data_1GNG
# 
_entry.id   1GNG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GNG         
PDBE  EBI-8654     
WWPDB D_1290008654 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1H8F 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'GLYCOGEN SYNTHASE KINASE 3 BETA.' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GNG 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2001-10-04 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bax, B.'       1  
'Carter, P.S.'  2  
'Lewis, C.'     3  
'Guy, A.R.'     4  
'Bridges, A.'   5  
'Tanner, R.'    6  
'Pettman, G.'   7  
'Mannix, C.'    8  
'Culbert, A.A.' 9  
'Brown, M.J.B.' 10 
'Smith, D.G.'   11 
'Reith, A.D.'   12 
# 
_citation.id                        primary 
_citation.title                     
'The Structure of Phosphorylated Gsk-3Beta Complexed with a Peptide, Frattide, that Inhibits Beta-Catenin Phosphorylation' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            9 
_citation.page_first                1143 
_citation.page_last                 ? 
_citation.year                      2001 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11738041 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(01)00679-7' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bax, B.'       1  
primary 'Carter, P.S.'  2  
primary 'Lewis, C.'     3  
primary 'Guy, A.R.'     4  
primary 'Bridges, A.'   5  
primary 'Tanner, R.'    6  
primary 'Pettman, G.'   7  
primary 'Mannix, C.'    8  
primary 'Culbert, A.A.' 9  
primary 'Brown, M.J.B.' 10 
primary 'Smith, D.G.'   11 
primary 'Reith, A.D.'   12 
# 
_cell.entry_id           1GNG 
_cell.length_a           153.050 
_cell.length_b           153.050 
_cell.length_c           213.350 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              36 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GNG 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GLYCOGEN SYNTHASE KINASE-3 BETA'        43126.277 2   2.7.1.37 ? 'RESIDUES 27-393'  ? 
2 polymer     syn FRATTIDE                                 4543.136  2   ?        ? 'RESIDUES 188-226' ? 
3 non-polymer syn 'SULFATE ION'                            96.063    4   ?        ? ?                  ? 
4 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143   1   ?        ? ?                  ? 
5 water       nat water                                    18.015    140 ?        ? ?                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        GSK3B 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;MHHHHHHHHHHKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKN
RELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSF
GICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVS(PTR)ICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELL
LGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTP
LEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTN
;
;MHHHHHHHHHHKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKN
RELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSF
GICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQP
IFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEAC
AHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTN
;
A,B ? 
2 'polypeptide(L)' no no  SQPETRTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQ SQPETRTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQ X,Y ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  HIS n 
1 12  LYS n 
1 13  VAL n 
1 14  SER n 
1 15  ARG n 
1 16  ASP n 
1 17  LYS n 
1 18  ASP n 
1 19  GLY n 
1 20  SER n 
1 21  LYS n 
1 22  VAL n 
1 23  THR n 
1 24  THR n 
1 25  VAL n 
1 26  VAL n 
1 27  ALA n 
1 28  THR n 
1 29  PRO n 
1 30  GLY n 
1 31  GLN n 
1 32  GLY n 
1 33  PRO n 
1 34  ASP n 
1 35  ARG n 
1 36  PRO n 
1 37  GLN n 
1 38  GLU n 
1 39  VAL n 
1 40  SER n 
1 41  TYR n 
1 42  THR n 
1 43  ASP n 
1 44  THR n 
1 45  LYS n 
1 46  VAL n 
1 47  ILE n 
1 48  GLY n 
1 49  ASN n 
1 50  GLY n 
1 51  SER n 
1 52  PHE n 
1 53  GLY n 
1 54  VAL n 
1 55  VAL n 
1 56  TYR n 
1 57  GLN n 
1 58  ALA n 
1 59  LYS n 
1 60  LEU n 
1 61  CYS n 
1 62  ASP n 
1 63  SER n 
1 64  GLY n 
1 65  GLU n 
1 66  LEU n 
1 67  VAL n 
1 68  ALA n 
1 69  ILE n 
1 70  LYS n 
1 71  LYS n 
1 72  VAL n 
1 73  LEU n 
1 74  GLN n 
1 75  ASP n 
1 76  LYS n 
1 77  ARG n 
1 78  PHE n 
1 79  LYS n 
1 80  ASN n 
1 81  ARG n 
1 82  GLU n 
1 83  LEU n 
1 84  GLN n 
1 85  ILE n 
1 86  MET n 
1 87  ARG n 
1 88  LYS n 
1 89  LEU n 
1 90  ASP n 
1 91  HIS n 
1 92  CYS n 
1 93  ASN n 
1 94  ILE n 
1 95  VAL n 
1 96  ARG n 
1 97  LEU n 
1 98  ARG n 
1 99  TYR n 
1 100 PHE n 
1 101 PHE n 
1 102 TYR n 
1 103 SER n 
1 104 SER n 
1 105 GLY n 
1 106 GLU n 
1 107 LYS n 
1 108 LYS n 
1 109 ASP n 
1 110 GLU n 
1 111 VAL n 
1 112 TYR n 
1 113 LEU n 
1 114 ASN n 
1 115 LEU n 
1 116 VAL n 
1 117 LEU n 
1 118 ASP n 
1 119 TYR n 
1 120 VAL n 
1 121 PRO n 
1 122 GLU n 
1 123 THR n 
1 124 VAL n 
1 125 TYR n 
1 126 ARG n 
1 127 VAL n 
1 128 ALA n 
1 129 ARG n 
1 130 HIS n 
1 131 TYR n 
1 132 SER n 
1 133 ARG n 
1 134 ALA n 
1 135 LYS n 
1 136 GLN n 
1 137 THR n 
1 138 LEU n 
1 139 PRO n 
1 140 VAL n 
1 141 ILE n 
1 142 TYR n 
1 143 VAL n 
1 144 LYS n 
1 145 LEU n 
1 146 TYR n 
1 147 MET n 
1 148 TYR n 
1 149 GLN n 
1 150 LEU n 
1 151 PHE n 
1 152 ARG n 
1 153 SER n 
1 154 LEU n 
1 155 ALA n 
1 156 TYR n 
1 157 ILE n 
1 158 HIS n 
1 159 SER n 
1 160 PHE n 
1 161 GLY n 
1 162 ILE n 
1 163 CYS n 
1 164 HIS n 
1 165 ARG n 
1 166 ASP n 
1 167 ILE n 
1 168 LYS n 
1 169 PRO n 
1 170 GLN n 
1 171 ASN n 
1 172 LEU n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 PRO n 
1 177 ASP n 
1 178 THR n 
1 179 ALA n 
1 180 VAL n 
1 181 LEU n 
1 182 LYS n 
1 183 LEU n 
1 184 CYS n 
1 185 ASP n 
1 186 PHE n 
1 187 GLY n 
1 188 SER n 
1 189 ALA n 
1 190 LYS n 
1 191 GLN n 
1 192 LEU n 
1 193 VAL n 
1 194 ARG n 
1 195 GLY n 
1 196 GLU n 
1 197 PRO n 
1 198 ASN n 
1 199 VAL n 
1 200 SER n 
1 201 PTR n 
1 202 ILE n 
1 203 CYS n 
1 204 SER n 
1 205 ARG n 
1 206 TYR n 
1 207 TYR n 
1 208 ARG n 
1 209 ALA n 
1 210 PRO n 
1 211 GLU n 
1 212 LEU n 
1 213 ILE n 
1 214 PHE n 
1 215 GLY n 
1 216 ALA n 
1 217 THR n 
1 218 ASP n 
1 219 TYR n 
1 220 THR n 
1 221 SER n 
1 222 SER n 
1 223 ILE n 
1 224 ASP n 
1 225 VAL n 
1 226 TRP n 
1 227 SER n 
1 228 ALA n 
1 229 GLY n 
1 230 CYS n 
1 231 VAL n 
1 232 LEU n 
1 233 ALA n 
1 234 GLU n 
1 235 LEU n 
1 236 LEU n 
1 237 LEU n 
1 238 GLY n 
1 239 GLN n 
1 240 PRO n 
1 241 ILE n 
1 242 PHE n 
1 243 PRO n 
1 244 GLY n 
1 245 ASP n 
1 246 SER n 
1 247 GLY n 
1 248 VAL n 
1 249 ASP n 
1 250 GLN n 
1 251 LEU n 
1 252 VAL n 
1 253 GLU n 
1 254 ILE n 
1 255 ILE n 
1 256 LYS n 
1 257 VAL n 
1 258 LEU n 
1 259 GLY n 
1 260 THR n 
1 261 PRO n 
1 262 THR n 
1 263 ARG n 
1 264 GLU n 
1 265 GLN n 
1 266 ILE n 
1 267 ARG n 
1 268 GLU n 
1 269 MET n 
1 270 ASN n 
1 271 PRO n 
1 272 ASN n 
1 273 TYR n 
1 274 THR n 
1 275 GLU n 
1 276 PHE n 
1 277 LYS n 
1 278 PHE n 
1 279 PRO n 
1 280 GLN n 
1 281 ILE n 
1 282 LYS n 
1 283 ALA n 
1 284 HIS n 
1 285 PRO n 
1 286 TRP n 
1 287 THR n 
1 288 LYS n 
1 289 VAL n 
1 290 PHE n 
1 291 ARG n 
1 292 PRO n 
1 293 ARG n 
1 294 THR n 
1 295 PRO n 
1 296 PRO n 
1 297 GLU n 
1 298 ALA n 
1 299 ILE n 
1 300 ALA n 
1 301 LEU n 
1 302 CYS n 
1 303 SER n 
1 304 ARG n 
1 305 LEU n 
1 306 LEU n 
1 307 GLU n 
1 308 TYR n 
1 309 THR n 
1 310 PRO n 
1 311 THR n 
1 312 ALA n 
1 313 ARG n 
1 314 LEU n 
1 315 THR n 
1 316 PRO n 
1 317 LEU n 
1 318 GLU n 
1 319 ALA n 
1 320 CYS n 
1 321 ALA n 
1 322 HIS n 
1 323 SER n 
1 324 PHE n 
1 325 PHE n 
1 326 ASP n 
1 327 GLU n 
1 328 LEU n 
1 329 ARG n 
1 330 ASP n 
1 331 PRO n 
1 332 ASN n 
1 333 VAL n 
1 334 LYS n 
1 335 LEU n 
1 336 PRO n 
1 337 ASN n 
1 338 GLY n 
1 339 ARG n 
1 340 ASP n 
1 341 THR n 
1 342 PRO n 
1 343 ALA n 
1 344 LEU n 
1 345 PHE n 
1 346 ASN n 
1 347 PHE n 
1 348 THR n 
1 349 THR n 
1 350 GLN n 
1 351 GLU n 
1 352 LEU n 
1 353 SER n 
1 354 SER n 
1 355 ASN n 
1 356 PRO n 
1 357 PRO n 
1 358 LEU n 
1 359 ALA n 
1 360 THR n 
1 361 ILE n 
1 362 LEU n 
1 363 ILE n 
1 364 PRO n 
1 365 PRO n 
1 366 HIS n 
1 367 ALA n 
1 368 ARG n 
1 369 ILE n 
1 370 GLN n 
1 371 ALA n 
1 372 ALA n 
1 373 ALA n 
1 374 SER n 
1 375 THR n 
1 376 PRO n 
1 377 THR n 
1 378 ASN n 
2 1   SER n 
2 2   GLN n 
2 3   PRO n 
2 4   GLU n 
2 5   THR n 
2 6   ARG n 
2 7   THR n 
2 8   GLY n 
2 9   ASP n 
2 10  ASP n 
2 11  ASP n 
2 12  PRO n 
2 13  HIS n 
2 14  ARG n 
2 15  LEU n 
2 16  LEU n 
2 17  GLN n 
2 18  GLN n 
2 19  LEU n 
2 20  VAL n 
2 21  LEU n 
2 22  SER n 
2 23  GLY n 
2 24  ASN n 
2 25  LEU n 
2 26  ILE n 
2 27  LYS n 
2 28  GLU n 
2 29  ALA n 
2 30  VAL n 
2 31  ARG n 
2 32  ARG n 
2 33  LEU n 
2 34  HIS n 
2 35  SER n 
2 36  ARG n 
2 37  ARG n 
2 38  LEU n 
2 39  GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'SPODOPTERA FRUGIPERDA' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACULOVIRUS 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'HOMO SAPIENS' 
_pdbx_entity_src_syn.organism_common_name   HUMAN 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 1GNG       1 ? ? 1GNG   ? 
2 UNP KG3B_HUMAN 1 ? ? P49841 ? 
3 UNP FRT1_HUMAN 2 ? ? Q92837 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1GNG A 1  ? 11  ? 1GNG   16  ? 26  ? 16  26  
2 2 1GNG A 12 ? 378 ? P49841 27  ? 393 ? 27  393 
3 1 1GNG B 1  ? 11  ? 1GNG   16  ? 26  ? 16  26  
4 2 1GNG B 12 ? 378 ? P49841 27  ? 393 ? 27  393 
5 3 1GNG X 1  ? 39  ? Q92837 188 ? 226 ? 188 226 
6 3 1GNG Y 1  ? 39  ? Q92837 188 ? 226 ? 188 226 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1GNG LEU A 335 ? UNP P49841 HIS 350 conflict 350 1 
3 1GNG LEU B 335 ? UNP P49841 HIS 350 conflict 350 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                 ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                 ?                 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                  ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                    ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                   ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                               ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                  ?                 'C5 H9 N O2'     115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE                        PHOSPHONOTYROSINE 'C9 H12 N O6 P'  261.168 
SER 'L-peptide linking' y SERINE                                   ?                 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'                            ?                 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE                                ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?                 'C11 H12 N2 O2'  204.225 
TRS non-polymer         . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER'     'C4 H12 N O3 1'  122.143 
TYR 'L-peptide linking' y TYROSINE                                 ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                   ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1GNG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.6 
_exptl_crystal.density_percent_sol   50 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '1.6M AMMONIUM SULPHATE, 0.1M TRIS PH7.5, pH 7.50' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2000-04-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9326 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             0.9326 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1GNG 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25.000 
_reflns.d_resolution_high            2.600 
_reflns.number_obs                   29716 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.06600 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        52.7 
_reflns.pdbx_redundancy              11.200 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.64 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.44800 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.000 
_reflns_shell.pdbx_redundancy        11.00 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1GNG 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     29649 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             18.00 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_obs                          0.196 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.196 
_refine.ls_R_factor_R_free                       0.262 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               53.5 
_refine.aniso_B[1][1]                            -4.93 
_refine.aniso_B[2][2]                            -4.93 
_refine.aniso_B[3][3]                            9.86 
_refine.aniso_B[1][2]                            4.15 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2ERK' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            SHELLS 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1GNG 
_refine_analyze.Luzzati_coordinate_error_obs    0.31 
_refine_analyze.Luzzati_sigma_a_obs             0.39 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.41 
_refine_analyze.Luzzati_sigma_a_free            0.43 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6059 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.number_atoms_solvent             140 
_refine_hist.number_atoms_total               6227 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        18.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.4  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.85  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.60 
_refine_ls_shell.d_res_low                        2.76 
_refine_ls_shell.number_reflns_R_work             4697 
_refine_ls_shell.R_factor_R_work                  0.291 
_refine_ls_shell.percent_reflns_obs               100.0 
_refine_ls_shell.R_factor_R_free                  0.321 
_refine_ls_shell.R_factor_R_free_error            0.021 
_refine_ls_shell.percent_reflns_R_free            4.6 
_refine_ls_shell.number_reflns_R_free             224 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1GNG 
_struct.title                     'Glycogen synthase kinase-3 beta (GSK3) complex with FRATtide peptide' 
_struct.pdbx_descriptor           'GLYCOGEN SYNTHASE KINASE-3 BETA (E.C.2.7.1.37), FRATTIDE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GNG 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, PROTEIN KINASE, GSK3-FRATTIDE COMPLEX, PHOSPHORYLATED, ACTIVE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 80  ? LEU A 89  ? ASN A 95  LEU A 104 1 ? 10 
HELX_P HELX_P2  2  THR A 123 ? ALA A 134 ? THR A 138 ALA A 149 1 ? 12 
HELX_P HELX_P3  3  PRO A 139 ? PHE A 160 ? PRO A 154 PHE A 175 1 ? 22 
HELX_P HELX_P4  4  LYS A 168 ? GLN A 170 ? LYS A 183 GLN A 185 5 ? 3  
HELX_P HELX_P5  5  SER A 204 ? ARG A 208 ? SER A 219 ARG A 223 5 ? 5  
HELX_P HELX_P6  6  ALA A 209 ? PHE A 214 ? ALA A 224 PHE A 229 1 ? 6  
HELX_P HELX_P7  7  SER A 221 ? GLY A 238 ? SER A 236 GLY A 253 1 ? 18 
HELX_P HELX_P8  8  SER A 246 ? GLY A 259 ? SER A 261 GLY A 274 1 ? 14 
HELX_P HELX_P9  9  THR A 262 ? ASN A 270 ? THR A 277 ASN A 285 1 ? 9  
HELX_P HELX_P10 10 PRO A 285 ? PHE A 290 ? PRO A 300 PHE A 305 1 ? 6  
HELX_P HELX_P11 11 PRO A 295 ? LEU A 306 ? PRO A 310 LEU A 321 1 ? 12 
HELX_P HELX_P12 12 THR A 309 ? ARG A 313 ? THR A 324 ARG A 328 5 ? 5  
HELX_P HELX_P13 13 THR A 315 ? ALA A 321 ? THR A 330 ALA A 336 1 ? 7  
HELX_P HELX_P14 14 HIS A 322 ? ASP A 330 ? HIS A 337 ASP A 345 5 ? 9  
HELX_P HELX_P15 15 THR A 348 ? SER A 353 ? THR A 363 SER A 368 1 ? 6  
HELX_P HELX_P16 16 ASN A 355 ? PRO A 357 ? ASN A 370 PRO A 372 5 ? 3  
HELX_P HELX_P17 17 LEU A 358 ? ILE A 363 ? LEU A 373 ILE A 378 1 ? 6  
HELX_P HELX_P18 18 ASN B 80  ? LEU B 89  ? ASN B 95  LEU B 104 1 ? 10 
HELX_P HELX_P19 19 THR B 123 ? ALA B 134 ? THR B 138 ALA B 149 1 ? 12 
HELX_P HELX_P20 20 PRO B 139 ? PHE B 160 ? PRO B 154 PHE B 175 1 ? 22 
HELX_P HELX_P21 21 LYS B 168 ? GLN B 170 ? LYS B 183 GLN B 185 5 ? 3  
HELX_P HELX_P22 22 SER B 204 ? ARG B 208 ? SER B 219 ARG B 223 5 ? 5  
HELX_P HELX_P23 23 ALA B 209 ? PHE B 214 ? ALA B 224 PHE B 229 1 ? 6  
HELX_P HELX_P24 24 SER B 221 ? GLY B 238 ? SER B 236 GLY B 253 1 ? 18 
HELX_P HELX_P25 25 SER B 246 ? GLY B 259 ? SER B 261 GLY B 274 1 ? 14 
HELX_P HELX_P26 26 THR B 262 ? ASN B 270 ? THR B 277 ASN B 285 1 ? 9  
HELX_P HELX_P27 27 PRO B 285 ? PHE B 290 ? PRO B 300 PHE B 305 1 ? 6  
HELX_P HELX_P28 28 PRO B 295 ? ARG B 304 ? PRO B 310 ARG B 319 1 ? 10 
HELX_P HELX_P29 29 THR B 309 ? ARG B 313 ? THR B 324 ARG B 328 5 ? 5  
HELX_P HELX_P30 30 THR B 315 ? ALA B 321 ? THR B 330 ALA B 336 1 ? 7  
HELX_P HELX_P31 31 HIS B 322 ? ASP B 330 ? HIS B 337 ASP B 345 5 ? 9  
HELX_P HELX_P32 32 THR B 348 ? SER B 353 ? THR B 363 SER B 368 1 ? 6  
HELX_P HELX_P33 33 ASN B 355 ? PRO B 357 ? ASN B 370 PRO B 372 5 ? 3  
HELX_P HELX_P34 34 LEU B 358 ? ILE B 363 ? LEU B 373 ILE B 378 1 ? 6  
HELX_P HELX_P35 35 ASP C 11  ? GLY C 23  ? ASP X 198 GLY X 210 1 ? 13 
HELX_P HELX_P36 36 ASN C 24  ? SER C 35  ? ASN X 211 SER X 222 1 ? 12 
HELX_P HELX_P37 37 ASP D 11  ? GLY D 23  ? ASP Y 198 GLY Y 210 1 ? 13 
HELX_P HELX_P38 38 ASN D 24  ? HIS D 34  ? ASN Y 211 HIS Y 221 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A SER 200 C ? ? ? 1_555 A PTR 201 N ? ? A SER 215 A PTR 216 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale2 covale ? ? A PTR 201 C ? ? ? 1_555 A ILE 202 N ? ? A PTR 216 A ILE 217 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale3 covale ? ? B SER 200 C ? ? ? 1_555 B PTR 201 N ? ? B SER 215 B PTR 216 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale4 covale ? ? B PTR 201 C ? ? ? 1_555 B ILE 202 N ? ? B PTR 216 B ILE 217 1_555 ? ? ? ? ? ? ? 1.326 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 8 ? 
AB ? 2 ? 
AC ? 2 ? 
BA ? 7 ? 
BB ? 2 ? 
BC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AA 6 7 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BA 5 6 ? anti-parallel 
BA 6 7 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 THR A 23  ? PRO A 29  ? THR A 38  PRO A 44  
AA 2 GLN A 37  ? ASN A 49  ? GLN A 52  ASN A 64  
AA 3 VAL A 54  ? LEU A 60  ? VAL A 69  LEU A 75  
AA 4 LEU A 66  ? ASP A 75  ? LEU A 81  ASP A 90  
AA 5 GLU A 110 ? ASP A 118 ? GLU A 125 ASP A 133 
AA 6 LEU A 97  ? SER A 103 ? LEU A 112 SER A 118 
AA 7 THR A 23  ? PRO A 29  ? THR A 38  PRO A 44  
AA 8 THR A 23  ? PRO A 29  ? THR A 38  PRO A 44  
AB 1 ILE A 162 ? CYS A 163 ? ILE A 177 CYS A 178 
AB 2 LYS A 190 ? GLN A 191 ? LYS A 205 GLN A 206 
AC 1 LEU A 172 ? LEU A 174 ? LEU A 187 LEU A 189 
AC 2 LEU A 181 ? LEU A 183 ? LEU A 196 LEU A 198 
BA 1 VAL B 22  ? PRO B 29  ? VAL B 37  PRO B 44  
BA 2 GLN B 37  ? GLY B 48  ? GLN B 52  GLY B 63  
BA 3 GLY B 53  ? LEU B 60  ? GLY B 68  LEU B 75  
BA 4 LEU B 66  ? ASP B 75  ? LEU B 81  ASP B 90  
BA 5 GLU B 110 ? ASP B 118 ? GLU B 125 ASP B 133 
BA 6 LEU B 97  ? SER B 104 ? LEU B 112 SER B 119 
BA 7 VAL B 22  ? PRO B 29  ? VAL B 37  PRO B 44  
BB 1 ILE B 162 ? CYS B 163 ? ILE B 177 CYS B 178 
BB 2 LYS B 190 ? GLN B 191 ? LYS B 205 GLN B 206 
BC 1 LEU B 172 ? LEU B 174 ? LEU B 187 LEU B 189 
BC 2 LEU B 181 ? LEU B 183 ? LEU B 196 LEU B 198 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ALA A 27  ? N ALA A 42  O GLN A 37  ? O GLN A 52  
AA 2 3 N ILE A 47  ? N ILE A 62  O VAL A 55  ? O VAL A 70  
AA 3 4 N ALA A 58  ? N ALA A 73  O VAL A 67  ? O VAL A 82  
AA 4 5 N GLN A 74  ? N GLN A 89  O VAL A 111 ? O VAL A 126 
AA 5 6 O VAL A 116 ? O VAL A 131 N ARG A 98  ? N ARG A 113 
AA 6 7 N PHE A 100 ? N PHE A 115 O THR A 28  ? O THR A 43  
AB 1 2 N CYS A 163 ? N CYS A 178 O LYS A 190 ? O LYS A 205 
AC 1 2 N LEU A 173 ? N LEU A 188 O LYS A 182 ? O LYS A 197 
BA 1 2 N ALA B 27  ? N ALA B 42  O GLN B 37  ? O GLN B 52  
BA 2 3 N ILE B 47  ? N ILE B 62  O VAL B 55  ? O VAL B 70  
BA 3 4 N ALA B 58  ? N ALA B 73  O VAL B 67  ? O VAL B 82  
BA 4 5 N GLN B 74  ? N GLN B 89  O VAL B 111 ? O VAL B 126 
BA 5 6 O VAL B 116 ? O VAL B 131 N ARG B 98  ? N ARG B 113 
BA 6 7 N PHE B 100 ? N PHE B 115 O THR B 28  ? O THR B 43  
BB 1 2 N CYS B 163 ? N CYS B 178 O LYS B 190 ? O LYS B 205 
BC 1 2 N LEU B 173 ? N LEU B 188 O LYS B 182 ? O LYS B 197 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A1385' 
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 A1386' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 B1384' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 B1385' 
AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE TRS B1386' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ARG A 81  ? ARG A 96   . ? 1_555 ? 
2  AC1 5 ARG A 165 ? ARG A 180  . ? 1_555 ? 
3  AC1 5 LYS A 190 ? LYS A 205  . ? 1_555 ? 
4  AC1 5 ASN A 198 ? ASN A 213  . ? 1_555 ? 
5  AC1 5 VAL A 199 ? VAL A 214  . ? 1_555 ? 
6  AC2 2 ARG A 194 ? ARG A 209  . ? 1_555 ? 
7  AC2 2 ARG B 194 ? ARG B 209  . ? 1_555 ? 
8  AC3 5 ARG B 81  ? ARG B 96   . ? 1_555 ? 
9  AC3 5 ARG B 165 ? ARG B 180  . ? 1_555 ? 
10 AC3 5 LYS B 190 ? LYS B 205  . ? 1_555 ? 
11 AC3 5 ASN B 198 ? ASN B 213  . ? 1_555 ? 
12 AC3 5 VAL B 199 ? VAL B 214  . ? 1_555 ? 
13 AC4 4 ARG A 194 ? ARG A 209  . ? 1_555 ? 
14 AC4 4 VAL B 193 ? VAL B 208  . ? 1_555 ? 
15 AC4 4 ARG B 194 ? ARG B 209  . ? 1_555 ? 
16 AC4 4 HOH K .   ? HOH B 2026 . ? 1_555 ? 
17 AC5 2 ARG B 81  ? ARG B 96   . ? 1_555 ? 
18 AC5 2 HOH K .   ? HOH B 2024 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1GNG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GNG 
_atom_sites.fract_transf_matrix[1][1]   0.006534 
_atom_sites.fract_transf_matrix[1][2]   0.003772 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007544 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004687 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 21  ? 101.254 19.621 -31.539 1.00 80.08  ? 36   LYS A N   1 
ATOM   2    C CA  . LYS A 1 21  ? 99.812  19.726 -31.916 1.00 81.07  ? 36   LYS A CA  1 
ATOM   3    C C   . LYS A 1 21  ? 98.971  20.304 -30.771 1.00 80.70  ? 36   LYS A C   1 
ATOM   4    O O   . LYS A 1 21  ? 99.494  20.598 -29.692 1.00 81.35  ? 36   LYS A O   1 
ATOM   5    C CB  . LYS A 1 21  ? 99.284  18.351 -32.318 1.00 81.07  ? 36   LYS A CB  1 
ATOM   6    N N   . VAL A 1 22  ? 97.670  20.470 -31.013 1.00 79.55  ? 37   VAL A N   1 
ATOM   7    C CA  . VAL A 1 22  ? 96.755  21.016 -30.008 1.00 78.50  ? 37   VAL A CA  1 
ATOM   8    C C   . VAL A 1 22  ? 95.942  19.936 -29.308 1.00 78.02  ? 37   VAL A C   1 
ATOM   9    O O   . VAL A 1 22  ? 94.990  19.388 -29.870 1.00 79.89  ? 37   VAL A O   1 
ATOM   10   C CB  . VAL A 1 22  ? 95.765  22.022 -30.624 1.00 77.49  ? 37   VAL A CB  1 
ATOM   11   C CG1 . VAL A 1 22  ? 94.754  22.459 -29.574 1.00 77.71  ? 37   VAL A CG1 1 
ATOM   12   C CG2 . VAL A 1 22  ? 96.518  23.223 -31.167 1.00 76.42  ? 37   VAL A CG2 1 
ATOM   13   N N   . THR A 1 23  ? 96.315  19.650 -28.067 1.00 76.30  ? 38   THR A N   1 
ATOM   14   C CA  . THR A 1 23  ? 95.631  18.637 -27.284 1.00 74.18  ? 38   THR A CA  1 
ATOM   15   C C   . THR A 1 23  ? 94.296  19.148 -26.768 1.00 71.44  ? 38   THR A C   1 
ATOM   16   O O   . THR A 1 23  ? 94.185  20.294 -26.332 1.00 69.35  ? 38   THR A O   1 
ATOM   17   C CB  . THR A 1 23  ? 96.475  18.216 -26.084 1.00 74.31  ? 38   THR A CB  1 
ATOM   18   O OG1 . THR A 1 23  ? 97.834  18.052 -26.503 1.00 76.94  ? 38   THR A OG1 1 
ATOM   19   C CG2 . THR A 1 23  ? 95.961  16.898 -25.509 1.00 72.66  ? 38   THR A CG2 1 
ATOM   20   N N   . THR A 1 24  ? 93.283  18.291 -26.831 1.00 69.52  ? 39   THR A N   1 
ATOM   21   C CA  . THR A 1 24  ? 91.957  18.648 -26.348 1.00 68.48  ? 39   THR A CA  1 
ATOM   22   C C   . THR A 1 24  ? 91.440  17.532 -25.449 1.00 67.59  ? 39   THR A C   1 
ATOM   23   O O   . THR A 1 24  ? 91.470  16.353 -25.817 1.00 67.55  ? 39   THR A O   1 
ATOM   24   C CB  . THR A 1 24  ? 90.974  18.872 -27.503 1.00 67.24  ? 39   THR A CB  1 
ATOM   25   O OG1 . THR A 1 24  ? 91.547  19.791 -28.440 1.00 67.84  ? 39   THR A OG1 1 
ATOM   26   C CG2 . THR A 1 24  ? 89.667  19.454 -26.977 1.00 64.51  ? 39   THR A CG2 1 
ATOM   27   N N   . VAL A 1 25  ? 90.977  17.919 -24.263 1.00 66.01  ? 40   VAL A N   1 
ATOM   28   C CA  . VAL A 1 25  ? 90.470  16.971 -23.278 1.00 64.30  ? 40   VAL A CA  1 
ATOM   29   C C   . VAL A 1 25  ? 89.159  17.448 -22.654 1.00 63.65  ? 40   VAL A C   1 
ATOM   30   O O   . VAL A 1 25  ? 88.785  18.612 -22.794 1.00 64.18  ? 40   VAL A O   1 
ATOM   31   C CB  . VAL A 1 25  ? 91.510  16.757 -22.138 1.00 64.18  ? 40   VAL A CB  1 
ATOM   32   C CG1 . VAL A 1 25  ? 92.777  16.134 -22.697 1.00 63.61  ? 40   VAL A CG1 1 
ATOM   33   C CG2 . VAL A 1 25  ? 91.840  18.084 -21.467 1.00 63.45  ? 40   VAL A CG2 1 
ATOM   34   N N   . VAL A 1 26  ? 88.453  16.535 -21.992 1.00 63.20  ? 41   VAL A N   1 
ATOM   35   C CA  . VAL A 1 26  ? 87.207  16.874 -21.306 1.00 63.28  ? 41   VAL A CA  1 
ATOM   36   C C   . VAL A 1 26  ? 87.621  16.990 -19.849 1.00 61.14  ? 41   VAL A C   1 
ATOM   37   O O   . VAL A 1 26  ? 88.053  16.008 -19.243 1.00 61.62  ? 41   VAL A O   1 
ATOM   38   C CB  . VAL A 1 26  ? 86.147  15.757 -21.429 1.00 64.85  ? 41   VAL A CB  1 
ATOM   39   C CG1 . VAL A 1 26  ? 84.879  16.151 -20.666 1.00 61.51  ? 41   VAL A CG1 1 
ATOM   40   C CG2 . VAL A 1 26  ? 85.840  15.493 -22.900 1.00 64.90  ? 41   VAL A CG2 1 
ATOM   41   N N   . ALA A 1 27  ? 87.506  18.186 -19.285 1.00 59.71  ? 42   ALA A N   1 
ATOM   42   C CA  . ALA A 1 27  ? 87.921  18.382 -17.911 1.00 58.52  ? 42   ALA A CA  1 
ATOM   43   C C   . ALA A 1 27  ? 86.845  18.984 -17.037 1.00 57.72  ? 42   ALA A C   1 
ATOM   44   O O   . ALA A 1 27  ? 85.848  19.507 -17.524 1.00 56.90  ? 42   ALA A O   1 
ATOM   45   C CB  . ALA A 1 27  ? 89.165  19.255 -17.876 1.00 59.34  ? 42   ALA A CB  1 
ATOM   46   N N   . THR A 1 28  ? 87.067  18.899 -15.733 1.00 57.02  ? 43   THR A N   1 
ATOM   47   C CA  . THR A 1 28  ? 86.149  19.438 -14.746 1.00 56.21  ? 43   THR A CA  1 
ATOM   48   C C   . THR A 1 28  ? 86.788  20.689 -14.152 1.00 55.66  ? 43   THR A C   1 
ATOM   49   O O   . THR A 1 28  ? 88.001  20.734 -13.933 1.00 51.82  ? 43   THR A O   1 
ATOM   50   C CB  . THR A 1 28  ? 85.905  18.419 -13.618 1.00 56.20  ? 43   THR A CB  1 
ATOM   51   O OG1 . THR A 1 28  ? 85.367  17.214 -14.173 1.00 56.36  ? 43   THR A OG1 1 
ATOM   52   C CG2 . THR A 1 28  ? 84.941  18.978 -12.582 1.00 54.72  ? 43   THR A CG2 1 
ATOM   53   N N   . PRO A 1 29  ? 85.984  21.733 -13.911 1.00 56.88  ? 44   PRO A N   1 
ATOM   54   C CA  . PRO A 1 29  ? 86.528  22.966 -13.334 1.00 58.68  ? 44   PRO A CA  1 
ATOM   55   C C   . PRO A 1 29  ? 86.976  22.689 -11.898 1.00 60.08  ? 44   PRO A C   1 
ATOM   56   O O   . PRO A 1 29  ? 86.236  22.075 -11.130 1.00 58.86  ? 44   PRO A O   1 
ATOM   57   C CB  . PRO A 1 29  ? 85.337  23.926 -13.387 1.00 57.11  ? 44   PRO A CB  1 
ATOM   58   C CG  . PRO A 1 29  ? 84.539  23.422 -14.550 1.00 57.49  ? 44   PRO A CG  1 
ATOM   59   C CD  . PRO A 1 29  ? 84.591  21.929 -14.346 1.00 57.12  ? 44   PRO A CD  1 
ATOM   60   N N   . GLY A 1 30  ? 88.179  23.129 -11.539 1.00 62.78  ? 45   GLY A N   1 
ATOM   61   C CA  . GLY A 1 30  ? 88.675  22.906 -10.186 1.00 68.67  ? 45   GLY A CA  1 
ATOM   62   C C   . GLY A 1 30  ? 87.717  23.413 -9.118  1.00 72.21  ? 45   GLY A C   1 
ATOM   63   O O   . GLY A 1 30  ? 87.219  22.647 -8.285  1.00 69.99  ? 45   GLY A O   1 
ATOM   64   N N   . GLN A 1 31  ? 87.478  24.720 -9.129  1.00 77.14  ? 46   GLN A N   1 
ATOM   65   C CA  . GLN A 1 31  ? 86.550  25.335 -8.193  1.00 82.98  ? 46   GLN A CA  1 
ATOM   66   C C   . GLN A 1 31  ? 85.322  25.696 -9.017  1.00 84.30  ? 46   GLN A C   1 
ATOM   67   O O   . GLN A 1 31  ? 85.363  26.613 -9.835  1.00 84.49  ? 46   GLN A O   1 
ATOM   68   C CB  . GLN A 1 31  ? 87.151  26.601 -7.561  1.00 86.63  ? 46   GLN A CB  1 
ATOM   69   C CG  . GLN A 1 31  ? 88.358  26.364 -6.637  1.00 91.70  ? 46   GLN A CG  1 
ATOM   70   C CD  . GLN A 1 31  ? 89.704  26.493 -7.349  1.00 93.85  ? 46   GLN A CD  1 
ATOM   71   O OE1 . GLN A 1 31  ? 90.769  26.291 -6.745  1.00 94.54  ? 46   GLN A OE1 1 
ATOM   72   N NE2 . GLN A 1 31  ? 89.662  26.838 -8.636  1.00 94.54  ? 46   GLN A NE2 1 
ATOM   73   N N   . GLY A 1 32  ? 84.241  24.953 -8.822  1.00 86.76  ? 47   GLY A N   1 
ATOM   74   C CA  . GLY A 1 32  ? 83.032  25.231 -9.571  1.00 89.75  ? 47   GLY A CA  1 
ATOM   75   C C   . GLY A 1 32  ? 82.254  23.983 -9.946  1.00 91.85  ? 47   GLY A C   1 
ATOM   76   O O   . GLY A 1 32  ? 82.795  22.876 -9.878  1.00 92.16  ? 47   GLY A O   1 
ATOM   77   N N   . PRO A 1 33  ? 80.977  24.140 -10.360 1.00 93.59  ? 48   PRO A N   1 
ATOM   78   C CA  . PRO A 1 33  ? 80.039  23.082 -10.769 1.00 93.83  ? 48   PRO A CA  1 
ATOM   79   C C   . PRO A 1 33  ? 80.663  21.887 -11.486 1.00 94.35  ? 48   PRO A C   1 
ATOM   80   O O   . PRO A 1 33  ? 81.380  22.030 -12.484 1.00 94.98  ? 48   PRO A O   1 
ATOM   81   C CB  . PRO A 1 33  ? 79.040  23.834 -11.638 1.00 93.57  ? 48   PRO A CB  1 
ATOM   82   C CG  . PRO A 1 33  ? 78.922  25.141 -10.895 1.00 93.62  ? 48   PRO A CG  1 
ATOM   83   C CD  . PRO A 1 33  ? 80.373  25.474 -10.564 1.00 93.35  ? 48   PRO A CD  1 
ATOM   84   N N   . ASP A 1 34  ? 80.357  20.707 -10.960 1.00 93.55  ? 49   ASP A N   1 
ATOM   85   C CA  . ASP A 1 34  ? 80.868  19.446 -11.468 1.00 94.19  ? 49   ASP A CA  1 
ATOM   86   C C   . ASP A 1 34  ? 80.586  19.106 -12.928 1.00 94.05  ? 49   ASP A C   1 
ATOM   87   O O   . ASP A 1 34  ? 80.731  17.945 -13.319 1.00 94.77  ? 49   ASP A O   1 
ATOM   88   C CB  . ASP A 1 34  ? 80.354  18.299 -10.591 1.00 96.01  ? 49   ASP A CB  1 
ATOM   89   C CG  . ASP A 1 34  ? 81.410  17.772 -9.637  1.00 98.27  ? 49   ASP A CG  1 
ATOM   90   O OD1 . ASP A 1 34  ? 82.435  17.238 -10.123 1.00 99.28  ? 49   ASP A OD1 1 
ATOM   91   O OD2 . ASP A 1 34  ? 81.213  17.890 -8.404  1.00 99.43  ? 49   ASP A OD2 1 
ATOM   92   N N   . ARG A 1 35  ? 80.191  20.077 -13.746 1.00 92.86  ? 50   ARG A N   1 
ATOM   93   C CA  . ARG A 1 35  ? 79.928  19.735 -15.135 1.00 92.10  ? 50   ARG A CA  1 
ATOM   94   C C   . ARG A 1 35  ? 81.108  20.042 -16.059 1.00 90.41  ? 50   ARG A C   1 
ATOM   95   O O   . ARG A 1 35  ? 81.575  21.181 -16.134 1.00 89.25  ? 50   ARG A O   1 
ATOM   96   C CB  . ARG A 1 35  ? 78.651  20.414 -15.640 1.00 93.65  ? 50   ARG A CB  1 
ATOM   97   C CG  . ARG A 1 35  ? 78.235  19.890 -17.010 1.00 94.65  ? 50   ARG A CG  1 
ATOM   98   C CD  . ARG A 1 35  ? 76.744  19.587 -17.127 1.00 95.22  ? 50   ARG A CD  1 
ATOM   99   N NE  . ARG A 1 35  ? 75.924  20.789 -17.267 1.00 95.55  ? 50   ARG A NE  1 
ATOM   100  C CZ  . ARG A 1 35  ? 74.800  20.849 -17.984 1.00 95.00  ? 50   ARG A CZ  1 
ATOM   101  N NH1 . ARG A 1 35  ? 74.359  19.775 -18.633 1.00 95.63  ? 50   ARG A NH1 1 
ATOM   102  N NH2 . ARG A 1 35  ? 74.113  21.983 -18.052 1.00 93.83  ? 50   ARG A NH2 1 
ATOM   103  N N   . PRO A 1 36  ? 81.605  19.005 -16.767 1.00 88.93  ? 51   PRO A N   1 
ATOM   104  C CA  . PRO A 1 36  ? 82.725  19.009 -17.717 1.00 88.49  ? 51   PRO A CA  1 
ATOM   105  C C   . PRO A 1 36  ? 82.660  20.045 -18.834 1.00 87.90  ? 51   PRO A C   1 
ATOM   106  O O   . PRO A 1 36  ? 81.600  20.593 -19.128 1.00 89.45  ? 51   PRO A O   1 
ATOM   107  C CB  . PRO A 1 36  ? 82.705  17.586 -18.277 1.00 86.95  ? 51   PRO A CB  1 
ATOM   108  C CG  . PRO A 1 36  ? 82.228  16.792 -17.124 1.00 86.88  ? 51   PRO A CG  1 
ATOM   109  C CD  . PRO A 1 36  ? 81.079  17.635 -16.624 1.00 87.53  ? 51   PRO A CD  1 
ATOM   110  N N   . GLN A 1 37  ? 83.816  20.300 -19.441 1.00 86.64  ? 52   GLN A N   1 
ATOM   111  C CA  . GLN A 1 37  ? 83.951  21.229 -20.560 1.00 84.74  ? 52   GLN A CA  1 
ATOM   112  C C   . GLN A 1 37  ? 85.080  20.657 -21.385 1.00 83.78  ? 52   GLN A C   1 
ATOM   113  O O   . GLN A 1 37  ? 85.819  19.793 -20.914 1.00 82.83  ? 52   GLN A O   1 
ATOM   114  C CB  . GLN A 1 37  ? 84.423  22.615 -20.123 1.00 85.55  ? 52   GLN A CB  1 
ATOM   115  C CG  . GLN A 1 37  ? 83.937  23.132 -18.798 1.00 87.02  ? 52   GLN A CG  1 
ATOM   116  C CD  . GLN A 1 37  ? 84.586  24.465 -18.464 1.00 87.90  ? 52   GLN A CD  1 
ATOM   117  O OE1 . GLN A 1 37  ? 84.343  25.046 -17.401 1.00 88.42  ? 52   GLN A OE1 1 
ATOM   118  N NE2 . GLN A 1 37  ? 85.422  24.958 -19.379 1.00 86.01  ? 52   GLN A NE2 1 
ATOM   119  N N   . GLU A 1 38  ? 85.223  21.123 -22.617 1.00 81.97  ? 53   GLU A N   1 
ATOM   120  C CA  . GLU A 1 38  ? 86.347  20.665 -23.407 1.00 80.03  ? 53   GLU A CA  1 
ATOM   121  C C   . GLU A 1 38  ? 87.443  21.638 -23.027 1.00 78.35  ? 53   GLU A C   1 
ATOM   122  O O   . GLU A 1 38  ? 87.168  22.749 -22.557 1.00 77.74  ? 53   GLU A O   1 
ATOM   123  C CB  . GLU A 1 38  ? 86.085  20.757 -24.908 1.00 81.10  ? 53   GLU A CB  1 
ATOM   124  C CG  . GLU A 1 38  ? 85.656  19.444 -25.531 1.00 83.56  ? 53   GLU A CG  1 
ATOM   125  C CD  . GLU A 1 38  ? 85.708  19.462 -27.053 1.00 86.19  ? 53   GLU A CD  1 
ATOM   126  O OE1 . GLU A 1 38  ? 85.152  18.524 -27.676 1.00 87.60  ? 53   GLU A OE1 1 
ATOM   127  O OE2 . GLU A 1 38  ? 86.309  20.404 -27.623 1.00 84.91  ? 53   GLU A OE2 1 
ATOM   128  N N   . VAL A 1 39  ? 88.684  21.218 -23.212 1.00 76.04  ? 54   VAL A N   1 
ATOM   129  C CA  . VAL A 1 39  ? 89.812  22.062 -22.887 1.00 72.34  ? 54   VAL A CA  1 
ATOM   130  C C   . VAL A 1 39  ? 90.973  21.688 -23.782 1.00 70.65  ? 54   VAL A C   1 
ATOM   131  O O   . VAL A 1 39  ? 91.497  20.582 -23.707 1.00 68.27  ? 54   VAL A O   1 
ATOM   132  C CB  . VAL A 1 39  ? 90.224  21.905 -21.400 1.00 73.01  ? 54   VAL A CB  1 
ATOM   133  C CG1 . VAL A 1 39  ? 91.544  22.620 -21.146 1.00 72.70  ? 54   VAL A CG1 1 
ATOM   134  C CG2 . VAL A 1 39  ? 89.141  22.484 -20.491 1.00 69.86  ? 54   VAL A CG2 1 
ATOM   135  N N   . SER A 1 40  ? 91.356  22.617 -24.645 1.00 70.83  ? 55   SER A N   1 
ATOM   136  C CA  . SER A 1 40  ? 92.465  22.389 -25.546 1.00 72.66  ? 55   SER A CA  1 
ATOM   137  C C   . SER A 1 40  ? 93.677  23.165 -25.067 1.00 74.05  ? 55   SER A C   1 
ATOM   138  O O   . SER A 1 40  ? 93.559  24.300 -24.597 1.00 74.55  ? 55   SER A O   1 
ATOM   139  C CB  . SER A 1 40  ? 92.101  22.835 -26.957 1.00 71.46  ? 55   SER A CB  1 
ATOM   140  O OG  . SER A 1 40  ? 90.939  22.166 -27.399 1.00 71.33  ? 55   SER A OG  1 
ATOM   141  N N   . TYR A 1 41  ? 94.842  22.541 -25.166 1.00 74.00  ? 56   TYR A N   1 
ATOM   142  C CA  . TYR A 1 41  ? 96.074  23.195 -24.774 1.00 73.90  ? 56   TYR A CA  1 
ATOM   143  C C   . TYR A 1 41  ? 97.171  22.863 -25.770 1.00 74.58  ? 56   TYR A C   1 
ATOM   144  O O   . TYR A 1 41  ? 97.021  21.958 -26.593 1.00 73.77  ? 56   TYR A O   1 
ATOM   145  C CB  . TYR A 1 41  ? 96.489  22.806 -23.348 1.00 74.03  ? 56   TYR A CB  1 
ATOM   146  C CG  . TYR A 1 41  ? 96.701  21.328 -23.076 1.00 72.14  ? 56   TYR A CG  1 
ATOM   147  C CD1 . TYR A 1 41  ? 95.633  20.497 -22.711 1.00 70.49  ? 56   TYR A CD1 1 
ATOM   148  C CD2 . TYR A 1 41  ? 97.984  20.774 -23.115 1.00 71.28  ? 56   TYR A CD2 1 
ATOM   149  C CE1 . TYR A 1 41  ? 95.845  19.153 -22.382 1.00 69.57  ? 56   TYR A CE1 1 
ATOM   150  C CE2 . TYR A 1 41  ? 98.206  19.434 -22.791 1.00 70.25  ? 56   TYR A CE2 1 
ATOM   151  C CZ  . TYR A 1 41  ? 97.137  18.630 -22.423 1.00 69.59  ? 56   TYR A CZ  1 
ATOM   152  O OH  . TYR A 1 41  ? 97.376  17.314 -22.082 1.00 69.57  ? 56   TYR A OH  1 
ATOM   153  N N   . THR A 1 42  ? 98.272  23.602 -25.694 1.00 76.87  ? 57   THR A N   1 
ATOM   154  C CA  . THR A 1 42  ? 99.383  23.414 -26.620 1.00 78.94  ? 57   THR A CA  1 
ATOM   155  C C   . THR A 1 42  ? 100.723 23.814 -25.993 1.00 79.10  ? 57   THR A C   1 
ATOM   156  O O   . THR A 1 42  ? 100.790 24.195 -24.819 1.00 78.28  ? 57   THR A O   1 
ATOM   157  C CB  . THR A 1 42  ? 99.137  24.258 -27.915 1.00 79.85  ? 57   THR A CB  1 
ATOM   158  O OG1 . THR A 1 42  ? 100.156 23.983 -28.890 1.00 80.68  ? 57   THR A OG1 1 
ATOM   159  C CG2 . THR A 1 42  ? 99.121  25.758 -27.582 1.00 77.71  ? 57   THR A CG2 1 
ATOM   160  N N   . ASP A 1 43  ? 101.782 23.723 -26.796 1.00 79.75  ? 58   ASP A N   1 
ATOM   161  C CA  . ASP A 1 43  ? 103.134 24.074 -26.370 1.00 79.57  ? 58   ASP A CA  1 
ATOM   162  C C   . ASP A 1 43  ? 103.449 23.381 -25.059 1.00 78.48  ? 58   ASP A C   1 
ATOM   163  O O   . ASP A 1 43  ? 104.108 23.935 -24.175 1.00 78.98  ? 58   ASP A O   1 
ATOM   164  C CB  . ASP A 1 43  ? 103.261 25.592 -26.218 1.00 81.75  ? 58   ASP A CB  1 
ATOM   165  C CG  . ASP A 1 43  ? 102.823 26.341 -27.472 1.00 84.20  ? 58   ASP A CG  1 
ATOM   166  O OD1 . ASP A 1 43  ? 103.217 25.909 -28.582 1.00 83.40  ? 58   ASP A OD1 1 
ATOM   167  O OD2 . ASP A 1 43  ? 102.094 27.358 -27.347 1.00 85.92  ? 58   ASP A OD2 1 
ATOM   168  N N   . THR A 1 44  ? 102.956 22.153 -24.956 1.00 76.86  ? 59   THR A N   1 
ATOM   169  C CA  . THR A 1 44  ? 103.147 21.325 -23.778 1.00 75.53  ? 59   THR A CA  1 
ATOM   170  C C   . THR A 1 44  ? 104.620 20.916 -23.708 1.00 73.53  ? 59   THR A C   1 
ATOM   171  O O   . THR A 1 44  ? 105.275 20.766 -24.738 1.00 72.80  ? 59   THR A O   1 
ATOM   172  C CB  . THR A 1 44  ? 102.243 20.063 -23.852 1.00 75.42  ? 59   THR A CB  1 
ATOM   173  O OG1 . THR A 1 44  ? 100.942 20.432 -24.338 1.00 76.07  ? 59   THR A OG1 1 
ATOM   174  C CG2 . THR A 1 44  ? 102.092 19.431 -22.471 1.00 76.43  ? 59   THR A CG2 1 
ATOM   175  N N   . LYS A 1 45  ? 105.139 20.757 -22.495 1.00 71.50  ? 60   LYS A N   1 
ATOM   176  C CA  . LYS A 1 45  ? 106.529 20.366 -22.305 1.00 68.99  ? 60   LYS A CA  1 
ATOM   177  C C   . LYS A 1 45  ? 106.819 20.042 -20.837 1.00 66.63  ? 60   LYS A C   1 
ATOM   178  O O   . LYS A 1 45  ? 106.349 20.738 -19.933 1.00 68.06  ? 60   LYS A O   1 
ATOM   179  C CB  . LYS A 1 45  ? 107.464 21.484 -22.797 1.00 68.76  ? 60   LYS A CB  1 
ATOM   180  C CG  . LYS A 1 45  ? 107.337 22.798 -22.033 1.00 72.50  ? 60   LYS A CG  1 
ATOM   181  C CD  . LYS A 1 45  ? 108.247 23.890 -22.592 1.00 75.48  ? 60   LYS A CD  1 
ATOM   182  C CE  . LYS A 1 45  ? 107.843 24.282 -24.011 1.00 79.32  ? 60   LYS A CE  1 
ATOM   183  N NZ  . LYS A 1 45  ? 108.630 25.439 -24.535 1.00 80.99  ? 60   LYS A NZ  1 
ATOM   184  N N   . VAL A 1 46  ? 107.583 18.972 -20.615 1.00 62.31  ? 61   VAL A N   1 
ATOM   185  C CA  . VAL A 1 46  ? 107.970 18.533 -19.274 1.00 59.08  ? 61   VAL A CA  1 
ATOM   186  C C   . VAL A 1 46  ? 108.929 19.535 -18.638 1.00 60.77  ? 61   VAL A C   1 
ATOM   187  O O   . VAL A 1 46  ? 109.901 19.964 -19.259 1.00 63.15  ? 61   VAL A O   1 
ATOM   188  C CB  . VAL A 1 46  ? 108.676 17.157 -19.313 1.00 54.11  ? 61   VAL A CB  1 
ATOM   189  C CG1 . VAL A 1 46  ? 109.293 16.837 -17.957 1.00 51.36  ? 61   VAL A CG1 1 
ATOM   190  C CG2 . VAL A 1 46  ? 107.687 16.088 -19.696 1.00 51.83  ? 61   VAL A CG2 1 
ATOM   191  N N   . ILE A 1 47  ? 108.662 19.897 -17.391 1.00 60.48  ? 62   ILE A N   1 
ATOM   192  C CA  . ILE A 1 47  ? 109.512 20.844 -16.695 1.00 60.59  ? 62   ILE A CA  1 
ATOM   193  C C   . ILE A 1 47  ? 109.925 20.265 -15.344 1.00 63.27  ? 62   ILE A C   1 
ATOM   194  O O   . ILE A 1 47  ? 110.730 20.858 -14.612 1.00 64.64  ? 62   ILE A O   1 
ATOM   195  C CB  . ILE A 1 47  ? 108.779 22.179 -16.491 1.00 58.06  ? 62   ILE A CB  1 
ATOM   196  C CG1 . ILE A 1 47  ? 107.619 21.987 -15.517 1.00 57.53  ? 62   ILE A CG1 1 
ATOM   197  C CG2 . ILE A 1 47  ? 108.267 22.696 -17.834 1.00 56.08  ? 62   ILE A CG2 1 
ATOM   198  C CD1 . ILE A 1 47  ? 106.866 23.254 -15.195 1.00 57.90  ? 62   ILE A CD1 1 
ATOM   199  N N   . GLY A 1 48  ? 109.379 19.095 -15.027 1.00 63.59  ? 63   GLY A N   1 
ATOM   200  C CA  . GLY A 1 48  ? 109.693 18.455 -13.765 1.00 64.93  ? 63   GLY A CA  1 
ATOM   201  C C   . GLY A 1 48  ? 109.367 16.981 -13.786 1.00 67.59  ? 63   GLY A C   1 
ATOM   202  O O   . GLY A 1 48  ? 108.392 16.550 -14.396 1.00 67.95  ? 63   GLY A O   1 
ATOM   203  N N   . ASN A 1 49  ? 110.191 16.203 -13.101 1.00 69.55  ? 64   ASN A N   1 
ATOM   204  C CA  . ASN A 1 49  ? 110.009 14.764 -13.048 1.00 72.37  ? 64   ASN A CA  1 
ATOM   205  C C   . ASN A 1 49  ? 110.266 14.269 -11.617 1.00 73.97  ? 64   ASN A C   1 
ATOM   206  O O   . ASN A 1 49  ? 110.703 15.038 -10.757 1.00 74.89  ? 64   ASN A O   1 
ATOM   207  C CB  . ASN A 1 49  ? 110.977 14.116 -14.034 1.00 73.14  ? 64   ASN A CB  1 
ATOM   208  C CG  . ASN A 1 49  ? 110.654 12.672 -14.301 1.00 75.99  ? 64   ASN A CG  1 
ATOM   209  O OD1 . ASN A 1 49  ? 109.507 12.331 -14.596 1.00 77.86  ? 64   ASN A OD1 1 
ATOM   210  N ND2 . ASN A 1 49  ? 111.666 11.808 -14.215 1.00 74.82  ? 64   ASN A ND2 1 
ATOM   211  N N   . GLY A 1 50  ? 109.985 12.995 -11.356 1.00 75.75  ? 65   GLY A N   1 
ATOM   212  C CA  . GLY A 1 50  ? 110.203 12.454 -10.023 1.00 78.41  ? 65   GLY A CA  1 
ATOM   213  C C   . GLY A 1 50  ? 109.311 11.277 -9.652  1.00 79.91  ? 65   GLY A C   1 
ATOM   214  O O   . GLY A 1 50  ? 108.687 10.652 -10.513 1.00 80.72  ? 65   GLY A O   1 
ATOM   215  N N   . SER A 1 51  ? 109.254 10.971 -8.358  1.00 81.17  ? 66   SER A N   1 
ATOM   216  C CA  . SER A 1 51  ? 108.437 9.868  -7.856  1.00 81.95  ? 66   SER A CA  1 
ATOM   217  C C   . SER A 1 51  ? 106.942 10.197 -7.921  1.00 81.32  ? 66   SER A C   1 
ATOM   218  O O   . SER A 1 51  ? 106.124 9.363  -8.313  1.00 80.56  ? 66   SER A O   1 
ATOM   219  C CB  . SER A 1 51  ? 108.845 9.549  -6.414  1.00 82.19  ? 66   SER A CB  1 
ATOM   220  O OG  . SER A 1 51  ? 108.938 10.735 -5.640  1.00 83.96  ? 66   SER A OG  1 
ATOM   221  N N   . PHE A 1 52  ? 106.607 11.425 -7.536  1.00 82.00  ? 67   PHE A N   1 
ATOM   222  C CA  . PHE A 1 52  ? 105.232 11.925 -7.528  1.00 81.83  ? 67   PHE A CA  1 
ATOM   223  C C   . PHE A 1 52  ? 104.518 11.725 -8.867  1.00 80.32  ? 67   PHE A C   1 
ATOM   224  O O   . PHE A 1 52  ? 103.334 11.388 -8.911  1.00 80.60  ? 67   PHE A O   1 
ATOM   225  C CB  . PHE A 1 52  ? 105.239 13.416 -7.160  1.00 82.96  ? 67   PHE A CB  1 
ATOM   226  C CG  . PHE A 1 52  ? 106.031 14.279 -8.118  1.00 85.02  ? 67   PHE A CG  1 
ATOM   227  C CD1 . PHE A 1 52  ? 105.447 14.764 -9.294  1.00 84.24  ? 67   PHE A CD1 1 
ATOM   228  C CD2 . PHE A 1 52  ? 107.370 14.589 -7.857  1.00 84.56  ? 67   PHE A CD2 1 
ATOM   229  C CE1 . PHE A 1 52  ? 106.180 15.546 -10.196 1.00 83.01  ? 67   PHE A CE1 1 
ATOM   230  C CE2 . PHE A 1 52  ? 108.114 15.370 -8.754  1.00 83.70  ? 67   PHE A CE2 1 
ATOM   231  C CZ  . PHE A 1 52  ? 107.514 15.848 -9.925  1.00 82.50  ? 67   PHE A CZ  1 
ATOM   232  N N   . GLY A 1 53  ? 105.254 11.936 -9.954  1.00 78.14  ? 68   GLY A N   1 
ATOM   233  C CA  . GLY A 1 53  ? 104.697 11.795 -11.287 1.00 74.87  ? 68   GLY A CA  1 
ATOM   234  C C   . GLY A 1 53  ? 105.469 12.652 -12.272 1.00 72.46  ? 68   GLY A C   1 
ATOM   235  O O   . GLY A 1 53  ? 106.698 12.647 -12.287 1.00 73.16  ? 68   GLY A O   1 
ATOM   236  N N   . VAL A 1 54  ? 104.751 13.400 -13.095 1.00 67.43  ? 69   VAL A N   1 
ATOM   237  C CA  . VAL A 1 54  ? 105.385 14.254 -14.088 1.00 61.75  ? 69   VAL A CA  1 
ATOM   238  C C   . VAL A 1 54  ? 104.658 15.583 -14.148 1.00 59.84  ? 69   VAL A C   1 
ATOM   239  O O   . VAL A 1 54  ? 103.452 15.653 -13.922 1.00 59.84  ? 69   VAL A O   1 
ATOM   240  C CB  . VAL A 1 54  ? 105.337 13.609 -15.489 1.00 60.95  ? 69   VAL A CB  1 
ATOM   241  C CG1 . VAL A 1 54  ? 105.855 14.575 -16.531 1.00 61.64  ? 69   VAL A CG1 1 
ATOM   242  C CG2 . VAL A 1 54  ? 106.155 12.344 -15.500 1.00 60.79  ? 69   VAL A CG2 1 
ATOM   243  N N   . VAL A 1 55  ? 105.395 16.640 -14.456 1.00 56.74  ? 70   VAL A N   1 
ATOM   244  C CA  . VAL A 1 55  ? 104.804 17.962 -14.549 1.00 52.81  ? 70   VAL A CA  1 
ATOM   245  C C   . VAL A 1 55  ? 105.109 18.556 -15.902 1.00 49.99  ? 70   VAL A C   1 
ATOM   246  O O   . VAL A 1 55  ? 106.231 18.463 -16.382 1.00 50.28  ? 70   VAL A O   1 
ATOM   247  C CB  . VAL A 1 55  ? 105.364 18.904 -13.475 1.00 54.98  ? 70   VAL A CB  1 
ATOM   248  C CG1 . VAL A 1 55  ? 104.752 20.286 -13.643 1.00 52.49  ? 70   VAL A CG1 1 
ATOM   249  C CG2 . VAL A 1 55  ? 105.085 18.342 -12.082 1.00 52.58  ? 70   VAL A CG2 1 
ATOM   250  N N   . TYR A 1 56  ? 104.105 19.157 -16.523 1.00 50.51  ? 71   TYR A N   1 
ATOM   251  C CA  . TYR A 1 56  ? 104.297 19.779 -17.824 1.00 53.32  ? 71   TYR A CA  1 
ATOM   252  C C   . TYR A 1 56  ? 103.877 21.225 -17.724 1.00 53.16  ? 71   TYR A C   1 
ATOM   253  O O   . TYR A 1 56  ? 103.321 21.653 -16.719 1.00 51.83  ? 71   TYR A O   1 
ATOM   254  C CB  . TYR A 1 56  ? 103.444 19.110 -18.909 1.00 55.49  ? 71   TYR A CB  1 
ATOM   255  C CG  . TYR A 1 56  ? 103.580 17.607 -19.014 1.00 59.05  ? 71   TYR A CG  1 
ATOM   256  C CD1 . TYR A 1 56  ? 102.991 16.770 -18.069 1.00 60.21  ? 71   TYR A CD1 1 
ATOM   257  C CD2 . TYR A 1 56  ? 104.260 17.018 -20.079 1.00 58.62  ? 71   TYR A CD2 1 
ATOM   258  C CE1 . TYR A 1 56  ? 103.069 15.384 -18.182 1.00 62.14  ? 71   TYR A CE1 1 
ATOM   259  C CE2 . TYR A 1 56  ? 104.343 15.629 -20.201 1.00 58.53  ? 71   TYR A CE2 1 
ATOM   260  C CZ  . TYR A 1 56  ? 103.743 14.818 -19.249 1.00 61.62  ? 71   TYR A CZ  1 
ATOM   261  O OH  . TYR A 1 56  ? 103.790 13.442 -19.361 1.00 64.94  ? 71   TYR A OH  1 
ATOM   262  N N   . GLN A 1 57  ? 104.158 21.974 -18.776 1.00 55.83  ? 72   GLN A N   1 
ATOM   263  C CA  . GLN A 1 57  ? 103.787 23.370 -18.836 1.00 60.36  ? 72   GLN A CA  1 
ATOM   264  C C   . GLN A 1 57  ? 103.121 23.516 -20.180 1.00 61.89  ? 72   GLN A C   1 
ATOM   265  O O   . GLN A 1 57  ? 103.556 22.907 -21.152 1.00 63.16  ? 72   GLN A O   1 
ATOM   266  C CB  . GLN A 1 57  ? 105.022 24.259 -18.789 1.00 62.98  ? 72   GLN A CB  1 
ATOM   267  C CG  . GLN A 1 57  ? 104.696 25.741 -18.780 1.00 68.55  ? 72   GLN A CG  1 
ATOM   268  C CD  . GLN A 1 57  ? 105.427 26.506 -19.868 1.00 71.76  ? 72   GLN A CD  1 
ATOM   269  O OE1 . GLN A 1 57  ? 105.147 26.342 -21.062 1.00 73.79  ? 72   GLN A OE1 1 
ATOM   270  N NE2 . GLN A 1 57  ? 106.374 27.347 -19.461 1.00 72.93  ? 72   GLN A NE2 1 
ATOM   271  N N   . ALA A 1 58  ? 102.066 24.313 -20.251 1.00 64.56  ? 73   ALA A N   1 
ATOM   272  C CA  . ALA A 1 58  ? 101.388 24.489 -21.523 1.00 66.63  ? 73   ALA A CA  1 
ATOM   273  C C   . ALA A 1 58  ? 100.618 25.795 -21.593 1.00 67.00  ? 73   ALA A C   1 
ATOM   274  O O   . ALA A 1 58  ? 100.531 26.538 -20.612 1.00 64.97  ? 73   ALA A O   1 
ATOM   275  C CB  . ALA A 1 58  ? 100.455 23.310 -21.782 1.00 66.95  ? 73   ALA A CB  1 
ATOM   276  N N   . LYS A 1 59  ? 100.063 26.060 -22.770 1.00 70.45  ? 74   LYS A N   1 
ATOM   277  C CA  . LYS A 1 59  ? 99.293  27.271 -23.014 1.00 73.72  ? 74   LYS A CA  1 
ATOM   278  C C   . LYS A 1 59  ? 97.847  26.929 -23.367 1.00 75.14  ? 74   LYS A C   1 
ATOM   279  O O   . LYS A 1 59  ? 97.596  26.022 -24.161 1.00 75.35  ? 74   LYS A O   1 
ATOM   280  C CB  . LYS A 1 59  ? 99.924  28.058 -24.165 1.00 75.02  ? 74   LYS A CB  1 
ATOM   281  C CG  . LYS A 1 59  ? 99.115  29.252 -24.609 1.00 77.47  ? 74   LYS A CG  1 
ATOM   282  C CD  . LYS A 1 59  ? 99.637  29.818 -25.904 1.00 79.14  ? 74   LYS A CD  1 
ATOM   283  C CE  . LYS A 1 59  ? 98.701  30.898 -26.403 1.00 82.73  ? 74   LYS A CE  1 
ATOM   284  N NZ  . LYS A 1 59  ? 99.192  31.516 -27.661 1.00 83.71  ? 74   LYS A NZ  1 
ATOM   285  N N   . LEU A 1 60  ? 96.900  27.650 -22.774 1.00 77.87  ? 75   LEU A N   1 
ATOM   286  C CA  . LEU A 1 60  ? 95.490  27.417 -23.060 1.00 79.78  ? 75   LEU A CA  1 
ATOM   287  C C   . LEU A 1 60  ? 95.131  28.113 -24.370 1.00 82.40  ? 75   LEU A C   1 
ATOM   288  O O   . LEU A 1 60  ? 95.443  29.289 -24.570 1.00 83.45  ? 75   LEU A O   1 
ATOM   289  C CB  . LEU A 1 60  ? 94.626  27.935 -21.914 1.00 78.16  ? 75   LEU A CB  1 
ATOM   290  C CG  . LEU A 1 60  ? 94.884  27.180 -20.610 1.00 76.31  ? 75   LEU A CG  1 
ATOM   291  C CD1 . LEU A 1 60  ? 93.970  27.701 -19.514 1.00 76.67  ? 75   LEU A CD1 1 
ATOM   292  C CD2 . LEU A 1 60  ? 94.658  25.696 -20.841 1.00 74.71  ? 75   LEU A CD2 1 
ATOM   293  N N   . CYS A 1 61  ? 94.472  27.375 -25.256 1.00 84.75  ? 76   CYS A N   1 
ATOM   294  C CA  . CYS A 1 61  ? 94.110  27.881 -26.575 1.00 87.11  ? 76   CYS A CA  1 
ATOM   295  C C   . CYS A 1 61  ? 93.007  28.937 -26.666 1.00 89.59  ? 76   CYS A C   1 
ATOM   296  O O   . CYS A 1 61  ? 92.877  29.614 -27.690 1.00 90.46  ? 76   CYS A O   1 
ATOM   297  C CB  . CYS A 1 61  ? 93.793  26.697 -27.490 1.00 84.74  ? 76   CYS A CB  1 
ATOM   298  S SG  . CYS A 1 61  ? 95.250  25.664 -27.803 1.00 85.30  ? 76   CYS A SG  1 
ATOM   299  N N   . ASP A 1 62  ? 92.217  29.095 -25.612 1.00 92.15  ? 77   ASP A N   1 
ATOM   300  C CA  . ASP A 1 62  ? 91.157  30.099 -25.637 1.00 94.90  ? 77   ASP A CA  1 
ATOM   301  C C   . ASP A 1 62  ? 91.405  31.147 -24.547 1.00 95.47  ? 77   ASP A C   1 
ATOM   302  O O   . ASP A 1 62  ? 90.821  32.235 -24.571 1.00 95.35  ? 77   ASP A O   1 
ATOM   303  C CB  . ASP A 1 62  ? 89.784  29.434 -25.440 1.00 96.99  ? 77   ASP A CB  1 
ATOM   304  C CG  . ASP A 1 62  ? 89.540  28.993 -23.997 1.00 99.95  ? 77   ASP A CG  1 
ATOM   305  O OD1 . ASP A 1 62  ? 90.407  28.281 -23.427 1.00 101.56 ? 77   ASP A OD1 1 
ATOM   306  O OD2 . ASP A 1 62  ? 88.476  29.356 -23.434 1.00 100.74 ? 77   ASP A OD2 1 
ATOM   307  N N   . SER A 1 63  ? 92.287  30.811 -23.604 1.00 96.35  ? 78   SER A N   1 
ATOM   308  C CA  . SER A 1 63  ? 92.628  31.700 -22.492 1.00 95.95  ? 78   SER A CA  1 
ATOM   309  C C   . SER A 1 63  ? 94.020  32.306 -22.681 1.00 95.06  ? 78   SER A C   1 
ATOM   310  O O   . SER A 1 63  ? 94.370  33.301 -22.040 1.00 95.46  ? 78   SER A O   1 
ATOM   311  C CB  . SER A 1 63  ? 92.596  30.924 -21.169 1.00 97.37  ? 78   SER A CB  1 
ATOM   312  O OG  . SER A 1 63  ? 91.378  30.210 -21.007 1.00 98.65  ? 78   SER A OG  1 
ATOM   313  N N   . GLY A 1 64  ? 94.806  31.695 -23.564 1.00 93.83  ? 79   GLY A N   1 
ATOM   314  C CA  . GLY A 1 64  ? 96.156  32.163 -23.818 1.00 91.61  ? 79   GLY A CA  1 
ATOM   315  C C   . GLY A 1 64  ? 97.028  31.823 -22.628 1.00 90.44  ? 79   GLY A C   1 
ATOM   316  O O   . GLY A 1 64  ? 98.186  31.427 -22.774 1.00 90.42  ? 79   GLY A O   1 
ATOM   317  N N   . GLU A 1 65  ? 96.439  31.972 -21.444 1.00 88.26  ? 80   GLU A N   1 
ATOM   318  C CA  . GLU A 1 65  ? 97.097  31.706 -20.173 1.00 86.70  ? 80   GLU A CA  1 
ATOM   319  C C   . GLU A 1 65  ? 97.974  30.457 -20.192 1.00 84.23  ? 80   GLU A C   1 
ATOM   320  O O   . GLU A 1 65  ? 97.678  29.481 -20.887 1.00 84.46  ? 80   GLU A O   1 
ATOM   321  C CB  . GLU A 1 65  ? 96.043  31.565 -19.069 1.00 89.63  ? 80   GLU A CB  1 
ATOM   322  C CG  . GLU A 1 65  ? 95.085  32.749 -18.951 1.00 93.96  ? 80   GLU A CG  1 
ATOM   323  C CD  . GLU A 1 65  ? 94.019  32.548 -17.868 1.00 97.58  ? 80   GLU A CD  1 
ATOM   324  O OE1 . GLU A 1 65  ? 94.390  32.316 -16.689 1.00 99.61  ? 80   GLU A OE1 1 
ATOM   325  O OE2 . GLU A 1 65  ? 92.811  32.628 -18.199 1.00 98.36  ? 80   GLU A OE2 1 
ATOM   326  N N   . LEU A 1 66  ? 99.063  30.504 -19.430 1.00 79.56  ? 81   LEU A N   1 
ATOM   327  C CA  . LEU A 1 66  ? 99.982  29.377 -19.320 1.00 74.12  ? 81   LEU A CA  1 
ATOM   328  C C   . LEU A 1 66  ? 99.615  28.653 -18.045 1.00 69.26  ? 81   LEU A C   1 
ATOM   329  O O   . LEU A 1 66  ? 99.209  29.275 -17.061 1.00 68.34  ? 81   LEU A O   1 
ATOM   330  C CB  . LEU A 1 66  ? 101.442 29.845 -19.223 1.00 76.43  ? 81   LEU A CB  1 
ATOM   331  C CG  . LEU A 1 66  ? 102.274 30.070 -20.495 1.00 79.41  ? 81   LEU A CG  1 
ATOM   332  C CD1 . LEU A 1 66  ? 103.496 30.901 -20.143 1.00 77.61  ? 81   LEU A CD1 1 
ATOM   333  C CD2 . LEU A 1 66  ? 102.693 28.735 -21.119 1.00 79.01  ? 81   LEU A CD2 1 
ATOM   334  N N   . VAL A 1 67  ? 99.752  27.335 -18.067 1.00 63.41  ? 82   VAL A N   1 
ATOM   335  C CA  . VAL A 1 67  ? 99.435  26.547 -16.896 1.00 57.98  ? 82   VAL A CA  1 
ATOM   336  C C   . VAL A 1 67  ? 100.386 25.390 -16.748 1.00 54.92  ? 82   VAL A C   1 
ATOM   337  O O   . VAL A 1 67  ? 101.139 25.038 -17.662 1.00 54.59  ? 82   VAL A O   1 
ATOM   338  C CB  . VAL A 1 67  ? 98.003  25.971 -16.951 1.00 58.35  ? 82   VAL A CB  1 
ATOM   339  C CG1 . VAL A 1 67  ? 96.983  27.099 -17.012 1.00 55.89  ? 82   VAL A CG1 1 
ATOM   340  C CG2 . VAL A 1 67  ? 97.867  25.044 -18.139 1.00 56.45  ? 82   VAL A CG2 1 
ATOM   341  N N   . ALA A 1 68  ? 100.346 24.809 -15.565 1.00 50.52  ? 83   ALA A N   1 
ATOM   342  C CA  . ALA A 1 68  ? 101.165 23.666 -15.264 1.00 49.85  ? 83   ALA A CA  1 
ATOM   343  C C   . ALA A 1 68  ? 100.177 22.509 -15.151 1.00 49.67  ? 83   ALA A C   1 
ATOM   344  O O   . ALA A 1 68  ? 99.049  22.692 -14.688 1.00 49.53  ? 83   ALA A O   1 
ATOM   345  C CB  . ALA A 1 68  ? 101.893 23.883 -13.955 1.00 48.79  ? 83   ALA A CB  1 
ATOM   346  N N   . ILE A 1 69  ? 100.584 21.329 -15.606 1.00 48.95  ? 84   ILE A N   1 
ATOM   347  C CA  . ILE A 1 69  ? 99.720  20.169 -15.532 1.00 48.42  ? 84   ILE A CA  1 
ATOM   348  C C   . ILE A 1 69  ? 100.499 19.065 -14.843 1.00 49.41  ? 84   ILE A C   1 
ATOM   349  O O   . ILE A 1 69  ? 101.467 18.545 -15.397 1.00 49.76  ? 84   ILE A O   1 
ATOM   350  C CB  . ILE A 1 69  ? 99.298  19.684 -16.933 1.00 47.09  ? 84   ILE A CB  1 
ATOM   351  C CG1 . ILE A 1 69  ? 98.773  20.853 -17.765 1.00 45.29  ? 84   ILE A CG1 1 
ATOM   352  C CG2 . ILE A 1 69  ? 98.209  18.620 -16.800 1.00 47.59  ? 84   ILE A CG2 1 
ATOM   353  C CD1 . ILE A 1 69  ? 98.523  20.493 -19.204 1.00 42.58  ? 84   ILE A CD1 1 
ATOM   354  N N   . LYS A 1 70  ? 100.094 18.731 -13.622 1.00 49.33  ? 85   LYS A N   1 
ATOM   355  C CA  . LYS A 1 70  ? 100.745 17.669 -12.870 1.00 50.52  ? 85   LYS A CA  1 
ATOM   356  C C   . LYS A 1 70  ? 99.983  16.369 -13.159 1.00 50.97  ? 85   LYS A C   1 
ATOM   357  O O   . LYS A 1 70  ? 98.766  16.302 -12.973 1.00 52.73  ? 85   LYS A O   1 
ATOM   358  C CB  . LYS A 1 70  ? 100.731 17.985 -11.362 1.00 49.50  ? 85   LYS A CB  1 
ATOM   359  C CG  . LYS A 1 70  ? 101.381 16.899 -10.494 1.00 50.83  ? 85   LYS A CG  1 
ATOM   360  C CD  . LYS A 1 70  ? 101.467 17.266 -9.013  1.00 51.02  ? 85   LYS A CD  1 
ATOM   361  C CE  . LYS A 1 70  ? 102.134 16.136 -8.212  1.00 51.50  ? 85   LYS A CE  1 
ATOM   362  N NZ  . LYS A 1 70  ? 102.343 16.443 -6.759  1.00 49.00  ? 85   LYS A NZ  1 
ATOM   363  N N   . LYS A 1 71  ? 100.703 15.352 -13.631 1.00 51.16  ? 86   LYS A N   1 
ATOM   364  C CA  . LYS A 1 71  ? 100.112 14.060 -13.954 1.00 53.58  ? 86   LYS A CA  1 
ATOM   365  C C   . LYS A 1 71  ? 100.618 12.993 -12.997 1.00 55.34  ? 86   LYS A C   1 
ATOM   366  O O   . LYS A 1 71  ? 101.789 12.608 -13.018 1.00 55.66  ? 86   LYS A O   1 
ATOM   367  C CB  . LYS A 1 71  ? 100.450 13.679 -15.388 1.00 55.56  ? 86   LYS A CB  1 
ATOM   368  C CG  . LYS A 1 71  ? 99.759  12.433 -15.897 1.00 56.05  ? 86   LYS A CG  1 
ATOM   369  C CD  . LYS A 1 71  ? 100.076 12.254 -17.380 1.00 61.35  ? 86   LYS A CD  1 
ATOM   370  C CE  . LYS A 1 71  ? 99.499  10.970 -17.953 1.00 63.51  ? 86   LYS A CE  1 
ATOM   371  N NZ  . LYS A 1 71  ? 99.755  10.883 -19.413 1.00 63.77  ? 86   LYS A NZ  1 
ATOM   372  N N   . VAL A 1 72  ? 99.706  12.522 -12.158 1.00 55.53  ? 87   VAL A N   1 
ATOM   373  C CA  . VAL A 1 72  ? 100.005 11.521 -11.149 1.00 55.69  ? 87   VAL A CA  1 
ATOM   374  C C   . VAL A 1 72  ? 99.314  10.197 -11.458 1.00 55.96  ? 87   VAL A C   1 
ATOM   375  O O   . VAL A 1 72  ? 98.249  10.169 -12.071 1.00 55.41  ? 87   VAL A O   1 
ATOM   376  C CB  . VAL A 1 72  ? 99.525  12.013 -9.758  1.00 54.90  ? 87   VAL A CB  1 
ATOM   377  C CG1 . VAL A 1 72  ? 99.824  10.971 -8.689  1.00 56.13  ? 87   VAL A CG1 1 
ATOM   378  C CG2 . VAL A 1 72  ? 100.184 13.338 -9.428  1.00 55.38  ? 87   VAL A CG2 1 
ATOM   379  N N   . LEU A 1 73  ? 99.940  9.099  -11.049 1.00 58.23  ? 88   LEU A N   1 
ATOM   380  C CA  . LEU A 1 73  ? 99.349  7.779  -11.230 1.00 60.30  ? 88   LEU A CA  1 
ATOM   381  C C   . LEU A 1 73  ? 98.557  7.552  -9.945  1.00 60.95  ? 88   LEU A C   1 
ATOM   382  O O   . LEU A 1 73  ? 99.101  7.637  -8.836  1.00 59.70  ? 88   LEU A O   1 
ATOM   383  C CB  . LEU A 1 73  ? 100.430 6.705  -11.388 1.00 61.42  ? 88   LEU A CB  1 
ATOM   384  C CG  . LEU A 1 73  ? 99.958  5.255  -11.571 1.00 62.67  ? 88   LEU A CG  1 
ATOM   385  C CD1 . LEU A 1 73  ? 99.050  5.126  -12.793 1.00 63.97  ? 88   LEU A CD1 1 
ATOM   386  C CD2 . LEU A 1 73  ? 101.179 4.357  -11.719 1.00 62.67  ? 88   LEU A CD2 1 
ATOM   387  N N   . GLN A 1 74  ? 97.269  7.278  -10.100 1.00 61.06  ? 89   GLN A N   1 
ATOM   388  C CA  . GLN A 1 74  ? 96.390  7.085  -8.961  1.00 61.23  ? 89   GLN A CA  1 
ATOM   389  C C   . GLN A 1 74  ? 95.713  5.722  -8.991  1.00 61.39  ? 89   GLN A C   1 
ATOM   390  O O   . GLN A 1 74  ? 95.462  5.161  -10.062 1.00 61.11  ? 89   GLN A O   1 
ATOM   391  C CB  . GLN A 1 74  ? 95.337  8.202  -8.954  1.00 60.30  ? 89   GLN A CB  1 
ATOM   392  C CG  . GLN A 1 74  ? 94.335  8.147  -7.822  1.00 61.37  ? 89   GLN A CG  1 
ATOM   393  C CD  . GLN A 1 74  ? 94.988  8.240  -6.462  1.00 60.63  ? 89   GLN A CD  1 
ATOM   394  O OE1 . GLN A 1 74  ? 95.770  9.150  -6.205  1.00 63.09  ? 89   GLN A OE1 1 
ATOM   395  N NE2 . GLN A 1 74  ? 94.666  7.298  -5.578  1.00 62.41  ? 89   GLN A NE2 1 
ATOM   396  N N   . ASP A 1 75  ? 95.446  5.183  -7.804  1.00 61.81  ? 90   ASP A N   1 
ATOM   397  C CA  . ASP A 1 75  ? 94.756  3.911  -7.688  1.00 63.22  ? 90   ASP A CA  1 
ATOM   398  C C   . ASP A 1 75  ? 93.274  4.265  -7.696  1.00 63.46  ? 90   ASP A C   1 
ATOM   399  O O   . ASP A 1 75  ? 92.818  5.051  -6.863  1.00 62.51  ? 90   ASP A O   1 
ATOM   400  C CB  . ASP A 1 75  ? 95.127  3.216  -6.382  1.00 65.47  ? 90   ASP A CB  1 
ATOM   401  C CG  . ASP A 1 75  ? 94.378  1.911  -6.186  1.00 68.25  ? 90   ASP A CG  1 
ATOM   402  O OD1 . ASP A 1 75  ? 94.798  1.104  -5.330  1.00 69.82  ? 90   ASP A OD1 1 
ATOM   403  O OD2 . ASP A 1 75  ? 93.364  1.690  -6.884  1.00 71.63  ? 90   ASP A OD2 1 
ATOM   404  N N   . LYS A 1 76  ? 92.532  3.699  -8.647  1.00 64.81  ? 91   LYS A N   1 
ATOM   405  C CA  . LYS A 1 76  ? 91.100  3.972  -8.790  1.00 65.27  ? 91   LYS A CA  1 
ATOM   406  C C   . LYS A 1 76  ? 90.279  3.811  -7.513  1.00 67.73  ? 91   LYS A C   1 
ATOM   407  O O   . LYS A 1 76  ? 89.443  4.663  -7.189  1.00 68.12  ? 91   LYS A O   1 
ATOM   408  C CB  . LYS A 1 76  ? 90.495  3.084  -9.880  1.00 60.09  ? 91   LYS A CB  1 
ATOM   409  C CG  . LYS A 1 76  ? 90.956  3.414  -11.269 1.00 56.74  ? 91   LYS A CG  1 
ATOM   410  C CD  . LYS A 1 76  ? 90.214  2.595  -12.299 1.00 56.75  ? 91   LYS A CD  1 
ATOM   411  C CE  . LYS A 1 76  ? 90.752  2.888  -13.683 1.00 57.92  ? 91   LYS A CE  1 
ATOM   412  N NZ  . LYS A 1 76  ? 90.104  2.078  -14.738 1.00 59.36  ? 91   LYS A NZ  1 
ATOM   413  N N   . ARG A 1 77  ? 90.515  2.715  -6.797  1.00 69.58  ? 92   ARG A N   1 
ATOM   414  C CA  . ARG A 1 77  ? 89.796  2.427  -5.561  1.00 72.83  ? 92   ARG A CA  1 
ATOM   415  C C   . ARG A 1 77  ? 89.739  3.618  -4.604  1.00 73.46  ? 92   ARG A C   1 
ATOM   416  O O   . ARG A 1 77  ? 88.664  3.991  -4.127  1.00 75.67  ? 92   ARG A O   1 
ATOM   417  C CB  . ARG A 1 77  ? 90.433  1.225  -4.854  1.00 73.38  ? 92   ARG A CB  1 
ATOM   418  C CG  . ARG A 1 77  ? 90.349  -0.065 -5.651  1.00 75.35  ? 92   ARG A CG  1 
ATOM   419  C CD  . ARG A 1 77  ? 91.047  -1.210 -4.943  1.00 76.80  ? 92   ARG A CD  1 
ATOM   420  N NE  . ARG A 1 77  ? 92.464  -0.935 -4.730  1.00 79.24  ? 92   ARG A NE  1 
ATOM   421  C CZ  . ARG A 1 77  ? 93.310  -1.789 -4.162  1.00 82.09  ? 92   ARG A CZ  1 
ATOM   422  N NH1 . ARG A 1 77  ? 92.882  -2.977 -3.751  1.00 83.29  ? 92   ARG A NH1 1 
ATOM   423  N NH2 . ARG A 1 77  ? 94.583  -1.453 -4.000  1.00 81.57  ? 92   ARG A NH2 1 
ATOM   424  N N   . PHE A 1 78  ? 90.894  4.223  -4.339  1.00 72.93  ? 93   PHE A N   1 
ATOM   425  C CA  . PHE A 1 78  ? 90.975  5.356  -3.423  1.00 72.24  ? 93   PHE A CA  1 
ATOM   426  C C   . PHE A 1 78  ? 90.867  6.725  -4.093  1.00 69.66  ? 93   PHE A C   1 
ATOM   427  O O   . PHE A 1 78  ? 90.983  6.860  -5.316  1.00 67.96  ? 93   PHE A O   1 
ATOM   428  C CB  . PHE A 1 78  ? 92.291  5.307  -2.644  1.00 74.53  ? 93   PHE A CB  1 
ATOM   429  C CG  . PHE A 1 78  ? 92.587  3.972  -2.028  1.00 77.86  ? 93   PHE A CG  1 
ATOM   430  C CD1 . PHE A 1 78  ? 92.851  2.863  -2.829  1.00 78.13  ? 93   PHE A CD1 1 
ATOM   431  C CD2 . PHE A 1 78  ? 92.629  3.828  -0.642  1.00 79.87  ? 93   PHE A CD2 1 
ATOM   432  C CE1 . PHE A 1 78  ? 93.154  1.627  -2.262  1.00 78.62  ? 93   PHE A CE1 1 
ATOM   433  C CE2 . PHE A 1 78  ? 92.932  2.596  -0.060  1.00 81.07  ? 93   PHE A CE2 1 
ATOM   434  C CZ  . PHE A 1 78  ? 93.197  1.492  -0.874  1.00 80.97  ? 93   PHE A CZ  1 
ATOM   435  N N   . LYS A 1 79  ? 90.644  7.737  -3.261  1.00 67.29  ? 94   LYS A N   1 
ATOM   436  C CA  . LYS A 1 79  ? 90.546  9.114  -3.722  1.00 67.61  ? 94   LYS A CA  1 
ATOM   437  C C   . LYS A 1 79  ? 91.986  9.638  -3.798  1.00 65.02  ? 94   LYS A C   1 
ATOM   438  O O   . LYS A 1 79  ? 92.919  8.965  -3.352  1.00 64.75  ? 94   LYS A O   1 
ATOM   439  C CB  . LYS A 1 79  ? 89.729  9.950  -2.725  1.00 70.60  ? 94   LYS A CB  1 
ATOM   440  C CG  . LYS A 1 79  ? 88.317  9.429  -2.445  1.00 74.88  ? 94   LYS A CG  1 
ATOM   441  C CD  . LYS A 1 79  ? 87.682  10.156 -1.258  1.00 77.17  ? 94   LYS A CD  1 
ATOM   442  C CE  . LYS A 1 79  ? 86.314  9.582  -0.899  1.00 79.99  ? 94   LYS A CE  1 
ATOM   443  N NZ  . LYS A 1 79  ? 85.746  10.205 0.335   1.00 80.88  ? 94   LYS A NZ  1 
ATOM   444  N N   . ASN A 1 80  ? 92.173  10.824 -4.368  1.00 61.23  ? 95   ASN A N   1 
ATOM   445  C CA  . ASN A 1 80  ? 93.507  11.398 -4.483  1.00 57.03  ? 95   ASN A CA  1 
ATOM   446  C C   . ASN A 1 80  ? 93.663  12.560 -3.504  1.00 55.56  ? 95   ASN A C   1 
ATOM   447  O O   . ASN A 1 80  ? 93.067  13.625 -3.686  1.00 55.25  ? 95   ASN A O   1 
ATOM   448  C CB  . ASN A 1 80  ? 93.744  11.866 -5.919  1.00 57.17  ? 95   ASN A CB  1 
ATOM   449  C CG  . ASN A 1 80  ? 95.099  12.516 -6.106  1.00 56.06  ? 95   ASN A CG  1 
ATOM   450  O OD1 . ASN A 1 80  ? 95.326  13.643 -5.669  1.00 55.85  ? 95   ASN A OD1 1 
ATOM   451  N ND2 . ASN A 1 80  ? 96.010  11.807 -6.758  1.00 54.57  ? 95   ASN A ND2 1 
ATOM   452  N N   . ARG A 1 81  ? 94.467  12.345 -2.465  1.00 53.09  ? 96   ARG A N   1 
ATOM   453  C CA  . ARG A 1 81  ? 94.700  13.348 -1.431  1.00 52.05  ? 96   ARG A CA  1 
ATOM   454  C C   . ARG A 1 81  ? 94.847  14.748 -1.975  1.00 51.75  ? 96   ARG A C   1 
ATOM   455  O O   . ARG A 1 81  ? 94.180  15.664 -1.509  1.00 53.32  ? 96   ARG A O   1 
ATOM   456  C CB  . ARG A 1 81  ? 95.955  13.016 -0.649  1.00 50.98  ? 96   ARG A CB  1 
ATOM   457  C CG  . ARG A 1 81  ? 95.728  12.803 0.811   1.00 51.40  ? 96   ARG A CG  1 
ATOM   458  C CD  . ARG A 1 81  ? 97.032  12.416 1.442   1.00 49.77  ? 96   ARG A CD  1 
ATOM   459  N NE  . ARG A 1 81  ? 96.836  11.604 2.631   1.00 52.96  ? 96   ARG A NE  1 
ATOM   460  C CZ  . ARG A 1 81  ? 97.830  11.088 3.341   1.00 53.47  ? 96   ARG A CZ  1 
ATOM   461  N NH1 . ARG A 1 81  ? 99.088  11.307 2.981   1.00 50.64  ? 96   ARG A NH1 1 
ATOM   462  N NH2 . ARG A 1 81  ? 97.565  10.350 4.408   1.00 54.17  ? 96   ARG A NH2 1 
ATOM   463  N N   . GLU A 1 82  ? 95.732  14.909 -2.957  1.00 49.79  ? 97   GLU A N   1 
ATOM   464  C CA  . GLU A 1 82  ? 95.990  16.211 -3.564  1.00 49.87  ? 97   GLU A CA  1 
ATOM   465  C C   . GLU A 1 82  ? 94.765  16.793 -4.247  1.00 49.09  ? 97   GLU A C   1 
ATOM   466  O O   . GLU A 1 82  ? 94.416  17.949 -4.014  1.00 51.23  ? 97   GLU A O   1 
ATOM   467  C CB  . GLU A 1 82  ? 97.146  16.116 -4.570  1.00 50.62  ? 97   GLU A CB  1 
ATOM   468  C CG  . GLU A 1 82  ? 97.659  17.475 -5.038  1.00 52.71  ? 97   GLU A CG  1 
ATOM   469  C CD  . GLU A 1 82  ? 99.059  17.417 -5.638  1.00 55.44  ? 97   GLU A CD  1 
ATOM   470  O OE1 . GLU A 1 82  ? 99.629  18.502 -5.914  1.00 54.80  ? 97   GLU A OE1 1 
ATOM   471  O OE2 . GLU A 1 82  ? 99.583  16.295 -5.830  1.00 54.11  ? 97   GLU A OE2 1 
ATOM   472  N N   . LEU A 1 83  ? 94.110  16.001 -5.089  1.00 48.03  ? 98   LEU A N   1 
ATOM   473  C CA  . LEU A 1 83  ? 92.926  16.481 -5.785  1.00 50.08  ? 98   LEU A CA  1 
ATOM   474  C C   . LEU A 1 83  ? 91.845  16.926 -4.806  1.00 48.70  ? 98   LEU A C   1 
ATOM   475  O O   . LEU A 1 83  ? 91.272  17.998 -4.946  1.00 51.09  ? 98   LEU A O   1 
ATOM   476  C CB  . LEU A 1 83  ? 92.362  15.397 -6.701  1.00 51.21  ? 98   LEU A CB  1 
ATOM   477  C CG  . LEU A 1 83  ? 91.131  15.872 -7.478  1.00 52.31  ? 98   LEU A CG  1 
ATOM   478  C CD1 . LEU A 1 83  ? 91.512  17.074 -8.323  1.00 50.59  ? 98   LEU A CD1 1 
ATOM   479  C CD2 . LEU A 1 83  ? 90.591  14.757 -8.351  1.00 52.27  ? 98   LEU A CD2 1 
ATOM   480  N N   . GLN A 1 84  ? 91.571  16.098 -3.810  1.00 48.89  ? 99   GLN A N   1 
ATOM   481  C CA  . GLN A 1 84  ? 90.552  16.418 -2.821  1.00 49.82  ? 99   GLN A CA  1 
ATOM   482  C C   . GLN A 1 84  ? 90.831  17.727 -2.093  1.00 49.89  ? 99   GLN A C   1 
ATOM   483  O O   . GLN A 1 84  ? 89.923  18.523 -1.831  1.00 52.05  ? 99   GLN A O   1 
ATOM   484  C CB  . GLN A 1 84  ? 90.442  15.264 -1.826  1.00 49.74  ? 99   GLN A CB  1 
ATOM   485  C CG  . GLN A 1 84  ? 89.977  13.989 -2.501  1.00 53.88  ? 99   GLN A CG  1 
ATOM   486  C CD  . GLN A 1 84  ? 88.676  14.196 -3.268  1.00 57.54  ? 99   GLN A CD  1 
ATOM   487  O OE1 . GLN A 1 84  ? 87.595  14.249 -2.673  1.00 58.71  ? 99   GLN A OE1 1 
ATOM   488  N NE2 . GLN A 1 84  ? 88.776  14.335 -4.593  1.00 55.99  ? 99   GLN A NE2 1 
ATOM   489  N N   . ILE A 1 85  ? 92.100  17.948 -1.778  1.00 48.57  ? 100  ILE A N   1 
ATOM   490  C CA  . ILE A 1 85  ? 92.534  19.146 -1.077  1.00 47.59  ? 100  ILE A CA  1 
ATOM   491  C C   . ILE A 1 85  ? 92.409  20.409 -1.924  1.00 49.16  ? 100  ILE A C   1 
ATOM   492  O O   . ILE A 1 85  ? 91.855  21.411 -1.476  1.00 46.37  ? 100  ILE A O   1 
ATOM   493  C CB  . ILE A 1 85  ? 93.988  18.971 -0.605  1.00 47.64  ? 100  ILE A CB  1 
ATOM   494  C CG1 . ILE A 1 85  ? 94.008  18.045 0.611   1.00 44.95  ? 100  ILE A CG1 1 
ATOM   495  C CG2 . ILE A 1 85  ? 94.610  20.312 -0.297  1.00 49.02  ? 100  ILE A CG2 1 
ATOM   496  C CD1 . ILE A 1 85  ? 95.381  17.599 1.032   1.00 46.99  ? 100  ILE A CD1 1 
ATOM   497  N N   . MET A 1 86  ? 92.915  20.353 -3.151  1.00 50.83  ? 101  MET A N   1 
ATOM   498  C CA  . MET A 1 86  ? 92.866  21.496 -4.050  1.00 52.16  ? 101  MET A CA  1 
ATOM   499  C C   . MET A 1 86  ? 91.455  21.962 -4.368  1.00 53.76  ? 101  MET A C   1 
ATOM   500  O O   . MET A 1 86  ? 91.261  23.123 -4.745  1.00 55.05  ? 101  MET A O   1 
ATOM   501  C CB  . MET A 1 86  ? 93.583  21.174 -5.366  1.00 54.84  ? 101  MET A CB  1 
ATOM   502  C CG  . MET A 1 86  ? 95.098  21.059 -5.264  1.00 57.77  ? 101  MET A CG  1 
ATOM   503  S SD  . MET A 1 86  ? 95.855  22.538 -4.547  1.00 61.67  ? 101  MET A SD  1 
ATOM   504  C CE  . MET A 1 86  ? 95.568  23.758 -5.843  1.00 59.50  ? 101  MET A CE  1 
ATOM   505  N N   . ARG A 1 87  ? 90.474  21.070 -4.218  1.00 55.95  ? 102  ARG A N   1 
ATOM   506  C CA  . ARG A 1 87  ? 89.082  21.407 -4.527  1.00 58.99  ? 102  ARG A CA  1 
ATOM   507  C C   . ARG A 1 87  ? 88.384  22.255 -3.475  1.00 58.93  ? 102  ARG A C   1 
ATOM   508  O O   . ARG A 1 87  ? 87.471  23.026 -3.801  1.00 59.65  ? 102  ARG A O   1 
ATOM   509  C CB  . ARG A 1 87  ? 88.272  20.139 -4.791  1.00 60.04  ? 102  ARG A CB  1 
ATOM   510  C CG  . ARG A 1 87  ? 88.780  19.333 -5.982  1.00 65.04  ? 102  ARG A CG  1 
ATOM   511  C CD  . ARG A 1 87  ? 87.793  18.251 -6.386  1.00 65.36  ? 102  ARG A CD  1 
ATOM   512  N NE  . ARG A 1 87  ? 86.696  18.798 -7.178  1.00 70.79  ? 102  ARG A NE  1 
ATOM   513  C CZ  . ARG A 1 87  ? 85.606  18.119 -7.521  1.00 70.33  ? 102  ARG A CZ  1 
ATOM   514  N NH1 . ARG A 1 87  ? 85.460  16.854 -7.132  1.00 68.43  ? 102  ARG A NH1 1 
ATOM   515  N NH2 . ARG A 1 87  ? 84.671  18.705 -8.265  1.00 68.07  ? 102  ARG A NH2 1 
ATOM   516  N N   . LYS A 1 88  ? 88.808  22.114 -2.220  1.00 59.50  ? 103  LYS A N   1 
ATOM   517  C CA  . LYS A 1 88  ? 88.236  22.906 -1.135  1.00 58.87  ? 103  LYS A CA  1 
ATOM   518  C C   . LYS A 1 88  ? 88.829  24.302 -1.209  1.00 57.71  ? 103  LYS A C   1 
ATOM   519  O O   . LYS A 1 88  ? 88.162  25.293 -0.920  1.00 59.52  ? 103  LYS A O   1 
ATOM   520  C CB  . LYS A 1 88  ? 88.610  22.344 0.229   1.00 59.63  ? 103  LYS A CB  1 
ATOM   521  C CG  . LYS A 1 88  ? 88.311  20.900 0.459   1.00 60.53  ? 103  LYS A CG  1 
ATOM   522  C CD  . LYS A 1 88  ? 88.557  20.612 1.919   1.00 62.04  ? 103  LYS A CD  1 
ATOM   523  C CE  . LYS A 1 88  ? 88.275  19.172 2.271   1.00 61.33  ? 103  LYS A CE  1 
ATOM   524  N NZ  . LYS A 1 88  ? 88.442  18.966 3.734   1.00 59.25  ? 103  LYS A NZ  1 
ATOM   525  N N   . LEU A 1 89  ? 90.096  24.359 -1.606  1.00 57.15  ? 104  LEU A N   1 
ATOM   526  C CA  . LEU A 1 89  ? 90.838  25.605 -1.681  1.00 55.30  ? 104  LEU A CA  1 
ATOM   527  C C   . LEU A 1 89  ? 90.503  26.588 -2.788  1.00 55.60  ? 104  LEU A C   1 
ATOM   528  O O   . LEU A 1 89  ? 90.526  26.263 -3.971  1.00 57.77  ? 104  LEU A O   1 
ATOM   529  C CB  . LEU A 1 89  ? 92.332  25.296 -1.724  1.00 52.35  ? 104  LEU A CB  1 
ATOM   530  C CG  . LEU A 1 89  ? 92.775  24.312 -0.644  1.00 53.95  ? 104  LEU A CG  1 
ATOM   531  C CD1 . LEU A 1 89  ? 94.278  24.194 -0.645  1.00 51.50  ? 104  LEU A CD1 1 
ATOM   532  C CD2 . LEU A 1 89  ? 92.283  24.779 0.703   1.00 48.66  ? 104  LEU A CD2 1 
ATOM   533  N N   . ASP A 1 90  ? 90.203  27.808 -2.363  1.00 55.18  ? 105  ASP A N   1 
ATOM   534  C CA  . ASP A 1 90  ? 89.898  28.928 -3.241  1.00 56.31  ? 105  ASP A CA  1 
ATOM   535  C C   . ASP A 1 90  ? 90.319  30.169 -2.450  1.00 54.69  ? 105  ASP A C   1 
ATOM   536  O O   . ASP A 1 90  ? 89.522  30.777 -1.727  1.00 55.42  ? 105  ASP A O   1 
ATOM   537  C CB  . ASP A 1 90  ? 88.408  28.978 -3.567  1.00 59.06  ? 105  ASP A CB  1 
ATOM   538  C CG  . ASP A 1 90  ? 88.059  30.125 -4.490  1.00 61.52  ? 105  ASP A CG  1 
ATOM   539  O OD1 . ASP A 1 90  ? 86.891  30.205 -4.933  1.00 67.46  ? 105  ASP A OD1 1 
ATOM   540  O OD2 . ASP A 1 90  ? 88.955  30.949 -4.772  1.00 63.24  ? 105  ASP A OD2 1 
ATOM   541  N N   . HIS A 1 91  ? 91.595  30.517 -2.590  1.00 53.21  ? 106  HIS A N   1 
ATOM   542  C CA  . HIS A 1 91  ? 92.203  31.638 -1.890  1.00 48.30  ? 106  HIS A CA  1 
ATOM   543  C C   . HIS A 1 91  ? 93.146  32.335 -2.871  1.00 48.15  ? 106  HIS A C   1 
ATOM   544  O O   . HIS A 1 91  ? 93.635  31.718 -3.819  1.00 46.69  ? 106  HIS A O   1 
ATOM   545  C CB  . HIS A 1 91  ? 92.970  31.086 -0.685  1.00 49.29  ? 106  HIS A CB  1 
ATOM   546  C CG  . HIS A 1 91  ? 93.476  32.130 0.260   1.00 49.51  ? 106  HIS A CG  1 
ATOM   547  N ND1 . HIS A 1 91  ? 94.481  33.013 -0.070  1.00 51.15  ? 106  HIS A ND1 1 
ATOM   548  C CD2 . HIS A 1 91  ? 93.138  32.408 1.541   1.00 52.97  ? 106  HIS A CD2 1 
ATOM   549  C CE1 . HIS A 1 91  ? 94.741  33.789 0.967   1.00 51.02  ? 106  HIS A CE1 1 
ATOM   550  N NE2 . HIS A 1 91  ? 93.940  33.441 1.959   1.00 52.80  ? 106  HIS A NE2 1 
ATOM   551  N N   . CYS A 1 92  ? 93.402  33.618 -2.644  1.00 48.92  ? 107  CYS A N   1 
ATOM   552  C CA  . CYS A 1 92  ? 94.266  34.398 -3.529  1.00 49.64  ? 107  CYS A CA  1 
ATOM   553  C C   . CYS A 1 92  ? 95.763  34.141 -3.373  1.00 47.42  ? 107  CYS A C   1 
ATOM   554  O O   . CYS A 1 92  ? 96.548  34.501 -4.244  1.00 49.24  ? 107  CYS A O   1 
ATOM   555  C CB  . CYS A 1 92  ? 93.981  35.900 -3.351  1.00 52.80  ? 107  CYS A CB  1 
ATOM   556  S SG  . CYS A 1 92  ? 94.011  36.502 -1.622  1.00 62.96  ? 107  CYS A SG  1 
ATOM   557  N N   . ASN A 1 93  ? 96.163  33.522 -2.272  1.00 45.50  ? 108  ASN A N   1 
ATOM   558  C CA  . ASN A 1 93  ? 97.576  33.241 -2.032  1.00 44.52  ? 108  ASN A CA  1 
ATOM   559  C C   . ASN A 1 93  ? 97.841  31.751 -2.148  1.00 42.95  ? 108  ASN A C   1 
ATOM   560  O O   . ASN A 1 93  ? 98.779  31.216 -1.552  1.00 44.60  ? 108  ASN A O   1 
ATOM   561  C CB  . ASN A 1 93  ? 97.978  33.744 -0.642  1.00 42.60  ? 108  ASN A CB  1 
ATOM   562  C CG  . ASN A 1 93  ? 97.929  35.256 -0.539  1.00 43.61  ? 108  ASN A CG  1 
ATOM   563  O OD1 . ASN A 1 93  ? 97.270  35.819 0.348   1.00 46.79  ? 108  ASN A OD1 1 
ATOM   564  N ND2 . ASN A 1 93  ? 98.631  35.928 -1.449  1.00 39.86  ? 108  ASN A ND2 1 
ATOM   565  N N   . ILE A 1 94  ? 96.989  31.084 -2.914  1.00 41.84  ? 109  ILE A N   1 
ATOM   566  C CA  . ILE A 1 94  ? 97.115  29.661 -3.138  1.00 42.40  ? 109  ILE A CA  1 
ATOM   567  C C   . ILE A 1 94  ? 96.888  29.426 -4.620  1.00 41.74  ? 109  ILE A C   1 
ATOM   568  O O   . ILE A 1 94  ? 95.915  29.928 -5.193  1.00 42.34  ? 109  ILE A O   1 
ATOM   569  C CB  . ILE A 1 94  ? 96.082  28.867 -2.306  1.00 43.27  ? 109  ILE A CB  1 
ATOM   570  C CG1 . ILE A 1 94  ? 96.322  29.133 -0.818  1.00 39.59  ? 109  ILE A CG1 1 
ATOM   571  C CG2 . ILE A 1 94  ? 96.191  27.376 -2.619  1.00 38.76  ? 109  ILE A CG2 1 
ATOM   572  C CD1 . ILE A 1 94  ? 95.418  28.369 0.100   1.00 44.15  ? 109  ILE A CD1 1 
ATOM   573  N N   . VAL A 1 95  ? 97.805  28.686 -5.238  1.00 42.75  ? 110  VAL A N   1 
ATOM   574  C CA  . VAL A 1 95  ? 97.714  28.376 -6.660  1.00 45.96  ? 110  VAL A CA  1 
ATOM   575  C C   . VAL A 1 95  ? 96.330  27.775 -6.936  1.00 46.60  ? 110  VAL A C   1 
ATOM   576  O O   . VAL A 1 95  ? 95.881  26.861 -6.235  1.00 48.30  ? 110  VAL A O   1 
ATOM   577  C CB  . VAL A 1 95  ? 98.862  27.398 -7.088  1.00 47.74  ? 110  VAL A CB  1 
ATOM   578  C CG1 . VAL A 1 95  ? 98.622  26.001 -6.528  1.00 46.08  ? 110  VAL A CG1 1 
ATOM   579  C CG2 . VAL A 1 95  ? 98.990  27.370 -8.600  1.00 46.62  ? 110  VAL A CG2 1 
ATOM   580  N N   . ARG A 1 96  ? 95.647  28.312 -7.940  1.00 47.41  ? 111  ARG A N   1 
ATOM   581  C CA  . ARG A 1 96  ? 94.302  27.856 -8.279  1.00 50.46  ? 111  ARG A CA  1 
ATOM   582  C C   . ARG A 1 96  ? 94.279  26.646 -9.197  1.00 49.58  ? 111  ARG A C   1 
ATOM   583  O O   . ARG A 1 96  ? 95.042  26.582 -10.160 1.00 48.66  ? 111  ARG A O   1 
ATOM   584  C CB  . ARG A 1 96  ? 93.521  29.007 -8.931  1.00 53.28  ? 111  ARG A CB  1 
ATOM   585  C CG  . ARG A 1 96  ? 92.276  28.588 -9.698  1.00 58.05  ? 111  ARG A CG  1 
ATOM   586  C CD  . ARG A 1 96  ? 91.722  29.735 -10.544 1.00 63.55  ? 111  ARG A CD  1 
ATOM   587  N NE  . ARG A 1 96  ? 92.780  30.482 -11.234 1.00 69.37  ? 111  ARG A NE  1 
ATOM   588  C CZ  . ARG A 1 96  ? 92.586  31.278 -12.289 1.00 71.58  ? 111  ARG A CZ  1 
ATOM   589  N NH1 . ARG A 1 96  ? 91.369  31.436 -12.797 1.00 73.08  ? 111  ARG A NH1 1 
ATOM   590  N NH2 . ARG A 1 96  ? 93.607  31.932 -12.834 1.00 72.71  ? 111  ARG A NH2 1 
ATOM   591  N N   . LEU A 1 97  ? 93.412  25.684 -8.884  1.00 48.46  ? 112  LEU A N   1 
ATOM   592  C CA  . LEU A 1 97  ? 93.261  24.500 -9.724  1.00 48.80  ? 112  LEU A CA  1 
ATOM   593  C C   . LEU A 1 97  ? 92.260  24.889 -10.803 1.00 49.75  ? 112  LEU A C   1 
ATOM   594  O O   . LEU A 1 97  ? 91.072  25.028 -10.530 1.00 48.04  ? 112  LEU A O   1 
ATOM   595  C CB  . LEU A 1 97  ? 92.715  23.312 -8.929  1.00 47.79  ? 112  LEU A CB  1 
ATOM   596  C CG  . LEU A 1 97  ? 92.402  22.058 -9.760  1.00 49.50  ? 112  LEU A CG  1 
ATOM   597  C CD1 . LEU A 1 97  ? 93.675  21.507 -10.387 1.00 50.20  ? 112  LEU A CD1 1 
ATOM   598  C CD2 . LEU A 1 97  ? 91.761  21.003 -8.879  1.00 51.25  ? 112  LEU A CD2 1 
ATOM   599  N N   . ARG A 1 98  ? 92.745  25.088 -12.022 1.00 51.06  ? 113  ARG A N   1 
ATOM   600  C CA  . ARG A 1 98  ? 91.885  25.476 -13.126 1.00 53.77  ? 113  ARG A CA  1 
ATOM   601  C C   . ARG A 1 98  ? 90.915  24.352 -13.491 1.00 54.24  ? 113  ARG A C   1 
ATOM   602  O O   . ARG A 1 98  ? 89.693  24.510 -13.389 1.00 54.28  ? 113  ARG A O   1 
ATOM   603  C CB  . ARG A 1 98  ? 92.740  25.848 -14.337 1.00 56.72  ? 113  ARG A CB  1 
ATOM   604  C CG  . ARG A 1 98  ? 93.630  27.059 -14.120 1.00 62.44  ? 113  ARG A CG  1 
ATOM   605  C CD  . ARG A 1 98  ? 92.805  28.308 -13.821 1.00 69.19  ? 113  ARG A CD  1 
ATOM   606  N NE  . ARG A 1 98  ? 91.976  28.728 -14.955 1.00 74.53  ? 113  ARG A NE  1 
ATOM   607  C CZ  . ARG A 1 98  ? 92.427  29.390 -16.021 1.00 75.72  ? 113  ARG A CZ  1 
ATOM   608  N NH1 . ARG A 1 98  ? 91.584  29.719 -16.997 1.00 74.52  ? 113  ARG A NH1 1 
ATOM   609  N NH2 . ARG A 1 98  ? 93.711  29.733 -16.104 1.00 75.88  ? 113  ARG A NH2 1 
ATOM   610  N N   . TYR A 1 99  ? 91.469  23.222 -13.920 1.00 52.57  ? 114  TYR A N   1 
ATOM   611  C CA  . TYR A 1 99  ? 90.678  22.060 -14.309 1.00 54.17  ? 114  TYR A CA  1 
ATOM   612  C C   . TYR A 1 99  ? 91.407  20.796 -13.878 1.00 56.22  ? 114  TYR A C   1 
ATOM   613  O O   . TYR A 1 99  ? 92.528  20.843 -13.368 1.00 57.16  ? 114  TYR A O   1 
ATOM   614  C CB  . TYR A 1 99  ? 90.507  21.989 -15.837 1.00 53.96  ? 114  TYR A CB  1 
ATOM   615  C CG  . TYR A 1 99  ? 89.889  23.204 -16.493 1.00 53.83  ? 114  TYR A CG  1 
ATOM   616  C CD1 . TYR A 1 99  ? 90.679  24.162 -17.130 1.00 50.01  ? 114  TYR A CD1 1 
ATOM   617  C CD2 . TYR A 1 99  ? 88.509  23.405 -16.461 1.00 52.41  ? 114  TYR A CD2 1 
ATOM   618  C CE1 . TYR A 1 99  ? 90.103  25.294 -17.716 1.00 55.51  ? 114  TYR A CE1 1 
ATOM   619  C CE2 . TYR A 1 99  ? 87.927  24.527 -17.039 1.00 53.67  ? 114  TYR A CE2 1 
ATOM   620  C CZ  . TYR A 1 99  ? 88.722  25.468 -17.663 1.00 55.31  ? 114  TYR A CZ  1 
ATOM   621  O OH  . TYR A 1 99  ? 88.123  26.580 -18.217 1.00 59.37  ? 114  TYR A OH  1 
ATOM   622  N N   . PHE A 1 100 ? 90.760  19.660 -14.094 1.00 55.82  ? 115  PHE A N   1 
ATOM   623  C CA  . PHE A 1 100 ? 91.366  18.379 -13.791 1.00 55.26  ? 115  PHE A CA  1 
ATOM   624  C C   . PHE A 1 100 ? 90.636  17.314 -14.600 1.00 54.83  ? 115  PHE A C   1 
ATOM   625  O O   . PHE A 1 100 ? 89.412  17.307 -14.698 1.00 55.93  ? 115  PHE A O   1 
ATOM   626  C CB  . PHE A 1 100 ? 91.338  18.094 -12.278 1.00 54.45  ? 115  PHE A CB  1 
ATOM   627  C CG  . PHE A 1 100 ? 90.005  17.639 -11.745 1.00 50.67  ? 115  PHE A CG  1 
ATOM   628  C CD1 . PHE A 1 100 ? 89.674  16.285 -11.726 1.00 49.53  ? 115  PHE A CD1 1 
ATOM   629  C CD2 . PHE A 1 100 ? 89.099  18.559 -11.211 1.00 49.63  ? 115  PHE A CD2 1 
ATOM   630  C CE1 . PHE A 1 100 ? 88.460  15.850 -11.177 1.00 47.76  ? 115  PHE A CE1 1 
ATOM   631  C CE2 . PHE A 1 100 ? 87.877  18.133 -10.658 1.00 47.90  ? 115  PHE A CE2 1 
ATOM   632  C CZ  . PHE A 1 100 ? 87.561  16.779 -10.642 1.00 46.11  ? 115  PHE A CZ  1 
ATOM   633  N N   . PHE A 1 101 ? 91.406  16.439 -15.222 1.00 54.43  ? 116  PHE A N   1 
ATOM   634  C CA  . PHE A 1 101 ? 90.835  15.385 -16.032 1.00 53.19  ? 116  PHE A CA  1 
ATOM   635  C C   . PHE A 1 101 ? 91.641  14.126 -15.817 1.00 52.77  ? 116  PHE A C   1 
ATOM   636  O O   . PHE A 1 101 ? 92.684  14.147 -15.157 1.00 52.00  ? 116  PHE A O   1 
ATOM   637  C CB  . PHE A 1 101 ? 90.871  15.786 -17.497 1.00 51.79  ? 116  PHE A CB  1 
ATOM   638  C CG  . PHE A 1 101 ? 92.245  16.076 -18.000 1.00 53.38  ? 116  PHE A CG  1 
ATOM   639  C CD1 . PHE A 1 101 ? 93.007  15.079 -18.594 1.00 50.81  ? 116  PHE A CD1 1 
ATOM   640  C CD2 . PHE A 1 101 ? 92.788  17.350 -17.872 1.00 52.98  ? 116  PHE A CD2 1 
ATOM   641  C CE1 . PHE A 1 101 ? 94.295  15.347 -19.061 1.00 52.02  ? 116  PHE A CE1 1 
ATOM   642  C CE2 . PHE A 1 101 ? 94.073  17.628 -18.334 1.00 51.92  ? 116  PHE A CE2 1 
ATOM   643  C CZ  . PHE A 1 101 ? 94.829  16.624 -18.931 1.00 50.53  ? 116  PHE A CZ  1 
ATOM   644  N N   . TYR A 1 102 ? 91.156  13.028 -16.381 1.00 50.29  ? 117  TYR A N   1 
ATOM   645  C CA  . TYR A 1 102 ? 91.832  11.759 -16.228 1.00 48.30  ? 117  TYR A CA  1 
ATOM   646  C C   . TYR A 1 102 ? 92.366  11.183 -17.515 1.00 49.98  ? 117  TYR A C   1 
ATOM   647  O O   . TYR A 1 102 ? 91.948  11.545 -18.610 1.00 47.56  ? 117  TYR A O   1 
ATOM   648  C CB  . TYR A 1 102 ? 90.906  10.752 -15.563 1.00 45.47  ? 117  TYR A CB  1 
ATOM   649  C CG  . TYR A 1 102 ? 90.550  11.141 -14.163 1.00 44.06  ? 117  TYR A CG  1 
ATOM   650  C CD1 . TYR A 1 102 ? 89.592  12.123 -13.912 1.00 43.46  ? 117  TYR A CD1 1 
ATOM   651  C CD2 . TYR A 1 102 ? 91.191  10.545 -13.082 1.00 44.77  ? 117  TYR A CD2 1 
ATOM   652  C CE1 . TYR A 1 102 ? 89.277  12.499 -12.617 1.00 40.07  ? 117  TYR A CE1 1 
ATOM   653  C CE2 . TYR A 1 102 ? 90.893  10.911 -11.784 1.00 41.55  ? 117  TYR A CE2 1 
ATOM   654  C CZ  . TYR A 1 102 ? 89.934  11.885 -11.555 1.00 44.33  ? 117  TYR A CZ  1 
ATOM   655  O OH  . TYR A 1 102 ? 89.630  12.220 -10.254 1.00 45.96  ? 117  TYR A OH  1 
ATOM   656  N N   . SER A 1 103 ? 93.313  10.274 -17.358 1.00 54.50  ? 118  SER A N   1 
ATOM   657  C CA  . SER A 1 103 ? 93.925  9.630  -18.488 1.00 58.25  ? 118  SER A CA  1 
ATOM   658  C C   . SER A 1 103 ? 93.929  8.141  -18.283 1.00 61.27  ? 118  SER A C   1 
ATOM   659  O O   . SER A 1 103 ? 93.974  7.644  -17.159 1.00 58.52  ? 118  SER A O   1 
ATOM   660  C CB  . SER A 1 103 ? 95.355  10.128 -18.682 1.00 61.25  ? 118  SER A CB  1 
ATOM   661  O OG  . SER A 1 103 ? 95.355  11.449 -19.187 1.00 65.41  ? 118  SER A OG  1 
ATOM   662  N N   . SER A 1 104 ? 93.867  7.440  -19.403 1.00 65.91  ? 119  SER A N   1 
ATOM   663  C CA  . SER A 1 104 ? 93.869  5.997  -19.422 1.00 70.15  ? 119  SER A CA  1 
ATOM   664  C C   . SER A 1 104 ? 95.112  5.472  -18.710 1.00 72.65  ? 119  SER A C   1 
ATOM   665  O O   . SER A 1 104 ? 96.242  5.791  -19.095 1.00 73.78  ? 119  SER A O   1 
ATOM   666  C CB  . SER A 1 104 ? 93.845  5.513  -20.878 1.00 71.31  ? 119  SER A CB  1 
ATOM   667  O OG  . SER A 1 104 ? 93.982  4.104  -20.965 1.00 76.60  ? 119  SER A OG  1 
ATOM   668  N N   . GLY A 1 105 ? 94.898  4.692  -17.654 1.00 74.29  ? 120  GLY A N   1 
ATOM   669  C CA  . GLY A 1 105 ? 96.016  4.110  -16.940 1.00 78.10  ? 120  GLY A CA  1 
ATOM   670  C C   . GLY A 1 105 ? 96.434  2.884  -17.726 1.00 80.64  ? 120  GLY A C   1 
ATOM   671  O O   . GLY A 1 105 ? 95.773  2.519  -18.700 1.00 80.15  ? 120  GLY A O   1 
ATOM   672  N N   . GLU A 1 106 ? 97.527  2.243  -17.338 1.00 83.40  ? 121  GLU A N   1 
ATOM   673  C CA  . GLU A 1 106 ? 97.947  1.055  -18.064 1.00 85.84  ? 121  GLU A CA  1 
ATOM   674  C C   . GLU A 1 106 ? 97.409  -0.177 -17.341 1.00 85.40  ? 121  GLU A C   1 
ATOM   675  O O   . GLU A 1 106 ? 96.754  -1.021 -17.951 1.00 85.58  ? 121  GLU A O   1 
ATOM   676  C CB  . GLU A 1 106 ? 99.475  1.009  -18.175 1.00 88.99  ? 121  GLU A CB  1 
ATOM   677  C CG  . GLU A 1 106 ? 100.022 -0.082 -19.103 1.00 91.80  ? 121  GLU A CG  1 
ATOM   678  C CD  . GLU A 1 106 ? 99.370  -0.093 -20.485 1.00 94.90  ? 121  GLU A CD  1 
ATOM   679  O OE1 . GLU A 1 106 ? 99.008  0.993  -20.999 1.00 95.46  ? 121  GLU A OE1 1 
ATOM   680  O OE2 . GLU A 1 106 ? 99.236  -1.197 -21.062 1.00 94.94  ? 121  GLU A OE2 1 
ATOM   681  N N   . LYS A 1 107 ? 97.668  -0.264 -16.039 1.00 85.56  ? 122  LYS A N   1 
ATOM   682  C CA  . LYS A 1 107 ? 97.191  -1.386 -15.243 1.00 86.36  ? 122  LYS A CA  1 
ATOM   683  C C   . LYS A 1 107 ? 95.736  -1.093 -14.872 1.00 87.40  ? 122  LYS A C   1 
ATOM   684  O O   . LYS A 1 107 ? 95.460  -0.132 -14.155 1.00 89.73  ? 122  LYS A O   1 
ATOM   685  C CB  . LYS A 1 107 ? 98.049  -1.535 -13.985 1.00 86.92  ? 122  LYS A CB  1 
ATOM   686  C CG  . LYS A 1 107 ? 97.953  -2.902 -13.329 1.00 88.77  ? 122  LYS A CG  1 
ATOM   687  C CD  . LYS A 1 107 ? 99.133  -3.153 -12.390 1.00 89.73  ? 122  LYS A CD  1 
ATOM   688  C CE  . LYS A 1 107 ? 98.798  -2.852 -10.934 1.00 90.24  ? 122  LYS A CE  1 
ATOM   689  N NZ  . LYS A 1 107 ? 97.861  -3.859 -10.358 1.00 88.88  ? 122  LYS A NZ  1 
ATOM   690  N N   . LYS A 1 108 ? 94.817  -1.921 -15.372 1.00 87.30  ? 123  LYS A N   1 
ATOM   691  C CA  . LYS A 1 108 ? 93.367  -1.775 -15.151 1.00 86.73  ? 123  LYS A CA  1 
ATOM   692  C C   . LYS A 1 108 ? 92.859  -1.047 -13.905 1.00 84.92  ? 123  LYS A C   1 
ATOM   693  O O   . LYS A 1 108 ? 91.810  -0.403 -13.952 1.00 84.46  ? 123  LYS A O   1 
ATOM   694  C CB  . LYS A 1 108 ? 92.678  -3.148 -15.228 1.00 88.83  ? 123  LYS A CB  1 
ATOM   695  C CG  . LYS A 1 108 ? 92.368  -3.608 -16.659 1.00 90.89  ? 123  LYS A CG  1 
ATOM   696  C CD  . LYS A 1 108 ? 91.614  -4.947 -16.720 1.00 94.20  ? 123  LYS A CD  1 
ATOM   697  C CE  . LYS A 1 108 ? 92.489  -6.128 -16.280 1.00 96.54  ? 123  LYS A CE  1 
ATOM   698  N NZ  . LYS A 1 108 ? 91.866  -7.462 -16.588 1.00 98.70  ? 123  LYS A NZ  1 
ATOM   699  N N   . ASP A 1 109 ? 93.580  -1.153 -12.795 1.00 83.02  ? 124  ASP A N   1 
ATOM   700  C CA  . ASP A 1 109 ? 93.161  -0.490 -11.564 1.00 81.65  ? 124  ASP A CA  1 
ATOM   701  C C   . ASP A 1 109 ? 93.956  0.781  -11.279 1.00 78.01  ? 124  ASP A C   1 
ATOM   702  O O   . ASP A 1 109 ? 94.201  1.118  -10.118 1.00 76.76  ? 124  ASP A O   1 
ATOM   703  C CB  . ASP A 1 109 ? 93.295  -1.451 -10.385 1.00 85.07  ? 124  ASP A CB  1 
ATOM   704  C CG  . ASP A 1 109 ? 94.684  -2.044 -10.280 1.00 88.84  ? 124  ASP A CG  1 
ATOM   705  O OD1 . ASP A 1 109 ? 95.095  -2.763 -11.223 1.00 92.20  ? 124  ASP A OD1 1 
ATOM   706  O OD2 . ASP A 1 109 ? 95.365  -1.785 -9.261  1.00 92.38  ? 124  ASP A OD2 1 
ATOM   707  N N   . GLU A 1 110 ? 94.350  1.485  -12.338 1.00 73.82  ? 125  GLU A N   1 
ATOM   708  C CA  . GLU A 1 110 ? 95.116  2.717  -12.200 1.00 71.53  ? 125  GLU A CA  1 
ATOM   709  C C   . GLU A 1 110 ? 94.783  3.753  -13.261 1.00 67.86  ? 125  GLU A C   1 
ATOM   710  O O   . GLU A 1 110 ? 94.608  3.430  -14.438 1.00 67.34  ? 125  GLU A O   1 
ATOM   711  C CB  . GLU A 1 110 ? 96.614  2.410  -12.233 1.00 73.41  ? 125  GLU A CB  1 
ATOM   712  C CG  . GLU A 1 110 ? 97.121  1.737  -10.964 1.00 74.09  ? 125  GLU A CG  1 
ATOM   713  C CD  . GLU A 1 110 ? 98.489  1.102  -11.131 1.00 76.32  ? 125  GLU A CD  1 
ATOM   714  O OE1 . GLU A 1 110 ? 98.998  0.556  -10.128 1.00 75.81  ? 125  GLU A OE1 1 
ATOM   715  O OE2 . GLU A 1 110 ? 99.047  1.143  -12.257 1.00 76.32  ? 125  GLU A OE2 1 
ATOM   716  N N   . VAL A 1 111 ? 94.688  5.002  -12.818 1.00 63.11  ? 126  VAL A N   1 
ATOM   717  C CA  . VAL A 1 111 ? 94.390  6.131  -13.691 1.00 60.01  ? 126  VAL A CA  1 
ATOM   718  C C   . VAL A 1 111 ? 95.415  7.223  -13.472 1.00 60.10  ? 126  VAL A C   1 
ATOM   719  O O   . VAL A 1 111 ? 96.117  7.227  -12.467 1.00 60.20  ? 126  VAL A O   1 
ATOM   720  C CB  . VAL A 1 111 ? 93.014  6.762  -13.387 1.00 58.71  ? 126  VAL A CB  1 
ATOM   721  C CG1 . VAL A 1 111 ? 91.941  6.089  -14.193 1.00 53.38  ? 126  VAL A CG1 1 
ATOM   722  C CG2 . VAL A 1 111 ? 92.721  6.669  -11.905 1.00 53.86  ? 126  VAL A CG2 1 
ATOM   723  N N   . TYR A 1 112 ? 95.497  8.149  -14.417 1.00 60.14  ? 127  TYR A N   1 
ATOM   724  C CA  . TYR A 1 112 ? 96.407  9.274  -14.297 1.00 59.71  ? 127  TYR A CA  1 
ATOM   725  C C   . TYR A 1 112 ? 95.584  10.536 -14.094 1.00 57.65  ? 127  TYR A C   1 
ATOM   726  O O   . TYR A 1 112 ? 94.853  10.957 -14.988 1.00 58.45  ? 127  TYR A O   1 
ATOM   727  C CB  . TYR A 1 112 ? 97.258  9.433  -15.554 1.00 62.68  ? 127  TYR A CB  1 
ATOM   728  C CG  . TYR A 1 112 ? 98.317  8.381  -15.708 1.00 67.17  ? 127  TYR A CG  1 
ATOM   729  C CD1 . TYR A 1 112 ? 98.211  7.399  -16.692 1.00 69.61  ? 127  TYR A CD1 1 
ATOM   730  C CD2 . TYR A 1 112 ? 99.424  8.352  -14.855 1.00 67.53  ? 127  TYR A CD2 1 
ATOM   731  C CE1 . TYR A 1 112 ? 99.185  6.403  -16.827 1.00 72.55  ? 127  TYR A CE1 1 
ATOM   732  C CE2 . TYR A 1 112 ? 100.406 7.362  -14.976 1.00 70.18  ? 127  TYR A CE2 1 
ATOM   733  C CZ  . TYR A 1 112 ? 100.281 6.386  -15.964 1.00 72.46  ? 127  TYR A CZ  1 
ATOM   734  O OH  . TYR A 1 112 ? 101.230 5.386  -16.080 1.00 72.86  ? 127  TYR A OH  1 
ATOM   735  N N   . LEU A 1 113 ? 95.690  11.135 -12.917 1.00 54.38  ? 128  LEU A N   1 
ATOM   736  C CA  . LEU A 1 113 ? 94.954  12.357 -12.645 1.00 52.73  ? 128  LEU A CA  1 
ATOM   737  C C   . LEU A 1 113 ? 95.751  13.539 -13.199 1.00 52.97  ? 128  LEU A C   1 
ATOM   738  O O   . LEU A 1 113 ? 96.973  13.596 -13.050 1.00 52.02  ? 128  LEU A O   1 
ATOM   739  C CB  . LEU A 1 113 ? 94.735  12.498 -11.144 1.00 51.10  ? 128  LEU A CB  1 
ATOM   740  C CG  . LEU A 1 113 ? 94.073  13.780 -10.660 1.00 51.39  ? 128  LEU A CG  1 
ATOM   741  C CD1 . LEU A 1 113 ? 92.834  14.118 -11.483 1.00 50.91  ? 128  LEU A CD1 1 
ATOM   742  C CD2 . LEU A 1 113 ? 93.734  13.588 -9.205  1.00 52.66  ? 128  LEU A CD2 1 
ATOM   743  N N   . ASN A 1 114 ? 95.067  14.477 -13.845 1.00 51.22  ? 129  ASN A N   1 
ATOM   744  C CA  . ASN A 1 114 ? 95.756  15.618 -14.430 1.00 49.01  ? 129  ASN A CA  1 
ATOM   745  C C   . ASN A 1 114 ? 95.319  16.951 -13.858 1.00 49.22  ? 129  ASN A C   1 
ATOM   746  O O   . ASN A 1 114 ? 94.365  17.565 -14.333 1.00 50.43  ? 129  ASN A O   1 
ATOM   747  C CB  . ASN A 1 114 ? 95.557  15.623 -15.942 1.00 48.22  ? 129  ASN A CB  1 
ATOM   748  C CG  . ASN A 1 114 ? 96.301  14.499 -16.630 1.00 50.35  ? 129  ASN A CG  1 
ATOM   749  O OD1 . ASN A 1 114 ? 97.487  14.617 -16.931 1.00 50.17  ? 129  ASN A OD1 1 
ATOM   750  N ND2 . ASN A 1 114 ? 95.608  13.393 -16.873 1.00 49.40  ? 129  ASN A ND2 1 
ATOM   751  N N   . LEU A 1 115 ? 96.036  17.407 -12.842 1.00 49.33  ? 130  LEU A N   1 
ATOM   752  C CA  . LEU A 1 115 ? 95.711  18.672 -12.220 1.00 49.26  ? 130  LEU A CA  1 
ATOM   753  C C   . LEU A 1 115 ? 96.262  19.775 -13.085 1.00 50.13  ? 130  LEU A C   1 
ATOM   754  O O   . LEU A 1 115 ? 97.468  19.865 -13.290 1.00 50.84  ? 130  LEU A O   1 
ATOM   755  C CB  . LEU A 1 115 ? 96.316  18.753 -10.828 1.00 50.10  ? 130  LEU A CB  1 
ATOM   756  C CG  . LEU A 1 115 ? 95.967  17.556 -9.951  1.00 47.55  ? 130  LEU A CG  1 
ATOM   757  C CD1 . LEU A 1 115 ? 96.825  16.369 -10.359 1.00 49.91  ? 130  LEU A CD1 1 
ATOM   758  C CD2 . LEU A 1 115 ? 96.221  17.900 -8.503  1.00 48.11  ? 130  LEU A CD2 1 
ATOM   759  N N   . VAL A 1 116 ? 95.369  20.604 -13.608 1.00 50.47  ? 131  VAL A N   1 
ATOM   760  C CA  . VAL A 1 116 ? 95.764  21.705 -14.461 1.00 51.74  ? 131  VAL A CA  1 
ATOM   761  C C   . VAL A 1 116 ? 95.795  22.971 -13.625 1.00 53.70  ? 131  VAL A C   1 
ATOM   762  O O   . VAL A 1 116 ? 94.817  23.709 -13.542 1.00 56.45  ? 131  VAL A O   1 
ATOM   763  C CB  . VAL A 1 116 ? 94.785  21.851 -15.617 1.00 52.24  ? 131  VAL A CB  1 
ATOM   764  C CG1 . VAL A 1 116 ? 95.202  23.001 -16.502 1.00 54.19  ? 131  VAL A CG1 1 
ATOM   765  C CG2 . VAL A 1 116 ? 94.739  20.547 -16.399 1.00 53.05  ? 131  VAL A CG2 1 
ATOM   766  N N   . LEU A 1 117 ? 96.944  23.203 -13.004 1.00 56.50  ? 132  LEU A N   1 
ATOM   767  C CA  . LEU A 1 117 ? 97.170  24.344 -12.122 1.00 57.89  ? 132  LEU A CA  1 
ATOM   768  C C   . LEU A 1 117 ? 97.610  25.579 -12.886 1.00 60.02  ? 132  LEU A C   1 
ATOM   769  O O   . LEU A 1 117 ? 97.775  25.549 -14.103 1.00 59.72  ? 132  LEU A O   1 
ATOM   770  C CB  . LEU A 1 117 ? 98.258  23.995 -11.103 1.00 56.69  ? 132  LEU A CB  1 
ATOM   771  C CG  . LEU A 1 117 ? 98.287  22.581 -10.507 1.00 57.45  ? 132  LEU A CG  1 
ATOM   772  C CD1 . LEU A 1 117 ? 99.674  22.283 -9.930  1.00 57.66  ? 132  LEU A CD1 1 
ATOM   773  C CD2 . LEU A 1 117 ? 97.203  22.449 -9.448  1.00 58.69  ? 132  LEU A CD2 1 
ATOM   774  N N   . ASP A 1 118 ? 97.803  26.669 -12.155 1.00 62.90  ? 133  ASP A N   1 
ATOM   775  C CA  . ASP A 1 118 ? 98.256  27.902 -12.768 1.00 67.08  ? 133  ASP A CA  1 
ATOM   776  C C   . ASP A 1 118 ? 99.778  27.950 -12.778 1.00 68.01  ? 133  ASP A C   1 
ATOM   777  O O   . ASP A 1 118 ? 100.435 27.498 -11.833 1.00 67.32  ? 133  ASP A O   1 
ATOM   778  C CB  . ASP A 1 118 ? 97.696  29.111 -12.026 1.00 68.64  ? 133  ASP A CB  1 
ATOM   779  C CG  . ASP A 1 118 ? 96.296  29.473 -12.484 1.00 73.12  ? 133  ASP A CG  1 
ATOM   780  O OD1 . ASP A 1 118 ? 96.088  29.650 -13.716 1.00 73.13  ? 133  ASP A OD1 1 
ATOM   781  O OD2 . ASP A 1 118 ? 95.409  29.586 -11.608 1.00 74.91  ? 133  ASP A OD2 1 
ATOM   782  N N   . TYR A 1 119 ? 100.329 28.505 -13.855 1.00 68.28  ? 134  TYR A N   1 
ATOM   783  C CA  . TYR A 1 119 ? 101.772 28.603 -14.026 1.00 68.97  ? 134  TYR A CA  1 
ATOM   784  C C   . TYR A 1 119 ? 102.391 29.978 -13.814 1.00 68.47  ? 134  TYR A C   1 
ATOM   785  O O   . TYR A 1 119 ? 102.005 30.972 -14.437 1.00 68.03  ? 134  TYR A O   1 
ATOM   786  C CB  . TYR A 1 119 ? 102.164 28.121 -15.419 1.00 70.94  ? 134  TYR A CB  1 
ATOM   787  C CG  . TYR A 1 119 ? 103.638 28.269 -15.711 1.00 73.99  ? 134  TYR A CG  1 
ATOM   788  C CD1 . TYR A 1 119 ? 104.580 27.467 -15.063 1.00 74.97  ? 134  TYR A CD1 1 
ATOM   789  C CD2 . TYR A 1 119 ? 104.091 29.201 -16.643 1.00 74.67  ? 134  TYR A CD2 1 
ATOM   790  C CE1 . TYR A 1 119 ? 105.936 27.584 -15.340 1.00 74.98  ? 134  TYR A CE1 1 
ATOM   791  C CE2 . TYR A 1 119 ? 105.444 29.330 -16.928 1.00 75.38  ? 134  TYR A CE2 1 
ATOM   792  C CZ  . TYR A 1 119 ? 106.360 28.518 -16.274 1.00 75.50  ? 134  TYR A CZ  1 
ATOM   793  O OH  . TYR A 1 119 ? 107.698 28.634 -16.558 1.00 75.12  ? 134  TYR A OH  1 
ATOM   794  N N   . VAL A 1 120 ? 103.368 30.011 -12.922 1.00 67.12  ? 135  VAL A N   1 
ATOM   795  C CA  . VAL A 1 120 ? 104.106 31.219 -12.635 1.00 66.02  ? 135  VAL A CA  1 
ATOM   796  C C   . VAL A 1 120 ? 105.518 30.679 -12.564 1.00 64.60  ? 135  VAL A C   1 
ATOM   797  O O   . VAL A 1 120 ? 105.802 29.768 -11.784 1.00 61.27  ? 135  VAL A O   1 
ATOM   798  C CB  . VAL A 1 120 ? 103.713 31.835 -11.293 1.00 67.05  ? 135  VAL A CB  1 
ATOM   799  C CG1 . VAL A 1 120 ? 104.240 33.254 -11.214 1.00 67.42  ? 135  VAL A CG1 1 
ATOM   800  C CG2 . VAL A 1 120 ? 102.209 31.822 -11.141 1.00 68.45  ? 135  VAL A CG2 1 
ATOM   801  N N   . PRO A 1 121 ? 106.417 31.211 -13.405 1.00 64.89  ? 136  PRO A N   1 
ATOM   802  C CA  . PRO A 1 121 ? 107.815 30.767 -13.438 1.00 61.79  ? 136  PRO A CA  1 
ATOM   803  C C   . PRO A 1 121 ? 108.657 31.328 -12.298 1.00 58.62  ? 136  PRO A C   1 
ATOM   804  O O   . PRO A 1 121 ? 109.716 30.783 -11.980 1.00 58.33  ? 136  PRO A O   1 
ATOM   805  C CB  . PRO A 1 121 ? 108.290 31.256 -14.800 1.00 61.39  ? 136  PRO A CB  1 
ATOM   806  C CG  . PRO A 1 121 ? 107.578 32.585 -14.912 1.00 64.24  ? 136  PRO A CG  1 
ATOM   807  C CD  . PRO A 1 121 ? 106.176 32.285 -14.391 1.00 64.06  ? 136  PRO A CD  1 
ATOM   808  N N   . GLU A 1 122 ? 108.180 32.407 -11.681 1.00 54.85  ? 137  GLU A N   1 
ATOM   809  C CA  . GLU A 1 122 ? 108.907 33.050 -10.595 1.00 53.77  ? 137  GLU A CA  1 
ATOM   810  C C   . GLU A 1 122 ? 108.582 32.498 -9.207  1.00 51.99  ? 137  GLU A C   1 
ATOM   811  O O   . GLU A 1 122 ? 107.418 32.291 -8.867  1.00 48.95  ? 137  GLU A O   1 
ATOM   812  C CB  . GLU A 1 122 ? 108.629 34.550 -10.627 1.00 58.57  ? 137  GLU A CB  1 
ATOM   813  C CG  . GLU A 1 122 ? 109.529 35.375 -9.715  1.00 67.37  ? 137  GLU A CG  1 
ATOM   814  C CD  . GLU A 1 122 ? 110.980 35.419 -10.189 1.00 71.39  ? 137  GLU A CD  1 
ATOM   815  O OE1 . GLU A 1 122 ? 111.531 36.538 -10.295 1.00 73.64  ? 137  GLU A OE1 1 
ATOM   816  O OE2 . GLU A 1 122 ? 111.573 34.345 -10.450 1.00 73.73  ? 137  GLU A OE2 1 
ATOM   817  N N   . THR A 1 123 ? 109.621 32.262 -8.409  1.00 48.38  ? 138  THR A N   1 
ATOM   818  C CA  . THR A 1 123 ? 109.446 31.752 -7.053  1.00 46.23  ? 138  THR A CA  1 
ATOM   819  C C   . THR A 1 123 ? 110.281 32.568 -6.096  1.00 46.30  ? 138  THR A C   1 
ATOM   820  O O   . THR A 1 123 ? 111.301 33.130 -6.488  1.00 46.05  ? 138  THR A O   1 
ATOM   821  C CB  . THR A 1 123 ? 109.924 30.304 -6.896  1.00 45.96  ? 138  THR A CB  1 
ATOM   822  O OG1 . THR A 1 123 ? 111.334 30.238 -7.146  1.00 42.91  ? 138  THR A OG1 1 
ATOM   823  C CG2 . THR A 1 123 ? 109.178 29.389 -7.839  1.00 42.54  ? 138  THR A CG2 1 
ATOM   824  N N   . VAL A 1 124 ? 109.853 32.619 -4.839  1.00 41.27  ? 139  VAL A N   1 
ATOM   825  C CA  . VAL A 1 124 ? 110.580 33.348 -3.815  1.00 40.07  ? 139  VAL A CA  1 
ATOM   826  C C   . VAL A 1 124 ? 111.996 32.784 -3.746  1.00 42.93  ? 139  VAL A C   1 
ATOM   827  O O   . VAL A 1 124 ? 112.920 33.446 -3.289  1.00 40.63  ? 139  VAL A O   1 
ATOM   828  C CB  . VAL A 1 124 ? 109.879 33.210 -2.451  1.00 40.36  ? 139  VAL A CB  1 
ATOM   829  C CG1 . VAL A 1 124 ? 110.773 33.702 -1.341  1.00 35.93  ? 139  VAL A CG1 1 
ATOM   830  C CG2 . VAL A 1 124 ? 108.587 34.009 -2.462  1.00 39.26  ? 139  VAL A CG2 1 
ATOM   831  N N   . TYR A 1 125 ? 112.168 31.557 -4.219  1.00 44.82  ? 140  TYR A N   1 
ATOM   832  C CA  . TYR A 1 125 ? 113.486 30.946 -4.217  1.00 45.71  ? 140  TYR A CA  1 
ATOM   833  C C   . TYR A 1 125 ? 114.373 31.627 -5.249  1.00 47.33  ? 140  TYR A C   1 
ATOM   834  O O   . TYR A 1 125 ? 115.479 32.060 -4.941  1.00 46.42  ? 140  TYR A O   1 
ATOM   835  C CB  . TYR A 1 125 ? 113.399 29.455 -4.549  1.00 46.53  ? 140  TYR A CB  1 
ATOM   836  C CG  . TYR A 1 125 ? 114.761 28.814 -4.736  1.00 45.77  ? 140  TYR A CG  1 
ATOM   837  C CD1 . TYR A 1 125 ? 115.609 28.602 -3.648  1.00 47.61  ? 140  TYR A CD1 1 
ATOM   838  C CD2 . TYR A 1 125 ? 115.226 28.481 -6.011  1.00 45.89  ? 140  TYR A CD2 1 
ATOM   839  C CE1 . TYR A 1 125 ? 116.885 28.080 -3.822  1.00 48.49  ? 140  TYR A CE1 1 
ATOM   840  C CE2 . TYR A 1 125 ? 116.503 27.961 -6.197  1.00 46.87  ? 140  TYR A CE2 1 
ATOM   841  C CZ  . TYR A 1 125 ? 117.328 27.763 -5.099  1.00 49.57  ? 140  TYR A CZ  1 
ATOM   842  O OH  . TYR A 1 125 ? 118.599 27.257 -5.278  1.00 51.54  ? 140  TYR A OH  1 
ATOM   843  N N   . ARG A 1 126 ? 113.889 31.692 -6.483  1.00 47.92  ? 141  ARG A N   1 
ATOM   844  C CA  . ARG A 1 126 ? 114.642 32.321 -7.555  1.00 52.64  ? 141  ARG A CA  1 
ATOM   845  C C   . ARG A 1 126 ? 115.035 33.746 -7.165  1.00 52.16  ? 141  ARG A C   1 
ATOM   846  O O   . ARG A 1 126 ? 116.209 34.136 -7.251  1.00 52.86  ? 141  ARG A O   1 
ATOM   847  C CB  . ARG A 1 126 ? 113.809 32.342 -8.841  1.00 57.09  ? 141  ARG A CB  1 
ATOM   848  C CG  . ARG A 1 126 ? 113.915 31.072 -9.663  1.00 65.34  ? 141  ARG A CG  1 
ATOM   849  C CD  . ARG A 1 126 ? 113.235 31.220 -11.022 1.00 73.07  ? 141  ARG A CD  1 
ATOM   850  N NE  . ARG A 1 126 ? 113.818 30.335 -12.038 1.00 78.78  ? 141  ARG A NE  1 
ATOM   851  C CZ  . ARG A 1 126 ? 114.924 30.607 -12.738 1.00 80.53  ? 141  ARG A CZ  1 
ATOM   852  N NH1 . ARG A 1 126 ? 115.379 29.736 -13.638 1.00 81.10  ? 141  ARG A NH1 1 
ATOM   853  N NH2 . ARG A 1 126 ? 115.572 31.755 -12.555 1.00 79.84  ? 141  ARG A NH2 1 
ATOM   854  N N   . VAL A 1 127 ? 114.038 34.513 -6.736  1.00 49.21  ? 142  VAL A N   1 
ATOM   855  C CA  . VAL A 1 127 ? 114.233 35.889 -6.327  1.00 43.94  ? 142  VAL A CA  1 
ATOM   856  C C   . VAL A 1 127 ? 115.311 35.975 -5.267  1.00 45.36  ? 142  VAL A C   1 
ATOM   857  O O   . VAL A 1 127 ? 116.287 36.705 -5.426  1.00 44.03  ? 142  VAL A O   1 
ATOM   858  C CB  . VAL A 1 127 ? 112.938 36.459 -5.757  1.00 43.00  ? 142  VAL A CB  1 
ATOM   859  C CG1 . VAL A 1 127 ? 113.186 37.825 -5.177  1.00 42.11  ? 142  VAL A CG1 1 
ATOM   860  C CG2 . VAL A 1 127 ? 111.890 36.520 -6.842  1.00 43.18  ? 142  VAL A CG2 1 
ATOM   861  N N   . ALA A 1 128 ? 115.125 35.221 -4.186  1.00 44.46  ? 143  ALA A N   1 
ATOM   862  C CA  . ALA A 1 128 ? 116.078 35.203 -3.082  1.00 43.99  ? 143  ALA A CA  1 
ATOM   863  C C   . ALA A 1 128 ? 117.464 34.835 -3.573  1.00 44.82  ? 143  ALA A C   1 
ATOM   864  O O   . ALA A 1 128 ? 118.440 35.483 -3.207  1.00 45.21  ? 143  ALA A O   1 
ATOM   865  C CB  . ALA A 1 128 ? 115.631 34.220 -2.004  1.00 42.52  ? 143  ALA A CB  1 
ATOM   866  N N   . ARG A 1 129 ? 117.557 33.795 -4.399  1.00 46.20  ? 144  ARG A N   1 
ATOM   867  C CA  . ARG A 1 129 ? 118.851 33.376 -4.923  1.00 48.22  ? 144  ARG A CA  1 
ATOM   868  C C   . ARG A 1 129 ? 119.413 34.487 -5.795  1.00 48.34  ? 144  ARG A C   1 
ATOM   869  O O   . ARG A 1 129 ? 120.624 34.619 -5.945  1.00 46.61  ? 144  ARG A O   1 
ATOM   870  C CB  . ARG A 1 129 ? 118.734 32.093 -5.742  1.00 46.06  ? 144  ARG A CB  1 
ATOM   871  C CG  . ARG A 1 129 ? 120.092 31.539 -6.142  1.00 49.67  ? 144  ARG A CG  1 
ATOM   872  C CD  . ARG A 1 129 ? 119.978 30.462 -7.204  1.00 52.92  ? 144  ARG A CD  1 
ATOM   873  N NE  . ARG A 1 129 ? 118.920 30.783 -8.160  1.00 58.59  ? 144  ARG A NE  1 
ATOM   874  C CZ  . ARG A 1 129 ? 118.706 30.138 -9.303  1.00 57.85  ? 144  ARG A CZ  1 
ATOM   875  N NH1 . ARG A 1 129 ? 119.482 29.123 -9.668  1.00 58.83  ? 144  ARG A NH1 1 
ATOM   876  N NH2 . ARG A 1 129 ? 117.688 30.493 -10.073 1.00 57.51  ? 144  ARG A NH2 1 
ATOM   877  N N   . HIS A 1 130 ? 118.531 35.293 -6.367  1.00 49.19  ? 145  HIS A N   1 
ATOM   878  C CA  . HIS A 1 130 ? 118.976 36.394 -7.200  1.00 51.18  ? 145  HIS A CA  1 
ATOM   879  C C   . HIS A 1 130 ? 119.781 37.383 -6.379  1.00 51.61  ? 145  HIS A C   1 
ATOM   880  O O   . HIS A 1 130 ? 120.932 37.668 -6.685  1.00 51.53  ? 145  HIS A O   1 
ATOM   881  C CB  . HIS A 1 130 ? 117.793 37.123 -7.811  1.00 54.58  ? 145  HIS A CB  1 
ATOM   882  C CG  . HIS A 1 130 ? 118.195 38.274 -8.673  1.00 59.37  ? 145  HIS A CG  1 
ATOM   883  N ND1 . HIS A 1 130 ? 118.921 38.112 -9.833  1.00 60.74  ? 145  HIS A ND1 1 
ATOM   884  C CD2 . HIS A 1 130 ? 118.019 39.608 -8.519  1.00 62.31  ? 145  HIS A CD2 1 
ATOM   885  C CE1 . HIS A 1 130 ? 119.177 39.298 -10.357 1.00 62.59  ? 145  HIS A CE1 1 
ATOM   886  N NE2 . HIS A 1 130 ? 118.641 40.223 -9.579  1.00 61.51  ? 145  HIS A NE2 1 
ATOM   887  N N   . TYR A 1 131 ? 119.160 37.917 -5.336  1.00 52.21  ? 146  TYR A N   1 
ATOM   888  C CA  . TYR A 1 131 ? 119.832 38.871 -4.468  1.00 51.95  ? 146  TYR A CA  1 
ATOM   889  C C   . TYR A 1 131 ? 121.074 38.270 -3.843  1.00 52.33  ? 146  TYR A C   1 
ATOM   890  O O   . TYR A 1 131 ? 122.102 38.927 -3.709  1.00 53.44  ? 146  TYR A O   1 
ATOM   891  C CB  . TYR A 1 131 ? 118.894 39.343 -3.358  1.00 51.40  ? 146  TYR A CB  1 
ATOM   892  C CG  . TYR A 1 131 ? 117.844 40.304 -3.838  1.00 51.85  ? 146  TYR A CG  1 
ATOM   893  C CD1 . TYR A 1 131 ? 116.797 39.869 -4.639  1.00 56.29  ? 146  TYR A CD1 1 
ATOM   894  C CD2 . TYR A 1 131 ? 117.917 41.656 -3.523  1.00 51.65  ? 146  TYR A CD2 1 
ATOM   895  C CE1 . TYR A 1 131 ? 115.841 40.760 -5.119  1.00 58.81  ? 146  TYR A CE1 1 
ATOM   896  C CE2 . TYR A 1 131 ? 116.969 42.560 -3.998  1.00 54.43  ? 146  TYR A CE2 1 
ATOM   897  C CZ  . TYR A 1 131 ? 115.931 42.106 -4.797  1.00 56.79  ? 146  TYR A CZ  1 
ATOM   898  O OH  . TYR A 1 131 ? 114.985 42.983 -5.283  1.00 52.34  ? 146  TYR A OH  1 
ATOM   899  N N   . SER A 1 132 ? 120.968 37.012 -3.451  1.00 52.93  ? 147  SER A N   1 
ATOM   900  C CA  . SER A 1 132 ? 122.077 36.326 -2.830  1.00 53.96  ? 147  SER A CA  1 
ATOM   901  C C   . SER A 1 132 ? 123.290 36.329 -3.737  1.00 56.86  ? 147  SER A C   1 
ATOM   902  O O   . SER A 1 132 ? 124.397 36.585 -3.284  1.00 58.51  ? 147  SER A O   1 
ATOM   903  C CB  . SER A 1 132 ? 121.687 34.894 -2.509  1.00 53.14  ? 147  SER A CB  1 
ATOM   904  O OG  . SER A 1 132 ? 122.773 34.226 -1.905  1.00 56.36  ? 147  SER A OG  1 
ATOM   905  N N   . ARG A 1 133 ? 123.093 36.040 -5.017  1.00 58.01  ? 148  ARG A N   1 
ATOM   906  C CA  . ARG A 1 133 ? 124.214 36.027 -5.943  1.00 59.27  ? 148  ARG A CA  1 
ATOM   907  C C   . ARG A 1 133 ? 124.741 37.443 -6.178  1.00 61.03  ? 148  ARG A C   1 
ATOM   908  O O   . ARG A 1 133 ? 125.921 37.628 -6.478  1.00 60.82  ? 148  ARG A O   1 
ATOM   909  C CB  . ARG A 1 133 ? 123.808 35.344 -7.259  1.00 61.05  ? 148  ARG A CB  1 
ATOM   910  C CG  . ARG A 1 133 ? 123.522 33.846 -7.072  1.00 65.28  ? 148  ARG A CG  1 
ATOM   911  C CD  . ARG A 1 133 ? 123.636 33.006 -8.354  1.00 67.53  ? 148  ARG A CD  1 
ATOM   912  N NE  . ARG A 1 133 ? 122.415 32.994 -9.161  1.00 71.48  ? 148  ARG A NE  1 
ATOM   913  C CZ  . ARG A 1 133 ? 121.884 31.893 -9.695  1.00 73.57  ? 148  ARG A CZ  1 
ATOM   914  N NH1 . ARG A 1 133 ? 122.463 30.710 -9.504  1.00 73.10  ? 148  ARG A NH1 1 
ATOM   915  N NH2 . ARG A 1 133 ? 120.776 31.974 -10.425 1.00 72.72  ? 148  ARG A NH2 1 
ATOM   916  N N   . ALA A 1 134 ? 123.866 38.437 -6.020  1.00 61.57  ? 149  ALA A N   1 
ATOM   917  C CA  . ALA A 1 134 ? 124.233 39.848 -6.179  1.00 60.64  ? 149  ALA A CA  1 
ATOM   918  C C   . ALA A 1 134 ? 124.803 40.365 -4.854  1.00 63.32  ? 149  ALA A C   1 
ATOM   919  O O   . ALA A 1 134 ? 125.023 41.563 -4.668  1.00 63.15  ? 149  ALA A O   1 
ATOM   920  C CB  . ALA A 1 134 ? 123.016 40.660 -6.571  1.00 59.63  ? 149  ALA A CB  1 
ATOM   921  N N   . LYS A 1 135 ? 125.019 39.429 -3.935  1.00 66.82  ? 150  LYS A N   1 
ATOM   922  C CA  . LYS A 1 135 ? 125.572 39.686 -2.608  1.00 67.37  ? 150  LYS A CA  1 
ATOM   923  C C   . LYS A 1 135 ? 124.775 40.564 -1.654  1.00 67.08  ? 150  LYS A C   1 
ATOM   924  O O   . LYS A 1 135 ? 125.115 40.657 -0.474  1.00 69.07  ? 150  LYS A O   1 
ATOM   925  C CB  . LYS A 1 135 ? 127.004 40.203 -2.732  1.00 67.60  ? 150  LYS A CB  1 
ATOM   926  C CG  . LYS A 1 135 ? 127.958 39.138 -3.260  1.00 69.58  ? 150  LYS A CG  1 
ATOM   927  C CD  . LYS A 1 135 ? 129.402 39.503 -3.004  1.00 74.58  ? 150  LYS A CD  1 
ATOM   928  C CE  . LYS A 1 135 ? 130.321 38.314 -3.255  1.00 78.79  ? 150  LYS A CE  1 
ATOM   929  N NZ  . LYS A 1 135 ? 131.655 38.527 -2.611  1.00 80.88  ? 150  LYS A NZ  1 
ATOM   930  N N   . GLN A 1 136 ? 123.712 41.192 -2.141  1.00 66.16  ? 151  GLN A N   1 
ATOM   931  C CA  . GLN A 1 136 ? 122.894 42.014 -1.260  1.00 66.32  ? 151  GLN A CA  1 
ATOM   932  C C   . GLN A 1 136 ? 121.717 41.224 -0.691  1.00 64.80  ? 151  GLN A C   1 
ATOM   933  O O   . GLN A 1 136 ? 121.525 40.050 -1.011  1.00 63.76  ? 151  GLN A O   1 
ATOM   934  C CB  . GLN A 1 136 ? 122.405 43.262 -1.989  1.00 68.11  ? 151  GLN A CB  1 
ATOM   935  C CG  . GLN A 1 136 ? 121.876 43.008 -3.369  1.00 71.58  ? 151  GLN A CG  1 
ATOM   936  C CD  . GLN A 1 136 ? 122.030 44.230 -4.246  1.00 75.43  ? 151  GLN A CD  1 
ATOM   937  O OE1 . GLN A 1 136 ? 123.147 44.702 -4.468  1.00 75.89  ? 151  GLN A OE1 1 
ATOM   938  N NE2 . GLN A 1 136 ? 120.912 44.756 -4.746  1.00 75.82  ? 151  GLN A NE2 1 
ATOM   939  N N   . THR A 1 137 ? 120.928 41.871 0.158   1.00 64.06  ? 152  THR A N   1 
ATOM   940  C CA  . THR A 1 137 ? 119.797 41.205 0.794   1.00 61.34  ? 152  THR A CA  1 
ATOM   941  C C   . THR A 1 137 ? 118.461 41.691 0.237   1.00 58.63  ? 152  THR A C   1 
ATOM   942  O O   . THR A 1 137 ? 118.358 42.811 -0.259  1.00 57.53  ? 152  THR A O   1 
ATOM   943  C CB  . THR A 1 137 ? 119.844 41.434 2.338   1.00 62.77  ? 152  THR A CB  1 
ATOM   944  O OG1 . THR A 1 137 ? 118.996 40.485 3.002   1.00 64.83  ? 152  THR A OG1 1 
ATOM   945  C CG2 . THR A 1 137 ? 119.409 42.863 2.683   1.00 60.99  ? 152  THR A CG2 1 
ATOM   946  N N   . LEU A 1 138 ? 117.445 40.840 0.316   1.00 55.58  ? 153  LEU A N   1 
ATOM   947  C CA  . LEU A 1 138 ? 116.112 41.187 -0.168  1.00 53.57  ? 153  LEU A CA  1 
ATOM   948  C C   . LEU A 1 138 ? 115.540 42.376 0.622   1.00 52.91  ? 153  LEU A C   1 
ATOM   949  O O   . LEU A 1 138 ? 115.706 42.461 1.844   1.00 52.63  ? 153  LEU A O   1 
ATOM   950  C CB  . LEU A 1 138 ? 115.174 39.975 -0.038  1.00 49.83  ? 153  LEU A CB  1 
ATOM   951  C CG  . LEU A 1 138 ? 113.730 40.130 -0.521  1.00 52.53  ? 153  LEU A CG  1 
ATOM   952  C CD1 . LEU A 1 138 ? 113.699 40.433 -2.012  1.00 52.85  ? 153  LEU A CD1 1 
ATOM   953  C CD2 . LEU A 1 138 ? 112.960 38.864 -0.234  1.00 52.93  ? 153  LEU A CD2 1 
ATOM   954  N N   . PRO A 1 139 ? 114.885 43.323 -0.075  1.00 51.09  ? 154  PRO A N   1 
ATOM   955  C CA  . PRO A 1 139 ? 114.294 44.496 0.582   1.00 49.64  ? 154  PRO A CA  1 
ATOM   956  C C   . PRO A 1 139 ? 113.257 44.088 1.621   1.00 48.15  ? 154  PRO A C   1 
ATOM   957  O O   . PRO A 1 139 ? 112.409 43.229 1.385   1.00 45.47  ? 154  PRO A O   1 
ATOM   958  C CB  . PRO A 1 139 ? 113.683 45.270 -0.579  1.00 49.54  ? 154  PRO A CB  1 
ATOM   959  C CG  . PRO A 1 139 ? 114.653 44.981 -1.688  1.00 51.14  ? 154  PRO A CG  1 
ATOM   960  C CD  . PRO A 1 139 ? 114.889 43.495 -1.539  1.00 52.43  ? 154  PRO A CD  1 
ATOM   961  N N   . VAL A 1 140 ? 113.338 44.720 2.777   1.00 44.23  ? 155  VAL A N   1 
ATOM   962  C CA  . VAL A 1 140 ? 112.436 44.419 3.865   1.00 44.19  ? 155  VAL A CA  1 
ATOM   963  C C   . VAL A 1 140 ? 110.985 44.464 3.435   1.00 44.61  ? 155  VAL A C   1 
ATOM   964  O O   . VAL A 1 140 ? 110.157 43.677 3.906   1.00 43.59  ? 155  VAL A O   1 
ATOM   965  C CB  . VAL A 1 140 ? 112.614 45.419 4.997   1.00 43.78  ? 155  VAL A CB  1 
ATOM   966  C CG1 . VAL A 1 140 ? 111.848 44.952 6.221   1.00 40.75  ? 155  VAL A CG1 1 
ATOM   967  C CG2 . VAL A 1 140 ? 114.086 45.601 5.286   1.00 43.81  ? 155  VAL A CG2 1 
ATOM   968  N N   . ILE A 1 141 ? 110.669 45.399 2.550   1.00 41.98  ? 156  ILE A N   1 
ATOM   969  C CA  . ILE A 1 141 ? 109.297 45.527 2.102   1.00 40.21  ? 156  ILE A CA  1 
ATOM   970  C C   . ILE A 1 141 ? 108.796 44.219 1.511   1.00 42.52  ? 156  ILE A C   1 
ATOM   971  O O   . ILE A 1 141 ? 107.674 43.793 1.784   1.00 43.86  ? 156  ILE A O   1 
ATOM   972  C CB  . ILE A 1 141 ? 109.144 46.645 1.054   1.00 37.07  ? 156  ILE A CB  1 
ATOM   973  C CG1 . ILE A 1 141 ? 107.667 46.818 0.726   1.00 33.90  ? 156  ILE A CG1 1 
ATOM   974  C CG2 . ILE A 1 141 ? 109.943 46.325 -0.203  1.00 35.32  ? 156  ILE A CG2 1 
ATOM   975  C CD1 . ILE A 1 141 ? 106.807 47.055 1.964   1.00 33.81  ? 156  ILE A CD1 1 
ATOM   976  N N   . TYR A 1 142 ? 109.641 43.580 0.710   1.00 40.72  ? 157  TYR A N   1 
ATOM   977  C CA  . TYR A 1 142 ? 109.280 42.332 0.076   1.00 42.54  ? 157  TYR A CA  1 
ATOM   978  C C   . TYR A 1 142 ? 109.250 41.199 1.077   1.00 41.25  ? 157  TYR A C   1 
ATOM   979  O O   . TYR A 1 142 ? 108.425 40.297 0.973   1.00 37.18  ? 157  TYR A O   1 
ATOM   980  C CB  . TYR A 1 142 ? 110.244 42.043 -1.073  1.00 46.65  ? 157  TYR A CB  1 
ATOM   981  C CG  . TYR A 1 142 ? 109.970 42.925 -2.277  1.00 50.50  ? 157  TYR A CG  1 
ATOM   982  C CD1 . TYR A 1 142 ? 110.955 43.762 -2.807  1.00 53.30  ? 157  TYR A CD1 1 
ATOM   983  C CD2 . TYR A 1 142 ? 108.706 42.937 -2.875  1.00 52.45  ? 157  TYR A CD2 1 
ATOM   984  C CE1 . TYR A 1 142 ? 110.687 44.593 -3.906  1.00 53.67  ? 157  TYR A CE1 1 
ATOM   985  C CE2 . TYR A 1 142 ? 108.427 43.762 -3.968  1.00 54.36  ? 157  TYR A CE2 1 
ATOM   986  C CZ  . TYR A 1 142 ? 109.419 44.588 -4.479  1.00 55.76  ? 157  TYR A CZ  1 
ATOM   987  O OH  . TYR A 1 142 ? 109.124 45.412 -5.551  1.00 62.19  ? 157  TYR A OH  1 
ATOM   988  N N   . VAL A 1 143 ? 110.134 41.252 2.064   1.00 38.86  ? 158  VAL A N   1 
ATOM   989  C CA  . VAL A 1 143 ? 110.163 40.219 3.088   1.00 35.60  ? 158  VAL A CA  1 
ATOM   990  C C   . VAL A 1 143 ? 108.851 40.233 3.868   1.00 38.04  ? 158  VAL A C   1 
ATOM   991  O O   . VAL A 1 143 ? 108.342 39.184 4.251   1.00 40.42  ? 158  VAL A O   1 
ATOM   992  C CB  . VAL A 1 143 ? 111.342 40.427 4.055   1.00 34.66  ? 158  VAL A CB  1 
ATOM   993  C CG1 . VAL A 1 143 ? 111.203 39.525 5.245   1.00 32.48  ? 158  VAL A CG1 1 
ATOM   994  C CG2 . VAL A 1 143 ? 112.639 40.131 3.352   1.00 31.60  ? 158  VAL A CG2 1 
ATOM   995  N N   . LYS A 1 144 ? 108.297 41.421 4.093   1.00 37.10  ? 159  LYS A N   1 
ATOM   996  C CA  . LYS A 1 144 ? 107.035 41.544 4.826   1.00 40.41  ? 159  LYS A CA  1 
ATOM   997  C C   . LYS A 1 144 ? 105.856 41.098 3.969   1.00 41.54  ? 159  LYS A C   1 
ATOM   998  O O   . LYS A 1 144 ? 104.925 40.443 4.442   1.00 42.62  ? 159  LYS A O   1 
ATOM   999  C CB  . LYS A 1 144 ? 106.791 42.994 5.235   1.00 43.09  ? 159  LYS A CB  1 
ATOM   1000 C CG  . LYS A 1 144 ? 107.902 43.619 6.027   1.00 43.85  ? 159  LYS A CG  1 
ATOM   1001 C CD  . LYS A 1 144 ? 107.447 44.959 6.580   1.00 45.85  ? 159  LYS A CD  1 
ATOM   1002 C CE  . LYS A 1 144 ? 108.531 45.631 7.405   1.00 43.54  ? 159  LYS A CE  1 
ATOM   1003 N NZ  . LYS A 1 144 ? 108.014 46.843 8.090   1.00 49.37  ? 159  LYS A NZ  1 
ATOM   1004 N N   . LEU A 1 145 ? 105.915 41.476 2.701   1.00 42.18  ? 160  LEU A N   1 
ATOM   1005 C CA  . LEU A 1 145 ? 104.873 41.175 1.734   1.00 44.09  ? 160  LEU A CA  1 
ATOM   1006 C C   . LEU A 1 145 ? 104.729 39.686 1.464   1.00 43.91  ? 160  LEU A C   1 
ATOM   1007 O O   . LEU A 1 145 ? 103.624 39.146 1.450   1.00 43.60  ? 160  LEU A O   1 
ATOM   1008 C CB  . LEU A 1 145 ? 105.180 41.918 0.431   1.00 48.07  ? 160  LEU A CB  1 
ATOM   1009 C CG  . LEU A 1 145 ? 104.064 42.721 -0.255  1.00 52.82  ? 160  LEU A CG  1 
ATOM   1010 C CD1 . LEU A 1 145 ? 103.177 43.442 0.761   1.00 53.05  ? 160  LEU A CD1 1 
ATOM   1011 C CD2 . LEU A 1 145 ? 104.714 43.728 -1.183  1.00 51.83  ? 160  LEU A CD2 1 
ATOM   1012 N N   . TYR A 1 146 ? 105.863 39.033 1.255   1.00 41.67  ? 161  TYR A N   1 
ATOM   1013 C CA  . TYR A 1 146 ? 105.904 37.610 0.969   1.00 38.90  ? 161  TYR A CA  1 
ATOM   1014 C C   . TYR A 1 146 ? 105.518 36.782 2.182   1.00 36.83  ? 161  TYR A C   1 
ATOM   1015 O O   . TYR A 1 146 ? 104.634 35.923 2.104   1.00 36.27  ? 161  TYR A O   1 
ATOM   1016 C CB  . TYR A 1 146 ? 107.308 37.230 0.528   1.00 39.45  ? 161  TYR A CB  1 
ATOM   1017 C CG  . TYR A 1 146 ? 107.764 37.898 -0.746  1.00 40.97  ? 161  TYR A CG  1 
ATOM   1018 C CD1 . TYR A 1 146 ? 109.102 37.842 -1.129  1.00 41.71  ? 161  TYR A CD1 1 
ATOM   1019 C CD2 . TYR A 1 146 ? 106.860 38.554 -1.583  1.00 40.21  ? 161  TYR A CD2 1 
ATOM   1020 C CE1 . TYR A 1 146 ? 109.534 38.413 -2.310  1.00 40.02  ? 161  TYR A CE1 1 
ATOM   1021 C CE2 . TYR A 1 146 ? 107.280 39.132 -2.767  1.00 43.60  ? 161  TYR A CE2 1 
ATOM   1022 C CZ  . TYR A 1 146 ? 108.624 39.053 -3.124  1.00 43.68  ? 161  TYR A CZ  1 
ATOM   1023 O OH  . TYR A 1 146 ? 109.070 39.597 -4.306  1.00 47.69  ? 161  TYR A OH  1 
ATOM   1024 N N   . MET A 1 147 ? 106.191 37.038 3.299   1.00 32.94  ? 162  MET A N   1 
ATOM   1025 C CA  . MET A 1 147 ? 105.922 36.310 4.527   1.00 32.39  ? 162  MET A CA  1 
ATOM   1026 C C   . MET A 1 147 ? 104.478 36.494 4.964   1.00 37.26  ? 162  MET A C   1 
ATOM   1027 O O   . MET A 1 147 ? 103.843 35.565 5.470   1.00 39.32  ? 162  MET A O   1 
ATOM   1028 C CB  . MET A 1 147 ? 106.863 36.775 5.643   1.00 35.01  ? 162  MET A CB  1 
ATOM   1029 C CG  . MET A 1 147 ? 108.281 36.246 5.528   1.00 30.92  ? 162  MET A CG  1 
ATOM   1030 S SD  . MET A 1 147 ? 108.294 34.465 5.222   1.00 30.51  ? 162  MET A SD  1 
ATOM   1031 C CE  . MET A 1 147 ? 107.815 33.835 6.841   1.00 23.75  ? 162  MET A CE  1 
ATOM   1032 N N   . TYR A 1 148 ? 103.958 37.699 4.767   1.00 35.98  ? 163  TYR A N   1 
ATOM   1033 C CA  . TYR A 1 148 ? 102.594 37.979 5.150   1.00 37.14  ? 163  TYR A CA  1 
ATOM   1034 C C   . TYR A 1 148 ? 101.641 37.057 4.408   1.00 37.64  ? 163  TYR A C   1 
ATOM   1035 O O   . TYR A 1 148 ? 100.863 36.314 5.009   1.00 38.21  ? 163  TYR A O   1 
ATOM   1036 C CB  . TYR A 1 148 ? 102.237 39.418 4.822   1.00 35.67  ? 163  TYR A CB  1 
ATOM   1037 C CG  . TYR A 1 148 ? 100.829 39.753 5.230   1.00 32.87  ? 163  TYR A CG  1 
ATOM   1038 C CD1 . TYR A 1 148 ? 100.492 39.910 6.575   1.00 32.92  ? 163  TYR A CD1 1 
ATOM   1039 C CD2 . TYR A 1 148 ? 99.819  39.885 4.274   1.00 35.49  ? 163  TYR A CD2 1 
ATOM   1040 C CE1 . TYR A 1 148 ? 99.186  40.193 6.961   1.00 32.91  ? 163  TYR A CE1 1 
ATOM   1041 C CE2 . TYR A 1 148 ? 98.506  40.169 4.649   1.00 33.83  ? 163  TYR A CE2 1 
ATOM   1042 C CZ  . TYR A 1 148 ? 98.198  40.323 5.995   1.00 35.51  ? 163  TYR A CZ  1 
ATOM   1043 O OH  . TYR A 1 148 ? 96.905  40.630 6.367   1.00 40.53  ? 163  TYR A OH  1 
ATOM   1044 N N   . GLN A 1 149 ? 101.709 37.117 3.088   1.00 38.01  ? 164  GLN A N   1 
ATOM   1045 C CA  . GLN A 1 149 ? 100.850 36.304 2.238   1.00 39.32  ? 164  GLN A CA  1 
ATOM   1046 C C   . GLN A 1 149 ? 101.033 34.818 2.522   1.00 37.50  ? 164  GLN A C   1 
ATOM   1047 O O   . GLN A 1 149 ? 100.073 34.043 2.487   1.00 35.21  ? 164  GLN A O   1 
ATOM   1048 C CB  . GLN A 1 149 ? 101.148 36.614 0.764   1.00 39.27  ? 164  GLN A CB  1 
ATOM   1049 C CG  . GLN A 1 149 ? 101.025 38.107 0.429   1.00 37.99  ? 164  GLN A CG  1 
ATOM   1050 C CD  . GLN A 1 149 ? 101.212 38.416 -1.046  1.00 40.90  ? 164  GLN A CD  1 
ATOM   1051 O OE1 . GLN A 1 149 ? 100.372 38.073 -1.880  1.00 46.14  ? 164  GLN A OE1 1 
ATOM   1052 N NE2 . GLN A 1 149 ? 102.318 39.070 -1.376  1.00 37.78  ? 164  GLN A NE2 1 
ATOM   1053 N N   . LEU A 1 150 ? 102.274 34.424 2.795   1.00 36.98  ? 165  LEU A N   1 
ATOM   1054 C CA  . LEU A 1 150 ? 102.570 33.036 3.107   1.00 35.22  ? 165  LEU A CA  1 
ATOM   1055 C C   . LEU A 1 150 ? 101.709 32.633 4.292   1.00 35.84  ? 165  LEU A C   1 
ATOM   1056 O O   . LEU A 1 150 ? 101.047 31.603 4.256   1.00 37.53  ? 165  LEU A O   1 
ATOM   1057 C CB  . LEU A 1 150 ? 104.044 32.866 3.462   1.00 32.76  ? 165  LEU A CB  1 
ATOM   1058 C CG  . LEU A 1 150 ? 104.432 31.529 4.094   1.00 31.09  ? 165  LEU A CG  1 
ATOM   1059 C CD1 . LEU A 1 150 ? 104.070 30.390 3.162   1.00 25.25  ? 165  LEU A CD1 1 
ATOM   1060 C CD2 . LEU A 1 150 ? 105.918 31.527 4.405   1.00 29.79  ? 165  LEU A CD2 1 
ATOM   1061 N N   . PHE A 1 151 ? 101.700 33.458 5.337   1.00 37.22  ? 166  PHE A N   1 
ATOM   1062 C CA  . PHE A 1 151 ? 100.901 33.159 6.520   1.00 36.52  ? 166  PHE A CA  1 
ATOM   1063 C C   . PHE A 1 151 ? 99.412  33.082 6.274   1.00 38.55  ? 166  PHE A C   1 
ATOM   1064 O O   . PHE A 1 151 ? 98.740  32.209 6.817   1.00 40.69  ? 166  PHE A O   1 
ATOM   1065 C CB  . PHE A 1 151 ? 101.183 34.166 7.615   1.00 32.72  ? 166  PHE A CB  1 
ATOM   1066 C CG  . PHE A 1 151 ? 102.492 33.944 8.275   1.00 33.03  ? 166  PHE A CG  1 
ATOM   1067 C CD1 . PHE A 1 151 ? 103.502 34.889 8.185   1.00 33.82  ? 166  PHE A CD1 1 
ATOM   1068 C CD2 . PHE A 1 151 ? 102.746 32.743 8.926   1.00 33.82  ? 166  PHE A CD2 1 
ATOM   1069 C CE1 . PHE A 1 151 ? 104.752 34.641 8.727   1.00 31.11  ? 166  PHE A CE1 1 
ATOM   1070 C CE2 . PHE A 1 151 ? 103.990 32.479 9.471   1.00 34.46  ? 166  PHE A CE2 1 
ATOM   1071 C CZ  . PHE A 1 151 ? 105.002 33.429 9.371   1.00 34.94  ? 166  PHE A CZ  1 
ATOM   1072 N N   . ARG A 1 152 ? 98.889  33.992 5.463   1.00 39.10  ? 167  ARG A N   1 
ATOM   1073 C CA  . ARG A 1 152 ? 97.468  33.968 5.166   1.00 39.67  ? 167  ARG A CA  1 
ATOM   1074 C C   . ARG A 1 152 ? 97.115  32.643 4.515   1.00 38.07  ? 167  ARG A C   1 
ATOM   1075 O O   . ARG A 1 152 ? 96.116  32.020 4.867   1.00 40.01  ? 167  ARG A O   1 
ATOM   1076 C CB  . ARG A 1 152 ? 97.074  35.109 4.220   1.00 43.71  ? 167  ARG A CB  1 
ATOM   1077 C CG  . ARG A 1 152 ? 97.040  36.491 4.843   1.00 48.28  ? 167  ARG A CG  1 
ATOM   1078 C CD  . ARG A 1 152 ? 96.322  37.446 3.914   1.00 51.26  ? 167  ARG A CD  1 
ATOM   1079 N NE  . ARG A 1 152 ? 94.906  37.113 3.821   1.00 52.97  ? 167  ARG A NE  1 
ATOM   1080 C CZ  . ARG A 1 152 ? 94.086  37.559 2.873   1.00 49.12  ? 167  ARG A CZ  1 
ATOM   1081 N NH1 . ARG A 1 152 ? 94.541  38.363 1.922   1.00 50.87  ? 167  ARG A NH1 1 
ATOM   1082 N NH2 . ARG A 1 152 ? 92.808  37.200 2.877   1.00 45.37  ? 167  ARG A NH2 1 
ATOM   1083 N N   . SER A 1 153 ? 97.928  32.213 3.558   1.00 34.13  ? 168  SER A N   1 
ATOM   1084 C CA  . SER A 1 153 ? 97.644  30.959 2.881   1.00 35.91  ? 168  SER A CA  1 
ATOM   1085 C C   . SER A 1 153 ? 97.701  29.829 3.899   1.00 33.32  ? 168  SER A C   1 
ATOM   1086 O O   . SER A 1 153 ? 96.907  28.888 3.853   1.00 29.98  ? 168  SER A O   1 
ATOM   1087 C CB  . SER A 1 153 ? 98.641  30.720 1.735   1.00 36.28  ? 168  SER A CB  1 
ATOM   1088 O OG  . SER A 1 153 ? 99.947  30.446 2.203   1.00 41.41  ? 168  SER A OG  1 
ATOM   1089 N N   . LEU A 1 154 ? 98.632  29.944 4.834   1.00 32.30  ? 169  LEU A N   1 
ATOM   1090 C CA  . LEU A 1 154 ? 98.786  28.944 5.869   1.00 34.48  ? 169  LEU A CA  1 
ATOM   1091 C C   . LEU A 1 154 ? 97.558  28.977 6.742   1.00 38.98  ? 169  LEU A C   1 
ATOM   1092 O O   . LEU A 1 154 ? 96.945  27.949 7.010   1.00 37.66  ? 169  LEU A O   1 
ATOM   1093 C CB  . LEU A 1 154 ? 100.020 29.245 6.696   1.00 31.40  ? 169  LEU A CB  1 
ATOM   1094 C CG  . LEU A 1 154 ? 101.096 28.174 6.554   1.00 32.93  ? 169  LEU A CG  1 
ATOM   1095 C CD1 . LEU A 1 154 ? 101.157 27.654 5.123   1.00 23.67  ? 169  LEU A CD1 1 
ATOM   1096 C CD2 . LEU A 1 154 ? 102.422 28.752 7.000   1.00 29.75  ? 169  LEU A CD2 1 
ATOM   1097 N N   . ALA A 1 155 ? 97.191  30.171 7.182   1.00 38.52  ? 170  ALA A N   1 
ATOM   1098 C CA  . ALA A 1 155 ? 96.013  30.327 8.016   1.00 38.51  ? 170  ALA A CA  1 
ATOM   1099 C C   . ALA A 1 155 ? 94.809  29.695 7.321   1.00 40.37  ? 170  ALA A C   1 
ATOM   1100 O O   . ALA A 1 155 ? 94.048  28.945 7.928   1.00 39.60  ? 170  ALA A O   1 
ATOM   1101 C CB  . ALA A 1 155 ? 95.750  31.810 8.276   1.00 37.16  ? 170  ALA A CB  1 
ATOM   1102 N N   . TYR A 1 156 ? 94.655  29.995 6.038   1.00 42.57  ? 171  TYR A N   1 
ATOM   1103 C CA  . TYR A 1 156 ? 93.541  29.479 5.254   1.00 43.30  ? 171  TYR A CA  1 
ATOM   1104 C C   . TYR A 1 156 ? 93.524  27.953 5.114   1.00 43.15  ? 171  TYR A C   1 
ATOM   1105 O O   . TYR A 1 156 ? 92.512  27.318 5.411   1.00 46.70  ? 171  TYR A O   1 
ATOM   1106 C CB  . TYR A 1 156 ? 93.543  30.127 3.868   1.00 44.71  ? 171  TYR A CB  1 
ATOM   1107 C CG  . TYR A 1 156 ? 92.396  29.702 2.988   1.00 46.67  ? 171  TYR A CG  1 
ATOM   1108 C CD1 . TYR A 1 156 ? 91.103  30.137 3.246   1.00 47.44  ? 171  TYR A CD1 1 
ATOM   1109 C CD2 . TYR A 1 156 ? 92.605  28.856 1.901   1.00 45.76  ? 171  TYR A CD2 1 
ATOM   1110 C CE1 . TYR A 1 156 ? 90.042  29.741 2.442   1.00 45.71  ? 171  TYR A CE1 1 
ATOM   1111 C CE2 . TYR A 1 156 ? 91.558  28.456 1.091   1.00 46.05  ? 171  TYR A CE2 1 
ATOM   1112 C CZ  . TYR A 1 156 ? 90.276  28.898 1.365   1.00 46.27  ? 171  TYR A CZ  1 
ATOM   1113 O OH  . TYR A 1 156 ? 89.224  28.486 0.579   1.00 46.86  ? 171  TYR A OH  1 
ATOM   1114 N N   . ILE A 1 157 ? 94.622  27.354 4.663   1.00 40.19  ? 172  ILE A N   1 
ATOM   1115 C CA  . ILE A 1 157 ? 94.634  25.905 4.525   1.00 39.33  ? 172  ILE A CA  1 
ATOM   1116 C C   . ILE A 1 157 ? 94.532  25.209 5.880   1.00 40.74  ? 172  ILE A C   1 
ATOM   1117 O O   . ILE A 1 157 ? 93.928  24.148 5.995   1.00 41.89  ? 172  ILE A O   1 
ATOM   1118 C CB  . ILE A 1 157 ? 95.893  25.407 3.796   1.00 38.70  ? 172  ILE A CB  1 
ATOM   1119 C CG1 . ILE A 1 157 ? 97.140  25.615 4.655   1.00 40.80  ? 172  ILE A CG1 1 
ATOM   1120 C CG2 . ILE A 1 157 ? 96.030  26.136 2.483   1.00 39.76  ? 172  ILE A CG2 1 
ATOM   1121 C CD1 . ILE A 1 157 ? 98.381  24.949 4.083   1.00 39.03  ? 172  ILE A CD1 1 
ATOM   1122 N N   . HIS A 1 158 ? 95.116  25.800 6.914   1.00 39.86  ? 173  HIS A N   1 
ATOM   1123 C CA  . HIS A 1 158 ? 95.048  25.187 8.231   1.00 41.47  ? 173  HIS A CA  1 
ATOM   1124 C C   . HIS A 1 158 ? 93.622  25.185 8.758   1.00 44.20  ? 173  HIS A C   1 
ATOM   1125 O O   . HIS A 1 158 ? 93.212  24.245 9.438   1.00 44.72  ? 173  HIS A O   1 
ATOM   1126 C CB  . HIS A 1 158 ? 95.958  25.914 9.223   1.00 39.28  ? 173  HIS A CB  1 
ATOM   1127 C CG  . HIS A 1 158 ? 97.416  25.634 9.024   1.00 38.76  ? 173  HIS A CG  1 
ATOM   1128 N ND1 . HIS A 1 158 ? 98.393  26.177 9.828   1.00 37.96  ? 173  HIS A ND1 1 
ATOM   1129 C CD2 . HIS A 1 158 ? 98.064  24.884 8.100   1.00 36.35  ? 173  HIS A CD2 1 
ATOM   1130 C CE1 . HIS A 1 158 ? 99.580  25.776 9.408   1.00 36.91  ? 173  HIS A CE1 1 
ATOM   1131 N NE2 . HIS A 1 158 ? 99.408  24.991 8.361   1.00 37.59  ? 173  HIS A NE2 1 
ATOM   1132 N N   . SER A 1 159 ? 92.863  26.234 8.448   1.00 44.37  ? 174  SER A N   1 
ATOM   1133 C CA  . SER A 1 159 ? 91.476  26.325 8.908   1.00 46.33  ? 174  SER A CA  1 
ATOM   1134 C C   . SER A 1 159 ? 90.680  25.093 8.488   1.00 47.08  ? 174  SER A C   1 
ATOM   1135 O O   . SER A 1 159 ? 89.658  24.789 9.098   1.00 44.52  ? 174  SER A O   1 
ATOM   1136 C CB  . SER A 1 159 ? 90.797  27.571 8.347   1.00 44.82  ? 174  SER A CB  1 
ATOM   1137 O OG  . SER A 1 159 ? 90.692  27.476 6.938   1.00 45.83  ? 174  SER A OG  1 
ATOM   1138 N N   . PHE A 1 160 ? 91.136  24.402 7.439   1.00 45.68  ? 175  PHE A N   1 
ATOM   1139 C CA  . PHE A 1 160 ? 90.479  23.178 6.963   1.00 44.56  ? 175  PHE A CA  1 
ATOM   1140 C C   . PHE A 1 160 ? 91.102  21.935 7.604   1.00 42.69  ? 175  PHE A C   1 
ATOM   1141 O O   . PHE A 1 160 ? 90.627  20.824 7.380   1.00 41.62  ? 175  PHE A O   1 
ATOM   1142 C CB  . PHE A 1 160 ? 90.611  23.006 5.447   1.00 44.87  ? 175  PHE A CB  1 
ATOM   1143 C CG  . PHE A 1 160 ? 89.874  24.027 4.644   1.00 50.35  ? 175  PHE A CG  1 
ATOM   1144 C CD1 . PHE A 1 160 ? 90.463  25.251 4.342   1.00 49.10  ? 175  PHE A CD1 1 
ATOM   1145 C CD2 . PHE A 1 160 ? 88.593  23.759 4.171   1.00 50.14  ? 175  PHE A CD2 1 
ATOM   1146 C CE1 . PHE A 1 160 ? 89.788  26.193 3.580   1.00 53.75  ? 175  PHE A CE1 1 
ATOM   1147 C CE2 . PHE A 1 160 ? 87.909  24.692 3.411   1.00 52.70  ? 175  PHE A CE2 1 
ATOM   1148 C CZ  . PHE A 1 160 ? 88.507  25.914 3.113   1.00 52.31  ? 175  PHE A CZ  1 
ATOM   1149 N N   . GLY A 1 161 ? 92.170  22.125 8.376   1.00 41.52  ? 176  GLY A N   1 
ATOM   1150 C CA  . GLY A 1 161 ? 92.849  21.007 9.008   1.00 40.73  ? 176  GLY A CA  1 
ATOM   1151 C C   . GLY A 1 161 ? 93.928  20.453 8.089   1.00 42.06  ? 176  GLY A C   1 
ATOM   1152 O O   . GLY A 1 161 ? 94.564  19.442 8.383   1.00 44.10  ? 176  GLY A O   1 
ATOM   1153 N N   . ILE A 1 162 ? 94.137  21.132 6.970   1.00 40.65  ? 177  ILE A N   1 
ATOM   1154 C CA  . ILE A 1 162 ? 95.128  20.720 5.988   1.00 42.30  ? 177  ILE A CA  1 
ATOM   1155 C C   . ILE A 1 162 ? 96.526  21.227 6.323   1.00 41.37  ? 177  ILE A C   1 
ATOM   1156 O O   . ILE A 1 162 ? 96.714  22.405 6.609   1.00 40.13  ? 177  ILE A O   1 
ATOM   1157 C CB  . ILE A 1 162 ? 94.750  21.246 4.609   1.00 43.33  ? 177  ILE A CB  1 
ATOM   1158 C CG1 . ILE A 1 162 ? 93.384  20.698 4.209   1.00 44.11  ? 177  ILE A CG1 1 
ATOM   1159 C CG2 . ILE A 1 162 ? 95.806  20.862 3.605   1.00 45.66  ? 177  ILE A CG2 1 
ATOM   1160 C CD1 . ILE A 1 162 ? 92.788  21.407 3.035   1.00 43.86  ? 177  ILE A CD1 1 
ATOM   1161 N N   . CYS A 1 163 ? 97.504  20.331 6.287   1.00 43.07  ? 178  CYS A N   1 
ATOM   1162 C CA  . CYS A 1 163 ? 98.886  20.701 6.568   1.00 40.70  ? 178  CYS A CA  1 
ATOM   1163 C C   . CYS A 1 163 ? 99.628  20.504 5.251   1.00 40.18  ? 178  CYS A C   1 
ATOM   1164 O O   . CYS A 1 163 ? 99.471  19.471 4.598   1.00 40.36  ? 178  CYS A O   1 
ATOM   1165 C CB  . CYS A 1 163 ? 99.468  19.802 7.670   1.00 41.43  ? 178  CYS A CB  1 
ATOM   1166 S SG  . CYS A 1 163 ? 101.081 20.310 8.372   1.00 47.18  ? 178  CYS A SG  1 
ATOM   1167 N N   . HIS A 1 164 ? 100.410 21.505 4.850   1.00 39.02  ? 179  HIS A N   1 
ATOM   1168 C CA  . HIS A 1 164 ? 101.150 21.444 3.593   1.00 38.84  ? 179  HIS A CA  1 
ATOM   1169 C C   . HIS A 1 164 ? 102.338 20.481 3.690   1.00 40.95  ? 179  HIS A C   1 
ATOM   1170 O O   . HIS A 1 164 ? 102.638 19.736 2.748   1.00 40.62  ? 179  HIS A O   1 
ATOM   1171 C CB  . HIS A 1 164 ? 101.605 22.850 3.206   1.00 34.67  ? 179  HIS A CB  1 
ATOM   1172 C CG  . HIS A 1 164 ? 102.229 22.927 1.850   1.00 30.68  ? 179  HIS A CG  1 
ATOM   1173 N ND1 . HIS A 1 164 ? 103.530 22.541 1.606   1.00 23.16  ? 179  HIS A ND1 1 
ATOM   1174 C CD2 . HIS A 1 164 ? 101.720 23.318 0.658   1.00 24.54  ? 179  HIS A CD2 1 
ATOM   1175 C CE1 . HIS A 1 164 ? 103.796 22.692 0.320   1.00 26.27  ? 179  HIS A CE1 1 
ATOM   1176 N NE2 . HIS A 1 164 ? 102.714 23.162 -0.278  1.00 25.60  ? 179  HIS A NE2 1 
ATOM   1177 N N   . ARG A 1 165 ? 103.005 20.501 4.839   1.00 40.89  ? 180  ARG A N   1 
ATOM   1178 C CA  . ARG A 1 165 ? 104.128 19.614 5.096   1.00 41.80  ? 180  ARG A CA  1 
ATOM   1179 C C   . ARG A 1 165 ? 105.303 19.756 4.140   1.00 41.63  ? 180  ARG A C   1 
ATOM   1180 O O   . ARG A 1 165 ? 106.184 18.907 4.119   1.00 39.24  ? 180  ARG A O   1 
ATOM   1181 C CB  . ARG A 1 165 ? 103.643 18.170 5.088   1.00 44.82  ? 180  ARG A CB  1 
ATOM   1182 C CG  . ARG A 1 165 ? 102.405 17.948 5.920   1.00 44.79  ? 180  ARG A CG  1 
ATOM   1183 C CD  . ARG A 1 165 ? 101.728 16.668 5.506   1.00 45.65  ? 180  ARG A CD  1 
ATOM   1184 N NE  . ARG A 1 165 ? 102.258 15.501 6.192   1.00 47.51  ? 180  ARG A NE  1 
ATOM   1185 C CZ  . ARG A 1 165 ? 102.136 14.251 5.753   1.00 48.86  ? 180  ARG A CZ  1 
ATOM   1186 N NH1 . ARG A 1 165 ? 101.507 13.986 4.613   1.00 42.30  ? 180  ARG A NH1 1 
ATOM   1187 N NH2 . ARG A 1 165 ? 102.636 13.256 6.469   1.00 51.31  ? 180  ARG A NH2 1 
ATOM   1188 N N   . ASP A 1 166 ? 105.319 20.805 3.331   1.00 43.40  ? 181  ASP A N   1 
ATOM   1189 C CA  . ASP A 1 166 ? 106.458 21.005 2.445   1.00 44.76  ? 181  ASP A CA  1 
ATOM   1190 C C   . ASP A 1 166 ? 106.654 22.470 2.106   1.00 44.65  ? 181  ASP A C   1 
ATOM   1191 O O   . ASP A 1 166 ? 106.861 22.846 0.953   1.00 43.42  ? 181  ASP A O   1 
ATOM   1192 C CB  . ASP A 1 166 ? 106.327 20.188 1.164   1.00 45.00  ? 181  ASP A CB  1 
ATOM   1193 C CG  . ASP A 1 166 ? 107.651 20.086 0.416   1.00 47.03  ? 181  ASP A CG  1 
ATOM   1194 O OD1 . ASP A 1 166 ? 108.707 20.201 1.083   1.00 47.26  ? 181  ASP A OD1 1 
ATOM   1195 O OD2 . ASP A 1 166 ? 107.641 19.880 -0.819  1.00 47.26  ? 181  ASP A OD2 1 
ATOM   1196 N N   . ILE A 1 167 ? 106.583 23.295 3.138   1.00 40.99  ? 182  ILE A N   1 
ATOM   1197 C CA  . ILE A 1 167 ? 106.758 24.715 2.970   1.00 36.55  ? 182  ILE A CA  1 
ATOM   1198 C C   . ILE A 1 167 ? 108.241 25.012 2.770   1.00 36.71  ? 182  ILE A C   1 
ATOM   1199 O O   . ILE A 1 167 ? 109.079 24.582 3.563   1.00 37.02  ? 182  ILE A O   1 
ATOM   1200 C CB  . ILE A 1 167 ? 106.238 25.461 4.202   1.00 36.27  ? 182  ILE A CB  1 
ATOM   1201 C CG1 . ILE A 1 167 ? 104.734 25.250 4.331   1.00 31.57  ? 182  ILE A CG1 1 
ATOM   1202 C CG2 . ILE A 1 167 ? 106.558 26.928 4.088   1.00 29.91  ? 182  ILE A CG2 1 
ATOM   1203 C CD1 . ILE A 1 167 ? 103.952 25.805 3.169   1.00 34.86  ? 182  ILE A CD1 1 
ATOM   1204 N N   . LYS A 1 168 ? 108.553 25.731 1.691   1.00 39.31  ? 183  LYS A N   1 
ATOM   1205 C CA  . LYS A 1 168 ? 109.924 26.120 1.351   1.00 39.50  ? 183  LYS A CA  1 
ATOM   1206 C C   . LYS A 1 168 ? 109.888 27.127 0.203   1.00 39.01  ? 183  LYS A C   1 
ATOM   1207 O O   . LYS A 1 168 ? 108.931 27.163 -0.567  1.00 42.53  ? 183  LYS A O   1 
ATOM   1208 C CB  . LYS A 1 168 ? 110.754 24.906 0.941   1.00 39.46  ? 183  LYS A CB  1 
ATOM   1209 C CG  . LYS A 1 168 ? 110.298 24.252 -0.335  1.00 37.57  ? 183  LYS A CG  1 
ATOM   1210 C CD  . LYS A 1 168 ? 111.159 23.063 -0.605  1.00 41.51  ? 183  LYS A CD  1 
ATOM   1211 C CE  . LYS A 1 168 ? 110.634 22.252 -1.749  1.00 42.92  ? 183  LYS A CE  1 
ATOM   1212 N NZ  . LYS A 1 168 ? 111.447 21.012 -1.890  1.00 47.39  ? 183  LYS A NZ  1 
ATOM   1213 N N   . PRO A 1 169 ? 110.946 27.944 0.071   1.00 39.13  ? 184  PRO A N   1 
ATOM   1214 C CA  . PRO A 1 169 ? 111.100 28.982 -0.952  1.00 38.84  ? 184  PRO A CA  1 
ATOM   1215 C C   . PRO A 1 169 ? 110.696 28.561 -2.346  1.00 37.98  ? 184  PRO A C   1 
ATOM   1216 O O   . PRO A 1 169 ? 110.137 29.351 -3.090  1.00 40.96  ? 184  PRO A O   1 
ATOM   1217 C CB  . PRO A 1 169 ? 112.585 29.320 -0.887  1.00 38.72  ? 184  PRO A CB  1 
ATOM   1218 C CG  . PRO A 1 169 ? 112.932 29.060 0.529   1.00 40.61  ? 184  PRO A CG  1 
ATOM   1219 C CD  . PRO A 1 169 ? 112.206 27.770 0.816   1.00 38.49  ? 184  PRO A CD  1 
ATOM   1220 N N   . GLN A 1 170 ? 110.975 27.319 -2.705  1.00 34.57  ? 185  GLN A N   1 
ATOM   1221 C CA  . GLN A 1 170 ? 110.656 26.849 -4.036  1.00 36.17  ? 185  GLN A CA  1 
ATOM   1222 C C   . GLN A 1 170 ? 109.163 26.673 -4.290  1.00 37.81  ? 185  GLN A C   1 
ATOM   1223 O O   . GLN A 1 170 ? 108.720 26.762 -5.431  1.00 40.19  ? 185  GLN A O   1 
ATOM   1224 C CB  . GLN A 1 170 ? 111.400 25.544 -4.320  1.00 35.22  ? 185  GLN A CB  1 
ATOM   1225 C CG  . GLN A 1 170 ? 112.906 25.657 -4.186  1.00 38.01  ? 185  GLN A CG  1 
ATOM   1226 C CD  . GLN A 1 170 ? 113.366 25.626 -2.737  1.00 40.40  ? 185  GLN A CD  1 
ATOM   1227 O OE1 . GLN A 1 170 ? 112.655 26.077 -1.839  1.00 44.74  ? 185  GLN A OE1 1 
ATOM   1228 N NE2 . GLN A 1 170 ? 114.566 25.104 -2.504  1.00 41.57  ? 185  GLN A NE2 1 
ATOM   1229 N N   . ASN A 1 171 ? 108.388 26.436 -3.235  1.00 37.94  ? 186  ASN A N   1 
ATOM   1230 C CA  . ASN A 1 171 ? 106.948 26.250 -3.370  1.00 37.23  ? 186  ASN A CA  1 
ATOM   1231 C C   . ASN A 1 171 ? 106.164 27.534 -3.196  1.00 38.87  ? 186  ASN A C   1 
ATOM   1232 O O   . ASN A 1 171 ? 104.962 27.497 -2.940  1.00 34.80  ? 186  ASN A O   1 
ATOM   1233 C CB  . ASN A 1 171 ? 106.453 25.213 -2.365  1.00 39.20  ? 186  ASN A CB  1 
ATOM   1234 C CG  . ASN A 1 171 ? 106.981 23.837 -2.667  1.00 36.87  ? 186  ASN A CG  1 
ATOM   1235 O OD1 . ASN A 1 171 ? 107.054 23.443 -3.826  1.00 36.89  ? 186  ASN A OD1 1 
ATOM   1236 N ND2 . ASN A 1 171 ? 107.349 23.097 -1.636  1.00 35.84  ? 186  ASN A ND2 1 
ATOM   1237 N N   . LEU A 1 172 ? 106.845 28.668 -3.332  1.00 39.97  ? 187  LEU A N   1 
ATOM   1238 C CA  . LEU A 1 172 ? 106.198 29.970 -3.198  1.00 39.87  ? 187  LEU A CA  1 
ATOM   1239 C C   . LEU A 1 172 ? 106.310 30.737 -4.512  1.00 40.59  ? 187  LEU A C   1 
ATOM   1240 O O   . LEU A 1 172 ? 107.371 31.253 -4.856  1.00 40.40  ? 187  LEU A O   1 
ATOM   1241 C CB  . LEU A 1 172 ? 106.844 30.750 -2.058  1.00 38.02  ? 187  LEU A CB  1 
ATOM   1242 C CG  . LEU A 1 172 ? 106.822 29.982 -0.729  1.00 39.37  ? 187  LEU A CG  1 
ATOM   1243 C CD1 . LEU A 1 172 ? 107.612 30.746 0.292   1.00 33.47  ? 187  LEU A CD1 1 
ATOM   1244 C CD2 . LEU A 1 172 ? 105.392 29.762 -0.253  1.00 36.47  ? 187  LEU A CD2 1 
ATOM   1245 N N   . LEU A 1 173 ? 105.201 30.791 -5.242  1.00 40.36  ? 188  LEU A N   1 
ATOM   1246 C CA  . LEU A 1 173 ? 105.131 31.456 -6.535  1.00 41.13  ? 188  LEU A CA  1 
ATOM   1247 C C   . LEU A 1 173 ? 104.943 32.950 -6.412  1.00 42.32  ? 188  LEU A C   1 
ATOM   1248 O O   . LEU A 1 173 ? 104.236 33.411 -5.532  1.00 40.87  ? 188  LEU A O   1 
ATOM   1249 C CB  . LEU A 1 173 ? 103.960 30.903 -7.329  1.00 42.81  ? 188  LEU A CB  1 
ATOM   1250 C CG  . LEU A 1 173 ? 103.868 29.390 -7.419  1.00 43.64  ? 188  LEU A CG  1 
ATOM   1251 C CD1 . LEU A 1 173 ? 102.678 29.027 -8.280  1.00 44.54  ? 188  LEU A CD1 1 
ATOM   1252 C CD2 . LEU A 1 173 ? 105.149 28.828 -7.997  1.00 38.36  ? 188  LEU A CD2 1 
ATOM   1253 N N   . LEU A 1 174 ? 105.540 33.695 -7.337  1.00 48.68  ? 189  LEU A N   1 
ATOM   1254 C CA  . LEU A 1 174 ? 105.455 35.154 -7.347  1.00 50.80  ? 189  LEU A CA  1 
ATOM   1255 C C   . LEU A 1 174 ? 105.080 35.795 -8.684  1.00 54.71  ? 189  LEU A C   1 
ATOM   1256 O O   . LEU A 1 174 ? 105.445 35.311 -9.757  1.00 54.69  ? 189  LEU A O   1 
ATOM   1257 C CB  . LEU A 1 174 ? 106.795 35.744 -6.942  1.00 50.67  ? 189  LEU A CB  1 
ATOM   1258 C CG  . LEU A 1 174 ? 107.279 35.403 -5.558  1.00 52.60  ? 189  LEU A CG  1 
ATOM   1259 C CD1 . LEU A 1 174 ? 108.779 35.478 -5.529  1.00 53.95  ? 189  LEU A CD1 1 
ATOM   1260 C CD2 . LEU A 1 174 ? 106.651 36.359 -4.574  1.00 53.77  ? 189  LEU A CD2 1 
ATOM   1261 N N   . ASP A 1 175 ? 104.351 36.902 -8.594  1.00 61.68  ? 190  ASP A N   1 
ATOM   1262 C CA  . ASP A 1 175 ? 103.990 37.697 -9.761  1.00 66.36  ? 190  ASP A CA  1 
ATOM   1263 C C   . ASP A 1 175 ? 104.973 38.862 -9.606  1.00 69.03  ? 190  ASP A C   1 
ATOM   1264 O O   . ASP A 1 175 ? 104.844 39.686 -8.693  1.00 69.00  ? 190  ASP A O   1 
ATOM   1265 C CB  . ASP A 1 175 ? 102.555 38.217 -9.667  1.00 70.40  ? 190  ASP A CB  1 
ATOM   1266 C CG  . ASP A 1 175 ? 102.148 39.031 -10.894 1.00 74.25  ? 190  ASP A CG  1 
ATOM   1267 O OD1 . ASP A 1 175 ? 103.007 39.766 -11.438 1.00 76.46  ? 190  ASP A OD1 1 
ATOM   1268 O OD2 . ASP A 1 175 ? 100.969 38.948 -11.306 1.00 73.11  ? 190  ASP A OD2 1 
ATOM   1269 N N   . PRO A 1 176 ? 105.976 38.935 -10.489 1.00 71.95  ? 191  PRO A N   1 
ATOM   1270 C CA  . PRO A 1 176 ? 107.000 39.987 -10.454 1.00 73.36  ? 191  PRO A CA  1 
ATOM   1271 C C   . PRO A 1 176 ? 106.506 41.433 -10.586 1.00 71.87  ? 191  PRO A C   1 
ATOM   1272 O O   . PRO A 1 176 ? 107.210 42.371 -10.209 1.00 73.75  ? 191  PRO A O   1 
ATOM   1273 C CB  . PRO A 1 176 ? 107.935 39.578 -11.590 1.00 74.25  ? 191  PRO A CB  1 
ATOM   1274 C CG  . PRO A 1 176 ? 106.969 39.000 -12.595 1.00 74.08  ? 191  PRO A CG  1 
ATOM   1275 C CD  . PRO A 1 176 ? 106.084 38.136 -11.725 1.00 72.41  ? 191  PRO A CD  1 
ATOM   1276 N N   . ASP A 1 177 ? 105.299 41.615 -11.105 1.00 70.41  ? 192  ASP A N   1 
ATOM   1277 C CA  . ASP A 1 177 ? 104.763 42.959 -11.285 1.00 70.65  ? 192  ASP A CA  1 
ATOM   1278 C C   . ASP A 1 177 ? 103.755 43.344 -10.214 1.00 68.05  ? 192  ASP A C   1 
ATOM   1279 O O   . ASP A 1 177 ? 103.722 44.493 -9.766  1.00 67.67  ? 192  ASP A O   1 
ATOM   1280 C CB  . ASP A 1 177 ? 104.108 43.076 -12.662 1.00 73.07  ? 192  ASP A CB  1 
ATOM   1281 C CG  . ASP A 1 177 ? 105.016 42.598 -13.782 1.00 76.19  ? 192  ASP A CG  1 
ATOM   1282 O OD1 . ASP A 1 177 ? 106.161 43.104 -13.869 1.00 78.33  ? 192  ASP A OD1 1 
ATOM   1283 O OD2 . ASP A 1 177 ? 104.586 41.718 -14.569 1.00 77.61  ? 192  ASP A OD2 1 
ATOM   1284 N N   . THR A 1 178 ? 102.933 42.380 -9.809  1.00 65.38  ? 193  THR A N   1 
ATOM   1285 C CA  . THR A 1 178 ? 101.910 42.620 -8.795  1.00 64.01  ? 193  THR A CA  1 
ATOM   1286 C C   . THR A 1 178 ? 102.429 42.376 -7.378  1.00 61.48  ? 193  THR A C   1 
ATOM   1287 O O   . THR A 1 178 ? 101.926 42.965 -6.415  1.00 61.53  ? 193  THR A O   1 
ATOM   1288 C CB  . THR A 1 178 ? 100.658 41.720 -9.024  1.00 64.89  ? 193  THR A CB  1 
ATOM   1289 O OG1 . THR A 1 178 ? 100.956 40.369 -8.651  1.00 65.91  ? 193  THR A OG1 1 
ATOM   1290 C CG2 . THR A 1 178 ? 100.242 41.741 -10.490 1.00 67.76  ? 193  THR A CG2 1 
ATOM   1291 N N   . ALA A 1 179 ? 103.439 41.510 -7.270  1.00 58.34  ? 194  ALA A N   1 
ATOM   1292 C CA  . ALA A 1 179 ? 104.052 41.138 -5.996  1.00 54.02  ? 194  ALA A CA  1 
ATOM   1293 C C   . ALA A 1 179 ? 103.146 40.184 -5.229  1.00 52.69  ? 194  ALA A C   1 
ATOM   1294 O O   . ALA A 1 179 ? 103.155 40.170 -3.998  1.00 51.23  ? 194  ALA A O   1 
ATOM   1295 C CB  . ALA A 1 179 ? 104.330 42.372 -5.151  1.00 53.25  ? 194  ALA A CB  1 
ATOM   1296 N N   . VAL A 1 180 ? 102.364 39.387 -5.955  1.00 49.40  ? 195  VAL A N   1 
ATOM   1297 C CA  . VAL A 1 180 ? 101.459 38.438 -5.320  1.00 47.59  ? 195  VAL A CA  1 
ATOM   1298 C C   . VAL A 1 180 ? 102.104 37.061 -5.175  1.00 46.60  ? 195  VAL A C   1 
ATOM   1299 O O   . VAL A 1 180 ? 102.741 36.546 -6.103  1.00 44.50  ? 195  VAL A O   1 
ATOM   1300 C CB  . VAL A 1 180 ? 100.124 38.312 -6.108  1.00 47.38  ? 195  VAL A CB  1 
ATOM   1301 C CG1 . VAL A 1 180 ? 99.230  37.242 -5.484  1.00 45.32  ? 195  VAL A CG1 1 
ATOM   1302 C CG2 . VAL A 1 180 ? 99.408  39.651 -6.113  1.00 45.04  ? 195  VAL A CG2 1 
ATOM   1303 N N   . LEU A 1 181 ? 101.929 36.484 -3.990  1.00 44.40  ? 196  LEU A N   1 
ATOM   1304 C CA  . LEU A 1 181 ? 102.475 35.179 -3.660  1.00 42.45  ? 196  LEU A CA  1 
ATOM   1305 C C   . LEU A 1 181 ? 101.381 34.115 -3.580  1.00 41.41  ? 196  LEU A C   1 
ATOM   1306 O O   . LEU A 1 181 ? 100.259 34.383 -3.146  1.00 41.32  ? 196  LEU A O   1 
ATOM   1307 C CB  . LEU A 1 181 ? 103.227 35.271 -2.332  1.00 41.04  ? 196  LEU A CB  1 
ATOM   1308 C CG  . LEU A 1 181 ? 103.849 34.002 -1.752  1.00 39.02  ? 196  LEU A CG  1 
ATOM   1309 C CD1 . LEU A 1 181 ? 104.953 34.392 -0.799  1.00 35.97  ? 196  LEU A CD1 1 
ATOM   1310 C CD2 . LEU A 1 181 ? 102.794 33.159 -1.051  1.00 35.21  ? 196  LEU A CD2 1 
ATOM   1311 N N   . LYS A 1 182 ? 101.720 32.909 -4.023  1.00 42.55  ? 197  LYS A N   1 
ATOM   1312 C CA  . LYS A 1 182 ? 100.801 31.777 -4.001  1.00 43.23  ? 197  LYS A CA  1 
ATOM   1313 C C   . LYS A 1 182 ? 101.535 30.533 -3.542  1.00 42.42  ? 197  LYS A C   1 
ATOM   1314 O O   . LYS A 1 182 ? 102.638 30.234 -4.002  1.00 45.23  ? 197  LYS A O   1 
ATOM   1315 C CB  . LYS A 1 182 ? 100.231 31.480 -5.387  1.00 40.98  ? 197  LYS A CB  1 
ATOM   1316 C CG  . LYS A 1 182 ? 99.417  32.581 -6.001  1.00 44.11  ? 197  LYS A CG  1 
ATOM   1317 C CD  . LYS A 1 182 ? 98.800  32.104 -7.294  1.00 41.45  ? 197  LYS A CD  1 
ATOM   1318 C CE  . LYS A 1 182 ? 98.117  33.242 -8.026  1.00 44.57  ? 197  LYS A CE  1 
ATOM   1319 N NZ  . LYS A 1 182 ? 97.136  33.943 -7.157  1.00 46.22  ? 197  LYS A NZ  1 
ATOM   1320 N N   . LEU A 1 183 ? 100.913 29.805 -2.633  1.00 42.18  ? 198  LEU A N   1 
ATOM   1321 C CA  . LEU A 1 183 ? 101.481 28.570 -2.134  1.00 38.10  ? 198  LEU A CA  1 
ATOM   1322 C C   . LEU A 1 183 ? 101.159 27.511 -3.194  1.00 38.27  ? 198  LEU A C   1 
ATOM   1323 O O   . LEU A 1 183 ? 100.086 27.536 -3.800  1.00 38.16  ? 198  LEU A O   1 
ATOM   1324 C CB  . LEU A 1 183 ? 100.824 28.227 -0.800  1.00 35.04  ? 198  LEU A CB  1 
ATOM   1325 C CG  . LEU A 1 183 ? 101.339 27.025 -0.025  1.00 30.23  ? 198  LEU A CG  1 
ATOM   1326 C CD1 . LEU A 1 183 ? 102.851 27.093 0.105   1.00 30.99  ? 198  LEU A CD1 1 
ATOM   1327 C CD2 . LEU A 1 183 ? 100.669 27.014 1.336   1.00 36.53  ? 198  LEU A CD2 1 
ATOM   1328 N N   . CYS A 1 184 ? 102.083 26.592 -3.441  1.00 36.71  ? 199  CYS A N   1 
ATOM   1329 C CA  . CYS A 1 184 ? 101.824 25.566 -4.434  1.00 40.72  ? 199  CYS A CA  1 
ATOM   1330 C C   . CYS A 1 184 ? 102.403 24.213 -4.046  1.00 41.72  ? 199  CYS A C   1 
ATOM   1331 O O   . CYS A 1 184 ? 102.961 24.048 -2.957  1.00 42.87  ? 199  CYS A O   1 
ATOM   1332 C CB  . CYS A 1 184 ? 102.382 25.986 -5.794  1.00 41.77  ? 199  CYS A CB  1 
ATOM   1333 S SG  . CYS A 1 184 ? 104.139 25.664 -5.974  1.00 51.63  ? 199  CYS A SG  1 
ATOM   1334 N N   . ASP A 1 185 ? 102.265 23.256 -4.963  1.00 41.36  ? 200  ASP A N   1 
ATOM   1335 C CA  . ASP A 1 185 ? 102.735 21.884 -4.779  1.00 43.72  ? 200  ASP A CA  1 
ATOM   1336 C C   . ASP A 1 185 ? 102.222 21.259 -3.490  1.00 40.29  ? 200  ASP A C   1 
ATOM   1337 O O   . ASP A 1 185 ? 102.947 21.153 -2.503  1.00 35.28  ? 200  ASP A O   1 
ATOM   1338 C CB  . ASP A 1 185 ? 104.261 21.812 -4.794  1.00 47.57  ? 200  ASP A CB  1 
ATOM   1339 C CG  . ASP A 1 185 ? 104.770 20.382 -4.714  1.00 53.98  ? 200  ASP A CG  1 
ATOM   1340 O OD1 . ASP A 1 185 ? 105.996 20.198 -4.557  1.00 58.44  ? 200  ASP A OD1 1 
ATOM   1341 O OD2 . ASP A 1 185 ? 103.944 19.441 -4.810  1.00 58.91  ? 200  ASP A OD2 1 
ATOM   1342 N N   . PHE A 1 186 ? 100.962 20.845 -3.509  1.00 40.58  ? 201  PHE A N   1 
ATOM   1343 C CA  . PHE A 1 186 ? 100.363 20.232 -2.343  1.00 41.24  ? 201  PHE A CA  1 
ATOM   1344 C C   . PHE A 1 186 ? 100.563 18.727 -2.364  1.00 41.45  ? 201  PHE A C   1 
ATOM   1345 O O   . PHE A 1 186 ? 99.804  17.981 -1.741  1.00 45.56  ? 201  PHE A O   1 
ATOM   1346 C CB  . PHE A 1 186 ? 98.878  20.579 -2.270  1.00 40.36  ? 201  PHE A CB  1 
ATOM   1347 C CG  . PHE A 1 186 ? 98.608  21.985 -1.802  1.00 40.98  ? 201  PHE A CG  1 
ATOM   1348 C CD1 . PHE A 1 186 ? 99.019  23.077 -2.557  1.00 41.04  ? 201  PHE A CD1 1 
ATOM   1349 C CD2 . PHE A 1 186 ? 97.962  22.214 -0.592  1.00 33.89  ? 201  PHE A CD2 1 
ATOM   1350 C CE1 . PHE A 1 186 ? 98.793  24.381 -2.120  1.00 40.48  ? 201  PHE A CE1 1 
ATOM   1351 C CE2 . PHE A 1 186 ? 97.732  23.510 -0.143  1.00 40.54  ? 201  PHE A CE2 1 
ATOM   1352 C CZ  . PHE A 1 186 ? 98.150  24.599 -0.910  1.00 38.15  ? 201  PHE A CZ  1 
ATOM   1353 N N   . GLY A 1 187 ? 101.598 18.291 -3.075  1.00 41.43  ? 202  GLY A N   1 
ATOM   1354 C CA  . GLY A 1 187 ? 101.903 16.875 -3.159  1.00 44.40  ? 202  GLY A CA  1 
ATOM   1355 C C   . GLY A 1 187 ? 102.131 16.194 -1.811  1.00 44.58  ? 202  GLY A C   1 
ATOM   1356 O O   . GLY A 1 187 ? 101.880 14.997 -1.676  1.00 46.61  ? 202  GLY A O   1 
ATOM   1357 N N   . SER A 1 188 ? 102.607 16.937 -0.812  1.00 43.19  ? 203  SER A N   1 
ATOM   1358 C CA  . SER A 1 188 ? 102.854 16.371 0.518   1.00 42.29  ? 203  SER A CA  1 
ATOM   1359 C C   . SER A 1 188 ? 101.733 16.743 1.484   1.00 40.55  ? 203  SER A C   1 
ATOM   1360 O O   . SER A 1 188 ? 101.650 16.210 2.582   1.00 42.45  ? 203  SER A O   1 
ATOM   1361 C CB  . SER A 1 188 ? 104.195 16.871 1.091   1.00 45.22  ? 203  SER A CB  1 
ATOM   1362 O OG  . SER A 1 188 ? 105.303 16.553 0.254   1.00 46.73  ? 203  SER A OG  1 
ATOM   1363 N N   . ALA A 1 189 ? 100.874 17.661 1.068   1.00 38.66  ? 204  ALA A N   1 
ATOM   1364 C CA  . ALA A 1 189 ? 99.780  18.108 1.906   1.00 38.61  ? 204  ALA A CA  1 
ATOM   1365 C C   . ALA A 1 189 ? 98.894  16.949 2.328   1.00 40.66  ? 204  ALA A C   1 
ATOM   1366 O O   . ALA A 1 189 ? 98.810  15.927 1.651   1.00 40.76  ? 204  ALA A O   1 
ATOM   1367 C CB  . ALA A 1 189 ? 98.966  19.151 1.176   1.00 32.21  ? 204  ALA A CB  1 
ATOM   1368 N N   . LYS A 1 190 ? 98.235  17.124 3.465   1.00 45.20  ? 205  LYS A N   1 
ATOM   1369 C CA  . LYS A 1 190 ? 97.349  16.109 4.011   1.00 45.70  ? 205  LYS A CA  1 
ATOM   1370 C C   . LYS A 1 190 ? 96.403  16.726 5.029   1.00 46.55  ? 205  LYS A C   1 
ATOM   1371 O O   . LYS A 1 190 ? 96.785  17.627 5.778   1.00 45.46  ? 205  LYS A O   1 
ATOM   1372 C CB  . LYS A 1 190 ? 98.170  15.007 4.692   1.00 46.18  ? 205  LYS A CB  1 
ATOM   1373 C CG  . LYS A 1 190 ? 97.344  13.930 5.420   1.00 44.54  ? 205  LYS A CG  1 
ATOM   1374 C CD  . LYS A 1 190 ? 98.243  12.896 6.100   1.00 40.06  ? 205  LYS A CD  1 
ATOM   1375 C CE  . LYS A 1 190 ? 97.467  12.004 7.055   1.00 35.08  ? 205  LYS A CE  1 
ATOM   1376 N NZ  . LYS A 1 190 ? 98.360  11.073 7.797   1.00 33.32  ? 205  LYS A NZ  1 
ATOM   1377 N N   . GLN A 1 191 ? 95.163  16.250 5.041   1.00 49.08  ? 206  GLN A N   1 
ATOM   1378 C CA  . GLN A 1 191 ? 94.183  16.726 6.000   1.00 51.25  ? 206  GLN A CA  1 
ATOM   1379 C C   . GLN A 1 191 ? 94.501  15.979 7.294   1.00 51.25  ? 206  GLN A C   1 
ATOM   1380 O O   . GLN A 1 191 ? 94.330  14.764 7.366   1.00 52.32  ? 206  GLN A O   1 
ATOM   1381 C CB  . GLN A 1 191 ? 92.785  16.366 5.531   1.00 53.60  ? 206  GLN A CB  1 
ATOM   1382 C CG  . GLN A 1 191 ? 91.693  16.849 6.465   1.00 64.98  ? 206  GLN A CG  1 
ATOM   1383 C CD  . GLN A 1 191 ? 90.804  17.883 5.802   1.00 69.58  ? 206  GLN A CD  1 
ATOM   1384 O OE1 . GLN A 1 191 ? 90.953  18.171 4.605   1.00 71.63  ? 206  GLN A OE1 1 
ATOM   1385 N NE2 . GLN A 1 191 ? 89.867  18.446 6.570   1.00 69.87  ? 206  GLN A NE2 1 
ATOM   1386 N N   . LEU A 1 192 ? 94.976  16.687 8.312   1.00 48.65  ? 207  LEU A N   1 
ATOM   1387 C CA  . LEU A 1 192 ? 95.334  16.027 9.568   1.00 48.40  ? 207  LEU A CA  1 
ATOM   1388 C C   . LEU A 1 192 ? 94.156  15.764 10.507  1.00 49.01  ? 207  LEU A C   1 
ATOM   1389 O O   . LEU A 1 192 ? 93.277  16.614 10.697  1.00 51.19  ? 207  LEU A O   1 
ATOM   1390 C CB  . LEU A 1 192 ? 96.414  16.832 10.315  1.00 46.96  ? 207  LEU A CB  1 
ATOM   1391 C CG  . LEU A 1 192 ? 97.797  16.994 9.663   1.00 47.73  ? 207  LEU A CG  1 
ATOM   1392 C CD1 . LEU A 1 192 ? 98.735  17.763 10.593  1.00 44.60  ? 207  LEU A CD1 1 
ATOM   1393 C CD2 . LEU A 1 192 ? 98.382  15.630 9.345   1.00 42.21  ? 207  LEU A CD2 1 
ATOM   1394 N N   . VAL A 1 193 ? 94.149  14.568 11.086  1.00 47.54  ? 208  VAL A N   1 
ATOM   1395 C CA  . VAL A 1 193 ? 93.108  14.166 12.018  1.00 45.02  ? 208  VAL A CA  1 
ATOM   1396 C C   . VAL A 1 193 ? 93.772  13.659 13.278  1.00 43.00  ? 208  VAL A C   1 
ATOM   1397 O O   . VAL A 1 193 ? 94.415  12.612 13.268  1.00 41.52  ? 208  VAL A O   1 
ATOM   1398 C CB  . VAL A 1 193 ? 92.239  13.034 11.454  1.00 45.10  ? 208  VAL A CB  1 
ATOM   1399 C CG1 . VAL A 1 193 ? 91.236  12.600 12.502  1.00 41.37  ? 208  VAL A CG1 1 
ATOM   1400 C CG2 . VAL A 1 193 ? 91.534  13.491 10.192  1.00 42.64  ? 208  VAL A CG2 1 
ATOM   1401 N N   . ARG A 1 194 ? 93.623  14.412 14.360  1.00 43.25  ? 209  ARG A N   1 
ATOM   1402 C CA  . ARG A 1 194 ? 94.207  14.033 15.641  1.00 47.33  ? 209  ARG A CA  1 
ATOM   1403 C C   . ARG A 1 194 ? 93.898  12.574 15.943  1.00 49.15  ? 209  ARG A C   1 
ATOM   1404 O O   . ARG A 1 194 ? 92.793  12.089 15.669  1.00 49.91  ? 209  ARG A O   1 
ATOM   1405 C CB  . ARG A 1 194 ? 93.669  14.933 16.765  1.00 46.78  ? 209  ARG A CB  1 
ATOM   1406 C CG  . ARG A 1 194 ? 94.460  16.230 16.945  1.00 52.39  ? 209  ARG A CG  1 
ATOM   1407 C CD  . ARG A 1 194 ? 93.842  17.172 17.973  1.00 53.43  ? 209  ARG A CD  1 
ATOM   1408 N NE  . ARG A 1 194 ? 92.596  17.765 17.492  1.00 59.15  ? 209  ARG A NE  1 
ATOM   1409 C CZ  . ARG A 1 194 ? 91.897  18.678 18.158  1.00 63.34  ? 209  ARG A CZ  1 
ATOM   1410 N NH1 . ARG A 1 194 ? 92.323  19.107 19.343  1.00 63.01  ? 209  ARG A NH1 1 
ATOM   1411 N NH2 . ARG A 1 194 ? 90.780  19.167 17.631  1.00 60.75  ? 209  ARG A NH2 1 
ATOM   1412 N N   . GLY A 1 195 ? 94.879  11.869 16.494  1.00 49.17  ? 210  GLY A N   1 
ATOM   1413 C CA  . GLY A 1 195 ? 94.665  10.472 16.819  1.00 51.44  ? 210  GLY A CA  1 
ATOM   1414 C C   . GLY A 1 195 ? 95.089  9.535  15.708  1.00 51.79  ? 210  GLY A C   1 
ATOM   1415 O O   . GLY A 1 195 ? 95.300  8.343  15.941  1.00 52.63  ? 210  GLY A O   1 
ATOM   1416 N N   . GLU A 1 196 ? 95.195  10.068 14.495  1.00 52.82  ? 211  GLU A N   1 
ATOM   1417 C CA  . GLU A 1 196 ? 95.627  9.280  13.353  1.00 53.91  ? 211  GLU A CA  1 
ATOM   1418 C C   . GLU A 1 196 ? 97.051  9.694  13.037  1.00 51.58  ? 211  GLU A C   1 
ATOM   1419 O O   . GLU A 1 196 ? 97.325  10.864 12.773  1.00 54.02  ? 211  GLU A O   1 
ATOM   1420 C CB  . GLU A 1 196 ? 94.696  9.520  12.180  1.00 55.80  ? 211  GLU A CB  1 
ATOM   1421 C CG  . GLU A 1 196 ? 93.387  8.783  12.368  1.00 61.69  ? 211  GLU A CG  1 
ATOM   1422 C CD  . GLU A 1 196 ? 92.291  9.300  11.477  1.00 65.10  ? 211  GLU A CD  1 
ATOM   1423 O OE1 . GLU A 1 196 ? 92.608  10.070 10.541  1.00 69.11  ? 211  GLU A OE1 1 
ATOM   1424 O OE2 . GLU A 1 196 ? 91.118  8.931  11.713  1.00 65.24  ? 211  GLU A OE2 1 
ATOM   1425 N N   . PRO A 1 197 ? 97.981  8.729  13.076  1.00 50.14  ? 212  PRO A N   1 
ATOM   1426 C CA  . PRO A 1 197 ? 99.412  8.926  12.816  1.00 49.02  ? 212  PRO A CA  1 
ATOM   1427 C C   . PRO A 1 197 ? 99.800  9.408  11.418  1.00 46.99  ? 212  PRO A C   1 
ATOM   1428 O O   . PRO A 1 197 ? 99.179  9.032  10.418  1.00 44.57  ? 212  PRO A O   1 
ATOM   1429 C CB  . PRO A 1 197 ? 100.004 7.556  13.141  1.00 47.64  ? 212  PRO A CB  1 
ATOM   1430 C CG  . PRO A 1 197 ? 98.926  6.634  12.687  1.00 48.56  ? 212  PRO A CG  1 
ATOM   1431 C CD  . PRO A 1 197 ? 97.677  7.295  13.234  1.00 48.05  ? 212  PRO A CD  1 
ATOM   1432 N N   . ASN A 1 198 ? 100.842 10.239 11.363  1.00 43.51  ? 213  ASN A N   1 
ATOM   1433 C CA  . ASN A 1 198 ? 101.348 10.769 10.102  1.00 38.72  ? 213  ASN A CA  1 
ATOM   1434 C C   . ASN A 1 198 ? 102.819 10.429 10.020  1.00 38.20  ? 213  ASN A C   1 
ATOM   1435 O O   . ASN A 1 198 ? 103.515 10.398 11.037  1.00 38.43  ? 213  ASN A O   1 
ATOM   1436 C CB  . ASN A 1 198 ? 101.177 12.274 10.070  1.00 37.67  ? 213  ASN A CB  1 
ATOM   1437 C CG  . ASN A 1 198 ? 99.818  12.691 10.527  1.00 33.20  ? 213  ASN A CG  1 
ATOM   1438 O OD1 . ASN A 1 198 ? 98.837  12.530 9.806   1.00 29.86  ? 213  ASN A OD1 1 
ATOM   1439 N ND2 . ASN A 1 198 ? 99.738  13.208 11.746  1.00 32.57  ? 213  ASN A ND2 1 
ATOM   1440 N N   . VAL A 1 199 ? 103.286 10.174 8.806   1.00 37.69  ? 214  VAL A N   1 
ATOM   1441 C CA  . VAL A 1 199 ? 104.679 9.826  8.581   1.00 39.49  ? 214  VAL A CA  1 
ATOM   1442 C C   . VAL A 1 199 ? 105.571 10.912 9.184   1.00 39.95  ? 214  VAL A C   1 
ATOM   1443 O O   . VAL A 1 199 ? 105.292 12.102 9.042   1.00 40.91  ? 214  VAL A O   1 
ATOM   1444 C CB  . VAL A 1 199 ? 104.952 9.664  7.061   1.00 38.51  ? 214  VAL A CB  1 
ATOM   1445 C CG1 . VAL A 1 199 ? 104.682 10.964 6.330   1.00 33.78  ? 214  VAL A CG1 1 
ATOM   1446 C CG2 . VAL A 1 199 ? 106.370 9.195  6.838   1.00 38.50  ? 214  VAL A CG2 1 
ATOM   1447 N N   . SER A 1 200 ? 106.636 10.514 9.869   1.00 40.86  ? 215  SER A N   1 
ATOM   1448 C CA  . SER A 1 200 ? 107.501 11.510 10.480  1.00 44.70  ? 215  SER A CA  1 
ATOM   1449 C C   . SER A 1 200 ? 108.619 12.011 9.560   1.00 44.71  ? 215  SER A C   1 
ATOM   1450 O O   . SER A 1 200 ? 109.124 13.116 9.750   1.00 46.74  ? 215  SER A O   1 
ATOM   1451 C CB  . SER A 1 200 ? 108.085 10.983 11.797  1.00 43.32  ? 215  SER A CB  1 
ATOM   1452 O OG  . SER A 1 200 ? 109.268 10.244 11.580  1.00 51.77  ? 215  SER A OG  1 
HETATM 1453 N N   . PTR A 1 201 ? 109.021 11.220 8.570   1.00 45.60  ? 216  PTR A N   1 
HETATM 1454 C CA  . PTR A 1 201 ? 110.060 11.689 7.656   1.00 45.13  ? 216  PTR A CA  1 
HETATM 1455 C C   . PTR A 1 201 ? 109.345 12.342 6.487   1.00 45.81  ? 216  PTR A C   1 
HETATM 1456 O O   . PTR A 1 201 ? 109.197 11.751 5.418   1.00 44.43  ? 216  PTR A O   1 
HETATM 1457 C CB  . PTR A 1 201 ? 110.921 10.540 7.143   1.00 45.29  ? 216  PTR A CB  1 
HETATM 1458 C CG  . PTR A 1 201 ? 112.200 11.002 6.468   1.00 47.34  ? 216  PTR A CG  1 
HETATM 1459 C CD1 . PTR A 1 201 ? 112.368 10.897 5.076   1.00 44.25  ? 216  PTR A CD1 1 
HETATM 1460 C CD2 . PTR A 1 201 ? 113.263 11.503 7.226   1.00 45.80  ? 216  PTR A CD2 1 
HETATM 1461 C CE1 . PTR A 1 201 ? 113.574 11.273 4.455   1.00 46.14  ? 216  PTR A CE1 1 
HETATM 1462 C CE2 . PTR A 1 201 ? 114.474 11.878 6.621   1.00 44.91  ? 216  PTR A CE2 1 
HETATM 1463 C CZ  . PTR A 1 201 ? 114.631 11.754 5.235   1.00 48.38  ? 216  PTR A CZ  1 
HETATM 1464 O OH  . PTR A 1 201 ? 115.898 12.009 4.649   1.00 52.98  ? 216  PTR A OH  1 
HETATM 1465 P P   . PTR A 1 201 ? 116.316 13.445 4.242   1.00 48.73  ? 216  PTR A P   1 
HETATM 1466 O O1P . PTR A 1 201 ? 115.288 14.084 3.357   1.00 43.61  ? 216  PTR A O1P 1 
HETATM 1467 O O2P . PTR A 1 201 ? 117.634 13.328 3.565   1.00 52.09  ? 216  PTR A O2P 1 
HETATM 1468 O O3P . PTR A 1 201 ? 116.572 14.206 5.498   1.00 46.05  ? 216  PTR A O3P 1 
ATOM   1469 N N   . ILE A 1 202 ? 108.893 13.567 6.715   1.00 45.68  ? 217  ILE A N   1 
ATOM   1470 C CA  . ILE A 1 202 ? 108.163 14.342 5.718   1.00 43.27  ? 217  ILE A CA  1 
ATOM   1471 C C   . ILE A 1 202 ? 108.765 15.756 5.740   1.00 44.07  ? 217  ILE A C   1 
ATOM   1472 O O   . ILE A 1 202 ? 109.426 16.137 6.711   1.00 41.02  ? 217  ILE A O   1 
ATOM   1473 C CB  . ILE A 1 202 ? 106.633 14.386 6.086   1.00 41.57  ? 217  ILE A CB  1 
ATOM   1474 C CG1 . ILE A 1 202 ? 105.799 14.958 4.938   1.00 42.89  ? 217  ILE A CG1 1 
ATOM   1475 C CG2 . ILE A 1 202 ? 106.423 15.219 7.336   1.00 40.05  ? 217  ILE A CG2 1 
ATOM   1476 C CD1 . ILE A 1 202 ? 105.515 13.981 3.835   1.00 40.24  ? 217  ILE A CD1 1 
ATOM   1477 N N   . CYS A 1 203 ? 108.573 16.516 4.663   1.00 42.90  ? 218  CYS A N   1 
ATOM   1478 C CA  . CYS A 1 203 ? 109.082 17.886 4.603   1.00 44.07  ? 218  CYS A CA  1 
ATOM   1479 C C   . CYS A 1 203 ? 110.574 17.971 4.230   1.00 41.56  ? 218  CYS A C   1 
ATOM   1480 O O   . CYS A 1 203 ? 111.382 17.172 4.700   1.00 42.32  ? 218  CYS A O   1 
ATOM   1481 C CB  . CYS A 1 203 ? 108.829 18.555 5.958   1.00 44.32  ? 218  CYS A CB  1 
ATOM   1482 S SG  . CYS A 1 203 ? 108.882 20.315 5.927   1.00 55.84  ? 218  CYS A SG  1 
ATOM   1483 N N   . SER A 1 204 ? 110.934 18.942 3.392   1.00 39.03  ? 219  SER A N   1 
ATOM   1484 C CA  . SER A 1 204 ? 112.322 19.115 2.954   1.00 37.14  ? 219  SER A CA  1 
ATOM   1485 C C   . SER A 1 204 ? 113.278 19.354 4.124   1.00 38.54  ? 219  SER A C   1 
ATOM   1486 O O   . SER A 1 204 ? 113.097 20.282 4.923   1.00 37.95  ? 219  SER A O   1 
ATOM   1487 C CB  . SER A 1 204 ? 112.396 20.265 1.969   1.00 37.95  ? 219  SER A CB  1 
ATOM   1488 O OG  . SER A 1 204 ? 111.373 20.127 0.999   1.00 41.92  ? 219  SER A OG  1 
ATOM   1489 N N   . ARG A 1 205 ? 114.313 18.523 4.194   1.00 34.56  ? 220  ARG A N   1 
ATOM   1490 C CA  . ARG A 1 205 ? 115.262 18.566 5.287   1.00 33.56  ? 220  ARG A CA  1 
ATOM   1491 C C   . ARG A 1 205 ? 115.480 19.907 5.965   1.00 35.28  ? 220  ARG A C   1 
ATOM   1492 O O   . ARG A 1 205 ? 115.166 20.059 7.145   1.00 34.44  ? 220  ARG A O   1 
ATOM   1493 C CB  . ARG A 1 205 ? 116.612 18.002 4.864   1.00 31.28  ? 220  ARG A CB  1 
ATOM   1494 C CG  . ARG A 1 205 ? 117.489 17.736 6.089   1.00 36.29  ? 220  ARG A CG  1 
ATOM   1495 C CD  . ARG A 1 205 ? 118.913 17.390 5.733   1.00 36.34  ? 220  ARG A CD  1 
ATOM   1496 N NE  . ARG A 1 205 ? 118.962 16.201 4.900   1.00 37.61  ? 220  ARG A NE  1 
ATOM   1497 C CZ  . ARG A 1 205 ? 119.792 16.059 3.879   1.00 36.67  ? 220  ARG A CZ  1 
ATOM   1498 N NH1 . ARG A 1 205 ? 120.639 17.037 3.571   1.00 37.80  ? 220  ARG A NH1 1 
ATOM   1499 N NH2 . ARG A 1 205 ? 119.763 14.952 3.159   1.00 39.00  ? 220  ARG A NH2 1 
ATOM   1500 N N   . TYR A 1 206 ? 116.014 20.876 5.226   1.00 37.34  ? 221  TYR A N   1 
ATOM   1501 C CA  . TYR A 1 206 ? 116.310 22.205 5.772   1.00 36.74  ? 221  TYR A CA  1 
ATOM   1502 C C   . TYR A 1 206 ? 115.139 22.875 6.475   1.00 35.61  ? 221  TYR A C   1 
ATOM   1503 O O   . TYR A 1 206 ? 115.356 23.706 7.356   1.00 33.62  ? 221  TYR A O   1 
ATOM   1504 C CB  . TYR A 1 206 ? 116.817 23.150 4.671   1.00 37.34  ? 221  TYR A CB  1 
ATOM   1505 C CG  . TYR A 1 206 ? 118.155 22.786 4.048   1.00 38.45  ? 221  TYR A CG  1 
ATOM   1506 C CD1 . TYR A 1 206 ? 118.719 23.590 3.057   1.00 35.24  ? 221  TYR A CD1 1 
ATOM   1507 C CD2 . TYR A 1 206 ? 118.859 21.644 4.449   1.00 39.16  ? 221  TYR A CD2 1 
ATOM   1508 C CE1 . TYR A 1 206 ? 119.946 23.271 2.482   1.00 37.59  ? 221  TYR A CE1 1 
ATOM   1509 C CE2 . TYR A 1 206 ? 120.088 21.313 3.878   1.00 36.82  ? 221  TYR A CE2 1 
ATOM   1510 C CZ  . TYR A 1 206 ? 120.624 22.133 2.896   1.00 39.45  ? 221  TYR A CZ  1 
ATOM   1511 O OH  . TYR A 1 206 ? 121.840 21.818 2.328   1.00 38.78  ? 221  TYR A OH  1 
ATOM   1512 N N   . TYR A 1 207 ? 113.912 22.505 6.100   1.00 33.23  ? 222  TYR A N   1 
ATOM   1513 C CA  . TYR A 1 207 ? 112.712 23.108 6.683   1.00 32.89  ? 222  TYR A CA  1 
ATOM   1514 C C   . TYR A 1 207 ? 111.932 22.240 7.666   1.00 34.07  ? 222  TYR A C   1 
ATOM   1515 O O   . TYR A 1 207 ? 110.902 22.668 8.204   1.00 35.90  ? 222  TYR A O   1 
ATOM   1516 C CB  . TYR A 1 207 ? 111.782 23.555 5.557   1.00 32.82  ? 222  TYR A CB  1 
ATOM   1517 C CG  . TYR A 1 207 ? 112.512 24.381 4.544   1.00 32.84  ? 222  TYR A CG  1 
ATOM   1518 C CD1 . TYR A 1 207 ? 113.281 23.774 3.555   1.00 36.09  ? 222  TYR A CD1 1 
ATOM   1519 C CD2 . TYR A 1 207 ? 112.553 25.769 4.654   1.00 34.40  ? 222  TYR A CD2 1 
ATOM   1520 C CE1 . TYR A 1 207 ? 114.086 24.527 2.710   1.00 34.97  ? 222  TYR A CE1 1 
ATOM   1521 C CE2 . TYR A 1 207 ? 113.357 26.535 3.814   1.00 34.09  ? 222  TYR A CE2 1 
ATOM   1522 C CZ  . TYR A 1 207 ? 114.126 25.906 2.849   1.00 39.99  ? 222  TYR A CZ  1 
ATOM   1523 O OH  . TYR A 1 207 ? 114.972 26.647 2.058   1.00 40.39  ? 222  TYR A OH  1 
ATOM   1524 N N   . ARG A 1 208 ? 112.439 21.036 7.913   1.00 34.26  ? 223  ARG A N   1 
ATOM   1525 C CA  . ARG A 1 208 ? 111.794 20.067 8.794   1.00 34.62  ? 223  ARG A CA  1 
ATOM   1526 C C   . ARG A 1 208 ? 111.821 20.432 10.267  1.00 32.76  ? 223  ARG A C   1 
ATOM   1527 O O   . ARG A 1 208 ? 112.875 20.684 10.829  1.00 35.61  ? 223  ARG A O   1 
ATOM   1528 C CB  . ARG A 1 208 ? 112.453 18.713 8.587   1.00 35.50  ? 223  ARG A CB  1 
ATOM   1529 C CG  . ARG A 1 208 ? 111.729 17.552 9.209   1.00 39.77  ? 223  ARG A CG  1 
ATOM   1530 C CD  . ARG A 1 208 ? 112.421 16.280 8.777   1.00 36.10  ? 223  ARG A CD  1 
ATOM   1531 N NE  . ARG A 1 208 ? 112.492 16.215 7.318   1.00 36.76  ? 223  ARG A NE  1 
ATOM   1532 C CZ  . ARG A 1 208 ? 113.498 15.670 6.634   1.00 35.35  ? 223  ARG A CZ  1 
ATOM   1533 N NH1 . ARG A 1 208 ? 114.534 15.136 7.273   1.00 28.26  ? 223  ARG A NH1 1 
ATOM   1534 N NH2 . ARG A 1 208 ? 113.470 15.658 5.306   1.00 27.07  ? 223  ARG A NH2 1 
ATOM   1535 N N   . ALA A 1 209 ? 110.655 20.438 10.895  1.00 33.06  ? 224  ALA A N   1 
ATOM   1536 C CA  . ALA A 1 209 ? 110.551 20.784 12.303  1.00 32.03  ? 224  ALA A CA  1 
ATOM   1537 C C   . ALA A 1 209 ? 111.264 19.777 13.184  1.00 34.52  ? 224  ALA A C   1 
ATOM   1538 O O   . ALA A 1 209 ? 111.415 18.618 12.819  1.00 33.23  ? 224  ALA A O   1 
ATOM   1539 C CB  . ALA A 1 209 ? 109.096 20.869 12.702  1.00 30.53  ? 224  ALA A CB  1 
ATOM   1540 N N   . PRO A 1 210 ? 111.713 20.215 14.368  1.00 37.06  ? 225  PRO A N   1 
ATOM   1541 C CA  . PRO A 1 210 ? 112.417 19.357 15.329  1.00 36.55  ? 225  PRO A CA  1 
ATOM   1542 C C   . PRO A 1 210 ? 111.632 18.083 15.685  1.00 37.69  ? 225  PRO A C   1 
ATOM   1543 O O   . PRO A 1 210 ? 112.199 16.989 15.733  1.00 39.12  ? 225  PRO A O   1 
ATOM   1544 C CB  . PRO A 1 210 ? 112.589 20.267 16.548  1.00 35.72  ? 225  PRO A CB  1 
ATOM   1545 C CG  . PRO A 1 210 ? 112.661 21.621 15.966  1.00 38.88  ? 225  PRO A CG  1 
ATOM   1546 C CD  . PRO A 1 210 ? 111.616 21.596 14.879  1.00 35.55  ? 225  PRO A CD  1 
ATOM   1547 N N   . GLU A 1 211 ? 110.334 18.225 15.939  1.00 33.58  ? 226  GLU A N   1 
ATOM   1548 C CA  . GLU A 1 211 ? 109.527 17.067 16.309  1.00 36.87  ? 226  GLU A CA  1 
ATOM   1549 C C   . GLU A 1 211 ? 109.535 15.972 15.254  1.00 37.27  ? 226  GLU A C   1 
ATOM   1550 O O   . GLU A 1 211 ? 109.449 14.790 15.582  1.00 38.51  ? 226  GLU A O   1 
ATOM   1551 C CB  . GLU A 1 211 ? 108.073 17.464 16.605  1.00 37.04  ? 226  GLU A CB  1 
ATOM   1552 C CG  . GLU A 1 211 ? 107.343 18.130 15.461  1.00 37.94  ? 226  GLU A CG  1 
ATOM   1553 C CD  . GLU A 1 211 ? 107.473 19.633 15.504  1.00 41.66  ? 226  GLU A CD  1 
ATOM   1554 O OE1 . GLU A 1 211 ? 108.605 20.133 15.690  1.00 42.65  ? 226  GLU A OE1 1 
ATOM   1555 O OE2 . GLU A 1 211 ? 106.441 20.317 15.347  1.00 36.97  ? 226  GLU A OE2 1 
ATOM   1556 N N   . LEU A 1 212 ? 109.622 16.363 13.989  1.00 36.53  ? 227  LEU A N   1 
ATOM   1557 C CA  . LEU A 1 212 ? 109.643 15.387 12.917  1.00 34.48  ? 227  LEU A CA  1 
ATOM   1558 C C   . LEU A 1 212 ? 110.936 14.613 12.996  1.00 38.05  ? 227  LEU A C   1 
ATOM   1559 O O   . LEU A 1 212 ? 110.951 13.406 12.783  1.00 36.39  ? 227  LEU A O   1 
ATOM   1560 C CB  . LEU A 1 212 ? 109.552 16.075 11.564  1.00 36.28  ? 227  LEU A CB  1 
ATOM   1561 C CG  . LEU A 1 212 ? 108.237 16.777 11.252  1.00 37.12  ? 227  LEU A CG  1 
ATOM   1562 C CD1 . LEU A 1 212 ? 108.334 17.364 9.862   1.00 36.00  ? 227  LEU A CD1 1 
ATOM   1563 C CD2 . LEU A 1 212 ? 107.079 15.805 11.343  1.00 27.56  ? 227  LEU A CD2 1 
ATOM   1564 N N   . ILE A 1 213 ? 112.027 15.312 13.294  1.00 35.65  ? 228  ILE A N   1 
ATOM   1565 C CA  . ILE A 1 213 ? 113.328 14.662 13.419  1.00 37.17  ? 228  ILE A CA  1 
ATOM   1566 C C   . ILE A 1 213 ? 113.312 13.683 14.604  1.00 39.75  ? 228  ILE A C   1 
ATOM   1567 O O   . ILE A 1 213 ? 113.863 12.584 14.515  1.00 40.75  ? 228  ILE A O   1 
ATOM   1568 C CB  . ILE A 1 213 ? 114.453 15.699 13.626  1.00 37.28  ? 228  ILE A CB  1 
ATOM   1569 C CG1 . ILE A 1 213 ? 114.521 16.631 12.411  1.00 31.14  ? 228  ILE A CG1 1 
ATOM   1570 C CG2 . ILE A 1 213 ? 115.790 14.989 13.859  1.00 32.53  ? 228  ILE A CG2 1 
ATOM   1571 C CD1 . ILE A 1 213 ? 115.441 17.817 12.600  1.00 25.76  ? 228  ILE A CD1 1 
ATOM   1572 N N   . PHE A 1 214 ? 112.675 14.081 15.707  1.00 38.94  ? 229  PHE A N   1 
ATOM   1573 C CA  . PHE A 1 214 ? 112.575 13.226 16.890  1.00 37.96  ? 229  PHE A CA  1 
ATOM   1574 C C   . PHE A 1 214 ? 111.574 12.084 16.731  1.00 40.26  ? 229  PHE A C   1 
ATOM   1575 O O   . PHE A 1 214 ? 111.199 11.444 17.715  1.00 43.04  ? 229  PHE A O   1 
ATOM   1576 C CB  . PHE A 1 214 ? 112.178 14.038 18.113  1.00 39.36  ? 229  PHE A CB  1 
ATOM   1577 C CG  . PHE A 1 214 ? 113.320 14.717 18.782  1.00 38.23  ? 229  PHE A CG  1 
ATOM   1578 C CD1 . PHE A 1 214 ? 113.848 15.887 18.264  1.00 39.85  ? 229  PHE A CD1 1 
ATOM   1579 C CD2 . PHE A 1 214 ? 113.866 14.189 19.949  1.00 37.39  ? 229  PHE A CD2 1 
ATOM   1580 C CE1 . PHE A 1 214 ? 114.907 16.526 18.903  1.00 42.55  ? 229  PHE A CE1 1 
ATOM   1581 C CE2 . PHE A 1 214 ? 114.920 14.814 20.597  1.00 40.66  ? 229  PHE A CE2 1 
ATOM   1582 C CZ  . PHE A 1 214 ? 115.443 15.985 20.075  1.00 42.36  ? 229  PHE A CZ  1 
ATOM   1583 N N   . GLY A 1 215 ? 111.120 11.848 15.504  1.00 39.04  ? 230  GLY A N   1 
ATOM   1584 C CA  . GLY A 1 215 ? 110.196 10.756 15.254  1.00 38.95  ? 230  GLY A CA  1 
ATOM   1585 C C   . GLY A 1 215 ? 108.718 10.948 15.533  1.00 39.63  ? 230  GLY A C   1 
ATOM   1586 O O   . GLY A 1 215 ? 107.969 9.985  15.469  1.00 36.92  ? 230  GLY A O   1 
ATOM   1587 N N   . ALA A 1 216 ? 108.283 12.165 15.834  1.00 35.83  ? 231  ALA A N   1 
ATOM   1588 C CA  . ALA A 1 216 ? 106.869 12.396 16.096  1.00 37.01  ? 231  ALA A CA  1 
ATOM   1589 C C   . ALA A 1 216 ? 106.007 11.958 14.916  1.00 38.76  ? 231  ALA A C   1 
ATOM   1590 O O   . ALA A 1 216 ? 106.394 12.113 13.761  1.00 38.64  ? 231  ALA A O   1 
ATOM   1591 C CB  . ALA A 1 216 ? 106.623 13.865 16.392  1.00 37.47  ? 231  ALA A CB  1 
ATOM   1592 N N   . THR A 1 217 ? 104.837 11.408 15.227  1.00 37.08  ? 232  THR A N   1 
ATOM   1593 C CA  . THR A 1 217 ? 103.881 10.951 14.224  1.00 39.72  ? 232  THR A CA  1 
ATOM   1594 C C   . THR A 1 217 ? 102.527 11.573 14.566  1.00 42.13  ? 232  THR A C   1 
ATOM   1595 O O   . THR A 1 217 ? 101.574 11.503 13.786  1.00 43.55  ? 232  THR A O   1 
ATOM   1596 C CB  . THR A 1 217 ? 103.752 9.409  14.227  1.00 41.33  ? 232  THR A CB  1 
ATOM   1597 O OG1 . THR A 1 217 ? 103.681 8.937  15.579  1.00 45.84  ? 232  THR A OG1 1 
ATOM   1598 C CG2 . THR A 1 217 ? 104.934 8.768  13.538  1.00 34.48  ? 232  THR A CG2 1 
ATOM   1599 N N   . ASP A 1 218 ? 102.472 12.193 15.744  1.00 42.86  ? 233  ASP A N   1 
ATOM   1600 C CA  . ASP A 1 218 ? 101.277 12.867 16.261  1.00 44.90  ? 233  ASP A CA  1 
ATOM   1601 C C   . ASP A 1 218 ? 101.427 14.390 16.155  1.00 45.26  ? 233  ASP A C   1 
ATOM   1602 O O   . ASP A 1 218 ? 100.860 15.132 16.964  1.00 46.22  ? 233  ASP A O   1 
ATOM   1603 C CB  . ASP A 1 218 ? 101.073 12.514 17.735  1.00 47.91  ? 233  ASP A CB  1 
ATOM   1604 C CG  . ASP A 1 218 ? 102.190 13.074 18.639  1.00 52.85  ? 233  ASP A CG  1 
ATOM   1605 O OD1 . ASP A 1 218 ? 103.380 12.955 18.259  1.00 54.51  ? 233  ASP A OD1 1 
ATOM   1606 O OD2 . ASP A 1 218 ? 101.883 13.621 19.730  1.00 58.14  ? 233  ASP A OD2 1 
ATOM   1607 N N   . TYR A 1 219 ? 102.185 14.851 15.164  1.00 41.63  ? 234  TYR A N   1 
ATOM   1608 C CA  . TYR A 1 219 ? 102.416 16.279 14.986  1.00 38.90  ? 234  TYR A CA  1 
ATOM   1609 C C   . TYR A 1 219 ? 101.215 17.028 14.427  1.00 39.53  ? 234  TYR A C   1 
ATOM   1610 O O   . TYR A 1 219 ? 100.258 16.424 13.955  1.00 36.84  ? 234  TYR A O   1 
ATOM   1611 C CB  . TYR A 1 219 ? 103.648 16.508 14.098  1.00 37.81  ? 234  TYR A CB  1 
ATOM   1612 C CG  . TYR A 1 219 ? 103.610 15.833 12.740  1.00 36.44  ? 234  TYR A CG  1 
ATOM   1613 C CD1 . TYR A 1 219 ? 102.981 16.436 11.649  1.00 35.27  ? 234  TYR A CD1 1 
ATOM   1614 C CD2 . TYR A 1 219 ? 104.203 14.587 12.547  1.00 36.72  ? 234  TYR A CD2 1 
ATOM   1615 C CE1 . TYR A 1 219 ? 102.948 15.811 10.404  1.00 36.23  ? 234  TYR A CE1 1 
ATOM   1616 C CE2 . TYR A 1 219 ? 104.171 13.957 11.307  1.00 36.22  ? 234  TYR A CE2 1 
ATOM   1617 C CZ  . TYR A 1 219 ? 103.547 14.573 10.247  1.00 36.20  ? 234  TYR A CZ  1 
ATOM   1618 O OH  . TYR A 1 219 ? 103.535 13.951 9.032   1.00 37.84  ? 234  TYR A OH  1 
ATOM   1619 N N   . THR A 1 220 ? 101.269 18.354 14.501  1.00 37.91  ? 235  THR A N   1 
ATOM   1620 C CA  . THR A 1 220 ? 100.191 19.193 14.005  1.00 37.88  ? 235  THR A CA  1 
ATOM   1621 C C   . THR A 1 220 ? 100.679 20.067 12.874  1.00 39.45  ? 235  THR A C   1 
ATOM   1622 O O   . THR A 1 220 ? 101.869 20.079 12.536  1.00 40.25  ? 235  THR A O   1 
ATOM   1623 C CB  . THR A 1 220 ? 99.643  20.121 15.091  1.00 39.30  ? 235  THR A CB  1 
ATOM   1624 O OG1 . THR A 1 220 ? 100.646 21.084 15.448  1.00 39.74  ? 235  THR A OG1 1 
ATOM   1625 C CG2 . THR A 1 220 ? 99.250  19.316 16.316  1.00 30.84  ? 235  THR A CG2 1 
ATOM   1626 N N   . SER A 1 221 ? 99.750  20.813 12.299  1.00 37.42  ? 236  SER A N   1 
ATOM   1627 C CA  . SER A 1 221 ? 100.074 21.692 11.200  1.00 39.04  ? 236  SER A CA  1 
ATOM   1628 C C   . SER A 1 221 ? 101.031 22.801 11.625  1.00 38.40  ? 236  SER A C   1 
ATOM   1629 O O   . SER A 1 221 ? 101.391 23.656 10.809  1.00 37.28  ? 236  SER A O   1 
ATOM   1630 C CB  . SER A 1 221 ? 98.790  22.284 10.630  1.00 39.82  ? 236  SER A CB  1 
ATOM   1631 O OG  . SER A 1 221 ? 97.962  22.703 11.687  1.00 45.05  ? 236  SER A OG  1 
ATOM   1632 N N   . SER A 1 222 ? 101.454 22.795 12.890  1.00 37.38  ? 237  SER A N   1 
ATOM   1633 C CA  . SER A 1 222 ? 102.381 23.825 13.335  1.00 36.67  ? 237  SER A CA  1 
ATOM   1634 C C   . SER A 1 222 ? 103.781 23.529 12.811  1.00 39.64  ? 237  SER A C   1 
ATOM   1635 O O   . SER A 1 222 ? 104.709 24.301 13.061  1.00 42.67  ? 237  SER A O   1 
ATOM   1636 C CB  . SER A 1 222 ? 102.400 23.961 14.860  1.00 38.07  ? 237  SER A CB  1 
ATOM   1637 O OG  . SER A 1 222 ? 103.056 22.877 15.481  1.00 47.26  ? 237  SER A OG  1 
ATOM   1638 N N   . ILE A 1 223 ? 103.945 22.412 12.094  1.00 37.73  ? 238  ILE A N   1 
ATOM   1639 C CA  . ILE A 1 223 ? 105.242 22.096 11.498  1.00 36.40  ? 238  ILE A CA  1 
ATOM   1640 C C   . ILE A 1 223 ? 105.384 23.000 10.268  1.00 37.18  ? 238  ILE A C   1 
ATOM   1641 O O   . ILE A 1 223 ? 106.479 23.170 9.738   1.00 36.76  ? 238  ILE A O   1 
ATOM   1642 C CB  . ILE A 1 223 ? 105.353 20.634 11.024  1.00 37.09  ? 238  ILE A CB  1 
ATOM   1643 C CG1 . ILE A 1 223 ? 104.355 20.364 9.893   1.00 36.23  ? 238  ILE A CG1 1 
ATOM   1644 C CG2 . ILE A 1 223 ? 105.144 19.701 12.192  1.00 39.16  ? 238  ILE A CG2 1 
ATOM   1645 C CD1 . ILE A 1 223 ? 104.619 19.070 9.155   1.00 36.57  ? 238  ILE A CD1 1 
ATOM   1646 N N   . ASP A 1 224 ? 104.265 23.565 9.809   1.00 34.25  ? 239  ASP A N   1 
ATOM   1647 C CA  . ASP A 1 224 ? 104.279 24.481 8.670   1.00 34.04  ? 239  ASP A CA  1 
ATOM   1648 C C   . ASP A 1 224 ? 104.795 25.851 9.137   1.00 35.77  ? 239  ASP A C   1 
ATOM   1649 O O   . ASP A 1 224 ? 105.467 26.562 8.393   1.00 36.33  ? 239  ASP A O   1 
ATOM   1650 C CB  . ASP A 1 224 ? 102.876 24.630 8.064   1.00 34.40  ? 239  ASP A CB  1 
ATOM   1651 C CG  . ASP A 1 224 ? 102.551 23.549 7.026   1.00 33.29  ? 239  ASP A CG  1 
ATOM   1652 O OD1 . ASP A 1 224 ? 103.447 22.770 6.631   1.00 31.06  ? 239  ASP A OD1 1 
ATOM   1653 O OD2 . ASP A 1 224 ? 101.384 23.487 6.589   1.00 35.15  ? 239  ASP A OD2 1 
ATOM   1654 N N   . VAL A 1 225 ? 104.490 26.213 10.379  1.00 34.48  ? 240  VAL A N   1 
ATOM   1655 C CA  . VAL A 1 225 ? 104.946 27.485 10.923  1.00 31.48  ? 240  VAL A CA  1 
ATOM   1656 C C   . VAL A 1 225 ? 106.458 27.417 11.171  1.00 34.99  ? 240  VAL A C   1 
ATOM   1657 O O   . VAL A 1 225 ? 107.177 28.385 10.915  1.00 37.49  ? 240  VAL A O   1 
ATOM   1658 C CB  . VAL A 1 225 ? 104.187 27.848 12.231  1.00 32.39  ? 240  VAL A CB  1 
ATOM   1659 C CG1 . VAL A 1 225 ? 104.726 29.133 12.805  1.00 27.95  ? 240  VAL A CG1 1 
ATOM   1660 C CG2 . VAL A 1 225 ? 102.686 28.018 11.939  1.00 28.95  ? 240  VAL A CG2 1 
ATOM   1661 N N   . TRP A 1 226 ? 106.951 26.285 11.667  1.00 32.29  ? 241  TRP A N   1 
ATOM   1662 C CA  . TRP A 1 226 ? 108.391 26.146 11.872  1.00 28.14  ? 241  TRP A CA  1 
ATOM   1663 C C   . TRP A 1 226 ? 109.051 26.374 10.513  1.00 32.82  ? 241  TRP A C   1 
ATOM   1664 O O   . TRP A 1 226 ? 110.041 27.105 10.395  1.00 31.75  ? 241  TRP A O   1 
ATOM   1665 C CB  . TRP A 1 226 ? 108.750 24.740 12.386  1.00 28.48  ? 241  TRP A CB  1 
ATOM   1666 C CG  . TRP A 1 226 ? 110.216 24.429 12.287  1.00 24.07  ? 241  TRP A CG  1 
ATOM   1667 C CD1 . TRP A 1 226 ? 110.901 24.057 11.162  1.00 20.23  ? 241  TRP A CD1 1 
ATOM   1668 C CD2 . TRP A 1 226 ? 111.201 24.590 13.321  1.00 21.56  ? 241  TRP A CD2 1 
ATOM   1669 N NE1 . TRP A 1 226 ? 112.251 23.989 11.426  1.00 24.17  ? 241  TRP A NE1 1 
ATOM   1670 C CE2 . TRP A 1 226 ? 112.463 24.312 12.743  1.00 23.92  ? 241  TRP A CE2 1 
ATOM   1671 C CE3 . TRP A 1 226 ? 111.139 24.946 14.678  1.00 19.43  ? 241  TRP A CE3 1 
ATOM   1672 C CZ2 . TRP A 1 226 ? 113.656 24.382 13.475  1.00 18.78  ? 241  TRP A CZ2 1 
ATOM   1673 C CZ3 . TRP A 1 226 ? 112.321 25.015 15.406  1.00 21.21  ? 241  TRP A CZ3 1 
ATOM   1674 C CH2 . TRP A 1 226 ? 113.566 24.734 14.800  1.00 24.24  ? 241  TRP A CH2 1 
ATOM   1675 N N   . SER A 1 227 ? 108.489 25.748 9.484   1.00 32.86  ? 242  SER A N   1 
ATOM   1676 C CA  . SER A 1 227 ? 109.021 25.887 8.141   1.00 34.32  ? 242  SER A CA  1 
ATOM   1677 C C   . SER A 1 227 ? 109.004 27.330 7.655   1.00 32.82  ? 242  SER A C   1 
ATOM   1678 O O   . SER A 1 227 ? 109.956 27.779 7.027   1.00 33.64  ? 242  SER A O   1 
ATOM   1679 C CB  . SER A 1 227 ? 108.239 25.001 7.181   1.00 33.96  ? 242  SER A CB  1 
ATOM   1680 O OG  . SER A 1 227 ? 108.402 23.646 7.552   1.00 41.17  ? 242  SER A OG  1 
ATOM   1681 N N   . ALA A 1 228 ? 107.928 28.053 7.943   1.00 29.29  ? 243  ALA A N   1 
ATOM   1682 C CA  . ALA A 1 228 ? 107.814 29.453 7.533   1.00 28.57  ? 243  ALA A CA  1 
ATOM   1683 C C   . ALA A 1 228 ? 108.895 30.294 8.205   1.00 29.07  ? 243  ALA A C   1 
ATOM   1684 O O   . ALA A 1 228 ? 109.480 31.175 7.581   1.00 30.39  ? 243  ALA A O   1 
ATOM   1685 C CB  . ALA A 1 228 ? 106.434 29.994 7.888   1.00 29.75  ? 243  ALA A CB  1 
ATOM   1686 N N   . GLY A 1 229 ? 109.150 30.025 9.483   1.00 28.32  ? 244  GLY A N   1 
ATOM   1687 C CA  . GLY A 1 229 ? 110.183 30.752 10.192  1.00 28.96  ? 244  GLY A CA  1 
ATOM   1688 C C   . GLY A 1 229 ? 111.526 30.509 9.517   1.00 32.21  ? 244  GLY A C   1 
ATOM   1689 O O   . GLY A 1 229 ? 112.410 31.373 9.530   1.00 36.67  ? 244  GLY A O   1 
ATOM   1690 N N   . CYS A 1 230 ? 111.686 29.324 8.930   1.00 30.99  ? 245  CYS A N   1 
ATOM   1691 C CA  . CYS A 1 230 ? 112.916 28.972 8.243   1.00 29.93  ? 245  CYS A CA  1 
ATOM   1692 C C   . CYS A 1 230 ? 113.037 29.760 6.951   1.00 31.82  ? 245  CYS A C   1 
ATOM   1693 O O   . CYS A 1 230 ? 114.121 30.201 6.584   1.00 32.60  ? 245  CYS A O   1 
ATOM   1694 C CB  . CYS A 1 230 ? 112.951 27.473 7.945   1.00 33.15  ? 245  CYS A CB  1 
ATOM   1695 S SG  . CYS A 1 230 ? 113.379 26.429 9.368   1.00 36.68  ? 245  CYS A SG  1 
ATOM   1696 N N   . VAL A 1 231 ? 111.925 29.933 6.252   1.00 28.36  ? 246  VAL A N   1 
ATOM   1697 C CA  . VAL A 1 231 ? 111.942 30.694 5.013   1.00 32.07  ? 246  VAL A CA  1 
ATOM   1698 C C   . VAL A 1 231 ? 112.255 32.140 5.363   1.00 31.69  ? 246  VAL A C   1 
ATOM   1699 O O   . VAL A 1 231 ? 113.061 32.782 4.699   1.00 30.80  ? 246  VAL A O   1 
ATOM   1700 C CB  . VAL A 1 231 ? 110.584 30.638 4.295   1.00 31.75  ? 246  VAL A CB  1 
ATOM   1701 C CG1 . VAL A 1 231 ? 110.592 31.571 3.102   1.00 28.65  ? 246  VAL A CG1 1 
ATOM   1702 C CG2 . VAL A 1 231 ? 110.299 29.219 3.853   1.00 30.46  ? 246  VAL A CG2 1 
ATOM   1703 N N   . LEU A 1 232 ? 111.610 32.645 6.411   1.00 32.08  ? 247  LEU A N   1 
ATOM   1704 C CA  . LEU A 1 232 ? 111.836 34.016 6.853   1.00 35.99  ? 247  LEU A CA  1 
ATOM   1705 C C   . LEU A 1 232 ? 113.331 34.158 7.151   1.00 38.87  ? 247  LEU A C   1 
ATOM   1706 O O   . LEU A 1 232 ? 114.023 34.972 6.537   1.00 39.12  ? 247  LEU A O   1 
ATOM   1707 C CB  . LEU A 1 232 ? 111.032 34.323 8.131   1.00 35.35  ? 247  LEU A CB  1 
ATOM   1708 C CG  . LEU A 1 232 ? 110.701 35.775 8.553   1.00 37.31  ? 247  LEU A CG  1 
ATOM   1709 C CD1 . LEU A 1 232 ? 110.739 35.854 10.060  1.00 35.25  ? 247  LEU A CD1 1 
ATOM   1710 C CD2 . LEU A 1 232 ? 111.669 36.792 7.970   1.00 34.50  ? 247  LEU A CD2 1 
ATOM   1711 N N   . ALA A 1 233 ? 113.824 33.361 8.092   1.00 35.78  ? 248  ALA A N   1 
ATOM   1712 C CA  . ALA A 1 233 ? 115.224 33.417 8.461   1.00 36.28  ? 248  ALA A CA  1 
ATOM   1713 C C   . ALA A 1 233 ? 116.121 33.385 7.223   1.00 37.26  ? 248  ALA A C   1 
ATOM   1714 O O   . ALA A 1 233 ? 117.129 34.080 7.164   1.00 37.00  ? 248  ALA A O   1 
ATOM   1715 C CB  . ALA A 1 233 ? 115.557 32.259 9.388   1.00 38.68  ? 248  ALA A CB  1 
ATOM   1716 N N   . GLU A 1 234 ? 115.748 32.585 6.231   1.00 36.55  ? 249  GLU A N   1 
ATOM   1717 C CA  . GLU A 1 234 ? 116.538 32.470 5.010   1.00 36.04  ? 249  GLU A CA  1 
ATOM   1718 C C   . GLU A 1 234 ? 116.592 33.787 4.231   1.00 37.81  ? 249  GLU A C   1 
ATOM   1719 O O   . GLU A 1 234 ? 117.630 34.137 3.662   1.00 36.66  ? 249  GLU A O   1 
ATOM   1720 C CB  . GLU A 1 234 ? 115.967 31.369 4.111   1.00 34.70  ? 249  GLU A CB  1 
ATOM   1721 C CG  . GLU A 1 234 ? 116.855 31.030 2.930   1.00 42.18  ? 249  GLU A CG  1 
ATOM   1722 C CD  . GLU A 1 234 ? 116.412 29.770 2.211   1.00 50.59  ? 249  GLU A CD  1 
ATOM   1723 O OE1 . GLU A 1 234 ? 115.758 28.920 2.855   1.00 53.92  ? 249  GLU A OE1 1 
ATOM   1724 O OE2 . GLU A 1 234 ? 116.725 29.619 1.008   1.00 53.14  ? 249  GLU A OE2 1 
ATOM   1725 N N   . LEU A 1 235 ? 115.473 34.509 4.195   1.00 35.95  ? 250  LEU A N   1 
ATOM   1726 C CA  . LEU A 1 235 ? 115.406 35.777 3.486   1.00 34.55  ? 250  LEU A CA  1 
ATOM   1727 C C   . LEU A 1 235 ? 116.260 36.825 4.172   1.00 33.99  ? 250  LEU A C   1 
ATOM   1728 O O   . LEU A 1 235 ? 116.874 37.660 3.514   1.00 37.57  ? 250  LEU A O   1 
ATOM   1729 C CB  . LEU A 1 235 ? 113.965 36.254 3.407   1.00 30.16  ? 250  LEU A CB  1 
ATOM   1730 C CG  . LEU A 1 235 ? 113.083 35.312 2.586   1.00 30.61  ? 250  LEU A CG  1 
ATOM   1731 C CD1 . LEU A 1 235 ? 111.627 35.800 2.589   1.00 25.32  ? 250  LEU A CD1 1 
ATOM   1732 C CD2 . LEU A 1 235 ? 113.643 35.227 1.156   1.00 22.95  ? 250  LEU A CD2 1 
ATOM   1733 N N   . LEU A 1 236 ? 116.315 36.768 5.497   1.00 32.76  ? 251  LEU A N   1 
ATOM   1734 C CA  . LEU A 1 236 ? 117.100 37.721 6.268   1.00 30.91  ? 251  LEU A CA  1 
ATOM   1735 C C   . LEU A 1 236 ? 118.593 37.451 6.157   1.00 34.06  ? 251  LEU A C   1 
ATOM   1736 O O   . LEU A 1 236 ? 119.387 38.380 6.037   1.00 38.84  ? 251  LEU A O   1 
ATOM   1737 C CB  . LEU A 1 236 ? 116.693 37.671 7.746   1.00 30.45  ? 251  LEU A CB  1 
ATOM   1738 C CG  . LEU A 1 236 ? 115.220 37.913 8.106   1.00 33.88  ? 251  LEU A CG  1 
ATOM   1739 C CD1 . LEU A 1 236 ? 114.978 37.595 9.579   1.00 28.02  ? 251  LEU A CD1 1 
ATOM   1740 C CD2 . LEU A 1 236 ? 114.852 39.343 7.808   1.00 23.88  ? 251  LEU A CD2 1 
ATOM   1741 N N   . LEU A 1 237 ? 118.965 36.171 6.201   1.00 37.85  ? 252  LEU A N   1 
ATOM   1742 C CA  . LEU A 1 237 ? 120.366 35.747 6.150   1.00 36.38  ? 252  LEU A CA  1 
ATOM   1743 C C   . LEU A 1 237 ? 120.981 35.700 4.776   1.00 34.72  ? 252  LEU A C   1 
ATOM   1744 O O   . LEU A 1 237 ? 122.156 36.007 4.620   1.00 36.79  ? 252  LEU A O   1 
ATOM   1745 C CB  . LEU A 1 237 ? 120.532 34.363 6.759   1.00 39.70  ? 252  LEU A CB  1 
ATOM   1746 C CG  . LEU A 1 237 ? 120.212 34.114 8.224   1.00 43.02  ? 252  LEU A CG  1 
ATOM   1747 C CD1 . LEU A 1 237 ? 120.419 32.639 8.480   1.00 40.77  ? 252  LEU A CD1 1 
ATOM   1748 C CD2 . LEU A 1 237 ? 121.100 34.953 9.130   1.00 39.32  ? 252  LEU A CD2 1 
ATOM   1749 N N   . GLY A 1 238 ? 120.202 35.282 3.791   1.00 34.79  ? 253  GLY A N   1 
ATOM   1750 C CA  . GLY A 1 238 ? 120.722 35.186 2.444   1.00 37.30  ? 253  GLY A CA  1 
ATOM   1751 C C   . GLY A 1 238 ? 120.918 33.740 2.019   1.00 43.09  ? 253  GLY A C   1 
ATOM   1752 O O   . GLY A 1 238 ? 121.273 33.452 0.869   1.00 46.31  ? 253  GLY A O   1 
ATOM   1753 N N   . GLN A 1 239 ? 120.673 32.818 2.943   1.00 43.94  ? 254  GLN A N   1 
ATOM   1754 C CA  . GLN A 1 239 ? 120.829 31.401 2.651   1.00 44.87  ? 254  GLN A CA  1 
ATOM   1755 C C   . GLN A 1 239 ? 120.073 30.648 3.731   1.00 43.45  ? 254  GLN A C   1 
ATOM   1756 O O   . GLN A 1 239 ? 119.820 31.197 4.803   1.00 42.34  ? 254  GLN A O   1 
ATOM   1757 C CB  . GLN A 1 239 ? 122.300 31.041 2.728   1.00 46.06  ? 254  GLN A CB  1 
ATOM   1758 C CG  . GLN A 1 239 ? 122.821 31.274 4.116   1.00 51.34  ? 254  GLN A CG  1 
ATOM   1759 C CD  . GLN A 1 239 ? 124.305 31.115 4.225   1.00 54.63  ? 254  GLN A CD  1 
ATOM   1760 O OE1 . GLN A 1 239 ? 125.065 31.974 3.783   1.00 58.18  ? 254  GLN A OE1 1 
ATOM   1761 N NE2 . GLN A 1 239 ? 124.739 30.008 4.816   1.00 59.20  ? 254  GLN A NE2 1 
ATOM   1762 N N   . PRO A 1 240 ? 119.699 29.384 3.472   1.00 41.58  ? 255  PRO A N   1 
ATOM   1763 C CA  . PRO A 1 240 ? 118.972 28.638 4.508   1.00 41.31  ? 255  PRO A CA  1 
ATOM   1764 C C   . PRO A 1 240 ? 119.674 28.699 5.873   1.00 39.94  ? 255  PRO A C   1 
ATOM   1765 O O   . PRO A 1 240 ? 120.903 28.663 5.962   1.00 43.45  ? 255  PRO A O   1 
ATOM   1766 C CB  . PRO A 1 240 ? 118.882 27.221 3.927   1.00 41.73  ? 255  PRO A CB  1 
ATOM   1767 C CG  . PRO A 1 240 ? 119.949 27.186 2.871   1.00 40.41  ? 255  PRO A CG  1 
ATOM   1768 C CD  . PRO A 1 240 ? 119.907 28.557 2.276   1.00 39.85  ? 255  PRO A CD  1 
ATOM   1769 N N   . ILE A 1 241 ? 118.883 28.801 6.935   1.00 35.67  ? 256  ILE A N   1 
ATOM   1770 C CA  . ILE A 1 241 ? 119.419 28.901 8.287   1.00 33.38  ? 256  ILE A CA  1 
ATOM   1771 C C   . ILE A 1 241 ? 119.936 27.584 8.880   1.00 33.14  ? 256  ILE A C   1 
ATOM   1772 O O   . ILE A 1 241 ? 120.922 27.571 9.626   1.00 32.63  ? 256  ILE A O   1 
ATOM   1773 C CB  . ILE A 1 241 ? 118.355 29.539 9.235   1.00 34.06  ? 256  ILE A CB  1 
ATOM   1774 C CG1 . ILE A 1 241 ? 118.832 29.479 10.691  1.00 33.01  ? 256  ILE A CG1 1 
ATOM   1775 C CG2 . ILE A 1 241 ? 116.999 28.862 9.041   1.00 34.50  ? 256  ILE A CG2 1 
ATOM   1776 C CD1 . ILE A 1 241 ? 118.082 30.422 11.629  1.00 28.11  ? 256  ILE A CD1 1 
ATOM   1777 N N   . PHE A 1 242 ? 119.273 26.482 8.539   1.00 32.16  ? 257  PHE A N   1 
ATOM   1778 C CA  . PHE A 1 242 ? 119.652 25.160 9.030   1.00 33.68  ? 257  PHE A CA  1 
ATOM   1779 C C   . PHE A 1 242 ? 119.933 24.222 7.855   1.00 34.25  ? 257  PHE A C   1 
ATOM   1780 O O   . PHE A 1 242 ? 119.080 23.422 7.482   1.00 36.60  ? 257  PHE A O   1 
ATOM   1781 C CB  . PHE A 1 242 ? 118.519 24.565 9.863   1.00 31.39  ? 257  PHE A CB  1 
ATOM   1782 C CG  . PHE A 1 242 ? 118.045 25.446 10.991  1.00 29.17  ? 257  PHE A CG  1 
ATOM   1783 C CD1 . PHE A 1 242 ? 116.679 25.687 11.170  1.00 27.24  ? 257  PHE A CD1 1 
ATOM   1784 C CD2 . PHE A 1 242 ? 118.941 25.968 11.922  1.00 28.85  ? 257  PHE A CD2 1 
ATOM   1785 C CE1 . PHE A 1 242 ? 116.212 26.422 12.258  1.00 24.78  ? 257  PHE A CE1 1 
ATOM   1786 C CE2 . PHE A 1 242 ? 118.479 26.715 13.029  1.00 27.05  ? 257  PHE A CE2 1 
ATOM   1787 C CZ  . PHE A 1 242 ? 117.115 26.934 13.191  1.00 23.55  ? 257  PHE A CZ  1 
ATOM   1788 N N   . PRO A 1 243 ? 121.131 24.312 7.252   1.00 35.30  ? 258  PRO A N   1 
ATOM   1789 C CA  . PRO A 1 243 ? 121.508 23.460 6.114   1.00 37.11  ? 258  PRO A CA  1 
ATOM   1790 C C   . PRO A 1 243 ? 122.083 22.092 6.523   1.00 37.81  ? 258  PRO A C   1 
ATOM   1791 O O   . PRO A 1 243 ? 123.228 21.765 6.184   1.00 38.61  ? 258  PRO A O   1 
ATOM   1792 C CB  . PRO A 1 243 ? 122.541 24.312 5.398   1.00 34.24  ? 258  PRO A CB  1 
ATOM   1793 C CG  . PRO A 1 243 ? 123.282 24.905 6.546   1.00 32.00  ? 258  PRO A CG  1 
ATOM   1794 C CD  . PRO A 1 243 ? 122.163 25.340 7.488   1.00 30.68  ? 258  PRO A CD  1 
ATOM   1795 N N   . GLY A 1 244 ? 121.292 21.303 7.249   1.00 39.53  ? 259  GLY A N   1 
ATOM   1796 C CA  . GLY A 1 244 ? 121.748 19.996 7.685   1.00 39.86  ? 259  GLY A CA  1 
ATOM   1797 C C   . GLY A 1 244 ? 122.056 19.074 6.524   1.00 40.56  ? 259  GLY A C   1 
ATOM   1798 O O   . GLY A 1 244 ? 121.434 19.164 5.464   1.00 41.67  ? 259  GLY A O   1 
ATOM   1799 N N   . ASP A 1 245 ? 123.016 18.178 6.720   1.00 42.98  ? 260  ASP A N   1 
ATOM   1800 C CA  . ASP A 1 245 ? 123.399 17.242 5.664   1.00 49.14  ? 260  ASP A CA  1 
ATOM   1801 C C   . ASP A 1 245 ? 122.616 15.932 5.727   1.00 50.18  ? 260  ASP A C   1 
ATOM   1802 O O   . ASP A 1 245 ? 122.632 15.135 4.781   1.00 52.63  ? 260  ASP A O   1 
ATOM   1803 C CB  . ASP A 1 245 ? 124.895 16.922 5.733   1.00 47.43  ? 260  ASP A CB  1 
ATOM   1804 C CG  . ASP A 1 245 ? 125.762 18.164 5.738   1.00 49.49  ? 260  ASP A CG  1 
ATOM   1805 O OD1 . ASP A 1 245 ? 125.405 19.165 5.074   1.00 50.29  ? 260  ASP A OD1 1 
ATOM   1806 O OD2 . ASP A 1 245 ? 126.819 18.126 6.401   1.00 48.79  ? 260  ASP A OD2 1 
ATOM   1807 N N   . SER A 1 246 ? 121.935 15.711 6.843   1.00 49.24  ? 261  SER A N   1 
ATOM   1808 C CA  . SER A 1 246 ? 121.157 14.501 7.030   1.00 49.79  ? 261  SER A CA  1 
ATOM   1809 C C   . SER A 1 246 ? 120.155 14.802 8.114   1.00 49.95  ? 261  SER A C   1 
ATOM   1810 O O   . SER A 1 246 ? 120.020 15.947 8.531   1.00 53.91  ? 261  SER A O   1 
ATOM   1811 C CB  . SER A 1 246 ? 122.064 13.354 7.470   1.00 49.47  ? 261  SER A CB  1 
ATOM   1812 O OG  . SER A 1 246 ? 122.751 13.676 8.671   1.00 49.97  ? 261  SER A OG  1 
ATOM   1813 N N   . GLY A 1 247 ? 119.454 13.777 8.575   1.00 49.27  ? 262  GLY A N   1 
ATOM   1814 C CA  . GLY A 1 247 ? 118.479 13.989 9.622   1.00 49.20  ? 262  GLY A CA  1 
ATOM   1815 C C   . GLY A 1 247 ? 119.153 14.328 10.938  1.00 49.37  ? 262  GLY A C   1 
ATOM   1816 O O   . GLY A 1 247 ? 118.661 15.159 11.700  1.00 52.23  ? 262  GLY A O   1 
ATOM   1817 N N   . VAL A 1 248 ? 120.285 13.691 11.218  1.00 46.75  ? 263  VAL A N   1 
ATOM   1818 C CA  . VAL A 1 248 ? 120.985 13.953 12.468  1.00 43.18  ? 263  VAL A CA  1 
ATOM   1819 C C   . VAL A 1 248 ? 121.674 15.306 12.433  1.00 41.60  ? 263  VAL A C   1 
ATOM   1820 O O   . VAL A 1 248 ? 121.707 16.016 13.436  1.00 37.87  ? 263  VAL A O   1 
ATOM   1821 C CB  . VAL A 1 248 ? 122.044 12.868 12.775  1.00 41.41  ? 263  VAL A CB  1 
ATOM   1822 C CG1 . VAL A 1 248 ? 122.881 13.296 13.971  1.00 41.57  ? 263  VAL A CG1 1 
ATOM   1823 C CG2 . VAL A 1 248 ? 121.363 11.535 13.074  1.00 45.10  ? 263  VAL A CG2 1 
ATOM   1824 N N   . ASP A 1 249 ? 122.226 15.658 11.275  1.00 40.95  ? 264  ASP A N   1 
ATOM   1825 C CA  . ASP A 1 249 ? 122.913 16.933 11.135  1.00 40.69  ? 264  ASP A CA  1 
ATOM   1826 C C   . ASP A 1 249 ? 121.920 18.096 11.183  1.00 38.75  ? 264  ASP A C   1 
ATOM   1827 O O   . ASP A 1 249 ? 122.286 19.225 11.521  1.00 37.89  ? 264  ASP A O   1 
ATOM   1828 C CB  . ASP A 1 249 ? 123.699 16.977 9.827   1.00 39.50  ? 264  ASP A CB  1 
ATOM   1829 C CG  . ASP A 1 249 ? 124.647 18.162 9.762   1.00 45.50  ? 264  ASP A CG  1 
ATOM   1830 O OD1 . ASP A 1 249 ? 124.666 18.848 8.714   1.00 45.58  ? 264  ASP A OD1 1 
ATOM   1831 O OD2 . ASP A 1 249 ? 125.375 18.405 10.756  1.00 45.85  ? 264  ASP A OD2 1 
ATOM   1832 N N   . GLN A 1 250 ? 120.665 17.810 10.848  1.00 35.81  ? 265  GLN A N   1 
ATOM   1833 C CA  . GLN A 1 250 ? 119.615 18.823 10.868  1.00 38.23  ? 265  GLN A CA  1 
ATOM   1834 C C   . GLN A 1 250 ? 119.411 19.301 12.303  1.00 37.34  ? 265  GLN A C   1 
ATOM   1835 O O   . GLN A 1 250 ? 119.354 20.503 12.576  1.00 34.78  ? 265  GLN A O   1 
ATOM   1836 C CB  . GLN A 1 250 ? 118.313 18.238 10.334  1.00 36.49  ? 265  GLN A CB  1 
ATOM   1837 C CG  . GLN A 1 250 ? 117.243 19.267 10.114  1.00 39.23  ? 265  GLN A CG  1 
ATOM   1838 C CD  . GLN A 1 250 ? 117.729 20.389 9.226   1.00 42.78  ? 265  GLN A CD  1 
ATOM   1839 O OE1 . GLN A 1 250 ? 118.518 20.164 8.301   1.00 40.21  ? 265  GLN A OE1 1 
ATOM   1840 N NE2 . GLN A 1 250 ? 117.255 21.605 9.489   1.00 38.14  ? 265  GLN A NE2 1 
ATOM   1841 N N   . LEU A 1 251 ? 119.308 18.341 13.213  1.00 37.27  ? 266  LEU A N   1 
ATOM   1842 C CA  . LEU A 1 251 ? 119.126 18.640 14.618  1.00 37.83  ? 266  LEU A CA  1 
ATOM   1843 C C   . LEU A 1 251 ? 120.361 19.363 15.157  1.00 39.39  ? 266  LEU A C   1 
ATOM   1844 O O   . LEU A 1 251 ? 120.247 20.265 15.980  1.00 40.39  ? 266  LEU A O   1 
ATOM   1845 C CB  . LEU A 1 251 ? 118.891 17.352 15.399  1.00 32.83  ? 266  LEU A CB  1 
ATOM   1846 C CG  . LEU A 1 251 ? 118.685 17.555 16.900  1.00 35.67  ? 266  LEU A CG  1 
ATOM   1847 C CD1 . LEU A 1 251 ? 117.420 18.368 17.123  1.00 31.36  ? 266  LEU A CD1 1 
ATOM   1848 C CD2 . LEU A 1 251 ? 118.600 16.199 17.614  1.00 33.51  ? 266  LEU A CD2 1 
ATOM   1849 N N   . VAL A 1 252 ? 121.541 18.961 14.696  1.00 40.98  ? 267  VAL A N   1 
ATOM   1850 C CA  . VAL A 1 252 ? 122.781 19.599 15.135  1.00 39.32  ? 267  VAL A CA  1 
ATOM   1851 C C   . VAL A 1 252 ? 122.772 21.070 14.715  1.00 38.63  ? 267  VAL A C   1 
ATOM   1852 O O   . VAL A 1 252 ? 123.188 21.947 15.474  1.00 36.77  ? 267  VAL A O   1 
ATOM   1853 C CB  . VAL A 1 252 ? 124.022 18.898 14.524  1.00 39.24  ? 267  VAL A CB  1 
ATOM   1854 C CG1 . VAL A 1 252 ? 125.261 19.778 14.680  1.00 37.21  ? 267  VAL A CG1 1 
ATOM   1855 C CG2 . VAL A 1 252 ? 124.241 17.555 15.207  1.00 37.34  ? 267  VAL A CG2 1 
ATOM   1856 N N   . GLU A 1 253 ? 122.298 21.329 13.500  1.00 36.33  ? 268  GLU A N   1 
ATOM   1857 C CA  . GLU A 1 253 ? 122.212 22.693 12.988  1.00 35.67  ? 268  GLU A CA  1 
ATOM   1858 C C   . GLU A 1 253 ? 121.228 23.476 13.849  1.00 35.35  ? 268  GLU A C   1 
ATOM   1859 O O   . GLU A 1 253 ? 121.462 24.639 14.165  1.00 37.33  ? 268  GLU A O   1 
ATOM   1860 C CB  . GLU A 1 253 ? 121.736 22.698 11.527  1.00 34.84  ? 268  GLU A CB  1 
ATOM   1861 C CG  . GLU A 1 253 ? 122.809 22.339 10.513  1.00 38.23  ? 268  GLU A CG  1 
ATOM   1862 C CD  . GLU A 1 253 ? 123.955 23.350 10.494  1.00 43.35  ? 268  GLU A CD  1 
ATOM   1863 O OE1 . GLU A 1 253 ? 123.699 24.562 10.298  1.00 45.68  ? 268  GLU A OE1 1 
ATOM   1864 O OE2 . GLU A 1 253 ? 125.121 22.935 10.675  1.00 44.99  ? 268  GLU A OE2 1 
ATOM   1865 N N   . ILE A 1 254 ? 120.129 22.827 14.220  1.00 30.44  ? 269  ILE A N   1 
ATOM   1866 C CA  . ILE A 1 254 ? 119.119 23.464 15.041  1.00 32.62  ? 269  ILE A CA  1 
ATOM   1867 C C   . ILE A 1 254 ? 119.728 23.742 16.409  1.00 38.20  ? 269  ILE A C   1 
ATOM   1868 O O   . ILE A 1 254 ? 119.638 24.861 16.917  1.00 41.23  ? 269  ILE A O   1 
ATOM   1869 C CB  . ILE A 1 254 ? 117.851 22.565 15.170  1.00 32.91  ? 269  ILE A CB  1 
ATOM   1870 C CG1 . ILE A 1 254 ? 117.169 22.436 13.803  1.00 29.43  ? 269  ILE A CG1 1 
ATOM   1871 C CG2 . ILE A 1 254 ? 116.884 23.141 16.184  1.00 25.21  ? 269  ILE A CG2 1 
ATOM   1872 C CD1 . ILE A 1 254 ? 115.961 21.513 13.768  1.00 30.82  ? 269  ILE A CD1 1 
ATOM   1873 N N   . ILE A 1 255 ? 120.374 22.741 16.998  1.00 38.04  ? 270  ILE A N   1 
ATOM   1874 C CA  . ILE A 1 255 ? 120.984 22.925 18.304  1.00 38.08  ? 270  ILE A CA  1 
ATOM   1875 C C   . ILE A 1 255 ? 121.953 24.092 18.306  1.00 41.20  ? 270  ILE A C   1 
ATOM   1876 O O   . ILE A 1 255 ? 122.025 24.827 19.287  1.00 41.55  ? 270  ILE A O   1 
ATOM   1877 C CB  . ILE A 1 255 ? 121.740 21.672 18.770  1.00 38.00  ? 270  ILE A CB  1 
ATOM   1878 C CG1 . ILE A 1 255 ? 120.751 20.525 18.993  1.00 40.39  ? 270  ILE A CG1 1 
ATOM   1879 C CG2 . ILE A 1 255 ? 122.482 21.965 20.067  1.00 35.24  ? 270  ILE A CG2 1 
ATOM   1880 C CD1 . ILE A 1 255 ? 121.382 19.269 19.563  1.00 39.80  ? 270  ILE A CD1 1 
ATOM   1881 N N   . LYS A 1 256 ? 122.692 24.278 17.215  1.00 40.86  ? 271  LYS A N   1 
ATOM   1882 C CA  . LYS A 1 256 ? 123.663 25.382 17.140  1.00 44.55  ? 271  LYS A CA  1 
ATOM   1883 C C   . LYS A 1 256 ? 123.049 26.761 17.418  1.00 44.67  ? 271  LYS A C   1 
ATOM   1884 O O   . LYS A 1 256 ? 123.745 27.689 17.841  1.00 45.27  ? 271  LYS A O   1 
ATOM   1885 C CB  . LYS A 1 256 ? 124.367 25.388 15.775  1.00 45.78  ? 271  LYS A CB  1 
ATOM   1886 C CG  . LYS A 1 256 ? 125.263 24.183 15.576  1.00 54.34  ? 271  LYS A CG  1 
ATOM   1887 C CD  . LYS A 1 256 ? 125.819 24.063 14.167  1.00 58.33  ? 271  LYS A CD  1 
ATOM   1888 C CE  . LYS A 1 256 ? 126.897 25.082 13.883  1.00 62.79  ? 271  LYS A CE  1 
ATOM   1889 N NZ  . LYS A 1 256 ? 127.490 24.848 12.528  1.00 67.77  ? 271  LYS A NZ  1 
ATOM   1890 N N   . VAL A 1 257 ? 121.747 26.889 17.185  1.00 41.50  ? 272  VAL A N   1 
ATOM   1891 C CA  . VAL A 1 257 ? 121.066 28.149 17.422  1.00 35.81  ? 272  VAL A CA  1 
ATOM   1892 C C   . VAL A 1 257 ? 120.217 28.077 18.682  1.00 36.71  ? 272  VAL A C   1 
ATOM   1893 O O   . VAL A 1 257 ? 120.415 28.859 19.612  1.00 32.80  ? 272  VAL A O   1 
ATOM   1894 C CB  . VAL A 1 257 ? 120.155 28.521 16.250  1.00 35.18  ? 272  VAL A CB  1 
ATOM   1895 C CG1 . VAL A 1 257 ? 119.436 29.811 16.560  1.00 29.77  ? 272  VAL A CG1 1 
ATOM   1896 C CG2 . VAL A 1 257 ? 120.972 28.647 14.964  1.00 31.58  ? 272  VAL A CG2 1 
ATOM   1897 N N   . LEU A 1 258 ? 119.280 27.129 18.718  1.00 37.28  ? 273  LEU A N   1 
ATOM   1898 C CA  . LEU A 1 258 ? 118.383 26.988 19.868  1.00 35.37  ? 273  LEU A CA  1 
ATOM   1899 C C   . LEU A 1 258 ? 118.997 26.244 21.037  1.00 37.17  ? 273  LEU A C   1 
ATOM   1900 O O   . LEU A 1 258 ? 118.394 26.193 22.112  1.00 41.56  ? 273  LEU A O   1 
ATOM   1901 C CB  . LEU A 1 258 ? 117.090 26.241 19.501  1.00 32.11  ? 273  LEU A CB  1 
ATOM   1902 C CG  . LEU A 1 258 ? 116.260 26.468 18.238  1.00 35.38  ? 273  LEU A CG  1 
ATOM   1903 C CD1 . LEU A 1 258 ? 114.868 25.918 18.510  1.00 30.62  ? 273  LEU A CD1 1 
ATOM   1904 C CD2 . LEU A 1 258 ? 116.167 27.923 17.875  1.00 35.37  ? 273  LEU A CD2 1 
ATOM   1905 N N   . GLY A 1 259 ? 120.176 25.665 20.845  1.00 34.99  ? 274  GLY A N   1 
ATOM   1906 C CA  . GLY A 1 259 ? 120.769 24.889 21.919  1.00 35.56  ? 274  GLY A CA  1 
ATOM   1907 C C   . GLY A 1 259 ? 119.959 23.599 22.003  1.00 36.86  ? 274  GLY A C   1 
ATOM   1908 O O   . GLY A 1 259 ? 119.191 23.294 21.083  1.00 34.61  ? 274  GLY A O   1 
ATOM   1909 N N   . THR A 1 260 ? 120.104 22.843 23.088  1.00 36.26  ? 275  THR A N   1 
ATOM   1910 C CA  . THR A 1 260 ? 119.359 21.595 23.238  1.00 34.33  ? 275  THR A CA  1 
ATOM   1911 C C   . THR A 1 260 ? 117.982 21.832 23.863  1.00 34.79  ? 275  THR A C   1 
ATOM   1912 O O   . THR A 1 260 ? 117.803 22.721 24.697  1.00 35.39  ? 275  THR A O   1 
ATOM   1913 C CB  . THR A 1 260 ? 120.115 20.594 24.118  1.00 35.26  ? 275  THR A CB  1 
ATOM   1914 O OG1 . THR A 1 260 ? 120.192 21.118 25.445  1.00 34.94  ? 275  THR A OG1 1 
ATOM   1915 C CG2 . THR A 1 260 ? 121.531 20.341 23.581  1.00 34.89  ? 275  THR A CG2 1 
ATOM   1916 N N   . PRO A 1 261 ? 116.986 21.025 23.475  1.00 34.73  ? 276  PRO A N   1 
ATOM   1917 C CA  . PRO A 1 261 ? 115.650 21.208 24.038  1.00 34.77  ? 276  PRO A CA  1 
ATOM   1918 C C   . PRO A 1 261 ? 115.628 20.783 25.490  1.00 39.68  ? 276  PRO A C   1 
ATOM   1919 O O   . PRO A 1 261 ? 116.470 19.995 25.924  1.00 40.13  ? 276  PRO A O   1 
ATOM   1920 C CB  . PRO A 1 261 ? 114.793 20.308 23.168  1.00 29.62  ? 276  PRO A CB  1 
ATOM   1921 C CG  . PRO A 1 261 ? 115.703 19.167 22.940  1.00 33.03  ? 276  PRO A CG  1 
ATOM   1922 C CD  . PRO A 1 261 ? 117.024 19.831 22.616  1.00 32.00  ? 276  PRO A CD  1 
ATOM   1923 N N   . THR A 1 262 ? 114.680 21.325 26.246  1.00 40.60  ? 277  THR A N   1 
ATOM   1924 C CA  . THR A 1 262 ? 114.545 20.958 27.640  1.00 41.06  ? 277  THR A CA  1 
ATOM   1925 C C   . THR A 1 262 ? 113.646 19.747 27.581  1.00 46.30  ? 277  THR A C   1 
ATOM   1926 O O   . THR A 1 262 ? 112.992 19.508 26.562  1.00 48.27  ? 277  THR A O   1 
ATOM   1927 C CB  . THR A 1 262 ? 113.833 22.032 28.458  1.00 38.58  ? 277  THR A CB  1 
ATOM   1928 O OG1 . THR A 1 262 ? 112.518 22.224 27.931  1.00 36.52  ? 277  THR A OG1 1 
ATOM   1929 C CG2 . THR A 1 262 ? 114.608 23.344 28.426  1.00 31.93  ? 277  THR A CG2 1 
ATOM   1930 N N   . ARG A 1 263 ? 113.615 18.988 28.667  1.00 47.46  ? 278  ARG A N   1 
ATOM   1931 C CA  . ARG A 1 263 ? 112.797 17.789 28.743  1.00 49.59  ? 278  ARG A CA  1 
ATOM   1932 C C   . ARG A 1 263 ? 111.343 18.128 28.475  1.00 49.20  ? 278  ARG A C   1 
ATOM   1933 O O   . ARG A 1 263 ? 110.622 17.372 27.817  1.00 50.84  ? 278  ARG A O   1 
ATOM   1934 C CB  . ARG A 1 263 ? 112.965 17.155 30.118  1.00 50.99  ? 278  ARG A CB  1 
ATOM   1935 C CG  . ARG A 1 263 ? 114.417 16.835 30.387  1.00 55.97  ? 278  ARG A CG  1 
ATOM   1936 C CD  . ARG A 1 263 ? 114.631 16.052 31.656  1.00 59.78  ? 278  ARG A CD  1 
ATOM   1937 N NE  . ARG A 1 263 ? 115.907 15.349 31.599  1.00 60.69  ? 278  ARG A NE  1 
ATOM   1938 C CZ  . ARG A 1 263 ? 116.134 14.288 30.829  1.00 63.72  ? 278  ARG A CZ  1 
ATOM   1939 N NH1 . ARG A 1 263 ? 115.164 13.800 30.055  1.00 61.58  ? 278  ARG A NH1 1 
ATOM   1940 N NH2 . ARG A 1 263 ? 117.337 13.723 30.824  1.00 66.26  ? 278  ARG A NH2 1 
ATOM   1941 N N   . GLU A 1 264 ? 110.918 19.276 28.985  1.00 49.62  ? 279  GLU A N   1 
ATOM   1942 C CA  . GLU A 1 264 ? 109.556 19.723 28.784  1.00 49.94  ? 279  GLU A CA  1 
ATOM   1943 C C   . GLU A 1 264 ? 109.339 19.876 27.282  1.00 48.21  ? 279  GLU A C   1 
ATOM   1944 O O   . GLU A 1 264 ? 108.300 19.491 26.755  1.00 46.05  ? 279  GLU A O   1 
ATOM   1945 C CB  . GLU A 1 264 ? 109.346 21.063 29.476  1.00 54.13  ? 279  GLU A CB  1 
ATOM   1946 C CG  . GLU A 1 264 ? 107.909 21.554 29.472  1.00 63.15  ? 279  GLU A CG  1 
ATOM   1947 C CD  . GLU A 1 264 ? 107.811 23.049 29.754  1.00 69.29  ? 279  GLU A CD  1 
ATOM   1948 O OE1 . GLU A 1 264 ? 106.689 23.528 30.054  1.00 71.71  ? 279  GLU A OE1 1 
ATOM   1949 O OE2 . GLU A 1 264 ? 108.860 23.740 29.663  1.00 74.23  ? 279  GLU A OE2 1 
ATOM   1950 N N   . GLN A 1 265 ? 110.337 20.431 26.595  1.00 46.47  ? 280  GLN A N   1 
ATOM   1951 C CA  . GLN A 1 265 ? 110.257 20.649 25.155  1.00 44.58  ? 280  GLN A CA  1 
ATOM   1952 C C   . GLN A 1 265 ? 110.220 19.341 24.388  1.00 43.96  ? 280  GLN A C   1 
ATOM   1953 O O   . GLN A 1 265 ? 109.476 19.206 23.419  1.00 40.68  ? 280  GLN A O   1 
ATOM   1954 C CB  . GLN A 1 265 ? 111.435 21.509 24.687  1.00 44.11  ? 280  GLN A CB  1 
ATOM   1955 C CG  . GLN A 1 265 ? 111.359 22.949 25.182  1.00 40.65  ? 280  GLN A CG  1 
ATOM   1956 C CD  . GLN A 1 265 ? 112.558 23.790 24.783  1.00 42.17  ? 280  GLN A CD  1 
ATOM   1957 O OE1 . GLN A 1 265 ? 113.705 23.413 25.026  1.00 43.43  ? 280  GLN A OE1 1 
ATOM   1958 N NE2 . GLN A 1 265 ? 112.297 24.945 24.179  1.00 43.37  ? 280  GLN A NE2 1 
ATOM   1959 N N   . ILE A 1 266 ? 111.023 18.379 24.828  1.00 40.89  ? 281  ILE A N   1 
ATOM   1960 C CA  . ILE A 1 266 ? 111.071 17.069 24.190  1.00 44.04  ? 281  ILE A CA  1 
ATOM   1961 C C   . ILE A 1 266 ? 109.735 16.353 24.371  1.00 44.24  ? 281  ILE A C   1 
ATOM   1962 O O   . ILE A 1 266 ? 109.217 15.729 23.447  1.00 41.84  ? 281  ILE A O   1 
ATOM   1963 C CB  . ILE A 1 266 ? 112.167 16.191 24.801  1.00 45.22  ? 281  ILE A CB  1 
ATOM   1964 C CG1 . ILE A 1 266 ? 113.521 16.911 24.708  1.00 47.00  ? 281  ILE A CG1 1 
ATOM   1965 C CG2 . ILE A 1 266 ? 112.186 14.843 24.098  1.00 44.55  ? 281  ILE A CG2 1 
ATOM   1966 C CD1 . ILE A 1 266 ? 114.635 16.269 25.532  1.00 46.20  ? 281  ILE A CD1 1 
ATOM   1967 N N   . ARG A 1 267 ? 109.188 16.434 25.575  1.00 43.71  ? 282  ARG A N   1 
ATOM   1968 C CA  . ARG A 1 267 ? 107.911 15.809 25.857  1.00 47.47  ? 282  ARG A CA  1 
ATOM   1969 C C   . ARG A 1 267 ? 106.909 16.377 24.860  1.00 47.98  ? 282  ARG A C   1 
ATOM   1970 O O   . ARG A 1 267 ? 106.190 15.635 24.195  1.00 51.37  ? 282  ARG A O   1 
ATOM   1971 C CB  . ARG A 1 267 ? 107.488 16.139 27.281  1.00 47.97  ? 282  ARG A CB  1 
ATOM   1972 C CG  . ARG A 1 267 ? 107.062 14.943 28.097  1.00 57.01  ? 282  ARG A CG  1 
ATOM   1973 C CD  . ARG A 1 267 ? 107.064 15.294 29.578  1.00 60.73  ? 282  ARG A CD  1 
ATOM   1974 N NE  . ARG A 1 267 ? 108.421 15.391 30.121  1.00 64.05  ? 282  ARG A NE  1 
ATOM   1975 C CZ  . ARG A 1 267 ? 108.788 16.243 31.077  1.00 64.85  ? 282  ARG A CZ  1 
ATOM   1976 N NH1 . ARG A 1 267 ? 107.902 17.085 31.600  1.00 66.29  ? 282  ARG A NH1 1 
ATOM   1977 N NH2 . ARG A 1 267 ? 110.040 16.249 31.522  1.00 66.28  ? 282  ARG A NH2 1 
ATOM   1978 N N   . GLU A 1 268 ? 106.887 17.702 24.750  1.00 47.61  ? 283  GLU A N   1 
ATOM   1979 C CA  . GLU A 1 268 ? 105.986 18.408 23.842  1.00 48.59  ? 283  GLU A CA  1 
ATOM   1980 C C   . GLU A 1 268 ? 106.100 17.954 22.387  1.00 48.19  ? 283  GLU A C   1 
ATOM   1981 O O   . GLU A 1 268 ? 105.086 17.736 21.714  1.00 49.31  ? 283  GLU A O   1 
ATOM   1982 C CB  . GLU A 1 268 ? 106.266 19.908 23.900  1.00 52.82  ? 283  GLU A CB  1 
ATOM   1983 C CG  . GLU A 1 268 ? 105.911 20.577 25.210  1.00 59.56  ? 283  GLU A CG  1 
ATOM   1984 C CD  . GLU A 1 268 ? 104.420 20.818 25.362  1.00 63.39  ? 283  GLU A CD  1 
ATOM   1985 O OE1 . GLU A 1 268 ? 103.693 20.734 24.342  1.00 64.94  ? 283  GLU A OE1 1 
ATOM   1986 O OE2 . GLU A 1 268 ? 103.982 21.109 26.502  1.00 68.00  ? 283  GLU A OE2 1 
ATOM   1987 N N   . MET A 1 269 ? 107.333 17.839 21.897  1.00 46.08  ? 284  MET A N   1 
ATOM   1988 C CA  . MET A 1 269 ? 107.574 17.430 20.518  1.00 45.03  ? 284  MET A CA  1 
ATOM   1989 C C   . MET A 1 269 ? 107.166 15.990 20.309  1.00 45.38  ? 284  MET A C   1 
ATOM   1990 O O   . MET A 1 269 ? 106.424 15.682 19.382  1.00 47.48  ? 284  MET A O   1 
ATOM   1991 C CB  . MET A 1 269 ? 109.051 17.588 20.148  1.00 40.28  ? 284  MET A CB  1 
ATOM   1992 C CG  . MET A 1 269 ? 109.568 19.003 20.254  1.00 41.78  ? 284  MET A CG  1 
ATOM   1993 S SD  . MET A 1 269 ? 111.192 19.224 19.523  1.00 42.34  ? 284  MET A SD  1 
ATOM   1994 C CE  . MET A 1 269 ? 112.250 18.695 20.834  1.00 36.58  ? 284  MET A CE  1 
ATOM   1995 N N   . ASN A 1 270 ? 107.661 15.109 21.171  1.00 42.94  ? 285  ASN A N   1 
ATOM   1996 C CA  . ASN A 1 270 ? 107.346 13.694 21.075  1.00 45.22  ? 285  ASN A CA  1 
ATOM   1997 C C   . ASN A 1 270 ? 107.141 13.119 22.460  1.00 46.10  ? 285  ASN A C   1 
ATOM   1998 O O   . ASN A 1 270 ? 108.102 12.828 23.173  1.00 45.73  ? 285  ASN A O   1 
ATOM   1999 C CB  . ASN A 1 270 ? 108.474 12.937 20.390  1.00 46.19  ? 285  ASN A CB  1 
ATOM   2000 C CG  . ASN A 1 270 ? 108.037 11.582 19.903  1.00 44.62  ? 285  ASN A CG  1 
ATOM   2001 O OD1 . ASN A 1 270 ? 107.090 11.002 20.432  1.00 41.17  ? 285  ASN A OD1 1 
ATOM   2002 N ND2 . ASN A 1 270 ? 108.728 11.061 18.896  1.00 41.44  ? 285  ASN A ND2 1 
ATOM   2003 N N   . PRO A 1 271 ? 105.876 12.940 22.857  1.00 49.26  ? 286  PRO A N   1 
ATOM   2004 C CA  . PRO A 1 271 ? 105.534 12.396 24.173  1.00 49.32  ? 286  PRO A CA  1 
ATOM   2005 C C   . PRO A 1 271 ? 106.138 11.009 24.412  1.00 49.07  ? 286  PRO A C   1 
ATOM   2006 O O   . PRO A 1 271 ? 106.304 10.583 25.560  1.00 49.91  ? 286  PRO A O   1 
ATOM   2007 C CB  . PRO A 1 271 ? 104.005 12.362 24.139  1.00 50.75  ? 286  PRO A CB  1 
ATOM   2008 C CG  . PRO A 1 271 ? 103.646 13.452 23.144  1.00 51.33  ? 286  PRO A CG  1 
ATOM   2009 C CD  . PRO A 1 271 ? 104.658 13.209 22.069  1.00 51.21  ? 286  PRO A CD  1 
ATOM   2010 N N   . ASN A 1 272 ? 106.479 10.322 23.322  1.00 51.15  ? 287  ASN A N   1 
ATOM   2011 C CA  . ASN A 1 272 ? 107.039 8.980  23.398  1.00 51.44  ? 287  ASN A CA  1 
ATOM   2012 C C   . ASN A 1 272 ? 108.536 8.824  23.201  1.00 50.70  ? 287  ASN A C   1 
ATOM   2013 O O   . ASN A 1 272 ? 109.022 7.701  23.100  1.00 55.37  ? 287  ASN A O   1 
ATOM   2014 C CB  . ASN A 1 272 ? 106.308 8.059  22.427  1.00 55.07  ? 287  ASN A CB  1 
ATOM   2015 C CG  . ASN A 1 272 ? 104.846 7.923  22.773  1.00 59.39  ? 287  ASN A CG  1 
ATOM   2016 O OD1 . ASN A 1 272 ? 104.004 8.674  22.281  1.00 61.14  ? 287  ASN A OD1 1 
ATOM   2017 N ND2 . ASN A 1 272 ? 104.534 6.978  23.655  1.00 63.94  ? 287  ASN A ND2 1 
ATOM   2018 N N   . TYR A 1 273 ? 109.277 9.924  23.136  1.00 47.64  ? 288  TYR A N   1 
ATOM   2019 C CA  . TYR A 1 273 ? 110.724 9.809  22.997  1.00 45.74  ? 288  TYR A CA  1 
ATOM   2020 C C   . TYR A 1 273 ? 111.361 9.898  24.379  1.00 47.00  ? 288  TYR A C   1 
ATOM   2021 O O   . TYR A 1 273 ? 110.993 10.747 25.197  1.00 46.43  ? 288  TYR A O   1 
ATOM   2022 C CB  . TYR A 1 273 ? 111.297 10.911 22.102  1.00 42.61  ? 288  TYR A CB  1 
ATOM   2023 C CG  . TYR A 1 273 ? 112.818 10.905 22.032  1.00 38.68  ? 288  TYR A CG  1 
ATOM   2024 C CD1 . TYR A 1 273 ? 113.577 11.774 22.815  1.00 37.62  ? 288  TYR A CD1 1 
ATOM   2025 C CD2 . TYR A 1 273 ? 113.492 10.000 21.211  1.00 39.28  ? 288  TYR A CD2 1 
ATOM   2026 C CE1 . TYR A 1 273 ? 114.964 11.741 22.785  1.00 42.08  ? 288  TYR A CE1 1 
ATOM   2027 C CE2 . TYR A 1 273 ? 114.879 9.957  21.174  1.00 41.17  ? 288  TYR A CE2 1 
ATOM   2028 C CZ  . TYR A 1 273 ? 115.609 10.830 21.963  1.00 42.62  ? 288  TYR A CZ  1 
ATOM   2029 O OH  . TYR A 1 273 ? 116.983 10.790 21.923  1.00 40.36  ? 288  TYR A OH  1 
ATOM   2030 N N   . THR A 1 274 ? 112.313 9.013  24.643  1.00 46.10  ? 289  THR A N   1 
ATOM   2031 C CA  . THR A 1 274 ? 112.989 9.016  25.928  1.00 45.55  ? 289  THR A CA  1 
ATOM   2032 C C   . THR A 1 274 ? 114.500 9.023  25.739  1.00 45.80  ? 289  THR A C   1 
ATOM   2033 O O   . THR A 1 274 ? 115.039 8.278  24.908  1.00 45.83  ? 289  THR A O   1 
ATOM   2034 C CB  . THR A 1 274 ? 112.608 7.766  26.789  1.00 45.72  ? 289  THR A CB  1 
ATOM   2035 O OG1 . THR A 1 274 ? 111.196 7.756  27.038  1.00 50.16  ? 289  THR A OG1 1 
ATOM   2036 C CG2 . THR A 1 274 ? 113.334 7.793  28.125  1.00 44.90  ? 289  THR A CG2 1 
ATOM   2037 N N   . GLU A 1 275 ? 115.161 9.900  26.494  1.00 46.17  ? 290  GLU A N   1 
ATOM   2038 C CA  . GLU A 1 275 ? 116.620 10.003 26.517  1.00 48.74  ? 290  GLU A CA  1 
ATOM   2039 C C   . GLU A 1 275 ? 116.916 10.311 27.981  1.00 50.23  ? 290  GLU A C   1 
ATOM   2040 O O   . GLU A 1 275 ? 116.581 11.388 28.473  1.00 53.44  ? 290  GLU A O   1 
ATOM   2041 C CB  . GLU A 1 275 ? 117.138 11.121 25.607  1.00 47.29  ? 290  GLU A CB  1 
ATOM   2042 C CG  . GLU A 1 275 ? 118.655 11.145 25.521  1.00 45.69  ? 290  GLU A CG  1 
ATOM   2043 C CD  . GLU A 1 275 ? 119.188 11.763 24.234  1.00 47.74  ? 290  GLU A CD  1 
ATOM   2044 O OE1 . GLU A 1 275 ? 120.419 11.793 24.079  1.00 48.31  ? 290  GLU A OE1 1 
ATOM   2045 O OE2 . GLU A 1 275 ? 118.404 12.216 23.374  1.00 46.01  ? 290  GLU A OE2 1 
ATOM   2046 N N   . PHE A 1 276 ? 117.519 9.348  28.678  1.00 50.24  ? 291  PHE A N   1 
ATOM   2047 C CA  . PHE A 1 276 ? 117.808 9.482  30.108  1.00 50.92  ? 291  PHE A CA  1 
ATOM   2048 C C   . PHE A 1 276 ? 118.887 10.491 30.464  1.00 50.97  ? 291  PHE A C   1 
ATOM   2049 O O   . PHE A 1 276 ? 118.888 11.042 31.567  1.00 51.33  ? 291  PHE A O   1 
ATOM   2050 C CB  . PHE A 1 276 ? 118.166 8.110  30.716  1.00 49.34  ? 291  PHE A CB  1 
ATOM   2051 C CG  . PHE A 1 276 ? 117.146 7.035  30.433  1.00 47.94  ? 291  PHE A CG  1 
ATOM   2052 C CD1 . PHE A 1 276 ? 117.258 6.225  29.305  1.00 49.46  ? 291  PHE A CD1 1 
ATOM   2053 C CD2 . PHE A 1 276 ? 116.039 6.876  31.256  1.00 48.65  ? 291  PHE A CD2 1 
ATOM   2054 C CE1 . PHE A 1 276 ? 116.276 5.272  28.997  1.00 51.59  ? 291  PHE A CE1 1 
ATOM   2055 C CE2 . PHE A 1 276 ? 115.051 5.928  30.959  1.00 50.35  ? 291  PHE A CE2 1 
ATOM   2056 C CZ  . PHE A 1 276 ? 115.170 5.127  29.827  1.00 48.61  ? 291  PHE A CZ  1 
ATOM   2057 N N   . LYS A 1 277 ? 119.797 10.754 29.539  1.00 49.10  ? 292  LYS A N   1 
ATOM   2058 C CA  . LYS A 1 277 ? 120.854 11.699 29.830  1.00 48.51  ? 292  LYS A CA  1 
ATOM   2059 C C   . LYS A 1 277 ? 121.427 12.257 28.540  1.00 46.77  ? 292  LYS A C   1 
ATOM   2060 O O   . LYS A 1 277 ? 121.572 11.539 27.554  1.00 45.53  ? 292  LYS A O   1 
ATOM   2061 C CB  . LYS A 1 277 ? 121.942 10.991 30.631  1.00 48.94  ? 292  LYS A CB  1 
ATOM   2062 C CG  . LYS A 1 277 ? 123.126 11.857 30.995  1.00 59.64  ? 292  LYS A CG  1 
ATOM   2063 C CD  . LYS A 1 277 ? 124.403 11.026 31.102  1.00 61.98  ? 292  LYS A CD  1 
ATOM   2064 C CE  . LYS A 1 277 ? 124.737 10.369 29.761  1.00 64.71  ? 292  LYS A CE  1 
ATOM   2065 N NZ  . LYS A 1 277 ? 125.966 9.534  29.825  1.00 66.88  ? 292  LYS A NZ  1 
ATOM   2066 N N   . PHE A 1 278 ? 121.736 13.547 28.552  1.00 44.38  ? 293  PHE A N   1 
ATOM   2067 C CA  . PHE A 1 278 ? 122.312 14.226 27.402  1.00 43.69  ? 293  PHE A CA  1 
ATOM   2068 C C   . PHE A 1 278 ? 122.862 15.561 27.880  1.00 42.42  ? 293  PHE A C   1 
ATOM   2069 O O   . PHE A 1 278 ? 122.300 16.186 28.781  1.00 39.21  ? 293  PHE A O   1 
ATOM   2070 C CB  . PHE A 1 278 ? 121.257 14.438 26.304  1.00 44.05  ? 293  PHE A CB  1 
ATOM   2071 C CG  . PHE A 1 278 ? 120.149 15.404 26.676  1.00 43.95  ? 293  PHE A CG  1 
ATOM   2072 C CD1 . PHE A 1 278 ? 120.342 16.787 26.590  1.00 44.05  ? 293  PHE A CD1 1 
ATOM   2073 C CD2 . PHE A 1 278 ? 118.902 14.930 27.097  1.00 43.56  ? 293  PHE A CD2 1 
ATOM   2074 C CE1 . PHE A 1 278 ? 119.309 17.678 26.917  1.00 45.02  ? 293  PHE A CE1 1 
ATOM   2075 C CE2 . PHE A 1 278 ? 117.859 15.815 27.426  1.00 42.05  ? 293  PHE A CE2 1 
ATOM   2076 C CZ  . PHE A 1 278 ? 118.063 17.186 27.337  1.00 42.61  ? 293  PHE A CZ  1 
ATOM   2077 N N   . PRO A 1 279 ? 123.978 16.011 27.290  1.00 43.99  ? 294  PRO A N   1 
ATOM   2078 C CA  . PRO A 1 279 ? 124.620 17.275 27.649  1.00 45.03  ? 294  PRO A CA  1 
ATOM   2079 C C   . PRO A 1 279 ? 123.758 18.446 27.215  1.00 46.72  ? 294  PRO A C   1 
ATOM   2080 O O   . PRO A 1 279 ? 123.268 18.486 26.088  1.00 47.94  ? 294  PRO A O   1 
ATOM   2081 C CB  . PRO A 1 279 ? 125.931 17.210 26.893  1.00 44.25  ? 294  PRO A CB  1 
ATOM   2082 C CG  . PRO A 1 279 ? 125.523 16.541 25.640  1.00 47.26  ? 294  PRO A CG  1 
ATOM   2083 C CD  . PRO A 1 279 ? 124.650 15.407 26.130  1.00 43.75  ? 294  PRO A CD  1 
ATOM   2084 N N   . GLN A 1 280 ? 123.582 19.401 28.116  1.00 49.48  ? 295  GLN A N   1 
ATOM   2085 C CA  . GLN A 1 280 ? 122.754 20.559 27.839  1.00 52.14  ? 295  GLN A CA  1 
ATOM   2086 C C   . GLN A 1 280 ? 123.510 21.789 27.348  1.00 54.86  ? 295  GLN A C   1 
ATOM   2087 O O   . GLN A 1 280 ? 124.299 22.396 28.073  1.00 58.73  ? 295  GLN A O   1 
ATOM   2088 C CB  . GLN A 1 280 ? 121.916 20.873 29.076  1.00 51.79  ? 295  GLN A CB  1 
ATOM   2089 C CG  . GLN A 1 280 ? 120.940 19.739 29.373  1.00 57.16  ? 295  GLN A CG  1 
ATOM   2090 C CD  . GLN A 1 280 ? 119.987 20.032 30.516  1.00 59.74  ? 295  GLN A CD  1 
ATOM   2091 O OE1 . GLN A 1 280 ? 120.381 20.029 31.688  1.00 61.30  ? 295  GLN A OE1 1 
ATOM   2092 N NE2 . GLN A 1 280 ? 118.719 20.289 30.180  1.00 55.57  ? 295  GLN A NE2 1 
ATOM   2093 N N   . ILE A 1 281 ? 123.247 22.135 26.091  1.00 55.44  ? 296  ILE A N   1 
ATOM   2094 C CA  . ILE A 1 281 ? 123.857 23.271 25.417  1.00 55.28  ? 296  ILE A CA  1 
ATOM   2095 C C   . ILE A 1 281 ? 122.853 24.428 25.329  1.00 55.69  ? 296  ILE A C   1 
ATOM   2096 O O   . ILE A 1 281 ? 121.708 24.240 24.922  1.00 54.87  ? 296  ILE A O   1 
ATOM   2097 C CB  . ILE A 1 281 ? 124.297 22.846 24.015  1.00 55.18  ? 296  ILE A CB  1 
ATOM   2098 C CG1 . ILE A 1 281 ? 125.217 21.638 24.143  1.00 54.72  ? 296  ILE A CG1 1 
ATOM   2099 C CG2 . ILE A 1 281 ? 124.988 23.990 23.299  1.00 55.73  ? 296  ILE A CG2 1 
ATOM   2100 C CD1 . ILE A 1 281 ? 125.612 21.035 22.838  1.00 58.25  ? 296  ILE A CD1 1 
ATOM   2101 N N   . LYS A 1 282 ? 123.291 25.622 25.720  1.00 53.96  ? 297  LYS A N   1 
ATOM   2102 C CA  . LYS A 1 282 ? 122.435 26.799 25.700  1.00 53.27  ? 297  LYS A CA  1 
ATOM   2103 C C   . LYS A 1 282 ? 122.325 27.392 24.282  1.00 52.36  ? 297  LYS A C   1 
ATOM   2104 O O   . LYS A 1 282 ? 123.157 27.126 23.408  1.00 53.00  ? 297  LYS A O   1 
ATOM   2105 C CB  . LYS A 1 282 ? 122.981 27.839 26.684  1.00 55.06  ? 297  LYS A CB  1 
ATOM   2106 C CG  . LYS A 1 282 ? 121.908 28.715 27.307  1.00 62.02  ? 297  LYS A CG  1 
ATOM   2107 C CD  . LYS A 1 282 ? 122.510 29.856 28.119  1.00 65.30  ? 297  LYS A CD  1 
ATOM   2108 C CE  . LYS A 1 282 ? 123.310 29.345 29.306  1.00 66.25  ? 297  LYS A CE  1 
ATOM   2109 N NZ  . LYS A 1 282 ? 123.805 30.460 30.154  1.00 65.62  ? 297  LYS A NZ  1 
ATOM   2110 N N   . ALA A 1 283 ? 121.293 28.198 24.057  1.00 51.52  ? 298  ALA A N   1 
ATOM   2111 C CA  . ALA A 1 283 ? 121.072 28.799 22.745  1.00 51.60  ? 298  ALA A CA  1 
ATOM   2112 C C   . ALA A 1 283 ? 121.868 30.066 22.498  1.00 50.80  ? 298  ALA A C   1 
ATOM   2113 O O   . ALA A 1 283 ? 122.199 30.798 23.424  1.00 54.76  ? 298  ALA A O   1 
ATOM   2114 C CB  . ALA A 1 283 ? 119.596 29.097 22.562  1.00 49.88  ? 298  ALA A CB  1 
ATOM   2115 N N   . HIS A 1 284 ? 122.179 30.322 21.236  1.00 48.08  ? 299  HIS A N   1 
ATOM   2116 C CA  . HIS A 1 284 ? 122.889 31.535 20.881  1.00 49.12  ? 299  HIS A CA  1 
ATOM   2117 C C   . HIS A 1 284 ? 121.844 32.652 20.772  1.00 47.65  ? 299  HIS A C   1 
ATOM   2118 O O   . HIS A 1 284 ? 120.649 32.385 20.632  1.00 48.03  ? 299  HIS A O   1 
ATOM   2119 C CB  . HIS A 1 284 ? 123.627 31.345 19.552  1.00 51.71  ? 299  HIS A CB  1 
ATOM   2120 C CG  . HIS A 1 284 ? 124.924 30.608 19.687  1.00 57.13  ? 299  HIS A CG  1 
ATOM   2121 N ND1 . HIS A 1 284 ? 125.059 29.469 20.453  1.00 60.42  ? 299  HIS A ND1 1 
ATOM   2122 C CD2 . HIS A 1 284 ? 126.146 30.849 19.153  1.00 59.40  ? 299  HIS A CD2 1 
ATOM   2123 C CE1 . HIS A 1 284 ? 126.308 29.040 20.387  1.00 60.12  ? 299  HIS A CE1 1 
ATOM   2124 N NE2 . HIS A 1 284 ? 126.989 29.860 19.604  1.00 61.97  ? 299  HIS A NE2 1 
ATOM   2125 N N   . PRO A 1 285 ? 122.279 33.917 20.857  1.00 47.18  ? 300  PRO A N   1 
ATOM   2126 C CA  . PRO A 1 285 ? 121.385 35.079 20.770  1.00 44.81  ? 300  PRO A CA  1 
ATOM   2127 C C   . PRO A 1 285 ? 120.881 35.261 19.353  1.00 43.69  ? 300  PRO A C   1 
ATOM   2128 O O   . PRO A 1 285 ? 121.671 35.237 18.406  1.00 42.22  ? 300  PRO A O   1 
ATOM   2129 C CB  . PRO A 1 285 ? 122.279 36.252 21.175  1.00 45.77  ? 300  PRO A CB  1 
ATOM   2130 C CG  . PRO A 1 285 ? 123.432 35.608 21.893  1.00 49.58  ? 300  PRO A CG  1 
ATOM   2131 C CD  . PRO A 1 285 ? 123.659 34.343 21.124  1.00 47.40  ? 300  PRO A CD  1 
ATOM   2132 N N   . TRP A 1 286 ? 119.577 35.459 19.202  1.00 44.62  ? 301  TRP A N   1 
ATOM   2133 C CA  . TRP A 1 286 ? 119.014 35.652 17.872  1.00 44.20  ? 301  TRP A CA  1 
ATOM   2134 C C   . TRP A 1 286 ? 119.616 36.886 17.222  1.00 42.19  ? 301  TRP A C   1 
ATOM   2135 O O   . TRP A 1 286 ? 119.807 36.919 16.002  1.00 40.34  ? 301  TRP A O   1 
ATOM   2136 C CB  . TRP A 1 286 ? 117.494 35.808 17.938  1.00 44.92  ? 301  TRP A CB  1 
ATOM   2137 C CG  . TRP A 1 286 ? 116.760 34.518 18.097  1.00 43.34  ? 301  TRP A CG  1 
ATOM   2138 C CD1 . TRP A 1 286 ? 116.092 34.082 19.204  1.00 42.19  ? 301  TRP A CD1 1 
ATOM   2139 C CD2 . TRP A 1 286 ? 116.590 33.508 17.102  1.00 40.86  ? 301  TRP A CD2 1 
ATOM   2140 N NE1 . TRP A 1 286 ? 115.508 32.864 18.955  1.00 38.47  ? 301  TRP A NE1 1 
ATOM   2141 C CE2 . TRP A 1 286 ? 115.798 32.489 17.670  1.00 38.76  ? 301  TRP A CE2 1 
ATOM   2142 C CE3 . TRP A 1 286 ? 117.029 33.365 15.779  1.00 43.27  ? 301  TRP A CE3 1 
ATOM   2143 C CZ2 . TRP A 1 286 ? 115.434 31.343 16.964  1.00 39.30  ? 301  TRP A CZ2 1 
ATOM   2144 C CZ3 . TRP A 1 286 ? 116.667 32.221 15.075  1.00 42.12  ? 301  TRP A CZ3 1 
ATOM   2145 C CH2 . TRP A 1 286 ? 115.874 31.226 15.673  1.00 40.68  ? 301  TRP A CH2 1 
ATOM   2146 N N   . THR A 1 287 ? 119.916 37.892 18.048  1.00 39.59  ? 302  THR A N   1 
ATOM   2147 C CA  . THR A 1 287 ? 120.486 39.152 17.575  1.00 42.06  ? 302  THR A CA  1 
ATOM   2148 C C   . THR A 1 287 ? 121.790 38.946 16.821  1.00 43.68  ? 302  THR A C   1 
ATOM   2149 O O   . THR A 1 287 ? 122.172 39.770 15.979  1.00 46.98  ? 302  THR A O   1 
ATOM   2150 C CB  . THR A 1 287 ? 120.732 40.141 18.747  1.00 42.20  ? 302  THR A CB  1 
ATOM   2151 O OG1 . THR A 1 287 ? 121.378 39.465 19.835  1.00 48.02  ? 302  THR A OG1 1 
ATOM   2152 C CG2 . THR A 1 287 ? 119.420 40.730 19.232  1.00 38.61  ? 302  THR A CG2 1 
ATOM   2153 N N   . LYS A 1 288 ? 122.467 37.839 17.115  1.00 42.85  ? 303  LYS A N   1 
ATOM   2154 C CA  . LYS A 1 288 ? 123.729 37.534 16.457  1.00 42.80  ? 303  LYS A CA  1 
ATOM   2155 C C   . LYS A 1 288 ? 123.589 36.514 15.333  1.00 43.44  ? 303  LYS A C   1 
ATOM   2156 O O   . LYS A 1 288 ? 124.489 36.378 14.502  1.00 40.65  ? 303  LYS A O   1 
ATOM   2157 C CB  . LYS A 1 288 ? 124.759 37.072 17.485  1.00 40.74  ? 303  LYS A CB  1 
ATOM   2158 C CG  . LYS A 1 288 ? 125.064 38.154 18.521  1.00 50.03  ? 303  LYS A CG  1 
ATOM   2159 C CD  . LYS A 1 288 ? 125.312 39.515 17.851  1.00 51.51  ? 303  LYS A CD  1 
ATOM   2160 C CE  . LYS A 1 288 ? 125.193 40.670 18.838  1.00 54.29  ? 303  LYS A CE  1 
ATOM   2161 N NZ  . LYS A 1 288 ? 125.283 41.989 18.134  1.00 59.61  ? 303  LYS A NZ  1 
ATOM   2162 N N   . VAL A 1 289 ? 122.459 35.809 15.291  1.00 41.43  ? 304  VAL A N   1 
ATOM   2163 C CA  . VAL A 1 289 ? 122.245 34.844 14.227  1.00 39.32  ? 304  VAL A CA  1 
ATOM   2164 C C   . VAL A 1 289 ? 122.215 35.594 12.922  1.00 39.88  ? 304  VAL A C   1 
ATOM   2165 O O   . VAL A 1 289 ? 122.749 35.124 11.922  1.00 41.37  ? 304  VAL A O   1 
ATOM   2166 C CB  . VAL A 1 289 ? 120.910 34.101 14.355  1.00 41.25  ? 304  VAL A CB  1 
ATOM   2167 C CG1 . VAL A 1 289 ? 120.708 33.205 13.158  1.00 34.32  ? 304  VAL A CG1 1 
ATOM   2168 C CG2 . VAL A 1 289 ? 120.893 33.273 15.614  1.00 41.11  ? 304  VAL A CG2 1 
ATOM   2169 N N   . PHE A 1 290 ? 121.595 36.773 12.934  1.00 40.99  ? 305  PHE A N   1 
ATOM   2170 C CA  . PHE A 1 290 ? 121.473 37.580 11.718  1.00 38.51  ? 305  PHE A CA  1 
ATOM   2171 C C   . PHE A 1 290 ? 122.468 38.729 11.656  1.00 37.47  ? 305  PHE A C   1 
ATOM   2172 O O   . PHE A 1 290 ? 123.066 39.095 12.672  1.00 34.96  ? 305  PHE A O   1 
ATOM   2173 C CB  . PHE A 1 290 ? 120.044 38.120 11.583  1.00 36.85  ? 305  PHE A CB  1 
ATOM   2174 C CG  . PHE A 1 290 ? 118.974 37.067 11.739  1.00 32.34  ? 305  PHE A CG  1 
ATOM   2175 C CD1 . PHE A 1 290 ? 118.497 36.723 13.002  1.00 29.91  ? 305  PHE A CD1 1 
ATOM   2176 C CD2 . PHE A 1 290 ? 118.461 36.402 10.625  1.00 31.82  ? 305  PHE A CD2 1 
ATOM   2177 C CE1 . PHE A 1 290 ? 117.520 35.729 13.156  1.00 27.95  ? 305  PHE A CE1 1 
ATOM   2178 C CE2 . PHE A 1 290 ? 117.489 35.408 10.767  1.00 30.96  ? 305  PHE A CE2 1 
ATOM   2179 C CZ  . PHE A 1 290 ? 117.017 35.071 12.038  1.00 30.97  ? 305  PHE A CZ  1 
ATOM   2180 N N   . ARG A 1 291 ? 122.640 39.287 10.455  1.00 40.25  ? 306  ARG A N   1 
ATOM   2181 C CA  . ARG A 1 291 ? 123.574 40.390 10.244  1.00 43.08  ? 306  ARG A CA  1 
ATOM   2182 C C   . ARG A 1 291 ? 123.163 41.508 11.183  1.00 42.03  ? 306  ARG A C   1 
ATOM   2183 O O   . ARG A 1 291 ? 122.039 41.528 11.665  1.00 40.83  ? 306  ARG A O   1 
ATOM   2184 C CB  . ARG A 1 291 ? 123.524 40.886 8.793   1.00 48.19  ? 306  ARG A CB  1 
ATOM   2185 C CG  . ARG A 1 291 ? 122.442 41.929 8.542   1.00 58.16  ? 306  ARG A CG  1 
ATOM   2186 C CD  . ARG A 1 291 ? 122.454 42.497 7.124   1.00 65.12  ? 306  ARG A CD  1 
ATOM   2187 N NE  . ARG A 1 291 ? 122.192 41.471 6.122   1.00 68.47  ? 306  ARG A NE  1 
ATOM   2188 C CZ  . ARG A 1 291 ? 123.138 40.751 5.525   1.00 71.89  ? 306  ARG A CZ  1 
ATOM   2189 N NH1 . ARG A 1 291 ? 124.417 40.955 5.827   1.00 72.44  ? 306  ARG A NH1 1 
ATOM   2190 N NH2 . ARG A 1 291 ? 122.803 39.821 4.633   1.00 75.11  ? 306  ARG A NH2 1 
ATOM   2191 N N   . PRO A 1 292 ? 124.067 42.460 11.452  1.00 43.48  ? 307  PRO A N   1 
ATOM   2192 C CA  . PRO A 1 292 ? 123.737 43.569 12.358  1.00 43.52  ? 307  PRO A CA  1 
ATOM   2193 C C   . PRO A 1 292 ? 122.560 44.471 11.930  1.00 44.85  ? 307  PRO A C   1 
ATOM   2194 O O   . PRO A 1 292 ? 121.784 44.928 12.776  1.00 46.01  ? 307  PRO A O   1 
ATOM   2195 C CB  . PRO A 1 292 ? 125.061 44.343 12.446  1.00 42.27  ? 307  PRO A CB  1 
ATOM   2196 C CG  . PRO A 1 292 ? 126.103 43.278 12.203  1.00 38.66  ? 307  PRO A CG  1 
ATOM   2197 C CD  . PRO A 1 292 ? 125.490 42.507 11.062  1.00 41.02  ? 307  PRO A CD  1 
ATOM   2198 N N   . ARG A 1 293 ? 122.424 44.717 10.627  1.00 46.13  ? 308  ARG A N   1 
ATOM   2199 C CA  . ARG A 1 293 ? 121.366 45.595 10.126  1.00 50.15  ? 308  ARG A CA  1 
ATOM   2200 C C   . ARG A 1 293 ? 119.977 45.002 10.025  1.00 50.46  ? 308  ARG A C   1 
ATOM   2201 O O   . ARG A 1 293 ? 119.044 45.700 9.648   1.00 53.26  ? 308  ARG A O   1 
ATOM   2202 C CB  . ARG A 1 293 ? 121.731 46.180 8.754   1.00 55.51  ? 308  ARG A CB  1 
ATOM   2203 C CG  . ARG A 1 293 ? 122.801 47.286 8.776   1.00 62.58  ? 308  ARG A CG  1 
ATOM   2204 C CD  . ARG A 1 293 ? 124.188 46.676 8.906   1.00 71.00  ? 308  ARG A CD  1 
ATOM   2205 N NE  . ARG A 1 293 ? 124.421 45.714 7.832   1.00 72.60  ? 308  ARG A NE  1 
ATOM   2206 C CZ  . ARG A 1 293 ? 125.354 44.779 7.863   1.00 72.07  ? 308  ARG A CZ  1 
ATOM   2207 N NH1 . ARG A 1 293 ? 126.145 44.685 8.920   1.00 73.20  ? 308  ARG A NH1 1 
ATOM   2208 N NH2 . ARG A 1 293 ? 125.479 43.940 6.844   1.00 75.56  ? 308  ARG A NH2 1 
ATOM   2209 N N   . THR A 1 294 ? 119.837 43.723 10.348  1.00 50.18  ? 309  THR A N   1 
ATOM   2210 C CA  . THR A 1 294 ? 118.542 43.043 10.292  1.00 46.50  ? 309  THR A CA  1 
ATOM   2211 C C   . THR A 1 294 ? 117.495 43.748 11.170  1.00 43.60  ? 309  THR A C   1 
ATOM   2212 O O   . THR A 1 294 ? 117.732 43.996 12.361  1.00 43.95  ? 309  THR A O   1 
ATOM   2213 C CB  . THR A 1 294 ? 118.679 41.581 10.765  1.00 45.94  ? 309  THR A CB  1 
ATOM   2214 O OG1 . THR A 1 294 ? 119.683 40.925 9.985   1.00 43.66  ? 309  THR A OG1 1 
ATOM   2215 C CG2 . THR A 1 294 ? 117.356 40.837 10.615  1.00 53.61  ? 309  THR A CG2 1 
ATOM   2216 N N   . PRO A 1 295 ? 116.332 44.101 10.585  1.00 42.17  ? 310  PRO A N   1 
ATOM   2217 C CA  . PRO A 1 295 ? 115.297 44.770 11.379  1.00 39.67  ? 310  PRO A CA  1 
ATOM   2218 C C   . PRO A 1 295 ? 114.883 43.909 12.568  1.00 42.20  ? 310  PRO A C   1 
ATOM   2219 O O   . PRO A 1 295 ? 114.434 42.775 12.403  1.00 46.64  ? 310  PRO A O   1 
ATOM   2220 C CB  . PRO A 1 295 ? 114.167 45.011 10.369  1.00 39.28  ? 310  PRO A CB  1 
ATOM   2221 C CG  . PRO A 1 295 ? 114.476 44.100 9.229   1.00 39.41  ? 310  PRO A CG  1 
ATOM   2222 C CD  . PRO A 1 295 ? 115.965 44.072 9.160   1.00 39.75  ? 310  PRO A CD  1 
ATOM   2223 N N   . PRO A 1 296 ? 115.025 44.454 13.788  1.00 43.02  ? 311  PRO A N   1 
ATOM   2224 C CA  . PRO A 1 296 ? 114.703 43.804 15.066  1.00 42.15  ? 311  PRO A CA  1 
ATOM   2225 C C   . PRO A 1 296 ? 113.388 43.023 15.108  1.00 42.91  ? 311  PRO A C   1 
ATOM   2226 O O   . PRO A 1 296 ? 113.327 41.923 15.661  1.00 46.32  ? 311  PRO A O   1 
ATOM   2227 C CB  . PRO A 1 296 ? 114.705 44.973 16.052  1.00 43.88  ? 311  PRO A CB  1 
ATOM   2228 C CG  . PRO A 1 296 ? 115.662 45.952 15.426  1.00 44.13  ? 311  PRO A CG  1 
ATOM   2229 C CD  . PRO A 1 296 ? 115.273 45.896 13.987  1.00 40.70  ? 311  PRO A CD  1 
ATOM   2230 N N   . GLU A 1 297 ? 112.341 43.601 14.526  1.00 40.63  ? 312  GLU A N   1 
ATOM   2231 C CA  . GLU A 1 297 ? 111.024 42.977 14.513  1.00 40.62  ? 312  GLU A CA  1 
ATOM   2232 C C   . GLU A 1 297 ? 110.952 41.714 13.677  1.00 38.20  ? 312  GLU A C   1 
ATOM   2233 O O   . GLU A 1 297 ? 110.078 40.873 13.897  1.00 34.24  ? 312  GLU A O   1 
ATOM   2234 C CB  . GLU A 1 297 ? 109.968 43.986 14.049  1.00 39.34  ? 312  GLU A CB  1 
ATOM   2235 C CG  . GLU A 1 297 ? 109.279 44.688 15.217  1.00 50.46  ? 312  GLU A CG  1 
ATOM   2236 C CD  . GLU A 1 297 ? 108.226 45.698 14.786  1.00 58.20  ? 312  GLU A CD  1 
ATOM   2237 O OE1 . GLU A 1 297 ? 107.428 46.135 15.658  1.00 60.70  ? 312  GLU A OE1 1 
ATOM   2238 O OE2 . GLU A 1 297 ? 108.203 46.055 13.583  1.00 59.33  ? 312  GLU A OE2 1 
ATOM   2239 N N   . ALA A 1 298 ? 111.860 41.592 12.713  1.00 32.73  ? 313  ALA A N   1 
ATOM   2240 C CA  . ALA A 1 298 ? 111.908 40.415 11.870  1.00 32.67  ? 313  ALA A CA  1 
ATOM   2241 C C   . ALA A 1 298 ? 112.537 39.312 12.727  1.00 32.26  ? 313  ALA A C   1 
ATOM   2242 O O   . ALA A 1 298 ? 112.113 38.153 12.687  1.00 28.91  ? 313  ALA A O   1 
ATOM   2243 C CB  . ALA A 1 298 ? 112.744 40.691 10.647  1.00 30.25  ? 313  ALA A CB  1 
ATOM   2244 N N   . ILE A 1 299 ? 113.543 39.690 13.514  1.00 31.11  ? 314  ILE A N   1 
ATOM   2245 C CA  . ILE A 1 299 ? 114.217 38.756 14.402  1.00 33.41  ? 314  ILE A CA  1 
ATOM   2246 C C   . ILE A 1 299 ? 113.212 38.312 15.469  1.00 34.81  ? 314  ILE A C   1 
ATOM   2247 O O   . ILE A 1 299 ? 113.057 37.116 15.748  1.00 35.48  ? 314  ILE A O   1 
ATOM   2248 C CB  . ILE A 1 299 ? 115.419 39.424 15.104  1.00 31.89  ? 314  ILE A CB  1 
ATOM   2249 C CG1 . ILE A 1 299 ? 116.375 40.008 14.063  1.00 32.29  ? 314  ILE A CG1 1 
ATOM   2250 C CG2 . ILE A 1 299 ? 116.135 38.413 16.000  1.00 28.08  ? 314  ILE A CG2 1 
ATOM   2251 C CD1 . ILE A 1 299 ? 117.620 40.631 14.671  1.00 31.88  ? 314  ILE A CD1 1 
ATOM   2252 N N   . ALA A 1 300 ? 112.527 39.286 16.063  1.00 35.07  ? 315  ALA A N   1 
ATOM   2253 C CA  . ALA A 1 300 ? 111.533 38.995 17.092  1.00 36.09  ? 315  ALA A CA  1 
ATOM   2254 C C   . ALA A 1 300 ? 110.509 37.981 16.568  1.00 36.09  ? 315  ALA A C   1 
ATOM   2255 O O   . ALA A 1 300 ? 110.267 36.955 17.204  1.00 37.88  ? 315  ALA A O   1 
ATOM   2256 C CB  . ALA A 1 300 ? 110.842 40.278 17.526  1.00 30.78  ? 315  ALA A CB  1 
ATOM   2257 N N   . LEU A 1 301 ? 109.919 38.268 15.408  1.00 34.04  ? 316  LEU A N   1 
ATOM   2258 C CA  . LEU A 1 301 ? 108.934 37.377 14.786  1.00 33.57  ? 316  LEU A CA  1 
ATOM   2259 C C   . LEU A 1 301 ? 109.520 35.984 14.604  1.00 35.87  ? 316  LEU A C   1 
ATOM   2260 O O   . LEU A 1 301 ? 108.909 34.969 14.949  1.00 34.21  ? 316  LEU A O   1 
ATOM   2261 C CB  . LEU A 1 301 ? 108.514 37.919 13.418  1.00 25.76  ? 316  LEU A CB  1 
ATOM   2262 C CG  . LEU A 1 301 ? 107.743 36.945 12.532  1.00 30.00  ? 316  LEU A CG  1 
ATOM   2263 C CD1 . LEU A 1 301 ? 106.517 36.433 13.267  1.00 21.29  ? 316  LEU A CD1 1 
ATOM   2264 C CD2 . LEU A 1 301 ? 107.351 37.630 11.241  1.00 23.17  ? 316  LEU A CD2 1 
ATOM   2265 N N   . CYS A 1 302 ? 110.722 35.956 14.054  1.00 38.12  ? 317  CYS A N   1 
ATOM   2266 C CA  . CYS A 1 302 ? 111.430 34.715 13.802  1.00 40.17  ? 317  CYS A CA  1 
ATOM   2267 C C   . CYS A 1 302 ? 111.600 33.873 15.068  1.00 39.56  ? 317  CYS A C   1 
ATOM   2268 O O   . CYS A 1 302 ? 111.471 32.662 15.019  1.00 37.93  ? 317  CYS A O   1 
ATOM   2269 C CB  . CYS A 1 302 ? 112.790 35.043 13.196  1.00 45.17  ? 317  CYS A CB  1 
ATOM   2270 S SG  . CYS A 1 302 ? 113.624 33.671 12.423  1.00 54.01  ? 317  CYS A SG  1 
ATOM   2271 N N   . SER A 1 303 ? 111.874 34.509 16.201  1.00 38.52  ? 318  SER A N   1 
ATOM   2272 C CA  . SER A 1 303 ? 112.058 33.775 17.452  1.00 36.27  ? 318  SER A CA  1 
ATOM   2273 C C   . SER A 1 303 ? 110.783 33.103 17.962  1.00 38.10  ? 318  SER A C   1 
ATOM   2274 O O   . SER A 1 303 ? 110.847 32.166 18.771  1.00 39.33  ? 318  SER A O   1 
ATOM   2275 C CB  . SER A 1 303 ? 112.578 34.707 18.544  1.00 35.47  ? 318  SER A CB  1 
ATOM   2276 O OG  . SER A 1 303 ? 111.551 35.562 19.034  1.00 38.89  ? 318  SER A OG  1 
ATOM   2277 N N   . ARG A 1 304 ? 109.628 33.588 17.506  1.00 36.22  ? 319  ARG A N   1 
ATOM   2278 C CA  . ARG A 1 304 ? 108.344 33.041 17.935  1.00 33.03  ? 319  ARG A CA  1 
ATOM   2279 C C   . ARG A 1 304 ? 107.865 31.959 16.987  1.00 34.02  ? 319  ARG A C   1 
ATOM   2280 O O   . ARG A 1 304 ? 106.865 31.299 17.243  1.00 36.83  ? 319  ARG A O   1 
ATOM   2281 C CB  . ARG A 1 304 ? 107.298 34.153 18.035  1.00 34.30  ? 319  ARG A CB  1 
ATOM   2282 C CG  . ARG A 1 304 ? 107.643 35.243 19.043  1.00 34.47  ? 319  ARG A CG  1 
ATOM   2283 C CD  . ARG A 1 304 ? 107.758 34.690 20.463  1.00 31.00  ? 319  ARG A CD  1 
ATOM   2284 N NE  . ARG A 1 304 ? 106.506 34.096 20.923  1.00 35.76  ? 319  ARG A NE  1 
ATOM   2285 C CZ  . ARG A 1 304 ? 105.471 34.785 21.389  1.00 37.26  ? 319  ARG A CZ  1 
ATOM   2286 N NH1 . ARG A 1 304 ? 105.528 36.105 21.478  1.00 41.30  ? 319  ARG A NH1 1 
ATOM   2287 N NH2 . ARG A 1 304 ? 104.356 34.156 21.725  1.00 34.43  ? 319  ARG A NH2 1 
ATOM   2288 N N   . LEU A 1 305 ? 108.589 31.790 15.886  1.00 36.19  ? 320  LEU A N   1 
ATOM   2289 C CA  . LEU A 1 305 ? 108.277 30.769 14.885  1.00 34.41  ? 320  LEU A CA  1 
ATOM   2290 C C   . LEU A 1 305 ? 109.212 29.566 15.060  1.00 34.92  ? 320  LEU A C   1 
ATOM   2291 O O   . LEU A 1 305 ? 108.770 28.422 15.019  1.00 36.57  ? 320  LEU A O   1 
ATOM   2292 C CB  . LEU A 1 305 ? 108.443 31.329 13.466  1.00 34.92  ? 320  LEU A CB  1 
ATOM   2293 C CG  . LEU A 1 305 ? 107.618 32.574 13.130  1.00 37.62  ? 320  LEU A CG  1 
ATOM   2294 C CD1 . LEU A 1 305 ? 107.911 33.019 11.706  1.00 32.09  ? 320  LEU A CD1 1 
ATOM   2295 C CD2 . LEU A 1 305 ? 106.136 32.272 13.306  1.00 34.06  ? 320  LEU A CD2 1 
ATOM   2296 N N   . LEU A 1 306 ? 110.501 29.828 15.258  1.00 34.62  ? 321  LEU A N   1 
ATOM   2297 C CA  . LEU A 1 306 ? 111.468 28.759 15.433  1.00 33.22  ? 321  LEU A CA  1 
ATOM   2298 C C   . LEU A 1 306 ? 111.626 28.413 16.904  1.00 34.92  ? 321  LEU A C   1 
ATOM   2299 O O   . LEU A 1 306 ? 112.618 28.756 17.536  1.00 33.57  ? 321  LEU A O   1 
ATOM   2300 C CB  . LEU A 1 306 ? 112.813 29.153 14.823  1.00 29.66  ? 321  LEU A CB  1 
ATOM   2301 C CG  . LEU A 1 306 ? 112.785 29.486 13.319  1.00 34.43  ? 321  LEU A CG  1 
ATOM   2302 C CD1 . LEU A 1 306 ? 114.204 29.743 12.823  1.00 35.21  ? 321  LEU A CD1 1 
ATOM   2303 C CD2 . LEU A 1 306 ? 112.158 28.355 12.521  1.00 34.55  ? 321  LEU A CD2 1 
ATOM   2304 N N   . GLU A 1 307 ? 110.612 27.730 17.433  1.00 37.63  ? 322  GLU A N   1 
ATOM   2305 C CA  . GLU A 1 307 ? 110.559 27.282 18.822  1.00 38.67  ? 322  GLU A CA  1 
ATOM   2306 C C   . GLU A 1 307 ? 110.535 25.762 18.850  1.00 38.76  ? 322  GLU A C   1 
ATOM   2307 O O   . GLU A 1 307 ? 110.010 25.123 17.940  1.00 40.67  ? 322  GLU A O   1 
ATOM   2308 C CB  . GLU A 1 307 ? 109.283 27.791 19.492  1.00 40.85  ? 322  GLU A CB  1 
ATOM   2309 C CG  . GLU A 1 307 ? 109.273 29.272 19.725  1.00 45.44  ? 322  GLU A CG  1 
ATOM   2310 C CD  . GLU A 1 307 ? 109.722 29.634 21.126  1.00 48.47  ? 322  GLU A CD  1 
ATOM   2311 O OE1 . GLU A 1 307 ? 110.505 28.862 21.738  1.00 45.63  ? 322  GLU A OE1 1 
ATOM   2312 O OE2 . GLU A 1 307 ? 109.294 30.707 21.608  1.00 47.95  ? 322  GLU A OE2 1 
ATOM   2313 N N   . TYR A 1 308 ? 111.099 25.175 19.894  1.00 40.88  ? 323  TYR A N   1 
ATOM   2314 C CA  . TYR A 1 308 ? 111.082 23.731 20.005  1.00 37.45  ? 323  TYR A CA  1 
ATOM   2315 C C   . TYR A 1 308 ? 109.667 23.259 20.289  1.00 39.94  ? 323  TYR A C   1 
ATOM   2316 O O   . TYR A 1 308 ? 109.189 22.320 19.654  1.00 43.76  ? 323  TYR A O   1 
ATOM   2317 C CB  . TYR A 1 308 ? 112.012 23.278 21.116  1.00 35.45  ? 323  TYR A CB  1 
ATOM   2318 C CG  . TYR A 1 308 ? 113.407 22.991 20.634  1.00 37.71  ? 323  TYR A CG  1 
ATOM   2319 C CD1 . TYR A 1 308 ? 114.508 23.287 21.430  1.00 35.93  ? 323  TYR A CD1 1 
ATOM   2320 C CD2 . TYR A 1 308 ? 113.629 22.395 19.392  1.00 35.97  ? 323  TYR A CD2 1 
ATOM   2321 C CE1 . TYR A 1 308 ? 115.793 22.999 21.008  1.00 39.45  ? 323  TYR A CE1 1 
ATOM   2322 C CE2 . TYR A 1 308 ? 114.908 22.102 18.966  1.00 38.55  ? 323  TYR A CE2 1 
ATOM   2323 C CZ  . TYR A 1 308 ? 115.985 22.406 19.780  1.00 37.69  ? 323  TYR A CZ  1 
ATOM   2324 O OH  . TYR A 1 308 ? 117.262 22.104 19.384  1.00 40.30  ? 323  TYR A OH  1 
ATOM   2325 N N   . THR A 1 309 ? 108.988 23.918 21.225  1.00 36.84  ? 324  THR A N   1 
ATOM   2326 C CA  . THR A 1 309 ? 107.623 23.534 21.574  1.00 34.62  ? 324  THR A CA  1 
ATOM   2327 C C   . THR A 1 309 ? 106.614 23.911 20.488  1.00 36.37  ? 324  THR A C   1 
ATOM   2328 O O   . THR A 1 309 ? 106.297 25.089 20.293  1.00 38.65  ? 324  THR A O   1 
ATOM   2329 C CB  . THR A 1 309 ? 107.168 24.173 22.903  1.00 32.18  ? 324  THR A CB  1 
ATOM   2330 O OG1 . THR A 1 309 ? 108.040 23.762 23.963  1.00 32.06  ? 324  THR A OG1 1 
ATOM   2331 C CG2 . THR A 1 309 ? 105.756 23.730 23.239  1.00 27.89  ? 324  THR A CG2 1 
ATOM   2332 N N   . PRO A 1 310 ? 106.073 22.903 19.787  1.00 36.24  ? 325  PRO A N   1 
ATOM   2333 C CA  . PRO A 1 310 ? 105.097 23.082 18.712  1.00 35.75  ? 325  PRO A CA  1 
ATOM   2334 C C   . PRO A 1 310 ? 103.948 24.016 19.078  1.00 38.83  ? 325  PRO A C   1 
ATOM   2335 O O   . PRO A 1 310 ? 103.625 24.949 18.344  1.00 39.26  ? 325  PRO A O   1 
ATOM   2336 C CB  . PRO A 1 310 ? 104.611 21.661 18.454  1.00 34.88  ? 325  PRO A CB  1 
ATOM   2337 C CG  . PRO A 1 310 ? 105.796 20.822 18.828  1.00 34.68  ? 325  PRO A CG  1 
ATOM   2338 C CD  . PRO A 1 310 ? 106.275 21.472 20.081  1.00 37.50  ? 325  PRO A CD  1 
ATOM   2339 N N   . THR A 1 311 ? 103.330 23.754 20.222  1.00 39.29  ? 326  THR A N   1 
ATOM   2340 C CA  . THR A 1 311 ? 102.193 24.542 20.695  1.00 37.27  ? 326  THR A CA  1 
ATOM   2341 C C   . THR A 1 311 ? 102.557 25.996 21.012  1.00 38.01  ? 326  THR A C   1 
ATOM   2342 O O   . THR A 1 311 ? 101.668 26.848 21.138  1.00 38.86  ? 326  THR A O   1 
ATOM   2343 C CB  . THR A 1 311 ? 101.560 23.883 21.955  1.00 35.35  ? 326  THR A CB  1 
ATOM   2344 O OG1 . THR A 1 311 ? 102.515 23.854 23.025  1.00 37.28  ? 326  THR A OG1 1 
ATOM   2345 C CG2 . THR A 1 311 ? 101.155 22.458 21.657  1.00 35.06  ? 326  THR A CG2 1 
ATOM   2346 N N   . ALA A 1 312 ? 103.857 26.272 21.127  1.00 35.69  ? 327  ALA A N   1 
ATOM   2347 C CA  . ALA A 1 312 ? 104.341 27.614 21.443  1.00 37.35  ? 327  ALA A CA  1 
ATOM   2348 C C   . ALA A 1 312 ? 104.544 28.494 20.210  1.00 37.65  ? 327  ALA A C   1 
ATOM   2349 O O   . ALA A 1 312 ? 104.662 29.718 20.323  1.00 39.89  ? 327  ALA A O   1 
ATOM   2350 C CB  . ALA A 1 312 ? 105.637 27.525 22.223  1.00 39.25  ? 327  ALA A CB  1 
ATOM   2351 N N   . ARG A 1 313 ? 104.594 27.881 19.033  1.00 37.48  ? 328  ARG A N   1 
ATOM   2352 C CA  . ARG A 1 313 ? 104.779 28.644 17.814  1.00 36.45  ? 328  ARG A CA  1 
ATOM   2353 C C   . ARG A 1 313 ? 103.542 29.487 17.567  1.00 38.55  ? 328  ARG A C   1 
ATOM   2354 O O   . ARG A 1 313 ? 102.427 29.078 17.913  1.00 41.15  ? 328  ARG A O   1 
ATOM   2355 C CB  . ARG A 1 313 ? 105.024 27.697 16.638  1.00 34.53  ? 328  ARG A CB  1 
ATOM   2356 C CG  . ARG A 1 313 ? 106.319 26.929 16.770  1.00 34.50  ? 328  ARG A CG  1 
ATOM   2357 C CD  . ARG A 1 313 ? 106.463 25.797 15.770  1.00 30.66  ? 328  ARG A CD  1 
ATOM   2358 N NE  . ARG A 1 313 ? 107.506 24.891 16.238  1.00 33.40  ? 328  ARG A NE  1 
ATOM   2359 C CZ  . ARG A 1 313 ? 107.648 23.629 15.851  1.00 34.07  ? 328  ARG A CZ  1 
ATOM   2360 N NH1 . ARG A 1 313 ? 106.816 23.104 14.968  1.00 30.71  ? 328  ARG A NH1 1 
ATOM   2361 N NH2 . ARG A 1 313 ? 108.601 22.879 16.386  1.00 33.07  ? 328  ARG A NH2 1 
ATOM   2362 N N   . LEU A 1 314 ? 103.741 30.674 16.998  1.00 37.08  ? 329  LEU A N   1 
ATOM   2363 C CA  . LEU A 1 314 ? 102.632 31.572 16.669  1.00 39.72  ? 329  LEU A CA  1 
ATOM   2364 C C   . LEU A 1 314 ? 101.770 30.874 15.620  1.00 39.12  ? 329  LEU A C   1 
ATOM   2365 O O   . LEU A 1 314 ? 102.265 30.049 14.855  1.00 39.74  ? 329  LEU A O   1 
ATOM   2366 C CB  . LEU A 1 314 ? 103.171 32.883 16.080  1.00 38.76  ? 329  LEU A CB  1 
ATOM   2367 C CG  . LEU A 1 314 ? 103.394 34.103 16.982  1.00 42.32  ? 329  LEU A CG  1 
ATOM   2368 C CD1 . LEU A 1 314 ? 103.945 33.689 18.321  1.00 45.18  ? 329  LEU A CD1 1 
ATOM   2369 C CD2 . LEU A 1 314 ? 104.334 35.073 16.295  1.00 42.33  ? 329  LEU A CD2 1 
ATOM   2370 N N   . THR A 1 315 ? 100.481 31.179 15.582  1.00 38.61  ? 330  THR A N   1 
ATOM   2371 C CA  . THR A 1 315 ? 99.634  30.569 14.571  1.00 38.49  ? 330  THR A CA  1 
ATOM   2372 C C   . THR A 1 315 ? 99.738  31.497 13.365  1.00 37.65  ? 330  THR A C   1 
ATOM   2373 O O   . THR A 1 315 ? 100.104 32.661 13.509  1.00 38.13  ? 330  THR A O   1 
ATOM   2374 C CB  . THR A 1 315 ? 98.169  30.510 15.013  1.00 40.66  ? 330  THR A CB  1 
ATOM   2375 O OG1 . THR A 1 315 ? 97.650  31.843 15.107  1.00 44.23  ? 330  THR A OG1 1 
ATOM   2376 C CG2 . THR A 1 315 ? 98.041  29.803 16.355  1.00 36.77  ? 330  THR A CG2 1 
ATOM   2377 N N   . PRO A 1 316 ? 99.426  30.999 12.159  1.00 36.77  ? 331  PRO A N   1 
ATOM   2378 C CA  . PRO A 1 316 ? 99.506  31.848 10.969  1.00 32.98  ? 331  PRO A CA  1 
ATOM   2379 C C   . PRO A 1 316 ? 98.827  33.208 11.163  1.00 34.22  ? 331  PRO A C   1 
ATOM   2380 O O   . PRO A 1 316 ? 99.420  34.248 10.861  1.00 35.28  ? 331  PRO A O   1 
ATOM   2381 C CB  . PRO A 1 316 ? 98.824  30.999 9.906   1.00 36.21  ? 331  PRO A CB  1 
ATOM   2382 C CG  . PRO A 1 316 ? 99.207  29.605 10.312  1.00 32.79  ? 331  PRO A CG  1 
ATOM   2383 C CD  . PRO A 1 316 ? 99.002  29.631 11.807  1.00 32.82  ? 331  PRO A CD  1 
ATOM   2384 N N   . LEU A 1 317 ? 97.590  33.200 11.664  1.00 32.91  ? 332  LEU A N   1 
ATOM   2385 C CA  . LEU A 1 317 ? 96.848  34.447 11.912  1.00 35.98  ? 332  LEU A CA  1 
ATOM   2386 C C   . LEU A 1 317 ? 97.552  35.355 12.921  1.00 36.99  ? 332  LEU A C   1 
ATOM   2387 O O   . LEU A 1 317 ? 97.655  36.565 12.714  1.00 34.13  ? 332  LEU A O   1 
ATOM   2388 C CB  . LEU A 1 317 ? 95.440  34.164 12.443  1.00 40.03  ? 332  LEU A CB  1 
ATOM   2389 C CG  . LEU A 1 317 ? 94.234  34.064 11.512  1.00 43.91  ? 332  LEU A CG  1 
ATOM   2390 C CD1 . LEU A 1 317 ? 92.983  34.324 12.347  1.00 46.67  ? 332  LEU A CD1 1 
ATOM   2391 C CD2 . LEU A 1 317 ? 94.320  35.086 10.388  1.00 42.74  ? 332  LEU A CD2 1 
ATOM   2392 N N   . GLU A 1 318 ? 98.004  34.769 14.029  1.00 38.45  ? 333  GLU A N   1 
ATOM   2393 C CA  . GLU A 1 318 ? 98.703  35.538 15.046  1.00 41.72  ? 333  GLU A CA  1 
ATOM   2394 C C   . GLU A 1 318 ? 99.919  36.185 14.380  1.00 41.57  ? 333  GLU A C   1 
ATOM   2395 O O   . GLU A 1 318 ? 100.252 37.337 14.670  1.00 43.27  ? 333  GLU A O   1 
ATOM   2396 C CB  . GLU A 1 318 ? 99.162  34.636 16.207  1.00 42.62  ? 333  GLU A CB  1 
ATOM   2397 C CG  . GLU A 1 318 ? 98.044  33.873 16.925  1.00 46.80  ? 333  GLU A CG  1 
ATOM   2398 C CD  . GLU A 1 318 ? 98.531  33.099 18.163  1.00 51.38  ? 333  GLU A CD  1 
ATOM   2399 O OE1 . GLU A 1 318 ? 99.574  32.399 18.086  1.00 51.59  ? 333  GLU A OE1 1 
ATOM   2400 O OE2 . GLU A 1 318 ? 97.856  33.184 19.217  1.00 52.72  ? 333  GLU A OE2 1 
ATOM   2401 N N   . ALA A 1 319 ? 100.563 35.445 13.476  1.00 40.12  ? 334  ALA A N   1 
ATOM   2402 C CA  . ALA A 1 319 ? 101.744 35.936 12.781  1.00 39.84  ? 334  ALA A CA  1 
ATOM   2403 C C   . ALA A 1 319 ? 101.382 37.031 11.793  1.00 39.41  ? 334  ALA A C   1 
ATOM   2404 O O   . ALA A 1 319 ? 102.135 37.988 11.618  1.00 39.07  ? 334  ALA A O   1 
ATOM   2405 C CB  . ALA A 1 319 ? 102.447 34.796 12.070  1.00 37.49  ? 334  ALA A CB  1 
ATOM   2406 N N   . CYS A 1 320 ? 100.243 36.896 11.130  1.00 37.03  ? 335  CYS A N   1 
ATOM   2407 C CA  . CYS A 1 320 ? 99.836  37.929 10.196  1.00 38.77  ? 335  CYS A CA  1 
ATOM   2408 C C   . CYS A 1 320 ? 99.633  39.217 10.968  1.00 39.44  ? 335  CYS A C   1 
ATOM   2409 O O   . CYS A 1 320 ? 99.901  40.306 10.462  1.00 41.26  ? 335  CYS A O   1 
ATOM   2410 C CB  . CYS A 1 320 ? 98.533  37.557 9.519   1.00 38.47  ? 335  CYS A CB  1 
ATOM   2411 S SG  . CYS A 1 320 ? 98.764  36.561 8.092   1.00 43.47  ? 335  CYS A SG  1 
ATOM   2412 N N   . ALA A 1 321 ? 99.162  39.081 12.203  1.00 37.90  ? 336  ALA A N   1 
ATOM   2413 C CA  . ALA A 1 321 ? 98.904  40.226 13.066  1.00 38.69  ? 336  ALA A CA  1 
ATOM   2414 C C   . ALA A 1 321 ? 100.141 40.728 13.823  1.00 40.51  ? 336  ALA A C   1 
ATOM   2415 O O   . ALA A 1 321 ? 100.039 41.620 14.662  1.00 43.72  ? 336  ALA A O   1 
ATOM   2416 C CB  . ALA A 1 321 ? 97.813  39.870 14.058  1.00 36.35  ? 336  ALA A CB  1 
ATOM   2417 N N   . HIS A 1 322 ? 101.307 40.172 13.520  1.00 42.14  ? 337  HIS A N   1 
ATOM   2418 C CA  . HIS A 1 322 ? 102.533 40.556 14.209  1.00 43.01  ? 337  HIS A CA  1 
ATOM   2419 C C   . HIS A 1 322 ? 103.011 41.965 13.857  1.00 41.91  ? 337  HIS A C   1 
ATOM   2420 O O   . HIS A 1 322 ? 102.838 42.437 12.731  1.00 44.90  ? 337  HIS A O   1 
ATOM   2421 C CB  . HIS A 1 322 ? 103.620 39.513 13.917  1.00 40.13  ? 337  HIS A CB  1 
ATOM   2422 C CG  . HIS A 1 322 ? 104.847 39.666 14.756  1.00 39.06  ? 337  HIS A CG  1 
ATOM   2423 N ND1 . HIS A 1 322 ? 105.925 40.433 14.368  1.00 37.24  ? 337  HIS A ND1 1 
ATOM   2424 C CD2 . HIS A 1 322 ? 105.159 39.169 15.974  1.00 38.92  ? 337  HIS A CD2 1 
ATOM   2425 C CE1 . HIS A 1 322 ? 106.850 40.402 15.310  1.00 36.11  ? 337  HIS A CE1 1 
ATOM   2426 N NE2 . HIS A 1 322 ? 106.410 39.641 16.296  1.00 36.92  ? 337  HIS A NE2 1 
ATOM   2427 N N   . SER A 1 323 ? 103.618 42.626 14.838  1.00 42.36  ? 338  SER A N   1 
ATOM   2428 C CA  . SER A 1 323 ? 104.134 43.990 14.695  1.00 43.36  ? 338  SER A CA  1 
ATOM   2429 C C   . SER A 1 323 ? 105.040 44.206 13.483  1.00 43.73  ? 338  SER A C   1 
ATOM   2430 O O   . SER A 1 323 ? 105.208 45.325 13.013  1.00 46.99  ? 338  SER A O   1 
ATOM   2431 C CB  . SER A 1 323 ? 104.903 44.370 15.958  1.00 42.12  ? 338  SER A CB  1 
ATOM   2432 O OG  . SER A 1 323 ? 104.383 43.679 17.085  1.00 54.94  ? 338  SER A OG  1 
ATOM   2433 N N   . PHE A 1 324 ? 105.638 43.132 12.993  1.00 44.56  ? 339  PHE A N   1 
ATOM   2434 C CA  . PHE A 1 324 ? 106.540 43.191 11.847  1.00 43.88  ? 339  PHE A CA  1 
ATOM   2435 C C   . PHE A 1 324 ? 105.788 43.557 10.574  1.00 42.91  ? 339  PHE A C   1 
ATOM   2436 O O   . PHE A 1 324 ? 106.349 44.137 9.637   1.00 41.33  ? 339  PHE A O   1 
ATOM   2437 C CB  . PHE A 1 324 ? 107.231 41.828 11.694  1.00 41.84  ? 339  PHE A CB  1 
ATOM   2438 C CG  . PHE A 1 324 ? 108.085 41.696 10.463  1.00 37.67  ? 339  PHE A CG  1 
ATOM   2439 C CD1 . PHE A 1 324 ? 109.188 42.518 10.267  1.00 33.37  ? 339  PHE A CD1 1 
ATOM   2440 C CD2 . PHE A 1 324 ? 107.794 40.725 9.506   1.00 39.54  ? 339  PHE A CD2 1 
ATOM   2441 C CE1 . PHE A 1 324 ? 109.990 42.377 9.137   1.00 31.47  ? 339  PHE A CE1 1 
ATOM   2442 C CE2 . PHE A 1 324 ? 108.589 40.575 8.372   1.00 37.37  ? 339  PHE A CE2 1 
ATOM   2443 C CZ  . PHE A 1 324 ? 109.689 41.403 8.189   1.00 39.16  ? 339  PHE A CZ  1 
ATOM   2444 N N   . PHE A 1 325 ? 104.503 43.232 10.552  1.00 43.19  ? 340  PHE A N   1 
ATOM   2445 C CA  . PHE A 1 325 ? 103.685 43.510 9.386   1.00 44.89  ? 340  PHE A CA  1 
ATOM   2446 C C   . PHE A 1 325 ? 102.900 44.817 9.488   1.00 43.76  ? 340  PHE A C   1 
ATOM   2447 O O   . PHE A 1 325 ? 102.130 45.151 8.591   1.00 43.01  ? 340  PHE A O   1 
ATOM   2448 C CB  . PHE A 1 325 ? 102.732 42.332 9.137   1.00 42.07  ? 340  PHE A CB  1 
ATOM   2449 C CG  . PHE A 1 325 ? 103.440 41.036 8.845   1.00 40.98  ? 340  PHE A CG  1 
ATOM   2450 C CD1 . PHE A 1 325 ? 104.376 40.958 7.810   1.00 38.45  ? 340  PHE A CD1 1 
ATOM   2451 C CD2 . PHE A 1 325 ? 103.213 39.912 9.629   1.00 36.80  ? 340  PHE A CD2 1 
ATOM   2452 C CE1 . PHE A 1 325 ? 105.077 39.782 7.568   1.00 36.35  ? 340  PHE A CE1 1 
ATOM   2453 C CE2 . PHE A 1 325 ? 103.910 38.735 9.392   1.00 38.52  ? 340  PHE A CE2 1 
ATOM   2454 C CZ  . PHE A 1 325 ? 104.845 38.671 8.360   1.00 36.78  ? 340  PHE A CZ  1 
ATOM   2455 N N   . ASP A 1 326 ? 103.104 45.564 10.567  1.00 46.70  ? 341  ASP A N   1 
ATOM   2456 C CA  . ASP A 1 326 ? 102.389 46.818 10.761  1.00 43.19  ? 341  ASP A CA  1 
ATOM   2457 C C   . ASP A 1 326 ? 102.457 47.719 9.536   1.00 43.59  ? 341  ASP A C   1 
ATOM   2458 O O   . ASP A 1 326 ? 101.450 48.292 9.123   1.00 47.12  ? 341  ASP A O   1 
ATOM   2459 C CB  . ASP A 1 326 ? 102.915 47.537 12.008  1.00 41.01  ? 341  ASP A CB  1 
ATOM   2460 C CG  . ASP A 1 326 ? 102.337 46.960 13.301  1.00 44.26  ? 341  ASP A CG  1 
ATOM   2461 O OD1 . ASP A 1 326 ? 102.781 47.344 14.402  1.00 44.80  ? 341  ASP A OD1 1 
ATOM   2462 O OD2 . ASP A 1 326 ? 101.420 46.120 13.221  1.00 46.99  ? 341  ASP A OD2 1 
ATOM   2463 N N   . GLU A 1 327 ? 103.631 47.828 8.931   1.00 43.07  ? 342  GLU A N   1 
ATOM   2464 C CA  . GLU A 1 327 ? 103.785 48.666 7.742   1.00 45.16  ? 342  GLU A CA  1 
ATOM   2465 C C   . GLU A 1 327 ? 102.877 48.273 6.565   1.00 46.12  ? 342  GLU A C   1 
ATOM   2466 O O   . GLU A 1 327 ? 102.602 49.088 5.685   1.00 49.28  ? 342  GLU A O   1 
ATOM   2467 C CB  . GLU A 1 327 ? 105.242 48.649 7.280   1.00 44.04  ? 342  GLU A CB  1 
ATOM   2468 C CG  . GLU A 1 327 ? 105.467 49.323 5.937   1.00 46.56  ? 342  GLU A CG  1 
ATOM   2469 C CD  . GLU A 1 327 ? 106.894 49.167 5.434   1.00 52.18  ? 342  GLU A CD  1 
ATOM   2470 O OE1 . GLU A 1 327 ? 107.173 49.625 4.303   1.00 53.61  ? 342  GLU A OE1 1 
ATOM   2471 O OE2 . GLU A 1 327 ? 107.736 48.590 6.167   1.00 52.47  ? 342  GLU A OE2 1 
ATOM   2472 N N   . LEU A 1 328 ? 102.428 47.026 6.530   1.00 44.85  ? 343  LEU A N   1 
ATOM   2473 C CA  . LEU A 1 328 ? 101.560 46.580 5.447   1.00 46.81  ? 343  LEU A CA  1 
ATOM   2474 C C   . LEU A 1 328 ? 100.145 47.094 5.700   1.00 45.89  ? 343  LEU A C   1 
ATOM   2475 O O   . LEU A 1 328 ? 99.342  47.228 4.776   1.00 45.57  ? 343  LEU A O   1 
ATOM   2476 C CB  . LEU A 1 328 ? 101.541 45.046 5.364   1.00 43.79  ? 343  LEU A CB  1 
ATOM   2477 C CG  . LEU A 1 328 ? 102.841 44.293 5.086   1.00 43.60  ? 343  LEU A CG  1 
ATOM   2478 C CD1 . LEU A 1 328 ? 102.539 42.819 4.940   1.00 40.85  ? 343  LEU A CD1 1 
ATOM   2479 C CD2 . LEU A 1 328 ? 103.489 44.820 3.825   1.00 46.40  ? 343  LEU A CD2 1 
ATOM   2480 N N   . ARG A 1 329 ? 99.851  47.378 6.964   1.00 45.35  ? 344  ARG A N   1 
ATOM   2481 C CA  . ARG A 1 329 ? 98.535  47.863 7.359   1.00 48.41  ? 344  ARG A CA  1 
ATOM   2482 C C   . ARG A 1 329 ? 98.432  49.388 7.321   1.00 47.60  ? 344  ARG A C   1 
ATOM   2483 O O   . ARG A 1 329 ? 97.406  49.956 7.670   1.00 47.42  ? 344  ARG A O   1 
ATOM   2484 C CB  . ARG A 1 329 ? 98.186  47.339 8.757   1.00 47.23  ? 344  ARG A CB  1 
ATOM   2485 C CG  . ARG A 1 329 ? 97.651  45.914 8.775   1.00 49.14  ? 344  ARG A CG  1 
ATOM   2486 C CD  . ARG A 1 329 ? 97.339  45.474 10.190  1.00 47.94  ? 344  ARG A CD  1 
ATOM   2487 N NE  . ARG A 1 329 ? 98.560  45.318 10.976  1.00 48.89  ? 344  ARG A NE  1 
ATOM   2488 C CZ  . ARG A 1 329 ? 99.300  44.210 11.007  1.00 48.85  ? 344  ARG A CZ  1 
ATOM   2489 N NH1 . ARG A 1 329 ? 98.943  43.147 10.302  1.00 46.49  ? 344  ARG A NH1 1 
ATOM   2490 N NH2 . ARG A 1 329 ? 100.409 44.166 11.733  1.00 49.92  ? 344  ARG A NH2 1 
ATOM   2491 N N   . ASP A 1 330 ? 99.503  50.039 6.885   1.00 48.73  ? 345  ASP A N   1 
ATOM   2492 C CA  . ASP A 1 330 ? 99.558  51.493 6.774   1.00 52.44  ? 345  ASP A CA  1 
ATOM   2493 C C   . ASP A 1 330 ? 98.930  51.908 5.432   1.00 55.75  ? 345  ASP A C   1 
ATOM   2494 O O   . ASP A 1 330 ? 99.261  51.344 4.391   1.00 55.29  ? 345  ASP A O   1 
ATOM   2495 C CB  . ASP A 1 330 ? 101.024 51.928 6.853   1.00 54.86  ? 345  ASP A CB  1 
ATOM   2496 C CG  . ASP A 1 330 ? 101.221 53.406 6.610   1.00 58.68  ? 345  ASP A CG  1 
ATOM   2497 O OD1 . ASP A 1 330 ? 102.389 53.849 6.642   1.00 62.50  ? 345  ASP A OD1 1 
ATOM   2498 O OD2 . ASP A 1 330 ? 100.226 54.127 6.384   1.00 62.27  ? 345  ASP A OD2 1 
ATOM   2499 N N   . PRO A 1 331 ? 98.014  52.898 5.446   1.00 57.48  ? 346  PRO A N   1 
ATOM   2500 C CA  . PRO A 1 331 ? 97.307  53.418 4.264   1.00 59.50  ? 346  PRO A CA  1 
ATOM   2501 C C   . PRO A 1 331 ? 98.178  53.959 3.135   1.00 61.27  ? 346  PRO A C   1 
ATOM   2502 O O   . PRO A 1 331 ? 97.843  53.808 1.964   1.00 62.21  ? 346  PRO A O   1 
ATOM   2503 C CB  . PRO A 1 331 ? 96.424  54.518 4.843   1.00 61.14  ? 346  PRO A CB  1 
ATOM   2504 C CG  . PRO A 1 331 ? 96.184  54.073 6.238   1.00 61.29  ? 346  PRO A CG  1 
ATOM   2505 C CD  . PRO A 1 331 ? 97.533  53.570 6.666   1.00 59.75  ? 346  PRO A CD  1 
ATOM   2506 N N   . ASN A 1 332 ? 99.289  54.591 3.491   1.00 62.48  ? 347  ASN A N   1 
ATOM   2507 C CA  . ASN A 1 332 ? 100.198 55.188 2.514   1.00 64.69  ? 347  ASN A CA  1 
ATOM   2508 C C   . ASN A 1 332 ? 101.093 54.207 1.783   1.00 65.37  ? 347  ASN A C   1 
ATOM   2509 O O   . ASN A 1 332 ? 101.531 54.479 0.669   1.00 68.20  ? 347  ASN A O   1 
ATOM   2510 C CB  . ASN A 1 332 ? 101.096 56.205 3.207   1.00 66.88  ? 347  ASN A CB  1 
ATOM   2511 C CG  . ASN A 1 332 ? 100.333 57.089 4.157   1.00 69.52  ? 347  ASN A CG  1 
ATOM   2512 O OD1 . ASN A 1 332 ? 99.447  57.839 3.739   1.00 67.60  ? 347  ASN A OD1 1 
ATOM   2513 N ND2 . ASN A 1 332 ? 100.662 57.005 5.450   1.00 69.40  ? 347  ASN A ND2 1 
ATOM   2514 N N   . VAL A 1 333 ? 101.376 53.078 2.423   1.00 65.74  ? 348  VAL A N   1 
ATOM   2515 C CA  . VAL A 1 333 ? 102.257 52.062 1.863   1.00 62.54  ? 348  VAL A CA  1 
ATOM   2516 C C   . VAL A 1 333 ? 102.060 51.772 0.376   1.00 62.74  ? 348  VAL A C   1 
ATOM   2517 O O   . VAL A 1 333 ? 100.930 51.717 -0.126  1.00 62.90  ? 348  VAL A O   1 
ATOM   2518 C CB  . VAL A 1 333 ? 102.142 50.742 2.655   1.00 61.91  ? 348  VAL A CB  1 
ATOM   2519 C CG1 . VAL A 1 333 ? 100.820 50.065 2.368   1.00 58.52  ? 348  VAL A CG1 1 
ATOM   2520 C CG2 . VAL A 1 333 ? 103.296 49.844 2.312   1.00 59.64  ? 348  VAL A CG2 1 
ATOM   2521 N N   . LYS A 1 334 ? 103.184 51.602 -0.317  1.00 63.09  ? 349  LYS A N   1 
ATOM   2522 C CA  . LYS A 1 334 ? 103.208 51.305 -1.750  1.00 65.61  ? 349  LYS A CA  1 
ATOM   2523 C C   . LYS A 1 334 ? 104.448 50.458 -2.021  1.00 65.21  ? 349  LYS A C   1 
ATOM   2524 O O   . LYS A 1 334 ? 105.354 50.401 -1.189  1.00 64.98  ? 349  LYS A O   1 
ATOM   2525 C CB  . LYS A 1 334 ? 103.310 52.597 -2.574  1.00 68.67  ? 349  LYS A CB  1 
ATOM   2526 C CG  . LYS A 1 334 ? 102.166 53.591 -2.395  1.00 72.49  ? 349  LYS A CG  1 
ATOM   2527 C CD  . LYS A 1 334 ? 101.016 53.365 -3.372  1.00 74.79  ? 349  LYS A CD  1 
ATOM   2528 C CE  . LYS A 1 334 ? 99.907  54.377 -3.107  1.00 75.77  ? 349  LYS A CE  1 
ATOM   2529 N NZ  . LYS A 1 334 ? 98.752  54.223 -4.026  1.00 77.35  ? 349  LYS A NZ  1 
ATOM   2530 N N   . LEU A 1 335 ? 104.492 49.805 -3.179  1.00 65.22  ? 350  LEU A N   1 
ATOM   2531 C CA  . LEU A 1 335 ? 105.642 48.985 -3.544  1.00 66.34  ? 350  LEU A CA  1 
ATOM   2532 C C   . LEU A 1 335 ? 106.771 49.909 -3.989  1.00 69.44  ? 350  LEU A C   1 
ATOM   2533 O O   . LEU A 1 335 ? 106.518 51.013 -4.467  1.00 71.38  ? 350  LEU A O   1 
ATOM   2534 C CB  . LEU A 1 335 ? 105.276 48.045 -4.692  1.00 63.84  ? 350  LEU A CB  1 
ATOM   2535 C CG  . LEU A 1 335 ? 104.198 46.991 -4.440  1.00 61.04  ? 350  LEU A CG  1 
ATOM   2536 C CD1 . LEU A 1 335 ? 103.902 46.231 -5.723  1.00 59.69  ? 350  LEU A CD1 1 
ATOM   2537 C CD2 . LEU A 1 335 ? 104.666 46.047 -3.357  1.00 59.45  ? 350  LEU A CD2 1 
ATOM   2538 N N   . PRO A 1 336 ? 108.034 49.475 -3.841  1.00 72.02  ? 351  PRO A N   1 
ATOM   2539 C CA  . PRO A 1 336 ? 109.191 50.289 -4.242  1.00 73.57  ? 351  PRO A CA  1 
ATOM   2540 C C   . PRO A 1 336 ? 109.059 50.848 -5.665  1.00 74.84  ? 351  PRO A C   1 
ATOM   2541 O O   . PRO A 1 336 ? 109.818 51.733 -6.077  1.00 73.38  ? 351  PRO A O   1 
ATOM   2542 C CB  . PRO A 1 336 ? 110.355 49.307 -4.118  1.00 72.95  ? 351  PRO A CB  1 
ATOM   2543 C CG  . PRO A 1 336 ? 109.950 48.474 -2.966  1.00 74.19  ? 351  PRO A CG  1 
ATOM   2544 C CD  . PRO A 1 336 ? 108.480 48.197 -3.259  1.00 73.38  ? 351  PRO A CD  1 
ATOM   2545 N N   . ASN A 1 337 ? 108.089 50.317 -6.404  1.00 76.36  ? 352  ASN A N   1 
ATOM   2546 C CA  . ASN A 1 337 ? 107.834 50.736 -7.774  1.00 78.04  ? 352  ASN A CA  1 
ATOM   2547 C C   . ASN A 1 337 ? 106.488 51.457 -7.906  1.00 77.43  ? 352  ASN A C   1 
ATOM   2548 O O   . ASN A 1 337 ? 105.781 51.284 -8.899  1.00 76.66  ? 352  ASN A O   1 
ATOM   2549 C CB  . ASN A 1 337 ? 107.882 49.514 -8.704  1.00 81.01  ? 352  ASN A CB  1 
ATOM   2550 C CG  . ASN A 1 337 ? 106.778 48.507 -8.415  1.00 84.32  ? 352  ASN A CG  1 
ATOM   2551 O OD1 . ASN A 1 337 ? 106.406 48.291 -7.261  1.00 86.50  ? 352  ASN A OD1 1 
ATOM   2552 N ND2 . ASN A 1 337 ? 106.262 47.871 -9.465  1.00 84.14  ? 352  ASN A ND2 1 
ATOM   2553 N N   . GLY A 1 338 ? 106.140 52.256 -6.898  1.00 75.93  ? 353  GLY A N   1 
ATOM   2554 C CA  . GLY A 1 338 ? 104.892 53.004 -6.917  1.00 75.40  ? 353  GLY A CA  1 
ATOM   2555 C C   . GLY A 1 338 ? 103.588 52.215 -6.979  1.00 76.98  ? 353  GLY A C   1 
ATOM   2556 O O   . GLY A 1 338 ? 102.522 52.749 -6.648  1.00 75.63  ? 353  GLY A O   1 
ATOM   2557 N N   . ARG A 1 339 ? 103.664 50.953 -7.401  1.00 78.72  ? 354  ARG A N   1 
ATOM   2558 C CA  . ARG A 1 339 ? 102.489 50.087 -7.515  1.00 79.29  ? 354  ARG A CA  1 
ATOM   2559 C C   . ARG A 1 339 ? 101.800 49.867 -6.174  1.00 78.67  ? 354  ARG A C   1 
ATOM   2560 O O   . ARG A 1 339 ? 102.384 50.090 -5.111  1.00 78.30  ? 354  ARG A O   1 
ATOM   2561 C CB  . ARG A 1 339 ? 102.885 48.717 -8.079  1.00 83.14  ? 354  ARG A CB  1 
ATOM   2562 C CG  . ARG A 1 339 ? 103.556 48.749 -9.441  1.00 89.08  ? 354  ARG A CG  1 
ATOM   2563 C CD  . ARG A 1 339 ? 102.567 49.018 -10.560 1.00 92.17  ? 354  ARG A CD  1 
ATOM   2564 N NE  . ARG A 1 339 ? 101.639 47.906 -10.755 1.00 95.69  ? 354  ARG A NE  1 
ATOM   2565 C CZ  . ARG A 1 339 ? 100.683 47.888 -11.683 1.00 97.23  ? 354  ARG A CZ  1 
ATOM   2566 N NH1 . ARG A 1 339 ? 100.530 48.924 -12.501 1.00 97.91  ? 354  ARG A NH1 1 
ATOM   2567 N NH2 . ARG A 1 339 ? 99.881  46.835 -11.797 1.00 96.46  ? 354  ARG A NH2 1 
ATOM   2568 N N   . ASP A 1 340 ? 100.552 49.417 -6.235  1.00 77.86  ? 355  ASP A N   1 
ATOM   2569 C CA  . ASP A 1 340 ? 99.782  49.134 -5.036  1.00 76.11  ? 355  ASP A CA  1 
ATOM   2570 C C   . ASP A 1 340 ? 100.131 47.754 -4.510  1.00 74.24  ? 355  ASP A C   1 
ATOM   2571 O O   . ASP A 1 340 ? 100.643 46.901 -5.242  1.00 74.23  ? 355  ASP A O   1 
ATOM   2572 C CB  . ASP A 1 340 ? 98.288  49.163 -5.340  1.00 77.94  ? 355  ASP A CB  1 
ATOM   2573 C CG  . ASP A 1 340 ? 97.743  50.558 -5.416  1.00 80.96  ? 355  ASP A CG  1 
ATOM   2574 O OD1 . ASP A 1 340 ? 97.884  51.292 -4.415  1.00 82.42  ? 355  ASP A OD1 1 
ATOM   2575 O OD2 . ASP A 1 340 ? 97.173  50.918 -6.469  1.00 82.18  ? 355  ASP A OD2 1 
ATOM   2576 N N   . THR A 1 341 ? 99.842  47.540 -3.234  1.00 71.21  ? 356  THR A N   1 
ATOM   2577 C CA  . THR A 1 341 ? 100.088 46.251 -2.611  1.00 69.00  ? 356  THR A CA  1 
ATOM   2578 C C   . THR A 1 341 ? 98.878  45.357 -2.893  1.00 67.60  ? 356  THR A C   1 
ATOM   2579 O O   . THR A 1 341 ? 97.736  45.823 -2.889  1.00 69.27  ? 356  THR A O   1 
ATOM   2580 C CB  . THR A 1 341 ? 100.257 46.395 -1.086  1.00 68.60  ? 356  THR A CB  1 
ATOM   2581 O OG1 . THR A 1 341 ? 99.064  46.949 -0.517  1.00 67.70  ? 356  THR A OG1 1 
ATOM   2582 C CG2 . THR A 1 341 ? 101.417 47.306 -0.774  1.00 68.26  ? 356  THR A CG2 1 
ATOM   2583 N N   . PRO A 1 342 ? 99.111  44.066 -3.161  1.00 65.04  ? 357  PRO A N   1 
ATOM   2584 C CA  . PRO A 1 342 ? 97.998  43.157 -3.436  1.00 62.02  ? 357  PRO A CA  1 
ATOM   2585 C C   . PRO A 1 342 ? 96.939  43.219 -2.339  1.00 60.55  ? 357  PRO A C   1 
ATOM   2586 O O   . PRO A 1 342 ? 97.066  43.984 -1.379  1.00 60.16  ? 357  PRO A O   1 
ATOM   2587 C CB  . PRO A 1 342 ? 98.680  41.797 -3.496  1.00 61.85  ? 357  PRO A CB  1 
ATOM   2588 C CG  . PRO A 1 342 ? 99.999  42.125 -4.064  1.00 64.37  ? 357  PRO A CG  1 
ATOM   2589 C CD  . PRO A 1 342 ? 100.398 43.368 -3.302  1.00 64.61  ? 357  PRO A CD  1 
ATOM   2590 N N   . ALA A 1 343 ? 95.893  42.410 -2.490  1.00 59.94  ? 358  ALA A N   1 
ATOM   2591 C CA  . ALA A 1 343 ? 94.815  42.356 -1.509  1.00 57.96  ? 358  ALA A CA  1 
ATOM   2592 C C   . ALA A 1 343 ? 95.384  41.733 -0.244  1.00 56.23  ? 358  ALA A C   1 
ATOM   2593 O O   . ALA A 1 343 ? 95.756  40.560 -0.238  1.00 58.41  ? 358  ALA A O   1 
ATOM   2594 C CB  . ALA A 1 343 ? 93.668  41.512 -2.044  1.00 58.26  ? 358  ALA A CB  1 
ATOM   2595 N N   . LEU A 1 344 ? 95.460  42.508 0.828   1.00 52.40  ? 359  LEU A N   1 
ATOM   2596 C CA  . LEU A 1 344 ? 96.018  41.974 2.057   1.00 49.22  ? 359  LEU A CA  1 
ATOM   2597 C C   . LEU A 1 344 ? 94.995  41.813 3.161   1.00 49.56  ? 359  LEU A C   1 
ATOM   2598 O O   . LEU A 1 344 ? 95.248  41.110 4.137   1.00 50.37  ? 359  LEU A O   1 
ATOM   2599 C CB  . LEU A 1 344 ? 97.151  42.872 2.556   1.00 46.04  ? 359  LEU A CB  1 
ATOM   2600 C CG  . LEU A 1 344 ? 98.300  43.153 1.587   1.00 48.70  ? 359  LEU A CG  1 
ATOM   2601 C CD1 . LEU A 1 344 ? 99.346  44.001 2.282   1.00 45.92  ? 359  LEU A CD1 1 
ATOM   2602 C CD2 . LEU A 1 344 ? 98.904  41.853 1.102   1.00 42.40  ? 359  LEU A CD2 1 
ATOM   2603 N N   . PHE A 1 345 ? 93.830  42.429 3.005   1.00 49.68  ? 360  PHE A N   1 
ATOM   2604 C CA  . PHE A 1 345 ? 92.846  42.354 4.070   1.00 49.80  ? 360  PHE A CA  1 
ATOM   2605 C C   . PHE A 1 345 ? 91.494  41.769 3.725   1.00 52.61  ? 360  PHE A C   1 
ATOM   2606 O O   . PHE A 1 345 ? 90.557  41.868 4.515   1.00 52.54  ? 360  PHE A O   1 
ATOM   2607 C CB  . PHE A 1 345 ? 92.677  43.740 4.676   1.00 49.87  ? 360  PHE A CB  1 
ATOM   2608 C CG  . PHE A 1 345 ? 93.949  44.538 4.687   1.00 51.46  ? 360  PHE A CG  1 
ATOM   2609 C CD1 . PHE A 1 345 ? 94.265  45.377 3.620   1.00 50.70  ? 360  PHE A CD1 1 
ATOM   2610 C CD2 . PHE A 1 345 ? 94.857  44.410 5.734   1.00 50.57  ? 360  PHE A CD2 1 
ATOM   2611 C CE1 . PHE A 1 345 ? 95.463  46.071 3.598   1.00 53.49  ? 360  PHE A CE1 1 
ATOM   2612 C CE2 . PHE A 1 345 ? 96.063  45.102 5.721   1.00 52.26  ? 360  PHE A CE2 1 
ATOM   2613 C CZ  . PHE A 1 345 ? 96.368  45.934 4.652   1.00 53.74  ? 360  PHE A CZ  1 
ATOM   2614 N N   . ASN A 1 346 ? 91.385  41.149 2.560   1.00 53.53  ? 361  ASN A N   1 
ATOM   2615 C CA  . ASN A 1 346 ? 90.127  40.538 2.163   1.00 55.68  ? 361  ASN A CA  1 
ATOM   2616 C C   . ASN A 1 346 ? 89.930  39.188 2.868   1.00 57.53  ? 361  ASN A C   1 
ATOM   2617 O O   . ASN A 1 346 ? 89.694  38.160 2.225   1.00 59.75  ? 361  ASN A O   1 
ATOM   2618 C CB  . ASN A 1 346 ? 90.103  40.370 0.641   1.00 56.35  ? 361  ASN A CB  1 
ATOM   2619 C CG  . ASN A 1 346 ? 91.361  39.697 0.101   1.00 58.70  ? 361  ASN A CG  1 
ATOM   2620 O OD1 . ASN A 1 346 ? 92.464  39.912 0.604   1.00 60.46  ? 361  ASN A OD1 1 
ATOM   2621 N ND2 . ASN A 1 346 ? 91.200  38.899 -0.945  1.00 54.80  ? 361  ASN A ND2 1 
ATOM   2622 N N   . PHE A 1 347 ? 90.023  39.189 4.196   1.00 57.58  ? 362  PHE A N   1 
ATOM   2623 C CA  . PHE A 1 347 ? 89.860  37.953 4.955   1.00 59.64  ? 362  PHE A CA  1 
ATOM   2624 C C   . PHE A 1 347 ? 88.422  37.430 4.946   1.00 60.16  ? 362  PHE A C   1 
ATOM   2625 O O   . PHE A 1 347 ? 87.461  38.194 5.029   1.00 60.21  ? 362  PHE A O   1 
ATOM   2626 C CB  . PHE A 1 347 ? 90.311  38.139 6.414   1.00 58.07  ? 362  PHE A CB  1 
ATOM   2627 C CG  . PHE A 1 347 ? 91.786  38.400 6.576   1.00 56.22  ? 362  PHE A CG  1 
ATOM   2628 C CD1 . PHE A 1 347 ? 92.302  39.678 6.432   1.00 54.29  ? 362  PHE A CD1 1 
ATOM   2629 C CD2 . PHE A 1 347 ? 92.659  37.359 6.877   1.00 52.63  ? 362  PHE A CD2 1 
ATOM   2630 C CE1 . PHE A 1 347 ? 93.667  39.916 6.585   1.00 56.13  ? 362  PHE A CE1 1 
ATOM   2631 C CE2 . PHE A 1 347 ? 94.023  37.588 7.031   1.00 52.64  ? 362  PHE A CE2 1 
ATOM   2632 C CZ  . PHE A 1 347 ? 94.526  38.867 6.885   1.00 54.98  ? 362  PHE A CZ  1 
ATOM   2633 N N   . THR A 1 348 ? 88.286  36.113 4.847   1.00 61.39  ? 363  THR A N   1 
ATOM   2634 C CA  . THR A 1 348 ? 86.975  35.482 4.851   1.00 60.07  ? 363  THR A CA  1 
ATOM   2635 C C   . THR A 1 348 ? 86.726  34.894 6.231   1.00 60.22  ? 363  THR A C   1 
ATOM   2636 O O   . THR A 1 348 ? 87.620  34.873 7.078   1.00 61.03  ? 363  THR A O   1 
ATOM   2637 C CB  . THR A 1 348 ? 86.887  34.353 3.799   1.00 59.40  ? 363  THR A CB  1 
ATOM   2638 O OG1 . THR A 1 348 ? 87.839  33.321 4.102   1.00 60.88  ? 363  THR A OG1 1 
ATOM   2639 C CG2 . THR A 1 348 ? 87.179  34.911 2.422   1.00 59.17  ? 363  THR A CG2 1 
ATOM   2640 N N   . THR A 1 349 ? 85.505  34.428 6.454   1.00 59.35  ? 364  THR A N   1 
ATOM   2641 C CA  . THR A 1 349 ? 85.143  33.835 7.729   1.00 58.80  ? 364  THR A CA  1 
ATOM   2642 C C   . THR A 1 349 ? 86.003  32.607 7.961   1.00 58.74  ? 364  THR A C   1 
ATOM   2643 O O   . THR A 1 349 ? 86.543  32.404 9.048   1.00 60.53  ? 364  THR A O   1 
ATOM   2644 C CB  . THR A 1 349 ? 83.671  33.422 7.727   1.00 58.33  ? 364  THR A CB  1 
ATOM   2645 O OG1 . THR A 1 349 ? 82.860  34.602 7.664   1.00 59.52  ? 364  THR A OG1 1 
ATOM   2646 C CG2 . THR A 1 349 ? 83.328  32.611 8.979   1.00 57.84  ? 364  THR A CG2 1 
ATOM   2647 N N   . GLN A 1 350 ? 86.109  31.793 6.919   1.00 57.82  ? 365  GLN A N   1 
ATOM   2648 C CA  . GLN A 1 350 ? 86.899  30.568 6.936   1.00 57.74  ? 365  GLN A CA  1 
ATOM   2649 C C   . GLN A 1 350 ? 88.312  30.872 7.438   1.00 56.62  ? 365  GLN A C   1 
ATOM   2650 O O   . GLN A 1 350 ? 88.820  30.265 8.377   1.00 53.47  ? 365  GLN A O   1 
ATOM   2651 C CB  . GLN A 1 350 ? 86.955  30.017 5.507   1.00 58.52  ? 365  GLN A CB  1 
ATOM   2652 C CG  . GLN A 1 350 ? 87.888  28.838 5.281   1.00 62.57  ? 365  GLN A CG  1 
ATOM   2653 C CD  . GLN A 1 350 ? 87.351  27.554 5.859   1.00 63.00  ? 365  GLN A CD  1 
ATOM   2654 O OE1 . GLN A 1 350 ? 86.151  27.303 5.811   1.00 67.97  ? 365  GLN A OE1 1 
ATOM   2655 N NE2 . GLN A 1 350 ? 88.236  26.722 6.390   1.00 63.95  ? 365  GLN A NE2 1 
ATOM   2656 N N   . GLU A 1 351 ? 88.923  31.843 6.783   1.00 56.30  ? 366  GLU A N   1 
ATOM   2657 C CA  . GLU A 1 351 ? 90.269  32.290 7.063   1.00 57.85  ? 366  GLU A CA  1 
ATOM   2658 C C   . GLU A 1 351 ? 90.473  32.828 8.483   1.00 58.37  ? 366  GLU A C   1 
ATOM   2659 O O   . GLU A 1 351 ? 91.561  32.716 9.048   1.00 56.03  ? 366  GLU A O   1 
ATOM   2660 C CB  . GLU A 1 351 ? 90.602  33.357 6.030   1.00 59.14  ? 366  GLU A CB  1 
ATOM   2661 C CG  . GLU A 1 351 ? 92.024  33.810 5.982   1.00 60.92  ? 366  GLU A CG  1 
ATOM   2662 C CD  . GLU A 1 351 ? 92.259  34.703 4.791   1.00 63.99  ? 366  GLU A CD  1 
ATOM   2663 O OE1 . GLU A 1 351 ? 93.404  35.168 4.622   1.00 63.20  ? 366  GLU A OE1 1 
ATOM   2664 O OE2 . GLU A 1 351 ? 91.292  34.934 4.023   1.00 69.52  ? 366  GLU A OE2 1 
ATOM   2665 N N   . LEU A 1 352 ? 89.421  33.407 9.055   1.00 58.20  ? 367  LEU A N   1 
ATOM   2666 C CA  . LEU A 1 352 ? 89.477  33.992 10.396  1.00 58.30  ? 367  LEU A CA  1 
ATOM   2667 C C   . LEU A 1 352 ? 88.981  33.078 11.510  1.00 60.19  ? 367  LEU A C   1 
ATOM   2668 O O   . LEU A 1 352 ? 89.186  33.367 12.691  1.00 61.39  ? 367  LEU A O   1 
ATOM   2669 C CB  . LEU A 1 352 ? 88.653  35.284 10.424  1.00 57.45  ? 367  LEU A CB  1 
ATOM   2670 C CG  . LEU A 1 352 ? 89.247  36.491 9.700   1.00 56.83  ? 367  LEU A CG  1 
ATOM   2671 C CD1 . LEU A 1 352 ? 88.152  37.299 9.051   1.00 57.07  ? 367  LEU A CD1 1 
ATOM   2672 C CD2 . LEU A 1 352 ? 90.028  37.332 10.685  1.00 56.13  ? 367  LEU A CD2 1 
ATOM   2673 N N   . SER A 1 353 ? 88.331  31.983 11.128  1.00 61.45  ? 368  SER A N   1 
ATOM   2674 C CA  . SER A 1 353 ? 87.750  31.033 12.076  1.00 62.43  ? 368  SER A CA  1 
ATOM   2675 C C   . SER A 1 353 ? 88.524  30.741 13.359  1.00 61.39  ? 368  SER A C   1 
ATOM   2676 O O   . SER A 1 353 ? 87.941  30.755 14.445  1.00 63.23  ? 368  SER A O   1 
ATOM   2677 C CB  . SER A 1 353 ? 87.450  29.717 11.365  1.00 61.78  ? 368  SER A CB  1 
ATOM   2678 O OG  . SER A 1 353 ? 88.625  29.197 10.780  1.00 68.72  ? 368  SER A OG  1 
ATOM   2679 N N   . SER A 1 354 ? 89.823  30.480 13.246  1.00 60.87  ? 369  SER A N   1 
ATOM   2680 C CA  . SER A 1 354 ? 90.637  30.157 14.423  1.00 59.64  ? 369  SER A CA  1 
ATOM   2681 C C   . SER A 1 354 ? 90.582  31.188 15.543  1.00 60.11  ? 369  SER A C   1 
ATOM   2682 O O   . SER A 1 354 ? 90.750  30.847 16.712  1.00 62.34  ? 369  SER A O   1 
ATOM   2683 C CB  . SER A 1 354 ? 92.104  29.926 14.025  1.00 58.06  ? 369  SER A CB  1 
ATOM   2684 O OG  . SER A 1 354 ? 92.697  31.079 13.444  1.00 60.19  ? 369  SER A OG  1 
ATOM   2685 N N   . ASN A 1 355 ? 90.347  32.445 15.189  1.00 58.61  ? 370  ASN A N   1 
ATOM   2686 C CA  . ASN A 1 355 ? 90.294  33.512 16.172  1.00 58.38  ? 370  ASN A CA  1 
ATOM   2687 C C   . ASN A 1 355 ? 89.636  34.687 15.476  1.00 58.02  ? 370  ASN A C   1 
ATOM   2688 O O   . ASN A 1 355 ? 90.281  35.678 15.151  1.00 55.80  ? 370  ASN A O   1 
ATOM   2689 C CB  . ASN A 1 355 ? 91.710  33.875 16.597  1.00 58.64  ? 370  ASN A CB  1 
ATOM   2690 C CG  . ASN A 1 355 ? 91.741  34.768 17.807  1.00 60.49  ? 370  ASN A CG  1 
ATOM   2691 O OD1 . ASN A 1 355 ? 90.968  35.716 17.903  1.00 65.13  ? 370  ASN A OD1 1 
ATOM   2692 N ND2 . ASN A 1 355 ? 92.647  34.482 18.736  1.00 59.88  ? 370  ASN A ND2 1 
ATOM   2693 N N   . PRO A 1 356 ? 88.328  34.580 15.231  1.00 59.97  ? 371  PRO A N   1 
ATOM   2694 C CA  . PRO A 1 356 ? 87.556  35.627 14.557  1.00 59.09  ? 371  PRO A CA  1 
ATOM   2695 C C   . PRO A 1 356 ? 87.785  37.057 15.051  1.00 58.29  ? 371  PRO A C   1 
ATOM   2696 O O   . PRO A 1 356 ? 87.878  37.980 14.246  1.00 55.68  ? 371  PRO A O   1 
ATOM   2697 C CB  . PRO A 1 356 ? 86.119  35.158 14.740  1.00 58.66  ? 371  PRO A CB  1 
ATOM   2698 C CG  . PRO A 1 356 ? 86.268  33.651 14.734  1.00 61.14  ? 371  PRO A CG  1 
ATOM   2699 C CD  . PRO A 1 356 ? 87.460  33.461 15.638  1.00 60.40  ? 371  PRO A CD  1 
ATOM   2700 N N   . PRO A 1 357 ? 87.883  37.266 16.377  1.00 59.75  ? 372  PRO A N   1 
ATOM   2701 C CA  . PRO A 1 357 ? 88.101  38.633 16.874  1.00 60.07  ? 372  PRO A CA  1 
ATOM   2702 C C   . PRO A 1 357 ? 89.406  39.316 16.436  1.00 60.80  ? 372  PRO A C   1 
ATOM   2703 O O   . PRO A 1 357 ? 89.487  40.543 16.401  1.00 64.54  ? 372  PRO A O   1 
ATOM   2704 C CB  . PRO A 1 357 ? 87.975  38.479 18.393  1.00 57.05  ? 372  PRO A CB  1 
ATOM   2705 C CG  . PRO A 1 357 ? 88.343  37.055 18.637  1.00 58.45  ? 372  PRO A CG  1 
ATOM   2706 C CD  . PRO A 1 357 ? 87.685  36.325 17.495  1.00 59.59  ? 372  PRO A CD  1 
ATOM   2707 N N   . LEU A 1 358 ? 90.426  38.537 16.097  1.00 60.13  ? 373  LEU A N   1 
ATOM   2708 C CA  . LEU A 1 358 ? 91.671  39.131 15.634  1.00 58.22  ? 373  LEU A CA  1 
ATOM   2709 C C   . LEU A 1 358 ? 91.383  39.919 14.376  1.00 59.42  ? 373  LEU A C   1 
ATOM   2710 O O   . LEU A 1 358 ? 92.196  40.727 13.942  1.00 60.12  ? 373  LEU A O   1 
ATOM   2711 C CB  . LEU A 1 358 ? 92.702  38.060 15.295  1.00 53.36  ? 373  LEU A CB  1 
ATOM   2712 C CG  . LEU A 1 358 ? 93.663  37.677 16.412  1.00 50.81  ? 373  LEU A CG  1 
ATOM   2713 C CD1 . LEU A 1 358 ? 94.748  36.771 15.869  1.00 47.17  ? 373  LEU A CD1 1 
ATOM   2714 C CD2 . LEU A 1 358 ? 94.278  38.937 16.986  1.00 48.39  ? 373  LEU A CD2 1 
ATOM   2715 N N   . ALA A 1 359 ? 90.221  39.663 13.787  1.00 61.80  ? 374  ALA A N   1 
ATOM   2716 C CA  . ALA A 1 359 ? 89.815  40.330 12.557  1.00 64.04  ? 374  ALA A CA  1 
ATOM   2717 C C   . ALA A 1 359 ? 89.902  41.837 12.677  1.00 65.57  ? 374  ALA A C   1 
ATOM   2718 O O   . ALA A 1 359 ? 90.200  42.522 11.699  1.00 66.45  ? 374  ALA A O   1 
ATOM   2719 C CB  . ALA A 1 359 ? 88.392  39.924 12.177  1.00 62.03  ? 374  ALA A CB  1 
ATOM   2720 N N   . THR A 1 360 ? 89.655  42.351 13.878  1.00 66.84  ? 375  THR A N   1 
ATOM   2721 C CA  . THR A 1 360 ? 89.687  43.797 14.106  1.00 68.83  ? 375  THR A CA  1 
ATOM   2722 C C   . THR A 1 360 ? 91.098  44.399 14.062  1.00 66.91  ? 375  THR A C   1 
ATOM   2723 O O   . THR A 1 360 ? 91.268  45.608 13.866  1.00 67.21  ? 375  THR A O   1 
ATOM   2724 C CB  . THR A 1 360 ? 89.028  44.156 15.462  1.00 71.28  ? 375  THR A CB  1 
ATOM   2725 O OG1 . THR A 1 360 ? 87.767  43.480 15.577  1.00 72.86  ? 375  THR A OG1 1 
ATOM   2726 C CG2 . THR A 1 360 ? 88.787  45.664 15.550  1.00 72.75  ? 375  THR A CG2 1 
ATOM   2727 N N   . ILE A 1 361 ? 92.106  43.552 14.227  1.00 65.05  ? 376  ILE A N   1 
ATOM   2728 C CA  . ILE A 1 361 ? 93.494  43.997 14.219  1.00 63.94  ? 376  ILE A CA  1 
ATOM   2729 C C   . ILE A 1 361 ? 94.128  43.806 12.849  1.00 63.01  ? 376  ILE A C   1 
ATOM   2730 O O   . ILE A 1 361 ? 94.950  44.614 12.409  1.00 63.02  ? 376  ILE A O   1 
ATOM   2731 C CB  . ILE A 1 361 ? 94.310  43.210 15.263  1.00 65.96  ? 376  ILE A CB  1 
ATOM   2732 C CG1 . ILE A 1 361 ? 93.613  43.315 16.626  1.00 66.71  ? 376  ILE A CG1 1 
ATOM   2733 C CG2 . ILE A 1 361 ? 95.750  43.723 15.310  1.00 65.57  ? 376  ILE A CG2 1 
ATOM   2734 C CD1 . ILE A 1 361 ? 94.242  42.475 17.715  1.00 70.77  ? 376  ILE A CD1 1 
ATOM   2735 N N   . LEU A 1 362 ? 93.736  42.726 12.183  1.00 59.57  ? 377  LEU A N   1 
ATOM   2736 C CA  . LEU A 1 362 ? 94.254  42.394 10.864  1.00 57.82  ? 377  LEU A CA  1 
ATOM   2737 C C   . LEU A 1 362 ? 93.679  43.326 9.820   1.00 58.19  ? 377  LEU A C   1 
ATOM   2738 O O   . LEU A 1 362 ? 94.365  43.725 8.883   1.00 60.49  ? 377  LEU A O   1 
ATOM   2739 C CB  . LEU A 1 362 ? 93.889  40.952 10.512  1.00 56.14  ? 377  LEU A CB  1 
ATOM   2740 C CG  . LEU A 1 362 ? 94.568  39.865 11.339  1.00 53.10  ? 377  LEU A CG  1 
ATOM   2741 C CD1 . LEU A 1 362 ? 93.798  38.570 11.245  1.00 50.86  ? 377  LEU A CD1 1 
ATOM   2742 C CD2 . LEU A 1 362 ? 95.989  39.697 10.844  1.00 54.03  ? 377  LEU A CD2 1 
ATOM   2743 N N   . ILE A 1 363 ? 92.410  43.671 9.986   1.00 59.19  ? 378  ILE A N   1 
ATOM   2744 C CA  . ILE A 1 363 ? 91.750  44.545 9.035   1.00 58.56  ? 378  ILE A CA  1 
ATOM   2745 C C   . ILE A 1 363 ? 91.730  45.995 9.478   1.00 59.04  ? 378  ILE A C   1 
ATOM   2746 O O   . ILE A 1 363 ? 90.935  46.392 10.336  1.00 58.25  ? 378  ILE A O   1 
ATOM   2747 C CB  . ILE A 1 363 ? 90.321  44.080 8.767   1.00 57.17  ? 378  ILE A CB  1 
ATOM   2748 C CG1 . ILE A 1 363 ? 90.353  42.675 8.171   1.00 55.17  ? 378  ILE A CG1 1 
ATOM   2749 C CG2 . ILE A 1 363 ? 89.638  45.039 7.817   1.00 53.84  ? 378  ILE A CG2 1 
ATOM   2750 C CD1 . ILE A 1 363 ? 88.995  42.115 7.863   1.00 55.95  ? 378  ILE A CD1 1 
ATOM   2751 N N   . PRO A 1 364 ? 92.615  46.808 8.885   1.00 60.76  ? 379  PRO A N   1 
ATOM   2752 C CA  . PRO A 1 364 ? 92.756  48.238 9.171   1.00 63.61  ? 379  PRO A CA  1 
ATOM   2753 C C   . PRO A 1 364 ? 91.426  48.974 9.009   1.00 66.74  ? 379  PRO A C   1 
ATOM   2754 O O   . PRO A 1 364 ? 90.664  48.703 8.078   1.00 63.55  ? 379  PRO A O   1 
ATOM   2755 C CB  . PRO A 1 364 ? 93.787  48.695 8.137   1.00 62.40  ? 379  PRO A CB  1 
ATOM   2756 C CG  . PRO A 1 364 ? 94.597  47.464 7.883   1.00 61.68  ? 379  PRO A CG  1 
ATOM   2757 C CD  . PRO A 1 364 ? 93.547  46.396 7.819   1.00 60.74  ? 379  PRO A CD  1 
ATOM   2758 N N   . PRO A 1 365 ? 91.117  49.902 9.925   1.00 70.80  ? 380  PRO A N   1 
ATOM   2759 C CA  . PRO A 1 365 ? 89.841  50.597 9.744   1.00 73.69  ? 380  PRO A CA  1 
ATOM   2760 C C   . PRO A 1 365 ? 89.813  51.374 8.425   1.00 75.11  ? 380  PRO A C   1 
ATOM   2761 O O   . PRO A 1 365 ? 88.781  51.916 8.030   1.00 75.34  ? 380  PRO A O   1 
ATOM   2762 C CB  . PRO A 1 365 ? 89.770  51.489 10.976  1.00 74.08  ? 380  PRO A CB  1 
ATOM   2763 C CG  . PRO A 1 365 ? 90.406  50.612 12.024  1.00 72.92  ? 380  PRO A CG  1 
ATOM   2764 C CD  . PRO A 1 365 ? 91.632  50.098 11.293  1.00 73.20  ? 380  PRO A CD  1 
ATOM   2765 N N   . HIS A 1 366 ? 90.952  51.404 7.739   1.00 76.72  ? 381  HIS A N   1 
ATOM   2766 C CA  . HIS A 1 366 ? 91.049  52.099 6.463   1.00 79.10  ? 381  HIS A CA  1 
ATOM   2767 C C   . HIS A 1 366 ? 90.846  51.139 5.287   1.00 81.44  ? 381  HIS A C   1 
ATOM   2768 O O   . HIS A 1 366 ? 91.119  51.485 4.140   1.00 82.44  ? 381  HIS A O   1 
ATOM   2769 C CB  . HIS A 1 366 ? 92.410  52.808 6.351   1.00 78.35  ? 381  HIS A CB  1 
ATOM   2770 C CG  . HIS A 1 366 ? 93.514  51.955 5.802   1.00 78.15  ? 381  HIS A CG  1 
ATOM   2771 N ND1 . HIS A 1 366 ? 93.629  51.658 4.460   1.00 76.83  ? 381  HIS A ND1 1 
ATOM   2772 C CD2 . HIS A 1 366 ? 94.567  51.359 6.409   1.00 77.08  ? 381  HIS A CD2 1 
ATOM   2773 C CE1 . HIS A 1 366 ? 94.707  50.919 4.265   1.00 75.80  ? 381  HIS A CE1 1 
ATOM   2774 N NE2 . HIS A 1 366 ? 95.294  50.724 5.431   1.00 77.23  ? 381  HIS A NE2 1 
ATOM   2775 N N   . ALA A 1 367 ? 90.367  49.931 5.578   1.00 83.98  ? 382  ALA A N   1 
ATOM   2776 C CA  . ALA A 1 367 ? 90.127  48.919 4.544   1.00 85.43  ? 382  ALA A CA  1 
ATOM   2777 C C   . ALA A 1 367 ? 88.689  48.442 4.630   1.00 86.80  ? 382  ALA A C   1 
ATOM   2778 O O   . ALA A 1 367 ? 88.182  47.788 3.715   1.00 85.91  ? 382  ALA A O   1 
ATOM   2779 C CB  . ALA A 1 367 ? 91.075  47.736 4.720   1.00 85.76  ? 382  ALA A CB  1 
ATOM   2780 N N   . ARG A 1 368 ? 88.045  48.759 5.750   1.00 88.10  ? 383  ARG A N   1 
ATOM   2781 C CA  . ARG A 1 368 ? 86.659  48.390 5.961   1.00 88.92  ? 383  ARG A CA  1 
ATOM   2782 C C   . ARG A 1 368 ? 85.871  49.073 4.845   1.00 89.95  ? 383  ARG A C   1 
ATOM   2783 O O   . ARG A 1 368 ? 86.013  50.280 4.623   1.00 88.15  ? 383  ARG A O   1 
ATOM   2784 C CB  . ARG A 1 368 ? 86.219  48.859 7.344   1.00 89.01  ? 383  ARG A CB  1 
ATOM   2785 C CG  . ARG A 1 368 ? 87.118  48.292 8.422   1.00 89.28  ? 383  ARG A CG  1 
ATOM   2786 C CD  . ARG A 1 368 ? 86.608  48.570 9.820   1.00 91.27  ? 383  ARG A CD  1 
ATOM   2787 N NE  . ARG A 1 368 ? 87.226  47.673 10.798  1.00 90.63  ? 383  ARG A NE  1 
ATOM   2788 C CZ  . ARG A 1 368 ? 87.101  46.345 10.787  1.00 91.32  ? 383  ARG A CZ  1 
ATOM   2789 N NH1 . ARG A 1 368 ? 86.378  45.739 9.850   1.00 90.59  ? 383  ARG A NH1 1 
ATOM   2790 N NH2 . ARG A 1 368 ? 87.702  45.616 11.718  1.00 91.33  ? 383  ARG A NH2 1 
ATOM   2791 N N   . ILE A 1 369 ? 85.066  48.279 4.135   1.00 91.65  ? 384  ILE A N   1 
ATOM   2792 C CA  . ILE A 1 369 ? 84.262  48.740 2.993   1.00 92.67  ? 384  ILE A CA  1 
ATOM   2793 C C   . ILE A 1 369 ? 82.921  49.403 3.370   1.00 92.61  ? 384  ILE A C   1 
ATOM   2794 O O   . ILE A 1 369 ? 82.545  49.350 4.564   1.00 92.75  ? 384  ILE A O   1 
ATOM   2795 C CB  . ILE A 1 369 ? 83.999  47.541 2.015   1.00 93.46  ? 384  ILE A CB  1 
ATOM   2796 C CG1 . ILE A 1 369 ? 83.358  48.033 0.712   1.00 92.55  ? 384  ILE A CG1 1 
ATOM   2797 C CG2 . ILE A 1 369 ? 83.109  46.495 2.698   1.00 92.92  ? 384  ILE A CG2 1 
ATOM   2798 C CD1 . ILE A 1 369 ? 83.131  46.935 -0.309  1.00 90.49  ? 384  ILE A CD1 1 
ATOM   2799 N N   . GLN A 1 370 ? 82.261  49.973 2.464   1.00 91.19  ? 385  GLN A N   1 
ATOM   2800 N N   . VAL B 1 13  ? 102.345 75.011 70.899  1.00 88.97  ? 28   VAL B N   1 
ATOM   2801 C CA  . VAL B 1 13  ? 102.308 73.694 70.194  1.00 89.19  ? 28   VAL B CA  1 
ATOM   2802 C C   . VAL B 1 13  ? 103.070 72.622 70.972  1.00 89.60  ? 28   VAL B C   1 
ATOM   2803 O O   . VAL B 1 13  ? 104.064 72.917 71.641  1.00 90.22  ? 28   VAL B O   1 
ATOM   2804 C CB  . VAL B 1 13  ? 102.895 73.836 68.795  1.00 87.61  ? 28   VAL B CB  1 
ATOM   2805 N N   . SER B 1 14  ? 102.599 71.378 70.883  1.00 90.05  ? 29   SER B N   1 
ATOM   2806 C CA  . SER B 1 14  ? 103.248 70.267 71.582  1.00 88.78  ? 29   SER B CA  1 
ATOM   2807 C C   . SER B 1 14  ? 103.650 69.127 70.657  1.00 87.11  ? 29   SER B C   1 
ATOM   2808 O O   . SER B 1 14  ? 103.334 69.117 69.460  1.00 87.01  ? 29   SER B O   1 
ATOM   2809 C CB  . SER B 1 14  ? 102.348 69.708 72.687  1.00 89.18  ? 29   SER B CB  1 
ATOM   2810 O OG  . SER B 1 14  ? 103.071 68.878 73.588  1.00 88.06  ? 29   SER B OG  1 
ATOM   2811 N N   . ARG B 1 15  ? 104.323 68.154 71.261  1.00 84.22  ? 30   ARG B N   1 
ATOM   2812 C CA  . ARG B 1 15  ? 104.853 66.983 70.583  1.00 79.91  ? 30   ARG B CA  1 
ATOM   2813 C C   . ARG B 1 15  ? 104.108 65.712 71.019  1.00 77.21  ? 30   ARG B C   1 
ATOM   2814 O O   . ARG B 1 15  ? 103.218 65.773 71.869  1.00 75.37  ? 30   ARG B O   1 
ATOM   2815 C CB  . ARG B 1 15  ? 106.338 66.892 70.937  1.00 80.72  ? 30   ARG B CB  1 
ATOM   2816 C CG  . ARG B 1 15  ? 106.996 68.275 71.138  1.00 79.16  ? 30   ARG B CG  1 
ATOM   2817 C CD  . ARG B 1 15  ? 107.803 68.700 69.923  1.00 80.47  ? 30   ARG B CD  1 
ATOM   2818 N NE  . ARG B 1 15  ? 108.184 70.110 69.943  1.00 79.23  ? 30   ARG B NE  1 
ATOM   2819 C CZ  . ARG B 1 15  ? 108.963 70.683 69.027  1.00 79.88  ? 30   ARG B CZ  1 
ATOM   2820 N NH1 . ARG B 1 15  ? 109.456 69.971 68.016  1.00 82.09  ? 30   ARG B NH1 1 
ATOM   2821 N NH2 . ARG B 1 15  ? 109.239 71.976 69.109  1.00 79.93  ? 30   ARG B NH2 1 
ATOM   2822 N N   . ASP B 1 16  ? 104.468 64.567 70.436  1.00 75.23  ? 31   ASP B N   1 
ATOM   2823 C CA  . ASP B 1 16  ? 103.830 63.297 70.790  1.00 72.77  ? 31   ASP B CA  1 
ATOM   2824 C C   . ASP B 1 16  ? 104.644 62.532 71.837  1.00 72.46  ? 31   ASP B C   1 
ATOM   2825 O O   . ASP B 1 16  ? 105.576 63.076 72.426  1.00 69.52  ? 31   ASP B O   1 
ATOM   2826 C CB  . ASP B 1 16  ? 103.608 62.428 69.537  1.00 71.65  ? 31   ASP B CB  1 
ATOM   2827 C CG  . ASP B 1 16  ? 104.898 62.087 68.813  1.00 70.65  ? 31   ASP B CG  1 
ATOM   2828 O OD1 . ASP B 1 16  ? 105.745 62.981 68.652  1.00 72.39  ? 31   ASP B OD1 1 
ATOM   2829 O OD2 . ASP B 1 16  ? 105.061 60.926 68.385  1.00 70.85  ? 31   ASP B OD2 1 
ATOM   2830 N N   . LYS B 1 17  ? 104.278 61.280 72.083  1.00 73.12  ? 32   LYS B N   1 
ATOM   2831 C CA  . LYS B 1 17  ? 104.986 60.466 73.062  1.00 74.34  ? 32   LYS B CA  1 
ATOM   2832 C C   . LYS B 1 17  ? 106.496 60.579 72.897  1.00 75.17  ? 32   LYS B C   1 
ATOM   2833 O O   . LYS B 1 17  ? 107.234 60.723 73.872  1.00 75.57  ? 32   LYS B O   1 
ATOM   2834 C CB  . LYS B 1 17  ? 104.589 58.995 72.921  1.00 73.85  ? 32   LYS B CB  1 
ATOM   2835 C CG  . LYS B 1 17  ? 103.198 58.640 73.428  1.00 74.75  ? 32   LYS B CG  1 
ATOM   2836 C CD  . LYS B 1 17  ? 103.000 57.133 73.387  1.00 77.47  ? 32   LYS B CD  1 
ATOM   2837 C CE  . LYS B 1 17  ? 104.100 56.425 74.183  1.00 80.45  ? 32   LYS B CE  1 
ATOM   2838 N NZ  . LYS B 1 17  ? 104.067 54.938 74.092  1.00 79.86  ? 32   LYS B NZ  1 
ATOM   2839 N N   . ASP B 1 18  ? 106.946 60.528 71.648  1.00 77.35  ? 33   ASP B N   1 
ATOM   2840 C CA  . ASP B 1 18  ? 108.373 60.572 71.329  1.00 79.40  ? 33   ASP B CA  1 
ATOM   2841 C C   . ASP B 1 18  ? 108.982 61.965 71.115  1.00 78.55  ? 33   ASP B C   1 
ATOM   2842 O O   . ASP B 1 18  ? 110.133 62.086 70.692  1.00 77.12  ? 33   ASP B O   1 
ATOM   2843 C CB  . ASP B 1 18  ? 108.636 59.678 70.106  1.00 82.20  ? 33   ASP B CB  1 
ATOM   2844 C CG  . ASP B 1 18  ? 108.133 58.241 70.308  1.00 87.07  ? 33   ASP B CG  1 
ATOM   2845 O OD1 . ASP B 1 18  ? 108.738 57.486 71.111  1.00 87.17  ? 33   ASP B OD1 1 
ATOM   2846 O OD2 . ASP B 1 18  ? 107.120 57.873 69.668  1.00 88.78  ? 33   ASP B OD2 1 
ATOM   2847 N N   . GLY B 1 19  ? 108.210 63.009 71.405  1.00 77.73  ? 34   GLY B N   1 
ATOM   2848 C CA  . GLY B 1 19  ? 108.707 64.369 71.266  1.00 75.80  ? 34   GLY B CA  1 
ATOM   2849 C C   . GLY B 1 19  ? 108.730 65.005 69.883  1.00 75.47  ? 34   GLY B C   1 
ATOM   2850 O O   . GLY B 1 19  ? 109.476 65.961 69.669  1.00 75.88  ? 34   GLY B O   1 
ATOM   2851 N N   . SER B 1 20  ? 107.922 64.500 68.951  1.00 75.16  ? 35   SER B N   1 
ATOM   2852 C CA  . SER B 1 20  ? 107.870 65.049 67.593  1.00 72.57  ? 35   SER B CA  1 
ATOM   2853 C C   . SER B 1 20  ? 106.660 65.962 67.405  1.00 70.55  ? 35   SER B C   1 
ATOM   2854 O O   . SER B 1 20  ? 105.539 65.621 67.794  1.00 69.50  ? 35   SER B O   1 
ATOM   2855 C CB  . SER B 1 20  ? 107.811 63.918 66.563  1.00 74.51  ? 35   SER B CB  1 
ATOM   2856 O OG  . SER B 1 20  ? 108.899 63.022 66.717  1.00 78.76  ? 35   SER B OG  1 
ATOM   2857 N N   . LYS B 1 21  ? 106.900 67.126 66.811  1.00 68.99  ? 36   LYS B N   1 
ATOM   2858 C CA  . LYS B 1 21  ? 105.844 68.098 66.555  1.00 68.22  ? 36   LYS B CA  1 
ATOM   2859 C C   . LYS B 1 21  ? 104.681 67.333 65.918  1.00 67.03  ? 36   LYS B C   1 
ATOM   2860 O O   . LYS B 1 21  ? 104.901 66.519 65.017  1.00 65.20  ? 36   LYS B O   1 
ATOM   2861 C CB  . LYS B 1 21  ? 106.374 69.165 65.589  1.00 69.92  ? 36   LYS B CB  1 
ATOM   2862 C CG  . LYS B 1 21  ? 105.783 70.560 65.744  1.00 72.77  ? 36   LYS B CG  1 
ATOM   2863 C CD  . LYS B 1 21  ? 106.454 71.561 64.778  1.00 74.89  ? 36   LYS B CD  1 
ATOM   2864 C CE  . LYS B 1 21  ? 107.964 71.737 65.052  1.00 77.36  ? 36   LYS B CE  1 
ATOM   2865 N NZ  . LYS B 1 21  ? 108.657 72.711 64.141  1.00 76.32  ? 36   LYS B NZ  1 
ATOM   2866 N N   . VAL B 1 22  ? 103.458 67.560 66.399  1.00 65.83  ? 37   VAL B N   1 
ATOM   2867 C CA  . VAL B 1 22  ? 102.284 66.885 65.832  1.00 64.21  ? 37   VAL B CA  1 
ATOM   2868 C C   . VAL B 1 22  ? 101.334 67.868 65.156  1.00 62.94  ? 37   VAL B C   1 
ATOM   2869 O O   . VAL B 1 22  ? 100.509 68.513 65.807  1.00 63.43  ? 37   VAL B O   1 
ATOM   2870 C CB  . VAL B 1 22  ? 101.483 66.093 66.892  1.00 64.09  ? 37   VAL B CB  1 
ATOM   2871 C CG1 . VAL B 1 22  ? 100.232 65.487 66.254  1.00 63.32  ? 37   VAL B CG1 1 
ATOM   2872 C CG2 . VAL B 1 22  ? 102.345 64.996 67.470  1.00 64.13  ? 37   VAL B CG2 1 
ATOM   2873 N N   . THR B 1 23  ? 101.464 67.961 63.837  1.00 60.75  ? 38   THR B N   1 
ATOM   2874 C CA  . THR B 1 23  ? 100.651 68.845 63.023  1.00 58.52  ? 38   THR B CA  1 
ATOM   2875 C C   . THR B 1 23  ? 99.252  68.282 62.801  1.00 57.18  ? 38   THR B C   1 
ATOM   2876 O O   . THR B 1 23  ? 99.086  67.078 62.593  1.00 57.34  ? 38   THR B O   1 
ATOM   2877 C CB  . THR B 1 23  ? 101.300 69.054 61.648  1.00 59.83  ? 38   THR B CB  1 
ATOM   2878 O OG1 . THR B 1 23  ? 102.605 69.626 61.812  1.00 58.71  ? 38   THR B OG1 1 
ATOM   2879 C CG2 . THR B 1 23  ? 100.444 69.971 60.786  1.00 59.22  ? 38   THR B CG2 1 
ATOM   2880 N N   . THR B 1 24  ? 98.251  69.162 62.860  1.00 57.53  ? 39   THR B N   1 
ATOM   2881 C CA  . THR B 1 24  ? 96.848  68.791 62.634  1.00 56.44  ? 39   THR B CA  1 
ATOM   2882 C C   . THR B 1 24  ? 96.255  69.814 61.665  1.00 55.08  ? 39   THR B C   1 
ATOM   2883 O O   . THR B 1 24  ? 96.409  71.021 61.857  1.00 54.58  ? 39   THR B O   1 
ATOM   2884 C CB  . THR B 1 24  ? 96.019  68.807 63.941  1.00 57.06  ? 39   THR B CB  1 
ATOM   2885 O OG1 . THR B 1 24  ? 96.607  67.912 64.894  1.00 60.53  ? 39   THR B OG1 1 
ATOM   2886 C CG2 . THR B 1 24  ? 94.585  68.369 63.667  1.00 56.52  ? 39   THR B CG2 1 
ATOM   2887 N N   . VAL B 1 25  ? 95.588  69.337 60.621  1.00 51.53  ? 40   VAL B N   1 
ATOM   2888 C CA  . VAL B 1 25  ? 95.016  70.244 59.637  1.00 49.72  ? 40   VAL B CA  1 
ATOM   2889 C C   . VAL B 1 25  ? 93.658  69.772 59.145  1.00 49.97  ? 40   VAL B C   1 
ATOM   2890 O O   . VAL B 1 25  ? 93.235  68.645 59.419  1.00 47.85  ? 40   VAL B O   1 
ATOM   2891 C CB  . VAL B 1 25  ? 95.949  70.394 58.400  1.00 51.06  ? 40   VAL B CB  1 
ATOM   2892 C CG1 . VAL B 1 25  ? 97.296  70.938 58.822  1.00 46.99  ? 40   VAL B CG1 1 
ATOM   2893 C CG2 . VAL B 1 25  ? 96.120  69.047 57.699  1.00 46.37  ? 40   VAL B CG2 1 
ATOM   2894 N N   . VAL B 1 26  ? 92.975  70.658 58.428  1.00 49.72  ? 41   VAL B N   1 
ATOM   2895 C CA  . VAL B 1 26  ? 91.682  70.339 57.849  1.00 51.37  ? 41   VAL B CA  1 
ATOM   2896 C C   . VAL B 1 26  ? 91.953  70.043 56.382  1.00 50.39  ? 41   VAL B C   1 
ATOM   2897 O O   . VAL B 1 26  ? 92.252  70.940 55.593  1.00 50.06  ? 41   VAL B O   1 
ATOM   2898 C CB  . VAL B 1 26  ? 90.706  71.513 57.975  1.00 51.79  ? 41   VAL B CB  1 
ATOM   2899 C CG1 . VAL B 1 26  ? 89.349  71.154 57.346  1.00 50.19  ? 41   VAL B CG1 1 
ATOM   2900 C CG2 . VAL B 1 26  ? 90.544  71.852 59.437  1.00 53.41  ? 41   VAL B CG2 1 
ATOM   2901 N N   . ALA B 1 27  ? 91.862  68.767 56.033  1.00 50.00  ? 42   ALA B N   1 
ATOM   2902 C CA  . ALA B 1 27  ? 92.128  68.335 54.680  1.00 53.64  ? 42   ALA B CA  1 
ATOM   2903 C C   . ALA B 1 27  ? 90.887  67.781 54.008  1.00 55.08  ? 42   ALA B C   1 
ATOM   2904 O O   . ALA B 1 27  ? 89.929  67.372 54.658  1.00 55.61  ? 42   ALA B O   1 
ATOM   2905 C CB  . ALA B 1 27  ? 93.233  67.278 54.692  1.00 55.41  ? 42   ALA B CB  1 
ATOM   2906 N N   . THR B 1 28  ? 90.906  67.784 52.688  1.00 54.63  ? 43   THR B N   1 
ATOM   2907 C CA  . THR B 1 28  ? 89.802  67.245 51.939  1.00 54.92  ? 43   THR B CA  1 
ATOM   2908 C C   . THR B 1 28  ? 90.358  65.964 51.353  1.00 55.89  ? 43   THR B C   1 
ATOM   2909 O O   . THR B 1 28  ? 91.437  65.972 50.758  1.00 54.62  ? 43   THR B O   1 
ATOM   2910 C CB  . THR B 1 28  ? 89.416  68.159 50.790  1.00 53.33  ? 43   THR B CB  1 
ATOM   2911 O OG1 . THR B 1 28  ? 89.427  69.516 51.236  1.00 57.15  ? 43   THR B OG1 1 
ATOM   2912 C CG2 . THR B 1 28  ? 88.037  67.812 50.297  1.00 56.67  ? 43   THR B CG2 1 
ATOM   2913 N N   . PRO B 1 29  ? 89.668  64.833 51.549  1.00 58.04  ? 44   PRO B N   1 
ATOM   2914 C CA  . PRO B 1 29  ? 90.249  63.629 50.948  1.00 58.86  ? 44   PRO B CA  1 
ATOM   2915 C C   . PRO B 1 29  ? 90.150  63.817 49.434  1.00 61.02  ? 44   PRO B C   1 
ATOM   2916 O O   . PRO B 1 29  ? 89.095  64.187 48.927  1.00 59.82  ? 44   PRO B O   1 
ATOM   2917 C CB  . PRO B 1 29  ? 89.352  62.513 51.476  1.00 56.18  ? 44   PRO B CB  1 
ATOM   2918 C CG  . PRO B 1 29  ? 88.018  63.202 51.621  1.00 57.32  ? 44   PRO B CG  1 
ATOM   2919 C CD  . PRO B 1 29  ? 88.394  64.537 52.228  1.00 58.00  ? 44   PRO B CD  1 
ATOM   2920 N N   . GLY B 1 30  ? 91.246  63.601 48.714  1.00 65.33  ? 45   GLY B N   1 
ATOM   2921 C CA  . GLY B 1 30  ? 91.206  63.783 47.274  1.00 72.44  ? 45   GLY B CA  1 
ATOM   2922 C C   . GLY B 1 30  ? 90.461  62.683 46.535  1.00 77.08  ? 45   GLY B C   1 
ATOM   2923 O O   . GLY B 1 30  ? 90.186  62.805 45.340  1.00 77.13  ? 45   GLY B O   1 
ATOM   2924 N N   . GLN B 1 31  ? 90.112  61.619 47.256  1.00 81.89  ? 46   GLN B N   1 
ATOM   2925 C CA  . GLN B 1 31  ? 89.428  60.455 46.692  1.00 86.60  ? 46   GLN B CA  1 
ATOM   2926 C C   . GLN B 1 31  ? 87.987  60.654 46.201  1.00 87.84  ? 46   GLN B C   1 
ATOM   2927 O O   . GLN B 1 31  ? 87.756  60.849 45.003  1.00 88.56  ? 46   GLN B O   1 
ATOM   2928 C CB  . GLN B 1 31  ? 89.471  59.313 47.713  1.00 90.09  ? 46   GLN B CB  1 
ATOM   2929 C CG  . GLN B 1 31  ? 90.883  58.986 48.206  1.00 94.35  ? 46   GLN B CG  1 
ATOM   2930 C CD  . GLN B 1 31  ? 90.906  58.444 49.639  1.00 97.94  ? 46   GLN B CD  1 
ATOM   2931 O OE1 . GLN B 1 31  ? 90.360  59.064 50.565  1.00 97.01  ? 46   GLN B OE1 1 
ATOM   2932 N NE2 . GLN B 1 31  ? 91.550  57.289 49.828  1.00 99.05  ? 46   GLN B NE2 1 
ATOM   2933 N N   . GLY B 1 32  ? 87.021  60.599 47.118  1.00 89.56  ? 47   GLY B N   1 
ATOM   2934 C CA  . GLY B 1 32  ? 85.625  60.743 46.720  1.00 90.20  ? 47   GLY B CA  1 
ATOM   2935 C C   . GLY B 1 32  ? 84.834  61.892 47.330  1.00 90.07  ? 47   GLY B C   1 
ATOM   2936 O O   . GLY B 1 32  ? 84.891  63.010 46.814  1.00 90.46  ? 47   GLY B O   1 
ATOM   2937 N N   . PRO B 1 33  ? 84.061  61.642 48.412  1.00 90.29  ? 48   PRO B N   1 
ATOM   2938 C CA  . PRO B 1 33  ? 83.225  62.618 49.141  1.00 89.26  ? 48   PRO B CA  1 
ATOM   2939 C C   . PRO B 1 33  ? 83.943  63.893 49.636  1.00 87.74  ? 48   PRO B C   1 
ATOM   2940 O O   . PRO B 1 33  ? 84.591  63.896 50.691  1.00 86.54  ? 48   PRO B O   1 
ATOM   2941 C CB  . PRO B 1 33  ? 82.657  61.782 50.289  1.00 90.16  ? 48   PRO B CB  1 
ATOM   2942 C CG  . PRO B 1 33  ? 82.492  60.420 49.645  1.00 89.38  ? 48   PRO B CG  1 
ATOM   2943 C CD  . PRO B 1 33  ? 83.807  60.270 48.902  1.00 90.21  ? 48   PRO B CD  1 
ATOM   2944 N N   . ASP B 1 34  ? 83.786  64.970 48.866  1.00 86.05  ? 49   ASP B N   1 
ATOM   2945 C CA  . ASP B 1 34  ? 84.407  66.274 49.134  1.00 85.19  ? 49   ASP B CA  1 
ATOM   2946 C C   . ASP B 1 34  ? 83.969  66.930 50.452  1.00 84.96  ? 49   ASP B C   1 
ATOM   2947 O O   . ASP B 1 34  ? 83.114  67.818 50.455  1.00 85.50  ? 49   ASP B O   1 
ATOM   2948 C CB  . ASP B 1 34  ? 84.099  67.222 47.959  1.00 85.05  ? 49   ASP B CB  1 
ATOM   2949 C CG  . ASP B 1 34  ? 84.965  68.478 47.957  1.00 86.70  ? 49   ASP B CG  1 
ATOM   2950 O OD1 . ASP B 1 34  ? 85.094  69.137 49.013  1.00 88.74  ? 49   ASP B OD1 1 
ATOM   2951 O OD2 . ASP B 1 34  ? 85.507  68.817 46.884  1.00 87.66  ? 49   ASP B OD2 1 
ATOM   2952 N N   . ARG B 1 35  ? 84.548  66.502 51.570  1.00 83.18  ? 50   ARG B N   1 
ATOM   2953 C CA  . ARG B 1 35  ? 84.200  67.095 52.856  1.00 83.18  ? 50   ARG B CA  1 
ATOM   2954 C C   . ARG B 1 35  ? 85.416  67.156 53.773  1.00 81.18  ? 50   ARG B C   1 
ATOM   2955 O O   . ARG B 1 35  ? 86.079  66.144 54.006  1.00 80.66  ? 50   ARG B O   1 
ATOM   2956 C CB  . ARG B 1 35  ? 83.050  66.318 53.520  1.00 85.61  ? 50   ARG B CB  1 
ATOM   2957 C CG  . ARG B 1 35  ? 81.672  66.563 52.867  1.00 89.38  ? 50   ARG B CG  1 
ATOM   2958 C CD  . ARG B 1 35  ? 80.507  65.926 53.650  1.00 91.67  ? 50   ARG B CD  1 
ATOM   2959 N NE  . ARG B 1 35  ? 80.334  66.505 54.991  1.00 95.42  ? 50   ARG B NE  1 
ATOM   2960 C CZ  . ARG B 1 35  ? 79.369  66.171 55.857  1.00 96.73  ? 50   ARG B CZ  1 
ATOM   2961 N NH1 . ARG B 1 35  ? 78.466  65.250 55.540  1.00 96.99  ? 50   ARG B NH1 1 
ATOM   2962 N NH2 . ARG B 1 35  ? 79.300  66.763 57.050  1.00 97.87  ? 50   ARG B NH2 1 
ATOM   2963 N N   . PRO B 1 36  ? 85.732  68.359 54.292  1.00 79.66  ? 51   PRO B N   1 
ATOM   2964 C CA  . PRO B 1 36  ? 86.871  68.586 55.184  1.00 78.29  ? 51   PRO B CA  1 
ATOM   2965 C C   . PRO B 1 36  ? 86.937  67.602 56.328  1.00 76.49  ? 51   PRO B C   1 
ATOM   2966 O O   . PRO B 1 36  ? 85.927  67.299 56.958  1.00 75.24  ? 51   PRO B O   1 
ATOM   2967 C CB  . PRO B 1 36  ? 86.651  70.013 55.670  1.00 78.88  ? 51   PRO B CB  1 
ATOM   2968 C CG  . PRO B 1 36  ? 86.037  70.657 54.487  1.00 78.82  ? 51   PRO B CG  1 
ATOM   2969 C CD  . PRO B 1 36  ? 85.014  69.624 54.056  1.00 78.91  ? 51   PRO B CD  1 
ATOM   2970 N N   . GLN B 1 37  ? 88.144  67.101 56.571  1.00 76.59  ? 52   GLN B N   1 
ATOM   2971 C CA  . GLN B 1 37  ? 88.414  66.152 57.644  1.00 76.32  ? 52   GLN B CA  1 
ATOM   2972 C C   . GLN B 1 37  ? 89.599  66.670 58.439  1.00 75.23  ? 52   GLN B C   1 
ATOM   2973 O O   . GLN B 1 37  ? 90.332  67.551 57.983  1.00 74.07  ? 52   GLN B O   1 
ATOM   2974 C CB  . GLN B 1 37  ? 88.818  64.784 57.103  1.00 78.82  ? 52   GLN B CB  1 
ATOM   2975 C CG  . GLN B 1 37  ? 87.927  64.169 56.056  1.00 82.31  ? 52   GLN B CG  1 
ATOM   2976 C CD  . GLN B 1 37  ? 88.392  62.765 55.708  1.00 84.86  ? 52   GLN B CD  1 
ATOM   2977 O OE1 . GLN B 1 37  ? 87.896  62.149 54.761  1.00 87.95  ? 52   GLN B OE1 1 
ATOM   2978 N NE2 . GLN B 1 37  ? 89.352  62.250 56.482  1.00 82.95  ? 52   GLN B NE2 1 
ATOM   2979 N N   . GLU B 1 38  ? 89.799  66.097 59.620  1.00 73.43  ? 53   GLU B N   1 
ATOM   2980 C CA  . GLU B 1 38  ? 90.914  66.483 60.474  1.00 73.17  ? 53   GLU B CA  1 
ATOM   2981 C C   . GLU B 1 38  ? 91.998  65.409 60.419  1.00 70.44  ? 53   GLU B C   1 
ATOM   2982 O O   . GLU B 1 38  ? 91.830  64.303 60.935  1.00 71.52  ? 53   GLU B O   1 
ATOM   2983 C CB  . GLU B 1 38  ? 90.438  66.673 61.917  1.00 75.20  ? 53   GLU B CB  1 
ATOM   2984 C CG  . GLU B 1 38  ? 91.565  66.784 62.936  1.00 80.68  ? 53   GLU B CG  1 
ATOM   2985 C CD  . GLU B 1 38  ? 91.056  66.863 64.366  1.00 82.76  ? 53   GLU B CD  1 
ATOM   2986 O OE1 . GLU B 1 38  ? 91.770  66.378 65.268  1.00 81.42  ? 53   GLU B OE1 1 
ATOM   2987 O OE2 . GLU B 1 38  ? 89.954  67.415 64.592  1.00 84.51  ? 53   GLU B OE2 1 
ATOM   2988 N N   . VAL B 1 39  ? 93.110  65.735 59.783  1.00 66.44  ? 54   VAL B N   1 
ATOM   2989 C CA  . VAL B 1 39  ? 94.196  64.784 59.677  1.00 62.52  ? 54   VAL B CA  1 
ATOM   2990 C C   . VAL B 1 39  ? 95.369  65.273 60.504  1.00 60.32  ? 54   VAL B C   1 
ATOM   2991 O O   . VAL B 1 39  ? 95.729  66.451 60.444  1.00 60.13  ? 54   VAL B O   1 
ATOM   2992 C CB  . VAL B 1 39  ? 94.648  64.614 58.212  1.00 63.13  ? 54   VAL B CB  1 
ATOM   2993 C CG1 . VAL B 1 39  ? 95.789  63.598 58.134  1.00 60.26  ? 54   VAL B CG1 1 
ATOM   2994 C CG2 . VAL B 1 39  ? 93.464  64.181 57.352  1.00 58.73  ? 54   VAL B CG2 1 
ATOM   2995 N N   . SER B 1 40  ? 95.949  64.364 61.283  1.00 57.78  ? 55   SER B N   1 
ATOM   2996 C CA  . SER B 1 40  ? 97.097  64.685 62.118  1.00 55.70  ? 55   SER B CA  1 
ATOM   2997 C C   . SER B 1 40  ? 98.301  63.844 61.703  1.00 55.38  ? 55   SER B C   1 
ATOM   2998 O O   . SER B 1 40  ? 98.178  62.653 61.403  1.00 54.55  ? 55   SER B O   1 
ATOM   2999 C CB  . SER B 1 40  ? 96.764  64.424 63.577  1.00 54.82  ? 55   SER B CB  1 
ATOM   3000 O OG  . SER B 1 40  ? 95.541  65.047 63.899  1.00 58.55  ? 55   SER B OG  1 
ATOM   3001 N N   . TYR B 1 41  ? 99.468  64.469 61.669  1.00 53.67  ? 56   TYR B N   1 
ATOM   3002 C CA  . TYR B 1 41  ? 100.670 63.750 61.293  1.00 53.28  ? 56   TYR B CA  1 
ATOM   3003 C C   . TYR B 1 41  ? 101.884 64.203 62.089  1.00 54.47  ? 56   TYR B C   1 
ATOM   3004 O O   . TYR B 1 41  ? 101.911 65.295 62.642  1.00 52.06  ? 56   TYR B O   1 
ATOM   3005 C CB  . TYR B 1 41  ? 100.938 63.894 59.789  1.00 48.23  ? 56   TYR B CB  1 
ATOM   3006 C CG  . TYR B 1 41  ? 101.169 65.307 59.295  1.00 45.16  ? 56   TYR B CG  1 
ATOM   3007 C CD1 . TYR B 1 41  ? 100.116 66.069 58.781  1.00 43.46  ? 56   TYR B CD1 1 
ATOM   3008 C CD2 . TYR B 1 41  ? 102.453 65.864 59.281  1.00 43.07  ? 56   TYR B CD2 1 
ATOM   3009 C CE1 . TYR B 1 41  ? 100.338 67.353 58.255  1.00 43.52  ? 56   TYR B CE1 1 
ATOM   3010 C CE2 . TYR B 1 41  ? 102.687 67.141 58.760  1.00 42.64  ? 56   TYR B CE2 1 
ATOM   3011 C CZ  . TYR B 1 41  ? 101.626 67.881 58.246  1.00 44.91  ? 56   TYR B CZ  1 
ATOM   3012 O OH  . TYR B 1 41  ? 101.850 69.138 57.719  1.00 45.33  ? 56   TYR B OH  1 
ATOM   3013 N N   . THR B 1 42  ? 102.887 63.345 62.152  1.00 57.62  ? 57   THR B N   1 
ATOM   3014 C CA  . THR B 1 42  ? 104.091 63.667 62.884  1.00 60.76  ? 57   THR B CA  1 
ATOM   3015 C C   . THR B 1 42  ? 105.308 63.096 62.160  1.00 62.59  ? 57   THR B C   1 
ATOM   3016 O O   . THR B 1 42  ? 105.171 62.386 61.161  1.00 61.71  ? 57   THR B O   1 
ATOM   3017 C CB  . THR B 1 42  ? 104.004 63.124 64.331  1.00 60.80  ? 57   THR B CB  1 
ATOM   3018 O OG1 . THR B 1 42  ? 105.253 63.340 64.996  1.00 61.60  ? 57   THR B OG1 1 
ATOM   3019 C CG2 . THR B 1 42  ? 103.663 61.642 64.335  1.00 58.32  ? 57   THR B CG2 1 
ATOM   3020 N N   . ASP B 1 43  ? 106.496 63.424 62.659  1.00 63.67  ? 58   ASP B N   1 
ATOM   3021 C CA  . ASP B 1 43  ? 107.746 62.953 62.066  1.00 64.75  ? 58   ASP B CA  1 
ATOM   3022 C C   . ASP B 1 43  ? 107.923 63.541 60.687  1.00 64.23  ? 58   ASP B C   1 
ATOM   3023 O O   . ASP B 1 43  ? 108.195 62.832 59.714  1.00 63.96  ? 58   ASP B O   1 
ATOM   3024 C CB  . ASP B 1 43  ? 107.757 61.430 61.998  1.00 67.94  ? 58   ASP B CB  1 
ATOM   3025 C CG  . ASP B 1 43  ? 107.702 60.802 63.370  1.00 73.21  ? 58   ASP B CG  1 
ATOM   3026 O OD1 . ASP B 1 43  ? 108.651 61.028 64.156  1.00 74.09  ? 58   ASP B OD1 1 
ATOM   3027 O OD2 . ASP B 1 43  ? 106.710 60.098 63.668  1.00 77.90  ? 58   ASP B OD2 1 
ATOM   3028 N N   . THR B 1 44  ? 107.777 64.860 60.633  1.00 62.52  ? 59   THR B N   1 
ATOM   3029 C CA  . THR B 1 44  ? 107.886 65.619 59.400  1.00 60.95  ? 59   THR B CA  1 
ATOM   3030 C C   . THR B 1 44  ? 109.335 66.024 59.094  1.00 61.57  ? 59   THR B C   1 
ATOM   3031 O O   . THR B 1 44  ? 109.996 66.676 59.900  1.00 60.89  ? 59   THR B O   1 
ATOM   3032 C CB  . THR B 1 44  ? 106.986 66.883 59.479  1.00 61.10  ? 59   THR B CB  1 
ATOM   3033 O OG1 . THR B 1 44  ? 105.681 66.518 59.971  1.00 54.58  ? 59   THR B OG1 1 
ATOM   3034 C CG2 . THR B 1 44  ? 106.864 67.538 58.095  1.00 58.16  ? 59   THR B CG2 1 
ATOM   3035 N N   . LYS B 1 45  ? 109.825 65.627 57.923  1.00 62.25  ? 60   LYS B N   1 
ATOM   3036 C CA  . LYS B 1 45  ? 111.191 65.951 57.535  1.00 61.79  ? 60   LYS B CA  1 
ATOM   3037 C C   . LYS B 1 45  ? 111.328 66.112 56.033  1.00 59.32  ? 60   LYS B C   1 
ATOM   3038 O O   . LYS B 1 45  ? 110.814 65.295 55.272  1.00 59.15  ? 60   LYS B O   1 
ATOM   3039 C CB  . LYS B 1 45  ? 112.148 64.860 58.014  1.00 63.34  ? 60   LYS B CB  1 
ATOM   3040 C CG  . LYS B 1 45  ? 111.976 63.495 57.355  1.00 66.57  ? 60   LYS B CG  1 
ATOM   3041 C CD  . LYS B 1 45  ? 113.021 62.535 57.919  1.00 71.80  ? 60   LYS B CD  1 
ATOM   3042 C CE  . LYS B 1 45  ? 113.133 61.233 57.132  1.00 74.00  ? 60   LYS B CE  1 
ATOM   3043 N NZ  . LYS B 1 45  ? 114.295 60.396 57.598  1.00 74.20  ? 60   LYS B NZ  1 
ATOM   3044 N N   . VAL B 1 46  ? 112.025 67.165 55.611  1.00 56.52  ? 61   VAL B N   1 
ATOM   3045 C CA  . VAL B 1 46  ? 112.225 67.429 54.190  1.00 55.54  ? 61   VAL B CA  1 
ATOM   3046 C C   . VAL B 1 46  ? 112.939 66.245 53.560  1.00 56.39  ? 61   VAL B C   1 
ATOM   3047 O O   . VAL B 1 46  ? 113.894 65.729 54.124  1.00 57.83  ? 61   VAL B O   1 
ATOM   3048 C CB  . VAL B 1 46  ? 113.067 68.712 53.961  1.00 52.78  ? 61   VAL B CB  1 
ATOM   3049 C CG1 . VAL B 1 46  ? 113.327 68.908 52.484  1.00 49.66  ? 61   VAL B CG1 1 
ATOM   3050 C CG2 . VAL B 1 46  ? 112.337 69.923 54.524  1.00 48.85  ? 61   VAL B CG2 1 
ATOM   3051 N N   . ILE B 1 47  ? 112.456 65.798 52.406  1.00 57.63  ? 62   ILE B N   1 
ATOM   3052 C CA  . ILE B 1 47  ? 113.078 64.679 51.710  1.00 58.82  ? 62   ILE B CA  1 
ATOM   3053 C C   . ILE B 1 47  ? 113.190 64.965 50.212  1.00 63.10  ? 62   ILE B C   1 
ATOM   3054 O O   . ILE B 1 47  ? 113.633 64.108 49.448  1.00 64.75  ? 62   ILE B O   1 
ATOM   3055 C CB  . ILE B 1 47  ? 112.291 63.346 51.905  1.00 56.88  ? 62   ILE B CB  1 
ATOM   3056 C CG1 . ILE B 1 47  ? 110.894 63.458 51.284  1.00 58.35  ? 62   ILE B CG1 1 
ATOM   3057 C CG2 . ILE B 1 47  ? 112.213 62.993 53.382  1.00 55.88  ? 62   ILE B CG2 1 
ATOM   3058 C CD1 . ILE B 1 47  ? 110.060 62.191 51.391  1.00 55.15  ? 62   ILE B CD1 1 
ATOM   3059 N N   . GLY B 1 48  ? 112.796 66.169 49.796  1.00 66.43  ? 63   GLY B N   1 
ATOM   3060 C CA  . GLY B 1 48  ? 112.869 66.521 48.385  1.00 69.79  ? 63   GLY B CA  1 
ATOM   3061 C C   . GLY B 1 48  ? 112.638 67.993 48.086  1.00 72.29  ? 63   GLY B C   1 
ATOM   3062 O O   . GLY B 1 48  ? 111.825 68.646 48.736  1.00 71.94  ? 63   GLY B O   1 
ATOM   3063 N N   . ASN B 1 49  ? 113.351 68.520 47.094  1.00 75.09  ? 64   ASN B N   1 
ATOM   3064 C CA  . ASN B 1 49  ? 113.212 69.926 46.722  1.00 78.32  ? 64   ASN B CA  1 
ATOM   3065 C C   . ASN B 1 49  ? 113.082 70.190 45.228  1.00 80.89  ? 64   ASN B C   1 
ATOM   3066 O O   . ASN B 1 49  ? 112.901 69.278 44.421  1.00 81.30  ? 64   ASN B O   1 
ATOM   3067 C CB  . ASN B 1 49  ? 114.384 70.749 47.264  1.00 78.46  ? 64   ASN B CB  1 
ATOM   3068 C CG  . ASN B 1 49  ? 114.307 70.950 48.759  1.00 79.68  ? 64   ASN B CG  1 
ATOM   3069 O OD1 . ASN B 1 49  ? 114.501 70.015 49.539  1.00 80.25  ? 64   ASN B OD1 1 
ATOM   3070 N ND2 . ASN B 1 49  ? 114.009 72.175 49.170  1.00 81.38  ? 64   ASN B ND2 1 
ATOM   3071 N N   . GLY B 1 50  ? 113.179 71.466 44.879  1.00 84.00  ? 65   GLY B N   1 
ATOM   3072 C CA  . GLY B 1 50  ? 113.062 71.874 43.497  1.00 85.55  ? 65   GLY B CA  1 
ATOM   3073 C C   . GLY B 1 50  ? 112.456 73.260 43.450  1.00 87.20  ? 65   GLY B C   1 
ATOM   3074 O O   . GLY B 1 50  ? 112.025 73.801 44.479  1.00 87.05  ? 65   GLY B O   1 
ATOM   3075 N N   . SER B 1 51  ? 112.429 73.834 42.251  1.00 88.97  ? 66   SER B N   1 
ATOM   3076 C CA  . SER B 1 51  ? 111.875 75.167 42.030  1.00 90.11  ? 66   SER B CA  1 
ATOM   3077 C C   . SER B 1 51  ? 110.366 75.171 42.325  1.00 89.43  ? 66   SER B C   1 
ATOM   3078 O O   . SER B 1 51  ? 109.823 76.165 42.823  1.00 88.53  ? 66   SER B O   1 
ATOM   3079 C CB  . SER B 1 51  ? 112.129 75.600 40.576  1.00 91.14  ? 66   SER B CB  1 
ATOM   3080 O OG  . SER B 1 51  ? 113.504 75.487 40.228  1.00 93.04  ? 66   SER B OG  1 
ATOM   3081 N N   . PHE B 1 52  ? 109.706 74.050 42.020  1.00 87.91  ? 67   PHE B N   1 
ATOM   3082 C CA  . PHE B 1 52  ? 108.266 73.890 42.233  1.00 85.70  ? 67   PHE B CA  1 
ATOM   3083 C C   . PHE B 1 52  ? 107.895 73.969 43.714  1.00 81.91  ? 67   PHE B C   1 
ATOM   3084 O O   . PHE B 1 52  ? 106.870 74.552 44.074  1.00 82.25  ? 67   PHE B O   1 
ATOM   3085 C CB  . PHE B 1 52  ? 107.791 72.543 41.656  1.00 88.12  ? 67   PHE B CB  1 
ATOM   3086 C CG  . PHE B 1 52  ? 108.218 71.345 42.466  1.00 92.02  ? 67   PHE B CG  1 
ATOM   3087 C CD1 . PHE B 1 52  ? 107.570 71.025 43.665  1.00 93.75  ? 67   PHE B CD1 1 
ATOM   3088 C CD2 . PHE B 1 52  ? 109.293 70.559 42.054  1.00 94.36  ? 67   PHE B CD2 1 
ATOM   3089 C CE1 . PHE B 1 52  ? 107.989 69.942 44.447  1.00 96.09  ? 67   PHE B CE1 1 
ATOM   3090 C CE2 . PHE B 1 52  ? 109.721 69.471 42.827  1.00 96.43  ? 67   PHE B CE2 1 
ATOM   3091 C CZ  . PHE B 1 52  ? 109.067 69.163 44.028  1.00 96.64  ? 67   PHE B CZ  1 
ATOM   3092 N N   . GLY B 1 53  ? 108.729 73.377 44.564  1.00 77.24  ? 68   GLY B N   1 
ATOM   3093 C CA  . GLY B 1 53  ? 108.458 73.390 45.986  1.00 71.97  ? 68   GLY B CA  1 
ATOM   3094 C C   . GLY B 1 53  ? 109.262 72.360 46.747  1.00 68.16  ? 68   GLY B C   1 
ATOM   3095 O O   . GLY B 1 53  ? 110.261 71.850 46.249  1.00 68.51  ? 68   GLY B O   1 
ATOM   3096 N N   . VAL B 1 54  ? 108.813 72.053 47.960  1.00 62.01  ? 69   VAL B N   1 
ATOM   3097 C CA  . VAL B 1 54  ? 109.482 71.094 48.829  1.00 57.48  ? 69   VAL B CA  1 
ATOM   3098 C C   . VAL B 1 54  ? 108.603 69.879 49.100  1.00 55.34  ? 69   VAL B C   1 
ATOM   3099 O O   . VAL B 1 54  ? 107.382 69.991 49.198  1.00 54.95  ? 69   VAL B O   1 
ATOM   3100 C CB  . VAL B 1 54  ? 109.833 71.735 50.191  1.00 57.34  ? 69   VAL B CB  1 
ATOM   3101 C CG1 . VAL B 1 54  ? 110.659 70.773 51.037  1.00 51.93  ? 69   VAL B CG1 1 
ATOM   3102 C CG2 . VAL B 1 54  ? 110.580 73.026 49.970  1.00 57.25  ? 69   VAL B CG2 1 
ATOM   3103 N N   . VAL B 1 55  ? 109.237 68.720 49.232  1.00 51.98  ? 70   VAL B N   1 
ATOM   3104 C CA  . VAL B 1 55  ? 108.530 67.476 49.518  1.00 49.00  ? 70   VAL B CA  1 
ATOM   3105 C C   . VAL B 1 55  ? 108.903 66.974 50.913  1.00 48.12  ? 70   VAL B C   1 
ATOM   3106 O O   . VAL B 1 55  ? 110.081 66.862 51.243  1.00 50.38  ? 70   VAL B O   1 
ATOM   3107 C CB  . VAL B 1 55  ? 108.893 66.386 48.497  1.00 45.70  ? 70   VAL B CB  1 
ATOM   3108 C CG1 . VAL B 1 55  ? 107.988 65.184 48.696  1.00 39.78  ? 70   VAL B CG1 1 
ATOM   3109 C CG2 . VAL B 1 55  ? 108.796 66.947 47.077  1.00 45.50  ? 70   VAL B CG2 1 
ATOM   3110 N N   . TYR B 1 56  ? 107.907 66.677 51.736  1.00 47.83  ? 71   TYR B N   1 
ATOM   3111 C CA  . TYR B 1 56  ? 108.191 66.189 53.077  1.00 48.69  ? 71   TYR B CA  1 
ATOM   3112 C C   . TYR B 1 56  ? 107.734 64.765 53.250  1.00 47.36  ? 71   TYR B C   1 
ATOM   3113 O O   . TYR B 1 56  ? 107.056 64.205 52.401  1.00 50.46  ? 71   TYR B O   1 
ATOM   3114 C CB  . TYR B 1 56  ? 107.471 67.016 54.146  1.00 50.52  ? 71   TYR B CB  1 
ATOM   3115 C CG  . TYR B 1 56  ? 107.835 68.472 54.206  1.00 52.28  ? 71   TYR B CG  1 
ATOM   3116 C CD1 . TYR B 1 56  ? 107.542 69.327 53.145  1.00 54.68  ? 71   TYR B CD1 1 
ATOM   3117 C CD2 . TYR B 1 56  ? 108.438 69.006 55.339  1.00 53.85  ? 71   TYR B CD2 1 
ATOM   3118 C CE1 . TYR B 1 56  ? 107.837 70.684 53.213  1.00 53.64  ? 71   TYR B CE1 1 
ATOM   3119 C CE2 . TYR B 1 56  ? 108.740 70.360 55.419  1.00 56.10  ? 71   TYR B CE2 1 
ATOM   3120 C CZ  . TYR B 1 56  ? 108.435 71.194 54.351  1.00 53.85  ? 71   TYR B CZ  1 
ATOM   3121 O OH  . TYR B 1 56  ? 108.713 72.539 54.427  1.00 57.98  ? 71   TYR B OH  1 
ATOM   3122 N N   . GLN B 1 57  ? 108.124 64.189 54.375  1.00 49.82  ? 72   GLN B N   1 
ATOM   3123 C CA  . GLN B 1 57  ? 107.720 62.846 54.742  1.00 52.41  ? 72   GLN B CA  1 
ATOM   3124 C C   . GLN B 1 57  ? 107.210 62.978 56.162  1.00 51.70  ? 72   GLN B C   1 
ATOM   3125 O O   . GLN B 1 57  ? 107.844 63.629 56.997  1.00 53.22  ? 72   GLN B O   1 
ATOM   3126 C CB  . GLN B 1 57  ? 108.884 61.861 54.742  1.00 55.33  ? 72   GLN B CB  1 
ATOM   3127 C CG  . GLN B 1 57  ? 108.476 60.534 55.386  1.00 62.43  ? 72   GLN B CG  1 
ATOM   3128 C CD  . GLN B 1 57  ? 109.644 59.625 55.702  1.00 67.74  ? 72   GLN B CD  1 
ATOM   3129 O OE1 . GLN B 1 57  ? 109.516 58.679 56.489  1.00 70.22  ? 72   GLN B OE1 1 
ATOM   3130 N NE2 . GLN B 1 57  ? 110.790 59.897 55.084  1.00 68.86  ? 72   GLN B NE2 1 
ATOM   3131 N N   . ALA B 1 58  ? 106.065 62.365 56.429  1.00 51.11  ? 73   ALA B N   1 
ATOM   3132 C CA  . ALA B 1 58  ? 105.468 62.414 57.750  1.00 51.61  ? 73   ALA B CA  1 
ATOM   3133 C C   . ALA B 1 58  ? 104.827 61.074 58.037  1.00 52.59  ? 73   ALA B C   1 
ATOM   3134 O O   . ALA B 1 58  ? 104.886 60.156 57.219  1.00 50.63  ? 73   ALA B O   1 
ATOM   3135 C CB  . ALA B 1 58  ? 104.428 63.513 57.809  1.00 50.05  ? 73   ALA B CB  1 
ATOM   3136 N N   . LYS B 1 59  ? 104.215 60.967 59.207  1.00 56.60  ? 74   LYS B N   1 
ATOM   3137 C CA  . LYS B 1 59  ? 103.559 59.738 59.606  1.00 60.82  ? 74   LYS B CA  1 
ATOM   3138 C C   . LYS B 1 59  ? 102.198 60.090 60.168  1.00 61.86  ? 74   LYS B C   1 
ATOM   3139 O O   . LYS B 1 59  ? 102.095 60.903 61.084  1.00 60.51  ? 74   LYS B O   1 
ATOM   3140 C CB  . LYS B 1 59  ? 104.391 59.014 60.670  1.00 63.68  ? 74   LYS B CB  1 
ATOM   3141 C CG  . LYS B 1 59  ? 103.924 57.589 60.966  1.00 68.15  ? 74   LYS B CG  1 
ATOM   3142 C CD  . LYS B 1 59  ? 104.847 56.883 61.954  1.00 71.43  ? 74   LYS B CD  1 
ATOM   3143 C CE  . LYS B 1 59  ? 104.840 57.580 63.305  1.00 74.21  ? 74   LYS B CE  1 
ATOM   3144 N NZ  . LYS B 1 59  ? 105.859 57.012 64.231  1.00 75.50  ? 74   LYS B NZ  1 
ATOM   3145 N N   . LEU B 1 60  ? 101.157 59.491 59.601  1.00 64.03  ? 75   LEU B N   1 
ATOM   3146 C CA  . LEU B 1 60  ? 99.795  59.722 60.061  1.00 65.98  ? 75   LEU B CA  1 
ATOM   3147 C C   . LEU B 1 60  ? 99.667  59.260 61.511  1.00 69.26  ? 75   LEU B C   1 
ATOM   3148 O O   . LEU B 1 60  ? 100.314 58.298 61.917  1.00 70.97  ? 75   LEU B O   1 
ATOM   3149 C CB  . LEU B 1 60  ? 98.814  58.946 59.184  1.00 64.45  ? 75   LEU B CB  1 
ATOM   3150 C CG  . LEU B 1 60  ? 98.117  59.732 58.077  1.00 63.24  ? 75   LEU B CG  1 
ATOM   3151 C CD1 . LEU B 1 60  ? 99.140  60.473 57.260  1.00 64.69  ? 75   LEU B CD1 1 
ATOM   3152 C CD2 . LEU B 1 60  ? 97.292  58.782 57.217  1.00 64.28  ? 75   LEU B CD2 1 
ATOM   3153 N N   . CYS B 1 61  ? 98.844  59.943 62.297  1.00 72.09  ? 76   CYS B N   1 
ATOM   3154 C CA  . CYS B 1 61  ? 98.667  59.558 63.692  1.00 73.75  ? 76   CYS B CA  1 
ATOM   3155 C C   . CYS B 1 61  ? 97.561  58.510 63.818  1.00 76.07  ? 76   CYS B C   1 
ATOM   3156 O O   . CYS B 1 61  ? 97.721  57.496 64.502  1.00 76.50  ? 76   CYS B O   1 
ATOM   3157 C CB  . CYS B 1 61  ? 98.342  60.793 64.534  1.00 72.35  ? 76   CYS B CB  1 
ATOM   3158 S SG  . CYS B 1 61  ? 99.688  62.009 64.592  1.00 74.10  ? 76   CYS B SG  1 
ATOM   3159 N N   . ASP B 1 62  ? 96.445  58.756 63.137  1.00 79.28  ? 77   ASP B N   1 
ATOM   3160 C CA  . ASP B 1 62  ? 95.306  57.843 63.156  1.00 82.54  ? 77   ASP B CA  1 
ATOM   3161 C C   . ASP B 1 62  ? 95.705  56.426 62.754  1.00 83.50  ? 77   ASP B C   1 
ATOM   3162 O O   . ASP B 1 62  ? 95.397  55.467 63.465  1.00 84.94  ? 77   ASP B O   1 
ATOM   3163 C CB  . ASP B 1 62  ? 94.185  58.348 62.221  1.00 84.60  ? 77   ASP B CB  1 
ATOM   3164 C CG  . ASP B 1 62  ? 94.619  58.435 60.742  1.00 87.99  ? 77   ASP B CG  1 
ATOM   3165 O OD1 . ASP B 1 62  ? 95.476  59.281 60.403  1.00 89.17  ? 77   ASP B OD1 1 
ATOM   3166 O OD2 . ASP B 1 62  ? 94.096  57.659 59.909  1.00 88.92  ? 77   ASP B OD2 1 
ATOM   3167 N N   . SER B 1 63  ? 96.403  56.309 61.621  1.00 83.27  ? 78   SER B N   1 
ATOM   3168 C CA  . SER B 1 63  ? 96.834  55.016 61.085  1.00 82.32  ? 78   SER B CA  1 
ATOM   3169 C C   . SER B 1 63  ? 98.346  54.768 61.096  1.00 81.38  ? 78   SER B C   1 
ATOM   3170 O O   . SER B 1 63  ? 98.798  53.723 60.637  1.00 80.93  ? 78   SER B O   1 
ATOM   3171 C CB  . SER B 1 63  ? 96.311  54.842 59.648  1.00 82.51  ? 78   SER B CB  1 
ATOM   3172 O OG  . SER B 1 63  ? 96.841  55.823 58.767  1.00 82.61  ? 78   SER B OG  1 
ATOM   3173 N N   . GLY B 1 64  ? 99.123  55.720 61.607  1.00 79.64  ? 79   GLY B N   1 
ATOM   3174 C CA  . GLY B 1 64  ? 100.569 55.551 61.657  1.00 77.92  ? 79   GLY B CA  1 
ATOM   3175 C C   . GLY B 1 64  ? 101.233 55.295 60.312  1.00 76.32  ? 79   GLY B C   1 
ATOM   3176 O O   . GLY B 1 64  ? 102.441 55.045 60.233  1.00 76.18  ? 79   GLY B O   1 
ATOM   3177 N N   . GLU B 1 65  ? 100.444 55.366 59.247  1.00 74.07  ? 80   GLU B N   1 
ATOM   3178 C CA  . GLU B 1 65  ? 100.948 55.129 57.907  1.00 71.65  ? 80   GLU B CA  1 
ATOM   3179 C C   . GLU B 1 65  ? 101.767 56.305 57.416  1.00 69.76  ? 80   GLU B C   1 
ATOM   3180 O O   . GLU B 1 65  ? 101.358 57.457 57.561  1.00 69.82  ? 80   GLU B O   1 
ATOM   3181 C CB  . GLU B 1 65  ? 99.774  54.880 56.976  1.00 71.72  ? 80   GLU B CB  1 
ATOM   3182 C CG  . GLU B 1 65  ? 98.823  53.855 57.547  1.00 74.03  ? 80   GLU B CG  1 
ATOM   3183 C CD  . GLU B 1 65  ? 97.594  53.655 56.699  1.00 75.58  ? 80   GLU B CD  1 
ATOM   3184 O OE1 . GLU B 1 65  ? 96.717  52.858 57.101  1.00 74.82  ? 80   GLU B OE1 1 
ATOM   3185 O OE2 . GLU B 1 65  ? 97.507  54.294 55.631  1.00 74.90  ? 80   GLU B OE2 1 
ATOM   3186 N N   . LEU B 1 66  ? 102.932 56.010 56.849  1.00 65.90  ? 81   LEU B N   1 
ATOM   3187 C CA  . LEU B 1 66  ? 103.802 57.054 56.324  1.00 62.73  ? 81   LEU B CA  1 
ATOM   3188 C C   . LEU B 1 66  ? 103.264 57.631 55.022  1.00 60.69  ? 81   LEU B C   1 
ATOM   3189 O O   . LEU B 1 66  ? 102.699 56.910 54.180  1.00 59.76  ? 81   LEU B O   1 
ATOM   3190 C CB  . LEU B 1 66  ? 105.218 56.524 56.095  1.00 63.96  ? 81   LEU B CB  1 
ATOM   3191 C CG  . LEU B 1 66  ? 106.057 56.432 57.369  1.00 67.55  ? 81   LEU B CG  1 
ATOM   3192 C CD1 . LEU B 1 66  ? 105.470 55.358 58.292  1.00 69.38  ? 81   LEU B CD1 1 
ATOM   3193 C CD2 . LEU B 1 66  ? 107.502 56.129 57.006  1.00 65.35  ? 81   LEU B CD2 1 
ATOM   3194 N N   . VAL B 1 67  ? 103.449 58.941 54.868  1.00 55.08  ? 82   VAL B N   1 
ATOM   3195 C CA  . VAL B 1 67  ? 102.982 59.661 53.690  1.00 51.20  ? 82   VAL B CA  1 
ATOM   3196 C C   . VAL B 1 67  ? 104.000 60.673 53.206  1.00 50.80  ? 82   VAL B C   1 
ATOM   3197 O O   . VAL B 1 67  ? 104.963 61.009 53.901  1.00 52.23  ? 82   VAL B O   1 
ATOM   3198 C CB  . VAL B 1 67  ? 101.674 60.429 53.981  1.00 49.33  ? 82   VAL B CB  1 
ATOM   3199 C CG1 . VAL B 1 67  ? 100.534 59.454 54.195  1.00 46.46  ? 82   VAL B CG1 1 
ATOM   3200 C CG2 . VAL B 1 67  ? 101.857 61.325 55.209  1.00 42.56  ? 82   VAL B CG2 1 
ATOM   3201 N N   . ALA B 1 68  ? 103.782 61.156 51.997  1.00 47.38  ? 83   ALA B N   1 
ATOM   3202 C CA  . ALA B 1 68  ? 104.659 62.162 51.436  1.00 46.84  ? 83   ALA B CA  1 
ATOM   3203 C C   . ALA B 1 68  ? 103.767 63.379 51.323  1.00 44.96  ? 83   ALA B C   1 
ATOM   3204 O O   . ALA B 1 68  ? 102.621 63.271 50.888  1.00 42.70  ? 83   ALA B O   1 
ATOM   3205 C CB  . ALA B 1 68  ? 105.159 61.732 50.061  1.00 47.67  ? 83   ALA B CB  1 
ATOM   3206 N N   . ILE B 1 69  ? 104.271 64.528 51.747  1.00 43.60  ? 84   ILE B N   1 
ATOM   3207 C CA  . ILE B 1 69  ? 103.485 65.741 51.667  1.00 43.51  ? 84   ILE B CA  1 
ATOM   3208 C C   . ILE B 1 69  ? 104.212 66.746 50.796  1.00 44.99  ? 84   ILE B C   1 
ATOM   3209 O O   . ILE B 1 69  ? 105.288 67.236 51.142  1.00 44.34  ? 84   ILE B O   1 
ATOM   3210 C CB  . ILE B 1 69  ? 103.230 66.333 53.063  1.00 43.56  ? 84   ILE B CB  1 
ATOM   3211 C CG1 . ILE B 1 69  ? 102.607 65.272 53.968  1.00 45.20  ? 84   ILE B CG1 1 
ATOM   3212 C CG2 . ILE B 1 69  ? 102.292 67.513 52.957  1.00 41.98  ? 84   ILE B CG2 1 
ATOM   3213 C CD1 . ILE B 1 69  ? 102.363 65.755 55.376  1.00 45.68  ? 84   ILE B CD1 1 
ATOM   3214 N N   . LYS B 1 70  ? 103.627 67.030 49.641  1.00 44.95  ? 85   LYS B N   1 
ATOM   3215 C CA  . LYS B 1 70  ? 104.220 67.975 48.715  1.00 44.72  ? 85   LYS B CA  1 
ATOM   3216 C C   . LYS B 1 70  ? 103.531 69.329 48.923  1.00 45.23  ? 85   LYS B C   1 
ATOM   3217 O O   . LYS B 1 70  ? 102.311 69.450 48.779  1.00 43.21  ? 85   LYS B O   1 
ATOM   3218 C CB  . LYS B 1 70  ? 104.051 67.453 47.281  1.00 44.11  ? 85   LYS B CB  1 
ATOM   3219 C CG  . LYS B 1 70  ? 104.770 68.262 46.217  1.00 47.93  ? 85   LYS B CG  1 
ATOM   3220 C CD  . LYS B 1 70  ? 104.561 67.626 44.865  1.00 48.44  ? 85   LYS B CD  1 
ATOM   3221 C CE  . LYS B 1 70  ? 105.130 68.465 43.734  1.00 49.88  ? 85   LYS B CE  1 
ATOM   3222 N NZ  . LYS B 1 70  ? 105.060 67.691 42.457  1.00 51.74  ? 85   LYS B NZ  1 
ATOM   3223 N N   . LYS B 1 71  ? 104.327 70.331 49.288  1.00 44.99  ? 86   LYS B N   1 
ATOM   3224 C CA  . LYS B 1 71  ? 103.839 71.680 49.547  1.00 47.19  ? 86   LYS B CA  1 
ATOM   3225 C C   . LYS B 1 71  ? 104.243 72.600 48.404  1.00 49.16  ? 86   LYS B C   1 
ATOM   3226 O O   . LYS B 1 71  ? 105.426 72.766 48.124  1.00 50.41  ? 86   LYS B O   1 
ATOM   3227 C CB  . LYS B 1 71  ? 104.437 72.180 50.858  1.00 47.85  ? 86   LYS B CB  1 
ATOM   3228 C CG  . LYS B 1 71  ? 103.917 73.514 51.354  1.00 51.23  ? 86   LYS B CG  1 
ATOM   3229 C CD  . LYS B 1 71  ? 104.695 73.929 52.607  1.00 54.12  ? 86   LYS B CD  1 
ATOM   3230 C CE  . LYS B 1 71  ? 104.231 75.258 53.200  1.00 58.65  ? 86   LYS B CE  1 
ATOM   3231 N NZ  . LYS B 1 71  ? 105.120 75.713 54.318  1.00 62.46  ? 86   LYS B NZ  1 
ATOM   3232 N N   . VAL B 1 72  ? 103.263 73.204 47.744  1.00 50.70  ? 87   VAL B N   1 
ATOM   3233 C CA  . VAL B 1 72  ? 103.545 74.093 46.610  1.00 53.27  ? 87   VAL B CA  1 
ATOM   3234 C C   . VAL B 1 72  ? 102.995 75.521 46.765  1.00 53.99  ? 87   VAL B C   1 
ATOM   3235 O O   . VAL B 1 72  ? 101.888 75.727 47.274  1.00 53.35  ? 87   VAL B O   1 
ATOM   3236 C CB  . VAL B 1 72  ? 102.982 73.502 45.274  1.00 52.86  ? 87   VAL B CB  1 
ATOM   3237 C CG1 . VAL B 1 72  ? 103.365 74.398 44.097  1.00 53.05  ? 87   VAL B CG1 1 
ATOM   3238 C CG2 . VAL B 1 72  ? 103.506 72.088 45.060  1.00 53.38  ? 87   VAL B CG2 1 
ATOM   3239 N N   . LEU B 1 73  ? 103.783 76.501 46.331  1.00 55.36  ? 88   LEU B N   1 
ATOM   3240 C CA  . LEU B 1 73  ? 103.358 77.889 46.388  1.00 56.46  ? 88   LEU B CA  1 
ATOM   3241 C C   . LEU B 1 73  ? 102.407 78.045 45.213  1.00 57.82  ? 88   LEU B C   1 
ATOM   3242 O O   . LEU B 1 73  ? 102.795 77.871 44.052  1.00 58.13  ? 88   LEU B O   1 
ATOM   3243 C CB  . LEU B 1 73  ? 104.550 78.825 46.228  1.00 58.11  ? 88   LEU B CB  1 
ATOM   3244 C CG  . LEU B 1 73  ? 104.187 80.293 46.424  1.00 61.97  ? 88   LEU B CG  1 
ATOM   3245 C CD1 . LEU B 1 73  ? 103.682 80.526 47.846  1.00 61.35  ? 88   LEU B CD1 1 
ATOM   3246 C CD2 . LEU B 1 73  ? 105.402 81.139 46.140  1.00 61.27  ? 88   LEU B CD2 1 
ATOM   3247 N N   . GLN B 1 74  ? 101.156 78.361 45.520  1.00 58.30  ? 89   GLN B N   1 
ATOM   3248 C CA  . GLN B 1 74  ? 100.133 78.494 44.498  1.00 58.11  ? 89   GLN B CA  1 
ATOM   3249 C C   . GLN B 1 74  ? 99.509  79.879 44.473  1.00 58.53  ? 89   GLN B C   1 
ATOM   3250 O O   . GLN B 1 74  ? 99.537  80.606 45.462  1.00 61.07  ? 89   GLN B O   1 
ATOM   3251 C CB  . GLN B 1 74  ? 99.041  77.443 44.740  1.00 58.18  ? 89   GLN B CB  1 
ATOM   3252 C CG  . GLN B 1 74  ? 97.923  77.445 43.721  1.00 56.18  ? 89   GLN B CG  1 
ATOM   3253 C CD  . GLN B 1 74  ? 98.432  77.166 42.326  1.00 57.17  ? 89   GLN B CD  1 
ATOM   3254 O OE1 . GLN B 1 74  ? 99.069  76.142 42.087  1.00 58.37  ? 89   GLN B OE1 1 
ATOM   3255 N NE2 . GLN B 1 74  ? 98.158  78.078 41.394  1.00 54.14  ? 89   GLN B NE2 1 
ATOM   3256 N N   . ASP B 1 75  ? 98.949  80.240 43.327  1.00 59.69  ? 90   ASP B N   1 
ATOM   3257 C CA  . ASP B 1 75  ? 98.284  81.523 43.180  1.00 57.98  ? 90   ASP B CA  1 
ATOM   3258 C C   . ASP B 1 75  ? 96.779  81.286 43.324  1.00 56.22  ? 90   ASP B C   1 
ATOM   3259 O O   . ASP B 1 75  ? 96.188  80.515 42.565  1.00 54.80  ? 90   ASP B O   1 
ATOM   3260 C CB  . ASP B 1 75  ? 98.608  82.129 41.815  1.00 58.27  ? 90   ASP B CB  1 
ATOM   3261 C CG  . ASP B 1 75  ? 98.048  83.529 41.651  1.00 60.97  ? 90   ASP B CG  1 
ATOM   3262 O OD1 . ASP B 1 75  ? 98.602  84.292 40.831  1.00 58.77  ? 90   ASP B OD1 1 
ATOM   3263 O OD2 . ASP B 1 75  ? 97.053  83.863 42.332  1.00 57.26  ? 90   ASP B OD2 1 
ATOM   3264 N N   . LYS B 1 76  ? 96.179  81.940 44.319  1.00 57.35  ? 91   LYS B N   1 
ATOM   3265 C CA  . LYS B 1 76  ? 94.750  81.820 44.610  1.00 57.67  ? 91   LYS B CA  1 
ATOM   3266 C C   . LYS B 1 76  ? 93.874  82.034 43.388  1.00 57.17  ? 91   LYS B C   1 
ATOM   3267 O O   . LYS B 1 76  ? 92.855  81.370 43.207  1.00 58.62  ? 91   LYS B O   1 
ATOM   3268 C CB  . LYS B 1 76  ? 94.331  82.850 45.659  1.00 58.44  ? 91   LYS B CB  1 
ATOM   3269 C CG  . LYS B 1 76  ? 94.992  82.735 47.014  1.00 60.22  ? 91   LYS B CG  1 
ATOM   3270 C CD  . LYS B 1 76  ? 94.377  83.764 47.954  1.00 61.71  ? 91   LYS B CD  1 
ATOM   3271 C CE  . LYS B 1 76  ? 94.994  83.719 49.339  1.00 65.76  ? 91   LYS B CE  1 
ATOM   3272 N NZ  . LYS B 1 76  ? 94.442  84.790 50.226  1.00 66.92  ? 91   LYS B NZ  1 
ATOM   3273 N N   . ARG B 1 77  ? 94.275  82.988 42.561  1.00 57.79  ? 92   ARG B N   1 
ATOM   3274 C CA  . ARG B 1 77  ? 93.528  83.333 41.366  1.00 60.28  ? 92   ARG B CA  1 
ATOM   3275 C C   . ARG B 1 77  ? 93.425  82.209 40.348  1.00 60.55  ? 92   ARG B C   1 
ATOM   3276 O O   . ARG B 1 77  ? 92.477  82.164 39.563  1.00 63.56  ? 92   ARG B O   1 
ATOM   3277 C CB  . ARG B 1 77  ? 94.147  84.576 40.720  1.00 62.17  ? 92   ARG B CB  1 
ATOM   3278 C CG  . ARG B 1 77  ? 93.917  85.856 41.519  1.00 65.35  ? 92   ARG B CG  1 
ATOM   3279 C CD  . ARG B 1 77  ? 94.804  86.985 41.039  1.00 66.68  ? 92   ARG B CD  1 
ATOM   3280 N NE  . ARG B 1 77  ? 96.189  86.778 41.446  1.00 70.51  ? 92   ARG B NE  1 
ATOM   3281 C CZ  . ARG B 1 77  ? 97.208  87.541 41.059  1.00 73.08  ? 92   ARG B CZ  1 
ATOM   3282 N NH1 . ARG B 1 77  ? 97.003  88.570 40.246  1.00 74.39  ? 92   ARG B NH1 1 
ATOM   3283 N NH2 . ARG B 1 77  ? 98.437  87.277 41.489  1.00 74.09  ? 92   ARG B NH2 1 
ATOM   3284 N N   . PHE B 1 78  ? 94.391  81.299 40.352  1.00 58.75  ? 93   PHE B N   1 
ATOM   3285 C CA  . PHE B 1 78  ? 94.366  80.197 39.401  1.00 56.84  ? 93   PHE B CA  1 
ATOM   3286 C C   . PHE B 1 78  ? 94.324  78.858 40.097  1.00 55.88  ? 93   PHE B C   1 
ATOM   3287 O O   . PHE B 1 78  ? 94.718  78.728 41.264  1.00 56.29  ? 93   PHE B O   1 
ATOM   3288 C CB  . PHE B 1 78  ? 95.587  80.235 38.477  1.00 59.25  ? 93   PHE B CB  1 
ATOM   3289 C CG  . PHE B 1 78  ? 95.789  81.557 37.795  1.00 60.30  ? 93   PHE B CG  1 
ATOM   3290 C CD1 . PHE B 1 78  ? 96.499  82.578 38.426  1.00 60.79  ? 93   PHE B CD1 1 
ATOM   3291 C CD2 . PHE B 1 78  ? 95.240  81.797 36.540  1.00 60.99  ? 93   PHE B CD2 1 
ATOM   3292 C CE1 . PHE B 1 78  ? 96.656  83.819 37.819  1.00 60.49  ? 93   PHE B CE1 1 
ATOM   3293 C CE2 . PHE B 1 78  ? 95.391  83.033 35.926  1.00 60.32  ? 93   PHE B CE2 1 
ATOM   3294 C CZ  . PHE B 1 78  ? 96.101  84.046 36.569  1.00 60.86  ? 93   PHE B CZ  1 
ATOM   3295 N N   . LYS B 1 79  ? 93.842  77.861 39.364  1.00 54.29  ? 94   LYS B N   1 
ATOM   3296 C CA  . LYS B 1 79  ? 93.752  76.508 39.886  1.00 52.59  ? 94   LYS B CA  1 
ATOM   3297 C C   . LYS B 1 79  ? 95.122  75.857 39.746  1.00 50.44  ? 94   LYS B C   1 
ATOM   3298 O O   . LYS B 1 79  ? 95.928  76.254 38.898  1.00 51.86  ? 94   LYS B O   1 
ATOM   3299 C CB  . LYS B 1 79  ? 92.733  75.679 39.094  1.00 54.99  ? 94   LYS B CB  1 
ATOM   3300 C CG  . LYS B 1 79  ? 91.364  76.309 38.885  1.00 58.80  ? 94   LYS B CG  1 
ATOM   3301 C CD  . LYS B 1 79  ? 90.429  75.287 38.263  1.00 63.26  ? 94   LYS B CD  1 
ATOM   3302 C CE  . LYS B 1 79  ? 89.087  75.887 37.894  1.00 62.57  ? 94   LYS B CE  1 
ATOM   3303 N NZ  . LYS B 1 79  ? 88.199  74.841 37.305  1.00 64.65  ? 94   LYS B NZ  1 
ATOM   3304 N N   . ASN B 1 80  ? 95.383  74.863 40.586  1.00 49.20  ? 95   ASN B N   1 
ATOM   3305 C CA  . ASN B 1 80  ? 96.643  74.145 40.529  1.00 47.44  ? 95   ASN B CA  1 
ATOM   3306 C C   . ASN B 1 80  ? 96.425  72.912 39.656  1.00 47.00  ? 95   ASN B C   1 
ATOM   3307 O O   . ASN B 1 80  ? 95.593  72.051 39.968  1.00 47.30  ? 95   ASN B O   1 
ATOM   3308 C CB  . ASN B 1 80  ? 97.088  73.745 41.933  1.00 46.72  ? 95   ASN B CB  1 
ATOM   3309 C CG  . ASN B 1 80  ? 98.308  72.861 41.922  1.00 44.96  ? 95   ASN B CG  1 
ATOM   3310 O OD1 . ASN B 1 80  ? 98.226  71.675 41.613  1.00 44.36  ? 95   ASN B OD1 1 
ATOM   3311 N ND2 . ASN B 1 80  ? 99.452  73.434 42.248  1.00 45.54  ? 95   ASN B ND2 1 
ATOM   3312 N N   . ARG B 1 81  ? 97.161  72.849 38.548  1.00 46.57  ? 96   ARG B N   1 
ATOM   3313 C CA  . ARG B 1 81  ? 97.057  71.741 37.604  1.00 42.92  ? 96   ARG B CA  1 
ATOM   3314 C C   . ARG B 1 81  ? 97.199  70.393 38.278  1.00 44.32  ? 96   ARG B C   1 
ATOM   3315 O O   . ARG B 1 81  ? 96.349  69.511 38.125  1.00 41.69  ? 96   ARG B O   1 
ATOM   3316 C CB  . ARG B 1 81  ? 98.134  71.851 36.531  1.00 44.82  ? 96   ARG B CB  1 
ATOM   3317 C CG  . ARG B 1 81  ? 97.825  72.777 35.395  1.00 41.40  ? 96   ARG B CG  1 
ATOM   3318 C CD  . ARG B 1 81  ? 98.938  72.710 34.382  1.00 40.47  ? 96   ARG B CD  1 
ATOM   3319 N NE  . ARG B 1 81  ? 98.751  73.693 33.327  1.00 42.78  ? 96   ARG B NE  1 
ATOM   3320 C CZ  . ARG B 1 81  ? 99.728  74.152 32.560  1.00 43.06  ? 96   ARG B CZ  1 
ATOM   3321 N NH1 . ARG B 1 81  ? 100.968 73.709 32.731  1.00 43.37  ? 96   ARG B NH1 1 
ATOM   3322 N NH2 . ARG B 1 81  ? 99.468  75.072 31.640  1.00 42.20  ? 96   ARG B NH2 1 
ATOM   3323 N N   . GLU B 1 82  ? 98.299  70.237 39.007  1.00 45.74  ? 97   GLU B N   1 
ATOM   3324 C CA  . GLU B 1 82  ? 98.581  68.993 39.698  1.00 46.08  ? 97   GLU B CA  1 
ATOM   3325 C C   . GLU B 1 82  ? 97.381  68.519 40.511  1.00 45.83  ? 97   GLU B C   1 
ATOM   3326 O O   . GLU B 1 82  ? 96.980  67.358 40.409  1.00 45.25  ? 97   GLU B O   1 
ATOM   3327 C CB  . GLU B 1 82  ? 99.809  69.165 40.593  1.00 45.18  ? 97   GLU B CB  1 
ATOM   3328 C CG  . GLU B 1 82  ? 100.349 67.865 41.158  1.00 46.44  ? 97   GLU B CG  1 
ATOM   3329 C CD  . GLU B 1 82  ? 101.795 67.997 41.597  1.00 49.53  ? 97   GLU B CD  1 
ATOM   3330 O OE1 . GLU B 1 82  ? 102.365 67.008 42.116  1.00 53.17  ? 97   GLU B OE1 1 
ATOM   3331 O OE2 . GLU B 1 82  ? 102.366 69.097 41.415  1.00 50.63  ? 97   GLU B OE2 1 
ATOM   3332 N N   . LEU B 1 83  ? 96.791  69.414 41.295  1.00 45.39  ? 98   LEU B N   1 
ATOM   3333 C CA  . LEU B 1 83  ? 95.643  69.035 42.108  1.00 46.30  ? 98   LEU B CA  1 
ATOM   3334 C C   . LEU B 1 83  ? 94.473  68.644 41.214  1.00 47.32  ? 98   LEU B C   1 
ATOM   3335 O O   . LEU B 1 83  ? 93.813  67.623 41.438  1.00 47.28  ? 98   LEU B O   1 
ATOM   3336 C CB  . LEU B 1 83  ? 95.235  70.188 43.032  1.00 47.91  ? 98   LEU B CB  1 
ATOM   3337 C CG  . LEU B 1 83  ? 94.273  69.922 44.197  1.00 45.11  ? 98   LEU B CG  1 
ATOM   3338 C CD1 . LEU B 1 83  ? 93.990  71.219 44.931  1.00 46.93  ? 98   LEU B CD1 1 
ATOM   3339 C CD2 . LEU B 1 83  ? 92.987  69.372 43.691  1.00 46.32  ? 98   LEU B CD2 1 
ATOM   3340 N N   . GLN B 1 84  ? 94.211  69.449 40.194  1.00 47.70  ? 99   GLN B N   1 
ATOM   3341 C CA  . GLN B 1 84  ? 93.108  69.149 39.298  1.00 50.04  ? 99   GLN B CA  1 
ATOM   3342 C C   . GLN B 1 84  ? 93.238  67.772 38.666  1.00 51.15  ? 99   GLN B C   1 
ATOM   3343 O O   . GLN B 1 84  ? 92.311  66.956 38.740  1.00 50.78  ? 99   GLN B O   1 
ATOM   3344 C CB  . GLN B 1 84  ? 92.991  70.243 38.238  1.00 51.08  ? 99   GLN B CB  1 
ATOM   3345 C CG  . GLN B 1 84  ? 92.431  71.508 38.846  1.00 53.74  ? 99   GLN B CG  1 
ATOM   3346 C CD  . GLN B 1 84  ? 91.207  71.210 39.722  1.00 56.07  ? 99   GLN B CD  1 
ATOM   3347 O OE1 . GLN B 1 84  ? 90.125  70.875 39.215  1.00 55.90  ? 99   GLN B OE1 1 
ATOM   3348 N NE2 . GLN B 1 84  ? 91.384  71.307 41.044  1.00 52.94  ? 99   GLN B NE2 1 
ATOM   3349 N N   . ILE B 1 85  ? 94.399  67.511 38.069  1.00 50.83  ? 100  ILE B N   1 
ATOM   3350 C CA  . ILE B 1 85  ? 94.665  66.228 37.435  1.00 49.92  ? 100  ILE B CA  1 
ATOM   3351 C C   . ILE B 1 85  ? 94.526  65.099 38.440  1.00 51.96  ? 100  ILE B C   1 
ATOM   3352 O O   . ILE B 1 85  ? 93.826  64.115 38.187  1.00 52.48  ? 100  ILE B O   1 
ATOM   3353 C CB  . ILE B 1 85  ? 96.080  66.190 36.845  1.00 51.94  ? 100  ILE B CB  1 
ATOM   3354 C CG1 . ILE B 1 85  ? 96.166  67.152 35.663  1.00 52.04  ? 100  ILE B CG1 1 
ATOM   3355 C CG2 . ILE B 1 85  ? 96.436  64.776 36.423  1.00 53.09  ? 100  ILE B CG2 1 
ATOM   3356 C CD1 . ILE B 1 85  ? 97.523  67.215 35.025  1.00 56.60  ? 100  ILE B CD1 1 
ATOM   3357 N N   . MET B 1 86  ? 95.188  65.255 39.583  1.00 51.92  ? 101  MET B N   1 
ATOM   3358 C CA  . MET B 1 86  ? 95.160  64.242 40.632  1.00 54.36  ? 101  MET B CA  1 
ATOM   3359 C C   . MET B 1 86  ? 93.761  63.874 41.120  1.00 54.85  ? 101  MET B C   1 
ATOM   3360 O O   . MET B 1 86  ? 93.507  62.725 41.486  1.00 55.01  ? 101  MET B O   1 
ATOM   3361 C CB  . MET B 1 86  ? 96.016  64.688 41.821  1.00 55.58  ? 101  MET B CB  1 
ATOM   3362 C CG  . MET B 1 86  ? 97.516  64.689 41.551  1.00 58.69  ? 101  MET B CG  1 
ATOM   3363 S SD  . MET B 1 86  ? 98.139  63.082 40.987  1.00 62.22  ? 101  MET B SD  1 
ATOM   3364 C CE  . MET B 1 86  ? 98.514  62.272 42.540  1.00 58.86  ? 101  MET B CE  1 
ATOM   3365 N N   . ARG B 1 87  ? 92.848  64.838 41.128  1.00 55.95  ? 102  ARG B N   1 
ATOM   3366 C CA  . ARG B 1 87  ? 91.496  64.554 41.585  1.00 56.06  ? 102  ARG B CA  1 
ATOM   3367 C C   . ARG B 1 87  ? 90.686  63.764 40.566  1.00 54.94  ? 102  ARG B C   1 
ATOM   3368 O O   . ARG B 1 87  ? 89.670  63.165 40.912  1.00 54.30  ? 102  ARG B O   1 
ATOM   3369 C CB  . ARG B 1 87  ? 90.767  65.848 41.927  1.00 57.53  ? 102  ARG B CB  1 
ATOM   3370 C CG  . ARG B 1 87  ? 91.401  66.627 43.049  1.00 62.12  ? 102  ARG B CG  1 
ATOM   3371 C CD  . ARG B 1 87  ? 90.441  67.665 43.576  1.00 63.93  ? 102  ARG B CD  1 
ATOM   3372 N NE  . ARG B 1 87  ? 89.418  67.060 44.414  1.00 66.16  ? 102  ARG B NE  1 
ATOM   3373 C CZ  . ARG B 1 87  ? 88.454  67.743 45.019  1.00 69.08  ? 102  ARG B CZ  1 
ATOM   3374 N NH1 . ARG B 1 87  ? 88.387  69.063 44.872  1.00 67.00  ? 102  ARG B NH1 1 
ATOM   3375 N NH2 . ARG B 1 87  ? 87.564  67.107 45.775  1.00 67.97  ? 102  ARG B NH2 1 
ATOM   3376 N N   . LYS B 1 88  ? 91.130  63.770 39.311  1.00 55.66  ? 103  LYS B N   1 
ATOM   3377 C CA  . LYS B 1 88  ? 90.434  63.036 38.249  1.00 56.59  ? 103  LYS B CA  1 
ATOM   3378 C C   . LYS B 1 88  ? 90.857  61.570 38.245  1.00 56.02  ? 103  LYS B C   1 
ATOM   3379 O O   . LYS B 1 88  ? 90.048  60.668 37.991  1.00 55.45  ? 103  LYS B O   1 
ATOM   3380 C CB  . LYS B 1 88  ? 90.774  63.595 36.861  1.00 58.49  ? 103  LYS B CB  1 
ATOM   3381 C CG  . LYS B 1 88  ? 90.383  65.030 36.573  1.00 62.82  ? 103  LYS B CG  1 
ATOM   3382 C CD  . LYS B 1 88  ? 90.655  65.335 35.100  1.00 65.42  ? 103  LYS B CD  1 
ATOM   3383 C CE  . LYS B 1 88  ? 90.535  66.813 34.785  1.00 65.99  ? 103  LYS B CE  1 
ATOM   3384 N NZ  . LYS B 1 88  ? 91.067  67.072 33.423  1.00 67.60  ? 103  LYS B NZ  1 
ATOM   3385 N N   . LEU B 1 89  ? 92.140  61.358 38.530  1.00 55.52  ? 104  LEU B N   1 
ATOM   3386 C CA  . LEU B 1 89  ? 92.756  60.044 38.509  1.00 51.33  ? 104  LEU B CA  1 
ATOM   3387 C C   . LEU B 1 89  ? 92.435  59.073 39.625  1.00 51.99  ? 104  LEU B C   1 
ATOM   3388 O O   . LEU B 1 89  ? 92.551  59.384 40.811  1.00 52.92  ? 104  LEU B O   1 
ATOM   3389 C CB  . LEU B 1 89  ? 94.264  60.217 38.403  1.00 45.94  ? 104  LEU B CB  1 
ATOM   3390 C CG  . LEU B 1 89  ? 94.653  61.177 37.284  1.00 43.77  ? 104  LEU B CG  1 
ATOM   3391 C CD1 . LEU B 1 89  ? 96.146  61.343 37.262  1.00 42.93  ? 104  LEU B CD1 1 
ATOM   3392 C CD2 . LEU B 1 89  ? 94.155  60.653 35.960  1.00 39.21  ? 104  LEU B CD2 1 
ATOM   3393 N N   . ASP B 1 90  ? 92.031  57.879 39.202  1.00 53.25  ? 105  ASP B N   1 
ATOM   3394 C CA  . ASP B 1 90  ? 91.707  56.767 40.085  1.00 55.40  ? 105  ASP B CA  1 
ATOM   3395 C C   . ASP B 1 90  ? 92.140  55.518 39.316  1.00 55.39  ? 105  ASP B C   1 
ATOM   3396 O O   . ASP B 1 90  ? 91.390  55.004 38.492  1.00 56.51  ? 105  ASP B O   1 
ATOM   3397 C CB  . ASP B 1 90  ? 90.205  56.718 40.359  1.00 57.15  ? 105  ASP B CB  1 
ATOM   3398 C CG  . ASP B 1 90  ? 89.821  55.565 41.273  1.00 60.91  ? 105  ASP B CG  1 
ATOM   3399 O OD1 . ASP B 1 90  ? 88.627  55.437 41.617  1.00 60.50  ? 105  ASP B OD1 1 
ATOM   3400 O OD2 . ASP B 1 90  ? 90.718  54.782 41.649  1.00 64.64  ? 105  ASP B OD2 1 
ATOM   3401 N N   . HIS B 1 91  ? 93.349  55.030 39.576  1.00 53.92  ? 106  HIS B N   1 
ATOM   3402 C CA  . HIS B 1 91  ? 93.851  53.868 38.843  1.00 52.02  ? 106  HIS B CA  1 
ATOM   3403 C C   . HIS B 1 91  ? 94.881  53.120 39.675  1.00 50.30  ? 106  HIS B C   1 
ATOM   3404 O O   . HIS B 1 91  ? 95.603  53.724 40.477  1.00 50.11  ? 106  HIS B O   1 
ATOM   3405 C CB  . HIS B 1 91  ? 94.462  54.345 37.518  1.00 50.11  ? 106  HIS B CB  1 
ATOM   3406 C CG  . HIS B 1 91  ? 94.775  53.247 36.552  1.00 50.45  ? 106  HIS B CG  1 
ATOM   3407 N ND1 . HIS B 1 91  ? 95.962  52.548 36.577  1.00 49.71  ? 106  HIS B ND1 1 
ATOM   3408 C CD2 . HIS B 1 91  ? 94.053  52.729 35.531  1.00 47.89  ? 106  HIS B CD2 1 
ATOM   3409 C CE1 . HIS B 1 91  ? 95.957  51.647 35.611  1.00 48.79  ? 106  HIS B CE1 1 
ATOM   3410 N NE2 . HIS B 1 91  ? 94.810  51.736 34.963  1.00 47.23  ? 106  HIS B NE2 1 
ATOM   3411 N N   . CYS B 1 92  ? 94.950  51.807 39.479  1.00 49.60  ? 107  CYS B N   1 
ATOM   3412 C CA  . CYS B 1 92  ? 95.878  50.964 40.243  1.00 51.34  ? 107  CYS B CA  1 
ATOM   3413 C C   . CYS B 1 92  ? 97.367  51.237 40.000  1.00 47.21  ? 107  CYS B C   1 
ATOM   3414 O O   . CYS B 1 92  ? 98.210  50.902 40.835  1.00 45.81  ? 107  CYS B O   1 
ATOM   3415 C CB  . CYS B 1 92  ? 95.575  49.472 39.990  1.00 55.00  ? 107  CYS B CB  1 
ATOM   3416 S SG  . CYS B 1 92  ? 95.884  48.849 38.286  1.00 65.89  ? 107  CYS B SG  1 
ATOM   3417 N N   . ASN B 1 93  ? 97.688  51.856 38.870  1.00 44.47  ? 108  ASN B N   1 
ATOM   3418 C CA  . ASN B 1 93  ? 99.076  52.132 38.549  1.00 43.10  ? 108  ASN B CA  1 
ATOM   3419 C C   . ASN B 1 93  ? 99.427  53.600 38.640  1.00 43.19  ? 108  ASN B C   1 
ATOM   3420 O O   . ASN B 1 93  ? 100.440 54.046 38.105  1.00 42.98  ? 108  ASN B O   1 
ATOM   3421 C CB  . ASN B 1 93  ? 99.399  51.559 37.173  1.00 40.16  ? 108  ASN B CB  1 
ATOM   3422 C CG  . ASN B 1 93  ? 99.310  50.039 37.161  1.00 41.54  ? 108  ASN B CG  1 
ATOM   3423 O OD1 . ASN B 1 93  ? 98.709  49.439 36.266  1.00 42.57  ? 108  ASN B OD1 1 
ATOM   3424 N ND2 . ASN B 1 93  ? 99.905  49.408 38.170  1.00 36.19  ? 108  ASN B ND2 1 
ATOM   3425 N N   . ILE B 1 94  ? 98.582  54.345 39.341  1.00 43.10  ? 109  ILE B N   1 
ATOM   3426 C CA  . ILE B 1 94  ? 98.809  55.767 39.551  1.00 42.04  ? 109  ILE B CA  1 
ATOM   3427 C C   . ILE B 1 94  ? 98.842  55.964 41.076  1.00 42.27  ? 109  ILE B C   1 
ATOM   3428 O O   . ILE B 1 94  ? 98.030  55.375 41.809  1.00 42.42  ? 109  ILE B O   1 
ATOM   3429 C CB  . ILE B 1 94  ? 97.658  56.643 38.953  1.00 41.98  ? 109  ILE B CB  1 
ATOM   3430 C CG1 . ILE B 1 94  ? 97.299  56.200 37.523  1.00 38.70  ? 109  ILE B CG1 1 
ATOM   3431 C CG2 . ILE B 1 94  ? 98.087  58.107 38.964  1.00 39.18  ? 109  ILE B CG2 1 
ATOM   3432 C CD1 . ILE B 1 94  ? 97.973  56.991 36.425  1.00 34.33  ? 109  ILE B CD1 1 
ATOM   3433 N N   . VAL B 1 95  ? 99.785  56.767 41.560  1.00 40.88  ? 110  VAL B N   1 
ATOM   3434 C CA  . VAL B 1 95  ? 99.864  57.012 42.993  1.00 42.06  ? 110  VAL B CA  1 
ATOM   3435 C C   . VAL B 1 95  ? 98.556  57.670 43.417  1.00 43.69  ? 110  VAL B C   1 
ATOM   3436 O O   . VAL B 1 95  ? 97.994  58.482 42.679  1.00 43.72  ? 110  VAL B O   1 
ATOM   3437 C CB  . VAL B 1 95  ? 101.055 57.935 43.360  1.00 42.79  ? 110  VAL B CB  1 
ATOM   3438 C CG1 . VAL B 1 95  ? 100.852 59.325 42.762  1.00 41.48  ? 110  VAL B CG1 1 
ATOM   3439 C CG2 . VAL B 1 95  ? 101.207 58.004 44.889  1.00 43.59  ? 110  VAL B CG2 1 
ATOM   3440 N N   . ARG B 1 96  ? 98.064  57.330 44.603  1.00 46.90  ? 111  ARG B N   1 
ATOM   3441 C CA  . ARG B 1 96  ? 96.800  57.903 45.055  1.00 48.61  ? 111  ARG B CA  1 
ATOM   3442 C C   . ARG B 1 96  ? 96.937  59.109 45.969  1.00 46.34  ? 111  ARG B C   1 
ATOM   3443 O O   . ARG B 1 96  ? 97.714  59.097 46.919  1.00 47.70  ? 111  ARG B O   1 
ATOM   3444 C CB  . ARG B 1 96  ? 95.966  56.841 45.763  1.00 52.45  ? 111  ARG B CB  1 
ATOM   3445 C CG  . ARG B 1 96  ? 94.563  57.303 46.128  1.00 64.82  ? 111  ARG B CG  1 
ATOM   3446 C CD  . ARG B 1 96  ? 93.987  56.391 47.185  1.00 73.12  ? 111  ARG B CD  1 
ATOM   3447 N NE  . ARG B 1 96  ? 95.016  56.078 48.174  1.00 79.92  ? 111  ARG B NE  1 
ATOM   3448 C CZ  . ARG B 1 96  ? 94.826  55.322 49.251  1.00 83.06  ? 111  ARG B CZ  1 
ATOM   3449 N NH1 . ARG B 1 96  ? 93.628  54.797 49.489  1.00 85.75  ? 111  ARG B NH1 1 
ATOM   3450 N NH2 . ARG B 1 96  ? 95.835  55.083 50.087  1.00 83.92  ? 111  ARG B NH2 1 
ATOM   3451 N N   . LEU B 1 97  ? 96.181  60.157 45.659  1.00 44.17  ? 112  LEU B N   1 
ATOM   3452 C CA  . LEU B 1 97  ? 96.172  61.367 46.473  1.00 43.83  ? 112  LEU B CA  1 
ATOM   3453 C C   . LEU B 1 97  ? 95.278  61.095 47.698  1.00 42.74  ? 112  LEU B C   1 
ATOM   3454 O O   . LEU B 1 97  ? 94.057  60.979 47.576  1.00 39.56  ? 112  LEU B O   1 
ATOM   3455 C CB  . LEU B 1 97  ? 95.608  62.549 45.666  1.00 41.68  ? 112  LEU B CB  1 
ATOM   3456 C CG  . LEU B 1 97  ? 95.395  63.887 46.387  1.00 45.05  ? 112  LEU B CG  1 
ATOM   3457 C CD1 . LEU B 1 97  ? 96.738  64.489 46.771  1.00 40.54  ? 112  LEU B CD1 1 
ATOM   3458 C CD2 . LEU B 1 97  ? 94.638  64.841 45.484  1.00 44.51  ? 112  LEU B CD2 1 
ATOM   3459 N N   . ARG B 1 98  ? 95.879  60.975 48.876  1.00 44.27  ? 113  ARG B N   1 
ATOM   3460 C CA  . ARG B 1 98  ? 95.086  60.715 50.073  1.00 47.92  ? 113  ARG B CA  1 
ATOM   3461 C C   . ARG B 1 98  ? 94.225  61.931 50.453  1.00 46.84  ? 113  ARG B C   1 
ATOM   3462 O O   . ARG B 1 98  ? 92.993  61.839 50.500  1.00 46.49  ? 113  ARG B O   1 
ATOM   3463 C CB  . ARG B 1 98  ? 96.012  60.286 51.218  1.00 50.97  ? 113  ARG B CB  1 
ATOM   3464 C CG  . ARG B 1 98  ? 96.817  59.037 50.856  1.00 54.46  ? 113  ARG B CG  1 
ATOM   3465 C CD  . ARG B 1 98  ? 97.283  58.268 52.074  1.00 61.07  ? 113  ARG B CD  1 
ATOM   3466 N NE  . ARG B 1 98  ? 96.174  57.895 52.952  1.00 64.83  ? 113  ARG B NE  1 
ATOM   3467 C CZ  . ARG B 1 98  ? 96.323  57.237 54.100  1.00 67.91  ? 113  ARG B CZ  1 
ATOM   3468 N NH1 . ARG B 1 98  ? 97.536  56.875 54.501  1.00 65.21  ? 113  ARG B NH1 1 
ATOM   3469 N NH2 . ARG B 1 98  ? 95.265  56.964 54.861  1.00 70.45  ? 113  ARG B NH2 1 
ATOM   3470 N N   . TYR B 1 99  ? 94.870  63.064 50.717  1.00 44.15  ? 114  TYR B N   1 
ATOM   3471 C CA  . TYR B 1 99  ? 94.160  64.294 51.047  1.00 44.73  ? 114  TYR B CA  1 
ATOM   3472 C C   . TYR B 1 99  ? 94.940  65.459 50.492  1.00 44.08  ? 114  TYR B C   1 
ATOM   3473 O O   . TYR B 1 99  ? 95.940  65.294 49.795  1.00 43.11  ? 114  TYR B O   1 
ATOM   3474 C CB  . TYR B 1 99  ? 94.054  64.521 52.555  1.00 48.04  ? 114  TYR B CB  1 
ATOM   3475 C CG  . TYR B 1 99  ? 93.700  63.312 53.368  1.00 50.00  ? 114  TYR B CG  1 
ATOM   3476 C CD1 . TYR B 1 99  ? 94.688  62.411 53.763  1.00 53.30  ? 114  TYR B CD1 1 
ATOM   3477 C CD2 . TYR B 1 99  ? 92.382  63.080 53.771  1.00 51.19  ? 114  TYR B CD2 1 
ATOM   3478 C CE1 . TYR B 1 99  ? 94.381  61.310 54.547  1.00 57.05  ? 114  TYR B CE1 1 
ATOM   3479 C CE2 . TYR B 1 99  ? 92.057  61.982 54.555  1.00 54.72  ? 114  TYR B CE2 1 
ATOM   3480 C CZ  . TYR B 1 99  ? 93.063  61.098 54.946  1.00 57.52  ? 114  TYR B CZ  1 
ATOM   3481 O OH  . TYR B 1 99  ? 92.771  60.019 55.763  1.00 59.87  ? 114  TYR B OH  1 
ATOM   3482 N N   . PHE B 1 100 ? 94.465  66.648 50.811  1.00 40.41  ? 115  PHE B N   1 
ATOM   3483 C CA  . PHE B 1 100 ? 95.141  67.860 50.413  1.00 40.03  ? 115  PHE B CA  1 
ATOM   3484 C C   . PHE B 1 100 ? 94.555  68.962 51.271  1.00 43.49  ? 115  PHE B C   1 
ATOM   3485 O O   . PHE B 1 100 ? 93.390  68.903 51.675  1.00 45.75  ? 115  PHE B O   1 
ATOM   3486 C CB  . PHE B 1 100 ? 94.989  68.129 48.905  1.00 37.00  ? 115  PHE B CB  1 
ATOM   3487 C CG  . PHE B 1 100 ? 93.584  68.456 48.454  1.00 40.21  ? 115  PHE B CG  1 
ATOM   3488 C CD1 . PHE B 1 100 ? 93.164  69.780 48.342  1.00 39.23  ? 115  PHE B CD1 1 
ATOM   3489 C CD2 . PHE B 1 100 ? 92.704  67.444 48.068  1.00 41.66  ? 115  PHE B CD2 1 
ATOM   3490 C CE1 . PHE B 1 100 ? 91.892  70.094 47.847  1.00 43.66  ? 115  PHE B CE1 1 
ATOM   3491 C CE2 . PHE B 1 100 ? 91.427  67.752 47.571  1.00 46.04  ? 115  PHE B CE2 1 
ATOM   3492 C CZ  . PHE B 1 100 ? 91.025  69.080 47.461  1.00 41.88  ? 115  PHE B CZ  1 
ATOM   3493 N N   . PHE B 1 101 ? 95.383  69.943 51.594  1.00 42.50  ? 116  PHE B N   1 
ATOM   3494 C CA  . PHE B 1 101 ? 94.942  71.041 52.420  1.00 42.44  ? 116  PHE B CA  1 
ATOM   3495 C C   . PHE B 1 101 ? 95.791  72.260 52.102  1.00 43.42  ? 116  PHE B C   1 
ATOM   3496 O O   . PHE B 1 101 ? 96.828  72.157 51.448  1.00 39.09  ? 116  PHE B O   1 
ATOM   3497 C CB  . PHE B 1 101 ? 95.077  70.649 53.889  1.00 41.95  ? 116  PHE B CB  1 
ATOM   3498 C CG  . PHE B 1 101 ? 96.481  70.336 54.297  1.00 45.02  ? 116  PHE B CG  1 
ATOM   3499 C CD1 . PHE B 1 101 ? 97.380  71.361 54.603  1.00 45.78  ? 116  PHE B CD1 1 
ATOM   3500 C CD2 . PHE B 1 101 ? 96.926  69.014 54.343  1.00 43.77  ? 116  PHE B CD2 1 
ATOM   3501 C CE1 . PHE B 1 101 ? 98.707  71.070 54.950  1.00 45.08  ? 116  PHE B CE1 1 
ATOM   3502 C CE2 . PHE B 1 101 ? 98.252  68.711 54.689  1.00 41.13  ? 116  PHE B CE2 1 
ATOM   3503 C CZ  . PHE B 1 101 ? 99.144  69.743 54.992  1.00 42.44  ? 116  PHE B CZ  1 
ATOM   3504 N N   . TYR B 1 102 ? 95.349  73.417 52.571  1.00 43.41  ? 117  TYR B N   1 
ATOM   3505 C CA  . TYR B 1 102 ? 96.077  74.636 52.308  1.00 43.30  ? 117  TYR B CA  1 
ATOM   3506 C C   . TYR B 1 102 ? 96.789  75.200 53.518  1.00 43.95  ? 117  TYR B C   1 
ATOM   3507 O O   . TYR B 1 102 ? 96.398  74.956 54.651  1.00 42.72  ? 117  TYR B O   1 
ATOM   3508 C CB  . TYR B 1 102 ? 95.127  75.674 51.715  1.00 43.36  ? 117  TYR B CB  1 
ATOM   3509 C CG  . TYR B 1 102 ? 94.607  75.265 50.355  1.00 40.17  ? 117  TYR B CG  1 
ATOM   3510 C CD1 . TYR B 1 102 ? 93.562  74.349 50.231  1.00 37.88  ? 117  TYR B CD1 1 
ATOM   3511 C CD2 . TYR B 1 102 ? 95.190  75.763 49.188  1.00 40.56  ? 117  TYR B CD2 1 
ATOM   3512 C CE1 . TYR B 1 102 ? 93.108  73.939 48.981  1.00 34.31  ? 117  TYR B CE1 1 
ATOM   3513 C CE2 . TYR B 1 102 ? 94.746  75.358 47.930  1.00 37.89  ? 117  TYR B CE2 1 
ATOM   3514 C CZ  . TYR B 1 102 ? 93.702  74.448 47.832  1.00 38.73  ? 117  TYR B CZ  1 
ATOM   3515 O OH  . TYR B 1 102 ? 93.237  74.072 46.583  1.00 37.96  ? 117  TYR B OH  1 
ATOM   3516 N N   . SER B 1 103 ? 97.869  75.925 53.255  1.00 48.34  ? 118  SER B N   1 
ATOM   3517 C CA  . SER B 1 103 ? 98.649  76.581 54.293  1.00 53.43  ? 118  SER B CA  1 
ATOM   3518 C C   . SER B 1 103 ? 98.536  78.043 53.974  1.00 57.10  ? 118  SER B C   1 
ATOM   3519 O O   . SER B 1 103 ? 98.271  78.414 52.832  1.00 55.96  ? 118  SER B O   1 
ATOM   3520 C CB  . SER B 1 103 ? 100.123 76.200 54.222  1.00 55.39  ? 118  SER B CB  1 
ATOM   3521 O OG  . SER B 1 103 ? 100.365 74.994 54.907  1.00 59.92  ? 118  SER B OG  1 
ATOM   3522 N N   . SER B 1 104 ? 98.736  78.880 54.978  1.00 60.63  ? 119  SER B N   1 
ATOM   3523 C CA  . SER B 1 104 ? 98.667  80.309 54.747  1.00 63.09  ? 119  SER B CA  1 
ATOM   3524 C C   . SER B 1 104 ? 99.898  80.647 53.912  1.00 64.15  ? 119  SER B C   1 
ATOM   3525 O O   . SER B 1 104 ? 101.017 80.257 54.266  1.00 65.12  ? 119  SER B O   1 
ATOM   3526 C CB  . SER B 1 104 ? 98.691  81.066 56.083  1.00 64.04  ? 119  SER B CB  1 
ATOM   3527 O OG  . SER B 1 104 ? 98.266  82.411 55.921  1.00 63.82  ? 119  SER B OG  1 
ATOM   3528 N N   . GLY B 1 105 ? 99.689  81.334 52.791  1.00 66.50  ? 120  GLY B N   1 
ATOM   3529 C CA  . GLY B 1 105 ? 100.807 81.713 51.946  1.00 70.07  ? 120  GLY B CA  1 
ATOM   3530 C C   . GLY B 1 105 ? 101.650 82.729 52.688  1.00 72.90  ? 120  GLY B C   1 
ATOM   3531 O O   . GLY B 1 105 ? 102.093 82.483 53.806  1.00 75.24  ? 120  GLY B O   1 
ATOM   3532 N N   . GLU B 1 106 ? 101.873 83.880 52.074  1.00 74.61  ? 121  GLU B N   1 
ATOM   3533 C CA  . GLU B 1 106 ? 102.653 84.935 52.703  1.00 77.65  ? 121  GLU B CA  1 
ATOM   3534 C C   . GLU B 1 106 ? 102.229 86.243 52.063  1.00 77.71  ? 121  GLU B C   1 
ATOM   3535 O O   . GLU B 1 106 ? 101.913 87.212 52.753  1.00 75.52  ? 121  GLU B O   1 
ATOM   3536 C CB  . GLU B 1 106 ? 104.150 84.672 52.517  1.00 80.94  ? 121  GLU B CB  1 
ATOM   3537 C CG  . GLU B 1 106 ? 104.635 83.497 53.356  1.00 84.87  ? 121  GLU B CG  1 
ATOM   3538 C CD  . GLU B 1 106 ? 105.912 82.869 52.837  1.00 88.36  ? 121  GLU B CD  1 
ATOM   3539 O OE1 . GLU B 1 106 ? 106.329 81.824 53.393  1.00 88.90  ? 121  GLU B OE1 1 
ATOM   3540 O OE2 . GLU B 1 106 ? 106.496 83.414 51.875  1.00 91.14  ? 121  GLU B OE2 1 
ATOM   3541 N N   . LYS B 1 107 ? 102.210 86.265 50.737  1.00 78.26  ? 122  LYS B N   1 
ATOM   3542 C CA  . LYS B 1 107 ? 101.768 87.448 50.030  1.00 81.16  ? 122  LYS B CA  1 
ATOM   3543 C C   . LYS B 1 107 ? 100.254 87.295 49.936  1.00 82.68  ? 122  LYS B C   1 
ATOM   3544 O O   . LYS B 1 107 ? 99.726  86.195 50.114  1.00 82.56  ? 122  LYS B O   1 
ATOM   3545 C CB  . LYS B 1 107 ? 102.407 87.507 48.645  1.00 82.01  ? 122  LYS B CB  1 
ATOM   3546 C CG  . LYS B 1 107 ? 103.927 87.446 48.697  1.00 83.98  ? 122  LYS B CG  1 
ATOM   3547 C CD  . LYS B 1 107 ? 104.547 87.698 47.341  1.00 85.80  ? 122  LYS B CD  1 
ATOM   3548 C CE  . LYS B 1 107 ? 106.055 87.557 47.396  1.00 86.77  ? 122  LYS B CE  1 
ATOM   3549 N NZ  . LYS B 1 107 ? 106.654 87.792 46.055  1.00 87.20  ? 122  LYS B NZ  1 
ATOM   3550 N N   . LYS B 1 108 ? 99.556  88.394 49.676  1.00 83.26  ? 123  LYS B N   1 
ATOM   3551 C CA  . LYS B 1 108 ? 98.099  88.361 49.579  1.00 83.95  ? 123  LYS B CA  1 
ATOM   3552 C C   . LYS B 1 108 ? 97.560  87.501 48.419  1.00 84.46  ? 123  LYS B C   1 
ATOM   3553 O O   . LYS B 1 108 ? 96.423  87.019 48.476  1.00 83.75  ? 123  LYS B O   1 
ATOM   3554 C CB  . LYS B 1 108 ? 97.556  89.791 49.453  1.00 84.59  ? 123  LYS B CB  1 
ATOM   3555 C CG  . LYS B 1 108 ? 98.042  90.533 48.207  1.00 87.13  ? 123  LYS B CG  1 
ATOM   3556 C CD  . LYS B 1 108 ? 97.319  91.860 48.011  1.00 88.04  ? 123  LYS B CD  1 
ATOM   3557 C CE  . LYS B 1 108 ? 97.679  92.479 46.669  1.00 88.14  ? 123  LYS B CE  1 
ATOM   3558 N NZ  . LYS B 1 108 ? 97.329  91.580 45.535  1.00 87.34  ? 123  LYS B NZ  1 
ATOM   3559 N N   . ASP B 1 109 ? 98.373  87.309 47.378  1.00 84.01  ? 124  ASP B N   1 
ATOM   3560 C CA  . ASP B 1 109 ? 97.977  86.525 46.200  1.00 83.30  ? 124  ASP B CA  1 
ATOM   3561 C C   . ASP B 1 109 ? 98.289  85.030 46.317  1.00 81.03  ? 124  ASP B C   1 
ATOM   3562 O O   . ASP B 1 109 ? 97.532  84.185 45.829  1.00 79.65  ? 124  ASP B O   1 
ATOM   3563 C CB  . ASP B 1 109 ? 98.676  87.069 44.949  1.00 86.52  ? 124  ASP B CB  1 
ATOM   3564 C CG  . ASP B 1 109 ? 98.350  88.525 44.680  1.00 90.10  ? 124  ASP B CG  1 
ATOM   3565 O OD1 . ASP B 1 109 ? 97.155  88.844 44.478  1.00 93.33  ? 124  ASP B OD1 1 
ATOM   3566 O OD2 . ASP B 1 109 ? 99.294  89.348 44.668  1.00 92.41  ? 124  ASP B OD2 1 
ATOM   3567 N N   . GLU B 1 110 ? 99.411  84.720 46.965  1.00 79.05  ? 125  GLU B N   1 
ATOM   3568 C CA  . GLU B 1 110 ? 99.880  83.349 47.144  1.00 76.69  ? 125  GLU B CA  1 
ATOM   3569 C C   . GLU B 1 110 ? 99.247  82.559 48.288  1.00 73.31  ? 125  GLU B C   1 
ATOM   3570 O O   . GLU B 1 110 ? 98.627  83.112 49.196  1.00 74.96  ? 125  GLU B O   1 
ATOM   3571 C CB  . GLU B 1 110 ? 101.396 83.362 47.316  1.00 77.82  ? 125  GLU B CB  1 
ATOM   3572 C CG  . GLU B 1 110 ? 102.110 83.958 46.125  1.00 81.84  ? 125  GLU B CG  1 
ATOM   3573 C CD  . GLU B 1 110 ? 103.593 84.146 46.365  1.00 85.66  ? 125  GLU B CD  1 
ATOM   3574 O OE1 . GLU B 1 110 ? 104.313 84.515 45.408  1.00 87.29  ? 125  GLU B OE1 1 
ATOM   3575 O OE2 . GLU B 1 110 ? 104.039 83.932 47.513  1.00 87.68  ? 125  GLU B OE2 1 
ATOM   3576 N N   . VAL B 1 111 ? 99.426  81.246 48.224  1.00 68.33  ? 126  VAL B N   1 
ATOM   3577 C CA  . VAL B 1 111 ? 98.904  80.326 49.220  1.00 61.88  ? 126  VAL B CA  1 
ATOM   3578 C C   . VAL B 1 111 ? 99.683  79.025 49.005  1.00 59.57  ? 126  VAL B C   1 
ATOM   3579 O O   . VAL B 1 111 ? 100.335 78.860 47.969  1.00 57.09  ? 126  VAL B O   1 
ATOM   3580 C CB  . VAL B 1 111 ? 97.388  80.101 49.007  1.00 61.19  ? 126  VAL B CB  1 
ATOM   3581 C CG1 . VAL B 1 111 ? 97.146  79.373 47.703  1.00 64.05  ? 126  VAL B CG1 1 
ATOM   3582 C CG2 . VAL B 1 111 ? 96.804  79.336 50.165  1.00 63.29  ? 126  VAL B CG2 1 
ATOM   3583 N N   . TYR B 1 112 ? 99.645  78.119 49.982  1.00 56.34  ? 127  TYR B N   1 
ATOM   3584 C CA  . TYR B 1 112 ? 100.350 76.838 49.873  1.00 51.28  ? 127  TYR B CA  1 
ATOM   3585 C C   . TYR B 1 112 ? 99.409  75.659 49.752  1.00 47.65  ? 127  TYR B C   1 
ATOM   3586 O O   . TYR B 1 112 ? 98.522  75.477 50.584  1.00 50.74  ? 127  TYR B O   1 
ATOM   3587 C CB  . TYR B 1 112 ? 101.258 76.600 51.085  1.00 53.39  ? 127  TYR B CB  1 
ATOM   3588 C CG  . TYR B 1 112 ? 102.542 77.368 51.012  1.00 52.93  ? 127  TYR B CG  1 
ATOM   3589 C CD1 . TYR B 1 112 ? 102.813 78.398 51.913  1.00 55.36  ? 127  TYR B CD1 1 
ATOM   3590 C CD2 . TYR B 1 112 ? 103.457 77.123 49.985  1.00 53.29  ? 127  TYR B CD2 1 
ATOM   3591 C CE1 . TYR B 1 112 ? 103.961 79.176 51.787  1.00 58.20  ? 127  TYR B CE1 1 
ATOM   3592 C CE2 . TYR B 1 112 ? 104.608 77.892 49.847  1.00 55.16  ? 127  TYR B CE2 1 
ATOM   3593 C CZ  . TYR B 1 112 ? 104.852 78.920 50.747  1.00 57.89  ? 127  TYR B CZ  1 
ATOM   3594 O OH  . TYR B 1 112 ? 105.962 79.714 50.586  1.00 57.85  ? 127  TYR B OH  1 
ATOM   3595 N N   . LEU B 1 113 ? 99.602  74.854 48.718  1.00 42.16  ? 128  LEU B N   1 
ATOM   3596 C CA  . LEU B 1 113 ? 98.772  73.678 48.537  1.00 39.22  ? 128  LEU B CA  1 
ATOM   3597 C C   . LEU B 1 113 ? 99.587  72.481 49.002  1.00 36.55  ? 128  LEU B C   1 
ATOM   3598 O O   . LEU B 1 113 ? 100.742 72.329 48.620  1.00 36.82  ? 128  LEU B O   1 
ATOM   3599 C CB  . LEU B 1 113 ? 98.387  73.517 47.067  1.00 38.14  ? 128  LEU B CB  1 
ATOM   3600 C CG  . LEU B 1 113 ? 97.696  72.193 46.729  1.00 39.14  ? 128  LEU B CG  1 
ATOM   3601 C CD1 . LEU B 1 113 ? 96.432  72.035 47.570  1.00 37.03  ? 128  LEU B CD1 1 
ATOM   3602 C CD2 . LEU B 1 113 ? 97.386  72.139 45.243  1.00 37.57  ? 128  LEU B CD2 1 
ATOM   3603 N N   . ASN B 1 114 ? 99.002  71.637 49.839  1.00 36.32  ? 129  ASN B N   1 
ATOM   3604 C CA  . ASN B 1 114 ? 99.733  70.477 50.318  1.00 38.24  ? 129  ASN B CA  1 
ATOM   3605 C C   . ASN B 1 114 ? 99.093  69.180 49.864  1.00 38.90  ? 129  ASN B C   1 
ATOM   3606 O O   . ASN B 1 114 ? 97.946  68.888 50.201  1.00 38.63  ? 129  ASN B O   1 
ATOM   3607 C CB  . ASN B 1 114 ? 99.837  70.487 51.848  1.00 39.22  ? 129  ASN B CB  1 
ATOM   3608 C CG  . ASN B 1 114 ? 100.329 71.819 52.393  1.00 42.30  ? 129  ASN B CG  1 
ATOM   3609 O OD1 . ASN B 1 114 ? 99.554  72.766 52.519  1.00 45.38  ? 129  ASN B OD1 1 
ATOM   3610 N ND2 . ASN B 1 114 ? 101.620 71.899 52.713  1.00 39.15  ? 129  ASN B ND2 1 
ATOM   3611 N N   . LEU B 1 115 ? 99.854  68.402 49.101  1.00 39.80  ? 130  LEU B N   1 
ATOM   3612 C CA  . LEU B 1 115 ? 99.371  67.131 48.594  1.00 39.42  ? 130  LEU B CA  1 
ATOM   3613 C C   . LEU B 1 115 ? 99.909  65.991 49.442  1.00 41.08  ? 130  LEU B C   1 
ATOM   3614 O O   . LEU B 1 115 ? 101.120 65.771 49.513  1.00 41.28  ? 130  LEU B O   1 
ATOM   3615 C CB  . LEU B 1 115 ? 99.794  66.959 47.145  1.00 37.81  ? 130  LEU B CB  1 
ATOM   3616 C CG  . LEU B 1 115 ? 99.243  68.029 46.200  1.00 41.45  ? 130  LEU B CG  1 
ATOM   3617 C CD1 . LEU B 1 115 ? 99.749  69.395 46.591  1.00 44.96  ? 130  LEU B CD1 1 
ATOM   3618 C CD2 . LEU B 1 115 ? 99.692  67.721 44.788  1.00 46.31  ? 130  LEU B CD2 1 
ATOM   3619 N N   . VAL B 1 116 ? 98.988  65.283 50.094  1.00 39.72  ? 131  VAL B N   1 
ATOM   3620 C CA  . VAL B 1 116 ? 99.305  64.150 50.964  1.00 40.30  ? 131  VAL B CA  1 
ATOM   3621 C C   . VAL B 1 116 ? 99.198  62.811 50.216  1.00 43.87  ? 131  VAL B C   1 
ATOM   3622 O O   . VAL B 1 116 ? 98.108  62.260 50.029  1.00 43.61  ? 131  VAL B O   1 
ATOM   3623 C CB  . VAL B 1 116 ? 98.359  64.129 52.168  1.00 38.25  ? 131  VAL B CB  1 
ATOM   3624 C CG1 . VAL B 1 116 ? 98.619  62.896 53.015  1.00 34.00  ? 131  VAL B CG1 1 
ATOM   3625 C CG2 . VAL B 1 116 ? 98.535  65.404 52.964  1.00 30.26  ? 131  VAL B CG2 1 
ATOM   3626 N N   . LEU B 1 117 ? 100.352 62.288 49.821  1.00 44.27  ? 132  LEU B N   1 
ATOM   3627 C CA  . LEU B 1 117 ? 100.438 61.053 49.059  1.00 44.56  ? 132  LEU B CA  1 
ATOM   3628 C C   . LEU B 1 117 ? 100.934 59.894 49.898  1.00 48.85  ? 132  LEU B C   1 
ATOM   3629 O O   . LEU B 1 117 ? 101.455 60.083 50.998  1.00 50.22  ? 132  LEU B O   1 
ATOM   3630 C CB  . LEU B 1 117 ? 101.398 61.271 47.895  1.00 42.99  ? 132  LEU B CB  1 
ATOM   3631 C CG  . LEU B 1 117 ? 101.237 62.631 47.205  1.00 41.31  ? 132  LEU B CG  1 
ATOM   3632 C CD1 . LEU B 1 117 ? 102.549 63.073 46.568  1.00 42.04  ? 132  LEU B CD1 1 
ATOM   3633 C CD2 . LEU B 1 117 ? 100.115 62.534 46.182  1.00 40.28  ? 132  LEU B CD2 1 
ATOM   3634 N N   . ASP B 1 118 ? 100.771 58.690 49.362  1.00 54.13  ? 133  ASP B N   1 
ATOM   3635 C CA  . ASP B 1 118 ? 101.231 57.484 50.038  1.00 57.92  ? 133  ASP B CA  1 
ATOM   3636 C C   . ASP B 1 118 ? 102.736 57.444 49.890  1.00 57.21  ? 133  ASP B C   1 
ATOM   3637 O O   . ASP B 1 118 ? 103.267 57.795 48.827  1.00 57.06  ? 133  ASP B O   1 
ATOM   3638 C CB  . ASP B 1 118 ? 100.647 56.245 49.378  1.00 61.35  ? 133  ASP B CB  1 
ATOM   3639 C CG  . ASP B 1 118 ? 99.157  56.153 49.543  1.00 66.03  ? 133  ASP B CG  1 
ATOM   3640 O OD1 . ASP B 1 118 ? 98.701  56.096 50.709  1.00 68.27  ? 133  ASP B OD1 1 
ATOM   3641 O OD2 . ASP B 1 118 ? 98.450  56.136 48.507  1.00 68.69  ? 133  ASP B OD2 1 
ATOM   3642 N N   . TYR B 1 119 ? 103.430 57.015 50.938  1.00 56.61  ? 134  TYR B N   1 
ATOM   3643 C CA  . TYR B 1 119 ? 104.882 56.951 50.856  1.00 58.53  ? 134  TYR B CA  1 
ATOM   3644 C C   . TYR B 1 119 ? 105.393 55.609 50.359  1.00 58.05  ? 134  TYR B C   1 
ATOM   3645 O O   . TYR B 1 119 ? 105.095 54.566 50.948  1.00 57.86  ? 134  TYR B O   1 
ATOM   3646 C CB  . TYR B 1 119 ? 105.543 57.245 52.208  1.00 58.02  ? 134  TYR B CB  1 
ATOM   3647 C CG  . TYR B 1 119 ? 107.055 57.360 52.096  1.00 56.31  ? 134  TYR B CG  1 
ATOM   3648 C CD1 . TYR B 1 119 ? 107.640 58.342 51.286  1.00 56.65  ? 134  TYR B CD1 1 
ATOM   3649 C CD2 . TYR B 1 119 ? 107.898 56.466 52.757  1.00 55.07  ? 134  TYR B CD2 1 
ATOM   3650 C CE1 . TYR B 1 119 ? 109.030 58.429 51.132  1.00 57.46  ? 134  TYR B CE1 1 
ATOM   3651 C CE2 . TYR B 1 119 ? 109.294 56.542 52.610  1.00 55.99  ? 134  TYR B CE2 1 
ATOM   3652 C CZ  . TYR B 1 119 ? 109.851 57.525 51.795  1.00 58.89  ? 134  TYR B CZ  1 
ATOM   3653 O OH  . TYR B 1 119 ? 111.221 57.593 51.628  1.00 60.62  ? 134  TYR B OH  1 
ATOM   3654 N N   . VAL B 1 120 ? 106.150 55.657 49.264  1.00 55.48  ? 135  VAL B N   1 
ATOM   3655 C CA  . VAL B 1 120 ? 106.771 54.479 48.678  1.00 54.43  ? 135  VAL B CA  1 
ATOM   3656 C C   . VAL B 1 120 ? 108.189 54.906 48.359  1.00 54.10  ? 135  VAL B C   1 
ATOM   3657 O O   . VAL B 1 120 ? 108.417 55.722 47.471  1.00 51.64  ? 135  VAL B O   1 
ATOM   3658 C CB  . VAL B 1 120 ? 106.088 54.039 47.399  1.00 54.04  ? 135  VAL B CB  1 
ATOM   3659 C CG1 . VAL B 1 120 ? 106.804 52.824 46.836  1.00 53.40  ? 135  VAL B CG1 1 
ATOM   3660 C CG2 . VAL B 1 120 ? 104.643 53.715 47.682  1.00 52.48  ? 135  VAL B CG2 1 
ATOM   3661 N N   . PRO B 1 121 ? 109.167 54.350 49.090  1.00 55.60  ? 136  PRO B N   1 
ATOM   3662 C CA  . PRO B 1 121 ? 110.588 54.660 48.927  1.00 53.69  ? 136  PRO B CA  1 
ATOM   3663 C C   . PRO B 1 121 ? 111.241 53.947 47.754  1.00 52.25  ? 136  PRO B C   1 
ATOM   3664 O O   . PRO B 1 121 ? 112.174 54.469 47.145  1.00 52.52  ? 136  PRO B O   1 
ATOM   3665 C CB  . PRO B 1 121 ? 111.168 54.218 50.257  1.00 53.89  ? 136  PRO B CB  1 
ATOM   3666 C CG  . PRO B 1 121 ? 110.414 52.917 50.473  1.00 53.90  ? 136  PRO B CG  1 
ATOM   3667 C CD  . PRO B 1 121 ? 108.983 53.257 50.068  1.00 54.38  ? 136  PRO B CD  1 
ATOM   3668 N N   . GLU B 1 122 ? 110.754 52.754 47.436  1.00 49.92  ? 137  GLU B N   1 
ATOM   3669 C CA  . GLU B 1 122 ? 111.336 52.008 46.341  1.00 50.95  ? 137  GLU B CA  1 
ATOM   3670 C C   . GLU B 1 122 ? 110.808 52.472 44.997  1.00 48.05  ? 137  GLU B C   1 
ATOM   3671 O O   . GLU B 1 122 ? 109.605 52.573 44.797  1.00 45.98  ? 137  GLU B O   1 
ATOM   3672 C CB  . GLU B 1 122 ? 111.075 50.511 46.514  1.00 54.55  ? 137  GLU B CB  1 
ATOM   3673 C CG  . GLU B 1 122 ? 111.975 49.657 45.637  1.00 64.02  ? 137  GLU B CG  1 
ATOM   3674 C CD  . GLU B 1 122 ? 113.461 49.789 45.997  1.00 69.67  ? 137  GLU B CD  1 
ATOM   3675 O OE1 . GLU B 1 122 ? 113.913 50.910 46.339  1.00 70.29  ? 137  GLU B OE1 1 
ATOM   3676 O OE2 . GLU B 1 122 ? 114.185 48.767 45.921  1.00 73.60  ? 137  GLU B OE2 1 
ATOM   3677 N N   . THR B 1 123 ? 111.721 52.755 44.078  1.00 46.00  ? 138  THR B N   1 
ATOM   3678 C CA  . THR B 1 123 ? 111.345 53.204 42.744  1.00 46.06  ? 138  THR B CA  1 
ATOM   3679 C C   . THR B 1 123 ? 112.086 52.402 41.687  1.00 44.15  ? 138  THR B C   1 
ATOM   3680 O O   . THR B 1 123 ? 113.166 51.876 41.947  1.00 45.16  ? 138  THR B O   1 
ATOM   3681 C CB  . THR B 1 123 ? 111.691 54.698 42.522  1.00 44.29  ? 138  THR B CB  1 
ATOM   3682 O OG1 . THR B 1 123 ? 113.106 54.896 42.641  1.00 39.71  ? 138  THR B OG1 1 
ATOM   3683 C CG2 . THR B 1 123 ? 110.979 55.560 43.533  1.00 43.11  ? 138  THR B CG2 1 
ATOM   3684 N N   . VAL B 1 124 ? 111.510 52.311 40.496  1.00 40.63  ? 139  VAL B N   1 
ATOM   3685 C CA  . VAL B 1 124 ? 112.159 51.597 39.414  1.00 36.78  ? 139  VAL B CA  1 
ATOM   3686 C C   . VAL B 1 124 ? 113.589 52.078 39.302  1.00 40.76  ? 139  VAL B C   1 
ATOM   3687 O O   . VAL B 1 124 ? 114.482 51.302 38.999  1.00 40.91  ? 139  VAL B O   1 
ATOM   3688 C CB  . VAL B 1 124 ? 111.461 51.842 38.079  1.00 34.05  ? 139  VAL B CB  1 
ATOM   3689 C CG1 . VAL B 1 124 ? 112.381 51.489 36.926  1.00 25.59  ? 139  VAL B CG1 1 
ATOM   3690 C CG2 . VAL B 1 124 ? 110.210 51.013 38.016  1.00 33.11  ? 139  VAL B CG2 1 
ATOM   3691 N N   . TYR B 1 125 ? 113.818 53.359 39.554  1.00 43.80  ? 140  TYR B N   1 
ATOM   3692 C CA  . TYR B 1 125 ? 115.171 53.874 39.456  1.00 47.40  ? 140  TYR B CA  1 
ATOM   3693 C C   . TYR B 1 125 ? 116.117 53.268 40.481  1.00 50.72  ? 140  TYR B C   1 
ATOM   3694 O O   . TYR B 1 125 ? 117.274 53.006 40.163  1.00 52.60  ? 140  TYR B O   1 
ATOM   3695 C CB  . TYR B 1 125 ? 115.213 55.377 39.625  1.00 47.16  ? 140  TYR B CB  1 
ATOM   3696 C CG  . TYR B 1 125 ? 116.633 55.875 39.689  1.00 51.25  ? 140  TYR B CG  1 
ATOM   3697 C CD1 . TYR B 1 125 ? 117.438 55.892 38.545  1.00 55.02  ? 140  TYR B CD1 1 
ATOM   3698 C CD2 . TYR B 1 125 ? 117.199 56.265 40.904  1.00 51.45  ? 140  TYR B CD2 1 
ATOM   3699 C CE1 . TYR B 1 125 ? 118.777 56.283 38.607  1.00 55.86  ? 140  TYR B CE1 1 
ATOM   3700 C CE2 . TYR B 1 125 ? 118.536 56.659 40.985  1.00 55.06  ? 140  TYR B CE2 1 
ATOM   3701 C CZ  . TYR B 1 125 ? 119.323 56.665 39.834  1.00 57.94  ? 140  TYR B CZ  1 
ATOM   3702 O OH  . TYR B 1 125 ? 120.653 57.034 39.917  1.00 57.62  ? 140  TYR B OH  1 
ATOM   3703 N N   . ARG B 1 126 ? 115.645 53.073 41.712  1.00 50.83  ? 141  ARG B N   1 
ATOM   3704 C CA  . ARG B 1 126 ? 116.488 52.490 42.753  1.00 51.98  ? 141  ARG B CA  1 
ATOM   3705 C C   . ARG B 1 126 ? 116.785 51.023 42.456  1.00 51.44  ? 141  ARG B C   1 
ATOM   3706 O O   . ARG B 1 126 ? 117.928 50.581 42.557  1.00 50.19  ? 141  ARG B O   1 
ATOM   3707 C CB  . ARG B 1 126 ? 115.830 52.638 44.133  1.00 54.67  ? 141  ARG B CB  1 
ATOM   3708 C CG  . ARG B 1 126 ? 116.268 53.903 44.878  1.00 60.32  ? 141  ARG B CG  1 
ATOM   3709 C CD  . ARG B 1 126 ? 115.460 54.145 46.155  1.00 67.94  ? 141  ARG B CD  1 
ATOM   3710 N NE  . ARG B 1 126 ? 115.954 55.276 46.953  1.00 74.98  ? 141  ARG B NE  1 
ATOM   3711 C CZ  . ARG B 1 126 ? 116.162 56.511 46.489  1.00 78.99  ? 141  ARG B CZ  1 
ATOM   3712 N NH1 . ARG B 1 126 ? 115.926 56.804 45.214  1.00 79.66  ? 141  ARG B NH1 1 
ATOM   3713 N NH2 . ARG B 1 126 ? 116.602 57.465 47.305  1.00 80.95  ? 141  ARG B NH2 1 
ATOM   3714 N N   . VAL B 1 127 ? 115.761 50.268 42.080  1.00 47.93  ? 142  VAL B N   1 
ATOM   3715 C CA  . VAL B 1 127 ? 115.953 48.863 41.754  1.00 45.89  ? 142  VAL B CA  1 
ATOM   3716 C C   . VAL B 1 127 ? 117.008 48.733 40.649  1.00 49.31  ? 142  VAL B C   1 
ATOM   3717 O O   . VAL B 1 127 ? 117.899 47.888 40.717  1.00 51.76  ? 142  VAL B O   1 
ATOM   3718 C CB  . VAL B 1 127 ? 114.633 48.224 41.268  1.00 44.84  ? 142  VAL B CB  1 
ATOM   3719 C CG1 . VAL B 1 127 ? 114.893 46.831 40.749  1.00 45.73  ? 142  VAL B CG1 1 
ATOM   3720 C CG2 . VAL B 1 127 ? 113.627 48.174 42.402  1.00 43.44  ? 142  VAL B CG2 1 
ATOM   3721 N N   . ALA B 1 128 ? 116.905 49.591 39.641  1.00 49.43  ? 143  ALA B N   1 
ATOM   3722 C CA  . ALA B 1 128 ? 117.818 49.582 38.507  1.00 47.78  ? 143  ALA B CA  1 
ATOM   3723 C C   . ALA B 1 128 ? 119.251 49.941 38.856  1.00 49.66  ? 143  ALA B C   1 
ATOM   3724 O O   . ALA B 1 128 ? 120.183 49.422 38.242  1.00 47.83  ? 143  ALA B O   1 
ATOM   3725 C CB  . ALA B 1 128 ? 117.307 50.525 37.429  1.00 49.11  ? 143  ALA B CB  1 
ATOM   3726 N N   . ARG B 1 129 ? 119.430 50.850 39.813  1.00 50.61  ? 144  ARG B N   1 
ATOM   3727 C CA  . ARG B 1 129 ? 120.770 51.267 40.232  1.00 52.84  ? 144  ARG B CA  1 
ATOM   3728 C C   . ARG B 1 129 ? 121.408 50.120 41.008  1.00 54.04  ? 144  ARG B C   1 
ATOM   3729 O O   . ARG B 1 129 ? 122.607 49.870 40.903  1.00 54.45  ? 144  ARG B O   1 
ATOM   3730 C CB  . ARG B 1 129 ? 120.699 52.515 41.117  1.00 52.69  ? 144  ARG B CB  1 
ATOM   3731 C CG  . ARG B 1 129 ? 122.054 53.059 41.547  1.00 54.50  ? 144  ARG B CG  1 
ATOM   3732 C CD  . ARG B 1 129 ? 121.911 54.291 42.430  1.00 55.35  ? 144  ARG B CD  1 
ATOM   3733 N NE  . ARG B 1 129 ? 120.959 54.050 43.511  1.00 61.19  ? 144  ARG B NE  1 
ATOM   3734 C CZ  . ARG B 1 129 ? 120.739 54.883 44.526  1.00 61.30  ? 144  ARG B CZ  1 
ATOM   3735 N NH1 . ARG B 1 129 ? 121.413 56.026 44.614  1.00 62.59  ? 144  ARG B NH1 1 
ATOM   3736 N NH2 . ARG B 1 129 ? 119.832 54.577 45.448  1.00 59.15  ? 144  ARG B NH2 1 
ATOM   3737 N N   . HIS B 1 130 ? 120.586 49.422 41.779  1.00 54.80  ? 145  HIS B N   1 
ATOM   3738 C CA  . HIS B 1 130 ? 121.036 48.287 42.567  1.00 57.55  ? 145  HIS B CA  1 
ATOM   3739 C C   . HIS B 1 130 ? 121.716 47.257 41.663  1.00 58.02  ? 145  HIS B C   1 
ATOM   3740 O O   . HIS B 1 130 ? 122.909 46.982 41.795  1.00 58.18  ? 145  HIS B O   1 
ATOM   3741 C CB  . HIS B 1 130 ? 119.837 47.649 43.266  1.00 59.04  ? 145  HIS B CB  1 
ATOM   3742 C CG  . HIS B 1 130 ? 120.179 46.430 44.059  1.00 62.97  ? 145  HIS B CG  1 
ATOM   3743 N ND1 . HIS B 1 130 ? 120.929 46.480 45.215  1.00 64.45  ? 145  HIS B ND1 1 
ATOM   3744 C CD2 . HIS B 1 130 ? 119.873 45.125 43.860  1.00 64.90  ? 145  HIS B CD2 1 
ATOM   3745 C CE1 . HIS B 1 130 ? 121.068 45.256 45.696  1.00 65.88  ? 145  HIS B CE1 1 
ATOM   3746 N NE2 . HIS B 1 130 ? 120.437 44.416 44.893  1.00 66.75  ? 145  HIS B NE2 1 
ATOM   3747 N N   . TYR B 1 131 ? 120.952 46.690 40.741  1.00 57.90  ? 146  TYR B N   1 
ATOM   3748 C CA  . TYR B 1 131 ? 121.495 45.698 39.833  1.00 58.50  ? 146  TYR B CA  1 
ATOM   3749 C C   . TYR B 1 131 ? 122.719 46.164 39.054  1.00 58.42  ? 146  TYR B C   1 
ATOM   3750 O O   . TYR B 1 131 ? 123.587 45.363 38.746  1.00 60.08  ? 146  TYR B O   1 
ATOM   3751 C CB  . TYR B 1 131 ? 120.416 45.226 38.855  1.00 57.69  ? 146  TYR B CB  1 
ATOM   3752 C CG  . TYR B 1 131 ? 119.401 44.290 39.471  1.00 59.25  ? 146  TYR B CG  1 
ATOM   3753 C CD1 . TYR B 1 131 ? 118.508 44.739 40.445  1.00 59.62  ? 146  TYR B CD1 1 
ATOM   3754 C CD2 . TYR B 1 131 ? 119.338 42.949 39.090  1.00 58.24  ? 146  TYR B CD2 1 
ATOM   3755 C CE1 . TYR B 1 131 ? 117.570 43.872 41.026  1.00 58.76  ? 146  TYR B CE1 1 
ATOM   3756 C CE2 . TYR B 1 131 ? 118.406 42.074 39.665  1.00 60.50  ? 146  TYR B CE2 1 
ATOM   3757 C CZ  . TYR B 1 131 ? 117.526 42.545 40.631  1.00 58.39  ? 146  TYR B CZ  1 
ATOM   3758 O OH  . TYR B 1 131 ? 116.600 41.698 41.199  1.00 63.07  ? 146  TYR B OH  1 
ATOM   3759 N N   . SER B 1 132 ? 122.809 47.448 38.737  1.00 59.49  ? 147  SER B N   1 
ATOM   3760 C CA  . SER B 1 132 ? 123.954 47.914 37.970  1.00 62.60  ? 147  SER B CA  1 
ATOM   3761 C C   . SER B 1 132 ? 125.224 47.922 38.806  1.00 64.60  ? 147  SER B C   1 
ATOM   3762 O O   . SER B 1 132 ? 126.303 47.583 38.313  1.00 66.81  ? 147  SER B O   1 
ATOM   3763 C CB  . SER B 1 132 ? 123.698 49.303 37.395  1.00 62.15  ? 147  SER B CB  1 
ATOM   3764 O OG  . SER B 1 132 ? 124.491 49.496 36.235  1.00 67.09  ? 147  SER B OG  1 
ATOM   3765 N N   . ARG B 1 133 ? 125.108 48.310 40.070  1.00 65.50  ? 148  ARG B N   1 
ATOM   3766 C CA  . ARG B 1 133 ? 126.277 48.314 40.940  1.00 65.96  ? 148  ARG B CA  1 
ATOM   3767 C C   . ARG B 1 133 ? 126.723 46.864 41.144  1.00 64.25  ? 148  ARG B C   1 
ATOM   3768 O O   . ARG B 1 133 ? 127.918 46.567 41.198  1.00 64.29  ? 148  ARG B O   1 
ATOM   3769 C CB  . ARG B 1 133 ? 125.946 48.979 42.283  1.00 66.60  ? 148  ARG B CB  1 
ATOM   3770 C CG  . ARG B 1 133 ? 125.936 50.500 42.216  1.00 71.11  ? 148  ARG B CG  1 
ATOM   3771 C CD  . ARG B 1 133 ? 125.571 51.147 43.549  1.00 72.98  ? 148  ARG B CD  1 
ATOM   3772 N NE  . ARG B 1 133 ? 125.585 52.607 43.440  1.00 78.35  ? 148  ARG B NE  1 
ATOM   3773 C CZ  . ARG B 1 133 ? 125.034 53.441 44.321  1.00 80.76  ? 148  ARG B CZ  1 
ATOM   3774 N NH1 . ARG B 1 133 ? 124.413 52.969 45.399  1.00 80.28  ? 148  ARG B NH1 1 
ATOM   3775 N NH2 . ARG B 1 133 ? 125.098 54.752 44.119  1.00 81.34  ? 148  ARG B NH2 1 
ATOM   3776 N N   . ALA B 1 134 ? 125.750 45.964 41.237  1.00 60.98  ? 149  ALA B N   1 
ATOM   3777 C CA  . ALA B 1 134 ? 126.039 44.550 41.413  1.00 61.84  ? 149  ALA B CA  1 
ATOM   3778 C C   . ALA B 1 134 ? 126.449 43.954 40.074  1.00 63.17  ? 149  ALA B C   1 
ATOM   3779 O O   . ALA B 1 134 ? 126.361 42.740 39.882  1.00 60.22  ? 149  ALA B O   1 
ATOM   3780 C CB  . ALA B 1 134 ? 124.810 43.828 41.943  1.00 59.20  ? 149  ALA B CB  1 
ATOM   3781 N N   . LYS B 1 135 ? 126.905 44.815 39.162  1.00 65.62  ? 150  LYS B N   1 
ATOM   3782 C CA  . LYS B 1 135 ? 127.309 44.404 37.815  1.00 68.74  ? 150  LYS B CA  1 
ATOM   3783 C C   . LYS B 1 135 ? 126.426 43.284 37.277  1.00 69.22  ? 150  LYS B C   1 
ATOM   3784 O O   . LYS B 1 135 ? 126.893 42.432 36.525  1.00 71.46  ? 150  LYS B O   1 
ATOM   3785 C CB  . LYS B 1 135 ? 128.760 43.919 37.787  1.00 67.75  ? 150  LYS B CB  1 
ATOM   3786 C CG  . LYS B 1 135 ? 129.819 44.989 37.814  1.00 68.05  ? 150  LYS B CG  1 
ATOM   3787 C CD  . LYS B 1 135 ? 131.095 44.424 37.210  1.00 68.56  ? 150  LYS B CD  1 
ATOM   3788 C CE  . LYS B 1 135 ? 132.302 45.269 37.545  1.00 69.93  ? 150  LYS B CE  1 
ATOM   3789 N NZ  . LYS B 1 135 ? 132.523 45.305 39.020  1.00 69.76  ? 150  LYS B NZ  1 
ATOM   3790 N N   . GLN B 1 136 ? 125.153 43.280 37.662  1.00 70.97  ? 151  GLN B N   1 
ATOM   3791 C CA  . GLN B 1 136 ? 124.227 42.245 37.209  1.00 70.94  ? 151  GLN B CA  1 
ATOM   3792 C C   . GLN B 1 136 ? 123.161 42.812 36.272  1.00 69.36  ? 151  GLN B C   1 
ATOM   3793 O O   . GLN B 1 136 ? 123.238 43.973 35.850  1.00 65.92  ? 151  GLN B O   1 
ATOM   3794 C CB  . GLN B 1 136 ? 123.553 41.571 38.407  1.00 73.61  ? 151  GLN B CB  1 
ATOM   3795 C CG  . GLN B 1 136 ? 123.062 40.163 38.113  1.00 78.09  ? 151  GLN B CG  1 
ATOM   3796 C CD  . GLN B 1 136 ? 122.192 39.605 39.222  1.00 80.33  ? 151  GLN B CD  1 
ATOM   3797 O OE1 . GLN B 1 136 ? 122.587 39.590 40.395  1.00 80.19  ? 151  GLN B OE1 1 
ATOM   3798 N NE2 . GLN B 1 136 ? 120.996 39.137 38.858  1.00 80.20  ? 151  GLN B NE2 1 
ATOM   3799 N N   . THR B 1 137 ? 122.162 41.993 35.955  1.00 68.15  ? 152  THR B N   1 
ATOM   3800 C CA  . THR B 1 137 ? 121.103 42.414 35.046  1.00 67.93  ? 152  THR B CA  1 
ATOM   3801 C C   . THR B 1 137 ? 119.690 42.161 35.575  1.00 64.33  ? 152  THR B C   1 
ATOM   3802 O O   . THR B 1 137 ? 119.394 41.086 36.117  1.00 64.09  ? 152  THR B O   1 
ATOM   3803 C CB  . THR B 1 137 ? 121.250 41.705 33.683  1.00 72.02  ? 152  THR B CB  1 
ATOM   3804 O OG1 . THR B 1 137 ? 120.298 42.252 32.759  1.00 75.01  ? 152  THR B OG1 1 
ATOM   3805 C CG2 . THR B 1 137 ? 121.023 40.188 33.839  1.00 72.30  ? 152  THR B CG2 1 
ATOM   3806 N N   . LEU B 1 138 ? 118.821 43.156 35.398  1.00 59.90  ? 153  LEU B N   1 
ATOM   3807 C CA  . LEU B 1 138 ? 117.443 43.065 35.852  1.00 53.74  ? 153  LEU B CA  1 
ATOM   3808 C C   . LEU B 1 138 ? 116.667 41.960 35.155  1.00 53.02  ? 153  LEU B C   1 
ATOM   3809 O O   . LEU B 1 138 ? 116.403 42.038 33.955  1.00 54.62  ? 153  LEU B O   1 
ATOM   3810 C CB  . LEU B 1 138 ? 116.717 44.387 35.616  1.00 53.06  ? 153  LEU B CB  1 
ATOM   3811 C CG  . LEU B 1 138 ? 115.242 44.367 36.029  1.00 52.74  ? 153  LEU B CG  1 
ATOM   3812 C CD1 . LEU B 1 138 ? 115.143 44.292 37.547  1.00 52.37  ? 153  LEU B CD1 1 
ATOM   3813 C CD2 . LEU B 1 138 ? 114.542 45.594 35.523  1.00 47.77  ? 153  LEU B CD2 1 
ATOM   3814 N N   . PRO B 1 139 ? 116.281 40.916 35.901  1.00 49.71  ? 154  PRO B N   1 
ATOM   3815 C CA  . PRO B 1 139 ? 115.524 39.793 35.347  1.00 48.71  ? 154  PRO B CA  1 
ATOM   3816 C C   . PRO B 1 139 ? 114.408 40.307 34.444  1.00 48.96  ? 154  PRO B C   1 
ATOM   3817 O O   . PRO B 1 139 ? 113.514 41.024 34.894  1.00 50.72  ? 154  PRO B O   1 
ATOM   3818 C CB  . PRO B 1 139 ? 114.986 39.107 36.591  1.00 47.57  ? 154  PRO B CB  1 
ATOM   3819 C CG  . PRO B 1 139 ? 116.096 39.301 37.551  1.00 48.92  ? 154  PRO B CG  1 
ATOM   3820 C CD  . PRO B 1 139 ? 116.498 40.739 37.345  1.00 49.20  ? 154  PRO B CD  1 
ATOM   3821 N N   . VAL B 1 140 ? 114.470 39.928 33.173  1.00 45.24  ? 155  VAL B N   1 
ATOM   3822 C CA  . VAL B 1 140 ? 113.501 40.349 32.161  1.00 42.20  ? 155  VAL B CA  1 
ATOM   3823 C C   . VAL B 1 140 ? 112.028 40.328 32.571  1.00 41.69  ? 155  VAL B C   1 
ATOM   3824 O O   . VAL B 1 140 ? 111.235 41.122 32.063  1.00 44.03  ? 155  VAL B O   1 
ATOM   3825 C CB  . VAL B 1 140 ? 113.640 39.504 30.868  1.00 43.79  ? 155  VAL B CB  1 
ATOM   3826 C CG1 . VAL B 1 140 ? 112.918 38.155 31.033  1.00 41.93  ? 155  VAL B CG1 1 
ATOM   3827 C CG2 . VAL B 1 140 ? 113.092 40.280 29.682  1.00 42.47  ? 155  VAL B CG2 1 
ATOM   3828 N N   . ILE B 1 141 ? 111.640 39.433 33.467  1.00 37.70  ? 156  ILE B N   1 
ATOM   3829 C CA  . ILE B 1 141 ? 110.243 39.410 33.837  1.00 36.68  ? 156  ILE B CA  1 
ATOM   3830 C C   . ILE B 1 141 ? 109.876 40.692 34.562  1.00 38.37  ? 156  ILE B C   1 
ATOM   3831 O O   . ILE B 1 141 ? 108.744 41.164 34.467  1.00 40.31  ? 156  ILE B O   1 
ATOM   3832 C CB  . ILE B 1 141 ? 109.889 38.233 34.744  1.00 36.62  ? 156  ILE B CB  1 
ATOM   3833 C CG1 . ILE B 1 141 ? 108.363 38.203 34.911  1.00 36.13  ? 156  ILE B CG1 1 
ATOM   3834 C CG2 . ILE B 1 141 ? 110.613 38.355 36.085  1.00 32.11  ? 156  ILE B CG2 1 
ATOM   3835 C CD1 . ILE B 1 141 ? 107.870 37.274 35.956  1.00 38.09  ? 156  ILE B CD1 1 
ATOM   3836 N N   . TYR B 1 142 ? 110.830 41.245 35.303  1.00 38.77  ? 157  TYR B N   1 
ATOM   3837 C CA  . TYR B 1 142 ? 110.603 42.489 36.023  1.00 40.93  ? 157  TYR B CA  1 
ATOM   3838 C C   . TYR B 1 142 ? 110.442 43.593 35.004  1.00 40.60  ? 157  TYR B C   1 
ATOM   3839 O O   . TYR B 1 142 ? 109.551 44.427 35.100  1.00 40.27  ? 157  TYR B O   1 
ATOM   3840 C CB  . TYR B 1 142 ? 111.780 42.773 36.939  1.00 44.97  ? 157  TYR B CB  1 
ATOM   3841 C CG  . TYR B 1 142 ? 111.749 41.906 38.166  1.00 48.03  ? 157  TYR B CG  1 
ATOM   3842 C CD1 . TYR B 1 142 ? 112.918 41.368 38.698  1.00 52.68  ? 157  TYR B CD1 1 
ATOM   3843 C CD2 . TYR B 1 142 ? 110.542 41.632 38.808  1.00 48.80  ? 157  TYR B CD2 1 
ATOM   3844 C CE1 . TYR B 1 142 ? 112.881 40.576 39.847  1.00 53.27  ? 157  TYR B CE1 1 
ATOM   3845 C CE2 . TYR B 1 142 ? 110.494 40.847 39.949  1.00 49.78  ? 157  TYR B CE2 1 
ATOM   3846 C CZ  . TYR B 1 142 ? 111.664 40.323 40.465  1.00 52.29  ? 157  TYR B CZ  1 
ATOM   3847 O OH  . TYR B 1 142 ? 111.616 39.553 41.607  1.00 53.96  ? 157  TYR B OH  1 
ATOM   3848 N N   . VAL B 1 143 ? 111.309 43.577 34.009  1.00 39.55  ? 158  VAL B N   1 
ATOM   3849 C CA  . VAL B 1 143 ? 111.243 44.558 32.953  1.00 38.62  ? 158  VAL B CA  1 
ATOM   3850 C C   . VAL B 1 143 ? 109.863 44.516 32.313  1.00 38.90  ? 158  VAL B C   1 
ATOM   3851 O O   . VAL B 1 143 ? 109.225 45.553 32.145  1.00 42.06  ? 158  VAL B O   1 
ATOM   3852 C CB  . VAL B 1 143 ? 112.309 44.280 31.892  1.00 38.95  ? 158  VAL B CB  1 
ATOM   3853 C CG1 . VAL B 1 143 ? 112.147 45.234 30.718  1.00 39.98  ? 158  VAL B CG1 1 
ATOM   3854 C CG2 . VAL B 1 143 ? 113.692 44.425 32.514  1.00 38.44  ? 158  VAL B CG2 1 
ATOM   3855 N N   . LYS B 1 144 ? 109.389 43.324 31.965  1.00 38.12  ? 159  LYS B N   1 
ATOM   3856 C CA  . LYS B 1 144 ? 108.072 43.204 31.345  1.00 38.66  ? 159  LYS B CA  1 
ATOM   3857 C C   . LYS B 1 144 ? 106.972 43.647 32.297  1.00 38.16  ? 159  LYS B C   1 
ATOM   3858 O O   . LYS B 1 144 ? 105.985 44.251 31.887  1.00 38.30  ? 159  LYS B O   1 
ATOM   3859 C CB  . LYS B 1 144 ? 107.786 41.758 30.934  1.00 38.11  ? 159  LYS B CB  1 
ATOM   3860 C CG  . LYS B 1 144 ? 108.742 41.166 29.933  1.00 40.43  ? 159  LYS B CG  1 
ATOM   3861 C CD  . LYS B 1 144 ? 108.341 39.746 29.579  1.00 41.41  ? 159  LYS B CD  1 
ATOM   3862 C CE  . LYS B 1 144 ? 109.333 39.139 28.607  1.00 42.41  ? 159  LYS B CE  1 
ATOM   3863 N NZ  . LYS B 1 144 ? 109.022 37.731 28.288  1.00 38.02  ? 159  LYS B NZ  1 
ATOM   3864 N N   . LEU B 1 145 ? 107.147 43.338 33.573  1.00 37.70  ? 160  LEU B N   1 
ATOM   3865 C CA  . LEU B 1 145 ? 106.147 43.669 34.566  1.00 40.72  ? 160  LEU B CA  1 
ATOM   3866 C C   . LEU B 1 145 ? 106.063 45.167 34.799  1.00 41.38  ? 160  LEU B C   1 
ATOM   3867 O O   . LEU B 1 145 ? 104.977 45.737 34.871  1.00 40.96  ? 160  LEU B O   1 
ATOM   3868 C CB  . LEU B 1 145 ? 106.467 42.947 35.869  1.00 42.27  ? 160  LEU B CB  1 
ATOM   3869 C CG  . LEU B 1 145 ? 105.239 42.541 36.681  1.00 46.48  ? 160  LEU B CG  1 
ATOM   3870 C CD1 . LEU B 1 145 ? 104.413 41.514 35.924  1.00 48.38  ? 160  LEU B CD1 1 
ATOM   3871 C CD2 . LEU B 1 145 ? 105.691 41.969 37.996  1.00 46.74  ? 160  LEU B CD2 1 
ATOM   3872 N N   . TYR B 1 146 ? 107.219 45.801 34.911  1.00 39.57  ? 161  TYR B N   1 
ATOM   3873 C CA  . TYR B 1 146 ? 107.284 47.232 35.131  1.00 39.24  ? 161  TYR B CA  1 
ATOM   3874 C C   . TYR B 1 146 ? 106.780 47.993 33.932  1.00 39.45  ? 161  TYR B C   1 
ATOM   3875 O O   . TYR B 1 146 ? 105.823 48.759 34.025  1.00 38.55  ? 161  TYR B O   1 
ATOM   3876 C CB  . TYR B 1 146 ? 108.718 47.642 35.404  1.00 38.44  ? 161  TYR B CB  1 
ATOM   3877 C CG  . TYR B 1 146 ? 109.265 47.048 36.670  1.00 38.92  ? 161  TYR B CG  1 
ATOM   3878 C CD1 . TYR B 1 146 ? 110.626 47.123 36.966  1.00 37.37  ? 161  TYR B CD1 1 
ATOM   3879 C CD2 . TYR B 1 146 ? 108.415 46.421 37.591  1.00 35.75  ? 161  TYR B CD2 1 
ATOM   3880 C CE1 . TYR B 1 146 ? 111.132 46.591 38.147  1.00 35.13  ? 161  TYR B CE1 1 
ATOM   3881 C CE2 . TYR B 1 146 ? 108.908 45.888 38.772  1.00 35.00  ? 161  TYR B CE2 1 
ATOM   3882 C CZ  . TYR B 1 146 ? 110.268 45.977 39.041  1.00 34.42  ? 161  TYR B CZ  1 
ATOM   3883 O OH  . TYR B 1 146 ? 110.762 45.448 40.206  1.00 39.13  ? 161  TYR B OH  1 
ATOM   3884 N N   . MET B 1 147 ? 107.434 47.785 32.799  1.00 36.48  ? 162  MET B N   1 
ATOM   3885 C CA  . MET B 1 147 ? 107.046 48.479 31.584  1.00 37.43  ? 162  MET B CA  1 
ATOM   3886 C C   . MET B 1 147 ? 105.571 48.310 31.285  1.00 36.81  ? 162  MET B C   1 
ATOM   3887 O O   . MET B 1 147 ? 104.894 49.265 30.925  1.00 38.97  ? 162  MET B O   1 
ATOM   3888 C CB  . MET B 1 147 ? 107.882 47.992 30.400  1.00 38.98  ? 162  MET B CB  1 
ATOM   3889 C CG  . MET B 1 147 ? 109.332 48.404 30.486  1.00 36.36  ? 162  MET B CG  1 
ATOM   3890 S SD  . MET B 1 147 ? 109.511 50.165 30.858  1.00 38.06  ? 162  MET B SD  1 
ATOM   3891 C CE  . MET B 1 147 ? 109.116 50.928 29.261  1.00 39.15  ? 162  MET B CE  1 
ATOM   3892 N N   . TYR B 1 148 ? 105.065 47.098 31.435  1.00 35.71  ? 163  TYR B N   1 
ATOM   3893 C CA  . TYR B 1 148 ? 103.656 46.879 31.166  1.00 37.00  ? 163  TYR B CA  1 
ATOM   3894 C C   . TYR B 1 148 ? 102.815 47.861 31.973  1.00 36.73  ? 163  TYR B C   1 
ATOM   3895 O O   . TYR B 1 148 ? 102.026 48.621 31.419  1.00 36.90  ? 163  TYR B O   1 
ATOM   3896 C CB  . TYR B 1 148 ? 103.243 45.461 31.540  1.00 37.51  ? 163  TYR B CB  1 
ATOM   3897 C CG  . TYR B 1 148 ? 101.803 45.163 31.192  1.00 36.77  ? 163  TYR B CG  1 
ATOM   3898 C CD1 . TYR B 1 148 ? 101.436 44.829 29.887  1.00 37.47  ? 163  TYR B CD1 1 
ATOM   3899 C CD2 . TYR B 1 148 ? 100.804 45.204 32.168  1.00 35.82  ? 163  TYR B CD2 1 
ATOM   3900 C CE1 . TYR B 1 148 ? 100.111 44.535 29.557  1.00 35.67  ? 163  TYR B CE1 1 
ATOM   3901 C CE2 . TYR B 1 148 ? 99.475  44.912 31.853  1.00 35.75  ? 163  TYR B CE2 1 
ATOM   3902 C CZ  . TYR B 1 148 ? 99.136  44.574 30.544  1.00 39.14  ? 163  TYR B CZ  1 
ATOM   3903 O OH  . TYR B 1 148 ? 97.833  44.237 30.229  1.00 40.15  ? 163  TYR B OH  1 
ATOM   3904 N N   . GLN B 1 149 ? 102.993 47.840 33.288  1.00 36.64  ? 164  GLN B N   1 
ATOM   3905 C CA  . GLN B 1 149 ? 102.237 48.715 34.168  1.00 38.19  ? 164  GLN B CA  1 
ATOM   3906 C C   . GLN B 1 149 ? 102.407 50.182 33.786  1.00 38.14  ? 164  GLN B C   1 
ATOM   3907 O O   . GLN B 1 149 ? 101.446 50.961 33.827  1.00 37.12  ? 164  GLN B O   1 
ATOM   3908 C CB  . GLN B 1 149 ? 102.655 48.468 35.617  1.00 35.46  ? 164  GLN B CB  1 
ATOM   3909 C CG  . GLN B 1 149 ? 102.479 47.019 36.014  1.00 36.26  ? 164  GLN B CG  1 
ATOM   3910 C CD  . GLN B 1 149 ? 102.785 46.752 37.472  1.00 43.47  ? 164  GLN B CD  1 
ATOM   3911 O OE1 . GLN B 1 149 ? 101.988 47.056 38.363  1.00 40.67  ? 164  GLN B OE1 1 
ATOM   3912 N NE2 . GLN B 1 149 ? 103.951 46.181 37.726  1.00 44.18  ? 164  GLN B NE2 1 
ATOM   3913 N N   . LEU B 1 150 ? 103.623 50.560 33.401  1.00 37.08  ? 165  LEU B N   1 
ATOM   3914 C CA  . LEU B 1 150 ? 103.881 51.938 32.996  1.00 35.78  ? 165  LEU B CA  1 
ATOM   3915 C C   . LEU B 1 150 ? 103.017 52.325 31.792  1.00 38.05  ? 165  LEU B C   1 
ATOM   3916 O O   . LEU B 1 150 ? 102.358 53.364 31.805  1.00 41.88  ? 165  LEU B O   1 
ATOM   3917 C CB  . LEU B 1 150 ? 105.358 52.139 32.654  1.00 31.44  ? 165  LEU B CB  1 
ATOM   3918 C CG  . LEU B 1 150 ? 105.680 53.492 32.021  1.00 31.22  ? 165  LEU B CG  1 
ATOM   3919 C CD1 . LEU B 1 150 ? 105.222 54.592 32.952  1.00 27.35  ? 165  LEU B CD1 1 
ATOM   3920 C CD2 . LEU B 1 150 ? 107.169 53.613 31.747  1.00 27.26  ? 165  LEU B CD2 1 
ATOM   3921 N N   . PHE B 1 151 ? 103.013 51.496 30.754  1.00 38.64  ? 166  PHE B N   1 
ATOM   3922 C CA  . PHE B 1 151 ? 102.207 51.798 29.571  1.00 38.87  ? 166  PHE B CA  1 
ATOM   3923 C C   . PHE B 1 151 ? 100.740 51.771 29.928  1.00 37.28  ? 166  PHE B C   1 
ATOM   3924 O O   . PHE B 1 151 ? 99.920  52.448 29.315  1.00 37.01  ? 166  PHE B O   1 
ATOM   3925 C CB  . PHE B 1 151 ? 102.483 50.795 28.443  1.00 35.09  ? 166  PHE B CB  1 
ATOM   3926 C CG  . PHE B 1 151 ? 103.782 51.031 27.748  1.00 34.77  ? 166  PHE B CG  1 
ATOM   3927 C CD1 . PHE B 1 151 ? 104.769 50.055 27.734  1.00 35.52  ? 166  PHE B CD1 1 
ATOM   3928 C CD2 . PHE B 1 151 ? 104.050 52.267 27.162  1.00 35.81  ? 166  PHE B CD2 1 
ATOM   3929 C CE1 . PHE B 1 151 ? 106.012 50.312 27.148  1.00 34.38  ? 166  PHE B CE1 1 
ATOM   3930 C CE2 . PHE B 1 151 ? 105.280 52.533 26.576  1.00 34.45  ? 166  PHE B CE2 1 
ATOM   3931 C CZ  . PHE B 1 151 ? 106.264 51.554 26.571  1.00 32.36  ? 166  PHE B CZ  1 
ATOM   3932 N N   . ARG B 1 152 ? 100.407 50.985 30.937  1.00 39.34  ? 167  ARG B N   1 
ATOM   3933 C CA  . ARG B 1 152 ? 99.022  50.891 31.331  1.00 39.29  ? 167  ARG B CA  1 
ATOM   3934 C C   . ARG B 1 152 ? 98.613  52.197 31.997  1.00 38.72  ? 167  ARG B C   1 
ATOM   3935 O O   . ARG B 1 152 ? 97.548  52.735 31.696  1.00 42.25  ? 167  ARG B O   1 
ATOM   3936 C CB  . ARG B 1 152 ? 98.811  49.705 32.269  1.00 39.37  ? 167  ARG B CB  1 
ATOM   3937 C CG  . ARG B 1 152 ? 97.414  49.187 32.187  1.00 41.39  ? 167  ARG B CG  1 
ATOM   3938 C CD  . ARG B 1 152 ? 97.094  48.217 33.277  1.00 46.01  ? 167  ARG B CD  1 
ATOM   3939 N NE  . ARG B 1 152 ? 95.646  48.108 33.420  1.00 50.01  ? 167  ARG B NE  1 
ATOM   3940 C CZ  . ARG B 1 152 ? 95.034  47.461 34.404  1.00 49.31  ? 167  ARG B CZ  1 
ATOM   3941 N NH1 . ARG B 1 152 ? 95.743  46.854 35.342  1.00 47.80  ? 167  ARG B NH1 1 
ATOM   3942 N NH2 . ARG B 1 152 ? 93.710  47.432 34.455  1.00 52.01  ? 167  ARG B NH2 1 
ATOM   3943 N N   . SER B 1 153 ? 99.462  52.713 32.885  1.00 35.29  ? 168  SER B N   1 
ATOM   3944 C CA  . SER B 1 153 ? 99.164  53.971 33.557  1.00 35.93  ? 168  SER B CA  1 
ATOM   3945 C C   . SER B 1 153 ? 99.121  55.104 32.514  1.00 37.23  ? 168  SER B C   1 
ATOM   3946 O O   . SER B 1 153 ? 98.325  56.040 32.613  1.00 37.05  ? 168  SER B O   1 
ATOM   3947 C CB  . SER B 1 153 ? 100.222 54.280 34.622  1.00 38.16  ? 168  SER B CB  1 
ATOM   3948 O OG  . SER B 1 153 ? 101.450 54.684 34.035  1.00 36.86  ? 168  SER B OG  1 
ATOM   3949 N N   . LEU B 1 154 ? 99.982  55.013 31.513  1.00 35.24  ? 169  LEU B N   1 
ATOM   3950 C CA  . LEU B 1 154 ? 100.019 56.005 30.457  1.00 35.23  ? 169  LEU B CA  1 
ATOM   3951 C C   . LEU B 1 154 ? 98.751  55.951 29.631  1.00 38.86  ? 169  LEU B C   1 
ATOM   3952 O O   . LEU B 1 154 ? 98.198  56.980 29.255  1.00 39.20  ? 169  LEU B O   1 
ATOM   3953 C CB  . LEU B 1 154 ? 101.200 55.738 29.550  1.00 33.05  ? 169  LEU B CB  1 
ATOM   3954 C CG  . LEU B 1 154 ? 102.320 56.755 29.647  1.00 36.04  ? 169  LEU B CG  1 
ATOM   3955 C CD1 . LEU B 1 154 ? 102.576 57.126 31.087  1.00 36.69  ? 169  LEU B CD1 1 
ATOM   3956 C CD2 . LEU B 1 154 ? 103.549 56.169 28.980  1.00 34.90  ? 169  LEU B CD2 1 
ATOM   3957 N N   . ALA B 1 155 ? 98.296  54.738 29.339  1.00 39.32  ? 170  ALA B N   1 
ATOM   3958 C CA  . ALA B 1 155 ? 97.090  54.549 28.543  1.00 39.88  ? 170  ALA B CA  1 
ATOM   3959 C C   . ALA B 1 155 ? 95.908  55.214 29.227  1.00 42.29  ? 170  ALA B C   1 
ATOM   3960 O O   . ALA B 1 155 ? 95.073  55.852 28.585  1.00 42.94  ? 170  ALA B O   1 
ATOM   3961 C CB  . ALA B 1 155 ? 96.819  53.066 28.361  1.00 37.61  ? 170  ALA B CB  1 
ATOM   3962 N N   . TYR B 1 156 ? 95.844  55.060 30.539  1.00 41.59  ? 171  TYR B N   1 
ATOM   3963 C CA  . TYR B 1 156 ? 94.763  55.632 31.307  1.00 43.87  ? 171  TYR B CA  1 
ATOM   3964 C C   . TYR B 1 156 ? 94.782  57.162 31.320  1.00 44.05  ? 171  TYR B C   1 
ATOM   3965 O O   . TYR B 1 156 ? 93.829  57.786 30.871  1.00 42.35  ? 171  TYR B O   1 
ATOM   3966 C CB  . TYR B 1 156 ? 94.819  55.087 32.725  1.00 45.51  ? 171  TYR B CB  1 
ATOM   3967 C CG  . TYR B 1 156 ? 93.809  55.691 33.660  1.00 45.45  ? 171  TYR B CG  1 
ATOM   3968 C CD1 . TYR B 1 156 ? 92.449  55.430 33.514  1.00 44.15  ? 171  TYR B CD1 1 
ATOM   3969 C CD2 . TYR B 1 156 ? 94.218  56.517 34.708  1.00 46.57  ? 171  TYR B CD2 1 
ATOM   3970 C CE1 . TYR B 1 156 ? 91.518  55.977 34.395  1.00 44.28  ? 171  TYR B CE1 1 
ATOM   3971 C CE2 . TYR B 1 156 ? 93.297  57.068 35.593  1.00 46.76  ? 171  TYR B CE2 1 
ATOM   3972 C CZ  . TYR B 1 156 ? 91.953  56.792 35.433  1.00 46.33  ? 171  TYR B CZ  1 
ATOM   3973 O OH  . TYR B 1 156 ? 91.055  57.311 36.331  1.00 47.55  ? 171  TYR B OH  1 
ATOM   3974 N N   . ILE B 1 157 ? 95.852  57.775 31.822  1.00 42.40  ? 172  ILE B N   1 
ATOM   3975 C CA  . ILE B 1 157 ? 95.889  59.239 31.865  1.00 43.62  ? 172  ILE B CA  1 
ATOM   3976 C C   . ILE B 1 157 ? 95.736  59.839 30.475  1.00 43.91  ? 172  ILE B C   1 
ATOM   3977 O O   . ILE B 1 157 ? 94.980  60.788 30.292  1.00 44.92  ? 172  ILE B O   1 
ATOM   3978 C CB  . ILE B 1 157 ? 97.188  59.804 32.512  1.00 41.20  ? 172  ILE B CB  1 
ATOM   3979 C CG1 . ILE B 1 157 ? 98.395  59.542 31.617  1.00 39.20  ? 172  ILE B CG1 1 
ATOM   3980 C CG2 . ILE B 1 157 ? 97.395  59.190 33.890  1.00 38.84  ? 172  ILE B CG2 1 
ATOM   3981 C CD1 . ILE B 1 157 ? 99.664  60.222 32.103  1.00 38.74  ? 172  ILE B CD1 1 
ATOM   3982 N N   . HIS B 1 158 ? 96.447  59.280 29.500  1.00 45.97  ? 173  HIS B N   1 
ATOM   3983 C CA  . HIS B 1 158 ? 96.375  59.758 28.120  1.00 43.70  ? 173  HIS B CA  1 
ATOM   3984 C C   . HIS B 1 158 ? 94.932  59.774 27.628  1.00 46.16  ? 173  HIS B C   1 
ATOM   3985 O O   . HIS B 1 158 ? 94.592  60.546 26.733  1.00 48.38  ? 173  HIS B O   1 
ATOM   3986 C CB  . HIS B 1 158 ? 97.200  58.861 27.199  1.00 39.21  ? 173  HIS B CB  1 
ATOM   3987 C CG  . HIS B 1 158 ? 98.672  59.114 27.260  1.00 39.31  ? 173  HIS B CG  1 
ATOM   3988 N ND1 . HIS B 1 158 ? 99.265  59.826 28.282  1.00 38.56  ? 173  HIS B ND1 1 
ATOM   3989 C CD2 . HIS B 1 158 ? 99.677  58.727 26.439  1.00 31.50  ? 173  HIS B CD2 1 
ATOM   3990 C CE1 . HIS B 1 158 ? 100.571 59.864 28.088  1.00 33.66  ? 173  HIS B CE1 1 
ATOM   3991 N NE2 . HIS B 1 158 ? 100.846 59.205 26.977  1.00 29.53  ? 173  HIS B NE2 1 
ATOM   3992 N N   . SER B 1 159 ? 94.084  58.922 28.203  1.00 46.83  ? 174  SER B N   1 
ATOM   3993 C CA  . SER B 1 159 ? 92.683  58.879 27.798  1.00 47.17  ? 174  SER B CA  1 
ATOM   3994 C C   . SER B 1 159 ? 92.016  60.194 28.196  1.00 48.55  ? 174  SER B C   1 
ATOM   3995 O O   . SER B 1 159 ? 91.134  60.681 27.490  1.00 52.74  ? 174  SER B O   1 
ATOM   3996 C CB  . SER B 1 159 ? 91.954  57.698 28.449  1.00 46.92  ? 174  SER B CB  1 
ATOM   3997 O OG  . SER B 1 159 ? 91.621  57.972 29.796  1.00 51.29  ? 174  SER B OG  1 
ATOM   3998 N N   . PHE B 1 160 ? 92.438  60.774 29.320  1.00 47.55  ? 175  PHE B N   1 
ATOM   3999 C CA  . PHE B 1 160 ? 91.881  62.050 29.765  1.00 47.30  ? 175  PHE B CA  1 
ATOM   4000 C C   . PHE B 1 160 ? 92.600  63.221 29.114  1.00 47.41  ? 175  PHE B C   1 
ATOM   4001 O O   . PHE B 1 160 ? 92.447  64.358 29.551  1.00 49.08  ? 175  PHE B O   1 
ATOM   4002 C CB  . PHE B 1 160 ? 92.009  62.214 31.272  1.00 48.73  ? 175  PHE B CB  1 
ATOM   4003 C CG  . PHE B 1 160 ? 91.159  61.284 32.053  1.00 54.94  ? 175  PHE B CG  1 
ATOM   4004 C CD1 . PHE B 1 160 ? 91.647  60.054 32.453  1.00 55.11  ? 175  PHE B CD1 1 
ATOM   4005 C CD2 . PHE B 1 160 ? 89.866  61.641 32.400  1.00 56.96  ? 175  PHE B CD2 1 
ATOM   4006 C CE1 . PHE B 1 160 ? 90.858  59.192 33.191  1.00 57.64  ? 175  PHE B CE1 1 
ATOM   4007 C CE2 . PHE B 1 160 ? 89.070  60.790 33.134  1.00 56.85  ? 175  PHE B CE2 1 
ATOM   4008 C CZ  . PHE B 1 160 ? 89.566  59.562 33.533  1.00 57.88  ? 175  PHE B CZ  1 
ATOM   4009 N N   . GLY B 1 161 ? 93.395  62.949 28.083  1.00 45.02  ? 176  GLY B N   1 
ATOM   4010 C CA  . GLY B 1 161 ? 94.130  64.011 27.417  1.00 44.02  ? 176  GLY B CA  1 
ATOM   4011 C C   . GLY B 1 161 ? 95.270  64.572 28.252  1.00 43.71  ? 176  GLY B C   1 
ATOM   4012 O O   . GLY B 1 161 ? 95.863  65.581 27.878  1.00 45.15  ? 176  GLY B O   1 
ATOM   4013 N N   . ILE B 1 162 ? 95.587  63.921 29.374  1.00 43.10  ? 177  ILE B N   1 
ATOM   4014 C CA  . ILE B 1 162 ? 96.665  64.364 30.268  1.00 43.61  ? 177  ILE B CA  1 
ATOM   4015 C C   . ILE B 1 162 ? 98.031  63.756 29.931  1.00 41.37  ? 177  ILE B C   1 
ATOM   4016 O O   . ILE B 1 162 ? 98.171  62.537 29.814  1.00 40.85  ? 177  ILE B O   1 
ATOM   4017 C CB  . ILE B 1 162 ? 96.369  63.994 31.731  1.00 43.90  ? 177  ILE B CB  1 
ATOM   4018 C CG1 . ILE B 1 162 ? 94.927  64.328 32.073  1.00 42.73  ? 177  ILE B CG1 1 
ATOM   4019 C CG2 . ILE B 1 162 ? 97.306  64.748 32.666  1.00 44.41  ? 177  ILE B CG2 1 
ATOM   4020 C CD1 . ILE B 1 162 ? 94.498  63.748 33.395  1.00 42.20  ? 177  ILE B CD1 1 
ATOM   4021 N N   . CYS B 1 163 ? 99.037  64.617 29.803  1.00 42.13  ? 178  CYS B N   1 
ATOM   4022 C CA  . CYS B 1 163 ? 100.398 64.189 29.498  1.00 39.23  ? 178  CYS B CA  1 
ATOM   4023 C C   . CYS B 1 163 ? 101.286 64.414 30.722  1.00 38.25  ? 178  CYS B C   1 
ATOM   4024 O O   . CYS B 1 163 ? 101.425 65.541 31.200  1.00 35.62  ? 178  CYS B O   1 
ATOM   4025 C CB  . CYS B 1 163 ? 100.936 64.977 28.301  1.00 39.38  ? 178  CYS B CB  1 
ATOM   4026 S SG  . CYS B 1 163 ? 102.637 64.579 27.817  1.00 43.93  ? 178  CYS B SG  1 
ATOM   4027 N N   . HIS B 1 164 ? 101.884 63.335 31.224  1.00 37.01  ? 179  HIS B N   1 
ATOM   4028 C CA  . HIS B 1 164 ? 102.740 63.399 32.410  1.00 35.19  ? 179  HIS B CA  1 
ATOM   4029 C C   . HIS B 1 164 ? 103.889 64.383 32.251  1.00 34.82  ? 179  HIS B C   1 
ATOM   4030 O O   . HIS B 1 164 ? 104.162 65.178 33.143  1.00 38.97  ? 179  HIS B O   1 
ATOM   4031 C CB  . HIS B 1 164 ? 103.287 62.006 32.732  1.00 30.20  ? 179  HIS B CB  1 
ATOM   4032 C CG  . HIS B 1 164 ? 103.950 61.913 34.070  1.00 26.61  ? 179  HIS B CG  1 
ATOM   4033 N ND1 . HIS B 1 164 ? 105.268 62.259 34.276  1.00 23.67  ? 179  HIS B ND1 1 
ATOM   4034 C CD2 . HIS B 1 164 ? 103.461 61.553 35.281  1.00 22.32  ? 179  HIS B CD2 1 
ATOM   4035 C CE1 . HIS B 1 164 ? 105.563 62.118 35.557  1.00 24.21  ? 179  HIS B CE1 1 
ATOM   4036 N NE2 . HIS B 1 164 ? 104.484 61.690 36.188  1.00 24.81  ? 179  HIS B NE2 1 
ATOM   4037 N N   . ARG B 1 165 ? 104.569 64.312 31.116  1.00 35.28  ? 180  ARG B N   1 
ATOM   4038 C CA  . ARG B 1 165 ? 105.679 65.198 30.808  1.00 36.01  ? 180  ARG B CA  1 
ATOM   4039 C C   . ARG B 1 165 ? 106.947 65.073 31.633  1.00 37.51  ? 180  ARG B C   1 
ATOM   4040 O O   . ARG B 1 165 ? 107.884 65.852 31.453  1.00 38.34  ? 180  ARG B O   1 
ATOM   4041 C CB  . ARG B 1 165 ? 105.205 66.645 30.821  1.00 35.61  ? 180  ARG B CB  1 
ATOM   4042 C CG  . ARG B 1 165 ? 104.173 66.913 29.753  1.00 38.28  ? 180  ARG B CG  1 
ATOM   4043 C CD  . ARG B 1 165 ? 104.178 68.361 29.326  1.00 38.50  ? 180  ARG B CD  1 
ATOM   4044 N NE  . ARG B 1 165 ? 103.798 69.255 30.410  1.00 40.78  ? 180  ARG B NE  1 
ATOM   4045 C CZ  . ARG B 1 165 ? 103.649 70.561 30.263  1.00 37.11  ? 180  ARG B CZ  1 
ATOM   4046 N NH1 . ARG B 1 165 ? 103.853 71.113 29.071  1.00 40.62  ? 180  ARG B NH1 1 
ATOM   4047 N NH2 . ARG B 1 165 ? 103.287 71.302 31.299  1.00 31.76  ? 180  ARG B NH2 1 
ATOM   4048 N N   . ASP B 1 166 ? 106.994 64.112 32.542  1.00 37.03  ? 181  ASP B N   1 
ATOM   4049 C CA  . ASP B 1 166 ? 108.213 63.923 33.317  1.00 40.01  ? 181  ASP B CA  1 
ATOM   4050 C C   . ASP B 1 166 ? 108.395 62.454 33.658  1.00 43.44  ? 181  ASP B C   1 
ATOM   4051 O O   . ASP B 1 166 ? 108.497 62.066 34.816  1.00 43.76  ? 181  ASP B O   1 
ATOM   4052 C CB  . ASP B 1 166 ? 108.203 64.771 34.590  1.00 41.49  ? 181  ASP B CB  1 
ATOM   4053 C CG  . ASP B 1 166 ? 109.548 64.751 35.309  1.00 42.91  ? 181  ASP B CG  1 
ATOM   4054 O OD1 . ASP B 1 166 ? 110.591 64.678 34.616  1.00 46.90  ? 181  ASP B OD1 1 
ATOM   4055 O OD2 . ASP B 1 166 ? 109.560 64.818 36.560  1.00 47.17  ? 181  ASP B OD2 1 
ATOM   4056 N N   . ILE B 1 167 ? 108.434 61.626 32.630  1.00 42.13  ? 182  ILE B N   1 
ATOM   4057 C CA  . ILE B 1 167 ? 108.605 60.215 32.851  1.00 38.87  ? 182  ILE B CA  1 
ATOM   4058 C C   . ILE B 1 167 ? 110.074 59.815 32.903  1.00 39.44  ? 182  ILE B C   1 
ATOM   4059 O O   . ILE B 1 167 ? 110.861 60.098 31.993  1.00 39.39  ? 182  ILE B O   1 
ATOM   4060 C CB  . ILE B 1 167 ? 107.844 59.427 31.786  1.00 39.22  ? 182  ILE B CB  1 
ATOM   4061 C CG1 . ILE B 1 167 ? 106.353 59.622 32.030  1.00 40.40  ? 182  ILE B CG1 1 
ATOM   4062 C CG2 . ILE B 1 167 ? 108.207 57.953 31.833  1.00 37.32  ? 182  ILE B CG2 1 
ATOM   4063 C CD1 . ILE B 1 167 ? 105.498 58.701 31.254  1.00 47.38  ? 182  ILE B CD1 1 
ATOM   4064 N N   . LYS B 1 168 ? 110.430 59.180 34.012  1.00 36.63  ? 183  LYS B N   1 
ATOM   4065 C CA  . LYS B 1 168 ? 111.777 58.697 34.258  1.00 37.02  ? 183  LYS B CA  1 
ATOM   4066 C C   . LYS B 1 168 ? 111.692 57.666 35.399  1.00 38.10  ? 183  LYS B C   1 
ATOM   4067 O O   . LYS B 1 168 ? 110.727 57.657 36.172  1.00 38.68  ? 183  LYS B O   1 
ATOM   4068 C CB  . LYS B 1 168 ? 112.685 59.860 34.631  1.00 36.58  ? 183  LYS B CB  1 
ATOM   4069 C CG  . LYS B 1 168 ? 112.219 60.620 35.843  1.00 41.00  ? 183  LYS B CG  1 
ATOM   4070 C CD  . LYS B 1 168 ? 113.166 61.755 36.122  1.00 39.50  ? 183  LYS B CD  1 
ATOM   4071 C CE  . LYS B 1 168 ? 112.653 62.648 37.228  1.00 44.16  ? 183  LYS B CE  1 
ATOM   4072 N NZ  . LYS B 1 168 ? 113.533 63.846 37.363  1.00 43.76  ? 183  LYS B NZ  1 
ATOM   4073 N N   . PRO B 1 169 ? 112.702 56.781 35.514  1.00 36.11  ? 184  PRO B N   1 
ATOM   4074 C CA  . PRO B 1 169 ? 112.759 55.733 36.539  1.00 32.93  ? 184  PRO B CA  1 
ATOM   4075 C C   . PRO B 1 169 ? 112.362 56.201 37.933  1.00 33.82  ? 184  PRO B C   1 
ATOM   4076 O O   . PRO B 1 169 ? 111.581 55.546 38.628  1.00 33.24  ? 184  PRO B O   1 
ATOM   4077 C CB  . PRO B 1 169 ? 114.215 55.292 36.494  1.00 33.39  ? 184  PRO B CB  1 
ATOM   4078 C CG  . PRO B 1 169 ? 114.594 55.526 35.076  1.00 34.05  ? 184  PRO B CG  1 
ATOM   4079 C CD  . PRO B 1 169 ? 113.983 56.860 34.786  1.00 36.75  ? 184  PRO B CD  1 
ATOM   4080 N N   . GLN B 1 170 ? 112.916 57.345 38.325  1.00 34.60  ? 185  GLN B N   1 
ATOM   4081 C CA  . GLN B 1 170 ? 112.693 57.937 39.633  1.00 36.04  ? 185  GLN B CA  1 
ATOM   4082 C C   . GLN B 1 170 ? 111.222 58.127 39.968  1.00 35.52  ? 185  GLN B C   1 
ATOM   4083 O O   . GLN B 1 170 ? 110.816 58.020 41.131  1.00 33.96  ? 185  GLN B O   1 
ATOM   4084 C CB  . GLN B 1 170 ? 113.445 59.267 39.712  1.00 37.82  ? 185  GLN B CB  1 
ATOM   4085 C CG  . GLN B 1 170 ? 114.959 59.127 39.459  1.00 46.42  ? 185  GLN B CG  1 
ATOM   4086 C CD  . GLN B 1 170 ? 115.348 59.046 37.965  1.00 50.81  ? 185  GLN B CD  1 
ATOM   4087 O OE1 . GLN B 1 170 ? 114.568 58.610 37.117  1.00 53.46  ? 185  GLN B OE1 1 
ATOM   4088 N NE2 . GLN B 1 170 ? 116.572 59.457 37.656  1.00 50.74  ? 185  GLN B NE2 1 
ATOM   4089 N N   . ASN B 1 171 ? 110.420 58.380 38.940  1.00 36.21  ? 186  ASN B N   1 
ATOM   4090 C CA  . ASN B 1 171 ? 108.999 58.609 39.127  1.00 36.04  ? 186  ASN B CA  1 
ATOM   4091 C C   . ASN B 1 171 ? 108.135 57.352 38.999  1.00 38.45  ? 186  ASN B C   1 
ATOM   4092 O O   . ASN B 1 171 ? 106.907 57.450 38.892  1.00 36.54  ? 186  ASN B O   1 
ATOM   4093 C CB  . ASN B 1 171 ? 108.503 59.689 38.150  1.00 34.82  ? 186  ASN B CB  1 
ATOM   4094 C CG  . ASN B 1 171 ? 109.092 61.066 38.436  1.00 31.40  ? 186  ASN B CG  1 
ATOM   4095 O OD1 . ASN B 1 171 ? 109.561 61.348 39.537  1.00 36.39  ? 186  ASN B OD1 1 
ATOM   4096 N ND2 . ASN B 1 171 ? 109.047 61.935 37.446  1.00 36.43  ? 186  ASN B ND2 1 
ATOM   4097 N N   . LEU B 1 172 ? 108.765 56.176 39.017  1.00 38.88  ? 187  LEU B N   1 
ATOM   4098 C CA  . LEU B 1 172 ? 108.032 54.906 38.928  1.00 38.99  ? 187  LEU B CA  1 
ATOM   4099 C C   . LEU B 1 172 ? 108.131 54.169 40.271  1.00 40.61  ? 187  LEU B C   1 
ATOM   4100 O O   . LEU B 1 172 ? 109.165 53.584 40.603  1.00 39.34  ? 187  LEU B O   1 
ATOM   4101 C CB  . LEU B 1 172 ? 108.614 54.049 37.806  1.00 41.23  ? 187  LEU B CB  1 
ATOM   4102 C CG  . LEU B 1 172 ? 108.600 54.694 36.420  1.00 39.30  ? 187  LEU B CG  1 
ATOM   4103 C CD1 . LEU B 1 172 ? 109.284 53.778 35.427  1.00 37.18  ? 187  LEU B CD1 1 
ATOM   4104 C CD2 . LEU B 1 172 ? 107.166 54.966 36.002  1.00 35.05  ? 187  LEU B CD2 1 
ATOM   4105 N N   . LEU B 1 173 ? 107.051 54.202 41.044  1.00 39.14  ? 188  LEU B N   1 
ATOM   4106 C CA  . LEU B 1 173 ? 107.039 53.573 42.359  1.00 40.70  ? 188  LEU B CA  1 
ATOM   4107 C C   . LEU B 1 173 ? 106.783 52.081 42.336  1.00 40.39  ? 188  LEU B C   1 
ATOM   4108 O O   . LEU B 1 173 ? 105.986 51.590 41.549  1.00 39.28  ? 188  LEU B O   1 
ATOM   4109 C CB  . LEU B 1 173 ? 105.996 54.244 43.241  1.00 43.03  ? 188  LEU B CB  1 
ATOM   4110 C CG  . LEU B 1 173 ? 106.180 55.753 43.331  1.00 44.76  ? 188  LEU B CG  1 
ATOM   4111 C CD1 . LEU B 1 173 ? 105.073 56.335 44.186  1.00 41.51  ? 188  LEU B CD1 1 
ATOM   4112 C CD2 . LEU B 1 173 ? 107.562 56.070 43.889  1.00 34.65  ? 188  LEU B CD2 1 
ATOM   4113 N N   . LEU B 1 174 ? 107.452 51.368 43.233  1.00 44.23  ? 189  LEU B N   1 
ATOM   4114 C CA  . LEU B 1 174 ? 107.328 49.921 43.320  1.00 47.69  ? 189  LEU B CA  1 
ATOM   4115 C C   . LEU B 1 174 ? 107.020 49.417 44.713  1.00 50.41  ? 189  LEU B C   1 
ATOM   4116 O O   . LEU B 1 174 ? 107.585 49.901 45.692  1.00 52.17  ? 189  LEU B O   1 
ATOM   4117 C CB  . LEU B 1 174 ? 108.635 49.264 42.890  1.00 47.33  ? 189  LEU B CB  1 
ATOM   4118 C CG  . LEU B 1 174 ? 108.930 48.893 41.445  1.00 49.27  ? 189  LEU B CG  1 
ATOM   4119 C CD1 . LEU B 1 174 ? 108.390 49.933 40.496  1.00 47.84  ? 189  LEU B CD1 1 
ATOM   4120 C CD2 . LEU B 1 174 ? 110.435 48.745 41.305  1.00 45.48  ? 189  LEU B CD2 1 
ATOM   4121 N N   . ASP B 1 175 ? 106.118 48.449 44.803  1.00 54.01  ? 190  ASP B N   1 
ATOM   4122 C CA  . ASP B 1 175 ? 105.852 47.835 46.086  1.00 58.65  ? 190  ASP B CA  1 
ATOM   4123 C C   . ASP B 1 175 ? 106.791 46.646 46.055  1.00 61.15  ? 190  ASP B C   1 
ATOM   4124 O O   . ASP B 1 175 ? 106.674 45.770 45.193  1.00 61.81  ? 190  ASP B O   1 
ATOM   4125 C CB  . ASP B 1 175 ? 104.431 47.317 46.226  1.00 60.91  ? 190  ASP B CB  1 
ATOM   4126 C CG  . ASP B 1 175 ? 104.284 46.398 47.431  1.00 66.20  ? 190  ASP B CG  1 
ATOM   4127 O OD1 . ASP B 1 175 ? 104.683 45.217 47.330  1.00 67.67  ? 190  ASP B OD1 1 
ATOM   4128 O OD2 . ASP B 1 175 ? 103.799 46.857 48.490  1.00 65.03  ? 190  ASP B OD2 1 
ATOM   4129 N N   . PRO B 1 176 ? 107.737 46.596 46.998  1.00 63.23  ? 191  PRO B N   1 
ATOM   4130 C CA  . PRO B 1 176 ? 108.708 45.499 47.062  1.00 64.03  ? 191  PRO B CA  1 
ATOM   4131 C C   . PRO B 1 176 ? 108.106 44.099 46.944  1.00 64.11  ? 191  PRO B C   1 
ATOM   4132 O O   . PRO B 1 176 ? 108.581 43.272 46.168  1.00 64.65  ? 191  PRO B O   1 
ATOM   4133 C CB  . PRO B 1 176 ? 109.396 45.734 48.407  1.00 65.01  ? 191  PRO B CB  1 
ATOM   4134 C CG  . PRO B 1 176 ? 108.320 46.432 49.228  1.00 63.88  ? 191  PRO B CG  1 
ATOM   4135 C CD  . PRO B 1 176 ? 107.777 47.410 48.228  1.00 64.94  ? 191  PRO B CD  1 
ATOM   4136 N N   . ASP B 1 177 ? 107.047 43.847 47.703  1.00 64.26  ? 192  ASP B N   1 
ATOM   4137 C CA  . ASP B 1 177 ? 106.404 42.538 47.709  1.00 63.73  ? 192  ASP B CA  1 
ATOM   4138 C C   . ASP B 1 177 ? 105.652 42.187 46.426  1.00 62.13  ? 192  ASP B C   1 
ATOM   4139 O O   . ASP B 1 177 ? 106.082 41.323 45.659  1.00 63.50  ? 192  ASP B O   1 
ATOM   4140 C CB  . ASP B 1 177 ? 105.447 42.434 48.915  1.00 67.64  ? 192  ASP B CB  1 
ATOM   4141 C CG  . ASP B 1 177 ? 106.118 42.819 50.240  1.00 69.58  ? 192  ASP B CG  1 
ATOM   4142 O OD1 . ASP B 1 177 ? 107.087 42.137 50.658  1.00 68.16  ? 192  ASP B OD1 1 
ATOM   4143 O OD2 . ASP B 1 177 ? 105.670 43.814 50.859  1.00 69.33  ? 192  ASP B OD2 1 
ATOM   4144 N N   . THR B 1 178 ? 104.536 42.872 46.208  1.00 58.52  ? 193  THR B N   1 
ATOM   4145 C CA  . THR B 1 178 ? 103.654 42.648 45.064  1.00 55.22  ? 193  THR B CA  1 
ATOM   4146 C C   . THR B 1 178 ? 104.156 43.003 43.662  1.00 52.58  ? 193  THR B C   1 
ATOM   4147 O O   . THR B 1 178 ? 103.573 42.562 42.669  1.00 48.49  ? 193  THR B O   1 
ATOM   4148 C CB  . THR B 1 178 ? 102.332 43.387 45.286  1.00 56.92  ? 193  THR B CB  1 
ATOM   4149 O OG1 . THR B 1 178 ? 102.588 44.793 45.422  1.00 57.38  ? 193  THR B OG1 1 
ATOM   4150 C CG2 . THR B 1 178 ? 101.653 42.875 46.544  1.00 56.98  ? 193  THR B CG2 1 
ATOM   4151 N N   . ALA B 1 179 ? 105.214 43.802 43.576  1.00 51.10  ? 194  ALA B N   1 
ATOM   4152 C CA  . ALA B 1 179 ? 105.771 44.204 42.286  1.00 49.36  ? 194  ALA B CA  1 
ATOM   4153 C C   . ALA B 1 179 ? 104.842 45.153 41.533  1.00 48.04  ? 194  ALA B C   1 
ATOM   4154 O O   . ALA B 1 179 ? 104.955 45.313 40.314  1.00 49.60  ? 194  ALA B O   1 
ATOM   4155 C CB  . ALA B 1 179 ? 106.060 42.979 41.431  1.00 49.17  ? 194  ALA B CB  1 
ATOM   4156 N N   . VAL B 1 180 ? 103.920 45.778 42.259  1.00 48.53  ? 195  VAL B N   1 
ATOM   4157 C CA  . VAL B 1 180 ? 102.987 46.722 41.656  1.00 45.59  ? 195  VAL B CA  1 
ATOM   4158 C C   . VAL B 1 180 ? 103.695 48.050 41.421  1.00 43.85  ? 195  VAL B C   1 
ATOM   4159 O O   . VAL B 1 180 ? 104.443 48.519 42.280  1.00 42.16  ? 195  VAL B O   1 
ATOM   4160 C CB  . VAL B 1 180 ? 101.763 46.948 42.565  1.00 45.47  ? 195  VAL B CB  1 
ATOM   4161 C CG1 . VAL B 1 180 ? 100.942 48.123 42.065  1.00 46.60  ? 195  VAL B CG1 1 
ATOM   4162 C CG2 . VAL B 1 180 ? 100.911 45.689 42.587  1.00 42.04  ? 195  VAL B CG2 1 
ATOM   4163 N N   . LEU B 1 181 ? 103.477 48.640 40.246  1.00 42.30  ? 196  LEU B N   1 
ATOM   4164 C CA  . LEU B 1 181 ? 104.091 49.921 39.908  1.00 38.79  ? 196  LEU B CA  1 
ATOM   4165 C C   . LEU B 1 181 ? 103.044 51.026 39.868  1.00 40.32  ? 196  LEU B C   1 
ATOM   4166 O O   . LEU B 1 181 ? 101.976 50.867 39.273  1.00 39.13  ? 196  LEU B O   1 
ATOM   4167 C CB  . LEU B 1 181 ? 104.817 49.842 38.548  1.00 38.38  ? 196  LEU B CB  1 
ATOM   4168 C CG  . LEU B 1 181 ? 105.400 51.133 37.935  1.00 37.74  ? 196  LEU B CG  1 
ATOM   4169 C CD1 . LEU B 1 181 ? 106.656 50.786 37.177  1.00 29.79  ? 196  LEU B CD1 1 
ATOM   4170 C CD2 . LEU B 1 181 ? 104.378 51.841 37.037  1.00 33.51  ? 196  LEU B CD2 1 
ATOM   4171 N N   . LYS B 1 182 ? 103.350 52.140 40.526  1.00 41.14  ? 197  LYS B N   1 
ATOM   4172 C CA  . LYS B 1 182 ? 102.462 53.291 40.545  1.00 41.92  ? 197  LYS B CA  1 
ATOM   4173 C C   . LYS B 1 182 ? 103.230 54.495 40.056  1.00 39.46  ? 197  LYS B C   1 
ATOM   4174 O O   . LYS B 1 182 ? 104.301 54.805 40.571  1.00 39.41  ? 197  LYS B O   1 
ATOM   4175 C CB  . LYS B 1 182 ? 101.930 53.549 41.947  1.00 41.19  ? 197  LYS B CB  1 
ATOM   4176 C CG  . LYS B 1 182 ? 100.815 52.610 42.326  1.00 44.44  ? 197  LYS B CG  1 
ATOM   4177 C CD  . LYS B 1 182 ? 100.408 52.800 43.772  1.00 48.69  ? 197  LYS B CD  1 
ATOM   4178 C CE  . LYS B 1 182 ? 99.352  51.792 44.186  1.00 48.64  ? 197  LYS B CE  1 
ATOM   4179 N NZ  . LYS B 1 182 ? 98.156  51.938 43.327  1.00 60.09  ? 197  LYS B NZ  1 
ATOM   4180 N N   . LEU B 1 183 ? 102.680 55.147 39.039  1.00 37.52  ? 198  LEU B N   1 
ATOM   4181 C CA  . LEU B 1 183 ? 103.270 56.339 38.447  1.00 36.76  ? 198  LEU B CA  1 
ATOM   4182 C C   . LEU B 1 183 ? 102.978 57.536 39.363  1.00 38.74  ? 198  LEU B C   1 
ATOM   4183 O O   . LEU B 1 183 ? 101.845 57.695 39.851  1.00 38.98  ? 198  LEU B O   1 
ATOM   4184 C CB  . LEU B 1 183 ? 102.658 56.558 37.061  1.00 36.21  ? 198  LEU B CB  1 
ATOM   4185 C CG  . LEU B 1 183 ? 102.953 57.820 36.249  1.00 34.32  ? 198  LEU B CG  1 
ATOM   4186 C CD1 . LEU B 1 183 ? 104.445 57.968 35.963  1.00 30.41  ? 198  LEU B CD1 1 
ATOM   4187 C CD2 . LEU B 1 183 ? 102.163 57.726 34.955  1.00 34.93  ? 198  LEU B CD2 1 
ATOM   4188 N N   . CYS B 1 184 ? 103.988 58.372 39.599  1.00 39.17  ? 199  CYS B N   1 
ATOM   4189 C CA  . CYS B 1 184 ? 103.807 59.526 40.472  1.00 42.10  ? 199  CYS B CA  1 
ATOM   4190 C C   . CYS B 1 184 ? 104.444 60.810 39.955  1.00 41.74  ? 199  CYS B C   1 
ATOM   4191 O O   . CYS B 1 184 ? 104.963 60.858 38.838  1.00 41.69  ? 199  CYS B O   1 
ATOM   4192 C CB  . CYS B 1 184 ? 104.362 59.220 41.868  1.00 44.47  ? 199  CYS B CB  1 
ATOM   4193 S SG  . CYS B 1 184 ? 106.167 59.386 42.030  1.00 50.21  ? 199  CYS B SG  1 
ATOM   4194 N N   . ASP B 1 185 ? 104.393 61.842 40.798  1.00 42.05  ? 200  ASP B N   1 
ATOM   4195 C CA  . ASP B 1 185 ? 104.930 63.173 40.510  1.00 43.88  ? 200  ASP B CA  1 
ATOM   4196 C C   . ASP B 1 185 ? 104.351 63.828 39.258  1.00 41.40  ? 200  ASP B C   1 
ATOM   4197 O O   . ASP B 1 185 ? 105.018 63.888 38.227  1.00 41.86  ? 200  ASP B O   1 
ATOM   4198 C CB  . ASP B 1 185 ? 106.454 63.129 40.382  1.00 48.10  ? 200  ASP B CB  1 
ATOM   4199 C CG  . ASP B 1 185 ? 107.066 64.518 40.244  1.00 53.97  ? 200  ASP B CG  1 
ATOM   4200 O OD1 . ASP B 1 185 ? 108.293 64.613 40.017  1.00 56.22  ? 200  ASP B OD1 1 
ATOM   4201 O OD2 . ASP B 1 185 ? 106.318 65.517 40.367  1.00 57.55  ? 200  ASP B OD2 1 
ATOM   4202 N N   . PHE B 1 186 ? 103.120 64.332 39.351  1.00 39.82  ? 201  PHE B N   1 
ATOM   4203 C CA  . PHE B 1 186 ? 102.482 64.982 38.211  1.00 37.66  ? 201  PHE B CA  1 
ATOM   4204 C C   . PHE B 1 186 ? 102.708 66.490 38.176  1.00 36.26  ? 201  PHE B C   1 
ATOM   4205 O O   . PHE B 1 186 ? 101.938 67.235 37.575  1.00 36.74  ? 201  PHE B O   1 
ATOM   4206 C CB  . PHE B 1 186 ? 100.990 64.667 38.196  1.00 34.89  ? 201  PHE B CB  1 
ATOM   4207 C CG  . PHE B 1 186 ? 100.690 63.220 37.921  1.00 36.29  ? 201  PHE B CG  1 
ATOM   4208 C CD1 . PHE B 1 186 ? 100.906 62.251 38.901  1.00 38.74  ? 201  PHE B CD1 1 
ATOM   4209 C CD2 . PHE B 1 186 ? 100.231 62.817 36.671  1.00 33.79  ? 201  PHE B CD2 1 
ATOM   4210 C CE1 . PHE B 1 186 ? 100.673 60.897 38.641  1.00 37.33  ? 201  PHE B CE1 1 
ATOM   4211 C CE2 . PHE B 1 186 ? 99.995  61.469 36.400  1.00 41.61  ? 201  PHE B CE2 1 
ATOM   4212 C CZ  . PHE B 1 186 ? 100.219 60.506 37.391  1.00 35.64  ? 201  PHE B CZ  1 
ATOM   4213 N N   . GLY B 1 187 ? 103.795 66.924 38.805  1.00 34.67  ? 202  GLY B N   1 
ATOM   4214 C CA  . GLY B 1 187 ? 104.123 68.332 38.845  1.00 37.52  ? 202  GLY B CA  1 
ATOM   4215 C C   . GLY B 1 187 ? 104.390 68.949 37.485  1.00 38.51  ? 202  GLY B C   1 
ATOM   4216 O O   . GLY B 1 187 ? 104.386 70.173 37.359  1.00 40.65  ? 202  GLY B O   1 
ATOM   4217 N N   . SER B 1 188 ? 104.627 68.127 36.468  1.00 37.44  ? 203  SER B N   1 
ATOM   4218 C CA  . SER B 1 188 ? 104.892 68.646 35.132  1.00 39.15  ? 203  SER B CA  1 
ATOM   4219 C C   . SER B 1 188 ? 103.752 68.303 34.206  1.00 38.90  ? 203  SER B C   1 
ATOM   4220 O O   . SER B 1 188 ? 103.666 68.803 33.090  1.00 36.69  ? 203  SER B O   1 
ATOM   4221 C CB  . SER B 1 188 ? 106.181 68.059 34.576  1.00 41.26  ? 203  SER B CB  1 
ATOM   4222 O OG  . SER B 1 188 ? 107.257 68.354 35.441  1.00 47.26  ? 203  SER B OG  1 
ATOM   4223 N N   . ALA B 1 189 ? 102.868 67.443 34.683  1.00 40.58  ? 204  ALA B N   1 
ATOM   4224 C CA  . ALA B 1 189 ? 101.732 67.031 33.883  1.00 44.18  ? 204  ALA B CA  1 
ATOM   4225 C C   . ALA B 1 189 ? 100.887 68.235 33.485  1.00 45.32  ? 204  ALA B C   1 
ATOM   4226 O O   . ALA B 1 189 ? 100.899 69.280 34.135  1.00 46.47  ? 204  ALA B O   1 
ATOM   4227 C CB  . ALA B 1 189 ? 100.885 66.017 34.655  1.00 41.79  ? 204  ALA B CB  1 
ATOM   4228 N N   . LYS B 1 190 ? 100.160 68.080 32.396  1.00 46.37  ? 205  LYS B N   1 
ATOM   4229 C CA  . LYS B 1 190 ? 99.305  69.134 31.908  1.00 48.32  ? 205  LYS B CA  1 
ATOM   4230 C C   . LYS B 1 190 ? 98.304  68.513 30.973  1.00 51.03  ? 205  LYS B C   1 
ATOM   4231 O O   . LYS B 1 190 ? 98.643  67.618 30.201  1.00 51.31  ? 205  LYS B O   1 
ATOM   4232 C CB  . LYS B 1 190 ? 100.106 70.174 31.132  1.00 46.83  ? 205  LYS B CB  1 
ATOM   4233 C CG  . LYS B 1 190 ? 99.212  71.137 30.355  1.00 47.04  ? 205  LYS B CG  1 
ATOM   4234 C CD  . LYS B 1 190 ? 100.020 72.181 29.611  1.00 45.92  ? 205  LYS B CD  1 
ATOM   4235 C CE  . LYS B 1 190 ? 99.131  73.136 28.836  1.00 44.61  ? 205  LYS B CE  1 
ATOM   4236 N NZ  . LYS B 1 190 ? 99.952  74.135 28.099  1.00 40.04  ? 205  LYS B NZ  1 
ATOM   4237 N N   . GLN B 1 191 ? 97.060  68.961 31.043  1.00 53.43  ? 206  GLN B N   1 
ATOM   4238 C CA  . GLN B 1 191 ? 96.094  68.419 30.123  1.00 55.10  ? 206  GLN B CA  1 
ATOM   4239 C C   . GLN B 1 191 ? 96.277  69.181 28.831  1.00 53.31  ? 206  GLN B C   1 
ATOM   4240 O O   . GLN B 1 191 ? 96.014  70.376 28.757  1.00 53.83  ? 206  GLN B O   1 
ATOM   4241 C CB  . GLN B 1 191 ? 94.679  68.596 30.620  1.00 58.73  ? 206  GLN B CB  1 
ATOM   4242 C CG  . GLN B 1 191 ? 93.692  68.082 29.608  1.00 65.49  ? 206  GLN B CG  1 
ATOM   4243 C CD  . GLN B 1 191 ? 92.323  67.971 30.186  1.00 68.87  ? 206  GLN B CD  1 
ATOM   4244 O OE1 . GLN B 1 191 ? 92.131  67.324 31.224  1.00 71.11  ? 206  GLN B OE1 1 
ATOM   4245 N NE2 . GLN B 1 191 ? 91.348  68.601 29.531  1.00 68.49  ? 206  GLN B NE2 1 
ATOM   4246 N N   . LEU B 1 192 ? 96.759  68.477 27.821  1.00 52.66  ? 207  LEU B N   1 
ATOM   4247 C CA  . LEU B 1 192 ? 97.002  69.064 26.517  1.00 51.47  ? 207  LEU B CA  1 
ATOM   4248 C C   . LEU B 1 192 ? 95.719  69.406 25.760  1.00 50.00  ? 207  LEU B C   1 
ATOM   4249 O O   . LEU B 1 192 ? 94.703  68.710 25.862  1.00 47.96  ? 207  LEU B O   1 
ATOM   4250 C CB  . LEU B 1 192 ? 97.864  68.106 25.685  1.00 48.98  ? 207  LEU B CB  1 
ATOM   4251 C CG  . LEU B 1 192 ? 99.386  68.177 25.846  1.00 50.77  ? 207  LEU B CG  1 
ATOM   4252 C CD1 . LEU B 1 192 ? 99.772  68.682 27.227  1.00 47.84  ? 207  LEU B CD1 1 
ATOM   4253 C CD2 . LEU B 1 192 ? 99.967  66.800 25.557  1.00 46.76  ? 207  LEU B CD2 1 
ATOM   4254 N N   . VAL B 1 193 ? 95.775  70.498 25.010  1.00 48.92  ? 208  VAL B N   1 
ATOM   4255 C CA  . VAL B 1 193 ? 94.647  70.931 24.212  1.00 48.64  ? 208  VAL B CA  1 
ATOM   4256 C C   . VAL B 1 193 ? 95.218  71.304 22.869  1.00 49.62  ? 208  VAL B C   1 
ATOM   4257 O O   . VAL B 1 193 ? 96.091  72.164 22.784  1.00 49.75  ? 208  VAL B O   1 
ATOM   4258 C CB  . VAL B 1 193 ? 93.959  72.161 24.805  1.00 49.86  ? 208  VAL B CB  1 
ATOM   4259 C CG1 . VAL B 1 193 ? 92.958  72.705 23.811  1.00 47.31  ? 208  VAL B CG1 1 
ATOM   4260 C CG2 . VAL B 1 193 ? 93.262  71.797 26.108  1.00 45.10  ? 208  VAL B CG2 1 
ATOM   4261 N N   . ARG B 1 194 ? 94.748  70.639 21.822  1.00 53.22  ? 209  ARG B N   1 
ATOM   4262 C CA  . ARG B 1 194 ? 95.238  70.937 20.490  1.00 56.30  ? 209  ARG B CA  1 
ATOM   4263 C C   . ARG B 1 194 ? 95.029  72.424 20.259  1.00 55.26  ? 209  ARG B C   1 
ATOM   4264 O O   . ARG B 1 194 ? 93.956  72.962 20.539  1.00 54.98  ? 209  ARG B O   1 
ATOM   4265 C CB  . ARG B 1 194 ? 94.499  70.092 19.445  1.00 60.85  ? 209  ARG B CB  1 
ATOM   4266 C CG  . ARG B 1 194 ? 94.935  68.629 19.463  1.00 65.08  ? 209  ARG B CG  1 
ATOM   4267 C CD  . ARG B 1 194 ? 94.286  67.787 18.372  1.00 71.20  ? 209  ARG B CD  1 
ATOM   4268 N NE  . ARG B 1 194 ? 92.916  67.380 18.687  1.00 76.57  ? 209  ARG B NE  1 
ATOM   4269 C CZ  . ARG B 1 194 ? 92.238  66.467 17.995  1.00 81.92  ? 209  ARG B CZ  1 
ATOM   4270 N NH1 . ARG B 1 194 ? 92.805  65.867 16.954  1.00 82.74  ? 209  ARG B NH1 1 
ATOM   4271 N NH2 . ARG B 1 194 ? 90.993  66.158 18.335  1.00 82.53  ? 209  ARG B NH2 1 
ATOM   4272 N N   . GLY B 1 195 ? 96.077  73.093 19.790  1.00 54.48  ? 210  GLY B N   1 
ATOM   4273 C CA  . GLY B 1 195 ? 95.992  74.520 19.544  1.00 58.27  ? 210  GLY B CA  1 
ATOM   4274 C C   . GLY B 1 195 ? 96.737  75.325 20.592  1.00 59.70  ? 210  GLY B C   1 
ATOM   4275 O O   . GLY B 1 195 ? 97.553  76.184 20.254  1.00 60.44  ? 210  GLY B O   1 
ATOM   4276 N N   . GLU B 1 196 ? 96.452  75.053 21.864  1.00 59.16  ? 211  GLU B N   1 
ATOM   4277 C CA  . GLU B 1 196 ? 97.100  75.747 22.974  1.00 57.61  ? 211  GLU B CA  1 
ATOM   4278 C C   . GLU B 1 196 ? 98.530  75.238 23.088  1.00 53.39  ? 211  GLU B C   1 
ATOM   4279 O O   . GLU B 1 196 ? 98.757  74.057 23.350  1.00 51.69  ? 211  GLU B O   1 
ATOM   4280 C CB  . GLU B 1 196 ? 96.330  75.486 24.265  1.00 60.10  ? 211  GLU B CB  1 
ATOM   4281 C CG  . GLU B 1 196 ? 94.856  75.864 24.153  1.00 65.50  ? 211  GLU B CG  1 
ATOM   4282 C CD  . GLU B 1 196 ? 94.059  75.529 25.404  1.00 70.76  ? 211  GLU B CD  1 
ATOM   4283 O OE1 . GLU B 1 196 ? 92.835  75.813 25.426  1.00 71.74  ? 211  GLU B OE1 1 
ATOM   4284 O OE2 . GLU B 1 196 ? 94.657  74.979 26.363  1.00 73.62  ? 211  GLU B OE2 1 
ATOM   4285 N N   . PRO B 1 197 ? 99.513  76.133 22.890  1.00 50.40  ? 212  PRO B N   1 
ATOM   4286 C CA  . PRO B 1 197 ? 100.946 75.822 22.950  1.00 48.24  ? 212  PRO B CA  1 
ATOM   4287 C C   . PRO B 1 197 ? 101.437 75.291 24.292  1.00 47.17  ? 212  PRO B C   1 
ATOM   4288 O O   . PRO B 1 197 ? 100.899 75.631 25.348  1.00 46.45  ? 212  PRO B O   1 
ATOM   4289 C CB  . PRO B 1 197 ? 101.602 77.148 22.572  1.00 46.64  ? 212  PRO B CB  1 
ATOM   4290 C CG  . PRO B 1 197 ? 100.655 78.143 23.147  1.00 44.48  ? 212  PRO B CG  1 
ATOM   4291 C CD  . PRO B 1 197 ? 99.304  77.585 22.756  1.00 47.98  ? 212  PRO B CD  1 
ATOM   4292 N N   . ASN B 1 198 ? 102.467 74.453 24.228  1.00 45.47  ? 213  ASN B N   1 
ATOM   4293 C CA  . ASN B 1 198 ? 103.048 73.850 25.410  1.00 41.21  ? 213  ASN B CA  1 
ATOM   4294 C C   . ASN B 1 198 ? 104.544 74.123 25.406  1.00 39.58  ? 213  ASN B C   1 
ATOM   4295 O O   . ASN B 1 198 ? 105.176 74.144 24.356  1.00 40.55  ? 213  ASN B O   1 
ATOM   4296 C CB  . ASN B 1 198 ? 102.776 72.350 25.393  1.00 43.27  ? 213  ASN B CB  1 
ATOM   4297 C CG  . ASN B 1 198 ? 101.293 72.023 25.225  1.00 45.39  ? 213  ASN B CG  1 
ATOM   4298 O OD1 . ASN B 1 198 ? 100.474 72.287 26.116  1.00 43.84  ? 213  ASN B OD1 1 
ATOM   4299 N ND2 . ASN B 1 198 ? 100.942 71.448 24.075  1.00 40.51  ? 213  ASN B ND2 1 
ATOM   4300 N N   . VAL B 1 199 ? 105.107 74.340 26.585  1.00 35.31  ? 214  VAL B N   1 
ATOM   4301 C CA  . VAL B 1 199 ? 106.531 74.627 26.719  1.00 37.12  ? 214  VAL B CA  1 
ATOM   4302 C C   . VAL B 1 199 ? 107.436 73.513 26.139  1.00 39.22  ? 214  VAL B C   1 
ATOM   4303 O O   . VAL B 1 199 ? 107.145 72.325 26.278  1.00 41.75  ? 214  VAL B O   1 
ATOM   4304 C CB  . VAL B 1 199 ? 106.865 74.871 28.211  1.00 33.79  ? 214  VAL B CB  1 
ATOM   4305 C CG1 . VAL B 1 199 ? 106.624 73.600 29.006  1.00 34.55  ? 214  VAL B CG1 1 
ATOM   4306 C CG2 . VAL B 1 199 ? 108.291 75.352 28.367  1.00 36.49  ? 214  VAL B CG2 1 
ATOM   4307 N N   . SER B 1 200 ? 108.534 73.889 25.492  1.00 39.47  ? 215  SER B N   1 
ATOM   4308 C CA  . SER B 1 200 ? 109.414 72.893 24.909  1.00 42.23  ? 215  SER B CA  1 
ATOM   4309 C C   . SER B 1 200 ? 110.387 72.283 25.891  1.00 43.95  ? 215  SER B C   1 
ATOM   4310 O O   . SER B 1 200 ? 110.534 71.064 25.960  1.00 44.46  ? 215  SER B O   1 
ATOM   4311 C CB  . SER B 1 200 ? 110.186 73.486 23.741  1.00 42.11  ? 215  SER B CB  1 
ATOM   4312 O OG  . SER B 1 200 ? 109.388 73.470 22.574  1.00 48.70  ? 215  SER B OG  1 
HETATM 4313 N N   . PTR B 1 201 ? 111.079 73.125 26.640  1.00 42.86  ? 216  PTR B N   1 
HETATM 4314 C CA  . PTR B 1 201 ? 112.028 72.613 27.619  1.00 43.76  ? 216  PTR B CA  1 
HETATM 4315 C C   . PTR B 1 201 ? 111.200 71.956 28.724  1.00 45.32  ? 216  PTR B C   1 
HETATM 4316 O O   . PTR B 1 201 ? 110.704 72.625 29.630  1.00 44.12  ? 216  PTR B O   1 
HETATM 4317 C CB  . PTR B 1 201 ? 112.864 73.755 28.196  1.00 42.68  ? 216  PTR B CB  1 
HETATM 4318 C CG  . PTR B 1 201 ? 114.117 73.311 28.908  1.00 46.82  ? 216  PTR B CG  1 
HETATM 4319 C CD1 . PTR B 1 201 ? 114.205 73.366 30.296  1.00 46.37  ? 216  PTR B CD1 1 
HETATM 4320 C CD2 . PTR B 1 201 ? 115.216 72.824 28.194  1.00 45.54  ? 216  PTR B CD2 1 
HETATM 4321 C CE1 . PTR B 1 201 ? 115.358 72.945 30.966  1.00 47.46  ? 216  PTR B CE1 1 
HETATM 4322 C CE2 . PTR B 1 201 ? 116.378 72.400 28.852  1.00 48.14  ? 216  PTR B CE2 1 
HETATM 4323 C CZ  . PTR B 1 201 ? 116.445 72.463 30.244  1.00 49.06  ? 216  PTR B CZ  1 
HETATM 4324 O OH  . PTR B 1 201 ? 117.617 72.075 30.938  1.00 54.80  ? 216  PTR B OH  1 
HETATM 4325 P P   . PTR B 1 201 ? 117.950 70.567 31.168  1.00 55.94  ? 216  PTR B P   1 
HETATM 4326 O O1P . PTR B 1 201 ? 116.758 69.777 31.606  1.00 53.89  ? 216  PTR B O1P 1 
HETATM 4327 O O2P . PTR B 1 201 ? 119.020 70.536 32.209  1.00 57.80  ? 216  PTR B O2P 1 
HETATM 4328 O O3P . PTR B 1 201 ? 118.547 70.042 29.891  1.00 56.08  ? 216  PTR B O3P 1 
ATOM   4329 N N   . ILE B 1 202 ? 111.046 70.642 28.640  1.00 43.76  ? 217  ILE B N   1 
ATOM   4330 C CA  . ILE B 1 202 ? 110.258 69.912 29.617  1.00 42.32  ? 217  ILE B CA  1 
ATOM   4331 C C   . ILE B 1 202 ? 110.864 68.506 29.697  1.00 42.76  ? 217  ILE B C   1 
ATOM   4332 O O   . ILE B 1 202 ? 111.620 68.118 28.801  1.00 45.57  ? 217  ILE B O   1 
ATOM   4333 C CB  . ILE B 1 202 ? 108.773 69.899 29.158  1.00 40.26  ? 217  ILE B CB  1 
ATOM   4334 C CG1 . ILE B 1 202 ? 107.872 69.329 30.255  1.00 40.00  ? 217  ILE B CG1 1 
ATOM   4335 C CG2 . ILE B 1 202 ? 108.641 69.146 27.836  1.00 36.57  ? 217  ILE B CG2 1 
ATOM   4336 C CD1 . ILE B 1 202 ? 107.549 70.305 31.365  1.00 37.11  ? 217  ILE B CD1 1 
ATOM   4337 N N   . CYS B 1 203 ? 110.553 67.761 30.761  1.00 43.56  ? 218  CYS B N   1 
ATOM   4338 C CA  . CYS B 1 203 ? 111.094 66.408 30.979  1.00 45.18  ? 218  CYS B CA  1 
ATOM   4339 C C   . CYS B 1 203 ? 112.556 66.456 31.403  1.00 41.77  ? 218  CYS B C   1 
ATOM   4340 O O   . CYS B 1 203 ? 113.243 67.448 31.179  1.00 37.16  ? 218  CYS B O   1 
ATOM   4341 C CB  . CYS B 1 203 ? 111.025 65.551 29.713  1.00 50.11  ? 218  CYS B CB  1 
ATOM   4342 S SG  . CYS B 1 203 ? 109.402 65.052 29.195  1.00 62.99  ? 218  CYS B SG  1 
ATOM   4343 N N   . SER B 1 204 ? 113.035 65.376 32.008  1.00 40.58  ? 219  SER B N   1 
ATOM   4344 C CA  . SER B 1 204 ? 114.430 65.316 32.408  1.00 40.48  ? 219  SER B CA  1 
ATOM   4345 C C   . SER B 1 204 ? 115.198 65.193 31.110  1.00 41.12  ? 219  SER B C   1 
ATOM   4346 O O   . SER B 1 204 ? 114.742 64.529 30.184  1.00 40.48  ? 219  SER B O   1 
ATOM   4347 C CB  . SER B 1 204 ? 114.687 64.097 33.278  1.00 41.46  ? 219  SER B CB  1 
ATOM   4348 O OG  . SER B 1 204 ? 113.781 64.083 34.365  1.00 50.63  ? 219  SER B OG  1 
ATOM   4349 N N   . ARG B 1 205 ? 116.360 65.829 31.040  1.00 41.59  ? 220  ARG B N   1 
ATOM   4350 C CA  . ARG B 1 205 ? 117.154 65.800 29.824  1.00 42.09  ? 220  ARG B CA  1 
ATOM   4351 C C   . ARG B 1 205 ? 117.291 64.431 29.134  1.00 42.70  ? 220  ARG B C   1 
ATOM   4352 O O   . ARG B 1 205 ? 117.035 64.313 27.934  1.00 43.83  ? 220  ARG B O   1 
ATOM   4353 C CB  . ARG B 1 205 ? 118.539 66.376 30.101  1.00 42.71  ? 220  ARG B CB  1 
ATOM   4354 C CG  . ARG B 1 205 ? 119.300 66.724 28.840  1.00 44.67  ? 220  ARG B CG  1 
ATOM   4355 C CD  . ARG B 1 205 ? 120.715 67.082 29.173  1.00 49.31  ? 220  ARG B CD  1 
ATOM   4356 N NE  . ARG B 1 205 ? 120.783 68.192 30.110  1.00 49.91  ? 220  ARG B NE  1 
ATOM   4357 C CZ  . ARG B 1 205 ? 121.687 68.283 31.079  1.00 54.83  ? 220  ARG B CZ  1 
ATOM   4358 N NH1 . ARG B 1 205 ? 122.592 67.327 31.237  1.00 54.96  ? 220  ARG B NH1 1 
ATOM   4359 N NH2 . ARG B 1 205 ? 121.697 69.333 31.889  1.00 59.92  ? 220  ARG B NH2 1 
ATOM   4360 N N   . TYR B 1 206 ? 117.678 63.399 29.879  1.00 41.52  ? 221  TYR B N   1 
ATOM   4361 C CA  . TYR B 1 206 ? 117.874 62.057 29.313  1.00 40.34  ? 221  TYR B CA  1 
ATOM   4362 C C   . TYR B 1 206 ? 116.649 61.375 28.711  1.00 38.55  ? 221  TYR B C   1 
ATOM   4363 O O   . TYR B 1 206 ? 116.780 60.487 27.874  1.00 38.76  ? 221  TYR B O   1 
ATOM   4364 C CB  . TYR B 1 206 ? 118.464 61.127 30.375  1.00 40.15  ? 221  TYR B CB  1 
ATOM   4365 C CG  . TYR B 1 206 ? 119.826 61.534 30.889  1.00 38.43  ? 221  TYR B CG  1 
ATOM   4366 C CD1 . TYR B 1 206 ? 120.459 60.804 31.895  1.00 40.26  ? 221  TYR B CD1 1 
ATOM   4367 C CD2 . TYR B 1 206 ? 120.485 62.648 30.373  1.00 39.25  ? 221  TYR B CD2 1 
ATOM   4368 C CE1 . TYR B 1 206 ? 121.719 61.174 32.375  1.00 38.55  ? 221  TYR B CE1 1 
ATOM   4369 C CE2 . TYR B 1 206 ? 121.738 63.025 30.843  1.00 41.72  ? 221  TYR B CE2 1 
ATOM   4370 C CZ  . TYR B 1 206 ? 122.349 62.284 31.842  1.00 42.16  ? 221  TYR B CZ  1 
ATOM   4371 O OH  . TYR B 1 206 ? 123.596 62.663 32.290  1.00 51.60  ? 221  TYR B OH  1 
ATOM   4372 N N   . TYR B 1 207 ? 115.461 61.793 29.129  1.00 39.26  ? 222  TYR B N   1 
ATOM   4373 C CA  . TYR B 1 207 ? 114.226 61.183 28.649  1.00 35.51  ? 222  TYR B CA  1 
ATOM   4374 C C   . TYR B 1 207 ? 113.367 62.083 27.750  1.00 35.51  ? 222  TYR B C   1 
ATOM   4375 O O   . TYR B 1 207 ? 112.233 61.726 27.405  1.00 36.27  ? 222  TYR B O   1 
ATOM   4376 C CB  . TYR B 1 207 ? 113.415 60.710 29.862  1.00 34.70  ? 222  TYR B CB  1 
ATOM   4377 C CG  . TYR B 1 207 ? 114.258 59.965 30.879  1.00 35.91  ? 222  TYR B CG  1 
ATOM   4378 C CD1 . TYR B 1 207 ? 115.071 60.655 31.781  1.00 36.92  ? 222  TYR B CD1 1 
ATOM   4379 C CD2 . TYR B 1 207 ? 114.297 58.569 30.893  1.00 33.05  ? 222  TYR B CD2 1 
ATOM   4380 C CE1 . TYR B 1 207 ? 115.905 59.981 32.665  1.00 33.49  ? 222  TYR B CE1 1 
ATOM   4381 C CE2 . TYR B 1 207 ? 115.128 57.882 31.772  1.00 34.82  ? 222  TYR B CE2 1 
ATOM   4382 C CZ  . TYR B 1 207 ? 115.930 58.595 32.653  1.00 38.34  ? 222  TYR B CZ  1 
ATOM   4383 O OH  . TYR B 1 207 ? 116.766 57.920 33.515  1.00 41.65  ? 222  TYR B OH  1 
ATOM   4384 N N   . ARG B 1 208 ? 113.930 63.226 27.358  1.00 34.45  ? 223  ARG B N   1 
ATOM   4385 C CA  . ARG B 1 208 ? 113.251 64.223 26.523  1.00 34.59  ? 223  ARG B CA  1 
ATOM   4386 C C   . ARG B 1 208 ? 113.131 63.859 25.033  1.00 34.87  ? 223  ARG B C   1 
ATOM   4387 O O   . ARG B 1 208 ? 114.142 63.634 24.365  1.00 35.97  ? 223  ARG B O   1 
ATOM   4388 C CB  . ARG B 1 208 ? 113.982 65.568 26.670  1.00 36.62  ? 223  ARG B CB  1 
ATOM   4389 C CG  . ARG B 1 208 ? 113.305 66.772 26.009  1.00 40.18  ? 223  ARG B CG  1 
ATOM   4390 C CD  . ARG B 1 208 ? 114.030 68.054 26.377  1.00 36.13  ? 223  ARG B CD  1 
ATOM   4391 N NE  . ARG B 1 208 ? 114.080 68.227 27.825  1.00 36.97  ? 223  ARG B NE  1 
ATOM   4392 C CZ  . ARG B 1 208 ? 115.108 68.744 28.497  1.00 35.40  ? 223  ARG B CZ  1 
ATOM   4393 N NH1 . ARG B 1 208 ? 116.199 69.156 27.864  1.00 32.58  ? 223  ARG B NH1 1 
ATOM   4394 N NH2 . ARG B 1 208 ? 115.050 68.835 29.818  1.00 32.88  ? 223  ARG B NH2 1 
ATOM   4395 N N   . ALA B 1 209 ? 111.896 63.825 24.518  1.00 34.41  ? 224  ALA B N   1 
ATOM   4396 C CA  . ALA B 1 209 ? 111.622 63.499 23.113  1.00 34.10  ? 224  ALA B CA  1 
ATOM   4397 C C   . ALA B 1 209 ? 112.344 64.463 22.167  1.00 35.26  ? 224  ALA B C   1 
ATOM   4398 O O   . ALA B 1 209 ? 112.572 65.609 22.517  1.00 36.17  ? 224  ALA B O   1 
ATOM   4399 C CB  . ALA B 1 209 ? 110.132 63.542 22.861  1.00 35.50  ? 224  ALA B CB  1 
ATOM   4400 N N   . PRO B 1 210 ? 112.687 64.018 20.942  1.00 37.71  ? 225  PRO B N   1 
ATOM   4401 C CA  . PRO B 1 210 ? 113.392 64.888 19.992  1.00 37.20  ? 225  PRO B CA  1 
ATOM   4402 C C   . PRO B 1 210 ? 112.661 66.182 19.648  1.00 36.32  ? 225  PRO B C   1 
ATOM   4403 O O   . PRO B 1 210 ? 113.269 67.249 19.617  1.00 37.82  ? 225  PRO B O   1 
ATOM   4404 C CB  . PRO B 1 210 ? 113.559 64.001 18.753  1.00 37.22  ? 225  PRO B CB  1 
ATOM   4405 C CG  . PRO B 1 210 ? 113.311 62.614 19.245  1.00 39.38  ? 225  PRO B CG  1 
ATOM   4406 C CD  . PRO B 1 210 ? 112.240 62.793 20.262  1.00 35.84  ? 225  PRO B CD  1 
ATOM   4407 N N   . GLU B 1 211 ? 111.362 66.088 19.378  1.00 36.89  ? 226  GLU B N   1 
ATOM   4408 C CA  . GLU B 1 211 ? 110.599 67.274 19.008  1.00 40.72  ? 226  GLU B CA  1 
ATOM   4409 C C   . GLU B 1 211 ? 110.761 68.405 20.022  1.00 40.69  ? 226  GLU B C   1 
ATOM   4410 O O   . GLU B 1 211 ? 110.818 69.576 19.648  1.00 42.34  ? 226  GLU B O   1 
ATOM   4411 C CB  . GLU B 1 211 ? 109.111 66.936 18.810  1.00 40.47  ? 226  GLU B CB  1 
ATOM   4412 C CG  . GLU B 1 211 ? 108.424 66.319 20.003  1.00 42.12  ? 226  GLU B CG  1 
ATOM   4413 C CD  . GLU B 1 211 ? 108.462 64.809 19.970  1.00 44.31  ? 226  GLU B CD  1 
ATOM   4414 O OE1 . GLU B 1 211 ? 109.484 64.244 19.522  1.00 40.69  ? 226  GLU B OE1 1 
ATOM   4415 O OE2 . GLU B 1 211 ? 107.473 64.188 20.407  1.00 42.35  ? 226  GLU B OE2 1 
ATOM   4416 N N   . LEU B 1 212 ? 110.841 68.049 21.299  1.00 40.52  ? 227  LEU B N   1 
ATOM   4417 C CA  . LEU B 1 212 ? 111.013 69.031 22.358  1.00 39.77  ? 227  LEU B CA  1 
ATOM   4418 C C   . LEU B 1 212 ? 112.375 69.712 22.203  1.00 40.90  ? 227  LEU B C   1 
ATOM   4419 O O   . LEU B 1 212 ? 112.514 70.911 22.427  1.00 42.75  ? 227  LEU B O   1 
ATOM   4420 C CB  . LEU B 1 212 ? 110.931 68.343 23.722  1.00 37.99  ? 227  LEU B CB  1 
ATOM   4421 C CG  . LEU B 1 212 ? 109.624 67.628 24.076  1.00 37.91  ? 227  LEU B CG  1 
ATOM   4422 C CD1 . LEU B 1 212 ? 109.824 66.704 25.260  1.00 33.78  ? 227  LEU B CD1 1 
ATOM   4423 C CD2 . LEU B 1 212 ? 108.559 68.662 24.382  1.00 38.94  ? 227  LEU B CD2 1 
ATOM   4424 N N   . ILE B 1 213 ? 113.383 68.938 21.823  1.00 40.45  ? 228  ILE B N   1 
ATOM   4425 C CA  . ILE B 1 213 ? 114.720 69.473 21.630  1.00 42.47  ? 228  ILE B CA  1 
ATOM   4426 C C   . ILE B 1 213 ? 114.717 70.362 20.392  1.00 46.85  ? 228  ILE B C   1 
ATOM   4427 O O   . ILE B 1 213 ? 115.593 71.206 20.213  1.00 49.47  ? 228  ILE B O   1 
ATOM   4428 C CB  . ILE B 1 213 ? 115.735 68.340 21.439  1.00 42.84  ? 228  ILE B CB  1 
ATOM   4429 C CG1 . ILE B 1 213 ? 115.713 67.434 22.669  1.00 39.22  ? 228  ILE B CG1 1 
ATOM   4430 C CG2 . ILE B 1 213 ? 117.126 68.907 21.192  1.00 45.99  ? 228  ILE B CG2 1 
ATOM   4431 C CD1 . ILE B 1 213 ? 116.703 66.299 22.616  1.00 36.08  ? 228  ILE B CD1 1 
ATOM   4432 N N   . PHE B 1 214 ? 113.716 70.165 19.539  1.00 48.63  ? 229  PHE B N   1 
ATOM   4433 C CA  . PHE B 1 214 ? 113.577 70.949 18.322  1.00 47.74  ? 229  PHE B CA  1 
ATOM   4434 C C   . PHE B 1 214 ? 112.616 72.122 18.471  1.00 47.27  ? 229  PHE B C   1 
ATOM   4435 O O   . PHE B 1 214 ? 112.301 72.785 17.482  1.00 48.70  ? 229  PHE B O   1 
ATOM   4436 C CB  . PHE B 1 214 ? 113.104 70.074 17.164  1.00 50.83  ? 229  PHE B CB  1 
ATOM   4437 C CG  . PHE B 1 214 ? 114.218 69.401 16.426  1.00 51.42  ? 229  PHE B CG  1 
ATOM   4438 C CD1 . PHE B 1 214 ? 114.653 68.136 16.794  1.00 53.03  ? 229  PHE B CD1 1 
ATOM   4439 C CD2 . PHE B 1 214 ? 114.844 70.043 15.357  1.00 50.11  ? 229  PHE B CD2 1 
ATOM   4440 C CE1 . PHE B 1 214 ? 115.699 67.517 16.103  1.00 53.36  ? 229  PHE B CE1 1 
ATOM   4441 C CE2 . PHE B 1 214 ? 115.891 69.434 14.658  1.00 50.83  ? 229  PHE B CE2 1 
ATOM   4442 C CZ  . PHE B 1 214 ? 116.318 68.172 15.031  1.00 50.83  ? 229  PHE B CZ  1 
ATOM   4443 N N   . GLY B 1 215 ? 112.135 72.365 19.689  1.00 43.30  ? 230  GLY B N   1 
ATOM   4444 C CA  . GLY B 1 215 ? 111.234 73.479 19.915  1.00 39.18  ? 230  GLY B CA  1 
ATOM   4445 C C   . GLY B 1 215 ? 109.755 73.240 19.677  1.00 41.18  ? 230  GLY B C   1 
ATOM   4446 O O   . GLY B 1 215 ? 108.978 74.184 19.647  1.00 41.55  ? 230  GLY B O   1 
ATOM   4447 N N   . ALA B 1 216 ? 109.341 71.994 19.504  1.00 42.28  ? 231  ALA B N   1 
ATOM   4448 C CA  . ALA B 1 216 ? 107.924 71.726 19.296  1.00 42.14  ? 231  ALA B CA  1 
ATOM   4449 C C   . ALA B 1 216 ? 107.149 72.236 20.499  1.00 42.84  ? 231  ALA B C   1 
ATOM   4450 O O   . ALA B 1 216 ? 107.511 71.972 21.646  1.00 42.65  ? 231  ALA B O   1 
ATOM   4451 C CB  . ALA B 1 216 ? 107.687 70.240 19.135  1.00 40.58  ? 231  ALA B CB  1 
ATOM   4452 N N   . THR B 1 217 ? 106.084 72.977 20.241  1.00 41.50  ? 232  THR B N   1 
ATOM   4453 C CA  . THR B 1 217 ? 105.257 73.490 21.322  1.00 40.15  ? 232  THR B CA  1 
ATOM   4454 C C   . THR B 1 217 ? 103.868 72.989 21.027  1.00 40.78  ? 232  THR B C   1 
ATOM   4455 O O   . THR B 1 217 ? 102.904 73.301 21.721  1.00 43.35  ? 232  THR B O   1 
ATOM   4456 C CB  . THR B 1 217 ? 105.217 75.004 21.326  1.00 40.34  ? 232  THR B CB  1 
ATOM   4457 O OG1 . THR B 1 217 ? 104.596 75.455 20.117  1.00 42.67  ? 232  THR B OG1 1 
ATOM   4458 C CG2 . THR B 1 217 ? 106.626 75.567 21.415  1.00 36.60  ? 232  THR B CG2 1 
ATOM   4459 N N   . ASP B 1 218 ? 103.785 72.201 19.969  1.00 40.66  ? 233  ASP B N   1 
ATOM   4460 C CA  . ASP B 1 218 ? 102.533 71.628 19.522  1.00 43.30  ? 233  ASP B CA  1 
ATOM   4461 C C   . ASP B 1 218 ? 102.642 70.121 19.630  1.00 44.90  ? 233  ASP B C   1 
ATOM   4462 O O   . ASP B 1 218 ? 101.961 69.394 18.916  1.00 47.03  ? 233  ASP B O   1 
ATOM   4463 C CB  . ASP B 1 218 ? 102.295 72.010 18.072  1.00 45.30  ? 233  ASP B CB  1 
ATOM   4464 C CG  . ASP B 1 218 ? 103.417 71.530 17.151  1.00 50.39  ? 233  ASP B CG  1 
ATOM   4465 O OD1 . ASP B 1 218 ? 104.615 71.654 17.519  1.00 54.34  ? 233  ASP B OD1 1 
ATOM   4466 O OD2 . ASP B 1 218 ? 103.094 71.039 16.046  1.00 54.28  ? 233  ASP B OD2 1 
ATOM   4467 N N   . TYR B 1 219 ? 103.510 69.655 20.521  1.00 44.13  ? 234  TYR B N   1 
ATOM   4468 C CA  . TYR B 1 219 ? 103.707 68.224 20.719  1.00 39.26  ? 234  TYR B CA  1 
ATOM   4469 C C   . TYR B 1 219 ? 102.519 67.561 21.405  1.00 38.73  ? 234  TYR B C   1 
ATOM   4470 O O   . TYR B 1 219 ? 101.703 68.222 22.051  1.00 38.15  ? 234  TYR B O   1 
ATOM   4471 C CB  . TYR B 1 219 ? 104.967 67.998 21.542  1.00 40.84  ? 234  TYR B CB  1 
ATOM   4472 C CG  . TYR B 1 219 ? 104.975 68.737 22.863  1.00 41.21  ? 234  TYR B CG  1 
ATOM   4473 C CD1 . TYR B 1 219 ? 104.294 68.230 23.969  1.00 37.49  ? 234  TYR B CD1 1 
ATOM   4474 C CD2 . TYR B 1 219 ? 105.705 69.917 23.021  1.00 39.81  ? 234  TYR B CD2 1 
ATOM   4475 C CE1 . TYR B 1 219 ? 104.345 68.870 25.199  1.00 36.50  ? 234  TYR B CE1 1 
ATOM   4476 C CE2 . TYR B 1 219 ? 105.763 70.565 24.255  1.00 38.97  ? 234  TYR B CE2 1 
ATOM   4477 C CZ  . TYR B 1 219 ? 105.081 70.033 25.336  1.00 35.66  ? 234  TYR B CZ  1 
ATOM   4478 O OH  . TYR B 1 219 ? 105.128 70.653 26.563  1.00 39.59  ? 234  TYR B OH  1 
ATOM   4479 N N   . THR B 1 220 ? 102.421 66.246 21.256  1.00 38.16  ? 235  THR B N   1 
ATOM   4480 C CA  . THR B 1 220 ? 101.331 65.500 21.870  1.00 39.34  ? 235  THR B CA  1 
ATOM   4481 C C   . THR B 1 220 ? 101.831 64.632 23.011  1.00 39.16  ? 235  THR B C   1 
ATOM   4482 O O   . THR B 1 220 ? 103.022 64.661 23.367  1.00 37.98  ? 235  THR B O   1 
ATOM   4483 C CB  . THR B 1 220 ? 100.601 64.605 20.850  1.00 39.45  ? 235  THR B CB  1 
ATOM   4484 O OG1 . THR B 1 220 ? 101.552 63.785 20.160  1.00 40.81  ? 235  THR B OG1 1 
ATOM   4485 C CG2 . THR B 1 220 ? 99.844  65.460 19.849  1.00 29.63  ? 235  THR B CG2 1 
ATOM   4486 N N   . SER B 1 221 ? 100.913 63.859 23.582  1.00 38.48  ? 236  SER B N   1 
ATOM   4487 C CA  . SER B 1 221 ? 101.249 62.996 24.700  1.00 38.43  ? 236  SER B CA  1 
ATOM   4488 C C   . SER B 1 221 ? 102.117 61.817 24.287  1.00 38.27  ? 236  SER B C   1 
ATOM   4489 O O   . SER B 1 221 ? 102.388 60.932 25.095  1.00 37.76  ? 236  SER B O   1 
ATOM   4490 C CB  . SER B 1 221 ? 99.980  62.509 25.378  1.00 33.21  ? 236  SER B CB  1 
ATOM   4491 O OG  . SER B 1 221 ? 99.159  61.875 24.426  1.00 42.68  ? 236  SER B OG  1 
ATOM   4492 N N   . SER B 1 222 ? 102.560 61.811 23.031  1.00 35.90  ? 237  SER B N   1 
ATOM   4493 C CA  . SER B 1 222 ? 103.434 60.749 22.556  1.00 36.65  ? 237  SER B CA  1 
ATOM   4494 C C   . SER B 1 222 ? 104.856 61.023 23.052  1.00 37.15  ? 237  SER B C   1 
ATOM   4495 O O   . SER B 1 222 ? 105.752 60.207 22.840  1.00 40.76  ? 237  SER B O   1 
ATOM   4496 C CB  . SER B 1 222 ? 103.413 60.637 21.023  1.00 37.71  ? 237  SER B CB  1 
ATOM   4497 O OG  . SER B 1 222 ? 104.091 61.707 20.384  1.00 42.95  ? 237  SER B OG  1 
ATOM   4498 N N   . ILE B 1 223 ? 105.064 62.168 23.707  1.00 34.55  ? 238  ILE B N   1 
ATOM   4499 C CA  . ILE B 1 223 ? 106.380 62.487 24.260  1.00 35.24  ? 238  ILE B CA  1 
ATOM   4500 C C   . ILE B 1 223 ? 106.564 61.570 25.464  1.00 34.97  ? 238  ILE B C   1 
ATOM   4501 O O   . ILE B 1 223 ? 107.685 61.275 25.869  1.00 36.21  ? 238  ILE B O   1 
ATOM   4502 C CB  . ILE B 1 223 ? 106.501 63.954 24.751  1.00 33.87  ? 238  ILE B CB  1 
ATOM   4503 C CG1 . ILE B 1 223 ? 105.530 64.212 25.903  1.00 34.60  ? 238  ILE B CG1 1 
ATOM   4504 C CG2 . ILE B 1 223 ? 106.221 64.902 23.612  1.00 40.88  ? 238  ILE B CG2 1 
ATOM   4505 C CD1 . ILE B 1 223 ? 105.719 65.546 26.569  1.00 29.33  ? 238  ILE B CD1 1 
ATOM   4506 N N   . ASP B 1 224 ? 105.452 61.131 26.043  1.00 33.17  ? 239  ASP B N   1 
ATOM   4507 C CA  . ASP B 1 224 ? 105.517 60.229 27.171  1.00 34.69  ? 239  ASP B CA  1 
ATOM   4508 C C   . ASP B 1 224 ? 105.963 58.846 26.689  1.00 37.73  ? 239  ASP B C   1 
ATOM   4509 O O   . ASP B 1 224 ? 106.690 58.144 27.391  1.00 40.32  ? 239  ASP B O   1 
ATOM   4510 C CB  . ASP B 1 224 ? 104.157 60.126 27.855  1.00 34.29  ? 239  ASP B CB  1 
ATOM   4511 C CG  . ASP B 1 224 ? 103.889 61.276 28.804  1.00 35.01  ? 239  ASP B CG  1 
ATOM   4512 O OD1 . ASP B 1 224 ? 104.839 62.035 29.104  1.00 29.93  ? 239  ASP B OD1 1 
ATOM   4513 O OD2 . ASP B 1 224 ? 102.729 61.408 29.260  1.00 32.56  ? 239  ASP B OD2 1 
ATOM   4514 N N   . VAL B 1 225 ? 105.534 58.453 25.490  1.00 34.84  ? 240  VAL B N   1 
ATOM   4515 C CA  . VAL B 1 225 ? 105.916 57.155 24.943  1.00 31.24  ? 240  VAL B CA  1 
ATOM   4516 C C   . VAL B 1 225 ? 107.428 57.121 24.672  1.00 34.92  ? 240  VAL B C   1 
ATOM   4517 O O   . VAL B 1 225 ? 108.094 56.114 24.921  1.00 35.79  ? 240  VAL B O   1 
ATOM   4518 C CB  . VAL B 1 225 ? 105.130 56.852 23.655  1.00 31.41  ? 240  VAL B CB  1 
ATOM   4519 C CG1 . VAL B 1 225 ? 105.752 55.683 22.916  1.00 27.54  ? 240  VAL B CG1 1 
ATOM   4520 C CG2 . VAL B 1 225 ? 103.688 56.531 24.004  1.00 24.79  ? 240  VAL B CG2 1 
ATOM   4521 N N   . TRP B 1 226 ? 107.973 58.221 24.167  1.00 32.87  ? 241  TRP B N   1 
ATOM   4522 C CA  . TRP B 1 226 ? 109.400 58.286 23.916  1.00 32.94  ? 241  TRP B CA  1 
ATOM   4523 C C   . TRP B 1 226 ? 110.133 58.016 25.212  1.00 37.02  ? 241  TRP B C   1 
ATOM   4524 O O   . TRP B 1 226 ? 111.009 57.156 25.272  1.00 40.34  ? 241  TRP B O   1 
ATOM   4525 C CB  . TRP B 1 226 ? 109.800 59.668 23.414  1.00 32.47  ? 241  TRP B CB  1 
ATOM   4526 C CG  . TRP B 1 226 ? 111.286 59.875 23.392  1.00 23.75  ? 241  TRP B CG  1 
ATOM   4527 C CD1 . TRP B 1 226 ? 112.077 60.265 24.434  1.00 24.91  ? 241  TRP B CD1 1 
ATOM   4528 C CD2 . TRP B 1 226 ? 112.164 59.640 22.286  1.00 22.00  ? 241  TRP B CD2 1 
ATOM   4529 N NE1 . TRP B 1 226 ? 113.398 60.287 24.045  1.00 25.12  ? 241  TRP B NE1 1 
ATOM   4530 C CE2 . TRP B 1 226 ? 113.477 59.908 22.730  1.00 23.65  ? 241  TRP B CE2 1 
ATOM   4531 C CE3 . TRP B 1 226 ? 111.967 59.226 20.960  1.00 25.25  ? 241  TRP B CE3 1 
ATOM   4532 C CZ2 . TRP B 1 226 ? 114.595 59.774 21.891  1.00 27.64  ? 241  TRP B CZ2 1 
ATOM   4533 C CZ3 . TRP B 1 226 ? 113.076 59.092 20.124  1.00 23.11  ? 241  TRP B CZ3 1 
ATOM   4534 C CH2 . TRP B 1 226 ? 114.375 59.367 20.594  1.00 27.51  ? 241  TRP B CH2 1 
ATOM   4535 N N   . SER B 1 227 ? 109.776 58.771 26.248  1.00 38.97  ? 242  SER B N   1 
ATOM   4536 C CA  . SER B 1 227 ? 110.396 58.634 27.560  1.00 38.09  ? 242  SER B CA  1 
ATOM   4537 C C   . SER B 1 227 ? 110.295 57.201 28.063  1.00 36.20  ? 242  SER B C   1 
ATOM   4538 O O   . SER B 1 227 ? 111.208 56.686 28.705  1.00 36.98  ? 242  SER B O   1 
ATOM   4539 C CB  . SER B 1 227 ? 109.722 59.580 28.545  1.00 36.71  ? 242  SER B CB  1 
ATOM   4540 O OG  . SER B 1 227 ? 109.843 60.914 28.090  1.00 39.13  ? 242  SER B OG  1 
ATOM   4541 N N   . ALA B 1 228 ? 109.176 56.558 27.767  1.00 34.99  ? 243  ALA B N   1 
ATOM   4542 C CA  . ALA B 1 228 ? 108.972 55.181 28.177  1.00 32.87  ? 243  ALA B CA  1 
ATOM   4543 C C   . ALA B 1 228 ? 110.024 54.297 27.502  1.00 33.78  ? 243  ALA B C   1 
ATOM   4544 O O   . ALA B 1 228 ? 110.605 53.417 28.138  1.00 35.56  ? 243  ALA B O   1 
ATOM   4545 C CB  . ALA B 1 228 ? 107.562 54.726 27.793  1.00 34.46  ? 243  ALA B CB  1 
ATOM   4546 N N   . GLY B 1 229 ? 110.264 54.542 26.215  1.00 29.17  ? 244  GLY B N   1 
ATOM   4547 C CA  . GLY B 1 229 ? 111.250 53.769 25.477  1.00 27.73  ? 244  GLY B CA  1 
ATOM   4548 C C   . GLY B 1 229 ? 112.639 53.980 26.050  1.00 32.25  ? 244  GLY B C   1 
ATOM   4549 O O   . GLY B 1 229 ? 113.499 53.096 25.974  1.00 35.44  ? 244  GLY B O   1 
ATOM   4550 N N   . CYS B 1 230 ? 112.869 55.166 26.607  1.00 29.25  ? 245  CYS B N   1 
ATOM   4551 C CA  . CYS B 1 230 ? 114.144 55.475 27.223  1.00 30.04  ? 245  CYS B CA  1 
ATOM   4552 C C   . CYS B 1 230 ? 114.277 54.658 28.512  1.00 32.34  ? 245  CYS B C   1 
ATOM   4553 O O   . CYS B 1 230 ? 115.361 54.174 28.822  1.00 32.38  ? 245  CYS B O   1 
ATOM   4554 C CB  . CYS B 1 230 ? 114.241 56.972 27.533  1.00 32.57  ? 245  CYS B CB  1 
ATOM   4555 S SG  . CYS B 1 230 ? 114.577 57.991 26.103  1.00 34.30  ? 245  CYS B SG  1 
ATOM   4556 N N   . VAL B 1 231 ? 113.180 54.504 29.259  1.00 30.06  ? 246  VAL B N   1 
ATOM   4557 C CA  . VAL B 1 231 ? 113.194 53.719 30.501  1.00 33.40  ? 246  VAL B CA  1 
ATOM   4558 C C   . VAL B 1 231 ? 113.388 52.232 30.176  1.00 34.22  ? 246  VAL B C   1 
ATOM   4559 O O   . VAL B 1 231 ? 114.213 51.547 30.788  1.00 33.83  ? 246  VAL B O   1 
ATOM   4560 C CB  . VAL B 1 231 ? 111.879 53.869 31.282  1.00 32.74  ? 246  VAL B CB  1 
ATOM   4561 C CG1 . VAL B 1 231 ? 111.889 52.957 32.482  1.00 32.73  ? 246  VAL B CG1 1 
ATOM   4562 C CG2 . VAL B 1 231 ? 111.699 55.301 31.723  1.00 34.64  ? 246  VAL B CG2 1 
ATOM   4563 N N   . LEU B 1 232 ? 112.609 51.744 29.215  1.00 31.62  ? 247  LEU B N   1 
ATOM   4564 C CA  . LEU B 1 232 ? 112.700 50.360 28.777  1.00 33.38  ? 247  LEU B CA  1 
ATOM   4565 C C   . LEU B 1 232 ? 114.150 50.130 28.397  1.00 35.62  ? 247  LEU B C   1 
ATOM   4566 O O   . LEU B 1 232 ? 114.781 49.195 28.873  1.00 30.13  ? 247  LEU B O   1 
ATOM   4567 C CB  . LEU B 1 232 ? 111.800 50.133 27.559  1.00 29.92  ? 247  LEU B CB  1 
ATOM   4568 C CG  . LEU B 1 232 ? 111.544 48.735 26.977  1.00 30.96  ? 247  LEU B CG  1 
ATOM   4569 C CD1 . LEU B 1 232 ? 112.112 48.661 25.572  1.00 31.38  ? 247  LEU B CD1 1 
ATOM   4570 C CD2 . LEU B 1 232 ? 112.138 47.661 27.869  1.00 27.87  ? 247  LEU B CD2 1 
ATOM   4571 N N   . ALA B 1 233 ? 114.681 51.010 27.556  1.00 37.09  ? 248  ALA B N   1 
ATOM   4572 C CA  . ALA B 1 233 ? 116.064 50.899 27.109  1.00 38.71  ? 248  ALA B CA  1 
ATOM   4573 C C   . ALA B 1 233 ? 117.064 50.937 28.261  1.00 38.94  ? 248  ALA B C   1 
ATOM   4574 O O   . ALA B 1 233 ? 118.108 50.283 28.201  1.00 40.30  ? 248  ALA B O   1 
ATOM   4575 C CB  . ALA B 1 233 ? 116.381 52.008 26.102  1.00 37.42  ? 248  ALA B CB  1 
ATOM   4576 N N   . GLU B 1 234 ? 116.748 51.697 29.308  1.00 38.51  ? 249  GLU B N   1 
ATOM   4577 C CA  . GLU B 1 234 ? 117.640 51.812 30.457  1.00 37.82  ? 249  GLU B CA  1 
ATOM   4578 C C   . GLU B 1 234 ? 117.674 50.512 31.240  1.00 38.87  ? 249  GLU B C   1 
ATOM   4579 O O   . GLU B 1 234 ? 118.715 50.117 31.753  1.00 39.83  ? 249  GLU B O   1 
ATOM   4580 C CB  . GLU B 1 234 ? 117.200 52.955 31.377  1.00 38.19  ? 249  GLU B CB  1 
ATOM   4581 C CG  . GLU B 1 234 ? 118.267 53.347 32.390  1.00 41.28  ? 249  GLU B CG  1 
ATOM   4582 C CD  . GLU B 1 234 ? 117.940 54.625 33.156  1.00 45.79  ? 249  GLU B CD  1 
ATOM   4583 O OE1 . GLU B 1 234 ? 117.458 55.588 32.512  1.00 45.11  ? 249  GLU B OE1 1 
ATOM   4584 O OE2 . GLU B 1 234 ? 118.184 54.676 34.390  1.00 46.70  ? 249  GLU B OE2 1 
ATOM   4585 N N   . LEU B 1 235 ? 116.528 49.847 31.332  1.00 38.75  ? 250  LEU B N   1 
ATOM   4586 C CA  . LEU B 1 235 ? 116.438 48.580 32.054  1.00 37.38  ? 250  LEU B CA  1 
ATOM   4587 C C   . LEU B 1 235 ? 117.201 47.477 31.333  1.00 37.47  ? 250  LEU B C   1 
ATOM   4588 O O   . LEU B 1 235 ? 117.700 46.547 31.956  1.00 42.24  ? 250  LEU B O   1 
ATOM   4589 C CB  . LEU B 1 235 ? 114.979 48.154 32.214  1.00 32.55  ? 250  LEU B CB  1 
ATOM   4590 C CG  . LEU B 1 235 ? 114.134 49.065 33.099  1.00 31.55  ? 250  LEU B CG  1 
ATOM   4591 C CD1 . LEU B 1 235 ? 112.695 48.595 33.086  1.00 30.29  ? 250  LEU B CD1 1 
ATOM   4592 C CD2 . LEU B 1 235 ? 114.681 49.062 34.517  1.00 25.61  ? 250  LEU B CD2 1 
ATOM   4593 N N   . LEU B 1 236 ? 117.290 47.580 30.016  1.00 34.98  ? 251  LEU B N   1 
ATOM   4594 C CA  . LEU B 1 236 ? 117.991 46.580 29.230  1.00 32.31  ? 251  LEU B CA  1 
ATOM   4595 C C   . LEU B 1 236 ? 119.505 46.796 29.199  1.00 34.19  ? 251  LEU B C   1 
ATOM   4596 O O   . LEU B 1 236 ? 120.277 45.844 29.050  1.00 33.80  ? 251  LEU B O   1 
ATOM   4597 C CB  . LEU B 1 236 ? 117.463 46.591 27.797  1.00 27.41  ? 251  LEU B CB  1 
ATOM   4598 C CG  . LEU B 1 236 ? 115.975 46.298 27.614  1.00 29.78  ? 251  LEU B CG  1 
ATOM   4599 C CD1 . LEU B 1 236 ? 115.608 46.367 26.145  1.00 23.35  ? 251  LEU B CD1 1 
ATOM   4600 C CD2 . LEU B 1 236 ? 115.657 44.931 28.196  1.00 25.68  ? 251  LEU B CD2 1 
ATOM   4601 N N   . LEU B 1 237 ? 119.921 48.052 29.326  1.00 37.78  ? 252  LEU B N   1 
ATOM   4602 C CA  . LEU B 1 237 ? 121.331 48.413 29.277  1.00 35.39  ? 252  LEU B CA  1 
ATOM   4603 C C   . LEU B 1 237 ? 121.974 48.519 30.636  1.00 37.61  ? 252  LEU B C   1 
ATOM   4604 O O   . LEU B 1 237 ? 123.166 48.285 30.771  1.00 41.23  ? 252  LEU B O   1 
ATOM   4605 C CB  . LEU B 1 237 ? 121.494 49.750 28.569  1.00 38.81  ? 252  LEU B CB  1 
ATOM   4606 C CG  . LEU B 1 237 ? 121.019 49.843 27.126  1.00 41.52  ? 252  LEU B CG  1 
ATOM   4607 C CD1 . LEU B 1 237 ? 121.054 51.294 26.687  1.00 37.65  ? 252  LEU B CD1 1 
ATOM   4608 C CD2 . LEU B 1 237 ? 121.910 48.978 26.245  1.00 38.97  ? 252  LEU B CD2 1 
ATOM   4609 N N   . GLY B 1 238 ? 121.189 48.891 31.638  1.00 38.51  ? 253  GLY B N   1 
ATOM   4610 C CA  . GLY B 1 238 ? 121.729 49.043 32.976  1.00 44.41  ? 253  GLY B CA  1 
ATOM   4611 C C   . GLY B 1 238 ? 122.219 50.468 33.159  1.00 48.51  ? 253  GLY B C   1 
ATOM   4612 O O   . GLY B 1 238 ? 123.027 50.756 34.048  1.00 50.56  ? 253  GLY B O   1 
ATOM   4613 N N   . GLN B 1 239 ? 121.720 51.365 32.309  1.00 51.49  ? 254  GLN B N   1 
ATOM   4614 C CA  . GLN B 1 239 ? 122.105 52.773 32.347  1.00 51.94  ? 254  GLN B CA  1 
ATOM   4615 C C   . GLN B 1 239 ? 121.338 53.536 31.276  1.00 49.79  ? 254  GLN B C   1 
ATOM   4616 O O   . GLN B 1 239 ? 120.827 52.938 30.334  1.00 48.50  ? 254  GLN B O   1 
ATOM   4617 C CB  . GLN B 1 239 ? 123.586 52.898 32.059  1.00 55.60  ? 254  GLN B CB  1 
ATOM   4618 C CG  . GLN B 1 239 ? 123.941 52.297 30.725  1.00 61.39  ? 254  GLN B CG  1 
ATOM   4619 C CD  . GLN B 1 239 ? 125.412 52.379 30.439  1.00 66.11  ? 254  GLN B CD  1 
ATOM   4620 O OE1 . GLN B 1 239 ? 126.237 51.952 31.253  1.00 69.28  ? 254  GLN B OE1 1 
ATOM   4621 N NE2 . GLN B 1 239 ? 125.761 52.925 29.274  1.00 64.26  ? 254  GLN B NE2 1 
ATOM   4622 N N   . PRO B 1 240 ? 121.269 54.872 31.399  1.00 48.49  ? 255  PRO B N   1 
ATOM   4623 C CA  . PRO B 1 240 ? 120.563 55.726 30.443  1.00 47.33  ? 255  PRO B CA  1 
ATOM   4624 C C   . PRO B 1 240 ? 121.058 55.522 29.019  1.00 47.52  ? 255  PRO B C   1 
ATOM   4625 O O   . PRO B 1 240 ? 122.261 55.470 28.768  1.00 51.21  ? 255  PRO B O   1 
ATOM   4626 C CB  . PRO B 1 240 ? 120.856 57.130 30.958  1.00 45.86  ? 255  PRO B CB  1 
ATOM   4627 C CG  . PRO B 1 240 ? 120.958 56.925 32.418  1.00 45.72  ? 255  PRO B CG  1 
ATOM   4628 C CD  . PRO B 1 240 ? 121.807 55.681 32.504  1.00 46.61  ? 255  PRO B CD  1 
ATOM   4629 N N   . ILE B 1 241 ? 120.128 55.411 28.083  1.00 44.69  ? 256  ILE B N   1 
ATOM   4630 C CA  . ILE B 1 241 ? 120.499 55.213 26.697  1.00 41.66  ? 256  ILE B CA  1 
ATOM   4631 C C   . ILE B 1 241 ? 121.028 56.511 26.083  1.00 42.05  ? 256  ILE B C   1 
ATOM   4632 O O   . ILE B 1 241 ? 121.998 56.493 25.331  1.00 38.81  ? 256  ILE B O   1 
ATOM   4633 C CB  . ILE B 1 241 ? 119.296 54.672 25.890  1.00 41.96  ? 256  ILE B CB  1 
ATOM   4634 C CG1 . ILE B 1 241 ? 119.681 54.525 24.422  1.00 40.78  ? 256  ILE B CG1 1 
ATOM   4635 C CG2 . ILE B 1 241 ? 118.094 55.587 26.061  1.00 39.51  ? 256  ILE B CG2 1 
ATOM   4636 C CD1 . ILE B 1 241 ? 118.702 53.683 23.632  1.00 42.67  ? 256  ILE B CD1 1 
ATOM   4637 N N   . PHE B 1 242 ? 120.408 57.640 26.422  1.00 37.06  ? 257  PHE B N   1 
ATOM   4638 C CA  . PHE B 1 242 ? 120.832 58.937 25.891  1.00 39.04  ? 257  PHE B CA  1 
ATOM   4639 C C   . PHE B 1 242 ? 121.207 59.909 27.008  1.00 38.91  ? 257  PHE B C   1 
ATOM   4640 O O   . PHE B 1 242 ? 120.389 60.725 27.426  1.00 40.69  ? 257  PHE B O   1 
ATOM   4641 C CB  . PHE B 1 242 ? 119.709 59.540 25.073  1.00 34.01  ? 257  PHE B CB  1 
ATOM   4642 C CG  . PHE B 1 242 ? 119.205 58.645 24.003  1.00 31.81  ? 257  PHE B CG  1 
ATOM   4643 C CD1 . PHE B 1 242 ? 117.859 58.318 23.942  1.00 30.21  ? 257  PHE B CD1 1 
ATOM   4644 C CD2 . PHE B 1 242 ? 120.060 58.173 23.016  1.00 31.80  ? 257  PHE B CD2 1 
ATOM   4645 C CE1 . PHE B 1 242 ? 117.362 57.543 22.909  1.00 33.44  ? 257  PHE B CE1 1 
ATOM   4646 C CE2 . PHE B 1 242 ? 119.575 57.391 21.970  1.00 33.15  ? 257  PHE B CE2 1 
ATOM   4647 C CZ  . PHE B 1 242 ? 118.220 57.077 21.914  1.00 32.23  ? 257  PHE B CZ  1 
ATOM   4648 N N   . PRO B 1 243 ? 122.452 59.846 27.496  1.00 37.20  ? 258  PRO B N   1 
ATOM   4649 C CA  . PRO B 1 243 ? 122.865 60.748 28.571  1.00 40.35  ? 258  PRO B CA  1 
ATOM   4650 C C   . PRO B 1 243 ? 123.583 62.024 28.093  1.00 43.71  ? 258  PRO B C   1 
ATOM   4651 O O   . PRO B 1 243 ? 124.806 62.129 28.218  1.00 46.32  ? 258  PRO B O   1 
ATOM   4652 C CB  . PRO B 1 243 ? 123.769 59.857 29.404  1.00 39.87  ? 258  PRO B CB  1 
ATOM   4653 C CG  . PRO B 1 243 ? 124.514 59.095 28.328  1.00 36.07  ? 258  PRO B CG  1 
ATOM   4654 C CD  . PRO B 1 243 ? 123.451 58.778 27.286  1.00 35.24  ? 258  PRO B CD  1 
ATOM   4655 N N   . GLY B 1 244 ? 122.829 62.988 27.557  1.00 46.35  ? 259  GLY B N   1 
ATOM   4656 C CA  . GLY B 1 244 ? 123.417 64.233 27.073  1.00 48.90  ? 259  GLY B CA  1 
ATOM   4657 C C   . GLY B 1 244 ? 123.845 65.147 28.207  1.00 51.41  ? 259  GLY B C   1 
ATOM   4658 O O   . GLY B 1 244 ? 123.210 65.159 29.260  1.00 53.10  ? 259  GLY B O   1 
ATOM   4659 N N   . ASP B 1 245 ? 124.919 65.908 28.006  1.00 54.10  ? 260  ASP B N   1 
ATOM   4660 C CA  . ASP B 1 245 ? 125.421 66.821 29.039  1.00 58.36  ? 260  ASP B CA  1 
ATOM   4661 C C   . ASP B 1 245 ? 124.657 68.131 28.971  1.00 59.16  ? 260  ASP B C   1 
ATOM   4662 O O   . ASP B 1 245 ? 124.361 68.756 29.993  1.00 61.23  ? 260  ASP B O   1 
ATOM   4663 C CB  . ASP B 1 245 ? 126.912 67.123 28.839  1.00 60.76  ? 260  ASP B CB  1 
ATOM   4664 C CG  . ASP B 1 245 ? 127.792 65.885 28.935  1.00 64.71  ? 260  ASP B CG  1 
ATOM   4665 O OD1 . ASP B 1 245 ? 127.721 65.168 29.966  1.00 66.52  ? 260  ASP B OD1 1 
ATOM   4666 O OD2 . ASP B 1 245 ? 128.565 65.641 27.976  1.00 65.77  ? 260  ASP B OD2 1 
ATOM   4667 N N   . SER B 1 246 ? 124.368 68.544 27.744  1.00 59.12  ? 261  SER B N   1 
ATOM   4668 C CA  . SER B 1 246 ? 123.641 69.773 27.478  1.00 56.52  ? 261  SER B CA  1 
ATOM   4669 C C   . SER B 1 246 ? 122.458 69.392 26.603  1.00 57.02  ? 261  SER B C   1 
ATOM   4670 O O   . SER B 1 246 ? 122.321 68.234 26.201  1.00 56.46  ? 261  SER B O   1 
ATOM   4671 C CB  . SER B 1 246 ? 124.535 70.773 26.729  1.00 56.06  ? 261  SER B CB  1 
ATOM   4672 O OG  . SER B 1 246 ? 124.803 70.350 25.398  1.00 57.10  ? 261  SER B OG  1 
ATOM   4673 N N   . GLY B 1 247 ? 121.604 70.365 26.312  1.00 56.25  ? 262  GLY B N   1 
ATOM   4674 C CA  . GLY B 1 247 ? 120.452 70.102 25.473  1.00 55.06  ? 262  GLY B CA  1 
ATOM   4675 C C   . GLY B 1 247 ? 120.851 69.849 24.033  1.00 55.50  ? 262  GLY B C   1 
ATOM   4676 O O   . GLY B 1 247 ? 120.133 69.171 23.302  1.00 56.48  ? 262  GLY B O   1 
ATOM   4677 N N   . VAL B 1 248 ? 121.985 70.403 23.614  1.00 54.03  ? 263  VAL B N   1 
ATOM   4678 C CA  . VAL B 1 248 ? 122.452 70.198 22.249  1.00 53.18  ? 263  VAL B CA  1 
ATOM   4679 C C   . VAL B 1 248 ? 123.068 68.813 22.171  1.00 53.51  ? 263  VAL B C   1 
ATOM   4680 O O   . VAL B 1 248 ? 122.904 68.096 21.183  1.00 53.82  ? 263  VAL B O   1 
ATOM   4681 C CB  . VAL B 1 248 ? 123.525 71.221 21.847  1.00 53.65  ? 263  VAL B CB  1 
ATOM   4682 C CG1 . VAL B 1 248 ? 123.980 70.947 20.409  1.00 51.87  ? 263  VAL B CG1 1 
ATOM   4683 C CG2 . VAL B 1 248 ? 122.980 72.641 22.004  1.00 55.46  ? 263  VAL B CG2 1 
ATOM   4684 N N   . ASP B 1 249 ? 123.774 68.443 23.233  1.00 52.41  ? 264  ASP B N   1 
ATOM   4685 C CA  . ASP B 1 249 ? 124.424 67.147 23.307  1.00 51.70  ? 264  ASP B CA  1 
ATOM   4686 C C   . ASP B 1 249 ? 123.423 65.992 23.399  1.00 49.20  ? 264  ASP B C   1 
ATOM   4687 O O   . ASP B 1 249 ? 123.685 64.882 22.938  1.00 50.44  ? 264  ASP B O   1 
ATOM   4688 C CB  . ASP B 1 249 ? 125.342 67.100 24.514  1.00 53.36  ? 264  ASP B CB  1 
ATOM   4689 C CG  . ASP B 1 249 ? 126.071 65.791 24.618  1.00 59.87  ? 264  ASP B CG  1 
ATOM   4690 O OD1 . ASP B 1 249 ? 126.408 65.390 25.752  1.00 61.24  ? 264  ASP B OD1 1 
ATOM   4691 O OD2 . ASP B 1 249 ? 126.312 65.162 23.559  1.00 62.71  ? 264  ASP B OD2 1 
ATOM   4692 N N   . GLN B 1 250 ? 122.281 66.251 24.017  1.00 46.45  ? 265  GLN B N   1 
ATOM   4693 C CA  . GLN B 1 250 ? 121.254 65.236 24.146  1.00 43.93  ? 265  GLN B CA  1 
ATOM   4694 C C   . GLN B 1 250 ? 120.830 64.801 22.747  1.00 42.56  ? 265  GLN B C   1 
ATOM   4695 O O   . GLN B 1 250 ? 120.537 63.637 22.507  1.00 42.48  ? 265  GLN B O   1 
ATOM   4696 C CB  . GLN B 1 250 ? 120.064 65.812 24.894  1.00 40.80  ? 265  GLN B CB  1 
ATOM   4697 C CG  . GLN B 1 250 ? 119.008 64.803 25.200  1.00 43.06  ? 265  GLN B CG  1 
ATOM   4698 C CD  . GLN B 1 250 ? 119.573 63.660 25.971  1.00 40.59  ? 265  GLN B CD  1 
ATOM   4699 O OE1 . GLN B 1 250 ? 120.331 63.860 26.914  1.00 42.26  ? 265  GLN B OE1 1 
ATOM   4700 N NE2 . GLN B 1 250 ? 119.210 62.449 25.586  1.00 41.83  ? 265  GLN B NE2 1 
ATOM   4701 N N   . LEU B 1 251 ? 120.797 65.747 21.820  1.00 42.12  ? 266  LEU B N   1 
ATOM   4702 C CA  . LEU B 1 251 ? 120.423 65.426 20.456  1.00 43.33  ? 266  LEU B CA  1 
ATOM   4703 C C   . LEU B 1 251 ? 121.509 64.572 19.823  1.00 45.19  ? 266  LEU B C   1 
ATOM   4704 O O   . LEU B 1 251 ? 121.234 63.677 19.018  1.00 45.20  ? 266  LEU B O   1 
ATOM   4705 C CB  . LEU B 1 251 ? 120.241 66.698 19.641  1.00 42.75  ? 266  LEU B CB  1 
ATOM   4706 C CG  . LEU B 1 251 ? 119.910 66.437 18.168  1.00 43.71  ? 266  LEU B CG  1 
ATOM   4707 C CD1 . LEU B 1 251 ? 118.912 65.287 18.030  1.00 42.60  ? 266  LEU B CD1 1 
ATOM   4708 C CD2 . LEU B 1 251 ? 119.344 67.712 17.563  1.00 46.99  ? 266  LEU B CD2 1 
ATOM   4709 N N   . VAL B 1 252 ? 122.750 64.869 20.190  1.00 44.17  ? 267  VAL B N   1 
ATOM   4710 C CA  . VAL B 1 252 ? 123.907 64.136 19.695  1.00 46.89  ? 267  VAL B CA  1 
ATOM   4711 C C   . VAL B 1 252 ? 123.782 62.662 20.092  1.00 46.04  ? 267  VAL B C   1 
ATOM   4712 O O   . VAL B 1 252 ? 123.919 61.770 19.247  1.00 47.55  ? 267  VAL B O   1 
ATOM   4713 C CB  . VAL B 1 252 ? 125.218 64.729 20.272  1.00 46.76  ? 267  VAL B CB  1 
ATOM   4714 C CG1 . VAL B 1 252 ? 126.396 63.824 19.941  1.00 46.21  ? 267  VAL B CG1 1 
ATOM   4715 C CG2 . VAL B 1 252 ? 125.441 66.129 19.705  1.00 45.41  ? 267  VAL B CG2 1 
ATOM   4716 N N   . GLU B 1 253 ? 123.525 62.426 21.381  1.00 44.38  ? 268  GLU B N   1 
ATOM   4717 C CA  . GLU B 1 253 ? 123.339 61.080 21.923  1.00 42.71  ? 268  GLU B CA  1 
ATOM   4718 C C   . GLU B 1 253 ? 122.282 60.351 21.112  1.00 41.46  ? 268  GLU B C   1 
ATOM   4719 O O   . GLU B 1 253 ? 122.437 59.179 20.778  1.00 43.55  ? 268  GLU B O   1 
ATOM   4720 C CB  . GLU B 1 253 ? 122.876 61.153 23.375  1.00 44.57  ? 268  GLU B CB  1 
ATOM   4721 C CG  . GLU B 1 253 ? 123.946 61.596 24.312  1.00 46.90  ? 268  GLU B CG  1 
ATOM   4722 C CD  . GLU B 1 253 ? 125.068 60.597 24.366  1.00 52.57  ? 268  GLU B CD  1 
ATOM   4723 O OE1 . GLU B 1 253 ? 124.832 59.464 24.842  1.00 57.42  ? 268  GLU B OE1 1 
ATOM   4724 O OE2 . GLU B 1 253 ? 126.184 60.935 23.923  1.00 56.59  ? 268  GLU B OE2 1 
ATOM   4725 N N   . ILE B 1 254 ? 121.201 61.056 20.805  1.00 39.29  ? 269  ILE B N   1 
ATOM   4726 C CA  . ILE B 1 254 ? 120.120 60.482 20.031  1.00 41.91  ? 269  ILE B CA  1 
ATOM   4727 C C   . ILE B 1 254 ? 120.586 60.117 18.625  1.00 45.71  ? 269  ILE B C   1 
ATOM   4728 O O   . ILE B 1 254 ? 120.345 59.004 18.156  1.00 48.81  ? 269  ILE B O   1 
ATOM   4729 C CB  . ILE B 1 254 ? 118.930 61.457 19.953  1.00 41.22  ? 269  ILE B CB  1 
ATOM   4730 C CG1 . ILE B 1 254 ? 118.320 61.609 21.341  1.00 35.35  ? 269  ILE B CG1 1 
ATOM   4731 C CG2 . ILE B 1 254 ? 117.884 60.950 18.975  1.00 40.87  ? 269  ILE B CG2 1 
ATOM   4732 C CD1 . ILE B 1 254 ? 117.067 62.431 21.359  1.00 38.42  ? 269  ILE B CD1 1 
ATOM   4733 N N   . ILE B 1 255 ? 121.267 61.043 17.961  1.00 46.86  ? 270  ILE B N   1 
ATOM   4734 C CA  . ILE B 1 255 ? 121.736 60.793 16.605  1.00 48.19  ? 270  ILE B CA  1 
ATOM   4735 C C   . ILE B 1 255 ? 122.776 59.683 16.523  1.00 47.28  ? 270  ILE B C   1 
ATOM   4736 O O   . ILE B 1 255 ? 122.943 59.044 15.480  1.00 45.00  ? 270  ILE B O   1 
ATOM   4737 C CB  . ILE B 1 255 ? 122.292 62.081 15.976  1.00 50.02  ? 270  ILE B CB  1 
ATOM   4738 C CG1 . ILE B 1 255 ? 121.132 63.069 15.776  1.00 52.01  ? 270  ILE B CG1 1 
ATOM   4739 C CG2 . ILE B 1 255 ? 123.016 61.762 14.656  1.00 46.52  ? 270  ILE B CG2 1 
ATOM   4740 C CD1 . ILE B 1 255 ? 121.518 64.386 15.131  1.00 48.78  ? 270  ILE B CD1 1 
ATOM   4741 N N   . LYS B 1 256 ? 123.473 59.449 17.624  1.00 45.84  ? 271  LYS B N   1 
ATOM   4742 C CA  . LYS B 1 256 ? 124.468 58.391 17.647  1.00 47.44  ? 271  LYS B CA  1 
ATOM   4743 C C   . LYS B 1 256 ? 123.784 57.038 17.479  1.00 47.60  ? 271  LYS B C   1 
ATOM   4744 O O   . LYS B 1 256 ? 124.389 56.084 16.999  1.00 49.75  ? 271  LYS B O   1 
ATOM   4745 C CB  . LYS B 1 256 ? 125.264 58.435 18.956  1.00 48.27  ? 271  LYS B CB  1 
ATOM   4746 C CG  . LYS B 1 256 ? 126.554 59.252 18.843  1.00 52.49  ? 271  LYS B CG  1 
ATOM   4747 C CD  . LYS B 1 256 ? 127.123 59.673 20.199  1.00 53.46  ? 271  LYS B CD  1 
ATOM   4748 C CE  . LYS B 1 256 ? 127.557 58.495 21.066  1.00 57.64  ? 271  LYS B CE  1 
ATOM   4749 N NZ  . LYS B 1 256 ? 128.109 58.954 22.381  1.00 58.00  ? 271  LYS B NZ  1 
ATOM   4750 N N   . VAL B 1 257 ? 122.514 56.964 17.861  1.00 45.69  ? 272  VAL B N   1 
ATOM   4751 C CA  . VAL B 1 257 ? 121.762 55.728 17.744  1.00 41.95  ? 272  VAL B CA  1 
ATOM   4752 C C   . VAL B 1 257 ? 120.854 55.735 16.532  1.00 42.39  ? 272  VAL B C   1 
ATOM   4753 O O   . VAL B 1 257 ? 120.951 54.857 15.685  1.00 43.49  ? 272  VAL B O   1 
ATOM   4754 C CB  . VAL B 1 257 ? 120.887 55.483 18.974  1.00 40.10  ? 272  VAL B CB  1 
ATOM   4755 C CG1 . VAL B 1 257 ? 119.974 54.304 18.722  1.00 33.28  ? 272  VAL B CG1 1 
ATOM   4756 C CG2 . VAL B 1 257 ? 121.756 55.233 20.181  1.00 31.41  ? 272  VAL B CG2 1 
ATOM   4757 N N   . LEU B 1 258 ? 119.970 56.725 16.454  1.00 43.09  ? 273  LEU B N   1 
ATOM   4758 C CA  . LEU B 1 258 ? 119.015 56.826 15.345  1.00 44.53  ? 273  LEU B CA  1 
ATOM   4759 C C   . LEU B 1 258 ? 119.562 57.543 14.105  1.00 46.79  ? 273  LEU B C   1 
ATOM   4760 O O   . LEU B 1 258 ? 118.906 57.580 13.057  1.00 44.67  ? 273  LEU B O   1 
ATOM   4761 C CB  . LEU B 1 258 ? 117.738 57.542 15.827  1.00 45.58  ? 273  LEU B CB  1 
ATOM   4762 C CG  . LEU B 1 258 ? 117.029 57.025 17.095  1.00 49.07  ? 273  LEU B CG  1 
ATOM   4763 C CD1 . LEU B 1 258 ? 115.917 57.982 17.475  1.00 48.92  ? 273  LEU B CD1 1 
ATOM   4764 C CD2 . LEU B 1 258 ? 116.456 55.626 16.873  1.00 46.97  ? 273  LEU B CD2 1 
ATOM   4765 N N   . GLY B 1 259 ? 120.768 58.096 14.222  1.00 48.15  ? 274  GLY B N   1 
ATOM   4766 C CA  . GLY B 1 259 ? 121.346 58.833 13.114  1.00 48.50  ? 274  GLY B CA  1 
ATOM   4767 C C   . GLY B 1 259 ? 120.565 60.126 12.950  1.00 50.16  ? 274  GLY B C   1 
ATOM   4768 O O   . GLY B 1 259 ? 119.842 60.533 13.852  1.00 49.85  ? 274  GLY B O   1 
ATOM   4769 N N   . THR B 1 260 ? 120.691 60.778 11.803  1.00 50.64  ? 275  THR B N   1 
ATOM   4770 C CA  . THR B 1 260 ? 119.973 62.026 11.578  1.00 53.23  ? 275  THR B CA  1 
ATOM   4771 C C   . THR B 1 260 ? 118.542 61.781 11.120  1.00 53.79  ? 275  THR B C   1 
ATOM   4772 O O   . THR B 1 260 ? 118.195 60.691 10.668  1.00 57.03  ? 275  THR B O   1 
ATOM   4773 C CB  . THR B 1 260 ? 120.680 62.914 10.512  1.00 55.66  ? 275  THR B CB  1 
ATOM   4774 O OG1 . THR B 1 260 ? 120.604 62.293 9.214   1.00 51.54  ? 275  THR B OG1 1 
ATOM   4775 C CG2 . THR B 1 260 ? 122.136 63.141 10.906  1.00 52.32  ? 275  THR B CG2 1 
ATOM   4776 N N   . PRO B 1 261 ? 117.681 62.794 11.252  1.00 54.51  ? 276  PRO B N   1 
ATOM   4777 C CA  . PRO B 1 261 ? 116.291 62.622 10.821  1.00 53.83  ? 276  PRO B CA  1 
ATOM   4778 C C   . PRO B 1 261 ? 116.176 62.843 9.309   1.00 53.38  ? 276  PRO B C   1 
ATOM   4779 O O   . PRO B 1 261 ? 117.149 63.206 8.640   1.00 53.76  ? 276  PRO B O   1 
ATOM   4780 C CB  . PRO B 1 261 ? 115.534 63.710 11.600  1.00 53.69  ? 276  PRO B CB  1 
ATOM   4781 C CG  . PRO B 1 261 ? 116.490 64.141 12.688  1.00 53.23  ? 276  PRO B CG  1 
ATOM   4782 C CD  . PRO B 1 261 ? 117.838 64.024 12.047  1.00 53.86  ? 276  PRO B CD  1 
ATOM   4783 N N   . THR B 1 262 ? 114.981 62.608 8.784   1.00 54.35  ? 277  THR B N   1 
ATOM   4784 C CA  . THR B 1 262 ? 114.698 62.819 7.374   1.00 54.74  ? 277  THR B CA  1 
ATOM   4785 C C   . THR B 1 262 ? 113.828 64.073 7.394   1.00 57.20  ? 277  THR B C   1 
ATOM   4786 O O   . THR B 1 262 ? 113.142 64.330 8.389   1.00 57.71  ? 277  THR B O   1 
ATOM   4787 C CB  . THR B 1 262 ? 113.893 61.618 6.742   1.00 52.32  ? 277  THR B CB  1 
ATOM   4788 O OG1 . THR B 1 262 ? 112.551 61.577 7.258   1.00 49.73  ? 277  THR B OG1 1 
ATOM   4789 C CG2 . THR B 1 262 ? 114.581 60.296 7.045   1.00 46.18  ? 277  THR B CG2 1 
ATOM   4790 N N   . ARG B 1 263 ? 113.859 64.865 6.328   1.00 58.64  ? 278  ARG B N   1 
ATOM   4791 C CA  . ARG B 1 263 ? 113.041 66.073 6.299   1.00 62.54  ? 278  ARG B CA  1 
ATOM   4792 C C   . ARG B 1 263 ? 111.638 65.725 6.759   1.00 61.39  ? 278  ARG B C   1 
ATOM   4793 O O   . ARG B 1 263 ? 110.994 66.502 7.460   1.00 61.47  ? 278  ARG B O   1 
ATOM   4794 C CB  . ARG B 1 263 ? 112.979 66.664 4.890   1.00 66.28  ? 278  ARG B CB  1 
ATOM   4795 C CG  . ARG B 1 263 ? 114.290 67.231 4.411   1.00 70.65  ? 278  ARG B CG  1 
ATOM   4796 C CD  . ARG B 1 263 ? 114.157 67.851 3.036   1.00 76.62  ? 278  ARG B CD  1 
ATOM   4797 N NE  . ARG B 1 263 ? 115.467 68.230 2.518   1.00 81.24  ? 278  ARG B NE  1 
ATOM   4798 C CZ  . ARG B 1 263 ? 116.285 69.089 3.119   1.00 84.63  ? 278  ARG B CZ  1 
ATOM   4799 N NH1 . ARG B 1 263 ? 115.923 69.667 4.264   1.00 83.22  ? 278  ARG B NH1 1 
ATOM   4800 N NH2 . ARG B 1 263 ? 117.472 69.358 2.584   1.00 86.62  ? 278  ARG B NH2 1 
ATOM   4801 N N   . GLU B 1 264 ? 111.178 64.545 6.362   1.00 60.95  ? 279  GLU B N   1 
ATOM   4802 C CA  . GLU B 1 264 ? 109.851 64.077 6.725   1.00 62.93  ? 279  GLU B CA  1 
ATOM   4803 C C   . GLU B 1 264 ? 109.722 63.963 8.240   1.00 61.59  ? 279  GLU B C   1 
ATOM   4804 O O   . GLU B 1 264 ? 108.685 64.305 8.817   1.00 60.46  ? 279  GLU B O   1 
ATOM   4805 C CB  . GLU B 1 264 ? 109.594 62.718 6.082   1.00 64.66  ? 279  GLU B CB  1 
ATOM   4806 C CG  . GLU B 1 264 ? 108.205 62.161 6.330   1.00 71.48  ? 279  GLU B CG  1 
ATOM   4807 C CD  . GLU B 1 264 ? 108.090 60.685 5.950   1.00 77.53  ? 279  GLU B CD  1 
ATOM   4808 O OE1 . GLU B 1 264 ? 106.953 60.151 5.989   1.00 80.18  ? 279  GLU B OE1 1 
ATOM   4809 O OE2 . GLU B 1 264 ? 109.133 60.059 5.625   1.00 78.42  ? 279  GLU B OE2 1 
ATOM   4810 N N   . GLN B 1 265 ? 110.776 63.474 8.883   1.00 58.51  ? 280  GLN B N   1 
ATOM   4811 C CA  . GLN B 1 265 ? 110.758 63.326 10.328  1.00 56.27  ? 280  GLN B CA  1 
ATOM   4812 C C   . GLN B 1 265 ? 110.839 64.696 11.004  1.00 54.69  ? 280  GLN B C   1 
ATOM   4813 O O   . GLN B 1 265 ? 110.082 64.973 11.942  1.00 51.80  ? 280  GLN B O   1 
ATOM   4814 C CB  . GLN B 1 265 ? 111.886 62.378 10.779  1.00 54.04  ? 280  GLN B CB  1 
ATOM   4815 C CG  . GLN B 1 265 ? 111.603 60.923 10.363  1.00 51.19  ? 280  GLN B CG  1 
ATOM   4816 C CD  . GLN B 1 265 ? 112.665 59.926 10.798  1.00 51.76  ? 280  GLN B CD  1 
ATOM   4817 O OE1 . GLN B 1 265 ? 113.840 60.093 10.497  1.00 46.70  ? 280  GLN B OE1 1 
ATOM   4818 N NE2 . GLN B 1 265 ? 112.248 58.871 11.499  1.00 52.52  ? 280  GLN B NE2 1 
ATOM   4819 N N   . ILE B 1 266 ? 111.729 65.562 10.514  1.00 52.13  ? 281  ILE B N   1 
ATOM   4820 C CA  . ILE B 1 266 ? 111.875 66.913 11.069  1.00 50.53  ? 281  ILE B CA  1 
ATOM   4821 C C   . ILE B 1 266 ? 110.546 67.663 10.971  1.00 49.60  ? 281  ILE B C   1 
ATOM   4822 O O   . ILE B 1 266 ? 110.122 68.358 11.893  1.00 49.08  ? 281  ILE B O   1 
ATOM   4823 C CB  . ILE B 1 266 ? 112.927 67.711 10.301  1.00 48.24  ? 281  ILE B CB  1 
ATOM   4824 C CG1 . ILE B 1 266 ? 114.307 67.101 10.538  1.00 49.68  ? 281  ILE B CG1 1 
ATOM   4825 C CG2 . ILE B 1 266 ? 112.881 69.163 10.730  1.00 48.93  ? 281  ILE B CG2 1 
ATOM   4826 C CD1 . ILE B 1 266 ? 115.404 67.700 9.677   1.00 48.79  ? 281  ILE B CD1 1 
ATOM   4827 N N   . ARG B 1 267 ? 109.903 67.504 9.826   1.00 52.08  ? 282  ARG B N   1 
ATOM   4828 C CA  . ARG B 1 267 ? 108.622 68.121 9.533   1.00 55.05  ? 282  ARG B CA  1 
ATOM   4829 C C   . ARG B 1 267 ? 107.595 67.586 10.526  1.00 54.42  ? 282  ARG B C   1 
ATOM   4830 O O   . ARG B 1 267 ? 106.668 68.290 10.923  1.00 57.29  ? 282  ARG B O   1 
ATOM   4831 C CB  . ARG B 1 267 ? 108.239 67.744 8.100   1.00 56.06  ? 282  ARG B CB  1 
ATOM   4832 C CG  . ARG B 1 267 ? 106.996 68.365 7.516   1.00 60.87  ? 282  ARG B CG  1 
ATOM   4833 C CD  . ARG B 1 267 ? 106.778 67.747 6.137   1.00 62.74  ? 282  ARG B CD  1 
ATOM   4834 N NE  . ARG B 1 267 ? 108.013 67.790 5.344   1.00 64.63  ? 282  ARG B NE  1 
ATOM   4835 C CZ  . ARG B 1 267 ? 108.269 67.027 4.278   1.00 64.15  ? 282  ARG B CZ  1 
ATOM   4836 N NH1 . ARG B 1 267 ? 107.371 66.141 3.855   1.00 63.69  ? 282  ARG B NH1 1 
ATOM   4837 N NH2 . ARG B 1 267 ? 109.434 67.143 3.640   1.00 59.85  ? 282  ARG B NH2 1 
ATOM   4838 N N   . GLU B 1 268 ? 107.782 66.335 10.933  1.00 55.11  ? 283  GLU B N   1 
ATOM   4839 C CA  . GLU B 1 268 ? 106.880 65.661 11.863  1.00 53.91  ? 283  GLU B CA  1 
ATOM   4840 C C   . GLU B 1 268 ? 107.019 66.097 13.315  1.00 52.42  ? 283  GLU B C   1 
ATOM   4841 O O   . GLU B 1 268 ? 106.028 66.202 14.041  1.00 46.87  ? 283  GLU B O   1 
ATOM   4842 C CB  . GLU B 1 268 ? 107.102 64.157 11.777  1.00 58.59  ? 283  GLU B CB  1 
ATOM   4843 C CG  . GLU B 1 268 ? 106.521 63.534 10.551  1.00 64.93  ? 283  GLU B CG  1 
ATOM   4844 C CD  . GLU B 1 268 ? 105.032 63.760 10.478  1.00 69.68  ? 283  GLU B CD  1 
ATOM   4845 O OE1 . GLU B 1 268 ? 104.329 63.465 11.472  1.00 72.24  ? 283  GLU B OE1 1 
ATOM   4846 O OE2 . GLU B 1 268 ? 104.563 64.235 9.425   1.00 75.28  ? 283  GLU B OE2 1 
ATOM   4847 N N   . MET B 1 269 ? 108.260 66.329 13.733  1.00 50.31  ? 284  MET B N   1 
ATOM   4848 C CA  . MET B 1 269 ? 108.545 66.747 15.095  1.00 51.34  ? 284  MET B CA  1 
ATOM   4849 C C   . MET B 1 269 ? 108.262 68.226 15.292  1.00 50.07  ? 284  MET B C   1 
ATOM   4850 O O   . MET B 1 269 ? 107.900 68.646 16.384  1.00 49.36  ? 284  MET B O   1 
ATOM   4851 C CB  . MET B 1 269 ? 110.000 66.458 15.431  1.00 49.51  ? 284  MET B CB  1 
ATOM   4852 C CG  . MET B 1 269 ? 110.371 65.009 15.277  1.00 48.57  ? 284  MET B CG  1 
ATOM   4853 S SD  . MET B 1 269 ? 112.064 64.746 15.776  1.00 47.43  ? 284  MET B SD  1 
ATOM   4854 C CE  . MET B 1 269 ? 112.946 65.157 14.274  1.00 46.94  ? 284  MET B CE  1 
ATOM   4855 N N   . ASN B 1 270 ? 108.433 69.016 14.236  1.00 50.41  ? 285  ASN B N   1 
ATOM   4856 C CA  . ASN B 1 270 ? 108.174 70.451 14.315  1.00 52.51  ? 285  ASN B CA  1 
ATOM   4857 C C   . ASN B 1 270 ? 108.101 71.102 12.934  1.00 52.34  ? 285  ASN B C   1 
ATOM   4858 O O   . ASN B 1 270 ? 109.119 71.484 12.359  1.00 49.58  ? 285  ASN B O   1 
ATOM   4859 C CB  . ASN B 1 270 ? 109.252 71.128 15.168  1.00 52.08  ? 285  ASN B CB  1 
ATOM   4860 C CG  . ASN B 1 270 ? 108.952 72.590 15.430  1.00 52.11  ? 285  ASN B CG  1 
ATOM   4861 O OD1 . ASN B 1 270 ? 107.804 73.033 15.329  1.00 51.40  ? 285  ASN B OD1 1 
ATOM   4862 N ND2 . ASN B 1 270 ? 109.980 73.345 15.786  1.00 48.69  ? 285  ASN B ND2 1 
ATOM   4863 N N   . PRO B 1 271 ? 106.884 71.235 12.385  1.00 54.41  ? 286  PRO B N   1 
ATOM   4864 C CA  . PRO B 1 271 ? 106.662 71.838 11.070  1.00 56.26  ? 286  PRO B CA  1 
ATOM   4865 C C   . PRO B 1 271 ? 107.302 73.208 10.943  1.00 58.62  ? 286  PRO B C   1 
ATOM   4866 O O   . PRO B 1 271 ? 107.805 73.569 9.883   1.00 60.12  ? 286  PRO B O   1 
ATOM   4867 C CB  . PRO B 1 271 ? 105.145 71.912 10.978  1.00 54.48  ? 286  PRO B CB  1 
ATOM   4868 C CG  . PRO B 1 271 ? 104.717 70.710 11.744  1.00 56.49  ? 286  PRO B CG  1 
ATOM   4869 C CD  . PRO B 1 271 ? 105.607 70.791 12.966  1.00 54.35  ? 286  PRO B CD  1 
ATOM   4870 N N   . ASN B 1 272 ? 107.293 73.973 12.028  1.00 60.30  ? 287  ASN B N   1 
ATOM   4871 C CA  . ASN B 1 272 ? 107.871 75.308 11.996  1.00 60.59  ? 287  ASN B CA  1 
ATOM   4872 C C   . ASN B 1 272 ? 109.389 75.293 11.989  1.00 58.81  ? 287  ASN B C   1 
ATOM   4873 O O   . ASN B 1 272 ? 110.013 76.348 11.972  1.00 60.56  ? 287  ASN B O   1 
ATOM   4874 C CB  . ASN B 1 272 ? 107.364 76.135 13.181  1.00 61.94  ? 287  ASN B CB  1 
ATOM   4875 C CG  . ASN B 1 272 ? 105.848 76.133 13.284  1.00 67.90  ? 287  ASN B CG  1 
ATOM   4876 O OD1 . ASN B 1 272 ? 105.147 76.526 12.347  1.00 70.57  ? 287  ASN B OD1 1 
ATOM   4877 N ND2 . ASN B 1 272 ? 105.332 75.684 14.425  1.00 69.51  ? 287  ASN B ND2 1 
ATOM   4878 N N   . TYR B 1 273 ? 109.999 74.113 12.010  1.00 55.11  ? 288  TYR B N   1 
ATOM   4879 C CA  . TYR B 1 273 ? 111.459 74.071 11.982  1.00 55.65  ? 288  TYR B CA  1 
ATOM   4880 C C   . TYR B 1 273 ? 111.997 73.843 10.576  1.00 58.69  ? 288  TYR B C   1 
ATOM   4881 O O   . TYR B 1 273 ? 111.482 73.005 9.832   1.00 61.29  ? 288  TYR B O   1 
ATOM   4882 C CB  . TYR B 1 273 ? 112.019 72.999 12.919  1.00 50.53  ? 288  TYR B CB  1 
ATOM   4883 C CG  . TYR B 1 273 ? 113.536 72.992 12.941  1.00 48.16  ? 288  TYR B CG  1 
ATOM   4884 C CD1 . TYR B 1 273 ? 114.267 72.146 12.105  1.00 44.25  ? 288  TYR B CD1 1 
ATOM   4885 C CD2 . TYR B 1 273 ? 114.241 73.849 13.785  1.00 47.40  ? 288  TYR B CD2 1 
ATOM   4886 C CE1 . TYR B 1 273 ? 115.668 72.151 12.113  1.00 44.27  ? 288  TYR B CE1 1 
ATOM   4887 C CE2 . TYR B 1 273 ? 115.635 73.863 13.800  1.00 44.89  ? 288  TYR B CE2 1 
ATOM   4888 C CZ  . TYR B 1 273 ? 116.343 73.012 12.965  1.00 45.67  ? 288  TYR B CZ  1 
ATOM   4889 O OH  . TYR B 1 273 ? 117.722 73.018 13.002  1.00 47.13  ? 288  TYR B OH  1 
ATOM   4890 N N   . THR B 1 274 ? 113.050 74.582 10.233  1.00 60.48  ? 289  THR B N   1 
ATOM   4891 C CA  . THR B 1 274 ? 113.657 74.501 8.910   1.00 62.54  ? 289  THR B CA  1 
ATOM   4892 C C   . THR B 1 274 ? 115.182 74.512 8.898   1.00 63.81  ? 289  THR B C   1 
ATOM   4893 O O   . THR B 1 274 ? 115.813 75.436 9.413   1.00 65.91  ? 289  THR B O   1 
ATOM   4894 C CB  . THR B 1 274 ? 113.192 75.680 8.021   1.00 64.65  ? 289  THR B CB  1 
ATOM   4895 O OG1 . THR B 1 274 ? 111.771 75.622 7.849   1.00 64.60  ? 289  THR B OG1 1 
ATOM   4896 C CG2 . THR B 1 274 ? 113.888 75.638 6.663   1.00 62.77  ? 289  THR B CG2 1 
ATOM   4897 N N   . GLU B 1 275 ? 115.777 73.485 8.309   1.00 64.73  ? 290  GLU B N   1 
ATOM   4898 C CA  . GLU B 1 275 ? 117.225 73.440 8.198   1.00 68.04  ? 290  GLU B CA  1 
ATOM   4899 C C   . GLU B 1 275 ? 117.514 73.043 6.758   1.00 71.33  ? 290  GLU B C   1 
ATOM   4900 O O   . GLU B 1 275 ? 117.512 71.865 6.399   1.00 72.41  ? 290  GLU B O   1 
ATOM   4901 C CB  . GLU B 1 275 ? 117.836 72.436 9.171   1.00 66.79  ? 290  GLU B CB  1 
ATOM   4902 C CG  . GLU B 1 275 ? 119.358 72.531 9.237   1.00 64.77  ? 290  GLU B CG  1 
ATOM   4903 C CD  . GLU B 1 275 ? 119.935 71.878 10.483  1.00 66.13  ? 290  GLU B CD  1 
ATOM   4904 O OE1 . GLU B 1 275 ? 121.176 71.825 10.598  1.00 66.39  ? 290  GLU B OE1 1 
ATOM   4905 O OE2 . GLU B 1 275 ? 119.156 71.423 11.355  1.00 65.07  ? 290  GLU B OE2 1 
ATOM   4906 N N   . PHE B 1 276 ? 117.738 74.060 5.935   1.00 73.75  ? 291  PHE B N   1 
ATOM   4907 C CA  . PHE B 1 276 ? 117.990 73.891 4.512   1.00 75.09  ? 291  PHE B CA  1 
ATOM   4908 C C   . PHE B 1 276 ? 118.945 72.765 4.124   1.00 73.57  ? 291  PHE B C   1 
ATOM   4909 O O   . PHE B 1 276 ? 118.788 72.168 3.063   1.00 74.17  ? 291  PHE B O   1 
ATOM   4910 C CB  . PHE B 1 276 ? 118.443 75.232 3.918   1.00 76.56  ? 291  PHE B CB  1 
ATOM   4911 C CG  . PHE B 1 276 ? 117.453 76.352 4.143   1.00 77.38  ? 291  PHE B CG  1 
ATOM   4912 C CD1 . PHE B 1 276 ? 117.680 77.328 5.109   1.00 78.37  ? 291  PHE B CD1 1 
ATOM   4913 C CD2 . PHE B 1 276 ? 116.266 76.399 3.416   1.00 78.29  ? 291  PHE B CD2 1 
ATOM   4914 C CE1 . PHE B 1 276 ? 116.727 78.332 5.352   1.00 79.54  ? 291  PHE B CE1 1 
ATOM   4915 C CE2 . PHE B 1 276 ? 115.309 77.394 3.648   1.00 76.44  ? 291  PHE B CE2 1 
ATOM   4916 C CZ  . PHE B 1 276 ? 115.544 78.364 4.620   1.00 77.28  ? 291  PHE B CZ  1 
ATOM   4917 N N   . LYS B 1 277 ? 119.924 72.456 4.966   1.00 73.18  ? 292  LYS B N   1 
ATOM   4918 C CA  . LYS B 1 277 ? 120.841 71.365 4.645   1.00 73.25  ? 292  LYS B CA  1 
ATOM   4919 C C   . LYS B 1 277 ? 121.714 70.976 5.821   1.00 72.94  ? 292  LYS B C   1 
ATOM   4920 O O   . LYS B 1 277 ? 122.031 71.812 6.667   1.00 74.57  ? 292  LYS B O   1 
ATOM   4921 C CB  . LYS B 1 277 ? 121.727 71.731 3.452   1.00 75.82  ? 292  LYS B CB  1 
ATOM   4922 C CG  . LYS B 1 277 ? 122.743 72.838 3.698   1.00 77.15  ? 292  LYS B CG  1 
ATOM   4923 C CD  . LYS B 1 277 ? 123.631 72.978 2.465   1.00 81.69  ? 292  LYS B CD  1 
ATOM   4924 C CE  . LYS B 1 277 ? 124.701 74.054 2.615   1.00 83.45  ? 292  LYS B CE  1 
ATOM   4925 N NZ  . LYS B 1 277 ? 125.531 74.168 1.370   1.00 83.07  ? 292  LYS B NZ  1 
ATOM   4926 N N   . PHE B 1 278 ? 122.097 69.701 5.865   1.00 69.84  ? 293  PHE B N   1 
ATOM   4927 C CA  . PHE B 1 278 ? 122.938 69.177 6.936   1.00 65.63  ? 293  PHE B CA  1 
ATOM   4928 C C   . PHE B 1 278 ? 123.565 67.851 6.547   1.00 64.30  ? 293  PHE B C   1 
ATOM   4929 O O   . PHE B 1 278 ? 122.997 67.091 5.767   1.00 64.59  ? 293  PHE B O   1 
ATOM   4930 C CB  . PHE B 1 278 ? 122.117 68.997 8.212   1.00 62.89  ? 293  PHE B CB  1 
ATOM   4931 C CG  . PHE B 1 278 ? 120.900 68.138 8.033   1.00 60.20  ? 293  PHE B CG  1 
ATOM   4932 C CD1 . PHE B 1 278 ? 120.988 66.748 8.117   1.00 58.69  ? 293  PHE B CD1 1 
ATOM   4933 C CD2 . PHE B 1 278 ? 119.659 68.721 7.773   1.00 55.90  ? 293  PHE B CD2 1 
ATOM   4934 C CE1 . PHE B 1 278 ? 119.850 65.946 7.945   1.00 57.16  ? 293  PHE B CE1 1 
ATOM   4935 C CE2 . PHE B 1 278 ? 118.514 67.937 7.598   1.00 55.22  ? 293  PHE B CE2 1 
ATOM   4936 C CZ  . PHE B 1 278 ? 118.608 66.546 7.685   1.00 54.25  ? 293  PHE B CZ  1 
ATOM   4937 N N   . PRO B 1 279 ? 124.752 67.556 7.096   1.00 64.76  ? 294  PRO B N   1 
ATOM   4938 C CA  . PRO B 1 279 ? 125.477 66.315 6.815   1.00 65.49  ? 294  PRO B CA  1 
ATOM   4939 C C   . PRO B 1 279 ? 124.748 65.144 7.452   1.00 68.11  ? 294  PRO B C   1 
ATOM   4940 O O   . PRO B 1 279 ? 124.398 65.194 8.634   1.00 70.66  ? 294  PRO B O   1 
ATOM   4941 C CB  . PRO B 1 279 ? 126.839 66.566 7.453   1.00 64.67  ? 294  PRO B CB  1 
ATOM   4942 C CG  . PRO B 1 279 ? 126.481 67.362 8.658   1.00 65.12  ? 294  PRO B CG  1 
ATOM   4943 C CD  . PRO B 1 279 ? 125.461 68.351 8.115   1.00 66.52  ? 294  PRO B CD  1 
ATOM   4944 N N   . GLN B 1 280 ? 124.534 64.084 6.682   1.00 67.64  ? 295  GLN B N   1 
ATOM   4945 C CA  . GLN B 1 280 ? 123.811 62.935 7.200   1.00 66.95  ? 295  GLN B CA  1 
ATOM   4946 C C   . GLN B 1 280 ? 124.587 61.821 7.882   1.00 65.47  ? 295  GLN B C   1 
ATOM   4947 O O   . GLN B 1 280 ? 125.683 61.437 7.469   1.00 66.61  ? 295  GLN B O   1 
ATOM   4948 C CB  . GLN B 1 280 ? 122.939 62.351 6.100   1.00 68.04  ? 295  GLN B CB  1 
ATOM   4949 C CG  . GLN B 1 280 ? 121.744 63.215 5.805   1.00 71.71  ? 295  GLN B CG  1 
ATOM   4950 C CD  . GLN B 1 280 ? 121.055 62.804 4.537   1.00 75.38  ? 295  GLN B CD  1 
ATOM   4951 O OE1 . GLN B 1 280 ? 120.708 61.636 4.358   1.00 77.20  ? 295  GLN B OE1 1 
ATOM   4952 N NE2 . GLN B 1 280 ? 120.850 63.762 3.639   1.00 76.12  ? 295  GLN B NE2 1 
ATOM   4953 N N   . ILE B 1 281 ? 123.977 61.325 8.954   1.00 64.19  ? 296  ILE B N   1 
ATOM   4954 C CA  . ILE B 1 281 ? 124.505 60.234 9.754   1.00 63.03  ? 296  ILE B CA  1 
ATOM   4955 C C   . ILE B 1 281 ? 123.471 59.110 9.662   1.00 62.98  ? 296  ILE B C   1 
ATOM   4956 O O   . ILE B 1 281 ? 122.260 59.351 9.705   1.00 63.07  ? 296  ILE B O   1 
ATOM   4957 C CB  . ILE B 1 281 ? 124.680 60.645 11.241  1.00 63.77  ? 296  ILE B CB  1 
ATOM   4958 C CG1 . ILE B 1 281 ? 125.650 61.823 11.346  1.00 63.33  ? 296  ILE B CG1 1 
ATOM   4959 C CG2 . ILE B 1 281 ? 125.191 59.460 12.064  1.00 61.08  ? 296  ILE B CG2 1 
ATOM   4960 C CD1 . ILE B 1 281 ? 127.022 61.548 10.760  1.00 63.43  ? 296  ILE B CD1 1 
ATOM   4961 N N   . LYS B 1 282 ? 123.946 57.882 9.516   1.00 61.51  ? 297  LYS B N   1 
ATOM   4962 C CA  . LYS B 1 282 ? 123.046 56.751 9.420   1.00 59.55  ? 297  LYS B CA  1 
ATOM   4963 C C   . LYS B 1 282 ? 122.853 56.134 10.808  1.00 56.37  ? 297  LYS B C   1 
ATOM   4964 O O   . LYS B 1 282 ? 123.754 56.152 11.665  1.00 53.34  ? 297  LYS B O   1 
ATOM   4965 C CB  . LYS B 1 282 ? 123.605 55.734 8.414   1.00 59.94  ? 297  LYS B CB  1 
ATOM   4966 C CG  . LYS B 1 282 ? 122.628 54.638 7.968   1.00 64.05  ? 297  LYS B CG  1 
ATOM   4967 C CD  . LYS B 1 282 ? 121.229 55.177 7.649   1.00 65.03  ? 297  LYS B CD  1 
ATOM   4968 C CE  . LYS B 1 282 ? 120.279 54.935 8.823   1.00 63.04  ? 297  LYS B CE  1 
ATOM   4969 N NZ  . LYS B 1 282 ? 118.957 55.605 8.689   1.00 61.08  ? 297  LYS B NZ  1 
ATOM   4970 N N   . ALA B 1 283 ? 121.654 55.615 11.032  1.00 54.42  ? 298  ALA B N   1 
ATOM   4971 C CA  . ALA B 1 283 ? 121.309 55.000 12.299  1.00 54.10  ? 298  ALA B CA  1 
ATOM   4972 C C   . ALA B 1 283 ? 122.212 53.818 12.618  1.00 52.00  ? 298  ALA B C   1 
ATOM   4973 O O   . ALA B 1 283 ? 122.692 53.114 11.731  1.00 51.74  ? 298  ALA B O   1 
ATOM   4974 C CB  . ALA B 1 283 ? 119.852 54.553 12.276  1.00 51.39  ? 298  ALA B CB  1 
ATOM   4975 N N   . HIS B 1 284 ? 122.442 53.613 13.902  1.00 49.77  ? 299  HIS B N   1 
ATOM   4976 C CA  . HIS B 1 284 ? 123.253 52.513 14.364  1.00 49.87  ? 299  HIS B CA  1 
ATOM   4977 C C   . HIS B 1 284 ? 122.318 51.294 14.440  1.00 50.10  ? 299  HIS B C   1 
ATOM   4978 O O   . HIS B 1 284 ? 121.123 51.446 14.700  1.00 51.42  ? 299  HIS B O   1 
ATOM   4979 C CB  . HIS B 1 284 ? 123.787 52.853 15.746  1.00 51.63  ? 299  HIS B CB  1 
ATOM   4980 C CG  . HIS B 1 284 ? 124.856 51.928 16.223  1.00 58.52  ? 299  HIS B CG  1 
ATOM   4981 N ND1 . HIS B 1 284 ? 126.173 52.054 15.835  1.00 60.94  ? 299  HIS B ND1 1 
ATOM   4982 C CD2 . HIS B 1 284 ? 124.803 50.845 17.036  1.00 60.79  ? 299  HIS B CD2 1 
ATOM   4983 C CE1 . HIS B 1 284 ? 126.886 51.088 16.391  1.00 63.42  ? 299  HIS B CE1 1 
ATOM   4984 N NE2 . HIS B 1 284 ? 126.078 50.340 17.124  1.00 62.13  ? 299  HIS B NE2 1 
ATOM   4985 N N   . PRO B 1 285 ? 122.837 50.076 14.184  1.00 50.10  ? 300  PRO B N   1 
ATOM   4986 C CA  . PRO B 1 285 ? 122.026 48.845 14.236  1.00 48.09  ? 300  PRO B CA  1 
ATOM   4987 C C   . PRO B 1 285 ? 121.441 48.631 15.629  1.00 43.06  ? 300  PRO B C   1 
ATOM   4988 O O   . PRO B 1 285 ? 122.170 48.644 16.616  1.00 42.17  ? 300  PRO B O   1 
ATOM   4989 C CB  . PRO B 1 285 ? 123.031 47.757 13.862  1.00 47.21  ? 300  PRO B CB  1 
ATOM   4990 C CG  . PRO B 1 285 ? 123.944 48.471 12.900  1.00 47.22  ? 300  PRO B CG  1 
ATOM   4991 C CD  . PRO B 1 285 ? 124.161 49.803 13.594  1.00 47.42  ? 300  PRO B CD  1 
ATOM   4992 N N   . TRP B 1 286 ? 120.131 48.426 15.711  1.00 43.10  ? 301  TRP B N   1 
ATOM   4993 C CA  . TRP B 1 286 ? 119.489 48.253 17.010  1.00 44.40  ? 301  TRP B CA  1 
ATOM   4994 C C   . TRP B 1 286 ? 120.032 47.083 17.811  1.00 43.58  ? 301  TRP B C   1 
ATOM   4995 O O   . TRP B 1 286 ? 120.167 47.168 19.031  1.00 45.69  ? 301  TRP B O   1 
ATOM   4996 C CB  . TRP B 1 286 ? 117.976 48.096 16.844  1.00 43.22  ? 301  TRP B CB  1 
ATOM   4997 C CG  . TRP B 1 286 ? 117.202 49.396 16.860  1.00 43.31  ? 301  TRP B CG  1 
ATOM   4998 C CD1 . TRP B 1 286 ? 116.381 49.878 15.873  1.00 43.63  ? 301  TRP B CD1 1 
ATOM   4999 C CD2 . TRP B 1 286 ? 117.125 50.345 17.940  1.00 42.94  ? 301  TRP B CD2 1 
ATOM   5000 N NE1 . TRP B 1 286 ? 115.796 51.060 16.274  1.00 41.09  ? 301  TRP B NE1 1 
ATOM   5001 C CE2 . TRP B 1 286 ? 116.235 51.370 17.535  1.00 42.98  ? 301  TRP B CE2 1 
ATOM   5002 C CE3 . TRP B 1 286 ? 117.719 50.428 19.209  1.00 41.66  ? 301  TRP B CE3 1 
ATOM   5003 C CZ2 . TRP B 1 286 ? 115.927 52.465 18.356  1.00 42.38  ? 301  TRP B CZ2 1 
ATOM   5004 C CZ3 . TRP B 1 286 ? 117.411 51.516 20.021  1.00 41.38  ? 301  TRP B CZ3 1 
ATOM   5005 C CH2 . TRP B 1 286 ? 116.522 52.520 19.589  1.00 42.98  ? 301  TRP B CH2 1 
ATOM   5006 N N   . THR B 1 287 ? 120.343 45.994 17.117  1.00 43.69  ? 302  THR B N   1 
ATOM   5007 C CA  . THR B 1 287 ? 120.864 44.784 17.747  1.00 44.60  ? 302  THR B CA  1 
ATOM   5008 C C   . THR B 1 287 ? 122.275 44.966 18.297  1.00 44.28  ? 302  THR B C   1 
ATOM   5009 O O   . THR B 1 287 ? 122.724 44.184 19.141  1.00 46.47  ? 302  THR B O   1 
ATOM   5010 C CB  . THR B 1 287 ? 120.841 43.617 16.747  1.00 43.36  ? 302  THR B CB  1 
ATOM   5011 O OG1 . THR B 1 287 ? 121.721 43.890 15.645  1.00 42.28  ? 302  THR B OG1 1 
ATOM   5012 C CG2 . THR B 1 287 ? 119.426 43.436 16.215  1.00 46.74  ? 302  THR B CG2 1 
ATOM   5013 N N   . LYS B 1 288 ? 122.960 46.001 17.807  1.00 44.92  ? 303  LYS B N   1 
ATOM   5014 C CA  . LYS B 1 288 ? 124.318 46.347 18.233  1.00 48.34  ? 303  LYS B CA  1 
ATOM   5015 C C   . LYS B 1 288 ? 124.269 47.274 19.442  1.00 49.86  ? 303  LYS B C   1 
ATOM   5016 O O   . LYS B 1 288 ? 125.195 47.283 20.260  1.00 48.65  ? 303  LYS B O   1 
ATOM   5017 C CB  . LYS B 1 288 ? 125.075 47.058 17.113  1.00 51.82  ? 303  LYS B CB  1 
ATOM   5018 C CG  . LYS B 1 288 ? 125.596 46.146 16.016  1.00 58.25  ? 303  LYS B CG  1 
ATOM   5019 C CD  . LYS B 1 288 ? 126.690 45.201 16.515  1.00 63.27  ? 303  LYS B CD  1 
ATOM   5020 C CE  . LYS B 1 288 ? 127.419 44.541 15.333  1.00 66.86  ? 303  LYS B CE  1 
ATOM   5021 N NZ  . LYS B 1 288 ? 128.582 43.681 15.735  1.00 70.40  ? 303  LYS B NZ  1 
ATOM   5022 N N   . VAL B 1 289 ? 123.186 48.052 19.540  1.00 47.42  ? 304  VAL B N   1 
ATOM   5023 C CA  . VAL B 1 289 ? 122.977 48.997 20.642  1.00 45.21  ? 304  VAL B CA  1 
ATOM   5024 C C   . VAL B 1 289 ? 122.820 48.295 21.995  1.00 43.20  ? 304  VAL B C   1 
ATOM   5025 O O   . VAL B 1 289 ? 123.325 48.779 23.007  1.00 41.05  ? 304  VAL B O   1 
ATOM   5026 C CB  . VAL B 1 289 ? 121.728 49.898 20.394  1.00 47.58  ? 304  VAL B CB  1 
ATOM   5027 C CG1 . VAL B 1 289 ? 121.470 50.786 21.602  1.00 44.65  ? 304  VAL B CG1 1 
ATOM   5028 C CG2 . VAL B 1 289 ? 121.941 50.765 19.166  1.00 48.68  ? 304  VAL B CG2 1 
ATOM   5029 N N   . PHE B 1 290 ? 122.121 47.163 22.015  1.00 41.77  ? 305  PHE B N   1 
ATOM   5030 C CA  . PHE B 1 290 ? 121.932 46.418 23.254  1.00 41.21  ? 305  PHE B CA  1 
ATOM   5031 C C   . PHE B 1 290 ? 122.840 45.202 23.297  1.00 43.49  ? 305  PHE B C   1 
ATOM   5032 O O   . PHE B 1 290 ? 123.391 44.788 22.276  1.00 42.92  ? 305  PHE B O   1 
ATOM   5033 C CB  . PHE B 1 290 ? 120.485 45.935 23.397  1.00 40.81  ? 305  PHE B CB  1 
ATOM   5034 C CG  . PHE B 1 290 ? 119.485 47.037 23.556  1.00 37.41  ? 305  PHE B CG  1 
ATOM   5035 C CD1 . PHE B 1 290 ? 118.821 47.557 22.452  1.00 34.51  ? 305  PHE B CD1 1 
ATOM   5036 C CD2 . PHE B 1 290 ? 119.227 47.575 24.811  1.00 35.87  ? 305  PHE B CD2 1 
ATOM   5037 C CE1 . PHE B 1 290 ? 117.914 48.600 22.593  1.00 35.33  ? 305  PHE B CE1 1 
ATOM   5038 C CE2 . PHE B 1 290 ? 118.321 48.619 24.964  1.00 38.37  ? 305  PHE B CE2 1 
ATOM   5039 C CZ  . PHE B 1 290 ? 117.664 49.133 23.850  1.00 34.54  ? 305  PHE B CZ  1 
ATOM   5040 N N   . ARG B 1 291 ? 122.979 44.623 24.485  1.00 47.37  ? 306  ARG B N   1 
ATOM   5041 C CA  . ARG B 1 291 ? 123.797 43.432 24.644  1.00 52.58  ? 306  ARG B CA  1 
ATOM   5042 C C   . ARG B 1 291 ? 123.192 42.290 23.827  1.00 52.00  ? 306  ARG B C   1 
ATOM   5043 O O   . ARG B 1 291 ? 122.005 42.307 23.496  1.00 52.20  ? 306  ARG B O   1 
ATOM   5044 C CB  . ARG B 1 291 ? 123.920 43.079 26.124  1.00 57.15  ? 306  ARG B CB  1 
ATOM   5045 C CG  . ARG B 1 291 ? 124.796 44.093 26.844  1.00 67.49  ? 306  ARG B CG  1 
ATOM   5046 C CD  . ARG B 1 291 ? 124.848 43.891 28.348  1.00 76.05  ? 306  ARG B CD  1 
ATOM   5047 N NE  . ARG B 1 291 ? 125.713 44.884 28.996  1.00 81.54  ? 306  ARG B NE  1 
ATOM   5048 C CZ  . ARG B 1 291 ? 125.438 46.186 29.094  1.00 84.46  ? 306  ARG B CZ  1 
ATOM   5049 N NH1 . ARG B 1 291 ? 124.310 46.673 28.589  1.00 84.83  ? 306  ARG B NH1 1 
ATOM   5050 N NH2 . ARG B 1 291 ? 126.297 47.005 29.695  1.00 86.39  ? 306  ARG B NH2 1 
ATOM   5051 N N   . PRO B 1 292 ? 124.004 41.278 23.494  1.00 52.32  ? 307  PRO B N   1 
ATOM   5052 C CA  . PRO B 1 292 ? 123.563 40.129 22.697  1.00 51.60  ? 307  PRO B CA  1 
ATOM   5053 C C   . PRO B 1 292 ? 122.414 39.332 23.299  1.00 50.99  ? 307  PRO B C   1 
ATOM   5054 O O   . PRO B 1 292 ? 121.445 38.980 22.606  1.00 49.99  ? 307  PRO B O   1 
ATOM   5055 C CB  . PRO B 1 292 ? 124.834 39.288 22.577  1.00 52.02  ? 307  PRO B CB  1 
ATOM   5056 C CG  . PRO B 1 292 ? 125.941 40.259 22.875  1.00 47.89  ? 307  PRO B CG  1 
ATOM   5057 C CD  . PRO B 1 292 ? 125.368 41.054 23.991  1.00 51.16  ? 307  PRO B CD  1 
ATOM   5058 N N   . ARG B 1 293 ? 122.547 39.045 24.591  1.00 49.36  ? 308  ARG B N   1 
ATOM   5059 C CA  . ARG B 1 293 ? 121.555 38.275 25.317  1.00 52.78  ? 308  ARG B CA  1 
ATOM   5060 C C   . ARG B 1 293 ? 120.233 38.995 25.516  1.00 50.70  ? 308  ARG B C   1 
ATOM   5061 O O   . ARG B 1 293 ? 119.290 38.419 26.059  1.00 51.63  ? 308  ARG B O   1 
ATOM   5062 C CB  . ARG B 1 293 ? 122.118 37.852 26.672  1.00 58.86  ? 308  ARG B CB  1 
ATOM   5063 C CG  . ARG B 1 293 ? 123.127 36.719 26.583  1.00 68.71  ? 308  ARG B CG  1 
ATOM   5064 C CD  . ARG B 1 293 ? 123.537 36.224 27.971  1.00 76.37  ? 308  ARG B CD  1 
ATOM   5065 N NE  . ARG B 1 293 ? 122.380 35.879 28.803  1.00 81.99  ? 308  ARG B NE  1 
ATOM   5066 C CZ  . ARG B 1 293 ? 122.450 35.228 29.965  1.00 85.67  ? 308  ARG B CZ  1 
ATOM   5067 N NH1 . ARG B 1 293 ? 123.628 34.836 30.445  1.00 86.86  ? 308  ARG B NH1 1 
ATOM   5068 N NH2 . ARG B 1 293 ? 121.341 34.976 30.657  1.00 86.40  ? 308  ARG B NH2 1 
ATOM   5069 N N   . THR B 1 294 ? 120.163 40.251 25.082  1.00 47.98  ? 309  THR B N   1 
ATOM   5070 C CA  . THR B 1 294 ? 118.937 41.030 25.216  1.00 46.54  ? 309  THR B CA  1 
ATOM   5071 C C   . THR B 1 294 ? 117.901 40.382 24.311  1.00 44.43  ? 309  THR B C   1 
ATOM   5072 O O   . THR B 1 294 ? 118.150 40.195 23.117  1.00 46.10  ? 309  THR B O   1 
ATOM   5073 C CB  . THR B 1 294 ? 119.134 42.506 24.768  1.00 49.54  ? 309  THR B CB  1 
ATOM   5074 O OG1 . THR B 1 294 ? 119.941 43.215 25.723  1.00 50.40  ? 309  THR B OG1 1 
ATOM   5075 C CG2 . THR B 1 294 ? 117.789 43.198 24.635  1.00 51.47  ? 309  THR B CG2 1 
ATOM   5076 N N   . PRO B 1 295 ? 116.730 40.012 24.869  1.00 42.84  ? 310  PRO B N   1 
ATOM   5077 C CA  . PRO B 1 295 ? 115.673 39.379 24.064  1.00 39.04  ? 310  PRO B CA  1 
ATOM   5078 C C   . PRO B 1 295 ? 115.243 40.235 22.877  1.00 38.56  ? 310  PRO B C   1 
ATOM   5079 O O   . PRO B 1 295 ? 115.118 41.450 22.994  1.00 39.25  ? 310  PRO B O   1 
ATOM   5080 C CB  . PRO B 1 295 ? 114.550 39.134 25.073  1.00 36.71  ? 310  PRO B CB  1 
ATOM   5081 C CG  . PRO B 1 295 ? 114.850 40.097 26.197  1.00 42.07  ? 310  PRO B CG  1 
ATOM   5082 C CD  . PRO B 1 295 ? 116.343 40.092 26.289  1.00 40.28  ? 310  PRO B CD  1 
ATOM   5083 N N   . PRO B 1 296 ? 115.024 39.604 21.711  1.00 37.75  ? 311  PRO B N   1 
ATOM   5084 C CA  . PRO B 1 296 ? 114.615 40.297 20.491  1.00 34.77  ? 311  PRO B CA  1 
ATOM   5085 C C   . PRO B 1 296 ? 113.356 41.146 20.640  1.00 38.15  ? 311  PRO B C   1 
ATOM   5086 O O   . PRO B 1 296 ? 113.298 42.274 20.132  1.00 40.09  ? 311  PRO B O   1 
ATOM   5087 C CB  . PRO B 1 296 ? 114.410 39.154 19.497  1.00 37.52  ? 311  PRO B CB  1 
ATOM   5088 C CG  . PRO B 1 296 ? 115.319 38.090 19.990  1.00 37.30  ? 311  PRO B CG  1 
ATOM   5089 C CD  . PRO B 1 296 ? 115.111 38.151 21.469  1.00 33.62  ? 311  PRO B CD  1 
ATOM   5090 N N   . GLU B 1 297 ? 112.350 40.607 21.326  1.00 34.69  ? 312  GLU B N   1 
ATOM   5091 C CA  . GLU B 1 297 ? 111.085 41.323 21.506  1.00 38.87  ? 312  GLU B CA  1 
ATOM   5092 C C   . GLU B 1 297 ? 111.222 42.623 22.305  1.00 36.25  ? 312  GLU B C   1 
ATOM   5093 O O   . GLU B 1 297 ? 110.443 43.550 22.119  1.00 37.35  ? 312  GLU B O   1 
ATOM   5094 C CB  . GLU B 1 297 ? 110.039 40.403 22.149  1.00 38.92  ? 312  GLU B CB  1 
ATOM   5095 C CG  . GLU B 1 297 ? 109.893 39.048 21.448  1.00 41.91  ? 312  GLU B CG  1 
ATOM   5096 C CD  . GLU B 1 297 ? 108.677 38.241 21.922  1.00 47.18  ? 312  GLU B CD  1 
ATOM   5097 O OE1 . GLU B 1 297 ? 108.554 37.970 23.145  1.00 48.88  ? 312  GLU B OE1 1 
ATOM   5098 O OE2 . GLU B 1 297 ? 107.843 37.874 21.059  1.00 44.42  ? 312  GLU B OE2 1 
ATOM   5099 N N   . ALA B 1 298 ? 112.206 42.701 23.190  1.00 34.00  ? 313  ALA B N   1 
ATOM   5100 C CA  . ALA B 1 298 ? 112.402 43.926 23.952  1.00 36.07  ? 313  ALA B CA  1 
ATOM   5101 C C   . ALA B 1 298 ? 112.993 44.973 23.011  1.00 35.40  ? 313  ALA B C   1 
ATOM   5102 O O   . ALA B 1 298 ? 112.523 46.112 22.952  1.00 34.16  ? 313  ALA B O   1 
ATOM   5103 C CB  . ALA B 1 298 ? 113.333 43.678 25.112  1.00 33.89  ? 313  ALA B CB  1 
ATOM   5104 N N   . ILE B 1 299 ? 114.028 44.569 22.279  1.00 35.03  ? 314  ILE B N   1 
ATOM   5105 C CA  . ILE B 1 299 ? 114.697 45.425 21.303  1.00 35.01  ? 314  ILE B CA  1 
ATOM   5106 C C   . ILE B 1 299 ? 113.697 45.885 20.225  1.00 36.68  ? 314  ILE B C   1 
ATOM   5107 O O   . ILE B 1 299 ? 113.713 47.043 19.778  1.00 38.02  ? 314  ILE B O   1 
ATOM   5108 C CB  . ILE B 1 299 ? 115.831 44.661 20.590  1.00 31.77  ? 314  ILE B CB  1 
ATOM   5109 C CG1 . ILE B 1 299 ? 116.835 44.134 21.613  1.00 32.20  ? 314  ILE B CG1 1 
ATOM   5110 C CG2 . ILE B 1 299 ? 116.504 45.560 19.580  1.00 29.72  ? 314  ILE B CG2 1 
ATOM   5111 C CD1 . ILE B 1 299 ? 117.983 43.351 20.994  1.00 31.39  ? 314  ILE B CD1 1 
ATOM   5112 N N   . ALA B 1 300 ? 112.834 44.969 19.793  1.00 36.11  ? 315  ALA B N   1 
ATOM   5113 C CA  . ALA B 1 300 ? 111.850 45.301 18.774  1.00 33.91  ? 315  ALA B CA  1 
ATOM   5114 C C   . ALA B 1 300 ? 110.915 46.382 19.313  1.00 35.58  ? 315  ALA B C   1 
ATOM   5115 O O   . ALA B 1 300 ? 110.753 47.443 18.713  1.00 32.80  ? 315  ALA B O   1 
ATOM   5116 C CB  . ALA B 1 300 ? 111.064 44.060 18.394  1.00 33.30  ? 315  ALA B CB  1 
ATOM   5117 N N   . LEU B 1 301 ? 110.305 46.101 20.457  1.00 33.93  ? 316  LEU B N   1 
ATOM   5118 C CA  . LEU B 1 301 ? 109.399 47.036 21.085  1.00 31.94  ? 316  LEU B CA  1 
ATOM   5119 C C   . LEU B 1 301 ? 110.063 48.390 21.229  1.00 35.00  ? 316  LEU B C   1 
ATOM   5120 O O   . LEU B 1 301 ? 109.503 49.419 20.867  1.00 33.59  ? 316  LEU B O   1 
ATOM   5121 C CB  . LEU B 1 301 ? 109.005 46.521 22.464  1.00 30.45  ? 316  LEU B CB  1 
ATOM   5122 C CG  . LEU B 1 301 ? 108.253 47.508 23.358  1.00 32.75  ? 316  LEU B CG  1 
ATOM   5123 C CD1 . LEU B 1 301 ? 107.042 48.067 22.626  1.00 31.33  ? 316  LEU B CD1 1 
ATOM   5124 C CD2 . LEU B 1 301 ? 107.831 46.805 24.636  1.00 32.75  ? 316  LEU B CD2 1 
ATOM   5125 N N   . CYS B 1 302 ? 111.274 48.379 21.757  1.00 38.52  ? 317  CYS B N   1 
ATOM   5126 C CA  . CYS B 1 302 ? 112.013 49.606 21.977  1.00 39.95  ? 317  CYS B CA  1 
ATOM   5127 C C   . CYS B 1 302 ? 112.176 50.428 20.708  1.00 39.69  ? 317  CYS B C   1 
ATOM   5128 O O   . CYS B 1 302 ? 112.029 51.642 20.723  1.00 39.99  ? 317  CYS B O   1 
ATOM   5129 C CB  . CYS B 1 302 ? 113.376 49.270 22.559  1.00 44.60  ? 317  CYS B CB  1 
ATOM   5130 S SG  . CYS B 1 302 ? 114.169 50.646 23.319  1.00 52.27  ? 317  CYS B SG  1 
ATOM   5131 N N   . SER B 1 303 ? 112.470 49.765 19.601  1.00 38.96  ? 318  SER B N   1 
ATOM   5132 C CA  . SER B 1 303 ? 112.649 50.475 18.345  1.00 40.03  ? 318  SER B CA  1 
ATOM   5133 C C   . SER B 1 303 ? 111.349 51.096 17.825  1.00 40.95  ? 318  SER B C   1 
ATOM   5134 O O   . SER B 1 303 ? 111.377 51.873 16.871  1.00 40.57  ? 318  SER B O   1 
ATOM   5135 C CB  . SER B 1 303 ? 113.199 49.526 17.286  1.00 39.85  ? 318  SER B CB  1 
ATOM   5136 O OG  . SER B 1 303 ? 112.175 48.671 16.800  1.00 45.35  ? 318  SER B OG  1 
ATOM   5137 N N   . ARG B 1 304 ? 110.218 50.742 18.438  1.00 39.24  ? 319  ARG B N   1 
ATOM   5138 C CA  . ARG B 1 304 ? 108.908 51.261 18.029  1.00 38.23  ? 319  ARG B CA  1 
ATOM   5139 C C   . ARG B 1 304 ? 108.473 52.379 18.950  1.00 39.94  ? 319  ARG B C   1 
ATOM   5140 O O   . ARG B 1 304 ? 107.399 52.964 18.787  1.00 43.49  ? 319  ARG B O   1 
ATOM   5141 C CB  . ARG B 1 304 ? 107.851 50.158 18.067  1.00 40.19  ? 319  ARG B CB  1 
ATOM   5142 C CG  . ARG B 1 304 ? 108.073 49.072 17.056  1.00 41.33  ? 319  ARG B CG  1 
ATOM   5143 C CD  . ARG B 1 304 ? 107.900 49.611 15.648  1.00 41.06  ? 319  ARG B CD  1 
ATOM   5144 N NE  . ARG B 1 304 ? 106.753 48.986 14.996  1.00 50.49  ? 319  ARG B NE  1 
ATOM   5145 C CZ  . ARG B 1 304 ? 105.563 49.558 14.826  1.00 48.94  ? 319  ARG B CZ  1 
ATOM   5146 N NH1 . ARG B 1 304 ? 105.345 50.797 15.250  1.00 57.40  ? 319  ARG B NH1 1 
ATOM   5147 N NH2 . ARG B 1 304 ? 104.580 48.875 14.253  1.00 47.89  ? 319  ARG B NH2 1 
ATOM   5148 N N   . LEU B 1 305 ? 109.312 52.658 19.935  1.00 38.99  ? 320  LEU B N   1 
ATOM   5149 C CA  . LEU B 1 305 ? 109.025 53.710 20.888  1.00 38.54  ? 320  LEU B CA  1 
ATOM   5150 C C   . LEU B 1 305 ? 110.000 54.841 20.619  1.00 39.97  ? 320  LEU B C   1 
ATOM   5151 O O   . LEU B 1 305 ? 109.606 55.999 20.548  1.00 39.88  ? 320  LEU B O   1 
ATOM   5152 C CB  . LEU B 1 305 ? 109.197 53.186 22.310  1.00 35.46  ? 320  LEU B CB  1 
ATOM   5153 C CG  . LEU B 1 305 ? 108.353 51.951 22.633  1.00 37.29  ? 320  LEU B CG  1 
ATOM   5154 C CD1 . LEU B 1 305 ? 108.823 51.352 23.932  1.00 34.65  ? 320  LEU B CD1 1 
ATOM   5155 C CD2 . LEU B 1 305 ? 106.895 52.315 22.720  1.00 27.59  ? 320  LEU B CD2 1 
ATOM   5156 N N   . LEU B 1 306 ? 111.272 54.495 20.449  1.00 36.32  ? 321  LEU B N   1 
ATOM   5157 C CA  . LEU B 1 306 ? 112.299 55.486 20.185  1.00 33.76  ? 321  LEU B CA  1 
ATOM   5158 C C   . LEU B 1 306 ? 112.402 55.779 18.693  1.00 37.75  ? 321  LEU B C   1 
ATOM   5159 O O   . LEU B 1 306 ? 113.351 55.381 18.016  1.00 36.78  ? 321  LEU B O   1 
ATOM   5160 C CB  . LEU B 1 306 ? 113.638 55.009 20.742  1.00 29.14  ? 321  LEU B CB  1 
ATOM   5161 C CG  . LEU B 1 306 ? 113.579 54.628 22.231  1.00 33.22  ? 321  LEU B CG  1 
ATOM   5162 C CD1 . LEU B 1 306 ? 114.976 54.292 22.729  1.00 30.02  ? 321  LEU B CD1 1 
ATOM   5163 C CD2 . LEU B 1 306 ? 112.980 55.762 23.054  1.00 33.39  ? 321  LEU B CD2 1 
ATOM   5164 N N   . GLU B 1 307 ? 111.393 56.489 18.203  1.00 39.73  ? 322  GLU B N   1 
ATOM   5165 C CA  . GLU B 1 307 ? 111.280 56.896 16.811  1.00 42.50  ? 322  GLU B CA  1 
ATOM   5166 C C   . GLU B 1 307 ? 111.187 58.421 16.720  1.00 41.81  ? 322  GLU B C   1 
ATOM   5167 O O   . GLU B 1 307 ? 110.540 59.050 17.556  1.00 44.60  ? 322  GLU B O   1 
ATOM   5168 C CB  . GLU B 1 307 ? 110.011 56.292 16.210  1.00 45.03  ? 322  GLU B CB  1 
ATOM   5169 C CG  . GLU B 1 307 ? 110.125 54.825 15.906  1.00 52.51  ? 322  GLU B CG  1 
ATOM   5170 C CD  . GLU B 1 307 ? 110.343 54.566 14.428  1.00 56.03  ? 322  GLU B CD  1 
ATOM   5171 O OE1 . GLU B 1 307 ? 110.952 55.434 13.750  1.00 56.72  ? 322  GLU B OE1 1 
ATOM   5172 O OE2 . GLU B 1 307 ? 109.910 53.490 13.949  1.00 56.93  ? 322  GLU B OE2 1 
ATOM   5173 N N   . TYR B 1 308 ? 111.824 59.009 15.709  1.00 41.23  ? 323  TYR B N   1 
ATOM   5174 C CA  . TYR B 1 308 ? 111.782 60.460 15.494  1.00 40.19  ? 323  TYR B CA  1 
ATOM   5175 C C   . TYR B 1 308 ? 110.363 60.973 15.239  1.00 42.18  ? 323  TYR B C   1 
ATOM   5176 O O   . TYR B 1 308 ? 109.938 61.969 15.835  1.00 43.01  ? 323  TYR B O   1 
ATOM   5177 C CB  . TYR B 1 308 ? 112.662 60.840 14.310  1.00 35.84  ? 323  TYR B CB  1 
ATOM   5178 C CG  . TYR B 1 308 ? 114.112 61.025 14.661  1.00 34.70  ? 323  TYR B CG  1 
ATOM   5179 C CD1 . TYR B 1 308 ? 115.117 60.575 13.810  1.00 35.68  ? 323  TYR B CD1 1 
ATOM   5180 C CD2 . TYR B 1 308 ? 114.486 61.711 15.817  1.00 34.16  ? 323  TYR B CD2 1 
ATOM   5181 C CE1 . TYR B 1 308 ? 116.468 60.810 14.101  1.00 37.72  ? 323  TYR B CE1 1 
ATOM   5182 C CE2 . TYR B 1 308 ? 115.820 61.954 16.111  1.00 33.64  ? 323  TYR B CE2 1 
ATOM   5183 C CZ  . TYR B 1 308 ? 116.805 61.506 15.253  1.00 33.00  ? 323  TYR B CZ  1 
ATOM   5184 O OH  . TYR B 1 308 ? 118.128 61.773 15.532  1.00 38.95  ? 323  TYR B OH  1 
ATOM   5185 N N   . THR B 1 309 ? 109.635 60.297 14.348  1.00 42.02  ? 324  THR B N   1 
ATOM   5186 C CA  . THR B 1 309 ? 108.261 60.692 14.021  1.00 42.95  ? 324  THR B CA  1 
ATOM   5187 C C   . THR B 1 309 ? 107.261 60.323 15.122  1.00 44.11  ? 324  THR B C   1 
ATOM   5188 O O   . THR B 1 309 ? 106.875 59.155 15.266  1.00 46.83  ? 324  THR B O   1 
ATOM   5189 C CB  . THR B 1 309 ? 107.797 60.054 12.695  1.00 40.81  ? 324  THR B CB  1 
ATOM   5190 O OG1 . THR B 1 309 ? 108.597 60.560 11.616  1.00 41.96  ? 324  THR B OG1 1 
ATOM   5191 C CG2 . THR B 1 309 ? 106.333 60.374 12.436  1.00 37.22  ? 324  THR B CG2 1 
ATOM   5192 N N   . PRO B 1 310 ? 106.823 61.325 15.911  1.00 45.21  ? 325  PRO B N   1 
ATOM   5193 C CA  . PRO B 1 310 ? 105.867 61.150 17.017  1.00 43.69  ? 325  PRO B CA  1 
ATOM   5194 C C   . PRO B 1 310 ? 104.660 60.237 16.736  1.00 43.34  ? 325  PRO B C   1 
ATOM   5195 O O   . PRO B 1 310 ? 104.277 59.409 17.560  1.00 41.89  ? 325  PRO B O   1 
ATOM   5196 C CB  . PRO B 1 310 ? 105.459 62.588 17.329  1.00 41.20  ? 325  PRO B CB  1 
ATOM   5197 C CG  . PRO B 1 310 ? 106.747 63.348 17.074  1.00 43.51  ? 325  PRO B CG  1 
ATOM   5198 C CD  . PRO B 1 310 ? 107.223 62.743 15.776  1.00 46.21  ? 325  PRO B CD  1 
ATOM   5199 N N   . THR B 1 311 ? 104.062 60.404 15.567  1.00 42.94  ? 326  THR B N   1 
ATOM   5200 C CA  . THR B 1 311 ? 102.905 59.617 15.167  1.00 45.45  ? 326  THR B CA  1 
ATOM   5201 C C   . THR B 1 311 ? 103.269 58.156 14.912  1.00 44.60  ? 326  THR B C   1 
ATOM   5202 O O   . THR B 1 311 ? 102.401 57.286 14.952  1.00 44.19  ? 326  THR B O   1 
ATOM   5203 C CB  . THR B 1 311 ? 102.282 60.188 13.879  1.00 46.59  ? 326  THR B CB  1 
ATOM   5204 O OG1 . THR B 1 311 ? 103.328 60.496 12.946  1.00 47.32  ? 326  THR B OG1 1 
ATOM   5205 C CG2 . THR B 1 311 ? 101.489 61.441 14.175  1.00 44.20  ? 326  THR B CG2 1 
ATOM   5206 N N   . ALA B 1 312 ? 104.551 57.904 14.643  1.00 41.84  ? 327  ALA B N   1 
ATOM   5207 C CA  . ALA B 1 312 ? 105.064 56.560 14.368  1.00 42.19  ? 327  ALA B CA  1 
ATOM   5208 C C   . ALA B 1 312 ? 105.154 55.710 15.628  1.00 41.52  ? 327  ALA B C   1 
ATOM   5209 O O   . ALA B 1 312 ? 105.062 54.481 15.570  1.00 44.23  ? 327  ALA B O   1 
ATOM   5210 C CB  . ALA B 1 312 ? 106.441 56.652 13.719  1.00 40.60  ? 327  ALA B CB  1 
ATOM   5211 N N   . ARG B 1 313 ? 105.350 56.374 16.763  1.00 40.78  ? 328  ARG B N   1 
ATOM   5212 C CA  . ARG B 1 313 ? 105.458 55.690 18.042  1.00 40.36  ? 328  ARG B CA  1 
ATOM   5213 C C   . ARG B 1 313 ? 104.165 54.988 18.404  1.00 40.30  ? 328  ARG B C   1 
ATOM   5214 O O   . ARG B 1 313 ? 103.072 55.448 18.064  1.00 38.20  ? 328  ARG B O   1 
ATOM   5215 C CB  . ARG B 1 313 ? 105.817 56.677 19.152  1.00 37.90  ? 328  ARG B CB  1 
ATOM   5216 C CG  . ARG B 1 313 ? 107.171 57.322 18.981  1.00 38.10  ? 328  ARG B CG  1 
ATOM   5217 C CD  . ARG B 1 313 ? 107.322 58.552 19.864  1.00 37.22  ? 328  ARG B CD  1 
ATOM   5218 N NE  . ARG B 1 313 ? 108.361 59.425 19.323  1.00 38.54  ? 328  ARG B NE  1 
ATOM   5219 C CZ  . ARG B 1 313 ? 108.533 60.697 19.662  1.00 39.81  ? 328  ARG B CZ  1 
ATOM   5220 N NH1 . ARG B 1 313 ? 107.730 61.259 20.557  1.00 37.20  ? 328  ARG B NH1 1 
ATOM   5221 N NH2 . ARG B 1 313 ? 109.494 61.412 19.082  1.00 41.95  ? 328  ARG B NH2 1 
ATOM   5222 N N   . LEU B 1 314 ? 104.317 53.864 19.100  1.00 39.12  ? 329  LEU B N   1 
ATOM   5223 C CA  . LEU B 1 314 ? 103.204 53.042 19.559  1.00 38.11  ? 329  LEU B CA  1 
ATOM   5224 C C   . LEU B 1 314 ? 102.414 53.805 20.628  1.00 38.37  ? 329  LEU B C   1 
ATOM   5225 O O   . LEU B 1 314 ? 102.962 54.668 21.325  1.00 38.37  ? 329  LEU B O   1 
ATOM   5226 C CB  . LEU B 1 314 ? 103.762 51.737 20.158  1.00 35.30  ? 329  LEU B CB  1 
ATOM   5227 C CG  . LEU B 1 314 ? 103.735 50.355 19.479  1.00 35.80  ? 329  LEU B CG  1 
ATOM   5228 C CD1 . LEU B 1 314 ? 103.944 50.424 17.979  1.00 24.62  ? 329  LEU B CD1 1 
ATOM   5229 C CD2 . LEU B 1 314 ? 104.809 49.507 20.139  1.00 36.84  ? 329  LEU B CD2 1 
ATOM   5230 N N   . THR B 1 315 ? 101.125 53.505 20.746  1.00 40.86  ? 330  THR B N   1 
ATOM   5231 C CA  . THR B 1 315 ? 100.312 54.146 21.769  1.00 42.57  ? 330  THR B CA  1 
ATOM   5232 C C   . THR B 1 315 ? 100.451 53.249 23.005  1.00 42.32  ? 330  THR B C   1 
ATOM   5233 O O   . THR B 1 315 ? 100.747 52.062 22.886  1.00 44.41  ? 330  THR B O   1 
ATOM   5234 C CB  . THR B 1 315 ? 98.806  54.257 21.343  1.00 44.40  ? 330  THR B CB  1 
ATOM   5235 O OG1 . THR B 1 315 ? 98.222  52.954 21.249  1.00 46.87  ? 330  THR B OG1 1 
ATOM   5236 C CG2 . THR B 1 315 ? 98.678  54.954 19.996  1.00 41.29  ? 330  THR B CG2 1 
ATOM   5237 N N   . PRO B 1 316 ? 100.267 53.804 24.207  1.00 41.68  ? 331  PRO B N   1 
ATOM   5238 C CA  . PRO B 1 316 ? 100.399 52.953 25.390  1.00 39.46  ? 331  PRO B CA  1 
ATOM   5239 C C   . PRO B 1 316 ? 99.656  51.619 25.290  1.00 40.55  ? 331  PRO B C   1 
ATOM   5240 O O   . PRO B 1 316 ? 100.195 50.578 25.654  1.00 41.65  ? 331  PRO B O   1 
ATOM   5241 C CB  . PRO B 1 316 ? 99.876  53.847 26.501  1.00 39.76  ? 331  PRO B CB  1 
ATOM   5242 C CG  . PRO B 1 316 ? 100.369 55.189 26.063  1.00 39.37  ? 331  PRO B CG  1 
ATOM   5243 C CD  . PRO B 1 316 ? 100.034 55.206 24.591  1.00 35.75  ? 331  PRO B CD  1 
ATOM   5244 N N   . LEU B 1 317 ? 98.424  51.634 24.801  1.00 40.98  ? 332  LEU B N   1 
ATOM   5245 C CA  . LEU B 1 317 ? 97.690  50.382 24.672  1.00 43.43  ? 332  LEU B CA  1 
ATOM   5246 C C   . LEU B 1 317 ? 98.414  49.431 23.733  1.00 45.31  ? 332  LEU B C   1 
ATOM   5247 O O   . LEU B 1 317 ? 98.664  48.285 24.092  1.00 46.73  ? 332  LEU B O   1 
ATOM   5248 C CB  . LEU B 1 317 ? 96.276  50.618 24.151  1.00 46.46  ? 332  LEU B CB  1 
ATOM   5249 C CG  . LEU B 1 317 ? 95.186  50.948 25.170  1.00 47.41  ? 332  LEU B CG  1 
ATOM   5250 C CD1 . LEU B 1 317 ? 93.841  50.932 24.462  1.00 48.92  ? 332  LEU B CD1 1 
ATOM   5251 C CD2 . LEU B 1 317 ? 95.189  49.922 26.293  1.00 45.70  ? 332  LEU B CD2 1 
ATOM   5252 N N   . GLU B 1 318 ? 98.743  49.910 22.533  1.00 45.81  ? 333  GLU B N   1 
ATOM   5253 C CA  . GLU B 1 318 ? 99.457  49.096 21.550  1.00 46.76  ? 333  GLU B CA  1 
ATOM   5254 C C   . GLU B 1 318 ? 100.695 48.469 22.187  1.00 45.02  ? 333  GLU B C   1 
ATOM   5255 O O   . GLU B 1 318 ? 101.009 47.309 21.921  1.00 47.50  ? 333  GLU B O   1 
ATOM   5256 C CB  . GLU B 1 318 ? 99.909  49.936 20.347  1.00 50.20  ? 333  GLU B CB  1 
ATOM   5257 C CG  . GLU B 1 318 ? 98.814  50.708 19.627  1.00 52.13  ? 333  GLU B CG  1 
ATOM   5258 C CD  . GLU B 1 318 ? 99.347  51.511 18.443  1.00 54.47  ? 333  GLU B CD  1 
ATOM   5259 O OE1 . GLU B 1 318 ? 100.416 52.146 18.573  1.00 52.61  ? 333  GLU B OE1 1 
ATOM   5260 O OE2 . GLU B 1 318 ? 98.685  51.515 17.381  1.00 55.89  ? 333  GLU B OE2 1 
ATOM   5261 N N   . ALA B 1 319 ? 101.398 49.242 23.015  1.00 41.32  ? 334  ALA B N   1 
ATOM   5262 C CA  . ALA B 1 319 ? 102.602 48.759 23.689  1.00 40.58  ? 334  ALA B CA  1 
ATOM   5263 C C   . ALA B 1 319 ? 102.265 47.595 24.617  1.00 40.48  ? 334  ALA B C   1 
ATOM   5264 O O   . ALA B 1 319 ? 102.941 46.568 24.604  1.00 40.47  ? 334  ALA B O   1 
ATOM   5265 C CB  . ALA B 1 319 ? 103.249 49.889 24.475  1.00 36.81  ? 334  ALA B CB  1 
ATOM   5266 N N   . CYS B 1 320 ? 101.216 47.766 25.417  1.00 40.44  ? 335  CYS B N   1 
ATOM   5267 C CA  . CYS B 1 320 ? 100.770 46.735 26.346  1.00 40.48  ? 335  CYS B CA  1 
ATOM   5268 C C   . CYS B 1 320 ? 100.514 45.437 25.614  1.00 41.14  ? 335  CYS B C   1 
ATOM   5269 O O   . CYS B 1 320 ? 100.792 44.353 26.126  1.00 39.29  ? 335  CYS B O   1 
ATOM   5270 C CB  . CYS B 1 320 ? 99.482  47.164 27.046  1.00 39.69  ? 335  CYS B CB  1 
ATOM   5271 S SG  . CYS B 1 320 ? 99.737  48.337 28.388  1.00 45.67  ? 335  CYS B SG  1 
ATOM   5272 N N   . ALA B 1 321 ? 99.969  45.564 24.411  1.00 38.79  ? 336  ALA B N   1 
ATOM   5273 C CA  . ALA B 1 321 ? 99.655  44.416 23.573  1.00 38.64  ? 336  ALA B CA  1 
ATOM   5274 C C   . ALA B 1 321 ? 100.869 43.962 22.760  1.00 38.47  ? 336  ALA B C   1 
ATOM   5275 O O   . ALA B 1 321 ? 100.780 43.056 21.936  1.00 37.04  ? 336  ALA B O   1 
ATOM   5276 C CB  . ALA B 1 321 ? 98.514  44.764 22.643  1.00 32.41  ? 336  ALA B CB  1 
ATOM   5277 N N   . HIS B 1 322 ? 102.015 44.584 22.983  1.00 37.75  ? 337  HIS B N   1 
ATOM   5278 C CA  . HIS B 1 322 ? 103.164 44.171 22.217  1.00 37.46  ? 337  HIS B CA  1 
ATOM   5279 C C   . HIS B 1 322 ? 103.572 42.757 22.604  1.00 39.75  ? 337  HIS B C   1 
ATOM   5280 O O   . HIS B 1 322 ? 103.484 42.349 23.774  1.00 40.10  ? 337  HIS B O   1 
ATOM   5281 C CB  . HIS B 1 322 ? 104.337 45.136 22.404  1.00 31.69  ? 337  HIS B CB  1 
ATOM   5282 C CG  . HIS B 1 322 ? 105.485 44.865 21.478  1.00 33.53  ? 337  HIS B CG  1 
ATOM   5283 N ND1 . HIS B 1 322 ? 106.522 44.015 21.801  1.00 32.47  ? 337  HIS B ND1 1 
ATOM   5284 C CD2 . HIS B 1 322 ? 105.749 45.318 20.230  1.00 30.11  ? 337  HIS B CD2 1 
ATOM   5285 C CE1 . HIS B 1 322 ? 107.375 43.960 20.794  1.00 29.76  ? 337  HIS B CE1 1 
ATOM   5286 N NE2 . HIS B 1 322 ? 106.929 44.742 19.828  1.00 27.51  ? 337  HIS B NE2 1 
ATOM   5287 N N   . SER B 1 323 ? 104.000 42.023 21.582  1.00 40.95  ? 338  SER B N   1 
ATOM   5288 C CA  . SER B 1 323 ? 104.453 40.647 21.692  1.00 40.60  ? 338  SER B CA  1 
ATOM   5289 C C   . SER B 1 323 ? 105.350 40.440 22.911  1.00 39.56  ? 338  SER B C   1 
ATOM   5290 O O   . SER B 1 323 ? 105.321 39.395 23.547  1.00 40.19  ? 338  SER B O   1 
ATOM   5291 C CB  . SER B 1 323 ? 105.212 40.290 20.412  1.00 39.85  ? 338  SER B CB  1 
ATOM   5292 O OG  . SER B 1 323 ? 105.478 38.910 20.338  1.00 48.28  ? 338  SER B OG  1 
ATOM   5293 N N   . PHE B 1 324 ? 106.141 41.452 23.238  1.00 38.94  ? 339  PHE B N   1 
ATOM   5294 C CA  . PHE B 1 324 ? 107.074 41.391 24.356  1.00 36.62  ? 339  PHE B CA  1 
ATOM   5295 C C   . PHE B 1 324 ? 106.412 41.148 25.710  1.00 40.17  ? 339  PHE B C   1 
ATOM   5296 O O   . PHE B 1 324 ? 107.062 40.723 26.670  1.00 42.06  ? 339  PHE B O   1 
ATOM   5297 C CB  . PHE B 1 324 ? 107.884 42.686 24.389  1.00 36.88  ? 339  PHE B CB  1 
ATOM   5298 C CG  . PHE B 1 324 ? 108.823 42.787 25.545  1.00 34.43  ? 339  PHE B CG  1 
ATOM   5299 C CD1 . PHE B 1 324 ? 109.839 41.859 25.718  1.00 35.35  ? 339  PHE B CD1 1 
ATOM   5300 C CD2 . PHE B 1 324 ? 108.685 43.808 26.475  1.00 34.66  ? 339  PHE B CD2 1 
ATOM   5301 C CE1 . PHE B 1 324 ? 110.704 41.943 26.805  1.00 31.28  ? 339  PHE B CE1 1 
ATOM   5302 C CE2 . PHE B 1 324 ? 109.547 43.905 27.571  1.00 34.31  ? 339  PHE B CE2 1 
ATOM   5303 C CZ  . PHE B 1 324 ? 110.557 42.970 27.736  1.00 37.04  ? 339  PHE B CZ  1 
ATOM   5304 N N   . PHE B 1 325 ? 105.115 41.402 25.798  1.00 42.05  ? 340  PHE B N   1 
ATOM   5305 C CA  . PHE B 1 325 ? 104.420 41.204 27.062  1.00 40.82  ? 340  PHE B CA  1 
ATOM   5306 C C   . PHE B 1 325 ? 103.638 39.899 27.127  1.00 40.78  ? 340  PHE B C   1 
ATOM   5307 O O   . PHE B 1 325 ? 102.975 39.619 28.126  1.00 38.56  ? 340  PHE B O   1 
ATOM   5308 C CB  . PHE B 1 325 ? 103.504 42.396 27.311  1.00 37.78  ? 340  PHE B CB  1 
ATOM   5309 C CG  . PHE B 1 325 ? 104.255 43.680 27.499  1.00 36.16  ? 340  PHE B CG  1 
ATOM   5310 C CD1 . PHE B 1 325 ? 105.066 43.863 28.619  1.00 32.44  ? 340  PHE B CD1 1 
ATOM   5311 C CD2 . PHE B 1 325 ? 104.201 44.685 26.540  1.00 33.17  ? 340  PHE B CD2 1 
ATOM   5312 C CE1 . PHE B 1 325 ? 105.813 45.026 28.777  1.00 28.94  ? 340  PHE B CE1 1 
ATOM   5313 C CE2 . PHE B 1 325 ? 104.945 45.849 26.691  1.00 25.88  ? 340  PHE B CE2 1 
ATOM   5314 C CZ  . PHE B 1 325 ? 105.751 46.021 27.808  1.00 25.23  ? 340  PHE B CZ  1 
ATOM   5315 N N   . ASP B 1 326 ? 103.730 39.102 26.061  1.00 41.21  ? 341  ASP B N   1 
ATOM   5316 C CA  . ASP B 1 326 ? 103.025 37.824 25.978  1.00 43.51  ? 341  ASP B CA  1 
ATOM   5317 C C   . ASP B 1 326 ? 103.204 36.974 27.237  1.00 43.62  ? 341  ASP B C   1 
ATOM   5318 O O   . ASP B 1 326 ? 102.233 36.455 27.789  1.00 44.37  ? 341  ASP B O   1 
ATOM   5319 C CB  . ASP B 1 326 ? 103.477 37.045 24.730  1.00 38.71  ? 341  ASP B CB  1 
ATOM   5320 C CG  . ASP B 1 326 ? 102.897 37.623 23.436  1.00 43.09  ? 341  ASP B CG  1 
ATOM   5321 O OD1 . ASP B 1 326 ? 103.117 37.051 22.336  1.00 45.29  ? 341  ASP B OD1 1 
ATOM   5322 O OD2 . ASP B 1 326 ? 102.210 38.662 23.524  1.00 46.09  ? 341  ASP B OD2 1 
ATOM   5323 N N   . GLU B 1 327 ? 104.434 36.843 27.712  1.00 44.02  ? 342  GLU B N   1 
ATOM   5324 C CA  . GLU B 1 327 ? 104.648 36.048 28.903  1.00 46.64  ? 342  GLU B CA  1 
ATOM   5325 C C   . GLU B 1 327 ? 103.693 36.465 30.019  1.00 47.70  ? 342  GLU B C   1 
ATOM   5326 O O   . GLU B 1 327 ? 103.201 35.624 30.764  1.00 48.60  ? 342  GLU B O   1 
ATOM   5327 C CB  . GLU B 1 327 ? 106.086 36.177 29.400  1.00 48.59  ? 342  GLU B CB  1 
ATOM   5328 C CG  . GLU B 1 327 ? 106.336 35.368 30.667  1.00 49.78  ? 342  GLU B CG  1 
ATOM   5329 C CD  . GLU B 1 327 ? 107.728 35.558 31.237  1.00 56.85  ? 342  GLU B CD  1 
ATOM   5330 O OE1 . GLU B 1 327 ? 108.058 34.841 32.212  1.00 62.57  ? 342  GLU B OE1 1 
ATOM   5331 O OE2 . GLU B 1 327 ? 108.487 36.417 30.720  1.00 55.32  ? 342  GLU B OE2 1 
ATOM   5332 N N   . LEU B 1 328 ? 103.427 37.761 30.139  1.00 47.98  ? 343  LEU B N   1 
ATOM   5333 C CA  . LEU B 1 328 ? 102.538 38.246 31.191  1.00 46.45  ? 343  LEU B CA  1 
ATOM   5334 C C   . LEU B 1 328 ? 101.087 37.765 31.026  1.00 46.31  ? 343  LEU B C   1 
ATOM   5335 O O   . LEU B 1 328 ? 100.347 37.663 32.006  1.00 45.95  ? 343  LEU B O   1 
ATOM   5336 C CB  . LEU B 1 328 ? 102.594 39.780 31.259  1.00 45.05  ? 343  LEU B CB  1 
ATOM   5337 C CG  . LEU B 1 328 ? 103.947 40.408 31.626  1.00 45.71  ? 343  LEU B CG  1 
ATOM   5338 C CD1 . LEU B 1 328 ? 103.776 41.902 31.813  1.00 45.13  ? 343  LEU B CD1 1 
ATOM   5339 C CD2 . LEU B 1 328 ? 104.483 39.793 32.903  1.00 47.26  ? 343  LEU B CD2 1 
ATOM   5340 N N   . ARG B 1 329 ? 100.698 37.453 29.793  1.00 46.51  ? 344  ARG B N   1 
ATOM   5341 C CA  . ARG B 1 329 ? 99.345  36.978 29.493  1.00 49.05  ? 344  ARG B CA  1 
ATOM   5342 C C   . ARG B 1 329 ? 99.286  35.447 29.535  1.00 50.98  ? 344  ARG B C   1 
ATOM   5343 O O   . ARG B 1 329 ? 98.455  34.815 28.877  1.00 52.17  ? 344  ARG B O   1 
ATOM   5344 C CB  . ARG B 1 329 ? 98.904  37.478 28.108  1.00 44.55  ? 344  ARG B CB  1 
ATOM   5345 C CG  . ARG B 1 329 ? 98.648  38.975 28.036  1.00 45.22  ? 344  ARG B CG  1 
ATOM   5346 C CD  . ARG B 1 329 ? 98.307  39.429 26.623  1.00 47.68  ? 344  ARG B CD  1 
ATOM   5347 N NE  . ARG B 1 329 ? 99.486  39.735 25.810  1.00 48.68  ? 344  ARG B NE  1 
ATOM   5348 C CZ  . ARG B 1 329 ? 100.074 40.925 25.760  1.00 47.51  ? 344  ARG B CZ  1 
ATOM   5349 N NH1 . ARG B 1 329 ? 99.595  41.932 26.477  1.00 48.56  ? 344  ARG B NH1 1 
ATOM   5350 N NH2 . ARG B 1 329 ? 101.135 41.112 24.985  1.00 48.36  ? 344  ARG B NH2 1 
ATOM   5351 N N   . ASP B 1 330 ? 100.179 34.860 30.318  1.00 54.43  ? 345  ASP B N   1 
ATOM   5352 C CA  . ASP B 1 330 ? 100.253 33.416 30.459  1.00 56.67  ? 345  ASP B CA  1 
ATOM   5353 C C   . ASP B 1 330 ? 99.684  33.038 31.822  1.00 59.41  ? 345  ASP B C   1 
ATOM   5354 O O   . ASP B 1 330 ? 99.957  33.699 32.825  1.00 59.74  ? 345  ASP B O   1 
ATOM   5355 C CB  . ASP B 1 330 ? 101.708 32.983 30.371  1.00 60.91  ? 345  ASP B CB  1 
ATOM   5356 C CG  . ASP B 1 330 ? 101.864 31.537 29.977  1.00 64.77  ? 345  ASP B CG  1 
ATOM   5357 O OD1 . ASP B 1 330 ? 101.526 31.203 28.818  1.00 69.52  ? 345  ASP B OD1 1 
ATOM   5358 O OD2 . ASP B 1 330 ? 102.330 30.741 30.824  1.00 65.35  ? 345  ASP B OD2 1 
ATOM   5359 N N   . PRO B 1 331 ? 98.880  31.968 31.876  1.00 60.67  ? 346  PRO B N   1 
ATOM   5360 C CA  . PRO B 1 331 ? 98.275  31.514 33.136  1.00 60.41  ? 346  PRO B CA  1 
ATOM   5361 C C   . PRO B 1 331 ? 99.290  31.036 34.185  1.00 61.56  ? 346  PRO B C   1 
ATOM   5362 O O   . PRO B 1 331 ? 99.058  31.161 35.388  1.00 60.15  ? 346  PRO B O   1 
ATOM   5363 C CB  . PRO B 1 331 ? 97.352  30.382 32.690  1.00 58.60  ? 346  PRO B CB  1 
ATOM   5364 C CG  . PRO B 1 331 ? 97.044  30.721 31.258  1.00 59.13  ? 346  PRO B CG  1 
ATOM   5365 C CD  . PRO B 1 331 ? 98.362  31.197 30.732  1.00 60.15  ? 346  PRO B CD  1 
ATOM   5366 N N   . ASN B 1 332 ? 100.414 30.497 33.718  1.00 63.95  ? 347  ASN B N   1 
ATOM   5367 C CA  . ASN B 1 332 ? 101.452 29.963 34.604  1.00 64.45  ? 347  ASN B CA  1 
ATOM   5368 C C   . ASN B 1 332 ? 102.413 31.009 35.138  1.00 64.67  ? 347  ASN B C   1 
ATOM   5369 O O   . ASN B 1 332 ? 103.306 30.691 35.926  1.00 65.94  ? 347  ASN B O   1 
ATOM   5370 C CB  . ASN B 1 332 ? 102.273 28.892 33.879  1.00 64.50  ? 347  ASN B CB  1 
ATOM   5371 C CG  . ASN B 1 332 ? 101.409 27.906 33.115  1.00 68.27  ? 347  ASN B CG  1 
ATOM   5372 O OD1 . ASN B 1 332 ? 100.460 27.336 33.662  1.00 65.44  ? 347  ASN B OD1 1 
ATOM   5373 N ND2 . ASN B 1 332 ? 101.737 27.692 31.839  1.00 69.90  ? 347  ASN B ND2 1 
ATOM   5374 N N   . VAL B 1 333 ? 102.237 32.251 34.715  1.00 62.08  ? 348  VAL B N   1 
ATOM   5375 C CA  . VAL B 1 333 ? 103.130 33.302 35.153  1.00 60.13  ? 348  VAL B CA  1 
ATOM   5376 C C   . VAL B 1 333 ? 103.089 33.541 36.669  1.00 59.63  ? 348  VAL B C   1 
ATOM   5377 O O   . VAL B 1 333 ? 102.019 33.640 37.277  1.00 60.30  ? 348  VAL B O   1 
ATOM   5378 C CB  . VAL B 1 333 ? 102.835 34.613 34.386  1.00 59.50  ? 348  VAL B CB  1 
ATOM   5379 C CG1 . VAL B 1 333 ? 101.497 35.187 34.816  1.00 58.82  ? 348  VAL B CG1 1 
ATOM   5380 C CG2 . VAL B 1 333 ? 103.966 35.600 34.593  1.00 58.20  ? 348  VAL B CG2 1 
ATOM   5381 N N   . LYS B 1 334 ? 104.281 33.615 37.262  1.00 58.72  ? 349  LYS B N   1 
ATOM   5382 C CA  . LYS B 1 334 ? 104.473 33.847 38.698  1.00 59.36  ? 349  LYS B CA  1 
ATOM   5383 C C   . LYS B 1 334 ? 105.677 34.761 38.884  1.00 58.94  ? 349  LYS B C   1 
ATOM   5384 O O   . LYS B 1 334 ? 106.515 34.878 37.993  1.00 57.86  ? 349  LYS B O   1 
ATOM   5385 C CB  . LYS B 1 334 ? 104.777 32.535 39.430  1.00 59.41  ? 349  LYS B CB  1 
ATOM   5386 C CG  . LYS B 1 334 ? 103.588 31.647 39.722  1.00 61.57  ? 349  LYS B CG  1 
ATOM   5387 C CD  . LYS B 1 334 ? 102.935 32.004 41.041  1.00 65.19  ? 349  LYS B CD  1 
ATOM   5388 C CE  . LYS B 1 334 ? 101.812 31.029 41.374  1.00 67.24  ? 349  LYS B CE  1 
ATOM   5389 N NZ  . LYS B 1 334 ? 101.232 31.301 42.722  1.00 69.48  ? 349  LYS B NZ  1 
ATOM   5390 N N   . LEU B 1 335 ? 105.772 35.396 40.047  1.00 57.87  ? 350  LEU B N   1 
ATOM   5391 C CA  . LEU B 1 335 ? 106.909 36.263 40.333  1.00 57.39  ? 350  LEU B CA  1 
ATOM   5392 C C   . LEU B 1 335 ? 108.029 35.401 40.918  1.00 57.68  ? 350  LEU B C   1 
ATOM   5393 O O   . LEU B 1 335 ? 107.783 34.288 41.390  1.00 56.86  ? 350  LEU B O   1 
ATOM   5394 C CB  . LEU B 1 335 ? 106.528 37.356 41.340  1.00 57.62  ? 350  LEU B CB  1 
ATOM   5395 C CG  . LEU B 1 335 ? 105.522 38.449 40.963  1.00 57.59  ? 350  LEU B CG  1 
ATOM   5396 C CD1 . LEU B 1 335 ? 105.287 39.354 42.172  1.00 56.45  ? 350  LEU B CD1 1 
ATOM   5397 C CD2 . LEU B 1 335 ? 106.045 39.246 39.784  1.00 54.44  ? 350  LEU B CD2 1 
ATOM   5398 N N   . PRO B 1 336 ? 109.275 35.905 40.891  1.00 57.72  ? 351  PRO B N   1 
ATOM   5399 C CA  . PRO B 1 336 ? 110.441 35.185 41.417  1.00 56.95  ? 351  PRO B CA  1 
ATOM   5400 C C   . PRO B 1 336 ? 110.340 34.828 42.897  1.00 55.31  ? 351  PRO B C   1 
ATOM   5401 O O   . PRO B 1 336 ? 110.881 33.812 43.334  1.00 55.40  ? 351  PRO B O   1 
ATOM   5402 C CB  . PRO B 1 336 ? 111.596 36.139 41.122  1.00 55.24  ? 351  PRO B CB  1 
ATOM   5403 C CG  . PRO B 1 336 ? 111.155 36.790 39.860  1.00 58.13  ? 351  PRO B CG  1 
ATOM   5404 C CD  . PRO B 1 336 ? 109.705 37.109 40.163  1.00 56.24  ? 351  PRO B CD  1 
ATOM   5405 N N   . ASN B 1 337 ? 109.669 35.663 43.677  1.00 54.70  ? 352  ASN B N   1 
ATOM   5406 C CA  . ASN B 1 337 ? 109.528 35.350 45.083  1.00 54.81  ? 352  ASN B CA  1 
ATOM   5407 C C   . ASN B 1 337 ? 108.318 34.434 45.241  1.00 55.78  ? 352  ASN B C   1 
ATOM   5408 O O   . ASN B 1 337 ? 107.764 34.311 46.329  1.00 56.42  ? 352  ASN B O   1 
ATOM   5409 C CB  . ASN B 1 337 ? 109.347 36.618 45.920  1.00 54.72  ? 352  ASN B CB  1 
ATOM   5410 C CG  . ASN B 1 337 ? 108.133 37.431 45.504  1.00 55.63  ? 352  ASN B CG  1 
ATOM   5411 O OD1 . ASN B 1 337 ? 107.167 36.898 44.960  1.00 50.97  ? 352  ASN B OD1 1 
ATOM   5412 N ND2 . ASN B 1 337 ? 108.169 38.730 45.780  1.00 58.03  ? 352  ASN B ND2 1 
ATOM   5413 N N   . GLY B 1 338 ? 107.904 33.809 44.140  1.00 55.69  ? 353  GLY B N   1 
ATOM   5414 C CA  . GLY B 1 338 ? 106.780 32.892 44.178  1.00 55.37  ? 353  GLY B CA  1 
ATOM   5415 C C   . GLY B 1 338 ? 105.392 33.487 44.312  1.00 57.20  ? 353  GLY B C   1 
ATOM   5416 O O   . GLY B 1 338 ? 104.405 32.755 44.264  1.00 58.57  ? 353  GLY B O   1 
ATOM   5417 N N   . ARG B 1 339 ? 105.293 34.799 44.488  1.00 59.71  ? 354  ARG B N   1 
ATOM   5418 C CA  . ARG B 1 339 ? 103.986 35.443 44.613  1.00 60.21  ? 354  ARG B CA  1 
ATOM   5419 C C   . ARG B 1 339 ? 103.400 35.627 43.205  1.00 59.75  ? 354  ARG B C   1 
ATOM   5420 O O   . ARG B 1 339 ? 104.132 35.602 42.211  1.00 57.74  ? 354  ARG B O   1 
ATOM   5421 C CB  . ARG B 1 339 ? 104.135 36.793 45.323  1.00 62.34  ? 354  ARG B CB  1 
ATOM   5422 C CG  . ARG B 1 339 ? 102.866 37.300 45.995  1.00 68.38  ? 354  ARG B CG  1 
ATOM   5423 C CD  . ARG B 1 339 ? 103.192 38.361 47.051  1.00 72.95  ? 354  ARG B CD  1 
ATOM   5424 N NE  . ARG B 1 339 ? 104.252 37.910 47.958  1.00 74.90  ? 354  ARG B NE  1 
ATOM   5425 C CZ  . ARG B 1 339 ? 104.579 38.500 49.107  1.00 76.95  ? 354  ARG B CZ  1 
ATOM   5426 N NH1 . ARG B 1 339 ? 103.929 39.584 49.519  1.00 78.59  ? 354  ARG B NH1 1 
ATOM   5427 N NH2 . ARG B 1 339 ? 105.562 38.002 49.849  1.00 77.87  ? 354  ARG B NH2 1 
ATOM   5428 N N   . ASP B 1 340 ? 102.085 35.797 43.114  1.00 60.52  ? 355  ASP B N   1 
ATOM   5429 C CA  . ASP B 1 340 ? 101.435 35.967 41.814  1.00 60.98  ? 355  ASP B CA  1 
ATOM   5430 C C   . ASP B 1 340 ? 101.692 37.333 41.215  1.00 58.25  ? 355  ASP B C   1 
ATOM   5431 O O   . ASP B 1 340 ? 102.230 38.220 41.869  1.00 59.26  ? 355  ASP B O   1 
ATOM   5432 C CB  . ASP B 1 340 ? 99.929  35.772 41.952  1.00 64.01  ? 355  ASP B CB  1 
ATOM   5433 C CG  . ASP B 1 340 ? 99.562  34.369 42.388  1.00 71.54  ? 355  ASP B CG  1 
ATOM   5434 O OD1 . ASP B 1 340 ? 99.739  33.431 41.575  1.00 72.50  ? 355  ASP B OD1 1 
ATOM   5435 O OD2 . ASP B 1 340 ? 99.103  34.206 43.543  1.00 74.56  ? 355  ASP B OD2 1 
ATOM   5436 N N   . THR B 1 341 ? 101.304 37.505 39.960  1.00 55.70  ? 356  THR B N   1 
ATOM   5437 C CA  . THR B 1 341 ? 101.479 38.798 39.319  1.00 55.90  ? 356  THR B CA  1 
ATOM   5438 C C   . THR B 1 341 ? 100.341 39.725 39.732  1.00 53.94  ? 356  THR B C   1 
ATOM   5439 O O   . THR B 1 341 ? 99.233  39.276 40.029  1.00 53.90  ? 356  THR B O   1 
ATOM   5440 C CB  . THR B 1 341 ? 101.468 38.693 37.782  1.00 54.81  ? 356  THR B CB  1 
ATOM   5441 O OG1 . THR B 1 341 ? 100.254 38.064 37.351  1.00 53.39  ? 356  THR B OG1 1 
ATOM   5442 C CG2 . THR B 1 341 ? 102.672 37.910 37.296  1.00 57.98  ? 356  THR B CG2 1 
ATOM   5443 N N   . PRO B 1 342 ? 100.605 41.038 39.760  1.00 53.53  ? 357  PRO B N   1 
ATOM   5444 C CA  . PRO B 1 342 ? 99.580  42.012 40.140  1.00 52.45  ? 357  PRO B CA  1 
ATOM   5445 C C   . PRO B 1 342 ? 98.408  41.905 39.187  1.00 49.37  ? 357  PRO B C   1 
ATOM   5446 O O   . PRO B 1 342 ? 98.454  41.128 38.234  1.00 48.53  ? 357  PRO B O   1 
ATOM   5447 C CB  . PRO B 1 342 ? 100.302 43.344 39.991  1.00 51.42  ? 357  PRO B CB  1 
ATOM   5448 C CG  . PRO B 1 342 ? 101.729 42.989 40.270  1.00 55.42  ? 357  PRO B CG  1 
ATOM   5449 C CD  . PRO B 1 342 ? 101.899 41.700 39.525  1.00 53.47  ? 357  PRO B CD  1 
ATOM   5450 N N   . ALA B 1 343 ? 97.357  42.675 39.450  1.00 49.39  ? 358  ALA B N   1 
ATOM   5451 C CA  . ALA B 1 343 ? 96.189  42.683 38.571  1.00 47.33  ? 358  ALA B CA  1 
ATOM   5452 C C   . ALA B 1 343 ? 96.707  43.293 37.282  1.00 45.41  ? 358  ALA B C   1 
ATOM   5453 O O   . ALA B 1 343 ? 97.316  44.360 37.307  1.00 46.55  ? 358  ALA B O   1 
ATOM   5454 C CB  . ALA B 1 343 ? 95.097  43.548 39.154  1.00 44.56  ? 358  ALA B CB  1 
ATOM   5455 N N   . LEU B 1 344 ? 96.474  42.633 36.156  1.00 45.13  ? 359  LEU B N   1 
ATOM   5456 C CA  . LEU B 1 344 ? 96.995  43.156 34.909  1.00 45.23  ? 359  LEU B CA  1 
ATOM   5457 C C   . LEU B 1 344 ? 95.989  43.293 33.783  1.00 46.67  ? 359  LEU B C   1 
ATOM   5458 O O   . LEU B 1 344 ? 96.249  44.005 32.817  1.00 45.82  ? 359  LEU B O   1 
ATOM   5459 C CB  . LEU B 1 344 ? 98.166  42.280 34.440  1.00 44.82  ? 359  LEU B CB  1 
ATOM   5460 C CG  . LEU B 1 344 ? 99.427  42.197 35.317  1.00 46.09  ? 359  LEU B CG  1 
ATOM   5461 C CD1 . LEU B 1 344 ? 100.334 41.086 34.823  1.00 45.01  ? 359  LEU B CD1 1 
ATOM   5462 C CD2 . LEU B 1 344 ? 100.169 43.525 35.295  1.00 42.69  ? 359  LEU B CD2 1 
ATOM   5463 N N   . PHE B 1 345 ? 94.835  42.646 33.902  1.00 47.04  ? 360  PHE B N   1 
ATOM   5464 C CA  . PHE B 1 345 ? 93.860  42.704 32.815  1.00 50.99  ? 360  PHE B CA  1 
ATOM   5465 C C   . PHE B 1 345 ? 92.507  43.301 33.143  1.00 52.57  ? 360  PHE B C   1 
ATOM   5466 O O   . PHE B 1 345 ? 91.583  43.252 32.329  1.00 54.92  ? 360  PHE B O   1 
ATOM   5467 C CB  . PHE B 1 345 ? 93.663  41.304 32.243  1.00 51.78  ? 360  PHE B CB  1 
ATOM   5468 C CG  . PHE B 1 345 ? 94.913  40.495 32.235  1.00 52.30  ? 360  PHE B CG  1 
ATOM   5469 C CD1 . PHE B 1 345 ? 95.072  39.431 33.116  1.00 51.45  ? 360  PHE B CD1 1 
ATOM   5470 C CD2 . PHE B 1 345 ? 95.970  40.843 31.403  1.00 50.39  ? 360  PHE B CD2 1 
ATOM   5471 C CE1 . PHE B 1 345 ? 96.270  38.728 33.175  1.00 48.81  ? 360  PHE B CE1 1 
ATOM   5472 C CE2 . PHE B 1 345 ? 97.173  40.144 31.454  1.00 50.63  ? 360  PHE B CE2 1 
ATOM   5473 C CZ  . PHE B 1 345 ? 97.323  39.085 32.344  1.00 48.96  ? 360  PHE B CZ  1 
ATOM   5474 N N   . ASN B 1 346 ? 92.386  43.863 34.332  1.00 53.95  ? 361  ASN B N   1 
ATOM   5475 C CA  . ASN B 1 346 ? 91.138  44.472 34.746  1.00 54.69  ? 361  ASN B CA  1 
ATOM   5476 C C   . ASN B 1 346 ? 91.032  45.882 34.155  1.00 57.90  ? 361  ASN B C   1 
ATOM   5477 O O   . ASN B 1 346 ? 91.063  46.866 34.897  1.00 56.91  ? 361  ASN B O   1 
ATOM   5478 C CB  . ASN B 1 346 ? 91.111  44.523 36.264  1.00 55.12  ? 361  ASN B CB  1 
ATOM   5479 C CG  . ASN B 1 346 ? 92.375  45.122 36.834  1.00 56.01  ? 361  ASN B CG  1 
ATOM   5480 O OD1 . ASN B 1 346 ? 93.419  45.113 36.182  1.00 59.62  ? 361  ASN B OD1 1 
ATOM   5481 N ND2 . ASN B 1 346 ? 92.298  45.633 38.057  1.00 53.31  ? 361  ASN B ND2 1 
ATOM   5482 N N   . PHE B 1 347 ? 90.914  45.968 32.824  1.00 59.14  ? 362  PHE B N   1 
ATOM   5483 C CA  . PHE B 1 347 ? 90.805  47.249 32.107  1.00 60.58  ? 362  PHE B CA  1 
ATOM   5484 C C   . PHE B 1 347 ? 89.427  47.893 32.188  1.00 61.13  ? 362  PHE B C   1 
ATOM   5485 O O   . PHE B 1 347 ? 88.399  47.220 32.121  1.00 59.79  ? 362  PHE B O   1 
ATOM   5486 C CB  . PHE B 1 347 ? 91.152  47.085 30.628  1.00 57.58  ? 362  PHE B CB  1 
ATOM   5487 C CG  . PHE B 1 347 ? 92.593  46.799 30.370  1.00 58.87  ? 362  PHE B CG  1 
ATOM   5488 C CD1 . PHE B 1 347 ? 93.132  45.550 30.658  1.00 57.54  ? 362  PHE B CD1 1 
ATOM   5489 C CD2 . PHE B 1 347 ? 93.421  47.780 29.836  1.00 56.64  ? 362  PHE B CD2 1 
ATOM   5490 C CE1 . PHE B 1 347 ? 94.482  45.280 30.414  1.00 54.61  ? 362  PHE B CE1 1 
ATOM   5491 C CE2 . PHE B 1 347 ? 94.771  47.520 29.590  1.00 52.31  ? 362  PHE B CE2 1 
ATOM   5492 C CZ  . PHE B 1 347 ? 95.302  46.269 29.880  1.00 53.53  ? 362  PHE B CZ  1 
ATOM   5493 N N   . THR B 1 348 ? 89.416  49.212 32.321  1.00 62.69  ? 363  THR B N   1 
ATOM   5494 C CA  . THR B 1 348 ? 88.163  49.935 32.405  1.00 64.37  ? 363  THR B CA  1 
ATOM   5495 C C   . THR B 1 348 ? 87.827  50.387 31.005  1.00 66.46  ? 363  THR B C   1 
ATOM   5496 O O   . THR B 1 348 ? 88.720  50.600 30.190  1.00 67.53  ? 363  THR B O   1 
ATOM   5497 C CB  . THR B 1 348 ? 88.270  51.184 33.320  1.00 63.49  ? 363  THR B CB  1 
ATOM   5498 O OG1 . THR B 1 348 ? 89.122  52.165 32.711  1.00 63.87  ? 363  THR B OG1 1 
ATOM   5499 C CG2 . THR B 1 348 ? 88.841  50.805 34.678  1.00 62.45  ? 363  THR B CG2 1 
ATOM   5500 N N   . THR B 1 349 ? 86.536  50.511 30.721  1.00 67.49  ? 364  THR B N   1 
ATOM   5501 C CA  . THR B 1 349 ? 86.094  50.962 29.415  1.00 67.09  ? 364  THR B CA  1 
ATOM   5502 C C   . THR B 1 349 ? 86.866  52.233 29.123  1.00 67.83  ? 364  THR B C   1 
ATOM   5503 O O   . THR B 1 349 ? 87.347  52.445 28.006  1.00 66.68  ? 364  THR B O   1 
ATOM   5504 C CB  . THR B 1 349 ? 84.606  51.257 29.439  1.00 67.35  ? 364  THR B CB  1 
ATOM   5505 O OG1 . THR B 1 349 ? 83.894  50.020 29.553  1.00 67.88  ? 364  THR B OG1 1 
ATOM   5506 C CG2 . THR B 1 349 ? 84.187  51.980 28.181  1.00 66.98  ? 364  THR B CG2 1 
ATOM   5507 N N   . GLN B 1 350 ? 86.985  53.062 30.158  1.00 68.12  ? 365  GLN B N   1 
ATOM   5508 C CA  . GLN B 1 350 ? 87.715  54.325 30.106  1.00 67.77  ? 365  GLN B CA  1 
ATOM   5509 C C   . GLN B 1 350 ? 89.143  54.076 29.595  1.00 67.63  ? 365  GLN B C   1 
ATOM   5510 O O   . GLN B 1 350 ? 89.633  54.752 28.687  1.00 64.88  ? 365  GLN B O   1 
ATOM   5511 C CB  . GLN B 1 350 ? 87.752  54.935 31.517  1.00 69.07  ? 365  GLN B CB  1 
ATOM   5512 C CG  . GLN B 1 350 ? 88.627  56.178 31.694  1.00 71.23  ? 365  GLN B CG  1 
ATOM   5513 C CD  . GLN B 1 350 ? 88.216  57.334 30.790  1.00 75.00  ? 365  GLN B CD  1 
ATOM   5514 O OE1 . GLN B 1 350 ? 87.034  57.503 30.486  1.00 76.30  ? 365  GLN B OE1 1 
ATOM   5515 N NE2 . GLN B 1 350 ? 89.190  58.145 30.369  1.00 70.85  ? 365  GLN B NE2 1 
ATOM   5516 N N   . GLU B 1 351 ? 89.792  53.078 30.179  1.00 67.98  ? 366  GLU B N   1 
ATOM   5517 C CA  . GLU B 1 351 ? 91.160  52.720 29.832  1.00 69.27  ? 366  GLU B CA  1 
ATOM   5518 C C   . GLU B 1 351 ? 91.327  52.140 28.408  1.00 70.33  ? 366  GLU B C   1 
ATOM   5519 O O   . GLU B 1 351 ? 92.374  52.325 27.782  1.00 69.46  ? 366  GLU B O   1 
ATOM   5520 C CB  . GLU B 1 351 ? 91.675  51.728 30.881  1.00 70.04  ? 366  GLU B CB  1 
ATOM   5521 C CG  . GLU B 1 351 ? 93.126  51.882 31.265  1.00 68.62  ? 366  GLU B CG  1 
ATOM   5522 C CD  . GLU B 1 351 ? 93.510  50.960 32.407  1.00 68.99  ? 366  GLU B CD  1 
ATOM   5523 O OE1 . GLU B 1 351 ? 94.717  50.869 32.694  1.00 72.29  ? 366  GLU B OE1 1 
ATOM   5524 O OE2 . GLU B 1 351 ? 92.616  50.331 33.020  1.00 66.60  ? 366  GLU B OE2 1 
ATOM   5525 N N   . LEU B 1 352 ? 90.308  51.448 27.900  1.00 68.82  ? 367  LEU B N   1 
ATOM   5526 C CA  . LEU B 1 352 ? 90.382  50.854 26.565  1.00 69.13  ? 367  LEU B CA  1 
ATOM   5527 C C   . LEU B 1 352 ? 89.805  51.763 25.500  1.00 70.88  ? 367  LEU B C   1 
ATOM   5528 O O   . LEU B 1 352 ? 89.789  51.419 24.320  1.00 72.39  ? 367  LEU B O   1 
ATOM   5529 C CB  . LEU B 1 352 ? 89.630  49.529 26.516  1.00 68.07  ? 367  LEU B CB  1 
ATOM   5530 C CG  . LEU B 1 352 ? 90.123  48.397 27.413  1.00 69.83  ? 367  LEU B CG  1 
ATOM   5531 C CD1 . LEU B 1 352 ? 89.079  48.128 28.486  1.00 71.33  ? 367  LEU B CD1 1 
ATOM   5532 C CD2 . LEU B 1 352 ? 90.369  47.148 26.585  1.00 69.52  ? 367  LEU B CD2 1 
ATOM   5533 N N   . SER B 1 353 ? 89.330  52.924 25.924  1.00 70.73  ? 368  SER B N   1 
ATOM   5534 C CA  . SER B 1 353 ? 88.722  53.900 25.028  1.00 70.16  ? 368  SER B CA  1 
ATOM   5535 C C   . SER B 1 353 ? 89.404  54.153 23.673  1.00 70.22  ? 368  SER B C   1 
ATOM   5536 O O   . SER B 1 353 ? 88.742  54.157 22.631  1.00 72.01  ? 368  SER B O   1 
ATOM   5537 C CB  . SER B 1 353 ? 88.563  55.228 25.776  1.00 70.04  ? 368  SER B CB  1 
ATOM   5538 O OG  . SER B 1 353 ? 89.778  55.619 26.393  1.00 72.15  ? 368  SER B OG  1 
ATOM   5539 N N   . SER B 1 354 ? 90.717  54.357 23.686  1.00 68.88  ? 369  SER B N   1 
ATOM   5540 C CA  . SER B 1 354 ? 91.455  54.657 22.460  1.00 68.39  ? 369  SER B CA  1 
ATOM   5541 C C   . SER B 1 354 ? 91.382  53.626 21.338  1.00 68.71  ? 369  SER B C   1 
ATOM   5542 O O   . SER B 1 354 ? 91.590  53.970 20.174  1.00 69.87  ? 369  SER B O   1 
ATOM   5543 C CB  . SER B 1 354 ? 92.929  54.939 22.784  1.00 67.50  ? 369  SER B CB  1 
ATOM   5544 O OG  . SER B 1 354 ? 93.586  53.793 23.299  1.00 69.16  ? 369  SER B OG  1 
ATOM   5545 N N   . ASN B 1 355 ? 91.096  52.372 21.675  1.00 67.76  ? 370  ASN B N   1 
ATOM   5546 C CA  . ASN B 1 355 ? 91.020  51.312 20.671  1.00 67.32  ? 370  ASN B CA  1 
ATOM   5547 C C   . ASN B 1 355 ? 90.272  50.161 21.327  1.00 67.26  ? 370  ASN B C   1 
ATOM   5548 O O   . ASN B 1 355 ? 90.859  49.130 21.651  1.00 67.28  ? 370  ASN B O   1 
ATOM   5549 C CB  . ASN B 1 355 ? 92.436  50.870 20.278  1.00 69.07  ? 370  ASN B CB  1 
ATOM   5550 C CG  . ASN B 1 355 ? 92.480  50.111 18.960  1.00 71.73  ? 370  ASN B CG  1 
ATOM   5551 O OD1 . ASN B 1 355 ? 91.681  49.208 18.723  1.00 73.65  ? 370  ASN B OD1 1 
ATOM   5552 N ND2 . ASN B 1 355 ? 93.431  50.467 18.103  1.00 70.85  ? 370  ASN B ND2 1 
ATOM   5553 N N   . PRO B 1 356 ? 88.956  50.329 21.528  1.00 66.50  ? 371  PRO B N   1 
ATOM   5554 C CA  . PRO B 1 356 ? 88.065  49.345 22.151  1.00 66.20  ? 371  PRO B CA  1 
ATOM   5555 C C   . PRO B 1 356 ? 88.338  47.884 21.799  1.00 65.45  ? 371  PRO B C   1 
ATOM   5556 O O   . PRO B 1 356 ? 88.368  47.018 22.677  1.00 63.75  ? 371  PRO B O   1 
ATOM   5557 C CB  . PRO B 1 356 ? 86.688  49.808 21.695  1.00 65.41  ? 371  PRO B CB  1 
ATOM   5558 C CG  . PRO B 1 356 ? 86.851  51.289 21.675  1.00 66.31  ? 371  PRO B CG  1 
ATOM   5559 C CD  . PRO B 1 356 ? 88.174  51.451 20.978  1.00 66.40  ? 371  PRO B CD  1 
ATOM   5560 N N   . PRO B 1 357 ? 88.550  47.598 20.506  1.00 65.13  ? 372  PRO B N   1 
ATOM   5561 C CA  . PRO B 1 357 ? 88.814  46.238 20.035  1.00 65.13  ? 372  PRO B CA  1 
ATOM   5562 C C   . PRO B 1 357 ? 90.130  45.592 20.442  1.00 66.56  ? 372  PRO B C   1 
ATOM   5563 O O   . PRO B 1 357 ? 90.336  44.405 20.196  1.00 69.04  ? 372  PRO B O   1 
ATOM   5564 C CB  . PRO B 1 357 ? 88.691  46.378 18.523  1.00 65.68  ? 372  PRO B CB  1 
ATOM   5565 C CG  . PRO B 1 357 ? 89.181  47.752 18.280  1.00 66.61  ? 372  PRO B CG  1 
ATOM   5566 C CD  . PRO B 1 357 ? 88.485  48.531 19.367  1.00 66.44  ? 372  PRO B CD  1 
ATOM   5567 N N   . LEU B 1 358 ? 91.033  46.351 21.048  1.00 65.24  ? 373  LEU B N   1 
ATOM   5568 C CA  . LEU B 1 358 ? 92.303  45.761 21.449  1.00 61.93  ? 373  LEU B CA  1 
ATOM   5569 C C   . LEU B 1 358 ? 92.102  44.798 22.596  1.00 61.68  ? 373  LEU B C   1 
ATOM   5570 O O   . LEU B 1 358 ? 92.957  43.954 22.852  1.00 61.26  ? 373  LEU B O   1 
ATOM   5571 C CB  . LEU B 1 358 ? 93.314  46.836 21.852  1.00 61.25  ? 373  LEU B CB  1 
ATOM   5572 C CG  . LEU B 1 358 ? 94.222  47.377 20.742  1.00 61.04  ? 373  LEU B CG  1 
ATOM   5573 C CD1 . LEU B 1 358 ? 95.145  48.453 21.289  1.00 56.76  ? 373  LEU B CD1 1 
ATOM   5574 C CD2 . LEU B 1 358 ? 95.037  46.240 20.165  1.00 57.65  ? 373  LEU B CD2 1 
ATOM   5575 N N   . ALA B 1 359 ? 90.970  44.920 23.283  1.00 59.96  ? 374  ALA B N   1 
ATOM   5576 C CA  . ALA B 1 359 ? 90.669  44.044 24.410  1.00 62.75  ? 374  ALA B CA  1 
ATOM   5577 C C   . ALA B 1 359 ? 90.836  42.585 23.996  1.00 63.74  ? 374  ALA B C   1 
ATOM   5578 O O   . ALA B 1 359 ? 90.967  41.699 24.840  1.00 62.61  ? 374  ALA B O   1 
ATOM   5579 C CB  . ALA B 1 359 ? 89.257  44.290 24.894  1.00 62.35  ? 374  ALA B CB  1 
ATOM   5580 N N   . THR B 1 360 ? 90.829  42.356 22.684  1.00 64.90  ? 375  THR B N   1 
ATOM   5581 C CA  . THR B 1 360 ? 90.981  41.027 22.099  1.00 64.90  ? 375  THR B CA  1 
ATOM   5582 C C   . THR B 1 360 ? 92.317  40.423 22.484  1.00 63.46  ? 375  THR B C   1 
ATOM   5583 O O   . THR B 1 360 ? 92.432  39.215 22.675  1.00 65.08  ? 375  THR B O   1 
ATOM   5584 C CB  . THR B 1 360 ? 90.900  41.093 20.542  1.00 70.43  ? 375  THR B CB  1 
ATOM   5585 O OG1 . THR B 1 360 ? 89.729  40.401 20.093  1.00 73.54  ? 375  THR B OG1 1 
ATOM   5586 C CG2 . THR B 1 360 ? 92.139  40.467 19.886  1.00 69.02  ? 375  THR B CG2 1 
ATOM   5587 N N   . ILE B 1 361 ? 93.328  41.273 22.583  1.00 59.59  ? 376  ILE B N   1 
ATOM   5588 C CA  . ILE B 1 361 ? 94.662  40.820 22.925  1.00 57.20  ? 376  ILE B CA  1 
ATOM   5589 C C   . ILE B 1 361 ? 94.997  41.038 24.394  1.00 56.77  ? 376  ILE B C   1 
ATOM   5590 O O   . ILE B 1 361 ? 95.514  40.150 25.072  1.00 58.53  ? 376  ILE B O   1 
ATOM   5591 C CB  . ILE B 1 361 ? 95.722  41.564 22.089  1.00 56.65  ? 376  ILE B CB  1 
ATOM   5592 C CG1 . ILE B 1 361 ? 95.458  41.354 20.602  1.00 57.86  ? 376  ILE B CG1 1 
ATOM   5593 C CG2 . ILE B 1 361 ? 97.113  41.069 22.449  1.00 53.94  ? 376  ILE B CG2 1 
ATOM   5594 C CD1 . ILE B 1 361 ? 95.548  39.906 20.173  1.00 60.59  ? 376  ILE B CD1 1 
ATOM   5595 N N   . LEU B 1 362 ? 94.695  42.232 24.878  1.00 54.67  ? 377  LEU B N   1 
ATOM   5596 C CA  . LEU B 1 362 ? 95.008  42.603 26.240  1.00 53.65  ? 377  LEU B CA  1 
ATOM   5597 C C   . LEU B 1 362 ? 94.391  41.720 27.309  1.00 53.77  ? 377  LEU B C   1 
ATOM   5598 O O   . LEU B 1 362 ? 95.009  41.480 28.343  1.00 55.60  ? 377  LEU B O   1 
ATOM   5599 C CB  . LEU B 1 362 ? 94.630  44.068 26.442  1.00 51.76  ? 377  LEU B CB  1 
ATOM   5600 C CG  . LEU B 1 362 ? 95.304  44.969 25.395  1.00 51.64  ? 377  LEU B CG  1 
ATOM   5601 C CD1 . LEU B 1 362 ? 94.691  46.337 25.431  1.00 51.36  ? 377  LEU B CD1 1 
ATOM   5602 C CD2 . LEU B 1 362 ? 96.811  45.048 25.646  1.00 52.90  ? 377  LEU B CD2 1 
ATOM   5603 N N   . ILE B 1 363 ? 93.190  41.212 27.066  1.00 54.42  ? 378  ILE B N   1 
ATOM   5604 C CA  . ILE B 1 363 ? 92.538  40.372 28.065  1.00 55.66  ? 378  ILE B CA  1 
ATOM   5605 C C   . ILE B 1 363 ? 92.485  38.900 27.669  1.00 57.77  ? 378  ILE B C   1 
ATOM   5606 O O   . ILE B 1 363 ? 91.670  38.488 26.844  1.00 56.86  ? 378  ILE B O   1 
ATOM   5607 C CB  . ILE B 1 363 ? 91.131  40.897 28.364  1.00 53.35  ? 378  ILE B CB  1 
ATOM   5608 C CG1 . ILE B 1 363 ? 91.235  42.359 28.805  1.00 52.41  ? 378  ILE B CG1 1 
ATOM   5609 C CG2 . ILE B 1 363 ? 90.488  40.074 29.458  1.00 52.35  ? 378  ILE B CG2 1 
ATOM   5610 C CD1 . ILE B 1 363 ? 89.942  43.096 28.818  1.00 47.49  ? 378  ILE B CD1 1 
ATOM   5611 N N   . PRO B 1 364 ? 93.366  38.088 28.271  1.00 61.56  ? 379  PRO B N   1 
ATOM   5612 C CA  . PRO B 1 364 ? 93.514  36.648 28.053  1.00 64.69  ? 379  PRO B CA  1 
ATOM   5613 C C   . PRO B 1 364 ? 92.263  35.839 28.362  1.00 67.78  ? 379  PRO B C   1 
ATOM   5614 O O   . PRO B 1 364 ? 91.399  36.273 29.130  1.00 66.69  ? 379  PRO B O   1 
ATOM   5615 C CB  . PRO B 1 364 ? 94.660  36.269 28.992  1.00 62.94  ? 379  PRO B CB  1 
ATOM   5616 C CG  . PRO B 1 364 ? 95.422  37.529 29.140  1.00 62.56  ? 379  PRO B CG  1 
ATOM   5617 C CD  . PRO B 1 364 ? 94.331  38.546 29.282  1.00 61.50  ? 379  PRO B CD  1 
ATOM   5618 N N   . PRO B 1 365 ? 92.161  34.640 27.767  1.00 71.61  ? 380  PRO B N   1 
ATOM   5619 C CA  . PRO B 1 365 ? 91.025  33.733 27.962  1.00 73.30  ? 380  PRO B CA  1 
ATOM   5620 C C   . PRO B 1 365 ? 90.781  33.438 29.441  1.00 75.05  ? 380  PRO B C   1 
ATOM   5621 O O   . PRO B 1 365 ? 89.663  33.579 29.937  1.00 75.06  ? 380  PRO B O   1 
ATOM   5622 C CB  . PRO B 1 365 ? 91.453  32.487 27.190  1.00 74.20  ? 380  PRO B CB  1 
ATOM   5623 C CG  . PRO B 1 365 ? 92.262  33.065 26.049  1.00 73.45  ? 380  PRO B CG  1 
ATOM   5624 C CD  . PRO B 1 365 ? 93.097  34.106 26.755  1.00 73.42  ? 380  PRO B CD  1 
ATOM   5625 N N   . HIS B 1 366 ? 91.849  33.044 30.133  1.00 78.12  ? 381  HIS B N   1 
ATOM   5626 C CA  . HIS B 1 366 ? 91.803  32.701 31.558  1.00 80.40  ? 381  HIS B CA  1 
ATOM   5627 C C   . HIS B 1 366 ? 91.357  33.836 32.473  1.00 82.40  ? 381  HIS B C   1 
ATOM   5628 O O   . HIS B 1 366 ? 91.299  33.679 33.695  1.00 81.93  ? 381  HIS B O   1 
ATOM   5629 C CB  . HIS B 1 366 ? 93.170  32.169 32.016  1.00 79.35  ? 381  HIS B CB  1 
ATOM   5630 C CG  . HIS B 1 366 ? 94.290  33.151 31.868  1.00 77.64  ? 381  HIS B CG  1 
ATOM   5631 N ND1 . HIS B 1 366 ? 94.506  34.174 32.765  1.00 76.02  ? 381  HIS B ND1 1 
ATOM   5632 C CD2 . HIS B 1 366 ? 95.259  33.261 30.930  1.00 78.74  ? 381  HIS B CD2 1 
ATOM   5633 C CE1 . HIS B 1 366 ? 95.563  34.871 32.388  1.00 76.86  ? 381  HIS B CE1 1 
ATOM   5634 N NE2 . HIS B 1 366 ? 96.039  34.337 31.278  1.00 78.36  ? 381  HIS B NE2 1 
ATOM   5635 N N   . ALA B 1 367 ? 91.054  34.981 31.877  1.00 84.90  ? 382  ALA B N   1 
ATOM   5636 C CA  . ALA B 1 367 ? 90.586  36.125 32.639  1.00 88.45  ? 382  ALA B CA  1 
ATOM   5637 C C   . ALA B 1 367 ? 89.069  36.183 32.444  1.00 91.07  ? 382  ALA B C   1 
ATOM   5638 O O   . ALA B 1 367 ? 88.303  35.878 33.365  1.00 91.10  ? 382  ALA B O   1 
ATOM   5639 C CB  . ALA B 1 367 ? 91.246  37.402 32.134  1.00 87.96  ? 382  ALA B CB  1 
ATOM   5640 N N   . ARG B 1 368 ? 88.644  36.549 31.235  1.00 93.55  ? 383  ARG B N   1 
ATOM   5641 C CA  . ARG B 1 368 ? 87.223  36.645 30.905  1.00 95.91  ? 383  ARG B CA  1 
ATOM   5642 C C   . ARG B 1 368 ? 86.435  35.480 31.515  1.00 98.03  ? 383  ARG B C   1 
ATOM   5643 O O   . ARG B 1 368 ? 85.502  35.749 32.314  1.00 99.54  ? 383  ARG B O   1 
ATOM   5644 C CB  . ARG B 1 368 ? 87.046  36.659 29.385  1.00 95.92  ? 383  ARG B CB  1 
ATOM   5645 C CG  . ARG B 1 368 ? 87.634  37.878 28.706  1.00 97.33  ? 383  ARG B CG  1 
ATOM   5646 C CD  . ARG B 1 368 ? 87.808  37.608 27.237  1.00 98.23  ? 383  ARG B CD  1 
ATOM   5647 N NE  . ARG B 1 368 ? 88.764  36.526 27.016  1.00 100.52 ? 383  ARG B NE  1 
ATOM   5648 C CZ  . ARG B 1 368 ? 88.947  35.911 25.851  1.00 101.32 ? 383  ARG B CZ  1 
ATOM   5649 N NH1 . ARG B 1 368 ? 88.232  36.261 24.791  1.00 102.06 ? 383  ARG B NH1 1 
ATOM   5650 N NH2 . ARG B 1 368 ? 89.855  34.953 25.736  1.00 101.24 ? 383  ARG B NH2 1 
ATOM   5651 N N   . ILE B 1 369 ? 86.767  34.313 31.194  1.00 99.22  ? 384  ILE B N   1 
ATOM   5652 N N   . ASP C 2 11  ? 124.337 4.901  6.220   1.00 91.05  ? 198  ASP X N   1 
ATOM   5653 C CA  . ASP C 2 11  ? 122.889 5.190  5.991   1.00 91.00  ? 198  ASP X CA  1 
ATOM   5654 C C   . ASP C 2 11  ? 122.291 5.967  7.166   1.00 90.84  ? 198  ASP X C   1 
ATOM   5655 O O   . ASP C 2 11  ? 122.032 5.391  8.226   1.00 91.45  ? 198  ASP X O   1 
ATOM   5656 C CB  . ASP C 2 11  ? 122.107 3.877  5.786   1.00 91.47  ? 198  ASP X CB  1 
ATOM   5657 C CG  . ASP C 2 11  ? 120.636 4.118  5.458   1.00 91.31  ? 198  ASP X CG  1 
ATOM   5658 O OD1 . ASP C 2 11  ? 119.957 3.169  5.025   1.00 89.63  ? 198  ASP X OD1 1 
ATOM   5659 O OD2 . ASP C 2 11  ? 120.159 5.260  5.643   1.00 91.94  ? 198  ASP X OD2 1 
ATOM   5660 N N   . PRO C 2 12  ? 122.045 7.281  6.979   1.00 90.20  ? 199  PRO X N   1 
ATOM   5661 C CA  . PRO C 2 12  ? 121.482 8.167  8.005   1.00 88.59  ? 199  PRO X CA  1 
ATOM   5662 C C   . PRO C 2 12  ? 120.020 7.996  8.462   1.00 87.48  ? 199  PRO X C   1 
ATOM   5663 O O   . PRO C 2 12  ? 119.691 8.393  9.585   1.00 87.30  ? 199  PRO X O   1 
ATOM   5664 C CB  . PRO C 2 12  ? 121.790 9.563  7.446   1.00 89.07  ? 199  PRO X CB  1 
ATOM   5665 C CG  . PRO C 2 12  ? 121.682 9.368  5.971   1.00 89.42  ? 199  PRO X CG  1 
ATOM   5666 C CD  . PRO C 2 12  ? 122.408 8.044  5.766   1.00 89.17  ? 199  PRO X CD  1 
ATOM   5667 N N   . HIS C 2 13  ? 119.153 7.421  7.626   1.00 85.87  ? 200  HIS X N   1 
ATOM   5668 C CA  . HIS C 2 13  ? 117.766 7.243  8.043   1.00 84.60  ? 200  HIS X CA  1 
ATOM   5669 C C   . HIS C 2 13  ? 117.769 6.211  9.136   1.00 81.05  ? 200  HIS X C   1 
ATOM   5670 O O   . HIS C 2 13  ? 117.128 6.371  10.173  1.00 81.44  ? 200  HIS X O   1 
ATOM   5671 C CB  . HIS C 2 13  ? 116.870 6.689  6.943   1.00 88.13  ? 200  HIS X CB  1 
ATOM   5672 C CG  . HIS C 2 13  ? 117.186 7.190  5.577   1.00 92.48  ? 200  HIS X CG  1 
ATOM   5673 N ND1 . HIS C 2 13  ? 118.206 6.665  4.810   1.00 95.69  ? 200  HIS X ND1 1 
ATOM   5674 C CD2 . HIS C 2 13  ? 116.562 8.109  4.803   1.00 94.21  ? 200  HIS X CD2 1 
ATOM   5675 C CE1 . HIS C 2 13  ? 118.189 7.233  3.617   1.00 96.47  ? 200  HIS X CE1 1 
ATOM   5676 N NE2 . HIS C 2 13  ? 117.200 8.112  3.588   1.00 95.17  ? 200  HIS X NE2 1 
ATOM   5677 N N   . ARG C 2 14  ? 118.481 5.127  8.861   1.00 77.47  ? 201  ARG X N   1 
ATOM   5678 C CA  . ARG C 2 14  ? 118.590 4.042  9.794   1.00 73.56  ? 201  ARG X CA  1 
ATOM   5679 C C   . ARG C 2 14  ? 119.269 4.595  11.031  1.00 67.86  ? 201  ARG X C   1 
ATOM   5680 O O   . ARG C 2 14  ? 118.784 4.404  12.146  1.00 68.95  ? 201  ARG X O   1 
ATOM   5681 C CB  . ARG C 2 14  ? 119.417 2.919  9.177   1.00 78.16  ? 201  ARG X CB  1 
ATOM   5682 C CG  . ARG C 2 14  ? 119.038 1.545  9.639   1.00 83.83  ? 201  ARG X CG  1 
ATOM   5683 C CD  . ARG C 2 14  ? 119.765 0.480  8.824   1.00 87.10  ? 201  ARG X CD  1 
ATOM   5684 N NE  . ARG C 2 14  ? 119.741 0.734  7.380   1.00 89.99  ? 201  ARG X NE  1 
ATOM   5685 C CZ  . ARG C 2 14  ? 119.976 -0.189 6.450   1.00 91.12  ? 201  ARG X CZ  1 
ATOM   5686 N NH1 . ARG C 2 14  ? 120.243 -1.432 6.814   1.00 92.93  ? 201  ARG X NH1 1 
ATOM   5687 N NH2 . ARG C 2 14  ? 119.966 0.132  5.158   1.00 92.27  ? 201  ARG X NH2 1 
ATOM   5688 N N   . LEU C 2 15  ? 120.385 5.293  10.829  1.00 60.84  ? 202  LEU X N   1 
ATOM   5689 C CA  . LEU C 2 15  ? 121.145 5.891  11.932  1.00 58.24  ? 202  LEU X CA  1 
ATOM   5690 C C   . LEU C 2 15  ? 120.233 6.753  12.796  1.00 57.67  ? 202  LEU X C   1 
ATOM   5691 O O   . LEU C 2 15  ? 120.300 6.720  14.023  1.00 57.87  ? 202  LEU X O   1 
ATOM   5692 C CB  . LEU C 2 15  ? 122.326 6.720  11.376  1.00 57.41  ? 202  LEU X CB  1 
ATOM   5693 C CG  . LEU C 2 15  ? 123.396 7.383  12.270  1.00 59.49  ? 202  LEU X CG  1 
ATOM   5694 C CD1 . LEU C 2 15  ? 123.918 6.439  13.356  1.00 56.59  ? 202  LEU X CD1 1 
ATOM   5695 C CD2 . LEU C 2 15  ? 124.536 7.832  11.365  1.00 59.12  ? 202  LEU X CD2 1 
ATOM   5696 N N   . LEU C 2 16  ? 119.364 7.511  12.146  1.00 56.45  ? 203  LEU X N   1 
ATOM   5697 C CA  . LEU C 2 16  ? 118.438 8.356  12.871  1.00 56.72  ? 203  LEU X CA  1 
ATOM   5698 C C   . LEU C 2 16  ? 117.420 7.483  13.582  1.00 56.17  ? 203  LEU X C   1 
ATOM   5699 O O   . LEU C 2 16  ? 117.115 7.697  14.753  1.00 55.97  ? 203  LEU X O   1 
ATOM   5700 C CB  . LEU C 2 16  ? 117.732 9.306  11.913  1.00 55.52  ? 203  LEU X CB  1 
ATOM   5701 C CG  . LEU C 2 16  ? 116.746 10.283 12.542  1.00 52.73  ? 203  LEU X CG  1 
ATOM   5702 C CD1 . LEU C 2 16  ? 117.439 11.147 13.583  1.00 51.53  ? 203  LEU X CD1 1 
ATOM   5703 C CD2 . LEU C 2 16  ? 116.156 11.131 11.437  1.00 52.81  ? 203  LEU X CD2 1 
ATOM   5704 N N   . GLN C 2 17  ? 116.907 6.493  12.864  1.00 56.21  ? 204  GLN X N   1 
ATOM   5705 C CA  . GLN C 2 17  ? 115.929 5.569  13.413  1.00 56.39  ? 204  GLN X CA  1 
ATOM   5706 C C   . GLN C 2 17  ? 116.486 4.866  14.647  1.00 52.80  ? 204  GLN X C   1 
ATOM   5707 O O   . GLN C 2 17  ? 115.752 4.592  15.592  1.00 53.11  ? 204  GLN X O   1 
ATOM   5708 C CB  . GLN C 2 17  ? 115.528 4.550  12.349  1.00 60.14  ? 204  GLN X CB  1 
ATOM   5709 C CG  . GLN C 2 17  ? 114.603 3.457  12.844  1.00 71.05  ? 204  GLN X CG  1 
ATOM   5710 C CD  . GLN C 2 17  ? 114.129 2.530  11.723  1.00 78.61  ? 204  GLN X CD  1 
ATOM   5711 O OE1 . GLN C 2 17  ? 114.791 2.391  10.683  1.00 83.35  ? 204  GLN X OE1 1 
ATOM   5712 N NE2 . GLN C 2 17  ? 112.983 1.878  11.939  1.00 78.42  ? 204  GLN X NE2 1 
ATOM   5713 N N   . GLN C 2 18  ? 117.783 4.587  14.654  1.00 48.71  ? 205  GLN X N   1 
ATOM   5714 C CA  . GLN C 2 18  ? 118.377 3.928  15.809  1.00 49.74  ? 205  GLN X CA  1 
ATOM   5715 C C   . GLN C 2 18  ? 118.595 4.900  16.956  1.00 48.69  ? 205  GLN X C   1 
ATOM   5716 O O   . GLN C 2 18  ? 118.356 4.554  18.113  1.00 47.94  ? 205  GLN X O   1 
ATOM   5717 C CB  . GLN C 2 18  ? 119.708 3.264  15.446  1.00 50.73  ? 205  GLN X CB  1 
ATOM   5718 C CG  . GLN C 2 18  ? 119.649 1.736  15.260  1.00 53.91  ? 205  GLN X CG  1 
ATOM   5719 C CD  . GLN C 2 18  ? 119.501 0.957  16.566  1.00 55.91  ? 205  GLN X CD  1 
ATOM   5720 O OE1 . GLN C 2 18  ? 120.330 1.072  17.474  1.00 57.54  ? 205  GLN X OE1 1 
ATOM   5721 N NE2 . GLN C 2 18  ? 118.446 0.150  16.657  1.00 56.20  ? 205  GLN X NE2 1 
ATOM   5722 N N   . LEU C 2 19  ? 119.063 6.105  16.640  1.00 48.19  ? 206  LEU X N   1 
ATOM   5723 C CA  . LEU C 2 19  ? 119.298 7.117  17.661  1.00 46.31  ? 206  LEU X CA  1 
ATOM   5724 C C   . LEU C 2 19  ? 117.983 7.396  18.359  1.00 47.30  ? 206  LEU X C   1 
ATOM   5725 O O   . LEU C 2 19  ? 117.939 7.605  19.572  1.00 48.07  ? 206  LEU X O   1 
ATOM   5726 C CB  . LEU C 2 19  ? 119.810 8.414  17.040  1.00 46.93  ? 206  LEU X CB  1 
ATOM   5727 C CG  . LEU C 2 19  ? 121.303 8.768  17.031  1.00 48.97  ? 206  LEU X CG  1 
ATOM   5728 C CD1 . LEU C 2 19  ? 122.085 7.820  17.910  1.00 45.99  ? 206  LEU X CD1 1 
ATOM   5729 C CD2 . LEU C 2 19  ? 121.817 8.741  15.608  1.00 48.37  ? 206  LEU X CD2 1 
ATOM   5730 N N   . VAL C 2 20  ? 116.906 7.396  17.582  1.00 45.14  ? 207  VAL X N   1 
ATOM   5731 C CA  . VAL C 2 20  ? 115.579 7.654  18.126  1.00 44.90  ? 207  VAL X CA  1 
ATOM   5732 C C   . VAL C 2 20  ? 115.035 6.472  18.913  1.00 47.07  ? 207  VAL X C   1 
ATOM   5733 O O   . VAL C 2 20  ? 114.384 6.657  19.938  1.00 49.03  ? 207  VAL X O   1 
ATOM   5734 C CB  . VAL C 2 20  ? 114.572 7.993  17.017  1.00 45.71  ? 207  VAL X CB  1 
ATOM   5735 C CG1 . VAL C 2 20  ? 113.183 8.203  17.620  1.00 42.56  ? 207  VAL X CG1 1 
ATOM   5736 C CG2 . VAL C 2 20  ? 115.031 9.234  16.264  1.00 42.51  ? 207  VAL X CG2 1 
ATOM   5737 N N   . LEU C 2 21  ? 115.282 5.259  18.424  1.00 48.63  ? 208  LEU X N   1 
ATOM   5738 C CA  . LEU C 2 21  ? 114.827 4.056  19.118  1.00 47.26  ? 208  LEU X CA  1 
ATOM   5739 C C   . LEU C 2 21  ? 115.615 3.861  20.405  1.00 47.67  ? 208  LEU X C   1 
ATOM   5740 O O   . LEU C 2 21  ? 115.047 3.549  21.459  1.00 46.61  ? 208  LEU X O   1 
ATOM   5741 C CB  . LEU C 2 21  ? 115.008 2.826  18.236  1.00 47.31  ? 208  LEU X CB  1 
ATOM   5742 C CG  . LEU C 2 21  ? 113.823 2.447  17.352  1.00 45.89  ? 208  LEU X CG  1 
ATOM   5743 C CD1 . LEU C 2 21  ? 114.141 1.133  16.676  1.00 47.16  ? 208  LEU X CD1 1 
ATOM   5744 C CD2 . LEU C 2 21  ? 112.554 2.316  18.186  1.00 44.98  ? 208  LEU X CD2 1 
ATOM   5745 N N   . SER C 2 22  ? 116.929 4.054  20.305  1.00 45.24  ? 209  SER X N   1 
ATOM   5746 C CA  . SER C 2 22  ? 117.830 3.906  21.438  1.00 45.82  ? 209  SER X CA  1 
ATOM   5747 C C   . SER C 2 22  ? 117.706 5.032  22.462  1.00 46.30  ? 209  SER X C   1 
ATOM   5748 O O   . SER C 2 22  ? 117.971 4.819  23.651  1.00 45.95  ? 209  SER X O   1 
ATOM   5749 C CB  . SER C 2 22  ? 119.280 3.820  20.946  1.00 46.33  ? 209  SER X CB  1 
ATOM   5750 O OG  . SER C 2 22  ? 119.682 5.018  20.311  1.00 47.50  ? 209  SER X OG  1 
ATOM   5751 N N   . GLY C 2 23  ? 117.306 6.222  22.001  1.00 47.20  ? 210  GLY X N   1 
ATOM   5752 C CA  . GLY C 2 23  ? 117.172 7.368  22.887  1.00 42.49  ? 210  GLY X CA  1 
ATOM   5753 C C   . GLY C 2 23  ? 118.514 8.054  23.078  1.00 42.19  ? 210  GLY X C   1 
ATOM   5754 O O   . GLY C 2 23  ? 118.915 8.368  24.204  1.00 39.10  ? 210  GLY X O   1 
ATOM   5755 N N   . ASN C 2 24  ? 119.215 8.276  21.966  1.00 42.02  ? 211  ASN X N   1 
ATOM   5756 C CA  . ASN C 2 24  ? 120.531 8.920  21.980  1.00 42.84  ? 211  ASN X CA  1 
ATOM   5757 C C   . ASN C 2 24  ? 120.649 9.987  20.898  1.00 44.04  ? 211  ASN X C   1 
ATOM   5758 O O   . ASN C 2 24  ? 121.744 10.333 20.458  1.00 44.49  ? 211  ASN X O   1 
ATOM   5759 C CB  . ASN C 2 24  ? 121.636 7.879  21.781  1.00 45.57  ? 211  ASN X CB  1 
ATOM   5760 C CG  . ASN C 2 24  ? 121.753 6.932  22.949  1.00 46.53  ? 211  ASN X CG  1 
ATOM   5761 O OD1 . ASN C 2 24  ? 121.976 7.355  24.080  1.00 47.47  ? 211  ASN X OD1 1 
ATOM   5762 N ND2 . ASN C 2 24  ? 121.593 5.643  22.686  1.00 47.85  ? 211  ASN X ND2 1 
ATOM   5763 N N   . LEU C 2 25  ? 119.513 10.514 20.472  1.00 44.28  ? 212  LEU X N   1 
ATOM   5764 C CA  . LEU C 2 25  ? 119.513 11.539 19.448  1.00 44.79  ? 212  LEU X CA  1 
ATOM   5765 C C   . LEU C 2 25  ? 120.199 12.837 19.889  1.00 45.46  ? 212  LEU X C   1 
ATOM   5766 O O   . LEU C 2 25  ? 121.135 13.287 19.231  1.00 44.51  ? 212  LEU X O   1 
ATOM   5767 C CB  . LEU C 2 25  ? 118.080 11.829 19.007  1.00 41.95  ? 212  LEU X CB  1 
ATOM   5768 C CG  . LEU C 2 25  ? 117.990 12.903 17.929  1.00 39.91  ? 212  LEU X CG  1 
ATOM   5769 C CD1 . LEU C 2 25  ? 118.942 12.587 16.779  1.00 29.57  ? 212  LEU X CD1 1 
ATOM   5770 C CD2 . LEU C 2 25  ? 116.560 12.985 17.451  1.00 37.53  ? 212  LEU X CD2 1 
ATOM   5771 N N   . ILE C 2 26  ? 119.744 13.430 20.996  1.00 44.10  ? 213  ILE X N   1 
ATOM   5772 C CA  . ILE C 2 26  ? 120.313 14.689 21.487  1.00 45.26  ? 213  ILE X CA  1 
ATOM   5773 C C   . ILE C 2 26  ? 121.774 14.539 21.870  1.00 46.38  ? 213  ILE X C   1 
ATOM   5774 O O   . ILE C 2 26  ? 122.622 15.351 21.503  1.00 47.65  ? 213  ILE X O   1 
ATOM   5775 C CB  . ILE C 2 26  ? 119.547 15.199 22.702  1.00 42.73  ? 213  ILE X CB  1 
ATOM   5776 C CG1 . ILE C 2 26  ? 118.065 15.292 22.350  1.00 39.60  ? 213  ILE X CG1 1 
ATOM   5777 C CG2 . ILE C 2 26  ? 120.107 16.547 23.138  1.00 39.67  ? 213  ILE X CG2 1 
ATOM   5778 C CD1 . ILE C 2 26  ? 117.184 15.680 23.492  1.00 38.08  ? 213  ILE X CD1 1 
ATOM   5779 N N   . LYS C 2 27  ? 122.048 13.490 22.626  1.00 47.13  ? 214  LYS X N   1 
ATOM   5780 C CA  . LYS C 2 27  ? 123.391 13.152 23.082  1.00 47.68  ? 214  LYS X CA  1 
ATOM   5781 C C   . LYS C 2 27  ? 124.353 12.998 21.892  1.00 48.86  ? 214  LYS X C   1 
ATOM   5782 O O   . LYS C 2 27  ? 125.458 13.545 21.897  1.00 51.84  ? 214  LYS X O   1 
ATOM   5783 C CB  . LYS C 2 27  ? 123.289 11.854 23.877  1.00 48.96  ? 214  LYS X CB  1 
ATOM   5784 C CG  . LYS C 2 27  ? 124.553 11.075 24.069  1.00 47.60  ? 214  LYS X CG  1 
ATOM   5785 C CD  . LYS C 2 27  ? 124.226 9.673  24.575  1.00 46.37  ? 214  LYS X CD  1 
ATOM   5786 C CE  . LYS C 2 27  ? 123.288 9.694  25.784  1.00 45.54  ? 214  LYS X CE  1 
ATOM   5787 N NZ  . LYS C 2 27  ? 121.852 9.771  25.389  1.00 48.48  ? 214  LYS X NZ  1 
ATOM   5788 N N   . GLU C 2 28  ? 123.924 12.260 20.875  1.00 46.71  ? 215  GLU X N   1 
ATOM   5789 C CA  . GLU C 2 28  ? 124.731 12.042 19.685  1.00 48.38  ? 215  GLU X CA  1 
ATOM   5790 C C   . GLU C 2 28  ? 124.952 13.327 18.888  1.00 51.07  ? 215  GLU X C   1 
ATOM   5791 O O   . GLU C 2 28  ? 126.063 13.603 18.436  1.00 53.66  ? 215  GLU X O   1 
ATOM   5792 C CB  . GLU C 2 28  ? 124.052 10.998 18.806  1.00 52.43  ? 215  GLU X CB  1 
ATOM   5793 C CG  . GLU C 2 28  ? 124.555 10.917 17.371  1.00 58.35  ? 215  GLU X CG  1 
ATOM   5794 C CD  . GLU C 2 28  ? 126.030 10.546 17.259  1.00 63.92  ? 215  GLU X CD  1 
ATOM   5795 O OE1 . GLU C 2 28  ? 126.569 9.904  18.196  1.00 63.96  ? 215  GLU X OE1 1 
ATOM   5796 O OE2 . GLU C 2 28  ? 126.641 10.885 16.217  1.00 66.05  ? 215  GLU X OE2 1 
ATOM   5797 N N   . ALA C 2 29  ? 123.892 14.109 18.708  1.00 49.55  ? 216  ALA X N   1 
ATOM   5798 C CA  . ALA C 2 29  ? 123.984 15.363 17.972  1.00 46.44  ? 216  ALA X CA  1 
ATOM   5799 C C   . ALA C 2 29  ? 124.961 16.310 18.667  1.00 44.89  ? 216  ALA X C   1 
ATOM   5800 O O   . ALA C 2 29  ? 125.734 17.006 18.010  1.00 42.79  ? 216  ALA X O   1 
ATOM   5801 C CB  . ALA C 2 29  ? 122.612 16.006 17.870  1.00 45.01  ? 216  ALA X CB  1 
ATOM   5802 N N   . VAL C 2 30  ? 124.929 16.341 19.996  1.00 44.21  ? 217  VAL X N   1 
ATOM   5803 C CA  . VAL C 2 30  ? 125.843 17.201 20.736  1.00 47.06  ? 217  VAL X CA  1 
ATOM   5804 C C   . VAL C 2 30  ? 127.283 16.741 20.506  1.00 47.09  ? 217  VAL X C   1 
ATOM   5805 O O   . VAL C 2 30  ? 128.179 17.559 20.317  1.00 46.92  ? 217  VAL X O   1 
ATOM   5806 C CB  . VAL C 2 30  ? 125.543 17.188 22.252  1.00 45.81  ? 217  VAL X CB  1 
ATOM   5807 C CG1 . VAL C 2 30  ? 126.629 17.941 23.001  1.00 43.65  ? 217  VAL X CG1 1 
ATOM   5808 C CG2 . VAL C 2 30  ? 124.195 17.835 22.522  1.00 48.34  ? 217  VAL X CG2 1 
ATOM   5809 N N   . ARG C 2 31  ? 127.508 15.431 20.522  1.00 49.71  ? 218  ARG X N   1 
ATOM   5810 C CA  . ARG C 2 31  ? 128.851 14.911 20.295  1.00 53.22  ? 218  ARG X CA  1 
ATOM   5811 C C   . ARG C 2 31  ? 129.398 15.443 18.983  1.00 53.40  ? 218  ARG X C   1 
ATOM   5812 O O   . ARG C 2 31  ? 130.520 15.948 18.918  1.00 53.94  ? 218  ARG X O   1 
ATOM   5813 C CB  . ARG C 2 31  ? 128.846 13.388 20.221  1.00 55.84  ? 218  ARG X CB  1 
ATOM   5814 C CG  . ARG C 2 31  ? 130.210 12.815 19.858  1.00 55.13  ? 218  ARG X CG  1 
ATOM   5815 C CD  . ARG C 2 31  ? 130.195 11.301 19.760  1.00 57.41  ? 218  ARG X CD  1 
ATOM   5816 N NE  . ARG C 2 31  ? 129.569 10.825 18.531  1.00 63.50  ? 218  ARG X NE  1 
ATOM   5817 C CZ  . ARG C 2 31  ? 130.071 11.014 17.315  1.00 64.83  ? 218  ARG X CZ  1 
ATOM   5818 N NH1 . ARG C 2 31  ? 131.213 11.673 17.156  1.00 64.42  ? 218  ARG X NH1 1 
ATOM   5819 N NH2 . ARG C 2 31  ? 129.436 10.539 16.253  1.00 66.16  ? 218  ARG X NH2 1 
ATOM   5820 N N   . ARG C 2 32  ? 128.595 15.302 17.936  1.00 52.89  ? 219  ARG X N   1 
ATOM   5821 C CA  . ARG C 2 32  ? 128.970 15.762 16.610  1.00 53.47  ? 219  ARG X CA  1 
ATOM   5822 C C   . ARG C 2 32  ? 129.150 17.259 16.608  1.00 54.44  ? 219  ARG X C   1 
ATOM   5823 O O   . ARG C 2 32  ? 129.932 17.805 15.841  1.00 55.51  ? 219  ARG X O   1 
ATOM   5824 C CB  . ARG C 2 32  ? 127.886 15.423 15.609  1.00 52.54  ? 219  ARG X CB  1 
ATOM   5825 C CG  . ARG C 2 32  ? 127.546 13.976 15.517  1.00 54.29  ? 219  ARG X CG  1 
ATOM   5826 C CD  . ARG C 2 32  ? 126.655 13.795 14.330  1.00 57.37  ? 219  ARG X CD  1 
ATOM   5827 N NE  . ARG C 2 32  ? 126.400 12.397 14.035  1.00 60.94  ? 219  ARG X NE  1 
ATOM   5828 C CZ  . ARG C 2 32  ? 125.848 11.980 12.902  1.00 66.44  ? 219  ARG X CZ  1 
ATOM   5829 N NH1 . ARG C 2 32  ? 125.500 12.861 11.966  1.00 69.31  ? 219  ARG X NH1 1 
ATOM   5830 N NH2 . ARG C 2 32  ? 125.645 10.684 12.706  1.00 68.94  ? 219  ARG X NH2 1 
ATOM   5831 N N   . LEU C 2 33  ? 128.397 17.923 17.465  1.00 56.14  ? 220  LEU X N   1 
ATOM   5832 C CA  . LEU C 2 33  ? 128.465 19.365 17.568  1.00 58.74  ? 220  LEU X CA  1 
ATOM   5833 C C   . LEU C 2 33  ? 129.847 19.842 18.035  1.00 61.33  ? 220  LEU X C   1 
ATOM   5834 O O   . LEU C 2 33  ? 130.259 20.969 17.760  1.00 61.54  ? 220  LEU X O   1 
ATOM   5835 C CB  . LEU C 2 33  ? 127.394 19.834 18.547  1.00 58.62  ? 220  LEU X CB  1 
ATOM   5836 C CG  . LEU C 2 33  ? 127.192 21.337 18.638  1.00 59.23  ? 220  LEU X CG  1 
ATOM   5837 C CD1 . LEU C 2 33  ? 126.953 21.905 17.252  1.00 60.54  ? 220  LEU X CD1 1 
ATOM   5838 C CD2 . LEU C 2 33  ? 126.011 21.623 19.530  1.00 62.70  ? 220  LEU X CD2 1 
ATOM   5839 N N   . HIS C 2 34  ? 130.566 18.964 18.724  1.00 63.84  ? 221  HIS X N   1 
ATOM   5840 C CA  . HIS C 2 34  ? 131.875 19.294 19.272  1.00 66.35  ? 221  HIS X CA  1 
ATOM   5841 C C   . HIS C 2 34  ? 133.084 18.858 18.455  1.00 67.08  ? 221  HIS X C   1 
ATOM   5842 O O   . HIS C 2 34  ? 134.204 19.290 18.726  1.00 66.91  ? 221  HIS X O   1 
ATOM   5843 C CB  . HIS C 2 34  ? 131.972 18.694 20.666  1.00 65.82  ? 221  HIS X CB  1 
ATOM   5844 C CG  . HIS C 2 34  ? 130.981 19.262 21.631  1.00 66.66  ? 221  HIS X CG  1 
ATOM   5845 N ND1 . HIS C 2 34  ? 130.419 18.517 22.647  1.00 65.15  ? 221  HIS X ND1 1 
ATOM   5846 C CD2 . HIS C 2 34  ? 130.485 20.515 21.762  1.00 64.41  ? 221  HIS X CD2 1 
ATOM   5847 C CE1 . HIS C 2 34  ? 129.621 19.288 23.363  1.00 62.93  ? 221  HIS X CE1 1 
ATOM   5848 N NE2 . HIS C 2 34  ? 129.644 20.504 22.848  1.00 65.10  ? 221  HIS X NE2 1 
ATOM   5849 N N   . SER C 2 35  ? 132.859 18.006 17.461  1.00 68.71  ? 222  SER X N   1 
ATOM   5850 C CA  . SER C 2 35  ? 133.938 17.495 16.621  1.00 70.07  ? 222  SER X CA  1 
ATOM   5851 C C   . SER C 2 35  ? 134.331 18.412 15.461  1.00 71.30  ? 222  SER X C   1 
ATOM   5852 O O   . SER C 2 35  ? 135.517 18.808 15.401  1.00 73.09  ? 222  SER X O   1 
ATOM   5853 C CB  . SER C 2 35  ? 133.544 16.123 16.083  1.00 69.75  ? 222  SER X CB  1 
ATOM   5854 O OG  . SER C 2 35  ? 133.196 15.259 17.152  1.00 73.31  ? 222  SER X OG  1 
ATOM   5855 N N   . ARG C 2 36  ? 133.459 18.720 14.620  1.00 73.05  ? 223  ARG X N   1 
ATOM   5856 N N   . ASP D 2 11  ? 126.684 78.837 28.161  1.00 97.07  ? 198  ASP Y N   1 
ATOM   5857 C CA  . ASP D 2 11  ? 125.287 78.373 28.443  1.00 98.03  ? 198  ASP Y CA  1 
ATOM   5858 C C   . ASP D 2 11  ? 124.649 77.750 27.190  1.00 98.00  ? 198  ASP Y C   1 
ATOM   5859 O O   . ASP D 2 11  ? 124.127 78.473 26.332  1.00 97.15  ? 198  ASP Y O   1 
ATOM   5860 C CB  . ASP D 2 11  ? 124.433 79.557 28.931  1.00 98.63  ? 198  ASP Y CB  1 
ATOM   5861 C CG  . ASP D 2 11  ? 122.984 79.171 29.206  1.00 99.25  ? 198  ASP Y CG  1 
ATOM   5862 O OD1 . ASP D 2 11  ? 122.163 80.074 29.490  1.00 98.88  ? 198  ASP Y OD1 1 
ATOM   5863 O OD2 . ASP D 2 11  ? 122.665 77.965 29.142  1.00 101.17 ? 198  ASP Y OD2 1 
ATOM   5864 N N   . PRO D 2 12  ? 124.687 76.399 27.072  1.00 98.46  ? 199  PRO Y N   1 
ATOM   5865 C CA  . PRO D 2 12  ? 124.124 75.643 25.933  1.00 97.66  ? 199  PRO Y CA  1 
ATOM   5866 C C   . PRO D 2 12  ? 122.585 75.586 25.895  1.00 96.40  ? 199  PRO Y C   1 
ATOM   5867 O O   . PRO D 2 12  ? 122.002 74.765 25.163  1.00 95.44  ? 199  PRO Y O   1 
ATOM   5868 C CB  . PRO D 2 12  ? 124.739 74.240 26.091  1.00 98.80  ? 199  PRO Y CB  1 
ATOM   5869 C CG  . PRO D 2 12  ? 125.964 74.469 26.950  1.00 99.96  ? 199  PRO Y CG  1 
ATOM   5870 C CD  . PRO D 2 12  ? 125.471 75.503 27.941  1.00 99.27  ? 199  PRO Y CD  1 
ATOM   5871 N N   . HIS D 2 13  ? 121.946 76.449 26.692  1.00 94.41  ? 200  HIS Y N   1 
ATOM   5872 C CA  . HIS D 2 13  ? 120.483 76.535 26.760  1.00 91.95  ? 200  HIS Y CA  1 
ATOM   5873 C C   . HIS D 2 13  ? 119.997 77.579 25.753  1.00 88.78  ? 200  HIS Y C   1 
ATOM   5874 O O   . HIS D 2 13  ? 119.079 77.315 24.963  1.00 87.49  ? 200  HIS Y O   1 
ATOM   5875 C CB  . HIS D 2 13  ? 120.031 76.913 28.178  1.00 94.56  ? 200  HIS Y CB  1 
ATOM   5876 C CG  . HIS D 2 13  ? 118.544 76.878 28.370  1.00 98.64  ? 200  HIS Y CG  1 
ATOM   5877 N ND1 . HIS D 2 13  ? 117.957 76.573 29.582  1.00 101.10 ? 200  HIS Y ND1 1 
ATOM   5878 C CD2 . HIS D 2 13  ? 117.524 77.125 27.511  1.00 100.62 ? 200  HIS Y CD2 1 
ATOM   5879 C CE1 . HIS D 2 13  ? 116.642 76.631 29.460  1.00 102.30 ? 200  HIS Y CE1 1 
ATOM   5880 N NE2 . HIS D 2 13  ? 116.353 76.965 28.213  1.00 102.83 ? 200  HIS Y NE2 1 
ATOM   5881 N N   . ARG D 2 14  ? 120.606 78.764 25.793  1.00 84.10  ? 201  ARG Y N   1 
ATOM   5882 C CA  . ARG D 2 14  ? 120.265 79.821 24.851  1.00 78.79  ? 201  ARG Y CA  1 
ATOM   5883 C C   . ARG D 2 14  ? 120.771 79.340 23.504  1.00 73.10  ? 201  ARG Y C   1 
ATOM   5884 O O   . ARG D 2 14  ? 120.105 79.483 22.481  1.00 69.55  ? 201  ARG Y O   1 
ATOM   5885 C CB  . ARG D 2 14  ? 120.963 81.122 25.232  1.00 82.20  ? 201  ARG Y CB  1 
ATOM   5886 C CG  . ARG D 2 14  ? 120.342 81.799 26.430  1.00 87.75  ? 201  ARG Y CG  1 
ATOM   5887 C CD  . ARG D 2 14  ? 121.152 83.005 26.861  1.00 90.70  ? 201  ARG Y CD  1 
ATOM   5888 N NE  . ARG D 2 14  ? 122.398 82.611 27.513  1.00 92.47  ? 201  ARG Y NE  1 
ATOM   5889 C CZ  . ARG D 2 14  ? 123.234 83.462 28.098  1.00 92.32  ? 201  ARG Y CZ  1 
ATOM   5890 N NH1 . ARG D 2 14  ? 122.959 84.761 28.109  1.00 92.66  ? 201  ARG Y NH1 1 
ATOM   5891 N NH2 . ARG D 2 14  ? 124.335 83.015 28.686  1.00 91.69  ? 201  ARG Y NH2 1 
ATOM   5892 N N   . LEU D 2 15  ? 121.963 78.754 23.534  1.00 67.29  ? 202  LEU Y N   1 
ATOM   5893 C CA  . LEU D 2 15  ? 122.602 78.211 22.350  1.00 62.37  ? 202  LEU Y CA  1 
ATOM   5894 C C   . LEU D 2 15  ? 121.621 77.302 21.623  1.00 61.05  ? 202  LEU Y C   1 
ATOM   5895 O O   . LEU D 2 15  ? 121.445 77.404 20.409  1.00 57.72  ? 202  LEU Y O   1 
ATOM   5896 C CB  . LEU D 2 15  ? 123.841 77.421 22.762  1.00 59.76  ? 202  LEU Y CB  1 
ATOM   5897 C CG  . LEU D 2 15  ? 124.582 76.654 21.669  1.00 62.03  ? 202  LEU Y CG  1 
ATOM   5898 C CD1 . LEU D 2 15  ? 125.085 77.618 20.607  1.00 63.83  ? 202  LEU Y CD1 1 
ATOM   5899 C CD2 . LEU D 2 15  ? 125.727 75.877 22.293  1.00 61.29  ? 202  LEU Y CD2 1 
ATOM   5900 N N   . LEU D 2 16  ? 120.980 76.411 22.371  1.00 58.40  ? 203  LEU Y N   1 
ATOM   5901 C CA  . LEU D 2 16  ? 120.018 75.503 21.775  1.00 60.00  ? 203  LEU Y CA  1 
ATOM   5902 C C   . LEU D 2 16  ? 118.924 76.323 21.119  1.00 60.79  ? 203  LEU Y C   1 
ATOM   5903 O O   . LEU D 2 16  ? 118.631 76.149 19.936  1.00 62.66  ? 203  LEU Y O   1 
ATOM   5904 C CB  . LEU D 2 16  ? 119.405 74.585 22.831  1.00 60.74  ? 203  LEU Y CB  1 
ATOM   5905 C CG  . LEU D 2 16  ? 118.311 73.647 22.310  1.00 59.03  ? 203  LEU Y CG  1 
ATOM   5906 C CD1 . LEU D 2 16  ? 118.883 72.735 21.232  1.00 55.34  ? 203  LEU Y CD1 1 
ATOM   5907 C CD2 . LEU D 2 16  ? 117.735 72.846 23.470  1.00 57.84  ? 203  LEU Y CD2 1 
ATOM   5908 N N   . GLN D 2 17  ? 118.324 77.223 21.889  1.00 61.84  ? 204  GLN Y N   1 
ATOM   5909 C CA  . GLN D 2 17  ? 117.267 78.074 21.366  1.00 63.17  ? 204  GLN Y CA  1 
ATOM   5910 C C   . GLN D 2 17  ? 117.707 78.826 20.104  1.00 61.94  ? 204  GLN Y C   1 
ATOM   5911 O O   . GLN D 2 17  ? 116.902 79.054 19.205  1.00 62.52  ? 204  GLN Y O   1 
ATOM   5912 C CB  . GLN D 2 17  ? 116.809 79.056 22.446  1.00 66.51  ? 204  GLN Y CB  1 
ATOM   5913 C CG  . GLN D 2 17  ? 116.226 78.363 23.682  1.00 73.75  ? 204  GLN Y CG  1 
ATOM   5914 C CD  . GLN D 2 17  ? 115.788 79.340 24.775  1.00 76.15  ? 204  GLN Y CD  1 
ATOM   5915 O OE1 . GLN D 2 17  ? 116.610 80.053 25.359  1.00 78.80  ? 204  GLN Y OE1 1 
ATOM   5916 N NE2 . GLN D 2 17  ? 114.486 79.373 25.055  1.00 75.60  ? 204  GLN Y NE2 1 
ATOM   5917 N N   . GLN D 2 18  ? 118.981 79.208 20.029  1.00 60.50  ? 205  GLN Y N   1 
ATOM   5918 C CA  . GLN D 2 18  ? 119.489 79.915 18.851  1.00 57.51  ? 205  GLN Y CA  1 
ATOM   5919 C C   . GLN D 2 18  ? 119.604 78.966 17.674  1.00 58.11  ? 205  GLN Y C   1 
ATOM   5920 O O   . GLN D 2 18  ? 119.152 79.274 16.568  1.00 58.84  ? 205  GLN Y O   1 
ATOM   5921 C CB  . GLN D 2 18  ? 120.868 80.531 19.121  1.00 56.59  ? 205  GLN Y CB  1 
ATOM   5922 C CG  . GLN D 2 18  ? 120.861 82.032 19.404  1.00 56.80  ? 205  GLN Y CG  1 
ATOM   5923 C CD  . GLN D 2 18  ? 120.263 82.861 18.271  1.00 55.46  ? 205  GLN Y CD  1 
ATOM   5924 O OE1 . GLN D 2 18  ? 120.704 82.787 17.119  1.00 57.13  ? 205  GLN Y OE1 1 
ATOM   5925 N NE2 . GLN D 2 18  ? 119.257 83.663 18.601  1.00 52.89  ? 205  GLN Y NE2 1 
ATOM   5926 N N   . LEU D 2 19  ? 120.222 77.812 17.919  1.00 57.54  ? 206  LEU Y N   1 
ATOM   5927 C CA  . LEU D 2 19  ? 120.403 76.808 16.881  1.00 54.67  ? 206  LEU Y CA  1 
ATOM   5928 C C   . LEU D 2 19  ? 119.058 76.404 16.297  1.00 53.38  ? 206  LEU Y C   1 
ATOM   5929 O O   . LEU D 2 19  ? 118.939 76.159 15.096  1.00 52.82  ? 206  LEU Y O   1 
ATOM   5930 C CB  . LEU D 2 19  ? 121.118 75.582 17.451  1.00 56.25  ? 206  LEU Y CB  1 
ATOM   5931 C CG  . LEU D 2 19  ? 122.547 75.819 17.957  1.00 57.00  ? 206  LEU Y CG  1 
ATOM   5932 C CD1 . LEU D 2 19  ? 123.133 74.534 18.545  1.00 57.83  ? 206  LEU Y CD1 1 
ATOM   5933 C CD2 . LEU D 2 19  ? 123.401 76.307 16.807  1.00 52.99  ? 206  LEU Y CD2 1 
ATOM   5934 N N   . VAL D 2 20  ? 118.044 76.346 17.152  1.00 51.91  ? 207  VAL Y N   1 
ATOM   5935 C CA  . VAL D 2 20  ? 116.705 75.976 16.712  1.00 52.33  ? 207  VAL Y CA  1 
ATOM   5936 C C   . VAL D 2 20  ? 116.113 77.075 15.835  1.00 53.48  ? 207  VAL Y C   1 
ATOM   5937 O O   . VAL D 2 20  ? 115.520 76.795 14.787  1.00 56.64  ? 207  VAL Y O   1 
ATOM   5938 C CB  . VAL D 2 20  ? 115.761 75.725 17.915  1.00 50.26  ? 207  VAL Y CB  1 
ATOM   5939 C CG1 . VAL D 2 20  ? 114.398 75.278 17.428  1.00 51.32  ? 207  VAL Y CG1 1 
ATOM   5940 C CG2 . VAL D 2 20  ? 116.341 74.661 18.819  1.00 49.56  ? 207  VAL Y CG2 1 
ATOM   5941 N N   . LEU D 2 21  ? 116.283 78.324 16.270  1.00 54.12  ? 208  LEU Y N   1 
ATOM   5942 C CA  . LEU D 2 21  ? 115.771 79.494 15.551  1.00 51.59  ? 208  LEU Y CA  1 
ATOM   5943 C C   . LEU D 2 21  ? 116.539 79.736 14.262  1.00 53.76  ? 208  LEU Y C   1 
ATOM   5944 O O   . LEU D 2 21  ? 115.945 79.981 13.211  1.00 54.91  ? 208  LEU Y O   1 
ATOM   5945 C CB  . LEU D 2 21  ? 115.850 80.734 16.441  1.00 47.73  ? 208  LEU Y CB  1 
ATOM   5946 C CG  . LEU D 2 21  ? 114.884 80.754 17.626  1.00 45.94  ? 208  LEU Y CG  1 
ATOM   5947 C CD1 . LEU D 2 21  ? 115.149 81.945 18.513  1.00 47.72  ? 208  LEU Y CD1 1 
ATOM   5948 C CD2 . LEU D 2 21  ? 113.475 80.799 17.102  1.00 45.33  ? 208  LEU Y CD2 1 
ATOM   5949 N N   . SER D 2 22  ? 117.863 79.663 14.342  1.00 52.93  ? 209  SER Y N   1 
ATOM   5950 C CA  . SER D 2 22  ? 118.688 79.868 13.165  1.00 53.84  ? 209  SER Y CA  1 
ATOM   5951 C C   . SER D 2 22  ? 118.501 78.719 12.184  1.00 55.65  ? 209  SER Y C   1 
ATOM   5952 O O   . SER D 2 22  ? 118.678 78.894 10.983  1.00 55.46  ? 209  SER Y O   1 
ATOM   5953 C CB  . SER D 2 22  ? 120.160 79.969 13.560  1.00 52.56  ? 209  SER Y CB  1 
ATOM   5954 O OG  . SER D 2 22  ? 120.606 78.768 14.157  1.00 54.71  ? 209  SER Y OG  1 
ATOM   5955 N N   . GLY D 2 23  ? 118.125 77.550 12.697  1.00 55.72  ? 210  GLY Y N   1 
ATOM   5956 C CA  . GLY D 2 23  ? 117.956 76.393 11.843  1.00 52.13  ? 210  GLY Y CA  1 
ATOM   5957 C C   . GLY D 2 23  ? 119.307 75.749 11.561  1.00 52.72  ? 210  GLY Y C   1 
ATOM   5958 O O   . GLY D 2 23  ? 119.648 75.520 10.405  1.00 53.12  ? 210  GLY Y O   1 
ATOM   5959 N N   . ASN D 2 24  ? 120.082 75.476 12.613  1.00 54.04  ? 211  ASN Y N   1 
ATOM   5960 C CA  . ASN D 2 24  ? 121.397 74.839 12.485  1.00 54.39  ? 211  ASN Y CA  1 
ATOM   5961 C C   . ASN D 2 24  ? 121.574 73.778 13.553  1.00 56.25  ? 211  ASN Y C   1 
ATOM   5962 O O   . ASN D 2 24  ? 122.705 73.436 13.908  1.00 58.03  ? 211  ASN Y O   1 
ATOM   5963 C CB  . ASN D 2 24  ? 122.530 75.845 12.669  1.00 56.54  ? 211  ASN Y CB  1 
ATOM   5964 C CG  . ASN D 2 24  ? 122.566 76.881 11.593  1.00 58.34  ? 211  ASN Y CG  1 
ATOM   5965 O OD1 . ASN D 2 24  ? 122.762 76.568 10.420  1.00 61.16  ? 211  ASN Y OD1 1 
ATOM   5966 N ND2 . ASN D 2 24  ? 122.382 78.136 11.981  1.00 60.79  ? 211  ASN Y ND2 1 
ATOM   5967 N N   . LEU D 2 25  ? 120.470 73.261 14.078  1.00 54.86  ? 212  LEU Y N   1 
ATOM   5968 C CA  . LEU D 2 25  ? 120.558 72.271 15.141  1.00 55.29  ? 212  LEU Y CA  1 
ATOM   5969 C C   . LEU D 2 25  ? 121.255 70.973 14.721  1.00 54.55  ? 212  LEU Y C   1 
ATOM   5970 O O   . LEU D 2 25  ? 122.230 70.541 15.362  1.00 53.23  ? 212  LEU Y O   1 
ATOM   5971 C CB  . LEU D 2 25  ? 119.154 71.986 15.701  1.00 53.67  ? 212  LEU Y CB  1 
ATOM   5972 C CG  . LEU D 2 25  ? 119.035 70.977 16.857  1.00 50.40  ? 212  LEU Y CG  1 
ATOM   5973 C CD1 . LEU D 2 25  ? 119.946 71.377 18.013  1.00 43.60  ? 212  LEU Y CD1 1 
ATOM   5974 C CD2 . LEU D 2 25  ? 117.581 70.891 17.303  1.00 47.09  ? 212  LEU Y CD2 1 
ATOM   5975 N N   . ILE D 2 26  ? 120.769 70.359 13.643  1.00 52.38  ? 213  ILE Y N   1 
ATOM   5976 C CA  . ILE D 2 26  ? 121.329 69.097 13.153  1.00 52.72  ? 213  ILE Y CA  1 
ATOM   5977 C C   . ILE D 2 26  ? 122.754 69.260 12.649  1.00 53.76  ? 213  ILE Y C   1 
ATOM   5978 O O   . ILE D 2 26  ? 123.606 68.408 12.837  1.00 53.69  ? 213  ILE Y O   1 
ATOM   5979 C CB  . ILE D 2 26  ? 120.435 68.526 12.025  1.00 51.09  ? 213  ILE Y CB  1 
ATOM   5980 C CG1 . ILE D 2 26  ? 118.992 68.476 12.517  1.00 49.78  ? 213  ILE Y CG1 1 
ATOM   5981 C CG2 . ILE D 2 26  ? 120.939 67.138 11.599  1.00 48.40  ? 213  ILE Y CG2 1 
ATOM   5982 C CD1 . ILE D 2 26  ? 117.998 68.052 11.495  1.00 48.22  ? 213  ILE Y CD1 1 
ATOM   5983 N N   . LYS D 2 27  ? 122.987 70.386 12.003  1.00 56.27  ? 214  LYS Y N   1 
ATOM   5984 C CA  . LYS D 2 27  ? 124.280 70.745 11.441  1.00 57.85  ? 214  LYS Y CA  1 
ATOM   5985 C C   . LYS D 2 27  ? 125.350 70.802 12.542  1.00 56.40  ? 214  LYS Y C   1 
ATOM   5986 O O   . LYS D 2 27  ? 126.427 70.228 12.422  1.00 56.48  ? 214  LYS Y O   1 
ATOM   5987 C CB  . LYS D 2 27  ? 124.107 72.110 10.759  1.00 60.18  ? 214  LYS Y CB  1 
ATOM   5988 C CG  . LYS D 2 27  ? 125.007 72.415 9.587   1.00 61.91  ? 214  LYS Y CG  1 
ATOM   5989 C CD  . LYS D 2 27  ? 124.686 73.813 9.028   1.00 62.18  ? 214  LYS Y CD  1 
ATOM   5990 C CE  . LYS D 2 27  ? 123.347 73.894 8.282   1.00 61.44  ? 214  LYS Y CE  1 
ATOM   5991 N NZ  . LYS D 2 27  ? 122.101 73.827 9.127   1.00 58.78  ? 214  LYS Y NZ  1 
ATOM   5992 N N   . GLU D 2 28  ? 125.023 71.503 13.617  1.00 55.99  ? 215  GLU Y N   1 
ATOM   5993 C CA  . GLU D 2 28  ? 125.923 71.658 14.736  1.00 55.85  ? 215  GLU Y CA  1 
ATOM   5994 C C   . GLU D 2 28  ? 126.018 70.392 15.577  1.00 55.40  ? 215  GLU Y C   1 
ATOM   5995 O O   . GLU D 2 28  ? 127.044 70.112 16.209  1.00 53.37  ? 215  GLU Y O   1 
ATOM   5996 C CB  . GLU D 2 28  ? 125.451 72.827 15.591  1.00 56.48  ? 215  GLU Y CB  1 
ATOM   5997 C CG  . GLU D 2 28  ? 126.282 73.098 16.838  1.00 61.06  ? 215  GLU Y CG  1 
ATOM   5998 C CD  . GLU D 2 28  ? 127.742 73.414 16.517  1.00 62.52  ? 215  GLU Y CD  1 
ATOM   5999 O OE1 . GLU D 2 28  ? 128.004 73.962 15.415  1.00 63.94  ? 215  GLU Y OE1 1 
ATOM   6000 O OE2 . GLU D 2 28  ? 128.617 73.135 17.377  1.00 63.56  ? 215  GLU Y OE2 1 
ATOM   6001 N N   . ALA D 2 29  ? 124.944 69.624 15.607  1.00 53.77  ? 216  ALA Y N   1 
ATOM   6002 C CA  . ALA D 2 29  ? 124.989 68.400 16.379  1.00 55.19  ? 216  ALA Y CA  1 
ATOM   6003 C C   . ALA D 2 29  ? 125.916 67.401 15.681  1.00 54.19  ? 216  ALA Y C   1 
ATOM   6004 O O   . ALA D 2 29  ? 126.804 66.815 16.300  1.00 53.21  ? 216  ALA Y O   1 
ATOM   6005 C CB  . ALA D 2 29  ? 123.606 67.830 16.526  1.00 54.44  ? 216  ALA Y CB  1 
ATOM   6006 N N   . VAL D 2 30  ? 125.728 67.231 14.377  1.00 54.53  ? 217  VAL Y N   1 
ATOM   6007 C CA  . VAL D 2 30  ? 126.554 66.307 13.602  1.00 55.80  ? 217  VAL Y CA  1 
ATOM   6008 C C   . VAL D 2 30  ? 128.029 66.695 13.693  1.00 57.72  ? 217  VAL Y C   1 
ATOM   6009 O O   . VAL D 2 30  ? 128.914 65.832 13.722  1.00 57.61  ? 217  VAL Y O   1 
ATOM   6010 C CB  . VAL D 2 30  ? 126.130 66.295 12.121  1.00 53.56  ? 217  VAL Y CB  1 
ATOM   6011 C CG1 . VAL D 2 30  ? 127.108 65.493 11.309  1.00 49.50  ? 217  VAL Y CG1 1 
ATOM   6012 C CG2 . VAL D 2 30  ? 124.719 65.710 11.995  1.00 51.12  ? 217  VAL Y CG2 1 
ATOM   6013 N N   . ARG D 2 31  ? 128.287 68.000 13.751  1.00 59.95  ? 218  ARG Y N   1 
ATOM   6014 C CA  . ARG D 2 31  ? 129.652 68.499 13.842  1.00 62.30  ? 218  ARG Y CA  1 
ATOM   6015 C C   . ARG D 2 31  ? 130.282 68.005 15.132  1.00 62.96  ? 218  ARG Y C   1 
ATOM   6016 O O   . ARG D 2 31  ? 131.332 67.367 15.109  1.00 63.79  ? 218  ARG Y O   1 
ATOM   6017 C CB  . ARG D 2 31  ? 129.671 70.030 13.808  1.00 63.37  ? 218  ARG Y CB  1 
ATOM   6018 C CG  . ARG D 2 31  ? 131.076 70.621 13.650  1.00 67.76  ? 218  ARG Y CG  1 
ATOM   6019 C CD  . ARG D 2 31  ? 131.102 72.135 13.883  1.00 73.47  ? 218  ARG Y CD  1 
ATOM   6020 N NE  . ARG D 2 31  ? 130.761 72.480 15.264  1.00 76.35  ? 218  ARG Y NE  1 
ATOM   6021 C CZ  . ARG D 2 31  ? 131.529 72.214 16.319  1.00 78.86  ? 218  ARG Y CZ  1 
ATOM   6022 N NH1 . ARG D 2 31  ? 132.697 71.601 16.154  1.00 80.57  ? 218  ARG Y NH1 1 
ATOM   6023 N NH2 . ARG D 2 31  ? 131.121 72.543 17.545  1.00 78.19  ? 218  ARG Y NH2 1 
ATOM   6024 N N   . ARG D 2 32  ? 129.632 68.299 16.254  1.00 61.71  ? 219  ARG Y N   1 
ATOM   6025 C CA  . ARG D 2 32  ? 130.132 67.880 17.559  1.00 62.42  ? 219  ARG Y CA  1 
ATOM   6026 C C   . ARG D 2 32  ? 130.291 66.367 17.622  1.00 63.36  ? 219  ARG Y C   1 
ATOM   6027 O O   . ARG D 2 32  ? 131.034 65.844 18.446  1.00 62.80  ? 219  ARG Y O   1 
ATOM   6028 C CB  . ARG D 2 32  ? 129.173 68.302 18.666  1.00 63.61  ? 219  ARG Y CB  1 
ATOM   6029 C CG  . ARG D 2 32  ? 128.887 69.779 18.774  1.00 65.93  ? 219  ARG Y CG  1 
ATOM   6030 C CD  . ARG D 2 32  ? 127.984 69.991 19.975  1.00 69.09  ? 219  ARG Y CD  1 
ATOM   6031 N NE  . ARG D 2 32  ? 127.764 71.391 20.318  1.00 69.86  ? 219  ARG Y NE  1 
ATOM   6032 C CZ  . ARG D 2 32  ? 127.341 71.797 21.512  1.00 70.84  ? 219  ARG Y CZ  1 
ATOM   6033 N NH1 . ARG D 2 32  ? 127.097 70.909 22.471  1.00 70.60  ? 219  ARG Y NH1 1 
ATOM   6034 N NH2 . ARG D 2 32  ? 127.166 73.087 21.752  1.00 71.28  ? 219  ARG Y NH2 1 
ATOM   6035 N N   . LEU D 2 33  ? 129.573 65.668 16.753  1.00 65.64  ? 220  LEU Y N   1 
ATOM   6036 C CA  . LEU D 2 33  ? 129.616 64.212 16.708  1.00 67.07  ? 220  LEU Y CA  1 
ATOM   6037 C C   . LEU D 2 33  ? 131.000 63.728 16.273  1.00 69.20  ? 220  LEU Y C   1 
ATOM   6038 O O   . LEU D 2 33  ? 131.652 62.938 16.959  1.00 69.24  ? 220  LEU Y O   1 
ATOM   6039 C CB  . LEU D 2 33  ? 128.551 63.712 15.724  1.00 66.16  ? 220  LEU Y CB  1 
ATOM   6040 C CG  . LEU D 2 33  ? 128.178 62.231 15.679  1.00 62.90  ? 220  LEU Y CG  1 
ATOM   6041 C CD1 . LEU D 2 33  ? 127.562 61.817 16.997  1.00 64.08  ? 220  LEU Y CD1 1 
ATOM   6042 C CD2 . LEU D 2 33  ? 127.192 61.999 14.553  1.00 64.00  ? 220  LEU Y CD2 1 
ATOM   6043 N N   . HIS D 2 34  ? 131.438 64.227 15.126  1.00 73.01  ? 221  HIS Y N   1 
ATOM   6044 C CA  . HIS D 2 34  ? 132.722 63.866 14.546  1.00 76.95  ? 221  HIS Y CA  1 
ATOM   6045 C C   . HIS D 2 34  ? 133.878 64.602 15.196  1.00 79.07  ? 221  HIS Y C   1 
ATOM   6046 O O   . HIS D 2 34  ? 135.013 64.516 14.728  1.00 80.80  ? 221  HIS Y O   1 
ATOM   6047 C CB  . HIS D 2 34  ? 132.708 64.180 13.054  1.00 79.00  ? 221  HIS Y CB  1 
ATOM   6048 C CG  . HIS D 2 34  ? 131.622 63.478 12.302  1.00 80.31  ? 221  HIS Y CG  1 
ATOM   6049 N ND1 . HIS D 2 34  ? 130.975 64.048 11.226  1.00 79.82  ? 221  HIS Y ND1 1 
ATOM   6050 C CD2 . HIS D 2 34  ? 131.078 62.249 12.462  1.00 81.00  ? 221  HIS Y CD2 1 
ATOM   6051 C CE1 . HIS D 2 34  ? 130.077 63.201 10.756  1.00 81.23  ? 221  HIS Y CE1 1 
ATOM   6052 N NE2 . HIS D 2 34  ? 130.119 62.101 11.488  1.00 82.99  ? 221  HIS Y NE2 1 
ATOM   6053 N N   . SER D 2 35  ? 133.592 65.335 16.264  1.00 80.65  ? 222  SER Y N   1 
ATOM   6054 C CA  . SER D 2 35  ? 134.631 66.079 16.967  1.00 81.39  ? 222  SER Y CA  1 
ATOM   6055 C C   . SER D 2 35  ? 135.500 65.153 17.822  1.00 82.20  ? 222  SER Y C   1 
ATOM   6056 O O   . SER D 2 35  ? 136.742 65.307 17.779  1.00 81.40  ? 222  SER Y O   1 
ATOM   6057 C CB  . SER D 2 35  ? 134.001 67.170 17.837  1.00 80.85  ? 222  SER Y CB  1 
ATOM   6058 O OG  . SER D 2 35  ? 133.333 68.123 17.029  1.00 80.41  ? 222  SER Y OG  1 
ATOM   6059 N N   . ARG D 2 36  ? 134.930 64.287 18.527  1.00 84.23  ? 223  ARG Y N   1 
HETATM 6060 S S   . SO4 E 3 .   ? 101.158 9.981  5.782   1.00 50.21  ? 1385 SO4 A S   1 
HETATM 6061 O O1  . SO4 E 3 .   ? 99.756  9.540  5.820   1.00 44.66  ? 1385 SO4 A O1  1 
HETATM 6062 O O2  . SO4 E 3 .   ? 101.389 10.799 4.568   1.00 46.84  ? 1385 SO4 A O2  1 
HETATM 6063 O O3  . SO4 E 3 .   ? 102.054 8.812  5.759   1.00 47.44  ? 1385 SO4 A O3  1 
HETATM 6064 O O4  . SO4 E 3 .   ? 101.427 10.757 7.009   1.00 54.39  ? 1385 SO4 A O4  1 
HETATM 6065 S S   . SO4 F 3 .   ? 90.536  16.500 14.366  1.00 82.98  ? 1386 SO4 A S   1 
HETATM 6066 O O1  . SO4 F 3 .   ? 90.222  15.276 15.140  1.00 82.95  ? 1386 SO4 A O1  1 
HETATM 6067 O O2  . SO4 F 3 .   ? 90.193  16.300 12.941  1.00 80.91  ? 1386 SO4 A O2  1 
HETATM 6068 O O3  . SO4 F 3 .   ? 91.982  16.785 14.461  1.00 86.85  ? 1386 SO4 A O3  1 
HETATM 6069 O O4  . SO4 F 3 .   ? 89.781  17.647 14.927  1.00 80.92  ? 1386 SO4 A O4  1 
HETATM 6070 S S   . SO4 G 3 .   ? 102.977 74.834 29.756  1.00 44.27  ? 1384 SO4 B S   1 
HETATM 6071 O O1  . SO4 G 3 .   ? 103.455 74.229 31.013  1.00 44.74  ? 1384 SO4 B O1  1 
HETATM 6072 O O2  . SO4 G 3 .   ? 102.732 73.819 28.708  1.00 47.99  ? 1384 SO4 B O2  1 
HETATM 6073 O O3  . SO4 G 3 .   ? 103.998 75.775 29.270  1.00 40.50  ? 1384 SO4 B O3  1 
HETATM 6074 O O4  . SO4 G 3 .   ? 101.707 75.519 30.025  1.00 47.22  ? 1384 SO4 B O4  1 
HETATM 6075 S S   . SO4 H 3 .   ? 91.357  68.794 22.430  1.00 123.40 ? 1385 SO4 B S   1 
HETATM 6076 O O1  . SO4 H 3 .   ? 91.200  67.454 23.062  1.00 123.44 ? 1385 SO4 B O1  1 
HETATM 6077 O O2  . SO4 H 3 .   ? 90.093  69.153 21.731  1.00 123.26 ? 1385 SO4 B O2  1 
HETATM 6078 O O3  . SO4 H 3 .   ? 92.478  68.776 21.450  1.00 122.23 ? 1385 SO4 B O3  1 
HETATM 6079 O O4  . SO4 H 3 .   ? 91.644  69.789 23.495  1.00 123.56 ? 1385 SO4 B O4  1 
HETATM 6080 C C   . TRS I 4 .   ? 95.470  75.915 33.230  1.00 89.68  ? 1386 TRS B C   1 
HETATM 6081 C C1  . TRS I 4 .   ? 95.193  74.410 32.998  1.00 87.75  ? 1386 TRS B C1  1 
HETATM 6082 C C2  . TRS I 4 .   ? 96.734  76.105 34.123  1.00 89.54  ? 1386 TRS B C2  1 
HETATM 6083 C C3  . TRS I 4 .   ? 95.608  76.661 31.857  1.00 90.01  ? 1386 TRS B C3  1 
HETATM 6084 N N   . TRS I 4 .   ? 94.329  76.493 33.947  1.00 91.49  ? 1386 TRS B N   1 
HETATM 6085 O O1  . TRS I 4 .   ? 96.256  73.764 32.336  1.00 84.49  ? 1386 TRS B O1  1 
HETATM 6086 O O2  . TRS I 4 .   ? 97.774  76.839 33.507  1.00 90.47  ? 1386 TRS B O2  1 
HETATM 6087 O O3  . TRS I 4 .   ? 96.624  76.107 31.040  1.00 88.81  ? 1386 TRS B O3  1 
HETATM 6088 O O   . HOH J 5 .   ? 99.965  16.941 -21.224 1.00 60.67  ? 2001 HOH A O   1 
HETATM 6089 O O   . HOH J 5 .   ? 98.600  19.820 19.882  1.00 34.88  ? 2002 HOH A O   1 
HETATM 6090 O O   . HOH J 5 .   ? 113.604 16.034 -12.449 1.00 48.16  ? 2003 HOH A O   1 
HETATM 6091 O O   . HOH J 5 .   ? 101.448 20.339 19.142  1.00 40.28  ? 2004 HOH A O   1 
HETATM 6092 O O   . HOH J 5 .   ? 97.565  5.228  -5.926  1.00 48.21  ? 2005 HOH A O   1 
HETATM 6093 O O   . HOH J 5 .   ? 115.496 47.680 2.484   1.00 52.41  ? 2006 HOH A O   1 
HETATM 6094 O O   . HOH J 5 .   ? 93.995  10.280 3.380   1.00 44.47  ? 2007 HOH A O   1 
HETATM 6095 O O   . HOH J 5 .   ? 93.005  14.822 0.934   1.00 48.12  ? 2008 HOH A O   1 
HETATM 6096 O O   . HOH J 5 .   ? 92.980  29.604 -5.344  1.00 54.38  ? 2009 HOH A O   1 
HETATM 6097 O O   . HOH J 5 .   ? 93.401  26.607 -5.224  1.00 47.23  ? 2010 HOH A O   1 
HETATM 6098 O O   . HOH J 5 .   ? 103.349 18.602 17.577  1.00 37.50  ? 2011 HOH A O   1 
HETATM 6099 O O   . HOH J 5 .   ? 98.989  15.143 -19.241 1.00 56.42  ? 2012 HOH A O   1 
HETATM 6100 O O   . HOH J 5 .   ? 117.232 31.005 -2.315  1.00 76.74  ? 2013 HOH A O   1 
HETATM 6101 O O   . HOH J 5 .   ? 119.627 36.485 -0.405  1.00 62.62  ? 2014 HOH A O   1 
HETATM 6102 O O   . HOH J 5 .   ? 120.349 35.271 -11.182 1.00 50.55  ? 2015 HOH A O   1 
HETATM 6103 O O   . HOH J 5 .   ? 117.478 37.980 0.660   1.00 63.92  ? 2016 HOH A O   1 
HETATM 6104 O O   . HOH J 5 .   ? 112.148 47.926 1.727   1.00 40.30  ? 2017 HOH A O   1 
HETATM 6105 O O   . HOH J 5 .   ? 106.227 46.848 10.071  1.00 60.97  ? 2018 HOH A O   1 
HETATM 6106 O O   . HOH J 5 .   ? 95.018  22.836 11.067  1.00 32.75  ? 2019 HOH A O   1 
HETATM 6107 O O   . HOH J 5 .   ? 103.160 19.681 -0.016  1.00 48.49  ? 2020 HOH A O   1 
HETATM 6108 O O   . HOH J 5 .   ? 100.622 13.509 2.104   1.00 35.46  ? 2021 HOH A O   1 
HETATM 6109 O O   . HOH J 5 .   ? 105.758 18.211 -2.270  1.00 40.91  ? 2022 HOH A O   1 
HETATM 6110 O O   . HOH J 5 .   ? 110.621 25.721 -7.888  1.00 60.09  ? 2023 HOH A O   1 
HETATM 6111 O O   . HOH J 5 .   ? 102.986 21.588 -8.991  1.00 53.26  ? 2024 HOH A O   1 
HETATM 6112 O O   . HOH J 5 .   ? 107.800 16.411 1.818   1.00 48.49  ? 2025 HOH A O   1 
HETATM 6113 O O   . HOH J 5 .   ? 94.392  14.292 3.473   1.00 61.71  ? 2026 HOH A O   1 
HETATM 6114 O O   . HOH J 5 .   ? 95.915  12.427 10.774  1.00 40.39  ? 2027 HOH A O   1 
HETATM 6115 O O   . HOH J 5 .   ? 114.771 16.597 2.182   1.00 34.99  ? 2028 HOH A O   1 
HETATM 6116 O O   . HOH J 5 .   ? 117.954 11.402 6.693   1.00 73.36  ? 2029 HOH A O   1 
HETATM 6117 O O   . HOH J 5 .   ? 116.901 25.900 7.008   1.00 38.88  ? 2030 HOH A O   1 
HETATM 6118 O O   . HOH J 5 .   ? 115.082 13.915 9.615   1.00 46.06  ? 2031 HOH A O   1 
HETATM 6119 O O   . HOH J 5 .   ? 114.548 22.760 10.199  1.00 44.26  ? 2032 HOH A O   1 
HETATM 6120 O O   . HOH J 5 .   ? 108.410 21.006 9.005   1.00 33.17  ? 2033 HOH A O   1 
HETATM 6121 O O   . HOH J 5 .   ? 103.716 20.091 15.139  1.00 29.45  ? 2034 HOH A O   1 
HETATM 6122 O O   . HOH J 5 .   ? 112.486 12.646 10.344  1.00 52.54  ? 2035 HOH A O   1 
HETATM 6123 O O   . HOH J 5 .   ? 101.585 15.991 20.909  1.00 47.80  ? 2036 HOH A O   1 
HETATM 6124 O O   . HOH J 5 .   ? 96.717  20.300 12.810  1.00 39.09  ? 2037 HOH A O   1 
HETATM 6125 O O   . HOH J 5 .   ? 106.037 22.402 6.017   1.00 28.35  ? 2038 HOH A O   1 
HETATM 6126 O O   . HOH J 5 .   ? 116.153 28.438 5.818   1.00 36.52  ? 2039 HOH A O   1 
HETATM 6127 O O   . HOH J 5 .   ? 118.788 31.270 0.324   1.00 52.16  ? 2040 HOH A O   1 
HETATM 6128 O O   . HOH J 5 .   ? 117.823 33.934 0.568   1.00 52.08  ? 2041 HOH A O   1 
HETATM 6129 O O   . HOH J 5 .   ? 120.093 31.705 -2.068  1.00 48.74  ? 2042 HOH A O   1 
HETATM 6130 O O   . HOH J 5 .   ? 123.062 27.939 4.150   1.00 67.75  ? 2043 HOH A O   1 
HETATM 6131 O O   . HOH J 5 .   ? 124.153 21.003 3.599   1.00 39.62  ? 2044 HOH A O   1 
HETATM 6132 O O   . HOH J 5 .   ? 115.662 27.459 22.873  1.00 37.44  ? 2045 HOH A O   1 
HETATM 6133 O O   . HOH J 5 .   ? 118.661 21.134 27.496  1.00 41.49  ? 2046 HOH A O   1 
HETATM 6134 O O   . HOH J 5 .   ? 111.907 14.426 28.914  1.00 53.47  ? 2047 HOH A O   1 
HETATM 6135 O O   . HOH J 5 .   ? 118.232 16.733 31.897  1.00 46.67  ? 2048 HOH A O   1 
HETATM 6136 O O   . HOH J 5 .   ? 104.382 15.957 18.029  1.00 43.89  ? 2049 HOH A O   1 
HETATM 6137 O O   . HOH J 5 .   ? 109.380 12.684 26.232  1.00 55.17  ? 2050 HOH A O   1 
HETATM 6138 O O   . HOH J 5 .   ? 113.153 12.151 27.735  1.00 59.32  ? 2051 HOH A O   1 
HETATM 6139 O O   . HOH J 5 .   ? 120.816 8.680  27.916  1.00 43.07  ? 2052 HOH A O   1 
HETATM 6140 O O   . HOH J 5 .   ? 120.210 15.123 30.790  1.00 49.62  ? 2053 HOH A O   1 
HETATM 6141 O O   . HOH J 5 .   ? 123.966 26.682 20.769  1.00 51.41  ? 2054 HOH A O   1 
HETATM 6142 O O   . HOH J 5 .   ? 124.673 42.405 15.549  1.00 65.45  ? 2055 HOH A O   1 
HETATM 6143 O O   . HOH J 5 .   ? 125.346 43.642 20.331  1.00 48.84  ? 2056 HOH A O   1 
HETATM 6144 O O   . HOH J 5 .   ? 120.934 41.608 14.217  1.00 43.44  ? 2057 HOH A O   1 
HETATM 6145 O O   . HOH J 5 .   ? 119.222 40.807 7.342   1.00 39.29  ? 2058 HOH A O   1 
HETATM 6146 O O   . HOH J 5 .   ? 119.265 45.592 13.921  1.00 59.90  ? 2059 HOH A O   1 
HETATM 6147 O O   . HOH J 5 .   ? 109.657 46.135 10.895  1.00 45.66  ? 2060 HOH A O   1 
HETATM 6148 O O   . HOH J 5 .   ? 111.947 45.927 12.709  1.00 39.05  ? 2061 HOH A O   1 
HETATM 6149 O O   . HOH J 5 .   ? 113.057 31.553 20.637  1.00 63.16  ? 2062 HOH A O   1 
HETATM 6150 O O   . HOH J 5 .   ? 111.310 35.376 21.826  1.00 30.58  ? 2063 HOH A O   1 
HETATM 6151 O O   . HOH J 5 .   ? 106.748 31.450 21.227  1.00 47.66  ? 2064 HOH A O   1 
HETATM 6152 O O   . HOH J 5 .   ? 113.579 28.851 19.839  1.00 72.74  ? 2065 HOH A O   1 
HETATM 6153 O O   . HOH J 5 .   ? 109.790 26.601 22.594  1.00 51.25  ? 2066 HOH A O   1 
HETATM 6154 O O   . HOH J 5 .   ? 112.862 26.663 21.715  1.00 33.37  ? 2067 HOH A O   1 
HETATM 6155 O O   . HOH J 5 .   ? 101.217 25.932 17.909  1.00 47.66  ? 2068 HOH A O   1 
HETATM 6156 O O   . HOH J 5 .   ? 101.353 27.073 14.720  1.00 48.77  ? 2069 HOH A O   1 
HETATM 6157 O O   . HOH J 5 .   ? 94.825  31.640 15.489  1.00 42.33  ? 2070 HOH A O   1 
HETATM 6158 O O   . HOH J 5 .   ? 100.744 30.800 20.374  1.00 60.08  ? 2071 HOH A O   1 
HETATM 6159 O O   . HOH J 5 .   ? 100.187 47.930 16.621  1.00 48.11  ? 2072 HOH A O   1 
HETATM 6160 O O   . HOH J 5 .   ? 96.853  42.629 8.634   1.00 47.22  ? 2073 HOH A O   1 
HETATM 6161 O O   . HOH J 5 .   ? 92.591  44.554 0.373   1.00 36.70  ? 2074 HOH A O   1 
HETATM 6162 O O   . HOH J 5 .   ? 94.833  32.427 18.401  1.00 60.52  ? 2075 HOH A O   1 
HETATM 6163 O O   . HOH J 5 .   ? 88.773  47.539 13.387  1.00 83.85  ? 2076 HOH A O   1 
HETATM 6164 O O   . HOH K 5 .   ? 95.876  61.661 61.283  1.00 51.80  ? 2001 HOH B O   1 
HETATM 6165 O O   . HOH K 5 .   ? 104.698 70.047 57.199  1.00 56.27  ? 2002 HOH B O   1 
HETATM 6166 O O   . HOH K 5 .   ? 116.824 59.714 58.919  1.00 62.98  ? 2003 HOH B O   1 
HETATM 6167 O O   . HOH K 5 .   ? 118.375 42.349 29.222  1.00 50.72  ? 2004 HOH B O   1 
HETATM 6168 O O   . HOH K 5 .   ? 94.635  77.808 43.882  1.00 54.25  ? 2005 HOH B O   1 
HETATM 6169 O O   . HOH K 5 .   ? 89.745  70.930 35.987  1.00 47.80  ? 2006 HOH B O   1 
HETATM 6170 O O   . HOH K 5 .   ? 98.778  46.795 35.705  1.00 42.54  ? 2007 HOH B O   1 
HETATM 6171 O O   . HOH K 5 .   ? 94.110  74.935 43.786  1.00 44.59  ? 2008 HOH B O   1 
HETATM 6172 O O   . HOH K 5 .   ? 90.669  73.887 46.003  1.00 43.11  ? 2009 HOH B O   1 
HETATM 6173 O O   . HOH K 5 .   ? 103.743 83.455 49.849  1.00 69.51  ? 2010 HOH B O   1 
HETATM 6174 O O   . HOH K 5 .   ? 103.768 71.195 54.699  1.00 60.30  ? 2011 HOH B O   1 
HETATM 6175 O O   . HOH K 5 .   ? 106.136 58.841 47.699  1.00 46.30  ? 2012 HOH B O   1 
HETATM 6176 O O   . HOH K 5 .   ? 122.492 49.481 46.328  1.00 56.30  ? 2013 HOH B O   1 
HETATM 6177 O O   . HOH K 5 .   ? 114.452 42.739 42.890  1.00 72.33  ? 2014 HOH B O   1 
HETATM 6178 O O   . HOH K 5 .   ? 117.329 43.450 31.696  1.00 45.09  ? 2015 HOH B O   1 
HETATM 6179 O O   . HOH K 5 .   ? 114.190 38.835 42.779  1.00 65.60  ? 2016 HOH B O   1 
HETATM 6180 O O   . HOH K 5 .   ? 106.933 37.929 26.779  1.00 50.41  ? 2017 HOH B O   1 
HETATM 6181 O O   . HOH K 5 .   ? 111.689 36.128 27.048  1.00 61.24  ? 2018 HOH B O   1 
HETATM 6182 O O   . HOH K 5 .   ? 99.072  46.433 39.097  1.00 42.22  ? 2019 HOH B O   1 
HETATM 6183 O O   . HOH K 5 .   ? 95.286  56.210 26.009  1.00 51.51  ? 2020 HOH B O   1 
HETATM 6184 O O   . HOH K 5 .   ? 104.767 65.376 35.758  1.00 33.73  ? 2021 HOH B O   1 
HETATM 6185 O O   . HOH K 5 .   ? 116.272 62.425 37.099  1.00 49.11  ? 2022 HOH B O   1 
HETATM 6186 O O   . HOH K 5 .   ? 105.810 63.459 45.095  1.00 53.68  ? 2023 HOH B O   1 
HETATM 6187 O O   . HOH K 5 .   ? 96.355  70.761 33.001  1.00 51.88  ? 2024 HOH B O   1 
HETATM 6188 O O   . HOH K 5 .   ? 97.778  72.359 25.318  1.00 28.92  ? 2025 HOH B O   1 
HETATM 6189 O O   . HOH K 5 .   ? 90.264  66.021 20.681  1.00 83.00  ? 2026 HOH B O   1 
HETATM 6190 O O   . HOH K 5 .   ? 124.461 68.623 33.519  1.00 74.48  ? 2027 HOH B O   1 
HETATM 6191 O O   . HOH K 5 .   ? 115.891 61.481 25.084  1.00 35.56  ? 2028 HOH B O   1 
HETATM 6192 O O   . HOH K 5 .   ? 109.793 63.504 26.115  1.00 32.91  ? 2029 HOH B O   1 
HETATM 6193 O O   . HOH K 5 .   ? 114.213 73.946 22.189  1.00 53.90  ? 2030 HOH B O   1 
HETATM 6194 O O   . HOH K 5 .   ? 113.709 71.634 24.681  1.00 43.05  ? 2031 HOH B O   1 
HETATM 6195 O O   . HOH K 5 .   ? 104.272 64.443 20.341  1.00 37.59  ? 2032 HOH B O   1 
HETATM 6196 O O   . HOH K 5 .   ? 97.966  64.504 23.577  1.00 48.79  ? 2033 HOH B O   1 
HETATM 6197 O O   . HOH K 5 .   ? 107.644 62.259 29.847  1.00 39.77  ? 2034 HOH B O   1 
HETATM 6198 O O   . HOH K 5 .   ? 117.487 55.759 29.488  1.00 27.91  ? 2035 HOH B O   1 
HETATM 6199 O O   . HOH K 5 .   ? 121.209 52.900 35.804  1.00 51.45  ? 2036 HOH B O   1 
HETATM 6200 O O   . HOH K 5 .   ? 118.344 58.160 28.030  1.00 42.17  ? 2037 HOH B O   1 
HETATM 6201 O O   . HOH K 5 .   ? 115.924 67.625 -0.241  1.00 77.33  ? 2038 HOH B O   1 
HETATM 6202 O O   . HOH K 5 .   ? 111.086 64.544 1.867   1.00 58.67  ? 2039 HOH B O   1 
HETATM 6203 O O   . HOH K 5 .   ? 102.935 74.911 10.409  1.00 57.51  ? 2040 HOH B O   1 
HETATM 6204 O O   . HOH K 5 .   ? 120.916 74.657 6.165   1.00 64.10  ? 2041 HOH B O   1 
HETATM 6205 O O   . HOH K 5 .   ? 126.132 54.239 14.008  1.00 54.81  ? 2042 HOH B O   1 
HETATM 6206 O O   . HOH K 5 .   ? 118.574 48.623 13.028  1.00 52.00  ? 2043 HOH B O   1 
HETATM 6207 O O   . HOH K 5 .   ? 125.283 50.562 23.704  1.00 43.69  ? 2044 HOH B O   1 
HETATM 6208 O O   . HOH K 5 .   ? 125.595 39.123 26.641  1.00 38.85  ? 2045 HOH B O   1 
HETATM 6209 O O   . HOH K 5 .   ? 107.199 35.911 24.562  1.00 45.69  ? 2046 HOH B O   1 
HETATM 6210 O O   . HOH K 5 .   ? 110.651 38.256 25.186  1.00 45.46  ? 2047 HOH B O   1 
HETATM 6211 O O   . HOH K 5 .   ? 112.498 37.798 22.804  1.00 41.09  ? 2048 HOH B O   1 
HETATM 6212 O O   . HOH K 5 .   ? 107.751 38.109 18.302  1.00 44.89  ? 2049 HOH B O   1 
HETATM 6213 O O   . HOH K 5 .   ? 111.805 48.358 14.294  1.00 49.51  ? 2050 HOH B O   1 
HETATM 6214 O O   . HOH K 5 .   ? 107.327 52.765 14.935  1.00 46.24  ? 2051 HOH B O   1 
HETATM 6215 O O   . HOH K 5 .   ? 113.691 57.218 14.160  1.00 36.63  ? 2052 HOH B O   1 
HETATM 6216 O O   . HOH K 5 .   ? 97.080  54.306 24.335  1.00 47.74  ? 2053 HOH B O   1 
HETATM 6217 O O   . HOH K 5 .   ? 101.957 46.187 19.096  1.00 43.42  ? 2054 HOH B O   1 
HETATM 6218 O O   . HOH K 5 .   ? 100.228 50.324 14.969  1.00 50.67  ? 2055 HOH B O   1 
HETATM 6219 O O   . HOH K 5 .   ? 100.877 35.912 20.730  1.00 50.10  ? 2056 HOH B O   1 
HETATM 6220 O O   . HOH K 5 .   ? 93.791  40.684 36.867  1.00 45.99  ? 2057 HOH B O   1 
HETATM 6221 O O   . HOH K 5 .   ? 93.068  54.217 26.007  1.00 60.87  ? 2058 HOH B O   1 
HETATM 6222 O O   . HOH K 5 .   ? 97.633  42.181 28.392  1.00 46.79  ? 2059 HOH B O   1 
HETATM 6223 O O   . HOH L 5 .   ? 114.776 8.355  8.428   1.00 72.54  ? 2001 HOH X O   1 
HETATM 6224 O O   . HOH L 5 .   ? 118.217 6.969  26.456  1.00 65.93  ? 2002 HOH X O   1 
HETATM 6225 O O   . HOH L 5 .   ? 124.653 10.443 9.221   1.00 49.21  ? 2003 HOH X O   1 
HETATM 6226 O O   . HOH M 5 .   ? 119.246 82.262 22.299  1.00 43.50  ? 2001 HOH Y O   1 
HETATM 6227 O O   . HOH M 5 .   ? 118.880 76.428 7.752   1.00 47.49  ? 2002 HOH Y O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   16  ?   ?   ?   A . n 
A 1 2   HIS 2   17  ?   ?   ?   A . n 
A 1 3   HIS 3   18  ?   ?   ?   A . n 
A 1 4   HIS 4   19  ?   ?   ?   A . n 
A 1 5   HIS 5   20  ?   ?   ?   A . n 
A 1 6   HIS 6   21  ?   ?   ?   A . n 
A 1 7   HIS 7   22  ?   ?   ?   A . n 
A 1 8   HIS 8   23  ?   ?   ?   A . n 
A 1 9   HIS 9   24  ?   ?   ?   A . n 
A 1 10  HIS 10  25  ?   ?   ?   A . n 
A 1 11  HIS 11  26  ?   ?   ?   A . n 
A 1 12  LYS 12  27  ?   ?   ?   A . n 
A 1 13  VAL 13  28  ?   ?   ?   A . n 
A 1 14  SER 14  29  ?   ?   ?   A . n 
A 1 15  ARG 15  30  ?   ?   ?   A . n 
A 1 16  ASP 16  31  ?   ?   ?   A . n 
A 1 17  LYS 17  32  ?   ?   ?   A . n 
A 1 18  ASP 18  33  ?   ?   ?   A . n 
A 1 19  GLY 19  34  ?   ?   ?   A . n 
A 1 20  SER 20  35  ?   ?   ?   A . n 
A 1 21  LYS 21  36  36  LYS LYS A . n 
A 1 22  VAL 22  37  37  VAL VAL A . n 
A 1 23  THR 23  38  38  THR THR A . n 
A 1 24  THR 24  39  39  THR THR A . n 
A 1 25  VAL 25  40  40  VAL VAL A . n 
A 1 26  VAL 26  41  41  VAL VAL A . n 
A 1 27  ALA 27  42  42  ALA ALA A . n 
A 1 28  THR 28  43  43  THR THR A . n 
A 1 29  PRO 29  44  44  PRO PRO A . n 
A 1 30  GLY 30  45  45  GLY GLY A . n 
A 1 31  GLN 31  46  46  GLN GLN A . n 
A 1 32  GLY 32  47  47  GLY GLY A . n 
A 1 33  PRO 33  48  48  PRO PRO A . n 
A 1 34  ASP 34  49  49  ASP ASP A . n 
A 1 35  ARG 35  50  50  ARG ARG A . n 
A 1 36  PRO 36  51  51  PRO PRO A . n 
A 1 37  GLN 37  52  52  GLN GLN A . n 
A 1 38  GLU 38  53  53  GLU GLU A . n 
A 1 39  VAL 39  54  54  VAL VAL A . n 
A 1 40  SER 40  55  55  SER SER A . n 
A 1 41  TYR 41  56  56  TYR TYR A . n 
A 1 42  THR 42  57  57  THR THR A . n 
A 1 43  ASP 43  58  58  ASP ASP A . n 
A 1 44  THR 44  59  59  THR THR A . n 
A 1 45  LYS 45  60  60  LYS LYS A . n 
A 1 46  VAL 46  61  61  VAL VAL A . n 
A 1 47  ILE 47  62  62  ILE ILE A . n 
A 1 48  GLY 48  63  63  GLY GLY A . n 
A 1 49  ASN 49  64  64  ASN ASN A . n 
A 1 50  GLY 50  65  65  GLY GLY A . n 
A 1 51  SER 51  66  66  SER SER A . n 
A 1 52  PHE 52  67  67  PHE PHE A . n 
A 1 53  GLY 53  68  68  GLY GLY A . n 
A 1 54  VAL 54  69  69  VAL VAL A . n 
A 1 55  VAL 55  70  70  VAL VAL A . n 
A 1 56  TYR 56  71  71  TYR TYR A . n 
A 1 57  GLN 57  72  72  GLN GLN A . n 
A 1 58  ALA 58  73  73  ALA ALA A . n 
A 1 59  LYS 59  74  74  LYS LYS A . n 
A 1 60  LEU 60  75  75  LEU LEU A . n 
A 1 61  CYS 61  76  76  CYS CYS A . n 
A 1 62  ASP 62  77  77  ASP ASP A . n 
A 1 63  SER 63  78  78  SER SER A . n 
A 1 64  GLY 64  79  79  GLY GLY A . n 
A 1 65  GLU 65  80  80  GLU GLU A . n 
A 1 66  LEU 66  81  81  LEU LEU A . n 
A 1 67  VAL 67  82  82  VAL VAL A . n 
A 1 68  ALA 68  83  83  ALA ALA A . n 
A 1 69  ILE 69  84  84  ILE ILE A . n 
A 1 70  LYS 70  85  85  LYS LYS A . n 
A 1 71  LYS 71  86  86  LYS LYS A . n 
A 1 72  VAL 72  87  87  VAL VAL A . n 
A 1 73  LEU 73  88  88  LEU LEU A . n 
A 1 74  GLN 74  89  89  GLN GLN A . n 
A 1 75  ASP 75  90  90  ASP ASP A . n 
A 1 76  LYS 76  91  91  LYS LYS A . n 
A 1 77  ARG 77  92  92  ARG ARG A . n 
A 1 78  PHE 78  93  93  PHE PHE A . n 
A 1 79  LYS 79  94  94  LYS LYS A . n 
A 1 80  ASN 80  95  95  ASN ASN A . n 
A 1 81  ARG 81  96  96  ARG ARG A . n 
A 1 82  GLU 82  97  97  GLU GLU A . n 
A 1 83  LEU 83  98  98  LEU LEU A . n 
A 1 84  GLN 84  99  99  GLN GLN A . n 
A 1 85  ILE 85  100 100 ILE ILE A . n 
A 1 86  MET 86  101 101 MET MET A . n 
A 1 87  ARG 87  102 102 ARG ARG A . n 
A 1 88  LYS 88  103 103 LYS LYS A . n 
A 1 89  LEU 89  104 104 LEU LEU A . n 
A 1 90  ASP 90  105 105 ASP ASP A . n 
A 1 91  HIS 91  106 106 HIS HIS A . n 
A 1 92  CYS 92  107 107 CYS CYS A . n 
A 1 93  ASN 93  108 108 ASN ASN A . n 
A 1 94  ILE 94  109 109 ILE ILE A . n 
A 1 95  VAL 95  110 110 VAL VAL A . n 
A 1 96  ARG 96  111 111 ARG ARG A . n 
A 1 97  LEU 97  112 112 LEU LEU A . n 
A 1 98  ARG 98  113 113 ARG ARG A . n 
A 1 99  TYR 99  114 114 TYR TYR A . n 
A 1 100 PHE 100 115 115 PHE PHE A . n 
A 1 101 PHE 101 116 116 PHE PHE A . n 
A 1 102 TYR 102 117 117 TYR TYR A . n 
A 1 103 SER 103 118 118 SER SER A . n 
A 1 104 SER 104 119 119 SER SER A . n 
A 1 105 GLY 105 120 120 GLY GLY A . n 
A 1 106 GLU 106 121 121 GLU GLU A . n 
A 1 107 LYS 107 122 122 LYS LYS A . n 
A 1 108 LYS 108 123 123 LYS LYS A . n 
A 1 109 ASP 109 124 124 ASP ASP A . n 
A 1 110 GLU 110 125 125 GLU GLU A . n 
A 1 111 VAL 111 126 126 VAL VAL A . n 
A 1 112 TYR 112 127 127 TYR TYR A . n 
A 1 113 LEU 113 128 128 LEU LEU A . n 
A 1 114 ASN 114 129 129 ASN ASN A . n 
A 1 115 LEU 115 130 130 LEU LEU A . n 
A 1 116 VAL 116 131 131 VAL VAL A . n 
A 1 117 LEU 117 132 132 LEU LEU A . n 
A 1 118 ASP 118 133 133 ASP ASP A . n 
A 1 119 TYR 119 134 134 TYR TYR A . n 
A 1 120 VAL 120 135 135 VAL VAL A . n 
A 1 121 PRO 121 136 136 PRO PRO A . n 
A 1 122 GLU 122 137 137 GLU GLU A . n 
A 1 123 THR 123 138 138 THR THR A . n 
A 1 124 VAL 124 139 139 VAL VAL A . n 
A 1 125 TYR 125 140 140 TYR TYR A . n 
A 1 126 ARG 126 141 141 ARG ARG A . n 
A 1 127 VAL 127 142 142 VAL VAL A . n 
A 1 128 ALA 128 143 143 ALA ALA A . n 
A 1 129 ARG 129 144 144 ARG ARG A . n 
A 1 130 HIS 130 145 145 HIS HIS A . n 
A 1 131 TYR 131 146 146 TYR TYR A . n 
A 1 132 SER 132 147 147 SER SER A . n 
A 1 133 ARG 133 148 148 ARG ARG A . n 
A 1 134 ALA 134 149 149 ALA ALA A . n 
A 1 135 LYS 135 150 150 LYS LYS A . n 
A 1 136 GLN 136 151 151 GLN GLN A . n 
A 1 137 THR 137 152 152 THR THR A . n 
A 1 138 LEU 138 153 153 LEU LEU A . n 
A 1 139 PRO 139 154 154 PRO PRO A . n 
A 1 140 VAL 140 155 155 VAL VAL A . n 
A 1 141 ILE 141 156 156 ILE ILE A . n 
A 1 142 TYR 142 157 157 TYR TYR A . n 
A 1 143 VAL 143 158 158 VAL VAL A . n 
A 1 144 LYS 144 159 159 LYS LYS A . n 
A 1 145 LEU 145 160 160 LEU LEU A . n 
A 1 146 TYR 146 161 161 TYR TYR A . n 
A 1 147 MET 147 162 162 MET MET A . n 
A 1 148 TYR 148 163 163 TYR TYR A . n 
A 1 149 GLN 149 164 164 GLN GLN A . n 
A 1 150 LEU 150 165 165 LEU LEU A . n 
A 1 151 PHE 151 166 166 PHE PHE A . n 
A 1 152 ARG 152 167 167 ARG ARG A . n 
A 1 153 SER 153 168 168 SER SER A . n 
A 1 154 LEU 154 169 169 LEU LEU A . n 
A 1 155 ALA 155 170 170 ALA ALA A . n 
A 1 156 TYR 156 171 171 TYR TYR A . n 
A 1 157 ILE 157 172 172 ILE ILE A . n 
A 1 158 HIS 158 173 173 HIS HIS A . n 
A 1 159 SER 159 174 174 SER SER A . n 
A 1 160 PHE 160 175 175 PHE PHE A . n 
A 1 161 GLY 161 176 176 GLY GLY A . n 
A 1 162 ILE 162 177 177 ILE ILE A . n 
A 1 163 CYS 163 178 178 CYS CYS A . n 
A 1 164 HIS 164 179 179 HIS HIS A . n 
A 1 165 ARG 165 180 180 ARG ARG A . n 
A 1 166 ASP 166 181 181 ASP ASP A . n 
A 1 167 ILE 167 182 182 ILE ILE A . n 
A 1 168 LYS 168 183 183 LYS LYS A . n 
A 1 169 PRO 169 184 184 PRO PRO A . n 
A 1 170 GLN 170 185 185 GLN GLN A . n 
A 1 171 ASN 171 186 186 ASN ASN A . n 
A 1 172 LEU 172 187 187 LEU LEU A . n 
A 1 173 LEU 173 188 188 LEU LEU A . n 
A 1 174 LEU 174 189 189 LEU LEU A . n 
A 1 175 ASP 175 190 190 ASP ASP A . n 
A 1 176 PRO 176 191 191 PRO PRO A . n 
A 1 177 ASP 177 192 192 ASP ASP A . n 
A 1 178 THR 178 193 193 THR THR A . n 
A 1 179 ALA 179 194 194 ALA ALA A . n 
A 1 180 VAL 180 195 195 VAL VAL A . n 
A 1 181 LEU 181 196 196 LEU LEU A . n 
A 1 182 LYS 182 197 197 LYS LYS A . n 
A 1 183 LEU 183 198 198 LEU LEU A . n 
A 1 184 CYS 184 199 199 CYS CYS A . n 
A 1 185 ASP 185 200 200 ASP ASP A . n 
A 1 186 PHE 186 201 201 PHE PHE A . n 
A 1 187 GLY 187 202 202 GLY GLY A . n 
A 1 188 SER 188 203 203 SER SER A . n 
A 1 189 ALA 189 204 204 ALA ALA A . n 
A 1 190 LYS 190 205 205 LYS LYS A . n 
A 1 191 GLN 191 206 206 GLN GLN A . n 
A 1 192 LEU 192 207 207 LEU LEU A . n 
A 1 193 VAL 193 208 208 VAL VAL A . n 
A 1 194 ARG 194 209 209 ARG ARG A . n 
A 1 195 GLY 195 210 210 GLY GLY A . n 
A 1 196 GLU 196 211 211 GLU GLU A . n 
A 1 197 PRO 197 212 212 PRO PRO A . n 
A 1 198 ASN 198 213 213 ASN ASN A . n 
A 1 199 VAL 199 214 214 VAL VAL A . n 
A 1 200 SER 200 215 215 SER SER A . n 
A 1 201 PTR 201 216 216 PTR PTR A . n 
A 1 202 ILE 202 217 217 ILE ILE A . n 
A 1 203 CYS 203 218 218 CYS CYS A . n 
A 1 204 SER 204 219 219 SER SER A . n 
A 1 205 ARG 205 220 220 ARG ARG A . n 
A 1 206 TYR 206 221 221 TYR TYR A . n 
A 1 207 TYR 207 222 222 TYR TYR A . n 
A 1 208 ARG 208 223 223 ARG ARG A . n 
A 1 209 ALA 209 224 224 ALA ALA A . n 
A 1 210 PRO 210 225 225 PRO PRO A . n 
A 1 211 GLU 211 226 226 GLU GLU A . n 
A 1 212 LEU 212 227 227 LEU LEU A . n 
A 1 213 ILE 213 228 228 ILE ILE A . n 
A 1 214 PHE 214 229 229 PHE PHE A . n 
A 1 215 GLY 215 230 230 GLY GLY A . n 
A 1 216 ALA 216 231 231 ALA ALA A . n 
A 1 217 THR 217 232 232 THR THR A . n 
A 1 218 ASP 218 233 233 ASP ASP A . n 
A 1 219 TYR 219 234 234 TYR TYR A . n 
A 1 220 THR 220 235 235 THR THR A . n 
A 1 221 SER 221 236 236 SER SER A . n 
A 1 222 SER 222 237 237 SER SER A . n 
A 1 223 ILE 223 238 238 ILE ILE A . n 
A 1 224 ASP 224 239 239 ASP ASP A . n 
A 1 225 VAL 225 240 240 VAL VAL A . n 
A 1 226 TRP 226 241 241 TRP TRP A . n 
A 1 227 SER 227 242 242 SER SER A . n 
A 1 228 ALA 228 243 243 ALA ALA A . n 
A 1 229 GLY 229 244 244 GLY GLY A . n 
A 1 230 CYS 230 245 245 CYS CYS A . n 
A 1 231 VAL 231 246 246 VAL VAL A . n 
A 1 232 LEU 232 247 247 LEU LEU A . n 
A 1 233 ALA 233 248 248 ALA ALA A . n 
A 1 234 GLU 234 249 249 GLU GLU A . n 
A 1 235 LEU 235 250 250 LEU LEU A . n 
A 1 236 LEU 236 251 251 LEU LEU A . n 
A 1 237 LEU 237 252 252 LEU LEU A . n 
A 1 238 GLY 238 253 253 GLY GLY A . n 
A 1 239 GLN 239 254 254 GLN GLN A . n 
A 1 240 PRO 240 255 255 PRO PRO A . n 
A 1 241 ILE 241 256 256 ILE ILE A . n 
A 1 242 PHE 242 257 257 PHE PHE A . n 
A 1 243 PRO 243 258 258 PRO PRO A . n 
A 1 244 GLY 244 259 259 GLY GLY A . n 
A 1 245 ASP 245 260 260 ASP ASP A . n 
A 1 246 SER 246 261 261 SER SER A . n 
A 1 247 GLY 247 262 262 GLY GLY A . n 
A 1 248 VAL 248 263 263 VAL VAL A . n 
A 1 249 ASP 249 264 264 ASP ASP A . n 
A 1 250 GLN 250 265 265 GLN GLN A . n 
A 1 251 LEU 251 266 266 LEU LEU A . n 
A 1 252 VAL 252 267 267 VAL VAL A . n 
A 1 253 GLU 253 268 268 GLU GLU A . n 
A 1 254 ILE 254 269 269 ILE ILE A . n 
A 1 255 ILE 255 270 270 ILE ILE A . n 
A 1 256 LYS 256 271 271 LYS LYS A . n 
A 1 257 VAL 257 272 272 VAL VAL A . n 
A 1 258 LEU 258 273 273 LEU LEU A . n 
A 1 259 GLY 259 274 274 GLY GLY A . n 
A 1 260 THR 260 275 275 THR THR A . n 
A 1 261 PRO 261 276 276 PRO PRO A . n 
A 1 262 THR 262 277 277 THR THR A . n 
A 1 263 ARG 263 278 278 ARG ARG A . n 
A 1 264 GLU 264 279 279 GLU GLU A . n 
A 1 265 GLN 265 280 280 GLN GLN A . n 
A 1 266 ILE 266 281 281 ILE ILE A . n 
A 1 267 ARG 267 282 282 ARG ARG A . n 
A 1 268 GLU 268 283 283 GLU GLU A . n 
A 1 269 MET 269 284 284 MET MET A . n 
A 1 270 ASN 270 285 285 ASN ASN A . n 
A 1 271 PRO 271 286 286 PRO PRO A . n 
A 1 272 ASN 272 287 287 ASN ASN A . n 
A 1 273 TYR 273 288 288 TYR TYR A . n 
A 1 274 THR 274 289 289 THR THR A . n 
A 1 275 GLU 275 290 290 GLU GLU A . n 
A 1 276 PHE 276 291 291 PHE PHE A . n 
A 1 277 LYS 277 292 292 LYS LYS A . n 
A 1 278 PHE 278 293 293 PHE PHE A . n 
A 1 279 PRO 279 294 294 PRO PRO A . n 
A 1 280 GLN 280 295 295 GLN GLN A . n 
A 1 281 ILE 281 296 296 ILE ILE A . n 
A 1 282 LYS 282 297 297 LYS LYS A . n 
A 1 283 ALA 283 298 298 ALA ALA A . n 
A 1 284 HIS 284 299 299 HIS HIS A . n 
A 1 285 PRO 285 300 300 PRO PRO A . n 
A 1 286 TRP 286 301 301 TRP TRP A . n 
A 1 287 THR 287 302 302 THR THR A . n 
A 1 288 LYS 288 303 303 LYS LYS A . n 
A 1 289 VAL 289 304 304 VAL VAL A . n 
A 1 290 PHE 290 305 305 PHE PHE A . n 
A 1 291 ARG 291 306 306 ARG ARG A . n 
A 1 292 PRO 292 307 307 PRO PRO A . n 
A 1 293 ARG 293 308 308 ARG ARG A . n 
A 1 294 THR 294 309 309 THR THR A . n 
A 1 295 PRO 295 310 310 PRO PRO A . n 
A 1 296 PRO 296 311 311 PRO PRO A . n 
A 1 297 GLU 297 312 312 GLU GLU A . n 
A 1 298 ALA 298 313 313 ALA ALA A . n 
A 1 299 ILE 299 314 314 ILE ILE A . n 
A 1 300 ALA 300 315 315 ALA ALA A . n 
A 1 301 LEU 301 316 316 LEU LEU A . n 
A 1 302 CYS 302 317 317 CYS CYS A . n 
A 1 303 SER 303 318 318 SER SER A . n 
A 1 304 ARG 304 319 319 ARG ARG A . n 
A 1 305 LEU 305 320 320 LEU LEU A . n 
A 1 306 LEU 306 321 321 LEU LEU A . n 
A 1 307 GLU 307 322 322 GLU GLU A . n 
A 1 308 TYR 308 323 323 TYR TYR A . n 
A 1 309 THR 309 324 324 THR THR A . n 
A 1 310 PRO 310 325 325 PRO PRO A . n 
A 1 311 THR 311 326 326 THR THR A . n 
A 1 312 ALA 312 327 327 ALA ALA A . n 
A 1 313 ARG 313 328 328 ARG ARG A . n 
A 1 314 LEU 314 329 329 LEU LEU A . n 
A 1 315 THR 315 330 330 THR THR A . n 
A 1 316 PRO 316 331 331 PRO PRO A . n 
A 1 317 LEU 317 332 332 LEU LEU A . n 
A 1 318 GLU 318 333 333 GLU GLU A . n 
A 1 319 ALA 319 334 334 ALA ALA A . n 
A 1 320 CYS 320 335 335 CYS CYS A . n 
A 1 321 ALA 321 336 336 ALA ALA A . n 
A 1 322 HIS 322 337 337 HIS HIS A . n 
A 1 323 SER 323 338 338 SER SER A . n 
A 1 324 PHE 324 339 339 PHE PHE A . n 
A 1 325 PHE 325 340 340 PHE PHE A . n 
A 1 326 ASP 326 341 341 ASP ASP A . n 
A 1 327 GLU 327 342 342 GLU GLU A . n 
A 1 328 LEU 328 343 343 LEU LEU A . n 
A 1 329 ARG 329 344 344 ARG ARG A . n 
A 1 330 ASP 330 345 345 ASP ASP A . n 
A 1 331 PRO 331 346 346 PRO PRO A . n 
A 1 332 ASN 332 347 347 ASN ASN A . n 
A 1 333 VAL 333 348 348 VAL VAL A . n 
A 1 334 LYS 334 349 349 LYS LYS A . n 
A 1 335 LEU 335 350 350 LEU LEU A . n 
A 1 336 PRO 336 351 351 PRO PRO A . n 
A 1 337 ASN 337 352 352 ASN ASN A . n 
A 1 338 GLY 338 353 353 GLY GLY A . n 
A 1 339 ARG 339 354 354 ARG ARG A . n 
A 1 340 ASP 340 355 355 ASP ASP A . n 
A 1 341 THR 341 356 356 THR THR A . n 
A 1 342 PRO 342 357 357 PRO PRO A . n 
A 1 343 ALA 343 358 358 ALA ALA A . n 
A 1 344 LEU 344 359 359 LEU LEU A . n 
A 1 345 PHE 345 360 360 PHE PHE A . n 
A 1 346 ASN 346 361 361 ASN ASN A . n 
A 1 347 PHE 347 362 362 PHE PHE A . n 
A 1 348 THR 348 363 363 THR THR A . n 
A 1 349 THR 349 364 364 THR THR A . n 
A 1 350 GLN 350 365 365 GLN GLN A . n 
A 1 351 GLU 351 366 366 GLU GLU A . n 
A 1 352 LEU 352 367 367 LEU LEU A . n 
A 1 353 SER 353 368 368 SER SER A . n 
A 1 354 SER 354 369 369 SER SER A . n 
A 1 355 ASN 355 370 370 ASN ASN A . n 
A 1 356 PRO 356 371 371 PRO PRO A . n 
A 1 357 PRO 357 372 372 PRO PRO A . n 
A 1 358 LEU 358 373 373 LEU LEU A . n 
A 1 359 ALA 359 374 374 ALA ALA A . n 
A 1 360 THR 360 375 375 THR THR A . n 
A 1 361 ILE 361 376 376 ILE ILE A . n 
A 1 362 LEU 362 377 377 LEU LEU A . n 
A 1 363 ILE 363 378 378 ILE ILE A . n 
A 1 364 PRO 364 379 379 PRO PRO A . n 
A 1 365 PRO 365 380 380 PRO PRO A . n 
A 1 366 HIS 366 381 381 HIS HIS A . n 
A 1 367 ALA 367 382 382 ALA ALA A . n 
A 1 368 ARG 368 383 383 ARG ARG A . n 
A 1 369 ILE 369 384 384 ILE ILE A . n 
A 1 370 GLN 370 385 385 GLN GLN A . n 
A 1 371 ALA 371 386 ?   ?   ?   A . n 
A 1 372 ALA 372 387 ?   ?   ?   A . n 
A 1 373 ALA 373 388 ?   ?   ?   A . n 
A 1 374 SER 374 389 ?   ?   ?   A . n 
A 1 375 THR 375 390 ?   ?   ?   A . n 
A 1 376 PRO 376 391 ?   ?   ?   A . n 
A 1 377 THR 377 392 ?   ?   ?   A . n 
A 1 378 ASN 378 393 ?   ?   ?   A . n 
B 1 1   MET 1   16  ?   ?   ?   B . n 
B 1 2   HIS 2   17  ?   ?   ?   B . n 
B 1 3   HIS 3   18  ?   ?   ?   B . n 
B 1 4   HIS 4   19  ?   ?   ?   B . n 
B 1 5   HIS 5   20  ?   ?   ?   B . n 
B 1 6   HIS 6   21  ?   ?   ?   B . n 
B 1 7   HIS 7   22  ?   ?   ?   B . n 
B 1 8   HIS 8   23  ?   ?   ?   B . n 
B 1 9   HIS 9   24  ?   ?   ?   B . n 
B 1 10  HIS 10  25  ?   ?   ?   B . n 
B 1 11  HIS 11  26  ?   ?   ?   B . n 
B 1 12  LYS 12  27  ?   ?   ?   B . n 
B 1 13  VAL 13  28  28  VAL VAL B . n 
B 1 14  SER 14  29  29  SER SER B . n 
B 1 15  ARG 15  30  30  ARG ARG B . n 
B 1 16  ASP 16  31  31  ASP ASP B . n 
B 1 17  LYS 17  32  32  LYS LYS B . n 
B 1 18  ASP 18  33  33  ASP ASP B . n 
B 1 19  GLY 19  34  34  GLY GLY B . n 
B 1 20  SER 20  35  35  SER SER B . n 
B 1 21  LYS 21  36  36  LYS LYS B . n 
B 1 22  VAL 22  37  37  VAL VAL B . n 
B 1 23  THR 23  38  38  THR THR B . n 
B 1 24  THR 24  39  39  THR THR B . n 
B 1 25  VAL 25  40  40  VAL VAL B . n 
B 1 26  VAL 26  41  41  VAL VAL B . n 
B 1 27  ALA 27  42  42  ALA ALA B . n 
B 1 28  THR 28  43  43  THR THR B . n 
B 1 29  PRO 29  44  44  PRO PRO B . n 
B 1 30  GLY 30  45  45  GLY GLY B . n 
B 1 31  GLN 31  46  46  GLN GLN B . n 
B 1 32  GLY 32  47  47  GLY GLY B . n 
B 1 33  PRO 33  48  48  PRO PRO B . n 
B 1 34  ASP 34  49  49  ASP ASP B . n 
B 1 35  ARG 35  50  50  ARG ARG B . n 
B 1 36  PRO 36  51  51  PRO PRO B . n 
B 1 37  GLN 37  52  52  GLN GLN B . n 
B 1 38  GLU 38  53  53  GLU GLU B . n 
B 1 39  VAL 39  54  54  VAL VAL B . n 
B 1 40  SER 40  55  55  SER SER B . n 
B 1 41  TYR 41  56  56  TYR TYR B . n 
B 1 42  THR 42  57  57  THR THR B . n 
B 1 43  ASP 43  58  58  ASP ASP B . n 
B 1 44  THR 44  59  59  THR THR B . n 
B 1 45  LYS 45  60  60  LYS LYS B . n 
B 1 46  VAL 46  61  61  VAL VAL B . n 
B 1 47  ILE 47  62  62  ILE ILE B . n 
B 1 48  GLY 48  63  63  GLY GLY B . n 
B 1 49  ASN 49  64  64  ASN ASN B . n 
B 1 50  GLY 50  65  65  GLY GLY B . n 
B 1 51  SER 51  66  66  SER SER B . n 
B 1 52  PHE 52  67  67  PHE PHE B . n 
B 1 53  GLY 53  68  68  GLY GLY B . n 
B 1 54  VAL 54  69  69  VAL VAL B . n 
B 1 55  VAL 55  70  70  VAL VAL B . n 
B 1 56  TYR 56  71  71  TYR TYR B . n 
B 1 57  GLN 57  72  72  GLN GLN B . n 
B 1 58  ALA 58  73  73  ALA ALA B . n 
B 1 59  LYS 59  74  74  LYS LYS B . n 
B 1 60  LEU 60  75  75  LEU LEU B . n 
B 1 61  CYS 61  76  76  CYS CYS B . n 
B 1 62  ASP 62  77  77  ASP ASP B . n 
B 1 63  SER 63  78  78  SER SER B . n 
B 1 64  GLY 64  79  79  GLY GLY B . n 
B 1 65  GLU 65  80  80  GLU GLU B . n 
B 1 66  LEU 66  81  81  LEU LEU B . n 
B 1 67  VAL 67  82  82  VAL VAL B . n 
B 1 68  ALA 68  83  83  ALA ALA B . n 
B 1 69  ILE 69  84  84  ILE ILE B . n 
B 1 70  LYS 70  85  85  LYS LYS B . n 
B 1 71  LYS 71  86  86  LYS LYS B . n 
B 1 72  VAL 72  87  87  VAL VAL B . n 
B 1 73  LEU 73  88  88  LEU LEU B . n 
B 1 74  GLN 74  89  89  GLN GLN B . n 
B 1 75  ASP 75  90  90  ASP ASP B . n 
B 1 76  LYS 76  91  91  LYS LYS B . n 
B 1 77  ARG 77  92  92  ARG ARG B . n 
B 1 78  PHE 78  93  93  PHE PHE B . n 
B 1 79  LYS 79  94  94  LYS LYS B . n 
B 1 80  ASN 80  95  95  ASN ASN B . n 
B 1 81  ARG 81  96  96  ARG ARG B . n 
B 1 82  GLU 82  97  97  GLU GLU B . n 
B 1 83  LEU 83  98  98  LEU LEU B . n 
B 1 84  GLN 84  99  99  GLN GLN B . n 
B 1 85  ILE 85  100 100 ILE ILE B . n 
B 1 86  MET 86  101 101 MET MET B . n 
B 1 87  ARG 87  102 102 ARG ARG B . n 
B 1 88  LYS 88  103 103 LYS LYS B . n 
B 1 89  LEU 89  104 104 LEU LEU B . n 
B 1 90  ASP 90  105 105 ASP ASP B . n 
B 1 91  HIS 91  106 106 HIS HIS B . n 
B 1 92  CYS 92  107 107 CYS CYS B . n 
B 1 93  ASN 93  108 108 ASN ASN B . n 
B 1 94  ILE 94  109 109 ILE ILE B . n 
B 1 95  VAL 95  110 110 VAL VAL B . n 
B 1 96  ARG 96  111 111 ARG ARG B . n 
B 1 97  LEU 97  112 112 LEU LEU B . n 
B 1 98  ARG 98  113 113 ARG ARG B . n 
B 1 99  TYR 99  114 114 TYR TYR B . n 
B 1 100 PHE 100 115 115 PHE PHE B . n 
B 1 101 PHE 101 116 116 PHE PHE B . n 
B 1 102 TYR 102 117 117 TYR TYR B . n 
B 1 103 SER 103 118 118 SER SER B . n 
B 1 104 SER 104 119 119 SER SER B . n 
B 1 105 GLY 105 120 120 GLY GLY B . n 
B 1 106 GLU 106 121 121 GLU GLU B . n 
B 1 107 LYS 107 122 122 LYS LYS B . n 
B 1 108 LYS 108 123 123 LYS LYS B . n 
B 1 109 ASP 109 124 124 ASP ASP B . n 
B 1 110 GLU 110 125 125 GLU GLU B . n 
B 1 111 VAL 111 126 126 VAL VAL B . n 
B 1 112 TYR 112 127 127 TYR TYR B . n 
B 1 113 LEU 113 128 128 LEU LEU B . n 
B 1 114 ASN 114 129 129 ASN ASN B . n 
B 1 115 LEU 115 130 130 LEU LEU B . n 
B 1 116 VAL 116 131 131 VAL VAL B . n 
B 1 117 LEU 117 132 132 LEU LEU B . n 
B 1 118 ASP 118 133 133 ASP ASP B . n 
B 1 119 TYR 119 134 134 TYR TYR B . n 
B 1 120 VAL 120 135 135 VAL VAL B . n 
B 1 121 PRO 121 136 136 PRO PRO B . n 
B 1 122 GLU 122 137 137 GLU GLU B . n 
B 1 123 THR 123 138 138 THR THR B . n 
B 1 124 VAL 124 139 139 VAL VAL B . n 
B 1 125 TYR 125 140 140 TYR TYR B . n 
B 1 126 ARG 126 141 141 ARG ARG B . n 
B 1 127 VAL 127 142 142 VAL VAL B . n 
B 1 128 ALA 128 143 143 ALA ALA B . n 
B 1 129 ARG 129 144 144 ARG ARG B . n 
B 1 130 HIS 130 145 145 HIS HIS B . n 
B 1 131 TYR 131 146 146 TYR TYR B . n 
B 1 132 SER 132 147 147 SER SER B . n 
B 1 133 ARG 133 148 148 ARG ARG B . n 
B 1 134 ALA 134 149 149 ALA ALA B . n 
B 1 135 LYS 135 150 150 LYS LYS B . n 
B 1 136 GLN 136 151 151 GLN GLN B . n 
B 1 137 THR 137 152 152 THR THR B . n 
B 1 138 LEU 138 153 153 LEU LEU B . n 
B 1 139 PRO 139 154 154 PRO PRO B . n 
B 1 140 VAL 140 155 155 VAL VAL B . n 
B 1 141 ILE 141 156 156 ILE ILE B . n 
B 1 142 TYR 142 157 157 TYR TYR B . n 
B 1 143 VAL 143 158 158 VAL VAL B . n 
B 1 144 LYS 144 159 159 LYS LYS B . n 
B 1 145 LEU 145 160 160 LEU LEU B . n 
B 1 146 TYR 146 161 161 TYR TYR B . n 
B 1 147 MET 147 162 162 MET MET B . n 
B 1 148 TYR 148 163 163 TYR TYR B . n 
B 1 149 GLN 149 164 164 GLN GLN B . n 
B 1 150 LEU 150 165 165 LEU LEU B . n 
B 1 151 PHE 151 166 166 PHE PHE B . n 
B 1 152 ARG 152 167 167 ARG ARG B . n 
B 1 153 SER 153 168 168 SER SER B . n 
B 1 154 LEU 154 169 169 LEU LEU B . n 
B 1 155 ALA 155 170 170 ALA ALA B . n 
B 1 156 TYR 156 171 171 TYR TYR B . n 
B 1 157 ILE 157 172 172 ILE ILE B . n 
B 1 158 HIS 158 173 173 HIS HIS B . n 
B 1 159 SER 159 174 174 SER SER B . n 
B 1 160 PHE 160 175 175 PHE PHE B . n 
B 1 161 GLY 161 176 176 GLY GLY B . n 
B 1 162 ILE 162 177 177 ILE ILE B . n 
B 1 163 CYS 163 178 178 CYS CYS B . n 
B 1 164 HIS 164 179 179 HIS HIS B . n 
B 1 165 ARG 165 180 180 ARG ARG B . n 
B 1 166 ASP 166 181 181 ASP ASP B . n 
B 1 167 ILE 167 182 182 ILE ILE B . n 
B 1 168 LYS 168 183 183 LYS LYS B . n 
B 1 169 PRO 169 184 184 PRO PRO B . n 
B 1 170 GLN 170 185 185 GLN GLN B . n 
B 1 171 ASN 171 186 186 ASN ASN B . n 
B 1 172 LEU 172 187 187 LEU LEU B . n 
B 1 173 LEU 173 188 188 LEU LEU B . n 
B 1 174 LEU 174 189 189 LEU LEU B . n 
B 1 175 ASP 175 190 190 ASP ASP B . n 
B 1 176 PRO 176 191 191 PRO PRO B . n 
B 1 177 ASP 177 192 192 ASP ASP B . n 
B 1 178 THR 178 193 193 THR THR B . n 
B 1 179 ALA 179 194 194 ALA ALA B . n 
B 1 180 VAL 180 195 195 VAL VAL B . n 
B 1 181 LEU 181 196 196 LEU LEU B . n 
B 1 182 LYS 182 197 197 LYS LYS B . n 
B 1 183 LEU 183 198 198 LEU LEU B . n 
B 1 184 CYS 184 199 199 CYS CYS B . n 
B 1 185 ASP 185 200 200 ASP ASP B . n 
B 1 186 PHE 186 201 201 PHE PHE B . n 
B 1 187 GLY 187 202 202 GLY GLY B . n 
B 1 188 SER 188 203 203 SER SER B . n 
B 1 189 ALA 189 204 204 ALA ALA B . n 
B 1 190 LYS 190 205 205 LYS LYS B . n 
B 1 191 GLN 191 206 206 GLN GLN B . n 
B 1 192 LEU 192 207 207 LEU LEU B . n 
B 1 193 VAL 193 208 208 VAL VAL B . n 
B 1 194 ARG 194 209 209 ARG ARG B . n 
B 1 195 GLY 195 210 210 GLY GLY B . n 
B 1 196 GLU 196 211 211 GLU GLU B . n 
B 1 197 PRO 197 212 212 PRO PRO B . n 
B 1 198 ASN 198 213 213 ASN ASN B . n 
B 1 199 VAL 199 214 214 VAL VAL B . n 
B 1 200 SER 200 215 215 SER SER B . n 
B 1 201 PTR 201 216 216 PTR PTR B . n 
B 1 202 ILE 202 217 217 ILE ILE B . n 
B 1 203 CYS 203 218 218 CYS CYS B . n 
B 1 204 SER 204 219 219 SER SER B . n 
B 1 205 ARG 205 220 220 ARG ARG B . n 
B 1 206 TYR 206 221 221 TYR TYR B . n 
B 1 207 TYR 207 222 222 TYR TYR B . n 
B 1 208 ARG 208 223 223 ARG ARG B . n 
B 1 209 ALA 209 224 224 ALA ALA B . n 
B 1 210 PRO 210 225 225 PRO PRO B . n 
B 1 211 GLU 211 226 226 GLU GLU B . n 
B 1 212 LEU 212 227 227 LEU LEU B . n 
B 1 213 ILE 213 228 228 ILE ILE B . n 
B 1 214 PHE 214 229 229 PHE PHE B . n 
B 1 215 GLY 215 230 230 GLY GLY B . n 
B 1 216 ALA 216 231 231 ALA ALA B . n 
B 1 217 THR 217 232 232 THR THR B . n 
B 1 218 ASP 218 233 233 ASP ASP B . n 
B 1 219 TYR 219 234 234 TYR TYR B . n 
B 1 220 THR 220 235 235 THR THR B . n 
B 1 221 SER 221 236 236 SER SER B . n 
B 1 222 SER 222 237 237 SER SER B . n 
B 1 223 ILE 223 238 238 ILE ILE B . n 
B 1 224 ASP 224 239 239 ASP ASP B . n 
B 1 225 VAL 225 240 240 VAL VAL B . n 
B 1 226 TRP 226 241 241 TRP TRP B . n 
B 1 227 SER 227 242 242 SER SER B . n 
B 1 228 ALA 228 243 243 ALA ALA B . n 
B 1 229 GLY 229 244 244 GLY GLY B . n 
B 1 230 CYS 230 245 245 CYS CYS B . n 
B 1 231 VAL 231 246 246 VAL VAL B . n 
B 1 232 LEU 232 247 247 LEU LEU B . n 
B 1 233 ALA 233 248 248 ALA ALA B . n 
B 1 234 GLU 234 249 249 GLU GLU B . n 
B 1 235 LEU 235 250 250 LEU LEU B . n 
B 1 236 LEU 236 251 251 LEU LEU B . n 
B 1 237 LEU 237 252 252 LEU LEU B . n 
B 1 238 GLY 238 253 253 GLY GLY B . n 
B 1 239 GLN 239 254 254 GLN GLN B . n 
B 1 240 PRO 240 255 255 PRO PRO B . n 
B 1 241 ILE 241 256 256 ILE ILE B . n 
B 1 242 PHE 242 257 257 PHE PHE B . n 
B 1 243 PRO 243 258 258 PRO PRO B . n 
B 1 244 GLY 244 259 259 GLY GLY B . n 
B 1 245 ASP 245 260 260 ASP ASP B . n 
B 1 246 SER 246 261 261 SER SER B . n 
B 1 247 GLY 247 262 262 GLY GLY B . n 
B 1 248 VAL 248 263 263 VAL VAL B . n 
B 1 249 ASP 249 264 264 ASP ASP B . n 
B 1 250 GLN 250 265 265 GLN GLN B . n 
B 1 251 LEU 251 266 266 LEU LEU B . n 
B 1 252 VAL 252 267 267 VAL VAL B . n 
B 1 253 GLU 253 268 268 GLU GLU B . n 
B 1 254 ILE 254 269 269 ILE ILE B . n 
B 1 255 ILE 255 270 270 ILE ILE B . n 
B 1 256 LYS 256 271 271 LYS LYS B . n 
B 1 257 VAL 257 272 272 VAL VAL B . n 
B 1 258 LEU 258 273 273 LEU LEU B . n 
B 1 259 GLY 259 274 274 GLY GLY B . n 
B 1 260 THR 260 275 275 THR THR B . n 
B 1 261 PRO 261 276 276 PRO PRO B . n 
B 1 262 THR 262 277 277 THR THR B . n 
B 1 263 ARG 263 278 278 ARG ARG B . n 
B 1 264 GLU 264 279 279 GLU GLU B . n 
B 1 265 GLN 265 280 280 GLN GLN B . n 
B 1 266 ILE 266 281 281 ILE ILE B . n 
B 1 267 ARG 267 282 282 ARG ARG B . n 
B 1 268 GLU 268 283 283 GLU GLU B . n 
B 1 269 MET 269 284 284 MET MET B . n 
B 1 270 ASN 270 285 285 ASN ASN B . n 
B 1 271 PRO 271 286 286 PRO PRO B . n 
B 1 272 ASN 272 287 287 ASN ASN B . n 
B 1 273 TYR 273 288 288 TYR TYR B . n 
B 1 274 THR 274 289 289 THR THR B . n 
B 1 275 GLU 275 290 290 GLU GLU B . n 
B 1 276 PHE 276 291 291 PHE PHE B . n 
B 1 277 LYS 277 292 292 LYS LYS B . n 
B 1 278 PHE 278 293 293 PHE PHE B . n 
B 1 279 PRO 279 294 294 PRO PRO B . n 
B 1 280 GLN 280 295 295 GLN GLN B . n 
B 1 281 ILE 281 296 296 ILE ILE B . n 
B 1 282 LYS 282 297 297 LYS LYS B . n 
B 1 283 ALA 283 298 298 ALA ALA B . n 
B 1 284 HIS 284 299 299 HIS HIS B . n 
B 1 285 PRO 285 300 300 PRO PRO B . n 
B 1 286 TRP 286 301 301 TRP TRP B . n 
B 1 287 THR 287 302 302 THR THR B . n 
B 1 288 LYS 288 303 303 LYS LYS B . n 
B 1 289 VAL 289 304 304 VAL VAL B . n 
B 1 290 PHE 290 305 305 PHE PHE B . n 
B 1 291 ARG 291 306 306 ARG ARG B . n 
B 1 292 PRO 292 307 307 PRO PRO B . n 
B 1 293 ARG 293 308 308 ARG ARG B . n 
B 1 294 THR 294 309 309 THR THR B . n 
B 1 295 PRO 295 310 310 PRO PRO B . n 
B 1 296 PRO 296 311 311 PRO PRO B . n 
B 1 297 GLU 297 312 312 GLU GLU B . n 
B 1 298 ALA 298 313 313 ALA ALA B . n 
B 1 299 ILE 299 314 314 ILE ILE B . n 
B 1 300 ALA 300 315 315 ALA ALA B . n 
B 1 301 LEU 301 316 316 LEU LEU B . n 
B 1 302 CYS 302 317 317 CYS CYS B . n 
B 1 303 SER 303 318 318 SER SER B . n 
B 1 304 ARG 304 319 319 ARG ARG B . n 
B 1 305 LEU 305 320 320 LEU LEU B . n 
B 1 306 LEU 306 321 321 LEU LEU B . n 
B 1 307 GLU 307 322 322 GLU GLU B . n 
B 1 308 TYR 308 323 323 TYR TYR B . n 
B 1 309 THR 309 324 324 THR THR B . n 
B 1 310 PRO 310 325 325 PRO PRO B . n 
B 1 311 THR 311 326 326 THR THR B . n 
B 1 312 ALA 312 327 327 ALA ALA B . n 
B 1 313 ARG 313 328 328 ARG ARG B . n 
B 1 314 LEU 314 329 329 LEU LEU B . n 
B 1 315 THR 315 330 330 THR THR B . n 
B 1 316 PRO 316 331 331 PRO PRO B . n 
B 1 317 LEU 317 332 332 LEU LEU B . n 
B 1 318 GLU 318 333 333 GLU GLU B . n 
B 1 319 ALA 319 334 334 ALA ALA B . n 
B 1 320 CYS 320 335 335 CYS CYS B . n 
B 1 321 ALA 321 336 336 ALA ALA B . n 
B 1 322 HIS 322 337 337 HIS HIS B . n 
B 1 323 SER 323 338 338 SER SER B . n 
B 1 324 PHE 324 339 339 PHE PHE B . n 
B 1 325 PHE 325 340 340 PHE PHE B . n 
B 1 326 ASP 326 341 341 ASP ASP B . n 
B 1 327 GLU 327 342 342 GLU GLU B . n 
B 1 328 LEU 328 343 343 LEU LEU B . n 
B 1 329 ARG 329 344 344 ARG ARG B . n 
B 1 330 ASP 330 345 345 ASP ASP B . n 
B 1 331 PRO 331 346 346 PRO PRO B . n 
B 1 332 ASN 332 347 347 ASN ASN B . n 
B 1 333 VAL 333 348 348 VAL VAL B . n 
B 1 334 LYS 334 349 349 LYS LYS B . n 
B 1 335 LEU 335 350 350 LEU LEU B . n 
B 1 336 PRO 336 351 351 PRO PRO B . n 
B 1 337 ASN 337 352 352 ASN ASN B . n 
B 1 338 GLY 338 353 353 GLY GLY B . n 
B 1 339 ARG 339 354 354 ARG ARG B . n 
B 1 340 ASP 340 355 355 ASP ASP B . n 
B 1 341 THR 341 356 356 THR THR B . n 
B 1 342 PRO 342 357 357 PRO PRO B . n 
B 1 343 ALA 343 358 358 ALA ALA B . n 
B 1 344 LEU 344 359 359 LEU LEU B . n 
B 1 345 PHE 345 360 360 PHE PHE B . n 
B 1 346 ASN 346 361 361 ASN ASN B . n 
B 1 347 PHE 347 362 362 PHE PHE B . n 
B 1 348 THR 348 363 363 THR THR B . n 
B 1 349 THR 349 364 364 THR THR B . n 
B 1 350 GLN 350 365 365 GLN GLN B . n 
B 1 351 GLU 351 366 366 GLU GLU B . n 
B 1 352 LEU 352 367 367 LEU LEU B . n 
B 1 353 SER 353 368 368 SER SER B . n 
B 1 354 SER 354 369 369 SER SER B . n 
B 1 355 ASN 355 370 370 ASN ASN B . n 
B 1 356 PRO 356 371 371 PRO PRO B . n 
B 1 357 PRO 357 372 372 PRO PRO B . n 
B 1 358 LEU 358 373 373 LEU LEU B . n 
B 1 359 ALA 359 374 374 ALA ALA B . n 
B 1 360 THR 360 375 375 THR THR B . n 
B 1 361 ILE 361 376 376 ILE ILE B . n 
B 1 362 LEU 362 377 377 LEU LEU B . n 
B 1 363 ILE 363 378 378 ILE ILE B . n 
B 1 364 PRO 364 379 379 PRO PRO B . n 
B 1 365 PRO 365 380 380 PRO PRO B . n 
B 1 366 HIS 366 381 381 HIS HIS B . n 
B 1 367 ALA 367 382 382 ALA ALA B . n 
B 1 368 ARG 368 383 383 ARG ARG B . n 
B 1 369 ILE 369 384 384 ILE ILE B . n 
B 1 370 GLN 370 385 ?   ?   ?   B . n 
B 1 371 ALA 371 386 ?   ?   ?   B . n 
B 1 372 ALA 372 387 ?   ?   ?   B . n 
B 1 373 ALA 373 388 ?   ?   ?   B . n 
B 1 374 SER 374 389 ?   ?   ?   B . n 
B 1 375 THR 375 390 ?   ?   ?   B . n 
B 1 376 PRO 376 391 ?   ?   ?   B . n 
B 1 377 THR 377 392 ?   ?   ?   B . n 
B 1 378 ASN 378 393 ?   ?   ?   B . n 
C 2 1   SER 1   188 ?   ?   ?   X . n 
C 2 2   GLN 2   189 ?   ?   ?   X . n 
C 2 3   PRO 3   190 ?   ?   ?   X . n 
C 2 4   GLU 4   191 ?   ?   ?   X . n 
C 2 5   THR 5   192 ?   ?   ?   X . n 
C 2 6   ARG 6   193 ?   ?   ?   X . n 
C 2 7   THR 7   194 ?   ?   ?   X . n 
C 2 8   GLY 8   195 ?   ?   ?   X . n 
C 2 9   ASP 9   196 ?   ?   ?   X . n 
C 2 10  ASP 10  197 ?   ?   ?   X . n 
C 2 11  ASP 11  198 198 ASP ASP X . n 
C 2 12  PRO 12  199 199 PRO PRO X . n 
C 2 13  HIS 13  200 200 HIS HIS X . n 
C 2 14  ARG 14  201 201 ARG ARG X . n 
C 2 15  LEU 15  202 202 LEU LEU X . n 
C 2 16  LEU 16  203 203 LEU LEU X . n 
C 2 17  GLN 17  204 204 GLN GLN X . n 
C 2 18  GLN 18  205 205 GLN GLN X . n 
C 2 19  LEU 19  206 206 LEU LEU X . n 
C 2 20  VAL 20  207 207 VAL VAL X . n 
C 2 21  LEU 21  208 208 LEU LEU X . n 
C 2 22  SER 22  209 209 SER SER X . n 
C 2 23  GLY 23  210 210 GLY GLY X . n 
C 2 24  ASN 24  211 211 ASN ASN X . n 
C 2 25  LEU 25  212 212 LEU LEU X . n 
C 2 26  ILE 26  213 213 ILE ILE X . n 
C 2 27  LYS 27  214 214 LYS LYS X . n 
C 2 28  GLU 28  215 215 GLU GLU X . n 
C 2 29  ALA 29  216 216 ALA ALA X . n 
C 2 30  VAL 30  217 217 VAL VAL X . n 
C 2 31  ARG 31  218 218 ARG ARG X . n 
C 2 32  ARG 32  219 219 ARG ARG X . n 
C 2 33  LEU 33  220 220 LEU LEU X . n 
C 2 34  HIS 34  221 221 HIS HIS X . n 
C 2 35  SER 35  222 222 SER SER X . n 
C 2 36  ARG 36  223 223 ARG ARG X . n 
C 2 37  ARG 37  224 ?   ?   ?   X . n 
C 2 38  LEU 38  225 ?   ?   ?   X . n 
C 2 39  GLN 39  226 ?   ?   ?   X . n 
D 2 1   SER 1   188 ?   ?   ?   Y . n 
D 2 2   GLN 2   189 ?   ?   ?   Y . n 
D 2 3   PRO 3   190 ?   ?   ?   Y . n 
D 2 4   GLU 4   191 ?   ?   ?   Y . n 
D 2 5   THR 5   192 ?   ?   ?   Y . n 
D 2 6   ARG 6   193 ?   ?   ?   Y . n 
D 2 7   THR 7   194 ?   ?   ?   Y . n 
D 2 8   GLY 8   195 ?   ?   ?   Y . n 
D 2 9   ASP 9   196 ?   ?   ?   Y . n 
D 2 10  ASP 10  197 ?   ?   ?   Y . n 
D 2 11  ASP 11  198 198 ASP ASP Y . n 
D 2 12  PRO 12  199 199 PRO PRO Y . n 
D 2 13  HIS 13  200 200 HIS HIS Y . n 
D 2 14  ARG 14  201 201 ARG ARG Y . n 
D 2 15  LEU 15  202 202 LEU LEU Y . n 
D 2 16  LEU 16  203 203 LEU LEU Y . n 
D 2 17  GLN 17  204 204 GLN GLN Y . n 
D 2 18  GLN 18  205 205 GLN GLN Y . n 
D 2 19  LEU 19  206 206 LEU LEU Y . n 
D 2 20  VAL 20  207 207 VAL VAL Y . n 
D 2 21  LEU 21  208 208 LEU LEU Y . n 
D 2 22  SER 22  209 209 SER SER Y . n 
D 2 23  GLY 23  210 210 GLY GLY Y . n 
D 2 24  ASN 24  211 211 ASN ASN Y . n 
D 2 25  LEU 25  212 212 LEU LEU Y . n 
D 2 26  ILE 26  213 213 ILE ILE Y . n 
D 2 27  LYS 27  214 214 LYS LYS Y . n 
D 2 28  GLU 28  215 215 GLU GLU Y . n 
D 2 29  ALA 29  216 216 ALA ALA Y . n 
D 2 30  VAL 30  217 217 VAL VAL Y . n 
D 2 31  ARG 31  218 218 ARG ARG Y . n 
D 2 32  ARG 32  219 219 ARG ARG Y . n 
D 2 33  LEU 33  220 220 LEU LEU Y . n 
D 2 34  HIS 34  221 221 HIS HIS Y . n 
D 2 35  SER 35  222 222 SER SER Y . n 
D 2 36  ARG 36  223 223 ARG ARG Y . n 
D 2 37  ARG 37  224 ?   ?   ?   Y . n 
D 2 38  LEU 38  225 ?   ?   ?   Y . n 
D 2 39  GLN 39  226 ?   ?   ?   Y . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 SO4 1  1385 1385 SO4 SO4 A . 
F 3 SO4 1  1386 1386 SO4 SO4 A . 
G 3 SO4 1  1384 1384 SO4 SO4 B . 
H 3 SO4 1  1385 1385 SO4 SO4 B . 
I 4 TRS 1  1386 1386 TRS TRS B . 
J 5 HOH 1  2001 2001 HOH HOH A . 
J 5 HOH 2  2002 2002 HOH HOH A . 
J 5 HOH 3  2003 2003 HOH HOH A . 
J 5 HOH 4  2004 2004 HOH HOH A . 
J 5 HOH 5  2005 2005 HOH HOH A . 
J 5 HOH 6  2006 2006 HOH HOH A . 
J 5 HOH 7  2007 2007 HOH HOH A . 
J 5 HOH 8  2008 2008 HOH HOH A . 
J 5 HOH 9  2009 2009 HOH HOH A . 
J 5 HOH 10 2010 2010 HOH HOH A . 
J 5 HOH 11 2011 2011 HOH HOH A . 
J 5 HOH 12 2012 2012 HOH HOH A . 
J 5 HOH 13 2013 2013 HOH HOH A . 
J 5 HOH 14 2014 2014 HOH HOH A . 
J 5 HOH 15 2015 2015 HOH HOH A . 
J 5 HOH 16 2016 2016 HOH HOH A . 
J 5 HOH 17 2017 2017 HOH HOH A . 
J 5 HOH 18 2018 2018 HOH HOH A . 
J 5 HOH 19 2019 2019 HOH HOH A . 
J 5 HOH 20 2020 2020 HOH HOH A . 
J 5 HOH 21 2021 2021 HOH HOH A . 
J 5 HOH 22 2022 2022 HOH HOH A . 
J 5 HOH 23 2023 2023 HOH HOH A . 
J 5 HOH 24 2024 2024 HOH HOH A . 
J 5 HOH 25 2025 2025 HOH HOH A . 
J 5 HOH 26 2026 2026 HOH HOH A . 
J 5 HOH 27 2027 2027 HOH HOH A . 
J 5 HOH 28 2028 2028 HOH HOH A . 
J 5 HOH 29 2029 2029 HOH HOH A . 
J 5 HOH 30 2030 2030 HOH HOH A . 
J 5 HOH 31 2031 2031 HOH HOH A . 
J 5 HOH 32 2032 2032 HOH HOH A . 
J 5 HOH 33 2033 2033 HOH HOH A . 
J 5 HOH 34 2034 2034 HOH HOH A . 
J 5 HOH 35 2035 2035 HOH HOH A . 
J 5 HOH 36 2036 2036 HOH HOH A . 
J 5 HOH 37 2037 2037 HOH HOH A . 
J 5 HOH 38 2038 2038 HOH HOH A . 
J 5 HOH 39 2039 2039 HOH HOH A . 
J 5 HOH 40 2040 2040 HOH HOH A . 
J 5 HOH 41 2041 2041 HOH HOH A . 
J 5 HOH 42 2042 2042 HOH HOH A . 
J 5 HOH 43 2043 2043 HOH HOH A . 
J 5 HOH 44 2044 2044 HOH HOH A . 
J 5 HOH 45 2045 2045 HOH HOH A . 
J 5 HOH 46 2046 2046 HOH HOH A . 
J 5 HOH 47 2047 2047 HOH HOH A . 
J 5 HOH 48 2048 2048 HOH HOH A . 
J 5 HOH 49 2049 2049 HOH HOH A . 
J 5 HOH 50 2050 2050 HOH HOH A . 
J 5 HOH 51 2051 2051 HOH HOH A . 
J 5 HOH 52 2052 2052 HOH HOH A . 
J 5 HOH 53 2053 2053 HOH HOH A . 
J 5 HOH 54 2054 2054 HOH HOH A . 
J 5 HOH 55 2055 2055 HOH HOH A . 
J 5 HOH 56 2056 2056 HOH HOH A . 
J 5 HOH 57 2057 2057 HOH HOH A . 
J 5 HOH 58 2058 2058 HOH HOH A . 
J 5 HOH 59 2059 2059 HOH HOH A . 
J 5 HOH 60 2060 2060 HOH HOH A . 
J 5 HOH 61 2061 2061 HOH HOH A . 
J 5 HOH 62 2062 2062 HOH HOH A . 
J 5 HOH 63 2063 2063 HOH HOH A . 
J 5 HOH 64 2064 2064 HOH HOH A . 
J 5 HOH 65 2065 2065 HOH HOH A . 
J 5 HOH 66 2066 2066 HOH HOH A . 
J 5 HOH 67 2067 2067 HOH HOH A . 
J 5 HOH 68 2068 2068 HOH HOH A . 
J 5 HOH 69 2069 2069 HOH HOH A . 
J 5 HOH 70 2070 2070 HOH HOH A . 
J 5 HOH 71 2071 2071 HOH HOH A . 
J 5 HOH 72 2072 2072 HOH HOH A . 
J 5 HOH 73 2073 2073 HOH HOH A . 
J 5 HOH 74 2074 2074 HOH HOH A . 
J 5 HOH 75 2075 2075 HOH HOH A . 
J 5 HOH 76 2076 2076 HOH HOH A . 
K 5 HOH 1  2001 2001 HOH HOH B . 
K 5 HOH 2  2002 2002 HOH HOH B . 
K 5 HOH 3  2003 2003 HOH HOH B . 
K 5 HOH 4  2004 2004 HOH HOH B . 
K 5 HOH 5  2005 2005 HOH HOH B . 
K 5 HOH 6  2006 2006 HOH HOH B . 
K 5 HOH 7  2007 2007 HOH HOH B . 
K 5 HOH 8  2008 2008 HOH HOH B . 
K 5 HOH 9  2009 2009 HOH HOH B . 
K 5 HOH 10 2010 2010 HOH HOH B . 
K 5 HOH 11 2011 2011 HOH HOH B . 
K 5 HOH 12 2012 2012 HOH HOH B . 
K 5 HOH 13 2013 2013 HOH HOH B . 
K 5 HOH 14 2014 2014 HOH HOH B . 
K 5 HOH 15 2015 2015 HOH HOH B . 
K 5 HOH 16 2016 2016 HOH HOH B . 
K 5 HOH 17 2017 2017 HOH HOH B . 
K 5 HOH 18 2018 2018 HOH HOH B . 
K 5 HOH 19 2019 2019 HOH HOH B . 
K 5 HOH 20 2020 2020 HOH HOH B . 
K 5 HOH 21 2021 2021 HOH HOH B . 
K 5 HOH 22 2022 2022 HOH HOH B . 
K 5 HOH 23 2023 2023 HOH HOH B . 
K 5 HOH 24 2024 2024 HOH HOH B . 
K 5 HOH 25 2025 2025 HOH HOH B . 
K 5 HOH 26 2026 2026 HOH HOH B . 
K 5 HOH 27 2027 2027 HOH HOH B . 
K 5 HOH 28 2028 2028 HOH HOH B . 
K 5 HOH 29 2029 2029 HOH HOH B . 
K 5 HOH 30 2030 2030 HOH HOH B . 
K 5 HOH 31 2031 2031 HOH HOH B . 
K 5 HOH 32 2032 2032 HOH HOH B . 
K 5 HOH 33 2033 2033 HOH HOH B . 
K 5 HOH 34 2034 2034 HOH HOH B . 
K 5 HOH 35 2035 2035 HOH HOH B . 
K 5 HOH 36 2036 2036 HOH HOH B . 
K 5 HOH 37 2037 2037 HOH HOH B . 
K 5 HOH 38 2038 2038 HOH HOH B . 
K 5 HOH 39 2039 2039 HOH HOH B . 
K 5 HOH 40 2040 2040 HOH HOH B . 
K 5 HOH 41 2041 2041 HOH HOH B . 
K 5 HOH 42 2042 2042 HOH HOH B . 
K 5 HOH 43 2043 2043 HOH HOH B . 
K 5 HOH 44 2044 2044 HOH HOH B . 
K 5 HOH 45 2045 2045 HOH HOH B . 
K 5 HOH 46 2046 2046 HOH HOH B . 
K 5 HOH 47 2047 2047 HOH HOH B . 
K 5 HOH 48 2048 2048 HOH HOH B . 
K 5 HOH 49 2049 2049 HOH HOH B . 
K 5 HOH 50 2050 2050 HOH HOH B . 
K 5 HOH 51 2051 2051 HOH HOH B . 
K 5 HOH 52 2052 2052 HOH HOH B . 
K 5 HOH 53 2053 2053 HOH HOH B . 
K 5 HOH 54 2054 2054 HOH HOH B . 
K 5 HOH 55 2055 2055 HOH HOH B . 
K 5 HOH 56 2056 2056 HOH HOH B . 
K 5 HOH 57 2057 2057 HOH HOH B . 
K 5 HOH 58 2058 2058 HOH HOH B . 
K 5 HOH 59 2059 2059 HOH HOH B . 
L 5 HOH 1  2001 2001 HOH HOH X . 
L 5 HOH 2  2002 2002 HOH HOH X . 
L 5 HOH 3  2003 2003 HOH HOH X . 
M 5 HOH 1  2001 2001 HOH HOH Y . 
M 5 HOH 2  2002 2002 HOH HOH Y . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A PTR 201 A PTR 216 ? TYR O-PHOSPHOTYROSINE 
2 B PTR 201 B PTR 216 ? TYR O-PHOSPHOTYROSINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS dimeric 2 
2 author_and_software_defined_assembly PQS dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,F,J,L   
2 1 B,D,G,H,I,K,M 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-10-03 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS   refinement . ? 1 
AMoRE phasing    . ? 2 
# 
_pdbx_database_remark.id     285 
_pdbx_database_remark.text   
; THE SPACE-GROUP H 3 2 IS THE HEXAGONAL SETTING OF R 3 2              
 (NO 155)                                                             

;
# 
_pdbx_entry_details.entry_id             1GNG 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;NOTE RESIDUE 350 IS LEU (CF HIS IN SWISSPROT)
SEE REFERENCE BIOCHEM. J. 303:701-704(1994)
;
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    LYS 
_pdbx_validate_symm_contact.auth_seq_id_1     150 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    LYS 
_pdbx_validate_symm_contact.auth_seq_id_2     150 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   10_545 
_pdbx_validate_symm_contact.dist              2.03 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 48  ? ? -34.21  127.21  
2  1 ASP A 49  ? ? -57.76  16.17   
3  1 LYS A 60  ? ? -171.22 138.27  
4  1 ASP A 105 ? ? -151.97 87.16   
5  1 LYS A 123 ? ? -25.49  -32.95  
6  1 LYS A 150 ? ? 63.39   -8.83   
7  1 ASP A 181 ? ? -153.02 45.91   
8  1 ASP A 200 ? ? 52.72   77.37   
9  1 CYS A 218 ? ? 81.31   139.52  
10 1 ARG A 220 ? ? -28.83  -64.47  
11 1 SER A 236 ? ? -64.41  1.68    
12 1 PRO A 351 ? ? -49.65  -12.82  
13 1 PRO A 357 ? ? -52.48  -179.02 
14 1 ASN A 370 ? ? -164.50 71.68   
15 1 GLN B 46  ? ? -67.60  -82.57  
16 1 PRO B 48  ? ? -53.97  99.02   
17 1 ASP B 49  ? ? -62.26  80.08   
18 1 GLU B 121 ? ? -156.06 -49.56  
19 1 ALA B 149 ? ? -78.21  21.92   
20 1 LYS B 150 ? ? 36.00   32.48   
21 1 ASP B 181 ? ? -147.67 57.16   
22 1 ASP B 192 ? ? -70.02  -70.36  
23 1 ASP B 200 ? ? 57.41   76.00   
24 1 PTR B 216 ? ? -69.66  96.97   
25 1 CYS B 218 ? ? 73.79   160.29  
26 1 ASN B 285 ? ? -166.03 94.45   
27 1 PRO B 357 ? ? -59.67  176.16  
28 1 ASN B 370 ? ? -162.91 71.75   
29 1 HIS B 381 ? ? -60.62  0.66    
30 1 ALA B 382 ? ? -101.97 -70.89  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 36  ? CG  ? A LYS 21  CG  
2  1 Y 1 A LYS 36  ? CD  ? A LYS 21  CD  
3  1 Y 1 A LYS 36  ? CE  ? A LYS 21  CE  
4  1 Y 1 A LYS 36  ? NZ  ? A LYS 21  NZ  
5  1 Y 1 A GLN 385 ? CA  ? A GLN 370 CA  
6  1 Y 1 A GLN 385 ? C   ? A GLN 370 C   
7  1 Y 1 A GLN 385 ? O   ? A GLN 370 O   
8  1 Y 1 A GLN 385 ? CB  ? A GLN 370 CB  
9  1 Y 1 A GLN 385 ? CG  ? A GLN 370 CG  
10 1 Y 1 A GLN 385 ? CD  ? A GLN 370 CD  
11 1 Y 1 A GLN 385 ? OE1 ? A GLN 370 OE1 
12 1 Y 1 A GLN 385 ? NE2 ? A GLN 370 NE2 
13 1 Y 1 B VAL 28  ? CG1 ? B VAL 13  CG1 
14 1 Y 1 B VAL 28  ? CG2 ? B VAL 13  CG2 
15 1 Y 1 B ILE 384 ? CA  ? B ILE 369 CA  
16 1 Y 1 B ILE 384 ? C   ? B ILE 369 C   
17 1 Y 1 B ILE 384 ? O   ? B ILE 369 O   
18 1 Y 1 B ILE 384 ? CB  ? B ILE 369 CB  
19 1 Y 1 B ILE 384 ? CG1 ? B ILE 369 CG1 
20 1 Y 1 B ILE 384 ? CG2 ? B ILE 369 CG2 
21 1 Y 1 B ILE 384 ? CD1 ? B ILE 369 CD1 
22 1 Y 1 X ARG 223 ? CA  ? C ARG 36  CA  
23 1 Y 1 X ARG 223 ? C   ? C ARG 36  C   
24 1 Y 1 X ARG 223 ? O   ? C ARG 36  O   
25 1 Y 1 X ARG 223 ? CB  ? C ARG 36  CB  
26 1 Y 1 X ARG 223 ? CG  ? C ARG 36  CG  
27 1 Y 1 X ARG 223 ? CD  ? C ARG 36  CD  
28 1 Y 1 X ARG 223 ? NE  ? C ARG 36  NE  
29 1 Y 1 X ARG 223 ? CZ  ? C ARG 36  CZ  
30 1 Y 1 X ARG 223 ? NH1 ? C ARG 36  NH1 
31 1 Y 1 X ARG 223 ? NH2 ? C ARG 36  NH2 
32 1 Y 1 Y ARG 223 ? CA  ? D ARG 36  CA  
33 1 Y 1 Y ARG 223 ? C   ? D ARG 36  C   
34 1 Y 1 Y ARG 223 ? O   ? D ARG 36  O   
35 1 Y 1 Y ARG 223 ? CB  ? D ARG 36  CB  
36 1 Y 1 Y ARG 223 ? CG  ? D ARG 36  CG  
37 1 Y 1 Y ARG 223 ? CD  ? D ARG 36  CD  
38 1 Y 1 Y ARG 223 ? NE  ? D ARG 36  NE  
39 1 Y 1 Y ARG 223 ? CZ  ? D ARG 36  CZ  
40 1 Y 1 Y ARG 223 ? NH1 ? D ARG 36  NH1 
41 1 Y 1 Y ARG 223 ? NH2 ? D ARG 36  NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 16  ? A MET 1   
2  1 Y 1 A HIS 17  ? A HIS 2   
3  1 Y 1 A HIS 18  ? A HIS 3   
4  1 Y 1 A HIS 19  ? A HIS 4   
5  1 Y 1 A HIS 20  ? A HIS 5   
6  1 Y 1 A HIS 21  ? A HIS 6   
7  1 Y 1 A HIS 22  ? A HIS 7   
8  1 Y 1 A HIS 23  ? A HIS 8   
9  1 Y 1 A HIS 24  ? A HIS 9   
10 1 Y 1 A HIS 25  ? A HIS 10  
11 1 Y 1 A HIS 26  ? A HIS 11  
12 1 Y 1 A LYS 27  ? A LYS 12  
13 1 Y 1 A VAL 28  ? A VAL 13  
14 1 Y 1 A SER 29  ? A SER 14  
15 1 Y 1 A ARG 30  ? A ARG 15  
16 1 Y 1 A ASP 31  ? A ASP 16  
17 1 Y 1 A LYS 32  ? A LYS 17  
18 1 Y 1 A ASP 33  ? A ASP 18  
19 1 Y 1 A GLY 34  ? A GLY 19  
20 1 Y 1 A SER 35  ? A SER 20  
21 1 Y 1 A ALA 386 ? A ALA 371 
22 1 Y 1 A ALA 387 ? A ALA 372 
23 1 Y 1 A ALA 388 ? A ALA 373 
24 1 Y 1 A SER 389 ? A SER 374 
25 1 Y 1 A THR 390 ? A THR 375 
26 1 Y 1 A PRO 391 ? A PRO 376 
27 1 Y 1 A THR 392 ? A THR 377 
28 1 Y 1 A ASN 393 ? A ASN 378 
29 1 Y 1 B MET 16  ? B MET 1   
30 1 Y 1 B HIS 17  ? B HIS 2   
31 1 Y 1 B HIS 18  ? B HIS 3   
32 1 Y 1 B HIS 19  ? B HIS 4   
33 1 Y 1 B HIS 20  ? B HIS 5   
34 1 Y 1 B HIS 21  ? B HIS 6   
35 1 Y 1 B HIS 22  ? B HIS 7   
36 1 Y 1 B HIS 23  ? B HIS 8   
37 1 Y 1 B HIS 24  ? B HIS 9   
38 1 Y 1 B HIS 25  ? B HIS 10  
39 1 Y 1 B HIS 26  ? B HIS 11  
40 1 Y 1 B LYS 27  ? B LYS 12  
41 1 Y 1 B GLN 385 ? B GLN 370 
42 1 Y 1 B ALA 386 ? B ALA 371 
43 1 Y 1 B ALA 387 ? B ALA 372 
44 1 Y 1 B ALA 388 ? B ALA 373 
45 1 Y 1 B SER 389 ? B SER 374 
46 1 Y 1 B THR 390 ? B THR 375 
47 1 Y 1 B PRO 391 ? B PRO 376 
48 1 Y 1 B THR 392 ? B THR 377 
49 1 Y 1 B ASN 393 ? B ASN 378 
50 1 Y 1 X SER 188 ? C SER 1   
51 1 Y 1 X GLN 189 ? C GLN 2   
52 1 Y 1 X PRO 190 ? C PRO 3   
53 1 Y 1 X GLU 191 ? C GLU 4   
54 1 Y 1 X THR 192 ? C THR 5   
55 1 Y 1 X ARG 193 ? C ARG 6   
56 1 Y 1 X THR 194 ? C THR 7   
57 1 Y 1 X GLY 195 ? C GLY 8   
58 1 Y 1 X ASP 196 ? C ASP 9   
59 1 Y 1 X ASP 197 ? C ASP 10  
60 1 Y 1 X ARG 224 ? C ARG 37  
61 1 Y 1 X LEU 225 ? C LEU 38  
62 1 Y 1 X GLN 226 ? C GLN 39  
63 1 Y 1 Y SER 188 ? D SER 1   
64 1 Y 1 Y GLN 189 ? D GLN 2   
65 1 Y 1 Y PRO 190 ? D PRO 3   
66 1 Y 1 Y GLU 191 ? D GLU 4   
67 1 Y 1 Y THR 192 ? D THR 5   
68 1 Y 1 Y ARG 193 ? D ARG 6   
69 1 Y 1 Y THR 194 ? D THR 7   
70 1 Y 1 Y GLY 195 ? D GLY 8   
71 1 Y 1 Y ASP 196 ? D ASP 9   
72 1 Y 1 Y ASP 197 ? D ASP 10  
73 1 Y 1 Y ARG 224 ? D ARG 37  
74 1 Y 1 Y LEU 225 ? D LEU 38  
75 1 Y 1 Y GLN 226 ? D GLN 39  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION'                            SO4 
4 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 
5 water                                    HOH 
#