00 17.02 ? 164 ARG A NH2 1 
ATOM   1083 N N   . GLY A 1 137 ? 36.286 35.032 38.412 1.00 24.76 ? 165 GLY A N   1 
ATOM   1084 C CA  . GLY A 1 137 ? 37.198 36.134 38.550 1.00 24.16 ? 165 GLY A CA  1 
ATOM   1085 C C   . GLY A 1 137 ? 38.110 36.117 37.342 1.00 24.84 ? 165 GLY A C   1 
ATOM   1086 O O   . GLY A 1 137 ? 37.773 35.529 36.312 1.00 23.91 ? 165 GLY A O   1 
ATOM   1087 N N   . THR A 1 138 ? 39.279 36.731 37.475 1.00 23.78 ? 166 THR A N   1 
ATOM   1088 C CA  . THR A 1 138 ? 40.202 36.794 36.359 1.00 22.43 ? 166 THR A CA  1 
ATOM   1089 C C   . THR A 1 138 ? 41.633 36.375 36.683 1.00 22.08 ? 166 THR A C   1 
ATOM   1090 O O   . THR A 1 138 ? 42.585 36.906 36.123 1.00 24.13 ? 166 THR A O   1 
ATOM   1091 C CB  . THR A 1 138 ? 40.178 38.236 35.728 1.00 21.86 ? 166 THR A CB  1 
ATOM   1092 O OG1 . THR A 1 138 ? 40.409 39.234 36.739 1.00 19.93 ? 166 THR A OG1 1 
ATOM   1093 C CG2 . THR A 1 138 ? 38.826 38.501 35.073 1.00 18.66 ? 166 THR A CG2 1 
ATOM   1094 N N   . GLU A 1 139 ? 41.794 35.425 37.592 1.00 21.86 ? 167 GLU A N   1 
ATOM   1095 C CA  . GLU A 1 139 ? 43.129 34.941 37.932 1.00 20.38 ? 167 GLU A CA  1 
ATOM   1096 C C   . GLU A 1 139 ? 43.535 33.861 36.957 1.00 18.95 ? 167 GLU A C   1 
ATOM   1097 O O   . GLU A 1 139 ? 42.674 33.229 36.355 1.00 19.34 ? 167 GLU A O   1 
ATOM   1098 C CB  . GLU A 1 139 ? 43.160 34.386 39.356 1.00 20.75 ? 167 GLU A CB  1 
ATOM   1099 C CG  . GLU A 1 139 ? 43.382 35.463 40.411 1.00 25.39 ? 167 GLU A CG  1 
ATOM   1100 C CD  . GLU A 1 139 ? 42.382 35.372 41.559 1.00 29.02 ? 167 GLU A CD  1 
ATOM   1101 O OE1 . GLU A 1 139 ? 42.716 34.720 42.578 1.00 29.79 ? 167 GLU A OE1 1 
ATOM   1102 O OE2 . GLU A 1 139 ? 41.262 35.942 41.440 1.00 27.98 ? 167 GLU A OE2 1 
ATOM   1103 N N   . LEU A 1 140 ? 44.841 33.665 36.792 1.00 17.91 ? 168 LEU A N   1 
ATOM   1104 C CA  . LEU A 1 140 ? 45.371 32.648 35.892 1.00 17.22 ? 168 LEU A CA  1 
ATOM   1105 C C   . LEU A 1 140 ? 46.306 31.713 36.634 1.00 18.09 ? 168 LEU A C   1 
ATOM   1106 O O   . LEU A 1 140 ? 47.237 32.150 37.292 1.00 21.47 ? 168 LEU A O   1 
ATOM   1107 C CB  . LEU A 1 140 ? 46.123 33.302 34.731 1.00 16.29 ? 168 LEU A CB  1 
ATOM   1108 C CG  . LEU A 1 140 ? 45.276 34.159 33.786 1.00 15.70 ? 168 LEU A CG  1 
ATOM   1109 C CD1 . LEU A 1 140 ? 46.022 35.442 33.449 1.00 19.64 ? 168 LEU A CD1 1 
ATOM   1110 C CD2 . LEU A 1 140 ? 44.957 33.403 32.548 1.00 14.35 ? 168 LEU A CD2 1 
ATOM   1111 N N   . ASP A 1 141 ? 46.061 30.415 36.506 1.00 19.61 ? 169 ASP A N   1 
ATOM   1112 C CA  . ASP A 1 141 ? 46.868 29.377 37.158 1.00 18.03 ? 169 ASP A CA  1 
ATOM   1113 C C   . ASP A 1 141 ? 48.040 29.012 36.248 1.00 20.33 ? 169 ASP A C   1 
ATOM   1114 O O   . ASP A 1 141 ? 47.904 28.181 35.346 1.00 20.86 ? 169 ASP A O   1 
ATOM   1115 C CB  . ASP A 1 141 ? 45.993 28.146 37.390 1.00 14.80 ? 169 ASP A CB  1 
ATOM   1116 C CG  . ASP A 1 141 ? 46.395 27.361 38.605 1.00 15.55 ? 169 ASP A CG  1 
ATOM   1117 O OD1 . ASP A 1 141 ? 47.529 26.810 38.635 1.00 13.10 ? 169 ASP A OD1 1 
ATOM   1118 O OD2 . ASP A 1 141 ? 45.552 27.294 39.530 1.00 11.88 ? 169 ASP A OD2 1 
ATOM   1119 N N   . CYS A 1 142 ? 49.187 29.650 36.476 1.00 23.29 ? 170 CYS A N   1 
ATOM   1120 C CA  . CYS A 1 142 ? 50.398 29.408 35.681 1.00 22.61 ? 170 CYS A CA  1 
ATOM   1121 C C   . CYS A 1 142 ? 50.900 28.003 35.954 1.00 22.24 ? 170 CYS A C   1 
ATOM   1122 O O   . CYS A 1 142 ? 51.828 27.527 35.321 1.00 25.62 ? 170 CYS A O   1 
ATOM   1123 C CB  . CYS A 1 142 ? 51.464 30.453 36.022 1.00 21.07 ? 170 CYS A CB  1 
ATOM   1124 S SG  . CYS A 1 142 ? 50.818 32.167 35.806 1.00 27.67 ? 170 CYS A SG  1 
ATOM   1125 N N   . GLY A 1 143 ? 50.253 27.330 36.895 1.00 21.87 ? 171 GLY A N   1 
ATOM   1126 C CA  . GLY A 1 143 ? 50.628 25.973 37.233 1.00 19.86 ? 171 GLY A CA  1 
ATOM   1127 C C   . GLY A 1 143 ? 52.046 25.758 37.694 1.00 17.63 ? 171 GLY A C   1 
ATOM   1128 O O   . GLY A 1 143 ? 52.848 26.680 37.777 1.00 18.78 ? 171 GLY A O   1 
ATOM   1129 N N   . ILE A 1 144 ? 52.346 24.512 38.020 1.00 18.32 ? 172 ILE A N   1 
ATOM   1130 C CA  . ILE A 1 144 ? 53.678 24.121 38.455 1.00 19.07 ? 172 ILE A CA  1 
ATOM   1131 C C   . ILE A 1 144 ? 54.095 22.854 37.731 1.00 20.61 ? 172 ILE A C   1 
ATOM   1132 O O   . ILE A 1 144 ? 53.463 21.813 37.868 1.00 21.69 ? 172 ILE A O   1 
ATOM   1133 C CB  . ILE A 1 144 ? 53.748 23.858 39.986 1.00 18.27 ? 172 ILE A CB  1 
ATOM   1134 C CG1 . ILE A 1 144 ? 55.156 23.381 40.359 1.00 15.19 ? 172 ILE A CG1 1 
ATOM   1135 C CG2 . ILE A 1 144 ? 52.696 22.835 40.404 1.00 16.75 ? 172 ILE A CG2 1 
ATOM   1136 C CD1 . ILE A 1 144 ? 56.269 24.341 39.920 1.00 12.53 ? 172 ILE A CD1 1 
ATOM   1137 N N   . GLU A 1 145 ? 55.151 22.956 36.938 1.00 24.13 ? 173 GLU A N   1 
ATOM   1138 C CA  . GLU A 1 145 ? 55.673 21.808 36.207 1.00 26.45 ? 173 GLU A CA  1 
ATOM   1139 C C   . GLU A 1 145 ? 56.738 21.176 37.084 1.00 27.84 ? 173 GLU A C   1 
ATOM   1140 O O   . GLU A 1 145 ? 56.524 20.050 37.586 1.00 28.66 ? 173 GLU A O   1 
ATOM   1141 C CB  . GLU A 1 145 ? 56.288 22.257 34.877 0.00 26.81 ? 173 GLU A CB  1 
ATOM   1142 C CG  . GLU A 1 145 ? 56.887 21.133 34.039 0.00 27.93 ? 173 GLU A CG  1 
ATOM   1143 C CD  . GLU A 1 145 ? 58.134 20.533 34.664 0.00 28.55 ? 173 GLU A CD  1 
ATOM   1144 O OE1 . GLU A 1 145 ? 59.115 21.280 34.867 0.00 28.96 ? 173 GLU A OE1 1 
ATOM   1145 O OE2 . GLU A 1 145 ? 58.133 19.318 34.954 0.00 28.96 ? 173 GLU A OE2 1 
ATOM   1146 N N   . HIS B 2 5   ? 14.497 17.439 63.763 1.00 46.73 ? 185 HIS B N   1 
ATOM   1147 C CA  . HIS B 2 5   ? 13.262 17.959 63.095 1.00 45.75 ? 185 HIS B CA  1 
ATOM   1148 C C   . HIS B 2 5   ? 13.577 18.975 62.014 1.00 42.42 ? 185 HIS B C   1 
ATOM   1149 O O   . HIS B 2 5   ? 12.970 18.959 60.937 1.00 42.74 ? 185 HIS B O   1 
ATOM   1150 C CB  . HIS B 2 5   ? 12.318 18.583 64.126 1.00 51.62 ? 185 HIS B CB  1 
ATOM   1151 C CG  . HIS B 2 5   ? 13.024 19.220 65.281 1.00 56.40 ? 185 HIS B CG  1 
ATOM   1152 N ND1 . HIS B 2 5   ? 13.943 20.237 65.124 1.00 58.62 ? 185 HIS B ND1 1 
ATOM   1153 C CD2 . HIS B 2 5   ? 12.970 18.964 66.610 1.00 58.58 ? 185 HIS B CD2 1 
ATOM   1154 C CE1 . HIS B 2 5   ? 14.428 20.577 66.305 1.00 59.84 ? 185 HIS B CE1 1 
ATOM   1155 N NE2 . HIS B 2 5   ? 13.854 19.820 67.224 1.00 60.06 ? 185 HIS B NE2 1 
ATOM   1156 N N   . LYS B 2 6   ? 14.534 19.849 62.296 1.00 37.95 ? 186 LYS B N   1 
ATOM   1157 C CA  . LYS B 2 6   ? 14.925 20.860 61.335 1.00 32.60 ? 186 LYS B CA  1 
ATOM   1158 C C   . LYS B 2 6   ? 16.249 20.518 60.676 1.00 31.47 ? 186 LYS B C   1 
ATOM   1159 O O   . LYS B 2 6   ? 17.050 19.741 61.229 1.00 31.60 ? 186 LYS B O   1 
ATOM   1160 C CB  . LYS B 2 6   ? 15.044 22.214 62.024 1.00 30.94 ? 186 LYS B CB  1 
ATOM   1161 C CG  . LYS B 2 6   ? 14.045 23.197 61.531 1.00 28.37 ? 186 LYS B CG  1 
ATOM   1162 C CD  . LYS B 2 6   ? 13.427 24.001 62.650 1.00 28.99 ? 186 LYS B CD  1 
ATOM   1163 C CE  . LYS B 2 6   ? 14.159 25.316 62.914 1.00 27.99 ? 186 LYS B CE  1 
ATOM   1164 N NZ  . LYS B 2 6   ? 15.517 25.082 63.466 1.00 30.76 ? 186 LYS B NZ  1 
ATOM   1165 N N   . ILE B 2 7   ? 16.447 21.077 59.478 1.00 27.94 ? 187 ILE B N   1 
ATOM   1166 C CA  . ILE B 2 7   ? 17.695 20.928 58.722 1.00 25.31 ? 187 ILE B CA  1 
ATOM   1167 C C   . ILE B 2 7   ? 18.063 22.258 58.038 1.00 23.36 ? 187 ILE B C   1 
ATOM   1168 O O   . ILE B 2 7   ? 17.195 23.054 57.701 1.00 21.68 ? 187 ILE B O   1 
ATOM   1169 C CB  . ILE B 2 7   ? 17.632 19.819 57.626 1.00 22.21 ? 187 ILE B CB  1 
ATOM   1170 C CG1 . ILE B 2 7   ? 16.576 20.145 56.583 1.00 21.11 ? 187 ILE B CG1 1 
ATOM   1171 C CG2 . ILE B 2 7   ? 17.397 18.483 58.259 1.00 21.47 ? 187 ILE B CG2 1 
ATOM   1172 C CD1 . ILE B 2 7   ? 16.762 19.364 55.327 1.00 20.48 ? 187 ILE B CD1 1 
ATOM   1173 N N   . PRO B 2 8   ? 19.362 22.519 57.842 1.00 21.39 ? 188 PRO B N   1 
ATOM   1174 C CA  . PRO B 2 8   ? 19.726 23.776 57.188 1.00 20.76 ? 188 PRO B CA  1 
ATOM   1175 C C   . PRO B 2 8   ? 18.958 23.897 55.855 1.00 21.51 ? 188 PRO B C   1 
ATOM   1176 O O   . PRO B 2 8   ? 18.643 22.887 55.213 1.00 20.27 ? 188 PRO B O   1 
ATOM   1177 C CB  . PRO B 2 8   ? 21.233 23.627 56.983 1.00 18.85 ? 188 PRO B CB  1 
ATOM   1178 C CG  . PRO B 2 8   ? 21.640 22.810 58.112 1.00 18.03 ? 188 PRO B CG  1 
ATOM   1179 C CD  . PRO B 2 8   ? 20.563 21.750 58.201 1.00 18.74 ? 188 PRO B CD  1 
ATOM   1180 N N   . VAL B 2 9   ? 18.645 25.124 55.448 1.00 21.33 ? 189 VAL B N   1 
ATOM   1181 C CA  . VAL B 2 9   ? 17.934 25.305 54.201 1.00 19.91 ? 189 VAL B CA  1 
ATOM   1182 C C   . VAL B 2 9   ? 18.931 25.316 53.062 1.00 21.70 ? 189 VAL B C   1 
ATOM   1183 O O   . VAL B 2 9   ? 18.549 25.162 51.899 1.00 23.52 ? 189 VAL B O   1 
ATOM   1184 C CB  . VAL B 2 9   ? 17.082 26.605 54.190 1.00 19.59 ? 189 VAL B CB  1 
ATOM   1185 C CG1 . VAL B 2 9   ? 16.007 26.502 55.226 1.00 17.51 ? 189 VAL B CG1 1 
ATOM   1186 C CG2 . VAL B 2 9   ? 17.947 27.833 54.407 1.00 14.47 ? 189 VAL B CG2 1 
ATOM   1187 N N   . ASP B 2 10  ? 20.207 25.505 53.402 1.00 21.88 ? 190 ASP B N   1 
ATOM   1188 C CA  . ASP B 2 10  ? 21.284 25.496 52.412 1.00 23.39 ? 190 ASP B CA  1 
ATOM   1189 C C   . ASP B 2 10  ? 21.826 24.064 52.309 1.00 23.38 ? 190 ASP B C   1 
ATOM   1190 O O   . ASP B 2 10  ? 22.770 23.798 51.571 1.00 23.29 ? 190 ASP B O   1 
ATOM   1191 C CB  . ASP B 2 10  ? 22.421 26.449 52.812 1.00 25.59 ? 190 ASP B CB  1 
ATOM   1192 C CG  . ASP B 2 10  ? 22.237 27.878 52.276 1.00 29.04 ? 190 ASP B CG  1 
ATOM   1193 O OD1 . ASP B 2 10  ? 22.168 28.096 51.048 1.00 28.39 ? 190 ASP B OD1 1 
ATOM   1194 O OD2 . ASP B 2 10  ? 22.185 28.807 53.095 1.00 31.09 ? 190 ASP B OD2 1 
ATOM   1195 N N   . ALA B 2 11  ? 21.215 23.150 53.061 1.00 23.70 ? 191 ALA B N   1 
ATOM   1196 C CA  . ALA B 2 11  ? 21.590 21.737 53.071 1.00 23.99 ? 191 ALA B CA  1 
ATOM   1197 C C   . ALA B 2 11  ? 21.129 21.006 51.804 1.00 23.81 ? 191 ALA B C   1 
ATOM   1198 O O   . ALA B 2 11  ? 20.075 21.320 51.248 1.00 25.36 ? 191 ALA B O   1 
ATOM   1199 C CB  . ALA B 2 11  ? 20.996 21.050 54.293 1.00 23.16 ? 191 ALA B CB  1 
ATOM   1200 N N   . ASP B 2 12  ? 21.922 20.016 51.385 1.00 23.29 ? 192 ASP B N   1 
ATOM   1201 C CA  . ASP B 2 12  ? 21.672 19.188 50.205 1.00 20.99 ? 192 ASP B CA  1 
ATOM   1202 C C   . ASP B 2 12  ? 21.797 19.929 48.879 1.00 20.98 ? 192 ASP B C   1 
ATOM   1203 O O   . ASP B 2 12  ? 20.963 19.769 47.997 1.00 20.17 ? 192 ASP B O   1 
ATOM   1204 C CB  . ASP B 2 12  ? 20.303 18.538 50.281 1.00 20.74 ? 192 ASP B CB  1 
ATOM   1205 C CG  . ASP B 2 12  ? 20.145 17.629 51.487 1.00 22.81 ? 192 ASP B CG  1 
ATOM   1206 O OD1 . ASP B 2 12  ? 20.966 16.708 51.677 1.00 21.37 ? 192 ASP B OD1 1 
ATOM   1207 O OD2 . ASP B 2 12  ? 19.175 17.830 52.244 1.00 24.48 ? 192 ASP B OD2 1 
ATOM   1208 N N   . PHE B 2 13  ? 22.843 20.740 48.754 1.00 20.27 ? 193 PHE B N   1 
ATOM   1209 C CA  . PHE B 2 13  ? 23.115 21.502 47.541 1.00 19.00 ? 193 PHE B CA  1 
ATOM   1210 C C   . PHE B 2 13  ? 24.514 21.127 47.142 1.00 18.14 ? 193 PHE B C   1 
ATOM   1211 O O   . PHE B 2 13  ? 25.355 20.916 48.006 1.00 16.98 ? 193 PHE B O   1 
ATOM   1212 C CB  . PHE B 2 13  ? 23.111 23.010 47.807 1.00 19.52 ? 193 PHE B CB  1 
ATOM   1213 C CG  . PHE B 2 13  ? 21.755 23.641 47.744 1.00 21.17 ? 193 PHE B CG  1 
ATOM   1214 C CD1 . PHE B 2 13  ? 21.345 24.322 46.596 1.00 22.20 ? 193 PHE B CD1 1 
ATOM   1215 C CD2 . PHE B 2 13  ? 20.874 23.544 48.823 1.00 21.47 ? 193 PHE B CD2 1 
ATOM   1216 C CE1 . PHE B 2 13  ? 20.075 24.897 46.520 1.00 21.73 ? 193 PHE B CE1 1 
ATOM   1217 C CE2 . PHE B 2 13  ? 19.609 24.111 48.765 1.00 20.01 ? 193 PHE B CE2 1 
ATOM   1218 C CZ  . PHE B 2 13  ? 19.208 24.790 47.608 1.00 21.48 ? 193 PHE B CZ  1 
ATOM   1219 N N   . LEU B 2 14  ? 24.777 21.022 45.849 1.00 15.25 ? 194 LEU B N   1 
ATOM   1220 C CA  . LEU B 2 14  ? 26.133 20.716 45.462 1.00 15.02 ? 194 LEU B CA  1 
ATOM   1221 C C   . LEU B 2 14  ? 26.563 21.678 44.397 1.00 14.64 ? 194 LEU B C   1 
ATOM   1222 O O   . LEU B 2 14  ? 25.857 21.875 43.427 1.00 14.57 ? 194 LEU B O   1 
ATOM   1223 C CB  . LEU B 2 14  ? 26.293 19.286 44.943 1.00 14.39 ? 194 LEU B CB  1 
ATOM   1224 C CG  . LEU B 2 14  ? 27.752 19.071 44.508 1.00 10.82 ? 194 LEU B CG  1 
ATOM   1225 C CD1 . LEU B 2 14  ? 28.332 17.979 45.319 1.00 12.44 ? 194 LEU B CD1 1 
ATOM   1226 C CD2 . LEU B 2 14  ? 27.860 18.775 43.021 1.00 7.73  ? 194 LEU B CD2 1 
ATOM   1227 N N   . TYR B 2 15  ? 27.734 22.270 44.585 1.00 14.79 ? 195 TYR B N   1 
ATOM   1228 C CA  . TYR B 2 15  ? 28.261 23.208 43.631 1.00 15.98 ? 195 TYR B CA  1 
ATOM   1229 C C   . TYR B 2 15  ? 29.513 22.693 42.960 1.00 16.25 ? 195 TYR B C   1 
ATOM   1230 O O   . TYR B 2 15  ? 30.554 22.590 43.579 1.00 16.14 ? 195 TYR B O   1 
ATOM   1231 C CB  . TYR B 2 15  ? 28.564 24.523 44.324 1.00 19.88 ? 195 TYR B CB  1 
ATOM   1232 C CG  . TYR B 2 15  ? 27.374 25.120 45.045 1.00 23.27 ? 195 TYR B CG  1 
ATOM   1233 C CD1 . TYR B 2 15  ? 27.065 24.751 46.355 1.00 25.54 ? 195 TYR B CD1 1 
ATOM   1234 C CD2 . TYR B 2 15  ? 26.560 26.048 44.420 1.00 24.33 ? 195 TYR B CD2 1 
ATOM   1235 C CE1 . TYR B 2 15  ? 25.978 25.296 47.020 1.00 25.62 ? 195 TYR B CE1 1 
ATOM   1236 C CE2 . TYR B 2 15  ? 25.474 26.598 45.073 1.00 26.57 ? 195 TYR B CE2 1 
ATOM   1237 C CZ  . TYR B 2 15  ? 25.187 26.221 46.373 1.00 27.54 ? 195 TYR B CZ  1 
ATOM   1238 O OH  . TYR B 2 15  ? 24.114 26.792 47.025 1.00 29.42 ? 195 TYR B OH  1 
ATOM   1239 N N   . ALA B 2 16  ? 29.406 22.362 41.685 1.00 16.68 ? 196 ALA B N   1 
ATOM   1240 C CA  . ALA B 2 16  ? 30.561 21.889 40.931 1.00 17.76 ? 196 ALA B CA  1 
ATOM   1241 C C   . ALA B 2 16  ? 31.102 23.072 40.118 1.00 18.24 ? 196 ALA B C   1 
ATOM   1242 O O   . ALA B 2 16  ? 30.585 23.401 39.074 1.00 21.36 ? 196 ALA B O   1 
ATOM   1243 C CB  . ALA B 2 16  ? 30.153 20.765 40.019 1.00 15.09 ? 196 ALA B CB  1 
ATOM   1244 N N   . TYR B 2 17  ? 32.136 23.716 40.627 1.00 17.78 ? 197 TYR B N   1 
ATOM   1245 C CA  . TYR B 2 17  ? 32.726 24.863 39.966 1.00 18.73 ? 197 TYR B CA  1 
ATOM   1246 C C   . TYR B 2 17  ? 33.821 24.363 39.072 1.00 17.48 ? 197 TYR B C   1 
ATOM   1247 O O   . TYR B 2 17  ? 34.571 23.493 39.449 1.00 21.41 ? 197 TYR B O   1 
ATOM   1248 C CB  . TYR B 2 17  ? 33.309 25.840 41.001 1.00 20.33 ? 197 TYR B CB  1 
ATOM   1249 C CG  . TYR B 2 17  ? 32.266 26.625 41.779 1.00 18.63 ? 197 TYR B CG  1 
ATOM   1250 C CD1 . TYR B 2 17  ? 31.594 27.701 41.199 1.00 19.43 ? 197 TYR B CD1 1 
ATOM   1251 C CD2 . TYR B 2 17  ? 31.933 26.273 43.079 1.00 17.85 ? 197 TYR B CD2 1 
ATOM   1252 C CE1 . TYR B 2 17  ? 30.614 28.411 41.897 1.00 16.92 ? 197 TYR B CE1 1 
ATOM   1253 C CE2 . TYR B 2 17  ? 30.969 26.968 43.782 1.00 19.14 ? 197 TYR B CE2 1 
ATOM   1254 C CZ  . TYR B 2 17  ? 30.316 28.040 43.187 1.00 18.45 ? 197 TYR B CZ  1 
ATOM   1255 O OH  . TYR B 2 17  ? 29.414 28.754 43.912 1.00 15.57 ? 197 TYR B OH  1 
ATOM   1256 N N   . SER B 2 18  ? 33.917 24.933 37.888 1.00 15.76 ? 198 SER B N   1 
ATOM   1257 C CA  . SER B 2 18  ? 34.916 24.536 36.924 1.00 13.79 ? 198 SER B CA  1 
ATOM   1258 C C   . SER B 2 18  ? 36.290 24.988 37.337 1.00 14.90 ? 198 SER B C   1 
ATOM   1259 O O   . SER B 2 18  ? 37.273 24.427 36.898 1.00 14.67 ? 198 SER B O   1 
ATOM   1260 C CB  . SER B 2 18  ? 34.563 25.133 35.578 1.00 13.95 ? 198 SER B CB  1 
ATOM   1261 O OG  . SER B 2 18  ? 34.421 26.530 35.689 1.00 11.20 ? 198 SER B OG  1 
ATOM   1262 N N   . THR B 2 19  ? 36.345 26.021 38.180 1.00 17.23 ? 199 THR B N   1 
ATOM   1263 C CA  . THR B 2 19  ? 37.597 26.584 38.667 1.00 14.41 ? 199 THR B CA  1 
ATOM   1264 C C   . THR B 2 19  ? 37.560 26.930 40.133 1.00 14.60 ? 199 THR B C   1 
ATOM   1265 O O   . THR B 2 19  ? 36.509 27.041 40.757 1.00 8.67  ? 199 THR B O   1 
ATOM   1266 C CB  . THR B 2 19  ? 37.958 27.927 38.014 1.00 14.52 ? 199 THR B CB  1 
ATOM   1267 O OG1 . THR B 2 19  ? 36.986 28.253 37.031 1.00 15.11 ? 199 THR B OG1 1 
ATOM   1268 C CG2 . THR B 2 19  ? 39.368 27.893 37.427 1.00 16.66 ? 199 THR B CG2 1 
ATOM   1269 N N   . ALA B 2 20  ? 38.773 27.150 40.633 1.00 16.72 ? 200 ALA B N   1 
ATOM   1270 C CA  . ALA B 2 20  ? 39.031 27.566 41.994 1.00 16.45 ? 200 ALA B CA  1 
ATOM   1271 C C   . ALA B 2 20  ? 38.466 28.969 42.001 1.00 14.73 ? 200 ALA B C   1 
ATOM   1272 O O   . ALA B 2 20  ? 38.366 29.592 40.958 1.00 14.86 ? 200 ALA B O   1 
ATOM   1273 C CB  . ALA B 2 20  ? 40.543 27.595 42.240 1.00 14.49 ? 200 ALA B CB  1 
ATOM   1274 N N   . PRO B 2 21  ? 38.082 29.488 43.167 1.00 15.90 ? 201 PRO B N   1 
ATOM   1275 C CA  . PRO B 2 21  ? 37.538 30.850 43.146 1.00 16.37 ? 201 PRO B CA  1 
ATOM   1276 C C   . PRO B 2 21  ? 38.522 31.971 42.764 1.00 17.63 ? 201 PRO B C   1 
ATOM   1277 O O   . PRO B 2 21  ? 39.678 32.006 43.211 1.00 17.40 ? 201 PRO B O   1 
ATOM   1278 C CB  . PRO B 2 21  ? 36.957 31.011 44.551 1.00 14.04 ? 201 PRO B CB  1 
ATOM   1279 C CG  . PRO B 2 21  ? 37.768 30.063 45.373 1.00 16.24 ? 201 PRO B CG  1 
ATOM   1280 C CD  . PRO B 2 21  ? 37.909 28.861 44.488 1.00 15.19 ? 201 PRO B CD  1 
ATOM   1281 N N   . GLY B 2 22  ? 38.046 32.872 41.908 1.00 18.27 ? 202 GLY B N   1 
ATOM   1282 C CA  . GLY B 2 22  ? 38.852 33.992 41.481 1.00 18.32 ? 202 GLY B CA  1 
ATOM   1283 C C   . GLY B 2 22  ? 39.572 33.799 40.168 1.00 20.28 ? 202 GLY B C   1 
ATOM   1284 O O   . GLY B 2 22  ? 39.947 34.776 39.523 1.00 22.49 ? 202 GLY B O   1 
ATOM   1285 N N   . TYR B 2 23  ? 39.778 32.549 39.767 1.00 20.93 ? 203 TYR B N   1 
ATOM   1286 C CA  . TYR B 2 23  ? 40.482 32.244 38.520 1.00 19.88 ? 203 TYR B CA  1 
ATOM   1287 C C   . TYR B 2 23  ? 39.612 32.250 37.255 1.00 21.40 ? 203 TYR B C   1 
ATOM   1288 O O   . TYR B 2 23  ? 38.368 32.407 37.308 1.00 24.30 ? 203 TYR B O   1 
ATOM   1289 C CB  . TYR B 2 23  ? 41.181 30.882 38.638 1.00 19.55 ? 203 TYR B CB  1 
ATOM   1290 C CG  . TYR B 2 23  ? 42.441 30.873 39.497 1.00 20.40 ? 203 TYR B CG  1 
ATOM   1291 C CD1 . TYR B 2 23  ? 42.375 30.822 40.902 1.00 19.24 ? 203 TYR B CD1 1 
ATOM   1292 C CD2 . TYR B 2 23  ? 43.698 30.978 38.904 1.00 19.95 ? 203 TYR B CD2 1 
ATOM   1293 C CE1 . TYR B 2 23  ? 43.541 30.880 41.687 1.00 18.85 ? 203 TYR B CE1 1 
ATOM   1294 C CE2 . TYR B 2 23  ? 44.861 31.048 39.674 1.00 20.70 ? 203 TYR B CE2 1 
ATOM   1295 C CZ  . TYR B 2 23  ? 44.785 31.000 41.061 1.00 20.54 ? 203 TYR B CZ  1 
ATOM   1296 O OH  . TYR B 2 23  ? 45.961 31.079 41.788 1.00 19.06 ? 203 TYR B OH  1 
ATOM   1297 N N   . TYR B 2 24  ? 40.287 32.087 36.117 1.00 19.20 ? 204 TYR B N   1 
ATOM   1298 C CA  . TYR B 2 24  ? 39.634 32.013 34.809 1.00 16.75 ? 204 TYR B CA  1 
ATOM   1299 C C   . TYR B 2 24  ? 39.117 30.603 34.622 1.00 12.15 ? 204 TYR B C   1 
ATOM   1300 O O   . TYR B 2 24  ? 39.587 29.696 35.277 1.00 11.02 ? 204 TYR B O   1 
ATOM   1301 C CB  . TYR B 2 24  ? 40.630 32.312 33.678 1.00 21.74 ? 204 TYR B CB  1 
ATOM   1302 C CG  . TYR B 2 24  ? 40.646 33.751 33.203 1.00 26.58 ? 204 TYR B CG  1 
ATOM   1303 C CD1 . TYR B 2 24  ? 39.524 34.324 32.600 1.00 27.77 ? 204 TYR B CD1 1 
ATOM   1304 C CD2 . TYR B 2 24  ? 41.788 34.540 33.358 1.00 30.46 ? 204 TYR B CD2 1 
ATOM   1305 C CE1 . TYR B 2 24  ? 39.539 35.655 32.158 1.00 31.34 ? 204 TYR B CE1 1 
ATOM   1306 C CE2 . TYR B 2 24  ? 41.821 35.879 32.922 1.00 31.94 ? 204 TYR B CE2 1 
ATOM   1307 C CZ  . TYR B 2 24  ? 40.699 36.430 32.322 1.00 33.25 ? 204 TYR B CZ  1 
ATOM   1308 O OH  . TYR B 2 24  ? 40.753 37.731 31.865 1.00 32.86 ? 204 TYR B OH  1 
ATOM   1309 N N   . SER B 2 25  ? 38.152 30.420 33.730 1.00 10.25 ? 205 SER B N   1 
ATOM   1310 C CA  . SER B 2 25  ? 37.618 29.092 33.449 1.00 8.81  ? 205 SER B CA  1 
ATOM   1311 C C   . SER B 2 25  ? 37.759 28.857 31.964 1.00 11.30 ? 205 SER B C   1 
ATOM   1312 O O   . SER B 2 25  ? 36.997 29.406 31.176 1.00 12.66 ? 205 SER B O   1 
ATOM   1313 C CB  . SER B 2 25  ? 36.155 28.985 33.849 1.00 7.02  ? 205 SER B CB  1 
ATOM   1314 O OG  . SER B 2 25  ? 35.644 27.714 33.520 1.00 7.23  ? 205 SER B OG  1 
ATOM   1315 N N   . TRP B 2 26  ? 38.744 28.038 31.595 1.00 13.16 ? 206 TRP B N   1 
ATOM   1316 C CA  . TRP B 2 26  ? 39.057 27.721 30.208 1.00 13.39 ? 206 TRP B CA  1 
ATOM   1317 C C   . TRP B 2 26  ? 38.006 27.013 29.403 1.00 13.33 ? 206 TRP B C   1 
ATOM   1318 O O   . TRP B 2 26  ? 37.252 26.193 29.916 1.00 14.33 ? 206 TRP B O   1 
ATOM   1319 C CB  . TRP B 2 26  ? 40.369 26.964 30.145 1.00 14.65 ? 206 TRP B CB  1 
ATOM   1320 C CG  . TRP B 2 26  ? 41.482 27.851 30.525 1.00 18.06 ? 206 TRP B CG  1 
ATOM   1321 C CD1 . TRP B 2 26  ? 42.000 28.034 31.770 1.00 19.28 ? 206 TRP B CD1 1 
ATOM   1322 C CD2 . TRP B 2 26  ? 42.158 28.767 29.669 1.00 19.51 ? 206 TRP B CD2 1 
ATOM   1323 N NE1 . TRP B 2 26  ? 42.959 29.011 31.747 1.00 19.94 ? 206 TRP B NE1 1 
ATOM   1324 C CE2 . TRP B 2 26  ? 43.074 29.484 30.468 1.00 21.25 ? 206 TRP B CE2 1 
ATOM   1325 C CE3 . TRP B 2 26  ? 42.074 29.059 28.302 1.00 21.36 ? 206 TRP B CE3 1 
ATOM   1326 C CZ2 . TRP B 2 26  ? 43.908 30.487 29.944 1.00 23.31 ? 206 TRP B CZ2 1 
ATOM   1327 C CZ3 . TRP B 2 26  ? 42.902 30.057 27.781 1.00 24.29 ? 206 TRP B CZ3 1 
ATOM   1328 C CH2 . TRP B 2 26  ? 43.807 30.759 28.605 1.00 23.06 ? 206 TRP B CH2 1 
ATOM   1329 N N   . ARG B 2 27  ? 37.985 27.355 28.120 1.00 13.84 ? 207 ARG B N   1 
ATOM   1330 C CA  . ARG B 2 27  ? 37.026 26.849 27.141 1.00 16.08 ? 207 ARG B CA  1 
ATOM   1331 C C   . ARG B 2 27  ? 37.776 26.787 25.832 1.00 15.97 ? 207 ARG B C   1 
ATOM   1332 O O   . ARG B 2 27  ? 38.540 27.670 25.499 1.00 16.76 ? 207 ARG B O   1 
ATOM   1333 C CB  . ARG B 2 27  ? 35.858 27.844 27.026 1.00 20.42 ? 207 ARG B CB  1 
ATOM   1334 C CG  . ARG B 2 27  ? 34.574 27.327 26.414 1.00 25.58 ? 207 ARG B CG  1 
ATOM   1335 C CD  . ARG B 2 27  ? 33.495 28.417 26.401 1.00 31.55 ? 207 ARG B CD  1 
ATOM   1336 N NE  . ARG B 2 27  ? 33.794 29.479 25.439 1.00 35.45 ? 207 ARG B NE  1 
ATOM   1337 C CZ  . ARG B 2 27  ? 34.199 30.704 25.759 1.00 37.40 ? 207 ARG B CZ  1 
ATOM   1338 N NH1 . ARG B 2 27  ? 34.353 31.049 27.033 1.00 37.23 ? 207 ARG B NH1 1 
ATOM   1339 N NH2 . ARG B 2 27  ? 34.469 31.583 24.796 1.00 37.73 ? 207 ARG B NH2 1 
ATOM   1340 N N   . ASN B 2 28  ? 37.590 25.729 25.079 1.00 19.23 ? 208 ASN B N   1 
ATOM   1341 C CA  . ASN B 2 28  ? 38.300 25.640 23.813 1.00 21.52 ? 208 ASN B CA  1 
ATOM   1342 C C   . ASN B 2 28  ? 37.276 25.822 22.706 1.00 21.90 ? 208 ASN B C   1 
ATOM   1343 O O   . ASN B 2 28  ? 36.317 25.055 22.617 1.00 20.21 ? 208 ASN B O   1 
ATOM   1344 C CB  . ASN B 2 28  ? 39.032 24.290 23.727 1.00 20.23 ? 208 ASN B CB  1 
ATOM   1345 C CG  . ASN B 2 28  ? 39.334 23.873 22.309 1.00 19.74 ? 208 ASN B CG  1 
ATOM   1346 O OD1 . ASN B 2 28  ? 38.723 22.943 21.801 1.00 18.61 ? 208 ASN B OD1 1 
ATOM   1347 N ND2 . ASN B 2 28  ? 40.275 24.561 21.659 1.00 17.23 ? 208 ASN B ND2 1 
ATOM   1348 N N   . SER B 2 29  ? 37.483 26.850 21.881 1.00 23.93 ? 209 SER B N   1 
ATOM   1349 C CA  . SER B 2 29  ? 36.550 27.179 20.793 1.00 27.15 ? 209 SER B CA  1 
ATOM   1350 C C   . SER B 2 29  ? 35.973 26.006 19.986 1.00 28.54 ? 209 SER B C   1 
ATOM   1351 O O   . SER B 2 29  ? 34.850 26.095 19.477 1.00 29.09 ? 209 SER B O   1 
ATOM   1352 C CB  . SER B 2 29  ? 37.183 28.202 19.841 1.00 27.57 ? 209 SER B CB  1 
ATOM   1353 O OG  . SER B 2 29  ? 37.118 29.521 20.380 1.00 27.74 ? 209 SER B OG  1 
ATOM   1354 N N   . LYS B 2 30  ? 36.717 24.903 19.905 1.00 28.74 ? 210 LYS B N   1 
ATOM   1355 C CA  . LYS B 2 30  ? 36.288 23.728 19.156 1.00 28.79 ? 210 LYS B CA  1 
ATOM   1356 C C   . LYS B 2 30  ? 35.686 22.605 20.008 1.00 30.46 ? 210 LYS B C   1 
ATOM   1357 O O   . LYS B 2 30  ? 34.512 22.275 19.848 1.00 30.66 ? 210 LYS B O   1 
ATOM   1358 C CB  . LYS B 2 30  ? 37.473 23.174 18.358 0.00 28.92 ? 210 LYS B CB  1 
ATOM   1359 C CG  . LYS B 2 30  ? 37.182 21.892 17.596 0.00 28.42 ? 210 LYS B CG  1 
ATOM   1360 C CD  . LYS B 2 30  ? 38.431 21.382 16.895 0.00 28.30 ? 210 LYS B CD  1 
ATOM   1361 C CE  . LYS B 2 30  ? 38.171 20.073 16.171 0.00 28.28 ? 210 LYS B CE  1 
ATOM   1362 N NZ  . LYS B 2 30  ? 39.400 19.562 15.502 0.00 28.22 ? 210 LYS B NZ  1 
ATOM   1363 N N   . ASP B 2 31  ? 36.494 22.036 20.914 1.00 31.26 ? 211 ASP B N   1 
ATOM   1364 C CA  . ASP B 2 31  ? 36.115 20.912 21.785 1.00 28.61 ? 211 ASP B CA  1 
ATOM   1365 C C   . ASP B 2 31  ? 35.211 21.187 22.972 1.00 27.64 ? 211 ASP B C   1 
ATOM   1366 O O   . ASP B 2 31  ? 34.721 20.252 23.593 1.00 29.13 ? 211 ASP B O   1 
ATOM   1367 C CB  . ASP B 2 31  ? 37.367 20.242 22.333 1.00 30.38 ? 211 ASP B CB  1 
ATOM   1368 C CG  . ASP B 2 31  ? 38.395 19.951 21.262 1.00 32.63 ? 211 ASP B CG  1 
ATOM   1369 O OD1 . ASP B 2 31  ? 38.112 19.123 20.367 1.00 33.16 ? 211 ASP B OD1 1 
ATOM   1370 O OD2 . ASP B 2 31  ? 39.496 20.550 21.319 1.00 31.64 ? 211 ASP B OD2 1 
ATOM   1371 N N   . GLY B 2 32  ? 35.011 22.452 23.313 1.00 27.31 ? 212 GLY B N   1 
ATOM   1372 C CA  . GLY B 2 32  ? 34.176 22.787 24.454 1.00 24.18 ? 212 GLY B CA  1 
ATOM   1373 C C   . GLY B 2 32  ? 35.045 23.201 25.629 1.00 21.94 ? 212 GLY B C   1 
ATOM   1374 O O   . GLY B 2 32  ? 36.257 23.374 25.491 1.00 22.67 ? 212 GLY B O   1 
ATOM   1375 N N   . SER B 2 33  ? 34.433 23.353 26.792 1.00 18.01 ? 213 SER B N   1 
ATOM   1376 C CA  . SER B 2 33  ? 35.166 23.757 27.977 1.00 16.36 ? 213 SER B CA  1 
ATOM   1377 C C   . SER B 2 33  ? 35.900 22.564 28.574 1.00 17.08 ? 213 SER B C   1 
ATOM   1378 O O   . SER B 2 33  ? 35.462 21.435 28.434 1.00 18.24 ? 213 SER B O   1 
ATOM   1379 C CB  . SER B 2 33  ? 34.201 24.340 29.016 1.00 17.09 ? 213 SER B CB  1 
ATOM   1380 O OG  . SER B 2 33  ? 33.405 23.329 29.611 1.00 16.64 ? 213 SER B OG  1 
ATOM   1381 N N   . TRP B 2 34  ? 37.023 22.813 29.234 1.00 15.59 ? 214 TRP B N   1 
ATOM   1382 C CA  . TRP B 2 34  ? 37.775 21.750 29.869 1.00 13.12 ? 214 TRP B CA  1 
ATOM   1383 C C   . TRP B 2 34  ? 36.868 21.020 30.845 1.00 13.02 ? 214 TRP B C   1 
ATOM   1384 O O   . TRP B 2 34  ? 36.731 19.806 30.784 1.00 12.56 ? 214 TRP B O   1 
ATOM   1385 C CB  . TRP B 2 34  ? 38.964 22.351 30.602 1.00 12.65 ? 214 TRP B CB  1 
ATOM   1386 C CG  . TRP B 2 34  ? 39.876 23.033 29.660 1.00 14.52 ? 214 TRP B CG  1 
ATOM   1387 C CD1 . TRP B 2 34  ? 39.628 23.308 28.351 1.00 12.27 ? 214 TRP B CD1 1 
ATOM   1388 C CD2 . TRP B 2 34  ? 41.208 23.509 29.923 1.00 15.88 ? 214 TRP B CD2 1 
ATOM   1389 N NE1 . TRP B 2 34  ? 40.714 23.913 27.785 1.00 15.93 ? 214 TRP B NE1 1 
ATOM   1390 C CE2 . TRP B 2 34  ? 41.700 24.044 28.727 1.00 15.05 ? 214 TRP B CE2 1 
ATOM   1391 C CE3 . TRP B 2 34  ? 42.027 23.534 31.065 1.00 17.92 ? 214 TRP B CE3 1 
ATOM   1392 C CZ2 . TRP B 2 34  ? 42.977 24.595 28.623 1.00 15.52 ? 214 TRP B CZ2 1 
ATOM   1393 C CZ3 . TRP B 2 34  ? 43.302 24.093 30.958 1.00 17.89 ? 214 TRP B CZ3 1 
ATOM   1394 C CH2 . TRP B 2 34  ? 43.758 24.610 29.744 1.00 15.42 ? 214 TRP B CH2 1 
ATOM   1395 N N   . PHE B 2 35  ? 36.230 21.778 31.731 1.00 12.80 ? 215 PHE B N   1 
ATOM   1396 C CA  . PHE B 2 35  ? 35.337 21.215 32.731 1.00 13.07 ? 215 PHE B CA  1 
ATOM   1397 C C   . PHE B 2 35  ? 34.227 20.277 32.229 1.00 12.98 ? 215 PHE B C   1 
ATOM   1398 O O   . PHE B 2 35  ? 34.186 19.112 32.589 1.00 12.01 ? 215 PHE B O   1 
ATOM   1399 C CB  . PHE B 2 35  ? 34.690 22.333 33.547 1.00 10.53 ? 215 PHE B CB  1 
ATOM   1400 C CG  . PHE B 2 35  ? 33.916 21.826 34.731 1.00 9.82  ? 215 PHE B CG  1 
ATOM   1401 C CD1 . PHE B 2 35  ? 34.528 20.944 35.651 1.00 9.75  ? 215 PHE B CD1 1 
ATOM   1402 C CD2 . PHE B 2 35  ? 32.584 22.188 34.924 1.00 9.35  ? 215 PHE B CD2 1 
ATOM   1403 C CE1 . PHE B 2 35  ? 33.816 20.424 36.742 1.00 9.22  ? 215 PHE B CE1 1 
ATOM   1404 C CE2 . PHE B 2 35  ? 31.836 21.669 36.032 1.00 10.21 ? 215 PHE B CE2 1 
ATOM   1405 C CZ  . PHE B 2 35  ? 32.457 20.785 36.937 1.00 9.28  ? 215 PHE B CZ  1 
ATOM   1406 N N   . ILE B 2 36  ? 33.320 20.804 31.411 1.00 13.85 ? 216 ILE B N   1 
ATOM   1407 C CA  . ILE B 2 36  ? 32.199 20.026 30.883 1.00 13.08 ? 216 ILE B CA  1 
ATOM   1408 C C   . ILE B 2 36  ? 32.641 18.888 29.946 1.00 13.79 ? 216 ILE B C   1 
ATOM   1409 O O   . ILE B 2 36  ? 31.941 17.881 29.752 1.00 13.36 ? 216 ILE B O   1 
ATOM   1410 C CB  . ILE B 2 36  ? 31.202 20.948 30.169 1.00 7.94  ? 216 ILE B CB  1 
ATOM   1411 C CG1 . ILE B 2 36  ? 30.768 22.080 31.111 1.00 10.08 ? 216 ILE B CG1 1 
ATOM   1412 C CG2 . ILE B 2 36  ? 30.017 20.158 29.720 1.00 9.43  ? 216 ILE B CG2 1 
ATOM   1413 C CD1 . ILE B 2 36  ? 30.220 21.666 32.469 1.00 5.12  ? 216 ILE B CD1 1 
ATOM   1414 N N   . GLN B 2 37  ? 33.818 19.048 29.372 1.00 12.00 ? 217 GLN B N   1 
ATOM   1415 C CA  . GLN B 2 37  ? 34.327 18.031 28.504 1.00 12.04 ? 217 GLN B CA  1 
ATOM   1416 C C   . GLN B 2 37  ? 34.661 16.908 29.464 1.00 13.64 ? 217 GLN B C   1 
ATOM   1417 O O   . GLN B 2 37  ? 34.128 15.810 29.354 1.00 14.22 ? 217 GLN B O   1 
ATOM   1418 C CB  . GLN B 2 37  ? 35.556 18.551 27.800 1.00 13.37 ? 217 GLN B CB  1 
ATOM   1419 C CG  . GLN B 2 37  ? 36.087 17.679 26.713 1.00 18.13 ? 217 GLN B CG  1 
ATOM   1420 C CD  . GLN B 2 37  ? 37.253 18.333 25.996 1.00 21.77 ? 217 GLN B CD  1 
ATOM   1421 O OE1 . GLN B 2 37  ? 38.102 17.642 25.415 1.00 23.22 ? 217 GLN B OE1 1 
ATOM   1422 N NE2 . GLN B 2 37  ? 37.300 19.674 26.024 1.00 20.41 ? 217 GLN B NE2 1 
ATOM   1423 N N   . SER B 2 38  ? 35.511 17.213 30.441 1.00 14.70 ? 218 SER B N   1 
ATOM   1424 C CA  . SER B 2 38  ? 35.926 16.247 31.462 1.00 13.39 ? 218 SER B CA  1 
ATOM   1425 C C   . SER B 2 38  ? 34.807 15.745 32.370 1.00 12.68 ? 218 SER B C   1 
ATOM   1426 O O   . SER B 2 38  ? 34.890 14.635 32.864 1.00 14.30 ? 218 SER B O   1 
ATOM   1427 C CB  . SER B 2 38  ? 37.022 16.849 32.315 1.00 12.14 ? 218 SER B CB  1 
ATOM   1428 O OG  . SER B 2 38  ? 38.043 17.337 31.474 1.00 15.98 ? 218 SER B OG  1 
ATOM   1429 N N   . LEU B 2 39  ? 33.769 16.551 32.592 1.00 11.37 ? 219 LEU B N   1 
ATOM   1430 C CA  . LEU B 2 39  ? 32.658 16.124 33.424 1.00 12.40 ? 219 LEU B CA  1 
ATOM   1431 C C   . LEU B 2 39  ? 31.834 15.044 32.724 1.00 14.21 ? 219 LEU B C   1 
ATOM   1432 O O   . LEU B 2 39  ? 31.426 14.056 33.342 1.00 16.41 ? 219 LEU B O   1 
ATOM   1433 C CB  . LEU B 2 39  ? 31.739 17.295 33.771 1.00 10.79 ? 219 LEU B CB  1 
ATOM   1434 C CG  . LEU B 2 39  ? 30.494 16.889 34.591 1.00 8.60  ? 219 LEU B CG  1 
ATOM   1435 C CD1 . LEU B 2 39  ? 30.895 16.482 36.006 1.00 5.40  ? 219 LEU B CD1 1 
ATOM   1436 C CD2 . LEU B 2 39  ? 29.483 18.030 34.605 1.00 7.69  ? 219 LEU B CD2 1 
ATOM   1437 N N   . CYS B 2 40  ? 31.584 15.235 31.436 1.00 13.94 ? 220 CYS B N   1 
ATOM   1438 C CA  . CYS B 2 40  ? 30.816 14.275 30.659 1.00 11.99 ? 220 CYS B CA  1 
ATOM   1439 C C   . CYS B 2 40  ? 31.612 12.975 30.448 1.00 12.09 ? 220 CYS B C   1 
ATOM   1440 O O   . CYS B 2 40  ? 31.053 11.887 30.441 1.00 11.98 ? 220 CYS B O   1 
ATOM   1441 C CB  . CYS B 2 40  ? 30.431 14.914 29.321 1.00 13.59 ? 220 CYS B CB  1 
ATOM   1442 S SG  . CYS B 2 40  ? 29.278 16.312 29.463 1.00 12.44 ? 220 CYS B SG  1 
ATOM   1443 N N   . ALA B 2 41  ? 32.922 13.095 30.291 1.00 10.83 ? 221 ALA B N   1 
ATOM   1444 C CA  . ALA B 2 41  ? 33.769 11.934 30.117 1.00 12.28 ? 221 ALA B CA  1 
ATOM   1445 C C   . ALA B 2 41  ? 33.640 11.033 31.351 1.00 14.29 ? 221 ALA B C   1 
ATOM   1446 O O   . ALA B 2 41  ? 33.289 9.844  31.258 1.00 14.64 ? 221 ALA B O   1 
ATOM   1447 C CB  . ALA B 2 41  ? 35.209 12.367 29.933 1.00 10.62 ? 221 ALA B CB  1 
ATOM   1448 N N   . MET B 2 42  ? 33.916 11.610 32.511 1.00 14.23 ? 222 MET B N   1 
ATOM   1449 C CA  . MET B 2 42  ? 33.824 10.881 33.762 1.00 13.81 ? 222 MET B CA  1 
ATOM   1450 C C   . MET B 2 42  ? 32.433 10.358 34.088 1.00 12.62 ? 222 MET B C   1 
ATOM   1451 O O   . MET B 2 42  ? 32.301 9.235  34.562 1.00 10.22 ? 222 MET B O   1 
ATOM   1452 C CB  . MET B 2 42  ? 34.320 11.755 34.902 1.00 15.42 ? 222 MET B CB  1 
ATOM   1453 C CG  . MET B 2 42  ? 35.682 11.357 35.411 1.00 16.25 ? 222 MET B CG  1 
ATOM   1454 S SD  . MET B 2 42  ? 36.950 11.306 34.152 1.00 20.66 ? 222 MET B SD  1 
ATOM   1455 C CE  . MET B 2 42  ? 36.839 9.650  33.603 1.00 14.35 ? 222 MET B CE  1 
ATOM   1456 N N   . LEU B 2 43  ? 31.397 11.152 33.843 1.00 11.63 ? 223 LEU B N   1 
ATOM   1457 C CA  . LEU B 2 43  ? 30.049 10.688 34.144 1.00 13.30 ? 223 LEU B CA  1 
ATOM   1458 C C   . LEU B 2 43  ? 29.728 9.405  33.383 1.00 16.32 ? 223 LEU B C   1 
ATOM   1459 O O   . LEU B 2 43  ? 29.333 8.411  33.981 1.00 18.48 ? 223 LEU B O   1 
ATOM   1460 C CB  . LEU B 2 43  ? 28.994 11.753 33.819 1.00 10.90 ? 223 LEU B CB  1 
ATOM   1461 C CG  . LEU B 2 43  ? 28.819 12.992 34.710 1.00 10.28 ? 223 LEU B CG  1 
ATOM   1462 C CD1 . LEU B 2 43  ? 27.641 13.771 34.238 1.00 7.43  ? 223 LEU B CD1 1 
ATOM   1463 C CD2 . LEU B 2 43  ? 28.627 12.602 36.154 1.00 11.97 ? 223 LEU B CD2 1 
ATOM   1464 N N   . LYS B 2 44  ? 29.914 9.403  32.068 1.00 17.08 ? 224 LYS B N   1 
ATOM   1465 C CA  . LYS B 2 44  ? 29.605 8.200  31.293 1.00 16.50 ? 224 LYS B CA  1 
ATOM   1466 C C   . LYS B 2 44  ? 30.483 6.996  31.637 1.00 13.43 ? 224 LYS B C   1 
ATOM   1467 O O   . LYS B 2 44  ? 30.057 5.854  31.540 1.00 12.56 ? 224 LYS B O   1 
ATOM   1468 C CB  . LYS B 2 44  ? 29.669 8.489  29.774 1.00 18.80 ? 224 LYS B CB  1 
ATOM   1469 C CG  . LYS B 2 44  ? 31.035 8.752  29.201 1.00 18.92 ? 224 LYS B CG  1 
ATOM   1470 C CD  . LYS B 2 44  ? 30.985 9.065  27.711 0.00 20.30 ? 224 LYS B CD  1 
ATOM   1471 C CE  . LYS B 2 44  ? 30.358 10.427 27.429 0.00 20.95 ? 224 LYS B CE  1 
ATOM   1472 N NZ  . LYS B 2 44  ? 28.925 10.507 27.823 0.00 21.44 ? 224 LYS B NZ  1 
ATOM   1473 N N   . GLN B 2 45  ? 31.707 7.253  32.050 1.00 13.32 ? 225 GLN B N   1 
ATOM   1474 C CA  . GLN B 2 45  ? 32.607 6.170  32.393 1.00 14.70 ? 225 GLN B CA  1 
ATOM   1475 C C   . GLN B 2 45  ? 32.437 5.618  33.807 1.00 13.09 ? 225 GLN B C   1 
ATOM   1476 O O   . GLN B 2 45  ? 32.919 4.541  34.096 1.00 9.71  ? 225 GLN B O   1 
ATOM   1477 C CB  . GLN B 2 45  ? 34.056 6.627  32.186 1.00 16.50 ? 225 GLN B CB  1 
ATOM   1478 C CG  . GLN B 2 45  ? 35.085 5.696  32.784 1.00 20.89 ? 225 GLN B CG  1 
ATOM   1479 C CD  . GLN B 2 45  ? 36.459 5.855  32.172 1.00 24.14 ? 225 GLN B CD  1 
ATOM   1480 O OE1 . GLN B 2 45  ? 36.947 4.952  31.484 1.00 27.55 ? 225 GLN B OE1 1 
ATOM   1481 N NE2 . GLN B 2 45  ? 37.098 7.003  32.413 1.00 26.44 ? 225 GLN B NE2 1 
ATOM   1482 N N   . TYR B 2 46  ? 31.749 6.346  34.684 1.00 14.08 ? 226 TYR B N   1 
ATOM   1483 C CA  . TYR B 2 46  ? 31.595 5.899  36.064 1.00 14.48 ? 226 TYR B CA  1 
ATOM   1484 C C   . TYR B 2 46  ? 30.280 6.194  36.726 1.00 15.10 ? 226 TYR B C   1 
ATOM   1485 O O   . TYR B 2 46  ? 30.061 5.752  37.839 1.00 16.46 ? 226 TYR B O   1 
ATOM   1486 C CB  . TYR B 2 46  ? 32.645 6.528  36.954 1.00 13.52 ? 226 TYR B CB  1 
ATOM   1487 C CG  . TYR B 2 46  ? 34.052 6.288  36.530 1.00 14.65 ? 226 TYR B CG  1 
ATOM   1488 C CD1 . TYR B 2 46  ? 34.668 5.057  36.769 1.00 16.06 ? 226 TYR B CD1 1 
ATOM   1489 C CD2 . TYR B 2 46  ? 34.795 7.295  35.928 1.00 13.13 ? 226 TYR B CD2 1 
ATOM   1490 C CE1 . TYR B 2 46  ? 35.982 4.837  36.429 1.00 13.03 ? 226 TYR B CE1 1 
ATOM   1491 C CE2 . TYR B 2 46  ? 36.105 7.082  35.588 1.00 16.18 ? 226 TYR B CE2 1 
ATOM   1492 C CZ  . TYR B 2 46  ? 36.692 5.839  35.843 1.00 15.71 ? 226 TYR B CZ  1 
ATOM   1493 O OH  . TYR B 2 46  ? 37.987 5.590  35.476 1.00 21.44 ? 226 TYR B OH  1 
ATOM   1494 N N   . ALA B 2 47  ? 29.406 6.955  36.099 1.00 15.08 ? 227 ALA B N   1 
ATOM   1495 C CA  . ALA B 2 47  ? 28.142 7.234  36.765 1.00 16.93 ? 227 ALA B CA  1 
ATOM   1496 C C   . ALA B 2 47  ? 27.517 5.959  37.350 1.00 16.31 ? 227 ALA B C   1 
ATOM   1497 O O   . ALA B 2 47  ? 26.733 6.020  38.298 1.00 19.24 ? 227 ALA B O   1 
ATOM   1498 C CB  . ALA B 2 47  ? 27.162 7.919  35.803 1.00 16.58 ? 227 ALA B CB  1 
ATOM   1499 N N   . ASP B 2 48  ? 27.877 4.807  36.803 1.00 15.36 ? 228 ASP B N   1 
ATOM   1500 C CA  . ASP B 2 48  ? 27.326 3.534  37.280 1.00 15.73 ? 228 ASP B CA  1 
ATOM   1501 C C   . ASP B 2 48  ? 28.368 2.719  38.048 1.00 16.53 ? 228 ASP B C   1 
ATOM   1502 O O   . ASP B 2 48  ? 28.265 1.511  38.158 1.00 15.19 ? 228 ASP B O   1 
ATOM   1503 C CB  . ASP B 2 48  ? 26.787 2.714  36.089 1.00 15.04 ? 228 ASP B CB  1 
ATOM   1504 C CG  . ASP B 2 48  ? 27.901 2.215  35.144 1.00 14.70 ? 228 ASP B CG  1 
ATOM   1505 O OD1 . ASP B 2 48  ? 29.078 2.622  35.300 1.00 14.45 ? 228 ASP B OD1 1 
ATOM   1506 O OD2 . ASP B 2 48  ? 27.589 1.416  34.235 1.00 11.97 ? 228 ASP B OD2 1 
ATOM   1507 N N   . LYS B 2 49  ? 29.372 3.399  38.585 1.00 17.79 ? 229 LYS B N   1 
ATOM   1508 C CA  . LYS B 2 49  ? 30.434 2.743  39.329 1.00 16.70 ? 229 LYS B CA  1 
ATOM   1509 C C   . LYS B 2 49  ? 30.792 3.493  40.619 1.00 15.79 ? 229 LYS B C   1 
ATOM   1510 O O   . LYS B 2 49  ? 30.797 2.924  41.695 1.00 14.78 ? 229 LYS B O   1 
ATOM   1511 C CB  . LYS B 2 49  ? 31.666 2.630  38.436 1.00 17.75 ? 229 LYS B CB  1 
ATOM   1512 C CG  . LYS B 2 49  ? 31.398 2.062  37.049 1.00 19.12 ? 229 LYS B CG  1 
ATOM   1513 C CD  . LYS B 2 49  ? 32.707 1.761  36.331 1.00 21.02 ? 229 LYS B CD  1 
ATOM   1514 C CE  . LYS B 2 49  ? 32.485 1.209  34.950 1.00 21.38 ? 229 LYS B CE  1 
ATOM   1515 N NZ  . LYS B 2 49  ? 31.598 2.102  34.156 1.00 24.71 ? 229 LYS B NZ  1 
ATOM   1516 N N   . LEU B 2 50  ? 31.075 4.784  40.486 1.00 17.33 ? 230 LEU B N   1 
ATOM   1517 C CA  . LEU B 2 50  ? 31.456 5.650  41.600 1.00 16.45 ? 230 LEU B CA  1 
ATOM   1518 C C   . LEU B 2 50  ? 30.348 6.537  42.175 1.00 17.89 ? 230 LEU B C   1 
ATOM   1519 O O   . LEU B 2 50  ? 29.339 6.808  41.512 1.00 19.81 ? 230 LEU B O   1 
ATOM   1520 C CB  . LEU B 2 50  ? 32.588 6.553  41.154 1.00 11.73 ? 230 LEU B CB  1 
ATOM   1521 C CG  . LEU B 2 50  ? 33.742 5.827  40.495 1.00 11.55 ? 230 LEU B CG  1 
ATOM   1522 C CD1 . LEU B 2 50  ? 34.811 6.831  40.117 1.00 10.09 ? 230 LEU B CD1 1 
ATOM   1523 C CD2 . LEU B 2 50  ? 34.296 4.770  41.462 1.00 13.13 ? 230 LEU B CD2 1 
ATOM   1524 N N   . GLU B 2 51  ? 30.566 6.980  43.417 1.00 17.09 ? 231 GLU B N   1 
ATOM   1525 C CA  . GLU B 2 51  ? 29.664 7.878  44.130 1.00 14.81 ? 231 GLU B CA  1 
ATOM   1526 C C   . GLU B 2 51  ? 29.988 9.227  43.500 1.00 14.02 ? 231 GLU B C   1 
ATOM   1527 O O   . GLU B 2 51  ? 31.122 9.458  43.104 1.00 14.22 ? 231 GLU B O   1 
ATOM   1528 C CB  . GLU B 2 51  ? 30.004 7.865  45.630 1.00 14.62 ? 231 GLU B CB  1 
ATOM   1529 C CG  . GLU B 2 51  ? 29.093 8.682  46.557 1.00 13.36 ? 231 GLU B CG  1 
ATOM   1530 C CD  . GLU B 2 51  ? 29.520 10.131 46.662 1.00 14.44 ? 231 GLU B CD  1 
ATOM   1531 O OE1 . GLU B 2 51  ? 30.739 10.375 46.720 1.00 12.76 ? 231 GLU B OE1 1 
ATOM   1532 O OE2 . GLU B 2 51  ? 28.654 11.025 46.701 1.00 14.63 ? 231 GLU B OE2 1 
ATOM   1533 N N   . PHE B 2 52  ? 29.015 10.124 43.409 1.00 14.28 ? 232 PHE B N   1 
ATOM   1534 C CA  . PHE B 2 52  ? 29.273 11.408 42.762 1.00 15.65 ? 232 PHE B CA  1 
ATOM   1535 C C   . PHE B 2 52  ? 30.553 12.145 43.092 1.00 14.53 ? 232 PHE B C   1 
ATOM   1536 O O   . PHE B 2 52  ? 31.251 12.545 42.183 1.00 16.90 ? 232 PHE B O   1 
ATOM   1537 C CB  . PHE B 2 52  ? 28.110 12.374 42.945 1.00 17.64 ? 232 PHE B CB  1 
ATOM   1538 C CG  . PHE B 2 52  ? 28.111 13.493 41.953 1.00 17.13 ? 232 PHE B CG  1 
ATOM   1539 C CD1 . PHE B 2 52  ? 28.580 13.283 40.660 1.00 19.04 ? 232 PHE B CD1 1 
ATOM   1540 C CD2 . PHE B 2 52  ? 27.591 14.729 42.280 1.00 18.77 ? 232 PHE B CD2 1 
ATOM   1541 C CE1 . PHE B 2 52  ? 28.527 14.281 39.708 1.00 17.40 ? 232 PHE B CE1 1 
ATOM   1542 C CE2 . PHE B 2 52  ? 27.531 15.745 41.326 1.00 19.06 ? 232 PHE B CE2 1 
ATOM   1543 C CZ  . PHE B 2 52  ? 27.999 15.513 40.041 1.00 19.00 ? 232 PHE B CZ  1 
ATOM   1544 N N   . MET B 2 53  ? 30.863 12.341 44.368 1.00 13.47 ? 233 MET B N   1 
ATOM   1545 C CA  . MET B 2 53  ? 32.086 13.057 44.729 1.00 13.21 ? 233 MET B CA  1 
ATOM   1546 C C   . MET B 2 53  ? 33.352 12.315 44.234 1.00 12.66 ? 233 MET B C   1 
ATOM   1547 O O   . MET B 2 53  ? 34.367 12.942 43.908 1.00 10.00 ? 233 MET B O   1 
ATOM   1548 C CB  . MET B 2 53  ? 32.146 13.304 46.251 1.00 13.37 ? 233 MET B CB  1 
ATOM   1549 C CG  . MET B 2 53  ? 31.032 14.158 46.827 1.00 17.34 ? 233 MET B CG  1 
ATOM   1550 S SD  . MET B 2 53  ? 30.841 15.864 46.150 1.00 24.26 ? 233 MET B SD  1 
ATOM   1551 C CE  . MET B 2 53  ? 32.074 16.738 47.165 1.00 23.69 ? 233 MET B CE  1 
ATOM   1552 N N   . HIS B 2 54  ? 33.308 10.990 44.165 1.00 11.55 ? 234 HIS B N   1 
ATOM   1553 C CA  . HIS B 2 54  ? 34.477 10.296 43.658 1.00 14.24 ? 234 HIS B CA  1 
ATOM   1554 C C   . HIS B 2 54  ? 34.602 10.535 42.147 1.00 14.36 ? 234 HIS B C   1 
ATOM   1555 O O   . HIS B 2 54  ? 35.714 10.635 41.598 1.00 13.45 ? 234 HIS B O   1 
ATOM   1556 C CB  . HIS B 2 54  ? 34.420 8.820  44.024 1.00 13.31 ? 234 HIS B CB  1 
ATOM   1557 C CG  . HIS B 2 54  ? 34.708 8.576  45.472 1.00 17.74 ? 234 HIS B CG  1 
ATOM   1558 N ND1 . HIS B 2 54  ? 34.525 7.356  46.081 1.00 19.22 ? 234 HIS B ND1 1 
ATOM   1559 C CD2 . HIS B 2 54  ? 35.166 9.412  46.433 1.00 18.76 ? 234 HIS B CD2 1 
ATOM   1560 C CE1 . HIS B 2 54  ? 34.855 7.451  47.357 1.00 17.28 ? 234 HIS B CE1 1 
ATOM   1561 N NE2 . HIS B 2 54  ? 35.247 8.689  47.597 1.00 18.58 ? 234 HIS B NE2 1 
ATOM   1562 N N   . ILE B 2 55  ? 33.457 10.661 41.483 1.00 12.17 ? 235 ILE B N   1 
ATOM   1563 C CA  . ILE B 2 55  ? 33.456 10.953 40.059 1.00 11.55 ? 235 ILE B CA  1 
ATOM   1564 C C   . ILE B 2 55  ? 34.095 12.341 39.840 1.00 11.84 ? 235 ILE B C   1 
ATOM   1565 O O   . ILE B 2 55  ? 35.113 12.470 39.158 1.00 9.94  ? 235 ILE B O   1 
ATOM   1566 C CB  . ILE B 2 55  ? 32.017 10.931 39.492 1.00 8.64  ? 235 ILE B CB  1 
ATOM   1567 C CG1 . ILE B 2 55  ? 31.475 9.497  39.532 1.00 10.97 ? 235 ILE B CG1 1 
ATOM   1568 C CG2 . ILE B 2 55  ? 32.012 11.461 38.086 1.00 7.58  ? 235 ILE B CG2 1 
ATOM   1569 C CD1 . ILE B 2 55  ? 29.957 9.344  39.251 1.00 13.82 ? 235 ILE B CD1 1 
ATOM   1570 N N   . LEU B 2 56  ? 33.499 13.363 40.447 1.00 11.12 ? 236 LEU B N   1 
ATOM   1571 C CA  . LEU B 2 56  ? 33.984 14.727 40.338 1.00 11.93 ? 236 LEU B CA  1 
ATOM   1572 C C   . LEU B 2 56  ? 35.471 14.882 40.694 1.00 13.44 ? 236 LEU B C   1 
ATOM   1573 O O   . LEU B 2 56  ? 36.105 15.826 40.273 1.00 15.93 ? 236 LEU B O   1 
ATOM   1574 C CB  . LEU B 2 56  ? 33.142 15.648 41.220 1.00 11.36 ? 236 LEU B CB  1 
ATOM   1575 C CG  . LEU B 2 56  ? 31.654 15.868 40.921 1.00 10.82 ? 236 LEU B CG  1 
ATOM   1576 C CD1 . LEU B 2 56  ? 31.067 16.652 42.066 1.00 7.50  ? 236 LEU B CD1 1 
ATOM   1577 C CD2 . LEU B 2 56  ? 31.446 16.595 39.609 1.00 5.97  ? 236 LEU B CD2 1 
ATOM   1578 N N   . THR B 2 57  ? 36.017 13.958 41.476 1.00 11.81 ? 237 THR B N   1 
ATOM   1579 C CA  . THR B 2 57  ? 37.420 14.013 41.853 1.00 10.27 ? 237 THR B CA  1 
ATOM   1580 C C   . THR B 2 57  ? 38.300 13.495 40.717 1.00 12.23 ? 237 THR B C   1 
ATOM   1581 O O   . THR B 2 57  ? 39.461 13.865 40.596 1.00 11.71 ? 237 THR B O   1 
ATOM   1582 C CB  . THR B 2 57  ? 37.643 13.189 43.110 1.00 9.67  ? 237 THR B CB  1 
ATOM   1583 O OG1 . THR B 2 57  ? 36.859 13.765 44.161 1.00 8.45  ? 237 THR B OG1 1 
ATOM   1584 C CG2 . THR B 2 57  ? 39.137 13.141 43.503 1.00 2.94  ? 237 THR B CG2 1 
ATOM   1585 N N   . ARG B 2 58  ? 37.738 12.608 39.904 1.00 13.37 ? 238 ARG B N   1 
ATOM   1586 C CA  . ARG B 2 58  ? 38.430 12.091 38.731 1.00 12.17 ? 238 ARG B CA  1 
ATOM   1587 C C   . ARG B 2 58  ? 38.345 13.250 37.760 1.00 12.18 ? 238 ARG B C   1 
ATOM   1588 O O   . ARG B 2 58  ? 39.294 13.512 37.009 1.00 13.87 ? 238 ARG B O   1 
ATOM   1589 C CB  . ARG B 2 58  ? 37.676 10.931 38.100 1.00 13.73 ? 238 ARG B CB  1 
ATOM   1590 C CG  . ARG B 2 58  ? 37.437 9.785  38.990 1.00 11.06 ? 238 ARG B CG  1 
ATOM   1591 C CD  . ARG B 2 58  ? 38.461 8.753  38.762 1.00 11.05 ? 238 ARG B CD  1 
ATOM   1592 N NE  . ARG B 2 58  ? 38.293 7.709  39.750 1.00 13.57 ? 238 ARG B NE  1 
ATOM   1593 C CZ  . ARG B 2 58  ? 38.677 6.458  39.585 1.00 15.83 ? 238 ARG B CZ  1 
ATOM   1594 N NH1 . ARG B 2 58  ? 39.262 6.079  38.449 1.00 15.55 ? 238 ARG B NH1 1 
ATOM   1595 N NH2 . ARG B 2 58  ? 38.478 5.597  40.575 1.00 18.67 ? 238 ARG B NH2 1 
ATOM   1596 N N   . VAL B 2 59  ? 37.192 13.934 37.780 1.00 9.79  ? 239 VAL B N   1 
ATOM   1597 C CA  . VAL B 2 59  ? 36.985 15.092 36.914 1.00 10.00 ? 239 VAL B CA  1 
ATOM   1598 C C   . VAL B 2 59  ? 38.000 16.183 37.225 1.00 9.91  ? 239 VAL B C   1 
ATOM   1599 O O   . VAL B 2 59  ? 38.410 16.911 36.352 1.00 11.50 ? 239 VAL B O   1 
ATOM   1600 C CB  . VAL B 2 59  ? 35.579 15.707 37.058 1.00 7.83  ? 239 VAL B CB  1 
ATOM   1601 C CG1 . VAL B 2 59  ? 35.521 17.016 36.303 1.00 6.00  ? 239 VAL B CG1 1 
ATOM   1602 C CG2 . VAL B 2 59  ? 34.527 14.776 36.509 1.00 8.93  ? 239 VAL B CG2 1 
ATOM   1603 N N   . ASN B 2 60  ? 38.410 16.282 38.476 1.00 9.40  ? 240 ASN B N   1 
ATOM   1604 C CA  . ASN B 2 60  ? 39.374 17.288 38.863 1.00 10.88 ? 240 ASN B CA  1 
ATOM   1605 C C   . ASN B 2 60  ? 40.770 16.979 38.303 1.00 12.51 ? 240 ASN B C   1 
ATOM   1606 O O   . ASN B 2 60  ? 41.449 17.890 37.812 1.00 13.86 ? 240 ASN B O   1 
ATOM   1607 C CB  . ASN B 2 60  ? 39.399 17.443 40.407 1.00 8.05  ? 240 ASN B CB  1 
ATOM   1608 C CG  . ASN B 2 60  ? 38.243 18.334 40.949 1.00 11.20 ? 240 ASN B CG  1 
ATOM   1609 O OD1 . ASN B 2 60  ? 37.324 18.740 40.220 1.00 7.30  ? 240 ASN B OD1 1 
ATOM   1610 N ND2 . ASN B 2 60  ? 38.294 18.623 42.234 1.00 8.27  ? 240 ASN B ND2 1 
ATOM   1611 N N   . ARG B 2 61  ? 41.185 15.711 38.336 1.00 11.14 ? 241 ARG B N   1 
ATOM   1612 C CA  . ARG B 2 61  ? 42.506 15.339 37.856 1.00 12.36 ? 241 ARG B CA  1 
ATOM   1613 C C   . ARG B 2 61  ? 42.596 15.351 36.337 1.00 13.31 ? 241 ARG B C   1 
ATOM   1614 O O   . ARG B 2 61  ? 43.671 15.554 35.769 1.00 11.18 ? 241 ARG B O   1 
ATOM   1615 C CB  . ARG B 2 61  ? 42.887 13.951 38.383 1.00 16.20 ? 241 ARG B CB  1 
ATOM   1616 C CG  . ARG B 2 61  ? 44.315 13.509 38.057 1.00 18.27 ? 241 ARG B CG  1 
ATOM   1617 C CD  . ARG B 2 61  ? 44.698 12.234 38.809 1.00 23.08 ? 241 ARG B CD  1 
ATOM   1618 N NE  . ARG B 2 61  ? 46.029 11.703 38.449 1.00 27.78 ? 241 ARG B NE  1 
ATOM   1619 C CZ  . ARG B 2 61  ? 47.217 12.243 38.759 1.00 28.42 ? 241 ARG B CZ  1 
ATOM   1620 N NH1 . ARG B 2 61  ? 47.313 13.372 39.461 1.00 29.49 ? 241 ARG B NH1 1 
ATOM   1621 N NH2 . ARG B 2 61  ? 48.330 11.630 38.372 1.00 26.31 ? 241 ARG B NH2 1 
ATOM   1622 N N   . LYS B 2 62  ? 41.460 15.132 35.675 1.00 13.09 ? 242 LYS B N   1 
ATOM   1623 C CA  . LYS B 2 62  ? 41.438 15.108 34.219 1.00 12.11 ? 242 LYS B CA  1 
ATOM   1624 C C   . LYS B 2 62  ? 41.739 16.484 33.694 1.00 10.66 ? 242 LYS B C   1 
ATOM   1625 O O   . LYS B 2 62  ? 42.523 16.667 32.772 1.00 9.44  ? 242 LYS B O   1 
ATOM   1626 C CB  . LYS B 2 62  ? 40.073 14.645 33.730 1.00 13.46 ? 242 LYS B CB  1 
ATOM   1627 C CG  . LYS B 2 62  ? 40.028 14.346 32.235 1.00 17.37 ? 242 LYS B CG  1 
ATOM   1628 C CD  . LYS B 2 62  ? 38.712 13.670 31.861 1.00 21.23 ? 242 LYS B CD  1 
ATOM   1629 C CE  . LYS B 2 62  ? 38.493 13.620 30.359 1.00 23.42 ? 242 LYS B CE  1 
ATOM   1630 N NZ  . LYS B 2 62  ? 39.558 12.877 29.638 1.00 27.00 ? 242 LYS B NZ  1 
ATOM   1631 N N   . VAL B 2 63  ? 41.096 17.459 34.313 1.00 10.73 ? 243 VAL B N   1 
ATOM   1632 C CA  . VAL B 2 63  ? 41.257 18.855 33.956 1.00 11.22 ? 243 VAL B CA  1 
ATOM   1633 C C   . VAL B 2 63  ? 42.673 19.316 34.289 1.00 11.33 ? 243 VAL B C   1 
ATOM   1634 O O   . VAL B 2 63  ? 43.390 19.838 33.444 1.00 9.42  ? 243 VAL B O   1 
ATOM   1635 C CB  . VAL B 2 63  ? 40.220 19.699 34.724 1.00 11.27 ? 243 VAL B CB  1 
ATOM   1636 C CG1 . VAL B 2 63  ? 40.591 21.201 34.682 1.00 11.78 ? 243 VAL B CG1 1 
ATOM   1637 C CG2 . VAL B 2 63  ? 38.841 19.469 34.127 1.00 6.00  ? 243 VAL B CG2 1 
ATOM   1638 N N   . ALA B 2 64  ? 43.047 19.075 35.541 1.00 10.83 ? 244 ALA B N   1 
ATOM   1639 C CA  . ALA B 2 64  ? 44.340 19.438 36.102 1.00 10.32 ? 244 ALA B CA  1 
ATOM   1640 C C   . ALA B 2 64  ? 45.541 18.925 35.360 1.00 9.27  ? 244 ALA B C   1 
ATOM   1641 O O   . ALA B 2 64  ? 46.524 19.634 35.145 1.00 11.73 ? 244 ALA B O   1 
ATOM   1642 C CB  . ALA B 2 64  ? 44.425 18.962 37.569 1.00 6.56  ? 244 ALA B CB  1 
ATOM   1643 N N   . THR B 2 65  ? 45.463 17.682 34.965 1.00 8.76  ? 245 THR B N   1 
ATOM   1644 C CA  . THR B 2 65  ? 46.591 17.062 34.338 1.00 9.05  ? 245 THR B CA  1 
ATOM   1645 C C   . THR B 2 65  ? 46.632 16.969 32.834 1.00 10.86 ? 245 THR B C   1 
ATOM   1646 O O   . THR B 2 65  ? 47.708 16.926 32.257 1.00 11.27 ? 245 THR B O   1 
ATOM   1647 C CB  . THR B 2 65  ? 46.707 15.674 34.876 1.00 9.35  ? 245 THR B CB  1 
ATOM   1648 O OG1 . THR B 2 65  ? 45.433 15.030 34.738 1.00 7.41  ? 245 THR B OG1 1 
ATOM   1649 C CG2 . THR B 2 65  ? 47.126 15.713 36.354 1.00 10.34 ? 245 THR B CG2 1 
ATOM   1650 N N   . GLU B 2 66  ? 45.465 16.940 32.202 1.00 11.42 ? 246 GLU B N   1 
ATOM   1651 C CA  . GLU B 2 66  ? 45.397 16.755 30.772 1.00 10.54 ? 246 GLU B CA  1 
ATOM   1652 C C   . GLU B 2 66  ? 45.299 18.004 29.946 1.00 10.91 ? 246 GLU B C   1 
ATOM   1653 O O   . GLU B 2 66  ? 45.638 17.987 28.769 1.00 11.72 ? 246 GLU B O   1 
ATOM   1654 C CB  . GLU B 2 66  ? 44.219 15.818 30.448 1.00 10.87 ? 246 GLU B CB  1 
ATOM   1655 C CG  . GLU B 2 66  ? 44.367 14.401 31.034 1.00 12.49 ? 246 GLU B CG  1 
ATOM   1656 C CD  . GLU B 2 66  ? 43.204 13.486 30.715 1.00 13.47 ? 246 GLU B CD  1 
ATOM   1657 O OE1 . GLU B 2 66  ? 42.310 13.897 29.963 1.00 14.05 ? 246 GLU B OE1 1 
ATOM   1658 O OE2 . GLU B 2 66  ? 43.187 12.346 31.215 1.00 15.49 ? 246 GLU B OE2 1 
ATOM   1659 N N   . PHE B 2 67  ? 44.839 19.093 30.545 1.00 10.91 ? 247 PHE B N   1 
ATOM   1660 C CA  . PHE B 2 67  ? 44.668 20.341 29.808 1.00 8.34  ? 247 PHE B CA  1 
ATOM   1661 C C   . PHE B 2 67  ? 45.642 21.425 30.230 1.00 8.91  ? 247 PHE B C   1 
ATOM   1662 O O   . PHE B 2 67  ? 46.044 21.504 31.369 1.00 8.39  ? 247 PHE B O   1 
ATOM   1663 C CB  . PHE B 2 67  ? 43.258 20.888 29.998 1.00 8.02  ? 247 PHE B CB  1 
ATOM   1664 C CG  . PHE B 2 67  ? 42.168 19.917 29.701 1.00 8.66  ? 247 PHE B CG  1 
ATOM   1665 C CD1 . PHE B 2 67  ? 41.227 20.201 28.710 1.00 10.01 ? 247 PHE B CD1 1 
ATOM   1666 C CD2 . PHE B 2 67  ? 42.006 18.765 30.478 1.00 8.95  ? 247 PHE B CD2 1 
ATOM   1667 C CE1 . PHE B 2 67  ? 40.117 19.352 28.502 1.00 8.71  ? 247 PHE B CE1 1 
ATOM   1668 C CE2 . PHE B 2 67  ? 40.932 17.919 30.295 1.00 8.21  ? 247 PHE B CE2 1 
ATOM   1669 C CZ  . PHE B 2 67  ? 39.974 18.212 29.303 1.00 9.67  ? 247 PHE B CZ  1 
ATOM   1670 N N   . GLU B 2 68  ? 46.021 22.259 29.280 1.00 11.30 ? 248 GLU B N   1 
ATOM   1671 C CA  . GLU B 2 68  ? 46.919 23.375 29.525 1.00 14.45 ? 248 GLU B CA  1 
ATOM   1672 C C   . GLU B 2 68  ? 46.775 24.288 28.307 1.00 16.36 ? 248 GLU B C   1 
ATOM   1673 O O   . GLU B 2 68  ? 47.032 23.866 27.186 1.00 18.59 ? 248 GLU B O   1 
ATOM   1674 C CB  . GLU B 2 68  ? 48.355 22.893 29.692 1.00 14.47 ? 248 GLU B CB  1 
ATOM   1675 C CG  . GLU B 2 68  ? 49.342 24.037 29.654 1.00 20.45 ? 248 GLU B CG  1 
ATOM   1676 C CD  . GLU B 2 68  ? 50.776 23.575 29.771 1.00 22.78 ? 248 GLU B CD  1 
ATOM   1677 O OE1 . GLU B 2 68  ? 51.639 24.112 29.031 1.00 23.70 ? 248 GLU B OE1 1 
ATOM   1678 O OE2 . GLU B 2 68  ? 51.026 22.679 30.608 1.00 22.21 ? 248 GLU B OE2 1 
ATOM   1679 N N   . SER B 2 69  ? 46.348 25.528 28.546 1.00 16.03 ? 249 SER B N   1 
ATOM   1680 C CA  . SER B 2 69  ? 46.083 26.540 27.509 1.00 14.63 ? 249 SER B CA  1 
ATOM   1681 C C   . SER B 2 69  ? 47.176 26.928 26.531 1.00 13.31 ? 249 SER B C   1 
ATOM   1682 O O   . SER B 2 69  ? 48.320 27.106 26.921 1.00 16.07 ? 249 SER B O   1 
ATOM   1683 C CB  . SER B 2 69  ? 45.633 27.829 28.168 1.00 14.86 ? 249 SER B CB  1 
ATOM   1684 O OG  . SER B 2 69  ? 46.777 28.522 28.601 1.00 13.33 ? 249 SER B OG  1 
ATOM   1685 N N   . PHE B 2 70  ? 46.807 27.082 25.263 1.00 10.86 ? 250 PHE B N   1 
ATOM   1686 C CA  . PHE B 2 70  ? 47.749 27.504 24.235 1.00 10.98 ? 250 PHE B CA  1 
ATOM   1687 C C   . PHE B 2 70  ? 47.265 28.878 23.808 1.00 13.60 ? 250 PHE B C   1 
ATOM   1688 O O   . PHE B 2 70  ? 46.053 29.097 23.625 1.00 13.13 ? 250 PHE B O   1 
ATOM   1689 C CB  . PHE B 2 70  ? 47.763 26.557 23.022 1.00 9.83  ? 250 PHE B CB  1 
ATOM   1690 C CG  . PHE B 2 70  ? 48.765 26.951 21.966 1.00 12.12 ? 250 PHE B CG  1 
ATOM   1691 C CD1 . PHE B 2 70  ? 50.133 26.683 22.142 1.00 11.33 ? 250 PHE B CD1 1 
ATOM   1692 C CD2 . PHE B 2 70  ? 48.369 27.690 20.842 1.00 12.74 ? 250 PHE B CD2 1 
ATOM   1693 C CE1 . PHE B 2 70  ? 51.091 27.142 21.236 1.00 5.92  ? 250 PHE B CE1 1 
ATOM   1694 C CE2 . PHE B 2 70  ? 49.329 28.158 19.926 1.00 9.45  ? 250 PHE B CE2 1 
ATOM   1695 C CZ  . PHE B 2 70  ? 50.692 27.877 20.134 1.00 7.62  ? 250 PHE B CZ  1 
ATOM   1696 N N   . SER B 2 71  ? 48.194 29.815 23.646 1.00 14.55 ? 251 SER B N   1 
ATOM   1697 C CA  . SER B 2 71  ? 47.777 31.159 23.270 1.00 15.74 ? 251 SER B CA  1 
ATOM   1698 C C   . SER B 2 71  ? 48.864 32.071 22.728 1.00 15.34 ? 251 SER B C   1 
ATOM   1699 O O   . SER B 2 71  ? 49.978 32.150 23.247 1.00 17.26 ? 251 SER B O   1 
ATOM   1700 C CB  . SER B 2 71  ? 47.120 31.830 24.463 1.00 14.25 ? 251 SER B CB  1 
ATOM   1701 O OG  . SER B 2 71  ? 46.562 33.062 24.072 1.00 23.43 ? 251 SER B OG  1 
ATOM   1702 N N   . PHE B 2 72  ? 48.538 32.784 21.674 1.00 13.79 ? 252 PHE B N   1 
ATOM   1703 C CA  . PHE B 2 72  ? 49.517 33.673 21.100 1.00 13.74 ? 252 PHE B CA  1 
ATOM   1704 C C   . PHE B 2 72  ? 49.912 34.750 22.105 1.00 13.90 ? 252 PHE B C   1 
ATOM   1705 O O   . PHE B 2 72  ? 50.991 35.322 22.022 1.00 14.83 ? 252 PHE B O   1 
ATOM   1706 C CB  . PHE B 2 72  ? 48.935 34.261 19.818 1.00 11.45 ? 252 PHE B CB  1 
ATOM   1707 C CG  . PHE B 2 72  ? 48.725 33.234 18.725 1.00 10.84 ? 252 PHE B CG  1 
ATOM   1708 C CD1 . PHE B 2 72  ? 47.711 33.380 17.797 1.00 9.23  ? 252 PHE B CD1 1 
ATOM   1709 C CD2 . PHE B 2 72  ? 49.575 32.127 18.609 1.00 10.71 ? 252 PHE B CD2 1 
ATOM   1710 C CE1 . PHE B 2 72  ? 47.547 32.457 16.782 1.00 6.83  ? 252 PHE B CE1 1 
ATOM   1711 C CE2 . PHE B 2 72  ? 49.411 31.200 17.590 1.00 6.25  ? 252 PHE B CE2 1 
ATOM   1712 C CZ  . PHE B 2 72  ? 48.404 31.366 16.684 1.00 6.49  ? 252 PHE B CZ  1 
ATOM   1713 N N   . ASP B 2 73  ? 49.037 34.981 23.077 1.00 14.20 ? 253 ASP B N   1 
ATOM   1714 C CA  . ASP B 2 73  ? 49.224 35.989 24.121 1.00 14.74 ? 253 ASP B CA  1 
ATOM   1715 C C   . ASP B 2 73  ? 49.880 35.400 25.372 1.00 14.48 ? 253 ASP B C   1 
ATOM   1716 O O   . ASP B 2 73  ? 49.239 34.649 26.117 1.00 12.01 ? 253 ASP B O   1 
ATOM   1717 C CB  . ASP B 2 73  ? 47.863 36.567 24.490 1.00 16.72 ? 253 ASP B CB  1 
ATOM   1718 C CG  . ASP B 2 73  ? 47.954 37.755 25.440 1.00 20.81 ? 253 ASP B CG  1 
ATOM   1719 O OD1 . ASP B 2 73  ? 49.069 38.054 25.942 1.00 18.82 ? 253 ASP B OD1 1 
ATOM   1720 O OD2 . ASP B 2 73  ? 46.889 38.390 25.680 1.00 22.35 ? 253 ASP B OD2 1 
ATOM   1721 N N   . ALA B 2 74  ? 51.147 35.756 25.607 1.00 12.96 ? 254 ALA B N   1 
ATOM   1722 C CA  . ALA B 2 74  ? 51.895 35.242 26.754 1.00 11.13 ? 254 ALA B CA  1 
ATOM   1723 C C   . ALA B 2 74  ? 50.991 35.201 27.964 1.00 13.20 ? 254 ALA B C   1 
ATOM   1724 O O   . ALA B 2 74  ? 50.788 34.159 28.597 1.00 14.62 ? 254 ALA B O   1 
ATOM   1725 C CB  . ALA B 2 74  ? 53.067 36.102 27.033 1.00 6.65  ? 254 ALA B CB  1 
ATOM   1726 N N   . THR B 2 75  ? 50.415 36.342 28.275 1.00 14.17 ? 255 THR B N   1 
ATOM   1727 C CA  . THR B 2 75  ? 49.541 36.393 29.416 1.00 16.30 ? 255 THR B CA  1 
ATOM   1728 C C   . THR B 2 75  ? 48.652 35.163 29.596 1.00 17.57 ? 255 THR B C   1 
ATOM   1729 O O   . THR B 2 75  ? 48.631 34.580 30.667 1.00 20.60 ? 255 THR B O   1 
ATOM   1730 C CB  . THR B 2 75  ? 48.681 37.612 29.356 1.00 15.38 ? 255 THR B CB  1 
ATOM   1731 O OG1 . THR B 2 75  ? 49.523 38.770 29.424 1.00 12.95 ? 255 THR B OG1 1 
ATOM   1732 C CG2 . THR B 2 75  ? 47.684 37.586 30.500 1.00 15.66 ? 255 THR B CG2 1 
ATOM   1733 N N   . PHE B 2 76  ? 47.935 34.757 28.560 1.00 17.95 ? 256 PHE B N   1 
ATOM   1734 C CA  . PHE B 2 76  ? 47.051 33.605 28.687 1.00 16.85 ? 256 PHE B CA  1 
ATOM   1735 C C   . PHE B 2 76  ? 47.643 32.295 28.174 1.00 16.34 ? 256 PHE B C   1 
ATOM   1736 O O   . PHE B 2 76  ? 46.925 31.295 28.065 1.00 14.65 ? 256 PHE B O   1 
ATOM   1737 C CB  . PHE B 2 76  ? 45.734 33.876 27.964 1.00 14.39 ? 256 PHE B CB  1 
ATOM   1738 C CG  . PHE B 2 76  ? 45.068 35.128 28.405 1.00 14.78 ? 256 PHE B CG  1 
ATOM   1739 C CD1 . PHE B 2 76  ? 45.424 36.353 27.855 1.00 14.46 ? 256 PHE B CD1 1 
ATOM   1740 C CD2 . PHE B 2 76  ? 44.090 35.098 29.385 1.00 13.83 ? 256 PHE B CD2 1 
ATOM   1741 C CE1 . PHE B 2 76  ? 44.813 37.514 28.284 1.00 10.55 ? 256 PHE B CE1 1 
ATOM   1742 C CE2 . PHE B 2 76  ? 43.480 36.255 29.809 1.00 9.94  ? 256 PHE B CE2 1 
ATOM   1743 C CZ  . PHE B 2 76  ? 43.843 37.455 29.258 1.00 10.71 ? 256 PHE B CZ  1 
ATOM   1744 N N   . HIS B 2 77  ? 48.934 32.289 27.856 1.00 15.23 ? 257 HIS B N   1 
ATOM   1745 C CA  . HIS B 2 77  ? 49.538 31.057 27.363 1.00 15.63 ? 257 HIS B CA  1 
ATOM   1746 C C   . HIS B 2 77  ? 50.052 30.124 28.471 1.00 14.53 ? 257 HIS B C   1 
ATOM   1747 O O   . HIS B 2 77  ? 50.584 30.562 29.477 1.00 14.52 ? 257 HIS B O   1 
ATOM   1748 C CB  . HIS B 2 77  ? 50.677 31.352 26.371 1.00 16.44 ? 257 HIS B CB  1 
ATOM   1749 C CG  . HIS B 2 77  ? 51.228 30.117 25.729 1.00 19.65 ? 257 HIS B CG  1 
ATOM   1750 N ND1 . HIS B 2 77  ? 50.437 29.245 25.011 1.00 18.99 ? 257 HIS B ND1 1 
ATOM   1751 C CD2 . HIS B 2 77  ? 52.452 29.536 25.809 1.00 21.36 ? 257 HIS B CD2 1 
ATOM   1752 C CE1 . HIS B 2 77  ? 51.145 28.176 24.686 1.00 21.29 ? 257 HIS B CE1 1 
ATOM   1753 N NE2 . HIS B 2 77  ? 52.372 28.326 25.157 1.00 21.13 ? 257 HIS B NE2 1 
ATOM   1754 N N   . ALA B 2 78  ? 49.847 28.830 28.284 1.00 12.01 ? 258 ALA B N   1 
ATOM   1755 C CA  . ALA B 2 78  ? 50.316 27.824 29.215 1.00 12.65 ? 258 ALA B CA  1 
ATOM   1756 C C   . ALA B 2 78  ? 49.734 27.870 30.637 1.00 15.15 ? 258 ALA B C   1 
ATOM   1757 O O   . ALA B 2 78  ? 50.467 27.757 31.628 1.00 17.89 ? 258 ALA B O   1 
ATOM   1758 C CB  . ALA B 2 78  ? 51.835 27.864 29.256 1.00 7.86  ? 258 ALA B CB  1 
ATOM   1759 N N   . LYS B 2 79  ? 48.411 27.992 30.739 1.00 15.17 ? 259 LYS B N   1 
ATOM   1760 C CA  . LYS B 2 79  ? 47.749 28.042 32.033 1.00 13.70 ? 259 LYS B CA  1 
ATOM   1761 C C   . LYS B 2 79  ? 47.066 26.727 32.372 1.00 15.21 ? 259 LYS B C   1 
ATOM   1762 O O   . LYS B 2 79  ? 46.623 25.979 31.492 1.00 16.21 ? 259 LYS B O   1 
ATOM   1763 C CB  . LYS B 2 79  ? 46.723 29.162 32.037 1.00 13.00 ? 259 LYS B CB  1 
ATOM   1764 C CG  . LYS B 2 79  ? 47.307 30.488 31.623 1.00 16.08 ? 259 LYS B CG  1 
ATOM   1765 C CD  . LYS B 2 79  ? 48.478 30.853 32.533 1.00 18.99 ? 259 LYS B CD  1 
ATOM   1766 C CE  . LYS B 2 79  ? 49.226 32.047 31.998 1.00 21.87 ? 259 LYS B CE  1 
ATOM   1767 N NZ  . LYS B 2 79  ? 50.435 32.420 32.798 1.00 21.89 ? 259 LYS B NZ  1 
ATOM   1768 N N   . LYS B 2 80  ? 46.987 26.441 33.661 1.00 14.61 ? 260 LYS B N   1 
ATOM   1769 C CA  . LYS B 2 80  ? 46.333 25.236 34.105 1.00 13.70 ? 260 LYS B CA  1 
ATOM   1770 C C   . LYS B 2 80  ? 45.004 25.668 34.715 1.00 15.82 ? 260 LYS B C   1 
ATOM   1771 O O   . LYS B 2 80  ? 44.681 26.865 34.739 1.00 14.86 ? 260 LYS B O   1 
ATOM   1772 C CB  . LYS B 2 80  ? 47.183 24.539 35.149 1.00 13.93 ? 260 LYS B CB  1 
ATOM   1773 C CG  . LYS B 2 80  ? 48.628 24.280 34.725 1.00 14.95 ? 260 LYS B CG  1 
ATOM   1774 C CD  . LYS B 2 80  ? 48.755 23.311 33.566 1.00 11.46 ? 260 LYS B CD  1 
ATOM   1775 C CE  . LYS B 2 80  ? 48.522 21.876 33.967 1.00 9.18  ? 260 LYS B CE  1 
ATOM   1776 N NZ  . LYS B 2 80  ? 47.134 21.463 33.874 1.00 6.19  ? 260 LYS B NZ  1 
ATOM   1777 N N   . GLN B 2 81  ? 44.242 24.694 35.211 1.00 15.84 ? 261 GLN B N   1 
ATOM   1778 C CA  . GLN B 2 81  ? 42.948 24.945 35.830 1.00 15.39 ? 261 GLN B CA  1 
ATOM   1779 C C   . GLN B 2 81  ? 42.551 23.743 36.685 1.00 17.07 ? 261 GLN B C   1 
ATOM   1780 O O   . GLN B 2 81  ? 42.817 22.598 36.324 1.00 20.32 ? 261 GLN B O   1 
ATOM   1781 C CB  . GLN B 2 81  ? 41.903 25.192 34.756 1.00 15.89 ? 261 GLN B CB  1 
ATOM   1782 C CG  . GLN B 2 81  ? 40.478 25.153 35.269 1.00 17.22 ? 261 GLN B CG  1 
ATOM   1783 C CD  . GLN B 2 81  ? 39.482 25.521 34.202 1.00 17.24 ? 261 GLN B CD  1 
ATOM   1784 O OE1 . GLN B 2 81  ? 39.674 26.485 33.485 1.00 19.96 ? 261 GLN B OE1 1 
ATOM   1785 N NE2 . GLN B 2 81  ? 38.418 24.761 34.090 1.00 17.81 ? 261 GLN B NE2 1 
ATOM   1786 N N   . ILE B 2 82  ? 41.920 24.010 37.825 1.00 16.31 ? 262 ILE B N   1 
ATOM   1787 C CA  . ILE B 2 82  ? 41.484 22.979 38.762 1.00 10.57 ? 262 ILE B CA  1 
ATOM   1788 C C   . ILE B 2 82  ? 40.041 23.265 39.125 1.00 9.81  ? 262 ILE B C   1 
ATOM   1789 O O   . ILE B 2 82  ? 39.733 24.315 39.657 1.00 10.24 ? 262 ILE B O   1 
ATOM   1790 C CB  . ILE B 2 82  ? 42.390 22.988 40.052 1.00 10.31 ? 262 ILE B CB  1 
ATOM   1791 C CG1 . ILE B 2 82  ? 42.998 21.596 40.290 1.00 12.56 ? 262 ILE B CG1 1 
ATOM   1792 C CG2 . ILE B 2 82  ? 41.621 23.433 41.258 1.00 6.92  ? 262 ILE B CG2 1 
ATOM   1793 C CD1 . ILE B 2 82  ? 42.021 20.468 40.607 1.00 9.29  ? 262 ILE B CD1 1 
ATOM   1794 N N   . PRO B 2 83  ? 39.122 22.347 38.803 1.00 11.52 ? 263 PRO B N   1 
ATOM   1795 C CA  . PRO B 2 83  ? 37.715 22.586 39.143 1.00 9.92  ? 263 PRO B CA  1 
ATOM   1796 C C   . PRO B 2 83  ? 37.586 22.584 40.663 1.00 9.70  ? 263 PRO B C   1 
ATOM   1797 O O   . PRO B 2 83  ? 38.492 22.129 41.354 1.00 12.04 ? 263 PRO B O   1 
ATOM   1798 C CB  . PRO B 2 83  ? 36.996 21.411 38.483 1.00 12.57 ? 263 PRO B CB  1 
ATOM   1799 C CG  . PRO B 2 83  ? 37.884 21.029 37.355 1.00 12.84 ? 263 PRO B CG  1 
ATOM   1800 C CD  . PRO B 2 83  ? 39.257 21.144 37.967 1.00 12.36 ? 263 PRO B CD  1 
ATOM   1801 N N   . CYS B 2 84  ? 36.468 23.068 41.177 1.00 8.04  ? 264 CYS B N   1 
ATOM   1802 C CA  . CYS B 2 84  ? 36.256 23.159 42.616 1.00 9.92  ? 264 CYS B CA  1 
ATOM   1803 C C   . CYS B 2 84  ? 34.971 22.452 43.083 1.00 12.25 ? 264 CYS B C   1 
ATOM   1804 O O   . CYS B 2 84  ? 33.851 22.914 42.799 1.00 13.55 ? 264 CYS B O   1 
ATOM   1805 C CB  . CYS B 2 84  ? 36.184 24.652 42.994 1.00 13.54 ? 264 CYS B CB  1 
ATOM   1806 S SG  . CYS B 2 84  ? 36.056 25.115 44.728 1.00 12.57 ? 264 CYS B SG  1 
ATOM   1807 N N   . ILE B 2 85  ? 35.109 21.345 43.804 1.00 8.77  ? 265 ILE B N   1 
ATOM   1808 C CA  . ILE B 2 85  ? 33.916 20.698 44.300 1.00 8.17  ? 265 ILE B CA  1 
ATOM   1809 C C   . ILE B 2 85  ? 33.492 21.295 45.609 1.00 9.92  ? 265 ILE B C   1 
ATOM   1810 O O   . ILE B 2 85  ? 34.217 21.176 46.598 1.00 11.51 ? 265 ILE B O   1 
ATOM   1811 C CB  . ILE B 2 85  ? 34.085 19.241 44.582 1.00 5.86  ? 265 ILE B CB  1 
ATOM   1812 C CG1 . ILE B 2 85  ? 34.799 18.565 43.403 1.00 7.88  ? 265 ILE B CG1 1 
ATOM   1813 C CG2 . ILE B 2 85  ? 32.702 18.674 44.923 1.00 2.00  ? 265 ILE B CG2 1 
ATOM   1814 C CD1 . ILE B 2 85  ? 35.168 17.135 43.607 1.00 2.49  ? 265 ILE B CD1 1 
ATOM   1815 N N   . VAL B 2 86  ? 32.311 21.918 45.604 1.00 8.89  ? 266 VAL B N   1 
ATOM   1816 C CA  . VAL B 2 86  ? 31.715 22.535 46.785 1.00 7.22  ? 266 VAL B CA  1 
ATOM   1817 C C   . VAL B 2 86  ? 30.407 21.783 47.166 1.00 8.01  ? 266 VAL B C   1 
ATOM   1818 O O   . VAL B 2 86  ? 29.351 21.950 46.551 1.00 7.71  ? 266 VAL B O   1 
ATOM   1819 C CB  . VAL B 2 86  ? 31.518 24.034 46.495 1.00 6.22  ? 266 VAL B CB  1 
ATOM   1820 C CG1 . VAL B 2 86  ? 30.862 24.758 47.655 1.00 4.28  ? 266 VAL B CG1 1 
ATOM   1821 C CG2 . VAL B 2 86  ? 32.881 24.621 46.195 1.00 4.15  ? 266 VAL B CG2 1 
ATOM   1822 N N   . SER B 2 87  ? 30.506 20.952 48.202 1.00 7.99  ? 267 SER B N   1 
ATOM   1823 C CA  . SER B 2 87  ? 29.394 20.116 48.648 1.00 9.11  ? 267 SER B CA  1 
ATOM   1824 C C   . SER B 2 87  ? 28.754 20.368 50.016 1.00 10.38 ? 267 SER B C   1 
ATOM   1825 O O   . SER B 2 87  ? 29.416 20.337 51.038 1.00 12.92 ? 267 SER B O   1 
ATOM   1826 C CB  . SER B 2 87  ? 29.844 18.658 48.607 1.00 8.68  ? 267 SER B CB  1 
ATOM   1827 O OG  . SER B 2 87  ? 28.779 17.770 48.887 1.00 10.28 ? 267 SER B OG  1 
ATOM   1828 N N   . MET B 2 88  ? 27.451 20.601 50.030 1.00 11.01 ? 268 MET B N   1 
ATOM   1829 C CA  . MET B 2 88  ? 26.735 20.771 51.281 1.00 10.96 ? 268 MET B CA  1 
ATOM   1830 C C   . MET B 2 88  ? 25.698 19.628 51.303 1.00 11.80 ? 268 MET B C   1 
ATOM   1831 O O   . MET B 2 88  ? 24.597 19.777 51.821 1.00 11.65 ? 268 MET B O   1 
ATOM   1832 C CB  . MET B 2 88  ? 26.021 22.135 51.368 1.00 11.19 ? 268 MET B CB  1 
ATOM   1833 C CG  . MET B 2 88  ? 26.494 23.170 50.391 1.00 12.13 ? 268 MET B CG  1 
ATOM   1834 S SD  . MET B 2 88  ? 27.678 24.343 50.982 1.00 18.93 ? 268 MET B SD  1 
ATOM   1835 C CE  . MET B 2 88  ? 27.295 25.677 49.963 1.00 12.09 ? 268 MET B CE  1 
ATOM   1836 N N   . LEU B 2 89  ? 26.064 18.489 50.719 1.00 11.97 ? 269 LEU B N   1 
ATOM   1837 C CA  . LEU B 2 89  ? 25.191 17.316 50.706 1.00 13.74 ? 269 LEU B CA  1 
ATOM   1838 C C   . LEU B 2 89  ? 25.360 16.551 52.020 1.00 14.80 ? 269 LEU B C   1 
ATOM   1839 O O   . LEU B 2 89  ? 26.438 16.544 52.612 1.00 15.28 ? 269 LEU B O   1 
ATOM   1840 C CB  . LEU B 2 89  ? 25.541 16.393 49.544 1.00 11.37 ? 269 LEU B CB  1 
ATOM   1841 C CG  . LEU B 2 89  ? 25.470 16.991 48.151 1.00 11.43 ? 269 LEU B CG  1 
ATOM   1842 C CD1 . LEU B 2 89  ? 25.894 15.961 47.170 1.00 11.29 ? 269 LEU B CD1 1 
ATOM   1843 C CD2 . LEU B 2 89  ? 24.076 17.470 47.853 1.00 11.33 ? 269 LEU B CD2 1 
ATOM   1844 N N   . THR B 2 90  ? 24.295 15.899 52.464 1.00 13.93 ? 270 THR B N   1 
ATOM   1845 C CA  . THR B 2 90  ? 24.318 15.160 53.711 1.00 12.72 ? 270 THR B CA  1 
ATOM   1846 C C   . THR B 2 90  ? 24.327 13.611 53.557 1.00 14.40 ? 270 THR B C   1 
ATOM   1847 O O   . THR B 2 90  ? 24.303 12.860 54.541 1.00 15.21 ? 270 THR B O   1 
ATOM   1848 C CB  . THR B 2 90  ? 23.133 15.648 54.578 1.00 10.72 ? 270 THR B CB  1 
ATOM   1849 O OG1 . THR B 2 90  ? 21.894 15.404 53.907 1.00 12.85 ? 270 THR B OG1 1 
ATOM   1850 C CG2 . THR B 2 90  ? 23.235 17.110 54.790 1.00 7.68  ? 270 THR B CG2 1 
ATOM   1851 N N   . LYS B 2 91  ? 24.370 13.136 52.316 1.00 13.98 ? 271 LYS B N   1 
ATOM   1852 C CA  . LYS B 2 91  ? 24.403 11.701 52.022 1.00 11.90 ? 271 LYS B CA  1 
ATOM   1853 C C   . LYS B 2 91  ? 25.143 11.473 50.704 1.00 11.51 ? 271 LYS B C   1 
ATOM   1854 O O   . LYS B 2 91  ? 25.266 12.387 49.899 1.00 11.50 ? 271 LYS B O   1 
ATOM   1855 C CB  . LYS B 2 91  ? 22.997 11.127 51.853 1.00 11.21 ? 271 LYS B CB  1 
ATOM   1856 C CG  . LYS B 2 91  ? 22.072 11.267 52.997 1.00 10.09 ? 271 LYS B CG  1 
ATOM   1857 C CD  . LYS B 2 91  ? 20.792 10.685 52.603 1.00 7.99  ? 271 LYS B CD  1 
ATOM   1858 C CE  . LYS B 2 91  ? 19.737 10.955 53.591 1.00 7.07  ? 271 LYS B CE  1 
ATOM   1859 N NZ  . LYS B 2 91  ? 18.559 10.179 53.097 1.00 13.10 ? 271 LYS B NZ  1 
ATOM   1860 N N   . GLU B 2 92  ? 25.615 10.249 50.492 1.00 10.20 ? 272 GLU B N   1 
ATOM   1861 C CA  . GLU B 2 92  ? 26.311 9.884  49.277 1.00 11.37 ? 272 GLU B CA  1 
ATOM   1862 C C   . GLU B 2 92  ? 25.379 9.869  48.103 1.00 13.65 ? 272 GLU B C   1 
ATOM   1863 O O   . GLU B 2 92  ? 24.174 9.673  48.255 1.00 14.74 ? 272 GLU B O   1 
ATOM   1864 C CB  . GLU B 2 92  ? 26.927 8.531  49.416 1.00 13.12 ? 272 GLU B CB  1 
ATOM   1865 C CG  . GLU B 2 92  ? 27.835 8.459  50.588 1.00 14.67 ? 272 GLU B CG  1 
ATOM   1866 C CD  . GLU B 2 92  ? 28.516 7.159  50.621 1.00 15.59 ? 272 GLU B CD  1 
ATOM   1867 O OE1 . GLU B 2 92  ? 27.802 6.141  50.476 1.00 20.41 ? 272 GLU B OE1 1 
ATOM   1868 O OE2 . GLU B 2 92  ? 29.742 7.153  50.779 1.00 15.14 ? 272 GLU B OE2 1 
ATOM   1869 N N   . LEU B 2 93  ? 25.950 10.031 46.918 1.00 14.40 ? 273 LEU B N   1 
ATOM   1870 C CA  . LEU B 2 93  ? 25.138 10.122 45.735 1.00 15.54 ? 273 LEU B CA  1 
ATOM   1871 C C   . LEU B 2 93  ? 25.556 9.220  44.601 1.00 16.72 ? 273 LEU B C   1 
ATOM   1872 O O   . LEU B 2 93  ? 26.634 9.349  44.044 1.00 17.62 ? 273 LEU B O   1 
ATOM   1873 C CB  . LEU B 2 93  ? 25.106 11.582 45.288 1.00 15.12 ? 273 LEU B CB  1 
ATOM   1874 C CG  . LEU B 2 93  ? 24.054 12.042 44.287 1.00 15.62 ? 273 LEU B CG  1 
ATOM   1875 C CD1 . LEU B 2 93  ? 22.685 11.513 44.663 1.00 15.22 ? 273 LEU B CD1 1 
ATOM   1876 C CD2 . LEU B 2 93  ? 24.046 13.537 44.277 1.00 15.26 ? 273 LEU B CD2 1 
ATOM   1877 N N   . TYR B 2 94  ? 24.655 8.304  44.278 1.00 18.84 ? 274 TYR B N   1 
ATOM   1878 C CA  . TYR B 2 94  ? 24.822 7.335  43.210 1.00 19.48 ? 274 TYR B CA  1 
ATOM   1879 C C   . TYR B 2 94  ? 23.623 7.493  42.295 1.00 20.56 ? 274 TYR B C   1 
ATOM   1880 O O   . TYR B 2 94  ? 22.470 7.388  42.719 1.00 19.24 ? 274 TYR B O   1 
ATOM   1881 C CB  . TYR B 2 94  ? 24.838 5.925  43.781 1.00 18.77 ? 274 TYR B CB  1 
ATOM   1882 C CG  . TYR B 2 94  ? 25.908 5.700  44.823 1.00 19.33 ? 274 TYR B CG  1 
ATOM   1883 C CD1 . TYR B 2 94  ? 27.207 5.352  44.456 1.00 19.72 ? 274 TYR B CD1 1 
ATOM   1884 C CD2 . TYR B 2 94  ? 25.613 5.812  46.167 1.00 17.67 ? 274 TYR B CD2 1 
ATOM   1885 C CE1 . TYR B 2 94  ? 28.170 5.116  45.396 1.00 18.89 ? 274 TYR B CE1 1 
ATOM   1886 C CE2 . TYR B 2 94  ? 26.570 5.582  47.122 1.00 18.12 ? 274 TYR B CE2 1 
ATOM   1887 C CZ  . TYR B 2 94  ? 27.844 5.234  46.735 1.00 18.93 ? 274 TYR B CZ  1 
ATOM   1888 O OH  . TYR B 2 94  ? 28.795 5.019  47.698 1.00 19.88 ? 274 TYR B OH  1 
ATOM   1889 N N   . PHE B 2 95  ? 23.915 7.763  41.033 1.00 23.51 ? 275 PHE B N   1 
ATOM   1890 C CA  . PHE B 2 95  ? 22.898 7.963  40.015 1.00 23.54 ? 275 PHE B CA  1 
ATOM   1891 C C   . PHE B 2 95  ? 22.183 6.642  39.711 1.00 26.45 ? 275 PHE B C   1 
ATOM   1892 O O   . PHE B 2 95  ? 21.064 6.649  39.202 1.00 30.00 ? 275 PHE B O   1 
ATOM   1893 C CB  . PHE B 2 95  ? 23.553 8.540  38.753 1.00 19.72 ? 275 PHE B CB  1 
ATOM   1894 C CG  . PHE B 2 95  ? 24.202 9.897  38.942 1.00 13.18 ? 275 PHE B CG  1 
ATOM   1895 C CD1 . PHE B 2 95  ? 23.441 11.032 39.191 1.00 14.61 ? 275 PHE B CD1 1 
ATOM   1896 C CD2 . PHE B 2 95  ? 25.571 10.053 38.785 1.00 12.31 ? 275 PHE B CD2 1 
ATOM   1897 C CE1 . PHE B 2 95  ? 24.052 12.308 39.271 1.00 14.02 ? 275 PHE B CE1 1 
ATOM   1898 C CE2 . PHE B 2 95  ? 26.182 11.320 38.864 1.00 7.42  ? 275 PHE B CE2 1 
ATOM   1899 C CZ  . PHE B 2 95  ? 25.431 12.434 39.104 1.00 9.93  ? 275 PHE B CZ  1 
ATOM   1900 N N   . TYR B 2 96  ? 22.820 5.508  40.016 1.00 28.95 ? 276 TYR B N   1 
ATOM   1901 C CA  . TYR B 2 96  ? 22.190 4.198  39.796 1.00 30.48 ? 276 TYR B CA  1 
ATOM   1902 C C   . TYR B 2 96  ? 21.529 3.726  41.079 1.00 32.30 ? 276 TYR B C   1 
ATOM   1903 O O   . TYR B 2 96  ? 21.583 4.407  42.089 1.00 34.43 ? 276 TYR B O   1 
ATOM   1904 C CB  . TYR B 2 96  ? 23.224 3.169  39.400 1.00 29.57 ? 276 TYR B CB  1 
ATOM   1905 C CG  . TYR B 2 96  ? 24.222 2.881  40.489 1.00 28.92 ? 276 TYR B CG  1 
ATOM   1906 C CD1 . TYR B 2 96  ? 23.888 2.059  41.577 1.00 26.62 ? 276 TYR B CD1 1 
ATOM   1907 C CD2 . TYR B 2 96  ? 25.508 3.431  40.439 1.00 28.58 ? 276 TYR B CD2 1 
ATOM   1908 C CE1 . TYR B 2 96  ? 24.807 1.789  42.586 1.00 24.65 ? 276 TYR B CE1 1 
ATOM   1909 C CE2 . TYR B 2 96  ? 26.442 3.169  41.449 1.00 28.42 ? 276 TYR B CE2 1 
ATOM   1910 C CZ  . TYR B 2 96  ? 26.078 2.352  42.515 1.00 27.86 ? 276 TYR B CZ  1 
ATOM   1911 O OH  . TYR B 2 96  ? 26.981 2.134  43.523 1.00 30.26 ? 276 TYR B OH  1 
ATOM   1912 N N   . HIS B 2 97  ? 20.903 2.557  41.040 1.00 34.90 ? 277 HIS B N   1 
ATOM   1913 C CA  . HIS B 2 97  ? 20.261 1.990  42.229 1.00 35.85 ? 277 HIS B CA  1 
ATOM   1914 C C   . HIS B 2 97  ? 19.995 0.502  42.052 1.00 36.86 ? 277 HIS B C   1 
ATOM   1915 O O   . HIS B 2 97  ? 20.701 -0.098 41.201 1.00 36.44 ? 277 HIS B O   1 
ATOM   1916 C CB  . HIS B 2 97  ? 18.955 2.719  42.585 1.00 34.95 ? 277 HIS B CB  1 
ATOM   1917 C CG  . HIS B 2 97  ? 17.872 2.562  41.570 1.00 36.97 ? 277 HIS B CG  1 
ATOM   1918 N ND1 . HIS B 2 97  ? 17.708 3.435  40.517 1.00 35.53 ? 277 HIS B ND1 1 
ATOM   1919 C CD2 . HIS B 2 97  ? 16.908 1.617  41.433 1.00 37.79 ? 277 HIS B CD2 1 
ATOM   1920 C CE1 . HIS B 2 97  ? 16.693 3.031  39.775 1.00 37.74 ? 277 HIS B CE1 1 
ATOM   1921 N NE2 . HIS B 2 97  ? 16.191 1.932  40.306 1.00 37.50 ? 277 HIS B NE2 1 
ATOM   1922 O OXT . HIS B 2 97  ? 19.116 -0.036 42.777 1.00 38.58 ? 277 HIS B OXT 1 
HETATM 1923 S S1  . MSI C 3 .   ? 37.832 31.958 27.609 1.00 54.12 ? 1   MSI A S1  1 
HETATM 1924 N N1  . MSI C 3 .   ? 34.899 36.018 31.049 1.00 48.47 ? 1   MSI A N1  1 
HETATM 1925 N N2  . MSI C 3 .   ? 39.573 32.069 27.847 1.00 52.94 ? 1   MSI A N2  1 
HETATM 1926 O O1  . MSI C 3 .   ? 41.050 32.581 25.002 1.00 58.30 ? 1   MSI A O1  1 
HETATM 1927 O O2  . MSI C 3 .   ? 33.615 35.333 32.895 1.00 51.11 ? 1   MSI A O2  1 
HETATM 1928 O O3  . MSI C 3 .   ? 34.141 32.711 31.675 1.00 44.57 ? 1   MSI A O3  1 
HETATM 1929 O O4  . MSI C 3 .   ? 37.453 30.645 28.040 1.00 53.11 ? 1   MSI A O4  1 
HETATM 1930 O O5  . MSI C 3 .   ? 37.759 32.316 26.243 1.00 53.43 ? 1   MSI A O5  1 
HETATM 1931 C C2  . MSI C 3 .   ? 34.447 35.109 32.008 1.00 48.22 ? 1   MSI A C2  1 
HETATM 1932 C C3  . MSI C 3 .   ? 35.112 33.759 31.846 1.00 45.49 ? 1   MSI A C3  1 
HETATM 1933 C C4  . MSI C 3 .   ? 36.500 32.931 29.906 1.00 48.73 ? 1   MSI A C4  1 
HETATM 1934 C C5  . MSI C 3 .   ? 36.970 33.228 28.581 1.00 50.48 ? 1   MSI A C5  1 
HETATM 1935 C C6  . MSI C 3 .   ? 36.777 34.539 28.023 1.00 49.15 ? 1   MSI A C6  1 
HETATM 1936 C C7  . MSI C 3 .   ? 36.120 35.562 28.763 1.00 48.79 ? 1   MSI A C7  1 
HETATM 1937 C C8  . MSI C 3 .   ? 35.639 35.246 30.063 1.00 48.19 ? 1   MSI A C8  1 
HETATM 1938 C C9  . MSI C 3 .   ? 35.811 33.971 30.606 1.00 47.70 ? 1   MSI A C9  1 
HETATM 1939 C C20 . MSI C 3 .   ? 40.258 33.341 27.486 1.00 53.08 ? 1   MSI A C20 1 
HETATM 1940 C C10 . MSI C 3 .   ? 40.965 33.931 28.703 1.00 52.41 ? 1   MSI A C10 1 
HETATM 1941 C C11 . MSI C 3 .   ? 40.635 32.993 29.842 1.00 51.89 ? 1   MSI A C11 1 
HETATM 1942 C C12 . MSI C 3 .   ? 40.061 31.748 29.193 1.00 53.29 ? 1   MSI A C12 1 
HETATM 1943 C C13 . MSI C 3 .   ? 41.291 33.239 26.293 1.00 55.60 ? 1   MSI A C13 1 
HETATM 1944 C C14 . MSI C 3 .   ? 39.893 32.891 24.233 1.00 59.01 ? 1   MSI A C14 1 
HETATM 1945 C C15 . MSI C 3 .   ? 39.547 34.247 23.909 1.00 60.37 ? 1   MSI A C15 1 
HETATM 1946 C C16 . MSI C 3 .   ? 38.407 34.544 23.100 1.00 59.19 ? 1   MSI A C16 1 
HETATM 1947 C C17 . MSI C 3 .   ? 37.605 33.488 22.607 1.00 59.97 ? 1   MSI A C17 1 
HETATM 1948 C C18 . MSI C 3 .   ? 37.940 32.128 22.919 1.00 60.43 ? 1   MSI A C18 1 
HETATM 1949 C C19 . MSI C 3 .   ? 39.077 31.833 23.728 1.00 59.36 ? 1   MSI A C19 1 
HETATM 1950 C C1  . MSI C 3 .   ? 34.732 37.470 31.083 1.00 49.04 ? 1   MSI A C1  1 
HETATM 1951 O O   . HOH D 4 .   ? 20.303 21.158 22.250 1.00 13.80 ? 176 HOH A O   1 
HETATM 1952 O O   . HOH D 4 .   ? 15.352 20.772 25.739 1.00 2.00  ? 177 HOH A O   1 
HETATM 1953 O O   . HOH D 4 .   ? 27.735 15.012 22.405 1.00 11.34 ? 178 HOH A O   1 
HETATM 1954 O O   . HOH D 4 .   ? 21.178 13.675 23.282 1.00 38.24 ? 179 HOH A O   1 
HETATM 1955 O O   . HOH D 4 .   ? 23.632 29.597 21.790 1.00 8.49  ? 180 HOH A O   1 
HETATM 1956 O O   . HOH D 4 .   ? 32.205 19.548 25.918 1.00 11.72 ? 181 HOH A O   1 
HETATM 1957 O O   . HOH D 4 .   ? 24.087 40.793 40.117 1.00 9.43  ? 182 HOH A O   1 
HETATM 1958 O O   . HOH D 4 .   ? 32.878 28.050 37.500 1.00 8.32  ? 183 HOH A O   1 
HETATM 1959 O O   . HOH D 4 .   ? 33.424 30.594 30.150 1.00 11.92 ? 184 HOH A O   1 
HETATM 1960 O O   . HOH D 4 .   ? 30.291 26.810 27.735 1.00 28.14 ? 185 HOH A O   1 
HETATM 1961 O O   . HOH D 4 .   ? 15.773 21.207 21.952 1.00 2.62  ? 186 HOH A O   1 
HETATM 1962 O O   . HOH D 4 .   ? 17.257 19.771 51.526 1.00 14.00 ? 187 HOH A O   1 
HETATM 1963 O O   . HOH D 4 .   ? 26.175 9.587  30.998 1.00 13.77 ? 188 HOH A O   1 
HETATM 1964 O O   . HOH D 4 .   ? 20.811 41.893 37.201 1.00 29.86 ? 189 HOH A O   1 
HETATM 1965 O O   . HOH D 4 .   ? 14.962 33.725 24.716 1.00 28.87 ? 190 HOH A O   1 
HETATM 1966 O O   . HOH D 4 .   ? 1.308  12.838 44.193 1.00 24.90 ? 191 HOH A O   1 
HETATM 1967 O O   . HOH D 4 .   ? 6.508  14.828 40.716 1.00 41.52 ? 192 HOH A O   1 
HETATM 1968 O O   . HOH D 4 .   ? 26.838 20.675 18.465 1.00 18.74 ? 193 HOH A O   1 
HETATM 1969 O O   . HOH D 4 .   ? 17.927 13.311 52.843 1.00 19.40 ? 194 HOH A O   1 
HETATM 1970 O O   . HOH D 4 .   ? 15.852 24.621 22.293 1.00 9.62  ? 195 HOH A O   1 
HETATM 1971 O O   . HOH D 4 .   ? 12.885 23.147 27.259 1.00 2.00  ? 196 HOH A O   1 
HETATM 1972 O O   . HOH D 4 .   ? 12.710 17.532 28.131 1.00 27.18 ? 197 HOH A O   1 
HETATM 1973 O O   . HOH D 4 .   ? 13.645 11.787 35.483 1.00 20.61 ? 198 HOH A O   1 
HETATM 1974 O O   . HOH D 4 .   ? 9.841  3.894  47.218 1.00 36.78 ? 199 HOH A O   1 
HETATM 1975 O O   . HOH D 4 .   ? 9.092  -3.471 55.002 1.00 12.22 ? 200 HOH A O   1 
HETATM 1976 O O   . HOH D 4 .   ? 7.748  -8.644 60.745 1.00 2.00  ? 201 HOH A O   1 
HETATM 1977 O O   . HOH D 4 .   ? 18.124 20.547 21.807 1.00 15.77 ? 202 HOH A O   1 
HETATM 1978 O O   . HOH D 4 .   ? 13.647 22.944 25.023 1.00 2.00  ? 203 HOH A O   1 
HETATM 1979 O O   . HOH E 4 .   ? 12.201 21.916 65.756 1.00 5.79  ? 1   HOH B O   1 
HETATM 1980 O O   . HOH E 4 .   ? 40.350 11.118 34.962 1.00 22.37 ? 3   HOH B O   1 
HETATM 1981 O O   . HOH E 4 .   ? 42.776 27.153 24.881 1.00 5.62  ? 4   HOH B O   1 
HETATM 1982 O O   . HOH E 4 .   ? 44.900 22.522 33.946 1.00 2.00  ? 5   HOH B O   1 
HETATM 1983 O O   . HOH E 4 .   ? 42.375 29.222 35.924 1.00 13.86 ? 6   HOH B O   1 
HETATM 1984 O O   . HOH E 4 .   ? 41.674 19.537 22.142 1.00 27.90 ? 7   HOH B O   1 
HETATM 1985 O O   . HOH E 4 .   ? 26.577 7.400  40.560 1.00 2.00  ? 12  HOH B O   1 
HETATM 1986 O O   . HOH E 4 .   ? 43.818 38.342 33.056 1.00 16.81 ? 13  HOH B O   1 
HETATM 1987 O O   . HOH E 4 .   ? 7.374  16.181 57.752 1.00 38.61 ? 15  HOH B O   1 
HETATM 1988 O O   . HOH E 4 .   ? 43.993 13.647 33.829 1.00 52.16 ? 21  HOH B O   1 
HETATM 1989 O O   . HOH E 4 .   ? 49.198 9.817  40.105 1.00 21.15 ? 23  HOH B O   1 
HETATM 1990 O O   . HOH E 4 .   ? 44.586 37.642 24.266 1.00 33.34 ? 25  HOH B O   1 
HETATM 1991 O O   . HOH E 4 .   ? 49.816 15.780 30.185 1.00 21.97 ? 33  HOH B O   1 
HETATM 1992 O O   . HOH E 4 .   ? 42.574 11.814 34.729 1.00 12.53 ? 41  HOH B O   1 
HETATM 1993 O O   . HOH E 4 .   ? 39.481 21.701 24.791 1.00 61.11 ? 42  HOH B O   1 
HETATM 1994 O O   . HOH E 4 .   ? 36.418 24.714 32.357 1.00 7.18  ? 43  HOH B O   1 
HETATM 1995 O O   . HOH E 4 .   ? 43.920 32.698 23.928 1.00 16.76 ? 44  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   29  29  SER SER A . n 
A 1 2   GLY 2   30  30  GLY GLY A . n 
A 1 3   ILE 3   31  31  ILE ILE A . n 
A 1 4   SER 4   32  32  SER SER A . n 
A 1 5   LEU 5   33  33  LEU LEU A . n 
A 1 6   ASP 6   34  34  ASP ASP A . n 
A 1 7   ASN 7   35  35  ASN ASN A . n 
A 1 8   SER 8   36  36  SER SER A . n 
A 1 9   TYR 9   37  37  TYR TYR A . n 
A 1 10  LYS 10  38  38  LYS LYS A . n 
A 1 11  MET 11  39  39  MET MET A . n 
A 1 12  ASP 12  40  40  ASP ASP A . n 
A 1 13  TYR 13  41  41  TYR TYR A . n 
A 1 14  PRO 14  42  42  PRO PRO A . n 
A 1 15  GLU 15  43  43  GLU GLU A . n 
A 1 16  MET 16  44  44  MET MET A . n 
A 1 17  GLY 17  45  45  GLY GLY A . n 
A 1 18  LEU 18  46  46  LEU LEU A . n 
A 1 19  CYS 19  47  47  CYS CYS A . n 
A 1 20  ILE 20  48  48  ILE ILE A . n 
A 1 21  ILE 21  49  49  ILE ILE A . n 
A 1 22  ILE 22  50  50  ILE ILE A . n 
A 1 23  ASN 23  51  51  ASN ASN A . n 
A 1 24  ASN 24  52  52  ASN ASN A . n 
A 1 25  LYS 25  53  53  LYS LYS A . n 
A 1 26  ASN 26  54  54  ASN ASN A . n 
A 1 27  PHE 27  55  55  PHE PHE A . n 
A 1 28  HIS 28  56  56  HIS HIS A . n 
A 1 29  LYS 29  57  57  LYS LYS A . n 
A 1 30  SER 30  58  58  SER SER A . n 
A 1 31  THR 31  59  59  THR THR A . n 
A 1 32  GLY 32  60  60  GLY GLY A . n 
A 1 33  MET 33  61  61  MET MET A . n 
A 1 34  THR 34  62  62  THR THR A . n 
A 1 35  SER 35  63  63  SER SER A . n 
A 1 36  ARG 36  64  64  ARG ARG A . n 
A 1 37  SER 37  65  65  SER SER A . n 
A 1 38  GLY 38  66  66  GLY GLY A . n 
A 1 39  THR 39  67  67  THR THR A . n 
A 1 40  ASP 40  68  68  ASP ASP A . n 
A 1 41  VAL 41  69  69  VAL VAL A . n 
A 1 42  ASP 42  70  70  ASP ASP A . n 
A 1 43  ALA 43  71  71  ALA ALA A . n 
A 1 44  ALA 44  72  72  ALA ALA A . n 
A 1 45  ASN 45  73  73  ASN ASN A . n 
A 1 46  LEU 46  74  74  LEU LEU A . n 
A 1 47  ARG 47  75  75  ARG ARG A . n 
A 1 48  GLU 48  76  76  GLU GLU A . n 
A 1 49  THR 49  77  77  THR THR A . n 
A 1 50  PHE 50  78  78  PHE PHE A . n 
A 1 51  ARG 51  79  79  ARG ARG A . n 
A 1 52  ASN 52  80  80  ASN ASN A . n 
A 1 53  LEU 53  81  81  LEU LEU A . n 
A 1 54  LYS 54  82  82  LYS LYS A . n 
A 1 55  TYR 55  83  83  TYR TYR A . n 
A 1 56  GLU 56  84  84  GLU GLU A . n 
A 1 57  VAL 57  85  85  VAL VAL A . n 
A 1 58  ARG 58  86  86  ARG ARG A . n 
A 1 59  ASN 59  87  87  ASN ASN A . n 
A 1 60  LYS 60  88  88  LYS LYS A . n 
A 1 61  ASN 61  89  89  ASN ASN A . n 
A 1 62  ASP 62  90  90  ASP ASP A . n 
A 1 63  LEU 63  91  91  LEU LEU A . n 
A 1 64  THR 64  92  92  THR THR A . n 
A 1 65  ARG 65  93  93  ARG ARG A . n 
A 1 66  GLU 66  94  94  GLU GLU A . n 
A 1 67  GLU 67  95  95  GLU GLU A . n 
A 1 68  ILE 68  96  96  ILE ILE A . n 
A 1 69  VAL 69  97  97  VAL VAL A . n 
A 1 70  GLU 70  98  98  GLU GLU A . n 
A 1 71  LEU 71  99  99  LEU LEU A . n 
A 1 72  MET 72  100 100 MET MET A . n 
A 1 73  ARG 73  101 101 ARG ARG A . n 
A 1 74  ASP 74  102 102 ASP ASP A . n 
A 1 75  VAL 75  103 103 VAL VAL A . n 
A 1 76  SER 76  104 104 SER SER A . n 
A 1 77  LYS 77  105 105 LYS LYS A . n 
A 1 78  GLU 78  106 106 GLU GLU A . n 
A 1 79  ASP 79  107 107 ASP ASP A . n 
A 1 80  HIS 80  108 108 HIS HIS A . n 
A 1 81  SER 81  109 109 SER SER A . n 
A 1 82  LYS 82  110 110 LYS LYS A . n 
A 1 83  ARG 83  111 111 ARG ARG A . n 
A 1 84  SER 84  112 112 SER SER A . n 
A 1 85  SER 85  113 113 SER SER A . n 
A 1 86  PHE 86  114 114 PHE PHE A . n 
A 1 87  VAL 87  115 115 VAL VAL A . n 
A 1 88  CYS 88  116 116 CYS CYS A . n 
A 1 89  VAL 89  117 117 VAL VAL A . n 
A 1 90  LEU 90  118 118 LEU LEU A . n 
A 1 91  LEU 91  119 119 LEU LEU A . n 
A 1 92  SER 92  120 120 SER SER A . n 
A 1 93  HIS 93  121 121 HIS HIS A . n 
A 1 94  GLY 94  122 122 GLY GLY A . n 
A 1 95  GLU 95  123 123 GLU GLU A . n 
A 1 96  GLU 96  124 124 GLU GLU A . n 
A 1 97  GLY 97  125 125 GLY GLY A . n 
A 1 98  ILE 98  126 126 ILE ILE A . n 
A 1 99  ILE 99  127 127 ILE ILE A . n 
A 1 100 PHE 100 128 128 PHE PHE A . n 
A 1 101 GLY 101 129 129 GLY GLY A . n 
A 1 102 THR 102 130 130 THR THR A . n 
A 1 103 ASN 103 131 131 ASN ASN A . n 
A 1 104 GLY 104 132 132 GLY GLY A . n 
A 1 105 PRO 105 133 133 PRO PRO A . n 
A 1 106 VAL 106 134 134 VAL VAL A . n 
A 1 107 ASP 107 135 135 ASP ASP A . n 
A 1 108 LEU 108 136 136 LEU LEU A . n 
A 1 109 LYS 109 137 137 LYS LYS A . n 
A 1 110 LYS 110 138 138 LYS LYS A . n 
A 1 111 ILE 111 139 139 ILE ILE A . n 
A 1 112 THR 112 140 140 THR THR A . n 
A 1 113 ASN 113 141 141 ASN ASN A . n 
A 1 114 PHE 114 142 142 PHE PHE A . n 
A 1 115 PHE 115 143 143 PHE PHE A . n 
A 1 116 ARG 116 144 144 ARG ARG A . n 
A 1 117 GLY 117 145 145 GLY GLY A . n 
A 1 118 ASP 118 146 146 ASP ASP A . n 
A 1 119 ARG 119 147 147 ARG ARG A . n 
A 1 120 CYS 120 148 148 CYS CYS A . n 
A 1 121 ARG 121 149 149 ARG ARG A . n 
A 1 122 SER 122 150 150 SER SER A . n 
A 1 123 LEU 123 151 151 LEU LEU A . n 
A 1 124 THR 124 152 152 THR THR A . n 
A 1 125 GLY 125 153 153 GLY GLY A . n 
A 1 126 LYS 126 154 154 LYS LYS A . n 
A 1 127 PRO 127 155 155 PRO PRO A . n 
A 1 128 LYS 128 156 156 LYS LYS A . n 
A 1 129 LEU 129 157 157 LEU LEU A . n 
A 1 130 PHE 130 158 158 PHE PHE A . n 
A 1 131 ILE 131 159 159 ILE ILE A . n 
A 1 132 ILE 132 160 160 ILE ILE A . n 
A 1 133 GLN 133 161 161 GLN GLN A . n 
A 1 134 ALA 134 162 162 ALA ALA A . n 
A 1 135 CYS 135 163 163 CYS CYS A . n 
A 1 136 ARG 136 164 164 ARG ARG A . n 
A 1 137 GLY 137 165 165 GLY GLY A . n 
A 1 138 THR 138 166 166 THR THR A . n 
A 1 139 GLU 139 167 167 GLU GLU A . n 
A 1 140 LEU 140 168 168 LEU LEU A . n 
A 1 141 ASP 141 169 169 ASP ASP A . n 
A 1 142 CYS 142 170 170 CYS CYS A . n 
A 1 143 GLY 143 171 171 GLY GLY A . n 
A 1 144 ILE 144 172 172 ILE ILE A . n 
A 1 145 GLU 145 173 173 GLU GLU A . n 
A 1 146 THR 146 174 ?   ?   ?   A . n 
A 1 147 ASP 147 175 ?   ?   ?   A . n 
B 2 1   ASP 1   181 ?   ?   ?   B . n 
B 2 2   MET 2   182 ?   ?   ?   B . n 
B 2 3   ALA 3   183 ?   ?   ?   B . n 
B 2 4   CYS 4   184 ?   ?   ?   B . n 
B 2 5   HIS 5   185 185 HIS HIS B . n 
B 2 6   LYS 6   186 186 LYS LYS B . n 
B 2 7   ILE 7   187 187 ILE ILE B . n 
B 2 8   PRO 8   188 188 PRO PRO B . n 
B 2 9   VAL 9   189 189 VAL VAL B . n 
B 2 10  ASP 10  190 190 ASP ASP B . n 
B 2 11  ALA 11  191 191 ALA ALA B . n 
B 2 12  ASP 12  192 192 ASP ASP B . n 
B 2 13  PHE 13  193 193 PHE PHE B . n 
B 2 14  LEU 14  194 194 LEU LEU B . n 
B 2 15  TYR 15  195 195 TYR TYR B . n 
B 2 16  ALA 16  196 196 ALA ALA B . n 
B 2 17  TYR 17  197 197 TYR TYR B . n 
B 2 18  SER 18  198 198 SER SER B . n 
B 2 19  THR 19  199 199 THR THR B . n 
B 2 20  ALA 20  200 200 ALA ALA B . n 
B 2 21  PRO 21  201 201 PRO PRO B . n 
B 2 22  GLY 22  202 202 GLY GLY B . n 
B 2 23  TYR 23  203 203 TYR TYR B . n 
B 2 24  TYR 24  204 204 TYR TYR B . n 
B 2 25  SER 25  205 205 SER SER B . n 
B 2 26  TRP 26  206 206 TRP TRP B . n 
B 2 27  ARG 27  207 207 ARG ARG B . n 
B 2 28  ASN 28  208 208 ASN ASN B . n 
B 2 29  SER 29  209 209 SER SER B . n 
B 2 30  LYS 30  210 210 LYS LYS B . n 
B 2 31  ASP 31  211 211 ASP ASP B . n 
B 2 32  GLY 32  212 212 GLY GLY B . n 
B 2 33  SER 33  213 213 SER SER B . n 
B 2 34  TRP 34  214 214 TRP TRP B . n 
B 2 35  PHE 35  215 215 PHE PHE B . n 
B 2 36  ILE 36  216 216 ILE ILE B . n 
B 2 37  GLN 37  217 217 GLN GLN B . n 
B 2 38  SER 38  218 218 SER SER B . n 
B 2 39  LEU 39  219 219 LEU LEU B . n 
B 2 40  CYS 40  220 220 CYS CYS B . n 
B 2 41  ALA 41  221 221 ALA ALA B . n 
B 2 42  MET 42  222 222 MET MET B . n 
B 2 43  LEU 43  223 223 LEU LEU B . n 
B 2 44  LYS 44  224 224 LYS LYS B . n 
B 2 45  GLN 45  225 225 GLN GLN B . n 
B 2 46  TYR 46  226 226 TYR TYR B . n 
B 2 47  ALA 47  227 227 ALA ALA B . n 
B 2 48  ASP 48  228 228 ASP ASP B . n 
B 2 49  LYS 49  229 229 LYS LYS B . n 
B 2 50  LEU 50  230 230 LEU LEU B . n 
B 2 51  GLU 51  231 231 GLU GLU B . n 
B 2 52  PHE 52  232 232 PHE PHE B . n 
B 2 53  MET 53  233 233 MET MET B . n 
B 2 54  HIS 54  234 234 HIS HIS B . n 
B 2 55  ILE 55  235 235 ILE ILE B . n 
B 2 56  LEU 56  236 236 LEU LEU B . n 
B 2 57  THR 57  237 237 THR THR B . n 
B 2 58  ARG 58  238 238 ARG ARG B . n 
B 2 59  VAL 59  239 239 VAL VAL B . n 
B 2 60  ASN 60  240 240 ASN ASN B . n 
B 2 61  ARG 61  241 241 ARG ARG B . n 
B 2 62  LYS 62  242 242 LYS LYS B . n 
B 2 63  VAL 63  243 243 VAL VAL B . n 
B 2 64  ALA 64  244 244 ALA ALA B . n 
B 2 65  THR 65  245 245 THR THR B . n 
B 2 66  GLU 66  246 246 GLU GLU B . n 
B 2 67  PHE 67  247 247 PHE PHE B . n 
B 2 68  GLU 68  248 248 GLU GLU B . n 
B 2 69  SER 69  249 249 SER SER B . n 
B 2 70  PHE 70  250 250 PHE PHE B . n 
B 2 71  SER 71  251 251 SER SER B . n 
B 2 72  PHE 72  252 252 PHE PHE B . n 
B 2 73  ASP 73  253 253 ASP ASP B . n 
B 2 74  ALA 74  254 254 ALA ALA B . n 
B 2 75  THR 75  255 255 THR THR B . n 
B 2 76  PHE 76  256 256 PHE PHE B . n 
B 2 77  HIS 77  257 257 HIS HIS B . n 
B 2 78  ALA 78  258 258 ALA ALA B . n 
B 2 79  LYS 79  259 259 LYS LYS B . n 
B 2 80  LYS 80  260 260 LYS LYS B . n 
B 2 81  GLN 81  261 261 GLN GLN B . n 
B 2 82  ILE 82  262 262 ILE ILE B . n 
B 2 83  PRO 83  263 263 PRO PRO B . n 
B 2 84  CYS 84  264 264 CYS CYS B . n 
B 2 85  ILE 85  265 265 ILE ILE B . n 
B 2 86  VAL 86  266 266 VAL VAL B . n 
B 2 87  SER 87  267 267 SER SER B . n 
B 2 88  MET 88  268 268 MET MET B . n 
B 2 89  LEU 89  269 269 LEU LEU B . n 
B 2 90  THR 90  270 270 THR THR B . n 
B 2 91  LYS 91  271 271 LYS LYS B . n 
B 2 92  GLU 92  272 272 GLU GLU B . n 
B 2 93  LEU 93  273 273 LEU LEU B . n 
B 2 94  TYR 94  274 274 TYR TYR B . n 
B 2 95  PHE 95  275 275 PHE PHE B . n 
B 2 96  TYR 96  276 276 TYR TYR B . n 
B 2 97  HIS 97  277 277 HIS HIS B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 MSI 1  1   1  MSI MSI A . 
D 4 HOH 1  176 2  HOH HOH A . 
D 4 HOH 2  177 8  HOH HOH A . 
D 4 HOH 3  178 9  HOH HOH A . 
D 4 HOH 4  179 10 HOH HOH A . 
D 4 HOH 5  180 11 HOH HOH A . 
D 4 HOH 6  181 14 HOH HOH A . 
D 4 HOH 7  182 16 HOH HOH A . 
D 4 HOH 8  183 17 HOH HOH A . 
D 4 HOH 9  184 18 HOH HOH A . 
D 4 HOH 10 185 19 HOH HOH A . 
D 4 HOH 11 186 20 HOH HOH A . 
D 4 HOH 12 187 22 HOH HOH A . 
D 4 HOH 13 188 24 HOH HOH A . 
D 4 HOH 14 189 26 HOH HOH A . 
D 4 HOH 15 190 27 HOH HOH A . 
D 4 HOH 16 191 28 HOH HOH A . 
D 4 HOH 17 192 29 HOH HOH A . 
D 4 HOH 18 193 30 HOH HOH A . 
D 4 HOH 19 194 31 HOH HOH A . 
D 4 HOH 20 195 32 HOH HOH A . 
D 4 HOH 21 196 34 HOH HOH A . 
D 4 HOH 22 197 35 HOH HOH A . 
D 4 HOH 23 198 36 HOH HOH A . 
D 4 HOH 24 199 37 HOH HOH A . 
D 4 HOH 25 200 38 HOH HOH A . 
D 4 HOH 26 201 39 HOH HOH A . 
D 4 HOH 27 202 40 HOH HOH A . 
D 4 HOH 28 203 45 HOH HOH A . 
E 4 HOH 1  1   1  HOH HOH B . 
E 4 HOH 2  3   3  HOH HOH B . 
E 4 HOH 3  4   4  HOH HOH B . 
E 4 HOH 4  5   5  HOH HOH B . 
E 4 HOH 5  6   6  HOH HOH B . 
E 4 HOH 6  7   7  HOH HOH B . 
E 4 HOH 7  12  12 HOH HOH B . 
E 4 HOH 8  13  13 HOH HOH B . 
E 4 HOH 9  15  15 HOH HOH B . 
E 4 HOH 10 21  21 HOH HOH B . 
E 4 HOH 11 23  23 HOH HOH B . 
E 4 HOH 12 25  25 HOH HOH B . 
E 4 HOH 13 33  33 HOH HOH B . 
E 4 HOH 14 41  41 HOH HOH B . 
E 4 HOH 15 42  42 HOH HOH B . 
E 4 HOH 16 43  43 HOH HOH B . 
E 4 HOH 17 44  44 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 software_defined_assembly            PISA octameric  8 
3 software_defined_assembly            PISA octameric  8 
4 software_defined_assembly            PISA tetrameric 4 
5 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1       A,B,C,D,E 
2 1,2,3,4 A,B,C,D,E 
3 1,5,3,6 A,B,C,D,E 
4 1,3     A,B,C,D,E 
5 1,6     A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5070  ? 
1 MORE         -23   ? 
1 'SSA (A^2)'  11720 ? 
2 'ABSA (A^2)' 33290 ? 
2 MORE         -144  ? 
2 'SSA (A^2)'  33880 ? 
3 'ABSA (A^2)' 32650 ? 
3 MORE         -163  ? 
3 'SSA (A^2)'  34510 ? 
4 'ABSA (A^2)' 14720 ? 
4 MORE         -70   ? 
4 'SSA (A^2)'  18860 ? 
5 'ABSA (A^2)' 11670 ? 
5 MORE         -56   ? 
5 'SSA (A^2)'  21910 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000  
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 67.2000000000 0.0000000000 -1.0000000000 
0.0000000000 83.3000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
3 'crystal symmetry operation' 3_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 67.2000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000  0.0000000000 0.0000000000 -1.0000000000 96.0000000000 
4 'crystal symmetry operation' 4_566 x,-y+1,-z+1 1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 -1.0000000000 
0.0000000000 83.3000000000 0.0000000000 0.0000000000 -1.0000000000 96.0000000000 
5 'crystal symmetry operation' 2_655 -x+1,-y,z   -1.0000000000 0.0000000000 0.0000000000 67.2000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
6 'crystal symmetry operation' 4_556 x,-y,-z+1   1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 -1.0000000000 
0.0000000000 0.0000000000  0.0000000000 0.0000000000 -1.0000000000 96.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-06-23 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
5 'Structure model' 1 4 2019-07-24 
6 'Structure model' 1 5 2019-08-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Refinement description'    
5 5 'Structure model' 'Data collection'           
6 5 'Structure model' 'Derived calculations'      
7 5 'Structure model' 'Refinement description'    
8 6 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 
2 4 'Structure model' software                     
3 5 'Structure model' software                     
4 5 'Structure model' struct_conn                  
5 6 'Structure model' computing                    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_software.classification'            
2 5 'Structure model' '_software.name'                      
3 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement        .             ? 1 
DENZO     'data reduction'  .             ? 2 
SCALEPACK 'data scaling'    .             ? 3 
AMoRE     phasing           .             ? 4 
X-PLOR    refinement        '3.851 & CNS' ? 5 
MAR345    'data collection' .             ? 6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 ND2 A ASN 51  ? ? OG1 A THR 67  ? ? 2.10 
2 1 O   B ARG 241 ? ? OG1 B THR 245 ? ? 2.11 
3 1 OG1 B THR 245 ? ? O   B HOH 21  ? ? 2.19 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             N 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             GLY 
_pdbx_validate_rmsd_angle.auth_seq_id_1              129 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             GLY 
_pdbx_validate_rmsd_angle.auth_seq_id_2              129 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             C 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             GLY 
_pdbx_validate_rmsd_angle.auth_seq_id_3              129 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                97.94 
_pdbx_validate_rmsd_angle.angle_target_value         113.10 
_pdbx_validate_rmsd_angle.angle_deviation            -15.16 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 34  ? ? -174.22 63.07   
2  1 PRO A 42  ? ? -39.78  -30.08  
3  1 ASN A 51  ? ? -102.37 74.07   
4  1 LYS A 57  ? ? -28.59  -40.83  
5  1 ASP A 90  ? ? 32.00   69.84   
6  1 SER A 120 ? ? -173.41 -166.89 
7  1 LYS B 210 ? ? -99.66  -62.70  
8  1 TYR B 226 ? ? -143.95 -7.44   
9  1 LYS B 229 ? ? -136.20 -52.81  
10 1 GLU B 248 ? ? -164.16 119.74  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 174 ? A THR 146 
2 1 Y 1 A ASP 175 ? A ASP 147 
3 1 Y 1 B ASP 181 ? B ASP 1   
4 1 Y 1 B MET 182 ? B MET 2   
5 1 Y 1 B ALA 183 ? B ALA 3   
6 1 Y 1 B CYS 184 ? B CYS 4   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 '1-METHYL-5-(2-PHENOXYMETHYL-PYRROLIDINE-1-SULFONYL)-1H-INDOLE-2,3-DIONE' MSI 
4 water                                                                     HOH 
#