data_1GIA
# 
_entry.id   1GIA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GIA         
WWPDB D_1000173580 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GIA 
_pdbx_database_status.recvd_initial_deposition_date   1994-07-20 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Berghuis, A.M.' 1 
'Coleman, D.E.'  2 
'Sprang, S.R.'   3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structures of active conformations of Gi alpha 1 and the mechanism of GTP hydrolysis.'                                
Science     265 1405 1412 1994 SCIEAS US 0036-8075 0038 ? 8073283 ? 
1       'Crystallization and Preliminary Crystallographic Studies of Gia1 and Mutants of Gia1 in the GTP and Gdp-Bound States' 
J.Mol.Biol. 238 630  ?    1994 JMOBAK UK 0022-2836 0070 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Coleman, D.E.'  1  
primary 'Berghuis, A.M.' 2  
primary 'Lee, E.'        3  
primary 'Linder, M.E.'   4  
primary 'Gilman, A.G.'   5  
primary 'Sprang, S.R.'   6  
1       'Coleman, D.E.'  7  
1       'Lee, E.'        8  
1       'Mixon, M.B.'    9  
1       'Linder, M.E.'   10 
1       'Berghuis, A.M.' 11 
1       'Gilman, A.G.'   12 
1       'Sprang, S.R.'   13 
# 
_cell.entry_id           1GIA 
_cell.length_a           80.600 
_cell.length_b           80.600 
_cell.length_c           106.500 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GIA 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'G PROTEIN GI ALPHA 1'                       40267.836 1   ? ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'                              24.305    1   ? ? ? ? 
3 non-polymer syn "5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE" 539.246   1   ? ? ? ? 
4 water       nat water                                        18.015    126 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSI
IAIIRAMGRLKIDFGDAARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDR
IAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMN
RMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYT
HFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSI
IAIIRAMGRLKIDFGDAARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDR
IAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMN
RMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYT
HFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   CYS n 
1 3   THR n 
1 4   LEU n 
1 5   SER n 
1 6   ALA n 
1 7   GLU n 
1 8   ASP n 
1 9   LYS n 
1 10  ALA n 
1 11  ALA n 
1 12  VAL n 
1 13  GLU n 
1 14  ARG n 
1 15  SER n 
1 16  LYS n 
1 17  MET n 
1 18  ILE n 
1 19  ASP n 
1 20  ARG n 
1 21  ASN n 
1 22  LEU n 
1 23  ARG n 
1 24  GLU n 
1 25  ASP n 
1 26  GLY n 
1 27  GLU n 
1 28  LYS n 
1 29  ALA n 
1 30  ALA n 
1 31  ARG n 
1 32  GLU n 
1 33  VAL n 
1 34  LYS n 
1 35  LEU n 
1 36  LEU n 
1 37  LEU n 
1 38  LEU n 
1 39  GLY n 
1 40  ALA n 
1 41  GLY n 
1 42  GLU n 
1 43  SER n 
1 44  GLY n 
1 45  LYS n 
1 46  SER n 
1 47  THR n 
1 48  ILE n 
1 49  VAL n 
1 50  LYS n 
1 51  GLN n 
1 52  MET n 
1 53  LYS n 
1 54  ILE n 
1 55  ILE n 
1 56  HIS n 
1 57  GLU n 
1 58  ALA n 
1 59  GLY n 
1 60  TYR n 
1 61  SER n 
1 62  GLU n 
1 63  GLU n 
1 64  GLU n 
1 65  CYS n 
1 66  LYS n 
1 67  GLN n 
1 68  TYR n 
1 69  LYS n 
1 70  ALA n 
1 71  VAL n 
1 72  VAL n 
1 73  TYR n 
1 74  SER n 
1 75  ASN n 
1 76  THR n 
1 77  ILE n 
1 78  GLN n 
1 79  SER n 
1 80  ILE n 
1 81  ILE n 
1 82  ALA n 
1 83  ILE n 
1 84  ILE n 
1 85  ARG n 
1 86  ALA n 
1 87  MET n 
1 88  GLY n 
1 89  ARG n 
1 90  LEU n 
1 91  LYS n 
1 92  ILE n 
1 93  ASP n 
1 94  PHE n 
1 95  GLY n 
1 96  ASP n 
1 97  ALA n 
1 98  ALA n 
1 99  ARG n 
1 100 ALA n 
1 101 ASP n 
1 102 ASP n 
1 103 ALA n 
1 104 ARG n 
1 105 GLN n 
1 106 LEU n 
1 107 PHE n 
1 108 VAL n 
1 109 LEU n 
1 110 ALA n 
1 111 GLY n 
1 112 ALA n 
1 113 ALA n 
1 114 GLU n 
1 115 GLU n 
1 116 GLY n 
1 117 PHE n 
1 118 MET n 
1 119 THR n 
1 120 ALA n 
1 121 GLU n 
1 122 LEU n 
1 123 ALA n 
1 124 GLY n 
1 125 VAL n 
1 126 ILE n 
1 127 LYS n 
1 128 ARG n 
1 129 LEU n 
1 130 TRP n 
1 131 LYS n 
1 132 ASP n 
1 133 SER n 
1 134 GLY n 
1 135 VAL n 
1 136 GLN n 
1 137 ALA n 
1 138 CYS n 
1 139 PHE n 
1 140 ASN n 
1 141 ARG n 
1 142 SER n 
1 143 ARG n 
1 144 GLU n 
1 145 TYR n 
1 146 GLN n 
1 147 LEU n 
1 148 ASN n 
1 149 ASP n 
1 150 SER n 
1 151 ALA n 
1 152 ALA n 
1 153 TYR n 
1 154 TYR n 
1 155 LEU n 
1 156 ASN n 
1 157 ASP n 
1 158 LEU n 
1 159 ASP n 
1 160 ARG n 
1 161 ILE n 
1 162 ALA n 
1 163 GLN n 
1 164 PRO n 
1 165 ASN n 
1 166 TYR n 
1 167 ILE n 
1 168 PRO n 
1 169 THR n 
1 170 GLN n 
1 171 GLN n 
1 172 ASP n 
1 173 VAL n 
1 174 LEU n 
1 175 ARG n 
1 176 THR n 
1 177 ARG n 
1 178 VAL n 
1 179 LYS n 
1 180 THR n 
1 181 THR n 
1 182 GLY n 
1 183 ILE n 
1 184 VAL n 
1 185 GLU n 
1 186 THR n 
1 187 HIS n 
1 188 PHE n 
1 189 THR n 
1 190 PHE n 
1 191 LYS n 
1 192 ASP n 
1 193 LEU n 
1 194 HIS n 
1 195 PHE n 
1 196 LYS n 
1 197 MET n 
1 198 PHE n 
1 199 ASP n 
1 200 VAL n 
1 201 GLY n 
1 202 GLY n 
1 203 GLN n 
1 204 ARG n 
1 205 SER n 
1 206 GLU n 
1 207 ARG n 
1 208 LYS n 
1 209 LYS n 
1 210 TRP n 
1 211 ILE n 
1 212 HIS n 
1 213 CYS n 
1 214 PHE n 
1 215 GLU n 
1 216 GLY n 
1 217 VAL n 
1 218 THR n 
1 219 ALA n 
1 220 ILE n 
1 221 ILE n 
1 222 PHE n 
1 223 CYS n 
1 224 VAL n 
1 225 ALA n 
1 226 LEU n 
1 227 SER n 
1 228 ASP n 
1 229 TYR n 
1 230 ASP n 
1 231 LEU n 
1 232 VAL n 
1 233 LEU n 
1 234 ALA n 
1 235 GLU n 
1 236 ASP n 
1 237 GLU n 
1 238 GLU n 
1 239 MET n 
1 240 ASN n 
1 241 ARG n 
1 242 MET n 
1 243 HIS n 
1 244 GLU n 
1 245 SER n 
1 246 MET n 
1 247 LYS n 
1 248 LEU n 
1 249 PHE n 
1 250 ASP n 
1 251 SER n 
1 252 ILE n 
1 253 CYS n 
1 254 ASN n 
1 255 ASN n 
1 256 LYS n 
1 257 TRP n 
1 258 PHE n 
1 259 THR n 
1 260 ASP n 
1 261 THR n 
1 262 SER n 
1 263 ILE n 
1 264 ILE n 
1 265 LEU n 
1 266 PHE n 
1 267 LEU n 
1 268 ASN n 
1 269 LYS n 
1 270 LYS n 
1 271 ASP n 
1 272 LEU n 
1 273 PHE n 
1 274 GLU n 
1 275 GLU n 
1 276 LYS n 
1 277 ILE n 
1 278 LYS n 
1 279 LYS n 
1 280 SER n 
1 281 PRO n 
1 282 LEU n 
1 283 THR n 
1 284 ILE n 
1 285 CYS n 
1 286 TYR n 
1 287 PRO n 
1 288 GLU n 
1 289 TYR n 
1 290 ALA n 
1 291 GLY n 
1 292 SER n 
1 293 ASN n 
1 294 THR n 
1 295 TYR n 
1 296 GLU n 
1 297 GLU n 
1 298 ALA n 
1 299 ALA n 
1 300 ALA n 
1 301 TYR n 
1 302 ILE n 
1 303 GLN n 
1 304 CYS n 
1 305 GLN n 
1 306 PHE n 
1 307 GLU n 
1 308 ASP n 
1 309 LEU n 
1 310 ASN n 
1 311 LYS n 
1 312 ARG n 
1 313 LYS n 
1 314 ASP n 
1 315 THR n 
1 316 LYS n 
1 317 GLU n 
1 318 ILE n 
1 319 TYR n 
1 320 THR n 
1 321 HIS n 
1 322 PHE n 
1 323 THR n 
1 324 CYS n 
1 325 ALA n 
1 326 THR n 
1 327 ASP n 
1 328 THR n 
1 329 LYS n 
1 330 ASN n 
1 331 VAL n 
1 332 GLN n 
1 333 PHE n 
1 334 VAL n 
1 335 PHE n 
1 336 ASP n 
1 337 ALA n 
1 338 VAL n 
1 339 THR n 
1 340 ASP n 
1 341 VAL n 
1 342 ILE n 
1 343 ILE n 
1 344 LYS n 
1 345 ASN n 
1 346 ASN n 
1 347 LEU n 
1 348 LYS n 
1 349 ASP n 
1 350 CYS n 
1 351 GLY n 
1 352 LEU n 
1 353 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Norway rat' 
_entity_src_gen.gene_src_genus                     Rattus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus norvegicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10116 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'PQE6 VECTOR' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GNAI1_RAT 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P10824 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;GCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSI
IAIIRAMGRLKIDFGDAARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDR
IAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMN
RMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYT
HFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1GIA 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 353 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P10824 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  353 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       354 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                      ? 'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE                                     ? 'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE                                   ? 'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                              ? 'C4 H7 N O4'          133.103 
CYS 'L-peptide linking' y CYSTEINE                                     ? 'C3 H7 N O2 S'        121.158 
GLN 'L-peptide linking' y GLUTAMINE                                    ? 'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                              ? 'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE                                      ? 'C2 H5 N O2'          75.067  
GSP non-polymer         . "5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE" ? 'C10 H16 N5 O13 P3 S' 539.246 
HIS 'L-peptide linking' y HISTIDINE                                    ? 'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER                                        ? 'H2 O'                18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                   ? 'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE                                      ? 'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE                                       ? 'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE                                   ? 'C5 H11 N O2 S'       149.211 
MG  non-polymer         . 'MAGNESIUM ION'                              ? 'Mg 2'                24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                ? 'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE                                      ? 'C5 H9 N O2'          115.130 
SER 'L-peptide linking' y SERINE                                       ? 'C3 H7 N O3'          105.093 
THR 'L-peptide linking' y THREONINE                                    ? 'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                   ? 'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE                                     ? 'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE                                       ? 'C5 H11 N O2'         117.146 
# 
_exptl.entry_id          1GIA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.48 
_exptl_crystal.density_percent_sol   50.40 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_reflns.entry_id                     1GIA 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            ? 
_reflns.number_obs                   24198 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1GIA 
_refine.ls_number_reflns_obs                     22440 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1750000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1750000 
_refine.ls_R_factor_R_free                       0.2280000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               20 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'THE STRUCTURE IS DISTORTED AT GLN 68 AND ILE 85.' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2491 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         33 
_refine_hist.number_atoms_solvent             126 
_refine_hist.number_atoms_total               2650 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        8.0 
# 
_struct.entry_id                  1GIA 
_struct.title                     'STRUCTURE OF ACTIVE CONFORMATIONS OF GIA1 AND THE MECHANISM OF GTP HYDROLYSIS' 
_struct.pdbx_descriptor           'GI ALPHA 1 (ACTIVE FORM WITH BOUND GTP-GAMMA-S)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GIA 
_struct_keywords.pdbx_keywords   'SIGNAL TRANSDUCTION PROTEIN' 
_struct_keywords.text            'SIGNAL TRANSDUCTION PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  A1 GLY A 44  ? GLU A 57  ? GLY A 45  GLU A 58  1 'DISTORTED AT VAL 50'  14 
HELX_P HELX_P2  AA SER A 61  ? LEU A 90  ? SER A 62  LEU A 91  1 'SEE REMARK 6'         30 
HELX_P HELX_P3  AB ASP A 96  ? GLY A 116 ? ASP A 97  GLY A 117 1 'SEE REMARK 7'         21 
HELX_P HELX_P4  AC THR A 119 ? LYS A 131 ? THR A 120 LYS A 132 1 ?                      13 
HELX_P HELX_P5  AD ASP A 132 ? TYR A 145 ? ASP A 133 TYR A 146 1 'SEE REMARK 8'         14 
HELX_P HELX_P6  AE SER A 150 ? ALA A 162 ? SER A 151 ALA A 163 1 'DISTORTED AT ASP 158' 13 
HELX_P HELX_P7  AF GLN A 170 ? ARG A 175 ? GLN A 171 ARG A 176 1 ?                      6  
HELX_P HELX_P8  A2 GLU A 206 ? PHE A 214 ? GLU A 207 PHE A 215 5 '(3/10 HELIX)'         9  
HELX_P HELX_P9  A3 ASN A 240 ? ASN A 254 ? ASN A 241 ASN A 255 1 ?                      15 
HELX_P HELX_P10 AG LYS A 269 ? ILE A 277 ? LYS A 270 ILE A 278 1 ?                      9  
HELX_P HELX_P11 A4 THR A 294 ? ASP A 308 ? THR A 295 ASP A 309 1 ?                      15 
HELX_P HELX_P12 A5 ASP A 327 ? ILE A 342 ? ASP A 328 ILE A 343 1 ?                      16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C GSP . O2G ? ? ? 1_555 B MG  .   MG  ? ? A GSP 355 A MG  356 1_555 ? ? ? ? ? ? ? 1.991 ? 
metalc2 metalc ? ? B MG  . MG  ? ? ? 1_555 C GSP .   O2B ? ? A MG  356 A GSP 355 1_555 ? ? ? ? ? ? ? 2.101 ? 
metalc3 metalc ? ? B MG  . MG  ? ? ? 1_555 A SER 46  OG  ? ? A MG  356 A SER 47  1_555 ? ? ? ? ? ? ? 1.938 ? 
metalc4 metalc ? ? B MG  . MG  ? ? ? 1_555 A THR 180 OG1 ? ? A MG  356 A THR 181 1_555 ? ? ? ? ? ? ? 2.077 ? 
metalc5 metalc ? ? B MG  . MG  ? ? ? 1_555 D HOH .   O   ? ? A MG  356 A HOH 413 1_555 ? ? ? ? ? ? ? 2.087 ? 
metalc6 metalc ? ? B MG  . MG  ? ? ? 1_555 D HOH .   O   ? ? A MG  356 A HOH 410 1_555 ? ? ? ? ? ? ? 2.042 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               B 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
B 1 VAL A 184 ? PHE A 190 ? VAL A 185 PHE A 191 
B 2 LEU A 193 ? ASP A 199 ? LEU A 194 ASP A 200 
B 3 VAL A 33  ? LEU A 38  ? VAL A 34  LEU A 39  
B 4 THR A 218 ? LEU A 226 ? THR A 219 LEU A 227 
B 5 SER A 262 ? ASN A 268 ? SER A 263 ASN A 269 
B 6 TYR A 319 ? THR A 323 ? TYR A 320 THR A 324 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 356'  
AC2 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE GSP A 355' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  SER A 46  ? SER A 47  . ? 1_555 ? 
2  AC1 5  THR A 180 ? THR A 181 . ? 1_555 ? 
3  AC1 5  GSP C .   ? GSP A 355 . ? 1_555 ? 
4  AC1 5  HOH D .   ? HOH A 410 . ? 1_555 ? 
5  AC1 5  HOH D .   ? HOH A 413 . ? 1_555 ? 
6  AC2 28 GLU A 42  ? GLU A 43  . ? 1_555 ? 
7  AC2 28 SER A 43  ? SER A 44  . ? 1_555 ? 
8  AC2 28 GLY A 44  ? GLY A 45  . ? 1_555 ? 
9  AC2 28 LYS A 45  ? LYS A 46  . ? 1_555 ? 
10 AC2 28 SER A 46  ? SER A 47  . ? 1_555 ? 
11 AC2 28 THR A 47  ? THR A 48  . ? 1_555 ? 
12 AC2 28 ASP A 149 ? ASP A 150 . ? 1_555 ? 
13 AC2 28 SER A 150 ? SER A 151 . ? 1_555 ? 
14 AC2 28 LEU A 174 ? LEU A 175 . ? 1_555 ? 
15 AC2 28 ARG A 175 ? ARG A 176 . ? 1_555 ? 
16 AC2 28 THR A 176 ? THR A 177 . ? 1_555 ? 
17 AC2 28 ARG A 177 ? ARG A 178 . ? 1_555 ? 
18 AC2 28 THR A 180 ? THR A 181 . ? 1_555 ? 
19 AC2 28 GLY A 201 ? GLY A 202 . ? 1_555 ? 
20 AC2 28 GLY A 202 ? GLY A 203 . ? 1_555 ? 
21 AC2 28 ASN A 268 ? ASN A 269 . ? 1_555 ? 
22 AC2 28 LYS A 269 ? LYS A 270 . ? 1_555 ? 
23 AC2 28 ASP A 271 ? ASP A 272 . ? 1_555 ? 
24 AC2 28 CYS A 324 ? CYS A 325 . ? 1_555 ? 
25 AC2 28 ALA A 325 ? ALA A 326 . ? 1_555 ? 
26 AC2 28 THR A 326 ? THR A 327 . ? 1_555 ? 
27 AC2 28 MG  B .   ? MG  A 356 . ? 1_555 ? 
28 AC2 28 HOH D .   ? HOH A 401 . ? 1_555 ? 
29 AC2 28 HOH D .   ? HOH A 402 . ? 1_555 ? 
30 AC2 28 HOH D .   ? HOH A 403 . ? 1_555 ? 
31 AC2 28 HOH D .   ? HOH A 410 . ? 1_555 ? 
32 AC2 28 HOH D .   ? HOH A 412 . ? 1_555 ? 
33 AC2 28 HOH D .   ? HOH A 413 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1GIA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GIA 
_atom_sites.fract_transf_matrix[1][1]   0.012407 
_atom_sites.fract_transf_matrix[1][2]   0.007163 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014326 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009390 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . VAL A 1 33  ? 14.104 -28.815 8.269   1.00 21.66 ? 34  VAL A N     1 
ATOM   2    C  CA    . VAL A 1 33  ? 15.188 -29.496 7.487   1.00 22.75 ? 34  VAL A CA    1 
ATOM   3    C  C     . VAL A 1 33  ? 16.353 -29.825 8.414   1.00 22.63 ? 34  VAL A C     1 
ATOM   4    O  O     . VAL A 1 33  ? 16.936 -28.918 9.011   1.00 21.82 ? 34  VAL A O     1 
ATOM   5    C  CB    . VAL A 1 33  ? 15.750 -28.587 6.358   1.00 23.87 ? 34  VAL A CB    1 
ATOM   6    C  CG1   . VAL A 1 33  ? 16.701 -29.378 5.482   1.00 23.50 ? 34  VAL A CG1   1 
ATOM   7    C  CG2   . VAL A 1 33  ? 14.622 -27.977 5.532   1.00 25.80 ? 34  VAL A CG2   1 
ATOM   8    N  N     . LYS A 1 34  ? 16.645 -31.112 8.584   1.00 20.27 ? 35  LYS A N     1 
ATOM   9    C  CA    . LYS A 1 34  ? 17.759 -31.516 9.422   1.00 18.37 ? 35  LYS A CA    1 
ATOM   10   C  C     . LYS A 1 34  ? 18.901 -32.014 8.535   1.00 19.33 ? 35  LYS A C     1 
ATOM   11   O  O     . LYS A 1 34  ? 18.733 -32.968 7.764   1.00 15.53 ? 35  LYS A O     1 
ATOM   12   C  CB    . LYS A 1 34  ? 17.342 -32.594 10.429  1.00 21.22 ? 35  LYS A CB    1 
ATOM   13   C  CG    . LYS A 1 34  ? 18.523 -33.221 11.147  1.00 23.50 ? 35  LYS A CG    1 
ATOM   14   C  CD    . LYS A 1 34  ? 18.122 -34.206 12.233  1.00 26.03 ? 35  LYS A CD    1 
ATOM   15   C  CE    . LYS A 1 34  ? 19.387 -34.904 12.750  1.00 28.91 ? 35  LYS A CE    1 
ATOM   16   N  NZ    . LYS A 1 34  ? 19.239 -35.681 14.016  1.00 28.78 ? 35  LYS A NZ    1 
ATOM   17   N  N     . LEU A 1 35  ? 20.046 -31.340 8.644   1.00 15.70 ? 36  LEU A N     1 
ATOM   18   C  CA    . LEU A 1 35  ? 21.243 -31.672 7.884   1.00 15.58 ? 36  LEU A CA    1 
ATOM   19   C  C     . LEU A 1 35  ? 22.356 -32.179 8.808   1.00 16.80 ? 36  LEU A C     1 
ATOM   20   O  O     . LEU A 1 35  ? 22.621 -31.585 9.859   1.00 16.09 ? 36  LEU A O     1 
ATOM   21   C  CB    . LEU A 1 35  ? 21.745 -30.449 7.112   1.00 15.15 ? 36  LEU A CB    1 
ATOM   22   C  CG    . LEU A 1 35  ? 20.807 -29.896 6.044   1.00 19.50 ? 36  LEU A CG    1 
ATOM   23   C  CD1   . LEU A 1 35  ? 21.466 -28.716 5.346   1.00 18.97 ? 36  LEU A CD1   1 
ATOM   24   C  CD2   . LEU A 1 35  ? 20.473 -30.981 5.033   1.00 20.85 ? 36  LEU A CD2   1 
ATOM   25   N  N     . LEU A 1 36  ? 23.004 -33.270 8.401   1.00 15.04 ? 37  LEU A N     1 
ATOM   26   C  CA    . LEU A 1 36  ? 24.092 -33.878 9.160   1.00 14.92 ? 37  LEU A CA    1 
ATOM   27   C  C     . LEU A 1 36  ? 25.346 -33.833 8.295   1.00 14.50 ? 37  LEU A C     1 
ATOM   28   O  O     . LEU A 1 36  ? 25.298 -34.249 7.138   1.00 15.42 ? 37  LEU A O     1 
ATOM   29   C  CB    . LEU A 1 36  ? 23.741 -35.338 9.505   1.00 13.01 ? 37  LEU A CB    1 
ATOM   30   C  CG    . LEU A 1 36  ? 24.745 -36.192 10.279  1.00 11.87 ? 37  LEU A CG    1 
ATOM   31   C  CD1   . LEU A 1 36  ? 25.187 -35.464 11.557  1.00 11.02 ? 37  LEU A CD1   1 
ATOM   32   C  CD2   . LEU A 1 36  ? 24.131 -37.565 10.587  1.00 8.54  ? 37  LEU A CD2   1 
ATOM   33   N  N     . LEU A 1 37  ? 26.432 -33.276 8.836   1.00 11.81 ? 38  LEU A N     1 
ATOM   34   C  CA    . LEU A 1 37  ? 27.715 -33.173 8.134   1.00 11.68 ? 38  LEU A CA    1 
ATOM   35   C  C     . LEU A 1 37  ? 28.627 -34.310 8.572   1.00 10.03 ? 38  LEU A C     1 
ATOM   36   O  O     . LEU A 1 37  ? 28.969 -34.408 9.746   1.00 14.50 ? 38  LEU A O     1 
ATOM   37   C  CB    . LEU A 1 37  ? 28.407 -31.846 8.469   1.00 9.88  ? 38  LEU A CB    1 
ATOM   38   C  CG    . LEU A 1 37  ? 27.737 -30.542 8.060   1.00 12.18 ? 38  LEU A CG    1 
ATOM   39   C  CD1   . LEU A 1 37  ? 28.369 -29.435 8.852   1.00 18.02 ? 38  LEU A CD1   1 
ATOM   40   C  CD2   . LEU A 1 37  ? 27.911 -30.266 6.585   1.00 17.62 ? 38  LEU A CD2   1 
ATOM   41   N  N     . LEU A 1 38  ? 29.018 -35.172 7.644   1.00 8.12  ? 39  LEU A N     1 
ATOM   42   C  CA    . LEU A 1 38  ? 29.895 -36.289 7.971   1.00 9.54  ? 39  LEU A CA    1 
ATOM   43   C  C     . LEU A 1 38  ? 31.153 -36.267 7.105   1.00 9.47  ? 39  LEU A C     1 
ATOM   44   O  O     . LEU A 1 38  ? 31.197 -35.588 6.073   1.00 11.40 ? 39  LEU A O     1 
ATOM   45   C  CB    . LEU A 1 38  ? 29.166 -37.636 7.806   1.00 11.55 ? 39  LEU A CB    1 
ATOM   46   C  CG    . LEU A 1 38  ? 27.955 -37.889 8.727   1.00 14.88 ? 39  LEU A CG    1 
ATOM   47   C  CD1   . LEU A 1 38  ? 27.328 -39.228 8.371   1.00 13.71 ? 39  LEU A CD1   1 
ATOM   48   C  CD2   . LEU A 1 38  ? 28.329 -37.837 10.217  1.00 11.23 ? 39  LEU A CD2   1 
ATOM   49   N  N     . GLY A 1 39  ? 32.161 -37.025 7.513   1.00 9.78  ? 40  GLY A N     1 
ATOM   50   C  CA    . GLY A 1 39  ? 33.406 -37.057 6.774   1.00 8.09  ? 40  GLY A CA    1 
ATOM   51   C  C     . GLY A 1 39  ? 34.540 -37.211 7.762   1.00 10.40 ? 40  GLY A C     1 
ATOM   52   O  O     . GLY A 1 39  ? 34.372 -36.977 8.964   1.00 10.33 ? 40  GLY A O     1 
ATOM   53   N  N     . ALA A 1 40  ? 35.700 -37.614 7.258   1.00 10.50 ? 41  ALA A N     1 
ATOM   54   C  CA    . ALA A 1 40  ? 36.890 -37.811 8.083   1.00 9.74  ? 41  ALA A CA    1 
ATOM   55   C  C     . ALA A 1 40  ? 37.423 -36.501 8.670   1.00 10.34 ? 41  ALA A C     1 
ATOM   56   O  O     . ALA A 1 40  ? 36.947 -35.404 8.342   1.00 8.86  ? 41  ALA A O     1 
ATOM   57   C  CB    . ALA A 1 40  ? 37.991 -38.513 7.270   1.00 7.07  ? 41  ALA A CB    1 
ATOM   58   N  N     . GLY A 1 41  ? 38.441 -36.619 9.514   1.00 9.84  ? 42  GLY A N     1 
ATOM   59   C  CA    . GLY A 1 41  ? 39.007 -35.443 10.135  1.00 9.20  ? 42  GLY A CA    1 
ATOM   60   C  C     . GLY A 1 41  ? 39.606 -34.445 9.158   1.00 10.21 ? 42  GLY A C     1 
ATOM   61   O  O     . GLY A 1 41  ? 40.244 -34.840 8.187   1.00 6.74  ? 42  GLY A O     1 
ATOM   62   N  N     . GLU A 1 42  ? 39.394 -33.158 9.437   1.00 9.94  ? 43  GLU A N     1 
ATOM   63   C  CA    . GLU A 1 42  ? 39.922 -32.052 8.644   1.00 8.59  ? 43  GLU A CA    1 
ATOM   64   C  C     . GLU A 1 42  ? 39.383 -31.979 7.211   1.00 9.62  ? 43  GLU A C     1 
ATOM   65   O  O     . GLU A 1 42  ? 39.970 -31.334 6.346   1.00 10.18 ? 43  GLU A O     1 
ATOM   66   C  CB    . GLU A 1 42  ? 41.459 -32.088 8.644   1.00 9.07  ? 43  GLU A CB    1 
ATOM   67   C  CG    . GLU A 1 42  ? 42.085 -31.716 9.993   1.00 13.46 ? 43  GLU A CG    1 
ATOM   68   C  CD    . GLU A 1 42  ? 43.606 -31.793 9.993   1.00 17.14 ? 43  GLU A CD    1 
ATOM   69   O  OE1   . GLU A 1 42  ? 44.151 -32.893 9.789   1.00 19.20 ? 43  GLU A OE1   1 
ATOM   70   O  OE2   . GLU A 1 42  ? 44.270 -30.761 10.221  1.00 20.18 ? 43  GLU A OE2   1 
ATOM   71   N  N     . SER A 1 43  ? 38.221 -32.563 6.983   1.00 7.14  ? 44  SER A N     1 
ATOM   72   C  CA    . SER A 1 43  ? 37.662 -32.558 5.658   1.00 6.50  ? 44  SER A CA    1 
ATOM   73   C  C     . SER A 1 43  ? 37.016 -31.234 5.271   1.00 9.22  ? 44  SER A C     1 
ATOM   74   O  O     . SER A 1 43  ? 36.851 -30.953 4.070   1.00 12.38 ? 44  SER A O     1 
ATOM   75   C  CB    . SER A 1 43  ? 36.699 -33.738 5.488   1.00 8.66  ? 44  SER A CB    1 
ATOM   76   O  OG    . SER A 1 43  ? 35.713 -33.765 6.509   1.00 11.56 ? 44  SER A OG    1 
ATOM   77   N  N     . GLY A 1 44  ? 36.676 -30.412 6.270   1.00 5.98  ? 45  GLY A N     1 
ATOM   78   C  CA    . GLY A 1 44  ? 36.048 -29.121 6.012   1.00 3.16  ? 45  GLY A CA    1 
ATOM   79   C  C     . GLY A 1 44  ? 34.634 -28.942 6.551   1.00 4.85  ? 45  GLY A C     1 
ATOM   80   O  O     . GLY A 1 44  ? 34.003 -27.926 6.303   1.00 5.36  ? 45  GLY A O     1 
ATOM   81   N  N     . LYS A 1 45  ? 34.151 -29.901 7.334   1.00 7.16  ? 46  LYS A N     1 
ATOM   82   C  CA    . LYS A 1 45  ? 32.802 -29.853 7.882   1.00 6.35  ? 46  LYS A CA    1 
ATOM   83   C  C     . LYS A 1 45  ? 32.501 -28.600 8.706   1.00 10.81 ? 46  LYS A C     1 
ATOM   84   O  O     . LYS A 1 45  ? 31.462 -27.945 8.510   1.00 8.45  ? 46  LYS A O     1 
ATOM   85   C  CB    . LYS A 1 45  ? 32.530 -31.080 8.762   1.00 9.72  ? 46  LYS A CB    1 
ATOM   86   C  CG    . LYS A 1 45  ? 32.624 -32.427 8.065   1.00 7.42  ? 46  LYS A CG    1 
ATOM   87   C  CD    . LYS A 1 45  ? 32.373 -33.562 9.038   1.00 6.81  ? 46  LYS A CD    1 
ATOM   88   C  CE    . LYS A 1 45  ? 33.381 -33.593 10.209  1.00 8.83  ? 46  LYS A CE    1 
ATOM   89   N  NZ    . LYS A 1 45  ? 34.810 -33.990 9.876   1.00 4.61  ? 46  LYS A NZ    1 
ATOM   90   N  N     . SER A 1 46  ? 33.374 -28.298 9.666   1.00 8.11  ? 47  SER A N     1 
ATOM   91   C  CA    . SER A 1 46  ? 33.185 -27.138 10.533  1.00 9.00  ? 47  SER A CA    1 
ATOM   92   C  C     . SER A 1 46  ? 33.274 -25.790 9.820   1.00 7.69  ? 47  SER A C     1 
ATOM   93   O  O     . SER A 1 46  ? 32.724 -24.799 10.295  1.00 10.13 ? 47  SER A O     1 
ATOM   94   C  CB    . SER A 1 46  ? 34.158 -27.197 11.710  1.00 8.91  ? 47  SER A CB    1 
ATOM   95   O  OG    . SER A 1 46  ? 33.891 -28.356 12.494  1.00 10.68 ? 47  SER A OG    1 
ATOM   96   N  N     . THR A 1 47  ? 33.977 -25.751 8.696   1.00 7.20  ? 48  THR A N     1 
ATOM   97   C  CA    . THR A 1 47  ? 34.102 -24.531 7.909   1.00 5.60  ? 48  THR A CA    1 
ATOM   98   C  C     . THR A 1 47  ? 32.761 -24.224 7.212   1.00 6.25  ? 48  THR A C     1 
ATOM   99   O  O     . THR A 1 47  ? 32.320 -23.078 7.151   1.00 6.60  ? 48  THR A O     1 
ATOM   100  C  CB    . THR A 1 47  ? 35.267 -24.685 6.937   1.00 3.88  ? 48  THR A CB    1 
ATOM   101  O  OG1   . THR A 1 47  ? 36.426 -25.015 7.704   1.00 5.82  ? 48  THR A OG1   1 
ATOM   102  C  CG2   . THR A 1 47  ? 35.548 -23.418 6.183   1.00 3.18  ? 48  THR A CG2   1 
ATOM   103  N  N     . ILE A 1 48  ? 32.064 -25.261 6.771   1.00 7.97  ? 49  ILE A N     1 
ATOM   104  C  CA    . ILE A 1 48  ? 30.767 -25.070 6.133   1.00 9.14  ? 49  ILE A CA    1 
ATOM   105  C  C     . ILE A 1 48  ? 29.790 -24.497 7.173   1.00 9.12  ? 49  ILE A C     1 
ATOM   106  O  O     . ILE A 1 48  ? 28.964 -23.660 6.854   1.00 7.59  ? 49  ILE A O     1 
ATOM   107  C  CB    . ILE A 1 48  ? 30.224 -26.396 5.538   1.00 10.79 ? 49  ILE A CB    1 
ATOM   108  C  CG1   . ILE A 1 48  ? 31.165 -26.904 4.440   1.00 12.75 ? 49  ILE A CG1   1 
ATOM   109  C  CG2   . ILE A 1 48  ? 28.827 -26.180 4.929   1.00 13.28 ? 49  ILE A CG2   1 
ATOM   110  C  CD1   . ILE A 1 48  ? 31.221 -25.985 3.217   1.00 12.17 ? 49  ILE A CD1   1 
ATOM   111  N  N     . VAL A 1 49  ? 29.910 -24.942 8.421   1.00 11.11 ? 50  VAL A N     1 
ATOM   112  C  CA    . VAL A 1 49  ? 29.055 -24.454 9.508   1.00 10.21 ? 50  VAL A CA    1 
ATOM   113  C  C     . VAL A 1 49  ? 29.253 -22.953 9.693   1.00 8.58  ? 50  VAL A C     1 
ATOM   114  O  O     . VAL A 1 49  ? 28.283 -22.201 9.832   1.00 7.67  ? 50  VAL A O     1 
ATOM   115  C  CB    . VAL A 1 49  ? 29.360 -25.166 10.844  1.00 10.40 ? 50  VAL A CB    1 
ATOM   116  C  CG1   . VAL A 1 49  ? 28.569 -24.535 11.958  1.00 14.24 ? 50  VAL A CG1   1 
ATOM   117  C  CG2   . VAL A 1 49  ? 28.984 -26.637 10.752  1.00 10.25 ? 50  VAL A CG2   1 
ATOM   118  N  N     . LYS A 1 50  ? 30.508 -22.518 9.667   1.00 7.86  ? 51  LYS A N     1 
ATOM   119  C  CA    . LYS A 1 50  ? 30.820 -21.108 9.819   1.00 7.17  ? 51  LYS A CA    1 
ATOM   120  C  C     . LYS A 1 50  ? 30.266 -20.289 8.634   1.00 9.24  ? 51  LYS A C     1 
ATOM   121  O  O     . LYS A 1 50  ? 29.852 -19.142 8.818   1.00 7.98  ? 51  LYS A O     1 
ATOM   122  C  CB    . LYS A 1 50  ? 32.328 -20.887 9.937   1.00 7.76  ? 51  LYS A CB    1 
ATOM   123  C  CG    . LYS A 1 50  ? 33.011 -21.483 11.145  1.00 7.95  ? 51  LYS A CG    1 
ATOM   124  C  CD    . LYS A 1 50  ? 34.460 -20.988 11.193  1.00 10.96 ? 51  LYS A CD    1 
ATOM   125  C  CE    . LYS A 1 50  ? 35.211 -21.406 12.449  1.00 10.18 ? 51  LYS A CE    1 
ATOM   126  N  NZ    . LYS A 1 50  ? 35.436 -22.878 12.484  1.00 11.23 ? 51  LYS A NZ    1 
ATOM   127  N  N     . GLN A 1 51  ? 30.257 -20.864 7.430   1.00 7.73  ? 52  GLN A N     1 
ATOM   128  C  CA    . GLN A 1 51  ? 29.729 -20.151 6.255   1.00 8.08  ? 52  GLN A CA    1 
ATOM   129  C  C     . GLN A 1 51  ? 28.227 -19.859 6.347   1.00 7.06  ? 52  GLN A C     1 
ATOM   130  O  O     . GLN A 1 51  ? 27.759 -18.825 5.877   1.00 6.99  ? 52  GLN A O     1 
ATOM   131  C  CB    . GLN A 1 51  ? 30.044 -20.916 4.963   1.00 5.93  ? 52  GLN A CB    1 
ATOM   132  C  CG    . GLN A 1 51  ? 31.533 -20.961 4.569   1.00 6.16  ? 52  GLN A CG    1 
ATOM   133  C  CD    . GLN A 1 51  ? 32.051 -19.676 3.934   1.00 4.83  ? 52  GLN A CD    1 
ATOM   134  O  OE1   . GLN A 1 51  ? 31.458 -18.613 4.078   1.00 7.51  ? 52  GLN A OE1   1 
ATOM   135  N  NE2   . GLN A 1 51  ? 33.174 -19.774 3.231   1.00 6.08  ? 52  GLN A NE2   1 
ATOM   136  N  N     . MET A 1 52  ? 27.466 -20.776 6.938   1.00 7.77  ? 53  MET A N     1 
ATOM   137  C  CA    . MET A 1 52  ? 26.034 -20.581 7.095   1.00 9.30  ? 53  MET A CA    1 
ATOM   138  C  C     . MET A 1 52  ? 25.772 -19.296 7.908   1.00 13.03 ? 53  MET A C     1 
ATOM   139  O  O     . MET A 1 52  ? 24.844 -18.532 7.610   1.00 13.80 ? 53  MET A O     1 
ATOM   140  C  CB    . MET A 1 52  ? 25.389 -21.808 7.766   1.00 8.55  ? 53  MET A CB    1 
ATOM   141  C  CG    . MET A 1 52  ? 25.569 -23.123 6.998   1.00 10.20 ? 53  MET A CG    1 
ATOM   142  S  SD    . MET A 1 52  ? 24.941 -23.120 5.273   1.00 18.01 ? 53  MET A SD    1 
ATOM   143  C  CE    . MET A 1 52  ? 26.403 -22.699 4.325   1.00 10.37 ? 53  MET A CE    1 
ATOM   144  N  N     . LYS A 1 53  ? 26.622 -19.023 8.891   1.00 13.66 ? 54  LYS A N     1 
ATOM   145  C  CA    . LYS A 1 53  ? 26.478 -17.822 9.717   1.00 15.50 ? 54  LYS A CA    1 
ATOM   146  C  C     . LYS A 1 53  ? 26.789 -16.564 8.909   1.00 14.25 ? 54  LYS A C     1 
ATOM   147  O  O     . LYS A 1 53  ? 26.110 -15.547 9.013   1.00 12.58 ? 54  LYS A O     1 
ATOM   148  C  CB    . LYS A 1 53  ? 27.407 -17.912 10.938  1.00 19.99 ? 54  LYS A CB    1 
ATOM   149  C  CG    . LYS A 1 53  ? 27.430 -16.654 11.815  1.00 22.90 ? 54  LYS A CG    1 
ATOM   150  C  CD    . LYS A 1 53  ? 27.548 -17.058 13.276  1.00 28.92 ? 54  LYS A CD    1 
ATOM   151  C  CE    . LYS A 1 53  ? 27.454 -15.860 14.204  1.00 28.32 ? 54  LYS A CE    1 
ATOM   152  N  NZ    . LYS A 1 53  ? 28.656 -15.035 14.048  1.00 33.74 ? 54  LYS A NZ    1 
ATOM   153  N  N     . ILE A 1 54  ? 27.840 -16.641 8.109   1.00 14.61 ? 55  ILE A N     1 
ATOM   154  C  CA    . ILE A 1 54  ? 28.259 -15.528 7.277   1.00 13.30 ? 55  ILE A CA    1 
ATOM   155  C  C     . ILE A 1 54  ? 27.213 -15.259 6.191   1.00 14.68 ? 55  ILE A C     1 
ATOM   156  O  O     . ILE A 1 54  ? 26.817 -14.121 5.957   1.00 15.59 ? 55  ILE A O     1 
ATOM   157  C  CB    . ILE A 1 54  ? 29.620 -15.846 6.623   1.00 11.87 ? 55  ILE A CB    1 
ATOM   158  C  CG1   . ILE A 1 54  ? 30.692 -15.938 7.713   1.00 13.68 ? 55  ILE A CG1   1 
ATOM   159  C  CG2   . ILE A 1 54  ? 29.953 -14.828 5.525   1.00 14.17 ? 55  ILE A CG2   1 
ATOM   160  C  CD1   . ILE A 1 54  ? 32.107 -16.143 7.203   1.00 16.26 ? 55  ILE A CD1   1 
ATOM   161  N  N     . ILE A 1 55  ? 26.749 -16.324 5.559   1.00 14.51 ? 56  ILE A N     1 
ATOM   162  C  CA    . ILE A 1 55  ? 25.793 -16.205 4.480   1.00 16.25 ? 56  ILE A CA    1 
ATOM   163  C  C     . ILE A 1 55  ? 24.350 -15.950 4.915   1.00 18.30 ? 56  ILE A C     1 
ATOM   164  O  O     . ILE A 1 55  ? 23.707 -15.030 4.412   1.00 21.93 ? 56  ILE A O     1 
ATOM   165  C  CB    . ILE A 1 55  ? 25.869 -17.459 3.551   1.00 17.30 ? 56  ILE A CB    1 
ATOM   166  C  CG1   . ILE A 1 55  ? 27.260 -17.563 2.925   1.00 12.91 ? 56  ILE A CG1   1 
ATOM   167  C  CG2   . ILE A 1 55  ? 24.824 -17.383 2.433   1.00 17.21 ? 56  ILE A CG2   1 
ATOM   168  C  CD1   . ILE A 1 55  ? 27.487 -18.861 2.237   1.00 14.69 ? 56  ILE A CD1   1 
ATOM   169  N  N     . HIS A 1 56  ? 23.831 -16.745 5.842   1.00 17.29 ? 57  HIS A N     1 
ATOM   170  C  CA    . HIS A 1 56  ? 22.441 -16.585 6.256   1.00 19.01 ? 57  HIS A CA    1 
ATOM   171  C  C     . HIS A 1 56  ? 22.164 -15.615 7.408   1.00 20.55 ? 57  HIS A C     1 
ATOM   172  O  O     . HIS A 1 56  ? 21.014 -15.237 7.655   1.00 19.12 ? 57  HIS A O     1 
ATOM   173  C  CB    . HIS A 1 56  ? 21.817 -17.959 6.490   1.00 18.77 ? 57  HIS A CB    1 
ATOM   174  C  CG    . HIS A 1 56  ? 21.871 -18.834 5.277   1.00 20.91 ? 57  HIS A CG    1 
ATOM   175  N  ND1   . HIS A 1 56  ? 22.482 -20.070 5.272   1.00 23.84 ? 57  HIS A ND1   1 
ATOM   176  C  CD2   . HIS A 1 56  ? 21.476 -18.609 4.003   1.00 18.81 ? 57  HIS A CD2   1 
ATOM   177  C  CE1   . HIS A 1 56  ? 22.470 -20.566 4.047   1.00 18.98 ? 57  HIS A CE1   1 
ATOM   178  N  NE2   . HIS A 1 56  ? 21.867 -19.699 3.256   1.00 21.28 ? 57  HIS A NE2   1 
ATOM   179  N  N     . GLU A 1 57  ? 23.209 -15.237 8.131   1.00 22.22 ? 58  GLU A N     1 
ATOM   180  C  CA    . GLU A 1 57  ? 23.065 -14.274 9.218   1.00 27.18 ? 58  GLU A CA    1 
ATOM   181  C  C     . GLU A 1 57  ? 23.871 -13.060 8.757   1.00 29.56 ? 58  GLU A C     1 
ATOM   182  O  O     . GLU A 1 57  ? 23.920 -12.759 7.559   1.00 32.14 ? 58  GLU A O     1 
ATOM   183  C  CB    . GLU A 1 57  ? 23.626 -14.810 10.527  1.00 28.21 ? 58  GLU A CB    1 
ATOM   184  C  CG    . GLU A 1 57  ? 23.304 -16.267 10.809  1.00 36.05 ? 58  GLU A CG    1 
ATOM   185  C  CD    . GLU A 1 57  ? 21.879 -16.515 11.235  1.00 39.47 ? 58  GLU A CD    1 
ATOM   186  O  OE1   . GLU A 1 57  ? 21.048 -15.582 11.149  1.00 46.91 ? 58  GLU A OE1   1 
ATOM   187  O  OE2   . GLU A 1 57  ? 21.591 -17.652 11.672  1.00 42.14 ? 58  GLU A OE2   1 
ATOM   188  N  N     . ALA A 1 58  ? 24.533 -12.373 9.672   1.00 30.83 ? 59  ALA A N     1 
ATOM   189  C  CA    . ALA A 1 58  ? 25.298 -11.208 9.247   1.00 32.06 ? 59  ALA A CA    1 
ATOM   190  C  C     . ALA A 1 58  ? 26.798 -11.371 9.444   1.00 31.36 ? 59  ALA A C     1 
ATOM   191  O  O     . ALA A 1 58  ? 27.540 -10.377 9.448   1.00 33.39 ? 59  ALA A O     1 
ATOM   192  C  CB    . ALA A 1 58  ? 24.803 -9.971  9.967   1.00 35.56 ? 59  ALA A CB    1 
ATOM   193  N  N     . GLY A 1 59  ? 27.245 -12.620 9.580   1.00 27.10 ? 60  GLY A N     1 
ATOM   194  C  CA    . GLY A 1 59  ? 28.658 -12.871 9.784   1.00 21.39 ? 60  GLY A CA    1 
ATOM   195  C  C     . GLY A 1 59  ? 29.017 -12.761 11.248  1.00 17.79 ? 60  GLY A C     1 
ATOM   196  O  O     . GLY A 1 59  ? 28.154 -12.628 12.113  1.00 17.06 ? 60  GLY A O     1 
ATOM   197  N  N     . TYR A 1 60  ? 30.297 -12.816 11.537  1.00 13.70 ? 61  TYR A N     1 
ATOM   198  C  CA    . TYR A 1 60  ? 30.732 -12.744 12.910  1.00 13.71 ? 61  TYR A CA    1 
ATOM   199  C  C     . TYR A 1 60  ? 30.893 -11.312 13.356  1.00 14.66 ? 61  TYR A C     1 
ATOM   200  O  O     . TYR A 1 60  ? 31.486 -10.508 12.646  1.00 16.34 ? 61  TYR A O     1 
ATOM   201  C  CB    . TYR A 1 60  ? 32.050 -13.502 13.079  1.00 12.66 ? 61  TYR A CB    1 
ATOM   202  C  CG    . TYR A 1 60  ? 31.890 -14.991 12.901  1.00 16.21 ? 61  TYR A CG    1 
ATOM   203  C  CD1   . TYR A 1 60  ? 31.799 -15.562 11.624  1.00 16.48 ? 61  TYR A CD1   1 
ATOM   204  C  CD2   . TYR A 1 60  ? 31.766 -15.823 14.005  1.00 13.07 ? 61  TYR A CD2   1 
ATOM   205  C  CE1   . TYR A 1 60  ? 31.577 -16.922 11.466  1.00 13.18 ? 61  TYR A CE1   1 
ATOM   206  C  CE2   . TYR A 1 60  ? 31.549 -17.175 13.861  1.00 15.47 ? 61  TYR A CE2   1 
ATOM   207  C  CZ    . TYR A 1 60  ? 31.450 -17.720 12.595  1.00 16.60 ? 61  TYR A CZ    1 
ATOM   208  O  OH    . TYR A 1 60  ? 31.180 -19.062 12.486  1.00 19.07 ? 61  TYR A OH    1 
ATOM   209  N  N     . SER A 1 61  ? 30.379 -11.002 14.544  1.00 12.46 ? 62  SER A N     1 
ATOM   210  C  CA    . SER A 1 61  ? 30.498 -9.665  15.100  1.00 13.16 ? 62  SER A CA    1 
ATOM   211  C  C     . SER A 1 61  ? 31.923 -9.411  15.589  1.00 11.86 ? 62  SER A C     1 
ATOM   212  O  O     . SER A 1 61  ? 32.735 -10.324 15.677  1.00 12.97 ? 62  SER A O     1 
ATOM   213  C  CB    . SER A 1 61  ? 29.565 -9.518  16.290  1.00 13.55 ? 62  SER A CB    1 
ATOM   214  O  OG    . SER A 1 61  ? 30.059 -10.290 17.364  1.00 15.06 ? 62  SER A OG    1 
ATOM   215  N  N     . GLU A 1 62  ? 32.187 -8.180  16.001  1.00 12.15 ? 63  GLU A N     1 
ATOM   216  C  CA    . GLU A 1 62  ? 33.499 -7.797  16.501  1.00 11.47 ? 63  GLU A CA    1 
ATOM   217  C  C     . GLU A 1 62  ? 33.898 -8.634  17.711  1.00 10.92 ? 63  GLU A C     1 
ATOM   218  O  O     . GLU A 1 62  ? 35.032 -9.093  17.801  1.00 12.04 ? 63  GLU A O     1 
ATOM   219  C  CB    . GLU A 1 62  ? 33.496 -6.322  16.877  1.00 17.51 ? 63  GLU A CB    1 
ATOM   220  C  CG    . GLU A 1 62  ? 34.845 -5.823  17.306  1.00 28.80 ? 63  GLU A CG    1 
ATOM   221  C  CD    . GLU A 1 62  ? 34.817 -4.378  17.741  1.00 37.61 ? 63  GLU A CD    1 
ATOM   222  O  OE1   . GLU A 1 62  ? 34.842 -3.495  16.856  1.00 42.62 ? 63  GLU A OE1   1 
ATOM   223  O  OE2   . GLU A 1 62  ? 34.779 -4.129  18.968  1.00 41.33 ? 63  GLU A OE2   1 
ATOM   224  N  N     . GLU A 1 63  ? 32.962 -8.844  18.630  1.00 11.28 ? 64  GLU A N     1 
ATOM   225  C  CA    . GLU A 1 63  ? 33.230 -9.648  19.825  1.00 12.49 ? 64  GLU A CA    1 
ATOM   226  C  C     . GLU A 1 63  ? 33.521 -11.097 19.498  1.00 12.85 ? 64  GLU A C     1 
ATOM   227  O  O     . GLU A 1 63  ? 34.387 -11.703 20.131  1.00 10.70 ? 64  GLU A O     1 
ATOM   228  C  CB    . GLU A 1 63  ? 32.085 -9.572  20.834  1.00 8.85  ? 64  GLU A CB    1 
ATOM   229  C  CG    . GLU A 1 63  ? 31.920 -8.201  21.444  1.00 15.10 ? 64  GLU A CG    1 
ATOM   230  C  CD    . GLU A 1 63  ? 31.262 -7.214  20.484  1.00 21.30 ? 64  GLU A CD    1 
ATOM   231  O  OE1   . GLU A 1 63  ? 30.526 -7.670  19.579  1.00 23.22 ? 64  GLU A OE1   1 
ATOM   232  O  OE2   . GLU A 1 63  ? 31.479 -5.986  20.636  1.00 22.04 ? 64  GLU A OE2   1 
ATOM   233  N  N     . GLU A 1 64  ? 32.774 -11.661 18.546  1.00 11.79 ? 65  GLU A N     1 
ATOM   234  C  CA    . GLU A 1 64  ? 32.981 -13.052 18.108  1.00 12.37 ? 65  GLU A CA    1 
ATOM   235  C  C     . GLU A 1 64  ? 34.348 -13.240 17.431  1.00 11.69 ? 65  GLU A C     1 
ATOM   236  O  O     . GLU A 1 64  ? 35.060 -14.204 17.729  1.00 11.93 ? 65  GLU A O     1 
ATOM   237  C  CB    . GLU A 1 64  ? 31.855 -13.498 17.168  1.00 10.63 ? 65  GLU A CB    1 
ATOM   238  C  CG    . GLU A 1 64  ? 30.571 -13.780 17.911  1.00 13.95 ? 65  GLU A CG    1 
ATOM   239  C  CD    . GLU A 1 64  ? 29.356 -13.869 17.035  1.00 15.14 ? 65  GLU A CD    1 
ATOM   240  O  OE1   . GLU A 1 64  ? 29.349 -13.280 15.944  1.00 17.24 ? 65  GLU A OE1   1 
ATOM   241  O  OE2   . GLU A 1 64  ? 28.377 -14.500 17.464  1.00 17.37 ? 65  GLU A OE2   1 
ATOM   242  N  N     . CYS A 1 65  ? 34.736 -12.279 16.587  1.00 9.85  ? 66  CYS A N     1 
ATOM   243  C  CA    . CYS A 1 65  ? 36.025 -12.321 15.892  1.00 9.20  ? 66  CYS A CA    1 
ATOM   244  C  C     . CYS A 1 65  ? 37.159 -12.252 16.898  1.00 10.29 ? 66  CYS A C     1 
ATOM   245  O  O     . CYS A 1 65  ? 38.143 -12.982 16.795  1.00 11.69 ? 66  CYS A O     1 
ATOM   246  C  CB    . CYS A 1 65  ? 36.151 -11.167 14.891  1.00 10.62 ? 66  CYS A CB    1 
ATOM   247  S  SG    . CYS A 1 65  ? 35.080 -11.310 13.419  1.00 10.56 ? 66  CYS A SG    1 
ATOM   248  N  N     . LYS A 1 66  ? 37.032 -11.367 17.874  1.00 10.75 ? 67  LYS A N     1 
ATOM   249  C  CA    . LYS A 1 66  ? 38.054 -11.251 18.899  1.00 12.64 ? 67  LYS A CA    1 
ATOM   250  C  C     . LYS A 1 66  ? 38.255 -12.564 19.676  1.00 10.76 ? 67  LYS A C     1 
ATOM   251  O  O     . LYS A 1 66  ? 39.366 -12.855 20.122  1.00 12.87 ? 67  LYS A O     1 
ATOM   252  C  CB    . LYS A 1 66  ? 37.752 -10.073 19.809  1.00 14.26 ? 67  LYS A CB    1 
ATOM   253  C  CG    . LYS A 1 66  ? 38.062 -8.746  19.155  1.00 19.57 ? 67  LYS A CG    1 
ATOM   254  C  CD    . LYS A 1 66  ? 37.605 -7.614  20.037  1.00 26.51 ? 67  LYS A CD    1 
ATOM   255  C  CE    . LYS A 1 66  ? 38.206 -6.292  19.581  1.00 35.44 ? 67  LYS A CE    1 
ATOM   256  N  NZ    . LYS A 1 66  ? 37.715 -5.100  20.352  1.00 36.99 ? 67  LYS A NZ    1 
ATOM   257  N  N     . GLN A 1 67  ? 37.218 -13.400 19.745  1.00 11.39 ? 68  GLN A N     1 
ATOM   258  C  CA    . GLN A 1 67  ? 37.317 -14.696 20.425  1.00 13.78 ? 68  GLN A CA    1 
ATOM   259  C  C     . GLN A 1 67  ? 38.255 -15.611 19.649  1.00 12.39 ? 68  GLN A C     1 
ATOM   260  O  O     . GLN A 1 67  ? 38.998 -16.405 20.231  1.00 11.07 ? 68  GLN A O     1 
ATOM   261  C  CB    . GLN A 1 67  ? 35.938 -15.371 20.554  1.00 15.34 ? 68  GLN A CB    1 
ATOM   262  C  CG    . GLN A 1 67  ? 35.098 -14.879 21.724  1.00 20.11 ? 68  GLN A CG    1 
ATOM   263  C  CD    . GLN A 1 67  ? 35.876 -14.870 23.031  1.00 23.52 ? 68  GLN A CD    1 
ATOM   264  O  OE1   . GLN A 1 67  ? 36.373 -15.897 23.486  1.00 24.90 ? 68  GLN A OE1   1 
ATOM   265  N  NE2   . GLN A 1 67  ? 36.032 -13.695 23.608  1.00 29.46 ? 68  GLN A NE2   1 
ATOM   266  N  N     . TYR A 1 68  ? 38.255 -15.448 18.329  1.00 12.74 ? 69  TYR A N     1 
ATOM   267  C  CA    . TYR A 1 68  ? 39.093 -16.267 17.442  1.00 12.97 ? 69  TYR A CA    1 
ATOM   268  C  C     . TYR A 1 68  ? 40.530 -15.804 17.360  1.00 12.80 ? 69  TYR A C     1 
ATOM   269  O  O     . TYR A 1 68  ? 41.386 -16.511 16.810  1.00 11.26 ? 69  TYR A O     1 
ATOM   270  C  CB    . TYR A 1 68  ? 38.491 -16.313 16.037  1.00 10.85 ? 69  TYR A CB    1 
ATOM   271  C  CG    . TYR A 1 68  ? 37.334 -17.262 15.942  1.00 11.89 ? 69  TYR A CG    1 
ATOM   272  C  CD1   . TYR A 1 68  ? 37.561 -18.623 15.788  1.00 12.50 ? 69  TYR A CD1   1 
ATOM   273  C  CD2   . TYR A 1 68  ? 36.016 -16.814 16.033  1.00 11.38 ? 69  TYR A CD2   1 
ATOM   274  C  CE1   . TYR A 1 68  ? 36.518 -19.521 15.728  1.00 13.69 ? 69  TYR A CE1   1 
ATOM   275  C  CE2   . TYR A 1 68  ? 34.952 -17.715 15.974  1.00 16.73 ? 69  TYR A CE2   1 
ATOM   276  C  CZ    . TYR A 1 68  ? 35.227 -19.075 15.823  1.00 16.15 ? 69  TYR A CZ    1 
ATOM   277  O  OH    . TYR A 1 68  ? 34.232 -20.018 15.796  1.00 22.74 ? 69  TYR A OH    1 
ATOM   278  N  N     . LYS A 1 69  ? 40.797 -14.631 17.930  1.00 13.53 ? 70  LYS A N     1 
ATOM   279  C  CA    . LYS A 1 69  ? 42.135 -14.062 17.916  1.00 15.11 ? 70  LYS A CA    1 
ATOM   280  C  C     . LYS A 1 69  ? 43.146 -15.026 18.507  1.00 14.48 ? 70  LYS A C     1 
ATOM   281  O  O     . LYS A 1 69  ? 44.208 -15.226 17.926  1.00 12.13 ? 70  LYS A O     1 
ATOM   282  C  CB    . LYS A 1 69  ? 42.155 -12.735 18.662  1.00 19.58 ? 70  LYS A CB    1 
ATOM   283  C  CG    . LYS A 1 69  ? 43.447 -11.940 18.513  1.00 28.23 ? 70  LYS A CG    1 
ATOM   284  C  CD    . LYS A 1 69  ? 43.225 -10.514 19.016  1.00 34.69 ? 70  LYS A CD    1 
ATOM   285  C  CE    . LYS A 1 69  ? 44.418 -9.611  18.769  1.00 40.21 ? 70  LYS A CE    1 
ATOM   286  N  NZ    . LYS A 1 69  ? 45.529 -9.838  19.738  1.00 49.76 ? 70  LYS A NZ    1 
ATOM   287  N  N     . ALA A 1 70  ? 42.805 -15.676 19.619  1.00 11.64 ? 71  ALA A N     1 
ATOM   288  C  CA    . ALA A 1 70  ? 43.736 -16.622 20.219  1.00 10.57 ? 71  ALA A CA    1 
ATOM   289  C  C     . ALA A 1 70  ? 43.932 -17.912 19.408  1.00 9.60  ? 71  ALA A C     1 
ATOM   290  O  O     . ALA A 1 70  ? 44.998 -18.534 19.492  1.00 8.96  ? 71  ALA A O     1 
ATOM   291  C  CB    . ALA A 1 70  ? 43.324 -16.948 21.628  1.00 10.82 ? 71  ALA A CB    1 
ATOM   292  N  N     . VAL A 1 71  ? 42.905 -18.325 18.653  1.00 8.47  ? 72  VAL A N     1 
ATOM   293  C  CA    . VAL A 1 71  ? 42.970 -19.533 17.814  1.00 8.14  ? 72  VAL A CA    1 
ATOM   294  C  C     . VAL A 1 71  ? 43.925 -19.245 16.631  1.00 7.28  ? 72  VAL A C     1 
ATOM   295  O  O     . VAL A 1 71  ? 44.759 -20.074 16.262  1.00 10.10 ? 72  VAL A O     1 
ATOM   296  C  CB    . VAL A 1 71  ? 41.558 -19.954 17.276  1.00 11.18 ? 72  VAL A CB    1 
ATOM   297  C  CG1   . VAL A 1 71  ? 41.630 -21.318 16.604  1.00 14.37 ? 72  VAL A CG1   1 
ATOM   298  C  CG2   . VAL A 1 71  ? 40.522 -20.010 18.398  1.00 11.35 ? 72  VAL A CG2   1 
ATOM   299  N  N     . VAL A 1 72  ? 43.809 -18.050 16.059  1.00 8.58  ? 73  VAL A N     1 
ATOM   300  C  CA    . VAL A 1 72  ? 44.682 -17.633 14.967  1.00 7.01  ? 73  VAL A CA    1 
ATOM   301  C  C     . VAL A 1 72  ? 46.147 -17.687 15.443  1.00 8.29  ? 73  VAL A C     1 
ATOM   302  O  O     . VAL A 1 72  ? 47.005 -18.258 14.766  1.00 8.34  ? 73  VAL A O     1 
ATOM   303  C  CB    . VAL A 1 72  ? 44.357 -16.177 14.502  1.00 8.41  ? 73  VAL A CB    1 
ATOM   304  C  CG1   . VAL A 1 72  ? 45.415 -15.683 13.511  1.00 6.04  ? 73  VAL A CG1   1 
ATOM   305  C  CG2   . VAL A 1 72  ? 42.973 -16.110 13.845  1.00 7.22  ? 73  VAL A CG2   1 
ATOM   306  N  N     . TYR A 1 73  ? 46.444 -17.053 16.577  1.00 7.85  ? 74  TYR A N     1 
ATOM   307  C  CA    . TYR A 1 73  ? 47.808 -17.046 17.102  1.00 8.97  ? 74  TYR A CA    1 
ATOM   308  C  C     . TYR A 1 73  ? 48.262 -18.438 17.449  1.00 7.40  ? 74  TYR A C     1 
ATOM   309  O  O     . TYR A 1 73  ? 49.397 -18.813 17.189  1.00 8.32  ? 74  TYR A O     1 
ATOM   310  C  CB    . TYR A 1 73  ? 47.917 -16.167 18.340  1.00 12.22 ? 74  TYR A CB    1 
ATOM   311  C  CG    . TYR A 1 73  ? 47.783 -14.712 18.034  1.00 14.47 ? 74  TYR A CG    1 
ATOM   312  C  CD1   . TYR A 1 73  ? 47.912 -14.236 16.726  1.00 16.99 ? 74  TYR A CD1   1 
ATOM   313  C  CD2   . TYR A 1 73  ? 47.533 -13.801 19.045  1.00 16.96 ? 74  TYR A CD2   1 
ATOM   314  C  CE1   . TYR A 1 73  ? 47.798 -12.877 16.437  1.00 16.81 ? 74  TYR A CE1   1 
ATOM   315  C  CE2   . TYR A 1 73  ? 47.412 -12.438 18.771  1.00 20.63 ? 74  TYR A CE2   1 
ATOM   316  C  CZ    . TYR A 1 73  ? 47.551 -11.976 17.467  1.00 19.24 ? 74  TYR A CZ    1 
ATOM   317  O  OH    . TYR A 1 73  ? 47.476 -10.615 17.218  1.00 19.75 ? 74  TYR A OH    1 
ATOM   318  N  N     . SER A 1 74  ? 47.374 -19.215 18.040  1.00 6.51  ? 75  SER A N     1 
ATOM   319  C  CA    . SER A 1 74  ? 47.735 -20.572 18.398  1.00 11.18 ? 75  SER A CA    1 
ATOM   320  C  C     . SER A 1 74  ? 48.011 -21.401 17.134  1.00 11.40 ? 75  SER A C     1 
ATOM   321  O  O     . SER A 1 74  ? 48.994 -22.158 17.077  1.00 9.38  ? 75  SER A O     1 
ATOM   322  C  CB    . SER A 1 74  ? 46.620 -21.190 19.239  1.00 13.51 ? 75  SER A CB    1 
ATOM   323  O  OG    . SER A 1 74  ? 46.918 -22.530 19.550  1.00 22.31 ? 75  SER A OG    1 
ATOM   324  N  N     . ASN A 1 75  ? 47.154 -21.246 16.122  1.00 9.52  ? 76  ASN A N     1 
ATOM   325  C  CA    . ASN A 1 75  ? 47.314 -21.955 14.850  1.00 9.18  ? 76  ASN A CA    1 
ATOM   326  C  C     . ASN A 1 75  ? 48.643 -21.565 14.195  1.00 8.37  ? 76  ASN A C     1 
ATOM   327  O  O     . ASN A 1 75  ? 49.315 -22.400 13.608  1.00 10.52 ? 76  ASN A O     1 
ATOM   328  C  CB    . ASN A 1 75  ? 46.172 -21.605 13.878  1.00 6.23  ? 76  ASN A CB    1 
ATOM   329  C  CG    . ASN A 1 75  ? 44.867 -22.341 14.178  1.00 10.88 ? 76  ASN A CG    1 
ATOM   330  O  OD1   . ASN A 1 75  ? 43.868 -22.125 13.505  1.00 16.83 ? 76  ASN A OD1   1 
ATOM   331  N  ND2   . ASN A 1 75  ? 44.874 -23.227 15.157  1.00 8.20  ? 76  ASN A ND2   1 
ATOM   332  N  N     . THR A 1 76  ? 48.997 -20.287 14.267  1.00 9.73  ? 77  THR A N     1 
ATOM   333  C  CA    . THR A 1 76  ? 50.231 -19.793 13.659  1.00 7.17  ? 77  THR A CA    1 
ATOM   334  C  C     . THR A 1 76  ? 51.487 -20.365 14.329  1.00 10.94 ? 77  THR A C     1 
ATOM   335  O  O     . THR A 1 76  ? 52.387 -20.866 13.655  1.00 10.19 ? 77  THR A O     1 
ATOM   336  C  CB    . THR A 1 76  ? 50.248 -18.251 13.684  1.00 9.69  ? 77  THR A CB    1 
ATOM   337  O  OG1   . THR A 1 76  ? 49.114 -17.752 12.966  1.00 8.19  ? 77  THR A OG1   1 
ATOM   338  C  CG2   . THR A 1 76  ? 51.494 -17.699 13.045  1.00 7.77  ? 77  THR A CG2   1 
ATOM   339  N  N     . ILE A 1 77  ? 51.530 -20.307 15.658  1.00 12.24 ? 78  ILE A N     1 
ATOM   340  C  CA    . ILE A 1 77  ? 52.663 -20.803 16.425  1.00 12.08 ? 78  ILE A CA    1 
ATOM   341  C  C     . ILE A 1 77  ? 52.801 -22.299 16.228  1.00 9.62  ? 78  ILE A C     1 
ATOM   342  O  O     . ILE A 1 77  ? 53.904 -22.784 16.027  1.00 12.31 ? 78  ILE A O     1 
ATOM   343  C  CB    . ILE A 1 77  ? 52.534 -20.421 17.945  1.00 14.29 ? 78  ILE A CB    1 
ATOM   344  C  CG1   . ILE A 1 77  ? 53.347 -19.166 18.241  1.00 18.90 ? 78  ILE A CG1   1 
ATOM   345  C  CG2   . ILE A 1 77  ? 53.094 -21.507 18.842  1.00 21.10 ? 78  ILE A CG2   1 
ATOM   346  C  CD1   . ILE A 1 77  ? 52.991 -17.972 17.394  1.00 22.96 ? 78  ILE A CD1   1 
ATOM   347  N  N     . GLN A 1 78  ? 51.693 -23.033 16.245  1.00 8.83  ? 79  GLN A N     1 
ATOM   348  C  CA    . GLN A 1 78  ? 51.774 -24.474 16.045  1.00 12.48 ? 79  GLN A CA    1 
ATOM   349  C  C     . GLN A 1 78  ? 52.302 -24.850 14.662  1.00 11.00 ? 79  GLN A C     1 
ATOM   350  O  O     . GLN A 1 78  ? 52.990 -25.858 14.524  1.00 11.56 ? 79  GLN A O     1 
ATOM   351  C  CB    . GLN A 1 78  ? 50.423 -25.157 16.288  1.00 19.53 ? 79  GLN A CB    1 
ATOM   352  C  CG    . GLN A 1 78  ? 50.047 -25.294 17.759  1.00 34.91 ? 79  GLN A CG    1 
ATOM   353  C  CD    . GLN A 1 78  ? 51.120 -26.032 18.572  1.00 44.89 ? 79  GLN A CD    1 
ATOM   354  O  OE1   . GLN A 1 78  ? 51.302 -27.250 18.430  1.00 49.42 ? 79  GLN A OE1   1 
ATOM   355  N  NE2   . GLN A 1 78  ? 51.842 -25.292 19.421  1.00 47.43 ? 79  GLN A NE2   1 
ATOM   356  N  N     . SER A 1 79  ? 51.959 -24.070 13.638  1.00 10.13 ? 80  SER A N     1 
ATOM   357  C  CA    . SER A 1 79  ? 52.410 -24.353 12.271  1.00 9.79  ? 80  SER A CA    1 
ATOM   358  C  C     . SER A 1 79  ? 53.915 -24.206 12.113  1.00 7.83  ? 80  SER A C     1 
ATOM   359  O  O     . SER A 1 79  ? 54.561 -25.092 11.585  1.00 6.87  ? 80  SER A O     1 
ATOM   360  C  CB    . SER A 1 79  ? 51.703 -23.446 11.271  1.00 11.20 ? 80  SER A CB    1 
ATOM   361  O  OG    . SER A 1 79  ? 50.301 -23.660 11.313  1.00 13.96 ? 80  SER A OG    1 
ATOM   362  N  N     . ILE A 1 80  ? 54.471 -23.092 12.588  1.00 11.23 ? 81  ILE A N     1 
ATOM   363  C  CA    . ILE A 1 80  ? 55.919 -22.866 12.499  1.00 11.14 ? 81  ILE A CA    1 
ATOM   364  C  C     . ILE A 1 80  ? 56.661 -23.905 13.352  1.00 12.42 ? 81  ILE A C     1 
ATOM   365  O  O     . ILE A 1 80  ? 57.698 -24.451 12.926  1.00 12.66 ? 81  ILE A O     1 
ATOM   366  C  CB    . ILE A 1 80  ? 56.327 -21.394 12.851  1.00 11.34 ? 81  ILE A CB    1 
ATOM   367  C  CG1   . ILE A 1 80  ? 57.799 -21.169 12.508  1.00 13.58 ? 81  ILE A CG1   1 
ATOM   368  C  CG2   . ILE A 1 80  ? 56.032 -21.050 14.318  1.00 11.26 ? 81  ILE A CG2   1 
ATOM   369  C  CD1   . ILE A 1 80  ? 58.072 -21.172 11.010  1.00 13.17 ? 81  ILE A CD1   1 
ATOM   370  N  N     . ILE A 1 81  ? 56.090 -24.253 14.509  1.00 10.30 ? 82  ILE A N     1 
ATOM   371  C  CA    . ILE A 1 81  ? 56.697 -25.266 15.361  1.00 9.12  ? 82  ILE A CA    1 
ATOM   372  C  C     . ILE A 1 81  ? 56.672 -26.663 14.698  1.00 12.53 ? 82  ILE A C     1 
ATOM   373  O  O     . ILE A 1 81  ? 57.669 -27.406 14.766  1.00 13.35 ? 82  ILE A O     1 
ATOM   374  C  CB    . ILE A 1 81  ? 56.048 -25.310 16.771  1.00 9.12  ? 82  ILE A CB    1 
ATOM   375  C  CG1   . ILE A 1 81  ? 56.434 -24.062 17.572  1.00 8.22  ? 82  ILE A CG1   1 
ATOM   376  C  CG2   . ILE A 1 81  ? 56.503 -26.559 17.519  1.00 11.18 ? 82  ILE A CG2   1 
ATOM   377  C  CD1   . ILE A 1 81  ? 55.809 -23.988 18.966  1.00 9.09  ? 82  ILE A CD1   1 
ATOM   378  N  N     . ALA A 1 82  ? 55.581 -27.009 14.008  1.00 11.85 ? 83  ALA A N     1 
ATOM   379  C  CA    . ALA A 1 82  ? 55.514 -28.316 13.356  1.00 10.73 ? 83  ALA A CA    1 
ATOM   380  C  C     . ALA A 1 82  ? 56.606 -28.424 12.295  1.00 12.67 ? 83  ALA A C     1 
ATOM   381  O  O     . ALA A 1 82  ? 57.220 -29.483 12.142  1.00 11.76 ? 83  ALA A O     1 
ATOM   382  C  CB    . ALA A 1 82  ? 54.165 -28.542 12.746  1.00 11.80 ? 83  ALA A CB    1 
ATOM   383  N  N     . ILE A 1 83  ? 56.856 -27.326 11.577  1.00 11.29 ? 84  ILE A N     1 
ATOM   384  C  CA    . ILE A 1 83  ? 57.901 -27.291 10.540  1.00 10.39 ? 84  ILE A CA    1 
ATOM   385  C  C     . ILE A 1 83  ? 59.306 -27.414 11.183  1.00 11.87 ? 84  ILE A C     1 
ATOM   386  O  O     . ILE A 1 83  ? 60.117 -28.240 10.745  1.00 12.47 ? 84  ILE A O     1 
ATOM   387  C  CB    . ILE A 1 83  ? 57.817 -25.984 9.662   1.00 9.96  ? 84  ILE A CB    1 
ATOM   388  C  CG1   . ILE A 1 83  ? 56.483 -25.920 8.902   1.00 7.83  ? 84  ILE A CG1   1 
ATOM   389  C  CG2   . ILE A 1 83  ? 58.933 -25.942 8.643   1.00 10.05 ? 84  ILE A CG2   1 
ATOM   390  C  CD1   . ILE A 1 83  ? 56.208 -24.544 8.249   1.00 10.39 ? 84  ILE A CD1   1 
ATOM   391  N  N     . ILE A 1 84  ? 59.590 -26.626 12.226  1.00 11.51 ? 85  ILE A N     1 
ATOM   392  C  CA    . ILE A 1 84  ? 60.901 -26.692 12.908  1.00 10.87 ? 85  ILE A CA    1 
ATOM   393  C  C     . ILE A 1 84  ? 61.168 -28.079 13.504  1.00 11.59 ? 85  ILE A C     1 
ATOM   394  O  O     . ILE A 1 84  ? 62.308 -28.550 13.518  1.00 13.89 ? 85  ILE A O     1 
ATOM   395  C  CB    . ILE A 1 84  ? 61.028 -25.585 13.991  1.00 14.05 ? 85  ILE A CB    1 
ATOM   396  C  CG1   . ILE A 1 84  ? 61.191 -24.236 13.298  1.00 15.28 ? 85  ILE A CG1   1 
ATOM   397  C  CG2   . ILE A 1 84  ? 62.209 -25.855 14.951  1.00 9.81  ? 85  ILE A CG2   1 
ATOM   398  C  CD1   . ILE A 1 84  ? 60.793 -23.086 14.155  1.00 20.33 ? 85  ILE A CD1   1 
ATOM   399  N  N     . ARG A 1 85  ? 60.118 -28.742 13.982  1.00 13.53 ? 86  ARG A N     1 
ATOM   400  C  CA    . ARG A 1 85  ? 60.238 -30.087 14.549  1.00 15.10 ? 86  ARG A CA    1 
ATOM   401  C  C     . ARG A 1 85  ? 60.618 -31.100 13.443  1.00 17.16 ? 86  ARG A C     1 
ATOM   402  O  O     . ARG A 1 85  ? 61.486 -31.971 13.648  1.00 14.82 ? 86  ARG A O     1 
ATOM   403  C  CB    . ARG A 1 85  ? 58.907 -30.480 15.184  1.00 17.61 ? 86  ARG A CB    1 
ATOM   404  C  CG    . ARG A 1 85  ? 58.893 -31.827 15.884  1.00 32.86 ? 86  ARG A CG    1 
ATOM   405  C  CD    . ARG A 1 85  ? 57.458 -32.397 16.060  1.00 39.77 ? 86  ARG A CD    1 
ATOM   406  N  NE    . ARG A 1 85  ? 56.536 -31.513 16.779  1.00 42.64 ? 86  ARG A NE    1 
ATOM   407  C  CZ    . ARG A 1 85  ? 55.394 -31.048 16.275  1.00 45.07 ? 86  ARG A CZ    1 
ATOM   408  N  NH1   . ARG A 1 85  ? 55.018 -31.372 15.044  1.00 45.85 ? 86  ARG A NH1   1 
ATOM   409  N  NH2   . ARG A 1 85  ? 54.615 -30.266 17.010  1.00 46.87 ? 86  ARG A NH2   1 
ATOM   410  N  N     . ALA A 1 86  ? 59.986 -30.967 12.268  1.00 14.71 ? 87  ALA A N     1 
ATOM   411  C  CA    . ALA A 1 86  ? 60.230 -31.872 11.136  1.00 12.75 ? 87  ALA A CA    1 
ATOM   412  C  C     . ALA A 1 86  ? 61.632 -31.719 10.561  1.00 11.04 ? 87  ALA A C     1 
ATOM   413  O  O     . ALA A 1 86  ? 62.225 -32.699 10.136  1.00 14.36 ? 87  ALA A O     1 
ATOM   414  C  CB    . ALA A 1 86  ? 59.181 -31.674 10.059  1.00 11.29 ? 87  ALA A CB    1 
ATOM   415  N  N     . MET A 1 87  ? 62.180 -30.510 10.585  1.00 9.74  ? 88  MET A N     1 
ATOM   416  C  CA    . MET A 1 87  ? 63.534 -30.289 10.083  1.00 12.80 ? 88  MET A CA    1 
ATOM   417  C  C     . MET A 1 87  ? 64.513 -31.185 10.827  1.00 16.91 ? 88  MET A C     1 
ATOM   418  O  O     . MET A 1 87  ? 65.481 -31.673 10.250  1.00 17.59 ? 88  MET A O     1 
ATOM   419  C  CB    . MET A 1 87  ? 63.957 -28.835 10.264  1.00 13.52 ? 88  MET A CB    1 
ATOM   420  C  CG    . MET A 1 87  ? 63.415 -27.891 9.229   1.00 12.35 ? 88  MET A CG    1 
ATOM   421  S  SD    . MET A 1 87  ? 63.731 -26.171 9.648   1.00 15.42 ? 88  MET A SD    1 
ATOM   422  C  CE    . MET A 1 87  ? 65.363 -25.907 8.926   1.00 11.88 ? 88  MET A CE    1 
ATOM   423  N  N     . GLY A 1 88  ? 64.267 -31.377 12.119  1.00 18.23 ? 89  GLY A N     1 
ATOM   424  C  CA    . GLY A 1 88  ? 65.138 -32.213 12.911  1.00 16.86 ? 89  GLY A CA    1 
ATOM   425  C  C     . GLY A 1 88  ? 65.067 -33.661 12.482  1.00 20.00 ? 89  GLY A C     1 
ATOM   426  O  O     . GLY A 1 88  ? 66.095 -34.307 12.258  1.00 22.19 ? 89  GLY A O     1 
ATOM   427  N  N     . ARG A 1 89  ? 63.851 -34.160 12.314  1.00 20.21 ? 90  ARG A N     1 
ATOM   428  C  CA    . ARG A 1 89  ? 63.637 -35.545 11.916  1.00 25.24 ? 90  ARG A CA    1 
ATOM   429  C  C     . ARG A 1 89  ? 64.117 -35.901 10.496  1.00 24.40 ? 90  ARG A C     1 
ATOM   430  O  O     . ARG A 1 89  ? 64.662 -36.988 10.289  1.00 23.66 ? 90  ARG A O     1 
ATOM   431  C  CB    . ARG A 1 89  ? 62.167 -35.931 12.169  1.00 31.53 ? 90  ARG A CB    1 
ATOM   432  C  CG    . ARG A 1 89  ? 61.815 -35.736 13.657  1.00 47.81 ? 90  ARG A CG    1 
ATOM   433  C  CD    . ARG A 1 89  ? 60.415 -36.194 14.123  1.00 59.93 ? 90  ARG A CD    1 
ATOM   434  N  NE    . ARG A 1 89  ? 60.247 -35.966 15.575  1.00 68.59 ? 90  ARG A NE    1 
ATOM   435  C  CZ    . ARG A 1 89  ? 59.117 -35.561 16.164  1.00 72.07 ? 90  ARG A CZ    1 
ATOM   436  N  NH1   . ARG A 1 89  ? 58.026 -35.341 15.440  1.00 74.23 ? 90  ARG A NH1   1 
ATOM   437  N  NH2   . ARG A 1 89  ? 59.083 -35.327 17.476  1.00 71.66 ? 90  ARG A NH2   1 
ATOM   438  N  N     . LEU A 1 90  ? 63.948 -34.972 9.546   1.00 20.99 ? 91  LEU A N     1 
ATOM   439  C  CA    . LEU A 1 90  ? 64.363 -35.154 8.144   1.00 18.80 ? 91  LEU A CA    1 
ATOM   440  C  C     . LEU A 1 90  ? 65.801 -34.666 7.912   1.00 20.19 ? 91  LEU A C     1 
ATOM   441  O  O     . LEU A 1 90  ? 66.323 -34.724 6.795   1.00 18.78 ? 91  LEU A O     1 
ATOM   442  C  CB    . LEU A 1 90  ? 63.419 -34.382 7.209   1.00 13.08 ? 91  LEU A CB    1 
ATOM   443  C  CG    . LEU A 1 90  ? 61.923 -34.693 7.335   1.00 15.41 ? 91  LEU A CG    1 
ATOM   444  C  CD1   . LEU A 1 90  ? 61.160 -33.898 6.308   1.00 13.38 ? 91  LEU A CD1   1 
ATOM   445  C  CD2   . LEU A 1 90  ? 61.663 -36.179 7.161   1.00 15.09 ? 91  LEU A CD2   1 
ATOM   446  N  N     . LYS A 1 91  ? 66.420 -34.162 8.976   1.00 20.95 ? 92  LYS A N     1 
ATOM   447  C  CA    . LYS A 1 91  ? 67.781 -33.642 8.947   1.00 21.31 ? 92  LYS A CA    1 
ATOM   448  C  C     . LYS A 1 91  ? 67.925 -32.530 7.916   1.00 21.38 ? 92  LYS A C     1 
ATOM   449  O  O     . LYS A 1 91  ? 68.685 -32.647 6.957   1.00 21.93 ? 92  LYS A O     1 
ATOM   450  C  CB    . LYS A 1 91  ? 68.814 -34.760 8.705   1.00 23.34 ? 92  LYS A CB    1 
ATOM   451  C  CG    . LYS A 1 91  ? 68.757 -35.938 9.697   1.00 30.29 ? 92  LYS A CG    1 
ATOM   452  C  CD    . LYS A 1 91  ? 69.082 -35.568 11.165  1.00 34.09 ? 92  LYS A CD    1 
ATOM   453  C  CE    . LYS A 1 91  ? 68.802 -36.742 12.159  1.00 28.67 ? 92  LYS A CE    1 
ATOM   454  N  NZ    . LYS A 1 91  ? 67.352 -36.991 12.459  1.00 22.24 ? 92  LYS A NZ    1 
ATOM   455  N  N     . ILE A 1 92  ? 67.156 -31.461 8.098   1.00 18.05 ? 93  ILE A N     1 
ATOM   456  C  CA    . ILE A 1 92  ? 67.229 -30.326 7.196   1.00 16.97 ? 93  ILE A CA    1 
ATOM   457  C  C     . ILE A 1 92  ? 67.777 -29.178 8.013   1.00 20.04 ? 93  ILE A C     1 
ATOM   458  O  O     . ILE A 1 92  ? 67.295 -28.906 9.107   1.00 20.84 ? 93  ILE A O     1 
ATOM   459  C  CB    . ILE A 1 92  ? 65.864 -29.944 6.627   1.00 12.48 ? 93  ILE A CB    1 
ATOM   460  C  CG1   . ILE A 1 92  ? 65.318 -31.092 5.773   1.00 9.30  ? 93  ILE A CG1   1 
ATOM   461  C  CG2   . ILE A 1 92  ? 65.982 -28.657 5.819   1.00 10.29 ? 93  ILE A CG2   1 
ATOM   462  C  CD1   . ILE A 1 92  ? 63.829 -30.992 5.463   1.00 8.88  ? 93  ILE A CD1   1 
ATOM   463  N  N     . ASP A 1 93  ? 68.816 -28.542 7.489   1.00 24.08 ? 94  ASP A N     1 
ATOM   464  C  CA    . ASP A 1 93  ? 69.470 -27.422 8.149   1.00 26.81 ? 94  ASP A CA    1 
ATOM   465  C  C     . ASP A 1 93  ? 68.839 -26.101 7.741   1.00 24.46 ? 94  ASP A C     1 
ATOM   466  O  O     . ASP A 1 93  ? 68.160 -26.006 6.717   1.00 24.67 ? 94  ASP A O     1 
ATOM   467  C  CB    . ASP A 1 93  ? 70.960 -27.377 7.764   1.00 33.86 ? 94  ASP A CB    1 
ATOM   468  C  CG    . ASP A 1 93  ? 71.753 -28.543 8.329   1.00 40.69 ? 94  ASP A CG    1 
ATOM   469  O  OD1   . ASP A 1 93  ? 72.087 -28.490 9.528   1.00 49.12 ? 94  ASP A OD1   1 
ATOM   470  O  OD2   . ASP A 1 93  ? 72.052 -29.506 7.581   1.00 46.52 ? 94  ASP A OD2   1 
ATOM   471  N  N     . PHE A 1 94  ? 69.053 -25.081 8.556   1.00 21.29 ? 95  PHE A N     1 
ATOM   472  C  CA    . PHE A 1 94  ? 68.552 -23.769 8.220   1.00 20.71 ? 95  PHE A CA    1 
ATOM   473  C  C     . PHE A 1 94  ? 69.482 -23.273 7.117   1.00 22.54 ? 95  PHE A C     1 
ATOM   474  O  O     . PHE A 1 94  ? 70.648 -23.694 7.036   1.00 20.89 ? 95  PHE A O     1 
ATOM   475  C  CB    . PHE A 1 94  ? 68.650 -22.816 9.424   1.00 20.17 ? 95  PHE A CB    1 
ATOM   476  C  CG    . PHE A 1 94  ? 67.685 -23.134 10.537  1.00 20.04 ? 95  PHE A CG    1 
ATOM   477  C  CD1   . PHE A 1 94  ? 66.337 -22.797 10.427  1.00 17.91 ? 95  PHE A CD1   1 
ATOM   478  C  CD2   . PHE A 1 94  ? 68.124 -23.785 11.692  1.00 18.61 ? 95  PHE A CD2   1 
ATOM   479  C  CE1   . PHE A 1 94  ? 65.436 -23.109 11.445  1.00 20.30 ? 95  PHE A CE1   1 
ATOM   480  C  CE2   . PHE A 1 94  ? 67.233 -24.101 12.716  1.00 20.29 ? 95  PHE A CE2   1 
ATOM   481  C  CZ    . PHE A 1 94  ? 65.884 -23.765 12.593  1.00 20.17 ? 95  PHE A CZ    1 
ATOM   482  N  N     . GLY A 1 95  ? 68.947 -22.411 6.257   1.00 23.79 ? 96  GLY A N     1 
ATOM   483  C  CA    . GLY A 1 95  ? 69.731 -21.817 5.191   1.00 29.30 ? 96  GLY A CA    1 
ATOM   484  C  C     . GLY A 1 95  ? 70.743 -20.843 5.785   1.00 33.11 ? 96  GLY A C     1 
ATOM   485  O  O     . GLY A 1 95  ? 71.820 -20.642 5.233   1.00 35.10 ? 96  GLY A O     1 
ATOM   486  N  N     . ASP A 1 96  ? 70.387 -20.229 6.910   1.00 35.27 ? 97  ASP A N     1 
ATOM   487  C  CA    . ASP A 1 96  ? 71.260 -19.293 7.608   1.00 35.66 ? 97  ASP A CA    1 
ATOM   488  C  C     . ASP A 1 96  ? 71.348 -19.774 9.051   1.00 32.96 ? 97  ASP A C     1 
ATOM   489  O  O     . ASP A 1 96  ? 70.336 -19.949 9.729   1.00 29.76 ? 97  ASP A O     1 
ATOM   490  C  CB    . ASP A 1 96  ? 70.697 -17.865 7.552   1.00 41.04 ? 97  ASP A CB    1 
ATOM   491  C  CG    . ASP A 1 96  ? 71.732 -16.798 7.946   1.00 47.67 ? 97  ASP A CG    1 
ATOM   492  O  OD1   . ASP A 1 96  ? 72.528 -17.023 8.890   1.00 49.26 ? 97  ASP A OD1   1 
ATOM   493  O  OD2   . ASP A 1 96  ? 71.743 -15.717 7.307   1.00 52.18 ? 97  ASP A OD2   1 
ATOM   494  N  N     . ALA A 1 97  ? 72.578 -19.983 9.505   1.00 33.61 ? 98  ALA A N     1 
ATOM   495  C  CA    . ALA A 1 97  ? 72.876 -20.465 10.859  1.00 33.50 ? 98  ALA A CA    1 
ATOM   496  C  C     . ALA A 1 97  ? 72.282 -19.622 11.986  1.00 30.49 ? 98  ALA A C     1 
ATOM   497  O  O     . ALA A 1 97  ? 71.904 -20.159 13.025  1.00 30.91 ? 98  ALA A O     1 
ATOM   498  C  CB    . ALA A 1 97  ? 74.397 -20.594 11.043  1.00 33.36 ? 98  ALA A CB    1 
ATOM   499  N  N     . ALA A 1 98  ? 72.217 -18.306 11.781  1.00 28.03 ? 99  ALA A N     1 
ATOM   500  C  CA    . ALA A 1 98  ? 71.664 -17.400 12.782  1.00 26.19 ? 99  ALA A CA    1 
ATOM   501  C  C     . ALA A 1 98  ? 70.234 -17.770 13.125  1.00 25.98 ? 99  ALA A C     1 
ATOM   502  O  O     . ALA A 1 98  ? 69.768 -17.470 14.220  1.00 26.80 ? 99  ALA A O     1 
ATOM   503  C  CB    . ALA A 1 98  ? 71.720 -15.976 12.292  1.00 25.64 ? 99  ALA A CB    1 
ATOM   504  N  N     . ARG A 1 99  ? 69.545 -18.440 12.201  1.00 23.93 ? 100 ARG A N     1 
ATOM   505  C  CA    . ARG A 1 99  ? 68.163 -18.836 12.427  1.00 21.67 ? 100 ARG A CA    1 
ATOM   506  C  C     . ARG A 1 99  ? 68.069 -19.735 13.633  1.00 21.18 ? 100 ARG A C     1 
ATOM   507  O  O     . ARG A 1 99  ? 66.995 -19.862 14.225  1.00 23.20 ? 100 ARG A O     1 
ATOM   508  C  CB    . ARG A 1 99  ? 67.586 -19.555 11.210  1.00 20.17 ? 100 ARG A CB    1 
ATOM   509  C  CG    . ARG A 1 99  ? 67.514 -18.713 9.981   1.00 20.40 ? 100 ARG A CG    1 
ATOM   510  C  CD    . ARG A 1 99  ? 66.506 -17.617 10.141  1.00 22.19 ? 100 ARG A CD    1 
ATOM   511  N  NE    . ARG A 1 99  ? 66.991 -16.543 10.997  1.00 24.33 ? 100 ARG A NE    1 
ATOM   512  C  CZ    . ARG A 1 99  ? 67.846 -15.594 10.614  1.00 28.46 ? 100 ARG A CZ    1 
ATOM   513  N  NH1   . ARG A 1 99  ? 68.331 -15.570 9.372   1.00 23.16 ? 100 ARG A NH1   1 
ATOM   514  N  NH2   . ARG A 1 99  ? 68.222 -14.663 11.486  1.00 28.12 ? 100 ARG A NH2   1 
ATOM   515  N  N     . ALA A 1 100 ? 69.190 -20.361 13.992  1.00 21.07 ? 101 ALA A N     1 
ATOM   516  C  CA    . ALA A 1 100 ? 69.249 -21.251 15.150  1.00 23.27 ? 101 ALA A CA    1 
ATOM   517  C  C     . ALA A 1 100 ? 68.943 -20.488 16.434  1.00 24.41 ? 101 ALA A C     1 
ATOM   518  O  O     . ALA A 1 100 ? 68.310 -21.013 17.345  1.00 24.52 ? 101 ALA A O     1 
ATOM   519  C  CB    . ALA A 1 100 ? 70.611 -21.912 15.246  1.00 24.19 ? 101 ALA A CB    1 
ATOM   520  N  N     . ASP A 1 101 ? 69.364 -19.237 16.496  1.00 27.56 ? 102 ASP A N     1 
ATOM   521  C  CA    . ASP A 1 101 ? 69.096 -18.423 17.674  1.00 32.52 ? 102 ASP A CA    1 
ATOM   522  C  C     . ASP A 1 101 ? 67.637 -17.952 17.697  1.00 29.37 ? 102 ASP A C     1 
ATOM   523  O  O     . ASP A 1 101 ? 67.051 -17.775 18.764  1.00 29.08 ? 102 ASP A O     1 
ATOM   524  C  CB    . ASP A 1 101 ? 70.068 -17.256 17.721  1.00 42.16 ? 102 ASP A CB    1 
ATOM   525  C  CG    . ASP A 1 101 ? 71.508 -17.714 17.616  1.00 49.63 ? 102 ASP A CG    1 
ATOM   526  O  OD1   . ASP A 1 101 ? 71.894 -18.633 18.386  1.00 53.80 ? 102 ASP A OD1   1 
ATOM   527  O  OD2   . ASP A 1 101 ? 72.238 -17.174 16.750  1.00 55.17 ? 102 ASP A OD2   1 
ATOM   528  N  N     . ASP A 1 102 ? 67.071 -17.723 16.515  1.00 25.68 ? 103 ASP A N     1 
ATOM   529  C  CA    . ASP A 1 102 ? 65.673 -17.347 16.404  1.00 23.67 ? 103 ASP A CA    1 
ATOM   530  C  C     . ASP A 1 102 ? 64.809 -18.526 16.838  1.00 20.44 ? 103 ASP A C     1 
ATOM   531  O  O     . ASP A 1 102 ? 63.830 -18.332 17.565  1.00 18.22 ? 103 ASP A O     1 
ATOM   532  C  CB    . ASP A 1 102 ? 65.328 -16.932 14.977  1.00 23.22 ? 103 ASP A CB    1 
ATOM   533  C  CG    . ASP A 1 102 ? 65.798 -15.543 14.666  1.00 24.73 ? 103 ASP A CG    1 
ATOM   534  O  OD1   . ASP A 1 102 ? 66.094 -14.802 15.627  1.00 28.44 ? 103 ASP A OD1   1 
ATOM   535  O  OD2   . ASP A 1 102 ? 65.882 -15.190 13.479  1.00 21.60 ? 103 ASP A OD2   1 
ATOM   536  N  N     . ALA A 1 103 ? 65.185 -19.739 16.422  1.00 17.87 ? 104 ALA A N     1 
ATOM   537  C  CA    . ALA A 1 103 ? 64.443 -20.943 16.792  1.00 19.54 ? 104 ALA A CA    1 
ATOM   538  C  C     . ALA A 1 103 ? 64.407 -21.078 18.312  1.00 20.95 ? 104 ALA A C     1 
ATOM   539  O  O     . ALA A 1 103 ? 63.379 -21.448 18.896  1.00 17.74 ? 104 ALA A O     1 
ATOM   540  C  CB    . ALA A 1 103 ? 65.068 -22.170 16.167  1.00 17.64 ? 104 ALA A CB    1 
ATOM   541  N  N     . ARG A 1 104 ? 65.525 -20.745 18.953  1.00 22.52 ? 105 ARG A N     1 
ATOM   542  C  CA    . ARG A 1 104 ? 65.606 -20.800 20.409  1.00 23.58 ? 105 ARG A CA    1 
ATOM   543  C  C     . ARG A 1 104 ? 64.625 -19.791 21.019  1.00 21.66 ? 105 ARG A C     1 
ATOM   544  O  O     . ARG A 1 104 ? 63.832 -20.142 21.901  1.00 18.06 ? 105 ARG A O     1 
ATOM   545  C  CB    . ARG A 1 104 ? 67.019 -20.479 20.888  1.00 29.92 ? 105 ARG A CB    1 
ATOM   546  C  CG    . ARG A 1 104 ? 67.148 -20.548 22.391  1.00 41.38 ? 105 ARG A CG    1 
ATOM   547  C  CD    . ARG A 1 104 ? 68.243 -19.649 22.946  1.00 50.86 ? 105 ARG A CD    1 
ATOM   548  N  NE    . ARG A 1 104 ? 68.331 -19.811 24.399  1.00 60.85 ? 105 ARG A NE    1 
ATOM   549  C  CZ    . ARG A 1 104 ? 67.717 -19.038 25.292  1.00 65.12 ? 105 ARG A CZ    1 
ATOM   550  N  NH1   . ARG A 1 104 ? 66.962 -18.016 24.899  1.00 67.75 ? 105 ARG A NH1   1 
ATOM   551  N  NH2   . ARG A 1 104 ? 67.814 -19.321 26.587  1.00 67.99 ? 105 ARG A NH2   1 
ATOM   552  N  N     . GLN A 1 105 ? 64.685 -18.545 20.542  1.00 18.86 ? 106 GLN A N     1 
ATOM   553  C  CA    . GLN A 1 105 ? 63.806 -17.483 21.022  1.00 19.14 ? 106 GLN A CA    1 
ATOM   554  C  C     . GLN A 1 105 ? 62.334 -17.780 20.836  1.00 17.49 ? 106 GLN A C     1 
ATOM   555  O  O     . GLN A 1 105 ? 61.502 -17.363 21.647  1.00 17.13 ? 106 GLN A O     1 
ATOM   556  C  CB    . GLN A 1 105 ? 64.130 -16.168 20.333  1.00 22.69 ? 106 GLN A CB    1 
ATOM   557  C  CG    . GLN A 1 105 ? 65.375 -15.524 20.845  1.00 33.25 ? 106 GLN A CG    1 
ATOM   558  C  CD    . GLN A 1 105 ? 65.267 -15.254 22.315  1.00 41.05 ? 106 GLN A CD    1 
ATOM   559  O  OE1   . GLN A 1 105 ? 65.921 -15.915 23.126  1.00 45.69 ? 106 GLN A OE1   1 
ATOM   560  N  NE2   . GLN A 1 105 ? 64.397 -14.312 22.684  1.00 42.20 ? 106 GLN A NE2   1 
ATOM   561  N  N     . LEU A 1 106 ? 62.012 -18.467 19.743  1.00 16.41 ? 107 LEU A N     1 
ATOM   562  C  CA    . LEU A 1 106 ? 60.634 -18.828 19.440  1.00 17.53 ? 107 LEU A CA    1 
ATOM   563  C  C     . LEU A 1 106 ? 59.962 -19.544 20.608  1.00 18.26 ? 107 LEU A C     1 
ATOM   564  O  O     . LEU A 1 106 ? 58.862 -19.168 21.031  1.00 18.44 ? 107 LEU A O     1 
ATOM   565  C  CB    . LEU A 1 106 ? 60.581 -19.716 18.201  1.00 17.22 ? 107 LEU A CB    1 
ATOM   566  C  CG    . LEU A 1 106 ? 59.228 -20.346 17.863  1.00 20.58 ? 107 LEU A CG    1 
ATOM   567  C  CD1   . LEU A 1 106 ? 58.158 -19.268 17.643  1.00 21.99 ? 107 LEU A CD1   1 
ATOM   568  C  CD2   . LEU A 1 106 ? 59.386 -21.213 16.629  1.00 20.39 ? 107 LEU A CD2   1 
ATOM   569  N  N     . PHE A 1 107 ? 60.620 -20.582 21.116  1.00 16.63 ? 108 PHE A N     1 
ATOM   570  C  CA    . PHE A 1 107 ? 60.083 -21.361 22.224  1.00 16.03 ? 108 PHE A CA    1 
ATOM   571  C  C     . PHE A 1 107 ? 59.964 -20.555 23.513  1.00 17.29 ? 108 PHE A C     1 
ATOM   572  O  O     . PHE A 1 107 ? 58.946 -20.618 24.206  1.00 17.03 ? 108 PHE A O     1 
ATOM   573  C  CB    . PHE A 1 107 ? 60.927 -22.611 22.414  1.00 17.10 ? 108 PHE A CB    1 
ATOM   574  C  CG    . PHE A 1 107 ? 60.719 -23.627 21.333  1.00 15.66 ? 108 PHE A CG    1 
ATOM   575  C  CD1   . PHE A 1 107 ? 59.590 -24.436 21.346  1.00 12.29 ? 108 PHE A CD1   1 
ATOM   576  C  CD2   . PHE A 1 107 ? 61.630 -23.752 20.294  1.00 13.19 ? 108 PHE A CD2   1 
ATOM   577  C  CE1   . PHE A 1 107 ? 59.365 -25.352 20.349  1.00 14.21 ? 108 PHE A CE1   1 
ATOM   578  C  CE2   . PHE A 1 107 ? 61.417 -24.664 19.289  1.00 14.52 ? 108 PHE A CE2   1 
ATOM   579  C  CZ    . PHE A 1 107 ? 60.278 -25.472 19.316  1.00 15.84 ? 108 PHE A CZ    1 
ATOM   580  N  N     . VAL A 1 108 ? 60.983 -19.756 23.802  1.00 17.60 ? 109 VAL A N     1 
ATOM   581  C  CA    . VAL A 1 108 ? 60.981 -18.906 24.988  1.00 20.40 ? 109 VAL A CA    1 
ATOM   582  C  C     . VAL A 1 108 ? 59.774 -17.957 24.966  1.00 21.44 ? 109 VAL A C     1 
ATOM   583  O  O     . VAL A 1 108 ? 59.139 -17.716 25.993  1.00 22.50 ? 109 VAL A O     1 
ATOM   584  C  CB    . VAL A 1 108 ? 62.261 -18.053 25.037  1.00 21.53 ? 109 VAL A CB    1 
ATOM   585  C  CG1   . VAL A 1 108 ? 62.144 -16.970 26.112  1.00 22.44 ? 109 VAL A CG1   1 
ATOM   586  C  CG2   . VAL A 1 108 ? 63.476 -18.950 25.289  1.00 23.49 ? 109 VAL A CG2   1 
ATOM   587  N  N     . LEU A 1 109 ? 59.449 -17.441 23.783  1.00 21.09 ? 110 LEU A N     1 
ATOM   588  C  CA    . LEU A 1 109 ? 58.347 -16.496 23.616  1.00 18.52 ? 110 LEU A CA    1 
ATOM   589  C  C     . LEU A 1 109 ? 56.976 -17.067 23.208  1.00 17.49 ? 110 LEU A C     1 
ATOM   590  O  O     . LEU A 1 109 ? 55.971 -16.367 23.307  1.00 18.44 ? 110 LEU A O     1 
ATOM   591  C  CB    . LEU A 1 109 ? 58.765 -15.433 22.602  1.00 17.59 ? 110 LEU A CB    1 
ATOM   592  C  CG    . LEU A 1 109 ? 60.054 -14.655 22.862  1.00 16.03 ? 110 LEU A CG    1 
ATOM   593  C  CD1   . LEU A 1 109 ? 60.509 -13.997 21.578  1.00 20.23 ? 110 LEU A CD1   1 
ATOM   594  C  CD2   . LEU A 1 109 ? 59.837 -13.634 23.969  1.00 15.28 ? 110 LEU A CD2   1 
ATOM   595  N  N     . ALA A 1 110 ? 56.929 -18.314 22.747  1.00 17.46 ? 111 ALA A N     1 
ATOM   596  C  CA    . ALA A 1 110 ? 55.679 -18.941 22.297  1.00 17.21 ? 111 ALA A CA    1 
ATOM   597  C  C     . ALA A 1 110 ? 54.487 -18.869 23.246  1.00 18.25 ? 111 ALA A C     1 
ATOM   598  O  O     . ALA A 1 110 ? 53.339 -18.767 22.800  1.00 19.09 ? 111 ALA A O     1 
ATOM   599  C  CB    . ALA A 1 110 ? 55.932 -20.384 21.906  1.00 16.19 ? 111 ALA A CB    1 
ATOM   600  N  N     . GLY A 1 111 ? 54.757 -18.900 24.548  1.00 18.86 ? 112 GLY A N     1 
ATOM   601  C  CA    . GLY A 1 111 ? 53.695 -18.871 25.543  1.00 15.37 ? 112 GLY A CA    1 
ATOM   602  C  C     . GLY A 1 111 ? 52.670 -17.759 25.467  1.00 15.02 ? 112 GLY A C     1 
ATOM   603  O  O     . GLY A 1 111 ? 51.491 -17.980 25.764  1.00 15.86 ? 112 GLY A O     1 
ATOM   604  N  N     . ALA A 1 112 ? 53.122 -16.561 25.107  1.00 15.89 ? 113 ALA A N     1 
ATOM   605  C  CA    . ALA A 1 112 ? 52.254 -15.385 24.981  1.00 18.02 ? 113 ALA A CA    1 
ATOM   606  C  C     . ALA A 1 112 ? 51.161 -15.542 23.914  1.00 21.63 ? 113 ALA A C     1 
ATOM   607  O  O     . ALA A 1 112 ? 49.985 -15.239 24.155  1.00 20.40 ? 113 ALA A O     1 
ATOM   608  C  CB    . ALA A 1 112 ? 53.095 -14.155 24.669  1.00 15.16 ? 113 ALA A CB    1 
ATOM   609  N  N     . ALA A 1 113 ? 51.567 -16.001 22.732  1.00 25.72 ? 114 ALA A N     1 
ATOM   610  C  CA    . ALA A 1 113 ? 50.664 -16.187 21.603  1.00 27.39 ? 114 ALA A CA    1 
ATOM   611  C  C     . ALA A 1 113 ? 49.490 -17.047 22.002  1.00 30.07 ? 114 ALA A C     1 
ATOM   612  O  O     . ALA A 1 113 ? 48.335 -16.736 21.690  1.00 30.30 ? 114 ALA A O     1 
ATOM   613  C  CB    . ALA A 1 113 ? 51.413 -16.803 20.439  1.00 27.82 ? 114 ALA A CB    1 
ATOM   614  N  N     . GLU A 1 114 ? 49.798 -18.111 22.731  1.00 33.49 ? 115 GLU A N     1 
ATOM   615  C  CA    . GLU A 1 114 ? 48.792 -19.035 23.228  1.00 39.01 ? 115 GLU A CA    1 
ATOM   616  C  C     . GLU A 1 114 ? 47.721 -18.270 24.002  1.00 37.44 ? 115 GLU A C     1 
ATOM   617  O  O     . GLU A 1 114 ? 46.534 -18.576 23.893  1.00 39.10 ? 115 GLU A O     1 
ATOM   618  C  CB    . GLU A 1 114 ? 49.440 -20.066 24.149  1.00 46.16 ? 115 GLU A CB    1 
ATOM   619  C  CG    . GLU A 1 114 ? 50.548 -20.895 23.498  1.00 57.44 ? 115 GLU A CG    1 
ATOM   620  C  CD    . GLU A 1 114 ? 51.223 -21.860 24.481  1.00 66.20 ? 115 GLU A CD    1 
ATOM   621  O  OE1   . GLU A 1 114 ? 50.504 -22.512 25.281  1.00 68.92 ? 115 GLU A OE1   1 
ATOM   622  O  OE2   . GLU A 1 114 ? 52.475 -21.962 24.456  1.00 70.33 ? 115 GLU A OE2   1 
ATOM   623  N  N     . GLU A 1 115 ? 48.145 -17.256 24.755  1.00 33.82 ? 116 GLU A N     1 
ATOM   624  C  CA    . GLU A 1 115 ? 47.227 -16.443 25.549  1.00 32.41 ? 116 GLU A CA    1 
ATOM   625  C  C     . GLU A 1 115 ? 46.530 -15.321 24.764  1.00 32.01 ? 116 GLU A C     1 
ATOM   626  O  O     . GLU A 1 115 ? 45.827 -14.492 25.345  1.00 33.26 ? 116 GLU A O     1 
ATOM   627  C  CB    . GLU A 1 115 ? 47.956 -15.874 26.773  1.00 29.44 ? 116 GLU A CB    1 
ATOM   628  C  CG    . GLU A 1 115 ? 48.603 -16.937 27.651  1.00 28.02 ? 116 GLU A CG    1 
ATOM   629  C  CD    . GLU A 1 115 ? 47.631 -18.029 28.112  1.00 30.70 ? 116 GLU A CD    1 
ATOM   630  O  OE1   . GLU A 1 115 ? 46.433 -17.734 28.325  1.00 29.55 ? 116 GLU A OE1   1 
ATOM   631  O  OE2   . GLU A 1 115 ? 48.059 -19.194 28.270  1.00 28.82 ? 116 GLU A OE2   1 
ATOM   632  N  N     . GLY A 1 116 ? 46.707 -15.312 23.445  1.00 32.17 ? 117 GLY A N     1 
ATOM   633  C  CA    . GLY A 1 116 ? 46.083 -14.298 22.613  1.00 28.72 ? 117 GLY A CA    1 
ATOM   634  C  C     . GLY A 1 116 ? 46.924 -13.048 22.474  1.00 30.67 ? 117 GLY A C     1 
ATOM   635  O  O     . GLY A 1 116 ? 46.433 -11.997 22.057  1.00 29.18 ? 117 GLY A O     1 
ATOM   636  N  N     . PHE A 1 117 ? 48.204 -13.154 22.803  1.00 29.74 ? 118 PHE A N     1 
ATOM   637  C  CA    . PHE A 1 117 ? 49.085 -12.009 22.703  1.00 29.31 ? 118 PHE A CA    1 
ATOM   638  C  C     . PHE A 1 117 ? 50.168 -12.268 21.666  1.00 29.77 ? 118 PHE A C     1 
ATOM   639  O  O     . PHE A 1 117 ? 50.644 -13.388 21.506  1.00 29.70 ? 118 PHE A O     1 
ATOM   640  C  CB    . PHE A 1 117 ? 49.686 -11.670 24.083  1.00 31.78 ? 118 PHE A CB    1 
ATOM   641  C  CG    . PHE A 1 117 ? 48.648 -11.298 25.118  1.00 30.26 ? 118 PHE A CG    1 
ATOM   642  C  CD1   . PHE A 1 117 ? 48.031 -12.275 25.885  1.00 31.65 ? 118 PHE A CD1   1 
ATOM   643  C  CD2   . PHE A 1 117 ? 48.252 -9.980  25.280  1.00 31.38 ? 118 PHE A CD2   1 
ATOM   644  C  CE1   . PHE A 1 117 ? 47.030 -11.943 26.795  1.00 32.34 ? 118 PHE A CE1   1 
ATOM   645  C  CE2   . PHE A 1 117 ? 47.253 -9.639  26.188  1.00 31.14 ? 118 PHE A CE2   1 
ATOM   646  C  CZ    . PHE A 1 117 ? 46.642 -10.624 26.944  1.00 30.96 ? 118 PHE A CZ    1 
ATOM   647  N  N     . MET A 1 118 ? 50.520 -11.235 20.923  1.00 28.74 ? 119 MET A N     1 
ATOM   648  C  CA    . MET A 1 118 ? 51.549 -11.358 19.916  1.00 30.04 ? 119 MET A CA    1 
ATOM   649  C  C     . MET A 1 118 ? 52.394 -10.103 20.028  1.00 29.94 ? 119 MET A C     1 
ATOM   650  O  O     . MET A 1 118 ? 51.888 -8.998  19.875  1.00 31.69 ? 119 MET A O     1 
ATOM   651  C  CB    . MET A 1 118 ? 50.906 -11.463 18.528  1.00 33.62 ? 119 MET A CB    1 
ATOM   652  C  CG    . MET A 1 118 ? 51.869 -11.472 17.350  1.00 33.10 ? 119 MET A CG    1 
ATOM   653  S  SD    . MET A 1 118 ? 52.822 -12.965 17.268  1.00 32.35 ? 119 MET A SD    1 
ATOM   654  C  CE    . MET A 1 118 ? 51.557 -14.189 16.909  1.00 29.04 ? 119 MET A CE    1 
ATOM   655  N  N     . THR A 1 119 ? 53.658 -10.269 20.393  1.00 28.53 ? 120 THR A N     1 
ATOM   656  C  CA    . THR A 1 119 ? 54.550 -9.134  20.522  1.00 27.11 ? 120 THR A CA    1 
ATOM   657  C  C     . THR A 1 119 ? 55.274 -8.938  19.200  1.00 28.37 ? 120 THR A C     1 
ATOM   658  O  O     . THR A 1 119 ? 55.473 -9.887  18.443  1.00 29.14 ? 120 THR A O     1 
ATOM   659  C  CB    . THR A 1 119 ? 55.581 -9.341  21.672  1.00 27.93 ? 120 THR A CB    1 
ATOM   660  O  OG1   . THR A 1 119 ? 56.491 -10.401 21.340  1.00 24.37 ? 120 THR A OG1   1 
ATOM   661  C  CG2   . THR A 1 119 ? 54.864 -9.703  22.969  1.00 26.09 ? 120 THR A CG2   1 
ATOM   662  N  N     . ALA A 1 120 ? 55.658 -7.702  18.917  1.00 27.91 ? 121 ALA A N     1 
ATOM   663  C  CA    . ALA A 1 120 ? 56.377 -7.389  17.694  1.00 28.12 ? 121 ALA A CA    1 
ATOM   664  C  C     . ALA A 1 120 ? 57.655 -8.238  17.629  1.00 27.67 ? 121 ALA A C     1 
ATOM   665  O  O     . ALA A 1 120 ? 58.092 -8.661  16.553  1.00 27.26 ? 121 ALA A O     1 
ATOM   666  C  CB    . ALA A 1 120 ? 56.719 -5.902  17.659  1.00 30.03 ? 121 ALA A CB    1 
ATOM   667  N  N     . GLU A 1 121 ? 58.229 -8.523  18.789  1.00 23.97 ? 122 GLU A N     1 
ATOM   668  C  CA    . GLU A 1 121 ? 59.425 -9.322  18.817  1.00 24.30 ? 122 GLU A CA    1 
ATOM   669  C  C     . GLU A 1 121 ? 59.143 -10.753 18.356  1.00 22.98 ? 122 GLU A C     1 
ATOM   670  O  O     . GLU A 1 121 ? 59.939 -11.322 17.607  1.00 21.00 ? 122 GLU A O     1 
ATOM   671  C  CB    . GLU A 1 121 ? 60.045 -9.340  20.205  1.00 25.86 ? 122 GLU A CB    1 
ATOM   672  C  CG    . GLU A 1 121 ? 61.296 -10.182 20.239  1.00 33.91 ? 122 GLU A CG    1 
ATOM   673  C  CD    . GLU A 1 121 ? 61.951 -10.231 21.587  1.00 40.61 ? 122 GLU A CD    1 
ATOM   674  O  OE1   . GLU A 1 121 ? 61.255 -10.040 22.611  1.00 45.49 ? 122 GLU A OE1   1 
ATOM   675  O  OE2   . GLU A 1 121 ? 63.174 -10.478 21.616  1.00 44.59 ? 122 GLU A OE2   1 
ATOM   676  N  N     . LEU A 1 122 ? 58.025 -11.333 18.801  1.00 18.37 ? 123 LEU A N     1 
ATOM   677  C  CA    . LEU A 1 122 ? 57.678 -12.705 18.420  1.00 15.89 ? 123 LEU A CA    1 
ATOM   678  C  C     . LEU A 1 122 ? 57.395 -12.796 16.920  1.00 14.92 ? 123 LEU A C     1 
ATOM   679  O  O     . LEU A 1 122 ? 57.810 -13.756 16.253  1.00 11.24 ? 123 LEU A O     1 
ATOM   680  C  CB    . LEU A 1 122 ? 56.476 -13.206 19.218  1.00 13.02 ? 123 LEU A CB    1 
ATOM   681  C  CG    . LEU A 1 122 ? 55.993 -14.635 18.942  1.00 12.59 ? 123 LEU A CG    1 
ATOM   682  C  CD1   . LEU A 1 122 ? 57.130 -15.624 19.006  1.00 15.97 ? 123 LEU A CD1   1 
ATOM   683  C  CD2   . LEU A 1 122 ? 54.948 -14.991 19.964  1.00 14.62 ? 123 LEU A CD2   1 
ATOM   684  N  N     . ALA A 1 123 ? 56.696 -11.781 16.410  1.00 15.04 ? 124 ALA A N     1 
ATOM   685  C  CA    . ALA A 1 123 ? 56.343 -11.675 15.000  1.00 15.68 ? 124 ALA A CA    1 
ATOM   686  C  C     . ALA A 1 123 ? 57.615 -11.647 14.161  1.00 15.66 ? 124 ALA A C     1 
ATOM   687  O  O     . ALA A 1 123 ? 57.686 -12.305 13.123  1.00 13.04 ? 124 ALA A O     1 
ATOM   688  C  CB    . ALA A 1 123 ? 55.523 -10.417 14.754  1.00 12.76 ? 124 ALA A CB    1 
ATOM   689  N  N     . GLY A 1 124 ? 58.619 -10.907 14.637  1.00 17.29 ? 125 GLY A N     1 
ATOM   690  C  CA    . GLY A 1 124 ? 59.891 -10.802 13.936  1.00 15.77 ? 125 GLY A CA    1 
ATOM   691  C  C     . GLY A 1 124 ? 60.658 -12.110 13.875  1.00 16.01 ? 125 GLY A C     1 
ATOM   692  O  O     . GLY A 1 124 ? 61.255 -12.449 12.850  1.00 17.03 ? 125 GLY A O     1 
ATOM   693  N  N     . VAL A 1 125 ? 60.657 -12.841 14.984  1.00 15.96 ? 126 VAL A N     1 
ATOM   694  C  CA    . VAL A 1 125 ? 61.323 -14.127 15.073  1.00 11.74 ? 126 VAL A CA    1 
ATOM   695  C  C     . VAL A 1 125 ? 60.716 -15.084 14.045  1.00 12.32 ? 126 VAL A C     1 
ATOM   696  O  O     . VAL A 1 125 ? 61.452 -15.733 13.294  1.00 14.69 ? 126 VAL A O     1 
ATOM   697  C  CB    . VAL A 1 125 ? 61.187 -14.708 16.508  1.00 12.27 ? 126 VAL A CB    1 
ATOM   698  C  CG1   . VAL A 1 125 ? 61.311 -16.224 16.515  1.00 11.32 ? 126 VAL A CG1   1 
ATOM   699  C  CG2   . VAL A 1 125 ? 62.249 -14.110 17.396  1.00 9.99  ? 126 VAL A CG2   1 
ATOM   700  N  N     . ILE A 1 126 ? 59.382 -15.155 14.007  1.00 12.76 ? 127 ILE A N     1 
ATOM   701  C  CA    . ILE A 1 126 ? 58.656 -16.046 13.086  1.00 11.74 ? 127 ILE A CA    1 
ATOM   702  C  C     . ILE A 1 126 ? 58.813 -15.655 11.617  1.00 13.42 ? 127 ILE A C     1 
ATOM   703  O  O     . ILE A 1 126 ? 59.004 -16.513 10.756  1.00 13.17 ? 127 ILE A O     1 
ATOM   704  C  CB    . ILE A 1 126 ? 57.151 -16.115 13.433  1.00 12.87 ? 127 ILE A CB    1 
ATOM   705  C  CG1   . ILE A 1 126 ? 56.970 -16.640 14.862  1.00 12.82 ? 127 ILE A CG1   1 
ATOM   706  C  CG2   . ILE A 1 126 ? 56.400 -17.020 12.434  1.00 10.30 ? 127 ILE A CG2   1 
ATOM   707  C  CD1   . ILE A 1 126 ? 55.572 -16.411 15.433  1.00 12.83 ? 127 ILE A CD1   1 
ATOM   708  N  N     . LYS A 1 127 ? 58.736 -14.366 11.326  1.00 12.22 ? 128 LYS A N     1 
ATOM   709  C  CA    . LYS A 1 127 ? 58.882 -13.925 9.958   1.00 16.98 ? 128 LYS A CA    1 
ATOM   710  C  C     . LYS A 1 127 ? 60.267 -14.300 9.417   1.00 15.90 ? 128 LYS A C     1 
ATOM   711  O  O     . LYS A 1 127 ? 60.393 -14.774 8.281   1.00 16.71 ? 128 LYS A O     1 
ATOM   712  C  CB    . LYS A 1 127 ? 58.642 -12.423 9.855   1.00 19.32 ? 128 LYS A CB    1 
ATOM   713  C  CG    . LYS A 1 127 ? 58.125 -12.033 8.501   1.00 30.92 ? 128 LYS A CG    1 
ATOM   714  C  CD    . LYS A 1 127 ? 57.930 -10.545 8.374   1.00 39.73 ? 128 LYS A CD    1 
ATOM   715  C  CE    . LYS A 1 127 ? 57.597 -10.187 6.929   1.00 44.86 ? 128 LYS A CE    1 
ATOM   716  N  NZ    . LYS A 1 127 ? 57.596 -8.711  6.723   1.00 50.25 ? 128 LYS A NZ    1 
ATOM   717  N  N     . ARG A 1 128 ? 61.307 -14.111 10.224  1.00 15.23 ? 129 ARG A N     1 
ATOM   718  C  CA    . ARG A 1 128 ? 62.643 -14.473 9.780   1.00 14.23 ? 129 ARG A CA    1 
ATOM   719  C  C     . ARG A 1 128 ? 62.748 -15.991 9.572   1.00 16.59 ? 129 ARG A C     1 
ATOM   720  O  O     . ARG A 1 128 ? 63.355 -16.433 8.597   1.00 17.56 ? 129 ARG A O     1 
ATOM   721  C  CB    . ARG A 1 128 ? 63.706 -13.976 10.748  1.00 14.43 ? 129 ARG A CB    1 
ATOM   722  C  CG    . ARG A 1 128 ? 63.867 -12.469 10.735  1.00 15.92 ? 129 ARG A CG    1 
ATOM   723  C  CD    . ARG A 1 128 ? 65.108 -12.015 11.488  1.00 16.83 ? 129 ARG A CD    1 
ATOM   724  N  NE    . ARG A 1 128 ? 65.049 -12.345 12.907  1.00 19.96 ? 129 ARG A NE    1 
ATOM   725  C  CZ    . ARG A 1 128 ? 64.412 -11.627 13.833  1.00 20.18 ? 129 ARG A CZ    1 
ATOM   726  N  NH1   . ARG A 1 128 ? 63.762 -10.519 13.507  1.00 21.72 ? 129 ARG A NH1   1 
ATOM   727  N  NH2   . ARG A 1 128 ? 64.422 -12.026 15.099  1.00 16.71 ? 129 ARG A NH2   1 
ATOM   728  N  N     . LEU A 1 129 ? 62.146 -16.793 10.455  1.00 12.96 ? 130 LEU A N     1 
ATOM   729  C  CA    . LEU A 1 129 ? 62.181 -18.253 10.291  1.00 13.42 ? 130 LEU A CA    1 
ATOM   730  C  C     . LEU A 1 129 ? 61.454 -18.702 9.006   1.00 12.64 ? 130 LEU A C     1 
ATOM   731  O  O     . LEU A 1 129 ? 61.980 -19.499 8.230   1.00 11.41 ? 130 LEU A O     1 
ATOM   732  C  CB    . LEU A 1 129 ? 61.579 -18.963 11.513  1.00 10.33 ? 130 LEU A CB    1 
ATOM   733  C  CG    . LEU A 1 129 ? 62.406 -18.908 12.813  1.00 14.06 ? 130 LEU A CG    1 
ATOM   734  C  CD1   . LEU A 1 129 ? 61.600 -19.482 13.960  1.00 15.77 ? 130 LEU A CD1   1 
ATOM   735  C  CD2   . LEU A 1 129 ? 63.705 -19.679 12.685  1.00 11.46 ? 130 LEU A CD2   1 
ATOM   736  N  N     . TRP A 1 130 ? 60.273 -18.132 8.768   1.00 13.86 ? 131 TRP A N     1 
ATOM   737  C  CA    . TRP A 1 130 ? 59.439 -18.462 7.606   1.00 14.01 ? 131 TRP A CA    1 
ATOM   738  C  C     . TRP A 1 130 ? 60.144 -18.197 6.268   1.00 15.72 ? 131 TRP A C     1 
ATOM   739  O  O     . TRP A 1 130 ? 60.001 -18.961 5.318   1.00 14.64 ? 131 TRP A O     1 
ATOM   740  C  CB    . TRP A 1 130 ? 58.114 -17.689 7.709   1.00 10.52 ? 131 TRP A CB    1 
ATOM   741  C  CG    . TRP A 1 130 ? 57.104 -17.888 6.593   1.00 9.26  ? 131 TRP A CG    1 
ATOM   742  C  CD1   . TRP A 1 130 ? 56.513 -16.905 5.854   1.00 6.13  ? 131 TRP A CD1   1 
ATOM   743  C  CD2   . TRP A 1 130 ? 56.548 -19.132 6.119   1.00 7.51  ? 131 TRP A CD2   1 
ATOM   744  N  NE1   . TRP A 1 130 ? 55.634 -17.448 4.957   1.00 6.63  ? 131 TRP A NE1   1 
ATOM   745  C  CE2   . TRP A 1 130 ? 55.636 -18.811 5.095   1.00 7.75  ? 131 TRP A CE2   1 
ATOM   746  C  CE3   . TRP A 1 130 ? 56.739 -20.474 6.458   1.00 11.13 ? 131 TRP A CE3   1 
ATOM   747  C  CZ2   . TRP A 1 130 ? 54.904 -19.790 4.401   1.00 13.41 ? 131 TRP A CZ2   1 
ATOM   748  C  CZ3   . TRP A 1 130 ? 56.013 -21.451 5.772   1.00 11.98 ? 131 TRP A CZ3   1 
ATOM   749  C  CH2   . TRP A 1 130 ? 55.107 -21.100 4.753   1.00 12.05 ? 131 TRP A CH2   1 
ATOM   750  N  N     . LYS A 1 131 ? 60.934 -17.137 6.219   1.00 18.57 ? 132 LYS A N     1 
ATOM   751  C  CA    . LYS A 1 131 ? 61.662 -16.774 5.011   1.00 22.46 ? 132 LYS A CA    1 
ATOM   752  C  C     . LYS A 1 131 ? 62.919 -17.602 4.783   1.00 22.49 ? 132 LYS A C     1 
ATOM   753  O  O     . LYS A 1 131 ? 63.502 -17.569 3.700   1.00 23.69 ? 132 LYS A O     1 
ATOM   754  C  CB    . LYS A 1 131 ? 62.087 -15.311 5.068   1.00 26.76 ? 132 LYS A CB    1 
ATOM   755  C  CG    . LYS A 1 131 ? 60.978 -14.300 4.893   1.00 37.95 ? 132 LYS A CG    1 
ATOM   756  C  CD    . LYS A 1 131 ? 61.608 -12.900 4.914   1.00 49.14 ? 132 LYS A CD    1 
ATOM   757  C  CE    . LYS A 1 131 ? 60.616 -11.790 4.579   1.00 53.40 ? 132 LYS A CE    1 
ATOM   758  N  NZ    . LYS A 1 131 ? 61.291 -10.447 4.559   1.00 56.08 ? 132 LYS A NZ    1 
ATOM   759  N  N     . ASP A 1 132 ? 63.363 -18.325 5.797   1.00 21.26 ? 133 ASP A N     1 
ATOM   760  C  CA    . ASP A 1 132 ? 64.581 -19.095 5.646   1.00 18.47 ? 133 ASP A CA    1 
ATOM   761  C  C     . ASP A 1 132 ? 64.416 -20.173 4.586   1.00 18.94 ? 133 ASP A C     1 
ATOM   762  O  O     . ASP A 1 132 ? 63.394 -20.860 4.557   1.00 17.35 ? 133 ASP A O     1 
ATOM   763  C  CB    . ASP A 1 132 ? 64.992 -19.692 6.980   1.00 17.58 ? 133 ASP A CB    1 
ATOM   764  C  CG    . ASP A 1 132 ? 66.296 -20.419 6.896   1.00 17.39 ? 133 ASP A CG    1 
ATOM   765  O  OD1   . ASP A 1 132 ? 67.351 -19.749 6.917   1.00 23.00 ? 133 ASP A OD1   1 
ATOM   766  O  OD2   . ASP A 1 132 ? 66.264 -21.654 6.781   1.00 15.83 ? 133 ASP A OD2   1 
ATOM   767  N  N     . SER A 1 133 ? 65.437 -20.351 3.743   1.00 17.88 ? 134 SER A N     1 
ATOM   768  C  CA    . SER A 1 133 ? 65.373 -21.342 2.666   1.00 15.85 ? 134 SER A CA    1 
ATOM   769  C  C     . SER A 1 133 ? 65.271 -22.788 3.153   1.00 14.48 ? 134 SER A C     1 
ATOM   770  O  O     . SER A 1 133 ? 64.663 -23.625 2.486   1.00 16.99 ? 134 SER A O     1 
ATOM   771  C  CB    . SER A 1 133 ? 66.555 -21.181 1.711   1.00 17.44 ? 134 SER A CB    1 
ATOM   772  O  OG    . SER A 1 133 ? 67.769 -21.485 2.366   1.00 16.11 ? 134 SER A OG    1 
ATOM   773  N  N     . GLY A 1 134 ? 65.888 -23.079 4.296   1.00 13.71 ? 135 GLY A N     1 
ATOM   774  C  CA    . GLY A 1 134 ? 65.828 -24.417 4.865   1.00 12.31 ? 135 GLY A CA    1 
ATOM   775  C  C     . GLY A 1 134 ? 64.433 -24.684 5.402   1.00 12.30 ? 135 GLY A C     1 
ATOM   776  O  O     . GLY A 1 134 ? 63.901 -25.784 5.276   1.00 12.21 ? 135 GLY A O     1 
ATOM   777  N  N     . VAL A 1 135 ? 63.816 -23.653 5.962   1.00 11.22 ? 136 VAL A N     1 
ATOM   778  C  CA    . VAL A 1 135 ? 62.468 -23.779 6.488   1.00 11.32 ? 136 VAL A CA    1 
ATOM   779  C  C     . VAL A 1 135 ? 61.482 -23.997 5.328   1.00 11.46 ? 136 VAL A C     1 
ATOM   780  O  O     . VAL A 1 135 ? 60.615 -24.876 5.390   1.00 11.93 ? 136 VAL A O     1 
ATOM   781  C  CB    . VAL A 1 135 ? 62.106 -22.532 7.327   1.00 14.19 ? 136 VAL A CB    1 
ATOM   782  C  CG1   . VAL A 1 135 ? 60.616 -22.511 7.662   1.00 11.64 ? 136 VAL A CG1   1 
ATOM   783  C  CG2   . VAL A 1 135 ? 62.936 -22.543 8.623   1.00 9.36  ? 136 VAL A CG2   1 
ATOM   784  N  N     . GLN A 1 136 ? 61.675 -23.265 4.234   1.00 12.17 ? 137 GLN A N     1 
ATOM   785  C  CA    . GLN A 1 136 ? 60.816 -23.398 3.058   1.00 11.07 ? 137 GLN A CA    1 
ATOM   786  C  C     . GLN A 1 136 ? 60.958 -24.785 2.409   1.00 11.26 ? 137 GLN A C     1 
ATOM   787  O  O     . GLN A 1 136 ? 59.961 -25.408 2.026   1.00 13.38 ? 137 GLN A O     1 
ATOM   788  C  CB    . GLN A 1 136 ? 61.114 -22.269 2.059   1.00 12.41 ? 137 GLN A CB    1 
ATOM   789  C  CG    . GLN A 1 136 ? 60.567 -20.898 2.486   1.00 10.22 ? 137 GLN A CG    1 
ATOM   790  C  CD    . GLN A 1 136 ? 59.047 -20.877 2.565   1.00 13.16 ? 137 GLN A CD    1 
ATOM   791  O  OE1   . GLN A 1 136 ? 58.367 -21.334 1.658   1.00 13.51 ? 137 GLN A OE1   1 
ATOM   792  N  NE2   . GLN A 1 136 ? 58.513 -20.355 3.657   1.00 14.77 ? 137 GLN A NE2   1 
ATOM   793  N  N     . ALA A 1 137 ? 62.183 -25.302 2.355   1.00 11.15 ? 138 ALA A N     1 
ATOM   794  C  CA    . ALA A 1 137 ? 62.424 -26.628 1.778   1.00 9.63  ? 138 ALA A CA    1 
ATOM   795  C  C     . ALA A 1 137 ? 61.670 -27.670 2.588   1.00 11.41 ? 138 ALA A C     1 
ATOM   796  O  O     . ALA A 1 137 ? 61.129 -28.618 2.032   1.00 14.33 ? 138 ALA A O     1 
ATOM   797  C  CB    . ALA A 1 137 ? 63.920 -26.957 1.762   1.00 11.75 ? 138 ALA A CB    1 
ATOM   798  N  N     . CYS A 1 138 ? 61.641 -27.509 3.907   1.00 8.94  ? 139 CYS A N     1 
ATOM   799  C  CA    . CYS A 1 138 ? 60.910 -28.443 4.746   1.00 7.87  ? 139 CYS A CA    1 
ATOM   800  C  C     . CYS A 1 138 ? 59.409 -28.176 4.552   1.00 7.74  ? 139 CYS A C     1 
ATOM   801  O  O     . CYS A 1 138 ? 58.601 -29.108 4.512   1.00 8.15  ? 139 CYS A O     1 
ATOM   802  C  CB    . CYS A 1 138 ? 61.300 -28.274 6.213   1.00 8.92  ? 139 CYS A CB    1 
ATOM   803  S  SG    . CYS A 1 138 ? 60.558 -29.508 7.326   1.00 14.25 ? 139 CYS A SG    1 
ATOM   804  N  N     . PHE A 1 139 ? 59.034 -26.908 4.401   1.00 8.16  ? 140 PHE A N     1 
ATOM   805  C  CA    . PHE A 1 139 ? 57.627 -26.582 4.205   1.00 9.85  ? 140 PHE A CA    1 
ATOM   806  C  C     . PHE A 1 139 ? 57.132 -27.317 2.967   1.00 12.85 ? 140 PHE A C     1 
ATOM   807  O  O     . PHE A 1 139 ? 56.017 -27.856 2.945   1.00 14.84 ? 140 PHE A O     1 
ATOM   808  C  CB    . PHE A 1 139 ? 57.415 -25.070 4.036   1.00 9.74  ? 140 PHE A CB    1 
ATOM   809  C  CG    . PHE A 1 139 ? 56.015 -24.711 3.633   1.00 13.07 ? 140 PHE A CG    1 
ATOM   810  C  CD1   . PHE A 1 139 ? 54.946 -24.992 4.474   1.00 12.15 ? 140 PHE A CD1   1 
ATOM   811  C  CD2   . PHE A 1 139 ? 55.751 -24.183 2.380   1.00 9.80  ? 140 PHE A CD2   1 
ATOM   812  C  CE1   . PHE A 1 139 ? 53.627 -24.762 4.070   1.00 14.06 ? 140 PHE A CE1   1 
ATOM   813  C  CE2   . PHE A 1 139 ? 54.438 -23.950 1.967   1.00 14.76 ? 140 PHE A CE2   1 
ATOM   814  C  CZ    . PHE A 1 139 ? 53.367 -24.244 2.821   1.00 11.69 ? 140 PHE A CZ    1 
ATOM   815  N  N     . ASN A 1 140 ? 57.975 -27.383 1.944   1.00 12.49 ? 141 ASN A N     1 
ATOM   816  C  CA    . ASN A 1 140 ? 57.583 -28.058 0.719   1.00 11.79 ? 141 ASN A CA    1 
ATOM   817  C  C     . ASN A 1 140 ? 57.561 -29.584 0.767   1.00 12.87 ? 141 ASN A C     1 
ATOM   818  O  O     . ASN A 1 140 ? 57.233 -30.238 -0.221  1.00 13.95 ? 141 ASN A O     1 
ATOM   819  C  CB    . ASN A 1 140 ? 58.382 -27.516 -0.458  1.00 14.62 ? 141 ASN A CB    1 
ATOM   820  C  CG    . ASN A 1 140 ? 57.979 -26.080 -0.800  1.00 21.33 ? 141 ASN A CG    1 
ATOM   821  O  OD1   . ASN A 1 140 ? 56.800 -25.791 -1.027  1.00 23.98 ? 141 ASN A OD1   1 
ATOM   822  N  ND2   . ASN A 1 140 ? 58.944 -25.172 -0.792  1.00 21.62 ? 141 ASN A ND2   1 
ATOM   823  N  N     . ARG A 1 141 ? 57.867 -30.151 1.931   1.00 10.70 ? 142 ARG A N     1 
ATOM   824  C  CA    . ARG A 1 141 ? 57.837 -31.599 2.118   1.00 10.11 ? 142 ARG A CA    1 
ATOM   825  C  C     . ARG A 1 141 ? 56.798 -31.943 3.195   1.00 7.87  ? 142 ARG A C     1 
ATOM   826  O  O     . ARG A 1 141 ? 56.841 -33.017 3.787   1.00 9.88  ? 142 ARG A O     1 
ATOM   827  C  CB    . ARG A 1 141 ? 59.227 -32.115 2.526   1.00 8.12  ? 142 ARG A CB    1 
ATOM   828  C  CG    . ARG A 1 141 ? 60.299 -31.934 1.424   1.00 10.65 ? 142 ARG A CG    1 
ATOM   829  C  CD    . ARG A 1 141 ? 61.714 -32.282 1.906   1.00 8.85  ? 142 ARG A CD    1 
ATOM   830  N  NE    . ARG A 1 141 ? 61.804 -33.662 2.363   1.00 10.74 ? 142 ARG A NE    1 
ATOM   831  C  CZ    . ARG A 1 141 ? 62.914 -34.239 2.802   1.00 6.89  ? 142 ARG A CZ    1 
ATOM   832  N  NH1   . ARG A 1 141 ? 64.042 -33.556 2.836   1.00 7.88  ? 142 ARG A NH1   1 
ATOM   833  N  NH2   . ARG A 1 141 ? 62.876 -35.481 3.252   1.00 6.38  ? 142 ARG A NH2   1 
ATOM   834  N  N     . SER A 1 142 ? 55.806 -31.075 3.362   1.00 8.28  ? 143 SER A N     1 
ATOM   835  C  CA    . SER A 1 142 ? 54.776 -31.254 4.381   1.00 8.19  ? 143 SER A CA    1 
ATOM   836  C  C     . SER A 1 142 ? 53.993 -32.554 4.398   1.00 12.08 ? 143 SER A C     1 
ATOM   837  O  O     . SER A 1 142 ? 53.451 -32.923 5.439   1.00 15.05 ? 143 SER A O     1 
ATOM   838  C  CB    . SER A 1 142 ? 53.830 -30.067 4.386   1.00 7.72  ? 143 SER A CB    1 
ATOM   839  O  OG    . SER A 1 142 ? 53.066 -30.022 3.202   1.00 12.89 ? 143 SER A OG    1 
ATOM   840  N  N     . ARG A 1 143 ? 53.928 -33.271 3.276   1.00 13.17 ? 144 ARG A N     1 
ATOM   841  C  CA    . ARG A 1 143 ? 53.195 -34.548 3.259   1.00 14.55 ? 144 ARG A CA    1 
ATOM   842  C  C     . ARG A 1 143 ? 53.911 -35.620 4.084   1.00 11.60 ? 144 ARG A C     1 
ATOM   843  O  O     . ARG A 1 143 ? 53.332 -36.642 4.406   1.00 13.17 ? 144 ARG A O     1 
ATOM   844  C  CB    . ARG A 1 143 ? 53.003 -35.059 1.834   1.00 16.07 ? 144 ARG A CB    1 
ATOM   845  C  CG    . ARG A 1 143 ? 54.279 -35.546 1.197   1.00 19.89 ? 144 ARG A CG    1 
ATOM   846  C  CD    . ARG A 1 143 ? 54.027 -36.025 -0.198  1.00 25.48 ? 144 ARG A CD    1 
ATOM   847  N  NE    . ARG A 1 143 ? 53.417 -37.342 -0.176  1.00 33.35 ? 144 ARG A NE    1 
ATOM   848  C  CZ    . ARG A 1 143 ? 54.042 -38.447 -0.562  1.00 40.53 ? 144 ARG A CZ    1 
ATOM   849  N  NH1   . ARG A 1 143 ? 55.296 -38.380 -1.001  1.00 42.51 ? 144 ARG A NH1   1 
ATOM   850  N  NH2   . ARG A 1 143 ? 53.416 -39.620 -0.502  1.00 44.51 ? 144 ARG A NH2   1 
ATOM   851  N  N     . GLU A 1 144 ? 55.187 -35.387 4.385   1.00 10.62 ? 145 GLU A N     1 
ATOM   852  C  CA    . GLU A 1 144 ? 55.988 -36.315 5.185   1.00 11.25 ? 145 GLU A CA    1 
ATOM   853  C  C     . GLU A 1 144 ? 55.758 -36.170 6.701   1.00 11.92 ? 145 GLU A C     1 
ATOM   854  O  O     . GLU A 1 144 ? 56.298 -36.938 7.501   1.00 10.57 ? 145 GLU A O     1 
ATOM   855  C  CB    . GLU A 1 144 ? 57.464 -36.162 4.841   1.00 8.52  ? 145 GLU A CB    1 
ATOM   856  C  CG    . GLU A 1 144 ? 57.762 -36.528 3.395   1.00 11.66 ? 145 GLU A CG    1 
ATOM   857  C  CD    . GLU A 1 144 ? 59.165 -36.197 3.020   1.00 13.38 ? 145 GLU A CD    1 
ATOM   858  O  OE1   . GLU A 1 144 ? 60.064 -36.565 3.784   1.00 16.89 ? 145 GLU A OE1   1 
ATOM   859  O  OE2   . GLU A 1 144 ? 59.382 -35.545 1.982   1.00 14.53 ? 145 GLU A OE2   1 
ATOM   860  N  N     . TYR A 1 145 ? 54.925 -35.202 7.081   1.00 11.44 ? 146 TYR A N     1 
ATOM   861  C  CA    . TYR A 1 145 ? 54.573 -34.976 8.474   1.00 11.76 ? 146 TYR A CA    1 
ATOM   862  C  C     . TYR A 1 145 ? 53.157 -34.398 8.506   1.00 14.15 ? 146 TYR A C     1 
ATOM   863  O  O     . TYR A 1 145 ? 52.458 -34.442 7.490   1.00 16.29 ? 146 TYR A O     1 
ATOM   864  C  CB    . TYR A 1 145 ? 55.619 -34.093 9.195   1.00 8.82  ? 146 TYR A CB    1 
ATOM   865  C  CG    . TYR A 1 145 ? 55.945 -32.771 8.540   1.00 6.24  ? 146 TYR A CG    1 
ATOM   866  C  CD1   . TYR A 1 145 ? 56.859 -32.700 7.472   1.00 7.80  ? 146 TYR A CD1   1 
ATOM   867  C  CD2   . TYR A 1 145 ? 55.379 -31.587 9.011   1.00 4.72  ? 146 TYR A CD2   1 
ATOM   868  C  CE1   . TYR A 1 145 ? 57.197 -31.486 6.906   1.00 6.38  ? 146 TYR A CE1   1 
ATOM   869  C  CE2   . TYR A 1 145 ? 55.708 -30.370 8.454   1.00 5.70  ? 146 TYR A CE2   1 
ATOM   870  C  CZ    . TYR A 1 145 ? 56.614 -30.319 7.406   1.00 9.64  ? 146 TYR A CZ    1 
ATOM   871  O  OH    . TYR A 1 145 ? 56.937 -29.096 6.865   1.00 11.11 ? 146 TYR A OH    1 
ATOM   872  N  N     . GLN A 1 146 ? 52.716 -33.881 9.653   1.00 15.70 ? 147 GLN A N     1 
ATOM   873  C  CA    . GLN A 1 146 ? 51.361 -33.339 9.764   1.00 12.96 ? 147 GLN A CA    1 
ATOM   874  C  C     . GLN A 1 146 ? 51.441 -31.826 9.927   1.00 13.28 ? 147 GLN A C     1 
ATOM   875  O  O     . GLN A 1 146 ? 52.090 -31.334 10.855  1.00 11.93 ? 147 GLN A O     1 
ATOM   876  C  CB    . GLN A 1 146 ? 50.627 -33.981 10.956  1.00 13.87 ? 147 GLN A CB    1 
ATOM   877  C  CG    . GLN A 1 146 ? 50.570 -35.522 10.946  1.00 17.71 ? 147 GLN A CG    1 
ATOM   878  C  CD    . GLN A 1 146 ? 49.660 -36.086 9.851   1.00 21.87 ? 147 GLN A CD    1 
ATOM   879  O  OE1   . GLN A 1 146 ? 48.600 -35.534 9.579   1.00 20.38 ? 147 GLN A OE1   1 
ATOM   880  N  NE2   . GLN A 1 146 ? 50.080 -37.180 9.217   1.00 20.79 ? 147 GLN A NE2   1 
ATOM   881  N  N     . LEU A 1 147 ? 50.808 -31.101 9.005   1.00 11.45 ? 148 LEU A N     1 
ATOM   882  C  CA    . LEU A 1 147 ? 50.807 -29.634 8.998   1.00 10.70 ? 148 LEU A CA    1 
ATOM   883  C  C     . LEU A 1 147 ? 49.435 -29.093 8.602   1.00 10.66 ? 148 LEU A C     1 
ATOM   884  O  O     . LEU A 1 147 ? 48.799 -29.618 7.694   1.00 12.94 ? 148 LEU A O     1 
ATOM   885  C  CB    . LEU A 1 147 ? 51.887 -29.094 8.029   1.00 8.02  ? 148 LEU A CB    1 
ATOM   886  C  CG    . LEU A 1 147 ? 52.106 -27.570 7.975   1.00 10.16 ? 148 LEU A CG    1 
ATOM   887  C  CD1   . LEU A 1 147 ? 52.686 -27.087 9.303   1.00 8.10  ? 148 LEU A CD1   1 
ATOM   888  C  CD2   . LEU A 1 147 ? 53.027 -27.177 6.825   1.00 6.08  ? 148 LEU A CD2   1 
ATOM   889  N  N     . ASN A 1 148 ? 48.969 -28.077 9.326   1.00 12.96 ? 149 ASN A N     1 
ATOM   890  C  CA    . ASN A 1 148 ? 47.684 -27.433 9.069   1.00 12.74 ? 149 ASN A CA    1 
ATOM   891  C  C     . ASN A 1 148 ? 47.667 -26.832 7.694   1.00 11.28 ? 149 ASN A C     1 
ATOM   892  O  O     . ASN A 1 148 ? 48.606 -26.139 7.317   1.00 9.21  ? 149 ASN A O     1 
ATOM   893  C  CB    . ASN A 1 148 ? 47.454 -26.261 10.026  1.00 16.74 ? 149 ASN A CB    1 
ATOM   894  C  CG    . ASN A 1 148 ? 47.112 -26.700 11.418  1.00 22.06 ? 149 ASN A CG    1 
ATOM   895  O  OD1   . ASN A 1 148 ? 46.782 -27.867 11.649  1.00 25.68 ? 149 ASN A OD1   1 
ATOM   896  N  ND2   . ASN A 1 148 ? 47.174 -25.768 12.366  1.00 20.37 ? 149 ASN A ND2   1 
ATOM   897  N  N     . ASP A 1 149 ? 46.527 -26.970 7.022   1.00 13.37 ? 150 ASP A N     1 
ATOM   898  C  CA    . ASP A 1 149 ? 46.298 -26.415 5.682   1.00 13.65 ? 150 ASP A CA    1 
ATOM   899  C  C     . ASP A 1 149 ? 46.497 -24.899 5.661   1.00 13.52 ? 150 ASP A C     1 
ATOM   900  O  O     . ASP A 1 149 ? 46.998 -24.346 4.678   1.00 13.23 ? 150 ASP A O     1 
ATOM   901  C  CB    . ASP A 1 149 ? 44.845 -26.671 5.228   1.00 17.18 ? 150 ASP A CB    1 
ATOM   902  C  CG    . ASP A 1 149 ? 44.521 -28.132 5.087   1.00 22.18 ? 150 ASP A CG    1 
ATOM   903  O  OD1   . ASP A 1 149 ? 44.997 -28.742 4.108   1.00 21.13 ? 150 ASP A OD1   1 
ATOM   904  O  OD2   . ASP A 1 149 ? 43.804 -28.667 5.965   1.00 26.72 ? 150 ASP A OD2   1 
ATOM   905  N  N     . SER A 1 150 ? 46.059 -24.228 6.726   1.00 8.76  ? 151 SER A N     1 
ATOM   906  C  CA    . SER A 1 150 ? 46.158 -22.781 6.814   1.00 7.45  ? 151 SER A CA    1 
ATOM   907  C  C     . SER A 1 150 ? 47.527 -22.240 7.247   1.00 9.60  ? 151 SER A C     1 
ATOM   908  O  O     . SER A 1 150 ? 47.669 -21.042 7.474   1.00 8.46  ? 151 SER A O     1 
ATOM   909  C  CB    . SER A 1 150 ? 45.084 -22.254 7.767   1.00 8.29  ? 151 SER A CB    1 
ATOM   910  O  OG    . SER A 1 150 ? 43.789 -22.622 7.319   1.00 5.72  ? 151 SER A OG    1 
ATOM   911  N  N     . ALA A 1 151 ? 48.542 -23.095 7.354   1.00 11.14 ? 152 ALA A N     1 
ATOM   912  C  CA    . ALA A 1 151 ? 49.855 -22.605 7.780   1.00 12.33 ? 152 ALA A CA    1 
ATOM   913  C  C     . ALA A 1 151 ? 50.366 -21.413 6.954   1.00 11.47 ? 152 ALA A C     1 
ATOM   914  O  O     . ALA A 1 151 ? 50.690 -20.366 7.509   1.00 12.14 ? 152 ALA A O     1 
ATOM   915  C  CB    . ALA A 1 151 ? 50.881 -23.739 7.767   1.00 9.98  ? 152 ALA A CB    1 
ATOM   916  N  N     . ALA A 1 152 ? 50.397 -21.565 5.633   1.00 10.40 ? 153 ALA A N     1 
ATOM   917  C  CA    . ALA A 1 152 ? 50.897 -20.521 4.744   1.00 10.76 ? 153 ALA A CA    1 
ATOM   918  C  C     . ALA A 1 152 ? 50.028 -19.254 4.716   1.00 8.33  ? 153 ALA A C     1 
ATOM   919  O  O     . ALA A 1 152 ? 50.549 -18.134 4.632   1.00 10.16 ? 153 ALA A O     1 
ATOM   920  C  CB    . ALA A 1 152 ? 51.101 -21.094 3.332   1.00 10.86 ? 153 ALA A CB    1 
ATOM   921  N  N     . TYR A 1 153 ? 48.716 -19.428 4.810   1.00 7.68  ? 154 TYR A N     1 
ATOM   922  C  CA    . TYR A 1 153 ? 47.784 -18.307 4.822   1.00 6.66  ? 154 TYR A CA    1 
ATOM   923  C  C     . TYR A 1 153 ? 48.133 -17.310 5.945   1.00 9.39  ? 154 TYR A C     1 
ATOM   924  O  O     . TYR A 1 153 ? 48.216 -16.097 5.728   1.00 7.60  ? 154 TYR A O     1 
ATOM   925  C  CB    . TYR A 1 153 ? 46.359 -18.830 5.014   1.00 5.84  ? 154 TYR A CB    1 
ATOM   926  C  CG    . TYR A 1 153 ? 45.358 -17.718 5.260   1.00 8.82  ? 154 TYR A CG    1 
ATOM   927  C  CD1   . TYR A 1 153 ? 44.710 -17.094 4.188   1.00 10.04 ? 154 TYR A CD1   1 
ATOM   928  C  CD2   . TYR A 1 153 ? 45.071 -17.273 6.557   1.00 5.92  ? 154 TYR A CD2   1 
ATOM   929  C  CE1   . TYR A 1 153 ? 43.803 -16.058 4.391   1.00 9.40  ? 154 TYR A CE1   1 
ATOM   930  C  CE2   . TYR A 1 153 ? 44.170 -16.235 6.775   1.00 6.01  ? 154 TYR A CE2   1 
ATOM   931  C  CZ    . TYR A 1 153 ? 43.537 -15.631 5.680   1.00 11.23 ? 154 TYR A CZ    1 
ATOM   932  O  OH    . TYR A 1 153 ? 42.623 -14.620 5.855   1.00 8.81  ? 154 TYR A OH    1 
ATOM   933  N  N     . TYR A 1 154 ? 48.321 -17.836 7.153   1.00 9.79  ? 155 TYR A N     1 
ATOM   934  C  CA    . TYR A 1 154 ? 48.645 -17.008 8.318   1.00 10.38 ? 155 TYR A CA    1 
ATOM   935  C  C     . TYR A 1 154 ? 50.086 -16.539 8.309   1.00 10.72 ? 155 TYR A C     1 
ATOM   936  O  O     . TYR A 1 154 ? 50.347 -15.366 8.567   1.00 10.02 ? 155 TYR A O     1 
ATOM   937  C  CB    . TYR A 1 154 ? 48.394 -17.774 9.622   1.00 9.65  ? 155 TYR A CB    1 
ATOM   938  C  CG    . TYR A 1 154 ? 46.939 -18.059 9.933   1.00 8.47  ? 155 TYR A CG    1 
ATOM   939  C  CD1   . TYR A 1 154 ? 45.982 -17.049 9.850   1.00 11.37 ? 155 TYR A CD1   1 
ATOM   940  C  CD2   . TYR A 1 154 ? 46.521 -19.331 10.324  1.00 10.48 ? 155 TYR A CD2   1 
ATOM   941  C  CE1   . TYR A 1 154 ? 44.638 -17.302 10.150  1.00 12.10 ? 155 TYR A CE1   1 
ATOM   942  C  CE2   . TYR A 1 154 ? 45.171 -19.597 10.630  1.00 10.65 ? 155 TYR A CE2   1 
ATOM   943  C  CZ    . TYR A 1 154 ? 44.237 -18.575 10.540  1.00 10.26 ? 155 TYR A CZ    1 
ATOM   944  O  OH    . TYR A 1 154 ? 42.908 -18.815 10.848  1.00 11.10 ? 155 TYR A OH    1 
ATOM   945  N  N     . LEU A 1 155 ? 51.014 -17.458 8.025   1.00 10.85 ? 156 LEU A N     1 
ATOM   946  C  CA    . LEU A 1 155 ? 52.437 -17.134 8.018   1.00 12.44 ? 156 LEU A CA    1 
ATOM   947  C  C     . LEU A 1 155 ? 52.803 -16.064 7.013   1.00 14.56 ? 156 LEU A C     1 
ATOM   948  O  O     . LEU A 1 155 ? 53.658 -15.217 7.296   1.00 15.13 ? 156 LEU A O     1 
ATOM   949  C  CB    . LEU A 1 155 ? 53.303 -18.389 7.867   1.00 11.20 ? 156 LEU A CB    1 
ATOM   950  C  CG    . LEU A 1 155 ? 53.282 -19.277 9.125   1.00 12.29 ? 156 LEU A CG    1 
ATOM   951  C  CD1   . LEU A 1 155 ? 53.963 -20.593 8.892   1.00 10.14 ? 156 LEU A CD1   1 
ATOM   952  C  CD2   . LEU A 1 155 ? 53.940 -18.564 10.284  1.00 15.90 ? 156 LEU A CD2   1 
ATOM   953  N  N     . ASN A 1 156 ? 52.125 -16.060 5.866   1.00 14.80 ? 157 ASN A N     1 
ATOM   954  C  CA    . ASN A 1 156 ? 52.364 -15.044 4.841   1.00 15.10 ? 157 ASN A CA    1 
ATOM   955  C  C     . ASN A 1 156 ? 51.715 -13.700 5.194   1.00 15.25 ? 157 ASN A C     1 
ATOM   956  O  O     . ASN A 1 156 ? 52.055 -12.688 4.607   1.00 17.46 ? 157 ASN A O     1 
ATOM   957  C  CB    . ASN A 1 156 ? 51.829 -15.496 3.483   1.00 14.61 ? 157 ASN A CB    1 
ATOM   958  C  CG    . ASN A 1 156 ? 52.728 -16.502 2.796   1.00 13.75 ? 157 ASN A CG    1 
ATOM   959  O  OD1   . ASN A 1 156 ? 53.953 -16.431 2.889   1.00 13.81 ? 157 ASN A OD1   1 
ATOM   960  N  ND2   . ASN A 1 156 ? 52.120 -17.434 2.076   1.00 16.76 ? 157 ASN A ND2   1 
ATOM   961  N  N     . ASP A 1 157 ? 50.777 -13.687 6.137   1.00 16.50 ? 158 ASP A N     1 
ATOM   962  C  CA    . ASP A 1 157 ? 50.081 -12.451 6.532   1.00 14.50 ? 158 ASP A CA    1 
ATOM   963  C  C     . ASP A 1 157 ? 50.447 -11.976 7.930   1.00 12.49 ? 158 ASP A C     1 
ATOM   964  O  O     . ASP A 1 157 ? 49.672 -11.275 8.582   1.00 10.55 ? 158 ASP A O     1 
ATOM   965  C  CB    . ASP A 1 157 ? 48.569 -12.667 6.479   1.00 18.33 ? 158 ASP A CB    1 
ATOM   966  C  CG    . ASP A 1 157 ? 47.913 -11.935 5.336   1.00 21.41 ? 158 ASP A CG    1 
ATOM   967  O  OD1   . ASP A 1 157 ? 48.515 -10.978 4.826   1.00 30.31 ? 158 ASP A OD1   1 
ATOM   968  O  OD2   . ASP A 1 157 ? 46.787 -12.307 4.957   1.00 27.16 ? 158 ASP A OD2   1 
ATOM   969  N  N     . LEU A 1 158 ? 51.638 -12.347 8.367   1.00 14.25 ? 159 LEU A N     1 
ATOM   970  C  CA    . LEU A 1 158 ? 52.149 -12.017 9.693   1.00 17.40 ? 159 LEU A CA    1 
ATOM   971  C  C     . LEU A 1 158 ? 52.146 -10.532 10.035  1.00 17.65 ? 159 LEU A C     1 
ATOM   972  O  O     . LEU A 1 158 ? 51.838 -10.154 11.170  1.00 16.32 ? 159 LEU A O     1 
ATOM   973  C  CB    . LEU A 1 158 ? 53.559 -12.594 9.850   1.00 19.91 ? 159 LEU A CB    1 
ATOM   974  C  CG    . LEU A 1 158 ? 54.020 -13.141 11.201  1.00 22.22 ? 159 LEU A CG    1 
ATOM   975  C  CD1   . LEU A 1 158 ? 53.090 -14.218 11.702  1.00 21.74 ? 159 LEU A CD1   1 
ATOM   976  C  CD2   . LEU A 1 158 ? 55.392 -13.721 11.011  1.00 27.11 ? 159 LEU A CD2   1 
ATOM   977  N  N     . ASP A 1 159 ? 52.517 -9.687  9.076   1.00 19.76 ? 160 ASP A N     1 
ATOM   978  C  CA    . ASP A 1 159 ? 52.531 -8.251  9.324   1.00 20.92 ? 160 ASP A CA    1 
ATOM   979  C  C     . ASP A 1 159 ? 51.157 -7.764  9.721   1.00 20.67 ? 160 ASP A C     1 
ATOM   980  O  O     . ASP A 1 159 ? 51.037 -6.973  10.646  1.00 22.40 ? 160 ASP A O     1 
ATOM   981  C  CB    . ASP A 1 159 ? 53.011 -7.470  8.100   1.00 27.41 ? 160 ASP A CB    1 
ATOM   982  C  CG    . ASP A 1 159 ? 54.499 -7.639  7.838   1.00 32.31 ? 160 ASP A CG    1 
ATOM   983  O  OD1   . ASP A 1 159 ? 55.278 -7.831  8.801   1.00 34.33 ? 160 ASP A OD1   1 
ATOM   984  O  OD2   . ASP A 1 159 ? 54.889 -7.566  6.653   1.00 37.77 ? 160 ASP A OD2   1 
ATOM   985  N  N     . ARG A 1 160 ? 50.123 -8.267  9.049   1.00 17.23 ? 161 ARG A N     1 
ATOM   986  C  CA    . ARG A 1 160 ? 48.754 -7.856  9.348   1.00 16.30 ? 161 ARG A CA    1 
ATOM   987  C  C     . ARG A 1 160 ? 48.220 -8.407  10.678  1.00 15.68 ? 161 ARG A C     1 
ATOM   988  O  O     . ARG A 1 160 ? 47.663 -7.668  11.484  1.00 12.64 ? 161 ARG A O     1 
ATOM   989  C  CB    . ARG A 1 160 ? 47.810 -8.241  8.206   1.00 14.79 ? 161 ARG A CB    1 
ATOM   990  C  CG    . ARG A 1 160 ? 46.366 -7.808  8.444   1.00 13.33 ? 161 ARG A CG    1 
ATOM   991  C  CD    . ARG A 1 160 ? 45.453 -8.223  7.321   1.00 12.40 ? 161 ARG A CD    1 
ATOM   992  N  NE    . ARG A 1 160 ? 45.477 -9.664  7.055   1.00 12.71 ? 161 ARG A NE    1 
ATOM   993  C  CZ    . ARG A 1 160 ? 44.677 -10.558 7.629   1.00 10.38 ? 161 ARG A CZ    1 
ATOM   994  N  NH1   . ARG A 1 160 ? 43.772 -10.196 8.525   1.00 7.53  ? 161 ARG A NH1   1 
ATOM   995  N  NH2   . ARG A 1 160 ? 44.781 -11.823 7.293   1.00 10.46 ? 161 ARG A NH2   1 
ATOM   996  N  N     . ILE A 1 161 ? 48.402 -9.700  10.914  1.00 13.90 ? 162 ILE A N     1 
ATOM   997  C  CA    . ILE A 1 161 ? 47.908 -10.294 12.148  1.00 14.93 ? 162 ILE A CA    1 
ATOM   998  C  C     . ILE A 1 161 ? 48.728 -9.940  13.413  1.00 15.30 ? 162 ILE A C     1 
ATOM   999  O  O     . ILE A 1 161 ? 48.234 -10.068 14.534  1.00 11.93 ? 162 ILE A O     1 
ATOM   1000 C  CB    . ILE A 1 161 ? 47.698 -11.846 12.017  1.00 16.01 ? 162 ILE A CB    1 
ATOM   1001 C  CG1   . ILE A 1 161 ? 49.028 -12.588 11.957  1.00 17.77 ? 162 ILE A CG1   1 
ATOM   1002 C  CG2   . ILE A 1 161 ? 46.899 -12.172 10.770  1.00 14.07 ? 162 ILE A CG2   1 
ATOM   1003 C  CD1   . ILE A 1 161 ? 48.845 -14.081 11.907  1.00 21.67 ? 162 ILE A CD1   1 
ATOM   1004 N  N     . ALA A 1 162 ? 49.968 -9.493  13.245  1.00 18.98 ? 163 ALA A N     1 
ATOM   1005 C  CA    . ALA A 1 162 ? 50.780 -9.134  14.405  1.00 25.88 ? 163 ALA A CA    1 
ATOM   1006 C  C     . ALA A 1 162 ? 50.559 -7.677  14.823  1.00 28.41 ? 163 ALA A C     1 
ATOM   1007 O  O     . ALA A 1 162 ? 51.205 -7.184  15.741  1.00 32.77 ? 163 ALA A O     1 
ATOM   1008 C  CB    . ALA A 1 162 ? 52.246 -9.384  14.122  1.00 23.95 ? 163 ALA A CB    1 
ATOM   1009 N  N     . GLN A 1 163 ? 49.653 -6.995  14.134  1.00 32.31 ? 164 GLN A N     1 
ATOM   1010 C  CA    . GLN A 1 163 ? 49.334 -5.597  14.415  1.00 35.43 ? 164 GLN A CA    1 
ATOM   1011 C  C     . GLN A 1 163 ? 48.743 -5.376  15.787  1.00 35.99 ? 164 GLN A C     1 
ATOM   1012 O  O     . GLN A 1 163 ? 48.079 -6.257  16.343  1.00 34.39 ? 164 GLN A O     1 
ATOM   1013 C  CB    . GLN A 1 163 ? 48.287 -5.076  13.444  1.00 36.68 ? 164 GLN A CB    1 
ATOM   1014 C  CG    . GLN A 1 163 ? 48.773 -4.618  12.122  1.00 44.10 ? 164 GLN A CG    1 
ATOM   1015 C  CD    . GLN A 1 163 ? 47.599 -4.299  11.222  1.00 52.40 ? 164 GLN A CD    1 
ATOM   1016 O  OE1   . GLN A 1 163 ? 47.488 -3.187  10.696  1.00 57.30 ? 164 GLN A OE1   1 
ATOM   1017 N  NE2   . GLN A 1 163 ? 46.696 -5.273  11.052  1.00 53.73 ? 164 GLN A NE2   1 
ATOM   1018 N  N     . PRO A 1 164 ? 48.945 -4.165  16.340  1.00 38.64 ? 165 PRO A N     1 
ATOM   1019 C  CA    . PRO A 1 164 ? 48.387 -3.869  17.654  1.00 38.82 ? 165 PRO A CA    1 
ATOM   1020 C  C     . PRO A 1 164 ? 46.911 -3.617  17.341  1.00 38.59 ? 165 PRO A C     1 
ATOM   1021 O  O     . PRO A 1 164 ? 46.587 -2.938  16.352  1.00 39.57 ? 165 PRO A O     1 
ATOM   1022 C  CB    . PRO A 1 164 ? 49.090 -2.558  18.043  1.00 40.41 ? 165 PRO A CB    1 
ATOM   1023 C  CG    . PRO A 1 164 ? 50.303 -2.491  17.146  1.00 40.36 ? 165 PRO A CG    1 
ATOM   1024 C  CD    . PRO A 1 164 ? 49.753 -3.030  15.858  1.00 40.56 ? 165 PRO A CD    1 
ATOM   1025 N  N     . ASN A 1 165 ? 46.025 -4.199  18.140  1.00 37.81 ? 166 ASN A N     1 
ATOM   1026 C  CA    . ASN A 1 165 ? 44.586 -4.027  17.938  1.00 36.00 ? 166 ASN A CA    1 
ATOM   1027 C  C     . ASN A 1 165 ? 44.091 -4.826  16.733  1.00 30.60 ? 166 ASN A C     1 
ATOM   1028 O  O     . ASN A 1 165 ? 43.159 -4.419  16.049  1.00 29.40 ? 166 ASN A O     1 
ATOM   1029 C  CB    . ASN A 1 165 ? 44.225 -2.534  17.779  1.00 41.41 ? 166 ASN A CB    1 
ATOM   1030 C  CG    . ASN A 1 165 ? 44.609 -1.699  19.006  1.00 48.47 ? 166 ASN A CG    1 
ATOM   1031 O  OD1   . ASN A 1 165 ? 44.102 -1.923  20.110  1.00 53.80 ? 166 ASN A OD1   1 
ATOM   1032 N  ND2   . ASN A 1 165 ? 45.530 -0.758  18.821  1.00 47.66 ? 166 ASN A ND2   1 
ATOM   1033 N  N     . TYR A 1 166 ? 44.747 -5.946  16.446  1.00 26.00 ? 167 TYR A N     1 
ATOM   1034 C  CA    . TYR A 1 166 ? 44.329 -6.802  15.339  1.00 19.76 ? 167 TYR A CA    1 
ATOM   1035 C  C     . TYR A 1 166 ? 43.014 -7.483  15.709  1.00 17.68 ? 167 TYR A C     1 
ATOM   1036 O  O     . TYR A 1 166 ? 42.845 -7.933  16.853  1.00 16.88 ? 167 TYR A O     1 
ATOM   1037 C  CB    . TYR A 1 166 ? 45.397 -7.870  15.056  1.00 15.37 ? 167 TYR A CB    1 
ATOM   1038 C  CG    . TYR A 1 166 ? 44.895 -9.114  14.331  1.00 11.44 ? 167 TYR A CG    1 
ATOM   1039 C  CD1   . TYR A 1 166 ? 44.478 -9.061  12.998  1.00 8.47  ? 167 TYR A CD1   1 
ATOM   1040 C  CD2   . TYR A 1 166 ? 44.835 -10.342 14.987  1.00 9.66  ? 167 TYR A CD2   1 
ATOM   1041 C  CE1   . TYR A 1 166 ? 44.008 -10.201 12.337  1.00 8.61  ? 167 TYR A CE1   1 
ATOM   1042 C  CE2   . TYR A 1 166 ? 44.370 -11.492 14.336  1.00 7.37  ? 167 TYR A CE2   1 
ATOM   1043 C  CZ    . TYR A 1 166 ? 43.957 -11.417 13.016  1.00 8.69  ? 167 TYR A CZ    1 
ATOM   1044 O  OH    . TYR A 1 166 ? 43.498 -12.568 12.391  1.00 7.41  ? 167 TYR A OH    1 
ATOM   1045 N  N     . ILE A 1 167 ? 42.063 -7.477  14.772  1.00 14.55 ? 168 ILE A N     1 
ATOM   1046 C  CA    . ILE A 1 167 ? 40.776 -8.161  14.954  1.00 15.70 ? 168 ILE A CA    1 
ATOM   1047 C  C     . ILE A 1 167 ? 40.620 -9.111  13.756  1.00 14.16 ? 168 ILE A C     1 
ATOM   1048 O  O     . ILE A 1 167 ? 40.730 -8.692  12.602  1.00 14.20 ? 168 ILE A O     1 
ATOM   1049 C  CB    . ILE A 1 167 ? 39.563 -7.201  15.001  1.00 14.34 ? 168 ILE A CB    1 
ATOM   1050 C  CG1   . ILE A 1 167 ? 39.609 -6.359  16.271  1.00 15.55 ? 168 ILE A CG1   1 
ATOM   1051 C  CG2   . ILE A 1 167 ? 38.262 -8.002  15.021  1.00 14.79 ? 168 ILE A CG2   1 
ATOM   1052 C  CD1   . ILE A 1 167 ? 38.602 -5.246  16.285  1.00 18.67 ? 168 ILE A CD1   1 
ATOM   1053 N  N     . PRO A 1 168 ? 40.478 -10.422 14.022  1.00 11.89 ? 169 PRO A N     1 
ATOM   1054 C  CA    . PRO A 1 168 ? 40.327 -11.357 12.902  1.00 12.54 ? 169 PRO A CA    1 
ATOM   1055 C  C     . PRO A 1 168 ? 39.249 -10.971 11.872  1.00 10.95 ? 169 PRO A C     1 
ATOM   1056 O  O     . PRO A 1 168 ? 38.176 -10.479 12.225  1.00 13.43 ? 169 PRO A O     1 
ATOM   1057 C  CB    . PRO A 1 168 ? 39.989 -12.677 13.621  1.00 10.44 ? 169 PRO A CB    1 
ATOM   1058 C  CG    . PRO A 1 168 ? 40.814 -12.594 14.878  1.00 10.43 ? 169 PRO A CG    1 
ATOM   1059 C  CD    . PRO A 1 168 ? 40.639 -11.136 15.305  1.00 7.91  ? 169 PRO A CD    1 
ATOM   1060 N  N     . THR A 1 169 ? 39.551 -11.149 10.592  1.00 10.95 ? 170 THR A N     1 
ATOM   1061 C  CA    . THR A 1 169 ? 38.558 -10.876 9.560   1.00 8.69  ? 170 THR A CA    1 
ATOM   1062 C  C     . THR A 1 169 ? 37.698 -12.140 9.435   1.00 7.12  ? 170 THR A C     1 
ATOM   1063 O  O     . THR A 1 169 ? 37.995 -13.164 10.043  1.00 7.36  ? 170 THR A O     1 
ATOM   1064 C  CB    . THR A 1 169 ? 39.211 -10.585 8.181   1.00 10.58 ? 170 THR A CB    1 
ATOM   1065 O  OG1   . THR A 1 169 ? 39.941 -11.732 7.750   1.00 10.96 ? 170 THR A OG1   1 
ATOM   1066 C  CG2   . THR A 1 169 ? 40.158 -9.379  8.250   1.00 9.67  ? 170 THR A CG2   1 
ATOM   1067 N  N     . GLN A 1 170 ? 36.643 -12.085 8.628   1.00 10.81 ? 171 GLN A N     1 
ATOM   1068 C  CA    . GLN A 1 170 ? 35.780 -13.255 8.419   1.00 7.92  ? 171 GLN A CA    1 
ATOM   1069 C  C     . GLN A 1 170 ? 36.592 -14.418 7.828   1.00 7.08  ? 171 GLN A C     1 
ATOM   1070 O  O     . GLN A 1 170 ? 36.417 -15.560 8.217   1.00 6.63  ? 171 GLN A O     1 
ATOM   1071 C  CB    . GLN A 1 170 ? 34.615 -12.908 7.480   1.00 9.31  ? 171 GLN A CB    1 
ATOM   1072 C  CG    . GLN A 1 170 ? 33.734 -11.694 7.894   1.00 14.14 ? 171 GLN A CG    1 
ATOM   1073 C  CD    . GLN A 1 170 ? 32.962 -11.878 9.214   1.00 16.08 ? 171 GLN A CD    1 
ATOM   1074 O  OE1   . GLN A 1 170 ? 32.186 -12.821 9.371   1.00 16.58 ? 171 GLN A OE1   1 
ATOM   1075 N  NE2   . GLN A 1 170 ? 33.152 -10.949 10.149  1.00 17.55 ? 171 GLN A NE2   1 
ATOM   1076 N  N     . GLN A 1 171 ? 37.500 -14.124 6.901   1.00 5.57  ? 172 GLN A N     1 
ATOM   1077 C  CA    . GLN A 1 171 ? 38.310 -15.170 6.294   1.00 5.86  ? 172 GLN A CA    1 
ATOM   1078 C  C     . GLN A 1 171 ? 39.286 -15.761 7.306   1.00 5.86  ? 172 GLN A C     1 
ATOM   1079 O  O     . GLN A 1 171 ? 39.568 -16.944 7.257   1.00 7.21  ? 172 GLN A O     1 
ATOM   1080 C  CB    . GLN A 1 171 ? 39.062 -14.624 5.080   1.00 7.46  ? 172 GLN A CB    1 
ATOM   1081 C  CG    . GLN A 1 171 ? 39.984 -15.625 4.354   1.00 11.05 ? 172 GLN A CG    1 
ATOM   1082 C  CD    . GLN A 1 171 ? 39.263 -16.769 3.617   1.00 8.94  ? 172 GLN A CD    1 
ATOM   1083 O  OE1   . GLN A 1 171 ? 39.888 -17.773 3.280   1.00 14.42 ? 172 GLN A OE1   1 
ATOM   1084 N  NE2   . GLN A 1 171 ? 37.960 -16.629 3.380   1.00 8.69  ? 172 GLN A NE2   1 
ATOM   1085 N  N     . ASP A 1 172 ? 39.841 -14.939 8.191   1.00 6.52  ? 173 ASP A N     1 
ATOM   1086 C  CA    . ASP A 1 172 ? 40.760 -15.447 9.212   1.00 6.89  ? 173 ASP A CA    1 
ATOM   1087 C  C     . ASP A 1 172 ? 40.001 -16.442 10.086  1.00 4.89  ? 173 ASP A C     1 
ATOM   1088 O  O     . ASP A 1 172 ? 40.551 -17.473 10.490  1.00 8.20  ? 173 ASP A O     1 
ATOM   1089 C  CB    . ASP A 1 172 ? 41.258 -14.320 10.116  1.00 8.17  ? 173 ASP A CB    1 
ATOM   1090 C  CG    . ASP A 1 172 ? 42.239 -13.412 9.438   1.00 11.96 ? 173 ASP A CG    1 
ATOM   1091 O  OD1   . ASP A 1 172 ? 42.766 -13.743 8.361   1.00 12.71 ? 173 ASP A OD1   1 
ATOM   1092 O  OD2   . ASP A 1 172 ? 42.490 -12.348 10.006  1.00 12.96 ? 173 ASP A OD2   1 
ATOM   1093 N  N     . VAL A 1 173 ? 38.750 -16.104 10.397  1.00 5.63  ? 174 VAL A N     1 
ATOM   1094 C  CA    . VAL A 1 173 ? 37.883 -16.970 11.210  1.00 9.09  ? 174 VAL A CA    1 
ATOM   1095 C  C     . VAL A 1 173 ? 37.668 -18.315 10.489  1.00 9.20  ? 174 VAL A C     1 
ATOM   1096 O  O     . VAL A 1 173 ? 37.866 -19.386 11.074  1.00 7.77  ? 174 VAL A O     1 
ATOM   1097 C  CB    . VAL A 1 173 ? 36.508 -16.294 11.511  1.00 6.90  ? 174 VAL A CB    1 
ATOM   1098 C  CG1   . VAL A 1 173 ? 35.538 -17.308 12.139  1.00 7.90  ? 174 VAL A CG1   1 
ATOM   1099 C  CG2   . VAL A 1 173 ? 36.706 -15.092 12.457  1.00 7.47  ? 174 VAL A CG2   1 
ATOM   1100 N  N     . LEU A 1 174 ? 37.286 -18.247 9.210   1.00 9.91  ? 175 LEU A N     1 
ATOM   1101 C  CA    . LEU A 1 174 ? 37.067 -19.444 8.377   1.00 7.84  ? 175 LEU A CA    1 
ATOM   1102 C  C     . LEU A 1 174 ? 38.324 -20.297 8.239   1.00 4.92  ? 175 LEU A C     1 
ATOM   1103 O  O     . LEU A 1 174 ? 38.217 -21.491 8.013   1.00 6.89  ? 175 LEU A O     1 
ATOM   1104 C  CB    . LEU A 1 174 ? 36.598 -19.039 6.971   1.00 8.41  ? 175 LEU A CB    1 
ATOM   1105 C  CG    . LEU A 1 174 ? 35.188 -18.488 6.814   1.00 4.73  ? 175 LEU A CG    1 
ATOM   1106 C  CD1   . LEU A 1 174 ? 35.078 -17.712 5.488   1.00 5.56  ? 175 LEU A CD1   1 
ATOM   1107 C  CD2   . LEU A 1 174 ? 34.215 -19.658 6.881   1.00 3.10  ? 175 LEU A CD2   1 
ATOM   1108 N  N     . ARG A 1 175 ? 39.505 -19.681 8.352   1.00 4.87  ? 176 ARG A N     1 
ATOM   1109 C  CA    . ARG A 1 175 ? 40.777 -20.407 8.240   1.00 5.61  ? 176 ARG A CA    1 
ATOM   1110 C  C     . ARG A 1 175 ? 41.268 -21.095 9.520   1.00 8.83  ? 176 ARG A C     1 
ATOM   1111 O  O     . ARG A 1 175 ? 42.206 -21.900 9.461   1.00 8.42  ? 176 ARG A O     1 
ATOM   1112 C  CB    . ARG A 1 175 ? 41.884 -19.486 7.738   1.00 6.36  ? 176 ARG A CB    1 
ATOM   1113 C  CG    . ARG A 1 175 ? 41.676 -19.007 6.328   1.00 7.64  ? 176 ARG A CG    1 
ATOM   1114 C  CD    . ARG A 1 175 ? 42.029 -20.049 5.289   1.00 8.03  ? 176 ARG A CD    1 
ATOM   1115 N  NE    . ARG A 1 175 ? 41.798 -19.472 3.974   1.00 12.36 ? 176 ARG A NE    1 
ATOM   1116 C  CZ    . ARG A 1 175 ? 42.480 -19.763 2.869   1.00 15.69 ? 176 ARG A CZ    1 
ATOM   1117 N  NH1   . ARG A 1 175 ? 43.455 -20.672 2.881   1.00 12.35 ? 176 ARG A NH1   1 
ATOM   1118 N  NH2   . ARG A 1 175 ? 42.276 -19.037 1.774   1.00 16.74 ? 176 ARG A NH2   1 
ATOM   1119 N  N     . THR A 1 176 ? 40.636 -20.817 10.660  1.00 7.31  ? 177 THR A N     1 
ATOM   1120 C  CA    . THR A 1 176 ? 41.069 -21.426 11.918  1.00 6.82  ? 177 THR A CA    1 
ATOM   1121 C  C     . THR A 1 176 ? 40.841 -22.926 11.940  1.00 8.00  ? 177 THR A C     1 
ATOM   1122 O  O     . THR A 1 176 ? 39.926 -23.432 11.290  1.00 8.94  ? 177 THR A O     1 
ATOM   1123 C  CB    . THR A 1 176 ? 40.342 -20.818 13.133  1.00 9.73  ? 177 THR A CB    1 
ATOM   1124 O  OG1   . THR A 1 176 ? 38.928 -20.923 12.946  1.00 10.02 ? 177 THR A OG1   1 
ATOM   1125 C  CG2   . THR A 1 176 ? 40.738 -19.364 13.331  1.00 8.29  ? 177 THR A CG2   1 
ATOM   1126 N  N     . ARG A 1 177 ? 41.676 -23.636 12.691  1.00 9.67  ? 178 ARG A N     1 
ATOM   1127 C  CA    . ARG A 1 177 ? 41.563 -25.075 12.808  1.00 12.21 ? 178 ARG A CA    1 
ATOM   1128 C  C     . ARG A 1 177 ? 41.434 -25.457 14.287  1.00 15.76 ? 178 ARG A C     1 
ATOM   1129 O  O     . ARG A 1 177 ? 42.334 -25.187 15.090  1.00 14.55 ? 178 ARG A O     1 
ATOM   1130 C  CB    . ARG A 1 177 ? 42.786 -25.741 12.167  1.00 18.14 ? 178 ARG A CB    1 
ATOM   1131 C  CG    . ARG A 1 177 ? 42.675 -27.241 11.928  1.00 24.93 ? 178 ARG A CG    1 
ATOM   1132 C  CD    . ARG A 1 177 ? 42.965 -28.014 13.183  1.00 35.74 ? 178 ARG A CD    1 
ATOM   1133 N  NE    . ARG A 1 177 ? 42.947 -29.463 12.980  1.00 46.17 ? 178 ARG A NE    1 
ATOM   1134 C  CZ    . ARG A 1 177 ? 43.999 -30.262 13.173  1.00 48.53 ? 178 ARG A CZ    1 
ATOM   1135 N  NH1   . ARG A 1 177 ? 45.167 -29.756 13.562  1.00 46.54 ? 178 ARG A NH1   1 
ATOM   1136 N  NH2   . ARG A 1 177 ? 43.874 -31.577 13.013  1.00 50.18 ? 178 ARG A NH2   1 
ATOM   1137 N  N     . VAL A 1 178 ? 40.281 -26.017 14.644  1.00 17.29 ? 179 VAL A N     1 
ATOM   1138 C  CA    . VAL A 1 178 ? 39.983 -26.482 16.004  1.00 16.24 ? 179 VAL A CA    1 
ATOM   1139 C  C     . VAL A 1 178 ? 39.254 -27.804 15.832  1.00 13.71 ? 179 VAL A C     1 
ATOM   1140 O  O     . VAL A 1 178 ? 38.225 -27.855 15.162  1.00 12.27 ? 179 VAL A O     1 
ATOM   1141 C  CB    . VAL A 1 178 ? 39.032 -25.516 16.756  1.00 20.18 ? 179 VAL A CB    1 
ATOM   1142 C  CG1   . VAL A 1 178 ? 38.681 -26.077 18.110  1.00 22.29 ? 179 VAL A CG1   1 
ATOM   1143 C  CG2   . VAL A 1 178 ? 39.653 -24.142 16.927  1.00 21.75 ? 179 VAL A CG2   1 
ATOM   1144 N  N     . LYS A 1 179 ? 39.811 -28.876 16.385  1.00 17.53 ? 180 LYS A N     1 
ATOM   1145 C  CA    . LYS A 1 179 ? 39.199 -30.205 16.297  1.00 17.93 ? 180 LYS A CA    1 
ATOM   1146 C  C     . LYS A 1 179 ? 37.853 -30.223 16.993  1.00 16.42 ? 180 LYS A C     1 
ATOM   1147 O  O     . LYS A 1 179 ? 37.740 -29.769 18.119  1.00 19.36 ? 180 LYS A O     1 
ATOM   1148 C  CB    . LYS A 1 179 ? 40.120 -31.255 16.918  1.00 22.62 ? 180 LYS A CB    1 
ATOM   1149 C  CG    . LYS A 1 179 ? 41.350 -31.530 16.064  1.00 33.46 ? 180 LYS A CG    1 
ATOM   1150 C  CD    . LYS A 1 179 ? 42.398 -32.352 16.788  1.00 41.73 ? 180 LYS A CD    1 
ATOM   1151 C  CE    . LYS A 1 179 ? 43.630 -32.545 15.906  1.00 47.06 ? 180 LYS A CE    1 
ATOM   1152 N  NZ    . LYS A 1 179 ? 44.837 -33.050 16.641  1.00 52.18 ? 180 LYS A NZ    1 
ATOM   1153 N  N     . THR A 1 180 ? 36.825 -30.724 16.315  1.00 16.81 ? 181 THR A N     1 
ATOM   1154 C  CA    . THR A 1 180 ? 35.483 -30.784 16.893  1.00 16.06 ? 181 THR A CA    1 
ATOM   1155 C  C     . THR A 1 180 ? 35.298 -32.010 17.801  1.00 19.40 ? 181 THR A C     1 
ATOM   1156 O  O     . THR A 1 180 ? 35.644 -33.137 17.434  1.00 18.54 ? 181 THR A O     1 
ATOM   1157 C  CB    . THR A 1 180 ? 34.386 -30.851 15.791  1.00 16.29 ? 181 THR A CB    1 
ATOM   1158 O  OG1   . THR A 1 180 ? 34.527 -29.744 14.894  1.00 13.55 ? 181 THR A OG1   1 
ATOM   1159 C  CG2   . THR A 1 180 ? 32.989 -30.833 16.403  1.00 13.25 ? 181 THR A CG2   1 
ATOM   1160 N  N     . THR A 1 181 ? 34.772 -31.765 18.992  1.00 22.05 ? 182 THR A N     1 
ATOM   1161 C  CA    . THR A 1 181 ? 34.461 -32.815 19.955  1.00 24.84 ? 182 THR A CA    1 
ATOM   1162 C  C     . THR A 1 181 ? 32.999 -32.530 20.327  1.00 27.07 ? 182 THR A C     1 
ATOM   1163 O  O     . THR A 1 181 ? 32.524 -31.382 20.237  1.00 30.05 ? 182 THR A O     1 
ATOM   1164 C  CB    . THR A 1 181 ? 35.373 -32.777 21.210  1.00 24.48 ? 182 THR A CB    1 
ATOM   1165 O  OG1   . THR A 1 181 ? 35.493 -31.434 21.695  1.00 27.39 ? 182 THR A OG1   1 
ATOM   1166 C  CG2   . THR A 1 181 ? 36.750 -33.312 20.884  1.00 23.61 ? 182 THR A CG2   1 
ATOM   1167 N  N     . GLY A 1 182 ? 32.263 -33.563 20.699  1.00 26.86 ? 183 GLY A N     1 
ATOM   1168 C  CA    . GLY A 1 182 ? 30.872 -33.338 21.022  1.00 25.66 ? 183 GLY A CA    1 
ATOM   1169 C  C     . GLY A 1 182 ? 30.053 -33.154 19.750  1.00 24.80 ? 183 GLY A C     1 
ATOM   1170 O  O     . GLY A 1 182 ? 30.505 -33.473 18.643  1.00 25.02 ? 183 GLY A O     1 
ATOM   1171 N  N     . ILE A 1 183 ? 28.839 -32.647 19.921  1.00 22.03 ? 184 ILE A N     1 
ATOM   1172 C  CA    . ILE A 1 183 ? 27.915 -32.428 18.821  1.00 21.70 ? 184 ILE A CA    1 
ATOM   1173 C  C     . ILE A 1 183 ? 27.528 -30.946 18.795  1.00 20.81 ? 184 ILE A C     1 
ATOM   1174 O  O     . ILE A 1 183 ? 27.079 -30.400 19.802  1.00 21.12 ? 184 ILE A O     1 
ATOM   1175 C  CB    . ILE A 1 183 ? 26.653 -33.317 19.012  1.00 19.81 ? 184 ILE A CB    1 
ATOM   1176 C  CG1   . ILE A 1 183 ? 27.029 -34.797 18.882  1.00 21.40 ? 184 ILE A CG1   1 
ATOM   1177 C  CG2   . ILE A 1 183 ? 25.543 -32.912 18.058  1.00 19.72 ? 184 ILE A CG2   1 
ATOM   1178 C  CD1   . ILE A 1 183 ? 26.027 -35.725 19.532  1.00 20.59 ? 184 ILE A CD1   1 
ATOM   1179 N  N     . VAL A 1 184 ? 27.774 -30.277 17.671  1.00 18.04 ? 185 VAL A N     1 
ATOM   1180 C  CA    . VAL A 1 184 ? 27.418 -28.871 17.555  1.00 14.91 ? 185 VAL A CA    1 
ATOM   1181 C  C     . VAL A 1 184 ? 26.118 -28.788 16.781  1.00 16.37 ? 185 VAL A C     1 
ATOM   1182 O  O     . VAL A 1 184 ? 25.925 -29.480 15.770  1.00 15.58 ? 185 VAL A O     1 
ATOM   1183 C  CB    . VAL A 1 184 ? 28.504 -28.041 16.813  1.00 13.09 ? 185 VAL A CB    1 
ATOM   1184 C  CG1   . VAL A 1 184 ? 28.051 -26.596 16.658  1.00 9.14  ? 185 VAL A CG1   1 
ATOM   1185 C  CG2   . VAL A 1 184 ? 29.834 -28.104 17.564  1.00 13.59 ? 185 VAL A CG2   1 
ATOM   1186 N  N     . GLU A 1 185 ? 25.225 -27.936 17.253  1.00 15.96 ? 186 GLU A N     1 
ATOM   1187 C  CA    . GLU A 1 185 ? 23.955 -27.752 16.597  1.00 18.55 ? 186 GLU A CA    1 
ATOM   1188 C  C     . GLU A 1 185 ? 23.800 -26.277 16.245  1.00 18.30 ? 186 GLU A C     1 
ATOM   1189 O  O     . GLU A 1 185 ? 24.002 -25.412 17.093  1.00 18.77 ? 186 GLU A O     1 
ATOM   1190 C  CB    . GLU A 1 185 ? 22.831 -28.232 17.502  1.00 21.12 ? 186 GLU A CB    1 
ATOM   1191 C  CG    . GLU A 1 185 ? 21.461 -28.130 16.868  1.00 24.53 ? 186 GLU A CG    1 
ATOM   1192 C  CD    . GLU A 1 185 ? 20.349 -28.643 17.770  1.00 27.59 ? 186 GLU A CD    1 
ATOM   1193 O  OE1   . GLU A 1 185 ? 20.639 -29.269 18.820  1.00 28.18 ? 186 GLU A OE1   1 
ATOM   1194 O  OE2   . GLU A 1 185 ? 19.174 -28.424 17.409  1.00 28.00 ? 186 GLU A OE2   1 
ATOM   1195 N  N     . THR A 1 186 ? 23.466 -26.004 14.986  1.00 18.29 ? 187 THR A N     1 
ATOM   1196 C  CA    . THR A 1 186 ? 23.289 -24.642 14.478  1.00 17.82 ? 187 THR A CA    1 
ATOM   1197 C  C     . THR A 1 186 ? 21.951 -24.549 13.738  1.00 16.37 ? 187 THR A C     1 
ATOM   1198 O  O     . THR A 1 186 ? 21.547 -25.482 13.056  1.00 16.05 ? 187 THR A O     1 
ATOM   1199 C  CB    . THR A 1 186 ? 24.436 -24.285 13.494  1.00 20.74 ? 187 THR A CB    1 
ATOM   1200 O  OG1   . THR A 1 186 ? 25.700 -24.584 14.108  1.00 28.12 ? 187 THR A OG1   1 
ATOM   1201 C  CG2   . THR A 1 186 ? 24.403 -22.813 13.123  1.00 23.76 ? 187 THR A CG2   1 
ATOM   1202 N  N     . HIS A 1 187 ? 21.265 -23.422 13.882  1.00 18.47 ? 188 HIS A N     1 
ATOM   1203 C  CA    . HIS A 1 187 ? 19.966 -23.204 13.241  1.00 21.73 ? 188 HIS A CA    1 
ATOM   1204 C  C     . HIS A 1 187 ? 20.033 -21.945 12.397  1.00 20.55 ? 188 HIS A C     1 
ATOM   1205 O  O     . HIS A 1 187 ? 20.766 -21.015 12.732  1.00 22.65 ? 188 HIS A O     1 
ATOM   1206 C  CB    . HIS A 1 187 ? 18.849 -22.997 14.292  1.00 24.92 ? 188 HIS A CB    1 
ATOM   1207 C  CG    . HIS A 1 187 ? 18.574 -24.194 15.156  1.00 30.55 ? 188 HIS A CG    1 
ATOM   1208 N  ND1   . HIS A 1 187 ? 17.815 -24.121 16.303  1.00 35.52 ? 188 HIS A ND1   1 
ATOM   1209 C  CD2   . HIS A 1 187 ? 18.936 -25.494 15.032  1.00 33.28 ? 188 HIS A CD2   1 
ATOM   1210 C  CE1   . HIS A 1 187 ? 17.718 -25.323 16.845  1.00 34.37 ? 188 HIS A CE1   1 
ATOM   1211 N  NE2   . HIS A 1 187 ? 18.389 -26.173 16.091  1.00 32.10 ? 188 HIS A NE2   1 
ATOM   1212 N  N     . PHE A 1 188 ? 19.274 -21.927 11.309  1.00 17.36 ? 189 PHE A N     1 
ATOM   1213 C  CA    . PHE A 1 188 ? 19.190 -20.764 10.435  1.00 16.92 ? 189 PHE A CA    1 
ATOM   1214 C  C     . PHE A 1 188 ? 18.006 -20.953 9.493   1.00 19.47 ? 189 PHE A C     1 
ATOM   1215 O  O     . PHE A 1 188 ? 17.513 -22.077 9.313   1.00 20.13 ? 189 PHE A O     1 
ATOM   1216 C  CB    . PHE A 1 188 ? 20.502 -20.489 9.665   1.00 16.99 ? 189 PHE A CB    1 
ATOM   1217 C  CG    . PHE A 1 188 ? 20.942 -21.612 8.742   1.00 19.55 ? 189 PHE A CG    1 
ATOM   1218 C  CD1   . PHE A 1 188 ? 21.775 -22.638 9.212   1.00 16.14 ? 189 PHE A CD1   1 
ATOM   1219 C  CD2   . PHE A 1 188 ? 20.549 -21.627 7.394   1.00 18.37 ? 189 PHE A CD2   1 
ATOM   1220 C  CE1   . PHE A 1 188 ? 22.212 -23.666 8.355   1.00 16.66 ? 189 PHE A CE1   1 
ATOM   1221 C  CE2   . PHE A 1 188 ? 20.980 -22.651 6.529   1.00 16.05 ? 189 PHE A CE2   1 
ATOM   1222 C  CZ    . PHE A 1 188 ? 21.813 -23.669 7.011   1.00 13.89 ? 189 PHE A CZ    1 
ATOM   1223 N  N     . THR A 1 189 ? 17.485 -19.839 8.990   1.00 20.15 ? 190 THR A N     1 
ATOM   1224 C  CA    . THR A 1 189 ? 16.352 -19.861 8.084   1.00 22.42 ? 190 THR A CA    1 
ATOM   1225 C  C     . THR A 1 189 ? 16.840 -19.442 6.716   1.00 24.39 ? 190 THR A C     1 
ATOM   1226 O  O     . THR A 1 189 ? 17.657 -18.521 6.595   1.00 24.33 ? 190 THR A O     1 
ATOM   1227 C  CB    . THR A 1 189 ? 15.249 -18.893 8.554   1.00 24.25 ? 190 THR A CB    1 
ATOM   1228 O  OG1   . THR A 1 189 ? 14.834 -19.264 9.876   1.00 26.30 ? 190 THR A OG1   1 
ATOM   1229 C  CG2   . THR A 1 189 ? 14.038 -18.967 7.621   1.00 25.52 ? 190 THR A CG2   1 
ATOM   1230 N  N     . PHE A 1 190 ? 16.385 -20.151 5.692   1.00 24.74 ? 191 PHE A N     1 
ATOM   1231 C  CA    . PHE A 1 190 ? 16.779 -19.845 4.324   1.00 25.18 ? 191 PHE A CA    1 
ATOM   1232 C  C     . PHE A 1 190 ? 15.662 -20.330 3.418   1.00 27.23 ? 191 PHE A C     1 
ATOM   1233 O  O     . PHE A 1 190 ? 15.171 -21.443 3.588   1.00 25.86 ? 191 PHE A O     1 
ATOM   1234 C  CB    . PHE A 1 190 ? 18.094 -20.550 3.993   1.00 24.89 ? 191 PHE A CB    1 
ATOM   1235 C  CG    . PHE A 1 190 ? 18.530 -20.401 2.567   1.00 24.38 ? 191 PHE A CG    1 
ATOM   1236 C  CD1   . PHE A 1 190 ? 18.558 -19.154 1.956   1.00 24.55 ? 191 PHE A CD1   1 
ATOM   1237 C  CD2   . PHE A 1 190 ? 18.935 -21.511 1.838   1.00 23.49 ? 191 PHE A CD2   1 
ATOM   1238 C  CE1   . PHE A 1 190 ? 18.987 -19.016 0.641   1.00 24.60 ? 191 PHE A CE1   1 
ATOM   1239 C  CE2   . PHE A 1 190 ? 19.363 -21.384 0.528   1.00 24.13 ? 191 PHE A CE2   1 
ATOM   1240 C  CZ    . PHE A 1 190 ? 19.391 -20.135 -0.074  1.00 25.43 ? 191 PHE A CZ    1 
ATOM   1241 N  N     . LYS A 1 191 ? 15.241 -19.468 2.491   1.00 29.73 ? 192 LYS A N     1 
ATOM   1242 C  CA    . LYS A 1 191 ? 14.165 -19.778 1.555   1.00 32.69 ? 192 LYS A CA    1 
ATOM   1243 C  C     . LYS A 1 191 ? 12.939 -20.294 2.305   1.00 35.97 ? 192 LYS A C     1 
ATOM   1244 O  O     . LYS A 1 191 ? 12.322 -21.289 1.917   1.00 36.60 ? 192 LYS A O     1 
ATOM   1245 C  CB    . LYS A 1 191 ? 14.630 -20.789 0.497   1.00 32.89 ? 192 LYS A CB    1 
ATOM   1246 C  CG    . LYS A 1 191 ? 15.615 -20.213 -0.512  1.00 35.77 ? 192 LYS A CG    1 
ATOM   1247 C  CD    . LYS A 1 191 ? 16.022 -21.244 -1.551  1.00 39.94 ? 192 LYS A CD    1 
ATOM   1248 C  CE    . LYS A 1 191 ? 16.821 -20.598 -2.682  1.00 44.28 ? 192 LYS A CE    1 
ATOM   1249 N  NZ    . LYS A 1 191 ? 17.102 -21.533 -3.816  1.00 43.28 ? 192 LYS A NZ    1 
ATOM   1250 N  N     . ASP A 1 192 ? 12.607 -19.618 3.402   1.00 37.24 ? 193 ASP A N     1 
ATOM   1251 C  CA    . ASP A 1 192 ? 11.458 -19.985 4.225   1.00 41.78 ? 193 ASP A CA    1 
ATOM   1252 C  C     . ASP A 1 192 ? 11.524 -21.405 4.809   1.00 41.06 ? 193 ASP A C     1 
ATOM   1253 O  O     . ASP A 1 192 ? 10.496 -21.997 5.168   1.00 41.36 ? 193 ASP A O     1 
ATOM   1254 C  CB    . ASP A 1 192 ? 10.149 -19.770 3.450   1.00 47.73 ? 193 ASP A CB    1 
ATOM   1255 C  CG    . ASP A 1 192 ? 9.956  -18.320 3.019   1.00 53.28 ? 193 ASP A CG    1 
ATOM   1256 O  OD1   . ASP A 1 192 ? 9.887  -17.434 3.903   1.00 56.72 ? 193 ASP A OD1   1 
ATOM   1257 O  OD2   . ASP A 1 192 ? 9.884  -18.064 1.795   1.00 56.39 ? 193 ASP A OD2   1 
ATOM   1258 N  N     . LEU A 1 193 ? 12.739 -21.936 4.902   1.00 37.46 ? 194 LEU A N     1 
ATOM   1259 C  CA    . LEU A 1 193 ? 12.967 -23.251 5.476   1.00 34.37 ? 194 LEU A CA    1 
ATOM   1260 C  C     . LEU A 1 193 ? 13.828 -23.052 6.724   1.00 30.87 ? 194 LEU A C     1 
ATOM   1261 O  O     . LEU A 1 193 ? 14.786 -22.277 6.709   1.00 29.05 ? 194 LEU A O     1 
ATOM   1262 C  CB    . LEU A 1 193 ? 13.707 -24.143 4.477   1.00 38.00 ? 194 LEU A CB    1 
ATOM   1263 C  CG    . LEU A 1 193 ? 13.000 -24.683 3.230   1.00 40.39 ? 194 LEU A CG    1 
ATOM   1264 C  CD1   . LEU A 1 193 ? 14.032 -25.154 2.209   1.00 41.84 ? 194 LEU A CD1   1 
ATOM   1265 C  CD2   . LEU A 1 193 ? 12.082 -25.833 3.619   1.00 40.85 ? 194 LEU A CD2   1 
ATOM   1266 N  N     . HIS A 1 194 ? 13.452 -23.686 7.824   1.00 28.09 ? 195 HIS A N     1 
ATOM   1267 C  CA    . HIS A 1 194 ? 14.245 -23.563 9.032   1.00 27.50 ? 195 HIS A CA    1 
ATOM   1268 C  C     . HIS A 1 194 ? 15.170 -24.760 9.094   1.00 24.46 ? 195 HIS A C     1 
ATOM   1269 O  O     . HIS A 1 194 ? 14.709 -25.901 9.226   1.00 22.45 ? 195 HIS A O     1 
ATOM   1270 C  CB    . HIS A 1 194 ? 13.388 -23.507 10.301  1.00 30.94 ? 195 HIS A CB    1 
ATOM   1271 C  CG    . HIS A 1 194 ? 14.197 -23.593 11.564  1.00 36.94 ? 195 HIS A CG    1 
ATOM   1272 N  ND1   . HIS A 1 194 ? 14.014 -24.590 12.504  1.00 38.42 ? 195 HIS A ND1   1 
ATOM   1273 C  CD2   . HIS A 1 194 ? 15.250 -22.859 11.997  1.00 38.66 ? 195 HIS A CD2   1 
ATOM   1274 C  CE1   . HIS A 1 194 ? 14.921 -24.469 13.455  1.00 37.52 ? 195 HIS A CE1   1 
ATOM   1275 N  NE2   . HIS A 1 194 ? 15.685 -23.429 13.172  1.00 40.91 ? 195 HIS A NE2   1 
ATOM   1276 N  N     . PHE A 1 195 ? 16.468 -24.492 9.048   1.00 18.81 ? 196 PHE A N     1 
ATOM   1277 C  CA    . PHE A 1 195 ? 17.468 -25.543 9.072   1.00 17.42 ? 196 PHE A CA    1 
ATOM   1278 C  C     . PHE A 1 195 ? 18.061 -25.799 10.448  1.00 16.90 ? 196 PHE A C     1 
ATOM   1279 O  O     . PHE A 1 195 ? 18.224 -24.858 11.232  1.00 17.13 ? 196 PHE A O     1 
ATOM   1280 C  CB    . PHE A 1 195 ? 18.619 -25.172 8.132   1.00 17.96 ? 196 PHE A CB    1 
ATOM   1281 C  CG    . PHE A 1 195 ? 18.261 -25.189 6.679   1.00 18.91 ? 196 PHE A CG    1 
ATOM   1282 C  CD1   . PHE A 1 195 ? 17.584 -24.122 6.105   1.00 21.18 ? 196 PHE A CD1   1 
ATOM   1283 C  CD2   . PHE A 1 195 ? 18.645 -26.256 5.872   1.00 19.98 ? 196 PHE A CD2   1 
ATOM   1284 C  CE1   . PHE A 1 195 ? 17.293 -24.111 4.736   1.00 22.60 ? 196 PHE A CE1   1 
ATOM   1285 C  CE2   . PHE A 1 195 ? 18.359 -26.256 4.501   1.00 21.81 ? 196 PHE A CE2   1 
ATOM   1286 C  CZ    . PHE A 1 195 ? 17.684 -25.182 3.934   1.00 21.86 ? 196 PHE A CZ    1 
ATOM   1287 N  N     . LYS A 1 196 ? 18.344 -27.073 10.736  1.00 16.75 ? 197 LYS A N     1 
ATOM   1288 C  CA    . LYS A 1 196 ? 19.012 -27.504 11.970  1.00 18.49 ? 197 LYS A CA    1 
ATOM   1289 C  C     . LYS A 1 196 ? 20.189 -28.301 11.442  1.00 18.37 ? 197 LYS A C     1 
ATOM   1290 O  O     . LYS A 1 196 ? 20.023 -29.409 10.925  1.00 21.05 ? 197 LYS A O     1 
ATOM   1291 C  CB    . LYS A 1 196 ? 18.144 -28.410 12.835  1.00 21.15 ? 197 LYS A CB    1 
ATOM   1292 C  CG    . LYS A 1 196 ? 16.923 -27.727 13.404  1.00 31.38 ? 197 LYS A CG    1 
ATOM   1293 C  CD    . LYS A 1 196 ? 16.265 -28.569 14.484  1.00 37.33 ? 197 LYS A CD    1 
ATOM   1294 C  CE    . LYS A 1 196 ? 15.106 -27.811 15.143  1.00 45.58 ? 197 LYS A CE    1 
ATOM   1295 N  NZ    . LYS A 1 196 ? 14.515 -28.531 16.329  1.00 50.48 ? 197 LYS A NZ    1 
ATOM   1296 N  N     . MET A 1 197 ? 21.378 -27.733 11.553  1.00 16.20 ? 198 MET A N     1 
ATOM   1297 C  CA    . MET A 1 197 ? 22.575 -28.377 11.036  1.00 14.43 ? 198 MET A CA    1 
ATOM   1298 C  C     . MET A 1 197 ? 23.376 -28.993 12.154  1.00 14.74 ? 198 MET A C     1 
ATOM   1299 O  O     . MET A 1 197 ? 23.641 -28.335 13.168  1.00 16.41 ? 198 MET A O     1 
ATOM   1300 C  CB    . MET A 1 197 ? 23.416 -27.331 10.287  1.00 16.32 ? 198 MET A CB    1 
ATOM   1301 C  CG    . MET A 1 197 ? 24.644 -27.840 9.545   1.00 16.06 ? 198 MET A CG    1 
ATOM   1302 S  SD    . MET A 1 197 ? 25.395 -26.484 8.572   1.00 20.18 ? 198 MET A SD    1 
ATOM   1303 C  CE    . MET A 1 197 ? 24.550 -26.677 6.937   1.00 16.37 ? 198 MET A CE    1 
ATOM   1304 N  N     . PHE A 1 198 ? 23.768 -30.248 11.967  1.00 11.85 ? 199 PHE A N     1 
ATOM   1305 C  CA    . PHE A 1 198 ? 24.569 -30.961 12.953  1.00 13.09 ? 199 PHE A CA    1 
ATOM   1306 C  C     . PHE A 1 198 ? 25.991 -31.221 12.467  1.00 15.08 ? 199 PHE A C     1 
ATOM   1307 O  O     . PHE A 1 198 ? 26.213 -31.680 11.333  1.00 13.17 ? 199 PHE A O     1 
ATOM   1308 C  CB    . PHE A 1 198 ? 23.885 -32.263 13.362  1.00 15.05 ? 199 PHE A CB    1 
ATOM   1309 C  CG    . PHE A 1 198 ? 22.598 -32.044 14.073  1.00 16.74 ? 199 PHE A CG    1 
ATOM   1310 C  CD1   . PHE A 1 198 ? 21.449 -31.720 13.361  1.00 17.30 ? 199 PHE A CD1   1 
ATOM   1311 C  CD2   . PHE A 1 198 ? 22.548 -32.064 15.462  1.00 20.73 ? 199 PHE A CD2   1 
ATOM   1312 C  CE1   . PHE A 1 198 ? 20.266 -31.407 14.023  1.00 21.78 ? 199 PHE A CE1   1 
ATOM   1313 C  CE2   . PHE A 1 198 ? 21.364 -31.753 16.143  1.00 21.06 ? 199 PHE A CE2   1 
ATOM   1314 C  CZ    . PHE A 1 198 ? 20.221 -31.423 15.417  1.00 19.51 ? 199 PHE A CZ    1 
ATOM   1315 N  N     . ASP A 1 199 ? 26.939 -30.972 13.365  1.00 13.43 ? 200 ASP A N     1 
ATOM   1316 C  CA    . ASP A 1 199 ? 28.350 -31.136 13.080  1.00 11.64 ? 200 ASP A CA    1 
ATOM   1317 C  C     . ASP A 1 199 ? 28.988 -31.992 14.180  1.00 14.11 ? 200 ASP A C     1 
ATOM   1318 O  O     . ASP A 1 199 ? 28.693 -31.808 15.359  1.00 13.54 ? 200 ASP A O     1 
ATOM   1319 C  CB    . ASP A 1 199 ? 28.957 -29.732 13.024  1.00 10.57 ? 200 ASP A CB    1 
ATOM   1320 C  CG    . ASP A 1 199 ? 30.432 -29.723 12.708  1.00 11.87 ? 200 ASP A CG    1 
ATOM   1321 O  OD1   . ASP A 1 199 ? 30.962 -30.699 12.137  1.00 11.85 ? 200 ASP A OD1   1 
ATOM   1322 O  OD2   . ASP A 1 199 ? 31.068 -28.710 13.053  1.00 11.83 ? 200 ASP A OD2   1 
ATOM   1323 N  N     . VAL A 1 200 ? 29.841 -32.937 13.781  1.00 14.75 ? 201 VAL A N     1 
ATOM   1324 C  CA    . VAL A 1 200 ? 30.571 -33.829 14.699  1.00 20.51 ? 201 VAL A CA    1 
ATOM   1325 C  C     . VAL A 1 200 ? 32.035 -33.966 14.228  1.00 22.52 ? 201 VAL A C     1 
ATOM   1326 O  O     . VAL A 1 200 ? 32.375 -33.539 13.114  1.00 24.41 ? 201 VAL A O     1 
ATOM   1327 C  CB    . VAL A 1 200 ? 29.935 -35.247 14.767  1.00 22.52 ? 201 VAL A CB    1 
ATOM   1328 C  CG1   . VAL A 1 200 ? 28.591 -35.194 15.492  1.00 23.53 ? 201 VAL A CG1   1 
ATOM   1329 C  CG2   . VAL A 1 200 ? 29.748 -35.824 13.359  1.00 21.78 ? 201 VAL A CG2   1 
ATOM   1330 N  N     . GLY A 1 201 ? 32.912 -34.489 15.085  1.00 22.55 ? 202 GLY A N     1 
ATOM   1331 C  CA    . GLY A 1 201 ? 34.313 -34.662 14.711  1.00 21.24 ? 202 GLY A CA    1 
ATOM   1332 C  C     . GLY A 1 201 ? 34.505 -35.877 13.813  1.00 21.48 ? 202 GLY A C     1 
ATOM   1333 O  O     . GLY A 1 201 ? 33.819 -36.905 13.999  1.00 22.37 ? 202 GLY A O     1 
ATOM   1334 N  N     . GLY A 1 202 ? 35.438 -35.786 12.862  1.00 18.99 ? 203 GLY A N     1 
ATOM   1335 C  CA    . GLY A 1 202 ? 35.678 -36.894 11.935  1.00 19.66 ? 203 GLY A CA    1 
ATOM   1336 C  C     . GLY A 1 202 ? 36.836 -37.823 12.257  1.00 19.54 ? 203 GLY A C     1 
ATOM   1337 O  O     . GLY A 1 202 ? 37.030 -38.856 11.602  1.00 19.57 ? 203 GLY A O     1 
ATOM   1338 N  N     . GLN A 1 203 ? 37.656 -37.447 13.229  1.00 20.23 ? 204 GLN A N     1 
ATOM   1339 C  CA    . GLN A 1 203 ? 38.776 -38.308 13.598  1.00 24.05 ? 204 GLN A CA    1 
ATOM   1340 C  C     . GLN A 1 203 ? 38.290 -39.577 14.289  1.00 21.57 ? 204 GLN A C     1 
ATOM   1341 O  O     . GLN A 1 203 ? 37.247 -39.585 14.938  1.00 20.00 ? 204 GLN A O     1 
ATOM   1342 C  CB    . GLN A 1 203 ? 39.798 -37.556 14.449  1.00 29.18 ? 204 GLN A CB    1 
ATOM   1343 C  CG    . GLN A 1 203 ? 40.606 -36.534 13.626  1.00 35.38 ? 204 GLN A CG    1 
ATOM   1344 C  CD    . GLN A 1 203 ? 41.766 -35.917 14.396  1.00 41.86 ? 204 GLN A CD    1 
ATOM   1345 O  OE1   . GLN A 1 203 ? 42.016 -36.255 15.565  1.00 43.73 ? 204 GLN A OE1   1 
ATOM   1346 N  NE2   . GLN A 1 203 ? 42.473 -34.995 13.748  1.00 40.79 ? 204 GLN A NE2   1 
ATOM   1347 N  N     . ARG A 1 204 ? 39.055 -40.648 14.132  1.00 22.78 ? 205 ARG A N     1 
ATOM   1348 C  CA    . ARG A 1 204 ? 38.715 -41.956 14.688  1.00 25.95 ? 205 ARG A CA    1 
ATOM   1349 C  C     . ARG A 1 204 ? 38.080 -42.024 16.076  1.00 24.76 ? 205 ARG A C     1 
ATOM   1350 O  O     . ARG A 1 204 ? 37.095 -42.729 16.264  1.00 26.43 ? 205 ARG A O     1 
ATOM   1351 C  CB    . ARG A 1 204 ? 39.912 -42.901 14.591  1.00 25.76 ? 205 ARG A CB    1 
ATOM   1352 C  CG    . ARG A 1 204 ? 40.188 -43.351 13.157  1.00 29.86 ? 205 ARG A CG    1 
ATOM   1353 C  CD    . ARG A 1 204 ? 41.398 -44.261 13.051  1.00 30.41 ? 205 ARG A CD    1 
ATOM   1354 N  NE    . ARG A 1 204 ? 41.581 -44.720 11.678  1.00 34.76 ? 205 ARG A NE    1 
ATOM   1355 C  CZ    . ARG A 1 204 ? 42.516 -45.580 11.274  1.00 35.75 ? 205 ARG A CZ    1 
ATOM   1356 N  NH1   . ARG A 1 204 ? 43.387 -46.101 12.134  1.00 36.34 ? 205 ARG A NH1   1 
ATOM   1357 N  NH2   . ARG A 1 204 ? 42.573 -45.928 9.997   1.00 36.54 ? 205 ARG A NH2   1 
ATOM   1358 N  N     . SER A 1 205 ? 38.586 -41.246 17.022  1.00 25.76 ? 206 SER A N     1 
ATOM   1359 C  CA    . SER A 1 205 ? 38.044 -41.259 18.377  1.00 25.77 ? 206 SER A CA    1 
ATOM   1360 C  C     . SER A 1 205 ? 36.648 -40.659 18.517  1.00 25.86 ? 206 SER A C     1 
ATOM   1361 O  O     . SER A 1 205 ? 35.948 -40.957 19.483  1.00 30.72 ? 206 SER A O     1 
ATOM   1362 C  CB    . SER A 1 205 ? 39.012 -40.566 19.336  1.00 25.84 ? 206 SER A CB    1 
ATOM   1363 O  OG    . SER A 1 205 ? 39.411 -39.300 18.837  1.00 27.70 ? 206 SER A OG    1 
ATOM   1364 N  N     . GLU A 1 206 ? 36.227 -39.852 17.545  1.00 22.85 ? 207 GLU A N     1 
ATOM   1365 C  CA    . GLU A 1 206 ? 34.923 -39.207 17.604  1.00 20.65 ? 207 GLU A CA    1 
ATOM   1366 C  C     . GLU A 1 206 ? 33.837 -39.918 16.825  1.00 20.20 ? 207 GLU A C     1 
ATOM   1367 O  O     . GLU A 1 206 ? 32.659 -39.667 17.052  1.00 19.15 ? 207 GLU A O     1 
ATOM   1368 C  CB    . GLU A 1 206 ? 35.016 -37.765 17.098  1.00 23.83 ? 207 GLU A CB    1 
ATOM   1369 C  CG    . GLU A 1 206 ? 35.890 -36.838 17.938  1.00 30.47 ? 207 GLU A CG    1 
ATOM   1370 C  CD    . GLU A 1 206 ? 35.322 -36.584 19.333  1.00 35.50 ? 207 GLU A CD    1 
ATOM   1371 O  OE1   . GLU A 1 206 ? 34.166 -36.105 19.434  1.00 36.95 ? 207 GLU A OE1   1 
ATOM   1372 O  OE2   . GLU A 1 206 ? 36.033 -36.868 20.326  1.00 38.83 ? 207 GLU A OE2   1 
ATOM   1373 N  N     . ARG A 1 207 ? 34.216 -40.801 15.909  1.00 18.38 ? 208 ARG A N     1 
ATOM   1374 C  CA    . ARG A 1 207 ? 33.225 -41.500 15.098  1.00 20.09 ? 208 ARG A CA    1 
ATOM   1375 C  C     . ARG A 1 207 ? 32.236 -42.355 15.875  1.00 21.58 ? 208 ARG A C     1 
ATOM   1376 O  O     . ARG A 1 207 ? 31.131 -42.627 15.391  1.00 21.21 ? 208 ARG A O     1 
ATOM   1377 C  CB    . ARG A 1 207 ? 33.888 -42.308 13.992  1.00 19.84 ? 208 ARG A CB    1 
ATOM   1378 C  CG    . ARG A 1 207 ? 34.684 -41.437 13.055  1.00 22.10 ? 208 ARG A CG    1 
ATOM   1379 C  CD    . ARG A 1 207 ? 35.420 -42.258 12.040  1.00 23.30 ? 208 ARG A CD    1 
ATOM   1380 N  NE    . ARG A 1 207 ? 36.527 -41.499 11.470  1.00 24.11 ? 208 ARG A NE    1 
ATOM   1381 C  CZ    . ARG A 1 207 ? 37.602 -42.050 10.918  1.00 25.05 ? 208 ARG A CZ    1 
ATOM   1382 N  NH1   . ARG A 1 207 ? 37.720 -43.370 10.843  1.00 26.38 ? 208 ARG A NH1   1 
ATOM   1383 N  NH2   . ARG A 1 207 ? 38.594 -41.279 10.500  1.00 27.81 ? 208 ARG A NH2   1 
ATOM   1384 N  N     . LYS A 1 208 ? 32.601 -42.768 17.083  1.00 23.96 ? 209 LYS A N     1 
ATOM   1385 C  CA    . LYS A 1 208 ? 31.671 -43.560 17.879  1.00 28.34 ? 209 LYS A CA    1 
ATOM   1386 C  C     . LYS A 1 208 ? 30.473 -42.699 18.296  1.00 27.26 ? 209 LYS A C     1 
ATOM   1387 O  O     . LYS A 1 208 ? 29.426 -43.230 18.644  1.00 28.74 ? 209 LYS A O     1 
ATOM   1388 C  CB    . LYS A 1 208 ? 32.353 -44.172 19.114  1.00 30.58 ? 209 LYS A CB    1 
ATOM   1389 C  CG    . LYS A 1 208 ? 32.783 -43.167 20.174  1.00 37.46 ? 209 LYS A CG    1 
ATOM   1390 C  CD    . LYS A 1 208 ? 33.409 -43.858 21.386  1.00 42.04 ? 209 LYS A CD    1 
ATOM   1391 C  CE    . LYS A 1 208 ? 34.810 -44.393 21.085  1.00 47.39 ? 209 LYS A CE    1 
ATOM   1392 N  NZ    . LYS A 1 208 ? 35.846 -43.307 20.925  1.00 51.29 ? 209 LYS A NZ    1 
ATOM   1393 N  N     . LYS A 1 209 ? 30.607 -41.375 18.203  1.00 27.56 ? 210 LYS A N     1 
ATOM   1394 C  CA    . LYS A 1 209 ? 29.528 -40.455 18.591  1.00 26.01 ? 210 LYS A CA    1 
ATOM   1395 C  C     . LYS A 1 209 ? 28.528 -40.143 17.471  1.00 22.02 ? 210 LYS A C     1 
ATOM   1396 O  O     . LYS A 1 209 ? 27.468 -39.560 17.707  1.00 19.57 ? 210 LYS A O     1 
ATOM   1397 C  CB    . LYS A 1 209 ? 30.122 -39.153 19.132  1.00 32.18 ? 210 LYS A CB    1 
ATOM   1398 C  CG    . LYS A 1 209 ? 31.110 -39.345 20.288  1.00 37.35 ? 210 LYS A CG    1 
ATOM   1399 C  CD    . LYS A 1 209 ? 31.793 -38.022 20.646  1.00 43.57 ? 210 LYS A CD    1 
ATOM   1400 C  CE    . LYS A 1 209 ? 32.837 -38.191 21.770  1.00 48.15 ? 210 LYS A CE    1 
ATOM   1401 N  NZ    . LYS A 1 209 ? 33.545 -36.913 22.154  1.00 48.17 ? 210 LYS A NZ    1 
ATOM   1402 N  N     . TRP A 1 210 ? 28.862 -40.555 16.257  1.00 18.27 ? 211 TRP A N     1 
ATOM   1403 C  CA    . TRP A 1 210 ? 28.003 -40.316 15.109  1.00 19.80 ? 211 TRP A CA    1 
ATOM   1404 C  C     . TRP A 1 210 ? 26.605 -40.909 15.278  1.00 17.93 ? 211 TRP A C     1 
ATOM   1405 O  O     . TRP A 1 210 ? 25.625 -40.253 14.925  1.00 15.76 ? 211 TRP A O     1 
ATOM   1406 C  CB    . TRP A 1 210 ? 28.644 -40.871 13.828  1.00 21.83 ? 211 TRP A CB    1 
ATOM   1407 C  CG    . TRP A 1 210 ? 29.884 -40.127 13.351  1.00 22.94 ? 211 TRP A CG    1 
ATOM   1408 C  CD1   . TRP A 1 210 ? 30.599 -39.167 14.032  1.00 22.48 ? 211 TRP A CD1   1 
ATOM   1409 C  CD2   . TRP A 1 210 ? 30.535 -40.283 12.084  1.00 23.22 ? 211 TRP A CD2   1 
ATOM   1410 N  NE1   . TRP A 1 210 ? 31.647 -38.722 13.262  1.00 23.83 ? 211 TRP A NE1   1 
ATOM   1411 C  CE2   . TRP A 1 210 ? 31.635 -39.388 12.063  1.00 23.55 ? 211 TRP A CE2   1 
ATOM   1412 C  CE3   . TRP A 1 210 ? 30.299 -41.097 10.963  1.00 24.42 ? 211 TRP A CE3   1 
ATOM   1413 C  CZ2   . TRP A 1 210 ? 32.500 -39.282 10.962  1.00 23.06 ? 211 TRP A CZ2   1 
ATOM   1414 C  CZ3   . TRP A 1 210 ? 31.163 -40.992 9.858   1.00 26.17 ? 211 TRP A CZ3   1 
ATOM   1415 C  CH2   . TRP A 1 210 ? 32.251 -40.087 9.874   1.00 24.90 ? 211 TRP A CH2   1 
ATOM   1416 N  N     . ILE A 1 211 ? 26.507 -42.115 15.853  1.00 17.48 ? 212 ILE A N     1 
ATOM   1417 C  CA    . ILE A 1 211 ? 25.194 -42.766 16.023  1.00 19.40 ? 212 ILE A CA    1 
ATOM   1418 C  C     . ILE A 1 211 ? 24.156 -41.958 16.802  1.00 19.68 ? 212 ILE A C     1 
ATOM   1419 O  O     . ILE A 1 211 ? 22.949 -42.088 16.574  1.00 20.81 ? 212 ILE A O     1 
ATOM   1420 C  CB    . ILE A 1 211 ? 25.260 -44.265 16.542  1.00 19.02 ? 212 ILE A CB    1 
ATOM   1421 C  CG1   . ILE A 1 211 ? 26.239 -44.463 17.702  1.00 16.62 ? 212 ILE A CG1   1 
ATOM   1422 C  CG2   . ILE A 1 211 ? 25.614 -45.194 15.392  1.00 22.81 ? 212 ILE A CG2   1 
ATOM   1423 C  CD1   . ILE A 1 211 ? 25.822 -43.849 19.003  1.00 19.64 ? 212 ILE A CD1   1 
ATOM   1424 N  N     . HIS A 1 212 ? 24.626 -41.052 17.648  1.00 21.88 ? 213 HIS A N     1 
ATOM   1425 C  CA    . HIS A 1 212 ? 23.724 -40.216 18.427  1.00 21.22 ? 213 HIS A CA    1 
ATOM   1426 C  C     . HIS A 1 212 ? 22.919 -39.243 17.537  1.00 18.94 ? 213 HIS A C     1 
ATOM   1427 O  O     . HIS A 1 212 ? 21.825 -38.832 17.912  1.00 20.78 ? 213 HIS A O     1 
ATOM   1428 C  CB    . HIS A 1 212 ? 24.507 -39.469 19.527  1.00 20.60 ? 213 HIS A CB    1 
ATOM   1429 C  CG    . HIS A 1 212 ? 25.219 -40.381 20.489  1.00 21.95 ? 213 HIS A CG    1 
ATOM   1430 N  ND1   . HIS A 1 212 ? 24.582 -41.404 21.161  1.00 22.37 ? 213 HIS A ND1   1 
ATOM   1431 C  CD2   . HIS A 1 212 ? 26.522 -40.449 20.860  1.00 23.97 ? 213 HIS A CD2   1 
ATOM   1432 C  CE1   . HIS A 1 212 ? 25.461 -42.069 21.894  1.00 21.75 ? 213 HIS A CE1   1 
ATOM   1433 N  NE2   . HIS A 1 212 ? 26.645 -41.509 21.729  1.00 22.67 ? 213 HIS A NE2   1 
ATOM   1434 N  N     . CYS A 1 213 ? 23.437 -38.906 16.351  1.00 20.26 ? 214 CYS A N     1 
ATOM   1435 C  CA    . CYS A 1 213 ? 22.743 -37.967 15.437  1.00 21.49 ? 214 CYS A CA    1 
ATOM   1436 C  C     . CYS A 1 213 ? 21.957 -38.601 14.285  1.00 17.96 ? 214 CYS A C     1 
ATOM   1437 O  O     . CYS A 1 213 ? 21.400 -37.880 13.460  1.00 17.39 ? 214 CYS A O     1 
ATOM   1438 C  CB    . CYS A 1 213 ? 23.729 -36.972 14.810  1.00 21.29 ? 214 CYS A CB    1 
ATOM   1439 S  SG    . CYS A 1 213 ? 24.828 -36.175 15.945  1.00 28.65 ? 214 CYS A SG    1 
ATOM   1440 N  N     . PHE A 1 214 ? 21.886 -39.927 14.251  1.00 16.07 ? 215 PHE A N     1 
ATOM   1441 C  CA    . PHE A 1 214 ? 21.212 -40.632 13.176  1.00 20.01 ? 215 PHE A CA    1 
ATOM   1442 C  C     . PHE A 1 214 ? 19.686 -40.519 13.016  1.00 21.17 ? 215 PHE A C     1 
ATOM   1443 O  O     . PHE A 1 214 ? 19.150 -41.023 12.033  1.00 23.36 ? 215 PHE A O     1 
ATOM   1444 C  CB    . PHE A 1 214 ? 21.614 -42.114 13.205  1.00 20.63 ? 215 PHE A CB    1 
ATOM   1445 C  CG    . PHE A 1 214 ? 22.989 -42.396 12.644  1.00 18.31 ? 215 PHE A CG    1 
ATOM   1446 C  CD1   . PHE A 1 214 ? 23.867 -41.357 12.328  1.00 20.17 ? 215 PHE A CD1   1 
ATOM   1447 C  CD2   . PHE A 1 214 ? 23.403 -43.710 12.429  1.00 16.89 ? 215 PHE A CD2   1 
ATOM   1448 C  CE1   . PHE A 1 214 ? 25.150 -41.623 11.800  1.00 20.87 ? 215 PHE A CE1   1 
ATOM   1449 C  CE2   . PHE A 1 214 ? 24.669 -43.985 11.907  1.00 20.66 ? 215 PHE A CE2   1 
ATOM   1450 C  CZ    . PHE A 1 214 ? 25.548 -42.936 11.592  1.00 18.99 ? 215 PHE A CZ    1 
ATOM   1451 N  N     . GLU A 1 215 ? 18.986 -39.847 13.925  1.00 23.24 ? 216 GLU A N     1 
ATOM   1452 C  CA    . GLU A 1 215 ? 17.524 -39.753 13.835  1.00 25.11 ? 216 GLU A CA    1 
ATOM   1453 C  C     . GLU A 1 215 ? 16.961 -38.601 12.998  1.00 24.68 ? 216 GLU A C     1 
ATOM   1454 O  O     . GLU A 1 215 ? 17.446 -37.478 13.081  1.00 25.09 ? 216 GLU A O     1 
ATOM   1455 C  CB    . GLU A 1 215 ? 16.915 -39.709 15.250  1.00 31.75 ? 216 GLU A CB    1 
ATOM   1456 C  CG    . GLU A 1 215 ? 15.418 -39.379 15.320  1.00 36.89 ? 216 GLU A CG    1 
ATOM   1457 C  CD    . GLU A 1 215 ? 14.516 -40.570 15.042  1.00 42.61 ? 216 GLU A CD    1 
ATOM   1458 O  OE1   . GLU A 1 215 ? 14.704 -41.254 14.005  1.00 44.04 ? 216 GLU A OE1   1 
ATOM   1459 O  OE2   . GLU A 1 215 ? 13.606 -40.816 15.870  1.00 46.29 ? 216 GLU A OE2   1 
ATOM   1460 N  N     . GLY A 1 216 ? 15.933 -38.891 12.198  1.00 21.96 ? 217 GLY A N     1 
ATOM   1461 C  CA    . GLY A 1 216 ? 15.286 -37.868 11.383  1.00 21.52 ? 217 GLY A CA    1 
ATOM   1462 C  C     . GLY A 1 216 ? 16.127 -36.985 10.460  1.00 23.91 ? 217 GLY A C     1 
ATOM   1463 O  O     . GLY A 1 216 ? 15.751 -35.841 10.167  1.00 21.94 ? 217 GLY A O     1 
ATOM   1464 N  N     . VAL A 1 217 ? 17.219 -37.527 9.933   1.00 22.26 ? 218 VAL A N     1 
ATOM   1465 C  CA    . VAL A 1 217 ? 18.089 -36.753 9.061   1.00 20.72 ? 218 VAL A CA    1 
ATOM   1466 C  C     . VAL A 1 217 ? 17.455 -36.565 7.677   1.00 19.51 ? 218 VAL A C     1 
ATOM   1467 O  O     . VAL A 1 217 ? 17.081 -37.541 7.018   1.00 19.71 ? 218 VAL A O     1 
ATOM   1468 C  CB    . VAL A 1 217 ? 19.480 -37.434 8.941   1.00 20.56 ? 218 VAL A CB    1 
ATOM   1469 C  CG1   . VAL A 1 217 ? 20.410 -36.592 8.095   1.00 22.65 ? 218 VAL A CG1   1 
ATOM   1470 C  CG2   . VAL A 1 217 ? 20.087 -37.649 10.317  1.00 17.81 ? 218 VAL A CG2   1 
ATOM   1471 N  N     . THR A 1 218 ? 17.315 -35.312 7.254   1.00 19.71 ? 219 THR A N     1 
ATOM   1472 C  CA    . THR A 1 218 ? 16.745 -34.988 5.943   1.00 19.97 ? 219 THR A CA    1 
ATOM   1473 C  C     . THR A 1 218 ? 17.786 -35.232 4.842   1.00 22.39 ? 219 THR A C     1 
ATOM   1474 O  O     . THR A 1 218 ? 17.498 -35.841 3.801   1.00 23.21 ? 219 THR A O     1 
ATOM   1475 C  CB    . THR A 1 218 ? 16.304 -33.499 5.864   1.00 20.76 ? 219 THR A CB    1 
ATOM   1476 O  OG1   . THR A 1 218 ? 15.325 -33.224 6.875   1.00 19.22 ? 219 THR A OG1   1 
ATOM   1477 C  CG2   . THR A 1 218 ? 15.717 -33.176 4.502   1.00 16.02 ? 219 THR A CG2   1 
ATOM   1478 N  N     . ALA A 1 219 ? 19.003 -34.757 5.073   1.00 18.68 ? 220 ALA A N     1 
ATOM   1479 C  CA    . ALA A 1 219 ? 20.060 -34.918 4.095   1.00 16.25 ? 220 ALA A CA    1 
ATOM   1480 C  C     . ALA A 1 219 ? 21.424 -34.930 4.767   1.00 15.86 ? 220 ALA A C     1 
ATOM   1481 O  O     . ALA A 1 219 ? 21.620 -34.326 5.828   1.00 13.67 ? 220 ALA A O     1 
ATOM   1482 C  CB    . ALA A 1 219 ? 19.984 -33.803 3.044   1.00 13.58 ? 220 ALA A CB    1 
ATOM   1483 N  N     . ILE A 1 220 ? 22.340 -35.688 4.178   1.00 15.54 ? 221 ILE A N     1 
ATOM   1484 C  CA    . ILE A 1 220 ? 23.704 -35.785 4.684   1.00 14.13 ? 221 ILE A CA    1 
ATOM   1485 C  C     . ILE A 1 220 ? 24.603 -35.069 3.694   1.00 12.55 ? 221 ILE A C     1 
ATOM   1486 O  O     . ILE A 1 220 ? 24.419 -35.182 2.480   1.00 11.51 ? 221 ILE A O     1 
ATOM   1487 C  CB    . ILE A 1 220 ? 24.164 -37.265 4.806   1.00 13.46 ? 221 ILE A CB    1 
ATOM   1488 C  CG1   . ILE A 1 220 ? 23.442 -37.946 5.969   1.00 16.08 ? 221 ILE A CG1   1 
ATOM   1489 C  CG2   . ILE A 1 220 ? 25.673 -37.362 5.008   1.00 13.47 ? 221 ILE A CG2   1 
ATOM   1490 C  CD1   . ILE A 1 220 ? 23.722 -39.426 6.061   1.00 16.78 ? 221 ILE A CD1   1 
ATOM   1491 N  N     . ILE A 1 221 ? 25.490 -34.236 4.216   1.00 11.15 ? 222 ILE A N     1 
ATOM   1492 C  CA    . ILE A 1 221 ? 26.464 -33.552 3.382   1.00 11.30 ? 222 ILE A CA    1 
ATOM   1493 C  C     . ILE A 1 221 ? 27.775 -34.227 3.763   1.00 10.76 ? 222 ILE A C     1 
ATOM   1494 O  O     . ILE A 1 221 ? 28.292 -34.033 4.867   1.00 10.24 ? 222 ILE A O     1 
ATOM   1495 C  CB    . ILE A 1 221 ? 26.515 -32.045 3.670   1.00 12.07 ? 222 ILE A CB    1 
ATOM   1496 C  CG1   . ILE A 1 221 ? 25.240 -31.385 3.136   1.00 10.76 ? 222 ILE A CG1   1 
ATOM   1497 C  CG2   . ILE A 1 221 ? 27.769 -31.448 3.073   1.00 8.19  ? 222 ILE A CG2   1 
ATOM   1498 C  CD1   . ILE A 1 221 ? 25.109 -29.909 3.462   1.00 13.12 ? 222 ILE A CD1   1 
ATOM   1499 N  N     . PHE A 1 222 ? 28.242 -35.126 2.907   1.00 9.72  ? 223 PHE A N     1 
ATOM   1500 C  CA    . PHE A 1 222 ? 29.477 -35.841 3.189   1.00 10.48 ? 223 PHE A CA    1 
ATOM   1501 C  C     . PHE A 1 222 ? 30.676 -35.078 2.586   1.00 8.74  ? 223 PHE A C     1 
ATOM   1502 O  O     . PHE A 1 222 ? 30.758 -34.893 1.376   1.00 9.69  ? 223 PHE A O     1 
ATOM   1503 C  CB    . PHE A 1 222 ? 29.363 -37.280 2.663   1.00 8.10  ? 223 PHE A CB    1 
ATOM   1504 C  CG    . PHE A 1 222 ? 30.418 -38.203 3.194   1.00 8.86  ? 223 PHE A CG    1 
ATOM   1505 C  CD1   . PHE A 1 222 ? 31.710 -38.198 2.653   1.00 10.10 ? 223 PHE A CD1   1 
ATOM   1506 C  CD2   . PHE A 1 222 ? 30.143 -39.043 4.258   1.00 10.54 ? 223 PHE A CD2   1 
ATOM   1507 C  CE1   . PHE A 1 222 ? 32.713 -39.013 3.172   1.00 11.97 ? 223 PHE A CE1   1 
ATOM   1508 C  CE2   . PHE A 1 222 ? 31.134 -39.863 4.788   1.00 13.42 ? 223 PHE A CE2   1 
ATOM   1509 C  CZ    . PHE A 1 222 ? 32.428 -39.846 4.242   1.00 12.83 ? 223 PHE A CZ    1 
ATOM   1510 N  N     . CYS A 1 223 ? 31.588 -34.617 3.436   1.00 10.69 ? 224 CYS A N     1 
ATOM   1511 C  CA    . CYS A 1 223 ? 32.754 -33.859 2.978   1.00 10.29 ? 224 CYS A CA    1 
ATOM   1512 C  C     . CYS A 1 223 ? 33.999 -34.708 2.769   1.00 9.94  ? 224 CYS A C     1 
ATOM   1513 O  O     . CYS A 1 223 ? 34.330 -35.551 3.597   1.00 12.98 ? 224 CYS A O     1 
ATOM   1514 C  CB    . CYS A 1 223 ? 33.091 -32.737 3.970   1.00 9.98  ? 224 CYS A CB    1 
ATOM   1515 S  SG    . CYS A 1 223 ? 31.763 -31.583 4.246   1.00 13.64 ? 224 CYS A SG    1 
ATOM   1516 N  N     . VAL A 1 224 ? 34.684 -34.478 1.657   1.00 9.49  ? 225 VAL A N     1 
ATOM   1517 C  CA    . VAL A 1 224 ? 35.917 -35.185 1.335   1.00 10.47 ? 225 VAL A CA    1 
ATOM   1518 C  C     . VAL A 1 224 ? 36.955 -34.145 0.928   1.00 9.09  ? 225 VAL A C     1 
ATOM   1519 O  O     . VAL A 1 224 ? 36.649 -33.221 0.185   1.00 10.67 ? 225 VAL A O     1 
ATOM   1520 C  CB    . VAL A 1 224 ? 35.716 -36.159 0.162   1.00 10.83 ? 225 VAL A CB    1 
ATOM   1521 C  CG1   . VAL A 1 224 ? 37.043 -36.741 -0.267  1.00 9.62  ? 225 VAL A CG1   1 
ATOM   1522 C  CG2   . VAL A 1 224 ? 34.798 -37.278 0.584   1.00 10.97 ? 225 VAL A CG2   1 
ATOM   1523 N  N     . ALA A 1 225 ? 38.164 -34.254 1.460   1.00 8.23  ? 226 ALA A N     1 
ATOM   1524 C  CA    . ALA A 1 225 ? 39.212 -33.316 1.102   1.00 7.00  ? 226 ALA A CA    1 
ATOM   1525 C  C     . ALA A 1 225 ? 39.980 -33.886 -0.100  1.00 9.42  ? 226 ALA A C     1 
ATOM   1526 O  O     . ALA A 1 225 ? 40.705 -34.881 0.023   1.00 9.35  ? 226 ALA A O     1 
ATOM   1527 C  CB    . ALA A 1 225 ? 40.141 -33.086 2.287   1.00 6.05  ? 226 ALA A CB    1 
ATOM   1528 N  N     . LEU A 1 226 ? 39.784 -33.275 -1.268  1.00 9.49  ? 227 LEU A N     1 
ATOM   1529 C  CA    . LEU A 1 226 ? 40.452 -33.694 -2.501  1.00 7.61  ? 227 LEU A CA    1 
ATOM   1530 C  C     . LEU A 1 226 ? 41.972 -33.738 -2.353  1.00 10.21 ? 227 LEU A C     1 
ATOM   1531 O  O     . LEU A 1 226 ? 42.631 -34.632 -2.897  1.00 11.48 ? 227 LEU A O     1 
ATOM   1532 C  CB    . LEU A 1 226 ? 40.088 -32.735 -3.638  1.00 6.36  ? 227 LEU A CB    1 
ATOM   1533 C  CG    . LEU A 1 226 ? 38.670 -32.837 -4.214  1.00 10.13 ? 227 LEU A CG    1 
ATOM   1534 C  CD1   . LEU A 1 226 ? 38.362 -31.659 -5.120  1.00 6.88  ? 227 LEU A CD1   1 
ATOM   1535 C  CD2   . LEU A 1 226 ? 38.527 -34.155 -4.965  1.00 7.45  ? 227 LEU A CD2   1 
ATOM   1536 N  N     . SER A 1 227 ? 42.526 -32.792 -1.598  1.00 9.50  ? 228 SER A N     1 
ATOM   1537 C  CA    . SER A 1 227 ? 43.970 -32.719 -1.400  1.00 9.31  ? 228 SER A CA    1 
ATOM   1538 C  C     . SER A 1 227 ? 44.585 -33.765 -0.451  1.00 12.37 ? 228 SER A C     1 
ATOM   1539 O  O     . SER A 1 227 ? 45.803 -33.793 -0.255  1.00 14.23 ? 228 SER A O     1 
ATOM   1540 C  CB    . SER A 1 227 ? 44.336 -31.314 -0.947  1.00 9.20  ? 228 SER A CB    1 
ATOM   1541 O  OG    . SER A 1 227 ? 43.399 -30.861 0.016   1.00 14.06 ? 228 SER A OG    1 
ATOM   1542 N  N     . ASP A 1 228 ? 43.748 -34.622 0.125   1.00 12.13 ? 229 ASP A N     1 
ATOM   1543 C  CA    . ASP A 1 228 ? 44.181 -35.688 1.030   1.00 11.60 ? 229 ASP A CA    1 
ATOM   1544 C  C     . ASP A 1 228 ? 44.835 -36.879 0.331   1.00 14.05 ? 229 ASP A C     1 
ATOM   1545 O  O     . ASP A 1 228 ? 45.401 -37.747 0.999   1.00 14.34 ? 229 ASP A O     1 
ATOM   1546 C  CB    . ASP A 1 228 ? 42.970 -36.254 1.768   1.00 13.77 ? 229 ASP A CB    1 
ATOM   1547 C  CG    . ASP A 1 228 ? 42.728 -35.603 3.112   1.00 15.22 ? 229 ASP A CG    1 
ATOM   1548 O  OD1   . ASP A 1 228 ? 43.421 -34.626 3.480   1.00 14.56 ? 229 ASP A OD1   1 
ATOM   1549 O  OD2   . ASP A 1 228 ? 41.827 -36.109 3.806   1.00 19.36 ? 229 ASP A OD2   1 
ATOM   1550 N  N     . TYR A 1 229 ? 44.729 -36.949 -0.998  1.00 14.40 ? 230 TYR A N     1 
ATOM   1551 C  CA    . TYR A 1 229 ? 45.264 -38.082 -1.754  1.00 12.93 ? 230 TYR A CA    1 
ATOM   1552 C  C     . TYR A 1 229 ? 46.723 -38.534 -1.530  1.00 13.39 ? 230 TYR A C     1 
ATOM   1553 O  O     . TYR A 1 229 ? 47.031 -39.706 -1.725  1.00 15.27 ? 230 TYR A O     1 
ATOM   1554 C  CB    . TYR A 1 229 ? 44.957 -37.940 -3.249  1.00 9.16  ? 230 TYR A CB    1 
ATOM   1555 C  CG    . TYR A 1 229 ? 45.856 -36.991 -3.997  1.00 10.55 ? 230 TYR A CG    1 
ATOM   1556 C  CD1   . TYR A 1 229 ? 47.076 -37.424 -4.536  1.00 6.51  ? 230 TYR A CD1   1 
ATOM   1557 C  CD2   . TYR A 1 229 ? 45.478 -35.670 -4.208  1.00 9.77  ? 230 TYR A CD2   1 
ATOM   1558 C  CE1   . TYR A 1 229 ? 47.885 -36.559 -5.269  1.00 7.47  ? 230 TYR A CE1   1 
ATOM   1559 C  CE2   . TYR A 1 229 ? 46.288 -34.792 -4.948  1.00 8.03  ? 230 TYR A CE2   1 
ATOM   1560 C  CZ    . TYR A 1 229 ? 47.479 -35.249 -5.470  1.00 4.50  ? 230 TYR A CZ    1 
ATOM   1561 O  OH    . TYR A 1 229 ? 48.251 -34.391 -6.199  1.00 6.30  ? 230 TYR A OH    1 
ATOM   1562 N  N     . ASP A 1 230 ? 47.609 -37.636 -1.106  1.00 14.34 ? 231 ASP A N     1 
ATOM   1563 C  CA    . ASP A 1 230 ? 48.999 -38.020 -0.872  1.00 13.66 ? 231 ASP A CA    1 
ATOM   1564 C  C     . ASP A 1 230 ? 49.408 -37.874 0.590   1.00 15.52 ? 231 ASP A C     1 
ATOM   1565 O  O     . ASP A 1 230 ? 50.597 -37.883 0.905   1.00 15.65 ? 231 ASP A O     1 
ATOM   1566 C  CB    . ASP A 1 230 ? 49.952 -37.214 -1.770  1.00 13.24 ? 231 ASP A CB    1 
ATOM   1567 C  CG    . ASP A 1 230 ? 49.961 -35.727 -1.454  1.00 13.59 ? 231 ASP A CG    1 
ATOM   1568 O  OD1   . ASP A 1 230 ? 49.084 -35.247 -0.714  1.00 17.16 ? 231 ASP A OD1   1 
ATOM   1569 O  OD2   . ASP A 1 230 ? 50.848 -35.009 -1.965  1.00 13.08 ? 231 ASP A OD2   1 
ATOM   1570 N  N     . LEU A 1 231 ? 48.420 -37.754 1.476   1.00 14.41 ? 232 LEU A N     1 
ATOM   1571 C  CA    . LEU A 1 231 ? 48.660 -37.582 2.905   1.00 11.62 ? 232 LEU A CA    1 
ATOM   1572 C  C     . LEU A 1 231 ? 48.276 -38.851 3.666   1.00 14.29 ? 232 LEU A C     1 
ATOM   1573 O  O     . LEU A 1 231 ? 47.572 -39.712 3.129   1.00 15.45 ? 232 LEU A O     1 
ATOM   1574 C  CB    . LEU A 1 231 ? 47.825 -36.403 3.424   1.00 10.19 ? 232 LEU A CB    1 
ATOM   1575 C  CG    . LEU A 1 231 ? 48.035 -35.086 2.670   1.00 9.58  ? 232 LEU A CG    1 
ATOM   1576 C  CD1   . LEU A 1 231 ? 47.090 -33.983 3.129   1.00 9.25  ? 232 LEU A CD1   1 
ATOM   1577 C  CD2   . LEU A 1 231 ? 49.459 -34.659 2.851   1.00 5.75  ? 232 LEU A CD2   1 
ATOM   1578 N  N     . VAL A 1 232 ? 48.771 -38.994 4.895   1.00 16.63 ? 233 VAL A N     1 
ATOM   1579 C  CA    . VAL A 1 232 ? 48.418 -40.151 5.731   1.00 15.75 ? 233 VAL A CA    1 
ATOM   1580 C  C     . VAL A 1 232 ? 47.666 -39.615 6.950   1.00 15.72 ? 233 VAL A C     1 
ATOM   1581 O  O     . VAL A 1 232 ? 47.743 -38.413 7.255   1.00 13.68 ? 233 VAL A O     1 
ATOM   1582 C  CB    . VAL A 1 232 ? 49.644 -40.953 6.192   1.00 16.70 ? 233 VAL A CB    1 
ATOM   1583 C  CG1   . VAL A 1 232 ? 50.406 -41.489 4.990   1.00 15.14 ? 233 VAL A CG1   1 
ATOM   1584 C  CG2   . VAL A 1 232 ? 50.539 -40.088 7.066   1.00 19.37 ? 233 VAL A CG2   1 
ATOM   1585 N  N     . LEU A 1 233 ? 46.919 -40.490 7.619   1.00 17.72 ? 234 LEU A N     1 
ATOM   1586 C  CA    . LEU A 1 233 ? 46.134 -40.098 8.788   1.00 18.17 ? 234 LEU A CA    1 
ATOM   1587 C  C     . LEU A 1 233 ? 46.987 -39.652 9.952   1.00 20.02 ? 234 LEU A C     1 
ATOM   1588 O  O     . LEU A 1 233 ? 48.005 -40.270 10.280  1.00 19.04 ? 234 LEU A O     1 
ATOM   1589 C  CB    . LEU A 1 233 ? 45.256 -41.244 9.282   1.00 16.12 ? 234 LEU A CB    1 
ATOM   1590 C  CG    . LEU A 1 233 ? 44.017 -41.730 8.534   1.00 18.70 ? 234 LEU A CG    1 
ATOM   1591 C  CD1   . LEU A 1 233 ? 43.444 -42.883 9.328   1.00 18.59 ? 234 LEU A CD1   1 
ATOM   1592 C  CD2   . LEU A 1 233 ? 42.970 -40.628 8.383   1.00 19.76 ? 234 LEU A CD2   1 
ATOM   1593 N  N     . ALA A 1 234 ? 46.528 -38.604 10.615  1.00 22.08 ? 235 ALA A N     1 
ATOM   1594 C  CA    . ALA A 1 234 ? 47.222 -38.104 11.779  1.00 27.46 ? 235 ALA A CA    1 
ATOM   1595 C  C     . ALA A 1 234 ? 47.179 -39.234 12.821  1.00 30.80 ? 235 ALA A C     1 
ATOM   1596 O  O     . ALA A 1 234 ? 48.153 -39.456 13.531  1.00 31.32 ? 235 ALA A O     1 
ATOM   1597 C  CB    . ALA A 1 234 ? 46.520 -36.866 12.303  1.00 27.35 ? 235 ALA A CB    1 
ATOM   1598 N  N     . GLU A 1 235 ? 46.069 -39.983 12.836  1.00 32.17 ? 236 GLU A N     1 
ATOM   1599 C  CA    . GLU A 1 235 ? 45.848 -41.103 13.769  1.00 34.72 ? 236 GLU A CA    1 
ATOM   1600 C  C     . GLU A 1 235 ? 46.657 -42.362 13.424  1.00 35.09 ? 236 GLU A C     1 
ATOM   1601 O  O     . GLU A 1 235 ? 46.773 -43.280 14.238  1.00 35.87 ? 236 GLU A O     1 
ATOM   1602 C  CB    . GLU A 1 235 ? 44.357 -41.520 13.815  1.00 34.00 ? 236 GLU A CB    1 
ATOM   1603 C  CG    . GLU A 1 235 ? 43.323 -40.415 13.966  1.00 28.89 ? 236 GLU A CG    1 
ATOM   1604 C  CD    . GLU A 1 235 ? 42.751 -39.981 12.627  1.00 28.70 ? 236 GLU A CD    1 
ATOM   1605 O  OE1   . GLU A 1 235 ? 43.503 -39.394 11.825  1.00 27.51 ? 236 GLU A OE1   1 
ATOM   1606 O  OE2   . GLU A 1 235 ? 41.554 -40.224 12.373  1.00 25.81 ? 236 GLU A OE2   1 
ATOM   1607 N  N     . ASP A 1 236 ? 47.168 -42.429 12.205  1.00 34.48 ? 237 ASP A N     1 
ATOM   1608 C  CA    . ASP A 1 236 ? 47.926 -43.586 11.776  1.00 35.59 ? 237 ASP A CA    1 
ATOM   1609 C  C     . ASP A 1 236 ? 48.652 -43.196 10.504  1.00 37.21 ? 237 ASP A C     1 
ATOM   1610 O  O     . ASP A 1 236 ? 48.033 -42.870 9.490   1.00 36.52 ? 237 ASP A O     1 
ATOM   1611 C  CB    . ASP A 1 236 ? 46.971 -44.751 11.517  1.00 37.89 ? 237 ASP A CB    1 
ATOM   1612 C  CG    . ASP A 1 236 ? 47.685 -46.026 11.103  1.00 39.44 ? 237 ASP A CG    1 
ATOM   1613 O  OD1   . ASP A 1 236 ? 48.932 -46.086 11.179  1.00 42.61 ? 237 ASP A OD1   1 
ATOM   1614 O  OD2   . ASP A 1 236 ? 46.984 -46.979 10.698  1.00 42.03 ? 237 ASP A OD2   1 
ATOM   1615 N  N     . GLU A 1 237 ? 49.974 -43.227 10.566  1.00 39.16 ? 238 GLU A N     1 
ATOM   1616 C  CA    . GLU A 1 237 ? 50.803 -42.853 9.432   1.00 42.08 ? 238 GLU A CA    1 
ATOM   1617 C  C     . GLU A 1 237 ? 50.981 -43.917 8.354   1.00 38.79 ? 238 GLU A C     1 
ATOM   1618 O  O     . GLU A 1 237 ? 51.717 -43.716 7.399   1.00 38.06 ? 238 GLU A O     1 
ATOM   1619 C  CB    . GLU A 1 237 ? 52.144 -42.349 9.949   1.00 49.04 ? 238 GLU A CB    1 
ATOM   1620 C  CG    . GLU A 1 237 ? 51.989 -41.030 10.714  1.00 63.06 ? 238 GLU A CG    1 
ATOM   1621 C  CD    . GLU A 1 237 ? 52.854 -40.936 11.970  1.00 71.40 ? 238 GLU A CD    1 
ATOM   1622 O  OE1   . GLU A 1 237 ? 53.923 -41.598 12.025  1.00 76.36 ? 238 GLU A OE1   1 
ATOM   1623 O  OE2   . GLU A 1 237 ? 52.456 -40.194 12.905  1.00 74.15 ? 238 GLU A OE2   1 
ATOM   1624 N  N     . GLU A 1 238 ? 50.295 -45.041 8.513   1.00 37.10 ? 239 GLU A N     1 
ATOM   1625 C  CA    . GLU A 1 238 ? 50.351 -46.139 7.557   1.00 36.98 ? 239 GLU A CA    1 
ATOM   1626 C  C     . GLU A 1 238 ? 49.104 -46.128 6.667   1.00 33.79 ? 239 GLU A C     1 
ATOM   1627 O  O     . GLU A 1 238 ? 49.058 -46.819 5.643   1.00 33.03 ? 239 GLU A O     1 
ATOM   1628 C  CB    . GLU A 1 238 ? 50.407 -47.478 8.309   1.00 43.94 ? 239 GLU A CB    1 
ATOM   1629 C  CG    . GLU A 1 238 ? 51.701 -47.748 9.103   1.00 54.46 ? 239 GLU A CG    1 
ATOM   1630 C  CD    . GLU A 1 238 ? 52.827 -48.333 8.240   1.00 62.63 ? 239 GLU A CD    1 
ATOM   1631 O  OE1   . GLU A 1 238 ? 52.564 -49.325 7.513   1.00 67.25 ? 239 GLU A OE1   1 
ATOM   1632 O  OE2   . GLU A 1 238 ? 53.971 -47.810 8.292   1.00 65.13 ? 239 GLU A OE2   1 
ATOM   1633 N  N     . MET A 1 239 ? 48.093 -45.358 7.076   1.00 27.97 ? 240 MET A N     1 
ATOM   1634 C  CA    . MET A 1 239 ? 46.829 -45.278 6.353   1.00 23.51 ? 240 MET A CA    1 
ATOM   1635 C  C     . MET A 1 239 ? 46.661 -43.990 5.541   1.00 18.55 ? 240 MET A C     1 
ATOM   1636 O  O     . MET A 1 239 ? 46.707 -42.891 6.094   1.00 13.76 ? 240 MET A O     1 
ATOM   1637 C  CB    . MET A 1 239 ? 45.666 -45.451 7.342   1.00 25.61 ? 240 MET A CB    1 
ATOM   1638 C  CG    . MET A 1 239 ? 44.257 -45.330 6.738   1.00 29.68 ? 240 MET A CG    1 
ATOM   1639 S  SD    . MET A 1 239 ? 43.849 -46.510 5.404   1.00 36.79 ? 240 MET A SD    1 
ATOM   1640 C  CE    . MET A 1 239 ? 44.056 -48.070 6.246   1.00 34.89 ? 240 MET A CE    1 
ATOM   1641 N  N     . ASN A 1 240 ? 46.465 -44.153 4.228   1.00 16.35 ? 241 ASN A N     1 
ATOM   1642 C  CA    . ASN A 1 240 ? 46.260 -43.035 3.299   1.00 15.58 ? 241 ASN A CA    1 
ATOM   1643 C  C     . ASN A 1 240 ? 44.929 -42.372 3.634   1.00 13.28 ? 241 ASN A C     1 
ATOM   1644 O  O     . ASN A 1 240 ? 43.917 -43.051 3.797   1.00 15.93 ? 241 ASN A O     1 
ATOM   1645 C  CB    . ASN A 1 240 ? 46.260 -43.529 1.848   1.00 14.02 ? 241 ASN A CB    1 
ATOM   1646 C  CG    . ASN A 1 240 ? 45.966 -42.416 0.843   1.00 16.86 ? 241 ASN A CG    1 
ATOM   1647 O  OD1   . ASN A 1 240 ? 44.809 -42.154 0.515   1.00 17.06 ? 241 ASN A OD1   1 
ATOM   1648 N  ND2   . ASN A 1 240 ? 47.010 -41.790 0.324   1.00 13.87 ? 241 ASN A ND2   1 
ATOM   1649 N  N     . ARG A 1 241 ? 44.941 -41.047 3.733   1.00 13.93 ? 242 ARG A N     1 
ATOM   1650 C  CA    . ARG A 1 241 ? 43.753 -40.279 4.077   1.00 14.10 ? 242 ARG A CA    1 
ATOM   1651 C  C     . ARG A 1 241 ? 42.566 -40.425 3.144   1.00 12.35 ? 242 ARG A C     1 
ATOM   1652 O  O     . ARG A 1 241 ? 41.430 -40.423 3.605   1.00 9.63  ? 242 ARG A O     1 
ATOM   1653 C  CB    . ARG A 1 241 ? 44.091 -38.804 4.207   1.00 13.09 ? 242 ARG A CB    1 
ATOM   1654 C  CG    . ARG A 1 241 ? 44.865 -38.456 5.447   1.00 13.88 ? 242 ARG A CG    1 
ATOM   1655 C  CD    . ARG A 1 241 ? 44.741 -36.976 5.681   1.00 16.10 ? 242 ARG A CD    1 
ATOM   1656 N  NE    . ARG A 1 241 ? 45.558 -36.487 6.785   1.00 19.47 ? 242 ARG A NE    1 
ATOM   1657 C  CZ    . ARG A 1 241 ? 45.266 -35.397 7.491   1.00 21.69 ? 242 ARG A CZ    1 
ATOM   1658 N  NH1   . ARG A 1 241 ? 44.174 -34.694 7.214   1.00 22.50 ? 242 ARG A NH1   1 
ATOM   1659 N  NH2   . ARG A 1 241 ? 46.077 -34.987 8.457   1.00 22.42 ? 242 ARG A NH2   1 
ATOM   1660 N  N     . MET A 1 242 ? 42.820 -40.567 1.848   1.00 10.54 ? 243 MET A N     1 
ATOM   1661 C  CA    . MET A 1 242 ? 41.726 -40.688 0.882   1.00 10.92 ? 243 MET A CA    1 
ATOM   1662 C  C     . MET A 1 242 ? 41.071 -42.056 0.935   1.00 9.01  ? 243 MET A C     1 
ATOM   1663 O  O     . MET A 1 242 ? 39.874 -42.173 0.721   1.00 11.23 ? 243 MET A O     1 
ATOM   1664 C  CB    . MET A 1 242 ? 42.224 -40.404 -0.535  1.00 14.70 ? 243 MET A CB    1 
ATOM   1665 C  CG    . MET A 1 242 ? 41.119 -40.350 -1.599  1.00 14.37 ? 243 MET A CG    1 
ATOM   1666 S  SD    . MET A 1 242 ? 40.163 -38.845 -1.449  1.00 25.50 ? 243 MET A SD    1 
ATOM   1667 C  CE    . MET A 1 242 ? 41.170 -37.736 -2.353  1.00 17.84 ? 243 MET A CE    1 
ATOM   1668 N  N     . HIS A 1 243 ? 41.863 -43.096 1.179   1.00 9.09  ? 244 HIS A N     1 
ATOM   1669 C  CA    . HIS A 1 243 ? 41.327 -44.459 1.264   1.00 11.97 ? 244 HIS A CA    1 
ATOM   1670 C  C     . HIS A 1 243 ? 40.414 -44.586 2.484   1.00 9.77  ? 244 HIS A C     1 
ATOM   1671 O  O     . HIS A 1 243 ? 39.416 -45.290 2.450   1.00 12.25 ? 244 HIS A O     1 
ATOM   1672 C  CB    . HIS A 1 243 ? 42.461 -45.479 1.351   1.00 13.76 ? 244 HIS A CB    1 
ATOM   1673 C  CG    . HIS A 1 243 ? 43.300 -45.548 0.116   1.00 21.53 ? 244 HIS A CG    1 
ATOM   1674 N  ND1   . HIS A 1 243 ? 44.554 -46.118 0.098   1.00 25.23 ? 244 HIS A ND1   1 
ATOM   1675 C  CD2   . HIS A 1 243 ? 43.069 -45.111 -1.146  1.00 25.60 ? 244 HIS A CD2   1 
ATOM   1676 C  CE1   . HIS A 1 243 ? 45.059 -46.031 -1.121  1.00 26.42 ? 244 HIS A CE1   1 
ATOM   1677 N  NE2   . HIS A 1 243 ? 44.179 -45.423 -1.894  1.00 26.73 ? 244 HIS A NE2   1 
ATOM   1678 N  N     . GLU A 1 244 ? 40.778 -43.902 3.560   1.00 10.17 ? 245 GLU A N     1 
ATOM   1679 C  CA    . GLU A 1 244 ? 39.987 -43.870 4.786   1.00 12.53 ? 245 GLU A CA    1 
ATOM   1680 C  C     . GLU A 1 244 ? 38.639 -43.220 4.469   1.00 11.65 ? 245 GLU A C     1 
ATOM   1681 O  O     . GLU A 1 244 ? 37.588 -43.699 4.906   1.00 13.81 ? 245 GLU A O     1 
ATOM   1682 C  CB    . GLU A 1 244 ? 40.713 -43.043 5.841   1.00 15.43 ? 245 GLU A CB    1 
ATOM   1683 C  CG    . GLU A 1 244 ? 39.970 -42.946 7.163   1.00 20.91 ? 245 GLU A CG    1 
ATOM   1684 C  CD    . GLU A 1 244 ? 40.341 -44.061 8.124   1.00 27.79 ? 245 GLU A CD    1 
ATOM   1685 O  OE1   . GLU A 1 244 ? 40.754 -45.158 7.659   1.00 26.78 ? 245 GLU A OE1   1 
ATOM   1686 O  OE2   . GLU A 1 244 ? 40.240 -43.819 9.348   1.00 25.29 ? 245 GLU A OE2   1 
ATOM   1687 N  N     . SER A 1 245 ? 38.667 -42.127 3.709   1.00 13.02 ? 246 SER A N     1 
ATOM   1688 C  CA    . SER A 1 245 ? 37.447 -41.433 3.298   1.00 11.44 ? 246 SER A CA    1 
ATOM   1689 C  C     . SER A 1 245 ? 36.529 -42.350 2.513   1.00 11.09 ? 246 SER A C     1 
ATOM   1690 O  O     . SER A 1 245 ? 35.311 -42.339 2.698   1.00 10.16 ? 246 SER A O     1 
ATOM   1691 C  CB    . SER A 1 245 ? 37.776 -40.240 2.416   1.00 10.53 ? 246 SER A CB    1 
ATOM   1692 O  OG    . SER A 1 245 ? 38.073 -39.127 3.212   1.00 17.74 ? 246 SER A OG    1 
ATOM   1693 N  N     . MET A 1 246 ? 37.106 -43.087 1.574   1.00 11.84 ? 247 MET A N     1 
ATOM   1694 C  CA    . MET A 1 246 ? 36.320 -44.005 0.769   1.00 10.26 ? 247 MET A CA    1 
ATOM   1695 C  C     . MET A 1 246 ? 35.590 -45.035 1.626   1.00 12.78 ? 247 MET A C     1 
ATOM   1696 O  O     . MET A 1 246 ? 34.388 -45.279 1.418   1.00 12.20 ? 247 MET A O     1 
ATOM   1697 C  CB    . MET A 1 246 ? 37.199 -44.684 -0.268  1.00 10.16 ? 247 MET A CB    1 
ATOM   1698 C  CG    . MET A 1 246 ? 37.565 -43.761 -1.424  1.00 17.49 ? 247 MET A CG    1 
ATOM   1699 S  SD    . MET A 1 246 ? 38.572 -44.557 -2.680  1.00 24.37 ? 247 MET A SD    1 
ATOM   1700 C  CE    . MET A 1 246 ? 40.124 -44.117 -2.119  1.00 28.82 ? 247 MET A CE    1 
ATOM   1701 N  N     . LYS A 1 247 ? 36.297 -45.613 2.604   1.00 15.51 ? 248 LYS A N     1 
ATOM   1702 C  CA    . LYS A 1 247 ? 35.714 -46.614 3.511   1.00 14.61 ? 248 LYS A CA    1 
ATOM   1703 C  C     . LYS A 1 247 ? 34.531 -46.026 4.237   1.00 13.03 ? 248 LYS A C     1 
ATOM   1704 O  O     . LYS A 1 247 ? 33.482 -46.657 4.292   1.00 11.98 ? 248 LYS A O     1 
ATOM   1705 C  CB    . LYS A 1 247 ? 36.738 -47.127 4.529   1.00 18.43 ? 248 LYS A CB    1 
ATOM   1706 C  CG    . LYS A 1 247 ? 37.859 -47.933 3.892   1.00 32.15 ? 248 LYS A CG    1 
ATOM   1707 C  CD    . LYS A 1 247 ? 38.965 -48.315 4.883   1.00 40.84 ? 248 LYS A CD    1 
ATOM   1708 C  CE    . LYS A 1 247 ? 40.183 -48.893 4.142   1.00 46.15 ? 248 LYS A CE    1 
ATOM   1709 N  NZ    . LYS A 1 247 ? 41.309 -49.309 5.043   1.00 51.89 ? 248 LYS A NZ    1 
ATOM   1710 N  N     . LEU A 1 248 ? 34.684 -44.796 4.740   1.00 13.20 ? 249 LEU A N     1 
ATOM   1711 C  CA    . LEU A 1 248 ? 33.601 -44.099 5.456   1.00 13.41 ? 249 LEU A CA    1 
ATOM   1712 C  C     . LEU A 1 248 ? 32.385 -43.838 4.581   1.00 13.64 ? 249 LEU A C     1 
ATOM   1713 O  O     . LEU A 1 248 ? 31.243 -44.039 5.023   1.00 11.36 ? 249 LEU A O     1 
ATOM   1714 C  CB    . LEU A 1 248 ? 34.082 -42.765 6.021   1.00 12.75 ? 249 LEU A CB    1 
ATOM   1715 C  CG    . LEU A 1 248 ? 35.018 -42.858 7.222   1.00 17.55 ? 249 LEU A CG    1 
ATOM   1716 C  CD1   . LEU A 1 248 ? 35.560 -41.476 7.567   1.00 17.36 ? 249 LEU A CD1   1 
ATOM   1717 C  CD2   . LEU A 1 248 ? 34.270 -43.458 8.396   1.00 17.27 ? 249 LEU A CD2   1 
ATOM   1718 N  N     . PHE A 1 249 ? 32.624 -43.362 3.355   1.00 12.48 ? 250 PHE A N     1 
ATOM   1719 C  CA    . PHE A 1 249 ? 31.531 -43.075 2.429   1.00 13.54 ? 250 PHE A CA    1 
ATOM   1720 C  C     . PHE A 1 249 ? 30.744 -44.333 2.081   1.00 14.70 ? 250 PHE A C     1 
ATOM   1721 O  O     . PHE A 1 249 ? 29.517 -44.303 2.047   1.00 15.81 ? 250 PHE A O     1 
ATOM   1722 C  CB    . PHE A 1 249 ? 32.028 -42.424 1.141   1.00 11.32 ? 250 PHE A CB    1 
ATOM   1723 C  CG    . PHE A 1 249 ? 30.913 -41.948 0.243   1.00 11.53 ? 250 PHE A CG    1 
ATOM   1724 C  CD1   . PHE A 1 249 ? 30.121 -40.859 0.619   1.00 11.53 ? 250 PHE A CD1   1 
ATOM   1725 C  CD2   . PHE A 1 249 ? 30.653 -42.591 -0.965  1.00 10.92 ? 250 PHE A CD2   1 
ATOM   1726 C  CE1   . PHE A 1 249 ? 29.086 -40.411 -0.190  1.00 12.93 ? 250 PHE A CE1   1 
ATOM   1727 C  CE2   . PHE A 1 249 ? 29.620 -42.159 -1.788  1.00 11.43 ? 250 PHE A CE2   1 
ATOM   1728 C  CZ    . PHE A 1 249 ? 28.833 -41.064 -1.402  1.00 11.10 ? 250 PHE A CZ    1 
ATOM   1729 N  N     . ASP A 1 250 ? 31.460 -45.411 1.772   1.00 15.99 ? 251 ASP A N     1 
ATOM   1730 C  CA    . ASP A 1 250 ? 30.847 -46.699 1.449   1.00 17.56 ? 251 ASP A CA    1 
ATOM   1731 C  C     . ASP A 1 250 ? 29.948 -47.100 2.629   1.00 20.75 ? 251 ASP A C     1 
ATOM   1732 O  O     . ASP A 1 250 ? 28.786 -47.479 2.448   1.00 23.15 ? 251 ASP A O     1 
ATOM   1733 C  CB    . ASP A 1 250 ? 31.955 -47.739 1.250   1.00 17.83 ? 251 ASP A CB    1 
ATOM   1734 C  CG    . ASP A 1 250 ? 31.424 -49.136 0.941   1.00 20.28 ? 251 ASP A CG    1 
ATOM   1735 O  OD1   . ASP A 1 250 ? 30.198 -49.344 0.790   1.00 21.45 ? 251 ASP A OD1   1 
ATOM   1736 O  OD2   . ASP A 1 250 ? 32.267 -50.044 0.843   1.00 23.85 ? 251 ASP A OD2   1 
ATOM   1737 N  N     . SER A 1 251 ? 30.489 -46.976 3.838   1.00 19.79 ? 252 SER A N     1 
ATOM   1738 C  CA    . SER A 1 251 ? 29.770 -47.290 5.068   1.00 19.31 ? 252 SER A CA    1 
ATOM   1739 C  C     . SER A 1 251 ? 28.470 -46.489 5.221   1.00 18.23 ? 252 SER A C     1 
ATOM   1740 O  O     . SER A 1 251 ? 27.412 -47.046 5.520   1.00 20.69 ? 252 SER A O     1 
ATOM   1741 C  CB    . SER A 1 251 ? 30.686 -47.010 6.262   1.00 21.05 ? 252 SER A CB    1 
ATOM   1742 O  OG    . SER A 1 251 ? 30.012 -47.223 7.481   1.00 30.18 ? 252 SER A OG    1 
ATOM   1743 N  N     . ILE A 1 252 ? 28.555 -45.181 5.009   1.00 15.65 ? 253 ILE A N     1 
ATOM   1744 C  CA    . ILE A 1 252 ? 27.408 -44.309 5.150   1.00 14.37 ? 253 ILE A CA    1 
ATOM   1745 C  C     . ILE A 1 252 ? 26.417 -44.412 4.001   1.00 16.22 ? 253 ILE A C     1 
ATOM   1746 O  O     . ILE A 1 252 ? 25.211 -44.561 4.208   1.00 15.70 ? 253 ILE A O     1 
ATOM   1747 C  CB    . ILE A 1 252 ? 27.870 -42.857 5.268   1.00 15.27 ? 253 ILE A CB    1 
ATOM   1748 C  CG1   . ILE A 1 252 ? 28.658 -42.674 6.568   1.00 16.02 ? 253 ILE A CG1   1 
ATOM   1749 C  CG2   . ILE A 1 252 ? 26.668 -41.899 5.169   1.00 15.14 ? 253 ILE A CG2   1 
ATOM   1750 C  CD1   . ILE A 1 252 ? 27.795 -42.769 7.807   1.00 18.10 ? 253 ILE A CD1   1 
ATOM   1751 N  N     . CYS A 1 253 ? 26.935 -44.323 2.785   1.00 17.05 ? 254 CYS A N     1 
ATOM   1752 C  CA    . CYS A 1 253 ? 26.112 -44.359 1.586   1.00 19.02 ? 254 CYS A CA    1 
ATOM   1753 C  C     . CYS A 1 253 ? 25.186 -45.577 1.457   1.00 20.40 ? 254 CYS A C     1 
ATOM   1754 O  O     . CYS A 1 253 ? 24.026 -45.457 1.031   1.00 18.38 ? 254 CYS A O     1 
ATOM   1755 C  CB    . CYS A 1 253 ? 27.012 -44.279 0.366   1.00 19.28 ? 254 CYS A CB    1 
ATOM   1756 S  SG    . CYS A 1 253 ? 26.066 -44.126 -1.083  1.00 27.18 ? 254 CYS A SG    1 
ATOM   1757 N  N     . ASN A 1 254 ? 25.691 -46.745 1.856   1.00 20.70 ? 255 ASN A N     1 
ATOM   1758 C  CA    . ASN A 1 254 ? 24.923 -47.983 1.758   1.00 18.89 ? 255 ASN A CA    1 
ATOM   1759 C  C     . ASN A 1 254 ? 24.198 -48.439 3.056   1.00 19.73 ? 255 ASN A C     1 
ATOM   1760 O  O     . ASN A 1 254 ? 23.658 -49.546 3.114   1.00 21.09 ? 255 ASN A O     1 
ATOM   1761 C  CB    . ASN A 1 254 ? 25.821 -49.087 1.160   1.00 16.43 ? 255 ASN A CB    1 
ATOM   1762 C  CG    . ASN A 1 254 ? 26.351 -48.721 -0.244  1.00 15.21 ? 255 ASN A CG    1 
ATOM   1763 O  OD1   . ASN A 1 254 ? 25.583 -48.532 -1.177  1.00 17.46 ? 255 ASN A OD1   1 
ATOM   1764 N  ND2   . ASN A 1 254 ? 27.661 -48.602 -0.375  1.00 16.83 ? 255 ASN A ND2   1 
ATOM   1765 N  N     . ASN A 1 255 ? 24.137 -47.575 4.071   1.00 18.76 ? 256 ASN A N     1 
ATOM   1766 C  CA    . ASN A 1 255 ? 23.467 -47.925 5.329   1.00 20.48 ? 256 ASN A CA    1 
ATOM   1767 C  C     . ASN A 1 255 ? 21.958 -47.921 5.132   1.00 21.29 ? 256 ASN A C     1 
ATOM   1768 O  O     . ASN A 1 255 ? 21.383 -46.875 4.833   1.00 21.44 ? 256 ASN A O     1 
ATOM   1769 C  CB    . ASN A 1 255 ? 23.828 -46.920 6.436   1.00 20.97 ? 256 ASN A CB    1 
ATOM   1770 C  CG    . ASN A 1 255 ? 23.237 -47.295 7.808   1.00 19.88 ? 256 ASN A CG    1 
ATOM   1771 O  OD1   . ASN A 1 255 ? 22.161 -47.875 7.913   1.00 18.19 ? 256 ASN A OD1   1 
ATOM   1772 N  ND2   . ASN A 1 255 ? 23.963 -46.970 8.856   1.00 21.98 ? 256 ASN A ND2   1 
ATOM   1773 N  N     . LYS A 1 256 ? 21.318 -49.062 5.388   1.00 25.01 ? 257 LYS A N     1 
ATOM   1774 C  CA    . LYS A 1 256 ? 19.861 -49.208 5.242   1.00 29.06 ? 257 LYS A CA    1 
ATOM   1775 C  C     . LYS A 1 256 ? 19.098 -48.056 5.891   1.00 27.48 ? 257 LYS A C     1 
ATOM   1776 O  O     . LYS A 1 256 ? 18.072 -47.603 5.369   1.00 27.05 ? 257 LYS A O     1 
ATOM   1777 C  CB    . LYS A 1 256 ? 19.362 -50.492 5.914   1.00 35.18 ? 257 LYS A CB    1 
ATOM   1778 C  CG    . LYS A 1 256 ? 20.028 -51.791 5.522   1.00 44.62 ? 257 LYS A CG    1 
ATOM   1779 C  CD    . LYS A 1 256 ? 19.439 -52.911 6.389   1.00 51.20 ? 257 LYS A CD    1 
ATOM   1780 C  CE    . LYS A 1 256 ? 20.234 -54.216 6.323   1.00 55.13 ? 257 LYS A CE    1 
ATOM   1781 N  NZ    . LYS A 1 256 ? 19.718 -55.232 7.306   1.00 57.19 ? 257 LYS A NZ    1 
ATOM   1782 N  N     . TRP A 1 257 ? 19.582 -47.619 7.055   1.00 25.73 ? 258 TRP A N     1 
ATOM   1783 C  CA    . TRP A 1 257 ? 18.967 -46.534 7.806   1.00 22.03 ? 258 TRP A CA    1 
ATOM   1784 C  C     . TRP A 1 257 ? 18.847 -45.255 6.968   1.00 22.12 ? 258 TRP A C     1 
ATOM   1785 O  O     . TRP A 1 257 ? 17.890 -44.486 7.133   1.00 21.62 ? 258 TRP A O     1 
ATOM   1786 C  CB    . TRP A 1 257 ? 19.765 -46.272 9.101   1.00 22.41 ? 258 TRP A CB    1 
ATOM   1787 C  CG    . TRP A 1 257 ? 19.201 -45.174 10.022  1.00 25.24 ? 258 TRP A CG    1 
ATOM   1788 C  CD1   . TRP A 1 257 ? 19.720 -43.919 10.220  1.00 24.24 ? 258 TRP A CD1   1 
ATOM   1789 C  CD2   . TRP A 1 257 ? 18.009 -45.240 10.829  1.00 25.73 ? 258 TRP A CD2   1 
ATOM   1790 N  NE1   . TRP A 1 257 ? 18.926 -43.210 11.083  1.00 23.77 ? 258 TRP A NE1   1 
ATOM   1791 C  CE2   . TRP A 1 257 ? 17.871 -43.987 11.475  1.00 24.77 ? 258 TRP A CE2   1 
ATOM   1792 C  CE3   . TRP A 1 257 ? 17.044 -46.237 11.067  1.00 29.21 ? 258 TRP A CE3   1 
ATOM   1793 C  CZ2   . TRP A 1 257 ? 16.804 -43.699 12.343  1.00 27.95 ? 258 TRP A CZ2   1 
ATOM   1794 C  CZ3   . TRP A 1 257 ? 15.979 -45.949 11.937  1.00 30.19 ? 258 TRP A CZ3   1 
ATOM   1795 C  CH2   . TRP A 1 257 ? 15.872 -44.685 12.562  1.00 26.74 ? 258 TRP A CH2   1 
ATOM   1796 N  N     . PHE A 1 258 ? 19.774 -45.044 6.036   1.00 18.99 ? 259 PHE A N     1 
ATOM   1797 C  CA    . PHE A 1 258 ? 19.729 -43.827 5.227   1.00 21.29 ? 259 PHE A CA    1 
ATOM   1798 C  C     . PHE A 1 258 ? 19.080 -43.935 3.846   1.00 22.21 ? 259 PHE A C     1 
ATOM   1799 O  O     . PHE A 1 258 ? 19.203 -43.025 3.034   1.00 20.42 ? 259 PHE A O     1 
ATOM   1800 C  CB    . PHE A 1 258 ? 21.121 -43.207 5.134   1.00 18.48 ? 259 PHE A CB    1 
ATOM   1801 C  CG    . PHE A 1 258 ? 21.636 -42.725 6.449   1.00 16.73 ? 259 PHE A CG    1 
ATOM   1802 C  CD1   . PHE A 1 258 ? 20.916 -41.792 7.190   1.00 17.20 ? 259 PHE A CD1   1 
ATOM   1803 C  CD2   . PHE A 1 258 ? 22.833 -43.209 6.961   1.00 17.74 ? 259 PHE A CD2   1 
ATOM   1804 C  CE1   . PHE A 1 258 ? 21.384 -41.343 8.428   1.00 16.74 ? 259 PHE A CE1   1 
ATOM   1805 C  CE2   . PHE A 1 258 ? 23.308 -42.766 8.196   1.00 15.74 ? 259 PHE A CE2   1 
ATOM   1806 C  CZ    . PHE A 1 258 ? 22.584 -41.832 8.927   1.00 11.74 ? 259 PHE A CZ    1 
ATOM   1807 N  N     . THR A 1 259 ? 18.287 -44.983 3.641   1.00 23.84 ? 260 THR A N     1 
ATOM   1808 C  CA    . THR A 1 259 ? 17.617 -45.209 2.369   1.00 27.22 ? 260 THR A CA    1 
ATOM   1809 C  C     . THR A 1 259 ? 16.873 -44.003 1.816   1.00 27.78 ? 260 THR A C     1 
ATOM   1810 O  O     . THR A 1 259 ? 16.993 -43.689 0.637   1.00 30.52 ? 260 THR A O     1 
ATOM   1811 C  CB    . THR A 1 259 ? 16.631 -46.376 2.444   1.00 28.76 ? 260 THR A CB    1 
ATOM   1812 O  OG1   . THR A 1 259 ? 17.319 -47.558 2.867   1.00 31.34 ? 260 THR A OG1   1 
ATOM   1813 C  CG2   . THR A 1 259 ? 16.024 -46.634 1.068   1.00 31.88 ? 260 THR A CG2   1 
ATOM   1814 N  N     . ASP A 1 260 ? 16.127 -43.313 2.663   1.00 28.75 ? 261 ASP A N     1 
ATOM   1815 C  CA    . ASP A 1 260 ? 15.367 -42.170 2.191   1.00 29.92 ? 261 ASP A CA    1 
ATOM   1816 C  C     . ASP A 1 260 ? 15.987 -40.825 2.530   1.00 28.18 ? 261 ASP A C     1 
ATOM   1817 O  O     . ASP A 1 260 ? 15.299 -39.802 2.524   1.00 31.38 ? 261 ASP A O     1 
ATOM   1818 C  CB    . ASP A 1 260 ? 13.928 -42.248 2.712   1.00 34.86 ? 261 ASP A CB    1 
ATOM   1819 C  CG    . ASP A 1 260 ? 13.269 -43.592 2.406   1.00 41.48 ? 261 ASP A CG    1 
ATOM   1820 O  OD1   . ASP A 1 260 ? 13.338 -44.055 1.237   1.00 43.73 ? 261 ASP A OD1   1 
ATOM   1821 O  OD2   . ASP A 1 260 ? 12.695 -44.194 3.342   1.00 43.81 ? 261 ASP A OD2   1 
ATOM   1822 N  N     . THR A 1 261 ? 17.283 -40.820 2.819   1.00 24.64 ? 262 THR A N     1 
ATOM   1823 C  CA    . THR A 1 261 ? 17.983 -39.583 3.141   1.00 19.77 ? 262 THR A CA    1 
ATOM   1824 C  C     . THR A 1 261 ? 18.781 -39.227 1.905   1.00 17.88 ? 262 THR A C     1 
ATOM   1825 O  O     . THR A 1 261 ? 19.388 -40.101 1.293   1.00 16.94 ? 262 THR A O     1 
ATOM   1826 C  CB    . THR A 1 261 ? 18.945 -39.780 4.361   1.00 20.12 ? 262 THR A CB    1 
ATOM   1827 O  OG1   . THR A 1 261 ? 18.178 -40.100 5.526   1.00 21.48 ? 262 THR A OG1   1 
ATOM   1828 C  CG2   . THR A 1 261 ? 19.734 -38.535 4.646   1.00 15.45 ? 262 THR A CG2   1 
ATOM   1829 N  N     . SER A 1 262 ? 18.730 -37.964 1.495   1.00 17.28 ? 263 SER A N     1 
ATOM   1830 C  CA    . SER A 1 262 ? 19.492 -37.523 0.328   1.00 16.64 ? 263 SER A CA    1 
ATOM   1831 C  C     . SER A 1 262 ? 20.969 -37.468 0.708   1.00 16.32 ? 263 SER A C     1 
ATOM   1832 O  O     . SER A 1 262 ? 21.309 -37.025 1.808   1.00 15.08 ? 263 SER A O     1 
ATOM   1833 C  CB    . SER A 1 262 ? 19.059 -36.126 -0.103  1.00 17.79 ? 263 SER A CB    1 
ATOM   1834 O  OG    . SER A 1 262 ? 17.661 -36.052 -0.319  1.00 21.82 ? 263 SER A OG    1 
ATOM   1835 N  N     . ILE A 1 263 ? 21.835 -37.954 -0.174  1.00 13.45 ? 264 ILE A N     1 
ATOM   1836 C  CA    . ILE A 1 263 ? 23.261 -37.908 0.084   1.00 13.06 ? 264 ILE A CA    1 
ATOM   1837 C  C     . ILE A 1 263 ? 23.881 -36.860 -0.837  1.00 13.70 ? 264 ILE A C     1 
ATOM   1838 O  O     . ILE A 1 263 ? 23.747 -36.945 -2.062  1.00 11.10 ? 264 ILE A O     1 
ATOM   1839 C  CB    . ILE A 1 263 ? 23.980 -39.256 -0.208  1.00 15.94 ? 264 ILE A CB    1 
ATOM   1840 C  CG1   . ILE A 1 263 ? 23.345 -40.421 0.568   1.00 17.62 ? 264 ILE A CG1   1 
ATOM   1841 C  CG2   . ILE A 1 263 ? 25.495 -39.117 0.088   1.00 15.11 ? 264 ILE A CG2   1 
ATOM   1842 C  CD1   . ILE A 1 263 ? 23.458 -40.337 2.066   1.00 18.39 ? 264 ILE A CD1   1 
ATOM   1843 N  N     . ILE A 1 264 ? 24.484 -35.834 -0.243  1.00 12.27 ? 265 ILE A N     1 
ATOM   1844 C  CA    . ILE A 1 264 ? 25.160 -34.796 -0.999  1.00 11.76 ? 265 ILE A CA    1 
ATOM   1845 C  C     . ILE A 1 264 ? 26.657 -34.997 -0.740  1.00 11.69 ? 265 ILE A C     1 
ATOM   1846 O  O     . ILE A 1 264 ? 27.083 -35.114 0.409   1.00 12.42 ? 265 ILE A O     1 
ATOM   1847 C  CB    . ILE A 1 264 ? 24.737 -33.354 -0.562  1.00 12.93 ? 265 ILE A CB    1 
ATOM   1848 C  CG1   . ILE A 1 264 ? 23.251 -33.095 -0.842  1.00 14.03 ? 265 ILE A CG1   1 
ATOM   1849 C  CG2   . ILE A 1 264 ? 25.551 -32.306 -1.301  1.00 12.39 ? 265 ILE A CG2   1 
ATOM   1850 C  CD1   . ILE A 1 264 ? 22.346 -33.402 0.315   1.00 15.90 ? 265 ILE A CD1   1 
ATOM   1851 N  N     . LEU A 1 265 ? 27.436 -35.118 -1.810  1.00 12.05 ? 266 LEU A N     1 
ATOM   1852 C  CA    . LEU A 1 265 ? 28.869 -35.287 -1.707  1.00 9.00  ? 266 LEU A CA    1 
ATOM   1853 C  C     . LEU A 1 265 ? 29.586 -33.975 -2.073  1.00 9.45  ? 266 LEU A C     1 
ATOM   1854 O  O     . LEU A 1 265 ? 29.359 -33.390 -3.139  1.00 9.33  ? 266 LEU A O     1 
ATOM   1855 C  CB    . LEU A 1 265 ? 29.321 -36.456 -2.590  1.00 5.99  ? 266 LEU A CB    1 
ATOM   1856 C  CG    . LEU A 1 265 ? 30.801 -36.843 -2.684  1.00 12.11 ? 266 LEU A CG    1 
ATOM   1857 C  CD1   . LEU A 1 265 ? 31.413 -37.193 -1.324  1.00 6.92  ? 266 LEU A CD1   1 
ATOM   1858 C  CD2   . LEU A 1 265 ? 30.930 -38.042 -3.631  1.00 12.51 ? 266 LEU A CD2   1 
ATOM   1859 N  N     . PHE A 1 266 ? 30.351 -33.452 -1.121  1.00 8.42  ? 267 PHE A N     1 
ATOM   1860 C  CA    . PHE A 1 266 ? 31.127 -32.233 -1.322  1.00 9.96  ? 267 PHE A CA    1 
ATOM   1861 C  C     . PHE A 1 266 ? 32.591 -32.668 -1.480  1.00 9.44  ? 267 PHE A C     1 
ATOM   1862 O  O     . PHE A 1 266 ? 33.202 -33.171 -0.531  1.00 10.60 ? 267 PHE A O     1 
ATOM   1863 C  CB    . PHE A 1 266 ? 31.034 -31.298 -0.093  1.00 8.78  ? 267 PHE A CB    1 
ATOM   1864 C  CG    . PHE A 1 266 ? 29.906 -30.300 -0.136  1.00 8.59  ? 267 PHE A CG    1 
ATOM   1865 C  CD1   . PHE A 1 266 ? 28.849 -30.425 -1.047  1.00 6.95  ? 267 PHE A CD1   1 
ATOM   1866 C  CD2   . PHE A 1 266 ? 29.886 -29.240 0.776   1.00 7.25  ? 267 PHE A CD2   1 
ATOM   1867 C  CE1   . PHE A 1 266 ? 27.788 -29.512 -1.041  1.00 7.44  ? 267 PHE A CE1   1 
ATOM   1868 C  CE2   . PHE A 1 266 ? 28.826 -28.313 0.793   1.00 7.02  ? 267 PHE A CE2   1 
ATOM   1869 C  CZ    . PHE A 1 266 ? 27.776 -28.451 -0.114  1.00 8.87  ? 267 PHE A CZ    1 
ATOM   1870 N  N     . LEU A 1 267 ? 33.138 -32.533 -2.682  1.00 10.85 ? 268 LEU A N     1 
ATOM   1871 C  CA    . LEU A 1 267 ? 34.547 -32.874 -2.914  1.00 10.17 ? 268 LEU A CA    1 
ATOM   1872 C  C     . LEU A 1 267 ? 35.213 -31.526 -2.694  1.00 10.64 ? 268 LEU A C     1 
ATOM   1873 O  O     . LEU A 1 267 ? 35.212 -30.631 -3.560  1.00 9.05  ? 268 LEU A O     1 
ATOM   1874 C  CB    . LEU A 1 267 ? 34.761 -33.460 -4.317  1.00 9.63  ? 268 LEU A CB    1 
ATOM   1875 C  CG    . LEU A 1 267 ? 34.004 -34.784 -4.539  1.00 12.57 ? 268 LEU A CG    1 
ATOM   1876 C  CD1   . LEU A 1 267 ? 34.170 -35.291 -5.971  1.00 8.97  ? 268 LEU A CD1   1 
ATOM   1877 C  CD2   . LEU A 1 267 ? 34.482 -35.856 -3.551  1.00 13.38 ? 268 LEU A CD2   1 
ATOM   1878 N  N     . ASN A 1 268 ? 35.656 -31.373 -1.447  1.00 10.85 ? 269 ASN A N     1 
ATOM   1879 C  CA    . ASN A 1 268 ? 36.238 -30.144 -0.911  1.00 8.98  ? 269 ASN A CA    1 
ATOM   1880 C  C     . ASN A 1 268 ? 37.747 -29.893 -1.121  1.00 7.55  ? 269 ASN A C     1 
ATOM   1881 O  O     . ASN A 1 268 ? 38.488 -30.766 -1.587  1.00 10.87 ? 269 ASN A O     1 
ATOM   1882 C  CB    . ASN A 1 268 ? 35.834 -30.089 0.581   1.00 6.60  ? 269 ASN A CB    1 
ATOM   1883 C  CG    . ASN A 1 268 ? 35.987 -28.710 1.193   1.00 8.13  ? 269 ASN A CG    1 
ATOM   1884 O  OD1   . ASN A 1 268 ? 35.620 -27.692 0.586   1.00 11.70 ? 269 ASN A OD1   1 
ATOM   1885 N  ND2   . ASN A 1 268 ? 36.537 -28.662 2.407   1.00 5.14  ? 269 ASN A ND2   1 
ATOM   1886 N  N     . LYS A 1 269 ? 38.182 -28.677 -0.788  1.00 10.23 ? 270 LYS A N     1 
ATOM   1887 C  CA    . LYS A 1 269 ? 39.567 -28.229 -0.921  1.00 7.31  ? 270 LYS A CA    1 
ATOM   1888 C  C     . LYS A 1 269 ? 40.027 -28.283 -2.365  1.00 10.13 ? 270 LYS A C     1 
ATOM   1889 O  O     . LYS A 1 269 ? 41.194 -28.567 -2.639  1.00 9.75  ? 270 LYS A O     1 
ATOM   1890 C  CB    . LYS A 1 269 ? 40.526 -29.023 -0.014  1.00 7.26  ? 270 LYS A CB    1 
ATOM   1891 C  CG    . LYS A 1 269 ? 40.253 -28.835 1.472   1.00 9.30  ? 270 LYS A CG    1 
ATOM   1892 C  CD    . LYS A 1 269 ? 41.287 -29.492 2.370   1.00 8.26  ? 270 LYS A CD    1 
ATOM   1893 C  CE    . LYS A 1 269 ? 40.849 -29.342 3.823   1.00 12.64 ? 270 LYS A CE    1 
ATOM   1894 N  NZ    . LYS A 1 269 ? 41.717 -30.122 4.740   1.00 19.29 ? 270 LYS A NZ    1 
ATOM   1895 N  N     . LYS A 1 270 ? 39.139 -27.917 -3.285  1.00 9.78  ? 271 LYS A N     1 
ATOM   1896 C  CA    . LYS A 1 270 ? 39.467 -27.930 -4.713  1.00 8.33  ? 271 LYS A CA    1 
ATOM   1897 C  C     . LYS A 1 270 ? 40.593 -26.954 -5.064  1.00 8.86  ? 271 LYS A C     1 
ATOM   1898 O  O     . LYS A 1 270 ? 41.307 -27.160 -6.041  1.00 8.19  ? 271 LYS A O     1 
ATOM   1899 C  CB    . LYS A 1 270 ? 38.215 -27.669 -5.562  1.00 10.38 ? 271 LYS A CB    1 
ATOM   1900 C  CG    . LYS A 1 270 ? 37.669 -26.252 -5.538  1.00 7.03  ? 271 LYS A CG    1 
ATOM   1901 C  CD    . LYS A 1 270 ? 36.276 -26.263 -6.120  1.00 12.03 ? 271 LYS A CD    1 
ATOM   1902 C  CE    . LYS A 1 270 ? 36.035 -25.131 -7.093  1.00 19.37 ? 271 LYS A CE    1 
ATOM   1903 N  NZ    . LYS A 1 270 ? 36.149 -23.789 -6.498  1.00 27.54 ? 271 LYS A NZ    1 
ATOM   1904 N  N     . ASP A 1 271 ? 40.768 -25.919 -4.237  1.00 7.86  ? 272 ASP A N     1 
ATOM   1905 C  CA    . ASP A 1 271 ? 41.828 -24.924 -4.419  1.00 9.80  ? 272 ASP A CA    1 
ATOM   1906 C  C     . ASP A 1 271 ? 43.198 -25.535 -4.133  1.00 12.03 ? 272 ASP A C     1 
ATOM   1907 O  O     . ASP A 1 271 ? 44.159 -25.333 -4.876  1.00 15.18 ? 272 ASP A O     1 
ATOM   1908 C  CB    . ASP A 1 271 ? 41.597 -23.698 -3.519  1.00 11.68 ? 272 ASP A CB    1 
ATOM   1909 C  CG    . ASP A 1 271 ? 41.499 -24.046 -2.007  1.00 14.84 ? 272 ASP A CG    1 
ATOM   1910 O  OD1   . ASP A 1 271 ? 40.928 -25.097 -1.628  1.00 12.15 ? 272 ASP A OD1   1 
ATOM   1911 O  OD2   . ASP A 1 271 ? 41.970 -23.224 -1.188  1.00 12.07 ? 272 ASP A OD2   1 
ATOM   1912 N  N     . LEU A 1 272 ? 43.275 -26.338 -3.083  1.00 10.82 ? 273 LEU A N     1 
ATOM   1913 C  CA    . LEU A 1 272 ? 44.531 -26.968 -2.738  1.00 9.86  ? 273 LEU A CA    1 
ATOM   1914 C  C     . LEU A 1 272 ? 44.848 -28.101 -3.718  1.00 10.75 ? 273 LEU A C     1 
ATOM   1915 O  O     . LEU A 1 272 ? 46.002 -28.296 -4.113  1.00 9.89  ? 273 LEU A O     1 
ATOM   1916 C  CB    . LEU A 1 272 ? 44.467 -27.488 -1.302  1.00 11.58 ? 273 LEU A CB    1 
ATOM   1917 C  CG    . LEU A 1 272 ? 44.195 -26.436 -0.234  1.00 12.02 ? 273 LEU A CG    1 
ATOM   1918 C  CD1   . LEU A 1 272 ? 44.277 -27.071 1.132   1.00 13.65 ? 273 LEU A CD1   1 
ATOM   1919 C  CD2   . LEU A 1 272 ? 45.191 -25.312 -0.351  1.00 12.82 ? 273 LEU A CD2   1 
ATOM   1920 N  N     . PHE A 1 273 ? 43.811 -28.831 -4.124  1.00 7.50  ? 274 PHE A N     1 
ATOM   1921 C  CA    . PHE A 1 273 ? 43.964 -29.934 -5.066  1.00 9.14  ? 274 PHE A CA    1 
ATOM   1922 C  C     . PHE A 1 273 ? 44.496 -29.412 -6.403  1.00 10.46 ? 274 PHE A C     1 
ATOM   1923 O  O     . PHE A 1 273 ? 45.387 -30.015 -7.009  1.00 10.67 ? 274 PHE A O     1 
ATOM   1924 C  CB    . PHE A 1 273 ? 42.617 -30.632 -5.253  1.00 6.06  ? 274 PHE A CB    1 
ATOM   1925 C  CG    . PHE A 1 273 ? 42.615 -31.708 -6.290  1.00 9.25  ? 274 PHE A CG    1 
ATOM   1926 C  CD1   . PHE A 1 273 ? 43.202 -32.936 -6.039  1.00 9.52  ? 274 PHE A CD1   1 
ATOM   1927 C  CD2   . PHE A 1 273 ? 41.940 -31.523 -7.496  1.00 12.21 ? 274 PHE A CD2   1 
ATOM   1928 C  CE1   . PHE A 1 273 ? 43.108 -33.967 -6.963  1.00 8.84  ? 274 PHE A CE1   1 
ATOM   1929 C  CE2   . PHE A 1 273 ? 41.841 -32.541 -8.419  1.00 10.02 ? 274 PHE A CE2   1 
ATOM   1930 C  CZ    . PHE A 1 273 ? 42.427 -33.768 -8.151  1.00 9.52  ? 274 PHE A CZ    1 
ATOM   1931 N  N     . GLU A 1 274 ? 43.981 -28.266 -6.827  1.00 12.83 ? 275 GLU A N     1 
ATOM   1932 C  CA    . GLU A 1 274 ? 44.402 -27.667 -8.078  1.00 17.85 ? 275 GLU A CA    1 
ATOM   1933 C  C     . GLU A 1 274 ? 45.904 -27.396 -8.103  1.00 16.56 ? 275 GLU A C     1 
ATOM   1934 O  O     . GLU A 1 274 ? 46.556 -27.625 -9.121  1.00 15.80 ? 275 GLU A O     1 
ATOM   1935 C  CB    . GLU A 1 274 ? 43.619 -26.391 -8.343  1.00 19.81 ? 275 GLU A CB    1 
ATOM   1936 C  CG    . GLU A 1 274 ? 43.783 -25.894 -9.744  1.00 30.25 ? 275 GLU A CG    1 
ATOM   1937 C  CD    . GLU A 1 274 ? 42.936 -24.678 -10.032 1.00 37.57 ? 275 GLU A CD    1 
ATOM   1938 O  OE1   . GLU A 1 274 ? 42.558 -23.955 -9.076  1.00 42.49 ? 275 GLU A OE1   1 
ATOM   1939 O  OE2   . GLU A 1 274 ? 42.648 -24.450 -11.225 1.00 43.26 ? 275 GLU A OE2   1 
ATOM   1940 N  N     . GLU A 1 275 ? 46.464 -26.931 -6.990  1.00 17.61 ? 276 GLU A N     1 
ATOM   1941 C  CA    . GLU A 1 275 ? 47.901 -26.683 -6.963  1.00 17.90 ? 276 GLU A CA    1 
ATOM   1942 C  C     . GLU A 1 275 ? 48.744 -27.941 -6.720  1.00 15.84 ? 276 GLU A C     1 
ATOM   1943 O  O     . GLU A 1 275 ? 49.858 -28.053 -7.223  1.00 16.87 ? 276 GLU A O     1 
ATOM   1944 C  CB    . GLU A 1 275 ? 48.281 -25.571 -5.974  1.00 22.15 ? 276 GLU A CB    1 
ATOM   1945 C  CG    . GLU A 1 275 ? 47.805 -25.752 -4.560  1.00 37.24 ? 276 GLU A CG    1 
ATOM   1946 C  CD    . GLU A 1 275 ? 48.399 -24.713 -3.594  1.00 45.62 ? 276 GLU A CD    1 
ATOM   1947 O  OE1   . GLU A 1 275 ? 48.289 -23.497 -3.882  1.00 49.23 ? 276 GLU A OE1   1 
ATOM   1948 O  OE2   . GLU A 1 275 ? 48.971 -25.111 -2.545  1.00 45.41 ? 276 GLU A OE2   1 
ATOM   1949 N  N     . LYS A 1 276 ? 48.185 -28.914 -6.013  1.00 13.51 ? 277 LYS A N     1 
ATOM   1950 C  CA    . LYS A 1 276 ? 48.900 -30.138 -5.698  1.00 11.02 ? 277 LYS A CA    1 
ATOM   1951 C  C     . LYS A 1 276 ? 49.006 -31.141 -6.844  1.00 10.70 ? 277 LYS A C     1 
ATOM   1952 O  O     . LYS A 1 276 ? 50.036 -31.811 -7.006  1.00 10.75 ? 277 LYS A O     1 
ATOM   1953 C  CB    . LYS A 1 276 ? 48.263 -30.789 -4.464  1.00 13.82 ? 277 LYS A CB    1 
ATOM   1954 C  CG    . LYS A 1 276 ? 48.917 -32.078 -4.049  1.00 19.23 ? 277 LYS A CG    1 
ATOM   1955 C  CD    . LYS A 1 276 ? 48.286 -32.671 -2.790  1.00 17.14 ? 277 LYS A CD    1 
ATOM   1956 C  CE    . LYS A 1 276 ? 48.564 -31.828 -1.570  1.00 11.45 ? 277 LYS A CE    1 
ATOM   1957 N  NZ    . LYS A 1 276 ? 48.364 -32.638 -0.336  1.00 10.53 ? 277 LYS A NZ    1 
ATOM   1958 N  N     . ILE A 1 277 ? 47.974 -31.219 -7.676  1.00 10.95 ? 278 ILE A N     1 
ATOM   1959 C  CA    . ILE A 1 277 ? 47.968 -32.164 -8.782  1.00 12.67 ? 278 ILE A CA    1 
ATOM   1960 C  C     . ILE A 1 277 ? 49.119 -31.964 -9.776  1.00 14.97 ? 278 ILE A C     1 
ATOM   1961 O  O     . ILE A 1 277 ? 49.600 -32.924 -10.372 1.00 18.35 ? 278 ILE A O     1 
ATOM   1962 C  CB    . ILE A 1 277 ? 46.586 -32.193 -9.503  1.00 13.82 ? 278 ILE A CB    1 
ATOM   1963 C  CG1   . ILE A 1 277 ? 46.471 -33.447 -10.373 1.00 12.14 ? 278 ILE A CG1   1 
ATOM   1964 C  CG2   . ILE A 1 277 ? 46.363 -30.919 -10.313 1.00 12.67 ? 278 ILE A CG2   1 
ATOM   1965 C  CD1   . ILE A 1 277 ? 46.437 -34.771 -9.581  1.00 13.00 ? 278 ILE A CD1   1 
ATOM   1966 N  N     . LYS A 1 278 ? 49.603 -30.734 -9.888  1.00 15.92 ? 279 LYS A N     1 
ATOM   1967 C  CA    . LYS A 1 278 ? 50.701 -30.410 -10.795 1.00 19.99 ? 279 LYS A CA    1 
ATOM   1968 C  C     . LYS A 1 278 ? 52.049 -30.959 -10.361 1.00 22.51 ? 279 LYS A C     1 
ATOM   1969 O  O     . LYS A 1 278 ? 52.930 -31.147 -11.199 1.00 25.16 ? 279 LYS A O     1 
ATOM   1970 C  CB    . LYS A 1 278 ? 50.882 -28.903 -10.896 1.00 19.28 ? 279 LYS A CB    1 
ATOM   1971 C  CG    . LYS A 1 278 ? 49.699 -28.149 -11.433 1.00 28.71 ? 279 LYS A CG    1 
ATOM   1972 C  CD    . LYS A 1 278 ? 49.919 -26.667 -11.224 1.00 29.99 ? 279 LYS A CD    1 
ATOM   1973 C  CE    . LYS A 1 278 ? 48.727 -25.860 -11.688 1.00 34.00 ? 279 LYS A CE    1 
ATOM   1974 N  NZ    . LYS A 1 278 ? 48.839 -24.471 -11.145 1.00 41.42 ? 279 LYS A NZ    1 
ATOM   1975 N  N     . LYS A 1 279 ? 52.223 -31.193 -9.061  1.00 20.74 ? 280 LYS A N     1 
ATOM   1976 C  CA    . LYS A 1 279 ? 53.511 -31.637 -8.558  1.00 18.75 ? 280 LYS A CA    1 
ATOM   1977 C  C     . LYS A 1 279 ? 53.496 -32.909 -7.741  1.00 20.77 ? 280 LYS A C     1 
ATOM   1978 O  O     . LYS A 1 279 ? 54.551 -33.357 -7.256  1.00 24.88 ? 280 LYS A O     1 
ATOM   1979 C  CB    . LYS A 1 279 ? 54.136 -30.518 -7.734  1.00 18.83 ? 280 LYS A CB    1 
ATOM   1980 C  CG    . LYS A 1 279 ? 53.429 -30.247 -6.425  1.00 19.05 ? 280 LYS A CG    1 
ATOM   1981 C  CD    . LYS A 1 279 ? 53.759 -28.870 -5.920  1.00 26.66 ? 280 LYS A CD    1 
ATOM   1982 C  CE    . LYS A 1 279 ? 53.043 -28.589 -4.607  1.00 31.66 ? 280 LYS A CE    1 
ATOM   1983 N  NZ    . LYS A 1 279 ? 53.225 -27.164 -4.199  1.00 37.42 ? 280 LYS A NZ    1 
ATOM   1984 N  N     . SER A 1 280 ? 52.317 -33.480 -7.543  1.00 20.11 ? 281 SER A N     1 
ATOM   1985 C  CA    . SER A 1 280 ? 52.218 -34.714 -6.773  1.00 19.38 ? 281 SER A CA    1 
ATOM   1986 C  C     . SER A 1 280 ? 51.296 -35.686 -7.495  1.00 16.60 ? 281 SER A C     1 
ATOM   1987 O  O     . SER A 1 280 ? 50.094 -35.477 -7.597  1.00 19.83 ? 281 SER A O     1 
ATOM   1988 C  CB    . SER A 1 280 ? 51.738 -34.433 -5.337  1.00 17.06 ? 281 SER A CB    1 
ATOM   1989 O  OG    . SER A 1 280 ? 51.793 -35.601 -4.529  1.00 21.39 ? 281 SER A OG    1 
ATOM   1990 N  N     . PRO A 1 281 ? 51.850 -36.786 -7.982  1.00 17.18 ? 282 PRO A N     1 
ATOM   1991 C  CA    . PRO A 1 281 ? 51.069 -37.784 -8.695  1.00 18.28 ? 282 PRO A CA    1 
ATOM   1992 C  C     . PRO A 1 281 ? 49.923 -38.418 -7.910  1.00 17.93 ? 282 PRO A C     1 
ATOM   1993 O  O     . PRO A 1 281 ? 50.075 -38.797 -6.739  1.00 16.63 ? 282 PRO A O     1 
ATOM   1994 C  CB    . PRO A 1 281 ? 52.123 -38.815 -9.089  1.00 20.74 ? 282 PRO A CB    1 
ATOM   1995 C  CG    . PRO A 1 281 ? 53.150 -38.687 -7.996  1.00 21.74 ? 282 PRO A CG    1 
ATOM   1996 C  CD    . PRO A 1 281 ? 53.254 -37.210 -7.843  1.00 18.61 ? 282 PRO A CD    1 
ATOM   1997 N  N     . LEU A 1 282 ? 48.788 -38.552 -8.593  1.00 17.12 ? 283 LEU A N     1 
ATOM   1998 C  CA    . LEU A 1 282 ? 47.578 -39.151 -8.050  1.00 16.66 ? 283 LEU A CA    1 
ATOM   1999 C  C     . LEU A 1 282 ? 47.766 -40.674 -7.924  1.00 18.17 ? 283 LEU A C     1 
ATOM   2000 O  O     . LEU A 1 282 ? 47.076 -41.341 -7.142  1.00 18.06 ? 283 LEU A O     1 
ATOM   2001 C  CB    . LEU A 1 282 ? 46.385 -38.821 -8.956  1.00 14.49 ? 283 LEU A CB    1 
ATOM   2002 C  CG    . LEU A 1 282 ? 44.987 -39.207 -8.450  1.00 15.40 ? 283 LEU A CG    1 
ATOM   2003 C  CD1   . LEU A 1 282 ? 44.687 -38.488 -7.130  1.00 13.76 ? 283 LEU A CD1   1 
ATOM   2004 C  CD2   . LEU A 1 282 ? 43.919 -38.881 -9.477  1.00 9.79  ? 283 LEU A CD2   1 
ATOM   2005 N  N     . THR A 1 283 ? 48.728 -41.212 -8.671  1.00 17.43 ? 284 THR A N     1 
ATOM   2006 C  CA    . THR A 1 283 ? 49.022 -42.641 -8.639  1.00 19.06 ? 284 THR A CA    1 
ATOM   2007 C  C     . THR A 1 283 ? 49.473 -43.091 -7.255  1.00 18.62 ? 284 THR A C     1 
ATOM   2008 O  O     . THR A 1 283 ? 49.495 -44.285 -6.969  1.00 21.18 ? 284 THR A O     1 
ATOM   2009 C  CB    . THR A 1 283 ? 50.082 -43.021 -9.679  1.00 16.42 ? 284 THR A CB    1 
ATOM   2010 O  OG1   . THR A 1 283 ? 51.193 -42.126 -9.566  1.00 18.67 ? 284 THR A OG1   1 
ATOM   2011 C  CG2   . THR A 1 283 ? 49.493 -42.937 -11.080 1.00 16.09 ? 284 THR A CG2   1 
ATOM   2012 N  N     . ILE A 1 284 ? 49.856 -42.132 -6.415  1.00 19.84 ? 285 ILE A N     1 
ATOM   2013 C  CA    . ILE A 1 284 ? 50.256 -42.401 -5.027  1.00 20.54 ? 285 ILE A CA    1 
ATOM   2014 C  C     . ILE A 1 284 ? 49.036 -43.013 -4.318  1.00 20.50 ? 285 ILE A C     1 
ATOM   2015 O  O     . ILE A 1 284 ? 49.163 -43.908 -3.481  1.00 18.72 ? 285 ILE A O     1 
ATOM   2016 C  CB    . ILE A 1 284 ? 50.600 -41.076 -4.276  1.00 20.52 ? 285 ILE A CB    1 
ATOM   2017 C  CG1   . ILE A 1 284 ? 51.901 -40.469 -4.814  1.00 23.34 ? 285 ILE A CG1   1 
ATOM   2018 C  CG2   . ILE A 1 284 ? 50.660 -41.312 -2.773  1.00 22.03 ? 285 ILE A CG2   1 
ATOM   2019 C  CD1   . ILE A 1 284 ? 52.181 -39.050 -4.320  1.00 26.25 ? 285 ILE A CD1   1 
ATOM   2020 N  N     . CYS A 1 285 ? 47.853 -42.556 -4.716  1.00 17.46 ? 286 CYS A N     1 
ATOM   2021 C  CA    . CYS A 1 285 ? 46.604 -42.996 -4.117  1.00 16.60 ? 286 CYS A CA    1 
ATOM   2022 C  C     . CYS A 1 285 ? 45.888 -44.054 -4.949  1.00 16.59 ? 286 CYS A C     1 
ATOM   2023 O  O     . CYS A 1 285 ? 45.355 -45.034 -4.411  1.00 16.32 ? 286 CYS A O     1 
ATOM   2024 C  CB    . CYS A 1 285 ? 45.701 -41.768 -3.927  1.00 13.89 ? 286 CYS A CB    1 
ATOM   2025 S  SG    . CYS A 1 285 ? 44.177 -42.057 -3.010  1.00 17.96 ? 286 CYS A SG    1 
ATOM   2026 N  N     . TYR A 1 286 ? 45.820 -43.813 -6.255  1.00 18.73 ? 287 TYR A N     1 
ATOM   2027 C  CA    . TYR A 1 286 ? 45.161 -44.712 -7.201  1.00 18.60 ? 287 TYR A CA    1 
ATOM   2028 C  C     . TYR A 1 286 ? 46.209 -45.077 -8.254  1.00 21.25 ? 287 TYR A C     1 
ATOM   2029 O  O     . TYR A 1 286 ? 46.338 -44.410 -9.281  1.00 18.86 ? 287 TYR A O     1 
ATOM   2030 C  CB    . TYR A 1 286 ? 43.990 -43.991 -7.865  1.00 17.26 ? 287 TYR A CB    1 
ATOM   2031 C  CG    . TYR A 1 286 ? 42.949 -43.449 -6.911  1.00 15.50 ? 287 TYR A CG    1 
ATOM   2032 C  CD1   . TYR A 1 286 ? 42.070 -44.307 -6.245  1.00 16.76 ? 287 TYR A CD1   1 
ATOM   2033 C  CD2   . TYR A 1 286 ? 42.809 -42.071 -6.707  1.00 16.90 ? 287 TYR A CD2   1 
ATOM   2034 C  CE1   . TYR A 1 286 ? 41.066 -43.798 -5.397  1.00 17.19 ? 287 TYR A CE1   1 
ATOM   2035 C  CE2   . TYR A 1 286 ? 41.815 -41.552 -5.860  1.00 16.35 ? 287 TYR A CE2   1 
ATOM   2036 C  CZ    . TYR A 1 286 ? 40.945 -42.420 -5.212  1.00 18.03 ? 287 TYR A CZ    1 
ATOM   2037 O  OH    . TYR A 1 286 ? 39.946 -41.920 -4.407  1.00 12.06 ? 287 TYR A OH    1 
ATOM   2038 N  N     . PRO A 1 287 ? 46.963 -46.161 -8.008  1.00 23.56 ? 288 PRO A N     1 
ATOM   2039 C  CA    . PRO A 1 287 ? 48.030 -46.661 -8.891  1.00 26.24 ? 288 PRO A CA    1 
ATOM   2040 C  C     . PRO A 1 287 ? 47.589 -46.897 -10.327 1.00 26.85 ? 288 PRO A C     1 
ATOM   2041 O  O     . PRO A 1 287 ? 48.377 -46.766 -11.252 1.00 29.13 ? 288 PRO A O     1 
ATOM   2042 C  CB    . PRO A 1 287 ? 48.440 -47.968 -8.218  1.00 27.70 ? 288 PRO A CB    1 
ATOM   2043 C  CG    . PRO A 1 287 ? 48.091 -47.752 -6.772  1.00 28.43 ? 288 PRO A CG    1 
ATOM   2044 C  CD    . PRO A 1 287 ? 46.741 -47.096 -6.894  1.00 26.15 ? 288 PRO A CD    1 
ATOM   2045 N  N     . GLU A 1 288 ? 46.321 -47.234 -10.491 1.00 29.58 ? 289 GLU A N     1 
ATOM   2046 C  CA    . GLU A 1 288 ? 45.731 -47.504 -11.791 1.00 32.74 ? 289 GLU A CA    1 
ATOM   2047 C  C     . GLU A 1 288 ? 45.374 -46.231 -12.597 1.00 29.42 ? 289 GLU A C     1 
ATOM   2048 O  O     . GLU A 1 288 ? 45.033 -46.312 -13.780 1.00 31.30 ? 289 GLU A O     1 
ATOM   2049 C  CB    . GLU A 1 288 ? 44.499 -48.387 -11.562 1.00 40.42 ? 289 GLU A CB    1 
ATOM   2050 C  CG    . GLU A 1 288 ? 43.596 -48.621 -12.755 1.00 57.25 ? 289 GLU A CG    1 
ATOM   2051 C  CD    . GLU A 1 288 ? 42.141 -48.871 -12.344 1.00 67.00 ? 289 GLU A CD    1 
ATOM   2052 O  OE1   . GLU A 1 288 ? 41.597 -48.086 -11.520 1.00 70.74 ? 289 GLU A OE1   1 
ATOM   2053 O  OE2   . GLU A 1 288 ? 41.538 -49.846 -12.860 1.00 72.53 ? 289 GLU A OE2   1 
ATOM   2054 N  N     . TYR A 1 289 ? 45.467 -45.061 -11.971 1.00 24.33 ? 290 TYR A N     1 
ATOM   2055 C  CA    . TYR A 1 289 ? 45.133 -43.829 -12.665 1.00 19.65 ? 290 TYR A CA    1 
ATOM   2056 C  C     . TYR A 1 289 ? 46.001 -43.717 -13.910 1.00 22.13 ? 290 TYR A C     1 
ATOM   2057 O  O     . TYR A 1 289 ? 47.234 -43.745 -13.820 1.00 20.32 ? 290 TYR A O     1 
ATOM   2058 C  CB    . TYR A 1 289 ? 45.341 -42.600 -11.765 1.00 15.65 ? 290 TYR A CB    1 
ATOM   2059 C  CG    . TYR A 1 289 ? 44.969 -41.286 -12.440 1.00 12.46 ? 290 TYR A CG    1 
ATOM   2060 C  CD1   . TYR A 1 289 ? 43.701 -41.105 -13.016 1.00 12.87 ? 290 TYR A CD1   1 
ATOM   2061 C  CD2   . TYR A 1 289 ? 45.872 -40.230 -12.511 1.00 11.27 ? 290 TYR A CD2   1 
ATOM   2062 C  CE1   . TYR A 1 289 ? 43.346 -39.901 -13.646 1.00 7.63  ? 290 TYR A CE1   1 
ATOM   2063 C  CE2   . TYR A 1 289 ? 45.518 -39.018 -13.135 1.00 11.70 ? 290 TYR A CE2   1 
ATOM   2064 C  CZ    . TYR A 1 289 ? 44.248 -38.875 -13.695 1.00 8.52  ? 290 TYR A CZ    1 
ATOM   2065 O  OH    . TYR A 1 289 ? 43.879 -37.696 -14.284 1.00 11.61 ? 290 TYR A OH    1 
ATOM   2066 N  N     . ALA A 1 290 ? 45.362 -43.594 -15.070 1.00 22.34 ? 291 ALA A N     1 
ATOM   2067 C  CA    . ALA A 1 290 ? 46.093 -43.465 -16.332 1.00 24.50 ? 291 ALA A CA    1 
ATOM   2068 C  C     . ALA A 1 290 ? 45.890 -42.112 -17.043 1.00 24.36 ? 291 ALA A C     1 
ATOM   2069 O  O     . ALA A 1 290 ? 46.347 -41.931 -18.174 1.00 26.85 ? 291 ALA A O     1 
ATOM   2070 C  CB    . ALA A 1 290 ? 45.741 -44.623 -17.265 1.00 22.38 ? 291 ALA A CB    1 
ATOM   2071 N  N     . GLY A 1 291 ? 45.226 -41.167 -16.375 1.00 20.69 ? 292 GLY A N     1 
ATOM   2072 C  CA    . GLY A 1 291 ? 44.990 -39.859 -16.964 1.00 16.49 ? 292 GLY A CA    1 
ATOM   2073 C  C     . GLY A 1 291 ? 46.151 -38.907 -16.754 1.00 15.40 ? 292 GLY A C     1 
ATOM   2074 O  O     . GLY A 1 291 ? 47.156 -39.274 -16.145 1.00 17.48 ? 292 GLY A O     1 
ATOM   2075 N  N     . SER A 1 292 ? 46.016 -37.677 -17.234 1.00 15.60 ? 293 SER A N     1 
ATOM   2076 C  CA    . SER A 1 292 ? 47.073 -36.697 -17.077 1.00 16.48 ? 293 SER A CA    1 
ATOM   2077 C  C     . SER A 1 292 ? 46.974 -36.005 -15.720 1.00 18.37 ? 293 SER A C     1 
ATOM   2078 O  O     . SER A 1 292 ? 45.983 -36.143 -15.003 1.00 20.22 ? 293 SER A O     1 
ATOM   2079 C  CB    . SER A 1 292 ? 47.025 -35.661 -18.208 1.00 18.08 ? 293 SER A CB    1 
ATOM   2080 O  OG    . SER A 1 292 ? 45.916 -34.784 -18.083 1.00 20.79 ? 293 SER A OG    1 
ATOM   2081 N  N     . ASN A 1 293 ? 48.001 -35.232 -15.390 1.00 20.14 ? 294 ASN A N     1 
ATOM   2082 C  CA    . ASN A 1 293 ? 48.067 -34.502 -14.130 1.00 19.52 ? 294 ASN A CA    1 
ATOM   2083 C  C     . ASN A 1 293 ? 47.377 -33.150 -14.242 1.00 19.39 ? 294 ASN A C     1 
ATOM   2084 O  O     . ASN A 1 293 ? 47.970 -32.115 -13.947 1.00 22.44 ? 294 ASN A O     1 
ATOM   2085 C  CB    . ASN A 1 293 ? 49.534 -34.330 -13.688 1.00 19.24 ? 294 ASN A CB    1 
ATOM   2086 C  CG    . ASN A 1 293 ? 50.382 -33.562 -14.710 1.00 20.42 ? 294 ASN A CG    1 
ATOM   2087 O  OD1   . ASN A 1 293 ? 50.216 -33.728 -15.919 1.00 22.53 ? 294 ASN A OD1   1 
ATOM   2088 N  ND2   . ASN A 1 293 ? 51.292 -32.726 -14.225 1.00 19.28 ? 294 ASN A ND2   1 
ATOM   2089 N  N     . THR A 1 294 ? 46.126 -33.157 -14.690 1.00 17.91 ? 295 THR A N     1 
ATOM   2090 C  CA    . THR A 1 294 ? 45.367 -31.921 -14.836 1.00 17.59 ? 295 THR A CA    1 
ATOM   2091 C  C     . THR A 1 294 ? 44.199 -31.974 -13.862 1.00 15.02 ? 295 THR A C     1 
ATOM   2092 O  O     . THR A 1 294 ? 43.724 -33.052 -13.516 1.00 16.47 ? 295 THR A O     1 
ATOM   2093 C  CB    . THR A 1 294 ? 44.823 -31.719 -16.294 1.00 19.69 ? 295 THR A CB    1 
ATOM   2094 O  OG1   . THR A 1 294 ? 43.805 -32.683 -16.596 1.00 22.25 ? 295 THR A OG1   1 
ATOM   2095 C  CG2   . THR A 1 294 ? 45.953 -31.840 -17.312 1.00 20.84 ? 295 THR A CG2   1 
ATOM   2096 N  N     . TYR A 1 295 ? 43.730 -30.808 -13.441 1.00 12.44 ? 296 TYR A N     1 
ATOM   2097 C  CA    . TYR A 1 295 ? 42.625 -30.712 -12.509 1.00 9.08  ? 296 TYR A CA    1 
ATOM   2098 C  C     . TYR A 1 295 ? 41.336 -31.397 -12.959 1.00 9.61  ? 296 TYR A C     1 
ATOM   2099 O  O     . TYR A 1 295 ? 40.794 -32.220 -12.235 1.00 10.41 ? 296 TYR A O     1 
ATOM   2100 C  CB    . TYR A 1 295 ? 42.355 -29.242 -12.192 1.00 11.57 ? 296 TYR A CB    1 
ATOM   2101 C  CG    . TYR A 1 295 ? 41.144 -28.999 -11.318 1.00 13.02 ? 296 TYR A CG    1 
ATOM   2102 C  CD1   . TYR A 1 295 ? 41.227 -29.115 -9.935  1.00 13.72 ? 296 TYR A CD1   1 
ATOM   2103 C  CD2   . TYR A 1 295 ? 39.915 -28.655 -11.879 1.00 14.76 ? 296 TYR A CD2   1 
ATOM   2104 C  CE1   . TYR A 1 295 ? 40.124 -28.901 -9.132  1.00 16.64 ? 296 TYR A CE1   1 
ATOM   2105 C  CE2   . TYR A 1 295 ? 38.807 -28.438 -11.084 1.00 19.72 ? 296 TYR A CE2   1 
ATOM   2106 C  CZ    . TYR A 1 295 ? 38.919 -28.567 -9.705  1.00 20.33 ? 296 TYR A CZ    1 
ATOM   2107 O  OH    . TYR A 1 295 ? 37.818 -28.381 -8.908  1.00 23.02 ? 296 TYR A OH    1 
ATOM   2108 N  N     . GLU A 1 296 ? 40.841 -31.056 -14.146 1.00 13.12 ? 297 GLU A N     1 
ATOM   2109 C  CA    . GLU A 1 296 ? 39.584 -31.619 -14.664 1.00 12.23 ? 297 GLU A CA    1 
ATOM   2110 C  C     . GLU A 1 296 ? 39.566 -33.122 -14.793 1.00 9.68  ? 297 GLU A C     1 
ATOM   2111 O  O     . GLU A 1 296 ? 38.560 -33.737 -14.513 1.00 12.67 ? 297 GLU A O     1 
ATOM   2112 C  CB    . GLU A 1 296 ? 39.194 -30.992 -16.012 1.00 12.88 ? 297 GLU A CB    1 
ATOM   2113 C  CG    . GLU A 1 296 ? 38.755 -29.523 -15.955 1.00 15.44 ? 297 GLU A CG    1 
ATOM   2114 C  CD    . GLU A 1 296 ? 39.913 -28.532 -15.813 1.00 20.32 ? 297 GLU A CD    1 
ATOM   2115 O  OE1   . GLU A 1 296 ? 41.090 -28.913 -16.005 1.00 21.84 ? 297 GLU A OE1   1 
ATOM   2116 O  OE2   . GLU A 1 296 ? 39.649 -27.354 -15.506 1.00 26.04 ? 297 GLU A OE2   1 
ATOM   2117 N  N     . GLU A 1 297 ? 40.648 -33.709 -15.283 1.00 11.05 ? 298 GLU A N     1 
ATOM   2118 C  CA    . GLU A 1 297 ? 40.712 -35.156 -15.422 1.00 12.86 ? 298 GLU A CA    1 
ATOM   2119 C  C     . GLU A 1 297 ? 40.858 -35.859 -14.066 1.00 10.82 ? 298 GLU A C     1 
ATOM   2120 O  O     . GLU A 1 297 ? 40.177 -36.851 -13.814 1.00 9.83  ? 298 GLU A O     1 
ATOM   2121 C  CB    . GLU A 1 297 ? 41.876 -35.566 -16.329 1.00 16.54 ? 298 GLU A CB    1 
ATOM   2122 C  CG    . GLU A 1 297 ? 41.614 -35.433 -17.816 1.00 23.39 ? 298 GLU A CG    1 
ATOM   2123 C  CD    . GLU A 1 297 ? 42.823 -35.870 -18.636 1.00 29.11 ? 298 GLU A CD    1 
ATOM   2124 O  OE1   . GLU A 1 297 ? 43.134 -37.080 -18.651 1.00 25.48 ? 298 GLU A OE1   1 
ATOM   2125 O  OE2   . GLU A 1 297 ? 43.481 -34.993 -19.240 1.00 34.89 ? 298 GLU A OE2   1 
ATOM   2126 N  N     . ALA A 1 298 ? 41.767 -35.371 -13.218 1.00 9.88  ? 299 ALA A N     1 
ATOM   2127 C  CA    . ALA A 1 298 ? 41.991 -35.956 -11.880 1.00 10.25 ? 299 ALA A CA    1 
ATOM   2128 C  C     . ALA A 1 298 ? 40.756 -35.830 -10.990 1.00 7.81  ? 299 ALA A C     1 
ATOM   2129 O  O     . ALA A 1 298 ? 40.395 -36.784 -10.296 1.00 9.91  ? 299 ALA A O     1 
ATOM   2130 C  CB    . ALA A 1 298 ? 43.187 -35.312 -11.199 1.00 8.10  ? 299 ALA A CB    1 
ATOM   2131 N  N     . ALA A 1 299 ? 40.107 -34.666 -11.017 1.00 10.30 ? 300 ALA A N     1 
ATOM   2132 C  CA    . ALA A 1 299 ? 38.891 -34.428 -10.228 1.00 10.20 ? 300 ALA A CA    1 
ATOM   2133 C  C     . ALA A 1 299 ? 37.748 -35.355 -10.655 1.00 10.64 ? 300 ALA A C     1 
ATOM   2134 O  O     . ALA A 1 299 ? 37.084 -35.969 -9.813  1.00 13.39 ? 300 ALA A O     1 
ATOM   2135 C  CB    . ALA A 1 299 ? 38.458 -32.972 -10.319 1.00 7.09  ? 300 ALA A CB    1 
ATOM   2136 N  N     . ALA A 1 300 ? 37.542 -35.511 -11.956 1.00 9.23  ? 301 ALA A N     1 
ATOM   2137 C  CA    . ALA A 1 300 ? 36.472 -36.393 -12.431 1.00 8.43  ? 301 ALA A CA    1 
ATOM   2138 C  C     . ALA A 1 300 ? 36.704 -37.858 -12.034 1.00 8.80  ? 301 ALA A C     1 
ATOM   2139 O  O     . ALA A 1 300 ? 35.742 -38.577 -11.742 1.00 9.39  ? 301 ALA A O     1 
ATOM   2140 C  CB    . ALA A 1 300 ? 36.316 -36.270 -13.934 1.00 7.09  ? 301 ALA A CB    1 
ATOM   2141 N  N     . TYR A 1 301 ? 37.965 -38.305 -12.054 1.00 10.22 ? 302 TYR A N     1 
ATOM   2142 C  CA    . TYR A 1 301 ? 38.334 -39.680 -11.682 1.00 10.65 ? 302 TYR A CA    1 
ATOM   2143 C  C     . TYR A 1 301 ? 37.987 -39.969 -10.201 1.00 12.08 ? 302 TYR A C     1 
ATOM   2144 O  O     . TYR A 1 301 ? 37.445 -41.035 -9.868  1.00 11.88 ? 302 TYR A O     1 
ATOM   2145 C  CB    . TYR A 1 301 ? 39.841 -39.903 -11.915 1.00 10.74 ? 302 TYR A CB    1 
ATOM   2146 C  CG    . TYR A 1 301 ? 40.324 -41.332 -11.675 1.00 14.64 ? 302 TYR A CG    1 
ATOM   2147 C  CD1   . TYR A 1 301 ? 40.105 -42.333 -12.626 1.00 13.76 ? 302 TYR A CD1   1 
ATOM   2148 C  CD2   . TYR A 1 301 ? 41.006 -41.680 -10.505 1.00 12.73 ? 302 TYR A CD2   1 
ATOM   2149 C  CE1   . TYR A 1 301 ? 40.546 -43.633 -12.423 1.00 15.92 ? 302 TYR A CE1   1 
ATOM   2150 C  CE2   . TYR A 1 301 ? 41.452 -42.979 -10.297 1.00 15.81 ? 302 TYR A CE2   1 
ATOM   2151 C  CZ    . TYR A 1 301 ? 41.217 -43.951 -11.257 1.00 16.18 ? 302 TYR A CZ    1 
ATOM   2152 O  OH    . TYR A 1 301 ? 41.631 -45.244 -11.050 1.00 20.43 ? 302 TYR A OH    1 
ATOM   2153 N  N     . ILE A 1 302 ? 38.313 -39.019 -9.324  1.00 12.74 ? 303 ILE A N     1 
ATOM   2154 C  CA    . ILE A 1 302 ? 38.038 -39.143 -7.893  1.00 9.87  ? 303 ILE A CA    1 
ATOM   2155 C  C     . ILE A 1 302 ? 36.525 -39.177 -7.677  1.00 8.82  ? 303 ILE A C     1 
ATOM   2156 O  O     . ILE A 1 302 ? 36.022 -40.009 -6.924  1.00 10.30 ? 303 ILE A O     1 
ATOM   2157 C  CB    . ILE A 1 302 ? 38.723 -38.001 -7.093  1.00 7.52  ? 303 ILE A CB    1 
ATOM   2158 C  CG1   . ILE A 1 302 ? 40.243 -38.176 -7.183  1.00 10.31 ? 303 ILE A CG1   1 
ATOM   2159 C  CG2   . ILE A 1 302 ? 38.307 -38.026 -5.625  1.00 5.21  ? 303 ILE A CG2   1 
ATOM   2160 C  CD1   . ILE A 1 302 ? 41.025 -37.053 -6.557  1.00 11.09 ? 303 ILE A CD1   1 
ATOM   2161 N  N     . GLN A 1 303 ? 35.791 -38.331 -8.393  1.00 7.67  ? 304 GLN A N     1 
ATOM   2162 C  CA    . GLN A 1 303 ? 34.345 -38.329 -8.272  1.00 8.82  ? 304 GLN A CA    1 
ATOM   2163 C  C     . GLN A 1 303 ? 33.781 -39.717 -8.584  1.00 12.96 ? 304 GLN A C     1 
ATOM   2164 O  O     . GLN A 1 303 ? 32.956 -40.252 -7.835  1.00 13.12 ? 304 GLN A O     1 
ATOM   2165 C  CB    . GLN A 1 303 ? 33.725 -37.296 -9.212  1.00 9.25  ? 304 GLN A CB    1 
ATOM   2166 C  CG    . GLN A 1 303 ? 32.187 -37.360 -9.332  1.00 9.65  ? 304 GLN A CG    1 
ATOM   2167 C  CD    . GLN A 1 303 ? 31.653 -36.347 -10.343 1.00 11.34 ? 304 GLN A CD    1 
ATOM   2168 O  OE1   . GLN A 1 303 ? 32.425 -35.661 -11.016 1.00 9.34  ? 304 GLN A OE1   1 
ATOM   2169 N  NE2   . GLN A 1 303 ? 30.343 -36.250 -10.451 1.00 11.66 ? 304 GLN A NE2   1 
ATOM   2170 N  N     . CYS A 1 304 ? 34.257 -40.326 -9.666  1.00 14.73 ? 305 CYS A N     1 
ATOM   2171 C  CA    . CYS A 1 304 ? 33.762 -41.640 -10.050 1.00 14.24 ? 305 CYS A CA    1 
ATOM   2172 C  C     . CYS A 1 304 ? 34.159 -42.720 -9.050  1.00 13.00 ? 305 CYS A C     1 
ATOM   2173 O  O     . CYS A 1 304 ? 33.396 -43.658 -8.829  1.00 15.18 ? 305 CYS A O     1 
ATOM   2174 C  CB    . CYS A 1 304 ? 34.208 -41.991 -11.477 1.00 19.46 ? 305 CYS A CB    1 
ATOM   2175 S  SG    . CYS A 1 304 ? 33.469 -40.927 -12.785 1.00 20.71 ? 305 CYS A SG    1 
ATOM   2176 N  N     . GLN A 1 305 ? 35.327 -42.575 -8.428  1.00 8.71  ? 306 GLN A N     1 
ATOM   2177 C  CA    . GLN A 1 305 ? 35.792 -43.544 -7.433  1.00 10.03 ? 306 GLN A CA    1 
ATOM   2178 C  C     . GLN A 1 305 ? 34.835 -43.559 -6.248  1.00 10.44 ? 306 GLN A C     1 
ATOM   2179 O  O     . GLN A 1 305 ? 34.579 -44.610 -5.661  1.00 13.31 ? 306 GLN A O     1 
ATOM   2180 C  CB    . GLN A 1 305 ? 37.194 -43.188 -6.937  1.00 11.08 ? 306 GLN A CB    1 
ATOM   2181 C  CG    . GLN A 1 305 ? 38.284 -43.360 -7.976  1.00 17.20 ? 306 GLN A CG    1 
ATOM   2182 C  CD    . GLN A 1 305 ? 38.486 -44.813 -8.363  1.00 24.62 ? 306 GLN A CD    1 
ATOM   2183 O  OE1   . GLN A 1 305 ? 38.704 -45.683 -7.508  1.00 27.50 ? 306 GLN A OE1   1 
ATOM   2184 N  NE2   . GLN A 1 305 ? 38.408 -45.090 -9.650  1.00 25.72 ? 306 GLN A NE2   1 
ATOM   2185 N  N     . PHE A 1 306 ? 34.348 -42.387 -5.860  1.00 10.45 ? 307 PHE A N     1 
ATOM   2186 C  CA    . PHE A 1 306 ? 33.395 -42.315 -4.759  1.00 9.80  ? 307 PHE A CA    1 
ATOM   2187 C  C     . PHE A 1 306 ? 31.990 -42.710 -5.190  1.00 10.93 ? 307 PHE A C     1 
ATOM   2188 O  O     . PHE A 1 306 ? 31.308 -43.489 -4.504  1.00 9.29  ? 307 PHE A O     1 
ATOM   2189 C  CB    . PHE A 1 306 ? 33.363 -40.923 -4.157  1.00 13.59 ? 307 PHE A CB    1 
ATOM   2190 C  CG    . PHE A 1 306 ? 34.410 -40.701 -3.115  1.00 12.21 ? 307 PHE A CG    1 
ATOM   2191 C  CD1   . PHE A 1 306 ? 35.697 -40.309 -3.479  1.00 10.27 ? 307 PHE A CD1   1 
ATOM   2192 C  CD2   . PHE A 1 306 ? 34.112 -40.893 -1.771  1.00 11.27 ? 307 PHE A CD2   1 
ATOM   2193 C  CE1   . PHE A 1 306 ? 36.677 -40.112 -2.518  1.00 10.74 ? 307 PHE A CE1   1 
ATOM   2194 C  CE2   . PHE A 1 306 ? 35.085 -40.699 -0.801  1.00 9.58  ? 307 PHE A CE2   1 
ATOM   2195 C  CZ    . PHE A 1 306 ? 36.375 -40.309 -1.176  1.00 9.17  ? 307 PHE A CZ    1 
ATOM   2196 N  N     . GLU A 1 307 ? 31.552 -42.209 -6.340  1.00 10.99 ? 308 GLU A N     1 
ATOM   2197 C  CA    . GLU A 1 307 ? 30.215 -42.546 -6.799  1.00 13.59 ? 308 GLU A CA    1 
ATOM   2198 C  C     . GLU A 1 307 ? 30.030 -44.030 -7.089  1.00 16.75 ? 308 GLU A C     1 
ATOM   2199 O  O     . GLU A 1 307 ? 28.938 -44.572 -6.926  1.00 17.11 ? 308 GLU A O     1 
ATOM   2200 C  CB    . GLU A 1 307 ? 29.825 -41.685 -7.986  1.00 15.14 ? 308 GLU A CB    1 
ATOM   2201 C  CG    . GLU A 1 307 ? 29.585 -40.248 -7.563  1.00 12.19 ? 308 GLU A CG    1 
ATOM   2202 C  CD    . GLU A 1 307 ? 29.064 -39.376 -8.682  1.00 20.32 ? 308 GLU A CD    1 
ATOM   2203 O  OE1   . GLU A 1 307 ? 28.893 -39.891 -9.804  1.00 23.14 ? 308 GLU A OE1   1 
ATOM   2204 O  OE2   . GLU A 1 307 ? 28.835 -38.170 -8.449  1.00 16.12 ? 308 GLU A OE2   1 
ATOM   2205 N  N     . ASP A 1 308 ? 31.125 -44.698 -7.424  1.00 15.75 ? 309 ASP A N     1 
ATOM   2206 C  CA    . ASP A 1 308 ? 31.095 -46.114 -7.723  1.00 17.39 ? 309 ASP A CA    1 
ATOM   2207 C  C     . ASP A 1 308 ? 30.799 -46.974 -6.500  1.00 17.54 ? 309 ASP A C     1 
ATOM   2208 O  O     . ASP A 1 308 ? 30.371 -48.115 -6.649  1.00 17.33 ? 309 ASP A O     1 
ATOM   2209 C  CB    . ASP A 1 308 ? 32.422 -46.544 -8.342  1.00 25.57 ? 309 ASP A CB    1 
ATOM   2210 C  CG    . ASP A 1 308 ? 32.395 -47.976 -8.819  1.00 37.59 ? 309 ASP A CG    1 
ATOM   2211 O  OD1   . ASP A 1 308 ? 31.573 -48.277 -9.715  1.00 44.21 ? 309 ASP A OD1   1 
ATOM   2212 O  OD2   . ASP A 1 308 ? 33.169 -48.808 -8.285  1.00 43.92 ? 309 ASP A OD2   1 
ATOM   2213 N  N     . LEU A 1 309 ? 31.005 -46.426 -5.298  1.00 16.25 ? 310 LEU A N     1 
ATOM   2214 C  CA    . LEU A 1 309 ? 30.770 -47.160 -4.040  1.00 16.33 ? 310 LEU A CA    1 
ATOM   2215 C  C     . LEU A 1 309 ? 29.289 -47.336 -3.727  1.00 16.29 ? 310 LEU A C     1 
ATOM   2216 O  O     . LEU A 1 309 ? 28.924 -48.168 -2.890  1.00 15.80 ? 310 LEU A O     1 
ATOM   2217 C  CB    . LEU A 1 309 ? 31.455 -46.456 -2.851  1.00 15.25 ? 310 LEU A CB    1 
ATOM   2218 C  CG    . LEU A 1 309 ? 32.983 -46.356 -2.818  1.00 10.58 ? 310 LEU A CG    1 
ATOM   2219 C  CD1   . LEU A 1 309 ? 33.421 -45.336 -1.790  1.00 10.43 ? 310 LEU A CD1   1 
ATOM   2220 C  CD2   . LEU A 1 309 ? 33.591 -47.706 -2.545  1.00 9.33  ? 310 LEU A CD2   1 
ATOM   2221 N  N     . ASN A 1 310 ? 28.457 -46.500 -4.344  1.00 13.87 ? 311 ASN A N     1 
ATOM   2222 C  CA    . ASN A 1 310 ? 27.017 -46.550 -4.159  1.00 18.32 ? 311 ASN A CA    1 
ATOM   2223 C  C     . ASN A 1 310 ? 26.560 -47.869 -4.758  1.00 23.66 ? 311 ASN A C     1 
ATOM   2224 O  O     . ASN A 1 310 ? 26.802 -48.124 -5.934  1.00 25.21 ? 311 ASN A O     1 
ATOM   2225 C  CB    . ASN A 1 310 ? 26.370 -45.374 -4.888  1.00 14.96 ? 311 ASN A CB    1 
ATOM   2226 C  CG    . ASN A 1 310 ? 24.853 -45.406 -4.852  1.00 18.42 ? 311 ASN A CG    1 
ATOM   2227 O  OD1   . ASN A 1 310 ? 24.241 -46.182 -4.113  1.00 19.89 ? 311 ASN A OD1   1 
ATOM   2228 N  ND2   . ASN A 1 310 ? 24.233 -44.557 -5.669  1.00 17.72 ? 311 ASN A ND2   1 
ATOM   2229 N  N     . LYS A 1 311 ? 25.961 -48.735 -3.945  1.00 27.94 ? 312 LYS A N     1 
ATOM   2230 C  CA    . LYS A 1 311 ? 25.508 -50.033 -4.441  1.00 34.40 ? 312 LYS A CA    1 
ATOM   2231 C  C     . LYS A 1 311 ? 24.094 -50.056 -5.017  1.00 36.11 ? 312 LYS A C     1 
ATOM   2232 O  O     . LYS A 1 311 ? 23.723 -50.993 -5.721  1.00 37.34 ? 312 LYS A O     1 
ATOM   2233 C  CB    . LYS A 1 311 ? 25.683 -51.114 -3.373  1.00 35.23 ? 312 LYS A CB    1 
ATOM   2234 C  CG    . LYS A 1 311 ? 27.050 -51.770 -3.433  1.00 38.13 ? 312 LYS A CG    1 
ATOM   2235 C  CD    . LYS A 1 311 ? 27.358 -52.625 -2.217  1.00 42.25 ? 312 LYS A CD    1 
ATOM   2236 C  CE    . LYS A 1 311 ? 27.757 -51.779 -1.020  1.00 46.90 ? 312 LYS A CE    1 
ATOM   2237 N  NZ    . LYS A 1 311 ? 28.428 -52.575 0.048   1.00 49.62 ? 312 LYS A NZ    1 
ATOM   2238 N  N     . ARG A 1 312 ? 23.330 -49.003 -4.758  1.00 38.95 ? 313 ARG A N     1 
ATOM   2239 C  CA    . ARG A 1 312 ? 21.958 -48.897 -5.243  1.00 43.69 ? 313 ARG A CA    1 
ATOM   2240 C  C     . ARG A 1 312 ? 21.899 -47.867 -6.376  1.00 42.61 ? 313 ARG A C     1 
ATOM   2241 O  O     . ARG A 1 312 ? 20.939 -47.100 -6.472  1.00 39.42 ? 313 ARG A O     1 
ATOM   2242 C  CB    . ARG A 1 312 ? 21.059 -48.437 -4.097  1.00 50.05 ? 313 ARG A CB    1 
ATOM   2243 C  CG    . ARG A 1 312 ? 21.395 -49.083 -2.765  1.00 62.51 ? 313 ARG A CG    1 
ATOM   2244 C  CD    . ARG A 1 312 ? 20.724 -48.367 -1.600  1.00 71.52 ? 313 ARG A CD    1 
ATOM   2245 N  NE    . ARG A 1 312 ? 21.047 -49.021 -0.332  1.00 80.47 ? 313 ARG A NE    1 
ATOM   2246 C  CZ    . ARG A 1 312 ? 20.498 -48.712 0.840   1.00 83.83 ? 313 ARG A CZ    1 
ATOM   2247 N  NH1   . ARG A 1 312 ? 19.590 -47.747 0.917   1.00 86.12 ? 313 ARG A NH1   1 
ATOM   2248 N  NH2   . ARG A 1 312 ? 20.844 -49.386 1.935   1.00 85.08 ? 313 ARG A NH2   1 
ATOM   2249 N  N     . LYS A 1 313 ? 22.909 -47.875 -7.243  1.00 42.16 ? 314 LYS A N     1 
ATOM   2250 C  CA    . LYS A 1 313 ? 22.999 -46.921 -8.344  1.00 47.19 ? 314 LYS A CA    1 
ATOM   2251 C  C     . LYS A 1 313 ? 21.727 -46.593 -9.130  1.00 49.21 ? 314 LYS A C     1 
ATOM   2252 O  O     . LYS A 1 313 ? 21.603 -45.482 -9.649  1.00 52.31 ? 314 LYS A O     1 
ATOM   2253 C  CB    . LYS A 1 313 ? 24.109 -47.320 -9.311  1.00 50.19 ? 314 LYS A CB    1 
ATOM   2254 C  CG    . LYS A 1 313 ? 25.461 -46.745 -8.965  1.00 55.41 ? 314 LYS A CG    1 
ATOM   2255 C  CD    . LYS A 1 313 ? 26.497 -47.125 -10.017 1.00 61.78 ? 314 LYS A CD    1 
ATOM   2256 C  CE    . LYS A 1 313 ? 27.844 -46.461 -9.731  1.00 66.08 ? 314 LYS A CE    1 
ATOM   2257 N  NZ    . LYS A 1 313 ? 28.917 -46.860 -10.694 1.00 68.91 ? 314 LYS A NZ    1 
ATOM   2258 N  N     . ASP A 1 314 ? 20.800 -47.545 -9.249  1.00 48.41 ? 315 ASP A N     1 
ATOM   2259 C  CA    . ASP A 1 314 ? 19.548 -47.300 -9.981  1.00 47.03 ? 315 ASP A CA    1 
ATOM   2260 C  C     . ASP A 1 314 ? 18.465 -46.706 -9.093  1.00 43.07 ? 315 ASP A C     1 
ATOM   2261 O  O     . ASP A 1 314 ? 17.594 -45.985 -9.565  1.00 40.80 ? 315 ASP A O     1 
ATOM   2262 C  CB    . ASP A 1 314 ? 18.995 -48.594 -10.605 1.00 51.42 ? 315 ASP A CB    1 
ATOM   2263 C  CG    . ASP A 1 314 ? 19.789 -49.059 -11.820 1.00 54.50 ? 315 ASP A CG    1 
ATOM   2264 O  OD1   . ASP A 1 314 ? 20.152 -48.216 -12.672 1.00 54.67 ? 315 ASP A OD1   1 
ATOM   2265 O  OD2   . ASP A 1 314 ? 20.037 -50.280 -11.930 1.00 55.85 ? 315 ASP A OD2   1 
ATOM   2266 N  N     . THR A 1 315 ? 18.522 -47.010 -7.807  1.00 39.84 ? 316 THR A N     1 
ATOM   2267 C  CA    . THR A 1 315 ? 17.504 -46.531 -6.897  1.00 39.60 ? 316 THR A CA    1 
ATOM   2268 C  C     . THR A 1 315 ? 17.979 -45.485 -5.896  1.00 39.91 ? 316 THR A C     1 
ATOM   2269 O  O     . THR A 1 315 ? 17.192 -45.046 -5.044  1.00 42.09 ? 316 THR A O     1 
ATOM   2270 C  CB    . THR A 1 315 ? 16.815 -47.720 -6.142  1.00 39.91 ? 316 THR A CB    1 
ATOM   2271 O  OG1   . THR A 1 315 ? 17.784 -48.462 -5.392  1.00 35.11 ? 316 THR A OG1   1 
ATOM   2272 C  CG2   . THR A 1 315 ? 16.132 -48.661 -7.126  1.00 39.66 ? 316 THR A CG2   1 
ATOM   2273 N  N     . LYS A 1 316 ? 19.252 -45.095 -5.969  1.00 35.97 ? 317 LYS A N     1 
ATOM   2274 C  CA    . LYS A 1 316 ? 19.777 -44.092 -5.039  1.00 31.49 ? 317 LYS A CA    1 
ATOM   2275 C  C     . LYS A 1 316 ? 20.723 -43.127 -5.735  1.00 27.49 ? 317 LYS A C     1 
ATOM   2276 O  O     . LYS A 1 316 ? 21.734 -43.522 -6.299  1.00 28.78 ? 317 LYS A O     1 
ATOM   2277 C  CB    . LYS A 1 316 ? 20.463 -44.764 -3.833  1.00 31.01 ? 317 LYS A CB    1 
ATOM   2278 C  CG    . LYS A 1 316 ? 20.906 -43.784 -2.742  1.00 31.58 ? 317 LYS A CG    1 
ATOM   2279 C  CD    . LYS A 1 316 ? 21.017 -44.462 -1.377  1.00 31.52 ? 317 LYS A CD    1 
ATOM   2280 C  CE    . LYS A 1 316 ? 21.245 -43.448 -0.253  1.00 25.77 ? 317 LYS A CE    1 
ATOM   2281 N  NZ    . LYS A 1 316 ? 20.169 -42.413 -0.174  1.00 23.52 ? 317 LYS A NZ    1 
ATOM   2282 N  N     . GLU A 1 317 ? 20.375 -41.855 -5.691  1.00 26.07 ? 318 GLU A N     1 
ATOM   2283 C  CA    . GLU A 1 317 ? 21.159 -40.804 -6.318  1.00 27.84 ? 318 GLU A CA    1 
ATOM   2284 C  C     . GLU A 1 317 ? 22.153 -40.153 -5.358  1.00 26.44 ? 318 GLU A C     1 
ATOM   2285 O  O     . GLU A 1 317 ? 21.931 -40.122 -4.153  1.00 28.75 ? 318 GLU A O     1 
ATOM   2286 C  CB    . GLU A 1 317 ? 20.206 -39.729 -6.824  1.00 31.83 ? 318 GLU A CB    1 
ATOM   2287 C  CG    . GLU A 1 317 ? 19.940 -39.764 -8.303  1.00 41.37 ? 318 GLU A CG    1 
ATOM   2288 C  CD    . GLU A 1 317 ? 21.058 -39.121 -9.083  1.00 46.94 ? 318 GLU A CD    1 
ATOM   2289 O  OE1   . GLU A 1 317 ? 21.135 -37.865 -9.074  1.00 47.96 ? 318 GLU A OE1   1 
ATOM   2290 O  OE2   . GLU A 1 317 ? 21.862 -39.875 -9.684  1.00 51.61 ? 318 GLU A OE2   1 
ATOM   2291 N  N     . ILE A 1 318 ? 23.266 -39.669 -5.888  1.00 22.07 ? 319 ILE A N     1 
ATOM   2292 C  CA    . ILE A 1 318 ? 24.244 -38.969 -5.080  1.00 18.38 ? 319 ILE A CA    1 
ATOM   2293 C  C     . ILE A 1 318 ? 24.427 -37.641 -5.778  1.00 17.02 ? 319 ILE A C     1 
ATOM   2294 O  O     . ILE A 1 318 ? 24.567 -37.597 -6.992  1.00 20.22 ? 319 ILE A O     1 
ATOM   2295 C  CB    . ILE A 1 318 ? 25.574 -39.705 -5.016  1.00 19.56 ? 319 ILE A CB    1 
ATOM   2296 C  CG1   . ILE A 1 318 ? 25.408 -40.996 -4.219  1.00 18.61 ? 319 ILE A CG1   1 
ATOM   2297 C  CG2   . ILE A 1 318 ? 26.628 -38.817 -4.370  1.00 17.93 ? 319 ILE A CG2   1 
ATOM   2298 C  CD1   . ILE A 1 318 ? 26.653 -41.843 -4.176  1.00 21.04 ? 319 ILE A CD1   1 
ATOM   2299 N  N     . TYR A 1 319 ? 24.316 -36.554 -5.031  1.00 17.64 ? 320 TYR A N     1 
ATOM   2300 C  CA    . TYR A 1 319 ? 24.478 -35.216 -5.589  1.00 18.15 ? 320 TYR A CA    1 
ATOM   2301 C  C     . TYR A 1 319 ? 25.878 -34.727 -5.251  1.00 18.96 ? 320 TYR A C     1 
ATOM   2302 O  O     . TYR A 1 319 ? 26.170 -34.413 -4.095  1.00 15.50 ? 320 TYR A O     1 
ATOM   2303 C  CB    . TYR A 1 319 ? 23.432 -34.270 -4.999  1.00 21.90 ? 320 TYR A CB    1 
ATOM   2304 C  CG    . TYR A 1 319 ? 22.044 -34.817 -5.150  1.00 26.49 ? 320 TYR A CG    1 
ATOM   2305 C  CD1   . TYR A 1 319 ? 21.372 -34.707 -6.366  1.00 29.91 ? 320 TYR A CD1   1 
ATOM   2306 C  CD2   . TYR A 1 319 ? 21.430 -35.520 -4.111  1.00 26.57 ? 320 TYR A CD2   1 
ATOM   2307 C  CE1   . TYR A 1 319 ? 20.121 -35.291 -6.555  1.00 30.84 ? 320 TYR A CE1   1 
ATOM   2308 C  CE2   . TYR A 1 319 ? 20.182 -36.107 -4.287  1.00 32.39 ? 320 TYR A CE2   1 
ATOM   2309 C  CZ    . TYR A 1 319 ? 19.535 -35.987 -5.520  1.00 31.33 ? 320 TYR A CZ    1 
ATOM   2310 O  OH    . TYR A 1 319 ? 18.312 -36.564 -5.738  1.00 34.56 ? 320 TYR A OH    1 
ATOM   2311 N  N     . THR A 1 320 ? 26.731 -34.638 -6.265  1.00 17.84 ? 321 THR A N     1 
ATOM   2312 C  CA    . THR A 1 320 ? 28.117 -34.222 -6.076  1.00 15.80 ? 321 THR A CA    1 
ATOM   2313 C  C     . THR A 1 320 ? 28.409 -32.769 -6.445  1.00 15.31 ? 321 THR A C     1 
ATOM   2314 O  O     . THR A 1 320 ? 27.903 -32.257 -7.438  1.00 13.59 ? 321 THR A O     1 
ATOM   2315 C  CB    . THR A 1 320 ? 29.057 -35.168 -6.863  1.00 16.32 ? 321 THR A CB    1 
ATOM   2316 O  OG1   . THR A 1 320 ? 28.811 -36.512 -6.447  1.00 16.42 ? 321 THR A OG1   1 
ATOM   2317 C  CG2   . THR A 1 320 ? 30.520 -34.840 -6.615  1.00 14.24 ? 321 THR A CG2   1 
ATOM   2318 N  N     . HIS A 1 321 ? 29.162 -32.090 -5.583  1.00 12.19 ? 322 HIS A N     1 
ATOM   2319 C  CA    . HIS A 1 321 ? 29.568 -30.713 -5.805  1.00 10.05 ? 322 HIS A CA    1 
ATOM   2320 C  C     . HIS A 1 321 ? 31.039 -30.599 -5.401  1.00 8.92  ? 322 HIS A C     1 
ATOM   2321 O  O     . HIS A 1 321 ? 31.487 -31.305 -4.500  1.00 10.44 ? 322 HIS A O     1 
ATOM   2322 C  CB    . HIS A 1 321 ? 28.733 -29.761 -4.956  1.00 11.12 ? 322 HIS A CB    1 
ATOM   2323 C  CG    . HIS A 1 321 ? 27.301 -29.658 -5.384  1.00 14.39 ? 322 HIS A CG    1 
ATOM   2324 N  ND1   . HIS A 1 321 ? 26.863 -28.727 -6.301  1.00 15.56 ? 322 HIS A ND1   1 
ATOM   2325 C  CD2   . HIS A 1 321 ? 26.203 -30.355 -5.006  1.00 13.87 ? 322 HIS A CD2   1 
ATOM   2326 C  CE1   . HIS A 1 321 ? 25.559 -28.851 -6.468  1.00 15.15 ? 322 HIS A CE1   1 
ATOM   2327 N  NE2   . HIS A 1 321 ? 25.134 -29.834 -5.695  1.00 16.97 ? 322 HIS A NE2   1 
ATOM   2328 N  N     . PHE A 1 322 ? 31.795 -29.788 -6.136  1.00 8.58  ? 323 PHE A N     1 
ATOM   2329 C  CA    . PHE A 1 322 ? 33.218 -29.535 -5.889  1.00 9.36  ? 323 PHE A CA    1 
ATOM   2330 C  C     . PHE A 1 322 ? 33.232 -28.178 -5.212  1.00 11.81 ? 323 PHE A C     1 
ATOM   2331 O  O     . PHE A 1 322 ? 32.685 -27.206 -5.751  1.00 10.99 ? 323 PHE A O     1 
ATOM   2332 C  CB    . PHE A 1 322 ? 34.013 -29.494 -7.211  1.00 9.75  ? 323 PHE A CB    1 
ATOM   2333 C  CG    . PHE A 1 322 ? 34.167 -30.849 -7.863  1.00 10.15 ? 323 PHE A CG    1 
ATOM   2334 C  CD1   . PHE A 1 322 ? 33.084 -31.461 -8.506  1.00 11.57 ? 323 PHE A CD1   1 
ATOM   2335 C  CD2   . PHE A 1 322 ? 35.371 -31.540 -7.784  1.00 9.51  ? 323 PHE A CD2   1 
ATOM   2336 C  CE1   . PHE A 1 322 ? 33.206 -32.740 -9.050  1.00 9.57  ? 323 PHE A CE1   1 
ATOM   2337 C  CE2   . PHE A 1 322 ? 35.498 -32.811 -8.324  1.00 6.29  ? 323 PHE A CE2   1 
ATOM   2338 C  CZ    . PHE A 1 322 ? 34.417 -33.409 -8.953  1.00 7.87  ? 323 PHE A CZ    1 
ATOM   2339 N  N     . THR A 1 323 ? 33.875 -28.105 -4.049  1.00 8.52  ? 324 THR A N     1 
ATOM   2340 C  CA    . THR A 1 323 ? 33.852 -26.881 -3.283  1.00 6.73  ? 324 THR A CA    1 
ATOM   2341 C  C     . THR A 1 323 ? 35.159 -26.405 -2.701  1.00 5.87  ? 324 THR A C     1 
ATOM   2342 O  O     . THR A 1 323 ? 36.164 -27.118 -2.684  1.00 7.50  ? 324 THR A O     1 
ATOM   2343 C  CB    . THR A 1 323 ? 32.879 -27.038 -2.068  1.00 7.47  ? 324 THR A CB    1 
ATOM   2344 O  OG1   . THR A 1 323 ? 33.332 -28.106 -1.220  1.00 6.99  ? 324 THR A OG1   1 
ATOM   2345 C  CG2   . THR A 1 323 ? 31.469 -27.382 -2.524  1.00 7.45  ? 324 THR A CG2   1 
ATOM   2346 N  N     . CYS A 1 324 ? 35.150 -25.134 -2.333  1.00 6.51  ? 325 CYS A N     1 
ATOM   2347 C  CA    . CYS A 1 324 ? 36.256 -24.526 -1.622  1.00 9.54  ? 325 CYS A CA    1 
ATOM   2348 C  C     . CYS A 1 324 ? 35.509 -23.945 -0.415  1.00 9.15  ? 325 CYS A C     1 
ATOM   2349 O  O     . CYS A 1 324 ? 34.923 -22.854 -0.503  1.00 9.94  ? 325 CYS A O     1 
ATOM   2350 C  CB    . CYS A 1 324 ? 36.939 -23.416 -2.410  1.00 8.85  ? 325 CYS A CB    1 
ATOM   2351 S  SG    . CYS A 1 324 ? 38.219 -22.624 -1.386  1.00 11.50 ? 325 CYS A SG    1 
ATOM   2352 N  N     . ALA A 1 325 ? 35.485 -24.712 0.681   1.00 9.35  ? 326 ALA A N     1 
ATOM   2353 C  CA    . ALA A 1 325 ? 34.778 -24.338 1.925   1.00 9.16  ? 326 ALA A CA    1 
ATOM   2354 C  C     . ALA A 1 325 ? 35.095 -22.970 2.520   1.00 9.42  ? 326 ALA A C     1 
ATOM   2355 O  O     . ALA A 1 325 ? 34.247 -22.380 3.203   1.00 13.27 ? 326 ALA A O     1 
ATOM   2356 C  CB    . ALA A 1 325 ? 34.939 -25.438 3.011   1.00 8.01  ? 326 ALA A CB    1 
ATOM   2357 N  N     . THR A 1 326 ? 36.284 -22.447 2.238   1.00 6.34  ? 327 THR A N     1 
ATOM   2358 C  CA    . THR A 1 326 ? 36.694 -21.161 2.767   1.00 8.10  ? 327 THR A CA    1 
ATOM   2359 C  C     . THR A 1 326 ? 36.243 -20.009 1.860   1.00 13.68 ? 327 THR A C     1 
ATOM   2360 O  O     . THR A 1 326 ? 36.335 -18.838 2.240   1.00 14.54 ? 327 THR A O     1 
ATOM   2361 C  CB    . THR A 1 326 ? 38.212 -21.132 2.946   1.00 8.89  ? 327 THR A CB    1 
ATOM   2362 O  OG1   . THR A 1 326 ? 38.827 -21.694 1.782   1.00 10.52 ? 327 THR A OG1   1 
ATOM   2363 C  CG2   . THR A 1 326 ? 38.638 -21.967 4.152   1.00 6.17  ? 327 THR A CG2   1 
ATOM   2364 N  N     . ASP A 1 327 ? 35.731 -20.349 0.674   1.00 12.62 ? 328 ASP A N     1 
ATOM   2365 C  CA    . ASP A 1 327 ? 35.283 -19.363 -0.309  1.00 11.90 ? 328 ASP A CA    1 
ATOM   2366 C  C     . ASP A 1 327 ? 33.779 -19.164 -0.128  1.00 9.68  ? 328 ASP A C     1 
ATOM   2367 O  O     . ASP A 1 327 ? 32.983 -20.005 -0.528  1.00 7.75  ? 328 ASP A O     1 
ATOM   2368 C  CB    . ASP A 1 327 ? 35.599 -19.880 -1.711  1.00 13.68 ? 328 ASP A CB    1 
ATOM   2369 C  CG    . ASP A 1 327 ? 35.361 -18.849 -2.800  1.00 15.83 ? 328 ASP A CG    1 
ATOM   2370 O  OD1   . ASP A 1 327 ? 34.583 -17.901 -2.605  1.00 16.93 ? 328 ASP A OD1   1 
ATOM   2371 O  OD2   . ASP A 1 327 ? 35.949 -19.012 -3.884  1.00 21.49 ? 328 ASP A OD2   1 
ATOM   2372 N  N     . THR A 1 328 ? 33.396 -18.035 0.457   1.00 9.95  ? 329 THR A N     1 
ATOM   2373 C  CA    . THR A 1 328 ? 31.987 -17.751 0.732   1.00 9.32  ? 329 THR A CA    1 
ATOM   2374 C  C     . THR A 1 328 ? 31.092 -17.721 -0.519  1.00 11.69 ? 329 THR A C     1 
ATOM   2375 O  O     . THR A 1 328 ? 29.990 -18.268 -0.507  1.00 10.52 ? 329 THR A O     1 
ATOM   2376 C  CB    . THR A 1 328 ? 31.846 -16.421 1.515   1.00 12.22 ? 329 THR A CB    1 
ATOM   2377 O  OG1   . THR A 1 328 ? 32.599 -16.503 2.728   1.00 12.65 ? 329 THR A OG1   1 
ATOM   2378 C  CG2   . THR A 1 328 ? 30.397 -16.136 1.847   1.00 9.13  ? 329 THR A CG2   1 
ATOM   2379 N  N     . LYS A 1 329 ? 31.573 -17.115 -1.604  1.00 12.80 ? 330 LYS A N     1 
ATOM   2380 C  CA    . LYS A 1 329 ? 30.774 -17.047 -2.825  1.00 13.64 ? 330 LYS A CA    1 
ATOM   2381 C  C     . LYS A 1 329 ? 30.527 -18.437 -3.389  1.00 11.46 ? 330 LYS A C     1 
ATOM   2382 O  O     . LYS A 1 329 ? 29.425 -18.744 -3.813  1.00 13.35 ? 330 LYS A O     1 
ATOM   2383 C  CB    . LYS A 1 329 ? 31.444 -16.155 -3.877  1.00 18.68 ? 330 LYS A CB    1 
ATOM   2384 C  CG    . LYS A 1 329 ? 30.469 -15.710 -4.993  1.00 27.37 ? 330 LYS A CG    1 
ATOM   2385 C  CD    . LYS A 1 329 ? 31.153 -14.905 -6.110  1.00 31.40 ? 330 LYS A CD    1 
ATOM   2386 C  CE    . LYS A 1 329 ? 31.928 -15.827 -7.043  1.00 35.08 ? 330 LYS A CE    1 
ATOM   2387 N  NZ    . LYS A 1 329 ? 32.711 -15.145 -8.101  1.00 37.59 ? 330 LYS A NZ    1 
ATOM   2388 N  N     . ASN A 1 330 ? 31.541 -19.295 -3.341  1.00 11.15 ? 331 ASN A N     1 
ATOM   2389 C  CA    . ASN A 1 330 ? 31.419 -20.657 -3.858  1.00 12.38 ? 331 ASN A CA    1 
ATOM   2390 C  C     . ASN A 1 330 ? 30.390 -21.451 -3.088  1.00 13.34 ? 331 ASN A C     1 
ATOM   2391 O  O     . ASN A 1 330 ? 29.537 -22.118 -3.680  1.00 13.87 ? 331 ASN A O     1 
ATOM   2392 C  CB    . ASN A 1 330 ? 32.776 -21.369 -3.794  1.00 12.57 ? 331 ASN A CB    1 
ATOM   2393 C  CG    . ASN A 1 330 ? 32.691 -22.835 -4.172  1.00 14.55 ? 331 ASN A CG    1 
ATOM   2394 O  OD1   . ASN A 1 330 ? 32.918 -23.717 -3.337  1.00 15.92 ? 331 ASN A OD1   1 
ATOM   2395 N  ND2   . ASN A 1 330 ? 32.401 -23.109 -5.443  1.00 15.08 ? 331 ASN A ND2   1 
ATOM   2396 N  N     . VAL A 1 331 ? 30.509 -21.400 -1.760  1.00 13.52 ? 332 VAL A N     1 
ATOM   2397 C  CA    . VAL A 1 331 ? 29.615 -22.100 -0.844  1.00 9.10  ? 332 VAL A CA    1 
ATOM   2398 C  C     . VAL A 1 331 ? 28.197 -21.547 -0.945  1.00 10.03 ? 332 VAL A C     1 
ATOM   2399 O  O     . VAL A 1 331 ? 27.225 -22.303 -0.903  1.00 12.71 ? 332 VAL A O     1 
ATOM   2400 C  CB    . VAL A 1 331 ? 30.144 -22.014 0.596   1.00 9.93  ? 332 VAL A CB    1 
ATOM   2401 C  CG1   . VAL A 1 331 ? 29.129 -22.566 1.578   1.00 7.45  ? 332 VAL A CG1   1 
ATOM   2402 C  CG2   . VAL A 1 331 ? 31.440 -22.780 0.688   1.00 5.25  ? 332 VAL A CG2   1 
ATOM   2403 N  N     . GLN A 1 332 ? 28.069 -20.241 -1.139  1.00 12.12 ? 333 GLN A N     1 
ATOM   2404 C  CA    . GLN A 1 332 ? 26.752 -19.639 -1.292  1.00 14.29 ? 333 GLN A CA    1 
ATOM   2405 C  C     . GLN A 1 332 ? 25.975 -20.241 -2.484  1.00 12.90 ? 333 GLN A C     1 
ATOM   2406 O  O     . GLN A 1 332 ? 24.820 -20.650 -2.356  1.00 12.82 ? 333 GLN A O     1 
ATOM   2407 C  CB    . GLN A 1 332 ? 26.904 -18.147 -1.488  1.00 16.84 ? 333 GLN A CB    1 
ATOM   2408 C  CG    . GLN A 1 332 ? 25.588 -17.443 -1.682  1.00 25.46 ? 333 GLN A CG    1 
ATOM   2409 C  CD    . GLN A 1 332 ? 25.750 -15.950 -1.700  1.00 35.55 ? 333 GLN A CD    1 
ATOM   2410 O  OE1   . GLN A 1 332 ? 26.832 -15.423 -1.423  1.00 43.40 ? 333 GLN A OE1   1 
ATOM   2411 N  NE2   . GLN A 1 332 ? 24.674 -15.245 -2.020  1.00 41.46 ? 333 GLN A NE2   1 
ATOM   2412 N  N     . PHE A 1 333 ? 26.607 -20.272 -3.649  1.00 12.99 ? 334 PHE A N     1 
ATOM   2413 C  CA    . PHE A 1 333 ? 25.974 -20.826 -4.839  1.00 14.44 ? 334 PHE A CA    1 
ATOM   2414 C  C     . PHE A 1 333 ? 25.733 -22.315 -4.771  1.00 15.21 ? 334 PHE A C     1 
ATOM   2415 O  O     . PHE A 1 333 ? 24.700 -22.796 -5.237  1.00 18.29 ? 334 PHE A O     1 
ATOM   2416 C  CB    . PHE A 1 333 ? 26.790 -20.473 -6.068  1.00 16.40 ? 334 PHE A CB    1 
ATOM   2417 C  CG    . PHE A 1 333 ? 26.665 -19.050 -6.443  1.00 18.97 ? 334 PHE A CG    1 
ATOM   2418 C  CD1   . PHE A 1 333 ? 27.506 -18.103 -5.891  1.00 21.19 ? 334 PHE A CD1   1 
ATOM   2419 C  CD2   . PHE A 1 333 ? 25.646 -18.639 -7.286  1.00 24.78 ? 334 PHE A CD2   1 
ATOM   2420 C  CE1   . PHE A 1 333 ? 27.341 -16.758 -6.162  1.00 24.44 ? 334 PHE A CE1   1 
ATOM   2421 C  CE2   . PHE A 1 333 ? 25.467 -17.290 -7.568  1.00 26.48 ? 334 PHE A CE2   1 
ATOM   2422 C  CZ    . PHE A 1 333 ? 26.322 -16.348 -6.999  1.00 26.31 ? 334 PHE A CZ    1 
ATOM   2423 N  N     . VAL A 1 334 ? 26.687 -23.058 -4.221  1.00 13.60 ? 335 VAL A N     1 
ATOM   2424 C  CA    . VAL A 1 334 ? 26.526 -24.501 -4.075  1.00 12.88 ? 335 VAL A CA    1 
ATOM   2425 C  C     . VAL A 1 334 ? 25.362 -24.814 -3.113  1.00 16.32 ? 335 VAL A C     1 
ATOM   2426 O  O     . VAL A 1 334 ? 24.565 -25.739 -3.364  1.00 18.47 ? 335 VAL A O     1 
ATOM   2427 C  CB    . VAL A 1 334 ? 27.838 -25.159 -3.580  1.00 10.74 ? 335 VAL A CB    1 
ATOM   2428 C  CG1   . VAL A 1 334 ? 27.606 -26.603 -3.136  1.00 7.86  ? 335 VAL A CG1   1 
ATOM   2429 C  CG2   . VAL A 1 334 ? 28.853 -25.144 -4.697  1.00 10.83 ? 335 VAL A CG2   1 
ATOM   2430 N  N     . PHE A 1 335 ? 25.246 -24.043 -2.028  1.00 14.81 ? 336 PHE A N     1 
ATOM   2431 C  CA    . PHE A 1 335 ? 24.172 -24.272 -1.065  1.00 13.76 ? 336 PHE A CA    1 
ATOM   2432 C  C     . PHE A 1 335 ? 22.815 -23.935 -1.673  1.00 14.71 ? 336 PHE A C     1 
ATOM   2433 O  O     . PHE A 1 335 ? 21.806 -24.541 -1.335  1.00 14.02 ? 336 PHE A O     1 
ATOM   2434 C  CB    . PHE A 1 335 ? 24.385 -23.480 0.222   1.00 12.84 ? 336 PHE A CB    1 
ATOM   2435 C  CG    . PHE A 1 335 ? 23.543 -23.973 1.357   1.00 13.92 ? 336 PHE A CG    1 
ATOM   2436 C  CD1   . PHE A 1 335 ? 23.812 -25.204 1.948   1.00 13.76 ? 336 PHE A CD1   1 
ATOM   2437 C  CD2   . PHE A 1 335 ? 22.441 -23.252 1.791   1.00 14.63 ? 336 PHE A CD2   1 
ATOM   2438 C  CE1   . PHE A 1 335 ? 22.996 -25.711 2.943   1.00 10.67 ? 336 PHE A CE1   1 
ATOM   2439 C  CE2   . PHE A 1 335 ? 21.618 -23.759 2.792   1.00 12.52 ? 336 PHE A CE2   1 
ATOM   2440 C  CZ    . PHE A 1 335 ? 21.903 -24.991 3.360   1.00 10.63 ? 336 PHE A CZ    1 
ATOM   2441 N  N     . ASP A 1 336 ? 22.793 -22.923 -2.527  1.00 15.37 ? 337 ASP A N     1 
ATOM   2442 C  CA    . ASP A 1 336 ? 21.583 -22.533 -3.240  1.00 20.56 ? 337 ASP A CA    1 
ATOM   2443 C  C     . ASP A 1 336 ? 21.107 -23.767 -4.013  1.00 20.96 ? 337 ASP A C     1 
ATOM   2444 O  O     . ASP A 1 336 ? 19.980 -24.235 -3.856  1.00 20.90 ? 337 ASP A O     1 
ATOM   2445 C  CB    . ASP A 1 336 ? 21.946 -21.457 -4.253  1.00 26.52 ? 337 ASP A CB    1 
ATOM   2446 C  CG    . ASP A 1 336 ? 21.012 -20.297 -4.227  1.00 34.37 ? 337 ASP A CG    1 
ATOM   2447 O  OD1   . ASP A 1 336 ? 19.784 -20.511 -4.269  1.00 36.84 ? 337 ASP A OD1   1 
ATOM   2448 O  OD2   . ASP A 1 336 ? 21.523 -19.156 -4.178  1.00 43.97 ? 337 ASP A OD2   1 
ATOM   2449 N  N     . ALA A 1 337 ? 21.999 -24.295 -4.842  1.00 21.84 ? 338 ALA A N     1 
ATOM   2450 C  CA    . ALA A 1 337 ? 21.724 -25.472 -5.657  1.00 22.29 ? 338 ALA A CA    1 
ATOM   2451 C  C     . ALA A 1 337 ? 21.296 -26.649 -4.808  1.00 22.54 ? 338 ALA A C     1 
ATOM   2452 O  O     . ALA A 1 337 ? 20.354 -27.365 -5.144  1.00 22.59 ? 338 ALA A O     1 
ATOM   2453 C  CB    . ALA A 1 337 ? 22.959 -25.842 -6.470  1.00 23.93 ? 338 ALA A CB    1 
ATOM   2454 N  N     . VAL A 1 338 ? 22.003 -26.868 -3.711  1.00 24.24 ? 339 VAL A N     1 
ATOM   2455 C  CA    . VAL A 1 338 ? 21.668 -27.973 -2.819  1.00 26.04 ? 339 VAL A CA    1 
ATOM   2456 C  C     . VAL A 1 338 ? 20.271 -27.833 -2.213  1.00 25.70 ? 339 VAL A C     1 
ATOM   2457 O  O     . VAL A 1 338 ? 19.521 -28.802 -2.185  1.00 24.62 ? 339 VAL A O     1 
ATOM   2458 C  CB    . VAL A 1 338 ? 22.721 -28.142 -1.678  1.00 27.19 ? 339 VAL A CB    1 
ATOM   2459 C  CG1   . VAL A 1 338 ? 22.165 -29.031 -0.563  1.00 27.48 ? 339 VAL A CG1   1 
ATOM   2460 C  CG2   . VAL A 1 338 ? 23.995 -28.767 -2.231  1.00 25.29 ? 339 VAL A CG2   1 
ATOM   2461 N  N     . THR A 1 339 ? 19.911 -26.641 -1.742  1.00 25.34 ? 340 THR A N     1 
ATOM   2462 C  CA    . THR A 1 339 ? 18.597 -26.473 -1.127  1.00 27.58 ? 340 THR A CA    1 
ATOM   2463 C  C     . THR A 1 339 ? 17.458 -26.710 -2.107  1.00 29.20 ? 340 THR A C     1 
ATOM   2464 O  O     . THR A 1 339 ? 16.389 -27.142 -1.701  1.00 26.91 ? 340 THR A O     1 
ATOM   2465 C  CB    . THR A 1 339 ? 18.434 -25.140 -0.337  1.00 26.26 ? 340 THR A CB    1 
ATOM   2466 O  OG1   . THR A 1 339 ? 18.755 -24.025 -1.165  1.00 28.27 ? 340 THR A OG1   1 
ATOM   2467 C  CG2   . THR A 1 339 ? 19.356 -25.135 0.875   1.00 25.82 ? 340 THR A CG2   1 
ATOM   2468 N  N     . ASP A 1 340 ? 17.699 -26.459 -3.393  1.00 30.51 ? 341 ASP A N     1 
ATOM   2469 C  CA    . ASP A 1 340 ? 16.684 -26.730 -4.404  1.00 36.35 ? 341 ASP A CA    1 
ATOM   2470 C  C     . ASP A 1 340 ? 16.520 -28.247 -4.493  1.00 39.22 ? 341 ASP A C     1 
ATOM   2471 O  O     . ASP A 1 340 ? 15.420 -28.749 -4.698  1.00 44.51 ? 341 ASP A O     1 
ATOM   2472 C  CB    . ASP A 1 340 ? 17.071 -26.141 -5.761  1.00 37.85 ? 341 ASP A CB    1 
ATOM   2473 C  CG    . ASP A 1 340 ? 16.965 -24.620 -5.789  1.00 43.09 ? 341 ASP A CG    1 
ATOM   2474 O  OD1   . ASP A 1 340 ? 16.334 -24.040 -4.870  1.00 45.25 ? 341 ASP A OD1   1 
ATOM   2475 O  OD2   . ASP A 1 340 ? 17.514 -24.003 -6.732  1.00 46.29 ? 341 ASP A OD2   1 
ATOM   2476 N  N     . VAL A 1 341 ? 17.617 -28.976 -4.344  1.00 38.99 ? 342 VAL A N     1 
ATOM   2477 C  CA    . VAL A 1 341 ? 17.563 -30.428 -4.361  1.00 39.25 ? 342 VAL A CA    1 
ATOM   2478 C  C     . VAL A 1 341 ? 16.776 -30.894 -3.123  1.00 40.87 ? 342 VAL A C     1 
ATOM   2479 O  O     . VAL A 1 341 ? 16.224 -31.999 -3.102  1.00 41.16 ? 342 VAL A O     1 
ATOM   2480 C  CB    . VAL A 1 341 ? 18.987 -31.012 -4.328  1.00 41.51 ? 342 VAL A CB    1 
ATOM   2481 C  CG1   . VAL A 1 341 ? 18.952 -32.533 -4.199  1.00 44.25 ? 342 VAL A CG1   1 
ATOM   2482 C  CG2   . VAL A 1 341 ? 19.741 -30.592 -5.574  1.00 42.48 ? 342 VAL A CG2   1 
ATOM   2483 N  N     . ILE A 1 342 ? 16.733 -30.048 -2.093  1.00 40.80 ? 343 ILE A N     1 
ATOM   2484 C  CA    . ILE A 1 342 ? 16.013 -30.354 -0.854  1.00 38.90 ? 343 ILE A CA    1 
ATOM   2485 C  C     . ILE A 1 342 ? 14.545 -29.916 -0.952  1.00 38.49 ? 343 ILE A C     1 
ATOM   2486 O  O     . ILE A 1 342 ? 13.714 -30.697 -0.448  1.00 42.04 ? 343 ILE A O     1 
ATOM   2487 C  CB    . ILE A 1 342 ? 16.697 -29.695 0.402   1.00 38.16 ? 343 ILE A CB    1 
ATOM   2488 C  CG1   . ILE A 1 342 ? 18.110 -30.241 0.589   1.00 35.82 ? 343 ILE A CG1   1 
ATOM   2489 C  CG2   . ILE A 1 342 ? 15.920 -30.001 1.677   1.00 35.36 ? 343 ILE A CG2   1 
ATOM   2490 C  CD1   . ILE A 1 342 ? 18.840 -29.605 1.728   1.00 34.10 ? 343 ILE A CD1   1 
HETATM 2491 MG MG    . MG  B 2 .   ? 35.021 -29.882 12.881  1.00 10.82 ? 356 MG  A MG    1 
HETATM 2492 P  PG    . GSP C 3 .   ? 37.221 -32.274 12.474  1.00 16.52 ? 355 GSP A PG    1 
HETATM 2493 O  O3B   . GSP C 3 .   ? 37.514 -31.584 10.994  1.00 10.05 ? 355 GSP A O3B   1 
HETATM 2494 S  S1G   . GSP C 3 .   ? 38.939 -32.825 13.146  1.00 15.37 ? 355 GSP A S1G   1 
HETATM 2495 O  O2G   . GSP C 3 .   ? 36.396 -31.275 13.244  1.00 10.64 ? 355 GSP A O2G   1 
HETATM 2496 O  O3G   . GSP C 3 .   ? 36.476 -33.475 12.007  1.00 15.02 ? 355 GSP A O3G   1 
HETATM 2497 P  PB    . GSP C 3 .   ? 36.539 -30.736 10.068  1.00 7.08  ? 355 GSP A PB    1 
HETATM 2498 O  O1B   . GSP C 3 .   ? 36.062 -31.672 9.055   1.00 9.62  ? 355 GSP A O1B   1 
HETATM 2499 O  O2B   . GSP C 3 .   ? 35.474 -29.962 10.831  1.00 7.65  ? 355 GSP A O2B   1 
HETATM 2500 P  PA    . GSP C 3 .   ? 37.707 -28.074 9.474   1.00 9.62  ? 355 GSP A PA    1 
HETATM 2501 O  O1A   . GSP C 3 .   ? 36.469 -27.480 8.953   1.00 9.50  ? 355 GSP A O1A   1 
HETATM 2502 O  O2A   . GSP C 3 .   ? 38.124 -27.746 10.879  1.00 10.76 ? 355 GSP A O2A   1 
HETATM 2503 O  O3A   . GSP C 3 .   ? 37.499 -29.683 9.305   1.00 5.77  ? 355 GSP A O3A   1 
HETATM 2504 O  "O5'" . GSP C 3 .   ? 38.916 -27.799 8.441   1.00 9.34  ? 355 GSP A "O5'" 1 
HETATM 2505 C  "C5'" . GSP C 3 .   ? 40.290 -27.982 8.746   1.00 9.23  ? 355 GSP A "C5'" 1 
HETATM 2506 C  "C4'" . GSP C 3 .   ? 41.124 -26.932 8.112   1.00 7.15  ? 355 GSP A "C4'" 1 
HETATM 2507 O  "O4'" . GSP C 3 .   ? 40.934 -26.927 6.670   1.00 7.81  ? 355 GSP A "O4'" 1 
HETATM 2508 C  "C3'" . GSP C 3 .   ? 40.695 -25.538 8.607   1.00 7.58  ? 355 GSP A "C3'" 1 
HETATM 2509 O  "O3'" . GSP C 3 .   ? 41.853 -24.747 8.895   1.00 12.34 ? 355 GSP A "O3'" 1 
HETATM 2510 C  "C2'" . GSP C 3 .   ? 39.943 -24.929 7.393   1.00 8.14  ? 355 GSP A "C2'" 1 
HETATM 2511 O  "O2'" . GSP C 3 .   ? 40.086 -23.530 7.331   1.00 7.29  ? 355 GSP A "O2'" 1 
HETATM 2512 C  "C1'" . GSP C 3 .   ? 40.647 -25.588 6.205   1.00 5.23  ? 355 GSP A "C1'" 1 
HETATM 2513 N  N9    . GSP C 3 .   ? 39.749 -25.681 5.036   1.00 7.32  ? 355 GSP A N9    1 
HETATM 2514 C  C8    . GSP C 3 .   ? 38.509 -26.289 4.920   1.00 6.67  ? 355 GSP A C8    1 
HETATM 2515 N  N7    . GSP C 3 .   ? 37.992 -26.231 3.746   1.00 7.55  ? 355 GSP A N7    1 
HETATM 2516 C  C5    . GSP C 3 .   ? 39.028 -25.685 2.977   1.00 5.32  ? 355 GSP A C5    1 
HETATM 2517 C  C6    . GSP C 3 .   ? 39.130 -25.486 1.542   1.00 10.25 ? 355 GSP A C6    1 
HETATM 2518 O  O6    . GSP C 3 .   ? 38.359 -25.823 0.637   1.00 7.84  ? 355 GSP A O6    1 
HETATM 2519 N  N1    . GSP C 3 .   ? 40.312 -24.833 1.213   1.00 8.04  ? 355 GSP A N1    1 
HETATM 2520 C  C2    . GSP C 3 .   ? 41.311 -24.534 2.099   1.00 9.16  ? 355 GSP A C2    1 
HETATM 2521 N  N2    . GSP C 3 .   ? 42.330 -23.811 1.690   1.00 6.00  ? 355 GSP A N2    1 
HETATM 2522 N  N3    . GSP C 3 .   ? 41.260 -24.824 3.393   1.00 8.36  ? 355 GSP A N3    1 
HETATM 2523 C  C4    . GSP C 3 .   ? 40.065 -25.317 3.772   1.00 5.51  ? 355 GSP A C4    1 
HETATM 2524 O  O     . HOH D 4 .   ? 44.547 -25.453 9.102   1.00 8.45  ? 401 HOH A O     1 
HETATM 2525 O  O     . HOH D 4 .   ? 43.351 -23.410 4.808   1.00 13.71 ? 402 HOH A O     1 
HETATM 2526 O  O     . HOH D 4 .   ? 38.067 -25.603 12.477  1.00 7.21  ? 403 HOH A O     1 
HETATM 2527 O  O     . HOH D 4 .   ? 37.018 -23.570 10.204  1.00 15.23 ? 404 HOH A O     1 
HETATM 2528 O  O     . HOH D 4 .   ? 50.905 -36.648 5.776   1.00 12.93 ? 405 HOH A O     1 
HETATM 2529 O  O     . HOH D 4 .   ? 50.234 -27.256 11.986  1.00 17.08 ? 406 HOH A O     1 
HETATM 2530 O  O     . HOH D 4 .   ? 23.013 -20.196 -0.087  1.00 22.30 ? 407 HOH A O     1 
HETATM 2531 O  O     . HOH D 4 .   ? 43.440 -37.393 10.219  1.00 18.47 ? 408 HOH A O     1 
HETATM 2532 O  O     . HOH D 4 .   ? 37.555 -34.523 15.576  1.00 22.19 ? 409 HOH A O     1 
HETATM 2533 O  O     . HOH D 4 .   ? 33.558 -31.254 12.500  1.00 6.02  ? 410 HOH A O     1 
HETATM 2534 O  O     . HOH D 4 .   ? 49.874 -24.169 4.229   1.00 11.99 ? 411 HOH A O     1 
HETATM 2535 O  O     . HOH D 4 .   ? 40.064 -29.670 12.234  1.00 19.43 ? 412 HOH A O     1 
HETATM 2536 O  O     . HOH D 4 .   ? 36.605 -28.535 13.065  1.00 8.83  ? 413 HOH A O     1 
HETATM 2537 O  O     . HOH D 4 .   ? 40.187 -38.832 10.277  1.00 12.76 ? 414 HOH A O     1 
HETATM 2538 O  O     . HOH D 4 .   ? 31.329 -26.458 14.449  1.00 19.55 ? 415 HOH A O     1 
HETATM 2539 O  O     . HOH D 4 .   ? 36.014 -37.556 4.451   1.00 20.50 ? 416 HOH A O     1 
HETATM 2540 O  O     . HOH D 4 .   ? 45.258 -23.436 10.712  1.00 26.75 ? 417 HOH A O     1 
HETATM 2541 O  O     . HOH D 4 .   ? 47.553 -21.817 3.714   1.00 26.78 ? 418 HOH A O     1 
HETATM 2542 O  O     . HOH D 4 .   ? 62.440 -33.398 15.958  1.00 20.39 ? 419 HOH A O     1 
HETATM 2543 O  O     . HOH D 4 .   ? 37.648 -22.992 14.294  1.00 21.74 ? 420 HOH A O     1 
HETATM 2544 O  O     . HOH D 4 .   ? 32.142 -33.651 -12.646 1.00 23.64 ? 421 HOH A O     1 
HETATM 2545 O  O     . HOH D 4 .   ? 39.370 -18.803 0.542   1.00 24.54 ? 422 HOH A O     1 
HETATM 2546 O  O     . HOH D 4 .   ? 50.876 -32.561 6.293   1.00 17.01 ? 423 HOH A O     1 
HETATM 2547 O  O     . HOH D 4 .   ? 30.328 -28.651 -8.466  1.00 18.60 ? 424 HOH A O     1 
HETATM 2548 O  O     . HOH D 4 .   ? 41.579 -37.436 8.057   1.00 23.21 ? 425 HOH A O     1 
HETATM 2549 O  O     . HOH D 4 .   ? 65.304 -15.170 6.961   1.00 28.42 ? 426 HOH A O     1 
HETATM 2550 O  O     . HOH D 4 .   ? 21.463 -45.771 1.979   1.00 23.11 ? 427 HOH A O     1 
HETATM 2551 O  O     . HOH D 4 .   ? 27.026 -46.502 8.728   1.00 49.78 ? 428 HOH A O     1 
HETATM 2552 O  O     . HOH D 4 .   ? 38.882 -39.057 -15.362 1.00 24.65 ? 429 HOH A O     1 
HETATM 2553 O  O     . HOH D 4 .   ? 46.054 -46.893 2.828   1.00 34.03 ? 430 HOH A O     1 
HETATM 2554 O  O     . HOH D 4 .   ? 47.144 -30.536 10.916  1.00 33.91 ? 431 HOH A O     1 
HETATM 2555 O  O     . HOH D 4 .   ? 36.055 -25.594 14.275  1.00 30.02 ? 432 HOH A O     1 
HETATM 2556 O  O     . HOH D 4 .   ? 30.310 -50.388 -2.330  1.00 39.32 ? 433 HOH A O     1 
HETATM 2557 O  O     . HOH D 4 .   ? 38.445 -36.059 3.686   1.00 21.08 ? 434 HOH A O     1 
HETATM 2558 O  O     . HOH D 4 .   ? 56.487 -32.012 12.844  1.00 13.48 ? 435 HOH A O     1 
HETATM 2559 O  O     . HOH D 4 .   ? 55.574 -12.914 6.633   1.00 29.59 ? 436 HOH A O     1 
HETATM 2560 O  O     . HOH D 4 .   ? 33.225 -8.128  12.272  1.00 21.76 ? 437 HOH A O     1 
HETATM 2561 O  O     . HOH D 4 .   ? 40.998 -40.828 -16.129 1.00 35.40 ? 438 HOH A O     1 
HETATM 2562 O  O     . HOH D 4 .   ? 37.393 -11.571 5.086   1.00 19.73 ? 439 HOH A O     1 
HETATM 2563 O  O     . HOH D 4 .   ? 70.718 -26.223 10.983  1.00 30.34 ? 440 HOH A O     1 
HETATM 2564 O  O     . HOH D 4 .   ? 48.999 -29.052 4.945   1.00 27.66 ? 441 HOH A O     1 
HETATM 2565 O  O     . HOH D 4 .   ? 67.594 -18.384 3.772   1.00 25.82 ? 442 HOH A O     1 
HETATM 2566 O  O     . HOH D 4 .   ? 64.662 -31.258 1.098   1.00 31.22 ? 443 HOH A O     1 
HETATM 2567 O  O     . HOH D 4 .   ? 57.273 -19.811 26.123  1.00 18.21 ? 444 HOH A O     1 
HETATM 2568 O  O     . HOH D 4 .   ? 35.238 -28.451 -10.388 1.00 30.04 ? 445 HOH A O     1 
HETATM 2569 O  O     . HOH D 4 .   ? 18.855 -17.304 10.068  1.00 36.71 ? 446 HOH A O     1 
HETATM 2570 O  O     . HOH D 4 .   ? 37.441 -26.991 -14.193 1.00 27.34 ? 447 HOH A O     1 
HETATM 2571 O  O     . HOH D 4 .   ? 44.494 -28.138 9.040   1.00 31.50 ? 448 HOH A O     1 
HETATM 2572 O  O     . HOH D 4 .   ? 40.913 -14.507 21.705  1.00 25.84 ? 449 HOH A O     1 
HETATM 2573 O  O     . HOH D 4 .   ? 39.983 -34.971 5.416   1.00 29.73 ? 450 HOH A O     1 
HETATM 2574 O  O     . HOH D 4 .   ? 46.776 -33.397 11.417  1.00 28.31 ? 451 HOH A O     1 
HETATM 2575 O  O     . HOH D 4 .   ? 35.107 -43.793 17.625  1.00 46.94 ? 452 HOH A O     1 
HETATM 2576 O  O     . HOH D 4 .   ? 48.737 -33.794 7.122   1.00 31.09 ? 453 HOH A O     1 
HETATM 2577 O  O     . HOH D 4 .   ? 26.271 -43.517 -7.647  1.00 23.50 ? 454 HOH A O     1 
HETATM 2578 O  O     . HOH D 4 .   ? 66.533 -34.737 4.106   1.00 34.35 ? 455 HOH A O     1 
HETATM 2579 O  O     . HOH D 4 .   ? 53.064 -27.987 16.331  1.00 31.34 ? 456 HOH A O     1 
HETATM 2580 O  O     . HOH D 4 .   ? 31.883 -35.374 17.519  1.00 31.02 ? 457 HOH A O     1 
HETATM 2581 O  O     . HOH D 4 .   ? 41.493 -11.321 5.422   1.00 24.94 ? 458 HOH A O     1 
HETATM 2582 O  O     . HOH D 4 .   ? 35.393 -15.775 0.813   1.00 24.04 ? 459 HOH A O     1 
HETATM 2583 O  O     . HOH D 4 .   ? 46.910 -31.831 7.821   1.00 29.65 ? 460 HOH A O     1 
HETATM 2584 O  O     . HOH D 4 .   ? 40.810 -38.623 5.799   1.00 32.02 ? 461 HOH A O     1 
HETATM 2585 O  O     . HOH D 4 .   ? 33.842 -27.215 15.812  1.00 25.25 ? 462 HOH A O     1 
HETATM 2586 O  O     . HOH D 4 .   ? 47.877 -15.160 3.136   1.00 26.01 ? 463 HOH A O     1 
HETATM 2587 O  O     . HOH D 4 .   ? 53.996 -32.848 12.454  1.00 26.37 ? 464 HOH A O     1 
HETATM 2588 O  O     . HOH D 4 .   ? 61.436 -37.073 0.223   1.00 12.24 ? 465 HOH A O     1 
HETATM 2589 O  O     . HOH D 4 .   ? 35.679 -8.561  8.135   1.00 29.36 ? 466 HOH A O     1 
HETATM 2590 O  O     . HOH D 4 .   ? 58.065 -34.347 12.548  1.00 30.57 ? 467 HOH A O     1 
HETATM 2591 O  O     . HOH D 4 .   ? 42.937 -7.657  9.921   1.00 24.62 ? 468 HOH A O     1 
HETATM 2592 O  O     . HOH D 4 .   ? 50.458 -31.056 4.094   1.00 20.59 ? 469 HOH A O     1 
HETATM 2593 O  O     . HOH D 4 .   ? 31.940 -25.331 -7.523  1.00 21.94 ? 470 HOH A O     1 
HETATM 2594 O  O     . HOH D 4 .   ? 67.532 -16.986 6.696   1.00 24.54 ? 471 HOH A O     1 
HETATM 2595 O  O     . HOH D 4 .   ? 50.107 -26.764 4.374   1.00 32.88 ? 472 HOH A O     1 
HETATM 2596 O  O     . HOH D 4 .   ? 53.523 -10.481 6.379   1.00 21.35 ? 473 HOH A O     1 
HETATM 2597 O  O     . HOH D 4 .   ? 28.076 -27.041 -8.199  1.00 35.07 ? 474 HOH A O     1 
HETATM 2598 O  O     . HOH D 4 .   ? 52.873 -27.548 2.341   1.00 28.22 ? 475 HOH A O     1 
HETATM 2599 O  O     . HOH D 4 .   ? 30.943 -5.626  14.163  1.00 47.91 ? 476 HOH A O     1 
HETATM 2600 O  O     . HOH D 4 .   ? 35.991 -14.401 3.737   1.00 37.30 ? 477 HOH A O     1 
HETATM 2601 O  O     . HOH D 4 .   ? 60.185 -39.087 4.644   1.00 39.12 ? 478 HOH A O     1 
HETATM 2602 O  O     . HOH D 4 .   ? 51.485 -22.572 -11.013 1.00 39.97 ? 479 HOH A O     1 
HETATM 2603 O  O     . HOH D 4 .   ? 49.016 -38.345 -11.865 1.00 43.28 ? 480 HOH A O     1 
HETATM 2604 O  O     . HOH D 4 .   ? 33.399 -14.096 3.825   1.00 24.83 ? 481 HOH A O     1 
HETATM 2605 O  O     . HOH D 4 .   ? 44.588 -38.366 -20.821 1.00 45.40 ? 482 HOH A O     1 
HETATM 2606 O  O     . HOH D 4 .   ? 56.420 -16.541 26.646  1.00 39.04 ? 483 HOH A O     1 
HETATM 2607 O  O     . HOH D 4 .   ? 26.275 -36.908 -8.937  1.00 29.28 ? 484 HOH A O     1 
HETATM 2608 O  O     . HOH D 4 .   ? 68.615 -13.032 14.329  1.00 36.29 ? 485 HOH A O     1 
HETATM 2609 O  O     . HOH D 4 .   ? 36.086 -8.552  11.421  1.00 26.32 ? 486 HOH A O     1 
HETATM 2610 O  O     . HOH D 4 .   ? 48.982 -41.375 -14.668 1.00 38.33 ? 487 HOH A O     1 
HETATM 2611 O  O     . HOH D 4 .   ? 42.471 -32.673 5.108   1.00 38.29 ? 488 HOH A O     1 
HETATM 2612 O  O     . HOH D 4 .   ? 20.375 -39.478 -2.106  1.00 23.99 ? 489 HOH A O     1 
HETATM 2613 O  O     . HOH D 4 .   ? 48.187 -27.625 -2.184  1.00 26.89 ? 490 HOH A O     1 
HETATM 2614 O  O     . HOH D 4 .   ? 44.360 -32.070 2.687   1.00 31.49 ? 491 HOH A O     1 
HETATM 2615 O  O     . HOH D 4 .   ? 50.268 -31.199 1.491   1.00 34.09 ? 492 HOH A O     1 
HETATM 2616 O  O     . HOH D 4 .   ? 23.156 -21.457 -7.224  1.00 37.27 ? 493 HOH A O     1 
HETATM 2617 O  O     . HOH D 4 .   ? 24.237 -47.738 11.686  1.00 33.57 ? 494 HOH A O     1 
HETATM 2618 O  O     . HOH D 4 .   ? 69.508 -15.770 5.302   1.00 36.96 ? 495 HOH A O     1 
HETATM 2619 O  O     . HOH D 4 .   ? 68.799 -23.822 1.671   1.00 37.94 ? 496 HOH A O     1 
HETATM 2620 O  O     . HOH D 4 .   ? 52.651 -38.124 9.872   1.00 36.45 ? 497 HOH A O     1 
HETATM 2621 O  O     . HOH D 4 .   ? 64.792 -37.588 4.780   1.00 36.07 ? 498 HOH A O     1 
HETATM 2622 O  O     . HOH D 4 .   ? 32.313 -24.213 13.370  1.00 26.59 ? 499 HOH A O     1 
HETATM 2623 O  O     . HOH D 4 .   ? 42.714 -34.894 11.174  1.00 26.75 ? 500 HOH A O     1 
HETATM 2624 O  O     . HOH D 4 .   ? 41.713 -39.251 -18.200 1.00 40.03 ? 501 HOH A O     1 
HETATM 2625 O  O     . HOH D 4 .   ? 66.796 -30.252 2.144   1.00 29.79 ? 502 HOH A O     1 
HETATM 2626 O  O     . HOH D 4 .   ? 35.632 -47.090 -6.067  1.00 22.05 ? 503 HOH A O     1 
HETATM 2627 O  O     . HOH D 4 .   ? 27.976 -11.069 20.443  1.00 42.16 ? 504 HOH A O     1 
HETATM 2628 O  O     . HOH D 4 .   ? 22.896 -31.533 -7.754  1.00 31.96 ? 505 HOH A O     1 
HETATM 2629 O  O     . HOH D 4 .   ? 50.760 -42.915 13.977  1.00 34.74 ? 506 HOH A O     1 
HETATM 2630 O  O     . HOH D 4 .   ? 34.728 -6.495  21.882  1.00 35.66 ? 507 HOH A O     1 
HETATM 2631 O  O     . HOH D 4 .   ? 25.107 -40.975 -8.477  1.00 39.72 ? 508 HOH A O     1 
HETATM 2632 O  O     . HOH D 4 .   ? 44.050 -21.582 -0.846  1.00 41.73 ? 509 HOH A O     1 
HETATM 2633 O  O     . HOH D 4 .   ? 42.320 -28.693 18.083  1.00 41.07 ? 510 HOH A O     1 
HETATM 2634 O  O     . HOH D 4 .   ? 30.673 -41.529 -11.646 1.00 34.25 ? 511 HOH A O     1 
HETATM 2635 O  O     . HOH D 4 .   ? 68.970 -26.453 4.011   1.00 30.45 ? 512 HOH A O     1 
HETATM 2636 O  O     . HOH D 4 .   ? 70.311 -20.680 0.974   1.00 46.38 ? 513 HOH A O     1 
HETATM 2637 O  O     . HOH D 4 .   ? 23.179 -51.485 6.149   1.00 41.09 ? 514 HOH A O     1 
HETATM 2638 O  O     . HOH D 4 .   ? 19.368 -38.237 16.624  1.00 40.00 ? 515 HOH A O     1 
HETATM 2639 O  O     . HOH D 4 .   ? 53.427 -19.912 0.762   1.00 29.16 ? 516 HOH A O     1 
HETATM 2640 O  O     . HOH D 4 .   ? 31.049 -20.277 14.959  1.00 36.64 ? 517 HOH A O     1 
HETATM 2641 O  O     . HOH D 4 .   ? 48.741 -17.029 1.468   1.00 38.28 ? 518 HOH A O     1 
HETATM 2642 O  O     . HOH D 4 .   ? 32.494 -28.231 -10.783 1.00 37.96 ? 519 HOH A O     1 
HETATM 2643 O  O     . HOH D 4 .   ? 24.415 -31.464 20.915  1.00 33.10 ? 520 HOH A O     1 
HETATM 2644 O  O     . HOH D 4 .   ? 62.510 -40.636 3.505   1.00 40.60 ? 521 HOH A O     1 
HETATM 2645 O  O     . HOH D 4 .   ? 40.111 -37.413 1.968   1.00 38.68 ? 522 HOH A O     1 
HETATM 2646 O  O     . HOH D 4 .   ? 42.478 -43.275 -15.399 1.00 26.78 ? 523 HOH A O     1 
HETATM 2647 O  O     . HOH D 4 .   ? 48.646 -29.122 -14.396 1.00 38.01 ? 524 HOH A O     1 
HETATM 2648 O  O     . HOH D 4 .   ? 55.796 -12.841 3.379   1.00 39.17 ? 525 HOH A O     1 
HETATM 2649 O  O     . HOH D 4 .   ? 43.208 -47.175 -9.192  1.00 46.61 ? 526 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   2   ?   ?   ?   A . n 
A 1 2   CYS 2   3   ?   ?   ?   A . n 
A 1 3   THR 3   4   ?   ?   ?   A . n 
A 1 4   LEU 4   5   ?   ?   ?   A . n 
A 1 5   SER 5   6   ?   ?   ?   A . n 
A 1 6   ALA 6   7   ?   ?   ?   A . n 
A 1 7   GLU 7   8   ?   ?   ?   A . n 
A 1 8   ASP 8   9   ?   ?   ?   A . n 
A 1 9   LYS 9   10  ?   ?   ?   A . n 
A 1 10  ALA 10  11  ?   ?   ?   A . n 
A 1 11  ALA 11  12  ?   ?   ?   A . n 
A 1 12  VAL 12  13  ?   ?   ?   A . n 
A 1 13  GLU 13  14  ?   ?   ?   A . n 
A 1 14  ARG 14  15  ?   ?   ?   A . n 
A 1 15  SER 15  16  ?   ?   ?   A . n 
A 1 16  LYS 16  17  ?   ?   ?   A . n 
A 1 17  MET 17  18  ?   ?   ?   A . n 
A 1 18  ILE 18  19  ?   ?   ?   A . n 
A 1 19  ASP 19  20  ?   ?   ?   A . n 
A 1 20  ARG 20  21  ?   ?   ?   A . n 
A 1 21  ASN 21  22  ?   ?   ?   A . n 
A 1 22  LEU 22  23  ?   ?   ?   A . n 
A 1 23  ARG 23  24  ?   ?   ?   A . n 
A 1 24  GLU 24  25  ?   ?   ?   A . n 
A 1 25  ASP 25  26  ?   ?   ?   A . n 
A 1 26  GLY 26  27  ?   ?   ?   A . n 
A 1 27  GLU 27  28  ?   ?   ?   A . n 
A 1 28  LYS 28  29  ?   ?   ?   A . n 
A 1 29  ALA 29  30  ?   ?   ?   A . n 
A 1 30  ALA 30  31  ?   ?   ?   A . n 
A 1 31  ARG 31  32  ?   ?   ?   A . n 
A 1 32  GLU 32  33  ?   ?   ?   A . n 
A 1 33  VAL 33  34  34  VAL VAL A . n 
A 1 34  LYS 34  35  35  LYS LYS A . n 
A 1 35  LEU 35  36  36  LEU LEU A . n 
A 1 36  LEU 36  37  37  LEU LEU A . n 
A 1 37  LEU 37  38  38  LEU LEU A . n 
A 1 38  LEU 38  39  39  LEU LEU A . n 
A 1 39  GLY 39  40  40  GLY GLY A . n 
A 1 40  ALA 40  41  41  ALA ALA A . n 
A 1 41  GLY 41  42  42  GLY GLY A . n 
A 1 42  GLU 42  43  43  GLU GLU A . n 
A 1 43  SER 43  44  44  SER SER A . n 
A 1 44  GLY 44  45  45  GLY GLY A . n 
A 1 45  LYS 45  46  46  LYS LYS A . n 
A 1 46  SER 46  47  47  SER SER A . n 
A 1 47  THR 47  48  48  THR THR A . n 
A 1 48  ILE 48  49  49  ILE ILE A . n 
A 1 49  VAL 49  50  50  VAL VAL A . n 
A 1 50  LYS 50  51  51  LYS LYS A . n 
A 1 51  GLN 51  52  52  GLN GLN A . n 
A 1 52  MET 52  53  53  MET MET A . n 
A 1 53  LYS 53  54  54  LYS LYS A . n 
A 1 54  ILE 54  55  55  ILE ILE A . n 
A 1 55  ILE 55  56  56  ILE ILE A . n 
A 1 56  HIS 56  57  57  HIS HIS A . n 
A 1 57  GLU 57  58  58  GLU GLU A . n 
A 1 58  ALA 58  59  59  ALA ALA A . n 
A 1 59  GLY 59  60  60  GLY GLY A . n 
A 1 60  TYR 60  61  61  TYR TYR A . n 
A 1 61  SER 61  62  62  SER SER A . n 
A 1 62  GLU 62  63  63  GLU GLU A . n 
A 1 63  GLU 63  64  64  GLU GLU A . n 
A 1 64  GLU 64  65  65  GLU GLU A . n 
A 1 65  CYS 65  66  66  CYS CYS A . n 
A 1 66  LYS 66  67  67  LYS LYS A . n 
A 1 67  GLN 67  68  68  GLN GLN A . n 
A 1 68  TYR 68  69  69  TYR TYR A . n 
A 1 69  LYS 69  70  70  LYS LYS A . n 
A 1 70  ALA 70  71  71  ALA ALA A . n 
A 1 71  VAL 71  72  72  VAL VAL A . n 
A 1 72  VAL 72  73  73  VAL VAL A . n 
A 1 73  TYR 73  74  74  TYR TYR A . n 
A 1 74  SER 74  75  75  SER SER A . n 
A 1 75  ASN 75  76  76  ASN ASN A . n 
A 1 76  THR 76  77  77  THR THR A . n 
A 1 77  ILE 77  78  78  ILE ILE A . n 
A 1 78  GLN 78  79  79  GLN GLN A . n 
A 1 79  SER 79  80  80  SER SER A . n 
A 1 80  ILE 80  81  81  ILE ILE A . n 
A 1 81  ILE 81  82  82  ILE ILE A . n 
A 1 82  ALA 82  83  83  ALA ALA A . n 
A 1 83  ILE 83  84  84  ILE ILE A . n 
A 1 84  ILE 84  85  85  ILE ILE A . n 
A 1 85  ARG 85  86  86  ARG ARG A . n 
A 1 86  ALA 86  87  87  ALA ALA A . n 
A 1 87  MET 87  88  88  MET MET A . n 
A 1 88  GLY 88  89  89  GLY GLY A . n 
A 1 89  ARG 89  90  90  ARG ARG A . n 
A 1 90  LEU 90  91  91  LEU LEU A . n 
A 1 91  LYS 91  92  92  LYS LYS A . n 
A 1 92  ILE 92  93  93  ILE ILE A . n 
A 1 93  ASP 93  94  94  ASP ASP A . n 
A 1 94  PHE 94  95  95  PHE PHE A . n 
A 1 95  GLY 95  96  96  GLY GLY A . n 
A 1 96  ASP 96  97  97  ASP ASP A . n 
A 1 97  ALA 97  98  98  ALA ALA A . n 
A 1 98  ALA 98  99  99  ALA ALA A . n 
A 1 99  ARG 99  100 100 ARG ARG A . n 
A 1 100 ALA 100 101 101 ALA ALA A . n 
A 1 101 ASP 101 102 102 ASP ASP A . n 
A 1 102 ASP 102 103 103 ASP ASP A . n 
A 1 103 ALA 103 104 104 ALA ALA A . n 
A 1 104 ARG 104 105 105 ARG ARG A . n 
A 1 105 GLN 105 106 106 GLN GLN A . n 
A 1 106 LEU 106 107 107 LEU LEU A . n 
A 1 107 PHE 107 108 108 PHE PHE A . n 
A 1 108 VAL 108 109 109 VAL VAL A . n 
A 1 109 LEU 109 110 110 LEU LEU A . n 
A 1 110 ALA 110 111 111 ALA ALA A . n 
A 1 111 GLY 111 112 112 GLY GLY A . n 
A 1 112 ALA 112 113 113 ALA ALA A . n 
A 1 113 ALA 113 114 114 ALA ALA A . n 
A 1 114 GLU 114 115 115 GLU GLU A . n 
A 1 115 GLU 115 116 116 GLU GLU A . n 
A 1 116 GLY 116 117 117 GLY GLY A . n 
A 1 117 PHE 117 118 118 PHE PHE A . n 
A 1 118 MET 118 119 119 MET MET A . n 
A 1 119 THR 119 120 120 THR THR A . n 
A 1 120 ALA 120 121 121 ALA ALA A . n 
A 1 121 GLU 121 122 122 GLU GLU A . n 
A 1 122 LEU 122 123 123 LEU LEU A . n 
A 1 123 ALA 123 124 124 ALA ALA A . n 
A 1 124 GLY 124 125 125 GLY GLY A . n 
A 1 125 VAL 125 126 126 VAL VAL A . n 
A 1 126 ILE 126 127 127 ILE ILE A . n 
A 1 127 LYS 127 128 128 LYS LYS A . n 
A 1 128 ARG 128 129 129 ARG ARG A . n 
A 1 129 LEU 129 130 130 LEU LEU A . n 
A 1 130 TRP 130 131 131 TRP TRP A . n 
A 1 131 LYS 131 132 132 LYS LYS A . n 
A 1 132 ASP 132 133 133 ASP ASP A . n 
A 1 133 SER 133 134 134 SER SER A . n 
A 1 134 GLY 134 135 135 GLY GLY A . n 
A 1 135 VAL 135 136 136 VAL VAL A . n 
A 1 136 GLN 136 137 137 GLN GLN A . n 
A 1 137 ALA 137 138 138 ALA ALA A . n 
A 1 138 CYS 138 139 139 CYS CYS A . n 
A 1 139 PHE 139 140 140 PHE PHE A . n 
A 1 140 ASN 140 141 141 ASN ASN A . n 
A 1 141 ARG 141 142 142 ARG ARG A . n 
A 1 142 SER 142 143 143 SER SER A . n 
A 1 143 ARG 143 144 144 ARG ARG A . n 
A 1 144 GLU 144 145 145 GLU GLU A . n 
A 1 145 TYR 145 146 146 TYR TYR A . n 
A 1 146 GLN 146 147 147 GLN GLN A . n 
A 1 147 LEU 147 148 148 LEU LEU A . n 
A 1 148 ASN 148 149 149 ASN ASN A . n 
A 1 149 ASP 149 150 150 ASP ASP A . n 
A 1 150 SER 150 151 151 SER SER A . n 
A 1 151 ALA 151 152 152 ALA ALA A . n 
A 1 152 ALA 152 153 153 ALA ALA A . n 
A 1 153 TYR 153 154 154 TYR TYR A . n 
A 1 154 TYR 154 155 155 TYR TYR A . n 
A 1 155 LEU 155 156 156 LEU LEU A . n 
A 1 156 ASN 156 157 157 ASN ASN A . n 
A 1 157 ASP 157 158 158 ASP ASP A . n 
A 1 158 LEU 158 159 159 LEU LEU A . n 
A 1 159 ASP 159 160 160 ASP ASP A . n 
A 1 160 ARG 160 161 161 ARG ARG A . n 
A 1 161 ILE 161 162 162 ILE ILE A . n 
A 1 162 ALA 162 163 163 ALA ALA A . n 
A 1 163 GLN 163 164 164 GLN GLN A . n 
A 1 164 PRO 164 165 165 PRO PRO A . n 
A 1 165 ASN 165 166 166 ASN ASN A . n 
A 1 166 TYR 166 167 167 TYR TYR A . n 
A 1 167 ILE 167 168 168 ILE ILE A . n 
A 1 168 PRO 168 169 169 PRO PRO A . n 
A 1 169 THR 169 170 170 THR THR A . n 
A 1 170 GLN 170 171 171 GLN GLN A . n 
A 1 171 GLN 171 172 172 GLN GLN A . n 
A 1 172 ASP 172 173 173 ASP ASP A . n 
A 1 173 VAL 173 174 174 VAL VAL A . n 
A 1 174 LEU 174 175 175 LEU LEU A . n 
A 1 175 ARG 175 176 176 ARG ARG A . n 
A 1 176 THR 176 177 177 THR THR A . n 
A 1 177 ARG 177 178 178 ARG ARG A . n 
A 1 178 VAL 178 179 179 VAL VAL A . n 
A 1 179 LYS 179 180 180 LYS LYS A . n 
A 1 180 THR 180 181 181 THR THR A . n 
A 1 181 THR 181 182 182 THR THR A . n 
A 1 182 GLY 182 183 183 GLY GLY A . n 
A 1 183 ILE 183 184 184 ILE ILE A . n 
A 1 184 VAL 184 185 185 VAL VAL A . n 
A 1 185 GLU 185 186 186 GLU GLU A . n 
A 1 186 THR 186 187 187 THR THR A . n 
A 1 187 HIS 187 188 188 HIS HIS A . n 
A 1 188 PHE 188 189 189 PHE PHE A . n 
A 1 189 THR 189 190 190 THR THR A . n 
A 1 190 PHE 190 191 191 PHE PHE A . n 
A 1 191 LYS 191 192 192 LYS LYS A . n 
A 1 192 ASP 192 193 193 ASP ASP A . n 
A 1 193 LEU 193 194 194 LEU LEU A . n 
A 1 194 HIS 194 195 195 HIS HIS A . n 
A 1 195 PHE 195 196 196 PHE PHE A . n 
A 1 196 LYS 196 197 197 LYS LYS A . n 
A 1 197 MET 197 198 198 MET MET A . n 
A 1 198 PHE 198 199 199 PHE PHE A . n 
A 1 199 ASP 199 200 200 ASP ASP A . n 
A 1 200 VAL 200 201 201 VAL VAL A . n 
A 1 201 GLY 201 202 202 GLY GLY A . n 
A 1 202 GLY 202 203 203 GLY GLY A . n 
A 1 203 GLN 203 204 204 GLN GLN A . n 
A 1 204 ARG 204 205 205 ARG ARG A . n 
A 1 205 SER 205 206 206 SER SER A . n 
A 1 206 GLU 206 207 207 GLU GLU A . n 
A 1 207 ARG 207 208 208 ARG ARG A . n 
A 1 208 LYS 208 209 209 LYS LYS A . n 
A 1 209 LYS 209 210 210 LYS LYS A . n 
A 1 210 TRP 210 211 211 TRP TRP A . n 
A 1 211 ILE 211 212 212 ILE ILE A . n 
A 1 212 HIS 212 213 213 HIS HIS A . n 
A 1 213 CYS 213 214 214 CYS CYS A . n 
A 1 214 PHE 214 215 215 PHE PHE A . n 
A 1 215 GLU 215 216 216 GLU GLU A . n 
A 1 216 GLY 216 217 217 GLY GLY A . n 
A 1 217 VAL 217 218 218 VAL VAL A . n 
A 1 218 THR 218 219 219 THR THR A . n 
A 1 219 ALA 219 220 220 ALA ALA A . n 
A 1 220 ILE 220 221 221 ILE ILE A . n 
A 1 221 ILE 221 222 222 ILE ILE A . n 
A 1 222 PHE 222 223 223 PHE PHE A . n 
A 1 223 CYS 223 224 224 CYS CYS A . n 
A 1 224 VAL 224 225 225 VAL VAL A . n 
A 1 225 ALA 225 226 226 ALA ALA A . n 
A 1 226 LEU 226 227 227 LEU LEU A . n 
A 1 227 SER 227 228 228 SER SER A . n 
A 1 228 ASP 228 229 229 ASP ASP A . n 
A 1 229 TYR 229 230 230 TYR TYR A . n 
A 1 230 ASP 230 231 231 ASP ASP A . n 
A 1 231 LEU 231 232 232 LEU LEU A . n 
A 1 232 VAL 232 233 233 VAL VAL A . n 
A 1 233 LEU 233 234 234 LEU LEU A . n 
A 1 234 ALA 234 235 235 ALA ALA A . n 
A 1 235 GLU 235 236 236 GLU GLU A . n 
A 1 236 ASP 236 237 237 ASP ASP A . n 
A 1 237 GLU 237 238 238 GLU GLU A . n 
A 1 238 GLU 238 239 239 GLU GLU A . n 
A 1 239 MET 239 240 240 MET MET A . n 
A 1 240 ASN 240 241 241 ASN ASN A . n 
A 1 241 ARG 241 242 242 ARG ARG A . n 
A 1 242 MET 242 243 243 MET MET A . n 
A 1 243 HIS 243 244 244 HIS HIS A . n 
A 1 244 GLU 244 245 245 GLU GLU A . n 
A 1 245 SER 245 246 246 SER SER A . n 
A 1 246 MET 246 247 247 MET MET A . n 
A 1 247 LYS 247 248 248 LYS LYS A . n 
A 1 248 LEU 248 249 249 LEU LEU A . n 
A 1 249 PHE 249 250 250 PHE PHE A . n 
A 1 250 ASP 250 251 251 ASP ASP A . n 
A 1 251 SER 251 252 252 SER SER A . n 
A 1 252 ILE 252 253 253 ILE ILE A . n 
A 1 253 CYS 253 254 254 CYS CYS A . n 
A 1 254 ASN 254 255 255 ASN ASN A . n 
A 1 255 ASN 255 256 256 ASN ASN A . n 
A 1 256 LYS 256 257 257 LYS LYS A . n 
A 1 257 TRP 257 258 258 TRP TRP A . n 
A 1 258 PHE 258 259 259 PHE PHE A . n 
A 1 259 THR 259 260 260 THR THR A . n 
A 1 260 ASP 260 261 261 ASP ASP A . n 
A 1 261 THR 261 262 262 THR THR A . n 
A 1 262 SER 262 263 263 SER SER A . n 
A 1 263 ILE 263 264 264 ILE ILE A . n 
A 1 264 ILE 264 265 265 ILE ILE A . n 
A 1 265 LEU 265 266 266 LEU LEU A . n 
A 1 266 PHE 266 267 267 PHE PHE A . n 
A 1 267 LEU 267 268 268 LEU LEU A . n 
A 1 268 ASN 268 269 269 ASN ASN A . n 
A 1 269 LYS 269 270 270 LYS LYS A . n 
A 1 270 LYS 270 271 271 LYS LYS A . n 
A 1 271 ASP 271 272 272 ASP ASP A . n 
A 1 272 LEU 272 273 273 LEU LEU A . n 
A 1 273 PHE 273 274 274 PHE PHE A . n 
A 1 274 GLU 274 275 275 GLU GLU A . n 
A 1 275 GLU 275 276 276 GLU GLU A . n 
A 1 276 LYS 276 277 277 LYS LYS A . n 
A 1 277 ILE 277 278 278 ILE ILE A . n 
A 1 278 LYS 278 279 279 LYS LYS A . n 
A 1 279 LYS 279 280 280 LYS LYS A . n 
A 1 280 SER 280 281 281 SER SER A . n 
A 1 281 PRO 281 282 282 PRO PRO A . n 
A 1 282 LEU 282 283 283 LEU LEU A . n 
A 1 283 THR 283 284 284 THR THR A . n 
A 1 284 ILE 284 285 285 ILE ILE A . n 
A 1 285 CYS 285 286 286 CYS CYS A . n 
A 1 286 TYR 286 287 287 TYR TYR A . n 
A 1 287 PRO 287 288 288 PRO PRO A . n 
A 1 288 GLU 288 289 289 GLU GLU A . n 
A 1 289 TYR 289 290 290 TYR TYR A . n 
A 1 290 ALA 290 291 291 ALA ALA A . n 
A 1 291 GLY 291 292 292 GLY GLY A . n 
A 1 292 SER 292 293 293 SER SER A . n 
A 1 293 ASN 293 294 294 ASN ASN A . n 
A 1 294 THR 294 295 295 THR THR A . n 
A 1 295 TYR 295 296 296 TYR TYR A . n 
A 1 296 GLU 296 297 297 GLU GLU A . n 
A 1 297 GLU 297 298 298 GLU GLU A . n 
A 1 298 ALA 298 299 299 ALA ALA A . n 
A 1 299 ALA 299 300 300 ALA ALA A . n 
A 1 300 ALA 300 301 301 ALA ALA A . n 
A 1 301 TYR 301 302 302 TYR TYR A . n 
A 1 302 ILE 302 303 303 ILE ILE A . n 
A 1 303 GLN 303 304 304 GLN GLN A . n 
A 1 304 CYS 304 305 305 CYS CYS A . n 
A 1 305 GLN 305 306 306 GLN GLN A . n 
A 1 306 PHE 306 307 307 PHE PHE A . n 
A 1 307 GLU 307 308 308 GLU GLU A . n 
A 1 308 ASP 308 309 309 ASP ASP A . n 
A 1 309 LEU 309 310 310 LEU LEU A . n 
A 1 310 ASN 310 311 311 ASN ASN A . n 
A 1 311 LYS 311 312 312 LYS LYS A . n 
A 1 312 ARG 312 313 313 ARG ARG A . n 
A 1 313 LYS 313 314 314 LYS LYS A . n 
A 1 314 ASP 314 315 315 ASP ASP A . n 
A 1 315 THR 315 316 316 THR THR A . n 
A 1 316 LYS 316 317 317 LYS LYS A . n 
A 1 317 GLU 317 318 318 GLU GLU A . n 
A 1 318 ILE 318 319 319 ILE ILE A . n 
A 1 319 TYR 319 320 320 TYR TYR A . n 
A 1 320 THR 320 321 321 THR THR A . n 
A 1 321 HIS 321 322 322 HIS HIS A . n 
A 1 322 PHE 322 323 323 PHE PHE A . n 
A 1 323 THR 323 324 324 THR THR A . n 
A 1 324 CYS 324 325 325 CYS CYS A . n 
A 1 325 ALA 325 326 326 ALA ALA A . n 
A 1 326 THR 326 327 327 THR THR A . n 
A 1 327 ASP 327 328 328 ASP ASP A . n 
A 1 328 THR 328 329 329 THR THR A . n 
A 1 329 LYS 329 330 330 LYS LYS A . n 
A 1 330 ASN 330 331 331 ASN ASN A . n 
A 1 331 VAL 331 332 332 VAL VAL A . n 
A 1 332 GLN 332 333 333 GLN GLN A . n 
A 1 333 PHE 333 334 334 PHE PHE A . n 
A 1 334 VAL 334 335 335 VAL VAL A . n 
A 1 335 PHE 335 336 336 PHE PHE A . n 
A 1 336 ASP 336 337 337 ASP ASP A . n 
A 1 337 ALA 337 338 338 ALA ALA A . n 
A 1 338 VAL 338 339 339 VAL VAL A . n 
A 1 339 THR 339 340 340 THR THR A . n 
A 1 340 ASP 340 341 341 ASP ASP A . n 
A 1 341 VAL 341 342 342 VAL VAL A . n 
A 1 342 ILE 342 343 343 ILE ILE A . n 
A 1 343 ILE 343 344 ?   ?   ?   A . n 
A 1 344 LYS 344 345 ?   ?   ?   A . n 
A 1 345 ASN 345 346 ?   ?   ?   A . n 
A 1 346 ASN 346 347 ?   ?   ?   A . n 
A 1 347 LEU 347 348 ?   ?   ?   A . n 
A 1 348 LYS 348 349 ?   ?   ?   A . n 
A 1 349 ASP 349 350 ?   ?   ?   A . n 
A 1 350 CYS 350 351 ?   ?   ?   A . n 
A 1 351 GLY 351 352 ?   ?   ?   A . n 
A 1 352 LEU 352 353 ?   ?   ?   A . n 
A 1 353 PHE 353 354 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   356 356 MG  MG  A . 
C 3 GSP 1   355 355 GSP GSP A . 
D 4 HOH 1   401 401 HOH HOH A . 
D 4 HOH 2   402 402 HOH HOH A . 
D 4 HOH 3   403 403 HOH HOH A . 
D 4 HOH 4   404 404 HOH HOH A . 
D 4 HOH 5   405 405 HOH HOH A . 
D 4 HOH 6   406 406 HOH HOH A . 
D 4 HOH 7   407 407 HOH HOH A . 
D 4 HOH 8   408 408 HOH HOH A . 
D 4 HOH 9   409 409 HOH HOH A . 
D 4 HOH 10  410 410 HOH HOH A . 
D 4 HOH 11  411 411 HOH HOH A . 
D 4 HOH 12  412 412 HOH HOH A . 
D 4 HOH 13  413 413 HOH HOH A . 
D 4 HOH 14  414 414 HOH HOH A . 
D 4 HOH 15  415 415 HOH HOH A . 
D 4 HOH 16  416 416 HOH HOH A . 
D 4 HOH 17  417 417 HOH HOH A . 
D 4 HOH 18  418 418 HOH HOH A . 
D 4 HOH 19  419 419 HOH HOH A . 
D 4 HOH 20  420 420 HOH HOH A . 
D 4 HOH 21  421 421 HOH HOH A . 
D 4 HOH 22  422 422 HOH HOH A . 
D 4 HOH 23  423 423 HOH HOH A . 
D 4 HOH 24  424 424 HOH HOH A . 
D 4 HOH 25  425 425 HOH HOH A . 
D 4 HOH 26  426 426 HOH HOH A . 
D 4 HOH 27  427 427 HOH HOH A . 
D 4 HOH 28  428 428 HOH HOH A . 
D 4 HOH 29  429 429 HOH HOH A . 
D 4 HOH 30  430 430 HOH HOH A . 
D 4 HOH 31  431 431 HOH HOH A . 
D 4 HOH 32  432 432 HOH HOH A . 
D 4 HOH 33  433 433 HOH HOH A . 
D 4 HOH 34  434 434 HOH HOH A . 
D 4 HOH 35  435 435 HOH HOH A . 
D 4 HOH 36  436 436 HOH HOH A . 
D 4 HOH 37  437 437 HOH HOH A . 
D 4 HOH 38  438 438 HOH HOH A . 
D 4 HOH 39  439 439 HOH HOH A . 
D 4 HOH 40  440 440 HOH HOH A . 
D 4 HOH 41  441 441 HOH HOH A . 
D 4 HOH 42  442 442 HOH HOH A . 
D 4 HOH 43  443 443 HOH HOH A . 
D 4 HOH 44  444 444 HOH HOH A . 
D 4 HOH 45  445 445 HOH HOH A . 
D 4 HOH 46  446 446 HOH HOH A . 
D 4 HOH 47  447 447 HOH HOH A . 
D 4 HOH 48  448 448 HOH HOH A . 
D 4 HOH 49  449 449 HOH HOH A . 
D 4 HOH 50  450 450 HOH HOH A . 
D 4 HOH 51  451 451 HOH HOH A . 
D 4 HOH 52  452 452 HOH HOH A . 
D 4 HOH 53  453 453 HOH HOH A . 
D 4 HOH 54  454 454 HOH HOH A . 
D 4 HOH 55  455 455 HOH HOH A . 
D 4 HOH 56  456 456 HOH HOH A . 
D 4 HOH 57  457 457 HOH HOH A . 
D 4 HOH 58  458 458 HOH HOH A . 
D 4 HOH 59  459 459 HOH HOH A . 
D 4 HOH 60  460 460 HOH HOH A . 
D 4 HOH 61  461 461 HOH HOH A . 
D 4 HOH 62  462 462 HOH HOH A . 
D 4 HOH 63  463 463 HOH HOH A . 
D 4 HOH 64  464 464 HOH HOH A . 
D 4 HOH 65  465 465 HOH HOH A . 
D 4 HOH 66  466 466 HOH HOH A . 
D 4 HOH 67  467 467 HOH HOH A . 
D 4 HOH 68  468 468 HOH HOH A . 
D 4 HOH 69  469 469 HOH HOH A . 
D 4 HOH 70  470 470 HOH HOH A . 
D 4 HOH 71  471 471 HOH HOH A . 
D 4 HOH 72  472 472 HOH HOH A . 
D 4 HOH 73  473 473 HOH HOH A . 
D 4 HOH 74  474 474 HOH HOH A . 
D 4 HOH 75  475 475 HOH HOH A . 
D 4 HOH 76  476 476 HOH HOH A . 
D 4 HOH 77  477 477 HOH HOH A . 
D 4 HOH 78  478 478 HOH HOH A . 
D 4 HOH 79  479 479 HOH HOH A . 
D 4 HOH 80  480 480 HOH HOH A . 
D 4 HOH 81  481 481 HOH HOH A . 
D 4 HOH 82  482 482 HOH HOH A . 
D 4 HOH 83  483 483 HOH HOH A . 
D 4 HOH 84  484 484 HOH HOH A . 
D 4 HOH 85  485 485 HOH HOH A . 
D 4 HOH 86  486 486 HOH HOH A . 
D 4 HOH 87  487 487 HOH HOH A . 
D 4 HOH 88  488 488 HOH HOH A . 
D 4 HOH 89  489 489 HOH HOH A . 
D 4 HOH 90  490 490 HOH HOH A . 
D 4 HOH 91  491 491 HOH HOH A . 
D 4 HOH 92  492 492 HOH HOH A . 
D 4 HOH 93  493 493 HOH HOH A . 
D 4 HOH 94  494 494 HOH HOH A . 
D 4 HOH 95  495 495 HOH HOH A . 
D 4 HOH 96  496 496 HOH HOH A . 
D 4 HOH 97  497 497 HOH HOH A . 
D 4 HOH 98  498 498 HOH HOH A . 
D 4 HOH 99  499 499 HOH HOH A . 
D 4 HOH 100 500 500 HOH HOH A . 
D 4 HOH 101 501 501 HOH HOH A . 
D 4 HOH 102 502 502 HOH HOH A . 
D 4 HOH 103 503 503 HOH HOH A . 
D 4 HOH 104 504 504 HOH HOH A . 
D 4 HOH 105 505 505 HOH HOH A . 
D 4 HOH 106 506 506 HOH HOH A . 
D 4 HOH 107 507 507 HOH HOH A . 
D 4 HOH 108 508 508 HOH HOH A . 
D 4 HOH 109 509 509 HOH HOH A . 
D 4 HOH 110 510 510 HOH HOH A . 
D 4 HOH 111 511 511 HOH HOH A . 
D 4 HOH 112 512 512 HOH HOH A . 
D 4 HOH 113 513 513 HOH HOH A . 
D 4 HOH 114 514 514 HOH HOH A . 
D 4 HOH 115 515 515 HOH HOH A . 
D 4 HOH 116 516 516 HOH HOH A . 
D 4 HOH 117 517 517 HOH HOH A . 
D 4 HOH 118 518 518 HOH HOH A . 
D 4 HOH 119 519 519 HOH HOH A . 
D 4 HOH 120 520 520 HOH HOH A . 
D 4 HOH 121 521 521 HOH HOH A . 
D 4 HOH 122 522 522 HOH HOH A . 
D 4 HOH 123 523 523 HOH HOH A . 
D 4 HOH 124 524 524 HOH HOH A . 
D 4 HOH 125 525 525 HOH HOH A . 
D 4 HOH 126 526 526 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O2G ? C GSP .   ? A GSP 355 ? 1_555 MG ? B MG . ? A MG 356 ? 1_555 O2B ? C GSP .   ? A GSP 355 ? 1_555 90.1  ? 
2  O2G ? C GSP .   ? A GSP 355 ? 1_555 MG ? B MG . ? A MG 356 ? 1_555 OG  ? A SER 46  ? A SER 47  ? 1_555 172.0 ? 
3  O2B ? C GSP .   ? A GSP 355 ? 1_555 MG ? B MG . ? A MG 356 ? 1_555 OG  ? A SER 46  ? A SER 47  ? 1_555 87.8  ? 
4  O2G ? C GSP .   ? A GSP 355 ? 1_555 MG ? B MG . ? A MG 356 ? 1_555 OG1 ? A THR 180 ? A THR 181 ? 1_555 92.0  ? 
5  O2B ? C GSP .   ? A GSP 355 ? 1_555 MG ? B MG . ? A MG 356 ? 1_555 OG1 ? A THR 180 ? A THR 181 ? 1_555 177.9 ? 
6  OG  ? A SER 46  ? A SER 47  ? 1_555 MG ? B MG . ? A MG 356 ? 1_555 OG1 ? A THR 180 ? A THR 181 ? 1_555 90.1  ? 
7  O2G ? C GSP .   ? A GSP 355 ? 1_555 MG ? B MG . ? A MG 356 ? 1_555 O   ? D HOH .   ? A HOH 413 ? 1_555 84.9  ? 
8  O2B ? C GSP .   ? A GSP 355 ? 1_555 MG ? B MG . ? A MG 356 ? 1_555 O   ? D HOH .   ? A HOH 413 ? 1_555 87.0  ? 
9  OG  ? A SER 46  ? A SER 47  ? 1_555 MG ? B MG . ? A MG 356 ? 1_555 O   ? D HOH .   ? A HOH 413 ? 1_555 87.2  ? 
10 OG1 ? A THR 180 ? A THR 181 ? 1_555 MG ? B MG . ? A MG 356 ? 1_555 O   ? D HOH .   ? A HOH 413 ? 1_555 93.0  ? 
11 O2G ? C GSP .   ? A GSP 355 ? 1_555 MG ? B MG . ? A MG 356 ? 1_555 O   ? D HOH .   ? A HOH 410 ? 1_555 93.4  ? 
12 O2B ? C GSP .   ? A GSP 355 ? 1_555 MG ? B MG . ? A MG 356 ? 1_555 O   ? D HOH .   ? A HOH 410 ? 1_555 87.0  ? 
13 OG  ? A SER 46  ? A SER 47  ? 1_555 MG ? B MG . ? A MG 356 ? 1_555 O   ? D HOH .   ? A HOH 410 ? 1_555 94.2  ? 
14 OG1 ? A THR 180 ? A THR 181 ? 1_555 MG ? B MG . ? A MG 356 ? 1_555 O   ? D HOH .   ? A HOH 410 ? 1_555 93.2  ? 
15 O   ? D HOH .   ? A HOH 413 ? 1_555 MG ? B MG . ? A MG 356 ? 1_555 O   ? D HOH .   ? A HOH 410 ? 1_555 173.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-09-30 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
_pdbx_database_remark.id     650 
_pdbx_database_remark.text   
;HELIX
BOTH TERMINI ARE IN 3/10 CONFORMATION.
FROM ALA 138 ONWARD, THE STRUCTURE IS IN 3/10 CONFORMATION.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 58  ? ? -114.94 -144.07 
2 1 ASP A 237 ? ? -165.63 117.69  
3 1 ARG A 313 ? ? -107.11 40.05   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 2   ? A GLY 1   
2  1 Y 1 A CYS 3   ? A CYS 2   
3  1 Y 1 A THR 4   ? A THR 3   
4  1 Y 1 A LEU 5   ? A LEU 4   
5  1 Y 1 A SER 6   ? A SER 5   
6  1 Y 1 A ALA 7   ? A ALA 6   
7  1 Y 1 A GLU 8   ? A GLU 7   
8  1 Y 1 A ASP 9   ? A ASP 8   
9  1 Y 1 A LYS 10  ? A LYS 9   
10 1 Y 1 A ALA 11  ? A ALA 10  
11 1 Y 1 A ALA 12  ? A ALA 11  
12 1 Y 1 A VAL 13  ? A VAL 12  
13 1 Y 1 A GLU 14  ? A GLU 13  
14 1 Y 1 A ARG 15  ? A ARG 14  
15 1 Y 1 A SER 16  ? A SER 15  
16 1 Y 1 A LYS 17  ? A LYS 16  
17 1 Y 1 A MET 18  ? A MET 17  
18 1 Y 1 A ILE 19  ? A ILE 18  
19 1 Y 1 A ASP 20  ? A ASP 19  
20 1 Y 1 A ARG 21  ? A ARG 20  
21 1 Y 1 A ASN 22  ? A ASN 21  
22 1 Y 1 A LEU 23  ? A LEU 22  
23 1 Y 1 A ARG 24  ? A ARG 23  
24 1 Y 1 A GLU 25  ? A GLU 24  
25 1 Y 1 A ASP 26  ? A ASP 25  
26 1 Y 1 A GLY 27  ? A GLY 26  
27 1 Y 1 A GLU 28  ? A GLU 27  
28 1 Y 1 A LYS 29  ? A LYS 28  
29 1 Y 1 A ALA 30  ? A ALA 29  
30 1 Y 1 A ALA 31  ? A ALA 30  
31 1 Y 1 A ARG 32  ? A ARG 31  
32 1 Y 1 A GLU 33  ? A GLU 32  
33 1 Y 1 A ILE 344 ? A ILE 343 
34 1 Y 1 A LYS 345 ? A LYS 344 
35 1 Y 1 A ASN 346 ? A ASN 345 
36 1 Y 1 A ASN 347 ? A ASN 346 
37 1 Y 1 A LEU 348 ? A LEU 347 
38 1 Y 1 A LYS 349 ? A LYS 348 
39 1 Y 1 A ASP 350 ? A ASP 349 
40 1 Y 1 A CYS 351 ? A CYS 350 
41 1 Y 1 A GLY 352 ? A GLY 351 
42 1 Y 1 A LEU 353 ? A LEU 352 
43 1 Y 1 A PHE 354 ? A PHE 353 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                              MG  
3 "5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE" GSP 
4 water                                        HOH 
#