data_1GOG
# 
_entry.id   1GOG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GOG         
WWPDB D_1000173645 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GOG 
_pdbx_database_status.recvd_initial_deposition_date   1993-09-30 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ito, N.'          1 
'Phillips, S.E.V.' 2 
'Knowles, P.F.'    3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Novel thioether bond revealed by a 1.7 A crystal structure of galactose oxidase.' Nature            350 87   90 1991 
NATUAS UK 0028-0836 0006 ? 2002850 10.1038/350087a0 
1       'The Crystal Structure of a Free Radical Enzyme, Galactose Oxidase'                'To be Published' ?   ?    ?  ?    ? ?  
?         0353 ? ?       ?                
2       'Galactose Oxidase of Dactylium Dendroides: Gene Cloning and Sequence Analysis'    J.Biol.Chem.      267 8146 ?  1992 
JBCHA3 US 0021-9258 0071 ? ?       ?                
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ito, N.'          1  
primary 'Phillips, S.E.'   2  
primary 'Stevens, C.'      3  
primary 'Ogel, Z.B.'       4  
primary 'McPherson, M.J.'  5  
primary 'Keen, J.N.'       6  
primary 'Yadav, K.D.'      7  
primary 'Knowles, P.F.'    8  
1       'Ito, N.'          9  
1       'Phillips, S.E.V.' 10 
1       'Yadav, K.K.S.'    11 
1       'Knowles, P.F.'    12 
2       'McPherson, M.J.'  13 
2       'Ogel, Z.B.'       14 
2       'Stevens, C.'      15 
2       'Yadav, K.D.S.'    16 
2       'Keen, J.M.'       17 
2       'Knowles, P.F.'    18 
# 
_cell.entry_id           1GOG 
_cell.length_a           98.000 
_cell.length_b           89.400 
_cell.length_c           86.700 
_cell.angle_alpha        90.00 
_cell.angle_beta         117.80 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GOG 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GALACTOSE OXIDASE' 68578.594 1   1.1.3.9 ? ? ? 
2 non-polymer syn 'COPPER (II) ION'   63.546    1   ?       ? ? ? 
3 non-polymer syn 'SODIUM ION'        22.990    1   ?       ? ? ? 
4 water       nat water               18.015    310 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ASAPIGSAISRNNWAVTCDSAQSGNECNKAIDGNKDTFWHTFYGANGDPKPPHTYTIDMKTTQNVNGLSMLPRQDGNQNG
WIGRHEVYLSSDGTNWGSPVASGSWFADSTTKYSNFETRPARYVRLVAITEANGQPWTSIAEINVFQASSYTAPQPGLGR
WGPTIDLPIVPAAAAIEPTSGRVLMWSSYRNDAFGGSPGGITLTSSWDPSTGIVSDRTVTVTKHDMFCPGISMDGNGQIV
VTGGNDAKKTSLYDSSSDSWIPGPDMQVARGYQSSATMSDGRVFTIGGSWSGGVFEKNGEVYSPSSKTWTSLPNAKVNPM
LTADKQGLYRSDNHAWLFGWKKGSVFQAGPSTAMNWYYTSGSGDVKSAGKRQSNRGVAPDAMCGNAVMYDAVKGKILTFG
GSPDYQDSDATTNAHIITLGEPGTSPNTVFASNGLYFARTFHTSVVLPDGSTFITGGQRRGIPFEDSTPVFTPEIYVPEQ
DTFYKQNPNSIVRVYHSISLLLPDGRVFNGGGGLCGDCTTNHFDAQIFTPNYLYNSNGNLATRPKITRTSTQSVKVGGRI
TISTDSSISKASLIRYGTATHTVNTDQRRIPLTLTNNGGNSYSFQVPSDSGVALPGYWMLFVMNSAGVPSVASTIRVTQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ASAPIGSAISRNNWAVTCDSAQSGNECNKAIDGNKDTFWHTFYGANGDPKPPHTYTIDMKTTQNVNGLSMLPRQDGNQNG
WIGRHEVYLSSDGTNWGSPVASGSWFADSTTKYSNFETRPARYVRLVAITEANGQPWTSIAEINVFQASSYTAPQPGLGR
WGPTIDLPIVPAAAAIEPTSGRVLMWSSYRNDAFGGSPGGITLTSSWDPSTGIVSDRTVTVTKHDMFCPGISMDGNGQIV
VTGGNDAKKTSLYDSSSDSWIPGPDMQVARGYQSSATMSDGRVFTIGGSWSGGVFEKNGEVYSPSSKTWTSLPNAKVNPM
LTADKQGLYRSDNHAWLFGWKKGSVFQAGPSTAMNWYYTSGSGDVKSAGKRQSNRGVAPDAMCGNAVMYDAVKGKILTFG
GSPDYQDSDATTNAHIITLGEPGTSPNTVFASNGLYFARTFHTSVVLPDGSTFITGGQRRGIPFEDSTPVFTPEIYVPEQ
DTFYKQNPNSIVRVYHSISLLLPDGRVFNGGGGLCGDCTTNHFDAQIFTPNYLYNSNGNLATRPKITRTSTQSVKVGGRI
TISTDSSISKASLIRYGTATHTVNTDQRRIPLTLTNNGGNSYSFQVPSDSGVALPGYWMLFVMNSAGVPSVASTIRVTQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   SER n 
1 3   ALA n 
1 4   PRO n 
1 5   ILE n 
1 6   GLY n 
1 7   SER n 
1 8   ALA n 
1 9   ILE n 
1 10  SER n 
1 11  ARG n 
1 12  ASN n 
1 13  ASN n 
1 14  TRP n 
1 15  ALA n 
1 16  VAL n 
1 17  THR n 
1 18  CYS n 
1 19  ASP n 
1 20  SER n 
1 21  ALA n 
1 22  GLN n 
1 23  SER n 
1 24  GLY n 
1 25  ASN n 
1 26  GLU n 
1 27  CYS n 
1 28  ASN n 
1 29  LYS n 
1 30  ALA n 
1 31  ILE n 
1 32  ASP n 
1 33  GLY n 
1 34  ASN n 
1 35  LYS n 
1 36  ASP n 
1 37  THR n 
1 38  PHE n 
1 39  TRP n 
1 40  HIS n 
1 41  THR n 
1 42  PHE n 
1 43  TYR n 
1 44  GLY n 
1 45  ALA n 
1 46  ASN n 
1 47  GLY n 
1 48  ASP n 
1 49  PRO n 
1 50  LYS n 
1 51  PRO n 
1 52  PRO n 
1 53  HIS n 
1 54  THR n 
1 55  TYR n 
1 56  THR n 
1 57  ILE n 
1 58  ASP n 
1 59  MET n 
1 60  LYS n 
1 61  THR n 
1 62  THR n 
1 63  GLN n 
1 64  ASN n 
1 65  VAL n 
1 66  ASN n 
1 67  GLY n 
1 68  LEU n 
1 69  SER n 
1 70  MET n 
1 71  LEU n 
1 72  PRO n 
1 73  ARG n 
1 74  GLN n 
1 75  ASP n 
1 76  GLY n 
1 77  ASN n 
1 78  GLN n 
1 79  ASN n 
1 80  GLY n 
1 81  TRP n 
1 82  ILE n 
1 83  GLY n 
1 84  ARG n 
1 85  HIS n 
1 86  GLU n 
1 87  VAL n 
1 88  TYR n 
1 89  LEU n 
1 90  SER n 
1 91  SER n 
1 92  ASP n 
1 93  GLY n 
1 94  THR n 
1 95  ASN n 
1 96  TRP n 
1 97  GLY n 
1 98  SER n 
1 99  PRO n 
1 100 VAL n 
1 101 ALA n 
1 102 SER n 
1 103 GLY n 
1 104 SER n 
1 105 TRP n 
1 106 PHE n 
1 107 ALA n 
1 108 ASP n 
1 109 SER n 
1 110 THR n 
1 111 THR n 
1 112 LYS n 
1 113 TYR n 
1 114 SER n 
1 115 ASN n 
1 116 PHE n 
1 117 GLU n 
1 118 THR n 
1 119 ARG n 
1 120 PRO n 
1 121 ALA n 
1 122 ARG n 
1 123 TYR n 
1 124 VAL n 
1 125 ARG n 
1 126 LEU n 
1 127 VAL n 
1 128 ALA n 
1 129 ILE n 
1 130 THR n 
1 131 GLU n 
1 132 ALA n 
1 133 ASN n 
1 134 GLY n 
1 135 GLN n 
1 136 PRO n 
1 137 TRP n 
1 138 THR n 
1 139 SER n 
1 140 ILE n 
1 141 ALA n 
1 142 GLU n 
1 143 ILE n 
1 144 ASN n 
1 145 VAL n 
1 146 PHE n 
1 147 GLN n 
1 148 ALA n 
1 149 SER n 
1 150 SER n 
1 151 TYR n 
1 152 THR n 
1 153 ALA n 
1 154 PRO n 
1 155 GLN n 
1 156 PRO n 
1 157 GLY n 
1 158 LEU n 
1 159 GLY n 
1 160 ARG n 
1 161 TRP n 
1 162 GLY n 
1 163 PRO n 
1 164 THR n 
1 165 ILE n 
1 166 ASP n 
1 167 LEU n 
1 168 PRO n 
1 169 ILE n 
1 170 VAL n 
1 171 PRO n 
1 172 ALA n 
1 173 ALA n 
1 174 ALA n 
1 175 ALA n 
1 176 ILE n 
1 177 GLU n 
1 178 PRO n 
1 179 THR n 
1 180 SER n 
1 181 GLY n 
1 182 ARG n 
1 183 VAL n 
1 184 LEU n 
1 185 MET n 
1 186 TRP n 
1 187 SER n 
1 188 SER n 
1 189 TYR n 
1 190 ARG n 
1 191 ASN n 
1 192 ASP n 
1 193 ALA n 
1 194 PHE n 
1 195 GLY n 
1 196 GLY n 
1 197 SER n 
1 198 PRO n 
1 199 GLY n 
1 200 GLY n 
1 201 ILE n 
1 202 THR n 
1 203 LEU n 
1 204 THR n 
1 205 SER n 
1 206 SER n 
1 207 TRP n 
1 208 ASP n 
1 209 PRO n 
1 210 SER n 
1 211 THR n 
1 212 GLY n 
1 213 ILE n 
1 214 VAL n 
1 215 SER n 
1 216 ASP n 
1 217 ARG n 
1 218 THR n 
1 219 VAL n 
1 220 THR n 
1 221 VAL n 
1 222 THR n 
1 223 LYS n 
1 224 HIS n 
1 225 ASP n 
1 226 MET n 
1 227 PHE n 
1 228 CYS n 
1 229 PRO n 
1 230 GLY n 
1 231 ILE n 
1 232 SER n 
1 233 MET n 
1 234 ASP n 
1 235 GLY n 
1 236 ASN n 
1 237 GLY n 
1 238 GLN n 
1 239 ILE n 
1 240 VAL n 
1 241 VAL n 
1 242 THR n 
1 243 GLY n 
1 244 GLY n 
1 245 ASN n 
1 246 ASP n 
1 247 ALA n 
1 248 LYS n 
1 249 LYS n 
1 250 THR n 
1 251 SER n 
1 252 LEU n 
1 253 TYR n 
1 254 ASP n 
1 255 SER n 
1 256 SER n 
1 257 SER n 
1 258 ASP n 
1 259 SER n 
1 260 TRP n 
1 261 ILE n 
1 262 PRO n 
1 263 GLY n 
1 264 PRO n 
1 265 ASP n 
1 266 MET n 
1 267 GLN n 
1 268 VAL n 
1 269 ALA n 
1 270 ARG n 
1 271 GLY n 
1 272 TYR n 
1 273 GLN n 
1 274 SER n 
1 275 SER n 
1 276 ALA n 
1 277 THR n 
1 278 MET n 
1 279 SER n 
1 280 ASP n 
1 281 GLY n 
1 282 ARG n 
1 283 VAL n 
1 284 PHE n 
1 285 THR n 
1 286 ILE n 
1 287 GLY n 
1 288 GLY n 
1 289 SER n 
1 290 TRP n 
1 291 SER n 
1 292 GLY n 
1 293 GLY n 
1 294 VAL n 
1 295 PHE n 
1 296 GLU n 
1 297 LYS n 
1 298 ASN n 
1 299 GLY n 
1 300 GLU n 
1 301 VAL n 
1 302 TYR n 
1 303 SER n 
1 304 PRO n 
1 305 SER n 
1 306 SER n 
1 307 LYS n 
1 308 THR n 
1 309 TRP n 
1 310 THR n 
1 311 SER n 
1 312 LEU n 
1 313 PRO n 
1 314 ASN n 
1 315 ALA n 
1 316 LYS n 
1 317 VAL n 
1 318 ASN n 
1 319 PRO n 
1 320 MET n 
1 321 LEU n 
1 322 THR n 
1 323 ALA n 
1 324 ASP n 
1 325 LYS n 
1 326 GLN n 
1 327 GLY n 
1 328 LEU n 
1 329 TYR n 
1 330 ARG n 
1 331 SER n 
1 332 ASP n 
1 333 ASN n 
1 334 HIS n 
1 335 ALA n 
1 336 TRP n 
1 337 LEU n 
1 338 PHE n 
1 339 GLY n 
1 340 TRP n 
1 341 LYS n 
1 342 LYS n 
1 343 GLY n 
1 344 SER n 
1 345 VAL n 
1 346 PHE n 
1 347 GLN n 
1 348 ALA n 
1 349 GLY n 
1 350 PRO n 
1 351 SER n 
1 352 THR n 
1 353 ALA n 
1 354 MET n 
1 355 ASN n 
1 356 TRP n 
1 357 TYR n 
1 358 TYR n 
1 359 THR n 
1 360 SER n 
1 361 GLY n 
1 362 SER n 
1 363 GLY n 
1 364 ASP n 
1 365 VAL n 
1 366 LYS n 
1 367 SER n 
1 368 ALA n 
1 369 GLY n 
1 370 LYS n 
1 371 ARG n 
1 372 GLN n 
1 373 SER n 
1 374 ASN n 
1 375 ARG n 
1 376 GLY n 
1 377 VAL n 
1 378 ALA n 
1 379 PRO n 
1 380 ASP n 
1 381 ALA n 
1 382 MET n 
1 383 CYS n 
1 384 GLY n 
1 385 ASN n 
1 386 ALA n 
1 387 VAL n 
1 388 MET n 
1 389 TYR n 
1 390 ASP n 
1 391 ALA n 
1 392 VAL n 
1 393 LYS n 
1 394 GLY n 
1 395 LYS n 
1 396 ILE n 
1 397 LEU n 
1 398 THR n 
1 399 PHE n 
1 400 GLY n 
1 401 GLY n 
1 402 SER n 
1 403 PRO n 
1 404 ASP n 
1 405 TYR n 
1 406 GLN n 
1 407 ASP n 
1 408 SER n 
1 409 ASP n 
1 410 ALA n 
1 411 THR n 
1 412 THR n 
1 413 ASN n 
1 414 ALA n 
1 415 HIS n 
1 416 ILE n 
1 417 ILE n 
1 418 THR n 
1 419 LEU n 
1 420 GLY n 
1 421 GLU n 
1 422 PRO n 
1 423 GLY n 
1 424 THR n 
1 425 SER n 
1 426 PRO n 
1 427 ASN n 
1 428 THR n 
1 429 VAL n 
1 430 PHE n 
1 431 ALA n 
1 432 SER n 
1 433 ASN n 
1 434 GLY n 
1 435 LEU n 
1 436 TYR n 
1 437 PHE n 
1 438 ALA n 
1 439 ARG n 
1 440 THR n 
1 441 PHE n 
1 442 HIS n 
1 443 THR n 
1 444 SER n 
1 445 VAL n 
1 446 VAL n 
1 447 LEU n 
1 448 PRO n 
1 449 ASP n 
1 450 GLY n 
1 451 SER n 
1 452 THR n 
1 453 PHE n 
1 454 ILE n 
1 455 THR n 
1 456 GLY n 
1 457 GLY n 
1 458 GLN n 
1 459 ARG n 
1 460 ARG n 
1 461 GLY n 
1 462 ILE n 
1 463 PRO n 
1 464 PHE n 
1 465 GLU n 
1 466 ASP n 
1 467 SER n 
1 468 THR n 
1 469 PRO n 
1 470 VAL n 
1 471 PHE n 
1 472 THR n 
1 473 PRO n 
1 474 GLU n 
1 475 ILE n 
1 476 TYR n 
1 477 VAL n 
1 478 PRO n 
1 479 GLU n 
1 480 GLN n 
1 481 ASP n 
1 482 THR n 
1 483 PHE n 
1 484 TYR n 
1 485 LYS n 
1 486 GLN n 
1 487 ASN n 
1 488 PRO n 
1 489 ASN n 
1 490 SER n 
1 491 ILE n 
1 492 VAL n 
1 493 ARG n 
1 494 VAL n 
1 495 TYR n 
1 496 HIS n 
1 497 SER n 
1 498 ILE n 
1 499 SER n 
1 500 LEU n 
1 501 LEU n 
1 502 LEU n 
1 503 PRO n 
1 504 ASP n 
1 505 GLY n 
1 506 ARG n 
1 507 VAL n 
1 508 PHE n 
1 509 ASN n 
1 510 GLY n 
1 511 GLY n 
1 512 GLY n 
1 513 GLY n 
1 514 LEU n 
1 515 CYS n 
1 516 GLY n 
1 517 ASP n 
1 518 CYS n 
1 519 THR n 
1 520 THR n 
1 521 ASN n 
1 522 HIS n 
1 523 PHE n 
1 524 ASP n 
1 525 ALA n 
1 526 GLN n 
1 527 ILE n 
1 528 PHE n 
1 529 THR n 
1 530 PRO n 
1 531 ASN n 
1 532 TYR n 
1 533 LEU n 
1 534 TYR n 
1 535 ASN n 
1 536 SER n 
1 537 ASN n 
1 538 GLY n 
1 539 ASN n 
1 540 LEU n 
1 541 ALA n 
1 542 THR n 
1 543 ARG n 
1 544 PRO n 
1 545 LYS n 
1 546 ILE n 
1 547 THR n 
1 548 ARG n 
1 549 THR n 
1 550 SER n 
1 551 THR n 
1 552 GLN n 
1 553 SER n 
1 554 VAL n 
1 555 LYS n 
1 556 VAL n 
1 557 GLY n 
1 558 GLY n 
1 559 ARG n 
1 560 ILE n 
1 561 THR n 
1 562 ILE n 
1 563 SER n 
1 564 THR n 
1 565 ASP n 
1 566 SER n 
1 567 SER n 
1 568 ILE n 
1 569 SER n 
1 570 LYS n 
1 571 ALA n 
1 572 SER n 
1 573 LEU n 
1 574 ILE n 
1 575 ARG n 
1 576 TYR n 
1 577 GLY n 
1 578 THR n 
1 579 ALA n 
1 580 THR n 
1 581 HIS n 
1 582 THR n 
1 583 VAL n 
1 584 ASN n 
1 585 THR n 
1 586 ASP n 
1 587 GLN n 
1 588 ARG n 
1 589 ARG n 
1 590 ILE n 
1 591 PRO n 
1 592 LEU n 
1 593 THR n 
1 594 LEU n 
1 595 THR n 
1 596 ASN n 
1 597 ASN n 
1 598 GLY n 
1 599 GLY n 
1 600 ASN n 
1 601 SER n 
1 602 TYR n 
1 603 SER n 
1 604 PHE n 
1 605 GLN n 
1 606 VAL n 
1 607 PRO n 
1 608 SER n 
1 609 ASP n 
1 610 SER n 
1 611 GLY n 
1 612 VAL n 
1 613 ALA n 
1 614 LEU n 
1 615 PRO n 
1 616 GLY n 
1 617 TYR n 
1 618 TRP n 
1 619 MET n 
1 620 LEU n 
1 621 PHE n 
1 622 VAL n 
1 623 MET n 
1 624 ASN n 
1 625 SER n 
1 626 ALA n 
1 627 GLY n 
1 628 VAL n 
1 629 PRO n 
1 630 SER n 
1 631 VAL n 
1 632 ALA n 
1 633 SER n 
1 634 THR n 
1 635 ILE n 
1 636 ARG n 
1 637 VAL n 
1 638 THR n 
1 639 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Hypomyces 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Hypomyces rosellus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     5132 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GAOA_DACDE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          Q01745 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MKHLLTLALCFSSINAVAVTVPHKAVGTGIPEGSLQFLSLRASAPIGSAISRNNWAVTCDSAQSGNECNKAIDGNKDTFW
HTFYGANGDPKPPHTYTIDMKTTQNVNGLSMLPRQDGNQNGWIGRHEVYLSSDGTNWGSPVASGSWFADSTTKYSNFETR
PARYVRLVAITEANGQPWTSIAEINVFQASSYTAPQPGLGRWGPTIDLPIVPAAAAIEPTSGRVLMWSSYRNDAFGGSPG
GITLTSSWDPSTGIVSDRTVTVTKHDMFCPGISMDGNGQIVVTGGNDAKKTSLYDSSSDSWIPGPDMQVARGYQSSATMS
DGRVFTIGGSWSGGVFEKNGEVYSPSSKTWTSLPNAKVNPMLTADKQGLYRSDNHAWLFGWKKGSVFQAGPSTAMNWYYT
SGSGDVKSAGKRQSNRGVAPDAMCGNAVMYDAVKGKILTFGGSPDYQDSDATTNAHIITLGEPGTSPNTVFASNGLYFAR
TFHTSVVLPDGSTFITGGQRRGIPFEDSTPVFTPEIYVPEQDTFYKQNPNSIVRVYHSISLLLPDGRVFNGGGGLCGDCT
TNHFDAQIFTPNYLYNSNGNLATRPKITRTSTQSVKVGGRITISTDSSISKASLIRYGTATHTVNTDQRRIPLTLTNNGG
NSYSFQVPSDSGVALPGYWMLFVMNSAGVPSVASTIRVTQ
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1GOG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 639 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q01745 
_struct_ref_seq.db_align_beg                  42 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  680 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       639 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CU  non-polymer         . 'COPPER (II) ION' ? 'Cu 2'           63.546  
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'      ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1GOG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.45 
_exptl_crystal.density_percent_sol   49.76 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1GOG 
_refine.ls_number_reflns_obs                     46302 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            1.9 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.17 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4830 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             310 
_refine_hist.number_atoms_total               5142 
_refine_hist.d_res_high                       1.9 
_refine_hist.d_res_low                        10.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.019  0.020 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.051  0.040 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.060  0.050 ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         5.850  1.000 ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        7.749  1.500 ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         7.534  1.000 ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        10.785 1.500 ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       0.018  0.020 ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      0.218  0.150 ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       0.181  0.300 ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.183  0.300 ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      0.164  0.300 ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        3.2    3.000 ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     16.0   15.00 ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   30.6   20.00 ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1GOG 
_struct.title                     'NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE' 
_struct.pdbx_descriptor           'GALACTOSE OXIDASE (E.C.1.1.3.9) (PH 7.0)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GOG 
_struct_keywords.pdbx_keywords   'OXIDOREDUCTASE(OXYGEN(A))' 
_struct_keywords.text            'OXIDOREDUCTASE(OXYGEN(A))' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       H1 
_struct_conf.beg_label_comp_id       LEU 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        328 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       SER 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        331 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        LEU 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         328 
_struct_conf.end_auth_comp_id        SER 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         331 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 A-HELIX 
_struct_conf.pdbx_PDB_helix_length   4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 18  SG  ? ? ? 1_555 A CYS 27  SG  ? ? A CYS 18  A CYS 27  1_555 ? ? ? ? ? ? ? 2.016 ? 
disulf2  disulf ? ? A CYS 515 SG  ? ? ? 1_555 A CYS 518 SG  ? ? A CYS 515 A CYS 518 1_555 ? ? ? ? ? ? ? 2.001 ? 
metalc1  metalc ? ? B CU  .   CU  ? ? ? 1_555 A HIS 581 NE2 ? ? A CU  700 A HIS 581 1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc2  metalc ? ? B CU  .   CU  ? ? ? 1_555 A HIS 496 NE2 ? ? A CU  700 A HIS 496 1_555 ? ? ? ? ? ? ? 2.239 ? 
metalc3  metalc ? ? B CU  .   CU  ? ? ? 1_555 A TYR 272 OH  ? ? A CU  700 A TYR 272 1_555 ? ? ? ? ? ? ? 1.911 ? 
metalc4  metalc ? ? B CU  .   CU  ? ? ? 1_555 A TYR 495 OH  ? ? A CU  700 A TYR 495 1_555 ? ? ? ? ? ? ? 2.586 ? 
metalc5  metalc ? ? C NA  .   NA  ? ? ? 1_555 A ASN 34  O   ? ? A NA  702 A ASN 34  1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc6  metalc ? ? C NA  .   NA  ? ? ? 1_555 A ASP 32  OD1 ? ? A NA  702 A ASP 32  1_555 ? ? ? ? ? ? ? 2.032 ? 
metalc7  metalc ? ? C NA  .   NA  ? ? ? 1_555 A THR 37  O   ? ? A NA  702 A THR 37  1_555 ? ? ? ? ? ? ? 1.869 ? 
metalc8  metalc ? ? C NA  .   NA  ? ? ? 1_555 A ALA 141 O   ? ? A NA  702 A ALA 141 1_555 ? ? ? ? ? ? ? 2.384 ? 
metalc9  metalc ? ? C NA  .   NA  ? ? ? 1_555 A GLU 142 OE2 ? ? A NA  702 A GLU 142 1_555 ? ? ? ? ? ? ? 1.966 ? 
metalc10 metalc ? ? C NA  .   NA  ? ? ? 1_555 A LYS 29  O   ? ? A NA  702 A LYS 29  1_555 ? ? ? ? ? ? ? 1.932 ? 
metalc11 metalc ? ? A THR 37  OG1 ? ? ? 1_555 C NA  .   NA  ? ? A THR 37  A NA  702 1_555 ? ? ? ? ? ? ? 2.708 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 51  A . ? PRO 51  A PRO 52  A ? PRO 52  A 1 3.80 
2 GLY 162 A . ? GLY 162 A PRO 163 A ? PRO 163 A 1 1.02 
3 GLY 349 A . ? GLY 349 A PRO 350 A ? PRO 350 A 1 4.43 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
S1 ? 9 ? 
S2 ? 3 ? 
S3 ? 5 ? 
S4 ? 4 ? 
S5 ? 4 ? 
S6 ? 4 ? 
S7 ? 4 ? 
S8 ? 4 ? 
S9 ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1 1 2 ? anti-parallel 
S1 2 3 ? anti-parallel 
S1 3 4 ? anti-parallel 
S1 4 5 ? anti-parallel 
S1 5 6 ? parallel      
S1 6 7 ? anti-parallel 
S1 7 8 ? anti-parallel 
S1 8 9 ? anti-parallel 
S2 1 2 ? anti-parallel 
S2 2 3 ? anti-parallel 
S3 1 2 ? anti-parallel 
S3 2 3 ? anti-parallel 
S3 3 4 ? anti-parallel 
S3 4 5 ? anti-parallel 
S4 1 2 ? anti-parallel 
S4 2 3 ? anti-parallel 
S4 3 4 ? anti-parallel 
S5 1 2 ? anti-parallel 
S5 2 3 ? anti-parallel 
S5 3 4 ? anti-parallel 
S6 1 2 ? anti-parallel 
S6 2 3 ? anti-parallel 
S6 3 4 ? anti-parallel 
S7 1 2 ? anti-parallel 
S7 2 3 ? anti-parallel 
S7 3 4 ? anti-parallel 
S8 1 2 ? anti-parallel 
S8 2 3 ? anti-parallel 
S8 3 4 ? anti-parallel 
S9 1 2 ? anti-parallel 
S9 2 3 ? anti-parallel 
S9 3 4 ? anti-parallel 
S9 4 5 ? anti-parallel 
S9 5 6 ? anti-parallel 
S9 6 7 ? anti-parallel 
S9 7 8 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1 1 ALA A 15  ? CYS A 18  ? ALA A 15  CYS A 18  
S1 2 HIS A 53  ? ASP A 58  ? HIS A 53  ASP A 58  
S1 3 TYR A 123 ? ALA A 128 ? TYR A 123 ALA A 128 
S1 4 ARG A 84  ? SER A 90  ? ARG A 84  SER A 90  
S1 5 ALA A 101 ? SER A 104 ? ALA A 101 SER A 104 
S1 6 ARG A 160 ? ASP A 166 ? ARG A 160 ASP A 166 
S1 7 ASP A 524 ? THR A 529 ? ASP A 524 THR A 529 
S1 8 VAL A 507 ? GLY A 511 ? VAL A 507 GLY A 511 
S1 9 SER A 497 ? LEU A 501 ? SER A 497 LEU A 501 
S2 1 LYS A 112 ? ALA A 121 ? LYS A 112 ALA A 121 
S2 2 GLN A 63  ? LEU A 71  ? GLN A 63  LEU A 71  
S2 3 GLU A 142 ? GLN A 147 ? GLU A 142 GLN A 147 
S3 1 VAL A 214 ? VAL A 219 ? VAL A 214 VAL A 219 
S3 2 THR A 202 ? TRP A 207 ? THR A 202 TRP A 207 
S3 3 VAL A 183 ? TRP A 186 ? VAL A 183 TRP A 186 
S3 4 ALA A 173 ? ILE A 176 ? ALA A 173 ILE A 176 
S3 5 THR A 578 ? THR A 580 ? THR A 578 THR A 580 
S4 1 GLY A 230 ? MET A 233 ? GLY A 230 MET A 233 
S4 2 GLN A 238 ? THR A 242 ? GLN A 238 THR A 242 
S4 3 THR A 250 ? ASP A 254 ? THR A 250 ASP A 254 
S4 4 SER A 259 ? PRO A 262 ? SER A 259 PRO A 262 
S5 1 SER A 274 ? THR A 277 ? SER A 274 THR A 277 
S5 2 VAL A 283 ? ILE A 286 ? VAL A 283 ILE A 286 
S5 3 GLY A 299 ? SER A 303 ? GLY A 299 SER A 303 
S5 4 THR A 308 ? LEU A 312 ? THR A 308 LEU A 312 
S6 1 LEU A 337 ? GLY A 339 ? LEU A 337 GLY A 339 
S6 2 VAL A 345 ? GLN A 347 ? VAL A 345 GLN A 347 
S6 3 ALA A 353 ? TYR A 358 ? ALA A 353 TYR A 358 
S6 4 ASP A 364 ? LYS A 370 ? ASP A 364 LYS A 370 
S7 1 ASN A 385 ? ASP A 390 ? ASN A 385 ASP A 390 
S7 2 LYS A 395 ? PHE A 399 ? LYS A 395 PHE A 399 
S7 3 ALA A 414 ? THR A 418 ? ALA A 414 THR A 418 
S7 4 ASN A 427 ? PHE A 430 ? ASN A 427 PHE A 430 
S8 1 THR A 443 ? VAL A 446 ? THR A 443 VAL A 446 
S8 2 SER A 451 ? THR A 455 ? SER A 451 THR A 455 
S8 3 GLU A 474 ? VAL A 477 ? GLU A 474 VAL A 477 
S8 4 THR A 482 ? LYS A 485 ? THR A 482 LYS A 485 
S9 1 ILE A 546 ? LYS A 555 ? ILE A 546 LYS A 555 
S9 2 ARG A 559 ? THR A 564 ? ARG A 559 THR A 564 
S9 3 SER A 601 ? GLN A 605 ? SER A 601 GLN A 605 
S9 4 ARG A 589 ? ASN A 596 ? ARG A 589 ASN A 596 
S9 5 LYS A 570 ? ARG A 575 ? LYS A 570 ARG A 575 
S9 6 GLY A 616 ? MET A 623 ? GLY A 616 MET A 623 
S9 7 SER A 633 ? THR A 638 ? SER A 633 THR A 638 
S9 8 ILE A 546 ? LYS A 555 ? ILE A 546 LYS A 555 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
S1 1 2 O THR A 17  ? O THR A 17  N THR A 56  ? N THR A 56  
S1 2 3 O TYR A 55  ? O TYR A 55  N LEU A 126 ? N LEU A 126 
S1 3 4 O ARG A 125 ? O ARG A 125 N TYR A 88  ? N TYR A 88  
S1 4 5 O HIS A 85  ? O HIS A 85  N GLY A 103 ? N GLY A 103 
S1 5 6 O SER A 102 ? O SER A 102 N ASP A 166 ? N ASP A 166 
S1 6 7 O PRO A 163 ? O PRO A 163 N ILE A 527 ? N ILE A 527 
S1 7 8 O GLN A 526 ? O GLN A 526 N ASN A 509 ? N ASN A 509 
S1 8 9 O PHE A 508 ? O PHE A 508 N LEU A 500 ? N LEU A 500 
S2 1 2 O SER A 114 ? O SER A 114 N LEU A 68  ? N LEU A 68  
S2 2 3 O GLY A 67  ? O GLY A 67  N PHE A 146 ? N PHE A 146 
S3 1 2 O SER A 215 ? O SER A 215 N SER A 206 ? N SER A 206 
S3 2 3 O SER A 205 ? O SER A 205 N MET A 185 ? N MET A 185 
S3 3 4 O LEU A 184 ? O LEU A 184 N ALA A 175 ? N ALA A 175 
S3 4 5 O ALA A 174 ? O ALA A 174 N ALA A 579 ? N ALA A 579 
S4 1 2 O SER A 232 ? O SER A 232 N VAL A 240 ? N VAL A 240 
S4 2 3 O ILE A 239 ? O ILE A 239 N TYR A 253 ? N TYR A 253 
S4 3 4 O LEU A 252 ? O LEU A 252 N ILE A 261 ? N ILE A 261 
S5 1 2 O ALA A 276 ? O ALA A 276 N PHE A 284 ? N PHE A 284 
S5 2 3 O VAL A 283 ? O VAL A 283 N TYR A 302 ? N TYR A 302 
S5 3 4 O VAL A 301 ? O VAL A 301 N THR A 310 ? N THR A 310 
S6 1 2 O PHE A 338 ? O PHE A 338 N PHE A 346 ? N PHE A 346 
S6 2 3 O VAL A 345 ? O VAL A 345 N TYR A 357 ? N TYR A 357 
S6 3 4 O TRP A 356 ? O TRP A 356 N LYS A 366 ? N LYS A 366 
S7 1 2 O VAL A 387 ? O VAL A 387 N LEU A 397 ? N LEU A 397 
S7 2 3 O ILE A 396 ? O ILE A 396 N ILE A 417 ? N ILE A 417 
S7 3 4 O ILE A 416 ? O ILE A 416 N VAL A 429 ? N VAL A 429 
S8 1 2 O VAL A 445 ? O VAL A 445 N PHE A 453 ? N PHE A 453 
S8 2 3 O THR A 452 ? O THR A 452 N TYR A 476 ? N TYR A 476 
S8 3 4 O ILE A 475 ? O ILE A 475 N TYR A 484 ? N TYR A 484 
S9 1 2 O ARG A 548 ? O ARG A 548 N SER A 563 ? N SER A 563 
S9 2 3 O ILE A 562 ? O ILE A 562 N TYR A 602 ? N TYR A 602 
S9 3 4 O SER A 603 ? O SER A 603 N THR A 595 ? N THR A 595 
S9 4 5 O ILE A 590 ? O ILE A 590 N LEU A 573 ? N LEU A 573 
S9 5 6 O SER A 572 ? O SER A 572 N PHE A 621 ? N PHE A 621 
S9 6 7 O LEU A 620 ? O LEU A 620 N SER A 633 ? N SER A 633 
S9 7 8 O ARG A 636 ? O ARG A 636 N VAL A 554 ? N VAL A 554 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
CU  Author   ? ? ? ? 5 'COPPER BINDING SITE'               
NA  Author   ? ? ? ? 6 'SODIUM BINDING SITE'               
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CU A 700' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 702' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  CU  5 TYR A 272 ? TYR A 272 . ? 1_555 ? 
2  CU  5 TYR A 495 ? TYR A 495 . ? 1_555 ? 
3  CU  5 HIS A 496 ? HIS A 496 . ? 1_555 ? 
4  CU  5 HIS A 581 ? HIS A 581 . ? 1_555 ? 
5  CU  5 HOH D .   ? HOH A 703 . ? 1_555 ? 
6  NA  6 LYS A 29  ? LYS A 29  . ? 1_555 ? 
7  NA  6 ASP A 32  ? ASP A 32  . ? 1_555 ? 
8  NA  6 ASN A 34  ? ASN A 34  . ? 1_555 ? 
9  NA  6 THR A 37  ? THR A 37  . ? 1_555 ? 
10 NA  6 ALA A 141 ? ALA A 141 . ? 1_555 ? 
11 NA  6 GLU A 142 ? GLU A 142 . ? 1_555 ? 
12 AC1 7 PHE A 227 ? PHE A 227 . ? 1_555 ? 
13 AC1 7 CYS A 228 ? CYS A 228 . ? 1_555 ? 
14 AC1 7 TYR A 272 ? TYR A 272 . ? 1_555 ? 
15 AC1 7 TYR A 495 ? TYR A 495 . ? 1_555 ? 
16 AC1 7 HIS A 496 ? HIS A 496 . ? 1_555 ? 
17 AC1 7 HIS A 581 ? HIS A 581 . ? 1_555 ? 
18 AC1 7 HOH D .   ? HOH A 703 . ? 1_555 ? 
19 AC2 6 LYS A 29  ? LYS A 29  . ? 1_555 ? 
20 AC2 6 ASP A 32  ? ASP A 32  . ? 1_555 ? 
21 AC2 6 ASN A 34  ? ASN A 34  . ? 1_555 ? 
22 AC2 6 THR A 37  ? THR A 37  . ? 1_555 ? 
23 AC2 6 ALA A 141 ? ALA A 141 . ? 1_555 ? 
24 AC2 6 GLU A 142 ? GLU A 142 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1GOG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GOG 
_atom_sites.fract_transf_matrix[1][1]   0.011535 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011186 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.006081 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011534 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'CIS PROLINE - PRO      52' 
2 'CIS PROLINE - PRO     163' 
3 'CIS PROLINE - PRO     350' 
# 
loop_
_atom_type.symbol 
C  
CU 
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 1   ? 38.954  0.214   0.860   1.00 37.16 ? 1    ALA A N   1 
ATOM   2    C  CA  . ALA A 1 1   ? 38.347  -1.013  0.307   1.00 48.12 ? 1    ALA A CA  1 
ATOM   3    C  C   . ALA A 1 1   ? 37.152  -1.518  1.139   1.00 48.12 ? 1    ALA A C   1 
ATOM   4    O  O   . ALA A 1 1   ? 36.806  -1.003  2.213   1.00 34.68 ? 1    ALA A O   1 
ATOM   5    C  CB  . ALA A 1 1   ? 39.392  -2.125  0.195   1.00 42.46 ? 1    ALA A CB  1 
ATOM   6    N  N   . SER A 1 2   ? 36.544  -2.575  0.571   1.00 36.83 ? 2    SER A N   1 
ATOM   7    C  CA  . SER A 1 2   ? 35.387  -3.215  1.215   1.00 42.04 ? 2    SER A CA  1 
ATOM   8    C  C   . SER A 1 2   ? 35.689  -4.715  1.080   1.00 47.76 ? 2    SER A C   1 
ATOM   9    O  O   . SER A 1 2   ? 36.822  -5.157  0.743   1.00 27.92 ? 2    SER A O   1 
ATOM   10   C  CB  . SER A 1 2   ? 34.020  -2.613  0.887   1.00 21.42 ? 2    SER A CB  1 
ATOM   11   O  OG  . SER A 1 2   ? 33.040  -3.327  1.725   1.00 21.14 ? 2    SER A OG  1 
ATOM   12   N  N   . ALA A 1 3   ? 34.676  -5.514  1.422   1.00 42.68 ? 3    ALA A N   1 
ATOM   13   C  CA  . ALA A 1 3   ? 34.908  -6.971  1.330   1.00 34.91 ? 3    ALA A CA  1 
ATOM   14   C  C   . ALA A 1 3   ? 33.527  -7.621  1.327   1.00 21.70 ? 3    ALA A C   1 
ATOM   15   O  O   . ALA A 1 3   ? 32.600  -6.942  1.792   1.00 34.84 ? 3    ALA A O   1 
ATOM   16   C  CB  . ALA A 1 3   ? 35.783  -7.323  2.530   1.00 31.49 ? 3    ALA A CB  1 
ATOM   17   N  N   . PRO A 1 4   ? 33.489  -8.796  0.805   1.00 29.90 ? 4    PRO A N   1 
ATOM   18   C  CA  . PRO A 1 4   ? 32.230  -9.592  0.727   1.00 33.35 ? 4    PRO A CA  1 
ATOM   19   C  C   . PRO A 1 4   ? 32.244  -10.454 1.988   1.00 41.02 ? 4    PRO A C   1 
ATOM   20   O  O   . PRO A 1 4   ? 33.337  -10.734 2.525   1.00 45.20 ? 4    PRO A O   1 
ATOM   21   C  CB  . PRO A 1 4   ? 32.410  -10.421 -0.539  1.00 35.80 ? 4    PRO A CB  1 
ATOM   22   C  CG  . PRO A 1 4   ? 33.911  -10.718 -0.507  1.00 44.23 ? 4    PRO A CG  1 
ATOM   23   C  CD  . PRO A 1 4   ? 34.612  -9.536  0.158   1.00 32.03 ? 4    PRO A CD  1 
ATOM   24   N  N   . ILE A 1 5   ? 31.097  -10.869 2.394   1.00 25.21 ? 5    ILE A N   1 
ATOM   25   C  CA  . ILE A 1 5   ? 30.885  -11.688 3.587   1.00 31.60 ? 5    ILE A CA  1 
ATOM   26   C  C   . ILE A 1 5   ? 31.001  -13.176 3.313   1.00 49.21 ? 5    ILE A C   1 
ATOM   27   O  O   . ILE A 1 5   ? 30.955  -14.009 4.248   1.00 51.08 ? 5    ILE A O   1 
ATOM   28   C  CB  . ILE A 1 5   ? 29.487  -11.191 4.213   1.00 42.55 ? 5    ILE A CB  1 
ATOM   29   C  CG1 . ILE A 1 5   ? 28.264  -11.367 3.286   1.00 33.93 ? 5    ILE A CG1 1 
ATOM   30   C  CG2 . ILE A 1 5   ? 29.617  -9.684  4.667   1.00 25.50 ? 5    ILE A CG2 1 
ATOM   31   C  CD1 . ILE A 1 5   ? 26.838  -11.061 3.837   1.00 22.31 ? 5    ILE A CD1 1 
ATOM   32   N  N   . GLY A 1 6   ? 31.160  -13.591 2.058   1.00 55.43 ? 6    GLY A N   1 
ATOM   33   C  CA  . GLY A 1 6   ? 31.256  -15.021 1.700   1.00 63.07 ? 6    GLY A CA  1 
ATOM   34   C  C   . GLY A 1 6   ? 32.478  -15.377 0.846   1.00 54.86 ? 6    GLY A C   1 
ATOM   35   O  O   . GLY A 1 6   ? 33.305  -14.465 0.617   1.00 36.48 ? 6    GLY A O   1 
ATOM   36   N  N   . SER A 1 7   ? 32.495  -16.628 0.376   1.00 37.96 ? 7    SER A N   1 
ATOM   37   C  CA  . SER A 1 7   ? 33.628  -17.036 -0.491  1.00 43.20 ? 7    SER A CA  1 
ATOM   38   C  C   . SER A 1 7   ? 33.146  -17.193 -1.929  1.00 24.01 ? 7    SER A C   1 
ATOM   39   O  O   . SER A 1 7   ? 32.025  -17.577 -2.323  1.00 32.86 ? 7    SER A O   1 
ATOM   40   C  CB  . SER A 1 7   ? 34.482  -18.170 0.046   1.00 59.15 ? 7    SER A CB  1 
ATOM   41   O  OG  . SER A 1 7   ? 33.789  -19.348 0.339   1.00 67.85 ? 7    SER A OG  1 
ATOM   42   N  N   . ALA A 1 8   ? 34.063  -16.742 -2.798  1.00 22.95 ? 8    ALA A N   1 
ATOM   43   C  CA  . ALA A 1 8   ? 33.810  -16.729 -4.237  1.00 21.38 ? 8    ALA A CA  1 
ATOM   44   C  C   . ALA A 1 8   ? 33.407  -18.124 -4.707  1.00 29.62 ? 8    ALA A C   1 
ATOM   45   O  O   . ALA A 1 8   ? 33.917  -19.158 -4.216  1.00 36.50 ? 8    ALA A O   1 
ATOM   46   C  CB  . ALA A 1 8   ? 34.945  -16.118 -4.993  1.00 36.36 ? 8    ALA A CB  1 
ATOM   47   N  N   . ILE A 1 9   ? 32.424  -18.028 -5.591  1.00 35.02 ? 9    ILE A N   1 
ATOM   48   C  CA  . ILE A 1 9   ? 31.852  -19.230 -6.212  1.00 43.70 ? 9    ILE A CA  1 
ATOM   49   C  C   . ILE A 1 9   ? 32.593  -19.475 -7.557  1.00 49.08 ? 9    ILE A C   1 
ATOM   50   O  O   . ILE A 1 9   ? 32.859  -18.535 -8.327  1.00 37.11 ? 9    ILE A O   1 
ATOM   51   C  CB  . ILE A 1 9   ? 30.328  -19.176 -6.403  1.00 34.41 ? 9    ILE A CB  1 
ATOM   52   C  CG1 . ILE A 1 9   ? 29.511  -19.117 -5.075  1.00 25.37 ? 9    ILE A CG1 1 
ATOM   53   C  CG2 . ILE A 1 9   ? 29.834  -20.383 -7.262  1.00 44.55 ? 9    ILE A CG2 1 
ATOM   54   C  CD1 . ILE A 1 9   ? 28.119  -18.518 -5.542  1.00 21.72 ? 9    ILE A CD1 1 
ATOM   55   N  N   . SER A 1 10  ? 32.914  -20.752 -7.762  1.00 54.60 ? 10   SER A N   1 
ATOM   56   C  CA  . SER A 1 10  ? 33.632  -21.163 -8.970  1.00 61.45 ? 10   SER A CA  1 
ATOM   57   C  C   . SER A 1 10  ? 32.687  -20.940 -10.166 1.00 44.26 ? 10   SER A C   1 
ATOM   58   O  O   . SER A 1 10  ? 31.572  -21.433 -10.210 1.00 54.45 ? 10   SER A O   1 
ATOM   59   C  CB  . SER A 1 10  ? 34.245  -22.534 -9.029  1.00 73.98 ? 10   SER A CB  1 
ATOM   60   O  OG  . SER A 1 10  ? 33.462  -23.555 -8.444  1.00 94.80 ? 10   SER A OG  1 
ATOM   61   N  N   . ARG A 1 11  ? 33.244  -20.173 -11.070 1.00 38.21 ? 11   ARG A N   1 
ATOM   62   C  CA  . ARG A 1 11  ? 32.711  -19.712 -12.308 1.00 39.79 ? 11   ARG A CA  1 
ATOM   63   C  C   . ARG A 1 11  ? 32.901  -20.656 -13.506 1.00 59.85 ? 11   ARG A C   1 
ATOM   64   O  O   . ARG A 1 11  ? 32.612  -20.156 -14.606 1.00 53.05 ? 11   ARG A O   1 
ATOM   65   C  CB  . ARG A 1 11  ? 33.300  -18.321 -12.603 1.00 40.10 ? 11   ARG A CB  1 
ATOM   66   C  CG  . ARG A 1 11  ? 32.823  -17.305 -11.540 1.00 28.14 ? 11   ARG A CG  1 
ATOM   67   C  CD  . ARG A 1 11  ? 33.070  -15.927 -12.062 1.00 26.68 ? 11   ARG A CD  1 
ATOM   68   N  NE  . ARG A 1 11  ? 34.530  -15.877 -12.174 1.00 28.08 ? 11   ARG A NE  1 
ATOM   69   C  CZ  . ARG A 1 11  ? 35.193  -14.788 -12.524 1.00 42.13 ? 11   ARG A CZ  1 
ATOM   70   N  NH1 . ARG A 1 11  ? 34.644  -13.588 -12.723 1.00 42.91 ? 11   ARG A NH1 1 
ATOM   71   N  NH2 . ARG A 1 11  ? 36.507  -14.895 -12.754 1.00 42.93 ? 11   ARG A NH2 1 
ATOM   72   N  N   . ASN A 1 12  ? 33.282  -21.907 -13.296 1.00 69.95 ? 12   ASN A N   1 
ATOM   73   C  CA  . ASN A 1 12  ? 33.479  -22.944 -14.318 1.00 66.27 ? 12   ASN A CA  1 
ATOM   74   C  C   . ASN A 1 12  ? 32.247  -23.176 -15.200 1.00 72.06 ? 12   ASN A C   1 
ATOM   75   O  O   . ASN A 1 12  ? 32.184  -22.761 -16.361 1.00 79.78 ? 12   ASN A O   1 
ATOM   76   C  CB  . ASN A 1 12  ? 33.801  -24.308 -13.692 1.00 74.58 ? 12   ASN A CB  1 
ATOM   77   C  CG  . ASN A 1 12  ? 35.253  -24.467 -13.310 1.00 91.40 ? 12   ASN A CG  1 
ATOM   78   O  OD1 . ASN A 1 12  ? 36.034  -23.520 -13.480 1.00 96.96 ? 12   ASN A OD1 1 
ATOM   79   N  ND2 . ASN A 1 12  ? 35.608  -25.650 -12.790 1.00 99.99 ? 12   ASN A ND2 1 
ATOM   80   N  N   . ASN A 1 13  ? 31.300  -23.851 -14.612 1.00 69.52 ? 13   ASN A N   1 
ATOM   81   C  CA  . ASN A 1 13  ? 30.009  -24.227 -15.167 1.00 77.53 ? 13   ASN A CA  1 
ATOM   82   C  C   . ASN A 1 13  ? 29.016  -23.126 -15.487 1.00 71.22 ? 13   ASN A C   1 
ATOM   83   O  O   . ASN A 1 13  ? 27.985  -23.489 -16.068 1.00 68.54 ? 13   ASN A O   1 
ATOM   84   C  CB  . ASN A 1 13  ? 29.312  -25.104 -14.079 1.00 91.25 ? 13   ASN A CB  1 
ATOM   85   C  CG  . ASN A 1 13  ? 29.540  -26.578 -14.362 1.00 99.99 ? 13   ASN A CG  1 
ATOM   86   O  OD1 . ASN A 1 13  ? 30.658  -26.898 -14.813 1.00 99.99 ? 13   ASN A OD1 1 
ATOM   87   N  ND2 . ASN A 1 13  ? 28.531  -27.420 -14.115 1.00 99.99 ? 13   ASN A ND2 1 
ATOM   88   N  N   . TRP A 1 14  ? 29.276  -21.892 -15.102 1.00 66.98 ? 14   TRP A N   1 
ATOM   89   C  CA  . TRP A 1 14  ? 28.316  -20.803 -15.315 1.00 55.78 ? 14   TRP A CA  1 
ATOM   90   C  C   . TRP A 1 14  ? 28.040  -20.460 -16.771 1.00 48.64 ? 14   TRP A C   1 
ATOM   91   O  O   . TRP A 1 14  ? 28.840  -20.561 -17.684 1.00 60.76 ? 14   TRP A O   1 
ATOM   92   C  CB  . TRP A 1 14  ? 28.635  -19.514 -14.559 1.00 50.83 ? 14   TRP A CB  1 
ATOM   93   C  CG  . TRP A 1 14  ? 28.808  -19.528 -13.087 1.00 35.56 ? 14   TRP A CG  1 
ATOM   94   C  CD1 . TRP A 1 14  ? 28.650  -20.487 -12.147 1.00 41.05 ? 14   TRP A CD1 1 
ATOM   95   C  CD2 . TRP A 1 14  ? 29.145  -18.314 -12.368 1.00 39.57 ? 14   TRP A CD2 1 
ATOM   96   N  NE1 . TRP A 1 14  ? 28.919  -19.991 -10.867 1.00 35.21 ? 14   TRP A NE1 1 
ATOM   97   C  CE2 . TRP A 1 14  ? 29.199  -18.651 -10.999 1.00 40.01 ? 14   TRP A CE2 1 
ATOM   98   C  CE3 . TRP A 1 14  ? 29.366  -16.995 -12.794 1.00 30.58 ? 14   TRP A CE3 1 
ATOM   99   C  CZ2 . TRP A 1 14  ? 29.528  -17.694 -10.030 1.00 30.66 ? 14   TRP A CZ2 1 
ATOM   100  C  CZ3 . TRP A 1 14  ? 29.697  -16.053 -11.845 1.00 34.17 ? 14   TRP A CZ3 1 
ATOM   101  C  CH2 . TRP A 1 14  ? 29.788  -16.423 -10.506 1.00 31.80 ? 14   TRP A CH2 1 
ATOM   102  N  N   . ALA A 1 15  ? 26.834  -19.967 -16.907 1.00 45.91 ? 15   ALA A N   1 
ATOM   103  C  CA  . ALA A 1 15  ? 26.273  -19.510 -18.182 1.00 54.38 ? 15   ALA A CA  1 
ATOM   104  C  C   . ALA A 1 15  ? 25.673  -18.129 -17.926 1.00 43.98 ? 15   ALA A C   1 
ATOM   105  O  O   . ALA A 1 15  ? 24.865  -18.100 -17.003 1.00 41.44 ? 15   ALA A O   1 
ATOM   106  C  CB  . ALA A 1 15  ? 25.248  -20.580 -18.512 1.00 67.85 ? 15   ALA A CB  1 
ATOM   107  N  N   . VAL A 1 16  ? 26.083  -17.120 -18.650 1.00 40.08 ? 16   VAL A N   1 
ATOM   108  C  CA  . VAL A 1 16  ? 25.682  -15.741 -18.502 1.00 35.56 ? 16   VAL A CA  1 
ATOM   109  C  C   . VAL A 1 16  ? 24.960  -15.149 -19.693 1.00 41.03 ? 16   VAL A C   1 
ATOM   110  O  O   . VAL A 1 16  ? 25.310  -15.530 -20.799 1.00 48.85 ? 16   VAL A O   1 
ATOM   111  C  CB  . VAL A 1 16  ? 26.953  -14.898 -18.190 1.00 35.05 ? 16   VAL A CB  1 
ATOM   112  C  CG1 . VAL A 1 16  ? 27.592  -15.304 -16.859 1.00 34.61 ? 16   VAL A CG1 1 
ATOM   113  C  CG2 . VAL A 1 16  ? 27.987  -14.960 -19.306 1.00 38.92 ? 16   VAL A CG2 1 
ATOM   114  N  N   . THR A 1 17  ? 24.042  -14.236 -19.481 1.00 34.60 ? 17   THR A N   1 
ATOM   115  C  CA  . THR A 1 17  ? 23.215  -13.518 -20.356 1.00 31.41 ? 17   THR A CA  1 
ATOM   116  C  C   . THR A 1 17  ? 23.250  -12.019 -20.084 1.00 38.05 ? 17   THR A C   1 
ATOM   117  O  O   . THR A 1 17  ? 23.108  -11.617 -18.915 1.00 43.06 ? 17   THR A O   1 
ATOM   118  C  CB  . THR A 1 17  ? 21.629  -13.800 -20.180 1.00 46.53 ? 17   THR A CB  1 
ATOM   119  O  OG1 . THR A 1 17  ? 21.546  -15.165 -19.703 1.00 63.32 ? 17   THR A OG1 1 
ATOM   120  C  CG2 . THR A 1 17  ? 20.858  -13.539 -21.460 1.00 51.80 ? 17   THR A CG2 1 
ATOM   121  N  N   . CYS A 1 18  ? 23.323  -11.315 -21.180 1.00 32.66 ? 18   CYS A N   1 
ATOM   122  C  CA  . CYS A 1 18  ? 23.381  -9.864  -21.155 1.00 27.67 ? 18   CYS A CA  1 
ATOM   123  C  C   . CYS A 1 18  ? 22.301  -9.287  -21.997 1.00 29.44 ? 18   CYS A C   1 
ATOM   124  O  O   . CYS A 1 18  ? 21.901  -10.036 -22.920 1.00 41.57 ? 18   CYS A O   1 
ATOM   125  C  CB  . CYS A 1 18  ? 24.766  -9.336  -21.602 1.00 41.48 ? 18   CYS A CB  1 
ATOM   126  S  SG  . CYS A 1 18  ? 26.005  -9.734  -20.372 1.00 33.65 ? 18   CYS A SG  1 
ATOM   127  N  N   . ASP A 1 19  ? 21.961  -8.075  -21.659 1.00 27.18 ? 19   ASP A N   1 
ATOM   128  C  CA  . ASP A 1 19  ? 20.858  -7.499  -22.515 1.00 53.16 ? 19   ASP A CA  1 
ATOM   129  C  C   . ASP A 1 19  ? 21.451  -7.151  -23.889 1.00 57.89 ? 19   ASP A C   1 
ATOM   130  O  O   . ASP A 1 19  ? 20.723  -7.394  -24.874 1.00 66.09 ? 19   ASP A O   1 
ATOM   131  C  CB  . ASP A 1 19  ? 20.006  -6.462  -21.787 1.00 30.68 ? 19   ASP A CB  1 
ATOM   132  C  CG  . ASP A 1 19  ? 20.789  -5.196  -21.508 1.00 41.74 ? 19   ASP A CG  1 
ATOM   133  O  OD1 . ASP A 1 19  ? 21.955  -5.311  -21.060 1.00 36.94 ? 19   ASP A OD1 1 
ATOM   134  O  OD2 . ASP A 1 19  ? 20.230  -4.116  -21.766 1.00 33.82 ? 19   ASP A OD2 1 
ATOM   135  N  N   . SER A 1 20  ? 22.655  -6.666  -24.008 1.00 49.25 ? 20   SER A N   1 
ATOM   136  C  CA  . SER A 1 20  ? 23.412  -6.276  -25.179 1.00 49.98 ? 20   SER A CA  1 
ATOM   137  C  C   . SER A 1 20  ? 24.884  -6.626  -24.779 1.00 51.61 ? 20   SER A C   1 
ATOM   138  O  O   . SER A 1 20  ? 25.106  -6.710  -23.583 1.00 52.24 ? 20   SER A O   1 
ATOM   139  C  CB  . SER A 1 20  ? 23.690  -4.812  -25.542 1.00 29.38 ? 20   SER A CB  1 
ATOM   140  O  OG  . SER A 1 20  ? 22.776  -3.915  -25.020 1.00 42.81 ? 20   SER A OG  1 
ATOM   141  N  N   . ALA A 1 21  ? 25.731  -6.661  -25.768 1.00 48.90 ? 21   ALA A N   1 
ATOM   142  C  CA  . ALA A 1 21  ? 27.168  -6.882  -25.619 1.00 37.61 ? 21   ALA A CA  1 
ATOM   143  C  C   . ALA A 1 21  ? 27.803  -6.431  -26.940 1.00 52.29 ? 21   ALA A C   1 
ATOM   144  O  O   . ALA A 1 21  ? 27.440  -6.923  -28.043 1.00 51.02 ? 21   ALA A O   1 
ATOM   145  C  CB  . ALA A 1 21  ? 27.548  -8.301  -25.221 1.00 34.76 ? 21   ALA A CB  1 
ATOM   146  N  N   . GLN A 1 22  ? 28.747  -5.499  -26.842 1.00 60.49 ? 22   GLN A N   1 
ATOM   147  C  CA  . GLN A 1 22  ? 29.446  -5.101  -28.090 1.00 58.83 ? 22   GLN A CA  1 
ATOM   148  C  C   . GLN A 1 22  ? 30.499  -6.184  -28.339 1.00 62.83 ? 22   GLN A C   1 
ATOM   149  O  O   . GLN A 1 22  ? 31.085  -6.689  -27.368 1.00 63.74 ? 22   GLN A O   1 
ATOM   150  C  CB  . GLN A 1 22  ? 29.913  -3.669  -28.149 1.00 56.55 ? 22   GLN A CB  1 
ATOM   151  C  CG  . GLN A 1 22  ? 28.739  -2.973  -28.921 1.00 74.11 ? 22   GLN A CG  1 
ATOM   152  C  CD  . GLN A 1 22  ? 29.254  -1.948  -29.894 1.00 74.10 ? 22   GLN A CD  1 
ATOM   153  O  OE1 . GLN A 1 22  ? 30.394  -1.513  -29.810 1.00 74.07 ? 22   GLN A OE1 1 
ATOM   154  N  NE2 . GLN A 1 22  ? 28.427  -1.561  -30.867 1.00 83.40 ? 22   GLN A NE2 1 
ATOM   155  N  N   . SER A 1 23  ? 30.687  -6.584  -29.595 1.00 65.19 ? 23   SER A N   1 
ATOM   156  C  CA  . SER A 1 23  ? 31.690  -7.626  -29.975 1.00 63.22 ? 23   SER A CA  1 
ATOM   157  C  C   . SER A 1 23  ? 33.040  -7.136  -29.469 1.00 48.35 ? 23   SER A C   1 
ATOM   158  O  O   . SER A 1 23  ? 33.457  -5.984  -29.644 1.00 58.32 ? 23   SER A O   1 
ATOM   159  C  CB  . SER A 1 23  ? 31.639  -7.932  -31.457 1.00 69.17 ? 23   SER A CB  1 
ATOM   160  O  OG  . SER A 1 23  ? 31.251  -6.790  -32.201 1.00 76.20 ? 23   SER A OG  1 
ATOM   161  N  N   . GLY A 1 24  ? 33.727  -7.941  -28.715 1.00 45.66 ? 24   GLY A N   1 
ATOM   162  C  CA  . GLY A 1 24  ? 35.014  -7.598  -28.093 1.00 64.00 ? 24   GLY A CA  1 
ATOM   163  C  C   . GLY A 1 24  ? 34.691  -7.349  -26.594 1.00 59.03 ? 24   GLY A C   1 
ATOM   164  O  O   . GLY A 1 24  ? 35.559  -7.470  -25.735 1.00 70.06 ? 24   GLY A O   1 
ATOM   165  N  N   . ASN A 1 25  ? 33.432  -7.050  -26.337 1.00 51.84 ? 25   ASN A N   1 
ATOM   166  C  CA  . ASN A 1 25  ? 32.897  -6.758  -25.016 1.00 28.35 ? 25   ASN A CA  1 
ATOM   167  C  C   . ASN A 1 25  ? 31.781  -7.715  -24.614 1.00 31.73 ? 25   ASN A C   1 
ATOM   168  O  O   . ASN A 1 25  ? 30.761  -7.272  -24.067 1.00 35.28 ? 25   ASN A O   1 
ATOM   169  C  CB  . ASN A 1 25  ? 32.444  -5.307  -25.005 1.00 30.02 ? 25   ASN A CB  1 
ATOM   170  C  CG  . ASN A 1 25  ? 33.575  -4.342  -25.284 1.00 47.25 ? 25   ASN A CG  1 
ATOM   171  O  OD1 . ASN A 1 25  ? 33.463  -3.283  -25.959 1.00 52.40 ? 25   ASN A OD1 1 
ATOM   172  N  ND2 . ASN A 1 25  ? 34.720  -4.713  -24.691 1.00 51.35 ? 25   ASN A ND2 1 
ATOM   173  N  N   . GLU A 1 26  ? 32.009  -8.976  -24.878 1.00 33.30 ? 26   GLU A N   1 
ATOM   174  C  CA  . GLU A 1 26  ? 31.058  -10.039 -24.610 1.00 49.80 ? 26   GLU A CA  1 
ATOM   175  C  C   . GLU A 1 26  ? 30.719  -10.200 -23.118 1.00 51.79 ? 26   GLU A C   1 
ATOM   176  O  O   . GLU A 1 26  ? 31.508  -10.000 -22.171 1.00 39.68 ? 26   GLU A O   1 
ATOM   177  C  CB  . GLU A 1 26  ? 31.516  -11.382 -25.162 1.00 64.61 ? 26   GLU A CB  1 
ATOM   178  C  CG  . GLU A 1 26  ? 31.900  -11.665 -26.589 1.00 74.84 ? 26   GLU A CG  1 
ATOM   179  C  CD  . GLU A 1 26  ? 32.905  -10.895 -27.388 1.00 78.16 ? 26   GLU A CD  1 
ATOM   180  O  OE1 . GLU A 1 26  ? 33.929  -10.475 -26.773 1.00 77.36 ? 26   GLU A OE1 1 
ATOM   181  O  OE2 . GLU A 1 26  ? 32.706  -10.692 -28.590 1.00 71.01 ? 26   GLU A OE2 1 
ATOM   182  N  N   . CYS A 1 27  ? 29.458  -10.632 -22.973 1.00 41.19 ? 27   CYS A N   1 
ATOM   183  C  CA  . CYS A 1 27  ? 28.878  -10.898 -21.668 1.00 56.11 ? 27   CYS A CA  1 
ATOM   184  C  C   . CYS A 1 27  ? 29.898  -11.608 -20.767 1.00 51.84 ? 27   CYS A C   1 
ATOM   185  O  O   . CYS A 1 27  ? 30.138  -11.305 -19.592 1.00 41.81 ? 27   CYS A O   1 
ATOM   186  C  CB  . CYS A 1 27  ? 27.625  -11.743 -21.891 1.00 53.11 ? 27   CYS A CB  1 
ATOM   187  S  SG  . CYS A 1 27  ? 26.465  -11.694 -20.472 1.00 48.12 ? 27   CYS A SG  1 
ATOM   188  N  N   . ASN A 1 28  ? 30.536  -12.589 -21.383 1.00 58.33 ? 28   ASN A N   1 
ATOM   189  C  CA  . ASN A 1 28  ? 31.545  -13.455 -20.760 1.00 53.71 ? 28   ASN A CA  1 
ATOM   190  C  C   . ASN A 1 28  ? 32.893  -12.839 -20.383 1.00 45.11 ? 28   ASN A C   1 
ATOM   191  O  O   . ASN A 1 28  ? 33.556  -13.504 -19.576 1.00 36.48 ? 28   ASN A O   1 
ATOM   192  C  CB  . ASN A 1 28  ? 31.628  -14.773 -21.538 1.00 71.13 ? 28   ASN A CB  1 
ATOM   193  C  CG  . ASN A 1 28  ? 32.509  -14.752 -22.762 1.00 81.73 ? 28   ASN A CG  1 
ATOM   194  O  OD1 . ASN A 1 28  ? 32.527  -13.807 -23.563 1.00 84.09 ? 28   ASN A OD1 1 
ATOM   195  N  ND2 . ASN A 1 28  ? 33.286  -15.829 -22.890 1.00 96.12 ? 28   ASN A ND2 1 
ATOM   196  N  N   . LYS A 1 29  ? 33.247  -11.662 -20.843 1.00 30.23 ? 29   LYS A N   1 
ATOM   197  C  CA  . LYS A 1 29  ? 34.497  -11.016 -20.450 1.00 33.31 ? 29   LYS A CA  1 
ATOM   198  C  C   . LYS A 1 29  ? 34.395  -10.669 -18.947 1.00 32.80 ? 29   LYS A C   1 
ATOM   199  O  O   . LYS A 1 29  ? 35.431  -10.483 -18.257 1.00 36.61 ? 29   LYS A O   1 
ATOM   200  C  CB  . LYS A 1 29  ? 34.658  -9.664  -21.150 1.00 35.25 ? 29   LYS A CB  1 
ATOM   201  C  CG  . LYS A 1 29  ? 34.665  -9.531  -22.668 1.00 33.62 ? 29   LYS A CG  1 
ATOM   202  C  CD  . LYS A 1 29  ? 35.503  -10.648 -23.248 1.00 44.61 ? 29   LYS A CD  1 
ATOM   203  C  CE  . LYS A 1 29  ? 36.191  -10.142 -24.503 1.00 68.45 ? 29   LYS A CE  1 
ATOM   204  N  NZ  . LYS A 1 29  ? 36.634  -11.330 -25.287 1.00 81.19 ? 29   LYS A NZ  1 
ATOM   205  N  N   . ALA A 1 30  ? 33.134  -10.560 -18.541 1.00 26.56 ? 30   ALA A N   1 
ATOM   206  C  CA  . ALA A 1 30  ? 32.828  -10.234 -17.119 1.00 24.93 ? 30   ALA A CA  1 
ATOM   207  C  C   . ALA A 1 30  ? 33.133  -11.439 -16.267 1.00 38.55 ? 30   ALA A C   1 
ATOM   208  O  O   . ALA A 1 30  ? 33.182  -11.282 -15.048 1.00 34.44 ? 30   ALA A O   1 
ATOM   209  C  CB  . ALA A 1 30  ? 31.367  -9.851  -17.142 1.00 21.47 ? 30   ALA A CB  1 
ATOM   210  N  N   . ILE A 1 31  ? 33.346  -12.649 -16.845 1.00 37.91 ? 31   ILE A N   1 
ATOM   211  C  CA  . ILE A 1 31  ? 33.669  -13.762 -15.951 1.00 31.86 ? 31   ILE A CA  1 
ATOM   212  C  C   . ILE A 1 31  ? 34.906  -14.541 -16.419 1.00 47.63 ? 31   ILE A C   1 
ATOM   213  O  O   . ILE A 1 31  ? 34.978  -15.758 -16.181 1.00 49.43 ? 31   ILE A O   1 
ATOM   214  C  CB  . ILE A 1 31  ? 32.500  -14.739 -15.677 1.00 36.13 ? 31   ILE A CB  1 
ATOM   215  C  CG1 . ILE A 1 31  ? 32.106  -15.382 -17.045 1.00 39.93 ? 31   ILE A CG1 1 
ATOM   216  C  CG2 . ILE A 1 31  ? 31.324  -14.048 -14.929 1.00 32.71 ? 31   ILE A CG2 1 
ATOM   217  C  CD1 . ILE A 1 31  ? 31.527  -16.830 -16.783 1.00 43.98 ? 31   ILE A CD1 1 
ATOM   218  N  N   . ASP A 1 32  ? 35.814  -13.806 -17.049 1.00 49.06 ? 32   ASP A N   1 
ATOM   219  C  CA  . ASP A 1 32  ? 37.042  -14.422 -17.559 1.00 43.55 ? 32   ASP A CA  1 
ATOM   220  C  C   . ASP A 1 32  ? 38.160  -14.472 -16.538 1.00 52.71 ? 32   ASP A C   1 
ATOM   221  O  O   . ASP A 1 32  ? 38.989  -15.414 -16.678 1.00 67.35 ? 32   ASP A O   1 
ATOM   222  C  CB  . ASP A 1 32  ? 37.375  -13.810 -18.895 1.00 36.99 ? 32   ASP A CB  1 
ATOM   223  C  CG  . ASP A 1 32  ? 37.685  -12.356 -18.967 1.00 44.95 ? 32   ASP A CG  1 
ATOM   224  O  OD1 . ASP A 1 32  ? 37.481  -11.603 -17.994 1.00 45.34 ? 32   ASP A OD1 1 
ATOM   225  O  OD2 . ASP A 1 32  ? 38.167  -11.880 -20.022 1.00 45.98 ? 32   ASP A OD2 1 
ATOM   226  N  N   . GLY A 1 33  ? 38.233  -13.584 -15.562 1.00 46.07 ? 33   GLY A N   1 
ATOM   227  C  CA  . GLY A 1 33  ? 39.404  -13.763 -14.613 1.00 46.32 ? 33   GLY A CA  1 
ATOM   228  C  C   . GLY A 1 33  ? 40.426  -12.682 -15.031 1.00 48.75 ? 33   GLY A C   1 
ATOM   229  O  O   . GLY A 1 33  ? 41.461  -12.526 -14.368 1.00 49.43 ? 33   GLY A O   1 
ATOM   230  N  N   . ASN A 1 34  ? 40.067  -11.956 -16.086 1.00 31.08 ? 34   ASN A N   1 
ATOM   231  C  CA  . ASN A 1 34  ? 40.914  -10.879 -16.589 1.00 29.66 ? 34   ASN A CA  1 
ATOM   232  C  C   . ASN A 1 34  ? 40.182  -9.519  -16.428 1.00 44.32 ? 34   ASN A C   1 
ATOM   233  O  O   . ASN A 1 34  ? 39.103  -9.250  -17.023 1.00 49.99 ? 34   ASN A O   1 
ATOM   234  C  CB  . ASN A 1 34  ? 41.275  -11.190 -18.009 1.00 53.37 ? 34   ASN A CB  1 
ATOM   235  C  CG  . ASN A 1 34  ? 42.415  -10.383 -18.584 1.00 65.64 ? 34   ASN A CG  1 
ATOM   236  O  OD1 . ASN A 1 34  ? 42.583  -9.190  -18.332 1.00 63.33 ? 34   ASN A OD1 1 
ATOM   237  N  ND2 . ASN A 1 34  ? 43.172  -11.150 -19.381 1.00 79.24 ? 34   ASN A ND2 1 
ATOM   238  N  N   . LYS A 1 35  ? 40.858  -8.825  -15.546 1.00 41.69 ? 35   LYS A N   1 
ATOM   239  C  CA  . LYS A 1 35  ? 40.462  -7.468  -15.136 1.00 45.11 ? 35   LYS A CA  1 
ATOM   240  C  C   . LYS A 1 35  ? 40.670  -6.458  -16.242 1.00 38.62 ? 35   LYS A C   1 
ATOM   241  O  O   . LYS A 1 35  ? 40.189  -5.313  -16.145 1.00 32.73 ? 35   LYS A O   1 
ATOM   242  C  CB  . LYS A 1 35  ? 41.210  -7.181  -13.884 1.00 63.44 ? 35   LYS A CB  1 
ATOM   243  C  CG  . LYS A 1 35  ? 42.496  -6.359  -13.815 1.00 77.82 ? 35   LYS A CG  1 
ATOM   244  C  CD  . LYS A 1 35  ? 42.703  -5.974  -12.351 1.00 91.66 ? 35   LYS A CD  1 
ATOM   245  C  CE  . LYS A 1 35  ? 41.620  -5.094  -11.757 1.00 99.99 ? 35   LYS A CE  1 
ATOM   246  N  NZ  . LYS A 1 35  ? 41.912  -4.635  -10.365 1.00 87.63 ? 35   LYS A NZ  1 
ATOM   247  N  N   . ASP A 1 36  ? 41.309  -6.908  -17.324 1.00 36.80 ? 36   ASP A N   1 
ATOM   248  C  CA  . ASP A 1 36  ? 41.571  -6.028  -18.474 1.00 41.49 ? 36   ASP A CA  1 
ATOM   249  C  C   . ASP A 1 36  ? 40.432  -6.115  -19.493 1.00 44.38 ? 36   ASP A C   1 
ATOM   250  O  O   . ASP A 1 36  ? 40.370  -5.168  -20.290 1.00 39.67 ? 36   ASP A O   1 
ATOM   251  C  CB  . ASP A 1 36  ? 42.875  -6.295  -19.200 1.00 65.46 ? 36   ASP A CB  1 
ATOM   252  C  CG  . ASP A 1 36  ? 44.089  -5.734  -18.459 1.00 66.19 ? 36   ASP A CG  1 
ATOM   253  O  OD1 . ASP A 1 36  ? 43.820  -4.735  -17.779 1.00 64.10 ? 36   ASP A OD1 1 
ATOM   254  O  OD2 . ASP A 1 36  ? 45.179  -6.286  -18.630 1.00 76.10 ? 36   ASP A OD2 1 
ATOM   255  N  N   . THR A 1 37  ? 39.717  -7.207  -19.314 1.00 46.29 ? 37   THR A N   1 
ATOM   256  C  CA  . THR A 1 37  ? 38.535  -7.454  -20.168 1.00 39.32 ? 37   THR A CA  1 
ATOM   257  C  C   . THR A 1 37  ? 37.209  -7.384  -19.349 1.00 45.56 ? 37   THR A C   1 
ATOM   258  O  O   . THR A 1 37  ? 36.997  -7.970  -18.244 1.00 22.50 ? 37   THR A O   1 
ATOM   259  C  CB  . THR A 1 37  ? 38.583  -8.809  -20.923 1.00 31.45 ? 37   THR A CB  1 
ATOM   260  O  OG1 . THR A 1 37  ? 38.392  -9.762  -19.837 1.00 35.30 ? 37   THR A OG1 1 
ATOM   261  C  CG2 . THR A 1 37  ? 39.940  -9.035  -21.578 1.00 65.21 ? 37   THR A CG2 1 
ATOM   262  N  N   . PHE A 1 38  ? 36.318  -6.702  -20.074 1.00 30.82 ? 38   PHE A N   1 
ATOM   263  C  CA  . PHE A 1 38  ? 34.990  -6.339  -19.676 1.00 42.19 ? 38   PHE A CA  1 
ATOM   264  C  C   . PHE A 1 38  ? 33.841  -6.420  -20.682 1.00 41.53 ? 38   PHE A C   1 
ATOM   265  O  O   . PHE A 1 38  ? 34.027  -6.190  -21.878 1.00 35.01 ? 38   PHE A O   1 
ATOM   266  C  CB  . PHE A 1 38  ? 35.055  -4.833  -19.253 1.00 44.66 ? 38   PHE A CB  1 
ATOM   267  C  CG  . PHE A 1 38  ? 35.475  -3.759  -20.188 1.00 45.58 ? 38   PHE A CG  1 
ATOM   268  C  CD1 . PHE A 1 38  ? 36.841  -3.395  -20.260 1.00 44.70 ? 38   PHE A CD1 1 
ATOM   269  C  CD2 . PHE A 1 38  ? 34.567  -3.050  -20.989 1.00 37.78 ? 38   PHE A CD2 1 
ATOM   270  C  CE1 . PHE A 1 38  ? 37.267  -2.390  -21.104 1.00 36.10 ? 38   PHE A CE1 1 
ATOM   271  C  CE2 . PHE A 1 38  ? 34.950  -2.024  -21.846 1.00 37.72 ? 38   PHE A CE2 1 
ATOM   272  C  CZ  . PHE A 1 38  ? 36.323  -1.683  -21.885 1.00 39.21 ? 38   PHE A CZ  1 
ATOM   273  N  N   . TRP A 1 39  ? 32.696  -6.727  -20.103 1.00 36.41 ? 39   TRP A N   1 
ATOM   274  C  CA  . TRP A 1 39  ? 31.413  -6.770  -20.832 1.00 37.86 ? 39   TRP A CA  1 
ATOM   275  C  C   . TRP A 1 39  ? 31.047  -5.313  -21.028 1.00 30.78 ? 39   TRP A C   1 
ATOM   276  O  O   . TRP A 1 39  ? 31.271  -4.419  -20.192 1.00 33.66 ? 39   TRP A O   1 
ATOM   277  C  CB  . TRP A 1 39  ? 30.321  -7.576  -20.107 1.00 41.94 ? 39   TRP A CB  1 
ATOM   278  C  CG  . TRP A 1 39  ? 28.955  -7.208  -20.560 1.00 40.38 ? 39   TRP A CG  1 
ATOM   279  C  CD1 . TRP A 1 39  ? 28.432  -7.356  -21.831 1.00 46.03 ? 39   TRP A CD1 1 
ATOM   280  C  CD2 . TRP A 1 39  ? 27.925  -6.626  -19.746 1.00 49.81 ? 39   TRP A CD2 1 
ATOM   281  N  NE1 . TRP A 1 39  ? 27.127  -6.932  -21.848 1.00 47.30 ? 39   TRP A NE1 1 
ATOM   282  C  CE2 . TRP A 1 39  ? 26.786  -6.458  -20.599 1.00 52.73 ? 39   TRP A CE2 1 
ATOM   283  C  CE3 . TRP A 1 39  ? 27.819  -6.296  -18.388 1.00 37.39 ? 39   TRP A CE3 1 
ATOM   284  C  CZ2 . TRP A 1 39  ? 25.598  -5.938  -20.098 1.00 39.03 ? 39   TRP A CZ2 1 
ATOM   285  C  CZ3 . TRP A 1 39  ? 26.632  -5.754  -17.928 1.00 34.36 ? 39   TRP A CZ3 1 
ATOM   286  C  CH2 . TRP A 1 39  ? 25.518  -5.603  -18.757 1.00 31.29 ? 39   TRP A CH2 1 
ATOM   287  N  N   . HIS A 1 40  ? 30.456  -4.999  -22.191 1.00 30.77 ? 40   HIS A N   1 
ATOM   288  C  CA  . HIS A 1 40  ? 30.076  -3.583  -22.450 1.00 29.31 ? 40   HIS A CA  1 
ATOM   289  C  C   . HIS A 1 40  ? 28.818  -3.669  -23.317 1.00 39.78 ? 40   HIS A C   1 
ATOM   290  O  O   . HIS A 1 40  ? 28.797  -4.582  -24.150 1.00 45.06 ? 40   HIS A O   1 
ATOM   291  C  CB  . HIS A 1 40  ? 31.140  -2.680  -23.052 1.00 23.79 ? 40   HIS A CB  1 
ATOM   292  C  CG  . HIS A 1 40  ? 30.906  -1.215  -23.115 1.00 22.80 ? 40   HIS A CG  1 
ATOM   293  N  ND1 . HIS A 1 40  ? 29.912  -0.506  -23.705 1.00 32.31 ? 40   HIS A ND1 1 
ATOM   294  C  CD2 . HIS A 1 40  ? 31.711  -0.268  -22.539 1.00 24.58 ? 40   HIS A CD2 1 
ATOM   295  C  CE1 . HIS A 1 40  ? 30.077  0.812   -23.521 1.00 23.89 ? 40   HIS A CE1 1 
ATOM   296  N  NE2 . HIS A 1 40  ? 31.185  0.975   -22.815 1.00 29.49 ? 40   HIS A NE2 1 
ATOM   297  N  N   . THR A 1 41  ? 27.842  -2.838  -23.026 1.00 27.78 ? 41   THR A N   1 
ATOM   298  C  CA  . THR A 1 41  ? 26.601  -2.891  -23.798 1.00 31.17 ? 41   THR A CA  1 
ATOM   299  C  C   . THR A 1 41  ? 26.930  -2.251  -25.146 1.00 42.31 ? 41   THR A C   1 
ATOM   300  O  O   . THR A 1 41  ? 28.049  -1.728  -25.320 1.00 41.55 ? 41   THR A O   1 
ATOM   301  C  CB  . THR A 1 41  ? 25.469  -2.122  -22.986 1.00 21.86 ? 41   THR A CB  1 
ATOM   302  O  OG1 . THR A 1 41  ? 25.932  -0.781  -22.682 1.00 23.01 ? 41   THR A OG1 1 
ATOM   303  C  CG2 . THR A 1 41  ? 24.985  -2.951  -21.796 1.00 26.74 ? 41   THR A CG2 1 
ATOM   304  N  N   . PHE A 1 42  ? 25.948  -2.299  -26.047 1.00 48.46 ? 42   PHE A N   1 
ATOM   305  C  CA  . PHE A 1 42  ? 26.123  -1.686  -27.368 1.00 38.26 ? 42   PHE A CA  1 
ATOM   306  C  C   . PHE A 1 42  ? 26.363  -0.181  -27.306 1.00 33.66 ? 42   PHE A C   1 
ATOM   307  O  O   . PHE A 1 42  ? 25.738  0.582   -26.550 1.00 30.99 ? 42   PHE A O   1 
ATOM   308  C  CB  . PHE A 1 42  ? 24.876  -1.760  -28.243 1.00 39.29 ? 42   PHE A CB  1 
ATOM   309  C  CG  . PHE A 1 42  ? 24.453  -3.101  -28.688 1.00 56.80 ? 42   PHE A CG  1 
ATOM   310  C  CD1 . PHE A 1 42  ? 25.354  -4.170  -28.799 1.00 70.45 ? 42   PHE A CD1 1 
ATOM   311  C  CD2 . PHE A 1 42  ? 23.111  -3.247  -29.080 1.00 63.64 ? 42   PHE A CD2 1 
ATOM   312  C  CE1 . PHE A 1 42  ? 24.893  -5.406  -29.250 1.00 81.21 ? 42   PHE A CE1 1 
ATOM   313  C  CE2 . PHE A 1 42  ? 22.643  -4.485  -29.534 1.00 67.08 ? 42   PHE A CE2 1 
ATOM   314  C  CZ  . PHE A 1 42  ? 23.551  -5.553  -29.599 1.00 79.92 ? 42   PHE A CZ  1 
ATOM   315  N  N   . TYR A 1 43  ? 27.290  0.150   -28.215 1.00 31.76 ? 43   TYR A N   1 
ATOM   316  C  CA  . TYR A 1 43  ? 27.583  1.576   -28.405 1.00 45.96 ? 43   TYR A CA  1 
ATOM   317  C  C   . TYR A 1 43  ? 27.960  1.772   -29.894 1.00 57.99 ? 43   TYR A C   1 
ATOM   318  O  O   . TYR A 1 43  ? 28.213  0.846   -30.686 1.00 50.55 ? 43   TYR A O   1 
ATOM   319  C  CB  . TYR A 1 43  ? 28.630  2.212   -27.519 1.00 49.75 ? 43   TYR A CB  1 
ATOM   320  C  CG  . TYR A 1 43  ? 29.992  1.566   -27.629 1.00 67.36 ? 43   TYR A CG  1 
ATOM   321  C  CD1 . TYR A 1 43  ? 30.197  0.252   -27.214 1.00 69.89 ? 43   TYR A CD1 1 
ATOM   322  C  CD2 . TYR A 1 43  ? 31.089  2.252   -28.134 1.00 73.43 ? 43   TYR A CD2 1 
ATOM   323  C  CE1 . TYR A 1 43  ? 31.460  -0.339  -27.273 1.00 82.36 ? 43   TYR A CE1 1 
ATOM   324  C  CE2 . TYR A 1 43  ? 32.348  1.681   -28.234 1.00 79.64 ? 43   TYR A CE2 1 
ATOM   325  C  CZ  . TYR A 1 43  ? 32.537  0.370   -27.807 1.00 82.40 ? 43   TYR A CZ  1 
ATOM   326  O  OH  . TYR A 1 43  ? 33.784  -0.180  -27.883 1.00 78.88 ? 43   TYR A OH  1 
ATOM   327  N  N   . GLY A 1 44  ? 28.031  3.045   -30.183 1.00 64.77 ? 44   GLY A N   1 
ATOM   328  C  CA  . GLY A 1 44  ? 28.370  3.631   -31.473 1.00 86.05 ? 44   GLY A CA  1 
ATOM   329  C  C   . GLY A 1 44  ? 27.387  3.178   -32.564 1.00 86.63 ? 44   GLY A C   1 
ATOM   330  O  O   . GLY A 1 44  ? 26.214  3.562   -32.644 1.00 82.34 ? 44   GLY A O   1 
ATOM   331  N  N   . ALA A 1 45  ? 27.963  2.322   -33.376 1.00 94.12 ? 45   ALA A N   1 
ATOM   332  C  CA  . ALA A 1 45  ? 27.417  1.650   -34.537 1.00 98.16 ? 45   ALA A CA  1 
ATOM   333  C  C   . ALA A 1 45  ? 26.427  0.539   -34.197 1.00 99.99 ? 45   ALA A C   1 
ATOM   334  O  O   . ALA A 1 45  ? 25.886  -0.045  -35.170 1.00 99.99 ? 45   ALA A O   1 
ATOM   335  C  CB  . ALA A 1 45  ? 28.578  1.049   -35.357 1.00 98.92 ? 45   ALA A CB  1 
ATOM   336  N  N   . ASN A 1 46  ? 26.263  0.255   -32.908 1.00 90.46 ? 46   ASN A N   1 
ATOM   337  C  CA  . ASN A 1 46  ? 25.263  -0.797  -32.568 1.00 85.64 ? 46   ASN A CA  1 
ATOM   338  C  C   . ASN A 1 46  ? 24.087  -0.035  -31.932 1.00 78.97 ? 46   ASN A C   1 
ATOM   339  O  O   . ASN A 1 46  ? 23.033  -0.610  -31.656 1.00 67.59 ? 46   ASN A O   1 
ATOM   340  C  CB  . ASN A 1 46  ? 25.774  -1.974  -31.784 1.00 89.50 ? 46   ASN A CB  1 
ATOM   341  C  CG  . ASN A 1 46  ? 26.138  -3.158  -32.658 1.00 96.28 ? 46   ASN A CG  1 
ATOM   342  O  OD1 . ASN A 1 46  ? 26.412  -4.272  -32.178 1.00 99.99 ? 46   ASN A OD1 1 
ATOM   343  N  ND2 . ASN A 1 46  ? 26.155  -2.931  -33.972 1.00 99.99 ? 46   ASN A ND2 1 
ATOM   344  N  N   . GLY A 1 47  ? 24.388  1.246   -31.787 1.00 74.45 ? 47   GLY A N   1 
ATOM   345  C  CA  . GLY A 1 47  ? 23.468  2.221   -31.196 1.00 84.37 ? 47   GLY A CA  1 
ATOM   346  C  C   . GLY A 1 47  ? 23.886  2.256   -29.695 1.00 85.33 ? 47   GLY A C   1 
ATOM   347  O  O   . GLY A 1 47  ? 24.746  1.449   -29.292 1.00 74.98 ? 47   GLY A O   1 
ATOM   348  N  N   . ASP A 1 48  ? 23.244  3.179   -28.999 1.00 76.66 ? 48   ASP A N   1 
ATOM   349  C  CA  . ASP A 1 48  ? 23.451  3.389   -27.570 1.00 61.31 ? 48   ASP A CA  1 
ATOM   350  C  C   . ASP A 1 48  ? 22.161  3.221   -26.757 1.00 45.53 ? 48   ASP A C   1 
ATOM   351  O  O   . ASP A 1 48  ? 21.710  4.287   -26.270 1.00 46.26 ? 48   ASP A O   1 
ATOM   352  C  CB  . ASP A 1 48  ? 24.029  4.799   -27.394 1.00 57.14 ? 48   ASP A CB  1 
ATOM   353  C  CG  . ASP A 1 48  ? 25.320  4.965   -28.189 1.00 59.80 ? 48   ASP A CG  1 
ATOM   354  O  OD1 . ASP A 1 48  ? 26.323  4.266   -27.965 1.00 48.91 ? 48   ASP A OD1 1 
ATOM   355  O  OD2 . ASP A 1 48  ? 25.278  5.850   -29.078 1.00 61.42 ? 48   ASP A OD2 1 
ATOM   356  N  N   . PRO A 1 49  ? 21.692  1.997   -26.592 1.00 37.12 ? 49   PRO A N   1 
ATOM   357  C  CA  . PRO A 1 49  ? 20.507  1.645   -25.801 1.00 41.82 ? 49   PRO A CA  1 
ATOM   358  C  C   . PRO A 1 49  ? 20.708  2.036   -24.315 1.00 47.10 ? 49   PRO A C   1 
ATOM   359  O  O   . PRO A 1 49  ? 21.764  1.664   -23.724 1.00 44.49 ? 49   PRO A O   1 
ATOM   360  C  CB  . PRO A 1 49  ? 20.366  0.126   -25.883 1.00 27.43 ? 49   PRO A CB  1 
ATOM   361  C  CG  . PRO A 1 49  ? 21.582  -0.396  -26.561 1.00 34.12 ? 49   PRO A CG  1 
ATOM   362  C  CD  . PRO A 1 49  ? 22.322  0.789   -27.138 1.00 31.60 ? 49   PRO A CD  1 
ATOM   363  N  N   . LYS A 1 50  ? 19.776  2.757   -23.754 1.00 33.07 ? 50   LYS A N   1 
ATOM   364  C  CA  . LYS A 1 50  ? 19.800  3.244   -22.364 1.00 41.34 ? 50   LYS A CA  1 
ATOM   365  C  C   . LYS A 1 50  ? 19.532  2.143   -21.352 1.00 39.96 ? 50   LYS A C   1 
ATOM   366  O  O   . LYS A 1 50  ? 19.103  1.031   -21.732 1.00 27.35 ? 50   LYS A O   1 
ATOM   367  C  CB  . LYS A 1 50  ? 18.896  4.447   -22.293 1.00 41.71 ? 50   LYS A CB  1 
ATOM   368  C  CG  . LYS A 1 50  ? 19.429  5.616   -23.091 1.00 50.40 ? 50   LYS A CG  1 
ATOM   369  C  CD  . LYS A 1 50  ? 18.758  6.920   -22.779 1.00 60.73 ? 50   LYS A CD  1 
ATOM   370  C  CE  . LYS A 1 50  ? 19.338  8.086   -23.551 1.00 76.09 ? 50   LYS A CE  1 
ATOM   371  N  NZ  . LYS A 1 50  ? 18.440  8.536   -24.639 1.00 84.10 ? 50   LYS A NZ  1 
ATOM   372  N  N   . PRO A 1 51  ? 19.937  2.401   -20.081 1.00 36.35 ? 51   PRO A N   1 
ATOM   373  C  CA  . PRO A 1 51  ? 19.706  1.401   -19.007 1.00 35.90 ? 51   PRO A CA  1 
ATOM   374  C  C   . PRO A 1 51  ? 18.196  1.408   -18.716 1.00 35.12 ? 51   PRO A C   1 
ATOM   375  O  O   . PRO A 1 51  ? 17.502  2.400   -19.063 1.00 31.64 ? 51   PRO A O   1 
ATOM   376  C  CB  . PRO A 1 51  ? 20.673  1.852   -17.948 1.00 27.29 ? 51   PRO A CB  1 
ATOM   377  C  CG  . PRO A 1 51  ? 21.110  3.293   -18.220 1.00 25.35 ? 51   PRO A CG  1 
ATOM   378  C  CD  . PRO A 1 51  ? 20.437  3.663   -19.534 1.00 25.88 ? 51   PRO A CD  1 
ATOM   379  N  N   . PRO A 1 52  ? 17.635  0.418   -18.079 1.00 29.26 ? 52   PRO A N   1 
ATOM   380  C  CA  . PRO A 1 52  ? 18.293  -0.716  -17.516 1.00 25.26 ? 52   PRO A CA  1 
ATOM   381  C  C   . PRO A 1 52  ? 19.025  -1.667  -18.404 1.00 31.70 ? 52   PRO A C   1 
ATOM   382  O  O   . PRO A 1 52  ? 18.571  -2.024  -19.475 1.00 31.88 ? 52   PRO A O   1 
ATOM   383  C  CB  . PRO A 1 52  ? 17.162  -1.512  -16.763 1.00 30.57 ? 52   PRO A CB  1 
ATOM   384  C  CG  . PRO A 1 52  ? 16.139  -0.448  -16.457 1.00 37.52 ? 52   PRO A CG  1 
ATOM   385  C  CD  . PRO A 1 52  ? 16.197  0.451   -17.701 1.00 33.21 ? 52   PRO A CD  1 
ATOM   386  N  N   . HIS A 1 53  ? 20.149  -2.131  -17.879 1.00 30.92 ? 53   HIS A N   1 
ATOM   387  C  CA  . HIS A 1 53  ? 21.022  -3.130  -18.517 1.00 31.48 ? 53   HIS A CA  1 
ATOM   388  C  C   . HIS A 1 53  ? 21.041  -4.248  -17.510 1.00 25.91 ? 53   HIS A C   1 
ATOM   389  O  O   . HIS A 1 53  ? 20.919  -3.934  -16.310 1.00 37.21 ? 53   HIS A O   1 
ATOM   390  C  CB  . HIS A 1 53  ? 22.419  -2.615  -18.930 1.00 40.24 ? 53   HIS A CB  1 
ATOM   391  C  CG  . HIS A 1 53  ? 22.249  -1.621  -20.053 1.00 42.03 ? 53   HIS A CG  1 
ATOM   392  N  ND1 . HIS A 1 53  ? 21.682  -1.985  -21.287 1.00 27.68 ? 53   HIS A ND1 1 
ATOM   393  C  CD2 . HIS A 1 53  ? 22.565  -0.319  -20.115 1.00 29.45 ? 53   HIS A CD2 1 
ATOM   394  C  CE1 . HIS A 1 53  ? 21.636  -0.886  -22.002 1.00 33.97 ? 53   HIS A CE1 1 
ATOM   395  N  NE2 . HIS A 1 53  ? 22.175  0.123   -21.335 1.00 41.52 ? 53   HIS A NE2 1 
ATOM   396  N  N   . THR A 1 54  ? 21.145  -5.457  -17.944 1.00 20.21 ? 54   THR A N   1 
ATOM   397  C  CA  . THR A 1 54  ? 21.063  -6.608  -17.036 1.00 22.43 ? 54   THR A CA  1 
ATOM   398  C  C   . THR A 1 54  ? 22.060  -7.666  -17.286 1.00 20.84 ? 54   THR A C   1 
ATOM   399  O  O   . THR A 1 54  ? 22.315  -7.998  -18.445 1.00 44.04 ? 54   THR A O   1 
ATOM   400  C  CB  . THR A 1 54  ? 19.574  -7.138  -17.423 1.00 26.06 ? 54   THR A CB  1 
ATOM   401  O  OG1 . THR A 1 54  ? 18.692  -6.023  -17.062 1.00 35.54 ? 54   THR A OG1 1 
ATOM   402  C  CG2 . THR A 1 54  ? 19.188  -8.433  -16.823 1.00 32.41 ? 54   THR A CG2 1 
ATOM   403  N  N   . TYR A 1 55  ? 22.559  -8.287  -16.257 1.00 24.70 ? 55   TYR A N   1 
ATOM   404  C  CA  . TYR A 1 55  ? 23.537  -9.366  -16.243 1.00 18.99 ? 55   TYR A CA  1 
ATOM   405  C  C   . TYR A 1 55  ? 22.918  -10.485 -15.453 1.00 33.03 ? 55   TYR A C   1 
ATOM   406  O  O   . TYR A 1 55  ? 22.622  -10.164 -14.291 1.00 27.76 ? 55   TYR A O   1 
ATOM   407  C  CB  . TYR A 1 55  ? 24.838  -8.813  -15.635 1.00 20.79 ? 55   TYR A CB  1 
ATOM   408  C  CG  . TYR A 1 55  ? 25.994  -9.681  -16.066 1.00 17.37 ? 55   TYR A CG  1 
ATOM   409  C  CD1 . TYR A 1 55  ? 26.200  -10.911 -15.517 1.00 25.83 ? 55   TYR A CD1 1 
ATOM   410  C  CD2 . TYR A 1 55  ? 26.856  -9.242  -17.091 1.00 24.17 ? 55   TYR A CD2 1 
ATOM   411  C  CE1 . TYR A 1 55  ? 27.267  -11.699 -15.930 1.00 38.12 ? 55   TYR A CE1 1 
ATOM   412  C  CE2 . TYR A 1 55  ? 27.918  -10.049 -17.502 1.00 25.59 ? 55   TYR A CE2 1 
ATOM   413  C  CZ  . TYR A 1 55  ? 28.107  -11.286 -16.961 1.00 29.43 ? 55   TYR A CZ  1 
ATOM   414  O  OH  . TYR A 1 55  ? 29.143  -12.125 -17.342 1.00 39.51 ? 55   TYR A OH  1 
ATOM   415  N  N   . THR A 1 56  ? 22.705  -11.626 -16.100 1.00 22.78 ? 56   THR A N   1 
ATOM   416  C  CA  . THR A 1 56  ? 22.038  -12.774 -15.497 1.00 29.68 ? 56   THR A CA  1 
ATOM   417  C  C   . THR A 1 56  ? 23.013  -13.919 -15.494 1.00 28.25 ? 56   THR A C   1 
ATOM   418  O  O   . THR A 1 56  ? 23.659  -14.071 -16.504 1.00 33.39 ? 56   THR A O   1 
ATOM   419  C  CB  . THR A 1 56  ? 20.599  -13.153 -16.116 1.00 22.99 ? 56   THR A CB  1 
ATOM   420  O  OG1 . THR A 1 56  ? 19.974  -11.876 -16.301 1.00 19.64 ? 56   THR A OG1 1 
ATOM   421  C  CG2 . THR A 1 56  ? 19.753  -14.051 -15.188 1.00 19.77 ? 56   THR A CG2 1 
ATOM   422  N  N   . ILE A 1 57  ? 23.124  -14.593 -14.370 1.00 26.08 ? 57   ILE A N   1 
ATOM   423  C  CA  . ILE A 1 57  ? 24.040  -15.703 -14.229 1.00 27.12 ? 57   ILE A CA  1 
ATOM   424  C  C   . ILE A 1 57  ? 23.175  -16.901 -13.828 1.00 38.27 ? 57   ILE A C   1 
ATOM   425  O  O   . ILE A 1 57  ? 22.279  -16.744 -12.976 1.00 31.92 ? 57   ILE A O   1 
ATOM   426  C  CB  . ILE A 1 57  ? 25.196  -15.503 -13.220 1.00 32.06 ? 57   ILE A CB  1 
ATOM   427  C  CG1 . ILE A 1 57  ? 26.143  -14.332 -13.649 1.00 30.77 ? 57   ILE A CG1 1 
ATOM   428  C  CG2 . ILE A 1 57  ? 26.058  -16.736 -12.758 1.00 28.35 ? 57   ILE A CG2 1 
ATOM   429  C  CD1 . ILE A 1 57  ? 26.723  -13.637 -12.327 1.00 30.13 ? 57   ILE A CD1 1 
ATOM   430  N  N   . ASP A 1 58  ? 23.596  -17.977 -14.478 1.00 35.51 ? 58   ASP A N   1 
ATOM   431  C  CA  . ASP A 1 58  ? 23.018  -19.290 -14.274 1.00 35.06 ? 58   ASP A CA  1 
ATOM   432  C  C   . ASP A 1 58  ? 24.236  -20.087 -13.766 1.00 34.52 ? 58   ASP A C   1 
ATOM   433  O  O   . ASP A 1 58  ? 25.170  -20.459 -14.475 1.00 35.21 ? 58   ASP A O   1 
ATOM   434  C  CB  . ASP A 1 58  ? 22.339  -19.968 -15.450 1.00 57.82 ? 58   ASP A CB  1 
ATOM   435  C  CG  . ASP A 1 58  ? 21.811  -21.368 -15.123 1.00 64.59 ? 58   ASP A CG  1 
ATOM   436  O  OD1 . ASP A 1 58  ? 21.962  -21.795 -13.951 1.00 54.41 ? 58   ASP A OD1 1 
ATOM   437  O  OD2 . ASP A 1 58  ? 21.278  -22.028 -16.041 1.00 69.44 ? 58   ASP A OD2 1 
ATOM   438  N  N   . MET A 1 59  ? 24.154  -20.334 -12.485 1.00 31.41 ? 59   MET A N   1 
ATOM   439  C  CA  . MET A 1 59  ? 25.201  -21.060 -11.749 1.00 36.11 ? 59   MET A CA  1 
ATOM   440  C  C   . MET A 1 59  ? 24.984  -22.561 -11.973 1.00 40.97 ? 59   MET A C   1 
ATOM   441  O  O   . MET A 1 59  ? 25.877  -23.236 -11.438 1.00 40.94 ? 59   MET A O   1 
ATOM   442  C  CB  . MET A 1 59  ? 25.224  -20.611 -10.296 1.00 39.49 ? 59   MET A CB  1 
ATOM   443  C  CG  . MET A 1 59  ? 25.423  -19.105 -10.121 1.00 46.49 ? 59   MET A CG  1 
ATOM   444  S  SD  . MET A 1 59  ? 25.686  -18.766 -8.309  1.00 38.91 ? 59   MET A SD  1 
ATOM   445  C  CE  . MET A 1 59  ? 23.972  -19.062 -7.733  1.00 30.93 ? 59   MET A CE  1 
ATOM   446  N  N   . LYS A 1 60  ? 23.928  -22.959 -12.695 1.00 36.89 ? 60   LYS A N   1 
ATOM   447  C  CA  . LYS A 1 60  ? 23.663  -24.367 -12.982 1.00 42.68 ? 60   LYS A CA  1 
ATOM   448  C  C   . LYS A 1 60  ? 23.187  -25.169 -11.789 1.00 41.89 ? 60   LYS A C   1 
ATOM   449  O  O   . LYS A 1 60  ? 22.484  -26.165 -11.935 1.00 54.81 ? 60   LYS A O   1 
ATOM   450  C  CB  . LYS A 1 60  ? 24.951  -25.146 -13.341 1.00 38.31 ? 60   LYS A CB  1 
ATOM   451  C  CG  . LYS A 1 60  ? 25.574  -24.530 -14.605 1.00 61.81 ? 60   LYS A CG  1 
ATOM   452  C  CD  . LYS A 1 60  ? 24.828  -24.990 -15.853 1.00 73.04 ? 60   LYS A CD  1 
ATOM   453  C  CE  . LYS A 1 60  ? 25.626  -24.872 -17.141 1.00 73.27 ? 60   LYS A CE  1 
ATOM   454  N  NZ  . LYS A 1 60  ? 25.474  -23.491 -17.705 1.00 67.28 ? 60   LYS A NZ  1 
ATOM   455  N  N   . THR A 1 61  ? 23.691  -24.703 -10.657 1.00 43.55 ? 61   THR A N   1 
ATOM   456  C  CA  . THR A 1 61  ? 23.299  -25.367 -9.405  1.00 40.80 ? 61   THR A CA  1 
ATOM   457  C  C   . THR A 1 61  ? 22.943  -24.311 -8.344  1.00 42.58 ? 61   THR A C   1 
ATOM   458  O  O   . THR A 1 61  ? 23.083  -23.103 -8.574  1.00 42.68 ? 61   THR A O   1 
ATOM   459  C  CB  . THR A 1 61  ? 24.446  -26.362 -9.071  1.00 53.99 ? 61   THR A CB  1 
ATOM   460  O  OG1 . THR A 1 61  ? 23.948  -27.091 -7.914  1.00 68.08 ? 61   THR A OG1 1 
ATOM   461  C  CG2 . THR A 1 61  ? 25.827  -25.721 -8.860  1.00 52.72 ? 61   THR A CG2 1 
ATOM   462  N  N   . THR A 1 62  ? 22.430  -24.792 -7.249  1.00 43.48 ? 62   THR A N   1 
ATOM   463  C  CA  . THR A 1 62  ? 21.941  -24.048 -6.094  1.00 56.21 ? 62   THR A CA  1 
ATOM   464  C  C   . THR A 1 62  ? 23.041  -23.726 -5.109  1.00 56.45 ? 62   THR A C   1 
ATOM   465  O  O   . THR A 1 62  ? 23.701  -24.674 -4.617  1.00 65.53 ? 62   THR A O   1 
ATOM   466  C  CB  . THR A 1 62  ? 20.705  -24.848 -5.491  1.00 57.27 ? 62   THR A CB  1 
ATOM   467  O  OG1 . THR A 1 62  ? 19.693  -24.868 -6.579  1.00 48.83 ? 62   THR A OG1 1 
ATOM   468  C  CG2 . THR A 1 62  ? 20.236  -24.205 -4.161  1.00 55.76 ? 62   THR A CG2 1 
ATOM   469  N  N   . GLN A 1 63  ? 23.251  -22.449 -4.837  1.00 51.70 ? 63   GLN A N   1 
ATOM   470  C  CA  . GLN A 1 63  ? 24.330  -22.035 -3.902  1.00 40.58 ? 63   GLN A CA  1 
ATOM   471  C  C   . GLN A 1 63  ? 23.718  -21.150 -2.820  1.00 23.97 ? 63   GLN A C   1 
ATOM   472  O  O   . GLN A 1 63  ? 22.715  -20.487 -3.130  1.00 36.54 ? 63   GLN A O   1 
ATOM   473  C  CB  . GLN A 1 63  ? 25.377  -21.200 -4.622  1.00 50.87 ? 63   GLN A CB  1 
ATOM   474  C  CG  . GLN A 1 63  ? 25.824  -21.746 -5.974  1.00 71.64 ? 63   GLN A CG  1 
ATOM   475  C  CD  . GLN A 1 63  ? 26.873  -22.846 -5.862  1.00 71.43 ? 63   GLN A CD  1 
ATOM   476  O  OE1 . GLN A 1 63  ? 27.270  -23.282 -4.790  1.00 63.30 ? 63   GLN A OE1 1 
ATOM   477  N  NE2 . GLN A 1 63  ? 27.340  -23.295 -7.025  1.00 75.04 ? 63   GLN A NE2 1 
ATOM   478  N  N   . ASN A 1 64  ? 24.335  -21.232 -1.667  1.00 20.01 ? 64   ASN A N   1 
ATOM   479  C  CA  . ASN A 1 64  ? 23.849  -20.390 -0.545  1.00 18.35 ? 64   ASN A CA  1 
ATOM   480  C  C   . ASN A 1 64  ? 24.528  -19.032 -0.788  1.00 19.96 ? 64   ASN A C   1 
ATOM   481  O  O   . ASN A 1 64  ? 25.586  -18.763 -0.261  1.00 29.00 ? 64   ASN A O   1 
ATOM   482  C  CB  . ASN A 1 64  ? 24.387  -21.039 0.733   1.00 21.31 ? 64   ASN A CB  1 
ATOM   483  C  CG  . ASN A 1 64  ? 23.563  -22.314 0.961   1.00 26.19 ? 64   ASN A CG  1 
ATOM   484  O  OD1 . ASN A 1 64  ? 22.398  -22.268 0.564   1.00 25.04 ? 64   ASN A OD1 1 
ATOM   485  N  ND2 . ASN A 1 64  ? 24.234  -23.276 1.537   1.00 33.53 ? 64   ASN A ND2 1 
ATOM   486  N  N   . VAL A 1 65  ? 24.007  -18.197 -1.611  1.00 17.37 ? 65   VAL A N   1 
ATOM   487  C  CA  . VAL A 1 65  ? 24.496  -16.893 -1.993  1.00 20.20 ? 65   VAL A CA  1 
ATOM   488  C  C   . VAL A 1 65  ? 24.285  -15.849 -0.896  1.00 24.12 ? 65   VAL A C   1 
ATOM   489  O  O   . VAL A 1 65  ? 23.141  -15.709 -0.378  1.00 23.73 ? 65   VAL A O   1 
ATOM   490  C  CB  . VAL A 1 65  ? 23.727  -16.557 -3.295  1.00 17.98 ? 65   VAL A CB  1 
ATOM   491  C  CG1 . VAL A 1 65  ? 24.130  -15.194 -3.872  1.00 21.25 ? 65   VAL A CG1 1 
ATOM   492  C  CG2 . VAL A 1 65  ? 23.857  -17.627 -4.377  1.00 25.14 ? 65   VAL A CG2 1 
ATOM   493  N  N   . ASN A 1 66  ? 25.330  -15.069 -0.665  1.00 21.16 ? 66   ASN A N   1 
ATOM   494  C  CA  . ASN A 1 66  ? 25.323  -13.980 0.340   1.00 21.39 ? 66   ASN A CA  1 
ATOM   495  C  C   . ASN A 1 66  ? 25.972  -12.733 -0.257  1.00 22.19 ? 66   ASN A C   1 
ATOM   496  O  O   . ASN A 1 66  ? 26.178  -11.812 0.550   1.00 25.14 ? 66   ASN A O   1 
ATOM   497  C  CB  . ASN A 1 66  ? 25.898  -14.281 1.718   1.00 27.87 ? 66   ASN A CB  1 
ATOM   498  C  CG  . ASN A 1 66  ? 27.337  -14.714 1.949   1.00 31.36 ? 66   ASN A CG  1 
ATOM   499  O  OD1 . ASN A 1 66  ? 28.132  -14.749 0.999   1.00 29.18 ? 66   ASN A OD1 1 
ATOM   500  N  ND2 . ASN A 1 66  ? 27.701  -15.005 3.217   1.00 21.11 ? 66   ASN A ND2 1 
ATOM   501  N  N   . GLY A 1 67  ? 26.292  -12.733 -1.535  1.00 16.89 ? 67   GLY A N   1 
ATOM   502  C  CA  . GLY A 1 67  ? 26.895  -11.444 -2.027  1.00 21.75 ? 67   GLY A CA  1 
ATOM   503  C  C   . GLY A 1 67  ? 27.378  -11.532 -3.457  1.00 18.32 ? 67   GLY A C   1 
ATOM   504  O  O   . GLY A 1 67  ? 27.365  -12.586 -4.075  1.00 22.12 ? 67   GLY A O   1 
ATOM   505  N  N   . LEU A 1 68  ? 27.735  -10.371 -3.974  1.00 13.43 ? 68   LEU A N   1 
ATOM   506  C  CA  . LEU A 1 68  ? 28.288  -10.211 -5.294  1.00 19.84 ? 68   LEU A CA  1 
ATOM   507  C  C   . LEU A 1 68  ? 29.318  -9.080  -5.296  1.00 19.79 ? 68   LEU A C   1 
ATOM   508  O  O   . LEU A 1 68  ? 29.276  -8.220  -4.442  1.00 22.10 ? 68   LEU A O   1 
ATOM   509  C  CB  . LEU A 1 68  ? 27.202  -10.169 -6.318  1.00 21.67 ? 68   LEU A CB  1 
ATOM   510  C  CG  . LEU A 1 68  ? 26.478  -8.986  -6.806  1.00 30.84 ? 68   LEU A CG  1 
ATOM   511  C  CD1 . LEU A 1 68  ? 27.315  -7.781  -7.223  1.00 28.15 ? 68   LEU A CD1 1 
ATOM   512  C  CD2 . LEU A 1 68  ? 25.694  -9.512  -8.023  1.00 45.76 ? 68   LEU A CD2 1 
ATOM   513  N  N   . SER A 1 69  ? 30.301  -9.190  -6.182  1.00 19.20 ? 69   SER A N   1 
ATOM   514  C  CA  . SER A 1 69  ? 31.312  -8.109  -6.332  1.00 14.11 ? 69   SER A CA  1 
ATOM   515  C  C   . SER A 1 69  ? 31.233  -7.681  -7.808  1.00 18.95 ? 69   SER A C   1 
ATOM   516  O  O   . SER A 1 69  ? 30.913  -8.358  -8.815  1.00 21.23 ? 69   SER A O   1 
ATOM   517  C  CB  . SER A 1 69  ? 32.665  -8.468  -5.844  1.00 16.73 ? 69   SER A CB  1 
ATOM   518  O  OG  . SER A 1 69  ? 33.229  -9.534  -6.536  1.00 23.53 ? 69   SER A OG  1 
ATOM   519  N  N   . MET A 1 70  ? 31.502  -6.403  -7.973  1.00 11.69 ? 70   MET A N   1 
ATOM   520  C  CA  . MET A 1 70  ? 31.430  -5.893  -9.354  1.00 15.90 ? 70   MET A CA  1 
ATOM   521  C  C   . MET A 1 70  ? 32.696  -5.037  -9.516  1.00 33.53 ? 70   MET A C   1 
ATOM   522  O  O   . MET A 1 70  ? 32.761  -3.970  -8.893  1.00 21.32 ? 70   MET A O   1 
ATOM   523  C  CB  . MET A 1 70  ? 30.162  -5.158  -9.682  1.00 25.61 ? 70   MET A CB  1 
ATOM   524  C  CG  . MET A 1 70  ? 29.924  -4.665  -11.108 1.00 19.62 ? 70   MET A CG  1 
ATOM   525  S  SD  . MET A 1 70  ? 31.054  -3.291  -11.515 1.00 22.77 ? 70   MET A SD  1 
ATOM   526  C  CE  . MET A 1 70  ? 30.602  -1.823  -10.566 1.00 24.76 ? 70   MET A CE  1 
ATOM   527  N  N   . LEU A 1 71  ? 33.629  -5.550  -10.325 1.00 27.83 ? 71   LEU A N   1 
ATOM   528  C  CA  . LEU A 1 71  ? 34.816  -4.728  -10.593 1.00 15.68 ? 71   LEU A CA  1 
ATOM   529  C  C   . LEU A 1 71  ? 34.554  -3.941  -11.869 1.00 22.43 ? 71   LEU A C   1 
ATOM   530  O  O   . LEU A 1 71  ? 34.384  -4.548  -12.959 1.00 27.76 ? 71   LEU A O   1 
ATOM   531  C  CB  . LEU A 1 71  ? 35.984  -5.714  -10.777 1.00 21.33 ? 71   LEU A CB  1 
ATOM   532  C  CG  . LEU A 1 71  ? 37.262  -4.950  -11.174 1.00 24.04 ? 71   LEU A CG  1 
ATOM   533  C  CD1 . LEU A 1 71  ? 37.730  -4.150  -9.977  1.00 21.59 ? 71   LEU A CD1 1 
ATOM   534  C  CD2 . LEU A 1 71  ? 38.333  -5.965  -11.549 1.00 27.98 ? 71   LEU A CD2 1 
ATOM   535  N  N   . PRO A 1 72  ? 34.579  -2.632  -11.793 1.00 19.99 ? 72   PRO A N   1 
ATOM   536  C  CA  . PRO A 1 72  ? 34.397  -1.816  -12.988 1.00 34.35 ? 72   PRO A CA  1 
ATOM   537  C  C   . PRO A 1 72  ? 35.599  -1.923  -13.951 1.00 37.17 ? 72   PRO A C   1 
ATOM   538  O  O   . PRO A 1 72  ? 36.647  -2.479  -13.613 1.00 31.84 ? 72   PRO A O   1 
ATOM   539  C  CB  . PRO A 1 72  ? 34.233  -0.405  -12.448 1.00 29.75 ? 72   PRO A CB  1 
ATOM   540  C  CG  . PRO A 1 72  ? 34.339  -0.477  -10.971 1.00 18.74 ? 72   PRO A CG  1 
ATOM   541  C  CD  . PRO A 1 72  ? 34.762  -1.861  -10.570 1.00 23.21 ? 72   PRO A CD  1 
ATOM   542  N  N   . ARG A 1 73  ? 35.468  -1.304  -15.115 1.00 30.33 ? 73   ARG A N   1 
ATOM   543  C  CA  . ARG A 1 73  ? 36.508  -1.277  -16.141 1.00 28.98 ? 73   ARG A CA  1 
ATOM   544  C  C   . ARG A 1 73  ? 37.665  -0.503  -15.521 1.00 32.85 ? 73   ARG A C   1 
ATOM   545  O  O   . ARG A 1 73  ? 37.563  0.570   -14.860 1.00 30.07 ? 73   ARG A O   1 
ATOM   546  C  CB  . ARG A 1 73  ? 35.950  -0.609  -17.398 1.00 23.09 ? 73   ARG A CB  1 
ATOM   547  C  CG  . ARG A 1 73  ? 35.768  0.913   -17.144 1.00 18.96 ? 73   ARG A CG  1 
ATOM   548  C  CD  . ARG A 1 73  ? 34.962  1.355   -18.330 1.00 31.68 ? 73   ARG A CD  1 
ATOM   549  N  NE  . ARG A 1 73  ? 35.823  1.291   -19.511 1.00 33.56 ? 73   ARG A NE  1 
ATOM   550  C  CZ  . ARG A 1 73  ? 35.342  1.519   -20.740 1.00 42.77 ? 73   ARG A CZ  1 
ATOM   551  N  NH1 . ARG A 1 73  ? 34.105  1.841   -21.121 1.00 33.83 ? 73   ARG A NH1 1 
ATOM   552  N  NH2 . ARG A 1 73  ? 36.254  1.464   -21.712 1.00 47.27 ? 73   ARG A NH2 1 
ATOM   553  N  N   . GLN A 1 74  ? 38.827  -1.115  -15.781 1.00 43.25 ? 74   GLN A N   1 
ATOM   554  C  CA  . GLN A 1 74  ? 40.079  -0.576  -15.179 1.00 47.55 ? 74   GLN A CA  1 
ATOM   555  C  C   . GLN A 1 74  ? 41.001  0.131   -16.142 1.00 55.88 ? 74   GLN A C   1 
ATOM   556  O  O   . GLN A 1 74  ? 42.174  0.340   -15.794 1.00 58.29 ? 74   GLN A O   1 
ATOM   557  C  CB  . GLN A 1 74  ? 40.796  -1.780  -14.533 1.00 42.06 ? 74   GLN A CB  1 
ATOM   558  C  CG  . GLN A 1 74  ? 39.891  -2.465  -13.514 1.00 40.88 ? 74   GLN A CG  1 
ATOM   559  C  CD  . GLN A 1 74  ? 39.857  -1.684  -12.237 1.00 35.31 ? 74   GLN A CD  1 
ATOM   560  O  OE1 . GLN A 1 74  ? 40.851  -1.335  -11.590 1.00 50.11 ? 74   GLN A OE1 1 
ATOM   561  N  NE2 . GLN A 1 74  ? 38.633  -1.392  -11.825 1.00 37.67 ? 74   GLN A NE2 1 
ATOM   562  N  N   . ASP A 1 75  ? 40.415  0.467   -17.283 1.00 54.55 ? 75   ASP A N   1 
ATOM   563  C  CA  . ASP A 1 75  ? 41.196  1.110   -18.343 1.00 53.76 ? 75   ASP A CA  1 
ATOM   564  C  C   . ASP A 1 75  ? 41.254  2.625   -18.322 1.00 51.24 ? 75   ASP A C   1 
ATOM   565  O  O   . ASP A 1 75  ? 41.702  3.164   -19.345 1.00 62.89 ? 75   ASP A O   1 
ATOM   566  C  CB  . ASP A 1 75  ? 40.680  0.568   -19.676 1.00 48.97 ? 75   ASP A CB  1 
ATOM   567  C  CG  . ASP A 1 75  ? 39.381  1.252   -20.064 1.00 45.29 ? 75   ASP A CG  1 
ATOM   568  O  OD1 . ASP A 1 75  ? 38.663  1.727   -19.163 1.00 40.66 ? 75   ASP A OD1 1 
ATOM   569  O  OD2 . ASP A 1 75  ? 39.146  1.278   -21.277 1.00 54.43 ? 75   ASP A OD2 1 
ATOM   570  N  N   . GLY A 1 76  ? 40.858  3.249   -17.236 1.00 45.50 ? 76   GLY A N   1 
ATOM   571  C  CA  . GLY A 1 76  ? 40.905  4.716   -17.228 1.00 49.02 ? 76   GLY A CA  1 
ATOM   572  C  C   . GLY A 1 76  ? 39.608  5.328   -17.727 1.00 48.28 ? 76   GLY A C   1 
ATOM   573  O  O   . GLY A 1 76  ? 39.374  6.493   -17.355 1.00 51.10 ? 76   GLY A O   1 
ATOM   574  N  N   . ASN A 1 77  ? 38.818  4.551   -18.454 1.00 46.43 ? 77   ASN A N   1 
ATOM   575  C  CA  . ASN A 1 77  ? 37.532  5.129   -18.940 1.00 49.17 ? 77   ASN A CA  1 
ATOM   576  C  C   . ASN A 1 77  ? 36.407  4.821   -17.943 1.00 39.71 ? 77   ASN A C   1 
ATOM   577  O  O   . ASN A 1 77  ? 36.242  3.718   -17.386 1.00 35.71 ? 77   ASN A O   1 
ATOM   578  C  CB  . ASN A 1 77  ? 37.318  4.728   -20.400 1.00 57.12 ? 77   ASN A CB  1 
ATOM   579  C  CG  . ASN A 1 77  ? 35.993  5.254   -20.950 1.00 64.90 ? 77   ASN A CG  1 
ATOM   580  O  OD1 . ASN A 1 77  ? 35.120  4.431   -21.248 1.00 73.44 ? 77   ASN A OD1 1 
ATOM   581  N  ND2 . ASN A 1 77  ? 35.823  6.572   -21.047 1.00 74.04 ? 77   ASN A ND2 1 
ATOM   582  N  N   . GLN A 1 78  ? 35.568  5.831   -17.741 1.00 31.29 ? 78   GLN A N   1 
ATOM   583  C  CA  . GLN A 1 78  ? 34.439  5.740   -16.831 1.00 41.82 ? 78   GLN A CA  1 
ATOM   584  C  C   . GLN A 1 78  ? 33.138  5.168   -17.365 1.00 43.64 ? 78   GLN A C   1 
ATOM   585  O  O   . GLN A 1 78  ? 32.265  4.818   -16.541 1.00 42.98 ? 78   GLN A O   1 
ATOM   586  C  CB  . GLN A 1 78  ? 34.010  7.154   -16.357 1.00 45.63 ? 78   GLN A CB  1 
ATOM   587  C  CG  . GLN A 1 78  ? 35.100  7.876   -15.615 1.00 72.11 ? 78   GLN A CG  1 
ATOM   588  C  CD  . GLN A 1 78  ? 34.810  9.301   -15.222 1.00 76.35 ? 78   GLN A CD  1 
ATOM   589  O  OE1 . GLN A 1 78  ? 35.400  9.745   -14.249 1.00 84.66 ? 78   GLN A OE1 1 
ATOM   590  N  NE2 . GLN A 1 78  ? 33.949  9.995   -15.969 1.00 77.75 ? 78   GLN A NE2 1 
ATOM   591  N  N   . ASN A 1 79  ? 32.998  5.124   -18.664 1.00 44.16 ? 79   ASN A N   1 
ATOM   592  C  CA  . ASN A 1 79  ? 31.798  4.719   -19.374 1.00 24.86 ? 79   ASN A CA  1 
ATOM   593  C  C   . ASN A 1 79  ? 31.320  3.349   -18.964 1.00 25.13 ? 79   ASN A C   1 
ATOM   594  O  O   . ASN A 1 79  ? 31.984  2.316   -19.057 1.00 17.78 ? 79   ASN A O   1 
ATOM   595  C  CB  . ASN A 1 79  ? 32.021  4.737   -20.883 1.00 38.48 ? 79   ASN A CB  1 
ATOM   596  C  CG  . ASN A 1 79  ? 32.151  6.098   -21.496 1.00 45.88 ? 79   ASN A CG  1 
ATOM   597  O  OD1 . ASN A 1 79  ? 31.921  7.192   -21.004 1.00 50.75 ? 79   ASN A OD1 1 
ATOM   598  N  ND2 . ASN A 1 79  ? 32.544  6.031   -22.775 1.00 62.07 ? 79   ASN A ND2 1 
ATOM   599  N  N   . GLY A 1 80  ? 30.080  3.474   -18.460 1.00 22.00 ? 80   GLY A N   1 
ATOM   600  C  CA  . GLY A 1 80  ? 29.465  2.195   -18.059 1.00 16.90 ? 80   GLY A CA  1 
ATOM   601  C  C   . GLY A 1 80  ? 29.583  1.959   -16.552 1.00 30.28 ? 80   GLY A C   1 
ATOM   602  O  O   . GLY A 1 80  ? 29.107  0.861   -16.204 1.00 23.10 ? 80   GLY A O   1 
ATOM   603  N  N   . TRP A 1 81  ? 30.152  2.872   -15.775 1.00 32.97 ? 81   TRP A N   1 
ATOM   604  C  CA  . TRP A 1 81  ? 30.187  2.645   -14.304 1.00 28.94 ? 81   TRP A CA  1 
ATOM   605  C  C   . TRP A 1 81  ? 28.735  2.578   -13.772 1.00 20.53 ? 81   TRP A C   1 
ATOM   606  O  O   . TRP A 1 81  ? 28.065  3.564   -14.117 1.00 20.74 ? 81   TRP A O   1 
ATOM   607  C  CB  . TRP A 1 81  ? 30.872  3.789   -13.542 1.00 26.62 ? 81   TRP A CB  1 
ATOM   608  C  CG  . TRP A 1 81  ? 32.368  3.662   -13.718 1.00 32.19 ? 81   TRP A CG  1 
ATOM   609  C  CD1 . TRP A 1 81  ? 33.112  2.616   -14.244 1.00 28.64 ? 81   TRP A CD1 1 
ATOM   610  C  CD2 . TRP A 1 81  ? 33.295  4.673   -13.304 1.00 27.45 ? 81   TRP A CD2 1 
ATOM   611  N  NE1 . TRP A 1 81  ? 34.456  2.961   -14.177 1.00 37.71 ? 81   TRP A NE1 1 
ATOM   612  C  CE2 . TRP A 1 81  ? 34.580  4.190   -13.600 1.00 36.70 ? 81   TRP A CE2 1 
ATOM   613  C  CE3 . TRP A 1 81  ? 33.069  5.911   -12.690 1.00 19.41 ? 81   TRP A CE3 1 
ATOM   614  C  CZ2 . TRP A 1 81  ? 35.729  4.930   -13.295 1.00 47.37 ? 81   TRP A CZ2 1 
ATOM   615  C  CZ3 . TRP A 1 81  ? 34.203  6.670   -12.428 1.00 35.51 ? 81   TRP A CZ3 1 
ATOM   616  C  CH2 . TRP A 1 81  ? 35.481  6.173   -12.698 1.00 40.75 ? 81   TRP A CH2 1 
ATOM   617  N  N   . ILE A 1 82  ? 28.411  1.548   -13.026 1.00 24.72 ? 82   ILE A N   1 
ATOM   618  C  CA  . ILE A 1 82  ? 27.021  1.404   -12.522 1.00 22.25 ? 82   ILE A CA  1 
ATOM   619  C  C   . ILE A 1 82  ? 26.696  2.312   -11.333 1.00 26.29 ? 82   ILE A C   1 
ATOM   620  O  O   . ILE A 1 82  ? 27.456  2.126   -10.389 1.00 18.18 ? 82   ILE A O   1 
ATOM   621  C  CB  . ILE A 1 82  ? 26.716  -0.096  -12.182 1.00 17.10 ? 82   ILE A CB  1 
ATOM   622  C  CG1 . ILE A 1 82  ? 26.945  -0.982  -13.429 1.00 18.89 ? 82   ILE A CG1 1 
ATOM   623  C  CG2 . ILE A 1 82  ? 25.249  -0.289  -11.651 1.00 18.18 ? 82   ILE A CG2 1 
ATOM   624  C  CD1 . ILE A 1 82  ? 26.954  -2.542  -13.275 1.00 17.75 ? 82   ILE A CD1 1 
ATOM   625  N  N   . GLY A 1 83  ? 25.654  3.120   -11.455 1.00 22.15 ? 83   GLY A N   1 
ATOM   626  C  CA  . GLY A 1 83  ? 25.183  3.987   -10.342 1.00 21.34 ? 83   GLY A CA  1 
ATOM   627  C  C   . GLY A 1 83  ? 24.120  3.083   -9.608  1.00 23.62 ? 83   GLY A C   1 
ATOM   628  O  O   . GLY A 1 83  ? 24.434  2.136   -8.816  1.00 18.01 ? 83   GLY A O   1 
ATOM   629  N  N   . ARG A 1 84  ? 22.877  3.406   -9.834  1.00 20.69 ? 84   ARG A N   1 
ATOM   630  C  CA  . ARG A 1 84  ? 21.702  2.696   -9.277  1.00 22.09 ? 84   ARG A CA  1 
ATOM   631  C  C   . ARG A 1 84  ? 21.646  1.289   -9.805  1.00 18.61 ? 84   ARG A C   1 
ATOM   632  O  O   . ARG A 1 84  ? 21.901  1.018   -10.994 1.00 26.70 ? 84   ARG A O   1 
ATOM   633  C  CB  . ARG A 1 84  ? 20.336  3.360   -9.610  1.00 27.79 ? 84   ARG A CB  1 
ATOM   634  C  CG  . ARG A 1 84  ? 20.378  4.820   -9.170  1.00 40.10 ? 84   ARG A CG  1 
ATOM   635  C  CD  . ARG A 1 84  ? 19.012  5.463   -9.147  1.00 61.33 ? 84   ARG A CD  1 
ATOM   636  N  NE  . ARG A 1 84  ? 18.095  4.439   -8.661  1.00 66.78 ? 84   ARG A NE  1 
ATOM   637  C  CZ  . ARG A 1 84  ? 16.843  4.176   -9.031  1.00 73.71 ? 84   ARG A CZ  1 
ATOM   638  N  NH1 . ARG A 1 84  ? 16.188  4.860   -9.982  1.00 59.40 ? 84   ARG A NH1 1 
ATOM   639  N  NH2 . ARG A 1 84  ? 16.348  3.164   -8.299  1.00 62.05 ? 84   ARG A NH2 1 
ATOM   640  N  N   . HIS A 1 85  ? 21.351  0.356   -8.928  1.00 15.78 ? 85   HIS A N   1 
ATOM   641  C  CA  . HIS A 1 85  ? 21.287  -1.050  -9.332  1.00 12.76 ? 85   HIS A CA  1 
ATOM   642  C  C   . HIS A 1 85  ? 20.337  -1.784  -8.397  1.00 19.86 ? 85   HIS A C   1 
ATOM   643  O  O   . HIS A 1 85  ? 19.935  -1.266  -7.363  1.00 17.86 ? 85   HIS A O   1 
ATOM   644  C  CB  . HIS A 1 85  ? 22.714  -1.719  -9.266  1.00 10.31 ? 85   HIS A CB  1 
ATOM   645  C  CG  . HIS A 1 85  ? 23.301  -1.510  -7.872  1.00 21.07 ? 85   HIS A CG  1 
ATOM   646  N  ND1 . HIS A 1 85  ? 23.936  -0.360  -7.356  1.00 16.28 ? 85   HIS A ND1 1 
ATOM   647  C  CD2 . HIS A 1 85  ? 23.317  -2.440  -6.886  1.00 14.42 ? 85   HIS A CD2 1 
ATOM   648  C  CE1 . HIS A 1 85  ? 24.267  -0.641  -6.120  1.00 12.50 ? 85   HIS A CE1 1 
ATOM   649  N  NE2 . HIS A 1 85  ? 23.929  -1.886  -5.822  1.00 11.85 ? 85   HIS A NE2 1 
ATOM   650  N  N   . GLU A 1 86  ? 20.071  -3.030  -8.707  1.00 20.93 ? 86   GLU A N   1 
ATOM   651  C  CA  . GLU A 1 86  ? 19.221  -3.948  -7.966  1.00 23.15 ? 86   GLU A CA  1 
ATOM   652  C  C   . GLU A 1 86  ? 19.775  -5.334  -8.143  1.00 16.37 ? 86   GLU A C   1 
ATOM   653  O  O   . GLU A 1 86  ? 20.203  -5.631  -9.258  1.00 28.73 ? 86   GLU A O   1 
ATOM   654  C  CB  . GLU A 1 86  ? 17.780  -3.994  -8.552  1.00 23.70 ? 86   GLU A CB  1 
ATOM   655  C  CG  . GLU A 1 86  ? 17.122  -2.617  -8.493  1.00 29.20 ? 86   GLU A CG  1 
ATOM   656  C  CD  . GLU A 1 86  ? 15.669  -2.611  -8.955  1.00 35.00 ? 86   GLU A CD  1 
ATOM   657  O  OE1 . GLU A 1 86  ? 15.430  -3.543  -9.727  1.00 35.07 ? 86   GLU A OE1 1 
ATOM   658  O  OE2 . GLU A 1 86  ? 14.925  -1.788  -8.481  1.00 39.58 ? 86   GLU A OE2 1 
ATOM   659  N  N   . VAL A 1 87  ? 19.790  -6.149  -7.148  1.00 12.09 ? 87   VAL A N   1 
ATOM   660  C  CA  . VAL A 1 87  ? 20.296  -7.520  -7.255  1.00 14.23 ? 87   VAL A CA  1 
ATOM   661  C  C   . VAL A 1 87  ? 19.123  -8.456  -7.017  1.00 19.85 ? 87   VAL A C   1 
ATOM   662  O  O   . VAL A 1 87  ? 18.360  -8.142  -6.092  1.00 22.83 ? 87   VAL A O   1 
ATOM   663  C  CB  . VAL A 1 87  ? 21.470  -7.726  -6.282  1.00 10.42 ? 87   VAL A CB  1 
ATOM   664  C  CG1 . VAL A 1 87  ? 21.917  -9.176  -6.377  1.00 12.33 ? 87   VAL A CG1 1 
ATOM   665  C  CG2 . VAL A 1 87  ? 22.569  -6.750  -6.602  1.00 11.05 ? 87   VAL A CG2 1 
ATOM   666  N  N   . TYR A 1 88  ? 18.955  -9.491  -7.806  1.00 20.08 ? 88   TYR A N   1 
ATOM   667  C  CA  . TYR A 1 88  ? 17.835  -10.428 -7.678  1.00 18.07 ? 88   TYR A CA  1 
ATOM   668  C  C   . TYR A 1 88  ? 18.360  -11.837 -7.731  1.00 16.41 ? 88   TYR A C   1 
ATOM   669  O  O   . TYR A 1 88  ? 19.424  -12.193 -8.280  1.00 24.47 ? 88   TYR A O   1 
ATOM   670  C  CB  . TYR A 1 88  ? 16.784  -10.403 -8.823  1.00 12.34 ? 88   TYR A CB  1 
ATOM   671  C  CG  . TYR A 1 88  ? 16.111  -9.092  -8.977  1.00 15.36 ? 88   TYR A CG  1 
ATOM   672  C  CD1 . TYR A 1 88  ? 16.654  -8.040  -9.676  1.00 14.58 ? 88   TYR A CD1 1 
ATOM   673  C  CD2 . TYR A 1 88  ? 14.769  -9.012  -8.449  1.00 13.78 ? 88   TYR A CD2 1 
ATOM   674  C  CE1 . TYR A 1 88  ? 15.994  -6.805  -9.832  1.00 25.85 ? 88   TYR A CE1 1 
ATOM   675  C  CE2 . TYR A 1 88  ? 14.128  -7.820  -8.608  1.00 15.40 ? 88   TYR A CE2 1 
ATOM   676  C  CZ  . TYR A 1 88  ? 14.680  -6.751  -9.286  1.00 27.57 ? 88   TYR A CZ  1 
ATOM   677  O  OH  . TYR A 1 88  ? 13.996  -5.581  -9.366  1.00 30.01 ? 88   TYR A OH  1 
ATOM   678  N  N   . LEU A 1 89  ? 17.538  -12.661 -7.073  1.00 27.14 ? 89   LEU A N   1 
ATOM   679  C  CA  . LEU A 1 89  ? 17.933  -14.079 -6.980  1.00 32.49 ? 89   LEU A CA  1 
ATOM   680  C  C   . LEU A 1 89  ? 16.702  -14.901 -7.407  1.00 35.85 ? 89   LEU A C   1 
ATOM   681  O  O   . LEU A 1 89  ? 15.639  -14.378 -7.178  1.00 37.62 ? 89   LEU A O   1 
ATOM   682  C  CB  . LEU A 1 89  ? 18.416  -14.528 -5.609  1.00 33.78 ? 89   LEU A CB  1 
ATOM   683  C  CG  . LEU A 1 89  ? 19.526  -13.843 -4.842  1.00 31.98 ? 89   LEU A CG  1 
ATOM   684  C  CD1 . LEU A 1 89  ? 19.765  -14.555 -3.510  1.00 27.11 ? 89   LEU A CD1 1 
ATOM   685  C  CD2 . LEU A 1 89  ? 20.799  -13.800 -5.709  1.00 25.99 ? 89   LEU A CD2 1 
ATOM   686  N  N   . SER A 1 90  ? 16.984  -16.058 -7.959  1.00 43.08 ? 90   SER A N   1 
ATOM   687  C  CA  . SER A 1 90  ? 15.968  -16.982 -8.467  1.00 41.62 ? 90   SER A CA  1 
ATOM   688  C  C   . SER A 1 90  ? 16.492  -18.401 -8.408  1.00 30.69 ? 90   SER A C   1 
ATOM   689  O  O   . SER A 1 90  ? 17.661  -18.740 -8.594  1.00 36.50 ? 90   SER A O   1 
ATOM   690  C  CB  . SER A 1 90  ? 15.603  -16.628 -9.887  1.00 26.68 ? 90   SER A CB  1 
ATOM   691  O  OG  . SER A 1 90  ? 14.353  -17.178 -10.280 1.00 43.74 ? 90   SER A OG  1 
ATOM   692  N  N   . SER A 1 91  ? 15.586  -19.273 -8.062  1.00 50.82 ? 91   SER A N   1 
ATOM   693  C  CA  . SER A 1 91  ? 15.758  -20.722 -7.990  1.00 58.64 ? 91   SER A CA  1 
ATOM   694  C  C   . SER A 1 91  ? 15.442  -21.347 -9.371  1.00 64.01 ? 91   SER A C   1 
ATOM   695  O  O   . SER A 1 91  ? 15.964  -22.413 -9.785  1.00 53.68 ? 91   SER A O   1 
ATOM   696  C  CB  . SER A 1 91  ? 14.831  -21.187 -6.878  1.00 68.34 ? 91   SER A CB  1 
ATOM   697  O  OG  . SER A 1 91  ? 15.381  -22.288 -6.190  1.00 82.05 ? 91   SER A OG  1 
ATOM   698  N  N   . ASP A 1 92  ? 14.610  -20.619 -10.107 1.00 52.15 ? 92   ASP A N   1 
ATOM   699  C  CA  . ASP A 1 92  ? 14.103  -20.984 -11.422 1.00 52.84 ? 92   ASP A CA  1 
ATOM   700  C  C   . ASP A 1 92  ? 14.446  -20.175 -12.636 1.00 51.40 ? 92   ASP A C   1 
ATOM   701  O  O   . ASP A 1 92  ? 14.440  -20.786 -13.734 1.00 58.00 ? 92   ASP A O   1 
ATOM   702  C  CB  . ASP A 1 92  ? 12.593  -21.182 -11.188 1.00 60.02 ? 92   ASP A CB  1 
ATOM   703  C  CG  . ASP A 1 92  ? 11.798  -19.896 -11.103 1.00 59.60 ? 92   ASP A CG  1 
ATOM   704  O  OD1 . ASP A 1 92  ? 12.265  -18.756 -11.272 1.00 53.04 ? 92   ASP A OD1 1 
ATOM   705  O  OD2 . ASP A 1 92  ? 10.580  -20.099 -10.900 1.00 66.41 ? 92   ASP A OD2 1 
ATOM   706  N  N   . GLY A 1 93  ? 14.697  -18.881 -12.615 1.00 43.97 ? 93   GLY A N   1 
ATOM   707  C  CA  . GLY A 1 93  ? 15.061  -18.107 -13.801 1.00 30.35 ? 93   GLY A CA  1 
ATOM   708  C  C   . GLY A 1 93  ? 13.939  -17.254 -14.314 1.00 45.85 ? 93   GLY A C   1 
ATOM   709  O  O   . GLY A 1 93  ? 14.123  -16.359 -15.190 1.00 45.06 ? 93   GLY A O   1 
ATOM   710  N  N   . THR A 1 94  ? 12.773  -17.574 -13.755 1.00 46.22 ? 94   THR A N   1 
ATOM   711  C  CA  . THR A 1 94  ? 11.616  -16.763 -14.202 1.00 58.66 ? 94   THR A CA  1 
ATOM   712  C  C   . THR A 1 94  ? 11.081  -15.894 -13.084 1.00 49.69 ? 94   THR A C   1 
ATOM   713  O  O   . THR A 1 94  ? 10.651  -14.749 -13.275 1.00 47.18 ? 94   THR A O   1 
ATOM   714  C  CB  . THR A 1 94  ? 10.486  -17.774 -14.713 1.00 66.44 ? 94   THR A CB  1 
ATOM   715  O  OG1 . THR A 1 94  ? 11.197  -18.690 -15.590 1.00 71.42 ? 94   THR A OG1 1 
ATOM   716  C  CG2 . THR A 1 94  ? 9.329   -17.029 -15.371 1.00 79.28 ? 94   THR A CG2 1 
ATOM   717  N  N   . ASN A 1 95  ? 11.079  -16.558 -11.935 1.00 36.09 ? 95   ASN A N   1 
ATOM   718  C  CA  . ASN A 1 95  ? 10.547  -15.860 -10.751 1.00 49.03 ? 95   ASN A CA  1 
ATOM   719  C  C   . ASN A 1 95  ? 11.771  -15.289 -9.976  1.00 43.94 ? 95   ASN A C   1 
ATOM   720  O  O   . ASN A 1 95  ? 12.442  -16.117 -9.346  1.00 38.11 ? 95   ASN A O   1 
ATOM   721  C  CB  . ASN A 1 95  ? 9.682   -16.812 -9.968  1.00 68.76 ? 95   ASN A CB  1 
ATOM   722  C  CG  . ASN A 1 95  ? 8.568   -17.446 -10.816 1.00 84.25 ? 95   ASN A CG  1 
ATOM   723  O  OD1 . ASN A 1 95  ? 7.401   -17.357 -10.414 1.00 94.75 ? 95   ASN A OD1 1 
ATOM   724  N  ND2 . ASN A 1 95  ? 8.914   -18.073 -11.930 1.00 75.75 ? 95   ASN A ND2 1 
ATOM   725  N  N   . TRP A 1 96  ? 11.850  -13.983 -10.069 1.00 41.71 ? 96   TRP A N   1 
ATOM   726  C  CA  . TRP A 1 96  ? 12.942  -13.229 -9.401  1.00 47.74 ? 96   TRP A CA  1 
ATOM   727  C  C   . TRP A 1 96  ? 12.591  -12.603 -8.053  1.00 50.07 ? 96   TRP A C   1 
ATOM   728  O  O   . TRP A 1 96  ? 13.498  -12.424 -7.241  1.00 56.04 ? 96   TRP A O   1 
ATOM   729  C  CB  . TRP A 1 96  ? 13.310  -12.088 -10.372 1.00 39.38 ? 96   TRP A CB  1 
ATOM   730  C  CG  . TRP A 1 96  ? 13.982  -12.757 -11.529 1.00 40.15 ? 96   TRP A CG  1 
ATOM   731  C  CD1 . TRP A 1 96  ? 13.427  -12.955 -12.750 1.00 38.72 ? 96   TRP A CD1 1 
ATOM   732  C  CD2 . TRP A 1 96  ? 15.288  -13.326 -11.548 1.00 38.29 ? 96   TRP A CD2 1 
ATOM   733  N  NE1 . TRP A 1 96  ? 14.350  -13.612 -13.533 1.00 53.70 ? 96   TRP A NE1 1 
ATOM   734  C  CE2 . TRP A 1 96  ? 15.497  -13.847 -12.863 1.00 48.16 ? 96   TRP A CE2 1 
ATOM   735  C  CE3 . TRP A 1 96  ? 16.335  -13.414 -10.640 1.00 26.72 ? 96   TRP A CE3 1 
ATOM   736  C  CZ2 . TRP A 1 96  ? 16.692  -14.446 -13.237 1.00 46.03 ? 96   TRP A CZ2 1 
ATOM   737  C  CZ3 . TRP A 1 96  ? 17.500  -14.007 -11.026 1.00 25.45 ? 96   TRP A CZ3 1 
ATOM   738  C  CH2 . TRP A 1 96  ? 17.733  -14.497 -12.299 1.00 36.48 ? 96   TRP A CH2 1 
ATOM   739  N  N   . GLY A 1 97  ? 11.326  -12.267 -7.855  1.00 45.49 ? 97   GLY A N   1 
ATOM   740  C  CA  . GLY A 1 97  ? 10.840  -11.658 -6.617  1.00 36.63 ? 97   GLY A CA  1 
ATOM   741  C  C   . GLY A 1 97  ? 11.298  -10.228 -6.462  1.00 32.38 ? 97   GLY A C   1 
ATOM   742  O  O   . GLY A 1 97  ? 11.469  -9.449  -7.413  1.00 39.94 ? 97   GLY A O   1 
ATOM   743  N  N   . SER A 1 98  ? 11.487  -9.887  -5.204  1.00 27.21 ? 98   SER A N   1 
ATOM   744  C  CA  . SER A 1 98  ? 11.963  -8.497  -4.842  1.00 35.01 ? 98   SER A CA  1 
ATOM   745  C  C   . SER A 1 98  ? 13.485  -8.495  -4.830  1.00 27.13 ? 98   SER A C   1 
ATOM   746  O  O   . SER A 1 98  ? 14.093  -9.549  -4.502  1.00 29.65 ? 98   SER A O   1 
ATOM   747  C  CB  . SER A 1 98  ? 11.316  -8.358  -3.465  1.00 41.21 ? 98   SER A CB  1 
ATOM   748  O  OG  . SER A 1 98  ? 11.385  -7.078  -2.899  1.00 69.34 ? 98   SER A OG  1 
ATOM   749  N  N   . PRO A 1 99  ? 14.161  -7.370  -5.081  1.00 19.90 ? 99   PRO A N   1 
ATOM   750  C  CA  . PRO A 1 99  ? 15.616  -7.365  -5.047  1.00 16.11 ? 99   PRO A CA  1 
ATOM   751  C  C   . PRO A 1 99  ? 16.081  -7.695  -3.613  1.00 21.14 ? 99   PRO A C   1 
ATOM   752  O  O   . PRO A 1 99  ? 15.423  -7.268  -2.625  1.00 16.34 ? 99   PRO A O   1 
ATOM   753  C  CB  . PRO A 1 99  ? 15.963  -5.964  -5.450  1.00 19.56 ? 99   PRO A CB  1 
ATOM   754  C  CG  . PRO A 1 99  ? 14.735  -5.162  -5.743  1.00 20.94 ? 99   PRO A CG  1 
ATOM   755  C  CD  . PRO A 1 99  ? 13.596  -6.096  -5.480  1.00 23.43 ? 99   PRO A CD  1 
ATOM   756  N  N   . VAL A 1 100 ? 17.194  -8.450  -3.513  1.00 17.98 ? 100  VAL A N   1 
ATOM   757  C  CA  . VAL A 1 100 ? 17.759  -8.766  -2.218  1.00 18.14 ? 100  VAL A CA  1 
ATOM   758  C  C   . VAL A 1 100 ? 18.670  -7.569  -1.771  1.00 16.66 ? 100  VAL A C   1 
ATOM   759  O  O   . VAL A 1 100 ? 19.001  -7.550  -0.560  1.00 14.93 ? 100  VAL A O   1 
ATOM   760  C  CB  . VAL A 1 100 ? 18.554  -10.075 -2.234  1.00 20.41 ? 100  VAL A CB  1 
ATOM   761  C  CG1 . VAL A 1 100 ? 17.599  -11.254 -2.220  1.00 21.43 ? 100  VAL A CG1 1 
ATOM   762  C  CG2 . VAL A 1 100 ? 19.644  -10.202 -3.301  1.00 11.48 ? 100  VAL A CG2 1 
ATOM   763  N  N   . ALA A 1 101 ? 19.043  -6.716  -2.721  1.00 11.83 ? 101  ALA A N   1 
ATOM   764  C  CA  . ALA A 1 101 ? 19.892  -5.535  -2.505  1.00 10.83 ? 101  ALA A CA  1 
ATOM   765  C  C   . ALA A 1 101 ? 19.596  -4.550  -3.616  1.00 16.69 ? 101  ALA A C   1 
ATOM   766  O  O   . ALA A 1 101 ? 19.242  -5.038  -4.693  1.00 15.34 ? 101  ALA A O   1 
ATOM   767  C  CB  . ALA A 1 101 ? 21.404  -5.785  -2.511  1.00 5.00  ? 101  ALA A CB  1 
ATOM   768  N  N   . SER A 1 102 ? 19.736  -3.278  -3.298  1.00 17.48 ? 102  SER A N   1 
ATOM   769  C  CA  . SER A 1 102 ? 19.543  -2.230  -4.278  1.00 18.83 ? 102  SER A CA  1 
ATOM   770  C  C   . SER A 1 102 ? 20.218  -1.008  -3.716  1.00 17.15 ? 102  SER A C   1 
ATOM   771  O  O   . SER A 1 102 ? 20.451  -0.954  -2.491  1.00 22.24 ? 102  SER A O   1 
ATOM   772  C  CB  . SER A 1 102 ? 18.054  -1.956  -4.609  1.00 23.79 ? 102  SER A CB  1 
ATOM   773  O  OG  . SER A 1 102 ? 17.324  -1.548  -3.493  1.00 23.14 ? 102  SER A OG  1 
ATOM   774  N  N   . GLY A 1 103 ? 20.418  0.021   -4.496  1.00 9.49  ? 103  GLY A N   1 
ATOM   775  C  CA  . GLY A 1 103 ? 20.979  1.285   -3.965  1.00 12.22 ? 103  GLY A CA  1 
ATOM   776  C  C   . GLY A 1 103 ? 21.877  1.889   -5.024  1.00 19.97 ? 103  GLY A C   1 
ATOM   777  O  O   . GLY A 1 103 ? 21.548  1.565   -6.151  1.00 25.86 ? 103  GLY A O   1 
ATOM   778  N  N   . SER A 1 104 ? 22.924  2.614   -4.605  1.00 16.13 ? 104  SER A N   1 
ATOM   779  C  CA  . SER A 1 104 ? 23.778  3.242   -5.608  1.00 9.02  ? 104  SER A CA  1 
ATOM   780  C  C   . SER A 1 104 ? 25.247  3.034   -5.302  1.00 17.00 ? 104  SER A C   1 
ATOM   781  O  O   . SER A 1 104 ? 25.484  3.073   -4.098  1.00 14.75 ? 104  SER A O   1 
ATOM   782  C  CB  . SER A 1 104 ? 23.705  4.789   -5.626  1.00 16.74 ? 104  SER A CB  1 
ATOM   783  O  OG  . SER A 1 104 ? 22.405  4.947   -6.226  1.00 30.34 ? 104  SER A OG  1 
ATOM   784  N  N   . TRP A 1 105 ? 26.048  2.910   -6.358  1.00 15.48 ? 105  TRP A N   1 
ATOM   785  C  CA  . TRP A 1 105 ? 27.482  2.669   -6.038  1.00 11.97 ? 105  TRP A CA  1 
ATOM   786  C  C   . TRP A 1 105 ? 28.190  3.970   -6.330  1.00 21.92 ? 105  TRP A C   1 
ATOM   787  O  O   . TRP A 1 105 ? 27.728  4.622   -7.237  1.00 17.77 ? 105  TRP A O   1 
ATOM   788  C  CB  . TRP A 1 105 ? 28.035  1.528   -6.805  1.00 10.69 ? 105  TRP A CB  1 
ATOM   789  C  CG  . TRP A 1 105 ? 27.717  0.172   -6.304  1.00 10.01 ? 105  TRP A CG  1 
ATOM   790  C  CD1 . TRP A 1 105 ? 27.672  -0.196  -4.970  1.00 11.11 ? 105  TRP A CD1 1 
ATOM   791  C  CD2 . TRP A 1 105 ? 27.525  -0.999  -7.090  1.00 19.95 ? 105  TRP A CD2 1 
ATOM   792  N  NE1 . TRP A 1 105 ? 27.482  -1.559  -4.918  1.00 15.68 ? 105  TRP A NE1 1 
ATOM   793  C  CE2 . TRP A 1 105 ? 27.382  -2.071  -6.190  1.00 21.46 ? 105  TRP A CE2 1 
ATOM   794  C  CE3 . TRP A 1 105 ? 27.465  -1.237  -8.462  1.00 21.49 ? 105  TRP A CE3 1 
ATOM   795  C  CZ2 . TRP A 1 105 ? 27.130  -3.370  -6.608  1.00 17.22 ? 105  TRP A CZ2 1 
ATOM   796  C  CZ3 . TRP A 1 105 ? 27.157  -2.535  -8.892  1.00 14.33 ? 105  TRP A CZ3 1 
ATOM   797  C  CH2 . TRP A 1 105 ? 27.026  -3.586  -8.006  1.00 14.75 ? 105  TRP A CH2 1 
ATOM   798  N  N   . PHE A 1 106 ? 29.261  4.230   -5.589  1.00 21.20 ? 106  PHE A N   1 
ATOM   799  C  CA  . PHE A 1 106 ? 29.978  5.501   -5.850  1.00 21.64 ? 106  PHE A CA  1 
ATOM   800  C  C   . PHE A 1 106 ? 30.635  5.419   -7.234  1.00 20.84 ? 106  PHE A C   1 
ATOM   801  O  O   . PHE A 1 106 ? 31.056  4.311   -7.627  1.00 26.78 ? 106  PHE A O   1 
ATOM   802  C  CB  . PHE A 1 106 ? 31.026  5.604   -4.743  1.00 21.92 ? 106  PHE A CB  1 
ATOM   803  C  CG  . PHE A 1 106 ? 31.787  6.917   -4.757  1.00 30.30 ? 106  PHE A CG  1 
ATOM   804  C  CD1 . PHE A 1 106 ? 31.196  8.067   -4.233  1.00 30.76 ? 106  PHE A CD1 1 
ATOM   805  C  CD2 . PHE A 1 106 ? 33.068  6.984   -5.305  1.00 29.65 ? 106  PHE A CD2 1 
ATOM   806  C  CE1 . PHE A 1 106 ? 31.906  9.282   -4.229  1.00 34.24 ? 106  PHE A CE1 1 
ATOM   807  C  CE2 . PHE A 1 106 ? 33.804  8.166   -5.265  1.00 32.59 ? 106  PHE A CE2 1 
ATOM   808  C  CZ  . PHE A 1 106 ? 33.203  9.319   -4.736  1.00 23.10 ? 106  PHE A CZ  1 
ATOM   809  N  N   . ALA A 1 107 ? 30.814  6.576   -7.802  1.00 17.73 ? 107  ALA A N   1 
ATOM   810  C  CA  . ALA A 1 107 ? 31.375  6.781   -9.134  1.00 20.28 ? 107  ALA A CA  1 
ATOM   811  C  C   . ALA A 1 107 ? 32.906  6.734   -9.116  1.00 19.33 ? 107  ALA A C   1 
ATOM   812  O  O   . ALA A 1 107 ? 33.417  7.828   -9.060  1.00 21.92 ? 107  ALA A O   1 
ATOM   813  C  CB  . ALA A 1 107 ? 30.820  8.031   -9.786  1.00 22.30 ? 107  ALA A CB  1 
ATOM   814  N  N   . ASP A 1 108 ? 33.432  5.540   -9.056  1.00 21.67 ? 108  ASP A N   1 
ATOM   815  C  CA  . ASP A 1 108 ? 34.906  5.380   -9.047  1.00 28.78 ? 108  ASP A CA  1 
ATOM   816  C  C   . ASP A 1 108 ? 35.153  3.993   -9.661  1.00 34.01 ? 108  ASP A C   1 
ATOM   817  O  O   . ASP A 1 108 ? 34.250  3.209   -10.024 1.00 25.34 ? 108  ASP A O   1 
ATOM   818  C  CB  . ASP A 1 108 ? 35.610  5.749   -7.765  1.00 23.82 ? 108  ASP A CB  1 
ATOM   819  C  CG  . ASP A 1 108 ? 35.525  4.738   -6.648  1.00 28.44 ? 108  ASP A CG  1 
ATOM   820  O  OD1 . ASP A 1 108 ? 35.078  3.570   -6.850  1.00 30.10 ? 108  ASP A OD1 1 
ATOM   821  O  OD2 . ASP A 1 108 ? 35.888  5.157   -5.552  1.00 34.77 ? 108  ASP A OD2 1 
ATOM   822  N  N   . SER A 1 109 ? 36.450  3.665   -9.762  1.00 31.01 ? 109  SER A N   1 
ATOM   823  C  CA  . SER A 1 109 ? 36.824  2.384   -10.387 1.00 32.10 ? 109  SER A CA  1 
ATOM   824  C  C   . SER A 1 109 ? 37.126  1.295   -9.395  1.00 30.89 ? 109  SER A C   1 
ATOM   825  O  O   . SER A 1 109 ? 37.696  0.234   -9.743  1.00 27.63 ? 109  SER A O   1 
ATOM   826  C  CB  . SER A 1 109 ? 37.979  2.674   -11.358 1.00 39.37 ? 109  SER A CB  1 
ATOM   827  O  OG  . SER A 1 109 ? 39.156  2.864   -10.561 1.00 46.21 ? 109  SER A OG  1 
ATOM   828  N  N   . THR A 1 110 ? 36.747  1.512   -8.121  1.00 22.22 ? 110  THR A N   1 
ATOM   829  C  CA  . THR A 1 110 ? 37.025  0.419   -7.143  1.00 27.91 ? 110  THR A CA  1 
ATOM   830  C  C   . THR A 1 110 ? 35.984  -0.712  -7.253  1.00 19.83 ? 110  THR A C   1 
ATOM   831  O  O   . THR A 1 110 ? 34.836  -0.444  -7.691  1.00 24.49 ? 110  THR A O   1 
ATOM   832  C  CB  . THR A 1 110 ? 37.026  0.983   -5.673  1.00 35.39 ? 110  THR A CB  1 
ATOM   833  O  OG1 . THR A 1 110 ? 35.707  1.523   -5.302  1.00 29.91 ? 110  THR A OG1 1 
ATOM   834  C  CG2 . THR A 1 110 ? 38.061  2.119   -5.443  1.00 39.47 ? 110  THR A CG2 1 
ATOM   835  N  N   . THR A 1 111 ? 36.383  -1.885  -6.828  1.00 20.33 ? 111  THR A N   1 
ATOM   836  C  CA  . THR A 1 111 ? 35.401  -3.004  -6.786  1.00 24.42 ? 111  THR A CA  1 
ATOM   837  C  C   . THR A 1 111 ? 34.254  -2.569  -5.848  1.00 30.15 ? 111  THR A C   1 
ATOM   838  O  O   . THR A 1 111 ? 34.439  -2.009  -4.729  1.00 30.77 ? 111  THR A O   1 
ATOM   839  C  CB  . THR A 1 111 ? 36.026  -4.300  -6.152  1.00 25.03 ? 111  THR A CB  1 
ATOM   840  O  OG1 . THR A 1 111 ? 37.241  -4.451  -6.975  1.00 28.89 ? 111  THR A OG1 1 
ATOM   841  C  CG2 . THR A 1 111 ? 35.158  -5.559  -6.149  1.00 19.13 ? 111  THR A CG2 1 
ATOM   842  N  N   . LYS A 1 112 ? 33.051  -2.831  -6.240  1.00 20.00 ? 112  LYS A N   1 
ATOM   843  C  CA  . LYS A 1 112 ? 31.804  -2.497  -5.512  1.00 12.95 ? 112  LYS A CA  1 
ATOM   844  C  C   . LYS A 1 112 ? 31.250  -3.830  -5.043  1.00 17.76 ? 112  LYS A C   1 
ATOM   845  O  O   . LYS A 1 112 ? 31.438  -4.892  -5.669  1.00 21.34 ? 112  LYS A O   1 
ATOM   846  C  CB  . LYS A 1 112 ? 30.855  -1.810  -6.522  1.00 17.02 ? 112  LYS A CB  1 
ATOM   847  C  CG  . LYS A 1 112 ? 31.234  -0.375  -6.923  1.00 14.04 ? 112  LYS A CG  1 
ATOM   848  C  CD  . LYS A 1 112 ? 32.087  0.321   -5.856  1.00 13.94 ? 112  LYS A CD  1 
ATOM   849  C  CE  . LYS A 1 112 ? 32.193  1.785   -6.266  1.00 13.20 ? 112  LYS A CE  1 
ATOM   850  N  NZ  . LYS A 1 112 ? 32.973  1.780   -7.562  1.00 14.34 ? 112  LYS A NZ  1 
ATOM   851  N  N   . TYR A 1 113 ? 30.524  -3.860  -3.937  1.00 13.76 ? 113  TYR A N   1 
ATOM   852  C  CA  . TYR A 1 113 ? 29.952  -5.108  -3.456  1.00 14.41 ? 113  TYR A CA  1 
ATOM   853  C  C   . TYR A 1 113 ? 28.452  -4.918  -3.107  1.00 16.65 ? 113  TYR A C   1 
ATOM   854  O  O   . TYR A 1 113 ? 28.046  -3.776  -2.845  1.00 15.32 ? 113  TYR A O   1 
ATOM   855  C  CB  . TYR A 1 113 ? 30.610  -5.485  -2.090  1.00 18.27 ? 113  TYR A CB  1 
ATOM   856  C  CG  . TYR A 1 113 ? 32.098  -5.764  -2.208  1.00 27.33 ? 113  TYR A CG  1 
ATOM   857  C  CD1 . TYR A 1 113 ? 33.027  -4.711  -2.174  1.00 24.51 ? 113  TYR A CD1 1 
ATOM   858  C  CD2 . TYR A 1 113 ? 32.547  -7.066  -2.449  1.00 19.67 ? 113  TYR A CD2 1 
ATOM   859  C  CE1 . TYR A 1 113 ? 34.382  -4.982  -2.306  1.00 30.39 ? 113  TYR A CE1 1 
ATOM   860  C  CE2 . TYR A 1 113 ? 33.896  -7.332  -2.627  1.00 28.28 ? 113  TYR A CE2 1 
ATOM   861  C  CZ  . TYR A 1 113 ? 34.811  -6.294  -2.509  1.00 31.51 ? 113  TYR A CZ  1 
ATOM   862  O  OH  . TYR A 1 113 ? 36.155  -6.555  -2.667  1.00 35.92 ? 113  TYR A OH  1 
ATOM   863  N  N   . SER A 1 114 ? 27.803  -6.043  -3.058  1.00 11.89 ? 114  SER A N   1 
ATOM   864  C  CA  . SER A 1 114 ? 26.424  -6.159  -2.578  1.00 16.84 ? 114  SER A CA  1 
ATOM   865  C  C   . SER A 1 114 ? 26.513  -7.311  -1.543  1.00 17.27 ? 114  SER A C   1 
ATOM   866  O  O   . SER A 1 114 ? 26.805  -8.437  -1.951  1.00 20.44 ? 114  SER A O   1 
ATOM   867  C  CB  . SER A 1 114 ? 25.169  -6.393  -3.400  1.00 15.80 ? 114  SER A CB  1 
ATOM   868  O  OG  . SER A 1 114 ? 25.205  -5.456  -4.433  1.00 26.25 ? 114  SER A OG  1 
ATOM   869  N  N   . ASN A 1 115 ? 26.341  -7.039  -0.249  1.00 14.22 ? 115  ASN A N   1 
ATOM   870  C  CA  . ASN A 1 115 ? 26.377  -8.137  0.821   1.00 12.23 ? 115  ASN A CA  1 
ATOM   871  C  C   . ASN A 1 115 ? 24.896  -8.293  1.272   1.00 16.24 ? 115  ASN A C   1 
ATOM   872  O  O   . ASN A 1 115 ? 24.281  -7.221  1.422   1.00 18.09 ? 115  ASN A O   1 
ATOM   873  C  CB  . ASN A 1 115 ? 27.293  -7.752  1.953   1.00 15.15 ? 115  ASN A CB  1 
ATOM   874  C  CG  . ASN A 1 115 ? 28.759  -7.819  1.473   1.00 27.09 ? 115  ASN A CG  1 
ATOM   875  O  OD1 . ASN A 1 115 ? 29.145  -8.800  0.819   1.00 29.14 ? 115  ASN A OD1 1 
ATOM   876  N  ND2 . ASN A 1 115 ? 29.631  -6.842  1.633   1.00 24.17 ? 115  ASN A ND2 1 
ATOM   877  N  N   . PHE A 1 116 ? 24.360  -9.471  1.418   1.00 8.61  ? 116  PHE A N   1 
ATOM   878  C  CA  . PHE A 1 116 ? 22.933  -9.582  1.802   1.00 12.89 ? 116  PHE A CA  1 
ATOM   879  C  C   . PHE A 1 116 ? 22.737  -10.901 2.522   1.00 18.60 ? 116  PHE A C   1 
ATOM   880  O  O   . PHE A 1 116 ? 23.622  -11.737 2.462   1.00 13.26 ? 116  PHE A O   1 
ATOM   881  C  CB  . PHE A 1 116 ? 21.999  -9.514  0.623   1.00 11.63 ? 116  PHE A CB  1 
ATOM   882  C  CG  . PHE A 1 116 ? 22.472  -10.224 -0.600  1.00 19.13 ? 116  PHE A CG  1 
ATOM   883  C  CD1 . PHE A 1 116 ? 22.321  -11.612 -0.732  1.00 17.02 ? 116  PHE A CD1 1 
ATOM   884  C  CD2 . PHE A 1 116 ? 23.103  -9.482  -1.597  1.00 16.98 ? 116  PHE A CD2 1 
ATOM   885  C  CE1 . PHE A 1 116 ? 22.779  -12.228 -1.893  1.00 23.17 ? 116  PHE A CE1 1 
ATOM   886  C  CE2 . PHE A 1 116 ? 23.576  -10.108 -2.754  1.00 22.09 ? 116  PHE A CE2 1 
ATOM   887  C  CZ  . PHE A 1 116 ? 23.406  -11.492 -2.922  1.00 17.64 ? 116  PHE A CZ  1 
ATOM   888  N  N   . GLU A 1 117 ? 21.590  -11.057 3.201   1.00 15.51 ? 117  GLU A N   1 
ATOM   889  C  CA  . GLU A 1 117 ? 21.467  -12.320 3.961   1.00 14.39 ? 117  GLU A CA  1 
ATOM   890  C  C   . GLU A 1 117 ? 21.446  -13.503 3.003   1.00 21.87 ? 117  GLU A C   1 
ATOM   891  O  O   . GLU A 1 117 ? 20.932  -13.368 1.901   1.00 21.92 ? 117  GLU A O   1 
ATOM   892  C  CB  . GLU A 1 117 ? 20.202  -12.235 4.782   1.00 17.02 ? 117  GLU A CB  1 
ATOM   893  C  CG  . GLU A 1 117 ? 20.249  -11.068 5.798   1.00 19.47 ? 117  GLU A CG  1 
ATOM   894  C  CD  . GLU A 1 117 ? 21.339  -11.272 6.824   1.00 23.41 ? 117  GLU A CD  1 
ATOM   895  O  OE1 . GLU A 1 117 ? 21.403  -12.323 7.436   1.00 18.10 ? 117  GLU A OE1 1 
ATOM   896  O  OE2 . GLU A 1 117 ? 22.247  -10.374 6.955   1.00 19.17 ? 117  GLU A OE2 1 
ATOM   897  N  N   . THR A 1 118 ? 22.026  -14.594 3.455   1.00 26.81 ? 118  THR A N   1 
ATOM   898  C  CA  . THR A 1 118 ? 22.130  -15.846 2.687   1.00 24.67 ? 118  THR A CA  1 
ATOM   899  C  C   . THR A 1 118 ? 20.772  -16.363 2.224   1.00 31.99 ? 118  THR A C   1 
ATOM   900  O  O   . THR A 1 118 ? 19.886  -16.453 3.096   1.00 24.70 ? 118  THR A O   1 
ATOM   901  C  CB  . THR A 1 118 ? 22.818  -16.957 3.572   1.00 18.97 ? 118  THR A CB  1 
ATOM   902  O  OG1 . THR A 1 118 ? 24.098  -16.300 3.939   1.00 29.08 ? 118  THR A OG1 1 
ATOM   903  C  CG2 . THR A 1 118 ? 22.983  -18.292 2.885   1.00 23.49 ? 118  THR A CG2 1 
ATOM   904  N  N   . ARG A 1 119 ? 20.789  -16.611 0.921   1.00 30.99 ? 119  ARG A N   1 
ATOM   905  C  CA  . ARG A 1 119 ? 19.571  -17.175 0.281   1.00 25.25 ? 119  ARG A CA  1 
ATOM   906  C  C   . ARG A 1 119 ? 19.926  -18.207 -0.803  1.00 29.89 ? 119  ARG A C   1 
ATOM   907  O  O   . ARG A 1 119 ? 20.620  -17.787 -1.752  1.00 34.86 ? 119  ARG A O   1 
ATOM   908  C  CB  . ARG A 1 119 ? 18.803  -16.034 -0.418  1.00 23.81 ? 119  ARG A CB  1 
ATOM   909  C  CG  . ARG A 1 119 ? 17.417  -16.531 -0.799  1.00 44.38 ? 119  ARG A CG  1 
ATOM   910  C  CD  . ARG A 1 119 ? 16.383  -15.455 -0.892  1.00 68.26 ? 119  ARG A CD  1 
ATOM   911  N  NE  . ARG A 1 119 ? 15.652  -15.682 -2.129  1.00 86.19 ? 119  ARG A NE  1 
ATOM   912  C  CZ  . ARG A 1 119 ? 15.093  -14.873 -3.013  1.00 89.51 ? 119  ARG A CZ  1 
ATOM   913  N  NH1 . ARG A 1 119 ? 15.054  -13.559 -2.932  1.00 84.56 ? 119  ARG A NH1 1 
ATOM   914  N  NH2 . ARG A 1 119 ? 14.567  -15.503 -4.082  1.00 99.99 ? 119  ARG A NH2 1 
ATOM   915  N  N   . PRO A 1 120 ? 19.442  -19.446 -0.716  1.00 37.01 ? 120  PRO A N   1 
ATOM   916  C  CA  . PRO A 1 120 ? 19.675  -20.447 -1.783  1.00 31.25 ? 120  PRO A CA  1 
ATOM   917  C  C   . PRO A 1 120 ? 19.179  -19.948 -3.126  1.00 34.64 ? 120  PRO A C   1 
ATOM   918  O  O   . PRO A 1 120 ? 18.062  -19.404 -3.354  1.00 44.43 ? 120  PRO A O   1 
ATOM   919  C  CB  . PRO A 1 120 ? 18.943  -21.707 -1.346  1.00 29.61 ? 120  PRO A CB  1 
ATOM   920  C  CG  . PRO A 1 120 ? 18.184  -21.398 -0.108  1.00 32.82 ? 120  PRO A CG  1 
ATOM   921  C  CD  . PRO A 1 120 ? 18.607  -19.998 0.346   1.00 30.68 ? 120  PRO A CD  1 
ATOM   922  N  N   . ALA A 1 121 ? 20.065  -20.045 -4.127  1.00 35.29 ? 121  ALA A N   1 
ATOM   923  C  CA  . ALA A 1 121 ? 19.658  -19.589 -5.483  1.00 32.08 ? 121  ALA A CA  1 
ATOM   924  C  C   . ALA A 1 121 ? 20.603  -20.247 -6.497  1.00 32.80 ? 121  ALA A C   1 
ATOM   925  O  O   . ALA A 1 121 ? 21.763  -20.494 -6.142  1.00 37.58 ? 121  ALA A O   1 
ATOM   926  C  CB  . ALA A 1 121 ? 19.755  -18.088 -5.654  1.00 29.04 ? 121  ALA A CB  1 
ATOM   927  N  N   . ARG A 1 122 ? 20.039  -20.435 -7.661  1.00 29.30 ? 122  ARG A N   1 
ATOM   928  C  CA  . ARG A 1 122 ? 20.822  -21.034 -8.759  1.00 33.97 ? 122  ARG A CA  1 
ATOM   929  C  C   . ARG A 1 122 ? 21.114  -19.896 -9.732  1.00 28.54 ? 122  ARG A C   1 
ATOM   930  O  O   . ARG A 1 122 ? 22.153  -19.930 -10.405 1.00 37.74 ? 122  ARG A O   1 
ATOM   931  C  CB  . ARG A 1 122 ? 20.010  -22.160 -9.441  1.00 31.59 ? 122  ARG A CB  1 
ATOM   932  C  CG  . ARG A 1 122 ? 20.568  -22.463 -10.830 1.00 32.53 ? 122  ARG A CG  1 
ATOM   933  C  CD  . ARG A 1 122 ? 19.681  -23.504 -11.512 1.00 43.38 ? 122  ARG A CD  1 
ATOM   934  N  NE  . ARG A 1 122 ? 20.382  -24.105 -12.637 1.00 61.02 ? 122  ARG A NE  1 
ATOM   935  C  CZ  . ARG A 1 122 ? 19.961  -24.513 -13.830 1.00 64.97 ? 122  ARG A CZ  1 
ATOM   936  N  NH1 . ARG A 1 122 ? 18.713  -24.446 -14.253 1.00 69.88 ? 122  ARG A NH1 1 
ATOM   937  N  NH2 . ARG A 1 122 ? 20.765  -25.031 -14.753 1.00 62.08 ? 122  ARG A NH2 1 
ATOM   938  N  N   . TYR A 1 123 ? 20.239  -18.918 -9.767  1.00 23.60 ? 123  TYR A N   1 
ATOM   939  C  CA  . TYR A 1 123 ? 20.328  -17.744 -10.599 1.00 27.68 ? 123  TYR A CA  1 
ATOM   940  C  C   . TYR A 1 123 ? 20.462  -16.405 -9.829  1.00 39.40 ? 123  TYR A C   1 
ATOM   941  O  O   . TYR A 1 123 ? 19.794  -16.252 -8.812  1.00 39.30 ? 123  TYR A O   1 
ATOM   942  C  CB  . TYR A 1 123 ? 19.174  -17.473 -11.561 1.00 24.48 ? 123  TYR A CB  1 
ATOM   943  C  CG  . TYR A 1 123 ? 18.758  -18.719 -12.331 1.00 36.86 ? 123  TYR A CG  1 
ATOM   944  C  CD1 . TYR A 1 123 ? 18.155  -19.812 -11.699 1.00 43.96 ? 123  TYR A CD1 1 
ATOM   945  C  CD2 . TYR A 1 123 ? 18.983  -18.755 -13.692 1.00 42.89 ? 123  TYR A CD2 1 
ATOM   946  C  CE1 . TYR A 1 123 ? 17.741  -20.933 -12.414 1.00 52.26 ? 123  TYR A CE1 1 
ATOM   947  C  CE2 . TYR A 1 123 ? 18.585  -19.874 -14.431 1.00 44.17 ? 123  TYR A CE2 1 
ATOM   948  C  CZ  . TYR A 1 123 ? 17.982  -20.942 -13.788 1.00 55.36 ? 123  TYR A CZ  1 
ATOM   949  O  OH  . TYR A 1 123 ? 17.616  -22.010 -14.563 1.00 75.43 ? 123  TYR A OH  1 
ATOM   950  N  N   . VAL A 1 124 ? 21.232  -15.527 -10.459 1.00 28.22 ? 124  VAL A N   1 
ATOM   951  C  CA  . VAL A 1 124 ? 21.551  -14.209 -9.971  1.00 22.31 ? 124  VAL A CA  1 
ATOM   952  C  C   . VAL A 1 124 ? 21.459  -13.300 -11.193 1.00 23.76 ? 124  VAL A C   1 
ATOM   953  O  O   . VAL A 1 124 ? 21.871  -13.672 -12.287 1.00 34.39 ? 124  VAL A O   1 
ATOM   954  C  CB  . VAL A 1 124 ? 22.992  -14.093 -9.424  1.00 30.98 ? 124  VAL A CB  1 
ATOM   955  C  CG1 . VAL A 1 124 ? 23.345  -12.627 -9.042  1.00 32.09 ? 124  VAL A CG1 1 
ATOM   956  C  CG2 . VAL A 1 124 ? 23.277  -15.062 -8.319  1.00 25.59 ? 124  VAL A CG2 1 
ATOM   957  N  N   . ARG A 1 125 ? 20.959  -12.161 -10.911 1.00 20.96 ? 125  ARG A N   1 
ATOM   958  C  CA  . ARG A 1 125 ? 20.722  -11.071 -11.824 1.00 26.33 ? 125  ARG A CA  1 
ATOM   959  C  C   . ARG A 1 125 ? 21.052  -9.749  -11.114 1.00 31.16 ? 125  ARG A C   1 
ATOM   960  O  O   . ARG A 1 125 ? 20.613  -9.392  -10.017 1.00 33.19 ? 125  ARG A O   1 
ATOM   961  C  CB  . ARG A 1 125 ? 19.236  -11.075 -12.282 1.00 26.06 ? 125  ARG A CB  1 
ATOM   962  C  CG  . ARG A 1 125 ? 18.949  -9.828  -13.134 1.00 35.24 ? 125  ARG A CG  1 
ATOM   963  C  CD  . ARG A 1 125 ? 17.549  -9.856  -13.694 1.00 46.83 ? 125  ARG A CD  1 
ATOM   964  N  NE  . ARG A 1 125 ? 17.468  -10.960 -14.603 1.00 69.35 ? 125  ARG A NE  1 
ATOM   965  C  CZ  . ARG A 1 125 ? 16.468  -11.410 -15.345 1.00 80.48 ? 125  ARG A CZ  1 
ATOM   966  N  NH1 . ARG A 1 125 ? 15.295  -10.811 -15.389 1.00 91.77 ? 125  ARG A NH1 1 
ATOM   967  N  NH2 . ARG A 1 125 ? 16.703  -12.523 -16.024 1.00 88.19 ? 125  ARG A NH2 1 
ATOM   968  N  N   . LEU A 1 126 ? 21.832  -8.952  -11.821 1.00 22.68 ? 126  LEU A N   1 
ATOM   969  C  CA  . LEU A 1 126 ? 22.217  -7.636  -11.454 1.00 20.48 ? 126  LEU A CA  1 
ATOM   970  C  C   . LEU A 1 126 ? 21.650  -6.738  -12.518 1.00 23.44 ? 126  LEU A C   1 
ATOM   971  O  O   . LEU A 1 126 ? 22.024  -6.937  -13.705 1.00 29.36 ? 126  LEU A O   1 
ATOM   972  C  CB  . LEU A 1 126 ? 23.784  -7.543  -11.424 1.00 28.50 ? 126  LEU A CB  1 
ATOM   973  C  CG  . LEU A 1 126 ? 24.319  -6.090  -11.389 1.00 24.48 ? 126  LEU A CG  1 
ATOM   974  C  CD1 . LEU A 1 126 ? 23.963  -5.396  -10.051 1.00 17.91 ? 126  LEU A CD1 1 
ATOM   975  C  CD2 . LEU A 1 126 ? 25.842  -6.030  -11.352 1.00 17.40 ? 126  LEU A CD2 1 
ATOM   976  N  N   . VAL A 1 127 ? 20.815  -5.772  -12.214 1.00 23.77 ? 127  VAL A N   1 
ATOM   977  C  CA  . VAL A 1 127 ? 20.218  -4.798  -13.056 1.00 17.57 ? 127  VAL A CA  1 
ATOM   978  C  C   . VAL A 1 127 ? 20.906  -3.467  -12.790 1.00 26.06 ? 127  VAL A C   1 
ATOM   979  O  O   . VAL A 1 127 ? 20.869  -2.994  -11.645 1.00 23.30 ? 127  VAL A O   1 
ATOM   980  C  CB  . VAL A 1 127 ? 18.664  -4.676  -12.767 1.00 22.26 ? 127  VAL A CB  1 
ATOM   981  C  CG1 . VAL A 1 127 ? 18.088  -3.701  -13.779 1.00 11.57 ? 127  VAL A CG1 1 
ATOM   982  C  CG2 . VAL A 1 127 ? 18.030  -6.058  -12.744 1.00 16.80 ? 127  VAL A CG2 1 
ATOM   983  N  N   . ALA A 1 128 ? 21.500  -2.854  -13.772 1.00 22.89 ? 128  ALA A N   1 
ATOM   984  C  CA  . ALA A 1 128 ? 22.150  -1.569  -13.726 1.00 21.37 ? 128  ALA A CA  1 
ATOM   985  C  C   . ALA A 1 128 ? 20.989  -0.678  -14.162 1.00 18.05 ? 128  ALA A C   1 
ATOM   986  O  O   . ALA A 1 128 ? 20.628  -0.835  -15.334 1.00 23.25 ? 128  ALA A O   1 
ATOM   987  C  CB  . ALA A 1 128 ? 23.321  -1.405  -14.690 1.00 17.52 ? 128  ALA A CB  1 
ATOM   988  N  N   . ILE A 1 129 ? 20.444  0.094   -13.260 1.00 20.63 ? 129  ILE A N   1 
ATOM   989  C  CA  . ILE A 1 129 ? 19.320  0.981   -13.461 1.00 23.30 ? 129  ILE A CA  1 
ATOM   990  C  C   . ILE A 1 129 ? 19.843  2.282   -14.032 1.00 31.96 ? 129  ILE A C   1 
ATOM   991  O  O   . ILE A 1 129 ? 19.155  2.854   -14.880 1.00 32.46 ? 129  ILE A O   1 
ATOM   992  C  CB  . ILE A 1 129 ? 18.438  1.259   -12.178 1.00 17.53 ? 129  ILE A CB  1 
ATOM   993  C  CG1 . ILE A 1 129 ? 17.857  -0.072  -11.536 1.00 9.50  ? 129  ILE A CG1 1 
ATOM   994  C  CG2 . ILE A 1 129 ? 17.333  2.266   -12.542 1.00 15.15 ? 129  ILE A CG2 1 
ATOM   995  C  CD1 . ILE A 1 129 ? 16.832  -0.671  -12.446 1.00 16.13 ? 129  ILE A CD1 1 
ATOM   996  N  N   . THR A 1 130 ? 21.022  2.682   -13.559 1.00 28.38 ? 130  THR A N   1 
ATOM   997  C  CA  . THR A 1 130 ? 21.642  3.910   -14.034 1.00 23.35 ? 130  THR A CA  1 
ATOM   998  C  C   . THR A 1 130 ? 23.169  3.706   -14.179 1.00 29.52 ? 130  THR A C   1 
ATOM   999  O  O   . THR A 1 130 ? 23.757  2.756   -13.686 1.00 23.16 ? 130  THR A O   1 
ATOM   1000 C  CB  . THR A 1 130 ? 21.416  5.261   -13.271 1.00 24.95 ? 130  THR A CB  1 
ATOM   1001 O  OG1 . THR A 1 130 ? 22.176  5.204   -12.003 1.00 24.41 ? 130  THR A OG1 1 
ATOM   1002 C  CG2 . THR A 1 130 ? 19.938  5.485   -13.073 1.00 25.71 ? 130  THR A CG2 1 
ATOM   1003 N  N   . GLU A 1 131 ? 23.729  4.686   -14.882 1.00 21.44 ? 131  GLU A N   1 
ATOM   1004 C  CA  . GLU A 1 131 ? 25.158  4.750   -15.172 1.00 15.95 ? 131  GLU A CA  1 
ATOM   1005 C  C   . GLU A 1 131 ? 25.578  5.891   -14.301 1.00 16.29 ? 131  GLU A C   1 
ATOM   1006 O  O   . GLU A 1 131 ? 24.831  6.888   -14.318 1.00 20.95 ? 131  GLU A O   1 
ATOM   1007 C  CB  . GLU A 1 131 ? 25.508  4.955   -16.655 1.00 25.24 ? 131  GLU A CB  1 
ATOM   1008 C  CG  . GLU A 1 131 ? 26.962  4.513   -17.062 1.00 18.66 ? 131  GLU A CG  1 
ATOM   1009 C  CD  . GLU A 1 131 ? 27.886  5.692   -17.224 1.00 31.77 ? 131  GLU A CD  1 
ATOM   1010 O  OE1 . GLU A 1 131 ? 27.355  6.790   -16.991 1.00 21.98 ? 131  GLU A OE1 1 
ATOM   1011 O  OE2 . GLU A 1 131 ? 29.059  5.630   -17.580 1.00 38.71 ? 131  GLU A OE2 1 
ATOM   1012 N  N   . ALA A 1 132 ? 26.722  5.701   -13.636 1.00 17.68 ? 132  ALA A N   1 
ATOM   1013 C  CA  . ALA A 1 132 ? 27.266  6.628   -12.694 1.00 25.35 ? 132  ALA A CA  1 
ATOM   1014 C  C   . ALA A 1 132 ? 27.204  8.070   -13.139 1.00 40.22 ? 132  ALA A C   1 
ATOM   1015 O  O   . ALA A 1 132 ? 26.970  8.904   -12.257 1.00 42.05 ? 132  ALA A O   1 
ATOM   1016 C  CB  . ALA A 1 132 ? 28.702  6.220   -12.338 1.00 26.75 ? 132  ALA A CB  1 
ATOM   1017 N  N   . ASN A 1 133 ? 27.445  8.355   -14.406 1.00 52.18 ? 133  ASN A N   1 
ATOM   1018 C  CA  . ASN A 1 133 ? 27.441  9.729   -14.932 1.00 54.83 ? 133  ASN A CA  1 
ATOM   1019 C  C   . ASN A 1 133 ? 26.275  10.077  -15.855 1.00 55.86 ? 133  ASN A C   1 
ATOM   1020 O  O   . ASN A 1 133 ? 26.259  11.067  -16.581 1.00 48.17 ? 133  ASN A O   1 
ATOM   1021 C  CB  . ASN A 1 133 ? 28.786  10.056  -15.600 1.00 53.46 ? 133  ASN A CB  1 
ATOM   1022 C  CG  . ASN A 1 133 ? 29.898  10.060  -14.563 1.00 61.63 ? 133  ASN A CG  1 
ATOM   1023 O  OD1 . ASN A 1 133 ? 30.480  9.001   -14.290 1.00 61.18 ? 133  ASN A OD1 1 
ATOM   1024 N  ND2 . ASN A 1 133 ? 30.091  11.263  -14.039 1.00 62.38 ? 133  ASN A ND2 1 
ATOM   1025 N  N   . GLY A 1 134 ? 25.257  9.244   -15.829 1.00 65.58 ? 134  GLY A N   1 
ATOM   1026 C  CA  . GLY A 1 134 ? 24.043  9.391   -16.607 1.00 56.74 ? 134  GLY A CA  1 
ATOM   1027 C  C   . GLY A 1 134 ? 24.171  9.039   -18.075 1.00 48.15 ? 134  GLY A C   1 
ATOM   1028 O  O   . GLY A 1 134 ? 23.387  9.618   -18.818 1.00 57.21 ? 134  GLY A O   1 
ATOM   1029 N  N   . GLN A 1 135 ? 25.032  8.176   -18.504 1.00 36.32 ? 135  GLN A N   1 
ATOM   1030 C  CA  . GLN A 1 135 ? 25.185  7.788   -19.906 1.00 41.02 ? 135  GLN A CA  1 
ATOM   1031 C  C   . GLN A 1 135 ? 24.362  6.490   -20.037 1.00 34.20 ? 135  GLN A C   1 
ATOM   1032 O  O   . GLN A 1 135 ? 23.974  5.992   -19.016 1.00 40.81 ? 135  GLN A O   1 
ATOM   1033 C  CB  . GLN A 1 135 ? 26.653  7.435   -20.243 1.00 43.22 ? 135  GLN A CB  1 
ATOM   1034 C  CG  . GLN A 1 135 ? 27.687  8.568   -20.055 1.00 49.83 ? 135  GLN A CG  1 
ATOM   1035 C  CD  . GLN A 1 135 ? 27.238  9.724   -20.948 1.00 67.54 ? 135  GLN A CD  1 
ATOM   1036 O  OE1 . GLN A 1 135 ? 26.399  10.548  -20.588 1.00 74.10 ? 135  GLN A OE1 1 
ATOM   1037 N  NE2 . GLN A 1 135 ? 27.756  9.729   -22.172 1.00 69.09 ? 135  GLN A NE2 1 
ATOM   1038 N  N   . PRO A 1 136 ? 24.223  6.012   -21.249 1.00 33.50 ? 136  PRO A N   1 
ATOM   1039 C  CA  . PRO A 1 136 ? 23.545  4.779   -21.533 1.00 20.84 ? 136  PRO A CA  1 
ATOM   1040 C  C   . PRO A 1 136 ? 24.143  3.429   -21.266 1.00 25.63 ? 136  PRO A C   1 
ATOM   1041 O  O   . PRO A 1 136 ? 23.394  2.430   -21.170 1.00 36.58 ? 136  PRO A O   1 
ATOM   1042 C  CB  . PRO A 1 136 ? 23.582  4.818   -23.105 1.00 38.96 ? 136  PRO A CB  1 
ATOM   1043 C  CG  . PRO A 1 136 ? 23.695  6.277   -23.471 1.00 38.24 ? 136  PRO A CG  1 
ATOM   1044 C  CD  . PRO A 1 136 ? 24.731  6.762   -22.458 1.00 38.96 ? 136  PRO A CD  1 
ATOM   1045 N  N   . TRP A 1 137 ? 25.470  3.301   -21.299 1.00 30.17 ? 137  TRP A N   1 
ATOM   1046 C  CA  . TRP A 1 137 ? 26.144  2.000   -21.140 1.00 31.23 ? 137  TRP A CA  1 
ATOM   1047 C  C   . TRP A 1 137 ? 26.276  1.518   -19.691 1.00 25.67 ? 137  TRP A C   1 
ATOM   1048 O  O   . TRP A 1 137 ? 26.112  2.227   -18.697 1.00 28.80 ? 137  TRP A O   1 
ATOM   1049 C  CB  . TRP A 1 137 ? 27.597  2.023   -21.736 1.00 28.45 ? 137  TRP A CB  1 
ATOM   1050 C  CG  . TRP A 1 137 ? 27.512  2.891   -22.956 1.00 41.93 ? 137  TRP A CG  1 
ATOM   1051 C  CD1 . TRP A 1 137 ? 26.921  2.520   -24.164 1.00 49.54 ? 137  TRP A CD1 1 
ATOM   1052 C  CD2 . TRP A 1 137 ? 27.919  4.253   -23.083 1.00 32.95 ? 137  TRP A CD2 1 
ATOM   1053 N  NE1 . TRP A 1 137 ? 26.952  3.582   -25.043 1.00 38.83 ? 137  TRP A NE1 1 
ATOM   1054 C  CE2 . TRP A 1 137 ? 27.541  4.645   -24.401 1.00 46.38 ? 137  TRP A CE2 1 
ATOM   1055 C  CE3 . TRP A 1 137 ? 28.498  5.188   -22.263 1.00 36.64 ? 137  TRP A CE3 1 
ATOM   1056 C  CZ2 . TRP A 1 137 ? 27.798  5.926   -24.873 1.00 48.30 ? 137  TRP A CZ2 1 
ATOM   1057 C  CZ3 . TRP A 1 137 ? 28.747  6.469   -22.725 1.00 38.34 ? 137  TRP A CZ3 1 
ATOM   1058 C  CH2 . TRP A 1 137 ? 28.393  6.836   -24.027 1.00 46.06 ? 137  TRP A CH2 1 
ATOM   1059 N  N   . THR A 1 138 ? 26.665  0.264   -19.751 1.00 23.64 ? 138  THR A N   1 
ATOM   1060 C  CA  . THR A 1 138 ? 26.940  -0.566  -18.613 1.00 33.11 ? 138  THR A CA  1 
ATOM   1061 C  C   . THR A 1 138 ? 28.128  -1.397  -19.034 1.00 31.13 ? 138  THR A C   1 
ATOM   1062 O  O   . THR A 1 138 ? 28.072  -2.051  -20.072 1.00 34.36 ? 138  THR A O   1 
ATOM   1063 C  CB  . THR A 1 138 ? 25.648  -1.363  -18.104 1.00 21.29 ? 138  THR A CB  1 
ATOM   1064 O  OG1 . THR A 1 138 ? 24.859  -0.208  -17.650 1.00 26.87 ? 138  THR A OG1 1 
ATOM   1065 C  CG2 . THR A 1 138 ? 25.893  -2.410  -17.028 1.00 23.95 ? 138  THR A CG2 1 
ATOM   1066 N  N   . SER A 1 139 ? 29.174  -1.409  -18.229 1.00 37.14 ? 139  SER A N   1 
ATOM   1067 C  CA  . SER A 1 139 ? 30.388  -2.195  -18.409 1.00 32.90 ? 139  SER A CA  1 
ATOM   1068 C  C   . SER A 1 139 ? 30.721  -2.836  -17.023 1.00 37.71 ? 139  SER A C   1 
ATOM   1069 O  O   . SER A 1 139 ? 30.516  -2.161  -15.990 1.00 36.74 ? 139  SER A O   1 
ATOM   1070 C  CB  . SER A 1 139 ? 31.645  -1.443  -18.801 1.00 28.25 ? 139  SER A CB  1 
ATOM   1071 O  OG  . SER A 1 139 ? 31.824  -0.119  -18.330 1.00 27.35 ? 139  SER A OG  1 
ATOM   1072 N  N   . ILE A 1 140 ? 31.217  -4.033  -17.087 1.00 17.53 ? 140  ILE A N   1 
ATOM   1073 C  CA  . ILE A 1 140 ? 31.665  -4.810  -15.921 1.00 28.53 ? 140  ILE A CA  1 
ATOM   1074 C  C   . ILE A 1 140 ? 32.940  -5.556  -16.357 1.00 35.22 ? 140  ILE A C   1 
ATOM   1075 O  O   . ILE A 1 140 ? 32.871  -6.372  -17.299 1.00 43.44 ? 140  ILE A O   1 
ATOM   1076 C  CB  . ILE A 1 140 ? 30.586  -5.862  -15.447 1.00 24.75 ? 140  ILE A CB  1 
ATOM   1077 C  CG1 . ILE A 1 140 ? 29.225  -5.172  -15.109 1.00 24.55 ? 140  ILE A CG1 1 
ATOM   1078 C  CG2 . ILE A 1 140 ? 31.171  -6.792  -14.357 1.00 19.02 ? 140  ILE A CG2 1 
ATOM   1079 C  CD1 . ILE A 1 140 ? 28.111  -6.244  -14.787 1.00 19.98 ? 140  ILE A CD1 1 
ATOM   1080 N  N   . ALA A 1 141 ? 34.055  -5.367  -15.705 1.00 26.38 ? 141  ALA A N   1 
ATOM   1081 C  CA  . ALA A 1 141 ? 35.343  -6.025  -15.972 1.00 16.85 ? 141  ALA A CA  1 
ATOM   1082 C  C   . ALA A 1 141 ? 35.220  -7.462  -15.535 1.00 22.48 ? 141  ALA A C   1 
ATOM   1083 O  O   . ALA A 1 141 ? 35.469  -8.501  -16.135 1.00 35.39 ? 141  ALA A O   1 
ATOM   1084 C  CB  . ALA A 1 141 ? 36.426  -5.222  -15.248 1.00 19.53 ? 141  ALA A CB  1 
ATOM   1085 N  N   . GLU A 1 142 ? 34.844  -7.626  -14.266 1.00 29.54 ? 142  GLU A N   1 
ATOM   1086 C  CA  . GLU A 1 142 ? 34.636  -8.895  -13.609 1.00 24.32 ? 142  GLU A CA  1 
ATOM   1087 C  C   . GLU A 1 142 ? 33.442  -8.858  -12.643 1.00 28.21 ? 142  GLU A C   1 
ATOM   1088 O  O   . GLU A 1 142 ? 33.203  -7.839  -11.975 1.00 23.45 ? 142  GLU A O   1 
ATOM   1089 C  CB  . GLU A 1 142 ? 35.919  -9.156  -12.799 1.00 29.53 ? 142  GLU A CB  1 
ATOM   1090 C  CG  . GLU A 1 142 ? 37.185  -9.660  -13.484 1.00 38.14 ? 142  GLU A CG  1 
ATOM   1091 C  CD  . GLU A 1 142 ? 36.960  -10.724 -14.545 1.00 41.33 ? 142  GLU A CD  1 
ATOM   1092 O  OE1 . GLU A 1 142 ? 36.657  -11.773 -13.986 1.00 30.71 ? 142  GLU A OE1 1 
ATOM   1093 O  OE2 . GLU A 1 142 ? 37.032  -10.613 -15.769 1.00 47.54 ? 142  GLU A OE2 1 
ATOM   1094 N  N   . ILE A 1 143 ? 32.750  -9.974  -12.543 1.00 25.20 ? 143  ILE A N   1 
ATOM   1095 C  CA  . ILE A 1 143 ? 31.602  -10.146 -11.636 1.00 26.83 ? 143  ILE A CA  1 
ATOM   1096 C  C   . ILE A 1 143 ? 31.782  -11.433 -10.861 1.00 34.79 ? 143  ILE A C   1 
ATOM   1097 O  O   . ILE A 1 143 ? 32.089  -12.441 -11.535 1.00 29.98 ? 143  ILE A O   1 
ATOM   1098 C  CB  . ILE A 1 143 ? 30.221  -10.123 -12.387 1.00 31.76 ? 143  ILE A CB  1 
ATOM   1099 C  CG1 . ILE A 1 143 ? 29.079  -10.219 -11.313 1.00 25.84 ? 143  ILE A CG1 1 
ATOM   1100 C  CG2 . ILE A 1 143 ? 30.058  -11.219 -13.454 1.00 32.04 ? 143  ILE A CG2 1 
ATOM   1101 C  CD1 . ILE A 1 143 ? 27.822  -9.477  -11.790 1.00 23.51 ? 143  ILE A CD1 1 
ATOM   1102 N  N   . ASN A 1 144 ? 31.644  -11.414 -9.549  1.00 29.13 ? 144  ASN A N   1 
ATOM   1103 C  CA  . ASN A 1 144 ? 31.749  -12.621 -8.721  1.00 28.49 ? 144  ASN A CA  1 
ATOM   1104 C  C   . ASN A 1 144 ? 30.516  -12.750 -7.807  1.00 25.73 ? 144  ASN A C   1 
ATOM   1105 O  O   . ASN A 1 144 ? 29.890  -11.727 -7.484  1.00 26.01 ? 144  ASN A O   1 
ATOM   1106 C  CB  . ASN A 1 144 ? 32.996  -12.744 -7.883  1.00 35.31 ? 144  ASN A CB  1 
ATOM   1107 C  CG  . ASN A 1 144 ? 34.208  -13.138 -8.737  1.00 37.51 ? 144  ASN A CG  1 
ATOM   1108 O  OD1 . ASN A 1 144 ? 34.419  -14.354 -8.808  1.00 28.22 ? 144  ASN A OD1 1 
ATOM   1109 N  ND2 . ASN A 1 144 ? 34.866  -12.116 -9.269  1.00 24.46 ? 144  ASN A ND2 1 
ATOM   1110 N  N   . VAL A 1 145 ? 30.311  -14.005 -7.421  1.00 23.86 ? 145  VAL A N   1 
ATOM   1111 C  CA  . VAL A 1 145 ? 29.172  -14.300 -6.520  1.00 21.46 ? 145  VAL A CA  1 
ATOM   1112 C  C   . VAL A 1 145 ? 29.760  -15.020 -5.341  1.00 23.66 ? 145  VAL A C   1 
ATOM   1113 O  O   . VAL A 1 145 ? 30.726  -15.814 -5.525  1.00 27.13 ? 145  VAL A O   1 
ATOM   1114 C  CB  . VAL A 1 145 ? 28.030  -15.048 -7.217  1.00 24.08 ? 145  VAL A CB  1 
ATOM   1115 C  CG1 . VAL A 1 145 ? 26.908  -15.410 -6.245  1.00 21.03 ? 145  VAL A CG1 1 
ATOM   1116 C  CG2 . VAL A 1 145 ? 27.500  -14.380 -8.465  1.00 31.53 ? 145  VAL A CG2 1 
ATOM   1117 N  N   . PHE A 1 146 ? 29.214  -14.721 -4.160  1.00 24.23 ? 146  PHE A N   1 
ATOM   1118 C  CA  . PHE A 1 146 ? 29.811  -15.378 -2.930  1.00 13.40 ? 146  PHE A CA  1 
ATOM   1119 C  C   . PHE A 1 146 ? 28.759  -16.233 -2.247  1.00 18.87 ? 146  PHE A C   1 
ATOM   1120 O  O   . PHE A 1 146 ? 27.539  -16.008 -2.290  1.00 23.09 ? 146  PHE A O   1 
ATOM   1121 C  CB  . PHE A 1 146 ? 30.298  -14.365 -1.913  1.00 12.67 ? 146  PHE A CB  1 
ATOM   1122 C  CG  . PHE A 1 146 ? 31.255  -13.471 -2.683  1.00 20.50 ? 146  PHE A CG  1 
ATOM   1123 C  CD1 . PHE A 1 146 ? 30.870  -12.430 -3.460  1.00 18.61 ? 146  PHE A CD1 1 
ATOM   1124 C  CD2 . PHE A 1 146 ? 32.609  -13.796 -2.649  1.00 26.97 ? 146  PHE A CD2 1 
ATOM   1125 C  CE1 . PHE A 1 146 ? 31.753  -11.655 -4.194  1.00 20.60 ? 146  PHE A CE1 1 
ATOM   1126 C  CE2 . PHE A 1 146 ? 33.517  -13.045 -3.388  1.00 22.99 ? 146  PHE A CE2 1 
ATOM   1127 C  CZ  . PHE A 1 146 ? 33.068  -11.989 -4.169  1.00 22.60 ? 146  PHE A CZ  1 
ATOM   1128 N  N   . GLN A 1 147 ? 29.281  -17.208 -1.558  1.00 20.73 ? 147  GLN A N   1 
ATOM   1129 C  CA  . GLN A 1 147 ? 28.441  -18.145 -0.842  1.00 28.64 ? 147  GLN A CA  1 
ATOM   1130 C  C   . GLN A 1 147 ? 28.950  -18.189 0.619   1.00 40.09 ? 147  GLN A C   1 
ATOM   1131 O  O   . GLN A 1 147 ? 30.149  -18.016 0.829   1.00 36.63 ? 147  GLN A O   1 
ATOM   1132 C  CB  . GLN A 1 147 ? 28.504  -19.576 -1.350  1.00 37.99 ? 147  GLN A CB  1 
ATOM   1133 C  CG  . GLN A 1 147 ? 29.947  -19.973 -1.483  1.00 41.36 ? 147  GLN A CG  1 
ATOM   1134 C  CD  . GLN A 1 147 ? 30.226  -21.400 -1.813  1.00 60.28 ? 147  GLN A CD  1 
ATOM   1135 O  OE1 . GLN A 1 147 ? 29.339  -22.182 -2.111  1.00 66.01 ? 147  GLN A OE1 1 
ATOM   1136 N  NE2 . GLN A 1 147 ? 31.547  -21.661 -1.771  1.00 71.42 ? 147  GLN A NE2 1 
ATOM   1137 N  N   . ALA A 1 148 ? 27.983  -18.488 1.441   1.00 36.70 ? 148  ALA A N   1 
ATOM   1138 C  CA  . ALA A 1 148 ? 28.044  -18.713 2.866   1.00 35.34 ? 148  ALA A CA  1 
ATOM   1139 C  C   . ALA A 1 148 ? 28.482  -20.189 2.986   1.00 47.73 ? 148  ALA A C   1 
ATOM   1140 O  O   . ALA A 1 148 ? 28.389  -21.007 2.037   1.00 36.44 ? 148  ALA A O   1 
ATOM   1141 C  CB  . ALA A 1 148 ? 26.641  -18.494 3.450   1.00 30.13 ? 148  ALA A CB  1 
ATOM   1142 N  N   . SER A 1 149 ? 28.947  -20.502 4.168   1.00 63.90 ? 149  SER A N   1 
ATOM   1143 C  CA  . SER A 1 149 ? 29.416  -21.837 4.567   1.00 80.73 ? 149  SER A CA  1 
ATOM   1144 C  C   . SER A 1 149 ? 28.269  -22.839 4.658   1.00 87.24 ? 149  SER A C   1 
ATOM   1145 O  O   . SER A 1 149 ? 28.424  -24.048 4.445   1.00 89.94 ? 149  SER A O   1 
ATOM   1146 C  CB  . SER A 1 149 ? 30.074  -21.723 5.953   1.00 91.39 ? 149  SER A CB  1 
ATOM   1147 O  OG  . SER A 1 149 ? 29.181  -21.021 6.833   1.00 97.53 ? 149  SER A OG  1 
ATOM   1148 N  N   . SER A 1 150 ? 27.109  -22.286 5.012   1.00 83.33 ? 150  SER A N   1 
ATOM   1149 C  CA  . SER A 1 150 ? 25.859  -22.998 5.206   1.00 72.93 ? 150  SER A CA  1 
ATOM   1150 C  C   . SER A 1 150 ? 24.717  -21.980 5.250   1.00 58.00 ? 150  SER A C   1 
ATOM   1151 O  O   . SER A 1 150 ? 24.939  -20.792 5.391   1.00 66.34 ? 150  SER A O   1 
ATOM   1152 C  CB  . SER A 1 150 ? 25.766  -23.667 6.588   1.00 76.20 ? 150  SER A CB  1 
ATOM   1153 O  OG  . SER A 1 150 ? 26.102  -22.639 7.540   1.00 78.97 ? 150  SER A OG  1 
ATOM   1154 N  N   . TYR A 1 151 ? 23.530  -22.526 5.206   1.00 55.42 ? 151  TYR A N   1 
ATOM   1155 C  CA  . TYR A 1 151 ? 22.275  -21.792 5.267   1.00 41.61 ? 151  TYR A CA  1 
ATOM   1156 C  C   . TYR A 1 151 ? 21.362  -22.344 6.383   1.00 57.22 ? 151  TYR A C   1 
ATOM   1157 O  O   . TYR A 1 151 ? 21.114  -23.542 6.451   1.00 62.95 ? 151  TYR A O   1 
ATOM   1158 C  CB  . TYR A 1 151 ? 21.479  -21.998 4.019   1.00 41.30 ? 151  TYR A CB  1 
ATOM   1159 C  CG  . TYR A 1 151 ? 20.131  -21.348 4.053   1.00 43.61 ? 151  TYR A CG  1 
ATOM   1160 C  CD1 . TYR A 1 151 ? 20.081  -19.946 4.081   1.00 47.41 ? 151  TYR A CD1 1 
ATOM   1161 C  CD2 . TYR A 1 151 ? 18.941  -22.085 4.050   1.00 39.17 ? 151  TYR A CD2 1 
ATOM   1162 C  CE1 . TYR A 1 151 ? 18.853  -19.294 4.046   1.00 51.96 ? 151  TYR A CE1 1 
ATOM   1163 C  CE2 . TYR A 1 151 ? 17.724  -21.420 4.031   1.00 43.48 ? 151  TYR A CE2 1 
ATOM   1164 C  CZ  . TYR A 1 151 ? 17.659  -20.044 4.009   1.00 46.72 ? 151  TYR A CZ  1 
ATOM   1165 O  OH  . TYR A 1 151 ? 16.481  -19.351 4.014   1.00 37.59 ? 151  TYR A OH  1 
ATOM   1166 N  N   . THR A 1 152 ? 20.858  -21.416 7.154   1.00 61.23 ? 152  THR A N   1 
ATOM   1167 C  CA  . THR A 1 152 ? 19.973  -21.651 8.283   1.00 63.72 ? 152  THR A CA  1 
ATOM   1168 C  C   . THR A 1 152 ? 18.813  -20.665 8.106   1.00 54.80 ? 152  THR A C   1 
ATOM   1169 O  O   . THR A 1 152 ? 19.054  -19.460 8.184   1.00 51.65 ? 152  THR A O   1 
ATOM   1170 C  CB  . THR A 1 152 ? 20.751  -21.419 9.652   1.00 70.23 ? 152  THR A CB  1 
ATOM   1171 O  OG1 . THR A 1 152 ? 21.956  -22.239 9.641   1.00 74.03 ? 152  THR A OG1 1 
ATOM   1172 C  CG2 . THR A 1 152 ? 19.949  -21.715 10.923  1.00 75.68 ? 152  THR A CG2 1 
ATOM   1173 N  N   . ALA A 1 153 ? 17.655  -21.182 7.859   1.00 39.63 ? 153  ALA A N   1 
ATOM   1174 C  CA  . ALA A 1 153 ? 16.449  -20.395 7.700   1.00 49.19 ? 153  ALA A CA  1 
ATOM   1175 C  C   . ALA A 1 153 ? 16.193  -19.586 8.989   1.00 44.44 ? 153  ALA A C   1 
ATOM   1176 O  O   . ALA A 1 153 ? 16.379  -20.125 10.086  1.00 38.32 ? 153  ALA A O   1 
ATOM   1177 C  CB  . ALA A 1 153 ? 15.280  -21.365 7.488   1.00 51.44 ? 153  ALA A CB  1 
ATOM   1178 N  N   . PRO A 1 154 ? 15.816  -18.352 8.779   1.00 36.92 ? 154  PRO A N   1 
ATOM   1179 C  CA  . PRO A 1 154 ? 15.459  -17.490 9.937   1.00 33.09 ? 154  PRO A CA  1 
ATOM   1180 C  C   . PRO A 1 154 ? 14.347  -18.234 10.687  1.00 37.74 ? 154  PRO A C   1 
ATOM   1181 O  O   . PRO A 1 154 ? 13.559  -19.026 10.107  1.00 28.99 ? 154  PRO A O   1 
ATOM   1182 C  CB  . PRO A 1 154 ? 14.958  -16.215 9.359   1.00 29.85 ? 154  PRO A CB  1 
ATOM   1183 C  CG  . PRO A 1 154 ? 15.033  -16.294 7.888   1.00 29.70 ? 154  PRO A CG  1 
ATOM   1184 C  CD  . PRO A 1 154 ? 15.575  -17.677 7.529   1.00 35.98 ? 154  PRO A CD  1 
ATOM   1185 N  N   . GLN A 1 155 ? 14.336  -18.050 11.987  1.00 29.85 ? 155  GLN A N   1 
ATOM   1186 C  CA  . GLN A 1 155 ? 13.303  -18.709 12.805  1.00 25.79 ? 155  GLN A CA  1 
ATOM   1187 C  C   . GLN A 1 155 ? 12.062  -17.809 12.759  1.00 24.06 ? 155  GLN A C   1 
ATOM   1188 O  O   . GLN A 1 155 ? 12.096  -16.586 12.729  1.00 20.75 ? 155  GLN A O   1 
ATOM   1189 C  CB  . GLN A 1 155 ? 13.754  -18.930 14.222  1.00 38.61 ? 155  GLN A CB  1 
ATOM   1190 C  CG  . GLN A 1 155 ? 14.750  -20.027 14.527  1.00 65.65 ? 155  GLN A CG  1 
ATOM   1191 C  CD  . GLN A 1 155 ? 14.893  -20.085 16.054  1.00 90.35 ? 155  GLN A CD  1 
ATOM   1192 O  OE1 . GLN A 1 155 ? 15.860  -19.690 16.723  1.00 93.35 ? 155  GLN A OE1 1 
ATOM   1193 N  NE2 . GLN A 1 155 ? 13.793  -20.570 16.646  1.00 97.66 ? 155  GLN A NE2 1 
ATOM   1194 N  N   . PRO A 1 156 ? 10.913  -18.481 12.803  1.00 25.54 ? 156  PRO A N   1 
ATOM   1195 C  CA  . PRO A 1 156 ? 9.636   -17.829 12.782  1.00 41.30 ? 156  PRO A CA  1 
ATOM   1196 C  C   . PRO A 1 156 ? 9.424   -17.042 14.074  1.00 27.70 ? 156  PRO A C   1 
ATOM   1197 O  O   . PRO A 1 156 ? 9.839   -17.484 15.123  1.00 27.72 ? 156  PRO A O   1 
ATOM   1198 C  CB  . PRO A 1 156 ? 8.590   -18.944 12.583  1.00 47.17 ? 156  PRO A CB  1 
ATOM   1199 C  CG  . PRO A 1 156 ? 9.418   -20.206 12.417  1.00 51.90 ? 156  PRO A CG  1 
ATOM   1200 C  CD  . PRO A 1 156 ? 10.830  -19.954 12.837  1.00 44.04 ? 156  PRO A CD  1 
ATOM   1201 N  N   . GLY A 1 157 ? 8.794   -15.877 13.927  1.00 27.48 ? 157  GLY A N   1 
ATOM   1202 C  CA  . GLY A 1 157 ? 8.517   -15.061 15.091  1.00 32.21 ? 157  GLY A CA  1 
ATOM   1203 C  C   . GLY A 1 157 ? 9.697   -14.200 15.592  1.00 26.94 ? 157  GLY A C   1 
ATOM   1204 O  O   . GLY A 1 157 ? 9.402   -13.475 16.510  1.00 22.88 ? 157  GLY A O   1 
ATOM   1205 N  N   . LEU A 1 158 ? 10.848  -14.296 14.997  1.00 23.09 ? 158  LEU A N   1 
ATOM   1206 C  CA  . LEU A 1 158 ? 12.007  -13.498 15.440  1.00 19.59 ? 158  LEU A CA  1 
ATOM   1207 C  C   . LEU A 1 158 ? 12.437  -12.390 14.500  1.00 19.50 ? 158  LEU A C   1 
ATOM   1208 O  O   . LEU A 1 158 ? 13.658  -12.078 14.399  1.00 18.67 ? 158  LEU A O   1 
ATOM   1209 C  CB  . LEU A 1 158 ? 13.087  -14.486 15.815  1.00 12.70 ? 158  LEU A CB  1 
ATOM   1210 C  CG  . LEU A 1 158 ? 12.904  -15.439 16.980  1.00 13.00 ? 158  LEU A CG  1 
ATOM   1211 C  CD1 . LEU A 1 158 ? 14.247  -16.011 17.310  1.00 13.83 ? 158  LEU A CD1 1 
ATOM   1212 C  CD2 . LEU A 1 158 ? 12.362  -14.712 18.167  1.00 20.22 ? 158  LEU A CD2 1 
ATOM   1213 N  N   . GLY A 1 159 ? 11.570  -11.795 13.772  1.00 12.39 ? 159  GLY A N   1 
ATOM   1214 C  CA  . GLY A 1 159 ? 11.944  -10.650 12.875  1.00 14.20 ? 159  GLY A CA  1 
ATOM   1215 C  C   . GLY A 1 159 ? 12.716  -11.234 11.683  1.00 13.11 ? 159  GLY A C   1 
ATOM   1216 O  O   . GLY A 1 159 ? 13.001  -12.435 11.513  1.00 20.14 ? 159  GLY A O   1 
ATOM   1217 N  N   . ARG A 1 160 ? 12.912  -10.337 10.760  1.00 14.77 ? 160  ARG A N   1 
ATOM   1218 C  CA  . ARG A 1 160 ? 13.667  -10.674 9.551   1.00 16.48 ? 160  ARG A CA  1 
ATOM   1219 C  C   . ARG A 1 160 ? 14.568  -9.495  9.126   1.00 9.56  ? 160  ARG A C   1 
ATOM   1220 O  O   . ARG A 1 160 ? 14.173  -8.305  9.121   1.00 15.73 ? 160  ARG A O   1 
ATOM   1221 C  CB  . ARG A 1 160 ? 12.688  -10.837 8.368   1.00 20.27 ? 160  ARG A CB  1 
ATOM   1222 C  CG  . ARG A 1 160 ? 11.690  -11.964 8.388   1.00 38.79 ? 160  ARG A CG  1 
ATOM   1223 C  CD  . ARG A 1 160 ? 12.284  -13.268 8.001   1.00 59.06 ? 160  ARG A CD  1 
ATOM   1224 N  NE  . ARG A 1 160 ? 11.324  -14.287 8.435   1.00 84.70 ? 160  ARG A NE  1 
ATOM   1225 C  CZ  . ARG A 1 160 ? 11.162  -15.433 7.763   1.00 99.99 ? 160  ARG A CZ  1 
ATOM   1226 N  NH1 . ARG A 1 160 ? 11.813  -15.738 6.634   1.00 99.99 ? 160  ARG A NH1 1 
ATOM   1227 N  NH2 . ARG A 1 160 ? 10.341  -16.339 8.311   1.00 99.99 ? 160  ARG A NH2 1 
ATOM   1228 N  N   . TRP A 1 161 ? 15.709  -9.848  8.609   1.00 11.05 ? 161  TRP A N   1 
ATOM   1229 C  CA  . TRP A 1 161 ? 16.682  -8.868  8.082   1.00 8.05  ? 161  TRP A CA  1 
ATOM   1230 C  C   . TRP A 1 161 ? 16.597  -8.840  6.561   1.00 17.09 ? 161  TRP A C   1 
ATOM   1231 O  O   . TRP A 1 161 ? 16.490  -9.928  5.996   1.00 16.21 ? 161  TRP A O   1 
ATOM   1232 C  CB  . TRP A 1 161 ? 18.074  -9.367  8.437   1.00 15.38 ? 161  TRP A CB  1 
ATOM   1233 C  CG  . TRP A 1 161 ? 18.489  -9.036  9.855   1.00 14.27 ? 161  TRP A CG  1 
ATOM   1234 C  CD1 . TRP A 1 161 ? 18.432  -9.821  10.951  1.00 10.85 ? 161  TRP A CD1 1 
ATOM   1235 C  CD2 . TRP A 1 161 ? 18.946  -7.748  10.277  1.00 11.60 ? 161  TRP A CD2 1 
ATOM   1236 N  NE1 . TRP A 1 161 ? 18.867  -9.138  12.046  1.00 14.25 ? 161  TRP A NE1 1 
ATOM   1237 C  CE2 . TRP A 1 161 ? 19.169  -7.845  11.677  1.00 13.30 ? 161  TRP A CE2 1 
ATOM   1238 C  CE3 . TRP A 1 161 ? 19.178  -6.541  9.604   1.00 11.72 ? 161  TRP A CE3 1 
ATOM   1239 C  CZ2 . TRP A 1 161 ? 19.687  -6.762  12.419  1.00 10.81 ? 161  TRP A CZ2 1 
ATOM   1240 C  CZ3 . TRP A 1 161 ? 19.674  -5.486  10.333  1.00 9.26  ? 161  TRP A CZ3 1 
ATOM   1241 C  CH2 . TRP A 1 161 ? 19.873  -5.578  11.715  1.00 10.87 ? 161  TRP A CH2 1 
ATOM   1242 N  N   . GLY A 1 162 ? 16.687  -7.698  5.931   1.00 12.40 ? 162  GLY A N   1 
ATOM   1243 C  CA  . GLY A 1 162 ? 16.685  -7.516  4.487   1.00 14.05 ? 162  GLY A CA  1 
ATOM   1244 C  C   . GLY A 1 162 ? 15.610  -6.541  4.090   1.00 24.16 ? 162  GLY A C   1 
ATOM   1245 O  O   . GLY A 1 162 ? 14.629  -6.338  4.831   1.00 19.58 ? 162  GLY A O   1 
ATOM   1246 N  N   . PRO A 1 163 ? 15.803  -5.933  2.931   1.00 17.82 ? 163  PRO A N   1 
ATOM   1247 C  CA  . PRO A 1 163 ? 16.916  -6.144  2.043   1.00 13.95 ? 163  PRO A CA  1 
ATOM   1248 C  C   . PRO A 1 163 ? 18.146  -5.309  2.442   1.00 12.19 ? 163  PRO A C   1 
ATOM   1249 O  O   . PRO A 1 163 ? 18.127  -4.709  3.489   1.00 11.55 ? 163  PRO A O   1 
ATOM   1250 C  CB  . PRO A 1 163 ? 16.369  -5.498  0.754   1.00 12.43 ? 163  PRO A CB  1 
ATOM   1251 C  CG  . PRO A 1 163 ? 15.502  -4.346  1.208   1.00 16.02 ? 163  PRO A CG  1 
ATOM   1252 C  CD  . PRO A 1 163 ? 14.813  -4.968  2.437   1.00 15.74 ? 163  PRO A CD  1 
ATOM   1253 N  N   . THR A 1 164 ? 19.144  -5.350  1.633   1.00 11.78 ? 164  THR A N   1 
ATOM   1254 C  CA  . THR A 1 164 ? 20.362  -4.554  1.825   1.00 6.51  ? 164  THR A CA  1 
ATOM   1255 C  C   . THR A 1 164 ? 20.171  -3.311  0.951   1.00 8.95  ? 164  THR A C   1 
ATOM   1256 O  O   . THR A 1 164 ? 19.670  -3.350  -0.186  1.00 12.28 ? 164  THR A O   1 
ATOM   1257 C  CB  . THR A 1 164 ? 21.692  -5.269  1.400   1.00 7.45  ? 164  THR A CB  1 
ATOM   1258 O  OG1 . THR A 1 164 ? 21.968  -6.315  2.351   1.00 10.96 ? 164  THR A OG1 1 
ATOM   1259 C  CG2 . THR A 1 164 ? 22.910  -4.267  1.374   1.00 11.13 ? 164  THR A CG2 1 
ATOM   1260 N  N   . ILE A 1 165 ? 20.543  -2.169  1.426   1.00 5.00  ? 165  ILE A N   1 
ATOM   1261 C  CA  . ILE A 1 165 ? 20.503  -0.914  0.695   1.00 8.92  ? 165  ILE A CA  1 
ATOM   1262 C  C   . ILE A 1 165 ? 21.996  -0.623  0.382   1.00 25.86 ? 165  ILE A C   1 
ATOM   1263 O  O   . ILE A 1 165 ? 22.747  -0.298  1.337   1.00 21.50 ? 165  ILE A O   1 
ATOM   1264 C  CB  . ILE A 1 165 ? 19.877  0.277   1.493   1.00 11.33 ? 165  ILE A CB  1 
ATOM   1265 C  CG1 . ILE A 1 165 ? 18.446  -0.049  2.087   1.00 10.91 ? 165  ILE A CG1 1 
ATOM   1266 C  CG2 . ILE A 1 165 ? 19.972  1.629   0.691   1.00 6.84  ? 165  ILE A CG2 1 
ATOM   1267 C  CD1 . ILE A 1 165 ? 17.543  -0.958  1.297   1.00 33.56 ? 165  ILE A CD1 1 
ATOM   1268 N  N   . ASP A 1 166 ? 22.467  -0.674  -0.852  1.00 18.87 ? 166  ASP A N   1 
ATOM   1269 C  CA  . ASP A 1 166 ? 23.875  -0.345  -1.210  1.00 13.81 ? 166  ASP A CA  1 
ATOM   1270 C  C   . ASP A 1 166 ? 23.940  1.168   -1.257  1.00 9.93  ? 166  ASP A C   1 
ATOM   1271 O  O   . ASP A 1 166 ? 23.041  1.766   -1.838  1.00 12.56 ? 166  ASP A O   1 
ATOM   1272 C  CB  . ASP A 1 166 ? 24.290  -0.886  -2.600  1.00 8.69  ? 166  ASP A CB  1 
ATOM   1273 C  CG  . ASP A 1 166 ? 24.277  -2.397  -2.555  1.00 17.28 ? 166  ASP A CG  1 
ATOM   1274 O  OD1 . ASP A 1 166 ? 24.366  -2.997  -1.452  1.00 19.01 ? 166  ASP A OD1 1 
ATOM   1275 O  OD2 . ASP A 1 166 ? 24.126  -3.024  -3.632  1.00 15.86 ? 166  ASP A OD2 1 
ATOM   1276 N  N   . LEU A 1 167 ? 25.035  1.727   -0.670  1.00 15.74 ? 167  LEU A N   1 
ATOM   1277 C  CA  . LEU A 1 167 ? 25.243  3.191   -0.708  1.00 13.68 ? 167  LEU A CA  1 
ATOM   1278 C  C   . LEU A 1 167 ? 26.594  3.637   -1.275  1.00 19.11 ? 167  LEU A C   1 
ATOM   1279 O  O   . LEU A 1 167 ? 27.531  2.818   -1.326  1.00 15.97 ? 167  LEU A O   1 
ATOM   1280 C  CB  . LEU A 1 167 ? 25.301  3.634   0.806   1.00 6.21  ? 167  LEU A CB  1 
ATOM   1281 C  CG  . LEU A 1 167 ? 24.011  3.248   1.560   1.00 15.79 ? 167  LEU A CG  1 
ATOM   1282 C  CD1 . LEU A 1 167 ? 24.305  3.368   3.059   1.00 13.64 ? 167  LEU A CD1 1 
ATOM   1283 C  CD2 . LEU A 1 167 ? 22.921  4.249   1.150   1.00 8.05  ? 167  LEU A CD2 1 
ATOM   1284 N  N   . PRO A 1 168 ? 26.714  4.895   -1.665  1.00 19.98 ? 168  PRO A N   1 
ATOM   1285 C  CA  . PRO A 1 168 ? 27.984  5.450   -2.171  1.00 13.81 ? 168  PRO A CA  1 
ATOM   1286 C  C   . PRO A 1 168 ? 28.985  5.765   -1.061  1.00 15.57 ? 168  PRO A C   1 
ATOM   1287 O  O   . PRO A 1 168 ? 30.173  6.034   -1.335  1.00 20.09 ? 168  PRO A O   1 
ATOM   1288 C  CB  . PRO A 1 168 ? 27.522  6.770   -2.783  1.00 9.95  ? 168  PRO A CB  1 
ATOM   1289 C  CG  . PRO A 1 168 ? 26.252  7.180   -2.066  1.00 16.61 ? 168  PRO A CG  1 
ATOM   1290 C  CD  . PRO A 1 168 ? 25.597  5.842   -1.794  1.00 10.94 ? 168  PRO A CD  1 
ATOM   1291 N  N   . ILE A 1 169 ? 28.548  5.828   0.198   1.00 10.60 ? 169  ILE A N   1 
ATOM   1292 C  CA  . ILE A 1 169 ? 29.320  6.191   1.354   1.00 9.20  ? 169  ILE A CA  1 
ATOM   1293 C  C   . ILE A 1 169 ? 29.171  5.264   2.544   1.00 20.13 ? 169  ILE A C   1 
ATOM   1294 O  O   . ILE A 1 169 ? 28.264  4.409   2.465   1.00 16.86 ? 169  ILE A O   1 
ATOM   1295 C  CB  . ILE A 1 169 ? 28.960  7.641   1.823   1.00 9.38  ? 169  ILE A CB  1 
ATOM   1296 C  CG1 . ILE A 1 169 ? 27.484  7.607   2.365   1.00 14.10 ? 169  ILE A CG1 1 
ATOM   1297 C  CG2 . ILE A 1 169 ? 29.084  8.639   0.655   1.00 14.22 ? 169  ILE A CG2 1 
ATOM   1298 C  CD1 . ILE A 1 169 ? 27.182  8.963   3.080   1.00 17.99 ? 169  ILE A CD1 1 
ATOM   1299 N  N   . VAL A 1 170 ? 30.084  5.469   3.529   1.00 17.99 ? 170  VAL A N   1 
ATOM   1300 C  CA  . VAL A 1 170 ? 29.915  4.683   4.794   1.00 12.39 ? 170  VAL A CA  1 
ATOM   1301 C  C   . VAL A 1 170 ? 28.988  5.565   5.628   1.00 14.02 ? 170  VAL A C   1 
ATOM   1302 O  O   . VAL A 1 170 ? 29.448  6.704   5.901   1.00 20.07 ? 170  VAL A O   1 
ATOM   1303 C  CB  . VAL A 1 170 ? 31.251  4.368   5.494   1.00 17.78 ? 170  VAL A CB  1 
ATOM   1304 C  CG1 . VAL A 1 170 ? 30.935  3.672   6.825   1.00 7.68  ? 170  VAL A CG1 1 
ATOM   1305 C  CG2 . VAL A 1 170 ? 32.176  3.576   4.592   1.00 11.08 ? 170  VAL A CG2 1 
ATOM   1306 N  N   . PRO A 1 171 ? 27.759  5.163   5.979   1.00 13.18 ? 171  PRO A N   1 
ATOM   1307 C  CA  . PRO A 1 171 ? 26.868  6.122   6.711   1.00 13.54 ? 171  PRO A CA  1 
ATOM   1308 C  C   . PRO A 1 171 ? 27.323  6.160   8.181   1.00 24.78 ? 171  PRO A C   1 
ATOM   1309 O  O   . PRO A 1 171 ? 26.765  5.413   8.995   1.00 24.35 ? 171  PRO A O   1 
ATOM   1310 C  CB  . PRO A 1 171 ? 25.521  5.500   6.402   1.00 8.39  ? 171  PRO A CB  1 
ATOM   1311 C  CG  . PRO A 1 171 ? 25.737  3.982   6.245   1.00 5.00  ? 171  PRO A CG  1 
ATOM   1312 C  CD  . PRO A 1 171 ? 27.130  3.867   5.642   1.00 5.00  ? 171  PRO A CD  1 
ATOM   1313 N  N   . ALA A 1 172 ? 28.305  6.940   8.606   1.00 16.64 ? 172  ALA A N   1 
ATOM   1314 C  CA  . ALA A 1 172 ? 28.753  6.911   10.036  1.00 9.31  ? 172  ALA A CA  1 
ATOM   1315 C  C   . ALA A 1 172 ? 27.920  7.853   10.889  1.00 15.56 ? 172  ALA A C   1 
ATOM   1316 O  O   . ALA A 1 172 ? 28.135  7.761   12.093  1.00 16.76 ? 172  ALA A O   1 
ATOM   1317 C  CB  . ALA A 1 172 ? 30.226  7.287   10.030  1.00 10.06 ? 172  ALA A CB  1 
ATOM   1318 N  N   . ALA A 1 173 ? 27.047  8.673   10.309  1.00 12.28 ? 173  ALA A N   1 
ATOM   1319 C  CA  . ALA A 1 173 ? 26.146  9.645   10.899  1.00 5.55  ? 173  ALA A CA  1 
ATOM   1320 C  C   . ALA A 1 173 ? 24.903  9.606   10.011  1.00 5.40  ? 173  ALA A C   1 
ATOM   1321 O  O   . ALA A 1 173 ? 24.880  9.498   8.773   1.00 9.52  ? 173  ALA A O   1 
ATOM   1322 C  CB  . ALA A 1 173 ? 26.673  11.031  11.217  1.00 5.00  ? 173  ALA A CB  1 
ATOM   1323 N  N   . ALA A 1 174 ? 23.761  9.661   10.694  1.00 8.07  ? 174  ALA A N   1 
ATOM   1324 C  CA  . ALA A 1 174 ? 22.476  9.605   9.976   1.00 6.03  ? 174  ALA A CA  1 
ATOM   1325 C  C   . ALA A 1 174 ? 21.395  10.306  10.827  1.00 16.13 ? 174  ALA A C   1 
ATOM   1326 O  O   . ALA A 1 174 ? 21.465  10.521  12.055  1.00 13.43 ? 174  ALA A O   1 
ATOM   1327 C  CB  . ALA A 1 174 ? 22.241  8.088   9.777   1.00 9.05  ? 174  ALA A CB  1 
ATOM   1328 N  N   . ALA A 1 175 ? 20.379  10.752  10.141  1.00 12.83 ? 175  ALA A N   1 
ATOM   1329 C  CA  . ALA A 1 175 ? 19.182  11.381  10.699  1.00 16.32 ? 175  ALA A CA  1 
ATOM   1330 C  C   . ALA A 1 175 ? 17.965  11.013  9.823   1.00 17.31 ? 175  ALA A C   1 
ATOM   1331 O  O   . ALA A 1 175 ? 18.229  10.725  8.647   1.00 17.83 ? 175  ALA A O   1 
ATOM   1332 C  CB  . ALA A 1 175 ? 19.363  12.886  10.703  1.00 13.70 ? 175  ALA A CB  1 
ATOM   1333 N  N   . ILE A 1 176 ? 16.762  11.038  10.338  1.00 19.80 ? 176  ILE A N   1 
ATOM   1334 C  CA  . ILE A 1 176 ? 15.549  10.854  9.519   1.00 10.97 ? 176  ILE A CA  1 
ATOM   1335 C  C   . ILE A 1 176 ? 15.161  12.281  9.110   1.00 14.71 ? 176  ILE A C   1 
ATOM   1336 O  O   . ILE A 1 176 ? 15.075  13.032  10.099  1.00 17.32 ? 176  ILE A O   1 
ATOM   1337 C  CB  . ILE A 1 176 ? 14.367  10.182  10.279  1.00 6.65  ? 176  ILE A CB  1 
ATOM   1338 C  CG1 . ILE A 1 176 ? 14.746  8.731   10.728  1.00 5.07  ? 176  ILE A CG1 1 
ATOM   1339 C  CG2 . ILE A 1 176 ? 13.098  10.282  9.413   1.00 10.06 ? 176  ILE A CG2 1 
ATOM   1340 C  CD1 . ILE A 1 176 ? 15.187  7.880   9.526   1.00 13.62 ? 176  ILE A CD1 1 
ATOM   1341 N  N   . GLU A 1 177 ? 14.898  12.712  7.892   1.00 24.03 ? 177  GLU A N   1 
ATOM   1342 C  CA  . GLU A 1 177 ? 14.394  14.087  7.586   1.00 21.36 ? 177  GLU A CA  1 
ATOM   1343 C  C   . GLU A 1 177 ? 12.863  13.896  7.887   1.00 20.94 ? 177  GLU A C   1 
ATOM   1344 O  O   . GLU A 1 177 ? 12.157  13.064  7.262   1.00 19.03 ? 177  GLU A O   1 
ATOM   1345 C  CB  . GLU A 1 177 ? 14.532  14.451  6.106   1.00 18.48 ? 177  GLU A CB  1 
ATOM   1346 C  CG  . GLU A 1 177 ? 15.908  14.109  5.585   1.00 17.17 ? 177  GLU A CG  1 
ATOM   1347 C  CD  . GLU A 1 177 ? 16.290  14.280  4.159   1.00 24.14 ? 177  GLU A CD  1 
ATOM   1348 O  OE1 . GLU A 1 177 ? 15.328  14.642  3.480   1.00 25.89 ? 177  GLU A OE1 1 
ATOM   1349 O  OE2 . GLU A 1 177 ? 17.363  14.041  3.656   1.00 24.20 ? 177  GLU A OE2 1 
ATOM   1350 N  N   . PRO A 1 178 ? 12.420  14.554  8.950   1.00 23.14 ? 178  PRO A N   1 
ATOM   1351 C  CA  . PRO A 1 178 ? 11.034  14.418  9.393   1.00 24.05 ? 178  PRO A CA  1 
ATOM   1352 C  C   . PRO A 1 178 ? 9.962   14.818  8.376   1.00 27.51 ? 178  PRO A C   1 
ATOM   1353 O  O   . PRO A 1 178 ? 9.003   14.060  8.449   1.00 26.17 ? 178  PRO A O   1 
ATOM   1354 C  CB  . PRO A 1 178 ? 10.910  15.141  10.701  1.00 15.42 ? 178  PRO A CB  1 
ATOM   1355 C  CG  . PRO A 1 178 ? 12.124  15.990  10.740  1.00 20.94 ? 178  PRO A CG  1 
ATOM   1356 C  CD  . PRO A 1 178 ? 13.186  15.500  9.794   1.00 16.79 ? 178  PRO A CD  1 
ATOM   1357 N  N   . THR A 1 179 ? 10.210  15.829  7.572   1.00 23.50 ? 179  THR A N   1 
ATOM   1358 C  CA  . THR A 1 179 ? 9.142   16.227  6.612   1.00 23.41 ? 179  THR A CA  1 
ATOM   1359 C  C   . THR A 1 179 ? 9.060   15.320  5.409   1.00 27.59 ? 179  THR A C   1 
ATOM   1360 O  O   . THR A 1 179 ? 7.953   15.080  4.913   1.00 38.98 ? 179  THR A O   1 
ATOM   1361 C  CB  . THR A 1 179 ? 9.216   17.728  6.209   1.00 26.58 ? 179  THR A CB  1 
ATOM   1362 O  OG1 . THR A 1 179 ? 10.409  17.950  5.428   1.00 29.37 ? 179  THR A OG1 1 
ATOM   1363 C  CG2 . THR A 1 179 ? 9.122   18.695  7.404   1.00 31.81 ? 179  THR A CG2 1 
ATOM   1364 N  N   . SER A 1 180 ? 10.179  14.702  5.076   1.00 29.74 ? 180  SER A N   1 
ATOM   1365 C  CA  . SER A 1 180 ? 10.259  13.826  3.923   1.00 28.61 ? 180  SER A CA  1 
ATOM   1366 C  C   . SER A 1 180 ? 10.282  12.339  4.215   1.00 24.70 ? 180  SER A C   1 
ATOM   1367 O  O   . SER A 1 180 ? 9.927   11.669  3.240   1.00 33.80 ? 180  SER A O   1 
ATOM   1368 C  CB  . SER A 1 180 ? 11.510  14.249  3.134   1.00 23.33 ? 180  SER A CB  1 
ATOM   1369 O  OG  . SER A 1 180 ? 12.633  13.746  3.826   1.00 15.01 ? 180  SER A OG  1 
ATOM   1370 N  N   . GLY A 1 181 ? 10.637  11.924  5.430   1.00 15.64 ? 181  GLY A N   1 
ATOM   1371 C  CA  . GLY A 1 181 ? 10.683  10.510  5.672   1.00 15.97 ? 181  GLY A CA  1 
ATOM   1372 C  C   . GLY A 1 181 ? 11.976  9.908   5.119   1.00 14.48 ? 181  GLY A C   1 
ATOM   1373 O  O   . GLY A 1 181 ? 12.146  8.703   5.360   1.00 21.91 ? 181  GLY A O   1 
ATOM   1374 N  N   . ARG A 1 182 ? 12.838  10.725  4.510   1.00 12.40 ? 182  ARG A N   1 
ATOM   1375 C  CA  . ARG A 1 182 ? 14.102  10.102  4.050   1.00 17.15 ? 182  ARG A CA  1 
ATOM   1376 C  C   . ARG A 1 182 ? 15.162  9.905   5.130   1.00 15.51 ? 182  ARG A C   1 
ATOM   1377 O  O   . ARG A 1 182 ? 15.161  10.608  6.116   1.00 17.67 ? 182  ARG A O   1 
ATOM   1378 C  CB  . ARG A 1 182 ? 14.627  11.133  3.079   1.00 10.44 ? 182  ARG A CB  1 
ATOM   1379 C  CG  . ARG A 1 182 ? 13.640  11.113  1.880   1.00 25.72 ? 182  ARG A CG  1 
ATOM   1380 C  CD  . ARG A 1 182 ? 14.194  11.785  0.695   1.00 30.25 ? 182  ARG A CD  1 
ATOM   1381 N  NE  . ARG A 1 182 ? 14.817  13.055  1.013   1.00 50.89 ? 182  ARG A NE  1 
ATOM   1382 C  CZ  . ARG A 1 182 ? 15.677  13.702  0.229   1.00 73.07 ? 182  ARG A CZ  1 
ATOM   1383 N  NH1 . ARG A 1 182 ? 16.043  13.234  -0.974  1.00 79.64 ? 182  ARG A NH1 1 
ATOM   1384 N  NH2 . ARG A 1 182 ? 16.254  14.827  0.687   1.00 77.69 ? 182  ARG A NH2 1 
ATOM   1385 N  N   . VAL A 1 183 ? 16.086  8.929   4.945   1.00 11.99 ? 183  VAL A N   1 
ATOM   1386 C  CA  . VAL A 1 183 ? 17.167  8.755   5.911   1.00 7.36  ? 183  VAL A CA  1 
ATOM   1387 C  C   . VAL A 1 183 ? 18.313  9.591   5.272   1.00 12.92 ? 183  VAL A C   1 
ATOM   1388 O  O   . VAL A 1 183 ? 18.618  9.275   4.118   1.00 17.66 ? 183  VAL A O   1 
ATOM   1389 C  CB  . VAL A 1 183 ? 17.609  7.283   5.919   1.00 7.47  ? 183  VAL A CB  1 
ATOM   1390 C  CG1 . VAL A 1 183 ? 18.798  7.006   6.852   1.00 15.80 ? 183  VAL A CG1 1 
ATOM   1391 C  CG2 . VAL A 1 183 ? 16.422  6.373   6.175   1.00 15.99 ? 183  VAL A CG2 1 
ATOM   1392 N  N   . LEU A 1 184 ? 18.779  10.563  5.977   1.00 10.76 ? 184  LEU A N   1 
ATOM   1393 C  CA  . LEU A 1 184 ? 19.916  11.425  5.617   1.00 7.58  ? 184  LEU A CA  1 
ATOM   1394 C  C   . LEU A 1 184 ? 21.142  10.839  6.330   1.00 11.71 ? 184  LEU A C   1 
ATOM   1395 O  O   . LEU A 1 184 ? 21.258  10.600  7.523   1.00 14.28 ? 184  LEU A O   1 
ATOM   1396 C  CB  . LEU A 1 184 ? 19.623  12.860  5.914   1.00 6.77  ? 184  LEU A CB  1 
ATOM   1397 C  CG  . LEU A 1 184 ? 20.933  13.713  5.938   1.00 12.15 ? 184  LEU A CG  1 
ATOM   1398 C  CD1 . LEU A 1 184 ? 21.536  13.894  4.546   1.00 15.98 ? 184  LEU A CD1 1 
ATOM   1399 C  CD2 . LEU A 1 184 ? 20.489  15.102  6.378   1.00 17.38 ? 184  LEU A CD2 1 
ATOM   1400 N  N   . MET A 1 185 ? 22.167  10.544  5.554   1.00 12.39 ? 185  MET A N   1 
ATOM   1401 C  CA  . MET A 1 185 ? 23.419  9.995   6.029   1.00 8.02  ? 185  MET A CA  1 
ATOM   1402 C  C   . MET A 1 185 ? 24.620  10.878  5.621   1.00 14.31 ? 185  MET A C   1 
ATOM   1403 O  O   . MET A 1 185 ? 24.577  11.462  4.541   1.00 18.37 ? 185  MET A O   1 
ATOM   1404 C  CB  . MET A 1 185 ? 23.627  8.609   5.379   1.00 7.58  ? 185  MET A CB  1 
ATOM   1405 C  CG  . MET A 1 185 ? 22.445  7.751   5.765   1.00 18.22 ? 185  MET A CG  1 
ATOM   1406 S  SD  . MET A 1 185 ? 22.385  6.234   4.773   1.00 13.33 ? 185  MET A SD  1 
ATOM   1407 C  CE  . MET A 1 185 ? 21.347  6.759   3.407   1.00 16.29 ? 185  MET A CE  1 
ATOM   1408 N  N   . TRP A 1 186 ? 25.713  10.838  6.389   1.00 11.98 ? 186  TRP A N   1 
ATOM   1409 C  CA  . TRP A 1 186 ? 26.881  11.595  5.909   1.00 11.89 ? 186  TRP A CA  1 
ATOM   1410 C  C   . TRP A 1 186 ? 28.138  10.864  6.365   1.00 16.03 ? 186  TRP A C   1 
ATOM   1411 O  O   . TRP A 1 186 ? 28.025  10.051  7.307   1.00 11.67 ? 186  TRP A O   1 
ATOM   1412 C  CB  . TRP A 1 186 ? 26.803  13.044  6.291   1.00 10.26 ? 186  TRP A CB  1 
ATOM   1413 C  CG  . TRP A 1 186 ? 26.885  13.426  7.713   1.00 6.68  ? 186  TRP A CG  1 
ATOM   1414 C  CD1 . TRP A 1 186 ? 27.927  13.776  8.486   1.00 12.48 ? 186  TRP A CD1 1 
ATOM   1415 C  CD2 . TRP A 1 186 ? 25.722  13.699  8.519   1.00 13.86 ? 186  TRP A CD2 1 
ATOM   1416 N  NE1 . TRP A 1 186 ? 27.553  14.168  9.755   1.00 11.44 ? 186  TRP A NE1 1 
ATOM   1417 C  CE2 . TRP A 1 186 ? 26.172  14.105  9.781   1.00 15.55 ? 186  TRP A CE2 1 
ATOM   1418 C  CE3 . TRP A 1 186 ? 24.359  13.542  8.270   1.00 19.77 ? 186  TRP A CE3 1 
ATOM   1419 C  CZ2 . TRP A 1 186 ? 25.295  14.444  10.810  1.00 11.10 ? 186  TRP A CZ2 1 
ATOM   1420 C  CZ3 . TRP A 1 186 ? 23.522  13.827  9.306   1.00 18.22 ? 186  TRP A CZ3 1 
ATOM   1421 C  CH2 . TRP A 1 186 ? 23.958  14.249  10.544  1.00 9.89  ? 186  TRP A CH2 1 
ATOM   1422 N  N   . SER A 1 187 ? 29.253  11.196  5.688   1.00 15.63 ? 187  SER A N   1 
ATOM   1423 C  CA  . SER A 1 187 ? 30.486  10.517  6.080   1.00 15.20 ? 187  SER A CA  1 
ATOM   1424 C  C   . SER A 1 187 ? 31.450  11.600  6.505   1.00 11.41 ? 187  SER A C   1 
ATOM   1425 O  O   . SER A 1 187 ? 31.496  11.947  7.714   1.00 19.65 ? 187  SER A O   1 
ATOM   1426 C  CB  . SER A 1 187 ? 31.055  9.571   5.030   1.00 12.47 ? 187  SER A CB  1 
ATOM   1427 O  OG  . SER A 1 187 ? 31.170  10.298  3.823   1.00 18.02 ? 187  SER A OG  1 
ATOM   1428 N  N   . SER A 1 188 ? 32.093  12.138  5.509   1.00 10.22 ? 188  SER A N   1 
ATOM   1429 C  CA  . SER A 1 188 ? 33.152  13.145  5.896   1.00 13.17 ? 188  SER A CA  1 
ATOM   1430 C  C   . SER A 1 188 ? 33.500  13.871  4.610   1.00 20.23 ? 188  SER A C   1 
ATOM   1431 O  O   . SER A 1 188 ? 32.613  13.961  3.745   1.00 17.49 ? 188  SER A O   1 
ATOM   1432 C  CB  . SER A 1 188 ? 34.401  12.436  6.463   1.00 17.65 ? 188  SER A CB  1 
ATOM   1433 O  OG  . SER A 1 188 ? 35.378  13.401  6.948   1.00 14.51 ? 188  SER A OG  1 
ATOM   1434 N  N   . TYR A 1 189 ? 34.747  14.290  4.496   1.00 23.67 ? 189  TYR A N   1 
ATOM   1435 C  CA  . TYR A 1 189 ? 35.171  15.001  3.261   1.00 31.45 ? 189  TYR A CA  1 
ATOM   1436 C  C   . TYR A 1 189 ? 35.238  13.968  2.123   1.00 32.06 ? 189  TYR A C   1 
ATOM   1437 O  O   . TYR A 1 189 ? 35.292  14.349  0.969   1.00 33.47 ? 189  TYR A O   1 
ATOM   1438 C  CB  . TYR A 1 189 ? 36.525  15.713  3.436   1.00 15.91 ? 189  TYR A CB  1 
ATOM   1439 C  CG  . TYR A 1 189 ? 37.752  14.850  3.400   1.00 21.66 ? 189  TYR A CG  1 
ATOM   1440 C  CD1 . TYR A 1 189 ? 38.132  13.936  4.356   1.00 23.65 ? 189  TYR A CD1 1 
ATOM   1441 C  CD2 . TYR A 1 189 ? 38.621  14.996  2.300   1.00 36.80 ? 189  TYR A CD2 1 
ATOM   1442 C  CE1 . TYR A 1 189 ? 39.289  13.188  4.258   1.00 23.85 ? 189  TYR A CE1 1 
ATOM   1443 C  CE2 . TYR A 1 189 ? 39.797  14.253  2.157   1.00 29.25 ? 189  TYR A CE2 1 
ATOM   1444 C  CZ  . TYR A 1 189 ? 40.129  13.351  3.160   1.00 35.95 ? 189  TYR A CZ  1 
ATOM   1445 O  OH  . TYR A 1 189 ? 41.307  12.613  3.066   1.00 39.64 ? 189  TYR A OH  1 
ATOM   1446 N  N   . ARG A 1 190 ? 35.289  12.691  2.443   1.00 23.63 ? 190  ARG A N   1 
ATOM   1447 C  CA  . ARG A 1 190 ? 35.283  11.597  1.483   1.00 25.65 ? 190  ARG A CA  1 
ATOM   1448 C  C   . ARG A 1 190 ? 34.199  10.559  1.831   1.00 24.39 ? 190  ARG A C   1 
ATOM   1449 O  O   . ARG A 1 190 ? 33.729  10.470  2.955   1.00 20.70 ? 190  ARG A O   1 
ATOM   1450 C  CB  . ARG A 1 190 ? 36.642  10.902  1.465   1.00 22.46 ? 190  ARG A CB  1 
ATOM   1451 C  CG  . ARG A 1 190 ? 37.768  11.724  0.825   1.00 43.36 ? 190  ARG A CG  1 
ATOM   1452 C  CD  . ARG A 1 190 ? 38.988  10.870  0.725   1.00 46.45 ? 190  ARG A CD  1 
ATOM   1453 N  NE  . ARG A 1 190 ? 38.744  9.856   -0.271  1.00 69.18 ? 190  ARG A NE  1 
ATOM   1454 C  CZ  . ARG A 1 190 ? 39.198  8.602   -0.199  1.00 86.32 ? 190  ARG A CZ  1 
ATOM   1455 N  NH1 . ARG A 1 190 ? 39.902  8.044   0.777   1.00 73.96 ? 190  ARG A NH1 1 
ATOM   1456 N  NH2 . ARG A 1 190 ? 38.872  7.867   -1.286  1.00 99.99 ? 190  ARG A NH2 1 
ATOM   1457 N  N   . ASN A 1 191 ? 33.907  9.716   0.847   1.00 23.83 ? 191  ASN A N   1 
ATOM   1458 C  CA  . ASN A 1 191 ? 32.913  8.653   0.986   1.00 20.48 ? 191  ASN A CA  1 
ATOM   1459 C  C   . ASN A 1 191 ? 33.390  7.563   1.898   1.00 14.40 ? 191  ASN A C   1 
ATOM   1460 O  O   . ASN A 1 191 ? 32.540  6.880   2.545   1.00 20.70 ? 191  ASN A O   1 
ATOM   1461 C  CB  . ASN A 1 191 ? 32.503  8.187   -0.443  1.00 19.44 ? 191  ASN A CB  1 
ATOM   1462 C  CG  . ASN A 1 191 ? 33.475  7.214   -1.060  1.00 28.02 ? 191  ASN A CG  1 
ATOM   1463 O  OD1 . ASN A 1 191 ? 34.701  7.447   -1.034  1.00 26.21 ? 191  ASN A OD1 1 
ATOM   1464 N  ND2 . ASN A 1 191 ? 33.089  6.056   -1.632  1.00 18.24 ? 191  ASN A ND2 1 
ATOM   1465 N  N   . ASP A 1 192 ? 34.690  7.366   1.999   1.00 14.14 ? 192  ASP A N   1 
ATOM   1466 C  CA  . ASP A 1 192 ? 35.219  6.264   2.795   1.00 20.75 ? 192  ASP A CA  1 
ATOM   1467 C  C   . ASP A 1 192 ? 36.298  6.628   3.804   1.00 24.18 ? 192  ASP A C   1 
ATOM   1468 O  O   . ASP A 1 192 ? 36.919  5.646   4.350   1.00 17.23 ? 192  ASP A O   1 
ATOM   1469 C  CB  . ASP A 1 192 ? 35.770  5.182   1.849   1.00 26.66 ? 192  ASP A CB  1 
ATOM   1470 C  CG  . ASP A 1 192 ? 37.013  5.605   1.104   1.00 38.84 ? 192  ASP A CG  1 
ATOM   1471 O  OD1 . ASP A 1 192 ? 37.309  6.824   1.146   1.00 30.78 ? 192  ASP A OD1 1 
ATOM   1472 O  OD2 . ASP A 1 192 ? 37.671  4.817   0.417   1.00 44.31 ? 192  ASP A OD2 1 
ATOM   1473 N  N   . ALA A 1 193 ? 36.487  7.926   3.997   1.00 18.97 ? 193  ALA A N   1 
ATOM   1474 C  CA  . ALA A 1 193 ? 37.548  8.315   4.958   1.00 14.36 ? 193  ALA A CA  1 
ATOM   1475 C  C   . ALA A 1 193 ? 37.344  9.706   5.513   1.00 14.29 ? 193  ALA A C   1 
ATOM   1476 O  O   . ALA A 1 193 ? 36.689  10.600  4.986   1.00 20.74 ? 193  ALA A O   1 
ATOM   1477 C  CB  . ALA A 1 193 ? 38.887  8.278   4.188   1.00 18.95 ? 193  ALA A CB  1 
ATOM   1478 N  N   . PHE A 1 194 ? 37.962  9.872   6.669   1.00 12.37 ? 194  PHE A N   1 
ATOM   1479 C  CA  . PHE A 1 194 ? 37.881  11.158  7.388   1.00 24.65 ? 194  PHE A CA  1 
ATOM   1480 C  C   . PHE A 1 194 ? 39.281  11.754  7.663   1.00 31.69 ? 194  PHE A C   1 
ATOM   1481 O  O   . PHE A 1 194 ? 39.429  12.973  7.888   1.00 20.78 ? 194  PHE A O   1 
ATOM   1482 C  CB  . PHE A 1 194 ? 37.212  10.905  8.774   1.00 22.74 ? 194  PHE A CB  1 
ATOM   1483 C  CG  . PHE A 1 194 ? 38.066  10.187  9.783   1.00 23.14 ? 194  PHE A CG  1 
ATOM   1484 C  CD1 . PHE A 1 194 ? 39.059  10.840  10.604  1.00 19.06 ? 194  PHE A CD1 1 
ATOM   1485 C  CD2 . PHE A 1 194 ? 37.874  8.813   9.891   1.00 22.86 ? 194  PHE A CD2 1 
ATOM   1486 C  CE1 . PHE A 1 194 ? 39.805  10.086  11.491  1.00 19.65 ? 194  PHE A CE1 1 
ATOM   1487 C  CE2 . PHE A 1 194 ? 38.621  8.040   10.814  1.00 21.77 ? 194  PHE A CE2 1 
ATOM   1488 C  CZ  . PHE A 1 194 ? 39.606  8.668   11.659  1.00 19.22 ? 194  PHE A CZ  1 
ATOM   1489 N  N   . GLY A 1 195 ? 40.257  10.856  7.767   1.00 34.75 ? 195  GLY A N   1 
ATOM   1490 C  CA  . GLY A 1 195 ? 41.633  11.254  8.076   1.00 44.65 ? 195  GLY A CA  1 
ATOM   1491 C  C   . GLY A 1 195 ? 42.147  12.048  6.869   1.00 51.23 ? 195  GLY A C   1 
ATOM   1492 O  O   . GLY A 1 195 ? 41.931  11.615  5.717   1.00 56.39 ? 195  GLY A O   1 
ATOM   1493 N  N   . GLY A 1 196 ? 42.834  13.130  7.192   1.00 48.44 ? 196  GLY A N   1 
ATOM   1494 C  CA  . GLY A 1 196 ? 43.386  13.971  6.139   1.00 50.06 ? 196  GLY A CA  1 
ATOM   1495 C  C   . GLY A 1 196 ? 42.427  14.945  5.492   1.00 50.42 ? 196  GLY A C   1 
ATOM   1496 O  O   . GLY A 1 196 ? 42.670  15.366  4.343   1.00 44.91 ? 196  GLY A O   1 
ATOM   1497 N  N   . SER A 1 197 ? 41.359  15.326  6.205   1.00 49.22 ? 197  SER A N   1 
ATOM   1498 C  CA  . SER A 1 197 ? 40.441  16.312  5.604   1.00 43.57 ? 197  SER A CA  1 
ATOM   1499 C  C   . SER A 1 197 ? 40.987  17.747  5.621   1.00 51.02 ? 197  SER A C   1 
ATOM   1500 O  O   . SER A 1 197 ? 41.558  18.141  6.638   1.00 43.38 ? 197  SER A O   1 
ATOM   1501 C  CB  . SER A 1 197 ? 39.160  16.261  6.428   1.00 15.96 ? 197  SER A CB  1 
ATOM   1502 O  OG  . SER A 1 197 ? 38.283  17.317  6.022   1.00 18.77 ? 197  SER A OG  1 
ATOM   1503 N  N   . PRO A 1 198 ? 40.754  18.483  4.544   1.00 54.75 ? 198  PRO A N   1 
ATOM   1504 C  CA  . PRO A 1 198 ? 41.131  19.896  4.497   1.00 53.18 ? 198  PRO A CA  1 
ATOM   1505 C  C   . PRO A 1 198 ? 40.018  20.707  5.188   1.00 49.85 ? 198  PRO A C   1 
ATOM   1506 O  O   . PRO A 1 198 ? 40.037  21.930  5.225   1.00 59.90 ? 198  PRO A O   1 
ATOM   1507 C  CB  . PRO A 1 198 ? 41.117  20.204  3.004   1.00 54.47 ? 198  PRO A CB  1 
ATOM   1508 C  CG  . PRO A 1 198 ? 40.036  19.321  2.405   1.00 43.17 ? 198  PRO A CG  1 
ATOM   1509 C  CD  . PRO A 1 198 ? 40.049  18.071  3.306   1.00 49.14 ? 198  PRO A CD  1 
ATOM   1510 N  N   . GLY A 1 199 ? 38.989  20.026  5.658   1.00 48.05 ? 199  GLY A N   1 
ATOM   1511 C  CA  . GLY A 1 199 ? 37.775  20.461  6.329   1.00 29.35 ? 199  GLY A CA  1 
ATOM   1512 C  C   . GLY A 1 199 ? 36.863  21.194  5.398   1.00 26.07 ? 199  GLY A C   1 
ATOM   1513 O  O   . GLY A 1 199 ? 37.400  21.268  4.252   1.00 25.80 ? 199  GLY A O   1 
ATOM   1514 N  N   . GLY A 1 200 ? 35.627  21.604  5.764   1.00 20.84 ? 200  GLY A N   1 
ATOM   1515 C  CA  . GLY A 1 200 ? 34.812  22.392  4.849   1.00 26.20 ? 200  GLY A CA  1 
ATOM   1516 C  C   . GLY A 1 200 ? 33.838  21.781  3.836   1.00 17.58 ? 200  GLY A C   1 
ATOM   1517 O  O   . GLY A 1 200 ? 33.084  22.367  3.044   1.00 16.86 ? 200  GLY A O   1 
ATOM   1518 N  N   . ILE A 1 201 ? 33.957  20.455  3.902   1.00 20.26 ? 201  ILE A N   1 
ATOM   1519 C  CA  . ILE A 1 201 ? 33.130  19.657  2.998   1.00 21.64 ? 201  ILE A CA  1 
ATOM   1520 C  C   . ILE A 1 201 ? 32.738  18.310  3.625   1.00 19.84 ? 201  ILE A C   1 
ATOM   1521 O  O   . ILE A 1 201 ? 33.594  17.666  4.286   1.00 17.77 ? 201  ILE A O   1 
ATOM   1522 C  CB  . ILE A 1 201 ? 33.964  19.356  1.700   1.00 27.78 ? 201  ILE A CB  1 
ATOM   1523 C  CG1 . ILE A 1 201 ? 33.072  18.414  0.832   1.00 30.08 ? 201  ILE A CG1 1 
ATOM   1524 C  CG2 . ILE A 1 201 ? 35.348  18.714  1.972   1.00 39.99 ? 201  ILE A CG2 1 
ATOM   1525 C  CD1 . ILE A 1 201 ? 33.667  18.278  -0.605  1.00 49.67 ? 201  ILE A CD1 1 
ATOM   1526 N  N   . THR A 1 202 ? 31.459  18.030  3.291   1.00 17.52 ? 202  THR A N   1 
ATOM   1527 C  CA  . THR A 1 202 ? 30.880  16.774  3.752   1.00 23.88 ? 202  THR A CA  1 
ATOM   1528 C  C   . THR A 1 202 ? 30.044  16.104  2.645   1.00 22.04 ? 202  THR A C   1 
ATOM   1529 O  O   . THR A 1 202 ? 29.198  16.798  2.109   1.00 18.54 ? 202  THR A O   1 
ATOM   1530 C  CB  . THR A 1 202 ? 29.859  16.996  4.990   1.00 19.36 ? 202  THR A CB  1 
ATOM   1531 O  OG1 . THR A 1 202 ? 30.632  17.608  6.094   1.00 24.09 ? 202  THR A OG1 1 
ATOM   1532 C  CG2 . THR A 1 202 ? 29.344  15.631  5.449   1.00 13.01 ? 202  THR A CG2 1 
ATOM   1533 N  N   . LEU A 1 203 ? 30.268  14.839  2.420   1.00 18.15 ? 203  LEU A N   1 
ATOM   1534 C  CA  . LEU A 1 203 ? 29.480  14.055  1.499   1.00 20.93 ? 203  LEU A CA  1 
ATOM   1535 C  C   . LEU A 1 203 ? 28.276  13.468  2.309   1.00 15.99 ? 203  LEU A C   1 
ATOM   1536 O  O   . LEU A 1 203 ? 28.477  12.771  3.310   1.00 10.81 ? 203  LEU A O   1 
ATOM   1537 C  CB  . LEU A 1 203 ? 30.300  12.852  1.028   1.00 16.30 ? 203  LEU A CB  1 
ATOM   1538 C  CG  . LEU A 1 203 ? 30.971  12.997  -0.316  1.00 34.95 ? 203  LEU A CG  1 
ATOM   1539 C  CD1 . LEU A 1 203 ? 31.854  14.228  -0.243  1.00 34.05 ? 203  LEU A CD1 1 
ATOM   1540 C  CD2 . LEU A 1 203 ? 31.776  11.758  -0.692  1.00 32.65 ? 203  LEU A CD2 1 
ATOM   1541 N  N   . THR A 1 204 ? 27.136  13.806  1.745   1.00 24.16 ? 204  THR A N   1 
ATOM   1542 C  CA  . THR A 1 204 ? 25.870  13.305  2.294   1.00 22.06 ? 204  THR A CA  1 
ATOM   1543 C  C   . THR A 1 204 ? 25.234  12.423  1.211   1.00 18.99 ? 204  THR A C   1 
ATOM   1544 O  O   . THR A 1 204 ? 25.535  12.496  0.002   1.00 19.69 ? 204  THR A O   1 
ATOM   1545 C  CB  . THR A 1 204 ? 24.943  14.468  2.804   1.00 16.13 ? 204  THR A CB  1 
ATOM   1546 O  OG1 . THR A 1 204 ? 24.260  14.932  1.586   1.00 16.82 ? 204  THR A OG1 1 
ATOM   1547 C  CG2 . THR A 1 204 ? 25.748  15.465  3.654   1.00 11.64 ? 204  THR A CG2 1 
ATOM   1548 N  N   . SER A 1 205 ? 24.325  11.577  1.651   1.00 13.75 ? 205  SER A N   1 
ATOM   1549 C  CA  . SER A 1 205 ? 23.536  10.679  0.789   1.00 15.23 ? 205  SER A CA  1 
ATOM   1550 C  C   . SER A 1 205 ? 22.218  10.455  1.479   1.00 16.93 ? 205  SER A C   1 
ATOM   1551 O  O   . SER A 1 205 ? 22.136  10.406  2.721   1.00 18.61 ? 205  SER A O   1 
ATOM   1552 C  CB  . SER A 1 205 ? 24.455  9.494   0.456   1.00 11.86 ? 205  SER A CB  1 
ATOM   1553 O  OG  . SER A 1 205 ? 23.677  8.454   -0.040  1.00 31.49 ? 205  SER A OG  1 
ATOM   1554 N  N   . SER A 1 206 ? 21.088  10.437  0.860   1.00 14.23 ? 206  SER A N   1 
ATOM   1555 C  CA  . SER A 1 206 ? 19.725  10.252  1.322   1.00 15.74 ? 206  SER A CA  1 
ATOM   1556 C  C   . SER A 1 206 ? 19.141  8.985   0.677   1.00 15.17 ? 206  SER A C   1 
ATOM   1557 O  O   . SER A 1 206 ? 19.300  8.693   -0.511  1.00 27.01 ? 206  SER A O   1 
ATOM   1558 C  CB  . SER A 1 206 ? 18.687  11.310  0.808   1.00 18.64 ? 206  SER A CB  1 
ATOM   1559 O  OG  . SER A 1 206 ? 18.820  12.384  1.793   1.00 32.33 ? 206  SER A OG  1 
ATOM   1560 N  N   . TRP A 1 207 ? 18.410  8.271   1.512   1.00 9.60  ? 207  TRP A N   1 
ATOM   1561 C  CA  . TRP A 1 207 ? 17.731  7.105   0.967   1.00 5.22  ? 207  TRP A CA  1 
ATOM   1562 C  C   . TRP A 1 207 ? 16.237  7.389   1.215   1.00 18.44 ? 207  TRP A C   1 
ATOM   1563 O  O   . TRP A 1 207 ? 15.871  7.717   2.346   1.00 15.59 ? 207  TRP A O   1 
ATOM   1564 C  CB  . TRP A 1 207 ? 18.125  5.814   1.578   1.00 16.97 ? 207  TRP A CB  1 
ATOM   1565 C  CG  . TRP A 1 207 ? 17.303  4.617   1.171   1.00 25.99 ? 207  TRP A CG  1 
ATOM   1566 C  CD1 . TRP A 1 207 ? 17.253  4.029   -0.063  1.00 24.37 ? 207  TRP A CD1 1 
ATOM   1567 C  CD2 . TRP A 1 207 ? 16.444  3.825   2.009   1.00 23.28 ? 207  TRP A CD2 1 
ATOM   1568 N  NE1 . TRP A 1 207 ? 16.394  2.971   -0.048  1.00 22.95 ? 207  TRP A NE1 1 
ATOM   1569 C  CE2 . TRP A 1 207 ? 15.915  2.799   1.215   1.00 17.44 ? 207  TRP A CE2 1 
ATOM   1570 C  CE3 . TRP A 1 207 ? 16.112  3.927   3.371   1.00 27.81 ? 207  TRP A CE3 1 
ATOM   1571 C  CZ2 . TRP A 1 207 ? 15.033  1.853   1.731   1.00 21.18 ? 207  TRP A CZ2 1 
ATOM   1572 C  CZ3 . TRP A 1 207 ? 15.253  2.970   3.908   1.00 22.93 ? 207  TRP A CZ3 1 
ATOM   1573 C  CH2 . TRP A 1 207 ? 14.742  1.983   3.086   1.00 23.56 ? 207  TRP A CH2 1 
ATOM   1574 N  N   . ASP A 1 208 ? 15.431  7.222   0.182   1.00 19.26 ? 208  ASP A N   1 
ATOM   1575 C  CA  . ASP A 1 208 ? 13.991  7.443   0.285   1.00 12.99 ? 208  ASP A CA  1 
ATOM   1576 C  C   . ASP A 1 208 ? 13.354  6.054   0.362   1.00 12.24 ? 208  ASP A C   1 
ATOM   1577 O  O   . ASP A 1 208 ? 13.253  5.403   -0.661  1.00 18.07 ? 208  ASP A O   1 
ATOM   1578 C  CB  . ASP A 1 208 ? 13.491  8.176   -0.986  1.00 20.39 ? 208  ASP A CB  1 
ATOM   1579 C  CG  . ASP A 1 208 ? 12.033  8.634   -0.754  1.00 27.38 ? 208  ASP A CG  1 
ATOM   1580 O  OD1 . ASP A 1 208 ? 11.292  8.000   0.036   1.00 19.47 ? 208  ASP A OD1 1 
ATOM   1581 O  OD2 . ASP A 1 208 ? 11.578  9.664   -1.224  1.00 33.69 ? 208  ASP A OD2 1 
ATOM   1582 N  N   . PRO A 1 209 ? 12.813  5.681   1.508   1.00 19.84 ? 209  PRO A N   1 
ATOM   1583 C  CA  . PRO A 1 209 ? 12.171  4.397   1.660   1.00 24.79 ? 209  PRO A CA  1 
ATOM   1584 C  C   . PRO A 1 209 ? 10.970  4.171   0.770   1.00 27.52 ? 209  PRO A C   1 
ATOM   1585 O  O   . PRO A 1 209 ? 10.702  3.039   0.413   1.00 40.72 ? 209  PRO A O   1 
ATOM   1586 C  CB  . PRO A 1 209 ? 11.778  4.269   3.122   1.00 21.46 ? 209  PRO A CB  1 
ATOM   1587 C  CG  . PRO A 1 209 ? 12.409  5.451   3.804   1.00 20.81 ? 209  PRO A CG  1 
ATOM   1588 C  CD  . PRO A 1 209 ? 12.800  6.469   2.756   1.00 23.98 ? 209  PRO A CD  1 
ATOM   1589 N  N   . SER A 1 210 ? 10.256  5.201   0.395   1.00 36.38 ? 210  SER A N   1 
ATOM   1590 C  CA  . SER A 1 210 ? 9.070   5.088   -0.466  1.00 38.18 ? 210  SER A CA  1 
ATOM   1591 C  C   . SER A 1 210 ? 9.551   4.754   -1.885  1.00 47.91 ? 210  SER A C   1 
ATOM   1592 O  O   . SER A 1 210 ? 8.985   3.827   -2.523  1.00 59.25 ? 210  SER A O   1 
ATOM   1593 C  CB  . SER A 1 210 ? 8.198   6.322   -0.337  1.00 34.23 ? 210  SER A CB  1 
ATOM   1594 O  OG  . SER A 1 210 ? 8.843   7.444   -0.953  1.00 45.91 ? 210  SER A OG  1 
ATOM   1595 N  N   . THR A 1 211 ? 10.549  5.431   -2.429  1.00 31.72 ? 211  THR A N   1 
ATOM   1596 C  CA  . THR A 1 211 ? 11.046  5.132   -3.774  1.00 31.35 ? 211  THR A CA  1 
ATOM   1597 C  C   . THR A 1 211 ? 12.251  4.226   -3.861  1.00 42.68 ? 211  THR A C   1 
ATOM   1598 O  O   . THR A 1 211 ? 12.490  3.695   -4.960  1.00 44.19 ? 211  THR A O   1 
ATOM   1599 C  CB  . THR A 1 211 ? 11.260  6.508   -4.484  1.00 36.20 ? 211  THR A CB  1 
ATOM   1600 O  OG1 . THR A 1 211 ? 12.434  7.073   -3.781  1.00 32.26 ? 211  THR A OG1 1 
ATOM   1601 C  CG2 . THR A 1 211 ? 9.953   7.281   -4.279  1.00 31.28 ? 211  THR A CG2 1 
ATOM   1602 N  N   . GLY A 1 212 ? 12.994  3.997   -2.793  1.00 41.63 ? 212  GLY A N   1 
ATOM   1603 C  CA  . GLY A 1 212 ? 14.185  3.136   -2.875  1.00 34.87 ? 212  GLY A CA  1 
ATOM   1604 C  C   . GLY A 1 212 ? 15.285  3.964   -3.571  1.00 29.36 ? 212  GLY A C   1 
ATOM   1605 O  O   . GLY A 1 212 ? 16.357  3.387   -3.860  1.00 39.79 ? 212  GLY A O   1 
ATOM   1606 N  N   . ILE A 1 213 ? 15.029  5.249   -3.860  1.00 23.72 ? 213  ILE A N   1 
ATOM   1607 C  CA  . ILE A 1 213 ? 16.158  6.004   -4.435  1.00 26.83 ? 213  ILE A CA  1 
ATOM   1608 C  C   . ILE A 1 213 ? 17.142  6.549   -3.379  1.00 26.27 ? 213  ILE A C   1 
ATOM   1609 O  O   . ILE A 1 213 ? 16.801  7.292   -2.450  1.00 18.27 ? 213  ILE A O   1 
ATOM   1610 C  CB  . ILE A 1 213 ? 15.712  7.261   -5.255  1.00 47.50 ? 213  ILE A CB  1 
ATOM   1611 C  CG1 . ILE A 1 213 ? 15.037  6.768   -6.586  1.00 55.66 ? 213  ILE A CG1 1 
ATOM   1612 C  CG2 . ILE A 1 213 ? 16.834  8.284   -5.485  1.00 38.18 ? 213  ILE A CG2 1 
ATOM   1613 C  CD1 . ILE A 1 213 ? 13.740  7.554   -6.931  1.00 62.23 ? 213  ILE A CD1 1 
ATOM   1614 N  N   . VAL A 1 214 ? 18.380  6.336   -3.718  1.00 26.72 ? 214  VAL A N   1 
ATOM   1615 C  CA  . VAL A 1 214 ? 19.564  6.837   -2.953  1.00 30.76 ? 214  VAL A CA  1 
ATOM   1616 C  C   . VAL A 1 214 ? 20.111  8.060   -3.708  1.00 27.63 ? 214  VAL A C   1 
ATOM   1617 O  O   . VAL A 1 214 ? 20.543  7.891   -4.875  1.00 45.57 ? 214  VAL A O   1 
ATOM   1618 C  CB  . VAL A 1 214 ? 20.601  5.708   -2.857  1.00 19.22 ? 214  VAL A CB  1 
ATOM   1619 C  CG1 . VAL A 1 214 ? 21.915  6.288   -2.328  1.00 19.38 ? 214  VAL A CG1 1 
ATOM   1620 C  CG2 . VAL A 1 214 ? 20.104  4.588   -2.001  1.00 15.87 ? 214  VAL A CG2 1 
ATOM   1621 N  N   . SER A 1 215 ? 20.053  9.231   -3.182  1.00 28.15 ? 215  SER A N   1 
ATOM   1622 C  CA  . SER A 1 215 ? 20.510  10.486  -3.750  1.00 41.28 ? 215  SER A CA  1 
ATOM   1623 C  C   . SER A 1 215 ? 21.746  11.018  -2.976  1.00 57.09 ? 215  SER A C   1 
ATOM   1624 O  O   . SER A 1 215 ? 21.813  10.860  -1.755  1.00 54.61 ? 215  SER A O   1 
ATOM   1625 C  CB  . SER A 1 215 ? 19.440  11.487  -3.936  1.00 47.10 ? 215  SER A CB  1 
ATOM   1626 O  OG  . SER A 1 215 ? 18.593  11.977  -2.971  1.00 62.13 ? 215  SER A OG  1 
ATOM   1627 N  N   . ASP A 1 216 ? 22.673  11.609  -3.710  1.00 55.13 ? 216  ASP A N   1 
ATOM   1628 C  CA  . ASP A 1 216 ? 23.926  12.090  -2.990  1.00 51.01 ? 216  ASP A CA  1 
ATOM   1629 C  C   . ASP A 1 216 ? 24.128  13.561  -3.266  1.00 55.67 ? 216  ASP A C   1 
ATOM   1630 O  O   . ASP A 1 216 ? 23.740  14.202  -4.272  1.00 70.43 ? 216  ASP A O   1 
ATOM   1631 C  CB  . ASP A 1 216 ? 24.887  10.935  -3.110  1.00 43.05 ? 216  ASP A CB  1 
ATOM   1632 C  CG  . ASP A 1 216 ? 25.607  10.696  -4.382  1.00 64.21 ? 216  ASP A CG  1 
ATOM   1633 O  OD1 . ASP A 1 216 ? 26.117  11.747  -4.847  1.00 85.61 ? 216  ASP A OD1 1 
ATOM   1634 O  OD2 . ASP A 1 216 ? 25.724  9.582   -4.924  1.00 65.84 ? 216  ASP A OD2 1 
ATOM   1635 N  N   . ARG A 1 217 ? 24.708  14.262  -2.306  1.00 40.38 ? 217  ARG A N   1 
ATOM   1636 C  CA  . ARG A 1 217 ? 24.976  15.687  -2.297  1.00 27.28 ? 217  ARG A CA  1 
ATOM   1637 C  C   . ARG A 1 217 ? 26.175  16.033  -1.431  1.00 31.54 ? 217  ARG A C   1 
ATOM   1638 O  O   . ARG A 1 217 ? 26.236  15.569  -0.286  1.00 31.93 ? 217  ARG A O   1 
ATOM   1639 C  CB  . ARG A 1 217 ? 23.735  16.421  -1.728  1.00 24.59 ? 217  ARG A CB  1 
ATOM   1640 C  CG  . ARG A 1 217 ? 23.892  17.791  -1.186  1.00 37.28 ? 217  ARG A CG  1 
ATOM   1641 C  CD  . ARG A 1 217 ? 22.797  18.762  -1.194  1.00 48.23 ? 217  ARG A CD  1 
ATOM   1642 N  NE  . ARG A 1 217 ? 21.565  18.438  -0.522  1.00 55.01 ? 217  ARG A NE  1 
ATOM   1643 C  CZ  . ARG A 1 217 ? 20.741  19.367  -0.029  1.00 68.55 ? 217  ARG A CZ  1 
ATOM   1644 N  NH1 . ARG A 1 217 ? 21.006  20.662  -0.241  1.00 71.78 ? 217  ARG A NH1 1 
ATOM   1645 N  NH2 . ARG A 1 217 ? 19.725  19.045  0.766   1.00 64.54 ? 217  ARG A NH2 1 
ATOM   1646 N  N   . THR A 1 218 ? 27.023  16.841  -1.966  1.00 28.44 ? 218  THR A N   1 
ATOM   1647 C  CA  . THR A 1 218 ? 28.215  17.359  -1.273  1.00 38.37 ? 218  THR A CA  1 
ATOM   1648 C  C   . THR A 1 218 ? 27.839  18.704  -0.630  1.00 42.50 ? 218  THR A C   1 
ATOM   1649 O  O   . THR A 1 218 ? 27.371  19.569  -1.403  1.00 46.73 ? 218  THR A O   1 
ATOM   1650 C  CB  . THR A 1 218 ? 29.333  17.604  -2.323  1.00 30.64 ? 218  THR A CB  1 
ATOM   1651 O  OG1 . THR A 1 218 ? 29.502  16.278  -2.898  1.00 38.91 ? 218  THR A OG1 1 
ATOM   1652 C  CG2 . THR A 1 218 ? 30.530  18.283  -1.737  1.00 27.87 ? 218  THR A CG2 1 
ATOM   1653 N  N   . VAL A 1 219 ? 28.020  18.816  0.662   1.00 27.54 ? 219  VAL A N   1 
ATOM   1654 C  CA  . VAL A 1 219 ? 27.652  20.064  1.346   1.00 20.18 ? 219  VAL A CA  1 
ATOM   1655 C  C   . VAL A 1 219 ? 28.926  20.816  1.664   1.00 20.34 ? 219  VAL A C   1 
ATOM   1656 O  O   . VAL A 1 219 ? 29.810  20.329  2.387   1.00 21.47 ? 219  VAL A O   1 
ATOM   1657 C  CB  . VAL A 1 219 ? 26.823  19.746  2.608   1.00 23.17 ? 219  VAL A CB  1 
ATOM   1658 C  CG1 . VAL A 1 219 ? 26.480  21.035  3.359   1.00 24.97 ? 219  VAL A CG1 1 
ATOM   1659 C  CG2 . VAL A 1 219 ? 25.617  18.853  2.275   1.00 19.79 ? 219  VAL A CG2 1 
ATOM   1660 N  N   . THR A 1 220 ? 28.936  22.034  1.100   1.00 33.09 ? 220  THR A N   1 
ATOM   1661 C  CA  . THR A 1 220 ? 30.097  22.928  1.339   1.00 37.59 ? 220  THR A CA  1 
ATOM   1662 C  C   . THR A 1 220 ? 29.763  24.313  1.905   1.00 38.09 ? 220  THR A C   1 
ATOM   1663 O  O   . THR A 1 220 ? 30.590  25.089  2.419   1.00 29.04 ? 220  THR A O   1 
ATOM   1664 C  CB  . THR A 1 220 ? 30.954  23.093  0.012   1.00 49.34 ? 220  THR A CB  1 
ATOM   1665 O  OG1 . THR A 1 220 ? 30.071  23.676  -0.975  1.00 44.39 ? 220  THR A OG1 1 
ATOM   1666 C  CG2 . THR A 1 220 ? 31.624  21.767  -0.393  1.00 57.03 ? 220  THR A CG2 1 
ATOM   1667 N  N   . VAL A 1 221 ? 28.511  24.630  1.764   1.00 26.44 ? 221  VAL A N   1 
ATOM   1668 C  CA  . VAL A 1 221 ? 27.892  25.904  2.141   1.00 27.85 ? 221  VAL A CA  1 
ATOM   1669 C  C   . VAL A 1 221 ? 28.054  26.206  3.621   1.00 40.84 ? 221  VAL A C   1 
ATOM   1670 O  O   . VAL A 1 221 ? 28.065  27.424  3.887   1.00 42.55 ? 221  VAL A O   1 
ATOM   1671 C  CB  . VAL A 1 221 ? 26.451  25.994  1.609   1.00 19.07 ? 221  VAL A CB  1 
ATOM   1672 C  CG1 . VAL A 1 221 ? 25.459  25.053  2.303   1.00 24.40 ? 221  VAL A CG1 1 
ATOM   1673 C  CG2 . VAL A 1 221 ? 26.020  27.457  1.761   1.00 26.71 ? 221  VAL A CG2 1 
ATOM   1674 N  N   . THR A 1 222 ? 28.206  25.174  4.449   1.00 27.52 ? 222  THR A N   1 
ATOM   1675 C  CA  . THR A 1 222 ? 28.389  25.495  5.886   1.00 17.71 ? 222  THR A CA  1 
ATOM   1676 C  C   . THR A 1 222 ? 29.875  25.397  6.178   1.00 17.92 ? 222  THR A C   1 
ATOM   1677 O  O   . THR A 1 222 ? 30.145  25.601  7.368   1.00 22.40 ? 222  THR A O   1 
ATOM   1678 C  CB  . THR A 1 222 ? 27.501  24.547  6.739   1.00 13.40 ? 222  THR A CB  1 
ATOM   1679 O  OG1 . THR A 1 222 ? 28.037  23.220  6.432   1.00 16.17 ? 222  THR A OG1 1 
ATOM   1680 C  CG2 . THR A 1 222 ? 26.004  24.691  6.372   1.00 16.94 ? 222  THR A CG2 1 
ATOM   1681 N  N   . LYS A 1 223 ? 30.696  25.113  5.171   1.00 17.04 ? 223  LYS A N   1 
ATOM   1682 C  CA  . LYS A 1 223 ? 32.148  25.083  5.448   1.00 22.22 ? 223  LYS A CA  1 
ATOM   1683 C  C   . LYS A 1 223 ? 32.473  24.196  6.637   1.00 23.74 ? 223  LYS A C   1 
ATOM   1684 O  O   . LYS A 1 223 ? 33.290  24.434  7.518   1.00 20.94 ? 223  LYS A O   1 
ATOM   1685 C  CB  . LYS A 1 223 ? 32.619  26.518  5.730   1.00 41.03 ? 223  LYS A CB  1 
ATOM   1686 C  CG  . LYS A 1 223 ? 32.606  27.326  4.425   1.00 51.72 ? 223  LYS A CG  1 
ATOM   1687 C  CD  . LYS A 1 223 ? 32.178  28.760  4.520   1.00 77.50 ? 223  LYS A CD  1 
ATOM   1688 C  CE  . LYS A 1 223 ? 32.255  29.524  3.194   1.00 83.32 ? 223  LYS A CE  1 
ATOM   1689 N  NZ  . LYS A 1 223 ? 31.154  29.076  2.257   1.00 92.30 ? 223  LYS A NZ  1 
ATOM   1690 N  N   . HIS A 1 224 ? 31.831  23.035  6.606   1.00 25.10 ? 224  HIS A N   1 
ATOM   1691 C  CA  . HIS A 1 224 ? 31.994  22.071  7.743   1.00 18.05 ? 224  HIS A CA  1 
ATOM   1692 C  C   . HIS A 1 224 ? 32.109  20.623  7.271   1.00 23.66 ? 224  HIS A C   1 
ATOM   1693 O  O   . HIS A 1 224 ? 31.279  20.110  6.490   1.00 24.53 ? 224  HIS A O   1 
ATOM   1694 C  CB  . HIS A 1 224 ? 30.637  22.341  8.516   1.00 20.46 ? 224  HIS A CB  1 
ATOM   1695 C  CG  . HIS A 1 224 ? 30.492  21.689  9.865   1.00 14.82 ? 224  HIS A CG  1 
ATOM   1696 N  ND1 . HIS A 1 224 ? 29.354  21.828  10.601  1.00 13.89 ? 224  HIS A ND1 1 
ATOM   1697 C  CD2 . HIS A 1 224 ? 31.364  20.848  10.546  1.00 12.23 ? 224  HIS A CD2 1 
ATOM   1698 C  CE1 . HIS A 1 224 ? 29.542  21.143  11.759  1.00 12.18 ? 224  HIS A CE1 1 
ATOM   1699 N  NE2 . HIS A 1 224 ? 30.746  20.580  11.722  1.00 15.06 ? 224  HIS A NE2 1 
ATOM   1700 N  N   . ASP A 1 225 ? 33.151  19.932  7.706   1.00 19.57 ? 225  ASP A N   1 
ATOM   1701 C  CA  . ASP A 1 225 ? 33.380  18.489  7.483   1.00 19.40 ? 225  ASP A CA  1 
ATOM   1702 C  C   . ASP A 1 225 ? 32.711  17.931  8.788   1.00 21.48 ? 225  ASP A C   1 
ATOM   1703 O  O   . ASP A 1 225 ? 33.292  18.011  9.904   1.00 17.79 ? 225  ASP A O   1 
ATOM   1704 C  CB  . ASP A 1 225 ? 34.864  18.180  7.365   1.00 20.38 ? 225  ASP A CB  1 
ATOM   1705 C  CG  . ASP A 1 225 ? 35.079  16.684  7.377   1.00 20.32 ? 225  ASP A CG  1 
ATOM   1706 O  OD1 . ASP A 1 225 ? 34.180  15.917  7.837   1.00 22.35 ? 225  ASP A OD1 1 
ATOM   1707 O  OD2 . ASP A 1 225 ? 36.193  16.299  7.015   1.00 19.49 ? 225  ASP A OD2 1 
ATOM   1708 N  N   . MET A 1 226 ? 31.479  17.487  8.641   1.00 20.39 ? 226  MET A N   1 
ATOM   1709 C  CA  . MET A 1 226 ? 30.647  17.036  9.760   1.00 11.36 ? 226  MET A CA  1 
ATOM   1710 C  C   . MET A 1 226 ? 30.855  15.666  10.384  1.00 19.64 ? 226  MET A C   1 
ATOM   1711 O  O   . MET A 1 226 ? 29.945  15.126  11.048  1.00 22.23 ? 226  MET A O   1 
ATOM   1712 C  CB  . MET A 1 226 ? 29.174  17.166  9.356   1.00 15.14 ? 226  MET A CB  1 
ATOM   1713 C  CG  . MET A 1 226 ? 28.831  18.600  8.991   1.00 21.09 ? 226  MET A CG  1 
ATOM   1714 S  SD  . MET A 1 226 ? 27.050  18.809  8.554   1.00 17.86 ? 226  MET A SD  1 
ATOM   1715 C  CE  . MET A 1 226 ? 26.933  17.726  7.161   1.00 36.93 ? 226  MET A CE  1 
ATOM   1716 N  N   . PHE A 1 227 ? 32.008  15.091  10.227  1.00 8.34  ? 227  PHE A N   1 
ATOM   1717 C  CA  . PHE A 1 227 ? 32.380  13.803  10.757  1.00 7.84  ? 227  PHE A CA  1 
ATOM   1718 C  C   . PHE A 1 227 ? 32.703  14.078  12.232  1.00 10.29 ? 227  PHE A C   1 
ATOM   1719 O  O   . PHE A 1 227 ? 33.245  15.113  12.648  1.00 11.67 ? 227  PHE A O   1 
ATOM   1720 C  CB  . PHE A 1 227 ? 33.675  13.309  10.096  1.00 10.62 ? 227  PHE A CB  1 
ATOM   1721 C  CG  . PHE A 1 227 ? 34.219  12.075  10.712  1.00 19.87 ? 227  PHE A CG  1 
ATOM   1722 C  CD1 . PHE A 1 227 ? 33.478  10.880  10.530  1.00 17.22 ? 227  PHE A CD1 1 
ATOM   1723 C  CD2 . PHE A 1 227 ? 35.426  12.076  11.442  1.00 18.57 ? 227  PHE A CD2 1 
ATOM   1724 C  CE1 . PHE A 1 227 ? 33.910  9.689   11.122  1.00 14.40 ? 227  PHE A CE1 1 
ATOM   1725 C  CE2 . PHE A 1 227 ? 35.887  10.886  11.986  1.00 14.70 ? 227  PHE A CE2 1 
ATOM   1726 C  CZ  . PHE A 1 227 ? 35.100  9.693   11.814  1.00 14.79 ? 227  PHE A CZ  1 
ATOM   1727 N  N   . CYS A 1 228 ? 32.291  13.116  13.065  1.00 17.57 ? 228  CYS A N   1 
ATOM   1728 C  CA  . CYS A 1 228 ? 32.504  13.150  14.551  1.00 10.17 ? 228  CYS A CA  1 
ATOM   1729 C  C   . CYS A 1 228 ? 31.807  14.324  15.282  1.00 13.02 ? 228  CYS A C   1 
ATOM   1730 O  O   . CYS A 1 228 ? 32.407  14.877  16.183  1.00 10.89 ? 228  CYS A O   1 
ATOM   1731 C  CB  . CYS A 1 228 ? 33.955  13.182  14.959  1.00 6.49  ? 228  CYS A CB  1 
ATOM   1732 S  SG  . CYS A 1 228 ? 34.614  11.496  15.041  1.00 10.14 ? 228  CYS A SG  1 
ATOM   1733 N  N   . PRO A 1 229 ? 30.542  14.590  14.970  1.00 13.44 ? 229  PRO A N   1 
ATOM   1734 C  CA  . PRO A 1 229 ? 29.875  15.688  15.619  1.00 8.41  ? 229  PRO A CA  1 
ATOM   1735 C  C   . PRO A 1 229 ? 28.890  15.374  16.701  1.00 12.52 ? 229  PRO A C   1 
ATOM   1736 O  O   . PRO A 1 229 ? 28.538  14.200  16.949  1.00 11.86 ? 229  PRO A O   1 
ATOM   1737 C  CB  . PRO A 1 229 ? 29.013  16.100  14.368  1.00 5.00  ? 229  PRO A CB  1 
ATOM   1738 C  CG  . PRO A 1 229 ? 28.444  14.810  13.841  1.00 7.33  ? 229  PRO A CG  1 
ATOM   1739 C  CD  . PRO A 1 229 ? 29.708  13.919  13.928  1.00 12.55 ? 229  PRO A CD  1 
ATOM   1740 N  N   . GLY A 1 230 ? 28.422  16.476  17.208  1.00 11.10 ? 230  GLY A N   1 
ATOM   1741 C  CA  . GLY A 1 230 ? 27.237  16.499  18.149  1.00 13.06 ? 230  GLY A CA  1 
ATOM   1742 C  C   . GLY A 1 230 ? 26.033  16.611  17.171  1.00 11.52 ? 230  GLY A C   1 
ATOM   1743 O  O   . GLY A 1 230 ? 26.144  17.223  16.083  1.00 11.55 ? 230  GLY A O   1 
ATOM   1744 N  N   . ILE A 1 231 ? 24.896  15.975  17.439  1.00 9.98  ? 231  ILE A N   1 
ATOM   1745 C  CA  . ILE A 1 231 ? 23.705  16.081  16.644  1.00 5.00  ? 231  ILE A CA  1 
ATOM   1746 C  C   . ILE A 1 231 ? 22.479  16.225  17.545  1.00 8.48  ? 231  ILE A C   1 
ATOM   1747 O  O   . ILE A 1 231 ? 22.335  15.446  18.461  1.00 10.95 ? 231  ILE A O   1 
ATOM   1748 C  CB  . ILE A 1 231 ? 23.428  14.907  15.663  1.00 9.72  ? 231  ILE A CB  1 
ATOM   1749 C  CG1 . ILE A 1 231 ? 24.740  14.305  15.022  1.00 8.69  ? 231  ILE A CG1 1 
ATOM   1750 C  CG2 . ILE A 1 231 ? 22.421  15.312  14.566  1.00 6.55  ? 231  ILE A CG2 1 
ATOM   1751 C  CD1 . ILE A 1 231 ? 24.572  13.044  14.156  1.00 5.04  ? 231  ILE A CD1 1 
ATOM   1752 N  N   . SER A 1 232 ? 21.654  17.238  17.307  1.00 8.69  ? 232  SER A N   1 
ATOM   1753 C  CA  . SER A 1 232 ? 20.380  17.386  18.011  1.00 9.21  ? 232  SER A CA  1 
ATOM   1754 C  C   . SER A 1 232 ? 19.293  17.925  17.043  1.00 12.69 ? 232  SER A C   1 
ATOM   1755 O  O   . SER A 1 232 ? 19.699  18.664  16.175  1.00 12.97 ? 232  SER A O   1 
ATOM   1756 C  CB  . SER A 1 232 ? 20.407  18.387  19.117  1.00 13.78 ? 232  SER A CB  1 
ATOM   1757 O  OG  . SER A 1 232 ? 21.223  17.806  20.144  1.00 7.42  ? 232  SER A OG  1 
ATOM   1758 N  N   . MET A 1 233 ? 18.031  17.615  17.271  1.00 7.94  ? 233  MET A N   1 
ATOM   1759 C  CA  . MET A 1 233 ? 16.906  18.180  16.457  1.00 5.33  ? 233  MET A CA  1 
ATOM   1760 C  C   . MET A 1 233 ? 16.439  19.277  17.435  1.00 11.03 ? 233  MET A C   1 
ATOM   1761 O  O   . MET A 1 233 ? 16.014  18.844  18.534  1.00 10.86 ? 233  MET A O   1 
ATOM   1762 C  CB  . MET A 1 233 ? 15.838  17.128  16.270  1.00 8.49  ? 233  MET A CB  1 
ATOM   1763 C  CG  . MET A 1 233 ? 14.617  17.941  15.665  1.00 12.26 ? 233  MET A CG  1 
ATOM   1764 S  SD  . MET A 1 233 ? 13.494  16.642  15.109  1.00 25.17 ? 233  MET A SD  1 
ATOM   1765 C  CE  . MET A 1 233 ? 12.781  15.923  16.551  1.00 16.80 ? 233  MET A CE  1 
ATOM   1766 N  N   . ASP A 1 234 ? 16.528  20.545  17.076  1.00 13.42 ? 234  ASP A N   1 
ATOM   1767 C  CA  . ASP A 1 234 ? 16.120  21.597  18.048  1.00 12.26 ? 234  ASP A CA  1 
ATOM   1768 C  C   . ASP A 1 234 ? 14.571  21.696  18.177  1.00 13.81 ? 234  ASP A C   1 
ATOM   1769 O  O   . ASP A 1 234 ? 13.753  20.990  17.580  1.00 11.37 ? 234  ASP A O   1 
ATOM   1770 C  CB  . ASP A 1 234 ? 16.865  22.840  17.703  1.00 11.76 ? 234  ASP A CB  1 
ATOM   1771 C  CG  . ASP A 1 234 ? 16.400  23.615  16.466  1.00 23.49 ? 234  ASP A CG  1 
ATOM   1772 O  OD1 . ASP A 1 234 ? 15.331  23.310  15.922  1.00 16.10 ? 234  ASP A OD1 1 
ATOM   1773 O  OD2 . ASP A 1 234 ? 17.182  24.508  16.059  1.00 24.72 ? 234  ASP A OD2 1 
ATOM   1774 N  N   . GLY A 1 235 ? 14.222  22.717  18.940  1.00 14.81 ? 235  GLY A N   1 
ATOM   1775 C  CA  . GLY A 1 235 ? 12.794  22.946  19.204  1.00 22.30 ? 235  GLY A CA  1 
ATOM   1776 C  C   . GLY A 1 235 ? 12.010  23.337  17.949  1.00 24.13 ? 235  GLY A C   1 
ATOM   1777 O  O   . GLY A 1 235 ? 10.776  23.243  17.922  1.00 33.49 ? 235  GLY A O   1 
ATOM   1778 N  N   . ASN A 1 236 ? 12.680  23.755  16.907  1.00 30.75 ? 236  ASN A N   1 
ATOM   1779 C  CA  . ASN A 1 236 ? 12.049  24.106  15.628  1.00 33.09 ? 236  ASN A CA  1 
ATOM   1780 C  C   . ASN A 1 236 ? 12.037  22.992  14.604  1.00 35.89 ? 236  ASN A C   1 
ATOM   1781 O  O   . ASN A 1 236 ? 11.496  23.197  13.479  1.00 41.43 ? 236  ASN A O   1 
ATOM   1782 C  CB  . ASN A 1 236 ? 12.749  25.295  14.965  1.00 43.54 ? 236  ASN A CB  1 
ATOM   1783 C  CG  . ASN A 1 236 ? 12.540  26.544  15.811  1.00 50.69 ? 236  ASN A CG  1 
ATOM   1784 O  OD1 . ASN A 1 236 ? 11.515  26.534  16.499  1.00 58.69 ? 236  ASN A OD1 1 
ATOM   1785 N  ND2 . ASN A 1 236 ? 13.432  27.483  15.663  1.00 47.11 ? 236  ASN A ND2 1 
ATOM   1786 N  N   . GLY A 1 237 ? 12.647  21.868  14.887  1.00 30.16 ? 237  GLY A N   1 
ATOM   1787 C  CA  . GLY A 1 237 ? 12.686  20.756  13.920  1.00 24.04 ? 237  GLY A CA  1 
ATOM   1788 C  C   . GLY A 1 237 ? 13.914  20.871  13.024  1.00 24.23 ? 237  GLY A C   1 
ATOM   1789 O  O   . GLY A 1 237 ? 14.038  20.125  12.055  1.00 26.58 ? 237  GLY A O   1 
ATOM   1790 N  N   . GLN A 1 238 ? 14.843  21.765  13.262  1.00 13.08 ? 238  GLN A N   1 
ATOM   1791 C  CA  . GLN A 1 238 ? 16.086  21.828  12.453  1.00 16.73 ? 238  GLN A CA  1 
ATOM   1792 C  C   . GLN A 1 238 ? 17.125  20.865  13.103  1.00 19.80 ? 238  GLN A C   1 
ATOM   1793 O  O   . GLN A 1 238 ? 17.231  20.762  14.330  1.00 16.18 ? 238  GLN A O   1 
ATOM   1794 C  CB  . GLN A 1 238 ? 16.664  23.222  12.480  1.00 10.18 ? 238  GLN A CB  1 
ATOM   1795 C  CG  . GLN A 1 238 ? 15.697  24.156  11.722  1.00 26.25 ? 238  GLN A CG  1 
ATOM   1796 C  CD  . GLN A 1 238 ? 16.508  25.376  11.327  1.00 36.92 ? 238  GLN A CD  1 
ATOM   1797 O  OE1 . GLN A 1 238 ? 17.478  25.778  11.951  1.00 24.84 ? 238  GLN A OE1 1 
ATOM   1798 N  NE2 . GLN A 1 238 ? 16.068  25.936  10.190  1.00 47.60 ? 238  GLN A NE2 1 
ATOM   1799 N  N   . ILE A 1 239 ? 17.908  20.123  12.311  1.00 15.30 ? 239  ILE A N   1 
ATOM   1800 C  CA  . ILE A 1 239 ? 18.954  19.248  12.876  1.00 13.67 ? 239  ILE A CA  1 
ATOM   1801 C  C   . ILE A 1 239 ? 20.202  20.116  13.035  1.00 18.52 ? 239  ILE A C   1 
ATOM   1802 O  O   . ILE A 1 239 ? 20.650  20.754  12.038  1.00 20.20 ? 239  ILE A O   1 
ATOM   1803 C  CB  . ILE A 1 239 ? 19.166  18.054  11.847  1.00 11.22 ? 239  ILE A CB  1 
ATOM   1804 C  CG1 . ILE A 1 239 ? 17.767  17.401  11.854  1.00 17.05 ? 239  ILE A CG1 1 
ATOM   1805 C  CG2 . ILE A 1 239 ? 20.418  17.316  12.394  1.00 8.74  ? 239  ILE A CG2 1 
ATOM   1806 C  CD1 . ILE A 1 239 ? 17.661  16.123  11.017  1.00 32.84 ? 239  ILE A CD1 1 
ATOM   1807 N  N   . VAL A 1 240 ? 20.761  20.218  14.222  1.00 14.75 ? 240  VAL A N   1 
ATOM   1808 C  CA  . VAL A 1 240 ? 21.909  21.034  14.597  1.00 15.17 ? 240  VAL A CA  1 
ATOM   1809 C  C   . VAL A 1 240 ? 23.117  20.070  14.631  1.00 19.29 ? 240  VAL A C   1 
ATOM   1810 O  O   . VAL A 1 240 ? 23.131  19.118  15.441  1.00 14.54 ? 240  VAL A O   1 
ATOM   1811 C  CB  . VAL A 1 240 ? 21.617  21.702  15.976  1.00 11.93 ? 240  VAL A CB  1 
ATOM   1812 C  CG1 . VAL A 1 240 ? 22.745  22.583  16.463  1.00 13.27 ? 240  VAL A CG1 1 
ATOM   1813 C  CG2 . VAL A 1 240 ? 20.253  22.410  15.932  1.00 9.31  ? 240  VAL A CG2 1 
ATOM   1814 N  N   . VAL A 1 241 ? 24.099  20.250  13.783  1.00 17.14 ? 241  VAL A N   1 
ATOM   1815 C  CA  . VAL A 1 241 ? 25.297  19.364  13.647  1.00 14.50 ? 241  VAL A CA  1 
ATOM   1816 C  C   . VAL A 1 241 ? 26.483  20.178  14.146  1.00 10.67 ? 241  VAL A C   1 
ATOM   1817 O  O   . VAL A 1 241 ? 26.759  21.244  13.564  1.00 13.67 ? 241  VAL A O   1 
ATOM   1818 C  CB  . VAL A 1 241 ? 25.452  18.799  12.209  1.00 10.83 ? 241  VAL A CB  1 
ATOM   1819 C  CG1 . VAL A 1 241 ? 26.707  17.890  12.176  1.00 7.72  ? 241  VAL A CG1 1 
ATOM   1820 C  CG2 . VAL A 1 241 ? 24.238  18.089  11.596  1.00 8.62  ? 241  VAL A CG2 1 
ATOM   1821 N  N   . THR A 1 242 ? 27.212  19.782  15.194  1.00 7.59  ? 242  THR A N   1 
ATOM   1822 C  CA  . THR A 1 242 ? 28.279  20.588  15.719  1.00 5.26  ? 242  THR A CA  1 
ATOM   1823 C  C   . THR A 1 242 ? 29.646  19.966  15.736  1.00 13.38 ? 242  THR A C   1 
ATOM   1824 O  O   . THR A 1 242 ? 29.777  18.791  16.114  1.00 10.50 ? 242  THR A O   1 
ATOM   1825 C  CB  . THR A 1 242 ? 27.855  20.956  17.220  1.00 9.49  ? 242  THR A CB  1 
ATOM   1826 O  OG1 . THR A 1 242 ? 27.418  19.730  17.843  1.00 9.81  ? 242  THR A OG1 1 
ATOM   1827 C  CG2 . THR A 1 242 ? 26.719  21.980  17.218  1.00 14.25 ? 242  THR A CG2 1 
ATOM   1828 N  N   . GLY A 1 243 ? 30.631  20.763  15.325  1.00 11.64 ? 243  GLY A N   1 
ATOM   1829 C  CA  . GLY A 1 243 ? 32.007  20.285  15.433  1.00 10.83 ? 243  GLY A CA  1 
ATOM   1830 C  C   . GLY A 1 243 ? 32.461  19.032  14.699  1.00 7.57  ? 243  GLY A C   1 
ATOM   1831 O  O   . GLY A 1 243 ? 31.971  18.819  13.600  1.00 11.74 ? 243  GLY A O   1 
ATOM   1832 N  N   . GLY A 1 244 ? 33.420  18.326  15.319  1.00 7.54  ? 244  GLY A N   1 
ATOM   1833 C  CA  . GLY A 1 244 ? 33.893  17.134  14.578  1.00 12.79 ? 244  GLY A CA  1 
ATOM   1834 C  C   . GLY A 1 244 ? 35.127  17.593  13.782  1.00 15.18 ? 244  GLY A C   1 
ATOM   1835 O  O   . GLY A 1 244 ? 35.960  18.312  14.375  1.00 11.17 ? 244  GLY A O   1 
ATOM   1836 N  N   . ASN A 1 245 ? 35.176  17.260  12.517  1.00 16.63 ? 245  ASN A N   1 
ATOM   1837 C  CA  . ASN A 1 245 ? 36.333  17.651  11.650  1.00 24.69 ? 245  ASN A CA  1 
ATOM   1838 C  C   . ASN A 1 245 ? 36.542  19.162  11.587  1.00 22.49 ? 245  ASN A C   1 
ATOM   1839 O  O   . ASN A 1 245 ? 37.744  19.495  11.529  1.00 22.59 ? 245  ASN A O   1 
ATOM   1840 C  CB  . ASN A 1 245 ? 36.389  16.934  10.297  1.00 23.86 ? 245  ASN A CB  1 
ATOM   1841 C  CG  . ASN A 1 245 ? 37.268  15.695  10.348  1.00 20.38 ? 245  ASN A CG  1 
ATOM   1842 O  OD1 . ASN A 1 245 ? 37.910  15.486  11.357  1.00 24.78 ? 245  ASN A OD1 1 
ATOM   1843 N  ND2 . ASN A 1 245 ? 37.388  14.901  9.305   1.00 22.16 ? 245  ASN A ND2 1 
ATOM   1844 N  N   . ASP A 1 246 ? 35.561  20.001  11.622  1.00 16.53 ? 246  ASP A N   1 
ATOM   1845 C  CA  . ASP A 1 246 ? 35.656  21.472  11.698  1.00 18.29 ? 246  ASP A CA  1 
ATOM   1846 C  C   . ASP A 1 246 ? 35.068  21.692  13.136  1.00 12.19 ? 246  ASP A C   1 
ATOM   1847 O  O   . ASP A 1 246 ? 33.842  21.806  13.250  1.00 13.29 ? 246  ASP A O   1 
ATOM   1848 C  CB  . ASP A 1 246 ? 35.016  22.202  10.549  1.00 17.62 ? 246  ASP A CB  1 
ATOM   1849 C  CG  . ASP A 1 246 ? 35.751  21.931  9.251   1.00 24.25 ? 246  ASP A CG  1 
ATOM   1850 O  OD1 . ASP A 1 246 ? 36.929  22.372  9.151   1.00 31.57 ? 246  ASP A OD1 1 
ATOM   1851 O  OD2 . ASP A 1 246 ? 35.204  21.382  8.289   1.00 23.01 ? 246  ASP A OD2 1 
ATOM   1852 N  N   . ALA A 1 247 ? 35.988  21.658  14.069  1.00 9.75  ? 247  ALA A N   1 
ATOM   1853 C  CA  . ALA A 1 247 ? 35.719  21.668  15.491  1.00 6.35  ? 247  ALA A CA  1 
ATOM   1854 C  C   . ALA A 1 247 ? 34.865  22.806  15.967  1.00 15.21 ? 247  ALA A C   1 
ATOM   1855 O  O   . ALA A 1 247 ? 34.259  22.469  17.005  1.00 12.18 ? 247  ALA A O   1 
ATOM   1856 C  CB  . ALA A 1 247 ? 36.931  21.339  16.329  1.00 8.22  ? 247  ALA A CB  1 
ATOM   1857 N  N   . LYS A 1 248 ? 34.755  23.985  15.438  1.00 20.00 ? 248  LYS A N   1 
ATOM   1858 C  CA  . LYS A 1 248 ? 33.866  25.043  15.992  1.00 19.11 ? 248  LYS A CA  1 
ATOM   1859 C  C   . LYS A 1 248 ? 32.602  25.279  15.264  1.00 13.40 ? 248  LYS A C   1 
ATOM   1860 O  O   . LYS A 1 248 ? 31.704  26.089  15.631  1.00 19.62 ? 248  LYS A O   1 
ATOM   1861 C  CB  . LYS A 1 248 ? 34.629  26.376  15.937  1.00 20.95 ? 248  LYS A CB  1 
ATOM   1862 C  CG  . LYS A 1 248 ? 35.087  26.851  17.296  1.00 24.54 ? 248  LYS A CG  1 
ATOM   1863 C  CD  . LYS A 1 248 ? 35.961  28.087  17.288  1.00 47.81 ? 248  LYS A CD  1 
ATOM   1864 C  CE  . LYS A 1 248 ? 35.999  28.785  18.640  1.00 59.80 ? 248  LYS A CE  1 
ATOM   1865 N  NZ  . LYS A 1 248 ? 35.002  29.898  18.655  1.00 63.98 ? 248  LYS A NZ  1 
ATOM   1866 N  N   . LYS A 1 249 ? 32.472  24.594  14.096  1.00 10.12 ? 249  LYS A N   1 
ATOM   1867 C  CA  . LYS A 1 249 ? 31.306  24.938  13.280  1.00 12.41 ? 249  LYS A CA  1 
ATOM   1868 C  C   . LYS A 1 249 ? 29.997  24.296  13.722  1.00 21.07 ? 249  LYS A C   1 
ATOM   1869 O  O   . LYS A 1 249 ? 29.952  23.234  14.350  1.00 14.36 ? 249  LYS A O   1 
ATOM   1870 C  CB  . LYS A 1 249 ? 31.644  24.426  11.820  1.00 10.97 ? 249  LYS A CB  1 
ATOM   1871 C  CG  . LYS A 1 249 ? 33.005  25.000  11.365  1.00 22.47 ? 249  LYS A CG  1 
ATOM   1872 C  CD  . LYS A 1 249 ? 32.984  26.498  11.195  1.00 24.55 ? 249  LYS A CD  1 
ATOM   1873 C  CE  . LYS A 1 249 ? 32.242  27.081  10.039  1.00 35.00 ? 249  LYS A CE  1 
ATOM   1874 N  NZ  . LYS A 1 249 ? 31.745  28.491  10.201  1.00 28.77 ? 249  LYS A NZ  1 
ATOM   1875 N  N   . THR A 1 250 ? 28.928  24.951  13.272  1.00 10.18 ? 250  THR A N   1 
ATOM   1876 C  CA  . THR A 1 250 ? 27.571  24.424  13.497  1.00 12.17 ? 250  THR A CA  1 
ATOM   1877 C  C   . THR A 1 250 ? 26.944  24.488  12.096  1.00 21.77 ? 250  THR A C   1 
ATOM   1878 O  O   . THR A 1 250 ? 27.137  25.537  11.453  1.00 21.57 ? 250  THR A O   1 
ATOM   1879 C  CB  . THR A 1 250 ? 26.776  25.312  14.507  1.00 10.49 ? 250  THR A CB  1 
ATOM   1880 O  OG1 . THR A 1 250 ? 27.470  25.421  15.760  1.00 12.56 ? 250  THR A OG1 1 
ATOM   1881 C  CG2 . THR A 1 250 ? 25.320  24.805  14.700  1.00 15.28 ? 250  THR A CG2 1 
ATOM   1882 N  N   . SER A 1 251 ? 26.264  23.517  11.562  1.00 14.98 ? 251  SER A N   1 
ATOM   1883 C  CA  . SER A 1 251 ? 25.586  23.460  10.277  1.00 11.91 ? 251  SER A CA  1 
ATOM   1884 C  C   . SER A 1 251 ? 24.151  23.122  10.675  1.00 16.10 ? 251  SER A C   1 
ATOM   1885 O  O   . SER A 1 251 ? 23.928  22.338  11.620  1.00 13.58 ? 251  SER A O   1 
ATOM   1886 C  CB  . SER A 1 251 ? 26.129  22.339  9.392   1.00 10.00 ? 251  SER A CB  1 
ATOM   1887 O  OG  . SER A 1 251 ? 27.473  22.813  9.091   1.00 13.71 ? 251  SER A OG  1 
ATOM   1888 N  N   . LEU A 1 252 ? 23.197  23.681  10.046  1.00 16.38 ? 252  LEU A N   1 
ATOM   1889 C  CA  . LEU A 1 252 ? 21.758  23.438  10.344  1.00 23.68 ? 252  LEU A CA  1 
ATOM   1890 C  C   . LEU A 1 252 ? 21.092  22.814  9.123   1.00 15.33 ? 252  LEU A C   1 
ATOM   1891 O  O   . LEU A 1 252 ? 21.151  23.359  8.007   1.00 17.06 ? 252  LEU A O   1 
ATOM   1892 C  CB  . LEU A 1 252 ? 21.087  24.782  10.717  1.00 20.71 ? 252  LEU A CB  1 
ATOM   1893 C  CG  . LEU A 1 252 ? 21.759  25.630  11.782  1.00 20.15 ? 252  LEU A CG  1 
ATOM   1894 C  CD1 . LEU A 1 252 ? 21.101  27.004  11.830  1.00 23.81 ? 252  LEU A CD1 1 
ATOM   1895 C  CD2 . LEU A 1 252 ? 21.622  24.835  13.110  1.00 18.32 ? 252  LEU A CD2 1 
ATOM   1896 N  N   . TYR A 1 253 ? 20.415  21.698  9.298   1.00 16.83 ? 253  TYR A N   1 
ATOM   1897 C  CA  . TYR A 1 253 ? 19.712  21.071  8.198   1.00 15.76 ? 253  TYR A CA  1 
ATOM   1898 C  C   . TYR A 1 253 ? 18.219  21.344  8.449   1.00 23.44 ? 253  TYR A C   1 
ATOM   1899 O  O   . TYR A 1 253 ? 17.637  20.967  9.496   1.00 15.66 ? 253  TYR A O   1 
ATOM   1900 C  CB  . TYR A 1 253 ? 19.994  19.540  8.062   1.00 11.74 ? 253  TYR A CB  1 
ATOM   1901 C  CG  . TYR A 1 253 ? 19.096  18.973  6.977   1.00 23.24 ? 253  TYR A CG  1 
ATOM   1902 C  CD1 . TYR A 1 253 ? 19.380  19.143  5.615   1.00 11.61 ? 253  TYR A CD1 1 
ATOM   1903 C  CD2 . TYR A 1 253 ? 17.934  18.270  7.351   1.00 17.04 ? 253  TYR A CD2 1 
ATOM   1904 C  CE1 . TYR A 1 253 ? 18.480  18.662  4.633   1.00 11.72 ? 253  TYR A CE1 1 
ATOM   1905 C  CE2 . TYR A 1 253 ? 17.081  17.745  6.385   1.00 15.12 ? 253  TYR A CE2 1 
ATOM   1906 C  CZ  . TYR A 1 253 ? 17.365  17.971  5.025   1.00 9.55  ? 253  TYR A CZ  1 
ATOM   1907 O  OH  . TYR A 1 253 ? 16.545  17.373  4.157   1.00 20.52 ? 253  TYR A OH  1 
ATOM   1908 N  N   . ASP A 1 254 ? 17.644  21.974  7.416   1.00 18.32 ? 254  ASP A N   1 
ATOM   1909 C  CA  . ASP A 1 254 ? 16.188  22.262  7.479   1.00 17.07 ? 254  ASP A CA  1 
ATOM   1910 C  C   . ASP A 1 254 ? 15.499  21.243  6.613   1.00 19.26 ? 254  ASP A C   1 
ATOM   1911 O  O   . ASP A 1 254 ? 15.679  21.407  5.379   1.00 20.57 ? 254  ASP A O   1 
ATOM   1912 C  CB  . ASP A 1 254 ? 15.981  23.713  6.996   1.00 23.79 ? 254  ASP A CB  1 
ATOM   1913 C  CG  . ASP A 1 254 ? 14.503  24.091  6.998   1.00 40.31 ? 254  ASP A CG  1 
ATOM   1914 O  OD1 . ASP A 1 254 ? 13.767  24.032  8.010   1.00 44.76 ? 254  ASP A OD1 1 
ATOM   1915 O  OD2 . ASP A 1 254 ? 14.061  24.444  5.914   1.00 48.69 ? 254  ASP A OD2 1 
ATOM   1916 N  N   . SER A 1 255 ? 14.717  20.301  7.114   1.00 16.11 ? 255  SER A N   1 
ATOM   1917 C  CA  . SER A 1 255 ? 14.029  19.271  6.365   1.00 17.64 ? 255  SER A CA  1 
ATOM   1918 C  C   . SER A 1 255 ? 13.035  19.853  5.337   1.00 21.78 ? 255  SER A C   1 
ATOM   1919 O  O   . SER A 1 255 ? 12.933  19.423  4.192   1.00 23.91 ? 255  SER A O   1 
ATOM   1920 C  CB  . SER A 1 255 ? 13.195  18.377  7.307   1.00 11.03 ? 255  SER A CB  1 
ATOM   1921 O  OG  . SER A 1 255 ? 12.737  17.202  6.654   1.00 19.20 ? 255  SER A OG  1 
ATOM   1922 N  N   . SER A 1 256 ? 12.303  20.839  5.786   1.00 31.74 ? 256  SER A N   1 
ATOM   1923 C  CA  . SER A 1 256 ? 11.283  21.580  5.050   1.00 43.51 ? 256  SER A CA  1 
ATOM   1924 C  C   . SER A 1 256 ? 11.736  22.067  3.688   1.00 48.76 ? 256  SER A C   1 
ATOM   1925 O  O   . SER A 1 256 ? 11.068  21.833  2.661   1.00 59.13 ? 256  SER A O   1 
ATOM   1926 C  CB  . SER A 1 256 ? 10.815  22.829  5.824   1.00 48.09 ? 256  SER A CB  1 
ATOM   1927 O  OG  . SER A 1 256 ? 9.667   22.366  6.555   1.00 71.06 ? 256  SER A OG  1 
ATOM   1928 N  N   . SER A 1 257 ? 12.818  22.808  3.743   1.00 34.89 ? 257  SER A N   1 
ATOM   1929 C  CA  . SER A 1 257 ? 13.411  23.367  2.518   1.00 40.18 ? 257  SER A CA  1 
ATOM   1930 C  C   . SER A 1 257 ? 14.477  22.458  1.925   1.00 39.06 ? 257  SER A C   1 
ATOM   1931 O  O   . SER A 1 257 ? 15.105  22.810  0.901   1.00 35.62 ? 257  SER A O   1 
ATOM   1932 C  CB  . SER A 1 257 ? 13.877  24.765  2.902   1.00 42.96 ? 257  SER A CB  1 
ATOM   1933 O  OG  . SER A 1 257 ? 15.102  24.991  3.533   1.00 45.37 ? 257  SER A OG  1 
ATOM   1934 N  N   . ASP A 1 258 ? 14.739  21.308  2.531   1.00 37.35 ? 258  ASP A N   1 
ATOM   1935 C  CA  . ASP A 1 258 ? 15.793  20.362  2.130   1.00 42.05 ? 258  ASP A CA  1 
ATOM   1936 C  C   . ASP A 1 258 ? 17.130  21.135  2.011   1.00 44.07 ? 258  ASP A C   1 
ATOM   1937 O  O   . ASP A 1 258 ? 17.951  20.971  1.079   1.00 36.75 ? 258  ASP A O   1 
ATOM   1938 C  CB  . ASP A 1 258 ? 15.552  19.406  0.959   1.00 42.45 ? 258  ASP A CB  1 
ATOM   1939 C  CG  . ASP A 1 258 ? 16.653  18.349  0.814   1.00 46.22 ? 258  ASP A CG  1 
ATOM   1940 O  OD1 . ASP A 1 258 ? 17.293  17.789  1.743   1.00 28.47 ? 258  ASP A OD1 1 
ATOM   1941 O  OD2 . ASP A 1 258 ? 17.005  18.035  -0.347  1.00 59.07 ? 258  ASP A OD2 1 
ATOM   1942 N  N   . SER A 1 259 ? 17.386  21.984  3.040   1.00 35.98 ? 259  SER A N   1 
ATOM   1943 C  CA  . SER A 1 259 ? 18.679  22.693  2.887   1.00 33.54 ? 259  SER A CA  1 
ATOM   1944 C  C   . SER A 1 259 ? 19.536  22.832  4.142   1.00 28.63 ? 259  SER A C   1 
ATOM   1945 O  O   . SER A 1 259 ? 19.025  22.791  5.260   1.00 22.10 ? 259  SER A O   1 
ATOM   1946 C  CB  . SER A 1 259 ? 18.328  23.995  2.166   1.00 39.97 ? 259  SER A CB  1 
ATOM   1947 O  OG  . SER A 1 259 ? 17.862  24.904  3.097   1.00 40.39 ? 259  SER A OG  1 
ATOM   1948 N  N   . TRP A 1 260 ? 20.819  23.076  3.875   1.00 19.18 ? 260  TRP A N   1 
ATOM   1949 C  CA  . TRP A 1 260 ? 21.878  23.279  4.848   1.00 22.93 ? 260  TRP A CA  1 
ATOM   1950 C  C   . TRP A 1 260 ? 22.181  24.781  5.020   1.00 33.70 ? 260  TRP A C   1 
ATOM   1951 O  O   . TRP A 1 260 ? 22.516  25.480  4.071   1.00 32.02 ? 260  TRP A O   1 
ATOM   1952 C  CB  . TRP A 1 260 ? 23.082  22.453  4.427   1.00 16.41 ? 260  TRP A CB  1 
ATOM   1953 C  CG  . TRP A 1 260 ? 23.012  20.971  4.535   1.00 26.22 ? 260  TRP A CG  1 
ATOM   1954 C  CD1 . TRP A 1 260 ? 22.677  20.050  3.588   1.00 30.11 ? 260  TRP A CD1 1 
ATOM   1955 C  CD2 . TRP A 1 260 ? 23.220  20.199  5.743   1.00 22.17 ? 260  TRP A CD2 1 
ATOM   1956 N  NE1 . TRP A 1 260 ? 22.757  18.762  4.093   1.00 21.44 ? 260  TRP A NE1 1 
ATOM   1957 C  CE2 . TRP A 1 260 ? 23.060  18.842  5.415   1.00 26.47 ? 260  TRP A CE2 1 
ATOM   1958 C  CE3 . TRP A 1 260 ? 23.527  20.562  7.053   1.00 18.72 ? 260  TRP A CE3 1 
ATOM   1959 C  CZ2 . TRP A 1 260 ? 23.199  17.830  6.368   1.00 26.55 ? 260  TRP A CZ2 1 
ATOM   1960 C  CZ3 . TRP A 1 260 ? 23.675  19.556  7.984   1.00 23.96 ? 260  TRP A CZ3 1 
ATOM   1961 C  CH2 . TRP A 1 260 ? 23.474  18.199  7.661   1.00 26.17 ? 260  TRP A CH2 1 
ATOM   1962 N  N   . ILE A 1 261 ? 22.085  25.260  6.246   1.00 17.10 ? 261  ILE A N   1 
ATOM   1963 C  CA  . ILE A 1 261 ? 22.331  26.623  6.674   1.00 21.09 ? 261  ILE A CA  1 
ATOM   1964 C  C   . ILE A 1 261 ? 23.443  26.712  7.705   1.00 27.08 ? 261  ILE A C   1 
ATOM   1965 O  O   . ILE A 1 261 ? 23.557  25.954  8.676   1.00 26.41 ? 261  ILE A O   1 
ATOM   1966 C  CB  . ILE A 1 261 ? 20.983  27.160  7.264   1.00 20.33 ? 261  ILE A CB  1 
ATOM   1967 C  CG1 . ILE A 1 261 ? 19.762  26.838  6.306   1.00 33.70 ? 261  ILE A CG1 1 
ATOM   1968 C  CG2 . ILE A 1 261 ? 21.016  28.630  7.651   1.00 29.49 ? 261  ILE A CG2 1 
ATOM   1969 C  CD1 . ILE A 1 261 ? 18.554  26.763  7.320   1.00 39.63 ? 261  ILE A CD1 1 
ATOM   1970 N  N   . PRO A 1 262 ? 24.387  27.639  7.479   1.00 31.62 ? 262  PRO A N   1 
ATOM   1971 C  CA  . PRO A 1 262 ? 25.475  27.829  8.406   1.00 30.23 ? 262  PRO A CA  1 
ATOM   1972 C  C   . PRO A 1 262 ? 24.830  28.296  9.718   1.00 37.19 ? 262  PRO A C   1 
ATOM   1973 O  O   . PRO A 1 262 ? 23.938  29.152  9.645   1.00 23.72 ? 262  PRO A O   1 
ATOM   1974 C  CB  . PRO A 1 262 ? 26.339  28.974  7.843   1.00 33.21 ? 262  PRO A CB  1 
ATOM   1975 C  CG  . PRO A 1 262 ? 25.902  29.061  6.424   1.00 34.50 ? 262  PRO A CG  1 
ATOM   1976 C  CD  . PRO A 1 262 ? 24.430  28.637  6.388   1.00 37.98 ? 262  PRO A CD  1 
ATOM   1977 N  N   . GLY A 1 263 ? 25.339  27.793  10.824  1.00 27.70 ? 263  GLY A N   1 
ATOM   1978 C  CA  . GLY A 1 263 ? 24.834  28.175  12.165  1.00 21.73 ? 263  GLY A CA  1 
ATOM   1979 C  C   . GLY A 1 263 ? 25.998  29.040  12.753  1.00 27.08 ? 263  GLY A C   1 
ATOM   1980 O  O   . GLY A 1 263 ? 27.086  29.261  12.166  1.00 19.80 ? 263  GLY A O   1 
ATOM   1981 N  N   . PRO A 1 264 ? 25.779  29.474  13.991  1.00 17.29 ? 264  PRO A N   1 
ATOM   1982 C  CA  . PRO A 1 264 ? 26.824  30.225  14.673  1.00 16.46 ? 264  PRO A CA  1 
ATOM   1983 C  C   . PRO A 1 264 ? 27.909  29.227  15.092  1.00 18.27 ? 264  PRO A C   1 
ATOM   1984 O  O   . PRO A 1 264 ? 27.652  28.036  15.358  1.00 19.09 ? 264  PRO A O   1 
ATOM   1985 C  CB  . PRO A 1 264 ? 26.113  30.710  15.939  1.00 20.39 ? 264  PRO A CB  1 
ATOM   1986 C  CG  . PRO A 1 264 ? 24.934  29.756  16.165  1.00 18.70 ? 264  PRO A CG  1 
ATOM   1987 C  CD  . PRO A 1 264 ? 24.555  29.227  14.806  1.00 16.89 ? 264  PRO A CD  1 
ATOM   1988 N  N   . ASP A 1 265 ? 29.121  29.648  15.220  1.00 17.82 ? 265  ASP A N   1 
ATOM   1989 C  CA  . ASP A 1 265 ? 30.245  28.853  15.743  1.00 21.62 ? 265  ASP A CA  1 
ATOM   1990 C  C   . ASP A 1 265 ? 30.016  28.691  17.267  1.00 21.05 ? 265  ASP A C   1 
ATOM   1991 O  O   . ASP A 1 265 ? 29.484  29.594  17.967  1.00 14.27 ? 265  ASP A O   1 
ATOM   1992 C  CB  . ASP A 1 265 ? 31.594  29.531  15.597  1.00 32.64 ? 265  ASP A CB  1 
ATOM   1993 C  CG  . ASP A 1 265 ? 32.327  29.644  14.293  1.00 33.18 ? 265  ASP A CG  1 
ATOM   1994 O  OD1 . ASP A 1 265 ? 31.718  29.248  13.326  1.00 26.12 ? 265  ASP A OD1 1 
ATOM   1995 O  OD2 . ASP A 1 265 ? 33.470  30.067  14.071  1.00 45.39 ? 265  ASP A OD2 1 
ATOM   1996 N  N   . MET A 1 266 ? 30.371  27.489  17.714  1.00 11.79 ? 266  MET A N   1 
ATOM   1997 C  CA  . MET A 1 266 ? 30.254  27.205  19.160  1.00 7.79  ? 266  MET A CA  1 
ATOM   1998 C  C   . MET A 1 266 ? 31.337  28.081  19.781  1.00 15.85 ? 266  MET A C   1 
ATOM   1999 O  O   . MET A 1 266 ? 32.363  28.540  19.198  1.00 16.56 ? 266  MET A O   1 
ATOM   2000 C  CB  . MET A 1 266 ? 30.714  25.714  19.354  1.00 5.00  ? 266  MET A CB  1 
ATOM   2001 C  CG  . MET A 1 266 ? 29.514  24.871  18.970  1.00 7.08  ? 266  MET A CG  1 
ATOM   2002 S  SD  . MET A 1 266 ? 29.799  23.171  19.454  1.00 12.72 ? 266  MET A SD  1 
ATOM   2003 C  CE  . MET A 1 266 ? 31.283  22.769  18.432  1.00 12.05 ? 266  MET A CE  1 
ATOM   2004 N  N   . GLN A 1 267 ? 31.234  28.258  21.060  1.00 19.73 ? 267  GLN A N   1 
ATOM   2005 C  CA  . GLN A 1 267 ? 32.217  28.967  21.907  1.00 19.14 ? 267  GLN A CA  1 
ATOM   2006 C  C   . GLN A 1 267 ? 33.484  28.153  22.082  1.00 18.26 ? 267  GLN A C   1 
ATOM   2007 O  O   . GLN A 1 267 ? 34.542  28.785  22.152  1.00 13.08 ? 267  GLN A O   1 
ATOM   2008 C  CB  . GLN A 1 267 ? 31.618  29.228  23.298  1.00 20.07 ? 267  GLN A CB  1 
ATOM   2009 C  CG  . GLN A 1 267 ? 30.448  30.213  23.259  1.00 19.37 ? 267  GLN A CG  1 
ATOM   2010 C  CD  . GLN A 1 267 ? 30.892  31.554  22.690  1.00 37.68 ? 267  GLN A CD  1 
ATOM   2011 O  OE1 . GLN A 1 267 ? 30.223  32.113  21.844  1.00 42.34 ? 267  GLN A OE1 1 
ATOM   2012 N  NE2 . GLN A 1 267 ? 32.045  32.067  23.128  1.00 29.13 ? 267  GLN A NE2 1 
ATOM   2013 N  N   . VAL A 1 268 ? 33.346  26.839  22.191  1.00 10.87 ? 268  VAL A N   1 
ATOM   2014 C  CA  . VAL A 1 268 ? 34.453  25.908  22.384  1.00 16.01 ? 268  VAL A CA  1 
ATOM   2015 C  C   . VAL A 1 268 ? 34.452  24.884  21.243  1.00 15.67 ? 268  VAL A C   1 
ATOM   2016 O  O   . VAL A 1 268 ? 33.434  24.368  20.860  1.00 14.52 ? 268  VAL A O   1 
ATOM   2017 C  CB  . VAL A 1 268 ? 34.395  25.189  23.755  1.00 11.86 ? 268  VAL A CB  1 
ATOM   2018 C  CG1 . VAL A 1 268 ? 35.513  24.221  24.077  1.00 7.20  ? 268  VAL A CG1 1 
ATOM   2019 C  CG2 . VAL A 1 268 ? 34.047  26.165  24.851  1.00 16.18 ? 268  VAL A CG2 1 
ATOM   2020 N  N   . ALA A 1 269 ? 35.626  24.637  20.669  1.00 14.51 ? 269  ALA A N   1 
ATOM   2021 C  CA  . ALA A 1 269 ? 35.790  23.673  19.564  1.00 16.34 ? 269  ALA A CA  1 
ATOM   2022 C  C   . ALA A 1 269 ? 35.734  22.271  20.198  1.00 10.53 ? 269  ALA A C   1 
ATOM   2023 O  O   . ALA A 1 269 ? 36.375  21.955  21.220  1.00 12.02 ? 269  ALA A O   1 
ATOM   2024 C  CB  . ALA A 1 269 ? 37.149  23.916  18.927  1.00 22.12 ? 269  ALA A CB  1 
ATOM   2025 N  N   . ARG A 1 270 ? 34.969  21.391  19.611  1.00 15.07 ? 270  ARG A N   1 
ATOM   2026 C  CA  . ARG A 1 270 ? 34.789  20.048  20.134  1.00 6.82  ? 270  ARG A CA  1 
ATOM   2027 C  C   . ARG A 1 270 ? 34.522  19.051  18.991  1.00 5.00  ? 270  ARG A C   1 
ATOM   2028 O  O   . ARG A 1 270 ? 34.087  19.408  17.892  1.00 10.25 ? 270  ARG A O   1 
ATOM   2029 C  CB  . ARG A 1 270 ? 33.283  20.109  20.731  1.00 8.19  ? 270  ARG A CB  1 
ATOM   2030 C  CG  . ARG A 1 270 ? 33.147  21.167  21.829  1.00 12.63 ? 270  ARG A CG  1 
ATOM   2031 C  CD  . ARG A 1 270 ? 31.757  21.178  22.405  1.00 5.19  ? 270  ARG A CD  1 
ATOM   2032 N  NE  . ARG A 1 270 ? 31.505  22.475  23.082  1.00 8.06  ? 270  ARG A NE  1 
ATOM   2033 C  CZ  . ARG A 1 270 ? 31.480  22.547  24.390  1.00 8.82  ? 270  ARG A CZ  1 
ATOM   2034 N  NH1 . ARG A 1 270 ? 31.710  21.469  25.128  1.00 11.59 ? 270  ARG A NH1 1 
ATOM   2035 N  NH2 . ARG A 1 270 ? 31.349  23.723  25.027  1.00 13.91 ? 270  ARG A NH2 1 
ATOM   2036 N  N   . GLY A 1 271 ? 34.841  17.821  19.404  1.00 5.00  ? 271  GLY A N   1 
ATOM   2037 C  CA  . GLY A 1 271 ? 34.517  16.715  18.519  1.00 5.00  ? 271  GLY A CA  1 
ATOM   2038 C  C   . GLY A 1 271 ? 34.145  15.548  19.454  1.00 12.34 ? 271  GLY A C   1 
ATOM   2039 O  O   . GLY A 1 271 ? 34.689  15.439  20.551  1.00 12.53 ? 271  GLY A O   1 
ATOM   2040 N  N   . TYR A 1 272 ? 33.159  14.716  19.041  1.00 13.05 ? 272  TYR A N   1 
ATOM   2041 C  CA  . TYR A 1 272 ? 32.688  13.577  19.798  1.00 9.35  ? 272  TYR A CA  1 
ATOM   2042 C  C   . TYR A 1 272 ? 31.921  13.935  21.056  1.00 9.66  ? 272  TYR A C   1 
ATOM   2043 O  O   . TYR A 1 272 ? 31.711  13.060  21.888  1.00 9.24  ? 272  TYR A O   1 
ATOM   2044 C  CB  . TYR A 1 272 ? 33.708  12.498  20.210  1.00 6.95  ? 272  TYR A CB  1 
ATOM   2045 C  CG  . TYR A 1 272 ? 34.215  11.602  19.123  1.00 5.03  ? 272  TYR A CG  1 
ATOM   2046 C  CD1 . TYR A 1 272 ? 34.119  11.959  17.785  1.00 5.79  ? 272  TYR A CD1 1 
ATOM   2047 C  CD2 . TYR A 1 272 ? 34.916  10.411  19.502  1.00 5.00  ? 272  TYR A CD2 1 
ATOM   2048 C  CE1 . TYR A 1 272 ? 34.660  11.122  16.779  1.00 10.45 ? 272  TYR A CE1 1 
ATOM   2049 C  CE2 . TYR A 1 272 ? 35.373  9.513   18.534  1.00 9.00  ? 272  TYR A CE2 1 
ATOM   2050 C  CZ  . TYR A 1 272 ? 35.241  9.916   17.203  1.00 12.48 ? 272  TYR A CZ  1 
ATOM   2051 O  OH  . TYR A 1 272 ? 35.750  9.154   16.197  1.00 18.36 ? 272  TYR A OH  1 
ATOM   2052 N  N   . GLN A 1 273 ? 31.468  15.173  21.161  1.00 12.52 ? 273  GLN A N   1 
ATOM   2053 C  CA  . GLN A 1 273 ? 30.615  15.534  22.294  1.00 5.00  ? 273  GLN A CA  1 
ATOM   2054 C  C   . GLN A 1 273 ? 29.201  15.061  21.990  1.00 8.84  ? 273  GLN A C   1 
ATOM   2055 O  O   . GLN A 1 273 ? 28.853  14.673  20.842  1.00 11.40 ? 273  GLN A O   1 
ATOM   2056 C  CB  . GLN A 1 273 ? 30.556  17.090  22.331  1.00 5.70  ? 273  GLN A CB  1 
ATOM   2057 C  CG  . GLN A 1 273 ? 29.828  17.745  21.164  1.00 12.12 ? 273  GLN A CG  1 
ATOM   2058 C  CD  . GLN A 1 273 ? 30.494  18.072  19.858  1.00 7.43  ? 273  GLN A CD  1 
ATOM   2059 O  OE1 . GLN A 1 273 ? 31.552  17.517  19.586  1.00 13.23 ? 273  GLN A OE1 1 
ATOM   2060 N  NE2 . GLN A 1 273 ? 30.036  18.866  18.932  1.00 5.86  ? 273  GLN A NE2 1 
ATOM   2061 N  N   . SER A 1 274 ? 28.322  14.956  22.997  1.00 5.00  ? 274  SER A N   1 
ATOM   2062 C  CA  . SER A 1 274 ? 26.927  14.710  22.734  1.00 5.00  ? 274  SER A CA  1 
ATOM   2063 C  C   . SER A 1 274 ? 26.221  16.088  22.854  1.00 5.00  ? 274  SER A C   1 
ATOM   2064 O  O   . SER A 1 274 ? 26.815  16.843  23.622  1.00 11.82 ? 274  SER A O   1 
ATOM   2065 C  CB  . SER A 1 274 ? 26.292  13.914  23.906  1.00 5.00  ? 274  SER A CB  1 
ATOM   2066 O  OG  . SER A 1 274 ? 26.613  12.622  23.553  1.00 13.84 ? 274  SER A OG  1 
ATOM   2067 N  N   . SER A 1 275 ? 25.078  16.287  22.233  1.00 5.14  ? 275  SER A N   1 
ATOM   2068 C  CA  . SER A 1 275 ? 24.331  17.537  22.437  1.00 5.00  ? 275  SER A CA  1 
ATOM   2069 C  C   . SER A 1 275 ? 22.929  16.972  22.729  1.00 6.81  ? 275  SER A C   1 
ATOM   2070 O  O   . SER A 1 275 ? 22.632  15.834  22.322  1.00 7.56  ? 275  SER A O   1 
ATOM   2071 C  CB  . SER A 1 275 ? 24.408  18.426  21.227  1.00 5.00  ? 275  SER A CB  1 
ATOM   2072 O  OG  . SER A 1 275 ? 23.882  17.815  20.047  1.00 6.51  ? 275  SER A OG  1 
ATOM   2073 N  N   . ALA A 1 276 ? 22.131  17.715  23.466  1.00 12.36 ? 276  ALA A N   1 
ATOM   2074 C  CA  . ALA A 1 276 ? 20.772  17.286  23.776  1.00 7.48  ? 276  ALA A CA  1 
ATOM   2075 C  C   . ALA A 1 276 ? 19.803  18.501  23.711  1.00 11.51 ? 276  ALA A C   1 
ATOM   2076 O  O   . ALA A 1 276 ? 20.041  19.528  24.353  1.00 9.56  ? 276  ALA A O   1 
ATOM   2077 C  CB  . ALA A 1 276 ? 20.697  16.755  25.211  1.00 7.80  ? 276  ALA A CB  1 
ATOM   2078 N  N   . THR A 1 277 ? 18.676  18.262  23.047  1.00 16.31 ? 277  THR A N   1 
ATOM   2079 C  CA  . THR A 1 277 ? 17.591  19.283  22.999  1.00 12.82 ? 277  THR A CA  1 
ATOM   2080 C  C   . THR A 1 277 ? 16.989  19.360  24.410  1.00 15.65 ? 277  THR A C   1 
ATOM   2081 O  O   . THR A 1 277 ? 16.866  18.327  25.113  1.00 11.34 ? 277  THR A O   1 
ATOM   2082 C  CB  . THR A 1 277 ? 16.562  18.948  21.872  1.00 12.32 ? 277  THR A CB  1 
ATOM   2083 O  OG1 . THR A 1 277 ? 17.418  18.809  20.709  1.00 15.82 ? 277  THR A OG1 1 
ATOM   2084 C  CG2 . THR A 1 277 ? 15.493  20.033  21.714  1.00 5.78  ? 277  THR A CG2 1 
ATOM   2085 N  N   . MET A 1 278 ? 16.717  20.607  24.779  1.00 13.38 ? 278  MET A N   1 
ATOM   2086 C  CA  . MET A 1 278 ? 16.169  21.040  26.078  1.00 13.22 ? 278  MET A CA  1 
ATOM   2087 C  C   . MET A 1 278 ? 14.652  21.285  26.015  1.00 14.35 ? 278  MET A C   1 
ATOM   2088 O  O   . MET A 1 278 ? 14.146  21.345  24.905  1.00 13.97 ? 278  MET A O   1 
ATOM   2089 C  CB  . MET A 1 278 ? 16.886  22.332  26.509  1.00 7.68  ? 278  MET A CB  1 
ATOM   2090 C  CG  . MET A 1 278 ? 18.367  21.984  26.745  1.00 7.50  ? 278  MET A CG  1 
ATOM   2091 S  SD  . MET A 1 278 ? 19.281  23.536  26.857  1.00 12.39 ? 278  MET A SD  1 
ATOM   2092 C  CE  . MET A 1 278 ? 18.336  24.619  27.937  1.00 13.45 ? 278  MET A CE  1 
ATOM   2093 N  N   . SER A 1 279 ? 14.007  21.359  27.177  1.00 12.79 ? 279  SER A N   1 
ATOM   2094 C  CA  . SER A 1 279 ? 12.548  21.538  27.249  1.00 13.18 ? 279  SER A CA  1 
ATOM   2095 C  C   . SER A 1 279 ? 12.104  22.842  26.557  1.00 23.01 ? 279  SER A C   1 
ATOM   2096 O  O   . SER A 1 279 ? 10.891  22.970  26.234  1.00 20.58 ? 279  SER A O   1 
ATOM   2097 C  CB  . SER A 1 279 ? 12.175  21.559  28.719  1.00 7.68  ? 279  SER A CB  1 
ATOM   2098 O  OG  . SER A 1 279 ? 12.871  22.601  29.386  1.00 8.81  ? 279  SER A OG  1 
ATOM   2099 N  N   . ASP A 1 280 ? 13.040  23.753  26.309  1.00 11.64 ? 280  ASP A N   1 
ATOM   2100 C  CA  . ASP A 1 280 ? 12.668  25.039  25.643  1.00 15.74 ? 280  ASP A CA  1 
ATOM   2101 C  C   . ASP A 1 280 ? 13.078  25.013  24.186  1.00 20.93 ? 280  ASP A C   1 
ATOM   2102 O  O   . ASP A 1 280 ? 13.048  26.076  23.550  1.00 14.69 ? 280  ASP A O   1 
ATOM   2103 C  CB  . ASP A 1 280 ? 13.184  26.197  26.502  1.00 14.84 ? 280  ASP A CB  1 
ATOM   2104 C  CG  . ASP A 1 280 ? 14.694  26.256  26.671  1.00 16.38 ? 280  ASP A CG  1 
ATOM   2105 O  OD1 . ASP A 1 280 ? 15.421  25.520  25.939  1.00 12.92 ? 280  ASP A OD1 1 
ATOM   2106 O  OD2 . ASP A 1 280 ? 15.160  26.938  27.559  1.00 18.79 ? 280  ASP A OD2 1 
ATOM   2107 N  N   . GLY A 1 281 ? 13.511  23.903  23.590  1.00 15.14 ? 281  GLY A N   1 
ATOM   2108 C  CA  . GLY A 1 281 ? 13.929  23.958  22.168  1.00 7.71  ? 281  GLY A CA  1 
ATOM   2109 C  C   . GLY A 1 281 ? 15.413  24.261  22.025  1.00 9.65  ? 281  GLY A C   1 
ATOM   2110 O  O   . GLY A 1 281 ? 15.850  24.107  20.855  1.00 10.69 ? 281  GLY A O   1 
ATOM   2111 N  N   . ARG A 1 282 ? 16.111  24.753  23.065  1.00 9.54  ? 282  ARG A N   1 
ATOM   2112 C  CA  . ARG A 1 282 ? 17.535  25.066  22.986  1.00 12.34 ? 282  ARG A CA  1 
ATOM   2113 C  C   . ARG A 1 282 ? 18.320  23.727  22.972  1.00 15.01 ? 282  ARG A C   1 
ATOM   2114 O  O   . ARG A 1 282 ? 17.763  22.635  23.188  1.00 13.58 ? 282  ARG A O   1 
ATOM   2115 C  CB  . ARG A 1 282 ? 18.071  25.939  24.118  1.00 9.54  ? 282  ARG A CB  1 
ATOM   2116 C  CG  . ARG A 1 282 ? 17.466  27.353  23.808  1.00 12.27 ? 282  ARG A CG  1 
ATOM   2117 C  CD  . ARG A 1 282 ? 18.013  28.279  24.811  1.00 16.18 ? 282  ARG A CD  1 
ATOM   2118 N  NE  . ARG A 1 282 ? 17.553  27.930  26.172  1.00 17.98 ? 282  ARG A NE  1 
ATOM   2119 C  CZ  . ARG A 1 282 ? 18.151  28.470  27.242  1.00 18.93 ? 282  ARG A CZ  1 
ATOM   2120 N  NH1 . ARG A 1 282 ? 19.174  29.332  27.235  1.00 21.47 ? 282  ARG A NH1 1 
ATOM   2121 N  NH2 . ARG A 1 282 ? 17.720  28.083  28.439  1.00 19.91 ? 282  ARG A NH2 1 
ATOM   2122 N  N   . VAL A 1 283 ? 19.553  23.827  22.584  1.00 11.49 ? 283  VAL A N   1 
ATOM   2123 C  CA  . VAL A 1 283 ? 20.471  22.659  22.459  1.00 6.18  ? 283  VAL A CA  1 
ATOM   2124 C  C   . VAL A 1 283 ? 21.652  22.894  23.378  1.00 10.22 ? 283  VAL A C   1 
ATOM   2125 O  O   . VAL A 1 283 ? 22.370  23.927  23.349  1.00 11.26 ? 283  VAL A O   1 
ATOM   2126 C  CB  . VAL A 1 283 ? 20.878  22.408  20.992  1.00 6.35  ? 283  VAL A CB  1 
ATOM   2127 C  CG1 . VAL A 1 283 ? 21.829  21.172  20.950  1.00 12.61 ? 283  VAL A CG1 1 
ATOM   2128 C  CG2 . VAL A 1 283 ? 19.814  22.135  19.966  1.00 5.27  ? 283  VAL A CG2 1 
ATOM   2129 N  N   . PHE A 1 284 ? 21.919  21.960  24.283  1.00 9.49  ? 284  PHE A N   1 
ATOM   2130 C  CA  . PHE A 1 284 ? 22.994  21.972  25.239  1.00 7.71  ? 284  PHE A CA  1 
ATOM   2131 C  C   . PHE A 1 284 ? 24.067  20.923  24.774  1.00 11.76 ? 284  PHE A C   1 
ATOM   2132 O  O   . PHE A 1 284 ? 23.814  19.797  24.357  1.00 11.04 ? 284  PHE A O   1 
ATOM   2133 C  CB  . PHE A 1 284 ? 22.484  21.443  26.597  1.00 6.34  ? 284  PHE A CB  1 
ATOM   2134 C  CG  . PHE A 1 284 ? 23.481  21.281  27.717  1.00 10.61 ? 284  PHE A CG  1 
ATOM   2135 C  CD1 . PHE A 1 284 ? 23.861  22.365  28.470  1.00 5.25  ? 284  PHE A CD1 1 
ATOM   2136 C  CD2 . PHE A 1 284 ? 24.013  20.002  28.004  1.00 9.43  ? 284  PHE A CD2 1 
ATOM   2137 C  CE1 . PHE A 1 284 ? 24.765  22.268  29.486  1.00 16.97 ? 284  PHE A CE1 1 
ATOM   2138 C  CE2 . PHE A 1 284 ? 24.909  19.839  29.093  1.00 14.31 ? 284  PHE A CE2 1 
ATOM   2139 C  CZ  . PHE A 1 284 ? 25.302  20.983  29.784  1.00 18.66 ? 284  PHE A CZ  1 
ATOM   2140 N  N   . THR A 1 285 ? 25.317  21.300  24.897  1.00 11.79 ? 285  THR A N   1 
ATOM   2141 C  CA  . THR A 1 285 ? 26.431  20.356  24.567  1.00 5.05  ? 285  THR A CA  1 
ATOM   2142 C  C   . THR A 1 285 ? 27.478  20.515  25.671  1.00 8.68  ? 285  THR A C   1 
ATOM   2143 O  O   . THR A 1 285 ? 27.623  21.563  26.375  1.00 12.59 ? 285  THR A O   1 
ATOM   2144 C  CB  . THR A 1 285 ? 26.939  20.595  23.111  1.00 5.00  ? 285  THR A CB  1 
ATOM   2145 O  OG1 . THR A 1 285 ? 27.794  19.433  22.891  1.00 6.80  ? 285  THR A OG1 1 
ATOM   2146 C  CG2 . THR A 1 285 ? 27.781  21.867  22.974  1.00 8.00  ? 285  THR A CG2 1 
ATOM   2147 N  N   . ILE A 1 286 ? 28.283  19.455  25.835  1.00 9.32  ? 286  ILE A N   1 
ATOM   2148 C  CA  . ILE A 1 286 ? 29.367  19.510  26.845  1.00 7.90  ? 286  ILE A CA  1 
ATOM   2149 C  C   . ILE A 1 286 ? 30.396  18.441  26.387  1.00 10.10 ? 286  ILE A C   1 
ATOM   2150 O  O   . ILE A 1 286 ? 29.925  17.457  25.746  1.00 9.53  ? 286  ILE A O   1 
ATOM   2151 C  CB  . ILE A 1 286 ? 28.815  19.130  28.278  1.00 8.19  ? 286  ILE A CB  1 
ATOM   2152 C  CG1 . ILE A 1 286 ? 29.857  19.407  29.379  1.00 11.03 ? 286  ILE A CG1 1 
ATOM   2153 C  CG2 . ILE A 1 286 ? 28.168  17.721  28.334  1.00 9.61  ? 286  ILE A CG2 1 
ATOM   2154 C  CD1 . ILE A 1 286 ? 29.214  19.643  30.776  1.00 6.63  ? 286  ILE A CD1 1 
ATOM   2155 N  N   . GLY A 1 287 ? 31.642  18.688  26.772  1.00 12.76 ? 287  GLY A N   1 
ATOM   2156 C  CA  . GLY A 1 287 ? 32.737  17.786  26.424  1.00 12.50 ? 287  GLY A CA  1 
ATOM   2157 C  C   . GLY A 1 287 ? 33.116  17.799  24.954  1.00 13.44 ? 287  GLY A C   1 
ATOM   2158 O  O   . GLY A 1 287 ? 32.927  18.820  24.294  1.00 9.52  ? 287  GLY A O   1 
ATOM   2159 N  N   . GLY A 1 288 ? 33.707  16.700  24.471  1.00 9.68  ? 288  GLY A N   1 
ATOM   2160 C  CA  . GLY A 1 288 ? 34.104  16.597  23.063  1.00 6.59  ? 288  GLY A CA  1 
ATOM   2161 C  C   . GLY A 1 288 ? 35.651  16.828  22.912  1.00 6.66  ? 288  GLY A C   1 
ATOM   2162 O  O   . GLY A 1 288 ? 35.837  17.868  22.243  1.00 9.35  ? 288  GLY A O   1 
ATOM   2163 N  N   . SER A 1 289 ? 36.501  15.974  23.444  1.00 9.79  ? 289  SER A N   1 
ATOM   2164 C  CA  . SER A 1 289 ? 37.948  16.305  23.249  1.00 7.47  ? 289  SER A CA  1 
ATOM   2165 C  C   . SER A 1 289 ? 38.506  15.561  22.022  1.00 10.14 ? 289  SER A C   1 
ATOM   2166 O  O   . SER A 1 289 ? 39.721  15.602  21.786  1.00 8.92  ? 289  SER A O   1 
ATOM   2167 C  CB  . SER A 1 289 ? 38.813  16.120  24.467  1.00 5.00  ? 289  SER A CB  1 
ATOM   2168 O  OG  . SER A 1 289 ? 38.459  17.151  25.396  1.00 8.57  ? 289  SER A OG  1 
ATOM   2169 N  N   . TRP A 1 290 ? 37.646  14.961  21.206  1.00 10.09 ? 290  TRP A N   1 
ATOM   2170 C  CA  . TRP A 1 290 ? 38.156  14.260  20.007  1.00 12.98 ? 290  TRP A CA  1 
ATOM   2171 C  C   . TRP A 1 290 ? 38.898  15.275  19.102  1.00 21.23 ? 290  TRP A C   1 
ATOM   2172 O  O   . TRP A 1 290 ? 39.892  15.050  18.377  1.00 14.48 ? 290  TRP A O   1 
ATOM   2173 C  CB  . TRP A 1 290 ? 37.087  13.494  19.195  1.00 7.33  ? 290  TRP A CB  1 
ATOM   2174 C  CG  . TRP A 1 290 ? 37.581  12.762  18.009  1.00 12.78 ? 290  TRP A CG  1 
ATOM   2175 C  CD1 . TRP A 1 290 ? 38.222  11.523  18.050  1.00 11.18 ? 290  TRP A CD1 1 
ATOM   2176 C  CD2 . TRP A 1 290 ? 37.597  13.161  16.627  1.00 24.00 ? 290  TRP A CD2 1 
ATOM   2177 N  NE1 . TRP A 1 290 ? 38.614  11.148  16.763  1.00 10.22 ? 290  TRP A NE1 1 
ATOM   2178 C  CE2 . TRP A 1 290 ? 38.231  12.110  15.893  1.00 16.67 ? 290  TRP A CE2 1 
ATOM   2179 C  CE3 . TRP A 1 290 ? 37.145  14.313  15.972  1.00 13.21 ? 290  TRP A CE3 1 
ATOM   2180 C  CZ2 . TRP A 1 290 ? 38.395  12.169  14.514  1.00 16.00 ? 290  TRP A CZ2 1 
ATOM   2181 C  CZ3 . TRP A 1 290 ? 37.298  14.352  14.550  1.00 15.36 ? 290  TRP A CZ3 1 
ATOM   2182 C  CH2 . TRP A 1 290 ? 37.925  13.301  13.860  1.00 14.53 ? 290  TRP A CH2 1 
ATOM   2183 N  N   . SER A 1 291 ? 38.362  16.494  19.002  1.00 11.22 ? 291  SER A N   1 
ATOM   2184 C  CA  . SER A 1 291 ? 38.946  17.519  18.154  1.00 13.67 ? 291  SER A CA  1 
ATOM   2185 C  C   . SER A 1 291 ? 38.809  18.846  18.915  1.00 18.58 ? 291  SER A C   1 
ATOM   2186 O  O   . SER A 1 291 ? 38.151  18.924  19.926  1.00 13.87 ? 291  SER A O   1 
ATOM   2187 C  CB  . SER A 1 291 ? 38.306  17.592  16.811  1.00 16.12 ? 291  SER A CB  1 
ATOM   2188 O  OG  . SER A 1 291 ? 36.927  17.992  16.812  1.00 20.32 ? 291  SER A OG  1 
ATOM   2189 N  N   . GLY A 1 292 ? 39.543  19.834  18.400  1.00 18.04 ? 292  GLY A N   1 
ATOM   2190 C  CA  . GLY A 1 292 ? 39.538  21.153  18.943  1.00 19.65 ? 292  GLY A CA  1 
ATOM   2191 C  C   . GLY A 1 292 ? 40.463  21.234  20.163  1.00 31.98 ? 292  GLY A C   1 
ATOM   2192 O  O   . GLY A 1 292 ? 40.338  22.312  20.772  1.00 30.72 ? 292  GLY A O   1 
ATOM   2193 N  N   . GLY A 1 293 ? 41.226  20.202  20.454  1.00 22.15 ? 293  GLY A N   1 
ATOM   2194 C  CA  . GLY A 1 293 ? 42.092  20.281  21.660  1.00 13.37 ? 293  GLY A CA  1 
ATOM   2195 C  C   . GLY A 1 293 ? 41.499  19.361  22.718  1.00 18.23 ? 293  GLY A C   1 
ATOM   2196 O  O   . GLY A 1 293 ? 40.320  18.961  22.677  1.00 17.89 ? 293  GLY A O   1 
ATOM   2197 N  N   . VAL A 1 294 ? 42.408  19.109  23.610  1.00 18.83 ? 294  VAL A N   1 
ATOM   2198 C  CA  . VAL A 1 294 ? 42.091  18.233  24.772  1.00 22.28 ? 294  VAL A CA  1 
ATOM   2199 C  C   . VAL A 1 294 ? 42.235  19.062  26.034  1.00 33.65 ? 294  VAL A C   1 
ATOM   2200 O  O   . VAL A 1 294 ? 43.389  19.377  26.451  1.00 32.05 ? 294  VAL A O   1 
ATOM   2201 C  CB  . VAL A 1 294 ? 42.993  16.960  24.712  1.00 15.70 ? 294  VAL A CB  1 
ATOM   2202 C  CG1 . VAL A 1 294 ? 42.687  16.114  25.927  1.00 17.64 ? 294  VAL A CG1 1 
ATOM   2203 C  CG2 . VAL A 1 294 ? 42.896  16.117  23.445  1.00 17.11 ? 294  VAL A CG2 1 
ATOM   2204 N  N   . PHE A 1 295 ? 41.155  19.458  26.658  1.00 28.85 ? 295  PHE A N   1 
ATOM   2205 C  CA  . PHE A 1 295 ? 41.153  20.252  27.926  1.00 26.80 ? 295  PHE A CA  1 
ATOM   2206 C  C   . PHE A 1 295 ? 39.713  20.187  28.462  1.00 29.66 ? 295  PHE A C   1 
ATOM   2207 O  O   . PHE A 1 295 ? 38.850  19.638  27.774  1.00 18.95 ? 295  PHE A O   1 
ATOM   2208 C  CB  . PHE A 1 295 ? 41.518  21.715  27.687  1.00 28.02 ? 295  PHE A CB  1 
ATOM   2209 C  CG  . PHE A 1 295 ? 40.723  22.405  26.612  1.00 20.54 ? 295  PHE A CG  1 
ATOM   2210 C  CD1 . PHE A 1 295 ? 41.165  22.424  25.292  1.00 23.79 ? 295  PHE A CD1 1 
ATOM   2211 C  CD2 . PHE A 1 295 ? 39.587  23.157  26.870  1.00 16.90 ? 295  PHE A CD2 1 
ATOM   2212 C  CE1 . PHE A 1 295 ? 40.513  23.026  24.257  1.00 22.34 ? 295  PHE A CE1 1 
ATOM   2213 C  CE2 . PHE A 1 295 ? 38.892  23.776  25.865  1.00 22.38 ? 295  PHE A CE2 1 
ATOM   2214 C  CZ  . PHE A 1 295 ? 39.330  23.766  24.535  1.00 23.95 ? 295  PHE A CZ  1 
ATOM   2215 N  N   . GLU A 1 296 ? 39.462  20.728  29.627  1.00 18.05 ? 296  GLU A N   1 
ATOM   2216 C  CA  . GLU A 1 296 ? 38.070  20.664  30.086  1.00 13.16 ? 296  GLU A CA  1 
ATOM   2217 C  C   . GLU A 1 296 ? 37.158  21.580  29.281  1.00 18.12 ? 296  GLU A C   1 
ATOM   2218 O  O   . GLU A 1 296 ? 37.283  22.818  29.267  1.00 14.83 ? 296  GLU A O   1 
ATOM   2219 C  CB  . GLU A 1 296 ? 37.983  20.980  31.570  1.00 15.19 ? 296  GLU A CB  1 
ATOM   2220 C  CG  . GLU A 1 296 ? 38.616  19.802  32.401  1.00 34.53 ? 296  GLU A CG  1 
ATOM   2221 C  CD  . GLU A 1 296 ? 38.123  19.873  33.841  1.00 47.84 ? 296  GLU A CD  1 
ATOM   2222 O  OE1 . GLU A 1 296 ? 37.878  21.013  34.266  1.00 48.09 ? 296  GLU A OE1 1 
ATOM   2223 O  OE2 . GLU A 1 296 ? 37.939  18.802  34.488  1.00 30.10 ? 296  GLU A OE2 1 
ATOM   2224 N  N   . LYS A 1 297 ? 36.183  20.928  28.627  1.00 15.10 ? 297  LYS A N   1 
ATOM   2225 C  CA  . LYS A 1 297 ? 35.166  21.630  27.780  1.00 11.95 ? 297  LYS A CA  1 
ATOM   2226 C  C   . LYS A 1 297 ? 33.823  21.639  28.516  1.00 16.71 ? 297  LYS A C   1 
ATOM   2227 O  O   . LYS A 1 297 ? 33.097  20.638  28.527  1.00 12.52 ? 297  LYS A O   1 
ATOM   2228 C  CB  . LYS A 1 297 ? 35.086  21.015  26.361  1.00 8.83  ? 297  LYS A CB  1 
ATOM   2229 C  CG  . LYS A 1 297 ? 36.522  21.004  25.737  1.00 7.89  ? 297  LYS A CG  1 
ATOM   2230 C  CD  . LYS A 1 297 ? 36.467  20.523  24.321  1.00 6.76  ? 297  LYS A CD  1 
ATOM   2231 C  CE  . LYS A 1 297 ? 37.944  20.084  23.938  1.00 5.00  ? 297  LYS A CE  1 
ATOM   2232 N  NZ  . LYS A 1 297 ? 37.796  19.996  22.406  1.00 5.00  ? 297  LYS A NZ  1 
ATOM   2233 N  N   . ASN A 1 298 ? 33.450  22.693  29.190  1.00 11.85 ? 298  ASN A N   1 
ATOM   2234 C  CA  . ASN A 1 298 ? 32.214  22.866  29.992  1.00 15.14 ? 298  ASN A CA  1 
ATOM   2235 C  C   . ASN A 1 298 ? 31.032  23.075  29.036  1.00 12.85 ? 298  ASN A C   1 
ATOM   2236 O  O   . ASN A 1 298 ? 31.260  23.048  27.845  1.00 10.76 ? 298  ASN A O   1 
ATOM   2237 C  CB  . ASN A 1 298 ? 32.359  23.889  31.113  1.00 13.98 ? 298  ASN A CB  1 
ATOM   2238 C  CG  . ASN A 1 298 ? 33.578  23.452  31.991  1.00 19.59 ? 298  ASN A CG  1 
ATOM   2239 O  OD1 . ASN A 1 298 ? 34.556  24.254  32.130  1.00 21.15 ? 298  ASN A OD1 1 
ATOM   2240 N  ND2 . ASN A 1 298 ? 33.571  22.236  32.493  1.00 8.26  ? 298  ASN A ND2 1 
ATOM   2241 N  N   . GLY A 1 299 ? 29.821  23.215  29.572  1.00 7.32  ? 299  GLY A N   1 
ATOM   2242 C  CA  . GLY A 1 299 ? 28.646  23.353  28.780  1.00 10.07 ? 299  GLY A CA  1 
ATOM   2243 C  C   . GLY A 1 299 ? 28.548  24.674  27.959  1.00 10.38 ? 299  GLY A C   1 
ATOM   2244 O  O   . GLY A 1 299 ? 29.200  25.658  28.307  1.00 13.91 ? 299  GLY A O   1 
ATOM   2245 N  N   . GLU A 1 300 ? 27.735  24.478  26.905  1.00 8.91  ? 300  GLU A N   1 
ATOM   2246 C  CA  . GLU A 1 300 ? 27.404  25.773  26.172  1.00 9.15  ? 300  GLU A CA  1 
ATOM   2247 C  C   . GLU A 1 300 ? 26.012  25.491  25.661  1.00 11.87 ? 300  GLU A C   1 
ATOM   2248 O  O   . GLU A 1 300 ? 25.581  24.313  25.525  1.00 13.81 ? 300  GLU A O   1 
ATOM   2249 C  CB  . GLU A 1 300 ? 28.339  26.329  25.156  1.00 6.66  ? 300  GLU A CB  1 
ATOM   2250 C  CG  . GLU A 1 300 ? 28.515  25.284  24.012  1.00 9.73  ? 300  GLU A CG  1 
ATOM   2251 C  CD  . GLU A 1 300 ? 29.501  26.058  23.101  1.00 17.51 ? 300  GLU A CD  1 
ATOM   2252 O  OE1 . GLU A 1 300 ? 29.172  27.006  22.420  1.00 10.49 ? 300  GLU A OE1 1 
ATOM   2253 O  OE2 . GLU A 1 300 ? 30.648  25.582  23.154  1.00 15.48 ? 300  GLU A OE2 1 
ATOM   2254 N  N   . VAL A 1 301 ? 25.212  26.536  25.407  1.00 5.00  ? 301  VAL A N   1 
ATOM   2255 C  CA  . VAL A 1 301 ? 23.838  26.272  24.975  1.00 7.70  ? 301  VAL A CA  1 
ATOM   2256 C  C   . VAL A 1 301 ? 23.555  27.123  23.710  1.00 15.50 ? 301  VAL A C   1 
ATOM   2257 O  O   . VAL A 1 301 ? 23.967  28.284  23.569  1.00 14.22 ? 301  VAL A O   1 
ATOM   2258 C  CB  . VAL A 1 301 ? 22.835  26.575  26.140  1.00 5.19  ? 301  VAL A CB  1 
ATOM   2259 C  CG1 . VAL A 1 301 ? 23.091  28.010  26.701  1.00 5.00  ? 301  VAL A CG1 1 
ATOM   2260 C  CG2 . VAL A 1 301 ? 21.432  26.453  25.610  1.00 9.03  ? 301  VAL A CG2 1 
ATOM   2261 N  N   . TYR A 1 302 ? 22.923  26.519  22.729  1.00 13.12 ? 302  TYR A N   1 
ATOM   2262 C  CA  . TYR A 1 302 ? 22.521  27.126  21.470  1.00 6.55  ? 302  TYR A CA  1 
ATOM   2263 C  C   . TYR A 1 302 ? 21.054  27.597  21.553  1.00 10.38 ? 302  TYR A C   1 
ATOM   2264 O  O   . TYR A 1 302 ? 20.108  26.848  21.925  1.00 8.99  ? 302  TYR A O   1 
ATOM   2265 C  CB  . TYR A 1 302 ? 22.637  26.108  20.319  1.00 10.96 ? 302  TYR A CB  1 
ATOM   2266 C  CG  . TYR A 1 302 ? 22.049  26.557  18.990  1.00 15.20 ? 302  TYR A CG  1 
ATOM   2267 C  CD1 . TYR A 1 302 ? 22.608  27.592  18.236  1.00 14.36 ? 302  TYR A CD1 1 
ATOM   2268 C  CD2 . TYR A 1 302 ? 20.899  25.936  18.456  1.00 19.85 ? 302  TYR A CD2 1 
ATOM   2269 C  CE1 . TYR A 1 302 ? 22.145  27.972  16.948  1.00 16.06 ? 302  TYR A CE1 1 
ATOM   2270 C  CE2 . TYR A 1 302 ? 20.393  26.323  17.207  1.00 27.51 ? 302  TYR A CE2 1 
ATOM   2271 C  CZ  . TYR A 1 302 ? 21.007  27.378  16.471  1.00 18.65 ? 302  TYR A CZ  1 
ATOM   2272 O  OH  . TYR A 1 302 ? 20.447  27.601  15.258  1.00 19.34 ? 302  TYR A OH  1 
ATOM   2273 N  N   . SER A 1 303 ? 20.829  28.816  21.171  1.00 12.29 ? 303  SER A N   1 
ATOM   2274 C  CA  . SER A 1 303 ? 19.421  29.350  21.094  1.00 10.05 ? 303  SER A CA  1 
ATOM   2275 C  C   . SER A 1 303 ? 19.034  29.487  19.615  1.00 18.51 ? 303  SER A C   1 
ATOM   2276 O  O   . SER A 1 303 ? 19.588  30.317  18.853  1.00 20.87 ? 303  SER A O   1 
ATOM   2277 C  CB  . SER A 1 303 ? 19.372  30.681  21.850  1.00 14.53 ? 303  SER A CB  1 
ATOM   2278 O  OG  . SER A 1 303 ? 18.008  31.157  21.489  1.00 18.79 ? 303  SER A OG  1 
ATOM   2279 N  N   . PRO A 1 304 ? 18.094  28.692  19.073  1.00 16.43 ? 304  PRO A N   1 
ATOM   2280 C  CA  . PRO A 1 304 ? 17.667  28.748  17.681  1.00 19.52 ? 304  PRO A CA  1 
ATOM   2281 C  C   . PRO A 1 304 ? 17.000  30.105  17.349  1.00 39.47 ? 304  PRO A C   1 
ATOM   2282 O  O   . PRO A 1 304 ? 16.996  30.564  16.216  1.00 36.52 ? 304  PRO A O   1 
ATOM   2283 C  CB  . PRO A 1 304 ? 16.597  27.654  17.515  1.00 24.36 ? 304  PRO A CB  1 
ATOM   2284 C  CG  . PRO A 1 304 ? 16.548  26.881  18.803  1.00 34.56 ? 304  PRO A CG  1 
ATOM   2285 C  CD  . PRO A 1 304 ? 17.350  27.633  19.840  1.00 20.23 ? 304  PRO A CD  1 
ATOM   2286 N  N   . SER A 1 305 ? 16.442  30.749  18.362  1.00 38.90 ? 305  SER A N   1 
ATOM   2287 C  CA  . SER A 1 305 ? 15.768  32.062  18.157  1.00 41.65 ? 305  SER A CA  1 
ATOM   2288 C  C   . SER A 1 305 ? 16.806  33.144  17.973  1.00 37.18 ? 305  SER A C   1 
ATOM   2289 O  O   . SER A 1 305 ? 16.804  33.848  16.925  1.00 42.86 ? 305  SER A O   1 
ATOM   2290 C  CB  . SER A 1 305 ? 14.696  32.214  19.191  1.00 33.68 ? 305  SER A CB  1 
ATOM   2291 O  OG  . SER A 1 305 ? 15.280  32.616  20.395  1.00 48.35 ? 305  SER A OG  1 
ATOM   2292 N  N   . SER A 1 306 ? 17.809  33.246  18.811  1.00 23.00 ? 306  SER A N   1 
ATOM   2293 C  CA  . SER A 1 306 ? 18.804  34.305  18.593  1.00 18.88 ? 306  SER A CA  1 
ATOM   2294 C  C   . SER A 1 306 ? 19.961  33.806  17.755  1.00 20.84 ? 306  SER A C   1 
ATOM   2295 O  O   . SER A 1 306 ? 20.818  34.651  17.408  1.00 22.41 ? 306  SER A O   1 
ATOM   2296 C  CB  . SER A 1 306 ? 19.232  34.862  19.918  1.00 18.64 ? 306  SER A CB  1 
ATOM   2297 O  OG  . SER A 1 306 ? 20.055  33.875  20.510  1.00 26.29 ? 306  SER A OG  1 
ATOM   2298 N  N   . LYS A 1 307 ? 19.998  32.510  17.562  1.00 22.38 ? 307  LYS A N   1 
ATOM   2299 C  CA  . LYS A 1 307 ? 21.128  31.959  16.764  1.00 23.61 ? 307  LYS A CA  1 
ATOM   2300 C  C   . LYS A 1 307 ? 22.467  32.286  17.352  1.00 18.62 ? 307  LYS A C   1 
ATOM   2301 O  O   . LYS A 1 307 ? 23.373  32.775  16.634  1.00 20.28 ? 307  LYS A O   1 
ATOM   2302 C  CB  . LYS A 1 307 ? 21.107  32.510  15.322  1.00 33.05 ? 307  LYS A CB  1 
ATOM   2303 C  CG  . LYS A 1 307 ? 19.824  32.137  14.591  1.00 33.54 ? 307  LYS A CG  1 
ATOM   2304 C  CD  . LYS A 1 307 ? 19.863  30.655  14.194  1.00 45.96 ? 307  LYS A CD  1 
ATOM   2305 C  CE  . LYS A 1 307 ? 18.747  30.367  13.156  1.00 61.20 ? 307  LYS A CE  1 
ATOM   2306 N  NZ  . LYS A 1 307 ? 19.310  30.254  11.776  1.00 49.94 ? 307  LYS A NZ  1 
ATOM   2307 N  N   . THR A 1 308 ? 22.633  31.987  18.643  1.00 20.91 ? 308  THR A N   1 
ATOM   2308 C  CA  . THR A 1 308 ? 23.880  32.212  19.377  1.00 22.36 ? 308  THR A CA  1 
ATOM   2309 C  C   . THR A 1 308 ? 24.207  30.964  20.208  1.00 15.27 ? 308  THR A C   1 
ATOM   2310 O  O   . THR A 1 308 ? 23.227  30.226  20.559  1.00 17.06 ? 308  THR A O   1 
ATOM   2311 C  CB  . THR A 1 308 ? 23.712  33.372  20.475  1.00 23.17 ? 308  THR A CB  1 
ATOM   2312 O  OG1 . THR A 1 308 ? 22.447  32.966  21.163  1.00 19.76 ? 308  THR A OG1 1 
ATOM   2313 C  CG2 . THR A 1 308 ? 23.603  34.727  19.808  1.00 28.65 ? 308  THR A CG2 1 
ATOM   2314 N  N   . TRP A 1 309 ? 25.459  30.829  20.511  1.00 16.17 ? 309  TRP A N   1 
ATOM   2315 C  CA  . TRP A 1 309 ? 25.966  29.770  21.373  1.00 10.43 ? 309  TRP A CA  1 
ATOM   2316 C  C   . TRP A 1 309 ? 26.358  30.519  22.623  1.00 15.05 ? 309  TRP A C   1 
ATOM   2317 O  O   . TRP A 1 309 ? 27.063  31.538  22.393  1.00 14.95 ? 309  TRP A O   1 
ATOM   2318 C  CB  . TRP A 1 309 ? 27.230  28.998  20.917  1.00 12.10 ? 309  TRP A CB  1 
ATOM   2319 C  CG  . TRP A 1 309 ? 26.777  27.904  19.961  1.00 12.70 ? 309  TRP A CG  1 
ATOM   2320 C  CD1 . TRP A 1 309 ? 26.741  27.943  18.623  1.00 18.96 ? 309  TRP A CD1 1 
ATOM   2321 C  CD2 . TRP A 1 309 ? 26.302  26.584  20.322  1.00 11.91 ? 309  TRP A CD2 1 
ATOM   2322 N  NE1 . TRP A 1 309 ? 26.300  26.739  18.114  1.00 16.44 ? 309  TRP A NE1 1 
ATOM   2323 C  CE2 . TRP A 1 309 ? 26.020  25.915  19.155  1.00 10.72 ? 309  TRP A CE2 1 
ATOM   2324 C  CE3 . TRP A 1 309 ? 26.112  25.963  21.564  1.00 10.17 ? 309  TRP A CE3 1 
ATOM   2325 C  CZ2 . TRP A 1 309 ? 25.523  24.607  19.101  1.00 13.93 ? 309  TRP A CZ2 1 
ATOM   2326 C  CZ3 . TRP A 1 309 ? 25.631  24.654  21.535  1.00 9.81  ? 309  TRP A CZ3 1 
ATOM   2327 C  CH2 . TRP A 1 309 ? 25.389  24.027  20.331  1.00 16.43 ? 309  TRP A CH2 1 
ATOM   2328 N  N   . THR A 1 310 ? 26.012  30.096  23.788  1.00 14.29 ? 310  THR A N   1 
ATOM   2329 C  CA  . THR A 1 310 ? 26.396  30.864  24.973  1.00 12.94 ? 310  THR A CA  1 
ATOM   2330 C  C   . THR A 1 310 ? 27.121  29.880  25.861  1.00 13.96 ? 310  THR A C   1 
ATOM   2331 O  O   . THR A 1 310 ? 26.500  28.816  26.051  1.00 14.09 ? 310  THR A O   1 
ATOM   2332 C  CB  . THR A 1 310 ? 25.200  31.519  25.828  1.00 14.81 ? 310  THR A CB  1 
ATOM   2333 O  OG1 . THR A 1 310 ? 24.635  32.413  24.824  1.00 13.80 ? 310  THR A OG1 1 
ATOM   2334 C  CG2 . THR A 1 310 ? 25.579  32.332  27.061  1.00 15.05 ? 310  THR A CG2 1 
ATOM   2335 N  N   . SER A 1 311 ? 28.255  30.332  26.378  1.00 12.89 ? 311  SER A N   1 
ATOM   2336 C  CA  . SER A 1 311 ? 28.988  29.426  27.275  1.00 14.18 ? 311  SER A CA  1 
ATOM   2337 C  C   . SER A 1 311 ? 28.368  29.252  28.631  1.00 10.90 ? 311  SER A C   1 
ATOM   2338 O  O   . SER A 1 311 ? 27.844  30.285  29.089  1.00 14.64 ? 311  SER A O   1 
ATOM   2339 C  CB  . SER A 1 311 ? 30.413  30.047  27.232  1.00 9.60  ? 311  SER A CB  1 
ATOM   2340 O  OG  . SER A 1 311 ? 31.212  29.256  28.013  1.00 31.43 ? 311  SER A OG  1 
ATOM   2341 N  N   . LEU A 1 312 ? 28.326  28.074  29.261  1.00 5.00  ? 312  LEU A N   1 
ATOM   2342 C  CA  . LEU A 1 312 ? 27.808  27.868  30.600  1.00 8.15  ? 312  LEU A CA  1 
ATOM   2343 C  C   . LEU A 1 312 ? 28.979  27.271  31.372  1.00 16.83 ? 312  LEU A C   1 
ATOM   2344 O  O   . LEU A 1 312 ? 29.014  26.027  31.526  1.00 17.29 ? 312  LEU A O   1 
ATOM   2345 C  CB  . LEU A 1 312 ? 26.601  26.910  30.665  1.00 6.66  ? 312  LEU A CB  1 
ATOM   2346 C  CG  . LEU A 1 312 ? 25.391  27.326  29.824  1.00 7.98  ? 312  LEU A CG  1 
ATOM   2347 C  CD1 . LEU A 1 312 ? 24.332  26.257  29.859  1.00 6.25  ? 312  LEU A CD1 1 
ATOM   2348 C  CD2 . LEU A 1 312 ? 24.837  28.656  30.259  1.00 8.00  ? 312  LEU A CD2 1 
ATOM   2349 N  N   . PRO A 1 313 ? 29.940  28.088  31.808  1.00 14.53 ? 313  PRO A N   1 
ATOM   2350 C  CA  . PRO A 1 313 ? 31.133  27.568  32.411  1.00 5.19  ? 313  PRO A CA  1 
ATOM   2351 C  C   . PRO A 1 313 ? 30.907  26.849  33.703  1.00 11.88 ? 313  PRO A C   1 
ATOM   2352 O  O   . PRO A 1 313 ? 31.743  26.020  33.985  1.00 17.91 ? 313  PRO A O   1 
ATOM   2353 C  CB  . PRO A 1 313 ? 32.058  28.765  32.591  1.00 13.25 ? 313  PRO A CB  1 
ATOM   2354 C  CG  . PRO A 1 313 ? 31.189  29.947  32.471  1.00 10.21 ? 313  PRO A CG  1 
ATOM   2355 C  CD  . PRO A 1 313 ? 29.991  29.547  31.616  1.00 13.15 ? 313  PRO A CD  1 
ATOM   2356 N  N   . ASN A 1 314 ? 29.798  27.134  34.358  1.00 5.84  ? 314  ASN A N   1 
ATOM   2357 C  CA  . ASN A 1 314 ? 29.611  26.441  35.648  1.00 8.07  ? 314  ASN A CA  1 
ATOM   2358 C  C   . ASN A 1 314 ? 28.885  25.088  35.422  1.00 8.17  ? 314  ASN A C   1 
ATOM   2359 O  O   . ASN A 1 314 ? 28.711  24.421  36.454  1.00 7.73  ? 314  ASN A O   1 
ATOM   2360 C  CB  . ASN A 1 314 ? 29.018  27.354  36.703  1.00 14.03 ? 314  ASN A CB  1 
ATOM   2361 C  CG  . ASN A 1 314 ? 29.820  28.570  37.008  1.00 19.09 ? 314  ASN A CG  1 
ATOM   2362 O  OD1 . ASN A 1 314 ? 31.026  28.356  37.103  1.00 18.83 ? 314  ASN A OD1 1 
ATOM   2363 N  ND2 . ASN A 1 314 ? 29.320  29.781  37.154  1.00 12.45 ? 314  ASN A ND2 1 
ATOM   2364 N  N   . ALA A 1 315 ? 28.557  24.736  34.206  1.00 5.82  ? 315  ALA A N   1 
ATOM   2365 C  CA  . ALA A 1 315 ? 27.978  23.396  33.960  1.00 5.00  ? 315  ALA A CA  1 
ATOM   2366 C  C   . ALA A 1 315 ? 29.309  22.706  33.544  1.00 6.38  ? 315  ALA A C   1 
ATOM   2367 O  O   . ALA A 1 315 ? 29.681  22.565  32.358  1.00 10.57 ? 315  ALA A O   1 
ATOM   2368 C  CB  . ALA A 1 315 ? 27.145  23.417  32.667  1.00 5.00  ? 315  ALA A CB  1 
ATOM   2369 N  N   . LYS A 1 316 ? 29.893  22.198  34.575  1.00 7.73  ? 316  LYS A N   1 
ATOM   2370 C  CA  . LYS A 1 316 ? 31.240  21.588  34.492  1.00 5.35  ? 316  LYS A CA  1 
ATOM   2371 C  C   . LYS A 1 316 ? 31.303  20.164  34.013  1.00 5.59  ? 316  LYS A C   1 
ATOM   2372 O  O   . LYS A 1 316 ? 30.540  19.353  34.531  1.00 7.92  ? 316  LYS A O   1 
ATOM   2373 C  CB  . LYS A 1 316 ? 31.626  21.495  35.976  1.00 17.84 ? 316  LYS A CB  1 
ATOM   2374 C  CG  . LYS A 1 316 ? 31.881  22.733  36.808  1.00 29.73 ? 316  LYS A CG  1 
ATOM   2375 C  CD  . LYS A 1 316 ? 32.810  23.751  36.210  1.00 37.93 ? 316  LYS A CD  1 
ATOM   2376 C  CE  . LYS A 1 316 ? 33.390  24.660  37.266  1.00 67.77 ? 316  LYS A CE  1 
ATOM   2377 N  NZ  . LYS A 1 316 ? 32.783  26.001  37.361  1.00 76.95 ? 316  LYS A NZ  1 
ATOM   2378 N  N   . VAL A 1 317 ? 32.264  20.010  33.108  1.00 5.00  ? 317  VAL A N   1 
ATOM   2379 C  CA  . VAL A 1 317 ? 32.352  18.622  32.579  1.00 5.00  ? 317  VAL A CA  1 
ATOM   2380 C  C   . VAL A 1 317 ? 33.038  17.725  33.570  1.00 16.22 ? 317  VAL A C   1 
ATOM   2381 O  O   . VAL A 1 317 ? 32.875  16.487  33.544  1.00 7.13  ? 317  VAL A O   1 
ATOM   2382 C  CB  . VAL A 1 317 ? 33.135  18.670  31.233  1.00 8.39  ? 317  VAL A CB  1 
ATOM   2383 C  CG1 . VAL A 1 317 ? 34.655  18.927  31.514  1.00 5.04  ? 317  VAL A CG1 1 
ATOM   2384 C  CG2 . VAL A 1 317 ? 32.940  17.328  30.518  1.00 10.55 ? 317  VAL A CG2 1 
ATOM   2385 N  N   . ASN A 1 318 ? 33.852  18.155  34.495  1.00 6.96  ? 318  ASN A N   1 
ATOM   2386 C  CA  . ASN A 1 318 ? 34.591  17.313  35.388  1.00 16.30 ? 318  ASN A CA  1 
ATOM   2387 C  C   . ASN A 1 318 ? 33.843  16.127  35.995  1.00 20.61 ? 318  ASN A C   1 
ATOM   2388 O  O   . ASN A 1 318 ? 34.389  14.987  35.924  1.00 15.86 ? 318  ASN A O   1 
ATOM   2389 C  CB  . ASN A 1 318 ? 35.474  18.190  36.306  1.00 20.11 ? 318  ASN A CB  1 
ATOM   2390 C  CG  . ASN A 1 318 ? 36.468  17.257  36.996  1.00 36.51 ? 318  ASN A CG  1 
ATOM   2391 O  OD1 . ASN A 1 318 ? 36.087  16.773  38.061  1.00 49.61 ? 318  ASN A OD1 1 
ATOM   2392 N  ND2 . ASN A 1 318 ? 37.664  17.030  36.466  1.00 39.51 ? 318  ASN A ND2 1 
ATOM   2393 N  N   . PRO A 1 319 ? 32.701  16.250  36.622  1.00 18.19 ? 319  PRO A N   1 
ATOM   2394 C  CA  . PRO A 1 319 ? 32.000  15.117  37.252  1.00 17.48 ? 319  PRO A CA  1 
ATOM   2395 C  C   . PRO A 1 319 ? 31.493  14.039  36.341  1.00 11.16 ? 319  PRO A C   1 
ATOM   2396 O  O   . PRO A 1 319 ? 31.095  12.958  36.865  1.00 15.46 ? 319  PRO A O   1 
ATOM   2397 C  CB  . PRO A 1 319 ? 30.855  15.675  38.124  1.00 14.96 ? 319  PRO A CB  1 
ATOM   2398 C  CG  . PRO A 1 319 ? 30.743  17.053  37.615  1.00 15.52 ? 319  PRO A CG  1 
ATOM   2399 C  CD  . PRO A 1 319 ? 31.950  17.509  36.837  1.00 13.24 ? 319  PRO A CD  1 
ATOM   2400 N  N   . MET A 1 320 ? 31.441  14.297  35.044  1.00 8.00  ? 320  MET A N   1 
ATOM   2401 C  CA  . MET A 1 320 ? 30.935  13.237  34.137  1.00 9.66  ? 320  MET A CA  1 
ATOM   2402 C  C   . MET A 1 320 ? 32.131  12.523  33.468  1.00 11.71 ? 320  MET A C   1 
ATOM   2403 O  O   . MET A 1 320 ? 31.761  11.669  32.669  1.00 10.10 ? 320  MET A O   1 
ATOM   2404 C  CB  . MET A 1 320 ? 29.996  13.788  33.101  1.00 6.88  ? 320  MET A CB  1 
ATOM   2405 C  CG  . MET A 1 320 ? 30.732  14.778  32.208  1.00 14.70 ? 320  MET A CG  1 
ATOM   2406 S  SD  . MET A 1 320 ? 29.738  15.118  30.639  1.00 16.97 ? 320  MET A SD  1 
ATOM   2407 C  CE  . MET A 1 320 ? 30.774  14.162  29.441  1.00 13.14 ? 320  MET A CE  1 
ATOM   2408 N  N   . LEU A 1 321 ? 33.389  12.866  33.760  1.00 6.76  ? 321  LEU A N   1 
ATOM   2409 C  CA  . LEU A 1 321 ? 34.437  12.166  33.004  1.00 11.07 ? 321  LEU A CA  1 
ATOM   2410 C  C   . LEU A 1 321 ? 34.565  10.680  33.376  1.00 19.88 ? 321  LEU A C   1 
ATOM   2411 O  O   . LEU A 1 321 ? 34.493  10.241  34.564  1.00 19.44 ? 321  LEU A O   1 
ATOM   2412 C  CB  . LEU A 1 321 ? 35.734  12.975  33.268  1.00 5.00  ? 321  LEU A CB  1 
ATOM   2413 C  CG  . LEU A 1 321 ? 35.809  14.452  33.026  1.00 5.00  ? 321  LEU A CG  1 
ATOM   2414 C  CD1 . LEU A 1 321 ? 37.193  14.993  33.196  1.00 5.19  ? 321  LEU A CD1 1 
ATOM   2415 C  CD2 . LEU A 1 321 ? 35.614  14.525  31.504  1.00 5.00  ? 321  LEU A CD2 1 
ATOM   2416 N  N   . THR A 1 322 ? 34.759  9.800   32.383  1.00 9.76  ? 322  THR A N   1 
ATOM   2417 C  CA  . THR A 1 322 ? 35.020  8.366   32.749  1.00 10.12 ? 322  THR A CA  1 
ATOM   2418 C  C   . THR A 1 322 ? 36.513  8.312   33.202  1.00 15.03 ? 322  THR A C   1 
ATOM   2419 O  O   . THR A 1 322 ? 37.326  9.256   33.172  1.00 8.39  ? 322  THR A O   1 
ATOM   2420 C  CB  . THR A 1 322 ? 34.738  7.416   31.575  1.00 5.00  ? 322  THR A CB  1 
ATOM   2421 O  OG1 . THR A 1 322 ? 35.768  7.665   30.566  1.00 5.00  ? 322  THR A OG1 1 
ATOM   2422 C  CG2 . THR A 1 322 ? 33.345  7.548   30.900  1.00 8.50  ? 322  THR A CG2 1 
ATOM   2423 N  N   . ALA A 1 323 ? 36.936  7.148   33.564  1.00 10.38 ? 323  ALA A N   1 
ATOM   2424 C  CA  . ALA A 1 323 ? 38.331  6.898   33.945  1.00 9.49  ? 323  ALA A CA  1 
ATOM   2425 C  C   . ALA A 1 323 ? 39.071  6.341   32.752  1.00 14.33 ? 323  ALA A C   1 
ATOM   2426 O  O   . ALA A 1 323 ? 40.007  5.544   33.046  1.00 17.23 ? 323  ALA A O   1 
ATOM   2427 C  CB  . ALA A 1 323 ? 38.428  5.928   35.115  1.00 11.99 ? 323  ALA A CB  1 
ATOM   2428 N  N   . ASP A 1 324 ? 38.688  6.664   31.537  1.00 11.09 ? 324  ASP A N   1 
ATOM   2429 C  CA  . ASP A 1 324 ? 39.378  6.117   30.349  1.00 12.91 ? 324  ASP A CA  1 
ATOM   2430 C  C   . ASP A 1 324 ? 40.905  6.147   30.451  1.00 17.26 ? 324  ASP A C   1 
ATOM   2431 O  O   . ASP A 1 324 ? 41.490  7.192   30.737  1.00 17.64 ? 324  ASP A O   1 
ATOM   2432 C  CB  . ASP A 1 324 ? 38.979  6.944   29.097  1.00 9.04  ? 324  ASP A CB  1 
ATOM   2433 C  CG  . ASP A 1 324 ? 39.027  6.050   27.880  1.00 14.41 ? 324  ASP A CG  1 
ATOM   2434 O  OD1 . ASP A 1 324 ? 40.123  5.689   27.395  1.00 14.53 ? 324  ASP A OD1 1 
ATOM   2435 O  OD2 . ASP A 1 324 ? 37.998  5.521   27.372  1.00 12.35 ? 324  ASP A OD2 1 
ATOM   2436 N  N   . LYS A 1 325 ? 41.620  5.078   30.175  1.00 15.98 ? 325  LYS A N   1 
ATOM   2437 C  CA  . LYS A 1 325 ? 43.061  4.981   30.120  1.00 18.00 ? 325  LYS A CA  1 
ATOM   2438 C  C   . LYS A 1 325 ? 43.690  5.984   29.158  1.00 19.78 ? 325  LYS A C   1 
ATOM   2439 O  O   . LYS A 1 325 ? 44.821  6.459   29.339  1.00 23.96 ? 325  LYS A O   1 
ATOM   2440 C  CB  . LYS A 1 325 ? 43.622  3.604   29.620  1.00 15.12 ? 325  LYS A CB  1 
ATOM   2441 C  CG  . LYS A 1 325 ? 43.421  2.589   30.724  1.00 22.74 ? 325  LYS A CG  1 
ATOM   2442 C  CD  . LYS A 1 325 ? 43.868  1.199   30.212  1.00 32.38 ? 325  LYS A CD  1 
ATOM   2443 C  CE  . LYS A 1 325 ? 43.614  0.209   31.328  1.00 35.37 ? 325  LYS A CE  1 
ATOM   2444 N  NZ  . LYS A 1 325 ? 43.223  -1.118  30.814  1.00 59.16 ? 325  LYS A NZ  1 
ATOM   2445 N  N   . GLN A 1 326 ? 43.027  6.391   28.106  1.00 11.72 ? 326  GLN A N   1 
ATOM   2446 C  CA  . GLN A 1 326 ? 43.572  7.337   27.141  1.00 11.94 ? 326  GLN A CA  1 
ATOM   2447 C  C   . GLN A 1 326 ? 43.320  8.759   27.686  1.00 11.41 ? 326  GLN A C   1 
ATOM   2448 O  O   . GLN A 1 326 ? 43.708  9.703   27.026  1.00 12.29 ? 326  GLN A O   1 
ATOM   2449 C  CB  . GLN A 1 326 ? 43.040  7.020   25.768  1.00 23.85 ? 326  GLN A CB  1 
ATOM   2450 C  CG  . GLN A 1 326 ? 43.415  5.853   24.923  1.00 29.83 ? 326  GLN A CG  1 
ATOM   2451 C  CD  . GLN A 1 326 ? 42.666  5.867   23.556  1.00 42.05 ? 326  GLN A CD  1 
ATOM   2452 O  OE1 . GLN A 1 326 ? 41.529  5.343   23.376  1.00 31.16 ? 326  GLN A OE1 1 
ATOM   2453 N  NE2 . GLN A 1 326 ? 43.288  6.450   22.497  1.00 29.93 ? 326  GLN A NE2 1 
ATOM   2454 N  N   . GLY A 1 327 ? 42.697  8.870   28.870  1.00 5.02  ? 327  GLY A N   1 
ATOM   2455 C  CA  . GLY A 1 327 ? 42.533  10.232  29.326  1.00 11.05 ? 327  GLY A CA  1 
ATOM   2456 C  C   . GLY A 1 327 ? 41.354  10.968  28.699  1.00 12.72 ? 327  GLY A C   1 
ATOM   2457 O  O   . GLY A 1 327 ? 40.410  10.452  28.159  1.00 11.31 ? 327  GLY A O   1 
ATOM   2458 N  N   . LEU A 1 328 ? 41.442  12.253  28.914  1.00 16.95 ? 328  LEU A N   1 
ATOM   2459 C  CA  . LEU A 1 328 ? 40.421  13.261  28.510  1.00 24.88 ? 328  LEU A CA  1 
ATOM   2460 C  C   . LEU A 1 328 ? 40.079  13.247  27.035  1.00 15.23 ? 328  LEU A C   1 
ATOM   2461 O  O   . LEU A 1 328 ? 38.963  13.496  26.621  1.00 8.80  ? 328  LEU A O   1 
ATOM   2462 C  CB  . LEU A 1 328 ? 40.864  14.638  29.120  1.00 19.13 ? 328  LEU A CB  1 
ATOM   2463 C  CG  . LEU A 1 328 ? 39.827  15.752  28.977  1.00 15.59 ? 328  LEU A CG  1 
ATOM   2464 C  CD1 . LEU A 1 328 ? 38.623  15.355  29.831  1.00 13.91 ? 328  LEU A CD1 1 
ATOM   2465 C  CD2 . LEU A 1 328 ? 40.495  17.062  29.423  1.00 16.40 ? 328  LEU A CD2 1 
ATOM   2466 N  N   . TYR A 1 329 ? 40.977  12.803  26.169  1.00 8.58  ? 329  TYR A N   1 
ATOM   2467 C  CA  . TYR A 1 329 ? 40.769  12.686  24.755  1.00 15.30 ? 329  TYR A CA  1 
ATOM   2468 C  C   . TYR A 1 329 ? 39.478  11.841  24.549  1.00 11.68 ? 329  TYR A C   1 
ATOM   2469 O  O   . TYR A 1 329 ? 38.759  12.098  23.625  1.00 9.94  ? 329  TYR A O   1 
ATOM   2470 C  CB  . TYR A 1 329 ? 41.955  11.959  24.102  1.00 9.86  ? 329  TYR A CB  1 
ATOM   2471 C  CG  . TYR A 1 329 ? 41.789  11.685  22.623  1.00 14.96 ? 329  TYR A CG  1 
ATOM   2472 C  CD1 . TYR A 1 329 ? 41.662  12.713  21.703  1.00 11.77 ? 329  TYR A CD1 1 
ATOM   2473 C  CD2 . TYR A 1 329 ? 41.822  10.323  22.189  1.00 11.55 ? 329  TYR A CD2 1 
ATOM   2474 C  CE1 . TYR A 1 329 ? 41.500  12.392  20.346  1.00 20.92 ? 329  TYR A CE1 1 
ATOM   2475 C  CE2 . TYR A 1 329 ? 41.692  10.039  20.830  1.00 12.48 ? 329  TYR A CE2 1 
ATOM   2476 C  CZ  . TYR A 1 329 ? 41.537  11.052  19.919  1.00 17.04 ? 329  TYR A CZ  1 
ATOM   2477 O  OH  . TYR A 1 329 ? 41.418  10.709  18.595  1.00 18.94 ? 329  TYR A OH  1 
ATOM   2478 N  N   . ARG A 1 330 ? 39.286  10.825  25.350  1.00 6.44  ? 330  ARG A N   1 
ATOM   2479 C  CA  . ARG A 1 330 ? 38.123  9.961   25.252  1.00 5.57  ? 330  ARG A CA  1 
ATOM   2480 C  C   . ARG A 1 330 ? 37.136  10.136  26.445  1.00 5.00  ? 330  ARG A C   1 
ATOM   2481 O  O   . ARG A 1 330 ? 35.974  9.817   26.240  1.00 11.06 ? 330  ARG A O   1 
ATOM   2482 C  CB  . ARG A 1 330 ? 38.631  8.483   25.454  1.00 5.00  ? 330  ARG A CB  1 
ATOM   2483 C  CG  . ARG A 1 330 ? 39.412  7.787   24.354  1.00 6.87  ? 330  ARG A CG  1 
ATOM   2484 C  CD  . ARG A 1 330 ? 38.866  8.203   22.989  1.00 7.77  ? 330  ARG A CD  1 
ATOM   2485 N  NE  . ARG A 1 330 ? 39.488  7.226   22.077  1.00 10.73 ? 330  ARG A NE  1 
ATOM   2486 C  CZ  . ARG A 1 330 ? 39.331  7.208   20.743  1.00 19.26 ? 330  ARG A CZ  1 
ATOM   2487 N  NH1 . ARG A 1 330 ? 38.637  8.164   20.109  1.00 8.02  ? 330  ARG A NH1 1 
ATOM   2488 N  NH2 . ARG A 1 330 ? 39.798  6.175   19.999  1.00 13.65 ? 330  ARG A NH2 1 
ATOM   2489 N  N   . SER A 1 331 ? 37.590  10.585  27.598  1.00 5.73  ? 331  SER A N   1 
ATOM   2490 C  CA  . SER A 1 331 ? 36.720  10.520  28.750  1.00 10.35 ? 331  SER A CA  1 
ATOM   2491 C  C   . SER A 1 331 ? 35.528  11.454  28.749  1.00 8.47  ? 331  SER A C   1 
ATOM   2492 O  O   . SER A 1 331 ? 34.664  11.187  29.578  1.00 8.69  ? 331  SER A O   1 
ATOM   2493 C  CB  . SER A 1 331 ? 37.523  10.525  30.061  1.00 12.26 ? 331  SER A CB  1 
ATOM   2494 O  OG  . SER A 1 331 ? 37.991  11.868  30.214  1.00 13.03 ? 331  SER A OG  1 
ATOM   2495 N  N   . ASP A 1 332 ? 35.560  12.468  27.952  1.00 9.43  ? 332  ASP A N   1 
ATOM   2496 C  CA  . ASP A 1 332 ? 34.371  13.385  27.902  1.00 12.98 ? 332  ASP A CA  1 
ATOM   2497 C  C   . ASP A 1 332 ? 33.520  13.107  26.695  1.00 9.58  ? 332  ASP A C   1 
ATOM   2498 O  O   . ASP A 1 332 ? 32.646  13.965  26.377  1.00 9.87  ? 332  ASP A O   1 
ATOM   2499 C  CB  . ASP A 1 332 ? 34.912  14.817  27.972  1.00 5.41  ? 332  ASP A CB  1 
ATOM   2500 C  CG  . ASP A 1 332 ? 35.650  15.291  26.760  1.00 16.03 ? 332  ASP A CG  1 
ATOM   2501 O  OD1 . ASP A 1 332 ? 35.648  14.542  25.716  1.00 14.59 ? 332  ASP A OD1 1 
ATOM   2502 O  OD2 . ASP A 1 332 ? 36.166  16.433  26.789  1.00 19.74 ? 332  ASP A OD2 1 
ATOM   2503 N  N   . ASN A 1 333 ? 33.713  11.953  26.012  1.00 8.92  ? 333  ASN A N   1 
ATOM   2504 C  CA  . ASN A 1 333 ? 32.963  11.720  24.801  1.00 7.91  ? 333  ASN A CA  1 
ATOM   2505 C  C   . ASN A 1 333 ? 31.574  11.005  25.017  1.00 9.09  ? 333  ASN A C   1 
ATOM   2506 O  O   . ASN A 1 333 ? 31.502  10.340  26.006  1.00 9.18  ? 333  ASN A O   1 
ATOM   2507 C  CB  . ASN A 1 333 ? 33.759  10.679  23.941  1.00 7.34  ? 333  ASN A CB  1 
ATOM   2508 C  CG  . ASN A 1 333 ? 35.128  11.133  23.462  1.00 10.33 ? 333  ASN A CG  1 
ATOM   2509 O  OD1 . ASN A 1 333 ? 35.682  10.298  22.778  1.00 13.26 ? 333  ASN A OD1 1 
ATOM   2510 N  ND2 . ASN A 1 333 ? 35.710  12.318  23.733  1.00 12.13 ? 333  ASN A ND2 1 
ATOM   2511 N  N   . HIS A 1 334 ? 30.749  11.253  24.033  1.00 7.17  ? 334  HIS A N   1 
ATOM   2512 C  CA  . HIS A 1 334 ? 29.454  10.573  23.859  1.00 7.71  ? 334  HIS A CA  1 
ATOM   2513 C  C   . HIS A 1 334 ? 28.673  10.431  25.157  1.00 9.40  ? 334  HIS A C   1 
ATOM   2514 O  O   . HIS A 1 334 ? 28.204  9.335   25.503  1.00 12.45 ? 334  HIS A O   1 
ATOM   2515 C  CB  . HIS A 1 334 ? 29.782  9.146   23.286  1.00 5.81  ? 334  HIS A CB  1 
ATOM   2516 C  CG  . HIS A 1 334 ? 30.739  9.091   22.095  1.00 5.00  ? 334  HIS A CG  1 
ATOM   2517 N  ND1 . HIS A 1 334 ? 30.573  9.901   20.982  1.00 5.00  ? 334  HIS A ND1 1 
ATOM   2518 C  CD2 . HIS A 1 334 ? 31.727  8.183   21.831  1.00 5.00  ? 334  HIS A CD2 1 
ATOM   2519 C  CE1 . HIS A 1 334 ? 31.575  9.576   20.152  1.00 8.01  ? 334  HIS A CE1 1 
ATOM   2520 N  NE2 . HIS A 1 334 ? 32.285  8.522   20.617  1.00 5.00  ? 334  HIS A NE2 1 
ATOM   2521 N  N   . ALA A 1 335 ? 28.477  11.543  25.838  1.00 6.01  ? 335  ALA A N   1 
ATOM   2522 C  CA  . ALA A 1 335 ? 27.712  11.486  27.109  1.00 7.15  ? 335  ALA A CA  1 
ATOM   2523 C  C   . ALA A 1 335 ? 26.303  10.972  26.832  1.00 7.53  ? 335  ALA A C   1 
ATOM   2524 O  O   . ALA A 1 335 ? 25.780  11.241  25.742  1.00 11.71 ? 335  ALA A O   1 
ATOM   2525 C  CB  . ALA A 1 335 ? 27.590  12.866  27.742  1.00 5.93  ? 335  ALA A CB  1 
ATOM   2526 N  N   . TRP A 1 336 ? 25.710  10.282  27.759  1.00 7.91  ? 336  TRP A N   1 
ATOM   2527 C  CA  . TRP A 1 336 ? 24.315  9.760   27.645  1.00 10.90 ? 336  TRP A CA  1 
ATOM   2528 C  C   . TRP A 1 336 ? 23.394  10.925  28.103  1.00 10.53 ? 336  TRP A C   1 
ATOM   2529 O  O   . TRP A 1 336 ? 23.028  10.891  29.277  1.00 7.91  ? 336  TRP A O   1 
ATOM   2530 C  CB  . TRP A 1 336 ? 24.091  8.527   28.454  1.00 7.31  ? 336  TRP A CB  1 
ATOM   2531 C  CG  . TRP A 1 336 ? 25.032  7.360   28.181  1.00 9.24  ? 336  TRP A CG  1 
ATOM   2532 C  CD1 . TRP A 1 336 ? 25.926  7.223   27.153  1.00 5.70  ? 336  TRP A CD1 1 
ATOM   2533 C  CD2 . TRP A 1 336 ? 25.071  6.149   28.925  1.00 5.56  ? 336  TRP A CD2 1 
ATOM   2534 N  NE1 . TRP A 1 336 ? 26.571  6.016   27.253  1.00 5.61  ? 336  TRP A NE1 1 
ATOM   2535 C  CE2 . TRP A 1 336 ? 26.104  5.349   28.348  1.00 7.02  ? 336  TRP A CE2 1 
ATOM   2536 C  CE3 . TRP A 1 336 ? 24.458  5.732   30.107  1.00 5.00  ? 336  TRP A CE3 1 
ATOM   2537 C  CZ2 . TRP A 1 336 ? 26.457  4.102   28.803  1.00 8.73  ? 336  TRP A CZ2 1 
ATOM   2538 C  CZ3 . TRP A 1 336 ? 24.827  4.505   30.556  1.00 5.81  ? 336  TRP A CZ3 1 
ATOM   2539 C  CH2 . TRP A 1 336 ? 25.776  3.648   29.952  1.00 9.18  ? 336  TRP A CH2 1 
ATOM   2540 N  N   . LEU A 1 337 ? 23.180  11.922  27.267  1.00 6.89  ? 337  LEU A N   1 
ATOM   2541 C  CA  . LEU A 1 337 ? 22.359  13.072  27.685  1.00 7.35  ? 337  LEU A CA  1 
ATOM   2542 C  C   . LEU A 1 337 ? 20.909  12.937  27.310  1.00 8.41  ? 337  LEU A C   1 
ATOM   2543 O  O   . LEU A 1 337 ? 20.509  12.444  26.245  1.00 11.83 ? 337  LEU A O   1 
ATOM   2544 C  CB  . LEU A 1 337 ? 22.955  14.344  27.021  1.00 5.00  ? 337  LEU A CB  1 
ATOM   2545 C  CG  . LEU A 1 337 ? 24.397  14.674  27.248  1.00 7.02  ? 337  LEU A CG  1 
ATOM   2546 C  CD1 . LEU A 1 337 ? 24.648  16.011  26.542  1.00 5.00  ? 337  LEU A CD1 1 
ATOM   2547 C  CD2 . LEU A 1 337 ? 24.550  14.849  28.763  1.00 6.23  ? 337  LEU A CD2 1 
ATOM   2548 N  N   . PHE A 1 338 ? 20.054  13.512  28.153  1.00 11.87 ? 338  PHE A N   1 
ATOM   2549 C  CA  . PHE A 1 338 ? 18.613  13.566  27.971  1.00 9.01  ? 338  PHE A CA  1 
ATOM   2550 C  C   . PHE A 1 338 ? 18.055  14.953  28.410  1.00 13.06 ? 338  PHE A C   1 
ATOM   2551 O  O   . PHE A 1 338 ? 18.206  15.213  29.607  1.00 11.96 ? 338  PHE A O   1 
ATOM   2552 C  CB  . PHE A 1 338 ? 17.771  12.437  28.587  1.00 12.42 ? 338  PHE A CB  1 
ATOM   2553 C  CG  . PHE A 1 338 ? 18.242  10.999  28.283  1.00 13.31 ? 338  PHE A CG  1 
ATOM   2554 C  CD1 . PHE A 1 338 ? 19.337  10.387  28.880  1.00 5.00  ? 338  PHE A CD1 1 
ATOM   2555 C  CD2 . PHE A 1 338 ? 17.550  10.400  27.217  1.00 9.83  ? 338  PHE A CD2 1 
ATOM   2556 C  CE1 . PHE A 1 338 ? 19.707  9.058   28.531  1.00 5.00  ? 338  PHE A CE1 1 
ATOM   2557 C  CE2 . PHE A 1 338 ? 17.945  9.103   26.868  1.00 16.94 ? 338  PHE A CE2 1 
ATOM   2558 C  CZ  . PHE A 1 338 ? 18.933  8.463   27.526  1.00 5.00  ? 338  PHE A CZ  1 
ATOM   2559 N  N   . GLY A 1 339 ? 17.386  15.683  27.525  1.00 8.14  ? 339  GLY A N   1 
ATOM   2560 C  CA  . GLY A 1 339 ? 16.746  16.980  27.946  1.00 5.00  ? 339  GLY A CA  1 
ATOM   2561 C  C   . GLY A 1 339 ? 15.578  16.504  28.868  1.00 5.00  ? 339  GLY A C   1 
ATOM   2562 O  O   . GLY A 1 339 ? 14.951  15.439  28.693  1.00 8.48  ? 339  GLY A O   1 
ATOM   2563 N  N   . TRP A 1 340 ? 15.456  17.255  29.984  1.00 8.87  ? 340  TRP A N   1 
ATOM   2564 C  CA  . TRP A 1 340 ? 14.436  16.840  30.943  1.00 5.00  ? 340  TRP A CA  1 
ATOM   2565 C  C   . TRP A 1 340 ? 13.682  18.127  31.392  1.00 7.89  ? 340  TRP A C   1 
ATOM   2566 O  O   . TRP A 1 340 ? 13.807  19.173  30.779  1.00 9.87  ? 340  TRP A O   1 
ATOM   2567 C  CB  . TRP A 1 340 ? 14.992  16.011  32.082  1.00 5.87  ? 340  TRP A CB  1 
ATOM   2568 C  CG  . TRP A 1 340 ? 14.039  15.311  33.008  1.00 9.77  ? 340  TRP A CG  1 
ATOM   2569 C  CD1 . TRP A 1 340 ? 13.992  15.446  34.398  1.00 8.53  ? 340  TRP A CD1 1 
ATOM   2570 C  CD2 . TRP A 1 340 ? 13.045  14.343  32.654  1.00 7.26  ? 340  TRP A CD2 1 
ATOM   2571 N  NE1 . TRP A 1 340 ? 13.008  14.548  34.857  1.00 6.41  ? 340  TRP A NE1 1 
ATOM   2572 C  CE2 . TRP A 1 340 ? 12.412  13.929  33.850  1.00 8.56  ? 340  TRP A CE2 1 
ATOM   2573 C  CE3 . TRP A 1 340 ? 12.690  13.804  31.420  1.00 10.46 ? 340  TRP A CE3 1 
ATOM   2574 C  CZ2 . TRP A 1 340 ? 11.394  12.988  33.842  1.00 9.08  ? 340  TRP A CZ2 1 
ATOM   2575 C  CZ3 . TRP A 1 340 ? 11.655  12.860  31.388  1.00 13.08 ? 340  TRP A CZ3 1 
ATOM   2576 C  CH2 . TRP A 1 340 ? 11.042  12.494  32.592  1.00 12.74 ? 340  TRP A CH2 1 
ATOM   2577 N  N   . LYS A 1 341 ? 13.017  17.973  32.550  1.00 8.08  ? 341  LYS A N   1 
ATOM   2578 C  CA  . LYS A 1 341 ? 12.227  19.139  32.939  1.00 6.94  ? 341  LYS A CA  1 
ATOM   2579 C  C   . LYS A 1 341 ? 13.007  20.346  33.332  1.00 13.28 ? 341  LYS A C   1 
ATOM   2580 O  O   . LYS A 1 341 ? 14.110  20.408  33.850  1.00 13.34 ? 341  LYS A O   1 
ATOM   2581 C  CB  . LYS A 1 341 ? 11.503  18.702  34.226  1.00 8.88  ? 341  LYS A CB  1 
ATOM   2582 C  CG  . LYS A 1 341 ? 10.623  17.523  33.962  1.00 15.02 ? 341  LYS A CG  1 
ATOM   2583 C  CD  . LYS A 1 341 ? 9.968   16.853  35.154  1.00 17.22 ? 341  LYS A CD  1 
ATOM   2584 C  CE  . LYS A 1 341 ? 8.948   15.884  34.524  1.00 23.83 ? 341  LYS A CE  1 
ATOM   2585 N  NZ  . LYS A 1 341 ? 8.080   15.370  35.624  1.00 32.19 ? 341  LYS A NZ  1 
ATOM   2586 N  N   . LYS A 1 342 ? 12.341  21.451  33.018  1.00 15.21 ? 342  LYS A N   1 
ATOM   2587 C  CA  . LYS A 1 342 ? 12.830  22.778  33.361  1.00 19.23 ? 342  LYS A CA  1 
ATOM   2588 C  C   . LYS A 1 342 ? 14.224  23.170  32.915  1.00 17.33 ? 342  LYS A C   1 
ATOM   2589 O  O   . LYS A 1 342 ? 14.911  23.744  33.754  1.00 15.95 ? 342  LYS A O   1 
ATOM   2590 C  CB  . LYS A 1 342 ? 12.799  22.832  34.917  1.00 27.88 ? 342  LYS A CB  1 
ATOM   2591 C  CG  . LYS A 1 342 ? 11.342  22.779  35.435  1.00 48.13 ? 342  LYS A CG  1 
ATOM   2592 C  CD  . LYS A 1 342 ? 11.421  22.758  36.958  1.00 65.64 ? 342  LYS A CD  1 
ATOM   2593 C  CE  . LYS A 1 342 ? 10.660  21.542  37.482  1.00 78.53 ? 342  LYS A CE  1 
ATOM   2594 N  NZ  . LYS A 1 342 ? 10.006  21.986  38.749  1.00 94.81 ? 342  LYS A NZ  1 
ATOM   2595 N  N   . GLY A 1 343 ? 14.575  22.938  31.694  1.00 10.56 ? 343  GLY A N   1 
ATOM   2596 C  CA  . GLY A 1 343 ? 15.851  23.350  31.131  1.00 14.81 ? 343  GLY A CA  1 
ATOM   2597 C  C   . GLY A 1 343 ? 17.007  22.422  31.634  1.00 12.91 ? 343  GLY A C   1 
ATOM   2598 O  O   . GLY A 1 343 ? 18.126  22.741  31.238  1.00 17.14 ? 343  GLY A O   1 
ATOM   2599 N  N   . SER A 1 344 ? 16.644  21.387  32.335  1.00 13.78 ? 344  SER A N   1 
ATOM   2600 C  CA  . SER A 1 344 ? 17.653  20.488  32.899  1.00 13.93 ? 344  SER A CA  1 
ATOM   2601 C  C   . SER A 1 344 ? 18.101  19.513  31.839  1.00 12.32 ? 344  SER A C   1 
ATOM   2602 O  O   . SER A 1 344 ? 17.325  19.233  30.963  1.00 9.20  ? 344  SER A O   1 
ATOM   2603 C  CB  . SER A 1 344 ? 17.232  19.730  34.196  1.00 8.08  ? 344  SER A CB  1 
ATOM   2604 O  OG  . SER A 1 344 ? 16.167  18.781  33.971  1.00 6.23  ? 344  SER A OG  1 
ATOM   2605 N  N   . VAL A 1 345 ? 19.320  18.948  32.028  1.00 8.76  ? 345  VAL A N   1 
ATOM   2606 C  CA  . VAL A 1 345 ? 19.793  17.919  31.104  1.00 7.06  ? 345  VAL A CA  1 
ATOM   2607 C  C   . VAL A 1 345 ? 20.272  16.775  32.054  1.00 18.18 ? 345  VAL A C   1 
ATOM   2608 O  O   . VAL A 1 345 ? 20.994  17.072  33.027  1.00 13.21 ? 345  VAL A O   1 
ATOM   2609 C  CB  . VAL A 1 345 ? 20.952  18.429  30.218  1.00 8.52  ? 345  VAL A CB  1 
ATOM   2610 C  CG1 . VAL A 1 345 ? 21.530  17.284  29.282  1.00 6.72  ? 345  VAL A CG1 1 
ATOM   2611 C  CG2 . VAL A 1 345 ? 20.425  19.496  29.320  1.00 5.45  ? 345  VAL A CG2 1 
ATOM   2612 N  N   . PHE A 1 346 ? 19.791  15.539  31.892  1.00 6.79  ? 346  PHE A N   1 
ATOM   2613 C  CA  . PHE A 1 346 ? 20.302  14.463  32.779  1.00 8.90  ? 346  PHE A CA  1 
ATOM   2614 C  C   . PHE A 1 346 ? 21.475  13.746  32.051  1.00 7.39  ? 346  PHE A C   1 
ATOM   2615 O  O   . PHE A 1 346 ? 21.333  13.461  30.836  1.00 10.48 ? 346  PHE A O   1 
ATOM   2616 C  CB  . PHE A 1 346 ? 19.172  13.459  33.026  1.00 5.00  ? 346  PHE A CB  1 
ATOM   2617 C  CG  . PHE A 1 346 ? 19.643  12.362  33.950  1.00 5.00  ? 346  PHE A CG  1 
ATOM   2618 C  CD1 . PHE A 1 346 ? 19.917  12.550  35.288  1.00 8.65  ? 346  PHE A CD1 1 
ATOM   2619 C  CD2 . PHE A 1 346 ? 19.767  11.070  33.430  1.00 8.84  ? 346  PHE A CD2 1 
ATOM   2620 C  CE1 . PHE A 1 346 ? 20.312  11.534  36.139  1.00 9.51  ? 346  PHE A CE1 1 
ATOM   2621 C  CE2 . PHE A 1 346 ? 20.165  10.003  34.197  1.00 5.51  ? 346  PHE A CE2 1 
ATOM   2622 C  CZ  . PHE A 1 346 ? 20.436  10.251  35.559  1.00 9.62  ? 346  PHE A CZ  1 
ATOM   2623 N  N   . GLN A 1 347 ? 22.533  13.405  32.789  1.00 10.30 ? 347  GLN A N   1 
ATOM   2624 C  CA  . GLN A 1 347 ? 23.679  12.653  32.098  1.00 5.60  ? 347  GLN A CA  1 
ATOM   2625 C  C   . GLN A 1 347 ? 23.684  11.318  32.831  1.00 5.39  ? 347  GLN A C   1 
ATOM   2626 O  O   . GLN A 1 347 ? 24.013  11.339  33.995  1.00 7.28  ? 347  GLN A O   1 
ATOM   2627 C  CB  . GLN A 1 347 ? 24.926  13.500  32.189  1.00 7.10  ? 347  GLN A CB  1 
ATOM   2628 C  CG  . GLN A 1 347 ? 26.217  12.733  31.831  1.00 5.00  ? 347  GLN A CG  1 
ATOM   2629 C  CD  . GLN A 1 347 ? 26.975  12.202  32.983  1.00 8.56  ? 347  GLN A CD  1 
ATOM   2630 O  OE1 . GLN A 1 347 ? 26.943  12.684  34.118  1.00 7.82  ? 347  GLN A OE1 1 
ATOM   2631 N  NE2 . GLN A 1 347 ? 27.768  11.125  32.778  1.00 5.00  ? 347  GLN A NE2 1 
ATOM   2632 N  N   . ALA A 1 348 ? 23.243  10.273  32.216  1.00 8.18  ? 348  ALA A N   1 
ATOM   2633 C  CA  . ALA A 1 348 ? 23.101  8.928   32.737  1.00 6.28  ? 348  ALA A CA  1 
ATOM   2634 C  C   . ALA A 1 348 ? 24.422  8.187   32.621  1.00 9.61  ? 348  ALA A C   1 
ATOM   2635 O  O   . ALA A 1 348 ? 24.387  7.141   33.201  1.00 5.92  ? 348  ALA A O   1 
ATOM   2636 C  CB  . ALA A 1 348 ? 22.005  8.206   31.990  1.00 5.00  ? 348  ALA A CB  1 
ATOM   2637 N  N   . GLY A 1 349 ? 25.469  8.690   31.977  1.00 5.26  ? 349  GLY A N   1 
ATOM   2638 C  CA  . GLY A 1 349 ? 26.705  7.856   31.870  1.00 8.59  ? 349  GLY A CA  1 
ATOM   2639 C  C   . GLY A 1 349 ? 27.378  8.456   30.614  1.00 7.06  ? 349  GLY A C   1 
ATOM   2640 O  O   . GLY A 1 349 ? 26.947  9.529   30.174  1.00 6.22  ? 349  GLY A O   1 
ATOM   2641 N  N   . PRO A 1 350 ? 28.373  7.804   30.032  1.00 6.64  ? 350  PRO A N   1 
ATOM   2642 C  CA  . PRO A 1 350 ? 28.866  6.477   30.417  1.00 6.35  ? 350  PRO A CA  1 
ATOM   2643 C  C   . PRO A 1 350 ? 29.567  6.340   31.757  1.00 6.98  ? 350  PRO A C   1 
ATOM   2644 O  O   . PRO A 1 350 ? 29.757  5.146   32.173  1.00 9.33  ? 350  PRO A O   1 
ATOM   2645 C  CB  . PRO A 1 350 ? 29.854  6.174   29.267  1.00 8.26  ? 350  PRO A CB  1 
ATOM   2646 C  CG  . PRO A 1 350 ? 30.202  7.504   28.626  1.00 5.70  ? 350  PRO A CG  1 
ATOM   2647 C  CD  . PRO A 1 350 ? 28.951  8.367   28.779  1.00 5.00  ? 350  PRO A CD  1 
ATOM   2648 N  N   . SER A 1 351 ? 29.978  7.420   32.334  1.00 10.26 ? 351  SER A N   1 
ATOM   2649 C  CA  . SER A 1 351 ? 30.669  7.364   33.665  1.00 5.73  ? 351  SER A CA  1 
ATOM   2650 C  C   . SER A 1 351 ? 29.700  6.724   34.647  1.00 5.35  ? 351  SER A C   1 
ATOM   2651 O  O   . SER A 1 351 ? 28.492  6.871   34.536  1.00 5.00  ? 351  SER A O   1 
ATOM   2652 C  CB  . SER A 1 351 ? 31.046  8.787   34.158  1.00 5.00  ? 351  SER A CB  1 
ATOM   2653 O  OG  . SER A 1 351 ? 29.875  9.574   34.207  1.00 7.42  ? 351  SER A OG  1 
ATOM   2654 N  N   . THR A 1 352 ? 30.253  6.042   35.643  1.00 7.84  ? 352  THR A N   1 
ATOM   2655 C  CA  . THR A 1 352 ? 29.448  5.475   36.734  1.00 7.81  ? 352  THR A CA  1 
ATOM   2656 C  C   . THR A 1 352 ? 28.622  6.605   37.392  1.00 8.61  ? 352  THR A C   1 
ATOM   2657 O  O   . THR A 1 352 ? 27.502  6.271   37.721  1.00 6.21  ? 352  THR A O   1 
ATOM   2658 C  CB  . THR A 1 352 ? 30.483  4.969   37.817  1.00 9.78  ? 352  THR A CB  1 
ATOM   2659 O  OG1 . THR A 1 352 ? 31.167  3.908   37.075  1.00 8.92  ? 352  THR A OG1 1 
ATOM   2660 C  CG2 . THR A 1 352 ? 29.796  4.452   39.065  1.00 8.05  ? 352  THR A CG2 1 
ATOM   2661 N  N   . ALA A 1 353 ? 29.249  7.776   37.555  1.00 12.53 ? 353  ALA A N   1 
ATOM   2662 C  CA  . ALA A 1 353 ? 28.639  8.969   38.150  1.00 13.94 ? 353  ALA A CA  1 
ATOM   2663 C  C   . ALA A 1 353 ? 27.585  9.564   37.193  1.00 10.88 ? 353  ALA A C   1 
ATOM   2664 O  O   . ALA A 1 353 ? 27.919  9.795   36.011  1.00 12.54 ? 353  ALA A O   1 
ATOM   2665 C  CB  . ALA A 1 353 ? 29.641  10.093  38.389  1.00 5.00  ? 353  ALA A CB  1 
ATOM   2666 N  N   . MET A 1 354 ? 26.360  9.732   37.645  1.00 6.60  ? 354  MET A N   1 
ATOM   2667 C  CA  . MET A 1 354 ? 25.266  10.345  36.879  1.00 6.88  ? 354  MET A CA  1 
ATOM   2668 C  C   . MET A 1 354 ? 25.182  11.807  37.394  1.00 9.38  ? 354  MET A C   1 
ATOM   2669 O  O   . MET A 1 354 ? 25.485  12.023  38.596  1.00 8.70  ? 354  MET A O   1 
ATOM   2670 C  CB  . MET A 1 354 ? 23.962  9.576   37.056  1.00 5.00  ? 354  MET A CB  1 
ATOM   2671 C  CG  . MET A 1 354 ? 24.260  8.166   36.524  1.00 5.00  ? 354  MET A CG  1 
ATOM   2672 S  SD  . MET A 1 354 ? 22.669  7.269   36.667  1.00 8.67  ? 354  MET A SD  1 
ATOM   2673 C  CE  . MET A 1 354 ? 22.285  7.385   38.347  1.00 5.00  ? 354  MET A CE  1 
ATOM   2674 N  N   . ASN A 1 355 ? 24.754  12.730  36.579  1.00 8.35  ? 355  ASN A N   1 
ATOM   2675 C  CA  . ASN A 1 355 ? 24.712  14.133  36.952  1.00 14.89 ? 355  ASN A CA  1 
ATOM   2676 C  C   . ASN A 1 355 ? 23.487  14.861  36.348  1.00 6.46  ? 355  ASN A C   1 
ATOM   2677 O  O   . ASN A 1 355 ? 23.040  14.471  35.264  1.00 9.03  ? 355  ASN A O   1 
ATOM   2678 C  CB  . ASN A 1 355 ? 26.039  14.859  36.520  1.00 6.32  ? 355  ASN A CB  1 
ATOM   2679 C  CG  . ASN A 1 355 ? 27.238  14.320  37.226  1.00 6.99  ? 355  ASN A CG  1 
ATOM   2680 O  OD1 . ASN A 1 355 ? 27.462  14.775  38.368  1.00 11.31 ? 355  ASN A OD1 1 
ATOM   2681 N  ND2 . ASN A 1 355 ? 27.978  13.379  36.666  1.00 5.54  ? 355  ASN A ND2 1 
ATOM   2682 N  N   . TRP A 1 356 ? 23.075  15.902  37.057  1.00 10.52 ? 356  TRP A N   1 
ATOM   2683 C  CA  . TRP A 1 356 ? 22.014  16.801  36.620  1.00 8.97  ? 356  TRP A CA  1 
ATOM   2684 C  C   . TRP A 1 356 ? 22.762  18.060  36.096  1.00 6.81  ? 356  TRP A C   1 
ATOM   2685 O  O   . TRP A 1 356 ? 23.612  18.544  36.830  1.00 9.46  ? 356  TRP A O   1 
ATOM   2686 C  CB  . TRP A 1 356 ? 21.101  17.228  37.776  1.00 6.65  ? 356  TRP A CB  1 
ATOM   2687 C  CG  . TRP A 1 356 ? 20.101  16.148  38.055  1.00 5.00  ? 356  TRP A CG  1 
ATOM   2688 C  CD1 . TRP A 1 356 ? 20.141  15.325  39.136  1.00 8.61  ? 356  TRP A CD1 1 
ATOM   2689 C  CD2 . TRP A 1 356 ? 18.990  15.749  37.251  1.00 7.01  ? 356  TRP A CD2 1 
ATOM   2690 N  NE1 . TRP A 1 356 ? 19.082  14.458  39.105  1.00 6.46  ? 356  TRP A NE1 1 
ATOM   2691 C  CE2 . TRP A 1 356 ? 18.367  14.696  37.957  1.00 11.82 ? 356  TRP A CE2 1 
ATOM   2692 C  CE3 . TRP A 1 356 ? 18.450  16.211  36.027  1.00 5.00  ? 356  TRP A CE3 1 
ATOM   2693 C  CZ2 . TRP A 1 356 ? 17.207  14.092  37.523  1.00 7.92  ? 356  TRP A CZ2 1 
ATOM   2694 C  CZ3 . TRP A 1 356 ? 17.331  15.559  35.624  1.00 13.46 ? 356  TRP A CZ3 1 
ATOM   2695 C  CH2 . TRP A 1 356 ? 16.713  14.474  36.285  1.00 6.92  ? 356  TRP A CH2 1 
ATOM   2696 N  N   . TYR A 1 357 ? 22.463  18.490  34.869  1.00 9.09  ? 357  TYR A N   1 
ATOM   2697 C  CA  . TYR A 1 357 ? 23.083  19.726  34.365  1.00 10.56 ? 357  TYR A CA  1 
ATOM   2698 C  C   . TYR A 1 357 ? 21.904  20.750  34.372  1.00 5.74  ? 357  TYR A C   1 
ATOM   2699 O  O   . TYR A 1 357 ? 20.783  20.336  34.033  1.00 9.24  ? 357  TYR A O   1 
ATOM   2700 C  CB  . TYR A 1 357 ? 23.687  19.523  32.964  1.00 6.95  ? 357  TYR A CB  1 
ATOM   2701 C  CG  . TYR A 1 357 ? 25.052  18.946  33.157  1.00 5.00  ? 357  TYR A CG  1 
ATOM   2702 C  CD1 . TYR A 1 357 ? 26.107  19.813  33.531  1.00 10.75 ? 357  TYR A CD1 1 
ATOM   2703 C  CD2 . TYR A 1 357 ? 25.213  17.550  33.013  1.00 8.96  ? 357  TYR A CD2 1 
ATOM   2704 C  CE1 . TYR A 1 357 ? 27.372  19.238  33.700  1.00 19.89 ? 357  TYR A CE1 1 
ATOM   2705 C  CE2 . TYR A 1 357 ? 26.481  17.019  33.247  1.00 16.99 ? 357  TYR A CE2 1 
ATOM   2706 C  CZ  . TYR A 1 357 ? 27.556  17.849  33.514  1.00 17.32 ? 357  TYR A CZ  1 
ATOM   2707 O  OH  . TYR A 1 357 ? 28.789  17.303  33.830  1.00 10.15 ? 357  TYR A OH  1 
ATOM   2708 N  N   . TYR A 1 358 ? 22.213  21.958  34.766  1.00 7.07  ? 358  TYR A N   1 
ATOM   2709 C  CA  . TYR A 1 358 ? 21.161  23.035  34.808  1.00 6.18  ? 358  TYR A CA  1 
ATOM   2710 C  C   . TYR A 1 358 ? 21.674  24.097  33.837  1.00 21.53 ? 358  TYR A C   1 
ATOM   2711 O  O   . TYR A 1 358 ? 22.900  24.281  33.762  1.00 11.26 ? 358  TYR A O   1 
ATOM   2712 C  CB  . TYR A 1 358 ? 21.156  23.629  36.210  1.00 5.00  ? 358  TYR A CB  1 
ATOM   2713 C  CG  . TYR A 1 358 ? 20.657  22.620  37.207  1.00 10.48 ? 358  TYR A CG  1 
ATOM   2714 C  CD1 . TYR A 1 358 ? 19.276  22.420  37.315  1.00 19.79 ? 358  TYR A CD1 1 
ATOM   2715 C  CD2 . TYR A 1 358 ? 21.555  21.871  37.936  1.00 17.09 ? 358  TYR A CD2 1 
ATOM   2716 C  CE1 . TYR A 1 358 ? 18.799  21.488  38.231  1.00 20.22 ? 358  TYR A CE1 1 
ATOM   2717 C  CE2 . TYR A 1 358 ? 21.095  20.934  38.855  1.00 22.12 ? 358  TYR A CE2 1 
ATOM   2718 C  CZ  . TYR A 1 358 ? 19.703  20.772  38.969  1.00 23.35 ? 358  TYR A CZ  1 
ATOM   2719 O  OH  . TYR A 1 358 ? 19.220  19.894  39.907  1.00 36.69 ? 358  TYR A OH  1 
ATOM   2720 N  N   . THR A 1 359 ? 20.756  24.772  33.159  1.00 19.01 ? 359  THR A N   1 
ATOM   2721 C  CA  . THR A 1 359 ? 21.113  25.769  32.162  1.00 14.18 ? 359  THR A CA  1 
ATOM   2722 C  C   . THR A 1 359 ? 20.733  27.202  32.497  1.00 18.29 ? 359  THR A C   1 
ATOM   2723 O  O   . THR A 1 359 ? 20.833  28.070  31.620  1.00 17.77 ? 359  THR A O   1 
ATOM   2724 C  CB  . THR A 1 359 ? 20.586  25.248  30.745  1.00 9.92  ? 359  THR A CB  1 
ATOM   2725 O  OG1 . THR A 1 359 ? 19.113  25.185  30.926  1.00 13.31 ? 359  THR A OG1 1 
ATOM   2726 C  CG2 . THR A 1 359 ? 21.207  23.944  30.327  1.00 9.38  ? 359  THR A CG2 1 
ATOM   2727 N  N   . SER A 1 360 ? 20.334  27.480  33.723  1.00 11.34 ? 360  SER A N   1 
ATOM   2728 C  CA  . SER A 1 360 ? 20.022  28.892  34.073  1.00 16.83 ? 360  SER A CA  1 
ATOM   2729 C  C   . SER A 1 360 ? 21.373  29.537  34.455  1.00 6.68  ? 360  SER A C   1 
ATOM   2730 O  O   . SER A 1 360 ? 22.341  28.848  34.804  1.00 11.36 ? 360  SER A O   1 
ATOM   2731 C  CB  . SER A 1 360 ? 19.008  28.866  35.187  1.00 17.03 ? 360  SER A CB  1 
ATOM   2732 O  OG  . SER A 1 360 ? 19.469  28.114  36.292  1.00 25.46 ? 360  SER A OG  1 
ATOM   2733 N  N   . GLY A 1 361 ? 21.396  30.852  34.339  1.00 10.60 ? 361  GLY A N   1 
ATOM   2734 C  CA  . GLY A 1 361 ? 22.577  31.677  34.672  1.00 7.08  ? 361  GLY A CA  1 
ATOM   2735 C  C   . GLY A 1 361 ? 23.742  31.021  33.911  1.00 10.47 ? 361  GLY A C   1 
ATOM   2736 O  O   . GLY A 1 361 ? 23.542  30.633  32.756  1.00 18.74 ? 361  GLY A O   1 
ATOM   2737 N  N   . SER A 1 362 ? 24.877  30.946  34.558  1.00 10.55 ? 362  SER A N   1 
ATOM   2738 C  CA  . SER A 1 362 ? 26.071  30.432  33.891  1.00 5.73  ? 362  SER A CA  1 
ATOM   2739 C  C   . SER A 1 362 ? 26.199  28.921  34.066  1.00 10.77 ? 362  SER A C   1 
ATOM   2740 O  O   . SER A 1 362 ? 27.327  28.471  33.853  1.00 12.89 ? 362  SER A O   1 
ATOM   2741 C  CB  . SER A 1 362 ? 27.267  31.169  34.372  1.00 5.47  ? 362  SER A CB  1 
ATOM   2742 O  OG  . SER A 1 362 ? 27.203  32.509  34.039  1.00 5.38  ? 362  SER A OG  1 
ATOM   2743 N  N   . GLY A 1 363 ? 25.090  28.280  34.336  1.00 8.85  ? 363  GLY A N   1 
ATOM   2744 C  CA  . GLY A 1 363 ? 25.036  26.807  34.421  1.00 10.45 ? 363  GLY A CA  1 
ATOM   2745 C  C   . GLY A 1 363 ? 25.359  26.309  35.831  1.00 9.34  ? 363  GLY A C   1 
ATOM   2746 O  O   . GLY A 1 363 ? 25.868  26.953  36.730  1.00 10.90 ? 363  GLY A O   1 
ATOM   2747 N  N   . ASP A 1 364 ? 25.011  25.021  35.927  1.00 6.69  ? 364  ASP A N   1 
ATOM   2748 C  CA  . ASP A 1 364 ? 25.276  24.267  37.168  1.00 14.98 ? 364  ASP A CA  1 
ATOM   2749 C  C   . ASP A 1 364 ? 25.289  22.750  36.915  1.00 8.88  ? 364  ASP A C   1 
ATOM   2750 O  O   . ASP A 1 364 ? 24.891  22.259  35.893  1.00 9.78  ? 364  ASP A O   1 
ATOM   2751 C  CB  . ASP A 1 364 ? 24.308  24.785  38.229  1.00 14.67 ? 364  ASP A CB  1 
ATOM   2752 C  CG  . ASP A 1 364 ? 24.833  24.633  39.639  1.00 18.11 ? 364  ASP A CG  1 
ATOM   2753 O  OD1 . ASP A 1 364 ? 26.026  24.293  39.846  1.00 19.52 ? 364  ASP A OD1 1 
ATOM   2754 O  OD2 . ASP A 1 364 ? 24.057  24.787  40.562  1.00 25.03 ? 364  ASP A OD2 1 
ATOM   2755 N  N   . VAL A 1 365 ? 25.830  21.977  37.890  1.00 9.69  ? 365  VAL A N   1 
ATOM   2756 C  CA  . VAL A 1 365 ? 25.895  20.518  37.726  1.00 8.57  ? 365  VAL A CA  1 
ATOM   2757 C  C   . VAL A 1 365 ? 25.673  20.087  39.157  1.00 14.25 ? 365  VAL A C   1 
ATOM   2758 O  O   . VAL A 1 365 ? 26.207  20.630  40.144  1.00 19.58 ? 365  VAL A O   1 
ATOM   2759 C  CB  . VAL A 1 365 ? 27.259  20.007  37.127  1.00 5.00  ? 365  VAL A CB  1 
ATOM   2760 C  CG1 . VAL A 1 365 ? 28.424  20.544  37.829  1.00 9.31  ? 365  VAL A CG1 1 
ATOM   2761 C  CG2 . VAL A 1 365 ? 27.279  18.491  37.102  1.00 5.00  ? 365  VAL A CG2 1 
ATOM   2762 N  N   . LYS A 1 366 ? 24.886  19.073  39.290  1.00 11.51 ? 366  LYS A N   1 
ATOM   2763 C  CA  . LYS A 1 366 ? 24.635  18.478  40.657  1.00 13.55 ? 366  LYS A CA  1 
ATOM   2764 C  C   . LYS A 1 366 ? 24.733  16.983  40.513  1.00 23.03 ? 366  LYS A C   1 
ATOM   2765 O  O   . LYS A 1 366 ? 24.243  16.419  39.525  1.00 17.39 ? 366  LYS A O   1 
ATOM   2766 C  CB  . LYS A 1 366 ? 23.158  18.879  40.864  1.00 20.69 ? 366  LYS A CB  1 
ATOM   2767 C  CG  . LYS A 1 366 ? 22.856  19.272  42.286  1.00 36.07 ? 366  LYS A CG  1 
ATOM   2768 C  CD  . LYS A 1 366 ? 21.954  18.151  42.826  1.00 48.56 ? 366  LYS A CD  1 
ATOM   2769 C  CE  . LYS A 1 366 ? 21.739  18.341  44.315  1.00 59.92 ? 366  LYS A CE  1 
ATOM   2770 N  NZ  . LYS A 1 366 ? 20.290  18.213  44.610  1.00 67.71 ? 366  LYS A NZ  1 
ATOM   2771 N  N   . SER A 1 367 ? 25.285  16.213  41.389  1.00 13.51 ? 367  SER A N   1 
ATOM   2772 C  CA  . SER A 1 367 ? 25.417  14.776  41.404  1.00 18.81 ? 367  SER A CA  1 
ATOM   2773 C  C   . SER A 1 367 ? 24.046  14.127  41.523  1.00 13.30 ? 367  SER A C   1 
ATOM   2774 O  O   . SER A 1 367 ? 23.216  14.590  42.325  1.00 11.58 ? 367  SER A O   1 
ATOM   2775 C  CB  . SER A 1 367 ? 26.325  14.380  42.565  1.00 33.82 ? 367  SER A CB  1 
ATOM   2776 O  OG  . SER A 1 367 ? 26.288  12.977  42.691  1.00 48.11 ? 367  SER A OG  1 
ATOM   2777 N  N   . ALA A 1 368 ? 23.833  13.088  40.725  1.00 7.87  ? 368  ALA A N   1 
ATOM   2778 C  CA  . ALA A 1 368 ? 22.556  12.359  40.697  1.00 5.63  ? 368  ALA A CA  1 
ATOM   2779 C  C   . ALA A 1 368 ? 22.926  10.945  41.182  1.00 7.98  ? 368  ALA A C   1 
ATOM   2780 O  O   . ALA A 1 368 ? 22.264  9.984   41.019  1.00 16.40 ? 368  ALA A O   1 
ATOM   2781 C  CB  . ALA A 1 368 ? 22.082  12.214  39.274  1.00 5.39  ? 368  ALA A CB  1 
ATOM   2782 N  N   . GLY A 1 369 ? 24.051  10.796  41.812  1.00 11.61 ? 369  GLY A N   1 
ATOM   2783 C  CA  . GLY A 1 369 ? 24.489  9.493   42.291  1.00 22.16 ? 369  GLY A CA  1 
ATOM   2784 C  C   . GLY A 1 369 ? 25.172  8.587   41.284  1.00 15.46 ? 369  GLY A C   1 
ATOM   2785 O  O   . GLY A 1 369 ? 25.733  9.130   40.363  1.00 17.75 ? 369  GLY A O   1 
ATOM   2786 N  N   . LYS A 1 370 ? 25.280  7.291   41.545  1.00 18.24 ? 370  LYS A N   1 
ATOM   2787 C  CA  . LYS A 1 370 ? 25.977  6.306   40.736  1.00 15.94 ? 370  LYS A CA  1 
ATOM   2788 C  C   . LYS A 1 370 ? 25.114  5.298   40.050  1.00 9.84  ? 370  LYS A C   1 
ATOM   2789 O  O   . LYS A 1 370 ? 24.124  4.947   40.637  1.00 11.80 ? 370  LYS A O   1 
ATOM   2790 C  CB  . LYS A 1 370 ? 27.055  5.510   41.571  1.00 21.23 ? 370  LYS A CB  1 
ATOM   2791 C  CG  . LYS A 1 370 ? 28.269  6.450   41.826  1.00 22.24 ? 370  LYS A CG  1 
ATOM   2792 C  CD  . LYS A 1 370 ? 29.205  5.804   42.830  1.00 33.82 ? 370  LYS A CD  1 
ATOM   2793 C  CE  . LYS A 1 370 ? 30.526  6.564   42.951  1.00 67.11 ? 370  LYS A CE  1 
ATOM   2794 N  NZ  . LYS A 1 370 ? 30.314  8.036   43.138  1.00 79.46 ? 370  LYS A NZ  1 
ATOM   2795 N  N   . ARG A 1 371 ? 25.481  4.934   38.818  1.00 10.77 ? 371  ARG A N   1 
ATOM   2796 C  CA  . ARG A 1 371 ? 24.629  3.907   38.166  1.00 13.84 ? 371  ARG A CA  1 
ATOM   2797 C  C   . ARG A 1 371 ? 24.998  2.634   38.940  1.00 14.09 ? 371  ARG A C   1 
ATOM   2798 O  O   . ARG A 1 371 ? 26.192  2.335   38.967  1.00 16.13 ? 371  ARG A O   1 
ATOM   2799 C  CB  . ARG A 1 371 ? 25.021  3.829   36.695  1.00 10.75 ? 371  ARG A CB  1 
ATOM   2800 C  CG  . ARG A 1 371 ? 24.120  2.987   35.816  1.00 8.42  ? 371  ARG A CG  1 
ATOM   2801 C  CD  . ARG A 1 371 ? 24.393  3.252   34.347  1.00 12.69 ? 371  ARG A CD  1 
ATOM   2802 N  NE  . ARG A 1 371 ? 25.788  2.883   34.032  1.00 13.81 ? 371  ARG A NE  1 
ATOM   2803 C  CZ  . ARG A 1 371 ? 26.763  3.783   33.851  1.00 14.04 ? 371  ARG A CZ  1 
ATOM   2804 N  NH1 . ARG A 1 371 ? 26.419  5.089   33.955  1.00 7.47  ? 371  ARG A NH1 1 
ATOM   2805 N  NH2 . ARG A 1 371 ? 28.000  3.401   33.659  1.00 10.65 ? 371  ARG A NH2 1 
ATOM   2806 N  N   . GLN A 1 372 ? 24.030  1.986   39.520  1.00 16.56 ? 372  GLN A N   1 
ATOM   2807 C  CA  . GLN A 1 372 ? 24.362  0.768   40.339  1.00 19.94 ? 372  GLN A CA  1 
ATOM   2808 C  C   . GLN A 1 372 ? 23.052  -0.052  40.483  1.00 18.16 ? 372  GLN A C   1 
ATOM   2809 O  O   . GLN A 1 372 ? 21.975  0.346   40.016  1.00 16.40 ? 372  GLN A O   1 
ATOM   2810 C  CB  . GLN A 1 372 ? 24.823  1.196   41.735  1.00 16.00 ? 372  GLN A CB  1 
ATOM   2811 C  CG  . GLN A 1 372 ? 23.691  1.861   42.513  1.00 22.77 ? 372  GLN A CG  1 
ATOM   2812 C  CD  . GLN A 1 372 ? 24.203  2.521   43.784  1.00 39.73 ? 372  GLN A CD  1 
ATOM   2813 O  OE1 . GLN A 1 372 ? 25.365  2.497   44.168  1.00 43.16 ? 372  GLN A OE1 1 
ATOM   2814 N  NE2 . GLN A 1 372 ? 23.255  3.111   44.446  1.00 44.90 ? 372  GLN A NE2 1 
ATOM   2815 N  N   . SER A 1 373 ? 23.127  -1.192  41.109  1.00 15.93 ? 373  SER A N   1 
ATOM   2816 C  CA  . SER A 1 373 ? 21.965  -2.094  41.309  1.00 15.90 ? 373  SER A CA  1 
ATOM   2817 C  C   . SER A 1 373 ? 22.400  -2.999  42.486  1.00 25.46 ? 373  SER A C   1 
ATOM   2818 O  O   . SER A 1 373 ? 23.458  -2.794  43.083  1.00 16.33 ? 373  SER A O   1 
ATOM   2819 C  CB  . SER A 1 373 ? 21.739  -2.912  40.039  1.00 6.58  ? 373  SER A CB  1 
ATOM   2820 O  OG  . SER A 1 373 ? 22.791  -3.900  39.954  1.00 14.63 ? 373  SER A OG  1 
ATOM   2821 N  N   . ASN A 1 374 ? 21.609  -4.001  42.805  1.00 29.00 ? 374  ASN A N   1 
ATOM   2822 C  CA  . ASN A 1 374 ? 21.909  -4.986  43.873  1.00 35.06 ? 374  ASN A CA  1 
ATOM   2823 C  C   . ASN A 1 374 ? 23.131  -5.787  43.410  1.00 27.25 ? 374  ASN A C   1 
ATOM   2824 O  O   . ASN A 1 374 ? 23.788  -6.465  44.183  1.00 26.31 ? 374  ASN A O   1 
ATOM   2825 C  CB  . ASN A 1 374 ? 20.709  -5.846  44.238  1.00 35.85 ? 374  ASN A CB  1 
ATOM   2826 C  CG  . ASN A 1 374 ? 20.004  -6.538  43.093  1.00 46.13 ? 374  ASN A CG  1 
ATOM   2827 O  OD1 . ASN A 1 374 ? 20.471  -6.652  41.953  1.00 41.28 ? 374  ASN A OD1 1 
ATOM   2828 N  ND2 . ASN A 1 374 ? 18.805  -7.057  43.424  1.00 52.63 ? 374  ASN A ND2 1 
ATOM   2829 N  N   . ARG A 1 375 ? 23.488  -5.655  42.147  1.00 17.73 ? 375  ARG A N   1 
ATOM   2830 C  CA  . ARG A 1 375 ? 24.695  -6.446  41.774  1.00 14.10 ? 375  ARG A CA  1 
ATOM   2831 C  C   . ARG A 1 375 ? 25.919  -5.563  41.986  1.00 24.54 ? 375  ARG A C   1 
ATOM   2832 O  O   . ARG A 1 375 ? 26.927  -6.129  41.591  1.00 24.79 ? 375  ARG A O   1 
ATOM   2833 C  CB  . ARG A 1 375 ? 24.608  -6.897  40.321  1.00 19.70 ? 375  ARG A CB  1 
ATOM   2834 C  CG  . ARG A 1 375 ? 23.216  -7.567  40.053  1.00 25.78 ? 375  ARG A CG  1 
ATOM   2835 C  CD  . ARG A 1 375 ? 23.357  -8.305  38.741  1.00 22.98 ? 375  ARG A CD  1 
ATOM   2836 N  NE  . ARG A 1 375 ? 22.119  -9.033  38.547  1.00 22.30 ? 375  ARG A NE  1 
ATOM   2837 C  CZ  . ARG A 1 375 ? 21.967  -9.973  37.599  1.00 31.26 ? 375  ARG A CZ  1 
ATOM   2838 N  NH1 . ARG A 1 375 ? 22.904  -10.265 36.693  1.00 32.01 ? 375  ARG A NH1 1 
ATOM   2839 N  NH2 . ARG A 1 375 ? 20.800  -10.635 37.610  1.00 16.99 ? 375  ARG A NH2 1 
ATOM   2840 N  N   . GLY A 1 376 ? 25.774  -4.315  42.440  1.00 16.23 ? 376  GLY A N   1 
ATOM   2841 C  CA  . GLY A 1 376 ? 27.090  -3.579  42.591  1.00 19.02 ? 376  GLY A CA  1 
ATOM   2842 C  C   . GLY A 1 376 ? 27.007  -2.261  41.827  1.00 22.13 ? 376  GLY A C   1 
ATOM   2843 O  O   . GLY A 1 376 ? 26.005  -1.947  41.175  1.00 17.87 ? 376  GLY A O   1 
ATOM   2844 N  N   . VAL A 1 377 ? 28.075  -1.502  41.938  1.00 15.86 ? 377  VAL A N   1 
ATOM   2845 C  CA  . VAL A 1 377 ? 28.137  -0.193  41.267  1.00 14.30 ? 377  VAL A CA  1 
ATOM   2846 C  C   . VAL A 1 377 ? 28.447  -0.467  39.821  1.00 11.27 ? 377  VAL A C   1 
ATOM   2847 O  O   . VAL A 1 377 ? 29.389  -1.248  39.686  1.00 26.47 ? 377  VAL A O   1 
ATOM   2848 C  CB  . VAL A 1 377 ? 29.259  0.641   41.942  1.00 25.27 ? 377  VAL A CB  1 
ATOM   2849 C  CG1 . VAL A 1 377 ? 29.475  1.954   41.194  1.00 18.12 ? 377  VAL A CG1 1 
ATOM   2850 C  CG2 . VAL A 1 377 ? 28.874  0.921   43.380  1.00 18.36 ? 377  VAL A CG2 1 
ATOM   2851 N  N   . ALA A 1 378 ? 27.921  0.170   38.832  1.00 9.28  ? 378  ALA A N   1 
ATOM   2852 C  CA  . ALA A 1 378 ? 28.328  -0.210  37.462  1.00 8.97  ? 378  ALA A CA  1 
ATOM   2853 C  C   . ALA A 1 378 ? 29.604  0.513   37.084  1.00 15.52 ? 378  ALA A C   1 
ATOM   2854 O  O   . ALA A 1 378 ? 29.822  1.692   37.380  1.00 19.39 ? 378  ALA A O   1 
ATOM   2855 C  CB  . ALA A 1 378 ? 27.163  0.265   36.618  1.00 9.01  ? 378  ALA A CB  1 
ATOM   2856 N  N   . PRO A 1 379 ? 30.458  -0.181  36.351  1.00 13.42 ? 379  PRO A N   1 
ATOM   2857 C  CA  . PRO A 1 379 ? 31.693  0.411   35.870  1.00 19.74 ? 379  PRO A CA  1 
ATOM   2858 C  C   . PRO A 1 379 ? 31.340  1.332   34.700  1.00 19.16 ? 379  PRO A C   1 
ATOM   2859 O  O   . PRO A 1 379 ? 30.266  1.295   34.100  1.00 11.98 ? 379  PRO A O   1 
ATOM   2860 C  CB  . PRO A 1 379 ? 32.573  -0.765  35.368  1.00 18.38 ? 379  PRO A CB  1 
ATOM   2861 C  CG  . PRO A 1 379 ? 31.764  -1.981  35.776  1.00 27.76 ? 379  PRO A CG  1 
ATOM   2862 C  CD  . PRO A 1 379 ? 30.343  -1.557  35.918  1.00 14.90 ? 379  PRO A CD  1 
ATOM   2863 N  N   . ASP A 1 380 ? 32.277  2.190   34.303  1.00 11.98 ? 380  ASP A N   1 
ATOM   2864 C  CA  . ASP A 1 380 ? 32.211  3.090   33.162  1.00 11.73 ? 380  ASP A CA  1 
ATOM   2865 C  C   . ASP A 1 380 ? 31.834  2.225   31.974  1.00 10.33 ? 380  ASP A C   1 
ATOM   2866 O  O   . ASP A 1 380 ? 32.320  1.067   31.819  1.00 10.64 ? 380  ASP A O   1 
ATOM   2867 C  CB  . ASP A 1 380 ? 33.559  3.783   32.809  1.00 14.07 ? 380  ASP A CB  1 
ATOM   2868 C  CG  . ASP A 1 380 ? 33.983  4.816   33.861  1.00 17.03 ? 380  ASP A CG  1 
ATOM   2869 O  OD1 . ASP A 1 380 ? 33.167  5.401   34.578  1.00 10.65 ? 380  ASP A OD1 1 
ATOM   2870 O  OD2 . ASP A 1 380 ? 35.192  5.077   33.963  1.00 16.66 ? 380  ASP A OD2 1 
ATOM   2871 N  N   . ALA A 1 381 ? 31.006  2.783   31.114  1.00 10.93 ? 381  ALA A N   1 
ATOM   2872 C  CA  . ALA A 1 381 ? 30.501  2.023   29.942  1.00 6.95  ? 381  ALA A CA  1 
ATOM   2873 C  C   . ALA A 1 381 ? 30.478  2.847   28.666  1.00 8.37  ? 381  ALA A C   1 
ATOM   2874 O  O   . ALA A 1 381 ? 29.421  3.112   28.095  1.00 13.31 ? 381  ALA A O   1 
ATOM   2875 C  CB  . ALA A 1 381 ? 29.124  1.439   30.297  1.00 5.00  ? 381  ALA A CB  1 
ATOM   2876 N  N   . MET A 1 382 ? 31.686  3.294   28.304  1.00 9.61  ? 382  MET A N   1 
ATOM   2877 C  CA  . MET A 1 382 ? 31.966  4.056   27.128  1.00 7.38  ? 382  MET A CA  1 
ATOM   2878 C  C   . MET A 1 382 ? 31.390  3.237   25.944  1.00 10.02 ? 382  MET A C   1 
ATOM   2879 O  O   . MET A 1 382 ? 31.655  2.043   25.808  1.00 10.00 ? 382  MET A O   1 
ATOM   2880 C  CB  . MET A 1 382 ? 33.475  4.366   27.073  1.00 9.13  ? 382  MET A CB  1 
ATOM   2881 C  CG  . MET A 1 382 ? 33.818  5.155   25.774  1.00 7.67  ? 382  MET A CG  1 
ATOM   2882 S  SD  . MET A 1 382 ? 32.863  6.753   25.659  1.00 10.21 ? 382  MET A SD  1 
ATOM   2883 C  CE  . MET A 1 382 ? 33.658  7.660   27.073  1.00 5.02  ? 382  MET A CE  1 
ATOM   2884 N  N   . CYS A 1 383 ? 30.598  3.876   25.106  1.00 10.59 ? 383  CYS A N   1 
ATOM   2885 C  CA  . CYS A 1 383 ? 29.904  3.408   23.930  1.00 7.76  ? 383  CYS A CA  1 
ATOM   2886 C  C   . CYS A 1 383 ? 28.731  2.447   24.286  1.00 5.00  ? 383  CYS A C   1 
ATOM   2887 O  O   . CYS A 1 383 ? 28.314  1.761   23.381  1.00 11.85 ? 383  CYS A O   1 
ATOM   2888 C  CB  . CYS A 1 383 ? 30.861  2.901   22.836  1.00 6.05  ? 383  CYS A CB  1 
ATOM   2889 S  SG  . CYS A 1 383 ? 31.880  4.290   22.238  1.00 10.59 ? 383  CYS A SG  1 
ATOM   2890 N  N   . GLY A 1 384 ? 28.335  2.413   25.518  1.00 5.00  ? 384  GLY A N   1 
ATOM   2891 C  CA  . GLY A 1 384 ? 27.119  1.720   25.945  1.00 5.00  ? 384  GLY A CA  1 
ATOM   2892 C  C   . GLY A 1 384 ? 26.066  2.663   25.309  1.00 8.81  ? 384  GLY A C   1 
ATOM   2893 O  O   . GLY A 1 384 ? 26.209  3.819   24.793  1.00 10.56 ? 384  GLY A O   1 
ATOM   2894 N  N   . ASN A 1 385 ? 24.797  2.143   25.274  1.00 5.00  ? 385  ASN A N   1 
ATOM   2895 C  CA  . ASN A 1 385 ? 23.705  2.907   24.694  1.00 5.00  ? 385  ASN A CA  1 
ATOM   2896 C  C   . ASN A 1 385 ? 22.717  3.271   25.808  1.00 6.66  ? 385  ASN A C   1 
ATOM   2897 O  O   . ASN A 1 385 ? 22.797  2.627   26.894  1.00 11.62 ? 385  ASN A O   1 
ATOM   2898 C  CB  . ASN A 1 385 ? 22.883  2.089   23.702  1.00 5.52  ? 385  ASN A CB  1 
ATOM   2899 C  CG  . ASN A 1 385 ? 23.587  1.794   22.387  1.00 7.90  ? 385  ASN A CG  1 
ATOM   2900 O  OD1 . ASN A 1 385 ? 22.766  1.309   21.593  1.00 13.51 ? 385  ASN A OD1 1 
ATOM   2901 N  ND2 . ASN A 1 385 ? 24.919  1.944   22.246  1.00 6.29  ? 385  ASN A ND2 1 
ATOM   2902 N  N   . ALA A 1 386 ? 21.916  4.281   25.559  1.00 5.00  ? 386  ALA A N   1 
ATOM   2903 C  CA  . ALA A 1 386 ? 20.945  4.672   26.599  1.00 5.43  ? 386  ALA A CA  1 
ATOM   2904 C  C   . ALA A 1 386 ? 19.694  5.121   25.831  1.00 10.20 ? 386  ALA A C   1 
ATOM   2905 O  O   . ALA A 1 386 ? 19.829  5.927   24.863  1.00 9.87  ? 386  ALA A O   1 
ATOM   2906 C  CB  . ALA A 1 386 ? 21.546  5.806   27.431  1.00 5.95  ? 386  ALA A CB  1 
ATOM   2907 N  N   . VAL A 1 387 ? 18.586  4.516   26.212  1.00 9.78  ? 387  VAL A N   1 
ATOM   2908 C  CA  . VAL A 1 387 ? 17.285  4.816   25.513  1.00 14.01 ? 387  VAL A CA  1 
ATOM   2909 C  C   . VAL A 1 387 ? 16.166  5.195   26.480  1.00 17.44 ? 387  VAL A C   1 
ATOM   2910 O  O   . VAL A 1 387 ? 15.869  4.386   27.387  1.00 12.24 ? 387  VAL A O   1 
ATOM   2911 C  CB  . VAL A 1 387 ? 16.945  3.516   24.739  1.00 13.12 ? 387  VAL A CB  1 
ATOM   2912 C  CG1 . VAL A 1 387 ? 15.592  3.540   24.005  1.00 14.73 ? 387  VAL A CG1 1 
ATOM   2913 C  CG2 . VAL A 1 387 ? 17.975  3.000   23.757  1.00 5.00  ? 387  VAL A CG2 1 
ATOM   2914 N  N   . MET A 1 388 ? 15.506  6.347   26.252  1.00 8.28  ? 388  MET A N   1 
ATOM   2915 C  CA  . MET A 1 388 ? 14.373  6.774   27.130  1.00 9.66  ? 388  MET A CA  1 
ATOM   2916 C  C   . MET A 1 388 ? 13.143  6.135   26.527  1.00 8.30  ? 388  MET A C   1 
ATOM   2917 O  O   . MET A 1 388 ? 12.505  6.620   25.545  1.00 9.88  ? 388  MET A O   1 
ATOM   2918 C  CB  . MET A 1 388 ? 14.235  8.287   27.218  1.00 5.00  ? 388  MET A CB  1 
ATOM   2919 C  CG  . MET A 1 388 ? 12.994  8.634   28.104  1.00 10.99 ? 388  MET A CG  1 
ATOM   2920 S  SD  . MET A 1 388 ? 13.108  10.446  28.275  1.00 10.73 ? 388  MET A SD  1 
ATOM   2921 C  CE  . MET A 1 388 ? 14.332  10.676  29.576  1.00 5.00  ? 388  MET A CE  1 
ATOM   2922 N  N   . TYR A 1 389 ? 12.728  4.978   27.013  1.00 6.60  ? 389  TYR A N   1 
ATOM   2923 C  CA  . TYR A 1 389 ? 11.622  4.264   26.365  1.00 6.30  ? 389  TYR A CA  1 
ATOM   2924 C  C   . TYR A 1 389 ? 10.277  4.653   26.976  1.00 16.58 ? 389  TYR A C   1 
ATOM   2925 O  O   . TYR A 1 389 ? 9.339   4.202   26.304  1.00 11.43 ? 389  TYR A O   1 
ATOM   2926 C  CB  . TYR A 1 389 ? 11.866  2.754   26.373  1.00 6.33  ? 389  TYR A CB  1 
ATOM   2927 C  CG  . TYR A 1 389 ? 11.850  2.145   27.770  1.00 18.19 ? 389  TYR A CG  1 
ATOM   2928 C  CD1 . TYR A 1 389 ? 10.654  1.733   28.387  1.00 14.68 ? 389  TYR A CD1 1 
ATOM   2929 C  CD2 . TYR A 1 389 ? 13.037  2.041   28.479  1.00 14.44 ? 389  TYR A CD2 1 
ATOM   2930 C  CE1 . TYR A 1 389 ? 10.658  1.230   29.710  1.00 7.29  ? 389  TYR A CE1 1 
ATOM   2931 C  CE2 . TYR A 1 389 ? 13.089  1.518   29.776  1.00 8.58  ? 389  TYR A CE2 1 
ATOM   2932 C  CZ  . TYR A 1 389 ? 11.852  1.054   30.332  1.00 7.87  ? 389  TYR A CZ  1 
ATOM   2933 O  OH  . TYR A 1 389 ? 11.932  0.612   31.574  1.00 14.50 ? 389  TYR A OH  1 
ATOM   2934 N  N   . ASP A 1 390 ? 10.257  5.326   28.093  1.00 10.44 ? 390  ASP A N   1 
ATOM   2935 C  CA  . ASP A 1 390 ? 8.893   5.788   28.580  1.00 7.06  ? 390  ASP A CA  1 
ATOM   2936 C  C   . ASP A 1 390 ? 9.202   7.128   29.180  1.00 5.00  ? 390  ASP A C   1 
ATOM   2937 O  O   . ASP A 1 390 ? 9.609   7.274   30.360  1.00 11.66 ? 390  ASP A O   1 
ATOM   2938 C  CB  . ASP A 1 390 ? 8.168   4.742   29.373  1.00 14.45 ? 390  ASP A CB  1 
ATOM   2939 C  CG  . ASP A 1 390 ? 6.859   5.301   30.025  1.00 10.26 ? 390  ASP A CG  1 
ATOM   2940 O  OD1 . ASP A 1 390 ? 6.721   6.547   29.971  1.00 9.98  ? 390  ASP A OD1 1 
ATOM   2941 O  OD2 . ASP A 1 390 ? 6.246   4.324   30.521  1.00 13.47 ? 390  ASP A OD2 1 
ATOM   2942 N  N   . ALA A 1 391 ? 9.097   8.180   28.380  1.00 8.45  ? 391  ALA A N   1 
ATOM   2943 C  CA  . ALA A 1 391 ? 9.428   9.505   28.875  1.00 5.73  ? 391  ALA A CA  1 
ATOM   2944 C  C   . ALA A 1 391 ? 8.420   9.982   29.955  1.00 14.65 ? 391  ALA A C   1 
ATOM   2945 O  O   . ALA A 1 391 ? 8.800   10.814  30.799  1.00 15.69 ? 391  ALA A O   1 
ATOM   2946 C  CB  . ALA A 1 391 ? 9.505   10.574  27.826  1.00 6.85  ? 391  ALA A CB  1 
ATOM   2947 N  N   . VAL A 1 392 ? 7.260   9.430   29.857  1.00 11.46 ? 392  VAL A N   1 
ATOM   2948 C  CA  . VAL A 1 392 ? 6.190   9.851   30.837  1.00 17.93 ? 392  VAL A CA  1 
ATOM   2949 C  C   . VAL A 1 392 ? 6.625   9.384   32.218  1.00 21.13 ? 392  VAL A C   1 
ATOM   2950 O  O   . VAL A 1 392 ? 6.553   10.089  33.238  1.00 15.22 ? 392  VAL A O   1 
ATOM   2951 C  CB  . VAL A 1 392 ? 4.813   9.325   30.356  1.00 11.89 ? 392  VAL A CB  1 
ATOM   2952 C  CG1 . VAL A 1 392 ? 3.726   9.563   31.417  1.00 23.54 ? 392  VAL A CG1 1 
ATOM   2953 C  CG2 . VAL A 1 392 ? 4.362   10.078  29.105  1.00 10.51 ? 392  VAL A CG2 1 
ATOM   2954 N  N   . LYS A 1 393 ? 7.070   8.120   32.257  1.00 14.74 ? 393  LYS A N   1 
ATOM   2955 C  CA  . LYS A 1 393 ? 7.528   7.601   33.557  1.00 15.57 ? 393  LYS A CA  1 
ATOM   2956 C  C   . LYS A 1 393 ? 9.024   7.818   33.821  1.00 17.22 ? 393  LYS A C   1 
ATOM   2957 O  O   . LYS A 1 393 ? 9.553   7.400   34.856  1.00 14.52 ? 393  LYS A O   1 
ATOM   2958 C  CB  . LYS A 1 393 ? 7.224   6.125   33.709  1.00 14.97 ? 393  LYS A CB  1 
ATOM   2959 C  CG  . LYS A 1 393 ? 5.817   5.549   33.765  1.00 25.09 ? 393  LYS A CG  1 
ATOM   2960 C  CD  . LYS A 1 393 ? 4.968   6.415   34.675  1.00 45.72 ? 393  LYS A CD  1 
ATOM   2961 C  CE  . LYS A 1 393 ? 4.949   5.903   36.108  1.00 72.96 ? 393  LYS A CE  1 
ATOM   2962 N  NZ  . LYS A 1 393 ? 4.103   6.786   36.992  1.00 83.42 ? 393  LYS A NZ  1 
ATOM   2963 N  N   . GLY A 1 394 ? 9.775   8.517   33.026  1.00 9.30  ? 394  GLY A N   1 
ATOM   2964 C  CA  . GLY A 1 394 ? 11.154  8.835   33.127  1.00 12.28 ? 394  GLY A CA  1 
ATOM   2965 C  C   . GLY A 1 394 ? 12.023  7.566   33.100  1.00 7.77  ? 394  GLY A C   1 
ATOM   2966 O  O   . GLY A 1 394 ? 13.106  7.574   33.710  1.00 14.08 ? 394  GLY A O   1 
ATOM   2967 N  N   . LYS A 1 395 ? 11.687  6.613   32.270  1.00 11.66 ? 395  LYS A N   1 
ATOM   2968 C  CA  . LYS A 1 395 ? 12.398  5.340   32.218  1.00 10.02 ? 395  LYS A CA  1 
ATOM   2969 C  C   . LYS A 1 395 ? 13.460  5.339   31.131  1.00 7.55  ? 395  LYS A C   1 
ATOM   2970 O  O   . LYS A 1 395 ? 13.072  5.545   29.995  1.00 6.99  ? 395  LYS A O   1 
ATOM   2971 C  CB  . LYS A 1 395 ? 11.423  4.201   31.875  1.00 8.25  ? 395  LYS A CB  1 
ATOM   2972 C  CG  . LYS A 1 395 ? 10.287  4.099   32.895  1.00 12.72 ? 395  LYS A CG  1 
ATOM   2973 C  CD  . LYS A 1 395 ? 10.834  3.414   34.135  1.00 15.73 ? 395  LYS A CD  1 
ATOM   2974 C  CE  . LYS A 1 395 ? 9.828   3.252   35.234  1.00 25.90 ? 395  LYS A CE  1 
ATOM   2975 N  NZ  . LYS A 1 395 ? 10.501  2.687   36.432  1.00 27.36 ? 395  LYS A NZ  1 
ATOM   2976 N  N   . ILE A 1 396 ? 14.659  5.055   31.536  1.00 5.00  ? 396  ILE A N   1 
ATOM   2977 C  CA  . ILE A 1 396 ? 15.769  4.965   30.605  1.00 5.27  ? 396  ILE A CA  1 
ATOM   2978 C  C   . ILE A 1 396 ? 16.457  3.603   30.831  1.00 5.00  ? 396  ILE A C   1 
ATOM   2979 O  O   . ILE A 1 396 ? 16.857  3.157   31.949  1.00 11.88 ? 396  ILE A O   1 
ATOM   2980 C  CB  . ILE A 1 396 ? 16.868  6.064   30.966  1.00 7.59  ? 396  ILE A CB  1 
ATOM   2981 C  CG1 . ILE A 1 396 ? 16.299  7.495   30.863  1.00 5.00  ? 396  ILE A CG1 1 
ATOM   2982 C  CG2 . ILE A 1 396 ? 18.103  5.830   30.041  1.00 6.50  ? 396  ILE A CG2 1 
ATOM   2983 C  CD1 . ILE A 1 396 ? 17.191  8.581   31.524  1.00 7.04  ? 396  ILE A CD1 1 
ATOM   2984 N  N   . LEU A 1 397 ? 16.609  2.906   29.703  1.00 5.00  ? 397  LEU A N   1 
ATOM   2985 C  CA  . LEU A 1 397 ? 17.343  1.616   29.721  1.00 5.00  ? 397  LEU A CA  1 
ATOM   2986 C  C   . LEU A 1 397 ? 18.753  1.920   29.201  1.00 12.93 ? 397  LEU A C   1 
ATOM   2987 O  O   . LEU A 1 397 ? 18.881  2.561   28.149  1.00 8.95  ? 397  LEU A O   1 
ATOM   2988 C  CB  . LEU A 1 397 ? 16.665  0.688   28.683  1.00 6.17  ? 397  LEU A CB  1 
ATOM   2989 C  CG  . LEU A 1 397 ? 17.326  -0.699  28.489  1.00 5.00  ? 397  LEU A CG  1 
ATOM   2990 C  CD1 . LEU A 1 397 ? 17.138  -1.513  29.736  1.00 6.50  ? 397  LEU A CD1 1 
ATOM   2991 C  CD2 . LEU A 1 397 ? 16.599  -1.334  27.312  1.00 5.43  ? 397  LEU A CD2 1 
ATOM   2992 N  N   . THR A 1 398 ? 19.768  1.420   29.874  1.00 11.13 ? 398  THR A N   1 
ATOM   2993 C  CA  . THR A 1 398 ? 21.197  1.601   29.539  1.00 18.50 ? 398  THR A CA  1 
ATOM   2994 C  C   . THR A 1 398 ? 21.804  0.241   29.335  1.00 13.71 ? 398  THR A C   1 
ATOM   2995 O  O   . THR A 1 398 ? 21.382  -0.662  30.087  1.00 10.39 ? 398  THR A O   1 
ATOM   2996 C  CB  . THR A 1 398 ? 21.882  2.591   30.572  1.00 13.15 ? 398  THR A CB  1 
ATOM   2997 O  OG1 . THR A 1 398 ? 22.144  1.858   31.812  1.00 9.79  ? 398  THR A OG1 1 
ATOM   2998 C  CG2 . THR A 1 398 ? 21.006  3.888   30.765  1.00 11.00 ? 398  THR A CG2 1 
ATOM   2999 N  N   . PHE A 1 399 ? 22.743  0.026   28.416  1.00 10.74 ? 399  PHE A N   1 
ATOM   3000 C  CA  . PHE A 1 399 ? 23.284  -1.351  28.293  1.00 9.41  ? 399  PHE A CA  1 
ATOM   3001 C  C   . PHE A 1 399 ? 24.577  -1.413  27.488  1.00 6.63  ? 399  PHE A C   1 
ATOM   3002 O  O   . PHE A 1 399 ? 24.712  -0.550  26.603  1.00 11.59 ? 399  PHE A O   1 
ATOM   3003 C  CB  . PHE A 1 399 ? 22.217  -2.214  27.564  1.00 5.00  ? 399  PHE A CB  1 
ATOM   3004 C  CG  . PHE A 1 399 ? 21.515  -1.561  26.401  1.00 6.90  ? 399  PHE A CG  1 
ATOM   3005 C  CD1 . PHE A 1 399 ? 20.371  -0.781  26.662  1.00 5.48  ? 399  PHE A CD1 1 
ATOM   3006 C  CD2 . PHE A 1 399 ? 22.031  -1.668  25.127  1.00 5.00  ? 399  PHE A CD2 1 
ATOM   3007 C  CE1 . PHE A 1 399 ? 19.742  -0.044  25.682  1.00 6.52  ? 399  PHE A CE1 1 
ATOM   3008 C  CE2 . PHE A 1 399 ? 21.362  -0.995  24.073  1.00 5.00  ? 399  PHE A CE2 1 
ATOM   3009 C  CZ  . PHE A 1 399 ? 20.227  -0.194  24.360  1.00 11.70 ? 399  PHE A CZ  1 
ATOM   3010 N  N   . GLY A 1 400 ? 25.378  -2.377  27.763  1.00 5.00  ? 400  GLY A N   1 
ATOM   3011 C  CA  . GLY A 1 400 ? 26.574  -2.571  26.963  1.00 5.29  ? 400  GLY A CA  1 
ATOM   3012 C  C   . GLY A 1 400 ? 27.633  -1.501  27.229  1.00 8.91  ? 400  GLY A C   1 
ATOM   3013 O  O   . GLY A 1 400 ? 27.591  -0.727  28.165  1.00 8.55  ? 400  GLY A O   1 
ATOM   3014 N  N   . GLY A 1 401 ? 28.619  -1.471  26.363  1.00 10.48 ? 401  GLY A N   1 
ATOM   3015 C  CA  . GLY A 1 401 ? 29.761  -0.542  26.472  1.00 8.77  ? 401  GLY A CA  1 
ATOM   3016 C  C   . GLY A 1 401 ? 30.935  -1.237  27.234  1.00 12.33 ? 401  GLY A C   1 
ATOM   3017 O  O   . GLY A 1 401 ? 30.758  -2.367  27.690  1.00 14.02 ? 401  GLY A O   1 
ATOM   3018 N  N   . SER A 1 402 ? 32.015  -0.499  27.380  1.00 5.81  ? 402  SER A N   1 
ATOM   3019 C  CA  . SER A 1 402 ? 33.227  -0.947  28.035  1.00 10.25 ? 402  SER A CA  1 
ATOM   3020 C  C   . SER A 1 402 ? 33.901  0.185   28.810  1.00 10.51 ? 402  SER A C   1 
ATOM   3021 O  O   . SER A 1 402 ? 33.629  1.347   28.471  1.00 13.81 ? 402  SER A O   1 
ATOM   3022 C  CB  . SER A 1 402 ? 34.196  -1.588  26.997  1.00 8.62  ? 402  SER A CB  1 
ATOM   3023 O  OG  . SER A 1 402 ? 34.572  -0.583  26.086  1.00 16.38 ? 402  SER A OG  1 
ATOM   3024 N  N   . PRO A 1 403 ? 34.711  -0.137  29.815  1.00 12.43 ? 403  PRO A N   1 
ATOM   3025 C  CA  . PRO A 1 403 ? 35.411  0.817   30.655  1.00 14.29 ? 403  PRO A CA  1 
ATOM   3026 C  C   . PRO A 1 403 ? 36.287  1.802   29.881  1.00 6.60  ? 403  PRO A C   1 
ATOM   3027 O  O   . PRO A 1 403 ? 36.290  3.014   30.160  1.00 9.44  ? 403  PRO A O   1 
ATOM   3028 C  CB  . PRO A 1 403 ? 36.115  -0.041  31.620  1.00 11.74 ? 403  PRO A CB  1 
ATOM   3029 C  CG  . PRO A 1 403 ? 35.896  -1.491  31.356  1.00 11.86 ? 403  PRO A CG  1 
ATOM   3030 C  CD  . PRO A 1 403 ? 34.981  -1.549  30.226  1.00 5.01  ? 403  PRO A CD  1 
ATOM   3031 N  N   . ASP A 1 404 ? 36.841  1.304   28.785  1.00 6.71  ? 404  ASP A N   1 
ATOM   3032 C  CA  . ASP A 1 404 ? 37.663  2.183   27.945  1.00 9.35  ? 404  ASP A CA  1 
ATOM   3033 C  C   . ASP A 1 404 ? 37.077  2.222   26.579  1.00 5.00  ? 404  ASP A C   1 
ATOM   3034 O  O   . ASP A 1 404 ? 36.468  1.211   26.214  1.00 7.38  ? 404  ASP A O   1 
ATOM   3035 C  CB  . ASP A 1 404 ? 39.094  1.583   27.755  1.00 9.03  ? 404  ASP A CB  1 
ATOM   3036 C  CG  . ASP A 1 404 ? 39.751  1.621   29.128  1.00 20.61 ? 404  ASP A CG  1 
ATOM   3037 O  OD1 . ASP A 1 404 ? 39.905  2.647   29.822  1.00 16.74 ? 404  ASP A OD1 1 
ATOM   3038 O  OD2 . ASP A 1 404 ? 40.106  0.473   29.481  1.00 25.07 ? 404  ASP A OD2 1 
ATOM   3039 N  N   . TYR A 1 405 ? 37.395  3.279   25.902  1.00 8.78  ? 405  TYR A N   1 
ATOM   3040 C  CA  . TYR A 1 405 ? 36.897  3.373   24.480  1.00 11.04 ? 405  TYR A CA  1 
ATOM   3041 C  C   . TYR A 1 405 ? 37.374  2.218   23.630  1.00 11.34 ? 405  TYR A C   1 
ATOM   3042 O  O   . TYR A 1 405 ? 36.562  1.722   22.827  1.00 12.34 ? 405  TYR A O   1 
ATOM   3043 C  CB  . TYR A 1 405 ? 37.368  4.715   23.874  1.00 12.77 ? 405  TYR A CB  1 
ATOM   3044 C  CG  . TYR A 1 405 ? 36.538  5.233   22.709  1.00 9.99  ? 405  TYR A CG  1 
ATOM   3045 C  CD1 . TYR A 1 405 ? 36.516  4.718   21.438  1.00 11.16 ? 405  TYR A CD1 1 
ATOM   3046 C  CD2 . TYR A 1 405 ? 35.764  6.374   22.902  1.00 8.97  ? 405  TYR A CD2 1 
ATOM   3047 C  CE1 . TYR A 1 405 ? 35.788  5.271   20.396  1.00 11.74 ? 405  TYR A CE1 1 
ATOM   3048 C  CE2 . TYR A 1 405 ? 34.977  6.967   21.917  1.00 10.57 ? 405  TYR A CE2 1 
ATOM   3049 C  CZ  . TYR A 1 405 ? 34.953  6.378   20.659  1.00 11.35 ? 405  TYR A CZ  1 
ATOM   3050 O  OH  . TYR A 1 405 ? 34.147  6.891   19.706  1.00 9.96  ? 405  TYR A OH  1 
ATOM   3051 N  N   . GLN A 1 406 ? 38.650  1.794   23.675  1.00 10.66 ? 406  GLN A N   1 
ATOM   3052 C  CA  . GLN A 1 406 ? 39.036  0.611   22.843  1.00 10.61 ? 406  GLN A CA  1 
ATOM   3053 C  C   . GLN A 1 406 ? 39.976  -0.274  23.663  1.00 13.13 ? 406  GLN A C   1 
ATOM   3054 O  O   . GLN A 1 406 ? 40.448  0.197   24.707  1.00 12.14 ? 406  GLN A O   1 
ATOM   3055 C  CB  . GLN A 1 406 ? 39.804  1.020   21.589  1.00 13.35 ? 406  GLN A CB  1 
ATOM   3056 C  CG  . GLN A 1 406 ? 40.999  1.927   21.906  1.00 13.04 ? 406  GLN A CG  1 
ATOM   3057 C  CD  . GLN A 1 406 ? 41.446  2.633   20.666  1.00 21.70 ? 406  GLN A CD  1 
ATOM   3058 O  OE1 . GLN A 1 406 ? 41.428  3.876   20.519  1.00 30.97 ? 406  GLN A OE1 1 
ATOM   3059 N  NE2 . GLN A 1 406 ? 41.916  1.938   19.665  1.00 16.93 ? 406  GLN A NE2 1 
ATOM   3060 N  N   . ASP A 1 407 ? 40.173  -1.478  23.175  1.00 16.94 ? 407  ASP A N   1 
ATOM   3061 C  CA  . ASP A 1 407 ? 41.079  -2.472  23.777  1.00 13.74 ? 407  ASP A CA  1 
ATOM   3062 C  C   . ASP A 1 407 ? 40.591  -2.890  25.151  1.00 17.34 ? 407  ASP A C   1 
ATOM   3063 O  O   . ASP A 1 407 ? 41.387  -3.155  26.045  1.00 21.29 ? 407  ASP A O   1 
ATOM   3064 C  CB  . ASP A 1 407 ? 42.504  -1.884  23.914  1.00 13.75 ? 407  ASP A CB  1 
ATOM   3065 C  CG  . ASP A 1 407 ? 43.071  -1.581  22.542  1.00 16.34 ? 407  ASP A CG  1 
ATOM   3066 O  OD1 . ASP A 1 407 ? 42.725  -2.292  21.578  1.00 16.86 ? 407  ASP A OD1 1 
ATOM   3067 O  OD2 . ASP A 1 407 ? 43.942  -0.707  22.421  1.00 23.36 ? 407  ASP A OD2 1 
ATOM   3068 N  N   . SER A 1 408 ? 39.278  -2.873  25.287  1.00 13.49 ? 408  SER A N   1 
ATOM   3069 C  CA  . SER A 1 408 ? 38.620  -3.235  26.566  1.00 13.45 ? 408  SER A CA  1 
ATOM   3070 C  C   . SER A 1 408 ? 37.426  -4.173  26.257  1.00 15.69 ? 408  SER A C   1 
ATOM   3071 O  O   . SER A 1 408 ? 36.803  -4.023  25.194  1.00 15.82 ? 408  SER A O   1 
ATOM   3072 C  CB  . SER A 1 408 ? 38.033  -1.803  26.894  1.00 17.23 ? 408  SER A CB  1 
ATOM   3073 O  OG  . SER A 1 408 ? 37.598  -1.876  28.205  1.00 29.95 ? 408  SER A OG  1 
ATOM   3074 N  N   . ASP A 1 409 ? 37.106  -5.093  27.116  1.00 11.07 ? 409  ASP A N   1 
ATOM   3075 C  CA  . ASP A 1 409 ? 35.978  -6.012  26.922  1.00 22.67 ? 409  ASP A CA  1 
ATOM   3076 C  C   . ASP A 1 409 ? 34.658  -5.273  27.286  1.00 16.35 ? 409  ASP A C   1 
ATOM   3077 O  O   . ASP A 1 409 ? 34.629  -4.609  28.314  1.00 11.17 ? 409  ASP A O   1 
ATOM   3078 C  CB  . ASP A 1 409 ? 36.078  -7.173  27.878  1.00 26.45 ? 409  ASP A CB  1 
ATOM   3079 C  CG  . ASP A 1 409 ? 37.240  -8.120  27.539  1.00 39.29 ? 409  ASP A CG  1 
ATOM   3080 O  OD1 . ASP A 1 409 ? 37.798  -8.155  26.457  1.00 28.46 ? 409  ASP A OD1 1 
ATOM   3081 O  OD2 . ASP A 1 409 ? 37.535  -8.829  28.512  1.00 58.36 ? 409  ASP A OD2 1 
ATOM   3082 N  N   . ALA A 1 410 ? 33.649  -5.514  26.453  1.00 12.02 ? 410  ALA A N   1 
ATOM   3083 C  CA  . ALA A 1 410 ? 32.324  -4.967  26.609  1.00 14.03 ? 410  ALA A CA  1 
ATOM   3084 C  C   . ALA A 1 410 ? 31.641  -5.693  27.763  1.00 15.93 ? 410  ALA A C   1 
ATOM   3085 O  O   . ALA A 1 410 ? 32.117  -6.758  28.141  1.00 12.10 ? 410  ALA A O   1 
ATOM   3086 C  CB  . ALA A 1 410 ? 31.611  -5.170  25.274  1.00 7.59  ? 410  ALA A CB  1 
ATOM   3087 N  N   . THR A 1 411 ? 30.569  -5.193  28.300  1.00 11.61 ? 411  THR A N   1 
ATOM   3088 C  CA  . THR A 1 411 ? 29.821  -5.817  29.397  1.00 14.79 ? 411  THR A CA  1 
ATOM   3089 C  C   . THR A 1 411 ? 28.406  -6.167  28.876  1.00 17.39 ? 411  THR A C   1 
ATOM   3090 O  O   . THR A 1 411 ? 27.899  -5.662  27.846  1.00 8.75  ? 411  THR A O   1 
ATOM   3091 C  CB  . THR A 1 411 ? 29.753  -4.733  30.539  1.00 13.72 ? 411  THR A CB  1 
ATOM   3092 O  OG1 . THR A 1 411 ? 28.840  -5.018  31.569  1.00 23.76 ? 411  THR A OG1 1 
ATOM   3093 C  CG2 . THR A 1 411 ? 29.091  -3.350  30.096  1.00 14.90 ? 411  THR A CG2 1 
ATOM   3094 N  N   . THR A 1 412 ? 27.762  -7.027  29.701  1.00 11.03 ? 412  THR A N   1 
ATOM   3095 C  CA  . THR A 1 412 ? 26.377  -7.387  29.467  1.00 11.66 ? 412  THR A CA  1 
ATOM   3096 C  C   . THR A 1 412 ? 25.487  -6.520  30.401  1.00 10.34 ? 412  THR A C   1 
ATOM   3097 O  O   . THR A 1 412 ? 24.258  -6.597  30.396  1.00 16.78 ? 412  THR A O   1 
ATOM   3098 C  CB  . THR A 1 412 ? 26.124  -8.916  29.692  1.00 16.52 ? 412  THR A CB  1 
ATOM   3099 O  OG1 . THR A 1 412 ? 26.577  -9.145  31.086  1.00 16.97 ? 412  THR A OG1 1 
ATOM   3100 C  CG2 . THR A 1 412 ? 26.768  -9.864  28.672  1.00 16.29 ? 412  THR A CG2 1 
ATOM   3101 N  N   . ASN A 1 413 ? 26.094  -5.667  31.223  1.00 9.80  ? 413  ASN A N   1 
ATOM   3102 C  CA  . ASN A 1 413 ? 25.374  -4.866  32.185  1.00 7.74  ? 413  ASN A CA  1 
ATOM   3103 C  C   . ASN A 1 413 ? 24.256  -4.107  31.463  1.00 8.49  ? 413  ASN A C   1 
ATOM   3104 O  O   . ASN A 1 413 ? 24.439  -3.515  30.398  1.00 9.05  ? 413  ASN A O   1 
ATOM   3105 C  CB  . ASN A 1 413 ? 26.177  -3.857  33.004  1.00 9.70  ? 413  ASN A CB  1 
ATOM   3106 C  CG  . ASN A 1 413 ? 27.173  -4.371  34.010  1.00 16.36 ? 413  ASN A CG  1 
ATOM   3107 O  OD1 . ASN A 1 413 ? 28.217  -3.703  34.192  1.00 19.99 ? 413  ASN A OD1 1 
ATOM   3108 N  ND2 . ASN A 1 413 ? 26.955  -5.496  34.592  1.00 17.23 ? 413  ASN A ND2 1 
ATOM   3109 N  N   . ALA A 1 414 ? 23.101  -4.072  32.140  1.00 9.24  ? 414  ALA A N   1 
ATOM   3110 C  CA  . ALA A 1 414 ? 21.950  -3.343  31.652  1.00 8.28  ? 414  ALA A CA  1 
ATOM   3111 C  C   . ALA A 1 414 ? 21.222  -2.809  32.875  1.00 7.77  ? 414  ALA A C   1 
ATOM   3112 O  O   . ALA A 1 414 ? 21.072  -3.521  33.828  1.00 7.12  ? 414  ALA A O   1 
ATOM   3113 C  CB  . ALA A 1 414 ? 21.055  -4.175  30.758  1.00 10.93 ? 414  ALA A CB  1 
ATOM   3114 N  N   . HIS A 1 415 ? 20.737  -1.579  32.841  1.00 8.06  ? 415  HIS A N   1 
ATOM   3115 C  CA  . HIS A 1 415 ? 20.070  -0.937  33.927  1.00 13.10 ? 415  HIS A CA  1 
ATOM   3116 C  C   . HIS A 1 415 ? 18.868  -0.148  33.454  1.00 12.84 ? 415  HIS A C   1 
ATOM   3117 O  O   . HIS A 1 415 ? 18.854  0.289   32.306  1.00 12.38 ? 415  HIS A O   1 
ATOM   3118 C  CB  . HIS A 1 415 ? 21.009  0.157   34.693  1.00 18.08 ? 415  HIS A CB  1 
ATOM   3119 C  CG  . HIS A 1 415 ? 22.198  -0.458  35.335  1.00 12.98 ? 415  HIS A CG  1 
ATOM   3120 N  ND1 . HIS A 1 415 ? 23.379  -0.825  34.713  1.00 5.00  ? 415  HIS A ND1 1 
ATOM   3121 C  CD2 . HIS A 1 415 ? 22.365  -0.822  36.616  1.00 5.58  ? 415  HIS A CD2 1 
ATOM   3122 C  CE1 . HIS A 1 415 ? 24.192  -1.382  35.522  1.00 7.11  ? 415  HIS A CE1 1 
ATOM   3123 N  NE2 . HIS A 1 415 ? 23.627  -1.369  36.692  1.00 12.41 ? 415  HIS A NE2 1 
ATOM   3124 N  N   . ILE A 1 416 ? 17.970  0.040   34.390  1.00 8.53  ? 416  ILE A N   1 
ATOM   3125 C  CA  . ILE A 1 416 ? 16.774  0.837   34.214  1.00 6.08  ? 416  ILE A CA  1 
ATOM   3126 C  C   . ILE A 1 416 ? 16.918  2.031   35.095  1.00 5.00  ? 416  ILE A C   1 
ATOM   3127 O  O   . ILE A 1 416 ? 17.056  1.773   36.281  1.00 7.04  ? 416  ILE A O   1 
ATOM   3128 C  CB  . ILE A 1 416 ? 15.469  0.127   34.727  1.00 7.94  ? 416  ILE A CB  1 
ATOM   3129 C  CG1 . ILE A 1 416 ? 15.347  -1.246  34.010  1.00 14.42 ? 416  ILE A CG1 1 
ATOM   3130 C  CG2 . ILE A 1 416 ? 14.365  1.099   34.359  1.00 8.61  ? 416  ILE A CG2 1 
ATOM   3131 C  CD1 . ILE A 1 416 ? 15.060  -1.108  32.524  1.00 25.69 ? 416  ILE A CD1 1 
ATOM   3132 N  N   . ILE A 1 417 ? 16.896  3.237   34.683  1.00 5.46  ? 417  ILE A N   1 
ATOM   3133 C  CA  . ILE A 1 417 ? 16.995  4.401   35.534  1.00 6.05  ? 417  ILE A CA  1 
ATOM   3134 C  C   . ILE A 1 417 ? 15.636  5.078   35.490  1.00 5.91  ? 417  ILE A C   1 
ATOM   3135 O  O   . ILE A 1 417 ? 15.154  5.189   34.380  1.00 10.05 ? 417  ILE A O   1 
ATOM   3136 C  CB  . ILE A 1 417 ? 18.069  5.377   34.933  1.00 15.13 ? 417  ILE A CB  1 
ATOM   3137 C  CG1 . ILE A 1 417 ? 19.363  4.454   34.946  1.00 8.10  ? 417  ILE A CG1 1 
ATOM   3138 C  CG2 . ILE A 1 417 ? 18.315  6.722   35.629  1.00 12.51 ? 417  ILE A CG2 1 
ATOM   3139 C  CD1 . ILE A 1 417 ? 20.505  5.276   34.364  1.00 13.28 ? 417  ILE A CD1 1 
ATOM   3140 N  N   . THR A 1 418 ? 15.168  5.478   36.654  1.00 9.99  ? 418  THR A N   1 
ATOM   3141 C  CA  . THR A 1 418 ? 13.841  6.133   36.580  1.00 6.30  ? 418  THR A CA  1 
ATOM   3142 C  C   . THR A 1 418 ? 14.061  7.553   37.076  1.00 5.69  ? 418  THR A C   1 
ATOM   3143 O  O   . THR A 1 418 ? 14.392  7.760   38.269  1.00 11.32 ? 418  THR A O   1 
ATOM   3144 C  CB  . THR A 1 418 ? 12.784  5.410   37.488  1.00 9.40  ? 418  THR A CB  1 
ATOM   3145 O  OG1 . THR A 1 418 ? 12.739  4.040   37.073  1.00 10.04 ? 418  THR A OG1 1 
ATOM   3146 C  CG2 . THR A 1 418 ? 11.391  6.021   37.368  1.00 7.76  ? 418  THR A CG2 1 
ATOM   3147 N  N   . LEU A 1 419 ? 13.838  8.499   36.209  1.00 7.13  ? 419  LEU A N   1 
ATOM   3148 C  CA  . LEU A 1 419 ? 14.045  9.903   36.641  1.00 10.43 ? 419  LEU A CA  1 
ATOM   3149 C  C   . LEU A 1 419 ? 12.764  10.493  37.250  1.00 12.63 ? 419  LEU A C   1 
ATOM   3150 O  O   . LEU A 1 419 ? 11.632  10.240  36.843  1.00 14.33 ? 419  LEU A O   1 
ATOM   3151 C  CB  . LEU A 1 419 ? 14.293  10.707  35.374  1.00 8.41  ? 419  LEU A CB  1 
ATOM   3152 C  CG  . LEU A 1 419 ? 15.472  10.475  34.487  1.00 17.43 ? 419  LEU A CG  1 
ATOM   3153 C  CD1 . LEU A 1 419 ? 15.531  11.656  33.464  1.00 9.98  ? 419  LEU A CD1 1 
ATOM   3154 C  CD2 . LEU A 1 419 ? 16.751  10.522  35.301  1.00 14.65 ? 419  LEU A CD2 1 
ATOM   3155 N  N   . GLY A 1 420 ? 13.038  11.376  38.147  1.00 20.31 ? 420  GLY A N   1 
ATOM   3156 C  CA  . GLY A 1 420 ? 12.027  12.172  38.864  1.00 27.49 ? 420  GLY A CA  1 
ATOM   3157 C  C   . GLY A 1 420 ? 12.301  13.638  38.473  1.00 17.31 ? 420  GLY A C   1 
ATOM   3158 O  O   . GLY A 1 420 ? 12.495  13.974  37.309  1.00 21.16 ? 420  GLY A O   1 
ATOM   3159 N  N   . GLU A 1 421 ? 12.285  14.467  39.509  1.00 20.62 ? 421  GLU A N   1 
ATOM   3160 C  CA  . GLU A 1 421 ? 12.478  15.890  39.364  1.00 19.93 ? 421  GLU A CA  1 
ATOM   3161 C  C   . GLU A 1 421 ? 13.953  16.162  39.227  1.00 15.67 ? 421  GLU A C   1 
ATOM   3162 O  O   . GLU A 1 421 ? 14.721  15.467  39.924  1.00 16.01 ? 421  GLU A O   1 
ATOM   3163 C  CB  . GLU A 1 421 ? 11.945  16.677  40.597  1.00 16.11 ? 421  GLU A CB  1 
ATOM   3164 C  CG  . GLU A 1 421 ? 10.404  16.790  40.649  1.00 36.54 ? 421  GLU A CG  1 
ATOM   3165 C  CD  . GLU A 1 421 ? 9.822   17.335  39.361  1.00 52.35 ? 421  GLU A CD  1 
ATOM   3166 O  OE1 . GLU A 1 421 ? 10.071  18.432  38.864  1.00 49.08 ? 421  GLU A OE1 1 
ATOM   3167 O  OE2 . GLU A 1 421 ? 9.085   16.453  38.838  1.00 53.91 ? 421  GLU A OE2 1 
ATOM   3168 N  N   . PRO A 1 422 ? 14.288  17.143  38.414  1.00 17.27 ? 422  PRO A N   1 
ATOM   3169 C  CA  . PRO A 1 422 ? 15.746  17.431  38.338  1.00 16.53 ? 422  PRO A CA  1 
ATOM   3170 C  C   . PRO A 1 422 ? 16.286  17.612  39.729  1.00 17.62 ? 422  PRO A C   1 
ATOM   3171 O  O   . PRO A 1 422 ? 15.615  18.202  40.627  1.00 17.02 ? 422  PRO A O   1 
ATOM   3172 C  CB  . PRO A 1 422 ? 15.750  18.737  37.536  1.00 11.06 ? 422  PRO A CB  1 
ATOM   3173 C  CG  . PRO A 1 422 ? 14.425  18.977  36.986  1.00 13.59 ? 422  PRO A CG  1 
ATOM   3174 C  CD  . PRO A 1 422 ? 13.424  17.994  37.582  1.00 14.91 ? 422  PRO A CD  1 
ATOM   3175 N  N   . GLY A 1 423 ? 17.558  17.278  40.042  1.00 19.77 ? 423  GLY A N   1 
ATOM   3176 C  CA  . GLY A 1 423 ? 18.061  17.514  41.354  1.00 27.95 ? 423  GLY A CA  1 
ATOM   3177 C  C   . GLY A 1 423 ? 17.929  16.331  42.274  1.00 30.89 ? 423  GLY A C   1 
ATOM   3178 O  O   . GLY A 1 423 ? 18.730  16.288  43.211  1.00 42.91 ? 423  GLY A O   1 
ATOM   3179 N  N   . THR A 1 424 ? 17.018  15.433  41.991  1.00 24.39 ? 424  THR A N   1 
ATOM   3180 C  CA  . THR A 1 424 ? 16.865  14.230  42.838  1.00 28.65 ? 424  THR A CA  1 
ATOM   3181 C  C   . THR A 1 424 ? 17.663  13.066  42.230  1.00 25.37 ? 424  THR A C   1 
ATOM   3182 O  O   . THR A 1 424 ? 17.887  12.877  41.016  1.00 25.97 ? 424  THR A O   1 
ATOM   3183 C  CB  . THR A 1 424 ? 15.344  13.899  43.066  1.00 27.44 ? 424  THR A CB  1 
ATOM   3184 O  OG1 . THR A 1 424 ? 15.000  13.500  41.723  1.00 36.11 ? 424  THR A OG1 1 
ATOM   3185 C  CG2 . THR A 1 424 ? 14.497  15.100  43.516  1.00 32.21 ? 424  THR A CG2 1 
ATOM   3186 N  N   . SER A 1 425 ? 18.059  12.172  43.108  1.00 20.24 ? 425  SER A N   1 
ATOM   3187 C  CA  . SER A 1 425 ? 18.806  10.955  42.724  1.00 20.42 ? 425  SER A CA  1 
ATOM   3188 C  C   . SER A 1 425 ? 17.728  9.960   42.220  1.00 25.02 ? 425  SER A C   1 
ATOM   3189 O  O   . SER A 1 425 ? 16.800  9.559   42.957  1.00 23.47 ? 425  SER A O   1 
ATOM   3190 C  CB  . SER A 1 425 ? 19.560  10.436  43.939  1.00 33.49 ? 425  SER A CB  1 
ATOM   3191 O  OG  . SER A 1 425 ? 20.666  11.345  44.140  1.00 49.94 ? 425  SER A OG  1 
ATOM   3192 N  N   . PRO A 1 426 ? 17.938  9.576   40.983  1.00 15.62 ? 426  PRO A N   1 
ATOM   3193 C  CA  . PRO A 1 426 ? 17.004  8.649   40.331  1.00 12.90 ? 426  PRO A CA  1 
ATOM   3194 C  C   . PRO A 1 426 ? 17.235  7.268   40.844  1.00 14.49 ? 426  PRO A C   1 
ATOM   3195 O  O   . PRO A 1 426 ? 18.303  6.915   41.334  1.00 19.71 ? 426  PRO A O   1 
ATOM   3196 C  CB  . PRO A 1 426 ? 17.436  8.730   38.858  1.00 20.00 ? 426  PRO A CB  1 
ATOM   3197 C  CG  . PRO A 1 426 ? 18.781  9.370   38.767  1.00 18.45 ? 426  PRO A CG  1 
ATOM   3198 C  CD  . PRO A 1 426 ? 19.045  10.033  40.098  1.00 15.17 ? 426  PRO A CD  1 
ATOM   3199 N  N   . ASN A 1 427 ? 16.231  6.435   40.761  1.00 19.47 ? 427  ASN A N   1 
ATOM   3200 C  CA  . ASN A 1 427 ? 16.324  5.041   41.177  1.00 20.40 ? 427  ASN A CA  1 
ATOM   3201 C  C   . ASN A 1 427 ? 16.934  4.256   40.003  1.00 15.29 ? 427  ASN A C   1 
ATOM   3202 O  O   . ASN A 1 427 ? 16.540  4.465   38.849  1.00 13.18 ? 427  ASN A O   1 
ATOM   3203 C  CB  . ASN A 1 427 ? 14.863  4.599   41.356  1.00 35.65 ? 427  ASN A CB  1 
ATOM   3204 C  CG  . ASN A 1 427 ? 14.753  3.119   41.643  1.00 60.20 ? 427  ASN A CG  1 
ATOM   3205 O  OD1 . ASN A 1 427 ? 15.054  2.785   42.802  1.00 77.19 ? 427  ASN A OD1 1 
ATOM   3206 N  ND2 . ASN A 1 427 ? 14.384  2.280   40.669  1.00 63.61 ? 427  ASN A ND2 1 
ATOM   3207 N  N   . THR A 1 428 ? 17.828  3.349   40.261  1.00 7.81  ? 428  THR A N   1 
ATOM   3208 C  CA  . THR A 1 428 ? 18.395  2.566   39.176  1.00 14.10 ? 428  THR A CA  1 
ATOM   3209 C  C   . THR A 1 428 ? 18.275  1.119   39.633  1.00 15.36 ? 428  THR A C   1 
ATOM   3210 O  O   . THR A 1 428 ? 18.510  0.861   40.814  1.00 18.70 ? 428  THR A O   1 
ATOM   3211 C  CB  . THR A 1 428 ? 19.929  2.935   38.808  1.00 10.04 ? 428  THR A CB  1 
ATOM   3212 O  OG1 . THR A 1 428 ? 20.580  2.735   40.046  1.00 27.80 ? 428  THR A OG1 1 
ATOM   3213 C  CG2 . THR A 1 428 ? 20.165  4.452   38.698  1.00 5.97  ? 428  THR A CG2 1 
ATOM   3214 N  N   . VAL A 1 429 ? 17.904  0.189   38.792  1.00 13.90 ? 429  VAL A N   1 
ATOM   3215 C  CA  . VAL A 1 429 ? 17.889  -1.235  39.085  1.00 13.58 ? 429  VAL A CA  1 
ATOM   3216 C  C   . VAL A 1 429 ? 18.577  -1.911  37.909  1.00 9.59  ? 429  VAL A C   1 
ATOM   3217 O  O   . VAL A 1 429 ? 18.700  -1.266  36.844  1.00 9.83  ? 429  VAL A O   1 
ATOM   3218 C  CB  . VAL A 1 429 ? 16.403  -1.753  39.196  1.00 11.03 ? 429  VAL A CB  1 
ATOM   3219 C  CG1 . VAL A 1 429 ? 15.840  -1.023  40.461  1.00 18.62 ? 429  VAL A CG1 1 
ATOM   3220 C  CG2 . VAL A 1 429 ? 15.532  -1.528  38.049  1.00 9.98  ? 429  VAL A CG2 1 
ATOM   3221 N  N   . PHE A 1 430 ? 18.862  -3.191  38.032  1.00 10.08 ? 430  PHE A N   1 
ATOM   3222 C  CA  . PHE A 1 430 ? 19.415  -3.989  36.941  1.00 14.05 ? 430  PHE A CA  1 
ATOM   3223 C  C   . PHE A 1 430 ? 18.282  -4.402  36.010  1.00 15.14 ? 430  PHE A C   1 
ATOM   3224 O  O   . PHE A 1 430 ? 17.135  -4.671  36.461  1.00 17.51 ? 430  PHE A O   1 
ATOM   3225 C  CB  . PHE A 1 430 ? 20.188  -5.206  37.469  1.00 12.89 ? 430  PHE A CB  1 
ATOM   3226 C  CG  . PHE A 1 430 ? 21.294  -5.688  36.558  1.00 10.35 ? 430  PHE A CG  1 
ATOM   3227 C  CD1 . PHE A 1 430 ? 22.525  -4.972  36.498  1.00 12.92 ? 430  PHE A CD1 1 
ATOM   3228 C  CD2 . PHE A 1 430 ? 21.105  -6.828  35.826  1.00 8.11  ? 430  PHE A CD2 1 
ATOM   3229 C  CE1 . PHE A 1 430 ? 23.522  -5.482  35.650  1.00 12.58 ? 430  PHE A CE1 1 
ATOM   3230 C  CE2 . PHE A 1 430 ? 22.122  -7.369  34.982  1.00 10.72 ? 430  PHE A CE2 1 
ATOM   3231 C  CZ  . PHE A 1 430 ? 23.334  -6.666  34.926  1.00 11.92 ? 430  PHE A CZ  1 
ATOM   3232 N  N   . ALA A 1 431 ? 18.555  -4.488  34.715  1.00 8.70  ? 431  ALA A N   1 
ATOM   3233 C  CA  . ALA A 1 431 ? 17.535  -4.902  33.723  1.00 12.00 ? 431  ALA A CA  1 
ATOM   3234 C  C   . ALA A 1 431 ? 17.682  -6.419  33.506  1.00 11.14 ? 431  ALA A C   1 
ATOM   3235 O  O   . ALA A 1 431 ? 18.678  -6.971  33.019  1.00 10.42 ? 431  ALA A O   1 
ATOM   3236 C  CB  . ALA A 1 431 ? 17.689  -4.180  32.420  1.00 8.05  ? 431  ALA A CB  1 
ATOM   3237 N  N   . SER A 1 432 ? 16.620  -7.096  33.985  1.00 12.94 ? 432  SER A N   1 
ATOM   3238 C  CA  . SER A 1 432 ? 16.556  -8.574  33.897  1.00 9.73  ? 432  SER A CA  1 
ATOM   3239 C  C   . SER A 1 432 ? 17.834  -9.184  34.346  1.00 17.26 ? 432  SER A C   1 
ATOM   3240 O  O   . SER A 1 432 ? 18.247  -8.970  35.489  1.00 12.25 ? 432  SER A O   1 
ATOM   3241 C  CB  . SER A 1 432 ? 16.170  -8.717  32.378  1.00 14.85 ? 432  SER A CB  1 
ATOM   3242 O  OG  . SER A 1 432 ? 15.772  -10.067 32.287  1.00 17.64 ? 432  SER A OG  1 
ATOM   3243 N  N   . ASN A 1 433 ? 18.508  -9.987  33.544  1.00 12.08 ? 433  ASN A N   1 
ATOM   3244 C  CA  . ASN A 1 433 ? 19.786  -10.615 33.799  1.00 14.26 ? 433  ASN A CA  1 
ATOM   3245 C  C   . ASN A 1 433 ? 20.859  -10.005 32.851  1.00 13.10 ? 433  ASN A C   1 
ATOM   3246 O  O   . ASN A 1 433 ? 21.880  -10.708 32.678  1.00 13.40 ? 433  ASN A O   1 
ATOM   3247 C  CB  . ASN A 1 433 ? 19.690  -12.135 33.778  1.00 5.79  ? 433  ASN A CB  1 
ATOM   3248 C  CG  . ASN A 1 433 ? 20.918  -12.880 34.160  1.00 8.72  ? 433  ASN A CG  1 
ATOM   3249 O  OD1 . ASN A 1 433 ? 21.468  -12.606 35.269  1.00 15.37 ? 433  ASN A OD1 1 
ATOM   3250 N  ND2 . ASN A 1 433 ? 21.495  -13.797 33.385  1.00 8.43  ? 433  ASN A ND2 1 
ATOM   3251 N  N   . GLY A 1 434 ? 20.589  -8.802  32.324  1.00 9.55  ? 434  GLY A N   1 
ATOM   3252 C  CA  . GLY A 1 434 ? 21.644  -8.177  31.451  1.00 9.19  ? 434  GLY A CA  1 
ATOM   3253 C  C   . GLY A 1 434 ? 21.550  -8.633  30.025  1.00 11.33 ? 434  GLY A C   1 
ATOM   3254 O  O   . GLY A 1 434 ? 20.709  -9.486  29.786  1.00 10.52 ? 434  GLY A O   1 
ATOM   3255 N  N   . LEU A 1 435 ? 22.388  -8.233  29.093  1.00 5.32  ? 435  LEU A N   1 
ATOM   3256 C  CA  . LEU A 1 435 ? 22.281  -8.629  27.701  1.00 6.61  ? 435  LEU A CA  1 
ATOM   3257 C  C   . LEU A 1 435 ? 22.684  -10.129 27.565  1.00 5.16  ? 435  LEU A C   1 
ATOM   3258 O  O   . LEU A 1 435 ? 23.370  -10.580 28.414  1.00 12.55 ? 435  LEU A O   1 
ATOM   3259 C  CB  . LEU A 1 435 ? 23.232  -7.804  26.858  1.00 5.00  ? 435  LEU A CB  1 
ATOM   3260 C  CG  . LEU A 1 435 ? 23.084  -6.299  26.877  1.00 8.24  ? 435  LEU A CG  1 
ATOM   3261 C  CD1 . LEU A 1 435 ? 24.314  -5.697  26.093  1.00 6.92  ? 435  LEU A CD1 1 
ATOM   3262 C  CD2 . LEU A 1 435 ? 21.724  -6.054  26.273  1.00 5.00  ? 435  LEU A CD2 1 
ATOM   3263 N  N   . TYR A 1 436 ? 22.213  -10.678 26.503  1.00 7.08  ? 436  TYR A N   1 
ATOM   3264 C  CA  . TYR A 1 436 ? 22.570  -12.059 26.169  1.00 5.18  ? 436  TYR A CA  1 
ATOM   3265 C  C   . TYR A 1 436 ? 24.024  -11.957 25.714  1.00 9.81  ? 436  TYR A C   1 
ATOM   3266 O  O   . TYR A 1 436 ? 24.783  -12.887 25.988  1.00 14.04 ? 436  TYR A O   1 
ATOM   3267 C  CB  . TYR A 1 436 ? 21.731  -12.593 24.990  1.00 7.28  ? 436  TYR A CB  1 
ATOM   3268 C  CG  . TYR A 1 436 ? 20.466  -13.327 25.396  1.00 7.36  ? 436  TYR A CG  1 
ATOM   3269 C  CD1 . TYR A 1 436 ? 20.541  -14.680 25.675  1.00 10.53 ? 436  TYR A CD1 1 
ATOM   3270 C  CD2 . TYR A 1 436 ? 19.272  -12.621 25.523  1.00 5.45  ? 436  TYR A CD2 1 
ATOM   3271 C  CE1 . TYR A 1 436 ? 19.346  -15.439 26.084  1.00 6.44  ? 436  TYR A CE1 1 
ATOM   3272 C  CE2 . TYR A 1 436 ? 18.101  -13.330 25.924  1.00 5.00  ? 436  TYR A CE2 1 
ATOM   3273 C  CZ  . TYR A 1 436 ? 18.214  -14.699 26.195  1.00 5.00  ? 436  TYR A CZ  1 
ATOM   3274 O  OH  . TYR A 1 436 ? 17.019  -15.274 26.535  1.00 11.15 ? 436  TYR A OH  1 
ATOM   3275 N  N   . PHE A 1 437 ? 24.412  -10.917 25.039  1.00 9.41  ? 437  PHE A N   1 
ATOM   3276 C  CA  . PHE A 1 437 ? 25.776  -10.746 24.525  1.00 9.52  ? 437  PHE A CA  1 
ATOM   3277 C  C   . PHE A 1 437 ? 26.427  -9.447  24.958  1.00 8.46  ? 437  PHE A C   1 
ATOM   3278 O  O   . PHE A 1 437 ? 25.863  -8.382  24.713  1.00 13.82 ? 437  PHE A O   1 
ATOM   3279 C  CB  . PHE A 1 437 ? 25.644  -10.769 22.987  1.00 8.55  ? 437  PHE A CB  1 
ATOM   3280 C  CG  . PHE A 1 437 ? 25.066  -12.039 22.389  1.00 18.99 ? 437  PHE A CG  1 
ATOM   3281 C  CD1 . PHE A 1 437 ? 25.844  -13.178 22.203  1.00 31.42 ? 437  PHE A CD1 1 
ATOM   3282 C  CD2 . PHE A 1 437 ? 23.726  -12.103 21.989  1.00 23.09 ? 437  PHE A CD2 1 
ATOM   3283 C  CE1 . PHE A 1 437 ? 25.303  -14.365 21.667  1.00 27.44 ? 437  PHE A CE1 1 
ATOM   3284 C  CE2 . PHE A 1 437 ? 23.160  -13.297 21.458  1.00 21.82 ? 437  PHE A CE2 1 
ATOM   3285 C  CZ  . PHE A 1 437 ? 23.971  -14.445 21.293  1.00 14.45 ? 437  PHE A CZ  1 
ATOM   3286 N  N   . ALA A 1 438 ? 27.600  -9.488  25.466  1.00 11.62 ? 438  ALA A N   1 
ATOM   3287 C  CA  . ALA A 1 438 ? 28.386  -8.308  25.792  1.00 7.79  ? 438  ALA A CA  1 
ATOM   3288 C  C   . ALA A 1 438 ? 28.638  -7.669  24.424  1.00 5.06  ? 438  ALA A C   1 
ATOM   3289 O  O   . ALA A 1 438 ? 28.988  -8.218  23.390  1.00 7.53  ? 438  ALA A O   1 
ATOM   3290 C  CB  . ALA A 1 438 ? 29.673  -8.675  26.433  1.00 6.45  ? 438  ALA A CB  1 
ATOM   3291 N  N   . ARG A 1 439 ? 28.498  -6.363  24.403  1.00 6.52  ? 439  ARG A N   1 
ATOM   3292 C  CA  . ARG A 1 439 ? 28.754  -5.613  23.192  1.00 13.33 ? 439  ARG A CA  1 
ATOM   3293 C  C   . ARG A 1 439 ? 29.095  -4.138  23.512  1.00 14.00 ? 439  ARG A C   1 
ATOM   3294 O  O   . ARG A 1 439 ? 28.632  -3.523  24.463  1.00 10.33 ? 439  ARG A O   1 
ATOM   3295 C  CB  . ARG A 1 439 ? 27.525  -5.586  22.197  1.00 15.85 ? 439  ARG A CB  1 
ATOM   3296 C  CG  . ARG A 1 439 ? 26.143  -5.639  22.807  1.00 19.67 ? 439  ARG A CG  1 
ATOM   3297 C  CD  . ARG A 1 439 ? 24.982  -5.772  21.879  1.00 13.56 ? 439  ARG A CD  1 
ATOM   3298 N  NE  . ARG A 1 439 ? 24.265  -7.082  21.856  1.00 11.83 ? 439  ARG A NE  1 
ATOM   3299 C  CZ  . ARG A 1 439 ? 23.716  -7.626  20.812  1.00 5.00  ? 439  ARG A CZ  1 
ATOM   3300 N  NH1 . ARG A 1 439 ? 23.929  -7.101  19.596  1.00 5.00  ? 439  ARG A NH1 1 
ATOM   3301 N  NH2 . ARG A 1 439 ? 22.774  -8.590  20.975  1.00 6.19  ? 439  ARG A NH2 1 
ATOM   3302 N  N   . THR A 1 440 ? 29.897  -3.623  22.604  1.00 7.81  ? 440  THR A N   1 
ATOM   3303 C  CA  . THR A 1 440 ? 30.274  -2.182  22.541  1.00 8.83  ? 440  THR A CA  1 
ATOM   3304 C  C   . THR A 1 440 ? 30.197  -1.750  21.076  1.00 14.04 ? 440  THR A C   1 
ATOM   3305 O  O   . THR A 1 440 ? 30.367  -2.584  20.157  1.00 7.31  ? 440  THR A O   1 
ATOM   3306 C  CB  . THR A 1 440 ? 31.613  -1.846  23.253  1.00 9.18  ? 440  THR A CB  1 
ATOM   3307 O  OG1 . THR A 1 440 ? 31.624  -0.397  23.309  1.00 6.82  ? 440  THR A OG1 1 
ATOM   3308 C  CG2 . THR A 1 440 ? 32.854  -2.378  22.477  1.00 8.33  ? 440  THR A CG2 1 
ATOM   3309 N  N   . PHE A 1 441 ? 29.903  -0.455  20.752  1.00 5.50  ? 441  PHE A N   1 
ATOM   3310 C  CA  . PHE A 1 441 ? 29.745  0.065   19.414  1.00 5.11  ? 441  PHE A CA  1 
ATOM   3311 C  C   . PHE A 1 441 ? 28.409  -0.414  18.806  1.00 12.10 ? 441  PHE A C   1 
ATOM   3312 O  O   . PHE A 1 441 ? 28.138  -0.205  17.604  1.00 13.78 ? 441  PHE A O   1 
ATOM   3313 C  CB  . PHE A 1 441 ? 30.896  -0.268  18.454  1.00 5.00  ? 441  PHE A CB  1 
ATOM   3314 C  CG  . PHE A 1 441 ? 32.203  0.223   19.016  1.00 5.02  ? 441  PHE A CG  1 
ATOM   3315 C  CD1 . PHE A 1 441 ? 32.334  1.389   19.710  1.00 9.12  ? 441  PHE A CD1 1 
ATOM   3316 C  CD2 . PHE A 1 441 ? 33.368  -0.558  18.747  1.00 11.73 ? 441  PHE A CD2 1 
ATOM   3317 C  CE1 . PHE A 1 441 ? 33.566  1.862   20.228  1.00 8.34  ? 441  PHE A CE1 1 
ATOM   3318 C  CE2 . PHE A 1 441 ? 34.637  -0.116  19.220  1.00 10.62 ? 441  PHE A CE2 1 
ATOM   3319 C  CZ  . PHE A 1 441 ? 34.706  1.067   19.934  1.00 6.70  ? 441  PHE A CZ  1 
ATOM   3320 N  N   . HIS A 1 442 ? 27.579  -1.086  19.584  1.00 7.32  ? 442  HIS A N   1 
ATOM   3321 C  CA  . HIS A 1 442 ? 26.239  -1.511  19.166  1.00 9.26  ? 442  HIS A CA  1 
ATOM   3322 C  C   . HIS A 1 442 ? 25.349  -0.251  19.076  1.00 7.54  ? 442  HIS A C   1 
ATOM   3323 O  O   . HIS A 1 442 ? 25.712  0.842   19.532  1.00 7.16  ? 442  HIS A O   1 
ATOM   3324 C  CB  . HIS A 1 442 ? 25.594  -2.478  20.192  1.00 10.11 ? 442  HIS A CB  1 
ATOM   3325 C  CG  . HIS A 1 442 ? 25.573  -1.948  21.605  1.00 9.58  ? 442  HIS A CG  1 
ATOM   3326 N  ND1 . HIS A 1 442 ? 26.720  -1.642  22.276  1.00 7.23  ? 442  HIS A ND1 1 
ATOM   3327 C  CD2 . HIS A 1 442 ? 24.560  -1.767  22.466  1.00 8.02  ? 442  HIS A CD2 1 
ATOM   3328 C  CE1 . HIS A 1 442 ? 26.404  -1.253  23.473  1.00 9.28  ? 442  HIS A CE1 1 
ATOM   3329 N  NE2 . HIS A 1 442 ? 25.100  -1.335  23.663  1.00 6.61  ? 442  HIS A NE2 1 
ATOM   3330 N  N   . THR A 1 443 ? 24.150  -0.362  18.517  1.00 5.09  ? 443  THR A N   1 
ATOM   3331 C  CA  . THR A 1 443 ? 23.176  0.726   18.330  1.00 5.00  ? 443  THR A CA  1 
ATOM   3332 C  C   . THR A 1 443 ? 21.801  0.115   18.710  1.00 6.42  ? 443  THR A C   1 
ATOM   3333 O  O   . THR A 1 443 ? 21.627  -1.098  18.829  1.00 8.57  ? 443  THR A O   1 
ATOM   3334 C  CB  . THR A 1 443 ? 23.269  1.296   16.899  1.00 5.00  ? 443  THR A CB  1 
ATOM   3335 O  OG1 . THR A 1 443 ? 22.949  0.224   16.040  1.00 7.37  ? 443  THR A OG1 1 
ATOM   3336 C  CG2 . THR A 1 443 ? 24.663  1.952   16.600  1.00 5.00  ? 443  THR A CG2 1 
ATOM   3337 N  N   . SER A 1 444 ? 20.888  1.087   18.921  1.00 6.16  ? 444  SER A N   1 
ATOM   3338 C  CA  . SER A 1 444 ? 19.605  0.695   19.394  1.00 5.76  ? 444  SER A CA  1 
ATOM   3339 C  C   . SER A 1 444 ? 18.581  1.778   19.092  1.00 10.58 ? 444  SER A C   1 
ATOM   3340 O  O   . SER A 1 444 ? 18.917  2.971   18.986  1.00 7.71  ? 444  SER A O   1 
ATOM   3341 C  CB  . SER A 1 444 ? 19.734  0.517   20.940  1.00 5.00  ? 444  SER A CB  1 
ATOM   3342 O  OG  . SER A 1 444 ? 20.274  1.660   21.570  1.00 5.00  ? 444  SER A OG  1 
ATOM   3343 N  N   . VAL A 1 445 ? 17.334  1.257   19.162  1.00 9.00  ? 445  VAL A N   1 
ATOM   3344 C  CA  . VAL A 1 445 ? 16.208  2.203   18.970  1.00 6.39  ? 445  VAL A CA  1 
ATOM   3345 C  C   . VAL A 1 445 ? 15.038  1.714   19.823  1.00 6.73  ? 445  VAL A C   1 
ATOM   3346 O  O   . VAL A 1 445 ? 14.893  0.492   20.042  1.00 8.87  ? 445  VAL A O   1 
ATOM   3347 C  CB  . VAL A 1 445 ? 15.704  2.287   17.498  1.00 13.50 ? 445  VAL A CB  1 
ATOM   3348 C  CG1 . VAL A 1 445 ? 16.702  2.633   16.416  1.00 15.32 ? 445  VAL A CG1 1 
ATOM   3349 C  CG2 . VAL A 1 445 ? 15.102  0.993   16.951  1.00 10.83 ? 445  VAL A CG2 1 
ATOM   3350 N  N   . VAL A 1 446 ? 14.217  2.692   20.195  1.00 7.79  ? 446  VAL A N   1 
ATOM   3351 C  CA  . VAL A 1 446 ? 12.979  2.331   20.919  1.00 12.08 ? 446  VAL A CA  1 
ATOM   3352 C  C   . VAL A 1 446 ? 11.921  2.159   19.801  1.00 9.96  ? 446  VAL A C   1 
ATOM   3353 O  O   . VAL A 1 446 ? 11.843  2.973   18.892  1.00 7.79  ? 446  VAL A O   1 
ATOM   3354 C  CB  . VAL A 1 446 ? 12.571  3.340   21.995  1.00 8.07  ? 446  VAL A CB  1 
ATOM   3355 C  CG1 . VAL A 1 446 ? 12.457  4.715   21.367  1.00 9.84  ? 446  VAL A CG1 1 
ATOM   3356 C  CG2 . VAL A 1 446 ? 11.181  2.879   22.556  1.00 10.12 ? 446  VAL A CG2 1 
ATOM   3357 N  N   . LEU A 1 447 ? 11.166  1.075   19.845  1.00 6.39  ? 447  LEU A N   1 
ATOM   3358 C  CA  . LEU A 1 447 ? 10.133  0.688   18.938  1.00 5.02  ? 447  LEU A CA  1 
ATOM   3359 C  C   . LEU A 1 447 ? 8.774   1.194   19.505  1.00 6.56  ? 447  LEU A C   1 
ATOM   3360 O  O   . LEU A 1 447 ? 8.719   1.478   20.709  1.00 7.74  ? 447  LEU A O   1 
ATOM   3361 C  CB  . LEU A 1 447 ? 10.189  -0.873  18.797  1.00 5.00  ? 447  LEU A CB  1 
ATOM   3362 C  CG  . LEU A 1 447 ? 11.547  -1.428  18.362  1.00 5.00  ? 447  LEU A CG  1 
ATOM   3363 C  CD1 . LEU A 1 447 ? 11.326  -2.921  18.057  1.00 5.00  ? 447  LEU A CD1 1 
ATOM   3364 C  CD2 . LEU A 1 447 ? 11.706  -0.963  16.949  1.00 5.00  ? 447  LEU A CD2 1 
ATOM   3365 N  N   . PRO A 1 448 ? 7.798   1.242   18.615  1.00 16.92 ? 448  PRO A N   1 
ATOM   3366 C  CA  . PRO A 1 448 ? 6.433   1.731   18.840  1.00 13.01 ? 448  PRO A CA  1 
ATOM   3367 C  C   . PRO A 1 448 ? 5.808   1.147   20.092  1.00 18.08 ? 448  PRO A C   1 
ATOM   3368 O  O   . PRO A 1 448 ? 5.144   1.865   20.848  1.00 16.58 ? 448  PRO A O   1 
ATOM   3369 C  CB  . PRO A 1 448 ? 5.660   1.360   17.568  1.00 13.76 ? 448  PRO A CB  1 
ATOM   3370 C  CG  . PRO A 1 448 ? 6.701   1.381   16.466  1.00 16.63 ? 448  PRO A CG  1 
ATOM   3371 C  CD  . PRO A 1 448 ? 7.971   0.902   17.158  1.00 21.59 ? 448  PRO A CD  1 
ATOM   3372 N  N   . ASP A 1 449 ? 6.023   -0.121  20.331  1.00 14.12 ? 449  ASP A N   1 
ATOM   3373 C  CA  . ASP A 1 449 ? 5.521   -0.818  21.525  1.00 22.36 ? 449  ASP A CA  1 
ATOM   3374 C  C   . ASP A 1 449 ? 6.301   -0.676  22.840  1.00 17.06 ? 449  ASP A C   1 
ATOM   3375 O  O   . ASP A 1 449 ? 5.952   -1.341  23.839  1.00 15.42 ? 449  ASP A O   1 
ATOM   3376 C  CB  . ASP A 1 449 ? 5.365   -2.319  21.171  1.00 24.13 ? 449  ASP A CB  1 
ATOM   3377 C  CG  . ASP A 1 449 ? 6.649   -3.053  20.923  1.00 26.67 ? 449  ASP A CG  1 
ATOM   3378 O  OD1 . ASP A 1 449 ? 7.781   -2.534  20.995  1.00 21.44 ? 449  ASP A OD1 1 
ATOM   3379 O  OD2 . ASP A 1 449 ? 6.609   -4.207  20.523  1.00 27.95 ? 449  ASP A OD2 1 
ATOM   3380 N  N   . GLY A 1 450 ? 7.314   0.202   22.899  1.00 12.78 ? 450  GLY A N   1 
ATOM   3381 C  CA  . GLY A 1 450 ? 8.082   0.368   24.099  1.00 9.82  ? 450  GLY A CA  1 
ATOM   3382 C  C   . GLY A 1 450 ? 9.259   -0.607  24.287  1.00 5.51  ? 450  GLY A C   1 
ATOM   3383 O  O   . GLY A 1 450 ? 10.008  -0.372  25.245  1.00 11.28 ? 450  GLY A O   1 
ATOM   3384 N  N   . SER A 1 451 ? 9.317   -1.555  23.368  1.00 8.61  ? 451  SER A N   1 
ATOM   3385 C  CA  . SER A 1 451 ? 10.512  -2.486  23.442  1.00 5.65  ? 451  SER A CA  1 
ATOM   3386 C  C   . SER A 1 451 ? 11.692  -1.722  22.803  1.00 13.75 ? 451  SER A C   1 
ATOM   3387 O  O   . SER A 1 451 ? 11.590  -0.768  22.044  1.00 8.98  ? 451  SER A O   1 
ATOM   3388 C  CB  . SER A 1 451 ? 10.274  -3.768  22.706  1.00 7.59  ? 451  SER A CB  1 
ATOM   3389 O  OG  . SER A 1 451 ? 10.087  -3.650  21.322  1.00 13.78 ? 451  SER A OG  1 
ATOM   3390 N  N   . THR A 1 452 ? 12.877  -2.160  23.209  1.00 14.62 ? 452  THR A N   1 
ATOM   3391 C  CA  . THR A 1 452 ? 14.158  -1.591  22.733  1.00 11.50 ? 452  THR A CA  1 
ATOM   3392 C  C   . THR A 1 452 ? 14.859  -2.653  21.859  1.00 7.21  ? 452  THR A C   1 
ATOM   3393 O  O   . THR A 1 452 ? 15.112  -3.709  22.369  1.00 8.65  ? 452  THR A O   1 
ATOM   3394 C  CB  . THR A 1 452 ? 15.013  -1.025  23.897  1.00 8.28  ? 452  THR A CB  1 
ATOM   3395 O  OG1 . THR A 1 452 ? 14.326  0.115   24.528  1.00 11.41 ? 452  THR A OG1 1 
ATOM   3396 C  CG2 . THR A 1 452 ? 16.395  -0.402  23.460  1.00 10.50 ? 452  THR A CG2 1 
ATOM   3397 N  N   . PHE A 1 453 ? 15.167  -2.281  20.603  1.00 6.90  ? 453  PHE A N   1 
ATOM   3398 C  CA  . PHE A 1 453 ? 15.913  -3.145  19.691  1.00 5.72  ? 453  PHE A CA  1 
ATOM   3399 C  C   . PHE A 1 453 ? 17.400  -2.806  19.786  1.00 10.40 ? 453  PHE A C   1 
ATOM   3400 O  O   . PHE A 1 453 ? 17.787  -1.621  19.644  1.00 5.27  ? 453  PHE A O   1 
ATOM   3401 C  CB  . PHE A 1 453 ? 15.363  -2.994  18.277  1.00 5.03  ? 453  PHE A CB  1 
ATOM   3402 C  CG  . PHE A 1 453 ? 16.123  -3.746  17.240  1.00 7.45  ? 453  PHE A CG  1 
ATOM   3403 C  CD1 . PHE A 1 453 ? 16.067  -5.112  17.169  1.00 7.15  ? 453  PHE A CD1 1 
ATOM   3404 C  CD2 . PHE A 1 453 ? 16.981  -3.017  16.372  1.00 11.73 ? 453  PHE A CD2 1 
ATOM   3405 C  CE1 . PHE A 1 453 ? 16.744  -5.863  16.175  1.00 10.72 ? 453  PHE A CE1 1 
ATOM   3406 C  CE2 . PHE A 1 453 ? 17.688  -3.725  15.381  1.00 9.30  ? 453  PHE A CE2 1 
ATOM   3407 C  CZ  . PHE A 1 453 ? 17.502  -5.116  15.285  1.00 5.00  ? 453  PHE A CZ  1 
ATOM   3408 N  N   . ILE A 1 454 ? 18.278  -3.809  20.018  1.00 9.53  ? 454  ILE A N   1 
ATOM   3409 C  CA  . ILE A 1 454 ? 19.696  -3.607  20.186  1.00 6.65  ? 454  ILE A CA  1 
ATOM   3410 C  C   . ILE A 1 454 ? 20.432  -4.467  19.155  1.00 9.95  ? 454  ILE A C   1 
ATOM   3411 O  O   . ILE A 1 454 ? 20.172  -5.690  19.142  1.00 8.65  ? 454  ILE A O   1 
ATOM   3412 C  CB  . ILE A 1 454 ? 20.079  -4.173  21.621  1.00 6.25  ? 454  ILE A CB  1 
ATOM   3413 C  CG1 . ILE A 1 454 ? 19.046  -3.522  22.567  1.00 5.00  ? 454  ILE A CG1 1 
ATOM   3414 C  CG2 . ILE A 1 454 ? 21.559  -3.966  22.103  1.00 5.70  ? 454  ILE A CG2 1 
ATOM   3415 C  CD1 . ILE A 1 454 ? 19.125  -4.061  24.020  1.00 8.36  ? 454  ILE A CD1 1 
ATOM   3416 N  N   . THR A 1 455 ? 21.339  -3.822  18.464  1.00 5.00  ? 455  THR A N   1 
ATOM   3417 C  CA  . THR A 1 455 ? 22.029  -4.684  17.447  1.00 9.75  ? 455  THR A CA  1 
ATOM   3418 C  C   . THR A 1 455 ? 23.470  -4.315  17.168  1.00 11.12 ? 455  THR A C   1 
ATOM   3419 O  O   . THR A 1 455 ? 23.902  -3.167  17.439  1.00 12.56 ? 455  THR A O   1 
ATOM   3420 C  CB  . THR A 1 455 ? 21.090  -4.438  16.150  1.00 5.40  ? 455  THR A CB  1 
ATOM   3421 O  OG1 . THR A 1 455 ? 21.378  -5.532  15.218  1.00 9.02  ? 455  THR A OG1 1 
ATOM   3422 C  CG2 . THR A 1 455 ? 21.182  -3.103  15.455  1.00 7.01  ? 455  THR A CG2 1 
ATOM   3423 N  N   . GLY A 1 456 ? 24.223  -5.265  16.653  1.00 10.53 ? 456  GLY A N   1 
ATOM   3424 C  CA  . GLY A 1 456 ? 25.652  -4.996  16.240  1.00 15.47 ? 456  GLY A CA  1 
ATOM   3425 C  C   . GLY A 1 456 ? 26.565  -4.920  17.438  1.00 13.10 ? 456  GLY A C   1 
ATOM   3426 O  O   . GLY A 1 456 ? 26.158  -5.492  18.464  1.00 11.38 ? 456  GLY A O   1 
ATOM   3427 N  N   . GLY A 1 457 ? 27.769  -4.349  17.248  1.00 9.75  ? 457  GLY A N   1 
ATOM   3428 C  CA  . GLY A 1 457 ? 28.756  -4.297  18.328  1.00 10.92 ? 457  GLY A CA  1 
ATOM   3429 C  C   . GLY A 1 457 ? 29.629  -5.610  18.161  1.00 5.06  ? 457  GLY A C   1 
ATOM   3430 O  O   . GLY A 1 457 ? 29.452  -6.389  17.266  1.00 6.98  ? 457  GLY A O   1 
ATOM   3431 N  N   . GLN A 1 458 ? 30.582  -5.600  19.016  1.00 11.43 ? 458  GLN A N   1 
ATOM   3432 C  CA  . GLN A 1 458 ? 31.669  -6.584  19.243  1.00 14.51 ? 458  GLN A CA  1 
ATOM   3433 C  C   . GLN A 1 458 ? 31.897  -6.649  20.747  1.00 8.77  ? 458  GLN A C   1 
ATOM   3434 O  O   . GLN A 1 458 ? 31.584  -5.821  21.610  1.00 5.00  ? 458  GLN A O   1 
ATOM   3435 C  CB  . GLN A 1 458 ? 32.912  -6.214  18.363  1.00 6.31  ? 458  GLN A CB  1 
ATOM   3436 C  CG  . GLN A 1 458 ? 33.551  -4.915  18.839  1.00 5.00  ? 458  GLN A CG  1 
ATOM   3437 C  CD  . GLN A 1 458 ? 34.591  -4.474  17.831  1.00 11.82 ? 458  GLN A CD  1 
ATOM   3438 O  OE1 . GLN A 1 458 ? 34.923  -3.297  17.929  1.00 13.48 ? 458  GLN A OE1 1 
ATOM   3439 N  NE2 . GLN A 1 458 ? 35.037  -5.343  16.923  1.00 9.61  ? 458  GLN A NE2 1 
ATOM   3440 N  N   . ARG A 1 459 ? 32.482  -7.822  21.080  1.00 5.16  ? 459  ARG A N   1 
ATOM   3441 C  CA  . ARG A 1 459 ? 32.753  -8.003  22.483  1.00 5.00  ? 459  ARG A CA  1 
ATOM   3442 C  C   . ARG A 1 459 ? 33.978  -7.321  22.929  1.00 8.04  ? 459  ARG A C   1 
ATOM   3443 O  O   . ARG A 1 459 ? 34.017  -7.204  24.165  1.00 17.64 ? 459  ARG A O   1 
ATOM   3444 C  CB  . ARG A 1 459 ? 32.949  -9.544  22.588  1.00 9.60  ? 459  ARG A CB  1 
ATOM   3445 C  CG  . ARG A 1 459 ? 32.976  -9.945  24.049  1.00 43.18 ? 459  ARG A CG  1 
ATOM   3446 C  CD  . ARG A 1 459 ? 33.214  -11.375 24.307  1.00 71.62 ? 459  ARG A CD  1 
ATOM   3447 N  NE  . ARG A 1 459 ? 34.611  -11.719 24.483  1.00 93.92 ? 459  ARG A NE  1 
ATOM   3448 C  CZ  . ARG A 1 459 ? 35.485  -11.259 25.402  1.00 99.99 ? 459  ARG A CZ  1 
ATOM   3449 N  NH1 . ARG A 1 459 ? 35.262  -10.377 26.370  1.00 94.28 ? 459  ARG A NH1 1 
ATOM   3450 N  NH2 . ARG A 1 459 ? 36.729  -11.765 25.318  1.00 99.99 ? 459  ARG A NH2 1 
ATOM   3451 N  N   . ARG A 1 460 ? 34.893  -6.959  22.074  1.00 9.75  ? 460  ARG A N   1 
ATOM   3452 C  CA  . ARG A 1 460 ? 36.133  -6.250  22.590  1.00 7.42  ? 460  ARG A CA  1 
ATOM   3453 C  C   . ARG A 1 460 ? 36.238  -5.137  21.591  1.00 5.64  ? 460  ARG A C   1 
ATOM   3454 O  O   . ARG A 1 460 ? 36.200  -5.356  20.329  1.00 10.84 ? 460  ARG A O   1 
ATOM   3455 C  CB  . ARG A 1 460 ? 37.231  -7.339  22.655  1.00 9.40  ? 460  ARG A CB  1 
ATOM   3456 C  CG  . ARG A 1 460 ? 38.465  -6.459  22.865  1.00 17.25 ? 460  ARG A CG  1 
ATOM   3457 C  CD  . ARG A 1 460 ? 39.395  -7.283  23.683  1.00 31.58 ? 460  ARG A CD  1 
ATOM   3458 N  NE  . ARG A 1 460 ? 40.656  -6.540  23.620  1.00 45.51 ? 460  ARG A NE  1 
ATOM   3459 C  CZ  . ARG A 1 460 ? 41.395  -6.505  24.749  1.00 57.78 ? 460  ARG A CZ  1 
ATOM   3460 N  NH1 . ARG A 1 460 ? 40.868  -7.113  25.825  1.00 49.34 ? 460  ARG A NH1 1 
ATOM   3461 N  NH2 . ARG A 1 460 ? 42.546  -5.846  24.580  1.00 43.33 ? 460  ARG A NH2 1 
ATOM   3462 N  N   . GLY A 1 461 ? 36.306  -3.926  22.091  1.00 8.90  ? 461  GLY A N   1 
ATOM   3463 C  CA  . GLY A 1 461 ? 36.254  -2.721  21.191  1.00 6.28  ? 461  GLY A CA  1 
ATOM   3464 C  C   . GLY A 1 461 ? 37.615  -2.466  20.564  1.00 10.65 ? 461  GLY A C   1 
ATOM   3465 O  O   . GLY A 1 461 ? 38.660  -2.143  21.160  1.00 14.86 ? 461  GLY A O   1 
ATOM   3466 N  N   . ILE A 1 462 ? 37.556  -2.693  19.265  1.00 12.52 ? 462  ILE A N   1 
ATOM   3467 C  CA  . ILE A 1 462 ? 38.720  -2.519  18.384  1.00 12.79 ? 462  ILE A CA  1 
ATOM   3468 C  C   . ILE A 1 462 ? 38.203  -1.805  17.124  1.00 18.38 ? 462  ILE A C   1 
ATOM   3469 O  O   . ILE A 1 462 ? 37.867  -2.411  16.113  1.00 13.64 ? 462  ILE A O   1 
ATOM   3470 C  CB  . ILE A 1 462 ? 39.445  -3.906  18.065  1.00 5.97  ? 462  ILE A CB  1 
ATOM   3471 C  CG1 . ILE A 1 462 ? 39.859  -4.464  19.422  1.00 6.32  ? 462  ILE A CG1 1 
ATOM   3472 C  CG2 . ILE A 1 462 ? 40.645  -3.454  17.133  1.00 12.00 ? 462  ILE A CG2 1 
ATOM   3473 C  CD1 . ILE A 1 462 ? 40.447  -5.909  19.211  1.00 23.40 ? 462  ILE A CD1 1 
ATOM   3474 N  N   . PRO A 1 463 ? 38.170  -0.465  17.190  1.00 12.43 ? 463  PRO A N   1 
ATOM   3475 C  CA  . PRO A 1 463 ? 37.728  0.335   16.066  1.00 12.87 ? 463  PRO A CA  1 
ATOM   3476 C  C   . PRO A 1 463 ? 38.312  -0.128  14.757  1.00 13.45 ? 463  PRO A C   1 
ATOM   3477 O  O   . PRO A 1 463 ? 39.520  -0.400  14.788  1.00 12.43 ? 463  PRO A O   1 
ATOM   3478 C  CB  . PRO A 1 463 ? 38.290  1.743   16.398  1.00 7.59  ? 463  PRO A CB  1 
ATOM   3479 C  CG  . PRO A 1 463 ? 38.103  1.770   17.916  1.00 8.90  ? 463  PRO A CG  1 
ATOM   3480 C  CD  . PRO A 1 463 ? 38.505  0.369   18.350  1.00 14.08 ? 463  PRO A CD  1 
ATOM   3481 N  N   . PHE A 1 464 ? 37.589  -0.184  13.679  1.00 8.76  ? 464  PHE A N   1 
ATOM   3482 C  CA  . PHE A 1 464 ? 37.971  -0.487  12.287  1.00 10.29 ? 464  PHE A CA  1 
ATOM   3483 C  C   . PHE A 1 464 ? 38.271  -1.976  12.106  1.00 18.13 ? 464  PHE A C   1 
ATOM   3484 O  O   . PHE A 1 464 ? 38.612  -2.359  11.004  1.00 14.95 ? 464  PHE A O   1 
ATOM   3485 C  CB  . PHE A 1 464 ? 39.170  0.368   11.832  1.00 7.64  ? 464  PHE A CB  1 
ATOM   3486 C  CG  . PHE A 1 464 ? 39.012  1.853   12.125  1.00 15.33 ? 464  PHE A CG  1 
ATOM   3487 C  CD1 . PHE A 1 464 ? 37.928  2.529   11.553  1.00 20.12 ? 464  PHE A CD1 1 
ATOM   3488 C  CD2 . PHE A 1 464 ? 39.908  2.559   12.897  1.00 12.04 ? 464  PHE A CD2 1 
ATOM   3489 C  CE1 . PHE A 1 464 ? 37.745  3.907   11.765  1.00 16.07 ? 464  PHE A CE1 1 
ATOM   3490 C  CE2 . PHE A 1 464 ? 39.711  3.916   13.148  1.00 15.35 ? 464  PHE A CE2 1 
ATOM   3491 C  CZ  . PHE A 1 464 ? 38.630  4.604   12.542  1.00 10.06 ? 464  PHE A CZ  1 
ATOM   3492 N  N   . GLU A 1 465 ? 38.084  -2.728  13.194  1.00 14.80 ? 465  GLU A N   1 
ATOM   3493 C  CA  . GLU A 1 465 ? 38.339  -4.175  13.056  1.00 10.99 ? 465  GLU A CA  1 
ATOM   3494 C  C   . GLU A 1 465 ? 36.993  -4.886  13.289  1.00 14.81 ? 465  GLU A C   1 
ATOM   3495 O  O   . GLU A 1 465 ? 36.288  -4.700  14.318  1.00 16.15 ? 465  GLU A O   1 
ATOM   3496 C  CB  . GLU A 1 465 ? 39.434  -4.655  13.982  1.00 10.79 ? 465  GLU A CB  1 
ATOM   3497 C  CG  . GLU A 1 465 ? 39.831  -6.117  13.741  1.00 22.09 ? 465  GLU A CG  1 
ATOM   3498 C  CD  . GLU A 1 465 ? 40.940  -6.551  14.693  1.00 27.72 ? 465  GLU A CD  1 
ATOM   3499 O  OE1 . GLU A 1 465 ? 42.064  -6.254  14.339  1.00 32.29 ? 465  GLU A OE1 1 
ATOM   3500 O  OE2 . GLU A 1 465 ? 40.585  -7.117  15.736  1.00 25.42 ? 465  GLU A OE2 1 
ATOM   3501 N  N   . ASP A 1 466 ? 36.687  -5.734  12.301  1.00 17.56 ? 466  ASP A N   1 
ATOM   3502 C  CA  . ASP A 1 466 ? 35.430  -6.501  12.378  1.00 22.01 ? 466  ASP A CA  1 
ATOM   3503 C  C   . ASP A 1 466 ? 35.538  -7.756  13.230  1.00 22.63 ? 466  ASP A C   1 
ATOM   3504 O  O   . ASP A 1 466 ? 34.858  -8.774  12.913  1.00 20.86 ? 466  ASP A O   1 
ATOM   3505 C  CB  . ASP A 1 466 ? 34.819  -6.750  10.974  1.00 23.84 ? 466  ASP A CB  1 
ATOM   3506 C  CG  . ASP A 1 466 ? 34.296  -5.484  10.287  1.00 21.67 ? 466  ASP A CG  1 
ATOM   3507 O  OD1 . ASP A 1 466 ? 34.138  -4.377  10.862  1.00 19.27 ? 466  ASP A OD1 1 
ATOM   3508 O  OD2 . ASP A 1 466 ? 34.041  -5.593  9.063   1.00 22.86 ? 466  ASP A OD2 1 
ATOM   3509 N  N   . SER A 1 467 ? 36.236  -7.691  14.333  1.00 17.14 ? 467  SER A N   1 
ATOM   3510 C  CA  . SER A 1 467 ? 36.403  -8.880  15.197  1.00 20.33 ? 467  SER A CA  1 
ATOM   3511 C  C   . SER A 1 467 ? 35.314  -8.988  16.254  1.00 19.64 ? 467  SER A C   1 
ATOM   3512 O  O   . SER A 1 467 ? 34.576  -8.032  16.554  1.00 13.29 ? 467  SER A O   1 
ATOM   3513 C  CB  . SER A 1 467 ? 37.852  -8.849  15.700  1.00 16.73 ? 467  SER A CB  1 
ATOM   3514 O  OG  . SER A 1 467 ? 37.995  -7.548  16.255  1.00 17.37 ? 467  SER A OG  1 
ATOM   3515 N  N   . THR A 1 468 ? 35.253  -10.143 16.853  1.00 17.38 ? 468  THR A N   1 
ATOM   3516 C  CA  . THR A 1 468 ? 34.286  -10.570 17.893  1.00 29.42 ? 468  THR A CA  1 
ATOM   3517 C  C   . THR A 1 468 ? 32.903  -9.966  17.613  1.00 22.73 ? 468  THR A C   1 
ATOM   3518 O  O   . THR A 1 468 ? 32.259  -9.426  18.526  1.00 15.82 ? 468  THR A O   1 
ATOM   3519 C  CB  . THR A 1 468 ? 34.798  -10.258 19.354  1.00 21.23 ? 468  THR A CB  1 
ATOM   3520 O  OG1 . THR A 1 468 ? 34.950  -8.808  19.554  1.00 18.11 ? 468  THR A OG1 1 
ATOM   3521 C  CG2 . THR A 1 468 ? 36.175  -10.911 19.680  1.00 15.08 ? 468  THR A CG2 1 
ATOM   3522 N  N   . PRO A 1 469 ? 32.408  -10.097 16.385  1.00 20.62 ? 469  PRO A N   1 
ATOM   3523 C  CA  . PRO A 1 469 ? 31.128  -9.466  16.029  1.00 15.72 ? 469  PRO A CA  1 
ATOM   3524 C  C   . PRO A 1 469 ? 29.980  -10.176 16.707  1.00 16.92 ? 469  PRO A C   1 
ATOM   3525 O  O   . PRO A 1 469 ? 30.039  -11.387 16.942  1.00 15.87 ? 469  PRO A O   1 
ATOM   3526 C  CB  . PRO A 1 469 ? 31.076  -9.526  14.478  1.00 7.82  ? 469  PRO A CB  1 
ATOM   3527 C  CG  . PRO A 1 469 ? 31.859  -10.803 14.181  1.00 12.94 ? 469  PRO A CG  1 
ATOM   3528 C  CD  . PRO A 1 469 ? 32.988  -10.770 15.220  1.00 13.93 ? 469  PRO A CD  1 
ATOM   3529 N  N   . VAL A 1 470 ? 28.969  -9.445  17.056  1.00 10.72 ? 470  VAL A N   1 
ATOM   3530 C  CA  . VAL A 1 470 ? 27.716  -9.999  17.630  1.00 14.80 ? 470  VAL A CA  1 
ATOM   3531 C  C   . VAL A 1 470 ? 26.725  -9.845  16.477  1.00 11.93 ? 470  VAL A C   1 
ATOM   3532 O  O   . VAL A 1 470 ? 26.356  -8.733  16.098  1.00 11.06 ? 470  VAL A O   1 
ATOM   3533 C  CB  . VAL A 1 470 ? 27.246  -9.284  18.893  1.00 12.83 ? 470  VAL A CB  1 
ATOM   3534 C  CG1 . VAL A 1 470 ? 25.905  -9.889  19.342  1.00 9.01  ? 470  VAL A CG1 1 
ATOM   3535 C  CG2 . VAL A 1 470 ? 28.278  -9.357  19.995  1.00 14.20 ? 470  VAL A CG2 1 
ATOM   3536 N  N   . PHE A 1 471 ? 26.252  -10.964 15.913  1.00 13.56 ? 471  PHE A N   1 
ATOM   3537 C  CA  . PHE A 1 471 ? 25.271  -10.925 14.809  1.00 12.68 ? 471  PHE A CA  1 
ATOM   3538 C  C   . PHE A 1 471 ? 23.831  -11.142 15.325  1.00 10.43 ? 471  PHE A C   1 
ATOM   3539 O  O   . PHE A 1 471 ? 22.941  -10.955 14.473  1.00 13.09 ? 471  PHE A O   1 
ATOM   3540 C  CB  . PHE A 1 471 ? 25.531  -12.046 13.826  1.00 15.78 ? 471  PHE A CB  1 
ATOM   3541 C  CG  . PHE A 1 471 ? 26.879  -11.947 13.134  1.00 23.39 ? 471  PHE A CG  1 
ATOM   3542 C  CD1 . PHE A 1 471 ? 27.064  -11.013 12.127  1.00 16.84 ? 471  PHE A CD1 1 
ATOM   3543 C  CD2 . PHE A 1 471 ? 27.909  -12.798 13.492  1.00 17.68 ? 471  PHE A CD2 1 
ATOM   3544 C  CE1 . PHE A 1 471 ? 28.255  -10.889 11.447  1.00 17.50 ? 471  PHE A CE1 1 
ATOM   3545 C  CE2 . PHE A 1 471 ? 29.149  -12.743 12.802  1.00 16.84 ? 471  PHE A CE2 1 
ATOM   3546 C  CZ  . PHE A 1 471 ? 29.285  -11.784 11.803  1.00 18.55 ? 471  PHE A CZ  1 
ATOM   3547 N  N   . THR A 1 472 ? 23.660  -11.486 16.574  1.00 10.16 ? 472  THR A N   1 
ATOM   3548 C  CA  . THR A 1 472 ? 22.285  -11.694 17.099  1.00 11.15 ? 472  THR A CA  1 
ATOM   3549 C  C   . THR A 1 472 ? 21.838  -10.443 17.858  1.00 7.46  ? 472  THR A C   1 
ATOM   3550 O  O   . THR A 1 472 ? 22.380  -10.085 18.935  1.00 10.77 ? 472  THR A O   1 
ATOM   3551 C  CB  . THR A 1 472 ? 22.154  -12.935 18.081  1.00 10.46 ? 472  THR A CB  1 
ATOM   3552 O  OG1 . THR A 1 472 ? 22.625  -14.074 17.332  1.00 14.28 ? 472  THR A OG1 1 
ATOM   3553 C  CG2 . THR A 1 472 ? 20.671  -13.137 18.553  1.00 7.30  ? 472  THR A CG2 1 
ATOM   3554 N  N   . PRO A 1 473 ? 20.824  -9.823  17.276  1.00 7.72  ? 473  PRO A N   1 
ATOM   3555 C  CA  . PRO A 1 473 ? 20.232  -8.665  17.940  1.00 6.97  ? 473  PRO A CA  1 
ATOM   3556 C  C   . PRO A 1 473 ? 19.368  -9.204  19.087  1.00 7.72  ? 473  PRO A C   1 
ATOM   3557 O  O   . PRO A 1 473 ? 19.031  -10.415 19.221  1.00 8.33  ? 473  PRO A O   1 
ATOM   3558 C  CB  . PRO A 1 473 ? 19.377  -8.061  16.834  1.00 7.61  ? 473  PRO A CB  1 
ATOM   3559 C  CG  . PRO A 1 473 ? 19.242  -9.018  15.717  1.00 12.14 ? 473  PRO A CG  1 
ATOM   3560 C  CD  . PRO A 1 473 ? 20.135  -10.191 16.035  1.00 7.73  ? 473  PRO A CD  1 
ATOM   3561 N  N   . GLU A 1 474 ? 19.044  -8.325  20.023  1.00 8.41  ? 474  GLU A N   1 
ATOM   3562 C  CA  . GLU A 1 474 ? 18.196  -8.625  21.196  1.00 5.00  ? 474  GLU A CA  1 
ATOM   3563 C  C   . GLU A 1 474 ? 17.153  -7.477  21.312  1.00 9.61  ? 474  GLU A C   1 
ATOM   3564 O  O   . GLU A 1 474 ? 17.392  -6.310  20.909  1.00 6.71  ? 474  GLU A O   1 
ATOM   3565 C  CB  . GLU A 1 474 ? 19.006  -8.508  22.503  1.00 6.32  ? 474  GLU A CB  1 
ATOM   3566 C  CG  . GLU A 1 474 ? 20.199  -9.427  22.405  1.00 16.99 ? 474  GLU A CG  1 
ATOM   3567 C  CD  . GLU A 1 474 ? 21.072  -9.269  23.632  1.00 19.74 ? 474  GLU A CD  1 
ATOM   3568 O  OE1 . GLU A 1 474 ? 20.410  -9.319  24.695  1.00 9.61  ? 474  GLU A OE1 1 
ATOM   3569 O  OE2 . GLU A 1 474 ? 22.272  -9.218  23.428  1.00 12.22 ? 474  GLU A OE2 1 
ATOM   3570 N  N   . ILE A 1 475 ? 16.016  -7.820  21.897  1.00 11.26 ? 475  ILE A N   1 
ATOM   3571 C  CA  . ILE A 1 475 ? 14.902  -6.864  22.171  1.00 7.77  ? 475  ILE A CA  1 
ATOM   3572 C  C   . ILE A 1 475 ? 14.603  -6.908  23.680  1.00 13.63 ? 475  ILE A C   1 
ATOM   3573 O  O   . ILE A 1 475 ? 14.506  -8.037  24.234  1.00 13.49 ? 475  ILE A O   1 
ATOM   3574 C  CB  . ILE A 1 475 ? 13.610  -7.213  21.376  1.00 5.00  ? 475  ILE A CB  1 
ATOM   3575 C  CG1 . ILE A 1 475 ? 13.957  -6.763  19.957  1.00 9.84  ? 475  ILE A CG1 1 
ATOM   3576 C  CG2 . ILE A 1 475 ? 12.426  -6.363  21.853  1.00 13.28 ? 475  ILE A CG2 1 
ATOM   3577 C  CD1 . ILE A 1 475 ? 12.773  -6.985  18.947  1.00 23.29 ? 475  ILE A CD1 1 
ATOM   3578 N  N   . TYR A 1 476 ? 14.530  -5.798  24.370  1.00 5.00  ? 476  TYR A N   1 
ATOM   3579 C  CA  . TYR A 1 476 ? 14.181  -5.802  25.782  1.00 5.93  ? 476  TYR A CA  1 
ATOM   3580 C  C   . TYR A 1 476 ? 12.664  -5.482  25.855  1.00 11.43 ? 476  TYR A C   1 
ATOM   3581 O  O   . TYR A 1 476 ? 12.301  -4.451  25.241  1.00 10.00 ? 476  TYR A O   1 
ATOM   3582 C  CB  . TYR A 1 476 ? 14.766  -4.634  26.522  1.00 7.86  ? 476  TYR A CB  1 
ATOM   3583 C  CG  . TYR A 1 476 ? 14.412  -4.589  27.979  1.00 7.40  ? 476  TYR A CG  1 
ATOM   3584 C  CD1 . TYR A 1 476 ? 14.816  -5.609  28.829  1.00 5.31  ? 476  TYR A CD1 1 
ATOM   3585 C  CD2 . TYR A 1 476 ? 13.695  -3.454  28.411  1.00 5.05  ? 476  TYR A CD2 1 
ATOM   3586 C  CE1 . TYR A 1 476 ? 14.488  -5.565  30.211  1.00 5.77  ? 476  TYR A CE1 1 
ATOM   3587 C  CE2 . TYR A 1 476 ? 13.381  -3.376  29.772  1.00 12.94 ? 476  TYR A CE2 1 
ATOM   3588 C  CZ  . TYR A 1 476 ? 13.716  -4.427  30.590  1.00 8.22  ? 476  TYR A CZ  1 
ATOM   3589 O  OH  . TYR A 1 476 ? 13.405  -4.308  31.941  1.00 7.52  ? 476  TYR A OH  1 
ATOM   3590 N  N   . VAL A 1 477 ? 11.874  -6.254  26.584  1.00 12.58 ? 477  VAL A N   1 
ATOM   3591 C  CA  . VAL A 1 477 ? 10.406  -6.059  26.703  1.00 12.34 ? 477  VAL A CA  1 
ATOM   3592 C  C   . VAL A 1 477 ? 10.166  -5.598  28.147  1.00 10.53 ? 477  VAL A C   1 
ATOM   3593 O  O   . VAL A 1 477 ? 10.303  -6.430  29.039  1.00 11.12 ? 477  VAL A O   1 
ATOM   3594 C  CB  . VAL A 1 477 ? 9.637   -7.374  26.351  1.00 9.59  ? 477  VAL A CB  1 
ATOM   3595 C  CG1 . VAL A 1 477 ? 8.144   -7.030  26.577  1.00 8.20  ? 477  VAL A CG1 1 
ATOM   3596 C  CG2 . VAL A 1 477 ? 9.823   -7.655  24.860  1.00 10.18 ? 477  VAL A CG2 1 
ATOM   3597 N  N   . PRO A 1 478 ? 9.911   -4.296  28.283  1.00 7.31  ? 478  PRO A N   1 
ATOM   3598 C  CA  . PRO A 1 478 ? 9.879   -3.755  29.632  1.00 7.35  ? 478  PRO A CA  1 
ATOM   3599 C  C   . PRO A 1 478 ? 8.782   -4.362  30.462  1.00 16.24 ? 478  PRO A C   1 
ATOM   3600 O  O   . PRO A 1 478 ? 9.029   -4.559  31.621  1.00 16.24 ? 478  PRO A O   1 
ATOM   3601 C  CB  . PRO A 1 478 ? 9.683   -2.244  29.383  1.00 13.24 ? 478  PRO A CB  1 
ATOM   3602 C  CG  . PRO A 1 478 ? 9.476   -2.007  27.932  1.00 13.11 ? 478  PRO A CG  1 
ATOM   3603 C  CD  . PRO A 1 478 ? 9.764   -3.318  27.201  1.00 7.78  ? 478  PRO A CD  1 
ATOM   3604 N  N   . GLU A 1 479 ? 7.630   -4.678  29.933  1.00 14.96 ? 479  GLU A N   1 
ATOM   3605 C  CA  . GLU A 1 479 ? 6.477   -5.250  30.686  1.00 22.88 ? 479  GLU A CA  1 
ATOM   3606 C  C   . GLU A 1 479 ? 6.818   -6.564  31.351  1.00 22.68 ? 479  GLU A C   1 
ATOM   3607 O  O   . GLU A 1 479 ? 6.376   -6.938  32.466  1.00 29.42 ? 479  GLU A O   1 
ATOM   3608 C  CB  . GLU A 1 479 ? 5.294   -5.440  29.733  1.00 33.22 ? 479  GLU A CB  1 
ATOM   3609 C  CG  . GLU A 1 479 ? 4.733   -4.171  29.115  1.00 59.83 ? 479  GLU A CG  1 
ATOM   3610 C  CD  . GLU A 1 479 ? 5.559   -3.452  28.089  1.00 56.15 ? 479  GLU A CD  1 
ATOM   3611 O  OE1 . GLU A 1 479 ? 6.394   -4.010  27.426  1.00 39.28 ? 479  GLU A OE1 1 
ATOM   3612 O  OE2 . GLU A 1 479 ? 5.229   -2.246  27.976  1.00 57.82 ? 479  GLU A OE2 1 
ATOM   3613 N  N   . GLN A 1 480 ? 7.645   -7.265  30.637  1.00 14.74 ? 480  GLN A N   1 
ATOM   3614 C  CA  . GLN A 1 480 ? 8.187   -8.573  31.070  1.00 15.06 ? 480  GLN A CA  1 
ATOM   3615 C  C   . GLN A 1 480 ? 9.532   -8.587  31.727  1.00 18.97 ? 480  GLN A C   1 
ATOM   3616 O  O   . GLN A 1 480 ? 9.937   -9.624  32.309  1.00 18.41 ? 480  GLN A O   1 
ATOM   3617 C  CB  . GLN A 1 480 ? 8.274   -9.425  29.768  1.00 17.28 ? 480  GLN A CB  1 
ATOM   3618 C  CG  . GLN A 1 480 ? 6.897   -9.839  29.237  1.00 33.93 ? 480  GLN A CG  1 
ATOM   3619 C  CD  . GLN A 1 480 ? 7.048   -10.589 27.926  1.00 50.25 ? 480  GLN A CD  1 
ATOM   3620 O  OE1 . GLN A 1 480 ? 8.133   -11.013 27.513  1.00 54.00 ? 480  GLN A OE1 1 
ATOM   3621 N  NE2 . GLN A 1 480 ? 5.925   -10.843 27.263  1.00 65.00 ? 480  GLN A NE2 1 
ATOM   3622 N  N   . ASP A 1 481 ? 10.327  -7.517  31.651  1.00 14.33 ? 481  ASP A N   1 
ATOM   3623 C  CA  . ASP A 1 481 ? 11.668  -7.347  32.133  1.00 12.60 ? 481  ASP A CA  1 
ATOM   3624 C  C   . ASP A 1 481 ? 12.485  -8.542  31.595  1.00 10.09 ? 481  ASP A C   1 
ATOM   3625 O  O   . ASP A 1 481 ? 13.094  -9.287  32.375  1.00 11.69 ? 481  ASP A O   1 
ATOM   3626 C  CB  . ASP A 1 481 ? 11.872  -7.253  33.612  1.00 14.20 ? 481  ASP A CB  1 
ATOM   3627 C  CG  . ASP A 1 481 ? 13.239  -6.855  34.048  1.00 14.36 ? 481  ASP A CG  1 
ATOM   3628 O  OD1 . ASP A 1 481 ? 13.909  -6.100  33.300  1.00 17.37 ? 481  ASP A OD1 1 
ATOM   3629 O  OD2 . ASP A 1 481 ? 13.567  -7.352  35.132  1.00 18.18 ? 481  ASP A OD2 1 
ATOM   3630 N  N   . THR A 1 482 ? 12.350  -8.704  30.278  1.00 7.06  ? 482  THR A N   1 
ATOM   3631 C  CA  . THR A 1 482 ? 13.027  -9.875  29.676  1.00 8.32  ? 482  THR A CA  1 
ATOM   3632 C  C   . THR A 1 482 ? 13.687  -9.467  28.372  1.00 11.09 ? 482  THR A C   1 
ATOM   3633 O  O   . THR A 1 482 ? 13.074  -8.602  27.719  1.00 8.75  ? 482  THR A O   1 
ATOM   3634 C  CB  . THR A 1 482 ? 11.960  -11.005 29.264  1.00 5.89  ? 482  THR A CB  1 
ATOM   3635 O  OG1 . THR A 1 482 ? 11.428  -11.456 30.590  1.00 11.14 ? 482  THR A OG1 1 
ATOM   3636 C  CG2 . THR A 1 482 ? 12.602  -12.272 28.690  1.00 7.50  ? 482  THR A CG2 1 
ATOM   3637 N  N   . PHE A 1 483 ? 14.843  -10.061 28.141  1.00 8.28  ? 483  PHE A N   1 
ATOM   3638 C  CA  . PHE A 1 483 ? 15.510  -9.794  26.841  1.00 9.44  ? 483  PHE A CA  1 
ATOM   3639 C  C   . PHE A 1 483 ? 15.172  -10.996 25.918  1.00 16.06 ? 483  PHE A C   1 
ATOM   3640 O  O   . PHE A 1 483 ? 15.101  -12.129 26.370  1.00 15.77 ? 483  PHE A O   1 
ATOM   3641 C  CB  . PHE A 1 483 ? 17.027  -9.732  26.974  1.00 6.04  ? 483  PHE A CB  1 
ATOM   3642 C  CG  . PHE A 1 483 ? 17.465  -8.438  27.590  1.00 11.82 ? 483  PHE A CG  1 
ATOM   3643 C  CD1 . PHE A 1 483 ? 17.568  -8.295  28.964  1.00 10.32 ? 483  PHE A CD1 1 
ATOM   3644 C  CD2 . PHE A 1 483 ? 17.754  -7.394  26.666  1.00 9.67  ? 483  PHE A CD2 1 
ATOM   3645 C  CE1 . PHE A 1 483 ? 18.054  -7.090  29.463  1.00 9.60  ? 483  PHE A CE1 1 
ATOM   3646 C  CE2 . PHE A 1 483 ? 18.147  -6.167  27.208  1.00 18.11 ? 483  PHE A CE2 1 
ATOM   3647 C  CZ  . PHE A 1 483 ? 18.271  -6.007  28.599  1.00 10.87 ? 483  PHE A CZ  1 
ATOM   3648 N  N   . TYR A 1 484 ? 15.033  -10.829 24.609  1.00 16.94 ? 484  TYR A N   1 
ATOM   3649 C  CA  . TYR A 1 484 ? 14.775  -11.848 23.636  1.00 15.50 ? 484  TYR A CA  1 
ATOM   3650 C  C   . TYR A 1 484 ? 15.747  -11.782 22.452  1.00 15.80 ? 484  TYR A C   1 
ATOM   3651 O  O   . TYR A 1 484 ? 15.794  -10.698 21.880  1.00 9.45  ? 484  TYR A O   1 
ATOM   3652 C  CB  . TYR A 1 484 ? 13.351  -11.705 23.039  1.00 6.55  ? 484  TYR A CB  1 
ATOM   3653 C  CG  . TYR A 1 484 ? 12.278  -11.981 24.075  1.00 10.79 ? 484  TYR A CG  1 
ATOM   3654 C  CD1 . TYR A 1 484 ? 11.846  -13.282 24.276  1.00 15.62 ? 484  TYR A CD1 1 
ATOM   3655 C  CD2 . TYR A 1 484 ? 11.706  -10.901 24.805  1.00 13.20 ? 484  TYR A CD2 1 
ATOM   3656 C  CE1 . TYR A 1 484 ? 10.865  -13.564 25.267  1.00 14.15 ? 484  TYR A CE1 1 
ATOM   3657 C  CE2 . TYR A 1 484 ? 10.683  -11.154 25.739  1.00 17.04 ? 484  TYR A CE2 1 
ATOM   3658 C  CZ  . TYR A 1 484 ? 10.284  -12.488 25.937  1.00 19.11 ? 484  TYR A CZ  1 
ATOM   3659 O  OH  . TYR A 1 484 ? 9.316   -12.809 26.853  1.00 24.83 ? 484  TYR A OH  1 
ATOM   3660 N  N   . LYS A 1 485 ? 16.409  -12.913 22.171  1.00 7.70  ? 485  LYS A N   1 
ATOM   3661 C  CA  . LYS A 1 485 ? 17.270  -12.863 20.976  1.00 9.12  ? 485  LYS A CA  1 
ATOM   3662 C  C   . LYS A 1 485 ? 16.395  -12.791 19.735  1.00 15.30 ? 485  LYS A C   1 
ATOM   3663 O  O   . LYS A 1 485 ? 15.288  -13.362 19.696  1.00 15.48 ? 485  LYS A O   1 
ATOM   3664 C  CB  . LYS A 1 485 ? 18.045  -14.190 21.009  1.00 10.50 ? 485  LYS A CB  1 
ATOM   3665 C  CG  . LYS A 1 485 ? 19.148  -14.108 22.037  1.00 9.87  ? 485  LYS A CG  1 
ATOM   3666 C  CD  . LYS A 1 485 ? 20.144  -15.274 22.141  1.00 15.47 ? 485  LYS A CD  1 
ATOM   3667 C  CE  . LYS A 1 485 ? 19.374  -16.565 22.257  1.00 12.14 ? 485  LYS A CE  1 
ATOM   3668 N  NZ  . LYS A 1 485 ? 20.438  -17.565 22.535  1.00 25.24 ? 485  LYS A NZ  1 
ATOM   3669 N  N   . GLN A 1 486 ? 16.757  -12.167 18.649  1.00 11.67 ? 486  GLN A N   1 
ATOM   3670 C  CA  . GLN A 1 486 ? 16.067  -12.067 17.365  1.00 12.79 ? 486  GLN A CA  1 
ATOM   3671 C  C   . GLN A 1 486 ? 16.882  -12.849 16.271  1.00 10.51 ? 486  GLN A C   1 
ATOM   3672 O  O   . GLN A 1 486 ? 17.947  -13.396 16.585  1.00 12.91 ? 486  GLN A O   1 
ATOM   3673 C  CB  . GLN A 1 486 ? 15.777  -10.622 16.982  1.00 7.54  ? 486  GLN A CB  1 
ATOM   3674 C  CG  . GLN A 1 486 ? 15.102  -9.828  18.087  1.00 10.51 ? 486  GLN A CG  1 
ATOM   3675 C  CD  . GLN A 1 486 ? 13.682  -10.332 18.244  1.00 12.63 ? 486  GLN A CD  1 
ATOM   3676 O  OE1 . GLN A 1 486 ? 12.824  -10.344 17.397  1.00 19.20 ? 486  GLN A OE1 1 
ATOM   3677 N  NE2 . GLN A 1 486 ? 13.291  -10.945 19.351  1.00 15.50 ? 486  GLN A NE2 1 
ATOM   3678 N  N   . ASN A 1 487 ? 16.354  -12.910 15.030  1.00 9.14  ? 487  ASN A N   1 
ATOM   3679 C  CA  . ASN A 1 487 ? 17.163  -13.647 14.044  1.00 5.00  ? 487  ASN A CA  1 
ATOM   3680 C  C   . ASN A 1 487 ? 18.456  -12.817 13.829  1.00 5.56  ? 487  ASN A C   1 
ATOM   3681 O  O   . ASN A 1 487 ? 18.374  -11.574 13.723  1.00 8.69  ? 487  ASN A O   1 
ATOM   3682 C  CB  . ASN A 1 487 ? 16.368  -13.746 12.818  1.00 5.00  ? 487  ASN A CB  1 
ATOM   3683 C  CG  . ASN A 1 487 ? 15.378  -14.911 12.911  1.00 11.70 ? 487  ASN A CG  1 
ATOM   3684 O  OD1 . ASN A 1 487 ? 15.800  -15.948 13.379  1.00 15.97 ? 487  ASN A OD1 1 
ATOM   3685 N  ND2 . ASN A 1 487 ? 14.110  -14.825 12.559  1.00 12.37 ? 487  ASN A ND2 1 
ATOM   3686 N  N   . PRO A 1 488 ? 19.551  -13.563 13.667  1.00 15.10 ? 488  PRO A N   1 
ATOM   3687 C  CA  . PRO A 1 488 ? 20.849  -12.929 13.393  1.00 12.27 ? 488  PRO A CA  1 
ATOM   3688 C  C   . PRO A 1 488 ? 21.062  -12.386 12.002  1.00 20.87 ? 488  PRO A C   1 
ATOM   3689 O  O   . PRO A 1 488 ? 20.366  -12.884 11.098  1.00 17.02 ? 488  PRO A O   1 
ATOM   3690 C  CB  . PRO A 1 488 ? 21.904  -14.029 13.657  1.00 10.81 ? 488  PRO A CB  1 
ATOM   3691 C  CG  . PRO A 1 488 ? 21.187  -15.298 13.350  1.00 13.66 ? 488  PRO A CG  1 
ATOM   3692 C  CD  . PRO A 1 488 ? 19.730  -14.989 13.800  1.00 14.69 ? 488  PRO A CD  1 
ATOM   3693 N  N   . ASN A 1 489 ? 21.999  -11.410 11.819  1.00 15.26 ? 489  ASN A N   1 
ATOM   3694 C  CA  . ASN A 1 489 ? 22.200  -10.955 10.447  1.00 12.10 ? 489  ASN A CA  1 
ATOM   3695 C  C   . ASN A 1 489 ? 23.599  -11.434 10.001  1.00 12.38 ? 489  ASN A C   1 
ATOM   3696 O  O   . ASN A 1 489 ? 24.215  -12.236 10.694  1.00 14.52 ? 489  ASN A O   1 
ATOM   3697 C  CB  . ASN A 1 489 ? 21.896  -9.494  10.234  1.00 11.46 ? 489  ASN A CB  1 
ATOM   3698 C  CG  . ASN A 1 489 ? 23.111  -8.700  10.774  1.00 7.14  ? 489  ASN A CG  1 
ATOM   3699 O  OD1 . ASN A 1 489 ? 23.593  -9.051  11.849  1.00 12.30 ? 489  ASN A OD1 1 
ATOM   3700 N  ND2 . ASN A 1 489 ? 23.499  -7.639  10.085  1.00 11.45 ? 489  ASN A ND2 1 
ATOM   3701 N  N   . SER A 1 490 ? 24.103  -10.994 8.874   1.00 12.82 ? 490  SER A N   1 
ATOM   3702 C  CA  . SER A 1 490 ? 25.391  -11.477 8.377   1.00 21.11 ? 490  SER A CA  1 
ATOM   3703 C  C   . SER A 1 490 ? 26.428  -10.408 8.191   1.00 14.95 ? 490  SER A C   1 
ATOM   3704 O  O   . SER A 1 490 ? 27.475  -10.834 7.732   1.00 15.65 ? 490  SER A O   1 
ATOM   3705 C  CB  . SER A 1 490 ? 24.999  -11.870 6.876   1.00 23.89 ? 490  SER A CB  1 
ATOM   3706 O  OG  . SER A 1 490 ? 24.498  -13.165 7.096   1.00 30.06 ? 490  SER A OG  1 
ATOM   3707 N  N   . ILE A 1 491 ? 26.064  -9.153  8.421   1.00 6.88  ? 491  ILE A N   1 
ATOM   3708 C  CA  . ILE A 1 491 ? 27.008  -8.063  8.195   1.00 6.96  ? 491  ILE A CA  1 
ATOM   3709 C  C   . ILE A 1 491 ? 27.421  -7.512  9.560   1.00 10.40 ? 491  ILE A C   1 
ATOM   3710 O  O   . ILE A 1 491 ? 26.528  -7.191  10.346  1.00 11.98 ? 491  ILE A O   1 
ATOM   3711 C  CB  . ILE A 1 491 ? 26.423  -6.990  7.232   1.00 5.92  ? 491  ILE A CB  1 
ATOM   3712 C  CG1 . ILE A 1 491 ? 26.104  -7.789  5.927   1.00 5.00  ? 491  ILE A CG1 1 
ATOM   3713 C  CG2 . ILE A 1 491 ? 27.501  -5.861  7.078   1.00 9.94  ? 491  ILE A CG2 1 
ATOM   3714 C  CD1 . ILE A 1 491 ? 25.249  -6.840  5.058   1.00 6.26  ? 491  ILE A CD1 1 
ATOM   3715 N  N   . VAL A 1 492 ? 28.742  -7.439  9.711   1.00 10.62 ? 492  VAL A N   1 
ATOM   3716 C  CA  . VAL A 1 492 ? 29.299  -6.899  10.985  1.00 10.56 ? 492  VAL A CA  1 
ATOM   3717 C  C   . VAL A 1 492 ? 28.981  -5.404  11.113  1.00 9.45  ? 492  VAL A C   1 
ATOM   3718 O  O   . VAL A 1 492 ? 29.170  -4.653  10.180  1.00 15.76 ? 492  VAL A O   1 
ATOM   3719 C  CB  . VAL A 1 492 ? 30.782  -7.185  11.062  1.00 9.66  ? 492  VAL A CB  1 
ATOM   3720 C  CG1 . VAL A 1 492 ? 31.365  -6.601  12.358  1.00 9.94  ? 492  VAL A CG1 1 
ATOM   3721 C  CG2 . VAL A 1 492 ? 31.078  -8.681  11.119  1.00 9.32  ? 492  VAL A CG2 1 
ATOM   3722 N  N   . ARG A 1 493 ? 28.469  -5.002  12.273  1.00 12.53 ? 493  ARG A N   1 
ATOM   3723 C  CA  . ARG A 1 493 ? 28.092  -3.577  12.492  1.00 17.13 ? 493  ARG A CA  1 
ATOM   3724 C  C   . ARG A 1 493 ? 28.852  -3.135  13.750  1.00 8.12  ? 493  ARG A C   1 
ATOM   3725 O  O   . ARG A 1 493 ? 28.281  -3.369  14.838  1.00 13.58 ? 493  ARG A O   1 
ATOM   3726 C  CB  . ARG A 1 493 ? 26.574  -3.426  12.543  1.00 10.81 ? 493  ARG A CB  1 
ATOM   3727 C  CG  . ARG A 1 493 ? 25.844  -3.758  11.241  1.00 12.79 ? 493  ARG A CG  1 
ATOM   3728 C  CD  . ARG A 1 493 ? 26.049  -2.786  10.138  1.00 12.23 ? 493  ARG A CD  1 
ATOM   3729 N  NE  . ARG A 1 493 ? 25.232  -3.209  8.974   1.00 14.05 ? 493  ARG A NE  1 
ATOM   3730 C  CZ  . ARG A 1 493 ? 25.554  -2.849  7.726   1.00 11.81 ? 493  ARG A CZ  1 
ATOM   3731 N  NH1 . ARG A 1 493 ? 26.624  -2.050  7.523   1.00 8.96  ? 493  ARG A NH1 1 
ATOM   3732 N  NH2 . ARG A 1 493 ? 24.686  -3.316  6.802   1.00 8.62  ? 493  ARG A NH2 1 
ATOM   3733 N  N   . VAL A 1 494 ? 30.078  -2.602  13.644  1.00 10.14 ? 494  VAL A N   1 
ATOM   3734 C  CA  . VAL A 1 494 ? 30.838  -2.279  14.880  1.00 7.20  ? 494  VAL A CA  1 
ATOM   3735 C  C   . VAL A 1 494 ? 31.071  -0.794  14.845  1.00 6.15  ? 494  VAL A C   1 
ATOM   3736 O  O   . VAL A 1 494 ? 30.218  0.017   14.662  1.00 11.13 ? 494  VAL A O   1 
ATOM   3737 C  CB  . VAL A 1 494 ? 32.114  -3.186  15.025  1.00 9.35  ? 494  VAL A CB  1 
ATOM   3738 C  CG1 . VAL A 1 494 ? 31.645  -4.617  15.265  1.00 5.00  ? 494  VAL A CG1 1 
ATOM   3739 C  CG2 . VAL A 1 494 ? 32.948  -3.088  13.711  1.00 5.00  ? 494  VAL A CG2 1 
ATOM   3740 N  N   . TYR A 1 495 ? 32.279  -0.381  15.183  1.00 7.57  ? 495  TYR A N   1 
ATOM   3741 C  CA  . TYR A 1 495 ? 32.464  1.088   15.183  1.00 6.14  ? 495  TYR A CA  1 
ATOM   3742 C  C   . TYR A 1 495 ? 32.050  1.831   13.941  1.00 10.12 ? 495  TYR A C   1 
ATOM   3743 O  O   . TYR A 1 495 ? 32.373  1.452   12.777  1.00 11.74 ? 495  TYR A O   1 
ATOM   3744 C  CB  . TYR A 1 495 ? 34.005  1.126   15.419  1.00 11.52 ? 495  TYR A CB  1 
ATOM   3745 C  CG  . TYR A 1 495 ? 34.435  2.547   15.694  1.00 12.18 ? 495  TYR A CG  1 
ATOM   3746 C  CD1 . TYR A 1 495 ? 34.002  3.078   16.922  1.00 17.63 ? 495  TYR A CD1 1 
ATOM   3747 C  CD2 . TYR A 1 495 ? 35.263  3.253   14.861  1.00 17.64 ? 495  TYR A CD2 1 
ATOM   3748 C  CE1 . TYR A 1 495 ? 34.287  4.366   17.323  1.00 13.47 ? 495  TYR A CE1 1 
ATOM   3749 C  CE2 . TYR A 1 495 ? 35.662  4.564   15.289  1.00 13.37 ? 495  TYR A CE2 1 
ATOM   3750 C  CZ  . TYR A 1 495 ? 35.162  5.070   16.486  1.00 18.91 ? 495  TYR A CZ  1 
ATOM   3751 O  OH  . TYR A 1 495 ? 35.576  6.326   16.839  1.00 25.81 ? 495  TYR A OH  1 
ATOM   3752 N  N   . HIS A 1 496 ? 31.335  2.991   14.166  1.00 6.16  ? 496  HIS A N   1 
ATOM   3753 C  CA  . HIS A 1 496 ? 30.835  3.820   13.121  1.00 5.63  ? 496  HIS A CA  1 
ATOM   3754 C  C   . HIS A 1 496 ? 29.539  3.297   12.457  1.00 10.66 ? 496  HIS A C   1 
ATOM   3755 O  O   . HIS A 1 496 ? 29.293  3.688   11.318  1.00 9.56  ? 496  HIS A O   1 
ATOM   3756 C  CB  . HIS A 1 496 ? 31.861  4.093   11.964  1.00 11.92 ? 496  HIS A CB  1 
ATOM   3757 C  CG  . HIS A 1 496 ? 32.849  5.121   12.464  1.00 13.92 ? 496  HIS A CG  1 
ATOM   3758 N  ND1 . HIS A 1 496 ? 34.003  5.340   11.758  1.00 16.84 ? 496  HIS A ND1 1 
ATOM   3759 C  CD2 . HIS A 1 496 ? 32.872  5.933   13.575  1.00 15.56 ? 496  HIS A CD2 1 
ATOM   3760 C  CE1 . HIS A 1 496 ? 34.735  6.276   12.353  1.00 13.37 ? 496  HIS A CE1 1 
ATOM   3761 N  NE2 . HIS A 1 496 ? 34.040  6.618   13.421  1.00 12.00 ? 496  HIS A NE2 1 
ATOM   3762 N  N   . SER A 1 497 ? 28.838  2.471   13.183  1.00 6.43  ? 497  SER A N   1 
ATOM   3763 C  CA  . SER A 1 497 ? 27.552  1.954   12.693  1.00 6.82  ? 497  SER A CA  1 
ATOM   3764 C  C   . SER A 1 497 ? 26.463  2.865   13.282  1.00 5.00  ? 497  SER A C   1 
ATOM   3765 O  O   . SER A 1 497 ? 26.715  3.539   14.297  1.00 6.22  ? 497  SER A O   1 
ATOM   3766 C  CB  . SER A 1 497 ? 27.312  0.499   12.968  1.00 5.01  ? 497  SER A CB  1 
ATOM   3767 O  OG  . SER A 1 497 ? 27.261  0.143   14.335  1.00 15.20 ? 497  SER A OG  1 
ATOM   3768 N  N   . ILE A 1 498 ? 25.295  2.690   12.726  1.00 7.52  ? 498  ILE A N   1 
ATOM   3769 C  CA  . ILE A 1 498 ? 24.118  3.499   13.123  1.00 5.90  ? 498  ILE A CA  1 
ATOM   3770 C  C   . ILE A 1 498 ? 22.846  2.630   13.041  1.00 10.96 ? 498  ILE A C   1 
ATOM   3771 O  O   . ILE A 1 498 ? 22.922  1.678   12.317  1.00 10.44 ? 498  ILE A O   1 
ATOM   3772 C  CB  . ILE A 1 498 ? 23.896  4.773   12.274  1.00 7.18  ? 498  ILE A CB  1 
ATOM   3773 C  CG1 . ILE A 1 498 ? 23.770  4.439   10.790  1.00 10.77 ? 498  ILE A CG1 1 
ATOM   3774 C  CG2 . ILE A 1 498 ? 25.016  5.893   12.404  1.00 5.94  ? 498  ILE A CG2 1 
ATOM   3775 C  CD1 . ILE A 1 498 ? 22.363  4.829   10.248  1.00 17.45 ? 498  ILE A CD1 1 
ATOM   3776 N  N   . SER A 1 499 ? 21.867  3.068   13.776  1.00 12.37 ? 499  SER A N   1 
ATOM   3777 C  CA  . SER A 1 499 ? 20.502  2.506   13.745  1.00 11.17 ? 499  SER A CA  1 
ATOM   3778 C  C   . SER A 1 499 ? 19.496  3.681   13.880  1.00 12.61 ? 499  SER A C   1 
ATOM   3779 O  O   . SER A 1 499 ? 19.781  4.560   14.733  1.00 10.42 ? 499  SER A O   1 
ATOM   3780 C  CB  . SER A 1 499 ? 20.107  1.446   14.712  1.00 5.00  ? 499  SER A CB  1 
ATOM   3781 O  OG  . SER A 1 499 ? 20.800  0.208   14.417  1.00 9.35  ? 499  SER A OG  1 
ATOM   3782 N  N   . LEU A 1 500 ? 18.421  3.629   13.060  1.00 14.66 ? 500  LEU A N   1 
ATOM   3783 C  CA  . LEU A 1 500 ? 17.361  4.617   13.196  1.00 9.27  ? 500  LEU A CA  1 
ATOM   3784 C  C   . LEU A 1 500 ? 15.996  3.881   13.084  1.00 11.58 ? 500  LEU A C   1 
ATOM   3785 O  O   . LEU A 1 500 ? 15.925  2.950   12.260  1.00 12.00 ? 500  LEU A O   1 
ATOM   3786 C  CB  . LEU A 1 500 ? 17.370  5.748   12.167  1.00 6.04  ? 500  LEU A CB  1 
ATOM   3787 C  CG  . LEU A 1 500 ? 18.520  6.732   12.424  1.00 7.43  ? 500  LEU A CG  1 
ATOM   3788 C  CD1 . LEU A 1 500 ? 18.739  7.529   11.134  1.00 10.79 ? 500  LEU A CD1 1 
ATOM   3789 C  CD2 . LEU A 1 500 ? 18.238  7.636   13.588  1.00 10.36 ? 500  LEU A CD2 1 
ATOM   3790 N  N   . LEU A 1 501 ? 15.022  4.450   13.800  1.00 7.01  ? 501  LEU A N   1 
ATOM   3791 C  CA  . LEU A 1 501 ? 13.662  3.877   13.581  1.00 5.18  ? 501  LEU A CA  1 
ATOM   3792 C  C   . LEU A 1 501 ? 13.097  4.544   12.297  1.00 7.97  ? 501  LEU A C   1 
ATOM   3793 O  O   . LEU A 1 501 ? 13.187  5.815   12.166  1.00 16.60 ? 501  LEU A O   1 
ATOM   3794 C  CB  . LEU A 1 501 ? 12.797  4.182   14.771  1.00 6.14  ? 501  LEU A CB  1 
ATOM   3795 C  CG  . LEU A 1 501 ? 11.354  3.645   14.577  1.00 10.29 ? 501  LEU A CG  1 
ATOM   3796 C  CD1 . LEU A 1 501 ? 11.210  2.131   14.549  1.00 9.66  ? 501  LEU A CD1 1 
ATOM   3797 C  CD2 . LEU A 1 501 ? 10.463  4.151   15.714  1.00 12.90 ? 501  LEU A CD2 1 
ATOM   3798 N  N   . LEU A 1 502 ? 12.527  3.839   11.313  1.00 17.40 ? 502  LEU A N   1 
ATOM   3799 C  CA  . LEU A 1 502 ? 11.917  4.427   10.110  1.00 10.61 ? 502  LEU A CA  1 
ATOM   3800 C  C   . LEU A 1 502 ? 10.419  4.695   10.466  1.00 20.67 ? 502  LEU A C   1 
ATOM   3801 O  O   . LEU A 1 502 ? 9.738   4.030   11.293  1.00 16.75 ? 502  LEU A O   1 
ATOM   3802 C  CB  . LEU A 1 502 ? 12.028  3.541   8.830   1.00 6.33  ? 502  LEU A CB  1 
ATOM   3803 C  CG  . LEU A 1 502 ? 13.477  3.075   8.497   1.00 5.00  ? 502  LEU A CG  1 
ATOM   3804 C  CD1 . LEU A 1 502 ? 13.332  2.037   7.422   1.00 5.00  ? 502  LEU A CD1 1 
ATOM   3805 C  CD2 . LEU A 1 502 ? 14.095  4.308   7.907   1.00 5.34  ? 502  LEU A CD2 1 
ATOM   3806 N  N   . PRO A 1 503 ? 9.832   5.704   9.838   1.00 17.11 ? 503  PRO A N   1 
ATOM   3807 C  CA  . PRO A 1 503 ? 8.376   5.993   10.051  1.00 13.41 ? 503  PRO A CA  1 
ATOM   3808 C  C   . PRO A 1 503 ? 7.450   4.821   9.830   1.00 16.13 ? 503  PRO A C   1 
ATOM   3809 O  O   . PRO A 1 503 ? 6.253   4.749   10.256  1.00 20.72 ? 503  PRO A O   1 
ATOM   3810 C  CB  . PRO A 1 503 ? 8.164   7.130   9.076   1.00 20.23 ? 503  PRO A CB  1 
ATOM   3811 C  CG  . PRO A 1 503 ? 9.537   7.789   8.968   1.00 16.95 ? 503  PRO A CG  1 
ATOM   3812 C  CD  . PRO A 1 503 ? 10.503  6.610   8.900   1.00 11.90 ? 503  PRO A CD  1 
ATOM   3813 N  N   . ASP A 1 504 ? 7.881   3.787   9.094   1.00 15.10 ? 504  ASP A N   1 
ATOM   3814 C  CA  . ASP A 1 504 ? 7.078   2.593   8.822   1.00 13.34 ? 504  ASP A CA  1 
ATOM   3815 C  C   . ASP A 1 504 ? 7.216   1.546   9.926   1.00 17.19 ? 504  ASP A C   1 
ATOM   3816 O  O   . ASP A 1 504 ? 6.645   0.466   9.710   1.00 19.64 ? 504  ASP A O   1 
ATOM   3817 C  CB  . ASP A 1 504 ? 7.282   2.020   7.400   1.00 22.90 ? 504  ASP A CB  1 
ATOM   3818 C  CG  . ASP A 1 504 ? 8.694   1.505   7.133   1.00 23.78 ? 504  ASP A CG  1 
ATOM   3819 O  OD1 . ASP A 1 504 ? 9.388   1.150   8.076   1.00 19.97 ? 504  ASP A OD1 1 
ATOM   3820 O  OD2 . ASP A 1 504 ? 9.218   1.519   6.019   1.00 35.74 ? 504  ASP A OD2 1 
ATOM   3821 N  N   . GLY A 1 505 ? 7.978   1.860   10.970  1.00 10.30 ? 505  GLY A N   1 
ATOM   3822 C  CA  . GLY A 1 505 ? 8.157   0.960   12.083  1.00 12.24 ? 505  GLY A CA  1 
ATOM   3823 C  C   . GLY A 1 505 ? 9.252   -0.114  11.906  1.00 12.78 ? 505  GLY A C   1 
ATOM   3824 O  O   . GLY A 1 505 ? 9.301   -1.033  12.711  1.00 14.27 ? 505  GLY A O   1 
ATOM   3825 N  N   . ARG A 1 506 ? 9.938   -0.006  10.797  1.00 7.95  ? 506  ARG A N   1 
ATOM   3826 C  CA  . ARG A 1 506 ? 11.065  -0.960  10.575  1.00 14.49 ? 506  ARG A CA  1 
ATOM   3827 C  C   . ARG A 1 506 ? 12.365  -0.261  11.061  1.00 23.73 ? 506  ARG A C   1 
ATOM   3828 O  O   . ARG A 1 506 ? 12.459  0.961   11.271  1.00 13.10 ? 506  ARG A O   1 
ATOM   3829 C  CB  . ARG A 1 506 ? 11.133  -1.251  9.078   1.00 15.34 ? 506  ARG A CB  1 
ATOM   3830 C  CG  . ARG A 1 506 ? 10.034  -2.227  8.623   1.00 18.56 ? 506  ARG A CG  1 
ATOM   3831 C  CD  . ARG A 1 506 ? 10.100  -2.616  7.165   1.00 19.27 ? 506  ARG A CD  1 
ATOM   3832 N  NE  . ARG A 1 506 ? 10.387  -1.437  6.366   1.00 33.47 ? 506  ARG A NE  1 
ATOM   3833 C  CZ  . ARG A 1 506 ? 10.853  -1.231  5.143   1.00 37.95 ? 506  ARG A CZ  1 
ATOM   3834 N  NH1 . ARG A 1 506 ? 11.157  -2.232  4.339   1.00 40.04 ? 506  ARG A NH1 1 
ATOM   3835 N  NH2 . ARG A 1 506 ? 11.049  -0.011  4.638   1.00 34.90 ? 506  ARG A NH2 1 
ATOM   3836 N  N   . VAL A 1 507 ? 13.474  -0.956  11.231  1.00 13.63 ? 507  VAL A N   1 
ATOM   3837 C  CA  . VAL A 1 507 ? 14.754  -0.339  11.713  1.00 9.53  ? 507  VAL A CA  1 
ATOM   3838 C  C   . VAL A 1 507 ? 15.790  -0.374  10.592  1.00 13.96 ? 507  VAL A C   1 
ATOM   3839 O  O   . VAL A 1 507 ? 15.840  -1.373  9.889   1.00 12.44 ? 507  VAL A O   1 
ATOM   3840 C  CB  . VAL A 1 507 ? 15.303  -1.260  12.793  1.00 8.76  ? 507  VAL A CB  1 
ATOM   3841 C  CG1 . VAL A 1 507 ? 16.643  -0.713  13.313  1.00 10.06 ? 507  VAL A CG1 1 
ATOM   3842 C  CG2 . VAL A 1 507 ? 14.298  -1.373  13.923  1.00 11.05 ? 507  VAL A CG2 1 
ATOM   3843 N  N   . PHE A 1 508 ? 16.446  0.748   10.421  1.00 10.98 ? 508  PHE A N   1 
ATOM   3844 C  CA  . PHE A 1 508 ? 17.476  0.915   9.409   1.00 5.00  ? 508  PHE A CA  1 
ATOM   3845 C  C   . PHE A 1 508 ? 18.811  0.792   10.202  1.00 10.60 ? 508  PHE A C   1 
ATOM   3846 O  O   . PHE A 1 508 ? 19.076  1.540   11.110  1.00 10.55 ? 508  PHE A O   1 
ATOM   3847 C  CB  . PHE A 1 508 ? 17.304  2.310   8.838   1.00 6.39  ? 508  PHE A CB  1 
ATOM   3848 C  CG  . PHE A 1 508 ? 18.271  2.723   7.756   1.00 13.28 ? 508  PHE A CG  1 
ATOM   3849 C  CD1 . PHE A 1 508 ? 17.976  2.331   6.444   1.00 15.97 ? 508  PHE A CD1 1 
ATOM   3850 C  CD2 . PHE A 1 508 ? 19.445  3.413   7.995   1.00 14.19 ? 508  PHE A CD2 1 
ATOM   3851 C  CE1 . PHE A 1 508 ? 18.843  2.677   5.401   1.00 16.46 ? 508  PHE A CE1 1 
ATOM   3852 C  CE2 . PHE A 1 508 ? 20.324  3.749   6.958   1.00 15.42 ? 508  PHE A CE2 1 
ATOM   3853 C  CZ  . PHE A 1 508 ? 19.967  3.414   5.645   1.00 10.36 ? 508  PHE A CZ  1 
ATOM   3854 N  N   . ASN A 1 509 ? 19.648  -0.167  9.834   1.00 9.37  ? 509  ASN A N   1 
ATOM   3855 C  CA  . ASN A 1 509 ? 20.930  -0.378  10.540  1.00 9.67  ? 509  ASN A CA  1 
ATOM   3856 C  C   . ASN A 1 509 ? 22.048  -0.336  9.489   1.00 9.31  ? 509  ASN A C   1 
ATOM   3857 O  O   . ASN A 1 509 ? 21.878  -1.037  8.479   1.00 12.66 ? 509  ASN A O   1 
ATOM   3858 C  CB  . ASN A 1 509 ? 20.722  -1.733  11.252  1.00 5.00  ? 509  ASN A CB  1 
ATOM   3859 C  CG  . ASN A 1 509 ? 22.044  -2.181  11.874  1.00 10.55 ? 509  ASN A CG  1 
ATOM   3860 O  OD1 . ASN A 1 509 ? 22.511  -3.299  11.655  1.00 8.55  ? 509  ASN A OD1 1 
ATOM   3861 N  ND2 . ASN A 1 509 ? 22.701  -1.288  12.661  1.00 8.38  ? 509  ASN A ND2 1 
ATOM   3862 N  N   . GLY A 1 510 ? 23.050  0.522   9.679   1.00 6.87  ? 510  GLY A N   1 
ATOM   3863 C  CA  . GLY A 1 510 ? 24.062  0.421   8.592   1.00 6.61  ? 510  GLY A CA  1 
ATOM   3864 C  C   . GLY A 1 510 ? 25.419  1.001   9.061   1.00 9.31  ? 510  GLY A C   1 
ATOM   3865 O  O   . GLY A 1 510 ? 25.554  1.333   10.232  1.00 9.82  ? 510  GLY A O   1 
ATOM   3866 N  N   . GLY A 1 511 ? 26.277  1.159   8.073   1.00 8.94  ? 511  GLY A N   1 
ATOM   3867 C  CA  . GLY A 1 511 ? 27.571  1.780   8.391   1.00 11.39 ? 511  GLY A CA  1 
ATOM   3868 C  C   . GLY A 1 511 ? 28.592  0.781   8.955   1.00 14.62 ? 511  GLY A C   1 
ATOM   3869 O  O   . GLY A 1 511 ? 28.468  -0.458  8.951   1.00 11.81 ? 511  GLY A O   1 
ATOM   3870 N  N   . GLY A 1 512 ? 29.590  1.465   9.516   1.00 11.02 ? 512  GLY A N   1 
ATOM   3871 C  CA  . GLY A 1 512 ? 30.719  0.758   10.109  1.00 14.93 ? 512  GLY A CA  1 
ATOM   3872 C  C   . GLY A 1 512 ? 31.948  0.967   9.228   1.00 15.63 ? 512  GLY A C   1 
ATOM   3873 O  O   . GLY A 1 512 ? 31.856  0.786   8.001   1.00 14.66 ? 512  GLY A O   1 
ATOM   3874 N  N   . GLY A 1 513 ? 33.034  1.293   9.890   1.00 12.81 ? 513  GLY A N   1 
ATOM   3875 C  CA  . GLY A 1 513 ? 34.290  1.447   9.093   1.00 8.07  ? 513  GLY A CA  1 
ATOM   3876 C  C   . GLY A 1 513 ? 34.602  2.934   9.055   1.00 12.14 ? 513  GLY A C   1 
ATOM   3877 O  O   . GLY A 1 513 ? 34.592  3.562   10.153  1.00 15.73 ? 513  GLY A O   1 
ATOM   3878 N  N   . LEU A 1 514 ? 34.867  3.337   7.816   1.00 13.62 ? 514  LEU A N   1 
ATOM   3879 C  CA  . LEU A 1 514 ? 35.305  4.707   7.429   1.00 19.96 ? 514  LEU A CA  1 
ATOM   3880 C  C   . LEU A 1 514 ? 36.821  4.810   7.690   1.00 15.45 ? 514  LEU A C   1 
ATOM   3881 O  O   . LEU A 1 514 ? 37.256  5.641   8.466   1.00 18.65 ? 514  LEU A O   1 
ATOM   3882 C  CB  . LEU A 1 514 ? 34.541  5.839   8.122   1.00 15.78 ? 514  LEU A CB  1 
ATOM   3883 C  CG  . LEU A 1 514 ? 34.418  7.086   7.246   1.00 17.38 ? 514  LEU A CG  1 
ATOM   3884 C  CD1 . LEU A 1 514 ? 33.537  6.848   6.030   1.00 15.21 ? 514  LEU A CD1 1 
ATOM   3885 C  CD2 . LEU A 1 514 ? 33.794  8.248   7.987   1.00 24.43 ? 514  LEU A CD2 1 
ATOM   3886 N  N   . CYS A 1 515 ? 37.643  3.894   7.274   1.00 15.04 ? 515  CYS A N   1 
ATOM   3887 C  CA  . CYS A 1 515 ? 39.055  3.824   7.483   1.00 18.14 ? 515  CYS A CA  1 
ATOM   3888 C  C   . CYS A 1 515 ? 39.875  3.729   6.182   1.00 27.29 ? 515  CYS A C   1 
ATOM   3889 O  O   . CYS A 1 515 ? 40.895  3.018   6.151   1.00 28.24 ? 515  CYS A O   1 
ATOM   3890 C  CB  . CYS A 1 515 ? 39.386  2.707   8.498   1.00 17.61 ? 515  CYS A CB  1 
ATOM   3891 S  SG  . CYS A 1 515 ? 38.405  1.238   8.203   1.00 14.42 ? 515  CYS A SG  1 
ATOM   3892 N  N   . GLY A 1 516 ? 39.393  4.419   5.176   1.00 20.82 ? 516  GLY A N   1 
ATOM   3893 C  CA  . GLY A 1 516 ? 40.035  4.580   3.872   1.00 20.03 ? 516  GLY A CA  1 
ATOM   3894 C  C   . GLY A 1 516 ? 40.355  3.239   3.247   1.00 31.47 ? 516  GLY A C   1 
ATOM   3895 O  O   . GLY A 1 516 ? 39.415  2.505   2.905   1.00 33.79 ? 516  GLY A O   1 
ATOM   3896 N  N   . ASP A 1 517 ? 41.601  2.878   3.231   1.00 40.19 ? 517  ASP A N   1 
ATOM   3897 C  CA  . ASP A 1 517 ? 42.132  1.622   2.690   1.00 59.81 ? 517  ASP A CA  1 
ATOM   3898 C  C   . ASP A 1 517 ? 41.790  0.350   3.449   1.00 51.79 ? 517  ASP A C   1 
ATOM   3899 O  O   . ASP A 1 517 ? 42.086  -0.770  2.935   1.00 39.82 ? 517  ASP A O   1 
ATOM   3900 C  CB  . ASP A 1 517 ? 43.617  1.830   2.353   1.00 76.00 ? 517  ASP A CB  1 
ATOM   3901 C  CG  . ASP A 1 517 ? 43.810  2.801   1.189   1.00 98.01 ? 517  ASP A CG  1 
ATOM   3902 O  OD1 . ASP A 1 517 ? 43.030  2.795   0.191   1.00 99.39 ? 517  ASP A OD1 1 
ATOM   3903 O  OD2 . ASP A 1 517 ? 44.742  3.622   1.221   1.00 99.99 ? 517  ASP A OD2 1 
ATOM   3904 N  N   . CYS A 1 518 ? 41.219  0.465   4.648   1.00 34.25 ? 518  CYS A N   1 
ATOM   3905 C  CA  . CYS A 1 518 ? 40.890  -0.765  5.375   1.00 22.42 ? 518  CYS A CA  1 
ATOM   3906 C  C   . CYS A 1 518 ? 39.902  -1.562  4.494   1.00 22.02 ? 518  CYS A C   1 
ATOM   3907 O  O   . CYS A 1 518 ? 39.275  -1.069  3.532   1.00 22.37 ? 518  CYS A O   1 
ATOM   3908 C  CB  . CYS A 1 518 ? 40.145  -0.471  6.678   1.00 24.27 ? 518  CYS A CB  1 
ATOM   3909 S  SG  . CYS A 1 518 ? 38.715  0.613   6.328   1.00 13.85 ? 518  CYS A SG  1 
ATOM   3910 N  N   . THR A 1 519 ? 39.733  -2.795  4.951   1.00 19.90 ? 519  THR A N   1 
ATOM   3911 C  CA  . THR A 1 519 ? 38.758  -3.589  4.149   1.00 27.82 ? 519  THR A CA  1 
ATOM   3912 C  C   . THR A 1 519 ? 37.470  -3.697  4.987   1.00 26.70 ? 519  THR A C   1 
ATOM   3913 O  O   . THR A 1 519 ? 36.680  -4.580  4.625   1.00 26.48 ? 519  THR A O   1 
ATOM   3914 C  CB  . THR A 1 519 ? 39.419  -4.994  3.863   1.00 35.80 ? 519  THR A CB  1 
ATOM   3915 O  OG1 . THR A 1 519 ? 39.783  -5.476  5.188   1.00 31.90 ? 519  THR A OG1 1 
ATOM   3916 C  CG2 . THR A 1 519 ? 40.621  -5.019  2.934   1.00 44.58 ? 519  THR A CG2 1 
ATOM   3917 N  N   . THR A 1 520 ? 37.353  -2.887  6.027   1.00 16.16 ? 520  THR A N   1 
ATOM   3918 C  CA  . THR A 1 520 ? 36.200  -2.980  6.929   1.00 16.63 ? 520  THR A CA  1 
ATOM   3919 C  C   . THR A 1 520 ? 35.210  -1.837  6.739   1.00 15.07 ? 520  THR A C   1 
ATOM   3920 O  O   . THR A 1 520 ? 34.488  -1.591  7.674   1.00 16.55 ? 520  THR A O   1 
ATOM   3921 C  CB  . THR A 1 520 ? 36.734  -3.170  8.420   1.00 14.83 ? 520  THR A CB  1 
ATOM   3922 O  OG1 . THR A 1 520 ? 37.724  -2.106  8.566   1.00 16.14 ? 520  THR A OG1 1 
ATOM   3923 C  CG2 . THR A 1 520 ? 37.309  -4.607  8.550   1.00 14.20 ? 520  THR A CG2 1 
ATOM   3924 N  N   . ASN A 1 521 ? 35.226  -1.218  5.572   1.00 13.32 ? 521  ASN A N   1 
ATOM   3925 C  CA  . ASN A 1 521 ? 34.262  -0.173  5.261   1.00 14.46 ? 521  ASN A CA  1 
ATOM   3926 C  C   . ASN A 1 521 ? 32.995  -0.956  4.839   1.00 15.00 ? 521  ASN A C   1 
ATOM   3927 O  O   . ASN A 1 521 ? 33.115  -1.924  4.083   1.00 16.91 ? 521  ASN A O   1 
ATOM   3928 C  CB  . ASN A 1 521 ? 34.534  0.694   4.051   1.00 13.61 ? 521  ASN A CB  1 
ATOM   3929 C  CG  . ASN A 1 521 ? 35.707  1.605   4.485   1.00 15.52 ? 521  ASN A CG  1 
ATOM   3930 O  OD1 . ASN A 1 521 ? 35.823  2.201   5.572   1.00 12.58 ? 521  ASN A OD1 1 
ATOM   3931 N  ND2 . ASN A 1 521 ? 36.675  1.650   3.575   1.00 16.64 ? 521  ASN A ND2 1 
ATOM   3932 N  N   . HIS A 1 522 ? 31.877  -0.479  5.330   1.00 17.62 ? 522  HIS A N   1 
ATOM   3933 C  CA  . HIS A 1 522 ? 30.607  -1.127  4.947   1.00 9.17  ? 522  HIS A CA  1 
ATOM   3934 C  C   . HIS A 1 522 ? 29.765  -0.046  4.318   1.00 16.39 ? 522  HIS A C   1 
ATOM   3935 O  O   . HIS A 1 522 ? 29.237  0.824   5.054   1.00 14.11 ? 522  HIS A O   1 
ATOM   3936 C  CB  . HIS A 1 522 ? 29.952  -1.801  6.149   1.00 14.81 ? 522  HIS A CB  1 
ATOM   3937 C  CG  . HIS A 1 522 ? 30.633  -3.047  6.622   1.00 18.17 ? 522  HIS A CG  1 
ATOM   3938 N  ND1 . HIS A 1 522 ? 31.562  -3.161  7.618   1.00 15.33 ? 522  HIS A ND1 1 
ATOM   3939 C  CD2 . HIS A 1 522 ? 30.446  -4.318  6.166   1.00 15.98 ? 522  HIS A CD2 1 
ATOM   3940 C  CE1 . HIS A 1 522 ? 31.915  -4.401  7.747   1.00 12.26 ? 522  HIS A CE1 1 
ATOM   3941 N  NE2 . HIS A 1 522 ? 31.257  -5.150  6.893   1.00 23.50 ? 522  HIS A NE2 1 
ATOM   3942 N  N   . PHE A 1 523 ? 29.670  -0.107  2.996   1.00 9.08  ? 523  PHE A N   1 
ATOM   3943 C  CA  . PHE A 1 523 ? 28.909  0.912   2.226   1.00 9.76  ? 523  PHE A CA  1 
ATOM   3944 C  C   . PHE A 1 523 ? 27.440  0.496   2.069   1.00 6.42  ? 523  PHE A C   1 
ATOM   3945 O  O   . PHE A 1 523 ? 26.981  0.453   0.934   1.00 9.93  ? 523  PHE A O   1 
ATOM   3946 C  CB  . PHE A 1 523 ? 29.551  1.068   0.870   1.00 11.00 ? 523  PHE A CB  1 
ATOM   3947 C  CG  . PHE A 1 523 ? 31.017  1.474   0.862   1.00 18.01 ? 523  PHE A CG  1 
ATOM   3948 C  CD1 . PHE A 1 523 ? 32.104  0.655   0.977   1.00 14.63 ? 523  PHE A CD1 1 
ATOM   3949 C  CD2 . PHE A 1 523 ? 31.248  2.824   0.722   1.00 15.17 ? 523  PHE A CD2 1 
ATOM   3950 C  CE1 . PHE A 1 523 ? 33.415  1.067   0.884   1.00 14.09 ? 523  PHE A CE1 1 
ATOM   3951 C  CE2 . PHE A 1 523 ? 32.552  3.329   0.634   1.00 14.57 ? 523  PHE A CE2 1 
ATOM   3952 C  CZ  . PHE A 1 523 ? 33.599  2.439   0.766   1.00 11.77 ? 523  PHE A CZ  1 
ATOM   3953 N  N   . ASP A 1 524 ? 26.887  0.115   3.227   1.00 8.34  ? 524  ASP A N   1 
ATOM   3954 C  CA  . ASP A 1 524 ? 25.462  -0.278  3.061   1.00 5.83  ? 524  ASP A CA  1 
ATOM   3955 C  C   . ASP A 1 524 ? 24.718  -0.171  4.402   1.00 11.74 ? 524  ASP A C   1 
ATOM   3956 O  O   . ASP A 1 524 ? 25.313  0.245   5.406   1.00 8.39  ? 524  ASP A O   1 
ATOM   3957 C  CB  . ASP A 1 524 ? 25.638  -1.743  2.582   1.00 5.00  ? 524  ASP A CB  1 
ATOM   3958 C  CG  . ASP A 1 524 ? 26.359  -2.711  3.422   1.00 19.10 ? 524  ASP A CG  1 
ATOM   3959 O  OD1 . ASP A 1 524 ? 26.572  -2.440  4.631   1.00 18.26 ? 524  ASP A OD1 1 
ATOM   3960 O  OD2 . ASP A 1 524 ? 26.679  -3.835  2.926   1.00 13.87 ? 524  ASP A OD2 1 
ATOM   3961 N  N   . ALA A 1 525 ? 23.471  -0.693  4.322   1.00 15.07 ? 525  ALA A N   1 
ATOM   3962 C  CA  . ALA A 1 525 ? 22.605  -0.728  5.518   1.00 10.51 ? 525  ALA A CA  1 
ATOM   3963 C  C   . ALA A 1 525 ? 21.665  -1.906  5.332   1.00 9.23  ? 525  ALA A C   1 
ATOM   3964 O  O   . ALA A 1 525 ? 21.455  -2.396  4.200   1.00 12.68 ? 525  ALA A O   1 
ATOM   3965 C  CB  . ALA A 1 525 ? 21.809  0.608   5.626   1.00 7.96  ? 525  ALA A CB  1 
ATOM   3966 N  N   . GLN A 1 526 ? 21.017  -2.390  6.351   1.00 6.66  ? 526  GLN A N   1 
ATOM   3967 C  CA  . GLN A 1 526 ? 20.029  -3.462  6.112   1.00 5.03  ? 526  GLN A CA  1 
ATOM   3968 C  C   . GLN A 1 526 ? 18.785  -2.954  6.822   1.00 6.88  ? 526  GLN A C   1 
ATOM   3969 O  O   . GLN A 1 526 ? 18.908  -2.157  7.742   1.00 12.13 ? 526  GLN A O   1 
ATOM   3970 C  CB  . GLN A 1 526 ? 20.322  -4.788  6.682   1.00 5.00  ? 526  GLN A CB  1 
ATOM   3971 C  CG  . GLN A 1 526 ? 21.465  -5.424  5.893   1.00 12.05 ? 526  GLN A CG  1 
ATOM   3972 C  CD  . GLN A 1 526 ? 21.821  -6.704  6.608   1.00 14.75 ? 526  GLN A CD  1 
ATOM   3973 O  OE1 . GLN A 1 526 ? 22.461  -6.657  7.670   1.00 18.07 ? 526  GLN A OE1 1 
ATOM   3974 N  NE2 . GLN A 1 526 ? 21.483  -7.850  6.052   1.00 12.48 ? 526  GLN A NE2 1 
ATOM   3975 N  N   . ILE A 1 527 ? 17.700  -3.576  6.510   1.00 6.45  ? 527  ILE A N   1 
ATOM   3976 C  CA  . ILE A 1 527 ? 16.413  -3.195  7.170   1.00 6.75  ? 527  ILE A CA  1 
ATOM   3977 C  C   . ILE A 1 527 ? 16.095  -4.406  8.050   1.00 9.18  ? 527  ILE A C   1 
ATOM   3978 O  O   . ILE A 1 527 ? 16.290  -5.530  7.637   1.00 9.73  ? 527  ILE A O   1 
ATOM   3979 C  CB  . ILE A 1 527 ? 15.264  -3.075  6.149   1.00 7.53  ? 527  ILE A CB  1 
ATOM   3980 C  CG1 . ILE A 1 527 ? 15.445  -1.969  5.111   1.00 6.08  ? 527  ILE A CG1 1 
ATOM   3981 C  CG2 . ILE A 1 527 ? 13.869  -2.948  6.828   1.00 9.51  ? 527  ILE A CG2 1 
ATOM   3982 C  CD1 . ILE A 1 527 ? 15.639  -0.552  5.625   1.00 12.09 ? 527  ILE A CD1 1 
ATOM   3983 N  N   . PHE A 1 528 ? 15.671  -4.213  9.293   1.00 16.54 ? 528  PHE A N   1 
ATOM   3984 C  CA  . PHE A 1 528 ? 15.252  -5.251  10.209  1.00 5.50  ? 528  PHE A CA  1 
ATOM   3985 C  C   . PHE A 1 528 ? 13.722  -4.966  10.369  1.00 11.25 ? 528  PHE A C   1 
ATOM   3986 O  O   . PHE A 1 528 ? 13.272  -3.811  10.644  1.00 9.50  ? 528  PHE A O   1 
ATOM   3987 C  CB  . PHE A 1 528 ? 15.839  -5.262  11.600  1.00 8.79  ? 528  PHE A CB  1 
ATOM   3988 C  CG  . PHE A 1 528 ? 15.249  -6.244  12.551  1.00 12.32 ? 528  PHE A CG  1 
ATOM   3989 C  CD1 . PHE A 1 528 ? 15.602  -7.584  12.416  1.00 14.13 ? 528  PHE A CD1 1 
ATOM   3990 C  CD2 . PHE A 1 528 ? 14.408  -5.817  13.605  1.00 15.15 ? 528  PHE A CD2 1 
ATOM   3991 C  CE1 . PHE A 1 528 ? 15.133  -8.544  13.302  1.00 14.59 ? 528  PHE A CE1 1 
ATOM   3992 C  CE2 . PHE A 1 528 ? 13.925  -6.786  14.519  1.00 16.34 ? 528  PHE A CE2 1 
ATOM   3993 C  CZ  . PHE A 1 528 ? 14.306  -8.126  14.350  1.00 11.54 ? 528  PHE A CZ  1 
ATOM   3994 N  N   . THR A 1 529 ? 12.972  -6.014  10.114  1.00 15.12 ? 529  THR A N   1 
ATOM   3995 C  CA  . THR A 1 529 ? 11.494  -5.961  10.252  1.00 15.46 ? 529  THR A CA  1 
ATOM   3996 C  C   . THR A 1 529 ? 11.135  -6.780  11.513  1.00 13.59 ? 529  THR A C   1 
ATOM   3997 O  O   . THR A 1 529 ? 11.273  -8.028  11.643  1.00 16.67 ? 529  THR A O   1 
ATOM   3998 C  CB  . THR A 1 529 ? 10.691  -6.533  9.024   1.00 17.61 ? 529  THR A CB  1 
ATOM   3999 O  OG1 . THR A 1 529 ? 11.205  -5.823  7.888   1.00 13.66 ? 529  THR A OG1 1 
ATOM   4000 C  CG2 . THR A 1 529 ? 9.130   -6.530  9.134   1.00 12.05 ? 529  THR A CG2 1 
ATOM   4001 N  N   . PRO A 1 530 ? 10.655  -6.043  12.505  1.00 11.44 ? 530  PRO A N   1 
ATOM   4002 C  CA  . PRO A 1 530 ? 10.279  -6.655  13.764  1.00 8.10  ? 530  PRO A CA  1 
ATOM   4003 C  C   . PRO A 1 530 ? 9.054   -7.564  13.548  1.00 10.64 ? 530  PRO A C   1 
ATOM   4004 O  O   . PRO A 1 530 ? 8.272   -7.435  12.632  1.00 14.13 ? 530  PRO A O   1 
ATOM   4005 C  CB  . PRO A 1 530 ? 10.036  -5.480  14.663  1.00 16.37 ? 530  PRO A CB  1 
ATOM   4006 C  CG  . PRO A 1 530 ? 10.765  -4.294  14.049  1.00 10.82 ? 530  PRO A CG  1 
ATOM   4007 C  CD  . PRO A 1 530 ? 10.461  -4.558  12.537  1.00 9.45  ? 530  PRO A CD  1 
ATOM   4008 N  N   . ASN A 1 531 ? 9.046   -8.596  14.391  1.00 10.38 ? 531  ASN A N   1 
ATOM   4009 C  CA  . ASN A 1 531 ? 7.963   -9.576  14.346  1.00 9.89  ? 531  ASN A CA  1 
ATOM   4010 C  C   . ASN A 1 531 ? 6.621   -8.880  14.511  1.00 19.63 ? 531  ASN A C   1 
ATOM   4011 O  O   . ASN A 1 531 ? 5.632   -9.551  14.204  1.00 21.98 ? 531  ASN A O   1 
ATOM   4012 C  CB  . ASN A 1 531 ? 8.218   -10.543 15.550  1.00 19.00 ? 531  ASN A CB  1 
ATOM   4013 C  CG  . ASN A 1 531 ? 7.070   -11.598 15.559  1.00 44.68 ? 531  ASN A CG  1 
ATOM   4014 O  OD1 . ASN A 1 531 ? 6.878   -12.248 14.540  1.00 31.38 ? 531  ASN A OD1 1 
ATOM   4015 N  ND2 . ASN A 1 531 ? 6.269   -11.770 16.599  1.00 37.09 ? 531  ASN A ND2 1 
ATOM   4016 N  N   . TYR A 1 532 ? 6.451   -7.683  14.997  1.00 15.08 ? 532  TYR A N   1 
ATOM   4017 C  CA  . TYR A 1 532 ? 5.080   -7.082  15.162  1.00 10.03 ? 532  TYR A CA  1 
ATOM   4018 C  C   . TYR A 1 532 ? 4.507   -6.749  13.816  1.00 14.59 ? 532  TYR A C   1 
ATOM   4019 O  O   . TYR A 1 532 ? 3.364   -6.321  13.739  1.00 20.58 ? 532  TYR A O   1 
ATOM   4020 C  CB  . TYR A 1 532 ? 5.106   -5.870  16.100  1.00 10.28 ? 532  TYR A CB  1 
ATOM   4021 C  CG  . TYR A 1 532 ? 6.004   -4.703  15.736  1.00 15.57 ? 532  TYR A CG  1 
ATOM   4022 C  CD1 . TYR A 1 532 ? 6.202   -4.152  14.476  1.00 12.50 ? 532  TYR A CD1 1 
ATOM   4023 C  CD2 . TYR A 1 532 ? 6.742   -4.162  16.807  1.00 17.45 ? 532  TYR A CD2 1 
ATOM   4024 C  CE1 . TYR A 1 532 ? 7.095   -3.068  14.319  1.00 13.85 ? 532  TYR A CE1 1 
ATOM   4025 C  CE2 . TYR A 1 532 ? 7.627   -3.063  16.676  1.00 14.58 ? 532  TYR A CE2 1 
ATOM   4026 C  CZ  . TYR A 1 532 ? 7.763   -2.546  15.400  1.00 10.52 ? 532  TYR A CZ  1 
ATOM   4027 O  OH  . TYR A 1 532 ? 8.602   -1.475  15.264  1.00 8.12  ? 532  TYR A OH  1 
ATOM   4028 N  N   . LEU A 1 533 ? 5.251   -6.901  12.711  1.00 17.96 ? 533  LEU A N   1 
ATOM   4029 C  CA  . LEU A 1 533 ? 4.764   -6.650  11.371  1.00 17.47 ? 533  LEU A CA  1 
ATOM   4030 C  C   . LEU A 1 533 ? 4.295   -7.953  10.664  1.00 16.91 ? 533  LEU A C   1 
ATOM   4031 O  O   . LEU A 1 533 ? 3.825   -7.843  9.529   1.00 22.72 ? 533  LEU A O   1 
ATOM   4032 C  CB  . LEU A 1 533 ? 5.709   -5.854  10.528  1.00 11.91 ? 533  LEU A CB  1 
ATOM   4033 C  CG  . LEU A 1 533 ? 5.988   -4.407  10.968  1.00 13.89 ? 533  LEU A CG  1 
ATOM   4034 C  CD1 . LEU A 1 533 ? 6.954   -3.735  10.009  1.00 13.88 ? 533  LEU A CD1 1 
ATOM   4035 C  CD2 . LEU A 1 533 ? 4.653   -3.673  10.892  1.00 17.15 ? 533  LEU A CD2 1 
ATOM   4036 N  N   . TYR A 1 534 ? 4.475   -9.082  11.283  1.00 14.67 ? 534  TYR A N   1 
ATOM   4037 C  CA  . TYR A 1 534 ? 4.024   -10.331 10.653  1.00 16.45 ? 534  TYR A CA  1 
ATOM   4038 C  C   . TYR A 1 534 ? 2.890   -10.928 11.438  1.00 26.87 ? 534  TYR A C   1 
ATOM   4039 O  O   . TYR A 1 534 ? 2.818   -10.731 12.655  1.00 27.08 ? 534  TYR A O   1 
ATOM   4040 C  CB  . TYR A 1 534 ? 5.143   -11.395 10.901  1.00 15.06 ? 534  TYR A CB  1 
ATOM   4041 C  CG  . TYR A 1 534 ? 6.325   -10.926 10.072  1.00 12.55 ? 534  TYR A CG  1 
ATOM   4042 C  CD1 . TYR A 1 534 ? 6.258   -11.069 8.690   1.00 17.32 ? 534  TYR A CD1 1 
ATOM   4043 C  CD2 . TYR A 1 534 ? 7.419   -10.296 10.638  1.00 18.46 ? 534  TYR A CD2 1 
ATOM   4044 C  CE1 . TYR A 1 534 ? 7.316   -10.646 7.910   1.00 41.88 ? 534  TYR A CE1 1 
ATOM   4045 C  CE2 . TYR A 1 534 ? 8.466   -9.875  9.822   1.00 31.04 ? 534  TYR A CE2 1 
ATOM   4046 C  CZ  . TYR A 1 534 ? 8.450   -10.058 8.456   1.00 33.49 ? 534  TYR A CZ  1 
ATOM   4047 O  OH  . TYR A 1 534 ? 9.443   -9.590  7.599   1.00 30.60 ? 534  TYR A OH  1 
ATOM   4048 N  N   . ASN A 1 535 ? 2.096   -11.753 10.770  1.00 36.72 ? 535  ASN A N   1 
ATOM   4049 C  CA  . ASN A 1 535 ? 0.993   -12.485 11.490  1.00 49.10 ? 535  ASN A CA  1 
ATOM   4050 C  C   . ASN A 1 535 ? 1.632   -13.868 11.688  1.00 58.04 ? 535  ASN A C   1 
ATOM   4051 O  O   . ASN A 1 535 ? 2.773   -14.019 11.185  1.00 52.21 ? 535  ASN A O   1 
ATOM   4052 C  CB  . ASN A 1 535 ? -0.309  -12.507 10.687  1.00 52.83 ? 535  ASN A CB  1 
ATOM   4053 C  CG  . ASN A 1 535 ? -0.114  -12.963 9.248   1.00 56.38 ? 535  ASN A CG  1 
ATOM   4054 O  OD1 . ASN A 1 535 ? 0.666   -13.883 8.955   1.00 48.10 ? 535  ASN A OD1 1 
ATOM   4055 N  ND2 . ASN A 1 535 ? -0.794  -12.300 8.272   1.00 60.59 ? 535  ASN A ND2 1 
ATOM   4056 N  N   . SER A 1 536 ? 0.959   -14.802 12.311  1.00 73.72 ? 536  SER A N   1 
ATOM   4057 C  CA  . SER A 1 536 ? 1.374   -16.175 12.593  1.00 84.04 ? 536  SER A CA  1 
ATOM   4058 C  C   . SER A 1 536 ? 1.951   -17.017 11.452  1.00 93.38 ? 536  SER A C   1 
ATOM   4059 O  O   . SER A 1 536 ? 2.921   -17.780 11.660  1.00 91.58 ? 536  SER A O   1 
ATOM   4060 C  CB  . SER A 1 536 ? 0.213   -16.989 13.179  1.00 89.64 ? 536  SER A CB  1 
ATOM   4061 O  OG  . SER A 1 536 ? -0.478  -16.221 14.156  1.00 99.99 ? 536  SER A OG  1 
ATOM   4062 N  N   . ASN A 1 537 ? 1.390   -16.851 10.275  1.00 93.49 ? 537  ASN A N   1 
ATOM   4063 C  CA  . ASN A 1 537 ? 1.778   -17.509 9.039   1.00 88.22 ? 537  ASN A CA  1 
ATOM   4064 C  C   . ASN A 1 537 ? 3.114   -17.005 8.496   1.00 81.77 ? 537  ASN A C   1 
ATOM   4065 O  O   . ASN A 1 537 ? 3.534   -17.593 7.479   1.00 81.96 ? 537  ASN A O   1 
ATOM   4066 C  CB  . ASN A 1 537 ? 0.692   -17.274 7.971   1.00 98.08 ? 537  ASN A CB  1 
ATOM   4067 C  CG  . ASN A 1 537 ? -0.650  -17.875 8.330   1.00 99.99 ? 537  ASN A CG  1 
ATOM   4068 O  OD1 . ASN A 1 537 ? -1.695  -17.295 7.986   1.00 99.99 ? 537  ASN A OD1 1 
ATOM   4069 N  ND2 . ASN A 1 537 ? -0.576  -19.019 9.014   1.00 99.99 ? 537  ASN A ND2 1 
ATOM   4070 N  N   . GLY A 1 538 ? 3.706   -15.974 9.116   1.00 62.33 ? 538  GLY A N   1 
ATOM   4071 C  CA  . GLY A 1 538 ? 4.979   -15.513 8.524   1.00 43.88 ? 538  GLY A CA  1 
ATOM   4072 C  C   . GLY A 1 538 ? 4.706   -14.504 7.415   1.00 46.99 ? 538  GLY A C   1 
ATOM   4073 O  O   . GLY A 1 538 ? 5.681   -14.056 6.758   1.00 44.28 ? 538  GLY A O   1 
ATOM   4074 N  N   . ASN A 1 539 ? 3.424   -14.162 7.202   1.00 34.70 ? 539  ASN A N   1 
ATOM   4075 C  CA  . ASN A 1 539 ? 3.178   -13.141 6.141   1.00 31.03 ? 539  ASN A CA  1 
ATOM   4076 C  C   . ASN A 1 539 ? 3.068   -11.809 6.919   1.00 33.49 ? 539  ASN A C   1 
ATOM   4077 O  O   . ASN A 1 539 ? 2.893   -11.794 8.158   1.00 24.71 ? 539  ASN A O   1 
ATOM   4078 C  CB  . ASN A 1 539 ? 1.874   -13.367 5.371   1.00 47.58 ? 539  ASN A CB  1 
ATOM   4079 C  CG  . ASN A 1 539 ? 1.756   -14.774 4.810   1.00 55.97 ? 539  ASN A CG  1 
ATOM   4080 O  OD1 . ASN A 1 539 ? 2.705   -15.244 4.159   1.00 55.10 ? 539  ASN A OD1 1 
ATOM   4081 N  ND2 . ASN A 1 539 ? 0.602   -15.398 5.076   1.00 70.00 ? 539  ASN A ND2 1 
ATOM   4082 N  N   . LEU A 1 540 ? 3.154   -10.763 6.123   1.00 21.65 ? 540  LEU A N   1 
ATOM   4083 C  CA  . LEU A 1 540 ? 3.037   -9.418  6.703   1.00 27.92 ? 540  LEU A CA  1 
ATOM   4084 C  C   . LEU A 1 540 ? 1.598   -9.246  7.212   1.00 26.62 ? 540  LEU A C   1 
ATOM   4085 O  O   . LEU A 1 540 ? 0.674   -9.521  6.481   1.00 29.92 ? 540  LEU A O   1 
ATOM   4086 C  CB  . LEU A 1 540 ? 3.524   -8.439  5.661   1.00 27.86 ? 540  LEU A CB  1 
ATOM   4087 C  CG  . LEU A 1 540 ? 5.020   -8.396  5.346   1.00 48.65 ? 540  LEU A CG  1 
ATOM   4088 C  CD1 . LEU A 1 540 ? 5.261   -7.312  4.292   1.00 54.34 ? 540  LEU A CD1 1 
ATOM   4089 C  CD2 . LEU A 1 540 ? 5.801   -8.050  6.608   1.00 56.89 ? 540  LEU A CD2 1 
ATOM   4090 N  N   . ALA A 1 541 ? 1.396   -8.784  8.418   1.00 22.39 ? 541  ALA A N   1 
ATOM   4091 C  CA  . ALA A 1 541 ? 0.104   -8.518  9.013   1.00 25.55 ? 541  ALA A CA  1 
ATOM   4092 C  C   . ALA A 1 541 ? -0.462  -7.291  8.356   1.00 19.90 ? 541  ALA A C   1 
ATOM   4093 O  O   . ALA A 1 541 ? 0.191   -6.420  7.755   1.00 22.40 ? 541  ALA A O   1 
ATOM   4094 C  CB  . ALA A 1 541 ? 0.281   -8.228  10.524  1.00 17.87 ? 541  ALA A CB  1 
ATOM   4095 N  N   . THR A 1 542 ? -1.798  -7.174  8.451   1.00 27.75 ? 542  THR A N   1 
ATOM   4096 C  CA  . THR A 1 542 ? -2.558  -6.019  7.958   1.00 40.22 ? 542  THR A CA  1 
ATOM   4097 C  C   . THR A 1 542 ? -2.373  -4.966  9.069   1.00 23.64 ? 542  THR A C   1 
ATOM   4098 O  O   . THR A 1 542 ? -2.374  -5.331  10.258  1.00 28.63 ? 542  THR A O   1 
ATOM   4099 C  CB  . THR A 1 542 ? -4.113  -6.238  7.630   1.00 42.45 ? 542  THR A CB  1 
ATOM   4100 O  OG1 . THR A 1 542 ? -4.193  -7.526  6.951   1.00 44.08 ? 542  THR A OG1 1 
ATOM   4101 C  CG2 . THR A 1 542 ? -4.607  -5.053  6.791   1.00 36.56 ? 542  THR A CG2 1 
ATOM   4102 N  N   . ARG A 1 543 ? -2.111  -3.765  8.708   1.00 20.05 ? 543  ARG A N   1 
ATOM   4103 C  CA  . ARG A 1 543 ? -1.864  -2.633  9.606   1.00 35.50 ? 543  ARG A CA  1 
ATOM   4104 C  C   . ARG A 1 543 ? -3.035  -1.627  9.704   1.00 33.62 ? 543  ARG A C   1 
ATOM   4105 O  O   . ARG A 1 543 ? -3.613  -1.264  8.672   1.00 34.67 ? 543  ARG A O   1 
ATOM   4106 C  CB  . ARG A 1 543 ? -0.636  -1.859  9.041   1.00 32.61 ? 543  ARG A CB  1 
ATOM   4107 C  CG  . ARG A 1 543 ? 0.578   -2.684  8.681   1.00 25.07 ? 543  ARG A CG  1 
ATOM   4108 C  CD  . ARG A 1 543 ? 1.677   -1.837  8.105   1.00 35.77 ? 543  ARG A CD  1 
ATOM   4109 N  NE  . ARG A 1 543 ? 2.400   -1.164  9.182   1.00 34.93 ? 543  ARG A NE  1 
ATOM   4110 C  CZ  . ARG A 1 543 ? 3.669   -0.770  9.172   1.00 23.21 ? 543  ARG A CZ  1 
ATOM   4111 N  NH1 . ARG A 1 543 ? 4.547   -0.977  8.205   1.00 17.01 ? 543  ARG A NH1 1 
ATOM   4112 N  NH2 . ARG A 1 543 ? 4.018   -0.132  10.306  1.00 16.66 ? 543  ARG A NH2 1 
ATOM   4113 N  N   . PRO A 1 544 ? -3.306  -1.151  10.903  1.00 17.54 ? 544  PRO A N   1 
ATOM   4114 C  CA  . PRO A 1 544 ? -4.348  -0.174  11.163  1.00 17.47 ? 544  PRO A CA  1 
ATOM   4115 C  C   . PRO A 1 544 ? -3.866  1.006   10.361  1.00 21.92 ? 544  PRO A C   1 
ATOM   4116 O  O   . PRO A 1 544 ? -2.641  1.081   10.123  1.00 20.66 ? 544  PRO A O   1 
ATOM   4117 C  CB  . PRO A 1 544 ? -4.374  0.023   12.670  1.00 24.79 ? 544  PRO A CB  1 
ATOM   4118 C  CG  . PRO A 1 544 ? -3.082  -0.506  13.202  1.00 20.57 ? 544  PRO A CG  1 
ATOM   4119 C  CD  . PRO A 1 544 ? -2.601  -1.507  12.166  1.00 18.93 ? 544  PRO A CD  1 
ATOM   4120 N  N   . LYS A 1 545 ? -4.831  1.795   9.989   1.00 20.76 ? 545  LYS A N   1 
ATOM   4121 C  CA  . LYS A 1 545 ? -4.592  3.005   9.245   1.00 18.24 ? 545  LYS A CA  1 
ATOM   4122 C  C   . LYS A 1 545 ? -5.174  4.183   10.021  1.00 28.30 ? 545  LYS A C   1 
ATOM   4123 O  O   . LYS A 1 545 ? -6.180  4.099   10.717  1.00 23.85 ? 545  LYS A O   1 
ATOM   4124 C  CB  . LYS A 1 545 ? -5.110  3.087   7.820   1.00 28.39 ? 545  LYS A CB  1 
ATOM   4125 C  CG  . LYS A 1 545 ? -4.541  2.036   6.859   1.00 49.01 ? 545  LYS A CG  1 
ATOM   4126 C  CD  . LYS A 1 545 ? -4.830  2.456   5.423   1.00 73.35 ? 545  LYS A CD  1 
ATOM   4127 C  CE  . LYS A 1 545 ? -6.319  2.569   5.154   1.00 92.70 ? 545  LYS A CE  1 
ATOM   4128 N  NZ  . LYS A 1 545 ? -6.680  3.740   4.302   1.00 98.68 ? 545  LYS A NZ  1 
ATOM   4129 N  N   . ILE A 1 546 ? -4.426  5.269   9.905   1.00 27.91 ? 546  ILE A N   1 
ATOM   4130 C  CA  . ILE A 1 546 ? -4.799  6.532   10.527  1.00 41.14 ? 546  ILE A CA  1 
ATOM   4131 C  C   . ILE A 1 546 ? -5.416  7.275   9.313   1.00 44.67 ? 546  ILE A C   1 
ATOM   4132 O  O   . ILE A 1 546 ? -4.717  7.670   8.358   1.00 37.06 ? 546  ILE A O   1 
ATOM   4133 C  CB  . ILE A 1 546 ? -3.664  7.338   11.262  1.00 30.85 ? 546  ILE A CB  1 
ATOM   4134 C  CG1 . ILE A 1 546 ? -2.955  6.416   12.316  1.00 25.30 ? 546  ILE A CG1 1 
ATOM   4135 C  CG2 . ILE A 1 546 ? -4.265  8.659   11.852  1.00 21.37 ? 546  ILE A CG2 1 
ATOM   4136 C  CD1 . ILE A 1 546 ? -1.862  7.182   13.064  1.00 17.08 ? 546  ILE A CD1 1 
ATOM   4137 N  N   . THR A 1 547 ? -6.724  7.391   9.425   1.00 40.78 ? 547  THR A N   1 
ATOM   4138 C  CA  . THR A 1 547 ? -7.514  8.030   8.324   1.00 44.09 ? 547  THR A CA  1 
ATOM   4139 C  C   . THR A 1 547 ? -7.588  9.530   8.479   1.00 45.76 ? 547  THR A C   1 
ATOM   4140 O  O   . THR A 1 547 ? -7.499  10.298  7.488   1.00 45.14 ? 547  THR A O   1 
ATOM   4141 C  CB  . THR A 1 547 ? -8.835  7.192   8.178   1.00 33.38 ? 547  THR A CB  1 
ATOM   4142 O  OG1 . THR A 1 547 ? -9.693  7.469   9.337   1.00 39.62 ? 547  THR A OG1 1 
ATOM   4143 C  CG2 . THR A 1 547 ? -8.570  5.678   8.127   1.00 29.49 ? 547  THR A CG2 1 
ATOM   4144 N  N   . ARG A 1 548 ? -7.643  9.983   9.723   1.00 46.11 ? 548  ARG A N   1 
ATOM   4145 C  CA  . ARG A 1 548 ? -7.693  11.418  9.978   1.00 47.89 ? 548  ARG A CA  1 
ATOM   4146 C  C   . ARG A 1 548 ? -6.929  11.854  11.244  1.00 32.83 ? 548  ARG A C   1 
ATOM   4147 O  O   . ARG A 1 548 ? -6.971  11.118  12.223  1.00 33.74 ? 548  ARG A O   1 
ATOM   4148 C  CB  . ARG A 1 548 ? -9.156  11.865  10.173  1.00 51.73 ? 548  ARG A CB  1 
ATOM   4149 C  CG  . ARG A 1 548 ? -9.433  13.212  9.544   1.00 70.64 ? 548  ARG A CG  1 
ATOM   4150 C  CD  . ARG A 1 548 ? -10.459 14.081  10.225  1.00 83.94 ? 548  ARG A CD  1 
ATOM   4151 N  NE  . ARG A 1 548 ? -9.998  15.448  10.092  1.00 96.43 ? 548  ARG A NE  1 
ATOM   4152 C  CZ  . ARG A 1 548 ? -10.250 16.696  10.375  1.00 95.13 ? 548  ARG A CZ  1 
ATOM   4153 N  NH1 . ARG A 1 548 ? -9.340  17.624  10.038  1.00 92.93 ? 548  ARG A NH1 1 
ATOM   4154 N  NH2 . ARG A 1 548 ? -11.327 17.109  11.033  1.00 99.99 ? 548  ARG A NH2 1 
ATOM   4155 N  N   . THR A 1 549 ? -6.378  13.032  11.155  1.00 37.38 ? 549  THR A N   1 
ATOM   4156 C  CA  . THR A 1 549 ? -5.664  13.746  12.217  1.00 47.88 ? 549  THR A CA  1 
ATOM   4157 C  C   . THR A 1 549 ? -6.219  15.195  12.273  1.00 38.29 ? 549  THR A C   1 
ATOM   4158 O  O   . THR A 1 549 ? -6.144  15.926  11.290  1.00 37.28 ? 549  THR A O   1 
ATOM   4159 C  CB  . THR A 1 549 ? -4.081  13.781  12.242  1.00 43.79 ? 549  THR A CB  1 
ATOM   4160 O  OG1 . THR A 1 549 ? -3.650  14.440  10.992  1.00 43.67 ? 549  THR A OG1 1 
ATOM   4161 C  CG2 . THR A 1 549 ? -3.485  12.389  12.488  1.00 35.14 ? 549  THR A CG2 1 
ATOM   4162 N  N   . SER A 1 550 ? -6.733  15.578  13.428  1.00 30.38 ? 550  SER A N   1 
ATOM   4163 C  CA  . SER A 1 550 ? -7.338  16.912  13.601  1.00 29.46 ? 550  SER A CA  1 
ATOM   4164 C  C   . SER A 1 550 ? -6.351  18.029  13.354  1.00 40.63 ? 550  SER A C   1 
ATOM   4165 O  O   . SER A 1 550 ? -6.721  19.182  13.022  1.00 31.13 ? 550  SER A O   1 
ATOM   4166 C  CB  . SER A 1 550 ? -7.951  16.934  14.994  1.00 29.23 ? 550  SER A CB  1 
ATOM   4167 O  OG  . SER A 1 550 ? -6.964  16.851  15.992  1.00 28.07 ? 550  SER A OG  1 
ATOM   4168 N  N   . THR A 1 551 ? -5.069  17.703  13.562  1.00 24.62 ? 551  THR A N   1 
ATOM   4169 C  CA  . THR A 1 551 ? -3.965  18.641  13.419  1.00 27.55 ? 551  THR A CA  1 
ATOM   4170 C  C   . THR A 1 551 ? -2.627  17.885  13.326  1.00 26.36 ? 551  THR A C   1 
ATOM   4171 O  O   . THR A 1 551 ? -2.502  16.700  13.735  1.00 24.42 ? 551  THR A O   1 
ATOM   4172 C  CB  . THR A 1 551 ? -3.913  19.608  14.668  1.00 36.51 ? 551  THR A CB  1 
ATOM   4173 O  OG1 . THR A 1 551 ? -3.025  20.695  14.308  1.00 34.35 ? 551  THR A OG1 1 
ATOM   4174 C  CG2 . THR A 1 551 ? -3.551  18.993  16.024  1.00 34.89 ? 551  THR A CG2 1 
ATOM   4175 N  N   . GLN A 1 552 ? -1.714  18.610  12.703  1.00 27.94 ? 552  GLN A N   1 
ATOM   4176 C  CA  . GLN A 1 552 ? -0.368  17.979  12.566  1.00 33.69 ? 552  GLN A CA  1 
ATOM   4177 C  C   . GLN A 1 552 ? 0.641   18.813  13.326  1.00 34.48 ? 552  GLN A C   1 
ATOM   4178 O  O   . GLN A 1 552 ? 1.830   18.468  13.215  1.00 35.08 ? 552  GLN A O   1 
ATOM   4179 C  CB  . GLN A 1 552 ? 0.018   17.509  11.177  1.00 50.13 ? 552  GLN A CB  1 
ATOM   4180 C  CG  . GLN A 1 552 ? -0.830  16.259  10.874  1.00 73.00 ? 552  GLN A CG  1 
ATOM   4181 C  CD  . GLN A 1 552 ? -0.332  15.132  10.018  1.00 88.00 ? 552  GLN A CD  1 
ATOM   4182 O  OE1 . GLN A 1 552 ? -1.030  14.128  9.718   1.00 90.88 ? 552  GLN A OE1 1 
ATOM   4183 N  NE2 . GLN A 1 552 ? 0.910   15.205  9.540   1.00 87.74 ? 552  GLN A NE2 1 
ATOM   4184 N  N   . SER A 1 553 ? 0.201   19.808  14.069  1.00 24.62 ? 553  SER A N   1 
ATOM   4185 C  CA  . SER A 1 553 ? 1.033   20.705  14.886  1.00 28.96 ? 553  SER A CA  1 
ATOM   4186 C  C   . SER A 1 553 ? 0.334   20.989  16.216  1.00 39.20 ? 553  SER A C   1 
ATOM   4187 O  O   . SER A 1 553 ? -0.739  21.601  16.300  1.00 43.42 ? 553  SER A O   1 
ATOM   4188 C  CB  . SER A 1 553 ? 1.540   21.947  14.181  1.00 20.04 ? 553  SER A CB  1 
ATOM   4189 O  OG  . SER A 1 553 ? 2.280   22.697  15.156  1.00 41.97 ? 553  SER A OG  1 
ATOM   4190 N  N   . VAL A 1 554 ? 0.881   20.585  17.347  1.00 26.10 ? 554  VAL A N   1 
ATOM   4191 C  CA  . VAL A 1 554 ? 0.270   20.719  18.668  1.00 14.44 ? 554  VAL A CA  1 
ATOM   4192 C  C   . VAL A 1 554 ? 1.228   21.240  19.685  1.00 26.96 ? 554  VAL A C   1 
ATOM   4193 O  O   . VAL A 1 554 ? 2.452   21.011  19.622  1.00 22.50 ? 554  VAL A O   1 
ATOM   4194 C  CB  . VAL A 1 554 ? -0.375  19.356  18.997  1.00 16.89 ? 554  VAL A CB  1 
ATOM   4195 C  CG1 . VAL A 1 554 ? 0.680   18.242  19.261  1.00 19.56 ? 554  VAL A CG1 1 
ATOM   4196 C  CG2 . VAL A 1 554 ? -1.247  19.337  20.255  1.00 18.39 ? 554  VAL A CG2 1 
ATOM   4197 N  N   . LYS A 1 555 ? 0.651   21.988  20.610  1.00 23.26 ? 555  LYS A N   1 
ATOM   4198 C  CA  . LYS A 1 555 ? 1.379   22.565  21.723  1.00 17.13 ? 555  LYS A CA  1 
ATOM   4199 C  C   . LYS A 1 555 ? 1.356   21.493  22.825  1.00 23.10 ? 555  LYS A C   1 
ATOM   4200 O  O   . LYS A 1 555 ? 0.374   20.721  22.937  1.00 24.59 ? 555  LYS A O   1 
ATOM   4201 C  CB  . LYS A 1 555 ? 0.723   23.747  22.404  1.00 21.07 ? 555  LYS A CB  1 
ATOM   4202 C  CG  . LYS A 1 555 ? 1.336   25.103  22.220  1.00 53.95 ? 555  LYS A CG  1 
ATOM   4203 C  CD  . LYS A 1 555 ? 0.981   25.987  23.452  1.00 75.25 ? 555  LYS A CD  1 
ATOM   4204 C  CE  . LYS A 1 555 ? 1.643   27.347  23.311  1.00 88.15 ? 555  LYS A CE  1 
ATOM   4205 N  NZ  . LYS A 1 555 ? 1.672   28.108  24.584  1.00 98.33 ? 555  LYS A NZ  1 
ATOM   4206 N  N   . VAL A 1 556 ? 2.404   21.526  23.629  1.00 22.39 ? 556  VAL A N   1 
ATOM   4207 C  CA  . VAL A 1 556 ? 2.447   20.610  24.798  1.00 25.03 ? 556  VAL A CA  1 
ATOM   4208 C  C   . VAL A 1 556 ? 1.156   20.856  25.592  1.00 15.87 ? 556  VAL A C   1 
ATOM   4209 O  O   . VAL A 1 556 ? 0.714   22.019  25.815  1.00 21.31 ? 556  VAL A O   1 
ATOM   4210 C  CB  . VAL A 1 556 ? 3.707   20.674  25.693  1.00 20.09 ? 556  VAL A CB  1 
ATOM   4211 C  CG1 . VAL A 1 556 ? 4.975   20.175  24.993  1.00 14.41 ? 556  VAL A CG1 1 
ATOM   4212 C  CG2 . VAL A 1 556 ? 4.012   22.152  26.005  1.00 17.94 ? 556  VAL A CG2 1 
ATOM   4213 N  N   . GLY A 1 557 ? 0.543   19.765  25.990  1.00 17.39 ? 557  GLY A N   1 
ATOM   4214 C  CA  . GLY A 1 557 ? -0.721  19.883  26.766  1.00 26.19 ? 557  GLY A CA  1 
ATOM   4215 C  C   . GLY A 1 557 ? -1.940  19.861  25.827  1.00 32.45 ? 557  GLY A C   1 
ATOM   4216 O  O   . GLY A 1 557 ? -3.055  19.702  26.308  1.00 24.00 ? 557  GLY A O   1 
ATOM   4217 N  N   . GLY A 1 558 ? -1.745  19.949  24.528  1.00 27.32 ? 558  GLY A N   1 
ATOM   4218 C  CA  . GLY A 1 558 ? -2.706  19.957  23.456  1.00 21.10 ? 558  GLY A CA  1 
ATOM   4219 C  C   . GLY A 1 558 ? -3.321  18.614  23.181  1.00 25.90 ? 558  GLY A C   1 
ATOM   4220 O  O   . GLY A 1 558 ? -2.840  17.520  23.494  1.00 24.49 ? 558  GLY A O   1 
ATOM   4221 N  N   . ARG A 1 559 ? -4.488  18.640  22.580  1.00 29.01 ? 559  ARG A N   1 
ATOM   4222 C  CA  . ARG A 1 559 ? -5.237  17.426  22.227  1.00 40.21 ? 559  ARG A CA  1 
ATOM   4223 C  C   . ARG A 1 559 ? -5.301  17.277  20.705  1.00 27.40 ? 559  ARG A C   1 
ATOM   4224 O  O   . ARG A 1 559 ? -5.301  18.215  19.943  1.00 25.61 ? 559  ARG A O   1 
ATOM   4225 C  CB  . ARG A 1 559 ? -6.560  17.320  22.959  1.00 52.54 ? 559  ARG A CB  1 
ATOM   4226 C  CG  . ARG A 1 559 ? -6.162  17.044  24.426  1.00 80.70 ? 559  ARG A CG  1 
ATOM   4227 C  CD  . ARG A 1 559 ? -7.204  17.560  25.317  1.00 99.63 ? 559  ARG A CD  1 
ATOM   4228 N  NE  . ARG A 1 559 ? -7.042  17.387  26.752  1.00 99.99 ? 559  ARG A NE  1 
ATOM   4229 C  CZ  . ARG A 1 559 ? -8.177  17.510  27.496  1.00 99.99 ? 559  ARG A CZ  1 
ATOM   4230 N  NH1 . ARG A 1 559 ? -9.360  17.691  26.893  1.00 99.99 ? 559  ARG A NH1 1 
ATOM   4231 N  NH2 . ARG A 1 559 ? -8.091  17.501  28.834  1.00 99.99 ? 559  ARG A NH2 1 
ATOM   4232 N  N   . ILE A 1 560 ? -5.246  16.013  20.346  1.00 25.68 ? 560  ILE A N   1 
ATOM   4233 C  CA  . ILE A 1 560 ? -5.280  15.500  19.017  1.00 24.47 ? 560  ILE A CA  1 
ATOM   4234 C  C   . ILE A 1 560 ? -6.363  14.412  18.978  1.00 25.47 ? 560  ILE A C   1 
ATOM   4235 O  O   . ILE A 1 560 ? -6.510  13.525  19.844  1.00 23.17 ? 560  ILE A O   1 
ATOM   4236 C  CB  . ILE A 1 560 ? -3.932  14.970  18.396  1.00 21.92 ? 560  ILE A CB  1 
ATOM   4237 C  CG1 . ILE A 1 560 ? -2.853  16.054  18.628  1.00 13.29 ? 560  ILE A CG1 1 
ATOM   4238 C  CG2 . ILE A 1 560 ? -4.104  14.517  16.923  1.00 22.19 ? 560  ILE A CG2 1 
ATOM   4239 C  CD1 . ILE A 1 560 ? -1.479  15.636  18.104  1.00 20.16 ? 560  ILE A CD1 1 
ATOM   4240 N  N   . THR A 1 561 ? -7.092  14.593  17.843  1.00 28.69 ? 561  THR A N   1 
ATOM   4241 C  CA  . THR A 1 561 ? -8.149  13.595  17.566  1.00 35.49 ? 561  THR A CA  1 
ATOM   4242 C  C   . THR A 1 561 ? -7.789  12.879  16.269  1.00 23.66 ? 561  THR A C   1 
ATOM   4243 O  O   . THR A 1 561 ? -7.371  13.555  15.321  1.00 22.80 ? 561  THR A O   1 
ATOM   4244 C  CB  . THR A 1 561 ? -9.596  14.241  17.504  1.00 40.20 ? 561  THR A CB  1 
ATOM   4245 O  OG1 . THR A 1 561 ? -9.722  14.899  18.787  1.00 37.57 ? 561  THR A OG1 1 
ATOM   4246 C  CG2 . THR A 1 561 ? -10.703 13.185  17.345  1.00 46.92 ? 561  THR A CG2 1 
ATOM   4247 N  N   . ILE A 1 562 ? -7.988  11.590  16.255  1.00 24.11 ? 562  ILE A N   1 
ATOM   4248 C  CA  . ILE A 1 562 ? -7.761  10.794  15.064  1.00 29.84 ? 562  ILE A CA  1 
ATOM   4249 C  C   . ILE A 1 562 ? -8.938  9.842   14.743  1.00 25.15 ? 562  ILE A C   1 
ATOM   4250 O  O   . ILE A 1 562 ? -9.641  9.395   15.673  1.00 16.99 ? 562  ILE A O   1 
ATOM   4251 C  CB  . ILE A 1 562 ? -6.453  9.941   15.356  1.00 16.99 ? 562  ILE A CB  1 
ATOM   4252 C  CG1 . ILE A 1 562 ? -6.569  9.021   16.576  1.00 15.50 ? 562  ILE A CG1 1 
ATOM   4253 C  CG2 . ILE A 1 562 ? -5.256  10.915  15.619  1.00 20.00 ? 562  ILE A CG2 1 
ATOM   4254 C  CD1 . ILE A 1 562 ? -5.744  7.700   16.519  1.00 23.83 ? 562  ILE A CD1 1 
ATOM   4255 N  N   . SER A 1 563 ? -9.004  9.450   13.457  1.00 23.78 ? 563  SER A N   1 
ATOM   4256 C  CA  . SER A 1 563 ? -10.007 8.377   13.158  1.00 27.24 ? 563  SER A CA  1 
ATOM   4257 C  C   . SER A 1 563 ? -9.089  7.263   12.600  1.00 19.23 ? 563  SER A C   1 
ATOM   4258 O  O   . SER A 1 563 ? -8.056  7.569   11.992  1.00 18.19 ? 563  SER A O   1 
ATOM   4259 C  CB  . SER A 1 563 ? -11.076 8.689   12.123  1.00 25.11 ? 563  SER A CB  1 
ATOM   4260 O  OG  . SER A 1 563 ? -11.146 10.116  12.097  1.00 46.11 ? 563  SER A OG  1 
ATOM   4261 N  N   . THR A 1 564 ? -9.401  6.031   12.845  1.00 16.68 ? 564  THR A N   1 
ATOM   4262 C  CA  . THR A 1 564 ? -8.653  4.903   12.325  1.00 22.60 ? 564  THR A CA  1 
ATOM   4263 C  C   . THR A 1 564 ? -9.656  4.061   11.526  1.00 38.36 ? 564  THR A C   1 
ATOM   4264 O  O   . THR A 1 564 ? -10.858 4.362   11.612  1.00 28.81 ? 564  THR A O   1 
ATOM   4265 C  CB  . THR A 1 564 ? -7.990  4.118   13.507  1.00 25.83 ? 564  THR A CB  1 
ATOM   4266 O  OG1 . THR A 1 564 ? -9.199  3.817   14.243  1.00 23.12 ? 564  THR A OG1 1 
ATOM   4267 C  CG2 . THR A 1 564 ? -7.041  5.066   14.212  1.00 17.44 ? 564  THR A CG2 1 
ATOM   4268 N  N   . ASP A 1 565 ? -9.124  3.058   10.881  1.00 33.29 ? 565  ASP A N   1 
ATOM   4269 C  CA  . ASP A 1 565 ? -9.944  2.136   10.070  1.00 42.53 ? 565  ASP A CA  1 
ATOM   4270 C  C   . ASP A 1 565 ? -10.352 0.885   10.851  1.00 43.67 ? 565  ASP A C   1 
ATOM   4271 O  O   . ASP A 1 565 ? -11.122 0.018   10.429  1.00 50.99 ? 565  ASP A O   1 
ATOM   4272 C  CB  . ASP A 1 565 ? -9.120  1.823   8.805   1.00 36.90 ? 565  ASP A CB  1 
ATOM   4273 C  CG  . ASP A 1 565 ? -8.019  0.805   9.100   1.00 39.49 ? 565  ASP A CG  1 
ATOM   4274 O  OD1 . ASP A 1 565 ? -7.572  0.535   10.246  1.00 30.98 ? 565  ASP A OD1 1 
ATOM   4275 O  OD2 . ASP A 1 565 ? -7.544  0.216   8.118   1.00 45.16 ? 565  ASP A OD2 1 
ATOM   4276 N  N   . SER A 1 566 ? -9.818  0.797   12.056  1.00 24.48 ? 566  SER A N   1 
ATOM   4277 C  CA  . SER A 1 566 ? -10.022 -0.374  12.871  1.00 35.58 ? 566  SER A CA  1 
ATOM   4278 C  C   . SER A 1 566 ? -9.800  0.174   14.269  1.00 23.81 ? 566  SER A C   1 
ATOM   4279 O  O   . SER A 1 566 ? -9.314  1.307   14.309  1.00 36.41 ? 566  SER A O   1 
ATOM   4280 C  CB  . SER A 1 566 ? -9.081  -1.550  12.608  1.00 45.73 ? 566  SER A CB  1 
ATOM   4281 O  OG  . SER A 1 566 ? -7.721  -1.362  12.401  1.00 42.27 ? 566  SER A OG  1 
ATOM   4282 N  N   . SER A 1 567 ? -10.280 -0.662  15.124  1.00 28.23 ? 567  SER A N   1 
ATOM   4283 C  CA  . SER A 1 567 ? -10.215 -0.330  16.546  1.00 55.45 ? 567  SER A CA  1 
ATOM   4284 C  C   . SER A 1 567 ? -8.736  -0.455  16.979  1.00 52.44 ? 567  SER A C   1 
ATOM   4285 O  O   . SER A 1 567 ? -8.085  -1.427  16.602  1.00 57.51 ? 567  SER A O   1 
ATOM   4286 C  CB  . SER A 1 567 ? -11.191 -1.152  17.352  1.00 60.92 ? 567  SER A CB  1 
ATOM   4287 O  OG  . SER A 1 567 ? -11.086 -2.540  17.267  1.00 66.69 ? 567  SER A OG  1 
ATOM   4288 N  N   . ILE A 1 568 ? -8.368  0.543   17.766  1.00 48.87 ? 568  ILE A N   1 
ATOM   4289 C  CA  . ILE A 1 568 ? -6.953  0.518   18.250  1.00 31.60 ? 568  ILE A CA  1 
ATOM   4290 C  C   . ILE A 1 568 ? -6.892  0.306   19.743  1.00 40.47 ? 568  ILE A C   1 
ATOM   4291 O  O   . ILE A 1 568 ? -7.761  0.734   20.505  1.00 48.13 ? 568  ILE A O   1 
ATOM   4292 C  CB  . ILE A 1 568 ? -6.152  1.661   17.584  1.00 27.04 ? 568  ILE A CB  1 
ATOM   4293 C  CG1 . ILE A 1 568 ? -6.813  3.002   17.846  1.00 22.02 ? 568  ILE A CG1 1 
ATOM   4294 C  CG2 . ILE A 1 568 ? -5.917  1.432   16.041  1.00 23.74 ? 568  ILE A CG2 1 
ATOM   4295 C  CD1 . ILE A 1 568 ? -5.772  4.125   18.061  1.00 36.92 ? 568  ILE A CD1 1 
ATOM   4296 N  N   . SER A 1 569 ? -5.830  -0.442  20.136  1.00 21.06 ? 569  SER A N   1 
ATOM   4297 C  CA  . SER A 1 569 ? -5.668  -0.723  21.538  1.00 34.97 ? 569  SER A CA  1 
ATOM   4298 C  C   . SER A 1 569 ? -4.639  0.195   22.229  1.00 39.28 ? 569  SER A C   1 
ATOM   4299 O  O   . SER A 1 569 ? -4.851  0.533   23.391  1.00 35.23 ? 569  SER A O   1 
ATOM   4300 C  CB  . SER A 1 569 ? -5.406  -2.185  21.688  1.00 41.70 ? 569  SER A CB  1 
ATOM   4301 O  OG  . SER A 1 569 ? -4.463  -2.724  20.802  1.00 59.18 ? 569  SER A OG  1 
ATOM   4302 N  N   . LYS A 1 570 ? -3.617  0.579   21.523  1.00 35.42 ? 570  LYS A N   1 
ATOM   4303 C  CA  . LYS A 1 570 ? -2.487  1.401   22.048  1.00 25.15 ? 570  LYS A CA  1 
ATOM   4304 C  C   . LYS A 1 570 ? -1.971  2.410   21.081  1.00 15.30 ? 570  LYS A C   1 
ATOM   4305 O  O   . LYS A 1 570 ? -2.196  2.319   19.863  1.00 24.82 ? 570  LYS A O   1 
ATOM   4306 C  CB  . LYS A 1 570 ? -1.397  0.342   22.187  1.00 33.50 ? 570  LYS A CB  1 
ATOM   4307 C  CG  . LYS A 1 570 ? -1.476  -0.343  23.521  1.00 53.79 ? 570  LYS A CG  1 
ATOM   4308 C  CD  . LYS A 1 570 ? -0.522  -1.527  23.576  1.00 71.58 ? 570  LYS A CD  1 
ATOM   4309 C  CE  . LYS A 1 570 ? -0.826  -2.343  24.818  1.00 91.48 ? 570  LYS A CE  1 
ATOM   4310 N  NZ  . LYS A 1 570 ? -0.878  -1.455  26.008  1.00 95.71 ? 570  LYS A NZ  1 
ATOM   4311 N  N   . ALA A 1 571 ? -1.267  3.434   21.585  1.00 13.54 ? 571  ALA A N   1 
ATOM   4312 C  CA  . ALA A 1 571 ? -0.766  4.438   20.675  1.00 9.16  ? 571  ALA A CA  1 
ATOM   4313 C  C   . ALA A 1 571 ? 0.535   4.944   21.388  1.00 11.03 ? 571  ALA A C   1 
ATOM   4314 O  O   . ALA A 1 571 ? 0.545   5.032   22.628  1.00 13.29 ? 571  ALA A O   1 
ATOM   4315 C  CB  . ALA A 1 571 ? -1.752  5.599   20.610  1.00 9.20  ? 571  ALA A CB  1 
ATOM   4316 N  N   . SER A 1 572 ? 1.458   5.373   20.562  1.00 9.78  ? 572  SER A N   1 
ATOM   4317 C  CA  . SER A 1 572 ? 2.681   5.964   21.207  1.00 14.91 ? 572  SER A CA  1 
ATOM   4318 C  C   . SER A 1 572 ? 3.186   7.076   20.300  1.00 20.34 ? 572  SER A C   1 
ATOM   4319 O  O   . SER A 1 572 ? 2.854   7.157   19.076  1.00 20.40 ? 572  SER A O   1 
ATOM   4320 C  CB  . SER A 1 572 ? 3.546   4.705   21.467  1.00 15.37 ? 572  SER A CB  1 
ATOM   4321 O  OG  . SER A 1 572 ? 4.269   4.468   20.270  1.00 21.53 ? 572  SER A OG  1 
ATOM   4322 N  N   . LEU A 1 573 ? 3.941   8.003   20.843  1.00 9.10  ? 573  LEU A N   1 
ATOM   4323 C  CA  . LEU A 1 573 ? 4.582   9.090   20.112  1.00 7.81  ? 573  LEU A CA  1 
ATOM   4324 C  C   . LEU A 1 573 ? 6.100   8.784   20.266  1.00 7.99  ? 573  LEU A C   1 
ATOM   4325 O  O   . LEU A 1 573 ? 6.591   8.559   21.398  1.00 12.34 ? 573  LEU A O   1 
ATOM   4326 C  CB  . LEU A 1 573 ? 4.355   10.469  20.660  1.00 11.48 ? 573  LEU A CB  1 
ATOM   4327 C  CG  . LEU A 1 573 ? 3.134   11.302  20.380  1.00 28.47 ? 573  LEU A CG  1 
ATOM   4328 C  CD1 . LEU A 1 573 ? 3.209   12.654  21.060  1.00 31.35 ? 573  LEU A CD1 1 
ATOM   4329 C  CD2 . LEU A 1 573 ? 2.960   11.475  18.862  1.00 21.94 ? 573  LEU A CD2 1 
ATOM   4330 N  N   . ILE A 1 574 ? 6.710   8.777   19.103  1.00 10.89 ? 574  ILE A N   1 
ATOM   4331 C  CA  . ILE A 1 574 ? 8.192   8.519   19.103  1.00 13.05 ? 574  ILE A CA  1 
ATOM   4332 C  C   . ILE A 1 574 ? 8.937   9.690   18.459  1.00 10.05 ? 574  ILE A C   1 
ATOM   4333 O  O   . ILE A 1 574 ? 8.702   9.958   17.225  1.00 9.47  ? 574  ILE A O   1 
ATOM   4334 C  CB  . ILE A 1 574 ? 8.493   7.105   18.490  1.00 17.31 ? 574  ILE A CB  1 
ATOM   4335 C  CG1 . ILE A 1 574 ? 7.816   6.057   19.374  1.00 11.25 ? 574  ILE A CG1 1 
ATOM   4336 C  CG2 . ILE A 1 574 ? 10.052  6.962   18.465  1.00 16.67 ? 574  ILE A CG2 1 
ATOM   4337 C  CD1 . ILE A 1 574 ? 8.115   4.605   19.245  1.00 25.60 ? 574  ILE A CD1 1 
ATOM   4338 N  N   . ARG A 1 575 ? 9.779   10.342  19.255  1.00 5.00  ? 575  ARG A N   1 
ATOM   4339 C  CA  . ARG A 1 575 ? 10.469  11.528  18.686  1.00 5.00  ? 575  ARG A CA  1 
ATOM   4340 C  C   . ARG A 1 575 ? 11.461  11.023  17.634  1.00 11.33 ? 575  ARG A C   1 
ATOM   4341 O  O   . ARG A 1 575 ? 12.126  10.015  17.837  1.00 7.00  ? 575  ARG A O   1 
ATOM   4342 C  CB  . ARG A 1 575 ? 11.157  12.239  19.843  1.00 5.00  ? 575  ARG A CB  1 
ATOM   4343 C  CG  . ARG A 1 575 ? 11.604  13.646  19.485  1.00 5.00  ? 575  ARG A CG  1 
ATOM   4344 C  CD  . ARG A 1 575 ? 11.870  14.499  20.664  1.00 5.04  ? 575  ARG A CD  1 
ATOM   4345 N  NE  . ARG A 1 575 ? 12.287  15.855  20.324  1.00 6.34  ? 575  ARG A NE  1 
ATOM   4346 C  CZ  . ARG A 1 575 ? 13.515  16.221  19.908  1.00 9.69  ? 575  ARG A CZ  1 
ATOM   4347 N  NH1 . ARG A 1 575 ? 14.464  15.301  19.781  1.00 6.70  ? 575  ARG A NH1 1 
ATOM   4348 N  NH2 . ARG A 1 575 ? 13.778  17.520  19.647  1.00 5.17  ? 575  ARG A NH2 1 
ATOM   4349 N  N   . TYR A 1 576 ? 11.554  11.692  16.503  1.00 8.25  ? 576  TYR A N   1 
ATOM   4350 C  CA  . TYR A 1 576 ? 12.476  11.400  15.407  1.00 16.29 ? 576  TYR A CA  1 
ATOM   4351 C  C   . TYR A 1 576 ? 13.929  11.396  15.949  1.00 15.18 ? 576  TYR A C   1 
ATOM   4352 O  O   . TYR A 1 576 ? 14.367  12.187  16.731  1.00 10.21 ? 576  TYR A O   1 
ATOM   4353 C  CB  . TYR A 1 576 ? 12.287  12.486  14.323  1.00 12.81 ? 576  TYR A CB  1 
ATOM   4354 C  CG  . TYR A 1 576 ? 11.176  12.154  13.353  1.00 18.17 ? 576  TYR A CG  1 
ATOM   4355 C  CD1 . TYR A 1 576 ? 11.401  11.371  12.209  1.00 20.51 ? 576  TYR A CD1 1 
ATOM   4356 C  CD2 . TYR A 1 576 ? 9.890   12.631  13.547  1.00 18.18 ? 576  TYR A CD2 1 
ATOM   4357 C  CE1 . TYR A 1 576 ? 10.390  11.082  11.280  1.00 16.21 ? 576  TYR A CE1 1 
ATOM   4358 C  CE2 . TYR A 1 576 ? 8.868   12.331  12.671  1.00 13.85 ? 576  TYR A CE2 1 
ATOM   4359 C  CZ  . TYR A 1 576 ? 9.127   11.545  11.540  1.00 10.98 ? 576  TYR A CZ  1 
ATOM   4360 O  OH  . TYR A 1 576 ? 8.117   11.267  10.685  1.00 18.13 ? 576  TYR A OH  1 
ATOM   4361 N  N   . GLY A 1 577 ? 14.726  10.456  15.470  1.00 13.08 ? 577  GLY A N   1 
ATOM   4362 C  CA  . GLY A 1 577 ? 16.111  10.208  15.865  1.00 11.04 ? 577  GLY A CA  1 
ATOM   4363 C  C   . GLY A 1 577 ? 17.203  10.811  14.995  1.00 9.76  ? 577  GLY A C   1 
ATOM   4364 O  O   . GLY A 1 577 ? 16.949  11.108  13.812  1.00 13.13 ? 577  GLY A O   1 
ATOM   4365 N  N   . THR A 1 578 ? 18.376  10.853  15.599  1.00 9.73  ? 578  THR A N   1 
ATOM   4366 C  CA  . THR A 1 578 ? 19.608  11.271  14.944  1.00 6.84  ? 578  THR A CA  1 
ATOM   4367 C  C   . THR A 1 578 ? 20.653  10.315  15.497  1.00 10.98 ? 578  THR A C   1 
ATOM   4368 O  O   . THR A 1 578 ? 20.515  9.900   16.676  1.00 9.91  ? 578  THR A O   1 
ATOM   4369 C  CB  . THR A 1 578 ? 20.008  12.787  15.140  1.00 6.07  ? 578  THR A CB  1 
ATOM   4370 O  OG1 . THR A 1 578 ? 20.272  12.833  16.554  1.00 14.73 ? 578  THR A OG1 1 
ATOM   4371 C  CG2 . THR A 1 578 ? 18.957  13.695  14.608  1.00 5.00  ? 578  THR A CG2 1 
ATOM   4372 N  N   . ALA A 1 579 ? 21.681  9.974   14.690  1.00 5.00  ? 579  ALA A N   1 
ATOM   4373 C  CA  . ALA A 1 579 ? 22.593  8.996   15.330  1.00 6.26  ? 579  ALA A CA  1 
ATOM   4374 C  C   . ALA A 1 579 ? 24.053  9.036   14.782  1.00 8.11  ? 579  ALA A C   1 
ATOM   4375 O  O   . ALA A 1 579 ? 24.161  9.240   13.590  1.00 10.86 ? 579  ALA A O   1 
ATOM   4376 C  CB  . ALA A 1 579 ? 22.077  7.586   14.945  1.00 5.00  ? 579  ALA A CB  1 
ATOM   4377 N  N   . THR A 1 580 ? 24.963  8.875   15.683  1.00 7.69  ? 580  THR A N   1 
ATOM   4378 C  CA  . THR A 1 580 ? 26.383  8.700   15.299  1.00 6.38  ? 580  THR A CA  1 
ATOM   4379 C  C   . THR A 1 580 ? 27.186  8.176   16.466  1.00 13.07 ? 580  THR A C   1 
ATOM   4380 O  O   . THR A 1 580 ? 26.880  8.557   17.600  1.00 8.32  ? 580  THR A O   1 
ATOM   4381 C  CB  . THR A 1 580 ? 26.930  10.006  14.642  1.00 5.00  ? 580  THR A CB  1 
ATOM   4382 O  OG1 . THR A 1 580 ? 28.297  9.643   14.234  1.00 11.63 ? 580  THR A OG1 1 
ATOM   4383 C  CG2 . THR A 1 580 ? 27.151  11.032  15.757  1.00 7.61  ? 580  THR A CG2 1 
ATOM   4384 N  N   . HIS A 1 581 ? 28.212  7.295   16.262  1.00 10.00 ? 581  HIS A N   1 
ATOM   4385 C  CA  . HIS A 1 581 ? 29.050  6.832   17.370  1.00 5.36  ? 581  HIS A CA  1 
ATOM   4386 C  C   . HIS A 1 581 ? 28.389  6.391   18.647  1.00 10.55 ? 581  HIS A C   1 
ATOM   4387 O  O   . HIS A 1 581 ? 28.868  6.704   19.768  1.00 7.29  ? 581  HIS A O   1 
ATOM   4388 C  CB  . HIS A 1 581 ? 29.935  8.095   17.812  1.00 7.86  ? 581  HIS A CB  1 
ATOM   4389 C  CG  . HIS A 1 581 ? 30.953  8.358   16.718  1.00 12.63 ? 581  HIS A CG  1 
ATOM   4390 N  ND1 . HIS A 1 581 ? 30.720  8.950   15.494  1.00 10.63 ? 581  HIS A ND1 1 
ATOM   4391 C  CD2 . HIS A 1 581 ? 32.264  8.053   16.744  1.00 5.00  ? 581  HIS A CD2 1 
ATOM   4392 C  CE1 . HIS A 1 581 ? 31.829  8.971   14.792  1.00 5.00  ? 581  HIS A CE1 1 
ATOM   4393 N  NE2 . HIS A 1 581 ? 32.723  8.555   15.559  1.00 9.77  ? 581  HIS A NE2 1 
ATOM   4394 N  N   . THR A 1 582 ? 27.309  5.650   18.484  1.00 11.97 ? 582  THR A N   1 
ATOM   4395 C  CA  . THR A 1 582 ? 26.413  5.068   19.458  1.00 8.18  ? 582  THR A CA  1 
ATOM   4396 C  C   . THR A 1 582 ? 25.401  6.040   20.096  1.00 15.50 ? 582  THR A C   1 
ATOM   4397 O  O   . THR A 1 582 ? 24.493  5.664   20.835  1.00 10.11 ? 582  THR A O   1 
ATOM   4398 C  CB  . THR A 1 582 ? 27.156  4.330   20.668  1.00 5.00  ? 582  THR A CB  1 
ATOM   4399 O  OG1 . THR A 1 582 ? 27.691  5.324   21.562  1.00 7.70  ? 582  THR A OG1 1 
ATOM   4400 C  CG2 . THR A 1 582 ? 28.203  3.337   20.087  1.00 5.00  ? 582  THR A CG2 1 
ATOM   4401 N  N   . VAL A 1 583 ? 25.529  7.328   19.893  1.00 8.18  ? 583  VAL A N   1 
ATOM   4402 C  CA  . VAL A 1 583 ? 24.719  8.343   20.494  1.00 6.78  ? 583  VAL A CA  1 
ATOM   4403 C  C   . VAL A 1 583 ? 23.469  8.683   19.694  1.00 13.37 ? 583  VAL A C   1 
ATOM   4404 O  O   . VAL A 1 583 ? 23.526  8.997   18.479  1.00 10.63 ? 583  VAL A O   1 
ATOM   4405 C  CB  . VAL A 1 583 ? 25.630  9.650   20.580  1.00 8.42  ? 583  VAL A CB  1 
ATOM   4406 C  CG1 . VAL A 1 583 ? 24.800  10.795  21.194  1.00 6.25  ? 583  VAL A CG1 1 
ATOM   4407 C  CG2 . VAL A 1 583 ? 26.904  9.346   21.308  1.00 5.00  ? 583  VAL A CG2 1 
ATOM   4408 N  N   . ASN A 1 584 ? 22.336  8.741   20.400  1.00 13.43 ? 584  ASN A N   1 
ATOM   4409 C  CA  . ASN A 1 584 ? 21.051  9.185   19.810  1.00 10.31 ? 584  ASN A CA  1 
ATOM   4410 C  C   . ASN A 1 584 ? 20.348  9.966   20.971  1.00 12.64 ? 584  ASN A C   1 
ATOM   4411 O  O   . ASN A 1 584 ? 19.651  9.264   21.758  1.00 15.01 ? 584  ASN A O   1 
ATOM   4412 C  CB  . ASN A 1 584 ? 20.173  8.107   19.210  1.00 5.01  ? 584  ASN A CB  1 
ATOM   4413 C  CG  . ASN A 1 584 ? 18.850  8.499   18.646  1.00 5.00  ? 584  ASN A CG  1 
ATOM   4414 O  OD1 . ASN A 1 584 ? 18.375  9.684   18.806  1.00 6.56  ? 584  ASN A OD1 1 
ATOM   4415 N  ND2 . ASN A 1 584 ? 18.386  7.647   17.767  1.00 5.00  ? 584  ASN A ND2 1 
ATOM   4416 N  N   . THR A 1 585 ? 20.451  11.278  21.013  1.00 7.35  ? 585  THR A N   1 
ATOM   4417 C  CA  . THR A 1 585 ? 19.814  12.013  22.133  1.00 10.52 ? 585  THR A CA  1 
ATOM   4418 C  C   . THR A 1 585 ? 18.429  12.502  21.782  1.00 13.13 ? 585  THR A C   1 
ATOM   4419 O  O   . THR A 1 585 ? 17.648  13.079  22.545  1.00 12.21 ? 585  THR A O   1 
ATOM   4420 C  CB  . THR A 1 585 ? 20.801  13.201  22.579  1.00 6.48  ? 585  THR A CB  1 
ATOM   4421 O  OG1 . THR A 1 585 ? 20.842  14.014  21.377  1.00 7.22  ? 585  THR A OG1 1 
ATOM   4422 C  CG2 . THR A 1 585 ? 22.168  12.629  23.062  1.00 5.00  ? 585  THR A CG2 1 
ATOM   4423 N  N   . ASP A 1 586 ? 18.018  12.265  20.529  1.00 8.20  ? 586  ASP A N   1 
ATOM   4424 C  CA  . ASP A 1 586 ? 16.752  12.761  19.977  1.00 5.63  ? 586  ASP A CA  1 
ATOM   4425 C  C   . ASP A 1 586 ? 15.583  11.772  20.118  1.00 13.02 ? 586  ASP A C   1 
ATOM   4426 O  O   . ASP A 1 586 ? 14.541  12.322  20.465  1.00 10.63 ? 586  ASP A O   1 
ATOM   4427 C  CB  . ASP A 1 586 ? 16.844  13.210  18.515  1.00 5.25  ? 586  ASP A CB  1 
ATOM   4428 C  CG  . ASP A 1 586 ? 17.734  14.448  18.436  1.00 9.09  ? 586  ASP A CG  1 
ATOM   4429 O  OD1 . ASP A 1 586 ? 17.239  15.419  19.031  1.00 11.12 ? 586  ASP A OD1 1 
ATOM   4430 O  OD2 . ASP A 1 586 ? 18.642  14.439  17.638  1.00 12.66 ? 586  ASP A OD2 1 
ATOM   4431 N  N   . GLN A 1 587 ? 15.787  10.478  19.964  1.00 8.34  ? 587  GLN A N   1 
ATOM   4432 C  CA  . GLN A 1 587 ? 14.672  9.534   20.126  1.00 7.40  ? 587  GLN A CA  1 
ATOM   4433 C  C   . GLN A 1 587 ? 14.202  9.444   21.603  1.00 5.96  ? 587  GLN A C   1 
ATOM   4434 O  O   . GLN A 1 587 ? 14.887  9.676   22.597  1.00 9.63  ? 587  GLN A O   1 
ATOM   4435 C  CB  . GLN A 1 587 ? 15.016  8.148   19.547  1.00 5.76  ? 587  GLN A CB  1 
ATOM   4436 C  CG  . GLN A 1 587 ? 16.035  7.461   20.513  1.00 5.00  ? 587  GLN A CG  1 
ATOM   4437 C  CD  . GLN A 1 587 ? 16.494  6.109   19.997  1.00 7.45  ? 587  GLN A CD  1 
ATOM   4438 O  OE1 . GLN A 1 587 ? 15.714  5.551   19.157  1.00 9.17  ? 587  GLN A OE1 1 
ATOM   4439 N  NE2 . GLN A 1 587 ? 17.660  5.652   20.529  1.00 7.52  ? 587  GLN A NE2 1 
ATOM   4440 N  N   . ARG A 1 588 ? 12.895  9.127   21.702  1.00 12.13 ? 588  ARG A N   1 
ATOM   4441 C  CA  . ARG A 1 588 ? 12.299  8.947   23.060  1.00 6.45  ? 588  ARG A CA  1 
ATOM   4442 C  C   . ARG A 1 588 ? 10.854  8.511   22.829  1.00 6.84  ? 588  ARG A C   1 
ATOM   4443 O  O   . ARG A 1 588 ? 10.309  8.765   21.748  1.00 10.10 ? 588  ARG A O   1 
ATOM   4444 C  CB  . ARG A 1 588 ? 12.388  10.100  24.036  1.00 7.10  ? 588  ARG A CB  1 
ATOM   4445 C  CG  . ARG A 1 588 ? 11.733  11.394  23.622  1.00 7.39  ? 588  ARG A CG  1 
ATOM   4446 C  CD  . ARG A 1 588 ? 11.623  12.443  24.685  1.00 9.85  ? 588  ARG A CD  1 
ATOM   4447 N  NE  . ARG A 1 588 ? 12.944  12.836  25.187  1.00 8.11  ? 588  ARG A NE  1 
ATOM   4448 C  CZ  . ARG A 1 588 ? 13.286  13.487  26.259  1.00 10.61 ? 588  ARG A CZ  1 
ATOM   4449 N  NH1 . ARG A 1 588 ? 12.379  13.938  27.086  1.00 6.82  ? 588  ARG A NH1 1 
ATOM   4450 N  NH2 . ARG A 1 588 ? 14.584  13.724  26.554  1.00 11.25 ? 588  ARG A NH2 1 
ATOM   4451 N  N   . ARG A 1 589 ? 10.200  7.863   23.755  1.00 9.51  ? 589  ARG A N   1 
ATOM   4452 C  CA  . ARG A 1 589 ? 8.814   7.468   23.453  1.00 7.38  ? 589  ARG A CA  1 
ATOM   4453 C  C   . ARG A 1 589 ? 7.882   7.960   24.570  1.00 9.28  ? 589  ARG A C   1 
ATOM   4454 O  O   . ARG A 1 589 ? 8.242   7.864   25.789  1.00 8.01  ? 589  ARG A O   1 
ATOM   4455 C  CB  . ARG A 1 589 ? 8.754   5.939   23.425  1.00 5.00  ? 589  ARG A CB  1 
ATOM   4456 C  CG  . ARG A 1 589 ? 7.350   5.378   23.433  1.00 5.00  ? 589  ARG A CG  1 
ATOM   4457 C  CD  . ARG A 1 589 ? 7.522   3.892   23.311  1.00 8.20  ? 589  ARG A CD  1 
ATOM   4458 N  NE  . ARG A 1 589 ? 6.276   3.218   23.680  1.00 11.31 ? 589  ARG A NE  1 
ATOM   4459 C  CZ  . ARG A 1 589 ? 5.962   2.864   24.909  1.00 13.31 ? 589  ARG A CZ  1 
ATOM   4460 N  NH1 . ARG A 1 589 ? 6.723   3.056   25.967  1.00 10.79 ? 589  ARG A NH1 1 
ATOM   4461 N  NH2 . ARG A 1 589 ? 4.850   2.109   25.065  1.00 14.74 ? 589  ARG A NH2 1 
ATOM   4462 N  N   . ILE A 1 590 ? 6.753   8.320   24.044  1.00 6.65  ? 590  ILE A N   1 
ATOM   4463 C  CA  . ILE A 1 590 ? 5.702   8.720   25.063  1.00 5.38  ? 590  ILE A CA  1 
ATOM   4464 C  C   . ILE A 1 590 ? 4.551   7.743   24.780  1.00 9.93  ? 590  ILE A C   1 
ATOM   4465 O  O   . ILE A 1 590 ? 4.089   7.628   23.644  1.00 13.03 ? 590  ILE A O   1 
ATOM   4466 C  CB  . ILE A 1 590 ? 5.189   10.137  24.834  1.00 5.05  ? 590  ILE A CB  1 
ATOM   4467 C  CG1 . ILE A 1 590 ? 6.275   11.061  25.373  1.00 5.00  ? 590  ILE A CG1 1 
ATOM   4468 C  CG2 . ILE A 1 590 ? 3.835   10.411  25.611  1.00 9.68  ? 590  ILE A CG2 1 
ATOM   4469 C  CD1 . ILE A 1 590 ? 5.952   12.540  25.006  1.00 9.44  ? 590  ILE A CD1 1 
ATOM   4470 N  N   . PRO A 1 591 ? 4.156   6.991   25.762  1.00 11.61 ? 591  PRO A N   1 
ATOM   4471 C  CA  . PRO A 1 591 ? 2.999   6.087   25.648  1.00 18.05 ? 591  PRO A CA  1 
ATOM   4472 C  C   . PRO A 1 591 ? 1.767   7.041   25.791  1.00 23.65 ? 591  PRO A C   1 
ATOM   4473 O  O   . PRO A 1 591 ? 1.744   7.938   26.704  1.00 16.19 ? 591  PRO A O   1 
ATOM   4474 C  CB  . PRO A 1 591 ? 3.202   5.154   26.807  1.00 19.23 ? 591  PRO A CB  1 
ATOM   4475 C  CG  . PRO A 1 591 ? 4.335   5.653   27.652  1.00 11.16 ? 591  PRO A CG  1 
ATOM   4476 C  CD  . PRO A 1 591 ? 4.668   6.991   27.123  1.00 9.74  ? 591  PRO A CD  1 
ATOM   4477 N  N   . LEU A 1 592 ? 0.756   6.839   24.936  1.00 12.94 ? 592  LEU A N   1 
ATOM   4478 C  CA  . LEU A 1 592 ? -0.407  7.754   25.037  1.00 16.13 ? 592  LEU A CA  1 
ATOM   4479 C  C   . LEU A 1 592 ? -1.588  7.072   25.684  1.00 25.26 ? 592  LEU A C   1 
ATOM   4480 O  O   . LEU A 1 592 ? -1.771  5.857   25.511  1.00 25.33 ? 592  LEU A O   1 
ATOM   4481 C  CB  . LEU A 1 592 ? -0.752  8.140   23.588  1.00 11.88 ? 592  LEU A CB  1 
ATOM   4482 C  CG  . LEU A 1 592 ? 0.361   8.867   22.854  1.00 9.42  ? 592  LEU A CG  1 
ATOM   4483 C  CD1 . LEU A 1 592 ? -0.027  9.102   21.410  1.00 12.26 ? 592  LEU A CD1 1 
ATOM   4484 C  CD2 . LEU A 1 592 ? 0.542   10.240  23.482  1.00 10.02 ? 592  LEU A CD2 1 
ATOM   4485 N  N   . THR A 1 593 ? -2.404  7.896   26.349  1.00 30.64 ? 593  THR A N   1 
ATOM   4486 C  CA  . THR A 1 593 ? -3.631  7.292   26.943  1.00 43.17 ? 593  THR A CA  1 
ATOM   4487 C  C   . THR A 1 593 ? -4.729  7.751   25.939  1.00 28.75 ? 593  THR A C   1 
ATOM   4488 O  O   . THR A 1 593 ? -4.771  8.952   25.596  1.00 25.30 ? 593  THR A O   1 
ATOM   4489 C  CB  . THR A 1 593 ? -3.744  7.616   28.462  1.00 65.83 ? 593  THR A CB  1 
ATOM   4490 O  OG1 . THR A 1 593 ? -3.957  9.042   28.697  1.00 79.61 ? 593  THR A OG1 1 
ATOM   4491 C  CG2 . THR A 1 593 ? -2.516  7.277   29.346  1.00 58.16 ? 593  THR A CG2 1 
ATOM   4492 N  N   . LEU A 1 594 ? -5.480  6.824   25.407  1.00 37.78 ? 594  LEU A N   1 
ATOM   4493 C  CA  . LEU A 1 594 ? -6.527  7.153   24.428  1.00 42.36 ? 594  LEU A CA  1 
ATOM   4494 C  C   . LEU A 1 594 ? -7.944  7.176   25.038  1.00 36.93 ? 594  LEU A C   1 
ATOM   4495 O  O   . LEU A 1 594 ? -8.294  6.349   25.860  1.00 38.28 ? 594  LEU A O   1 
ATOM   4496 C  CB  . LEU A 1 594 ? -6.635  6.162   23.270  1.00 28.78 ? 594  LEU A CB  1 
ATOM   4497 C  CG  . LEU A 1 594 ? -5.332  5.928   22.534  1.00 19.74 ? 594  LEU A CG  1 
ATOM   4498 C  CD1 . LEU A 1 594 ? -5.524  4.543   21.960  1.00 36.63 ? 594  LEU A CD1 1 
ATOM   4499 C  CD2 . LEU A 1 594 ? -5.269  7.074   21.549  1.00 17.55 ? 594  LEU A CD2 1 
ATOM   4500 N  N   . THR A 1 595 ? -8.633  8.157   24.548  1.00 35.75 ? 595  THR A N   1 
ATOM   4501 C  CA  . THR A 1 595 ? -10.059 8.380   24.879  1.00 34.12 ? 595  THR A CA  1 
ATOM   4502 C  C   . THR A 1 595 ? -10.814 7.810   23.677  1.00 28.49 ? 595  THR A C   1 
ATOM   4503 O  O   . THR A 1 595 ? -10.485 8.173   22.525  1.00 28.45 ? 595  THR A O   1 
ATOM   4504 C  CB  . THR A 1 595 ? -10.359 9.882   25.143  1.00 33.74 ? 595  THR A CB  1 
ATOM   4505 O  OG1 . THR A 1 595 ? -9.718  10.026  26.459  1.00 37.66 ? 595  THR A OG1 1 
ATOM   4506 C  CG2 . THR A 1 595 ? -11.827 10.298  25.109  1.00 47.58 ? 595  THR A CG2 1 
ATOM   4507 N  N   . ASN A 1 596 ? -11.660 6.843   23.913  1.00 35.08 ? 596  ASN A N   1 
ATOM   4508 C  CA  . ASN A 1 596 ? -12.443 6.224   22.817  1.00 32.60 ? 596  ASN A CA  1 
ATOM   4509 C  C   . ASN A 1 596 ? -13.719 7.080   22.634  1.00 37.40 ? 596  ASN A C   1 
ATOM   4510 O  O   . ASN A 1 596 ? -14.586 7.066   23.538  1.00 40.04 ? 596  ASN A O   1 
ATOM   4511 C  CB  . ASN A 1 596 ? -12.801 4.790   23.172  1.00 42.12 ? 596  ASN A CB  1 
ATOM   4512 C  CG  . ASN A 1 596 ? -13.613 4.066   22.114  1.00 51.32 ? 596  ASN A CG  1 
ATOM   4513 O  OD1 . ASN A 1 596 ? -13.911 4.593   21.031  1.00 48.01 ? 596  ASN A OD1 1 
ATOM   4514 N  ND2 . ASN A 1 596 ? -13.961 2.827   22.516  1.00 60.07 ? 596  ASN A ND2 1 
ATOM   4515 N  N   . ASN A 1 597 ? -13.687 7.773   21.535  1.00 27.02 ? 597  ASN A N   1 
ATOM   4516 C  CA  . ASN A 1 597 ? -14.814 8.646   21.127  1.00 32.87 ? 597  ASN A CA  1 
ATOM   4517 C  C   . ASN A 1 597 ? -15.958 7.827   20.471  1.00 47.79 ? 597  ASN A C   1 
ATOM   4518 O  O   . ASN A 1 597 ? -16.961 8.423   20.031  1.00 44.62 ? 597  ASN A O   1 
ATOM   4519 C  CB  . ASN A 1 597 ? -14.359 9.681   20.120  1.00 31.10 ? 597  ASN A CB  1 
ATOM   4520 C  CG  . ASN A 1 597 ? -13.359 10.660  20.741  1.00 32.32 ? 597  ASN A CG  1 
ATOM   4521 O  OD1 . ASN A 1 597 ? -12.559 11.207  19.997  1.00 35.72 ? 597  ASN A OD1 1 
ATOM   4522 N  ND2 . ASN A 1 597 ? -13.498 10.838  22.028  1.00 26.70 ? 597  ASN A ND2 1 
ATOM   4523 N  N   . GLY A 1 598 ? -15.793 6.521   20.367  1.00 41.22 ? 598  GLY A N   1 
ATOM   4524 C  CA  . GLY A 1 598 ? -16.764 5.647   19.691  1.00 39.92 ? 598  GLY A CA  1 
ATOM   4525 C  C   . GLY A 1 598 ? -16.501 5.888   18.170  1.00 36.54 ? 598  GLY A C   1 
ATOM   4526 O  O   . GLY A 1 598 ? -16.033 6.946   17.685  1.00 27.33 ? 598  GLY A O   1 
ATOM   4527 N  N   . GLY A 1 599 ? -16.855 4.864   17.398  1.00 37.95 ? 599  GLY A N   1 
ATOM   4528 C  CA  . GLY A 1 599 ? -16.729 4.823   15.967  1.00 36.52 ? 599  GLY A CA  1 
ATOM   4529 C  C   . GLY A 1 599 ? -15.324 4.855   15.359  1.00 49.11 ? 599  GLY A C   1 
ATOM   4530 O  O   . GLY A 1 599 ? -15.164 5.389   14.222  1.00 33.96 ? 599  GLY A O   1 
ATOM   4531 N  N   . ASN A 1 600 ? -14.379 4.288   16.136  1.00 40.61 ? 600  ASN A N   1 
ATOM   4532 C  CA  . ASN A 1 600 ? -12.962 4.280   15.693  1.00 37.59 ? 600  ASN A CA  1 
ATOM   4533 C  C   . ASN A 1 600 ? -12.452 5.716   15.564  1.00 31.44 ? 600  ASN A C   1 
ATOM   4534 O  O   . ASN A 1 600 ? -11.751 6.177   14.630  1.00 33.14 ? 600  ASN A O   1 
ATOM   4535 C  CB  . ASN A 1 600 ? -12.858 3.434   14.452  1.00 34.81 ? 600  ASN A CB  1 
ATOM   4536 C  CG  . ASN A 1 600 ? -13.190 1.968   14.599  1.00 33.52 ? 600  ASN A CG  1 
ATOM   4537 O  OD1 . ASN A 1 600 ? -13.429 1.382   13.531  1.00 36.83 ? 600  ASN A OD1 1 
ATOM   4538 N  ND2 . ASN A 1 600 ? -13.089 1.390   15.792  1.00 27.80 ? 600  ASN A ND2 1 
ATOM   4539 N  N   . SER A 1 601 ? -12.879 6.496   16.549  1.00 25.16 ? 601  SER A N   1 
ATOM   4540 C  CA  . SER A 1 601 ? -12.446 7.910   16.691  1.00 25.10 ? 601  SER A CA  1 
ATOM   4541 C  C   . SER A 1 601 ? -11.822 7.921   18.122  1.00 31.59 ? 601  SER A C   1 
ATOM   4542 O  O   . SER A 1 601 ? -12.340 7.311   19.104  1.00 19.89 ? 601  SER A O   1 
ATOM   4543 C  CB  . SER A 1 601 ? -13.561 8.910   16.583  1.00 39.49 ? 601  SER A CB  1 
ATOM   4544 O  OG  . SER A 1 601 ? -13.214 10.241  16.915  1.00 38.52 ? 601  SER A OG  1 
ATOM   4545 N  N   . TYR A 1 602 ? -10.668 8.571   18.219  1.00 24.47 ? 602  TYR A N   1 
ATOM   4546 C  CA  . TYR A 1 602 ? -9.930  8.617   19.494  1.00 14.23 ? 602  TYR A CA  1 
ATOM   4547 C  C   . TYR A 1 602 ? -9.141  9.956   19.554  1.00 10.58 ? 602  TYR A C   1 
ATOM   4548 O  O   . TYR A 1 602 ? -8.851  10.607  18.533  1.00 19.90 ? 602  TYR A O   1 
ATOM   4549 C  CB  . TYR A 1 602 ? -8.864  7.518   19.590  1.00 15.36 ? 602  TYR A CB  1 
ATOM   4550 C  CG  . TYR A 1 602 ? -9.303  6.122   19.294  1.00 9.80  ? 602  TYR A CG  1 
ATOM   4551 C  CD1 . TYR A 1 602 ? -9.472  5.770   17.948  1.00 12.48 ? 602  TYR A CD1 1 
ATOM   4552 C  CD2 . TYR A 1 602 ? -9.631  5.236   20.326  1.00 18.60 ? 602  TYR A CD2 1 
ATOM   4553 C  CE1 . TYR A 1 602 ? -9.860  4.435   17.691  1.00 13.54 ? 602  TYR A CE1 1 
ATOM   4554 C  CE2 . TYR A 1 602 ? -10.024 3.903   20.069  1.00 16.37 ? 602  TYR A CE2 1 
ATOM   4555 C  CZ  . TYR A 1 602 ? -10.134 3.575   18.734  1.00 23.56 ? 602  TYR A CZ  1 
ATOM   4556 O  OH  . TYR A 1 602 ? -10.609 2.283   18.451  1.00 31.72 ? 602  TYR A OH  1 
ATOM   4557 N  N   . SER A 1 603 ? -8.947  10.303  20.791  1.00 19.66 ? 603  SER A N   1 
ATOM   4558 C  CA  . SER A 1 603 ? -8.240  11.505  21.201  1.00 17.10 ? 603  SER A CA  1 
ATOM   4559 C  C   . SER A 1 603 ? -7.247  11.117  22.329  1.00 17.20 ? 603  SER A C   1 
ATOM   4560 O  O   . SER A 1 603 ? -7.408  10.161  23.120  1.00 14.24 ? 603  SER A O   1 
ATOM   4561 C  CB  . SER A 1 603 ? -9.222  12.445  22.007  1.00 27.57 ? 603  SER A CB  1 
ATOM   4562 O  OG  . SER A 1 603 ? -10.100 12.934  20.991  1.00 34.92 ? 603  SER A OG  1 
ATOM   4563 N  N   . PHE A 1 604 ? -6.301  11.989  22.385  1.00 16.70 ? 604  PHE A N   1 
ATOM   4564 C  CA  . PHE A 1 604 ? -5.241  11.864  23.414  1.00 26.66 ? 604  PHE A CA  1 
ATOM   4565 C  C   . PHE A 1 604 ? -4.694  13.285  23.569  1.00 19.26 ? 604  PHE A C   1 
ATOM   4566 O  O   . PHE A 1 604 ? -4.719  14.091  22.657  1.00 20.04 ? 604  PHE A O   1 
ATOM   4567 C  CB  . PHE A 1 604 ? -4.055  10.900  23.080  1.00 17.26 ? 604  PHE A CB  1 
ATOM   4568 C  CG  . PHE A 1 604 ? -3.382  11.250  21.773  1.00 15.82 ? 604  PHE A CG  1 
ATOM   4569 C  CD1 . PHE A 1 604 ? -2.347  12.212  21.685  1.00 16.71 ? 604  PHE A CD1 1 
ATOM   4570 C  CD2 . PHE A 1 604 ? -3.893  10.582  20.663  1.00 15.73 ? 604  PHE A CD2 1 
ATOM   4571 C  CE1 . PHE A 1 604 ? -1.814  12.490  20.406  1.00 11.01 ? 604  PHE A CE1 1 
ATOM   4572 C  CE2 . PHE A 1 604 ? -3.323  10.827  19.388  1.00 16.33 ? 604  PHE A CE2 1 
ATOM   4573 C  CZ  . PHE A 1 604 ? -2.313  11.808  19.289  1.00 15.73 ? 604  PHE A CZ  1 
ATOM   4574 N  N   . GLN A 1 605 ? -4.156  13.463  24.764  1.00 25.18 ? 605  GLN A N   1 
ATOM   4575 C  CA  . GLN A 1 605 ? -3.468  14.694  25.083  1.00 33.30 ? 605  GLN A CA  1 
ATOM   4576 C  C   . GLN A 1 605 ? -1.935  14.444  25.053  1.00 18.61 ? 605  GLN A C   1 
ATOM   4577 O  O   . GLN A 1 605 ? -1.471  13.373  25.428  1.00 15.18 ? 605  GLN A O   1 
ATOM   4578 C  CB  . GLN A 1 605 ? -3.945  15.021  26.502  1.00 45.63 ? 605  GLN A CB  1 
ATOM   4579 C  CG  . GLN A 1 605 ? -3.804  16.495  26.784  1.00 61.11 ? 605  GLN A CG  1 
ATOM   4580 C  CD  . GLN A 1 605 ? -3.699  16.839  28.251  1.00 62.28 ? 605  GLN A CD  1 
ATOM   4581 O  OE1 . GLN A 1 605 ? -3.677  15.976  29.121  1.00 62.50 ? 605  GLN A OE1 1 
ATOM   4582 N  NE2 . GLN A 1 605 ? -3.664  18.170  28.343  1.00 73.23 ? 605  GLN A NE2 1 
ATOM   4583 N  N   . VAL A 1 606 ? -1.204  15.389  24.519  1.00 13.91 ? 606  VAL A N   1 
ATOM   4584 C  CA  . VAL A 1 606 ? 0.283   15.342  24.555  1.00 11.14 ? 606  VAL A CA  1 
ATOM   4585 C  C   . VAL A 1 606 ? 0.592   15.892  25.944  1.00 23.81 ? 606  VAL A C   1 
ATOM   4586 O  O   . VAL A 1 606 ? -0.086  16.854  26.418  1.00 20.59 ? 606  VAL A O   1 
ATOM   4587 C  CB  . VAL A 1 606 ? 0.764   16.377  23.544  1.00 9.18  ? 606  VAL A CB  1 
ATOM   4588 C  CG1 . VAL A 1 606 ? 2.270   16.407  23.578  1.00 15.93 ? 606  VAL A CG1 1 
ATOM   4589 C  CG2 . VAL A 1 606 ? 0.140   15.896  22.244  1.00 9.21  ? 606  VAL A CG2 1 
ATOM   4590 N  N   . PRO A 1 607 ? 1.590   15.313  26.617  1.00 24.14 ? 607  PRO A N   1 
ATOM   4591 C  CA  . PRO A 1 607 ? 1.982   15.735  27.958  1.00 19.44 ? 607  PRO A CA  1 
ATOM   4592 C  C   . PRO A 1 607 ? 2.278   17.211  27.962  1.00 10.70 ? 607  PRO A C   1 
ATOM   4593 O  O   . PRO A 1 607 ? 2.755   17.869  27.046  1.00 14.11 ? 607  PRO A O   1 
ATOM   4594 C  CB  . PRO A 1 607 ? 3.148   14.812  28.336  1.00 24.64 ? 607  PRO A CB  1 
ATOM   4595 C  CG  . PRO A 1 607 ? 2.824   13.561  27.518  1.00 18.14 ? 607  PRO A CG  1 
ATOM   4596 C  CD  . PRO A 1 607 ? 2.384   14.130  26.166  1.00 17.25 ? 607  PRO A CD  1 
ATOM   4597 N  N   . SER A 1 608 ? 1.839   17.790  29.082  1.00 19.76 ? 608  SER A N   1 
ATOM   4598 C  CA  . SER A 1 608 ? 1.980   19.248  29.213  1.00 24.61 ? 608  SER A CA  1 
ATOM   4599 C  C   . SER A 1 608 ? 3.387   19.690  29.571  1.00 24.39 ? 608  SER A C   1 
ATOM   4600 O  O   . SER A 1 608 ? 3.645   20.893  29.383  1.00 27.63 ? 608  SER A O   1 
ATOM   4601 C  CB  . SER A 1 608 ? 0.956   19.862  30.169  1.00 18.67 ? 608  SER A CB  1 
ATOM   4602 O  OG  . SER A 1 608 ? 1.070   19.099  31.359  1.00 46.48 ? 608  SER A OG  1 
ATOM   4603 N  N   . ASP A 1 609 ? 4.251   18.796  29.984  1.00 25.77 ? 609  ASP A N   1 
ATOM   4604 C  CA  . ASP A 1 609 ? 5.657   19.150  30.315  1.00 22.94 ? 609  ASP A CA  1 
ATOM   4605 C  C   . ASP A 1 609 ? 6.534   19.013  29.054  1.00 15.60 ? 609  ASP A C   1 
ATOM   4606 O  O   . ASP A 1 609 ? 6.596   17.874  28.562  1.00 11.05 ? 609  ASP A O   1 
ATOM   4607 C  CB  . ASP A 1 609 ? 6.141   18.275  31.456  1.00 16.07 ? 609  ASP A CB  1 
ATOM   4608 C  CG  . ASP A 1 609 ? 7.393   18.772  32.145  1.00 20.35 ? 609  ASP A CG  1 
ATOM   4609 O  OD1 . ASP A 1 609 ? 8.272   19.308  31.444  1.00 17.09 ? 609  ASP A OD1 1 
ATOM   4610 O  OD2 . ASP A 1 609 ? 7.356   18.717  33.375  1.00 28.94 ? 609  ASP A OD2 1 
ATOM   4611 N  N   . SER A 1 610 ? 7.105   20.121  28.611  1.00 11.11 ? 610  SER A N   1 
ATOM   4612 C  CA  . SER A 1 610 ? 7.987   20.078  27.443  1.00 14.64 ? 610  SER A CA  1 
ATOM   4613 C  C   . SER A 1 610 ? 9.338   19.402  27.738  1.00 20.09 ? 610  SER A C   1 
ATOM   4614 O  O   . SER A 1 610 ? 10.153  19.202  26.818  1.00 16.98 ? 610  SER A O   1 
ATOM   4615 C  CB  . SER A 1 610 ? 8.105   21.502  26.894  1.00 9.68  ? 610  SER A CB  1 
ATOM   4616 O  OG  . SER A 1 610 ? 8.736   22.301  27.879  1.00 10.90 ? 610  SER A OG  1 
ATOM   4617 N  N   . GLY A 1 611 ? 9.625   19.038  28.985  1.00 14.80 ? 611  GLY A N   1 
ATOM   4618 C  CA  . GLY A 1 611 ? 10.873  18.304  29.303  1.00 12.37 ? 611  GLY A CA  1 
ATOM   4619 C  C   . GLY A 1 611 ? 10.581  16.809  29.062  1.00 15.76 ? 611  GLY A C   1 
ATOM   4620 O  O   . GLY A 1 611 ? 11.505  15.998  28.868  1.00 14.58 ? 611  GLY A O   1 
ATOM   4621 N  N   . VAL A 1 612 ? 9.322   16.434  29.058  1.00 10.91 ? 612  VAL A N   1 
ATOM   4622 C  CA  . VAL A 1 612 ? 8.856   15.057  28.718  1.00 12.25 ? 612  VAL A CA  1 
ATOM   4623 C  C   . VAL A 1 612 ? 8.652   15.075  27.189  1.00 13.83 ? 612  VAL A C   1 
ATOM   4624 O  O   . VAL A 1 612 ? 9.309   14.372  26.416  1.00 14.68 ? 612  VAL A O   1 
ATOM   4625 C  CB  . VAL A 1 612 ? 7.611   14.564  29.464  1.00 9.40  ? 612  VAL A CB  1 
ATOM   4626 C  CG1 . VAL A 1 612 ? 6.985   13.257  28.955  1.00 9.81  ? 612  VAL A CG1 1 
ATOM   4627 C  CG2 . VAL A 1 612 ? 7.872   14.435  30.937  1.00 10.23 ? 612  VAL A CG2 1 
ATOM   4628 N  N   . ALA A 1 613 ? 7.712   15.904  26.749  1.00 13.79 ? 613  ALA A N   1 
ATOM   4629 C  CA  . ALA A 1 613 ? 7.349   16.041  25.339  1.00 6.26  ? 613  ALA A CA  1 
ATOM   4630 C  C   . ALA A 1 613 ? 8.239   17.120  24.737  1.00 13.67 ? 613  ALA A C   1 
ATOM   4631 O  O   . ALA A 1 613 ? 7.788   18.256  24.491  1.00 6.19  ? 613  ALA A O   1 
ATOM   4632 C  CB  . ALA A 1 613 ? 5.864   16.312  25.162  1.00 5.15  ? 613  ALA A CB  1 
ATOM   4633 N  N   . LEU A 1 614 ? 9.536   16.728  24.617  1.00 5.00  ? 614  LEU A N   1 
ATOM   4634 C  CA  . LEU A 1 614 ? 10.460  17.679  24.017  1.00 7.88  ? 614  LEU A CA  1 
ATOM   4635 C  C   . LEU A 1 614 ? 9.986   18.184  22.667  1.00 10.91 ? 614  LEU A C   1 
ATOM   4636 O  O   . LEU A 1 614 ? 9.685   17.417  21.768  1.00 19.40 ? 614  LEU A O   1 
ATOM   4637 C  CB  . LEU A 1 614 ? 11.785  16.898  23.727  1.00 12.39 ? 614  LEU A CB  1 
ATOM   4638 C  CG  . LEU A 1 614 ? 12.905  16.803  24.676  1.00 10.77 ? 614  LEU A CG  1 
ATOM   4639 C  CD1 . LEU A 1 614 ? 14.201  16.345  23.874  1.00 18.91 ? 614  LEU A CD1 1 
ATOM   4640 C  CD2 . LEU A 1 614 ? 13.249  17.963  25.554  1.00 5.00  ? 614  LEU A CD2 1 
ATOM   4641 N  N   . PRO A 1 615 ? 10.025  19.495  22.419  1.00 12.02 ? 615  PRO A N   1 
ATOM   4642 C  CA  . PRO A 1 615 ? 9.623   20.011  21.117  1.00 11.93 ? 615  PRO A CA  1 
ATOM   4643 C  C   . PRO A 1 615 ? 10.475  19.446  19.974  1.00 11.26 ? 615  PRO A C   1 
ATOM   4644 O  O   . PRO A 1 615 ? 11.674  19.099  20.052  1.00 11.14 ? 615  PRO A O   1 
ATOM   4645 C  CB  . PRO A 1 615 ? 9.748   21.545  21.273  1.00 13.69 ? 615  PRO A CB  1 
ATOM   4646 C  CG  . PRO A 1 615 ? 10.570  21.744  22.488  1.00 16.22 ? 615  PRO A CG  1 
ATOM   4647 C  CD  . PRO A 1 615 ? 10.430  20.508  23.371  1.00 15.43 ? 615  PRO A CD  1 
ATOM   4648 N  N   . GLY A 1 616 ? 9.789   19.420  18.824  1.00 12.75 ? 616  GLY A N   1 
ATOM   4649 C  CA  . GLY A 1 616 ? 10.396  18.960  17.537  1.00 8.07  ? 616  GLY A CA  1 
ATOM   4650 C  C   . GLY A 1 616 ? 9.324   18.056  16.913  1.00 14.58 ? 616  GLY A C   1 
ATOM   4651 O  O   . GLY A 1 616 ? 8.150   18.094  17.251  1.00 17.84 ? 616  GLY A O   1 
ATOM   4652 N  N   . TYR A 1 617 ? 9.754   17.202  15.990  1.00 13.28 ? 617  TYR A N   1 
ATOM   4653 C  CA  . TYR A 1 617 ? 8.906   16.293  15.292  1.00 9.16  ? 617  TYR A CA  1 
ATOM   4654 C  C   . TYR A 1 617 ? 8.816   14.935  15.952  1.00 10.90 ? 617  TYR A C   1 
ATOM   4655 O  O   . TYR A 1 617 ? 9.877   14.513  16.432  1.00 17.18 ? 617  TYR A O   1 
ATOM   4656 C  CB  . TYR A 1 617 ? 9.424   16.061  13.845  1.00 9.89  ? 617  TYR A CB  1 
ATOM   4657 C  CG  . TYR A 1 617 ? 9.141   17.298  13.025  1.00 16.54 ? 617  TYR A CG  1 
ATOM   4658 C  CD1 . TYR A 1 617 ? 7.921   17.548  12.462  1.00 18.52 ? 617  TYR A CD1 1 
ATOM   4659 C  CD2 . TYR A 1 617 ? 10.233  18.175  12.762  1.00 26.57 ? 617  TYR A CD2 1 
ATOM   4660 C  CE1 . TYR A 1 617 ? 7.732   18.677  11.696  1.00 27.63 ? 617  TYR A CE1 1 
ATOM   4661 C  CE2 . TYR A 1 617 ? 10.053  19.306  11.978  1.00 36.67 ? 617  TYR A CE2 1 
ATOM   4662 C  CZ  . TYR A 1 617 ? 8.795   19.545  11.433  1.00 39.21 ? 617  TYR A CZ  1 
ATOM   4663 O  OH  . TYR A 1 617 ? 8.658   20.653  10.641  1.00 45.30 ? 617  TYR A OH  1 
ATOM   4664 N  N   . TRP A 1 618 ? 7.583   14.408  15.860  1.00 9.22  ? 618  TRP A N   1 
ATOM   4665 C  CA  . TRP A 1 618 ? 7.388   13.087  16.477  1.00 6.25  ? 618  TRP A CA  1 
ATOM   4666 C  C   . TRP A 1 618 ? 6.591   12.287  15.512  1.00 6.17  ? 618  TRP A C   1 
ATOM   4667 O  O   . TRP A 1 618 ? 5.930   12.882  14.636  1.00 11.18 ? 618  TRP A O   1 
ATOM   4668 C  CB  . TRP A 1 618 ? 6.570   13.192  17.767  1.00 8.74  ? 618  TRP A CB  1 
ATOM   4669 C  CG  . TRP A 1 618 ? 7.263   13.940  18.887  1.00 10.22 ? 618  TRP A CG  1 
ATOM   4670 C  CD1 . TRP A 1 618 ? 7.572   15.289  18.982  1.00 12.69 ? 618  TRP A CD1 1 
ATOM   4671 C  CD2 . TRP A 1 618 ? 7.620   13.403  20.156  1.00 8.75  ? 618  TRP A CD2 1 
ATOM   4672 N  NE1 . TRP A 1 618 ? 8.178   15.507  20.163  1.00 7.89  ? 618  TRP A NE1 1 
ATOM   4673 C  CE2 . TRP A 1 618 ? 8.215   14.385  20.904  1.00 7.20  ? 618  TRP A CE2 1 
ATOM   4674 C  CE3 . TRP A 1 618 ? 7.603   12.050  20.647  1.00 11.53 ? 618  TRP A CE3 1 
ATOM   4675 C  CZ2 . TRP A 1 618 ? 8.746   14.180  22.183  1.00 9.00  ? 618  TRP A CZ2 1 
ATOM   4676 C  CZ3 . TRP A 1 618 ? 8.072   11.849  21.924  1.00 10.23 ? 618  TRP A CZ3 1 
ATOM   4677 C  CH2 . TRP A 1 618 ? 8.616   12.898  22.720  1.00 8.81  ? 618  TRP A CH2 1 
ATOM   4678 N  N   . MET A 1 619 ? 6.685   10.970  15.693  1.00 10.50 ? 619  MET A N   1 
ATOM   4679 C  CA  . MET A 1 619 ? 5.941   9.985   14.937  1.00 8.91  ? 619  MET A CA  1 
ATOM   4680 C  C   . MET A 1 619 ? 4.811   9.453   15.852  1.00 13.12 ? 619  MET A C   1 
ATOM   4681 O  O   . MET A 1 619 ? 5.043   9.121   17.006  1.00 11.82 ? 619  MET A O   1 
ATOM   4682 C  CB  . MET A 1 619 ? 6.766   8.711   14.633  1.00 7.56  ? 619  MET A CB  1 
ATOM   4683 C  CG  . MET A 1 619 ? 7.854   9.116   13.625  1.00 8.69  ? 619  MET A CG  1 
ATOM   4684 S  SD  . MET A 1 619 ? 8.895   7.659   13.360  1.00 13.67 ? 619  MET A SD  1 
ATOM   4685 C  CE  . MET A 1 619 ? 10.285  8.083   14.347  1.00 27.80 ? 619  MET A CE  1 
ATOM   4686 N  N   . LEU A 1 620 ? 3.613   9.434   15.267  1.00 14.17 ? 620  LEU A N   1 
ATOM   4687 C  CA  . LEU A 1 620 ? 2.418   8.865   15.945  1.00 7.91  ? 620  LEU A CA  1 
ATOM   4688 C  C   . LEU A 1 620 ? 2.159   7.480   15.381  1.00 6.46  ? 620  LEU A C   1 
ATOM   4689 O  O   . LEU A 1 620 ? 2.020   7.324   14.156  1.00 13.84 ? 620  LEU A O   1 
ATOM   4690 C  CB  . LEU A 1 620 ? 1.174   9.782   15.724  1.00 9.40  ? 620  LEU A CB  1 
ATOM   4691 C  CG  . LEU A 1 620 ? -0.085  9.073   16.172  1.00 8.79  ? 620  LEU A CG  1 
ATOM   4692 C  CD1 . LEU A 1 620 ? -0.254  8.933   17.647  1.00 14.27 ? 620  LEU A CD1 1 
ATOM   4693 C  CD2 . LEU A 1 620 ? -1.233  9.952   15.664  1.00 16.92 ? 620  LEU A CD2 1 
ATOM   4694 N  N   . PHE A 1 621 ? 2.228   6.470   16.247  1.00 6.23  ? 621  PHE A N   1 
ATOM   4695 C  CA  . PHE A 1 621 ? 1.901   5.117   15.864  1.00 12.82 ? 621  PHE A CA  1 
ATOM   4696 C  C   . PHE A 1 621 ? 0.637   4.655   16.629  1.00 15.50 ? 621  PHE A C   1 
ATOM   4697 O  O   . PHE A 1 621 ? 0.624   4.871   17.862  1.00 17.94 ? 621  PHE A O   1 
ATOM   4698 C  CB  . PHE A 1 621 ? 3.024   4.150   16.242  1.00 6.42  ? 621  PHE A CB  1 
ATOM   4699 C  CG  . PHE A 1 621 ? 4.317   4.285   15.475  1.00 9.29  ? 621  PHE A CG  1 
ATOM   4700 C  CD1 . PHE A 1 621 ? 4.440   3.586   14.253  1.00 12.09 ? 621  PHE A CD1 1 
ATOM   4701 C  CD2 . PHE A 1 621 ? 5.313   5.095   15.974  1.00 10.70 ? 621  PHE A CD2 1 
ATOM   4702 C  CE1 . PHE A 1 621 ? 5.628   3.728   13.482  1.00 10.92 ? 621  PHE A CE1 1 
ATOM   4703 C  CE2 . PHE A 1 621 ? 6.518   5.259   15.216  1.00 9.40  ? 621  PHE A CE2 1 
ATOM   4704 C  CZ  . PHE A 1 621 ? 6.671   4.552   14.022  1.00 5.72  ? 621  PHE A CZ  1 
ATOM   4705 N  N   . VAL A 1 622 ? -0.287  3.955   15.979  1.00 16.63 ? 622  VAL A N   1 
ATOM   4706 C  CA  . VAL A 1 622 ? -1.441  3.341   16.693  1.00 13.16 ? 622  VAL A CA  1 
ATOM   4707 C  C   . VAL A 1 622 ? -1.198  1.831   16.497  1.00 14.72 ? 622  VAL A C   1 
ATOM   4708 O  O   . VAL A 1 622 ? -0.572  1.567   15.454  1.00 22.22 ? 622  VAL A O   1 
ATOM   4709 C  CB  . VAL A 1 622 ? -2.836  3.828   16.255  1.00 12.77 ? 622  VAL A CB  1 
ATOM   4710 C  CG1 . VAL A 1 622 ? -2.806  5.329   16.567  1.00 13.36 ? 622  VAL A CG1 1 
ATOM   4711 C  CG2 . VAL A 1 622 ? -3.021  3.718   14.726  1.00 13.15 ? 622  VAL A CG2 1 
ATOM   4712 N  N   . MET A 1 623 ? -1.591  0.959   17.368  1.00 12.20 ? 623  MET A N   1 
ATOM   4713 C  CA  . MET A 1 623 ? -1.475  -0.482  17.410  1.00 16.77 ? 623  MET A CA  1 
ATOM   4714 C  C   . MET A 1 623 ? -2.862  -1.146  17.566  1.00 22.68 ? 623  MET A C   1 
ATOM   4715 O  O   . MET A 1 623 ? -3.732  -0.617  18.264  1.00 17.24 ? 623  MET A O   1 
ATOM   4716 C  CB  . MET A 1 623 ? -0.635  -0.979  18.615  1.00 27.07 ? 623  MET A CB  1 
ATOM   4717 C  CG  . MET A 1 623 ? 0.797   -1.208  18.236  1.00 33.88 ? 623  MET A CG  1 
ATOM   4718 S  SD  . MET A 1 623 ? 1.664   0.409   18.309  1.00 41.66 ? 623  MET A SD  1 
ATOM   4719 C  CE  . MET A 1 623 ? 1.803   0.605   20.075  1.00 22.58 ? 623  MET A CE  1 
ATOM   4720 N  N   . ASN A 1 624 ? -3.041  -2.254  16.862  1.00 24.60 ? 624  ASN A N   1 
ATOM   4721 C  CA  . ASN A 1 624 ? -4.411  -2.909  16.950  1.00 17.68 ? 624  ASN A CA  1 
ATOM   4722 C  C   . ASN A 1 624 ? -4.312  -3.896  18.076  1.00 30.82 ? 624  ASN A C   1 
ATOM   4723 O  O   . ASN A 1 624 ? -3.206  -4.050  18.662  1.00 28.88 ? 624  ASN A O   1 
ATOM   4724 C  CB  . ASN A 1 624 ? -4.803  -3.313  15.528  1.00 23.17 ? 624  ASN A CB  1 
ATOM   4725 C  CG  . ASN A 1 624 ? -3.965  -4.441  14.950  1.00 35.69 ? 624  ASN A CG  1 
ATOM   4726 O  OD1 . ASN A 1 624 ? -3.227  -5.095  15.716  1.00 39.55 ? 624  ASN A OD1 1 
ATOM   4727 N  ND2 . ASN A 1 624 ? -4.027  -4.659  13.638  1.00 28.79 ? 624  ASN A ND2 1 
ATOM   4728 N  N   . SER A 1 625 ? -5.405  -4.612  18.408  1.00 34.22 ? 625  SER A N   1 
ATOM   4729 C  CA  . SER A 1 625 ? -5.218  -5.533  19.580  1.00 35.28 ? 625  SER A CA  1 
ATOM   4730 C  C   . SER A 1 625 ? -4.171  -6.592  19.336  1.00 38.97 ? 625  SER A C   1 
ATOM   4731 O  O   . SER A 1 625 ? -3.602  -7.136  20.320  1.00 41.36 ? 625  SER A O   1 
ATOM   4732 C  CB  . SER A 1 625 ? -6.481  -6.302  19.961  1.00 36.68 ? 625  SER A CB  1 
ATOM   4733 O  OG  . SER A 1 625 ? -6.898  -6.828  18.685  1.00 41.82 ? 625  SER A OG  1 
ATOM   4734 N  N   . ALA A 1 626 ? -3.973  -6.845  18.051  1.00 42.61 ? 626  ALA A N   1 
ATOM   4735 C  CA  . ALA A 1 626 ? -2.959  -7.825  17.612  1.00 51.70 ? 626  ALA A CA  1 
ATOM   4736 C  C   . ALA A 1 626 ? -1.529  -7.315  17.886  1.00 50.58 ? 626  ALA A C   1 
ATOM   4737 O  O   . ALA A 1 626 ? -0.642  -8.146  17.859  1.00 52.09 ? 626  ALA A O   1 
ATOM   4738 C  CB  . ALA A 1 626 ? -3.041  -8.106  16.118  1.00 59.58 ? 626  ALA A CB  1 
ATOM   4739 N  N   . GLY A 1 627 ? -1.358  -6.016  18.063  1.00 41.24 ? 627  GLY A N   1 
ATOM   4740 C  CA  . GLY A 1 627 ? -0.007  -5.488  18.345  1.00 40.71 ? 627  GLY A CA  1 
ATOM   4741 C  C   . GLY A 1 627 ? 0.652   -4.908  17.117  1.00 23.54 ? 627  GLY A C   1 
ATOM   4742 O  O   . GLY A 1 627 ? 1.794   -4.428  17.189  1.00 32.08 ? 627  GLY A O   1 
ATOM   4743 N  N   . VAL A 1 628 ? -0.076  -4.914  16.008  1.00 20.75 ? 628  VAL A N   1 
ATOM   4744 C  CA  . VAL A 1 628 ? 0.528   -4.437  14.756  1.00 13.65 ? 628  VAL A CA  1 
ATOM   4745 C  C   . VAL A 1 628 ? 0.399   -2.930  14.696  1.00 16.28 ? 628  VAL A C   1 
ATOM   4746 O  O   . VAL A 1 628 ? -0.736  -2.409  14.758  1.00 25.24 ? 628  VAL A O   1 
ATOM   4747 C  CB  . VAL A 1 628 ? -0.135  -5.116  13.550  1.00 18.88 ? 628  VAL A CB  1 
ATOM   4748 C  CG1 . VAL A 1 628 ? 0.357   -4.560  12.225  1.00 13.56 ? 628  VAL A CG1 1 
ATOM   4749 C  CG2 . VAL A 1 628 ? -0.116  -6.651  13.621  1.00 14.68 ? 628  VAL A CG2 1 
ATOM   4750 N  N   . PRO A 1 629 ? 1.525   -2.264  14.488  1.00 16.58 ? 629  PRO A N   1 
ATOM   4751 C  CA  . PRO A 1 629 ? 1.461   -0.821  14.371  1.00 15.07 ? 629  PRO A CA  1 
ATOM   4752 C  C   . PRO A 1 629 ? 1.143   -0.322  12.978  1.00 17.84 ? 629  PRO A C   1 
ATOM   4753 O  O   . PRO A 1 629 ? 1.513   -0.958  12.005  1.00 20.47 ? 629  PRO A O   1 
ATOM   4754 C  CB  . PRO A 1 629 ? 2.917   -0.391  14.725  1.00 23.46 ? 629  PRO A CB  1 
ATOM   4755 C  CG  . PRO A 1 629 ? 3.743   -1.504  14.123  1.00 19.00 ? 629  PRO A CG  1 
ATOM   4756 C  CD  . PRO A 1 629 ? 2.898   -2.770  14.406  1.00 19.10 ? 629  PRO A CD  1 
ATOM   4757 N  N   . SER A 1 630 ? 0.546   0.871   12.853  1.00 13.53 ? 630  SER A N   1 
ATOM   4758 C  CA  . SER A 1 630 ? 0.286   1.623   11.697  1.00 21.88 ? 630  SER A CA  1 
ATOM   4759 C  C   . SER A 1 630 ? 1.661   2.216   11.251  1.00 23.75 ? 630  SER A C   1 
ATOM   4760 O  O   . SER A 1 630 ? 2.661   2.092   11.978  1.00 18.30 ? 630  SER A O   1 
ATOM   4761 C  CB  . SER A 1 630 ? -0.622  2.865   11.967  1.00 13.88 ? 630  SER A CB  1 
ATOM   4762 O  OG  . SER A 1 630 ? 0.074   3.841   12.808  1.00 21.70 ? 630  SER A OG  1 
ATOM   4763 N  N   . VAL A 1 631 ? 1.701   2.858   10.102  1.00 22.48 ? 631  VAL A N   1 
ATOM   4764 C  CA  . VAL A 1 631 ? 2.917   3.595   9.681   1.00 21.88 ? 631  VAL A CA  1 
ATOM   4765 C  C   . VAL A 1 631 ? 2.675   4.909   10.494  1.00 23.93 ? 631  VAL A C   1 
ATOM   4766 O  O   . VAL A 1 631 ? 1.497   5.258   10.894  1.00 19.32 ? 631  VAL A O   1 
ATOM   4767 C  CB  . VAL A 1 631 ? 3.083   3.841   8.192   1.00 13.78 ? 631  VAL A CB  1 
ATOM   4768 C  CG1 . VAL A 1 631 ? 3.019   2.506   7.463   1.00 24.53 ? 631  VAL A CG1 1 
ATOM   4769 C  CG2 . VAL A 1 631 ? 2.104   4.799   7.675   1.00 22.09 ? 631  VAL A CG2 1 
ATOM   4770 N  N   . ALA A 1 632 ? 3.754   5.613   10.742  1.00 15.39 ? 632  ALA A N   1 
ATOM   4771 C  CA  . ALA A 1 632 ? 3.554   6.773   11.616  1.00 15.72 ? 632  ALA A CA  1 
ATOM   4772 C  C   . ALA A 1 632 ? 2.853   7.908   10.928  1.00 18.18 ? 632  ALA A C   1 
ATOM   4773 O  O   . ALA A 1 632 ? 3.020   8.052   9.739   1.00 22.62 ? 632  ALA A O   1 
ATOM   4774 C  CB  . ALA A 1 632 ? 4.978   7.283   12.060  1.00 16.48 ? 632  ALA A CB  1 
ATOM   4775 N  N   . SER A 1 633 ? 2.279   8.814   11.683  1.00 15.72 ? 633  SER A N   1 
ATOM   4776 C  CA  . SER A 1 633 ? 1.808   10.108  11.259  1.00 18.60 ? 633  SER A CA  1 
ATOM   4777 C  C   . SER A 1 633 ? 2.855   11.054  11.898  1.00 14.67 ? 633  SER A C   1 
ATOM   4778 O  O   . SER A 1 633 ? 3.258   10.845  13.062  1.00 23.72 ? 633  SER A O   1 
ATOM   4779 C  CB  . SER A 1 633 ? 0.406   10.595  11.707  1.00 29.31 ? 633  SER A CB  1 
ATOM   4780 O  OG  . SER A 1 633 ? -0.446  9.765   10.961  1.00 23.64 ? 633  SER A OG  1 
ATOM   4781 N  N   . THR A 1 634 ? 3.282   12.083  11.266  1.00 11.41 ? 634  THR A N   1 
ATOM   4782 C  CA  . THR A 1 634 ? 4.239   13.046  11.806  1.00 16.76 ? 634  THR A CA  1 
ATOM   4783 C  C   . THR A 1 634 ? 3.494   14.194  12.449  1.00 25.92 ? 634  THR A C   1 
ATOM   4784 O  O   . THR A 1 634 ? 2.624   14.745  11.797  1.00 26.38 ? 634  THR A O   1 
ATOM   4785 C  CB  . THR A 1 634 ? 5.166   13.510  10.610  1.00 10.77 ? 634  THR A CB  1 
ATOM   4786 O  OG1 . THR A 1 634 ? 5.695   12.227  10.216  1.00 23.66 ? 634  THR A OG1 1 
ATOM   4787 C  CG2 . THR A 1 634 ? 6.067   14.651  11.088  1.00 14.27 ? 634  THR A CG2 1 
ATOM   4788 N  N   . ILE A 1 635 ? 3.773   14.465  13.685  1.00 16.92 ? 635  ILE A N   1 
ATOM   4789 C  CA  . ILE A 1 635 ? 3.179   15.553  14.431  1.00 16.87 ? 635  ILE A CA  1 
ATOM   4790 C  C   . ILE A 1 635 ? 4.323   16.459  14.862  1.00 20.98 ? 635  ILE A C   1 
ATOM   4791 O  O   . ILE A 1 635 ? 5.308   15.958  15.403  1.00 16.87 ? 635  ILE A O   1 
ATOM   4792 C  CB  . ILE A 1 635 ? 2.575   14.898  15.754  1.00 16.81 ? 635  ILE A CB  1 
ATOM   4793 C  CG1 . ILE A 1 635 ? 1.594   13.781  15.360  1.00 24.40 ? 635  ILE A CG1 1 
ATOM   4794 C  CG2 . ILE A 1 635 ? 2.002   15.987  16.675  1.00 24.89 ? 635  ILE A CG2 1 
ATOM   4795 C  CD1 . ILE A 1 635 ? 0.369   14.315  14.586  1.00 31.62 ? 635  ILE A CD1 1 
ATOM   4796 N  N   . ARG A 1 636 ? 4.222   17.748  14.745  1.00 12.04 ? 636  ARG A N   1 
ATOM   4797 C  CA  . ARG A 1 636 ? 5.171   18.709  15.258  1.00 11.34 ? 636  ARG A CA  1 
ATOM   4798 C  C   . ARG A 1 636 ? 4.606   19.096  16.645  1.00 23.46 ? 636  ARG A C   1 
ATOM   4799 O  O   . ARG A 1 636 ? 3.399   19.410  16.746  1.00 28.42 ? 636  ARG A O   1 
ATOM   4800 C  CB  . ARG A 1 636 ? 5.282   19.933  14.378  1.00 14.27 ? 636  ARG A CB  1 
ATOM   4801 C  CG  . ARG A 1 636 ? 6.549   20.778  14.672  1.00 22.66 ? 636  ARG A CG  1 
ATOM   4802 C  CD  . ARG A 1 636 ? 6.478   21.802  13.577  1.00 34.39 ? 636  ARG A CD  1 
ATOM   4803 N  NE  . ARG A 1 636 ? 6.802   23.059  14.290  1.00 64.20 ? 636  ARG A NE  1 
ATOM   4804 C  CZ  . ARG A 1 636 ? 7.566   24.015  13.770  1.00 76.82 ? 636  ARG A CZ  1 
ATOM   4805 N  NH1 . ARG A 1 636 ? 8.188   23.896  12.608  1.00 80.35 ? 636  ARG A NH1 1 
ATOM   4806 N  NH2 . ARG A 1 636 ? 7.642   25.174  14.441  1.00 87.48 ? 636  ARG A NH2 1 
ATOM   4807 N  N   . VAL A 1 637 ? 5.385   19.062  17.696  1.00 19.37 ? 637  VAL A N   1 
ATOM   4808 C  CA  . VAL A 1 637 ? 5.143   19.384  19.088  1.00 21.23 ? 637  VAL A CA  1 
ATOM   4809 C  C   . VAL A 1 637 ? 5.886   20.695  19.338  1.00 23.75 ? 637  VAL A C   1 
ATOM   4810 O  O   . VAL A 1 637 ? 7.098   20.715  19.055  1.00 19.40 ? 637  VAL A O   1 
ATOM   4811 C  CB  . VAL A 1 637 ? 5.525   18.333  20.134  1.00 13.33 ? 637  VAL A CB  1 
ATOM   4812 C  CG1 . VAL A 1 637 ? 5.281   18.813  21.574  1.00 8.91  ? 637  VAL A CG1 1 
ATOM   4813 C  CG2 . VAL A 1 637 ? 4.662   17.057  19.936  1.00 19.01 ? 637  VAL A CG2 1 
ATOM   4814 N  N   . THR A 1 638 ? 5.102   21.714  19.693  1.00 23.59 ? 638  THR A N   1 
ATOM   4815 C  CA  . THR A 1 638 ? 5.819   23.011  19.941  1.00 18.64 ? 638  THR A CA  1 
ATOM   4816 C  C   . THR A 1 638 ? 5.648   23.352  21.422  1.00 28.43 ? 638  THR A C   1 
ATOM   4817 O  O   . THR A 1 638 ? 4.820   22.689  22.094  1.00 23.75 ? 638  THR A O   1 
ATOM   4818 C  CB  . THR A 1 638 ? 5.144   24.038  18.955  1.00 30.83 ? 638  THR A CB  1 
ATOM   4819 O  OG1 . THR A 1 638 ? 3.797   24.229  19.539  1.00 28.31 ? 638  THR A OG1 1 
ATOM   4820 C  CG2 . THR A 1 638 ? 4.999   23.540  17.519  1.00 27.44 ? 638  THR A CG2 1 
ATOM   4821 N  N   . GLN A 1 639 ? 6.396   24.317  21.976  1.00 31.90 ? 639  GLN A N   1 
ATOM   4822 C  CA  . GLN A 1 639 ? 6.108   24.661  23.394  1.00 53.36 ? 639  GLN A CA  1 
ATOM   4823 C  C   . GLN A 1 639 ? 4.979   25.717  23.283  1.00 72.79 ? 639  GLN A C   1 
ATOM   4824 O  O   . GLN A 1 639 ? 4.069   25.596  24.135  1.00 75.92 ? 639  GLN A O   1 
ATOM   4825 C  CB  . GLN A 1 639 ? 7.219   24.967  24.332  1.00 53.03 ? 639  GLN A CB  1 
ATOM   4826 C  CG  . GLN A 1 639 ? 8.618   24.908  23.744  1.00 52.05 ? 639  GLN A CG  1 
ATOM   4827 C  CD  . GLN A 1 639 ? 9.431   26.037  24.384  1.00 66.36 ? 639  GLN A CD  1 
ATOM   4828 O  OE1 . GLN A 1 639 ? 9.337   26.147  25.614  1.00 63.46 ? 639  GLN A OE1 1 
ATOM   4829 N  NE2 . GLN A 1 639 ? 10.087  26.790  23.505  1.00 66.16 ? 639  GLN A NE2 1 
ATOM   4830 O  OXT . GLN A 1 639 ? 4.889   26.577  22.371  1.00 84.78 ? 639  GLN A OXT 1 
HETATM 4831 CU CU  . CU  B 2 .   ? 34.790  7.991   15.023  1.00 24.89 ? 700  CU  A CU  1 
HETATM 4832 NA NA  . NA  C 3 .   ? 37.021  -9.686  -17.503 1.00 15.83 ? 702  NA  A NA  1 
HETATM 4833 O  O   . HOH D 4 .   ? 37.425  7.915   14.037  1.00 21.29 ? 703  HOH A O   1 
HETATM 4834 O  O   . HOH D 4 .   ? 24.174  0.145   32.178  1.00 14.51 ? 704  HOH A O   1 
HETATM 4835 O  O   . HOH D 4 .   ? 27.044  0.320   33.256  1.00 18.55 ? 705  HOH A O   1 
HETATM 4836 O  O   . HOH D 4 .   ? 26.263  -0.770  30.748  1.00 17.42 ? 706  HOH A O   1 
HETATM 4837 O  O   . HOH D 4 .   ? 30.539  3.836   16.644  1.00 7.42  ? 707  HOH A O   1 
HETATM 4838 O  O   . HOH D 4 .   ? 30.265  -0.819  -13.711 1.00 25.13 ? 708  HOH A O   1 
HETATM 4839 O  O   . HOH D 4 .   ? 25.528  1.470   -16.064 1.00 24.41 ? 709  HOH A O   1 
HETATM 4840 O  O   . HOH D 4 .   ? 18.361  -9.214  1.415   1.00 15.75 ? 710  HOH A O   1 
HETATM 4841 O  O   . HOH D 4 .   ? 25.977  7.146   -5.973  1.00 46.94 ? 711  HOH A O   1 
HETATM 4842 O  O   . HOH D 4 .   ? 29.655  2.496   -3.347  1.00 15.62 ? 712  HOH A O   1 
HETATM 4843 O  O   . HOH D 4 .   ? 35.237  4.522   -2.771  1.00 36.05 ? 713  HOH A O   1 
HETATM 4844 O  O   . HOH D 4 .   ? 26.327  -4.310  0.369   1.00 14.69 ? 714  HOH A O   1 
HETATM 4845 O  O   . HOH D 4 .   ? 15.384  -11.615 -5.545  1.00 14.95 ? 715  HOH A O   1 
HETATM 4846 O  O   . HOH D 4 .   ? 29.953  10.968  9.756   1.00 13.04 ? 716  HOH A O   1 
HETATM 4847 O  O   . HOH D 4 .   ? 22.185  6.321   -16.979 1.00 25.64 ? 717  HOH A O   1 
HETATM 4848 O  O   . HOH D 4 .   ? 13.196  -7.284  6.908   1.00 14.63 ? 718  HOH A O   1 
HETATM 4849 O  O   . HOH D 4 .   ? 20.108  -8.352  3.151   1.00 16.32 ? 719  HOH A O   1 
HETATM 4850 O  O   . HOH D 4 .   ? 27.694  -0.219  -1.784  1.00 12.15 ? 720  HOH A O   1 
HETATM 4851 O  O   . HOH D 4 .   ? 28.530  5.764   13.832  1.00 7.67  ? 721  HOH A O   1 
HETATM 4852 O  O   . HOH D 4 .   ? 15.527  13.290  13.014  1.00 26.59 ? 722  HOH A O   1 
HETATM 4853 O  O   . HOH D 4 .   ? 16.754  9.864   -2.079  1.00 23.53 ? 723  HOH A O   1 
HETATM 4854 O  O   . HOH D 4 .   ? 30.528  10.802  12.405  1.00 10.37 ? 724  HOH A O   1 
HETATM 4855 O  O   . HOH D 4 .   ? 30.373  11.970  17.405  1.00 6.68  ? 725  HOH A O   1 
HETATM 4856 O  O   . HOH D 4 .   ? 28.934  11.960  20.086  1.00 7.48  ? 726  HOH A O   1 
HETATM 4857 O  O   . HOH D 4 .   ? 26.642  12.891  18.629  1.00 8.70  ? 727  HOH A O   1 
HETATM 4858 O  O   . HOH D 4 .   ? 24.737  14.356  20.081  1.00 9.00  ? 728  HOH A O   1 
HETATM 4859 O  O   . HOH D 4 .   ? 24.740  19.421  18.029  1.00 11.62 ? 729  HOH A O   1 
HETATM 4860 O  O   . HOH D 4 .   ? 38.959  22.144  13.518  1.00 37.08 ? 730  HOH A O   1 
HETATM 4861 O  O   . HOH D 4 .   ? 29.494  27.700  12.224  1.00 23.43 ? 731  HOH A O   1 
HETATM 4862 O  O   . HOH D 4 .   ? 38.046  26.405  21.636  1.00 30.35 ? 732  HOH A O   1 
HETATM 4863 O  O   . HOH D 4 .   ? 19.075  15.968  21.169  1.00 7.08  ? 733  HOH A O   1 
HETATM 4864 O  O   . HOH D 4 .   ? 17.465  15.425  24.699  1.00 14.08 ? 734  HOH A O   1 
HETATM 4865 O  O   . HOH D 4 .   ? 19.052  29.744  30.107  1.00 28.05 ? 735  HOH A O   1 
HETATM 4866 O  O   . HOH D 4 .   ? 20.622  31.143  25.647  1.00 35.20 ? 736  HOH A O   1 
HETATM 4867 O  O   . HOH D 4 .   ? 29.915  14.526  25.592  1.00 8.99  ? 737  HOH A O   1 
HETATM 4868 O  O   . HOH D 4 .   ? 36.495  18.202  28.488  1.00 12.19 ? 738  HOH A O   1 
HETATM 4869 O  O   . HOH D 4 .   ? 41.477  17.289  20.237  1.00 10.63 ? 739  HOH A O   1 
HETATM 4870 O  O   . HOH D 4 .   ? 41.396  12.813  17.077  1.00 22.49 ? 740  HOH A O   1 
HETATM 4871 O  O   . HOH D 4 .   ? 37.963  10.891  21.236  1.00 11.19 ? 741  HOH A O   1 
HETATM 4872 O  O   . HOH D 4 .   ? 31.751  26.474  28.438  1.00 25.34 ? 742  HOH A O   1 
HETATM 4873 O  O   . HOH D 4 .   ? 34.827  25.542  28.651  1.00 29.85 ? 743  HOH A O   1 
HETATM 4874 O  O   . HOH D 4 .   ? 22.737  30.989  23.518  1.00 22.80 ? 744  HOH A O   1 
HETATM 4875 O  O   . HOH D 4 .   ? 29.301  32.865  25.713  1.00 25.46 ? 745  HOH A O   1 
HETATM 4876 O  O   . HOH D 4 .   ? 32.801  10.756  36.828  1.00 16.68 ? 746  HOH A O   1 
HETATM 4877 O  O   . HOH D 4 .   ? 30.167  10.166  31.164  1.00 5.00  ? 747  HOH A O   1 
HETATM 4878 O  O   . HOH D 4 .   ? 31.788  10.679  28.809  1.00 8.63  ? 748  HOH A O   1 
HETATM 4879 O  O   . HOH D 4 .   ? 35.953  5.442   29.036  1.00 5.43  ? 749  HOH A O   1 
HETATM 4880 O  O   . HOH D 4 .   ? 39.457  2.086   32.516  1.00 27.81 ? 750  HOH A O   1 
HETATM 4881 O  O   . HOH D 4 .   ? 40.513  4.005   25.348  1.00 13.07 ? 751  HOH A O   1 
HETATM 4882 O  O   . HOH D 4 .   ? 44.116  13.386  29.946  1.00 32.78 ? 752  HOH A O   1 
HETATM 4883 O  O   . HOH D 4 .   ? 31.673  5.033   19.152  1.00 10.37 ? 753  HOH A O   1 
HETATM 4884 O  O   . HOH D 4 .   ? 15.486  20.565  29.354  1.00 7.30  ? 754  HOH A O   1 
HETATM 4885 O  O   . HOH D 4 .   ? 28.865  6.478   25.392  1.00 7.29  ? 755  HOH A O   1 
HETATM 4886 O  O   . HOH D 4 .   ? 26.446  6.231   23.836  1.00 5.00  ? 756  HOH A O   1 
HETATM 4887 O  O   . HOH D 4 .   ? 25.138  8.505   24.305  1.00 10.47 ? 757  HOH A O   1 
HETATM 4888 O  O   . HOH D 4 .   ? 21.055  9.966   25.226  1.00 12.20 ? 758  HOH A O   1 
HETATM 4889 O  O   . HOH D 4 .   ? 22.419  8.381   23.315  1.00 7.49  ? 759  HOH A O   1 
HETATM 4890 O  O   . HOH D 4 .   ? 18.024  24.361  34.374  1.00 22.75 ? 760  HOH A O   1 
HETATM 4891 O  O   . HOH D 4 .   ? 32.341  8.262   37.407  1.00 15.13 ? 761  HOH A O   1 
HETATM 4892 O  O   . HOH D 4 .   ? 18.851  29.045  38.865  1.00 26.29 ? 762  HOH A O   1 
HETATM 4893 O  O   . HOH D 4 .   ? 22.033  26.768  36.560  1.00 18.91 ? 763  HOH A O   1 
HETATM 4894 O  O   . HOH D 4 .   ? 24.939  33.902  32.888  1.00 16.38 ? 764  HOH A O   1 
HETATM 4895 O  O   . HOH D 4 .   ? 19.556  33.137  33.074  1.00 13.80 ? 765  HOH A O   1 
HETATM 4896 O  O   . HOH D 4 .   ? 26.495  17.735  43.843  1.00 33.28 ? 766  HOH A O   1 
HETATM 4897 O  O   . HOH D 4 .   ? 21.079  7.552   41.803  1.00 29.31 ? 767  HOH A O   1 
HETATM 4898 O  O   . HOH D 4 .   ? 25.062  -2.854  38.764  1.00 8.63  ? 768  HOH A O   1 
HETATM 4899 O  O   . HOH D 4 .   ? 20.249  -8.499  40.027  1.00 45.85 ? 769  HOH A O   1 
HETATM 4900 O  O   . HOH D 4 .   ? 29.121  -1.141  33.238  1.00 27.17 ? 770  HOH A O   1 
HETATM 4901 O  O   . HOH D 4 .   ? 31.697  -1.495  31.396  1.00 10.75 ? 771  HOH A O   1 
HETATM 4902 O  O   . HOH D 4 .   ? 36.941  3.595   32.735  1.00 15.90 ? 772  HOH A O   1 
HETATM 4903 O  O   . HOH D 4 .   ? 12.438  -0.801  26.312  1.00 7.42  ? 773  HOH A O   1 
HETATM 4904 O  O   . HOH D 4 .   ? 16.341  7.832   24.058  1.00 9.00  ? 774  HOH A O   1 
HETATM 4905 O  O   . HOH D 4 .   ? 18.608  7.033   22.753  1.00 7.08  ? 775  HOH A O   1 
HETATM 4906 O  O   . HOH D 4 .   ? 20.401  4.578   21.099  1.00 9.08  ? 776  HOH A O   1 
HETATM 4907 O  O   . HOH D 4 .   ? 15.697  12.045  24.111  1.00 10.10 ? 777  HOH A O   1 
HETATM 4908 O  O   . HOH D 4 .   ? 8.140   6.753   37.058  1.00 39.70 ? 778  HOH A O   1 
HETATM 4909 O  O   . HOH D 4 .   ? 36.604  -1.227  24.025  1.00 15.07 ? 779  HOH A O   1 
HETATM 4910 O  O   . HOH D 4 .   ? 33.965  1.019   23.641  1.00 17.03 ? 780  HOH A O   1 
HETATM 4911 O  O   . HOH D 4 .   ? 44.936  0.554   24.696  1.00 19.06 ? 781  HOH A O   1 
HETATM 4912 O  O   . HOH D 4 .   ? 42.189  -0.320  27.358  1.00 25.57 ? 782  HOH A O   1 
HETATM 4913 O  O   . HOH D 4 .   ? 34.759  -5.031  30.920  1.00 25.71 ? 783  HOH A O   1 
HETATM 4914 O  O   . HOH D 4 .   ? 39.046  -5.489  29.406  1.00 32.40 ? 784  HOH A O   1 
HETATM 4915 O  O   . HOH D 4 .   ? 33.066  -3.579  32.708  1.00 22.33 ? 785  HOH A O   1 
HETATM 4916 O  O   . HOH D 4 .   ? 14.628  2.232   37.937  1.00 10.65 ? 786  HOH A O   1 
HETATM 4917 O  O   . HOH D 4 .   ? 13.118  7.843   40.815  1.00 29.02 ? 787  HOH A O   1 
HETATM 4918 O  O   . HOH D 4 .   ? 15.180  11.735  39.754  1.00 17.25 ? 788  HOH A O   1 
HETATM 4919 O  O   . HOH D 4 .   ? 17.196  -8.150  37.604  1.00 30.49 ? 789  HOH A O   1 
HETATM 4920 O  O   . HOH D 4 .   ? 23.653  -8.116  16.550  1.00 13.28 ? 790  HOH A O   1 
HETATM 4921 O  O   . HOH D 4 .   ? 15.801  6.429   16.158  1.00 7.34  ? 791  HOH A O   1 
HETATM 4922 O  O   . HOH D 4 .   ? 19.897  5.072   17.325  1.00 11.32 ? 792  HOH A O   1 
HETATM 4923 O  O   . HOH D 4 .   ? 22.647  4.809   16.640  1.00 11.18 ? 793  HOH A O   1 
HETATM 4924 O  O   . HOH D 4 .   ? 22.419  3.967   19.306  1.00 8.25  ? 794  HOH A O   1 
HETATM 4925 O  O   . HOH D 4 .   ? 24.855  -1.345  15.128  1.00 5.67  ? 795  HOH A O   1 
HETATM 4926 O  O   . HOH D 4 .   ? 28.324  2.388   16.514  1.00 6.27  ? 796  HOH A O   1 
HETATM 4927 O  O   . HOH D 4 .   ? 13.017  5.269   18.050  1.00 13.26 ? 797  HOH A O   1 
HETATM 4928 O  O   . HOH D 4 .   ? 13.169  7.693   16.506  1.00 9.12  ? 798  HOH A O   1 
HETATM 4929 O  O   . HOH D 4 .   ? 13.951  7.968   14.079  1.00 10.69 ? 799  HOH A O   1 
HETATM 4930 O  O   . HOH D 4 .   ? 23.503  -5.089  13.469  1.00 11.95 ? 800  HOH A O   1 
HETATM 4931 O  O   . HOH D 4 .   ? 22.286  -8.146  14.247  1.00 10.19 ? 801  HOH A O   1 
HETATM 4932 O  O   . HOH D 4 .   ? 28.213  -6.836  14.473  1.00 7.36  ? 802  HOH A O   1 
HETATM 4933 O  O   . HOH D 4 .   ? 25.508  -7.174  12.922  1.00 7.69  ? 803  HOH A O   1 
HETATM 4934 O  O   . HOH D 4 .   ? 35.037  -1.789  15.556  1.00 12.61 ? 804  HOH A O   1 
HETATM 4935 O  O   . HOH D 4 .   ? 37.200  -7.502  18.918  1.00 9.80  ? 805  HOH A O   1 
HETATM 4936 O  O   . HOH D 4 .   ? 41.956  -1.749  13.376  1.00 20.93 ? 806  HOH A O   1 
HETATM 4937 O  O   . HOH D 4 .   ? 33.799  -2.011  10.450  1.00 12.44 ? 807  HOH A O   1 
HETATM 4938 O  O   . HOH D 4 .   ? 31.039  -2.613  10.971  1.00 14.36 ? 808  HOH A O   1 
HETATM 4939 O  O   . HOH D 4 .   ? 34.738  -0.189  12.244  1.00 11.62 ? 809  HOH A O   1 
HETATM 4940 O  O   . HOH D 4 .   ? 26.500  -13.813 17.385  1.00 22.83 ? 810  HOH A O   1 
HETATM 4941 O  O   . HOH D 4 .   ? 15.781  -15.294 23.514  1.00 16.24 ? 811  HOH A O   1 
HETATM 4942 O  O   . HOH D 4 .   ? 18.397  -16.103 17.629  1.00 19.09 ? 812  HOH A O   1 
HETATM 4943 O  O   . HOH D 4 .   ? 18.347  -14.700 10.241  1.00 26.99 ? 813  HOH A O   1 
HETATM 4944 O  O   . HOH D 4 .   ? 19.173  -17.057 10.264  1.00 29.24 ? 814  HOH A O   1 
HETATM 4945 O  O   . HOH D 4 .   ? 22.933  -4.408  9.169   1.00 7.00  ? 815  HOH A O   1 
HETATM 4946 O  O   . HOH D 4 .   ? 30.610  -8.178  7.594   1.00 16.08 ? 816  HOH A O   1 
HETATM 4947 O  O   . HOH D 4 .   ? 33.721  -8.382  8.050   1.00 45.21 ? 817  HOH A O   1 
HETATM 4948 O  O   . HOH D 4 .   ? 25.391  5.353   15.974  1.00 5.02  ? 818  HOH A O   1 
HETATM 4949 O  O   . HOH D 4 .   ? 11.640  -5.297  4.165   1.00 40.52 ? 819  HOH A O   1 
HETATM 4950 O  O   . HOH D 4 .   ? 11.082  0.289   1.436   1.00 53.53 ? 820  HOH A O   1 
HETATM 4951 O  O   . HOH D 4 .   ? 7.376   -3.114  5.961   1.00 47.00 ? 821  HOH A O   1 
HETATM 4952 O  O   . HOH D 4 .   ? 29.216  -4.496  3.749   1.00 17.24 ? 822  HOH A O   1 
HETATM 4953 O  O   . HOH D 4 .   ? 2.770   -5.657  8.262   1.00 25.93 ? 823  HOH A O   1 
HETATM 4954 O  O   . HOH D 4 .   ? -3.609  -7.206  12.042  1.00 39.75 ? 824  HOH A O   1 
HETATM 4955 O  O   . HOH D 4 .   ? 8.810   11.217  8.302   1.00 19.58 ? 825  HOH A O   1 
HETATM 4956 O  O   . HOH D 4 .   ? 21.706  12.563  18.590  1.00 5.04  ? 826  HOH A O   1 
HETATM 4957 O  O   . HOH D 4 .   ? 24.265  11.621  17.661  1.00 10.75 ? 827  HOH A O   1 
HETATM 4958 O  O   . HOH D 4 .   ? 2.303   2.097   23.695  1.00 37.28 ? 828  HOH A O   1 
HETATM 4959 O  O   . HOH D 4 .   ? 6.370   1.733   28.597  1.00 54.71 ? 829  HOH A O   1 
HETATM 4960 O  O   . HOH D 4 .   ? 2.638   12.189  8.228   1.00 44.83 ? 830  HOH A O   1 
HETATM 4961 O  O   . HOH D 4 .   ? 32.347  -15.758 -8.199  1.00 29.95 ? 831  HOH A O   1 
HETATM 4962 O  O   . HOH D 4 .   ? 29.816  3.396   -9.918  1.00 18.60 ? 832  HOH A O   1 
HETATM 4963 O  O   . HOH D 4 .   ? 26.662  6.900   -8.350  1.00 41.03 ? 833  HOH A O   1 
HETATM 4964 O  O   . HOH D 4 .   ? 28.600  -2.615  -0.172  1.00 19.51 ? 834  HOH A O   1 
HETATM 4965 O  O   . HOH D 4 .   ? 30.547  -1.400  -2.476  1.00 19.01 ? 835  HOH A O   1 
HETATM 4966 O  O   . HOH D 4 .   ? 18.839  -11.880 1.121   1.00 17.58 ? 836  HOH A O   1 
HETATM 4967 O  O   . HOH D 4 .   ? 16.204  -12.945 8.700   1.00 24.01 ? 837  HOH A O   1 
HETATM 4968 O  O   . HOH D 4 .   ? 19.077  15.804  2.175   1.00 39.58 ? 838  HOH A O   1 
HETATM 4969 O  O   . HOH D 4 .   ? 40.213  7.808   7.281   1.00 24.91 ? 839  HOH A O   1 
HETATM 4970 O  O   . HOH D 4 .   ? 18.360  26.240  14.553  1.00 26.29 ? 840  HOH A O   1 
HETATM 4971 O  O   . HOH D 4 .   ? 21.877  16.687  2.315   1.00 21.33 ? 841  HOH A O   1 
HETATM 4972 O  O   . HOH D 4 .   ? 11.053  24.713  29.623  1.00 33.50 ? 842  HOH A O   1 
HETATM 4973 O  O   . HOH D 4 .   ? 35.078  20.922  34.558  1.00 20.52 ? 843  HOH A O   1 
HETATM 4974 O  O   . HOH D 4 .   ? 44.192  12.424  26.688  1.00 23.46 ? 844  HOH A O   1 
HETATM 4975 O  O   . HOH D 4 .   ? 45.503  8.376   23.546  1.00 26.85 ? 845  HOH A O   1 
HETATM 4976 O  O   . HOH D 4 .   ? 22.499  5.692   22.959  1.00 6.80  ? 846  HOH A O   1 
HETATM 4977 O  O   . HOH D 4 .   ? 35.045  1.793   35.670  1.00 30.69 ? 847  HOH A O   1 
HETATM 4978 O  O   . HOH D 4 .   ? 34.179  6.844   36.425  1.00 22.63 ? 848  HOH A O   1 
HETATM 4979 O  O   . HOH D 4 .   ? 10.072  -0.534  32.811  1.00 40.46 ? 849  HOH A O   1 
HETATM 4980 O  O   . HOH D 4 .   ? 11.131  -3.014  33.017  1.00 30.43 ? 850  HOH A O   1 
HETATM 4981 O  O   . HOH D 4 .   ? 10.140  -0.121  35.369  1.00 48.85 ? 851  HOH A O   1 
HETATM 4982 O  O   . HOH D 4 .   ? 12.637  0.552   37.923  1.00 40.33 ? 852  HOH A O   1 
HETATM 4983 O  O   . HOH D 4 .   ? 29.614  -10.865 22.965  1.00 27.45 ? 853  HOH A O   1 
HETATM 4984 O  O   . HOH D 4 .   ? 29.199  -12.132 25.635  1.00 25.47 ? 854  HOH A O   1 
HETATM 4985 O  O   . HOH D 4 .   ? 8.856   -5.615  19.858  1.00 23.95 ? 855  HOH A O   1 
HETATM 4986 O  O   . HOH D 4 .   ? 7.029   -3.636  24.843  1.00 25.68 ? 856  HOH A O   1 
HETATM 4987 O  O   . HOH D 4 .   ? 38.531  -7.119  10.551  1.00 20.32 ? 857  HOH A O   1 
HETATM 4988 O  O   . HOH D 4 .   ? 34.675  -10.991 11.421  1.00 35.68 ? 858  HOH A O   1 
HETATM 4989 O  O   . HOH D 4 .   ? 36.722  -12.750 15.683  1.00 32.74 ? 859  HOH A O   1 
HETATM 4990 O  O   . HOH D 4 .   ? 13.926  -15.364 21.056  1.00 25.97 ? 860  HOH A O   1 
HETATM 4991 O  O   . HOH D 4 .   ? 22.147  -17.619 20.228  1.00 57.39 ? 861  HOH A O   1 
HETATM 4992 O  O   . HOH D 4 .   ? 22.538  -17.848 24.790  1.00 33.27 ? 862  HOH A O   1 
HETATM 4993 O  O   . HOH D 4 .   ? 10.850  -8.831  16.560  1.00 22.26 ? 863  HOH A O   1 
HETATM 4994 O  O   . HOH D 4 .   ? 8.748   -7.486  17.807  1.00 28.13 ? 864  HOH A O   1 
HETATM 4995 O  O   . HOH D 4 .   ? 12.619  -2.013  1.613   1.00 54.69 ? 865  HOH A O   1 
HETATM 4996 O  O   . HOH D 4 .   ? -0.934  2.570   8.506   1.00 25.54 ? 866  HOH A O   1 
HETATM 4997 O  O   . HOH D 4 .   ? -1.921  5.080   8.800   1.00 21.39 ? 867  HOH A O   1 
HETATM 4998 O  O   . HOH D 4 .   ? -0.552  1.340   6.161   1.00 41.68 ? 868  HOH A O   1 
HETATM 4999 O  O   . HOH D 4 .   ? -0.331  6.925   9.956   1.00 32.97 ? 869  HOH A O   1 
HETATM 5000 O  O   . HOH D 4 .   ? 6.123   22.678  29.651  1.00 42.30 ? 870  HOH A O   1 
HETATM 5001 O  O   . HOH D 4 .   ? 30.234  -23.681 -9.231  1.00 42.68 ? 871  HOH A O   1 
HETATM 5002 O  O   . HOH D 4 .   ? 26.573  -22.906 -1.489  1.00 31.54 ? 872  HOH A O   1 
HETATM 5003 O  O   . HOH D 4 .   ? 34.452  -8.686  -9.030  1.00 29.09 ? 873  HOH A O   1 
HETATM 5004 O  O   . HOH D 4 .   ? 32.609  -0.244  -15.628 1.00 36.10 ? 874  HOH A O   1 
HETATM 5005 O  O   . HOH D 4 .   ? 16.375  -13.032 2.135   1.00 46.57 ? 875  HOH A O   1 
HETATM 5006 O  O   . HOH D 4 .   ? 19.368  -13.997 7.585   1.00 47.07 ? 876  HOH A O   1 
HETATM 5007 O  O   . HOH D 4 .   ? 13.612  16.800  3.280   1.00 27.69 ? 877  HOH A O   1 
HETATM 5008 O  O   . HOH D 4 .   ? 9.358   8.657   2.145   1.00 39.23 ? 878  HOH A O   1 
HETATM 5009 O  O   . HOH D 4 .   ? 9.985   7.154   5.279   1.00 33.33 ? 879  HOH A O   1 
HETATM 5010 O  O   . HOH D 4 .   ? 9.515   4.409   6.317   1.00 27.50 ? 880  HOH A O   1 
HETATM 5011 O  O   . HOH D 4 .   ? 12.723  9.820   -3.907  1.00 45.13 ? 881  HOH A O   1 
HETATM 5012 O  O   . HOH D 4 .   ? 22.013  23.118  0.962   1.00 38.32 ? 882  HOH A O   1 
HETATM 5013 O  O   . HOH D 4 .   ? 29.681  22.412  4.589   1.00 20.91 ? 883  HOH A O   1 
HETATM 5014 O  O   . HOH D 4 .   ? 15.086  19.633  9.782   1.00 28.51 ? 884  HOH A O   1 
HETATM 5015 O  O   . HOH D 4 .   ? 40.626  15.190  15.382  1.00 54.36 ? 885  HOH A O   1 
HETATM 5016 O  O   . HOH D 4 .   ? 37.250  23.417  33.804  1.00 53.10 ? 886  HOH A O   1 
HETATM 5017 O  O   . HOH D 4 .   ? 28.895  24.560  39.081  1.00 40.09 ? 887  HOH A O   1 
HETATM 5018 O  O   . HOH D 4 .   ? 33.652  28.962  36.009  1.00 31.75 ? 888  HOH A O   1 
HETATM 5019 O  O   . HOH D 4 .   ? 31.563  12.733  39.820  1.00 32.62 ? 889  HOH A O   1 
HETATM 5020 O  O   . HOH D 4 .   ? 28.846  13.412  40.233  1.00 21.15 ? 890  HOH A O   1 
HETATM 5021 O  O   . HOH D 4 .   ? 28.379  16.749  40.347  1.00 35.47 ? 891  HOH A O   1 
HETATM 5022 O  O   . HOH D 4 .   ? 27.408  11.578  40.903  1.00 31.76 ? 892  HOH A O   1 
HETATM 5023 O  O   . HOH D 4 .   ? 26.754  -4.498  37.595  1.00 26.70 ? 893  HOH A O   1 
HETATM 5024 O  O   . HOH D 4 .   ? 42.755  2.213   25.978  1.00 35.27 ? 894  HOH A O   1 
HETATM 5025 O  O   . HOH D 4 .   ? 44.762  2.968   24.352  1.00 27.29 ? 895  HOH A O   1 
HETATM 5026 O  O   . HOH D 4 .   ? 29.653  -8.766  31.298  1.00 49.28 ? 896  HOH A O   1 
HETATM 5027 O  O   . HOH D 4 .   ? 11.699  13.158  42.229  1.00 41.94 ? 897  HOH A O   1 
HETATM 5028 O  O   . HOH D 4 .   ? 25.420  -14.591 11.093  1.00 31.51 ? 898  HOH A O   1 
HETATM 5029 O  O   . HOH D 4 .   ? 30.276  -2.792  1.781   1.00 13.87 ? 899  HOH A O   1 
HETATM 5030 O  O   . HOH D 4 .   ? 3.546   -11.418 3.161   1.00 52.30 ? 900  HOH A O   1 
HETATM 5031 O  O   . HOH D 4 .   ? -1.714  3.549   24.451  1.00 32.10 ? 901  HOH A O   1 
HETATM 5032 O  O   . HOH D 4 .   ? -13.893 3.315   18.833  1.00 37.27 ? 902  HOH A O   1 
HETATM 5033 O  O   . HOH D 4 .   ? 37.033  -8.619  -8.806  1.00 49.32 ? 903  HOH A O   1 
HETATM 5034 O  O   . HOH D 4 .   ? 36.640  -1.996  -2.953  1.00 36.41 ? 904  HOH A O   1 
HETATM 5035 O  O   . HOH D 4 .   ? 26.915  23.550  -0.074  1.00 44.19 ? 905  HOH A O   1 
HETATM 5036 O  O   . HOH D 4 .   ? 34.855  26.967  30.854  1.00 36.25 ? 906  HOH A O   1 
HETATM 5037 O  O   . HOH D 4 .   ? 34.463  26.534  34.806  1.00 41.23 ? 907  HOH A O   1 
HETATM 5038 O  O   . HOH D 4 .   ? 14.382  -5.051  36.641  1.00 35.33 ? 908  HOH A O   1 
HETATM 5039 O  O   . HOH D 4 .   ? 17.438  -17.649 14.834  1.00 30.23 ? 909  HOH A O   1 
HETATM 5040 O  O   . HOH D 4 .   ? -2.177  -9.398  12.145  1.00 47.37 ? 910  HOH A O   1 
HETATM 5041 O  O   . HOH D 4 .   ? 33.720  -4.889  4.664   1.00 42.41 ? 911  HOH A O   1 
HETATM 5042 O  O   . HOH D 4 .   ? 23.693  -12.842 -23.974 1.00 45.05 ? 912  HOH A O   1 
HETATM 5043 O  O   . HOH D 4 .   ? 35.924  -9.973  -5.478  1.00 36.93 ? 913  HOH A O   1 
HETATM 5044 O  O   . HOH D 4 .   ? 33.238  -0.659  -2.582  1.00 44.50 ? 914  HOH A O   1 
HETATM 5045 O  O   . HOH D 4 .   ? 32.242  2.202   -2.591  1.00 34.42 ? 915  HOH A O   1 
HETATM 5046 O  O   . HOH D 4 .   ? 29.602  -11.500 0.163   1.00 30.01 ? 916  HOH A O   1 
HETATM 5047 O  O   . HOH D 4 .   ? 24.380  0.520   -24.484 1.00 31.80 ? 917  HOH A O   1 
HETATM 5048 O  O   . HOH D 4 .   ? 32.030  1.562   -10.191 1.00 22.65 ? 918  HOH A O   1 
HETATM 5049 O  O   . HOH D 4 .   ? 8.932   -12.631 12.732  1.00 26.62 ? 919  HOH A O   1 
HETATM 5050 O  O   . HOH D 4 .   ? 28.437  26.864  9.305   1.00 25.53 ? 920  HOH A O   1 
HETATM 5051 O  O   . HOH D 4 .   ? 8.468   22.087  17.250  1.00 29.03 ? 921  HOH A O   1 
HETATM 5052 O  O   . HOH D 4 .   ? 45.447  19.869  24.785  1.00 34.69 ? 922  HOH A O   1 
HETATM 5053 O  O   . HOH D 4 .   ? 27.302  31.964  31.066  1.00 38.04 ? 923  HOH A O   1 
HETATM 5054 O  O   . HOH D 4 .   ? 41.629  -3.402  6.895   1.00 38.26 ? 924  HOH A O   1 
HETATM 5055 O  O   . HOH D 4 .   ? -4.693  11.880  26.767  1.00 33.82 ? 925  HOH A O   1 
HETATM 5056 O  O   . HOH D 4 .   ? 9.460   21.385  32.070  1.00 18.78 ? 926  HOH A O   1 
HETATM 5057 O  O   . HOH D 4 .   ? 39.015  -3.294  -17.318 1.00 29.83 ? 927  HOH A O   1 
HETATM 5058 O  O   . HOH D 4 .   ? 15.666  -9.608  1.559   1.00 35.09 ? 928  HOH A O   1 
HETATM 5059 O  O   . HOH D 4 .   ? 22.844  -18.603 6.848   1.00 49.20 ? 929  HOH A O   1 
HETATM 5060 O  O   . HOH D 4 .   ? 9.809   18.239  2.879   1.00 43.52 ? 930  HOH A O   1 
HETATM 5061 O  O   . HOH D 4 .   ? 34.882  10.482  -1.888  1.00 49.73 ? 931  HOH A O   1 
HETATM 5062 O  O   . HOH D 4 .   ? 28.279  32.121  18.507  1.00 25.84 ? 932  HOH A O   1 
HETATM 5063 O  O   . HOH D 4 .   ? 41.788  21.743  31.094  1.00 43.14 ? 933  HOH A O   1 
HETATM 5064 O  O   . HOH D 4 .   ? 39.819  12.011  32.294  1.00 37.78 ? 934  HOH A O   1 
HETATM 5065 O  O   . HOH D 4 .   ? 18.157  -4.907  40.332  1.00 29.32 ? 935  HOH A O   1 
HETATM 5066 O  O   . HOH D 4 .   ? 40.906  -2.757  9.437   1.00 41.35 ? 936  HOH A O   1 
HETATM 5067 O  O   . HOH D 4 .   ? 12.040  -11.765 33.702  1.00 31.56 ? 937  HOH A O   1 
HETATM 5068 O  O   . HOH D 4 .   ? -2.709  -9.788  9.379   1.00 47.94 ? 938  HOH A O   1 
HETATM 5069 O  O   . HOH D 4 .   ? -2.489  22.712  20.578  1.00 45.93 ? 939  HOH A O   1 
HETATM 5070 O  O   . HOH D 4 .   ? 5.848   17.492  34.992  1.00 51.41 ? 940  HOH A O   1 
HETATM 5071 O  O   . HOH D 4 .   ? 21.581  -16.648 -17.871 1.00 51.09 ? 941  HOH A O   1 
HETATM 5072 O  O   . HOH D 4 .   ? 32.670  3.087   -23.788 1.00 40.93 ? 942  HOH A O   1 
HETATM 5073 O  O   . HOH D 4 .   ? 20.617  -10.728 -18.769 1.00 28.95 ? 943  HOH A O   1 
HETATM 5074 O  O   . HOH D 4 .   ? 30.489  6.944   -15.874 1.00 36.07 ? 944  HOH A O   1 
HETATM 5075 O  O   . HOH D 4 .   ? 35.227  26.008  7.868   1.00 43.01 ? 945  HOH A O   1 
HETATM 5076 O  O   . HOH D 4 .   ? 9.003   24.967  19.876  1.00 37.97 ? 946  HOH A O   1 
HETATM 5077 O  O   . HOH D 4 .   ? 36.406  25.293  13.197  1.00 33.18 ? 947  HOH A O   1 
HETATM 5078 O  O   . HOH D 4 .   ? 17.135  27.004  31.684  1.00 29.78 ? 948  HOH A O   1 
HETATM 5079 O  O   . HOH D 4 .   ? 40.176  24.952  20.701  1.00 53.00 ? 949  HOH A O   1 
HETATM 5080 O  O   . HOH D 4 .   ? 28.916  33.207  29.227  1.00 35.37 ? 950  HOH A O   1 
HETATM 5081 O  O   . HOH D 4 .   ? 36.097  8.843   36.823  1.00 43.73 ? 951  HOH A O   1 
HETATM 5082 O  O   . HOH D 4 .   ? 40.737  9.224   32.400  1.00 33.60 ? 952  HOH A O   1 
HETATM 5083 O  O   . HOH D 4 .   ? 32.196  7.742   40.307  1.00 38.06 ? 953  HOH A O   1 
HETATM 5084 O  O   . HOH D 4 .   ? 18.962  -3.546  42.273  1.00 45.30 ? 954  HOH A O   1 
HETATM 5085 O  O   . HOH D 4 .   ? 3.643   4.848   31.272  1.00 41.45 ? 955  HOH A O   1 
HETATM 5086 O  O   . HOH D 4 .   ? 17.436  12.729  46.098  1.00 48.97 ? 956  HOH A O   1 
HETATM 5087 O  O   . HOH D 4 .   ? 4.418   -5.660  19.806  1.00 44.45 ? 957  HOH A O   1 
HETATM 5088 O  O   . HOH D 4 .   ? 42.516  -5.087  22.250  1.00 40.50 ? 958  HOH A O   1 
HETATM 5089 O  O   . HOH D 4 .   ? 41.860  -8.923  17.268  1.00 49.53 ? 959  HOH A O   1 
HETATM 5090 O  O   . HOH D 4 .   ? 39.359  -9.191  20.037  1.00 34.16 ? 960  HOH A O   1 
HETATM 5091 O  O   . HOH D 4 .   ? 9.027   -13.364 30.071  1.00 34.11 ? 961  HOH A O   1 
HETATM 5092 O  O   . HOH D 4 .   ? 21.988  -15.074 9.375   1.00 36.01 ? 962  HOH A O   1 
HETATM 5093 O  O   . HOH D 4 .   ? 37.066  2.179   0.418   1.00 36.29 ? 963  HOH A O   1 
HETATM 5094 O  O   . HOH D 4 .   ? 32.222  -7.018  4.495   1.00 37.37 ? 964  HOH A O   1 
HETATM 5095 O  O   . HOH D 4 .   ? 2.080   -8.772  14.871  1.00 37.55 ? 965  HOH A O   1 
HETATM 5096 O  O   . HOH D 4 .   ? -0.151  -10.141 14.201  1.00 49.58 ? 966  HOH A O   1 
HETATM 5097 O  O   . HOH D 4 .   ? -13.595 2.701   11.693  1.00 38.84 ? 967  HOH A O   1 
HETATM 5098 O  O   . HOH D 4 .   ? -1.601  13.182  28.807  1.00 45.94 ? 968  HOH A O   1 
HETATM 5099 O  O   . HOH D 4 .   ? 38.187  7.667   17.149  1.00 22.10 ? 969  HOH A O   1 
HETATM 5100 O  O   . HOH D 4 .   ? 15.462  0.447   -6.721  1.00 55.10 ? 970  HOH A O   1 
HETATM 5101 O  O   . HOH D 4 .   ? 35.987  1.205   -2.273  1.00 49.11 ? 971  HOH A O   1 
HETATM 5102 O  O   . HOH D 4 .   ? 17.876  33.111  23.611  1.00 40.44 ? 972  HOH A O   1 
HETATM 5103 O  O   . HOH D 4 .   ? 46.032  6.203   31.882  1.00 35.74 ? 973  HOH A O   1 
HETATM 5104 O  O   . HOH D 4 .   ? 35.107  -3.459  34.571  1.00 47.87 ? 974  HOH A O   1 
HETATM 5105 O  O   . HOH D 4 .   ? 32.803  -9.506  27.236  1.00 52.94 ? 975  HOH A O   1 
HETATM 5106 O  O   . HOH D 4 .   ? 13.296  10.071  42.099  1.00 35.18 ? 976  HOH A O   1 
HETATM 5107 O  O   . HOH D 4 .   ? 43.849  4.757   4.122   1.00 40.51 ? 977  HOH A O   1 
HETATM 5108 O  O   . HOH D 4 .   ? -3.708  16.887  9.855   1.00 37.95 ? 978  HOH A O   1 
HETATM 5109 O  O   . HOH D 4 .   ? -1.539  10.933  26.480  1.00 43.37 ? 979  HOH A O   1 
HETATM 5110 O  O   . HOH D 4 .   ? 17.822  -4.337  -19.276 1.00 48.51 ? 980  HOH A O   1 
HETATM 5111 O  O   . HOH D 4 .   ? 40.535  17.347  13.614  1.00 47.10 ? 981  HOH A O   1 
HETATM 5112 O  O   . HOH D 4 .   ? 7.937   20.428  35.423  1.00 51.19 ? 982  HOH A O   1 
HETATM 5113 O  O   . HOH D 4 .   ? 41.150  -5.989  10.012  1.00 41.89 ? 983  HOH A O   1 
HETATM 5114 O  O   . HOH D 4 .   ? 30.913  -11.760 20.420  1.00 41.95 ? 984  HOH A O   1 
HETATM 5115 O  O   . HOH D 4 .   ? 28.506  -13.418 7.954   1.00 46.60 ? 985  HOH A O   1 
HETATM 5116 O  O   . HOH D 4 .   ? -1.445  -3.178  5.660   1.00 43.52 ? 986  HOH A O   1 
HETATM 5117 O  O   . HOH D 4 .   ? -6.204  -2.057  7.945   1.00 53.27 ? 987  HOH A O   1 
HETATM 5118 O  O   . HOH D 4 .   ? -2.421  21.045  10.887  1.00 47.60 ? 988  HOH A O   1 
HETATM 5119 O  O   . HOH D 4 .   ? -12.108 5.933   26.879  1.00 51.94 ? 989  HOH A O   1 
HETATM 5120 O  O   . HOH D 4 .   ? -14.161 -1.467  13.978  1.00 41.33 ? 990  HOH A O   1 
HETATM 5121 O  O   . HOH D 4 .   ? 31.295  -11.483 8.171   1.00 47.32 ? 991  HOH A O   1 
HETATM 5122 O  O   . HOH D 4 .   ? 13.474  -1.493  -11.136 1.00 45.56 ? 992  HOH A O   1 
HETATM 5123 O  O   . HOH D 4 .   ? 38.455  -6.713  -6.971  1.00 50.90 ? 993  HOH A O   1 
HETATM 5124 O  O   . HOH D 4 .   ? 38.695  24.566  30.382  1.00 46.05 ? 994  HOH A O   1 
HETATM 5125 O  O   . HOH D 4 .   ? 35.879  13.174  37.376  1.00 47.80 ? 995  HOH A O   1 
HETATM 5126 O  O   . HOH D 4 .   ? 20.601  23.948  40.968  1.00 52.07 ? 996  HOH A O   1 
HETATM 5127 O  O   . HOH D 4 .   ? 37.471  -4.938  31.599  1.00 53.59 ? 997  HOH A O   1 
HETATM 5128 O  O   . HOH D 4 .   ? 8.077   2.747   3.547   1.00 39.87 ? 998  HOH A O   1 
HETATM 5129 O  O   . HOH D 4 .   ? 21.152  -2.582  -24.493 1.00 39.89 ? 999  HOH A O   1 
HETATM 5130 O  O   . HOH D 4 .   ? 14.243  28.097  21.508  1.00 41.16 ? 1000 HOH A O   1 
HETATM 5131 O  O   . HOH D 4 .   ? 0.874   10.158  27.900  1.00 41.32 ? 1001 HOH A O   1 
HETATM 5132 O  O   . HOH D 4 .   ? 25.390  -9.094  33.320  1.00 49.80 ? 1002 HOH A O   1 
HETATM 5133 O  O   . HOH D 4 .   ? 33.231  -13.381 20.897  1.00 35.87 ? 1003 HOH A O   1 
HETATM 5134 O  O   . HOH D 4 .   ? -13.453 1.478   8.924   1.00 44.52 ? 1004 HOH A O   1 
HETATM 5135 O  O   . HOH D 4 .   ? 39.700  -1.051  -23.629 1.00 58.98 ? 1005 HOH A O   1 
HETATM 5136 O  O   . HOH D 4 .   ? 29.666  8.987   -6.953  1.00 46.21 ? 1006 HOH A O   1 
HETATM 5137 O  O   . HOH D 4 .   ? 40.393  16.686  34.107  1.00 38.93 ? 1007 HOH A O   1 
HETATM 5138 O  O   . HOH D 4 .   ? 21.951  30.288  11.635  1.00 41.94 ? 1008 HOH A O   1 
HETATM 5139 O  O   . HOH D 4 .   ? 3.523   16.115  31.507  1.00 33.10 ? 1009 HOH A O   1 
HETATM 5140 O  O   . HOH D 4 .   ? 37.794  2.965   -15.376 1.00 35.11 ? 1010 HOH A O   1 
HETATM 5141 O  O   . HOH D 4 .   ? 32.036  27.512  39.579  1.00 43.73 ? 1011 HOH A O   1 
HETATM 5142 O  O   . HOH D 4 .   ? 33.314  30.998  29.022  1.00 43.25 ? 1012 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   ALA 3   3   3   ALA ALA A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   GLY 6   6   6   GLY GLY A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  SER 10  10  10  SER SER A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  TRP 14  14  14  TRP TRP A . n 
A 1 15  ALA 15  15  15  ALA ALA A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  CYS 18  18  18  CYS CYS A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  SER 23  23  23  SER SER A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  ASN 25  25  25  ASN ASN A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  CYS 27  27  27  CYS CYS A . n 
A 1 28  ASN 28  28  28  ASN ASN A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  ASP 32  32  32  ASP ASP A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  ASN 34  34  34  ASN ASN A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  TRP 39  39  39  TRP TRP A . n 
A 1 40  HIS 40  40  40  HIS HIS A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  PHE 42  42  42  PHE PHE A . n 
A 1 43  TYR 43  43  43  TYR TYR A . n 
A 1 44  GLY 44  44  44  GLY GLY A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  LYS 50  50  50  LYS LYS A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  HIS 53  53  53  HIS HIS A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  TYR 55  55  55  TYR TYR A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  ILE 57  57  57  ILE ILE A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  MET 59  59  59  MET MET A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  SER 69  69  69  SER SER A . n 
A 1 70  MET 70  70  70  MET MET A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  PRO 72  72  72  PRO PRO A . n 
A 1 73  ARG 73  73  73  ARG ARG A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  ASN 77  77  77  ASN ASN A . n 
A 1 78  GLN 78  78  78  GLN GLN A . n 
A 1 79  ASN 79  79  79  ASN ASN A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  TRP 81  81  81  TRP TRP A . n 
A 1 82  ILE 82  82  82  ILE ILE A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  ARG 84  84  84  ARG ARG A . n 
A 1 85  HIS 85  85  85  HIS HIS A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  THR 94  94  94  THR THR A . n 
A 1 95  ASN 95  95  95  ASN ASN A . n 
A 1 96  TRP 96  96  96  TRP TRP A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  PRO 99  99  99  PRO PRO A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 SER 104 104 104 SER SER A . n 
A 1 105 TRP 105 105 105 TRP TRP A . n 
A 1 106 PHE 106 106 106 PHE PHE A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 ASP 108 108 108 ASP ASP A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 THR 111 111 111 THR THR A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 TYR 113 113 113 TYR TYR A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 PRO 120 120 120 PRO PRO A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 TYR 123 123 123 TYR TYR A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 ARG 125 125 125 ARG ARG A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 THR 130 130 130 THR THR A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
A 1 132 ALA 132 132 132 ALA ALA A . n 
A 1 133 ASN 133 133 133 ASN ASN A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 GLN 135 135 135 GLN GLN A . n 
A 1 136 PRO 136 136 136 PRO PRO A . n 
A 1 137 TRP 137 137 137 TRP TRP A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 ILE 140 140 140 ILE ILE A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 GLN 147 147 147 GLN GLN A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 SER 149 149 149 SER SER A . n 
A 1 150 SER 150 150 150 SER SER A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 PRO 154 154 154 PRO PRO A . n 
A 1 155 GLN 155 155 155 GLN GLN A . n 
A 1 156 PRO 156 156 156 PRO PRO A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 TRP 161 161 161 TRP TRP A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 PRO 163 163 163 PRO PRO A . n 
A 1 164 THR 164 164 164 THR THR A . n 
A 1 165 ILE 165 165 165 ILE ILE A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 ILE 169 169 169 ILE ILE A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 PRO 171 171 171 PRO PRO A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 ALA 173 173 173 ALA ALA A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 ALA 175 175 175 ALA ALA A . n 
A 1 176 ILE 176 176 176 ILE ILE A . n 
A 1 177 GLU 177 177 177 GLU GLU A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 THR 179 179 179 THR THR A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 GLY 181 181 181 GLY GLY A . n 
A 1 182 ARG 182 182 182 ARG ARG A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 MET 185 185 185 MET MET A . n 
A 1 186 TRP 186 186 186 TRP TRP A . n 
A 1 187 SER 187 187 187 SER SER A . n 
A 1 188 SER 188 188 188 SER SER A . n 
A 1 189 TYR 189 189 189 TYR TYR A . n 
A 1 190 ARG 190 190 190 ARG ARG A . n 
A 1 191 ASN 191 191 191 ASN ASN A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 ALA 193 193 193 ALA ALA A . n 
A 1 194 PHE 194 194 194 PHE PHE A . n 
A 1 195 GLY 195 195 195 GLY GLY A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 SER 197 197 197 SER SER A . n 
A 1 198 PRO 198 198 198 PRO PRO A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 ILE 201 201 201 ILE ILE A . n 
A 1 202 THR 202 202 202 THR THR A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 THR 204 204 204 THR THR A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 SER 206 206 206 SER SER A . n 
A 1 207 TRP 207 207 207 TRP TRP A . n 
A 1 208 ASP 208 208 208 ASP ASP A . n 
A 1 209 PRO 209 209 209 PRO PRO A . n 
A 1 210 SER 210 210 210 SER SER A . n 
A 1 211 THR 211 211 211 THR THR A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ASP 216 216 216 ASP ASP A . n 
A 1 217 ARG 217 217 217 ARG ARG A . n 
A 1 218 THR 218 218 218 THR THR A . n 
A 1 219 VAL 219 219 219 VAL VAL A . n 
A 1 220 THR 220 220 220 THR THR A . n 
A 1 221 VAL 221 221 221 VAL VAL A . n 
A 1 222 THR 222 222 222 THR THR A . n 
A 1 223 LYS 223 223 223 LYS LYS A . n 
A 1 224 HIS 224 224 224 HIS HIS A . n 
A 1 225 ASP 225 225 225 ASP ASP A . n 
A 1 226 MET 226 226 226 MET MET A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 CYS 228 228 228 CYS CYS A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 ILE 231 231 231 ILE ILE A . n 
A 1 232 SER 232 232 232 SER SER A . n 
A 1 233 MET 233 233 233 MET MET A . n 
A 1 234 ASP 234 234 234 ASP ASP A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 ASN 236 236 236 ASN ASN A . n 
A 1 237 GLY 237 237 237 GLY GLY A . n 
A 1 238 GLN 238 238 238 GLN GLN A . n 
A 1 239 ILE 239 239 239 ILE ILE A . n 
A 1 240 VAL 240 240 240 VAL VAL A . n 
A 1 241 VAL 241 241 241 VAL VAL A . n 
A 1 242 THR 242 242 242 THR THR A . n 
A 1 243 GLY 243 243 243 GLY GLY A . n 
A 1 244 GLY 244 244 244 GLY GLY A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
A 1 246 ASP 246 246 246 ASP ASP A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 LYS 248 248 248 LYS LYS A . n 
A 1 249 LYS 249 249 249 LYS LYS A . n 
A 1 250 THR 250 250 250 THR THR A . n 
A 1 251 SER 251 251 251 SER SER A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 TYR 253 253 253 TYR TYR A . n 
A 1 254 ASP 254 254 254 ASP ASP A . n 
A 1 255 SER 255 255 255 SER SER A . n 
A 1 256 SER 256 256 256 SER SER A . n 
A 1 257 SER 257 257 257 SER SER A . n 
A 1 258 ASP 258 258 258 ASP ASP A . n 
A 1 259 SER 259 259 259 SER SER A . n 
A 1 260 TRP 260 260 260 TRP TRP A . n 
A 1 261 ILE 261 261 261 ILE ILE A . n 
A 1 262 PRO 262 262 262 PRO PRO A . n 
A 1 263 GLY 263 263 263 GLY GLY A . n 
A 1 264 PRO 264 264 264 PRO PRO A . n 
A 1 265 ASP 265 265 265 ASP ASP A . n 
A 1 266 MET 266 266 266 MET MET A . n 
A 1 267 GLN 267 267 267 GLN GLN A . n 
A 1 268 VAL 268 268 268 VAL VAL A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 ARG 270 270 270 ARG ARG A . n 
A 1 271 GLY 271 271 271 GLY GLY A . n 
A 1 272 TYR 272 272 272 TYR TYR A . n 
A 1 273 GLN 273 273 273 GLN GLN A . n 
A 1 274 SER 274 274 274 SER SER A . n 
A 1 275 SER 275 275 275 SER SER A . n 
A 1 276 ALA 276 276 276 ALA ALA A . n 
A 1 277 THR 277 277 277 THR THR A . n 
A 1 278 MET 278 278 278 MET MET A . n 
A 1 279 SER 279 279 279 SER SER A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 GLY 281 281 281 GLY GLY A . n 
A 1 282 ARG 282 282 282 ARG ARG A . n 
A 1 283 VAL 283 283 283 VAL VAL A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 THR 285 285 285 THR THR A . n 
A 1 286 ILE 286 286 286 ILE ILE A . n 
A 1 287 GLY 287 287 287 GLY GLY A . n 
A 1 288 GLY 288 288 288 GLY GLY A . n 
A 1 289 SER 289 289 289 SER SER A . n 
A 1 290 TRP 290 290 290 TRP TRP A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 GLY 292 292 292 GLY GLY A . n 
A 1 293 GLY 293 293 293 GLY GLY A . n 
A 1 294 VAL 294 294 294 VAL VAL A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 GLU 296 296 296 GLU GLU A . n 
A 1 297 LYS 297 297 297 LYS LYS A . n 
A 1 298 ASN 298 298 298 ASN ASN A . n 
A 1 299 GLY 299 299 299 GLY GLY A . n 
A 1 300 GLU 300 300 300 GLU GLU A . n 
A 1 301 VAL 301 301 301 VAL VAL A . n 
A 1 302 TYR 302 302 302 TYR TYR A . n 
A 1 303 SER 303 303 303 SER SER A . n 
A 1 304 PRO 304 304 304 PRO PRO A . n 
A 1 305 SER 305 305 305 SER SER A . n 
A 1 306 SER 306 306 306 SER SER A . n 
A 1 307 LYS 307 307 307 LYS LYS A . n 
A 1 308 THR 308 308 308 THR THR A . n 
A 1 309 TRP 309 309 309 TRP TRP A . n 
A 1 310 THR 310 310 310 THR THR A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 LEU 312 312 312 LEU LEU A . n 
A 1 313 PRO 313 313 313 PRO PRO A . n 
A 1 314 ASN 314 314 314 ASN ASN A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 ASN 318 318 318 ASN ASN A . n 
A 1 319 PRO 319 319 319 PRO PRO A . n 
A 1 320 MET 320 320 320 MET MET A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 THR 322 322 322 THR THR A . n 
A 1 323 ALA 323 323 323 ALA ALA A . n 
A 1 324 ASP 324 324 324 ASP ASP A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 GLN 326 326 326 GLN GLN A . n 
A 1 327 GLY 327 327 327 GLY GLY A . n 
A 1 328 LEU 328 328 328 LEU LEU A . n 
A 1 329 TYR 329 329 329 TYR TYR A . n 
A 1 330 ARG 330 330 330 ARG ARG A . n 
A 1 331 SER 331 331 331 SER SER A . n 
A 1 332 ASP 332 332 332 ASP ASP A . n 
A 1 333 ASN 333 333 333 ASN ASN A . n 
A 1 334 HIS 334 334 334 HIS HIS A . n 
A 1 335 ALA 335 335 335 ALA ALA A . n 
A 1 336 TRP 336 336 336 TRP TRP A . n 
A 1 337 LEU 337 337 337 LEU LEU A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 GLY 339 339 339 GLY GLY A . n 
A 1 340 TRP 340 340 340 TRP TRP A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 LYS 342 342 342 LYS LYS A . n 
A 1 343 GLY 343 343 343 GLY GLY A . n 
A 1 344 SER 344 344 344 SER SER A . n 
A 1 345 VAL 345 345 345 VAL VAL A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 GLN 347 347 347 GLN GLN A . n 
A 1 348 ALA 348 348 348 ALA ALA A . n 
A 1 349 GLY 349 349 349 GLY GLY A . n 
A 1 350 PRO 350 350 350 PRO PRO A . n 
A 1 351 SER 351 351 351 SER SER A . n 
A 1 352 THR 352 352 352 THR THR A . n 
A 1 353 ALA 353 353 353 ALA ALA A . n 
A 1 354 MET 354 354 354 MET MET A . n 
A 1 355 ASN 355 355 355 ASN ASN A . n 
A 1 356 TRP 356 356 356 TRP TRP A . n 
A 1 357 TYR 357 357 357 TYR TYR A . n 
A 1 358 TYR 358 358 358 TYR TYR A . n 
A 1 359 THR 359 359 359 THR THR A . n 
A 1 360 SER 360 360 360 SER SER A . n 
A 1 361 GLY 361 361 361 GLY GLY A . n 
A 1 362 SER 362 362 362 SER SER A . n 
A 1 363 GLY 363 363 363 GLY GLY A . n 
A 1 364 ASP 364 364 364 ASP ASP A . n 
A 1 365 VAL 365 365 365 VAL VAL A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 SER 367 367 367 SER SER A . n 
A 1 368 ALA 368 368 368 ALA ALA A . n 
A 1 369 GLY 369 369 369 GLY GLY A . n 
A 1 370 LYS 370 370 370 LYS LYS A . n 
A 1 371 ARG 371 371 371 ARG ARG A . n 
A 1 372 GLN 372 372 372 GLN GLN A . n 
A 1 373 SER 373 373 373 SER SER A . n 
A 1 374 ASN 374 374 374 ASN ASN A . n 
A 1 375 ARG 375 375 375 ARG ARG A . n 
A 1 376 GLY 376 376 376 GLY GLY A . n 
A 1 377 VAL 377 377 377 VAL VAL A . n 
A 1 378 ALA 378 378 378 ALA ALA A . n 
A 1 379 PRO 379 379 379 PRO PRO A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ALA 381 381 381 ALA ALA A . n 
A 1 382 MET 382 382 382 MET MET A . n 
A 1 383 CYS 383 383 383 CYS CYS A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ASN 385 385 385 ASN ASN A . n 
A 1 386 ALA 386 386 386 ALA ALA A . n 
A 1 387 VAL 387 387 387 VAL VAL A . n 
A 1 388 MET 388 388 388 MET MET A . n 
A 1 389 TYR 389 389 389 TYR TYR A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 ALA 391 391 391 ALA ALA A . n 
A 1 392 VAL 392 392 392 VAL VAL A . n 
A 1 393 LYS 393 393 393 LYS LYS A . n 
A 1 394 GLY 394 394 394 GLY GLY A . n 
A 1 395 LYS 395 395 395 LYS LYS A . n 
A 1 396 ILE 396 396 396 ILE ILE A . n 
A 1 397 LEU 397 397 397 LEU LEU A . n 
A 1 398 THR 398 398 398 THR THR A . n 
A 1 399 PHE 399 399 399 PHE PHE A . n 
A 1 400 GLY 400 400 400 GLY GLY A . n 
A 1 401 GLY 401 401 401 GLY GLY A . n 
A 1 402 SER 402 402 402 SER SER A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 TYR 405 405 405 TYR TYR A . n 
A 1 406 GLN 406 406 406 GLN GLN A . n 
A 1 407 ASP 407 407 407 ASP ASP A . n 
A 1 408 SER 408 408 408 SER SER A . n 
A 1 409 ASP 409 409 409 ASP ASP A . n 
A 1 410 ALA 410 410 410 ALA ALA A . n 
A 1 411 THR 411 411 411 THR THR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 ASN 413 413 413 ASN ASN A . n 
A 1 414 ALA 414 414 414 ALA ALA A . n 
A 1 415 HIS 415 415 415 HIS HIS A . n 
A 1 416 ILE 416 416 416 ILE ILE A . n 
A 1 417 ILE 417 417 417 ILE ILE A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 LEU 419 419 419 LEU LEU A . n 
A 1 420 GLY 420 420 420 GLY GLY A . n 
A 1 421 GLU 421 421 421 GLU GLU A . n 
A 1 422 PRO 422 422 422 PRO PRO A . n 
A 1 423 GLY 423 423 423 GLY GLY A . n 
A 1 424 THR 424 424 424 THR THR A . n 
A 1 425 SER 425 425 425 SER SER A . n 
A 1 426 PRO 426 426 426 PRO PRO A . n 
A 1 427 ASN 427 427 427 ASN ASN A . n 
A 1 428 THR 428 428 428 THR THR A . n 
A 1 429 VAL 429 429 429 VAL VAL A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 ALA 431 431 431 ALA ALA A . n 
A 1 432 SER 432 432 432 SER SER A . n 
A 1 433 ASN 433 433 433 ASN ASN A . n 
A 1 434 GLY 434 434 434 GLY GLY A . n 
A 1 435 LEU 435 435 435 LEU LEU A . n 
A 1 436 TYR 436 436 436 TYR TYR A . n 
A 1 437 PHE 437 437 437 PHE PHE A . n 
A 1 438 ALA 438 438 438 ALA ALA A . n 
A 1 439 ARG 439 439 439 ARG ARG A . n 
A 1 440 THR 440 440 440 THR THR A . n 
A 1 441 PHE 441 441 441 PHE PHE A . n 
A 1 442 HIS 442 442 442 HIS HIS A . n 
A 1 443 THR 443 443 443 THR THR A . n 
A 1 444 SER 444 444 444 SER SER A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 VAL 446 446 446 VAL VAL A . n 
A 1 447 LEU 447 447 447 LEU LEU A . n 
A 1 448 PRO 448 448 448 PRO PRO A . n 
A 1 449 ASP 449 449 449 ASP ASP A . n 
A 1 450 GLY 450 450 450 GLY GLY A . n 
A 1 451 SER 451 451 451 SER SER A . n 
A 1 452 THR 452 452 452 THR THR A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 THR 455 455 455 THR THR A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 GLY 457 457 457 GLY GLY A . n 
A 1 458 GLN 458 458 458 GLN GLN A . n 
A 1 459 ARG 459 459 459 ARG ARG A . n 
A 1 460 ARG 460 460 460 ARG ARG A . n 
A 1 461 GLY 461 461 461 GLY GLY A . n 
A 1 462 ILE 462 462 462 ILE ILE A . n 
A 1 463 PRO 463 463 463 PRO PRO A . n 
A 1 464 PHE 464 464 464 PHE PHE A . n 
A 1 465 GLU 465 465 465 GLU GLU A . n 
A 1 466 ASP 466 466 466 ASP ASP A . n 
A 1 467 SER 467 467 467 SER SER A . n 
A 1 468 THR 468 468 468 THR THR A . n 
A 1 469 PRO 469 469 469 PRO PRO A . n 
A 1 470 VAL 470 470 470 VAL VAL A . n 
A 1 471 PHE 471 471 471 PHE PHE A . n 
A 1 472 THR 472 472 472 THR THR A . n 
A 1 473 PRO 473 473 473 PRO PRO A . n 
A 1 474 GLU 474 474 474 GLU GLU A . n 
A 1 475 ILE 475 475 475 ILE ILE A . n 
A 1 476 TYR 476 476 476 TYR TYR A . n 
A 1 477 VAL 477 477 477 VAL VAL A . n 
A 1 478 PRO 478 478 478 PRO PRO A . n 
A 1 479 GLU 479 479 479 GLU GLU A . n 
A 1 480 GLN 480 480 480 GLN GLN A . n 
A 1 481 ASP 481 481 481 ASP ASP A . n 
A 1 482 THR 482 482 482 THR THR A . n 
A 1 483 PHE 483 483 483 PHE PHE A . n 
A 1 484 TYR 484 484 484 TYR TYR A . n 
A 1 485 LYS 485 485 485 LYS LYS A . n 
A 1 486 GLN 486 486 486 GLN GLN A . n 
A 1 487 ASN 487 487 487 ASN ASN A . n 
A 1 488 PRO 488 488 488 PRO PRO A . n 
A 1 489 ASN 489 489 489 ASN ASN A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 ILE 491 491 491 ILE ILE A . n 
A 1 492 VAL 492 492 492 VAL VAL A . n 
A 1 493 ARG 493 493 493 ARG ARG A . n 
A 1 494 VAL 494 494 494 VAL VAL A . n 
A 1 495 TYR 495 495 495 TYR TYR A . n 
A 1 496 HIS 496 496 496 HIS HIS A . n 
A 1 497 SER 497 497 497 SER SER A . n 
A 1 498 ILE 498 498 498 ILE ILE A . n 
A 1 499 SER 499 499 499 SER SER A . n 
A 1 500 LEU 500 500 500 LEU LEU A . n 
A 1 501 LEU 501 501 501 LEU LEU A . n 
A 1 502 LEU 502 502 502 LEU LEU A . n 
A 1 503 PRO 503 503 503 PRO PRO A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 GLY 505 505 505 GLY GLY A . n 
A 1 506 ARG 506 506 506 ARG ARG A . n 
A 1 507 VAL 507 507 507 VAL VAL A . n 
A 1 508 PHE 508 508 508 PHE PHE A . n 
A 1 509 ASN 509 509 509 ASN ASN A . n 
A 1 510 GLY 510 510 510 GLY GLY A . n 
A 1 511 GLY 511 511 511 GLY GLY A . n 
A 1 512 GLY 512 512 512 GLY GLY A . n 
A 1 513 GLY 513 513 513 GLY GLY A . n 
A 1 514 LEU 514 514 514 LEU LEU A . n 
A 1 515 CYS 515 515 515 CYS CYS A . n 
A 1 516 GLY 516 516 516 GLY GLY A . n 
A 1 517 ASP 517 517 517 ASP ASP A . n 
A 1 518 CYS 518 518 518 CYS CYS A . n 
A 1 519 THR 519 519 519 THR THR A . n 
A 1 520 THR 520 520 520 THR THR A . n 
A 1 521 ASN 521 521 521 ASN ASN A . n 
A 1 522 HIS 522 522 522 HIS HIS A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 ASP 524 524 524 ASP ASP A . n 
A 1 525 ALA 525 525 525 ALA ALA A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 ILE 527 527 527 ILE ILE A . n 
A 1 528 PHE 528 528 528 PHE PHE A . n 
A 1 529 THR 529 529 529 THR THR A . n 
A 1 530 PRO 530 530 530 PRO PRO A . n 
A 1 531 ASN 531 531 531 ASN ASN A . n 
A 1 532 TYR 532 532 532 TYR TYR A . n 
A 1 533 LEU 533 533 533 LEU LEU A . n 
A 1 534 TYR 534 534 534 TYR TYR A . n 
A 1 535 ASN 535 535 535 ASN ASN A . n 
A 1 536 SER 536 536 536 SER SER A . n 
A 1 537 ASN 537 537 537 ASN ASN A . n 
A 1 538 GLY 538 538 538 GLY GLY A . n 
A 1 539 ASN 539 539 539 ASN ASN A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 ALA 541 541 541 ALA ALA A . n 
A 1 542 THR 542 542 542 THR THR A . n 
A 1 543 ARG 543 543 543 ARG ARG A . n 
A 1 544 PRO 544 544 544 PRO PRO A . n 
A 1 545 LYS 545 545 545 LYS LYS A . n 
A 1 546 ILE 546 546 546 ILE ILE A . n 
A 1 547 THR 547 547 547 THR THR A . n 
A 1 548 ARG 548 548 548 ARG ARG A . n 
A 1 549 THR 549 549 549 THR THR A . n 
A 1 550 SER 550 550 550 SER SER A . n 
A 1 551 THR 551 551 551 THR THR A . n 
A 1 552 GLN 552 552 552 GLN GLN A . n 
A 1 553 SER 553 553 553 SER SER A . n 
A 1 554 VAL 554 554 554 VAL VAL A . n 
A 1 555 LYS 555 555 555 LYS LYS A . n 
A 1 556 VAL 556 556 556 VAL VAL A . n 
A 1 557 GLY 557 557 557 GLY GLY A . n 
A 1 558 GLY 558 558 558 GLY GLY A . n 
A 1 559 ARG 559 559 559 ARG ARG A . n 
A 1 560 ILE 560 560 560 ILE ILE A . n 
A 1 561 THR 561 561 561 THR THR A . n 
A 1 562 ILE 562 562 562 ILE ILE A . n 
A 1 563 SER 563 563 563 SER SER A . n 
A 1 564 THR 564 564 564 THR THR A . n 
A 1 565 ASP 565 565 565 ASP ASP A . n 
A 1 566 SER 566 566 566 SER SER A . n 
A 1 567 SER 567 567 567 SER SER A . n 
A 1 568 ILE 568 568 568 ILE ILE A . n 
A 1 569 SER 569 569 569 SER SER A . n 
A 1 570 LYS 570 570 570 LYS LYS A . n 
A 1 571 ALA 571 571 571 ALA ALA A . n 
A 1 572 SER 572 572 572 SER SER A . n 
A 1 573 LEU 573 573 573 LEU LEU A . n 
A 1 574 ILE 574 574 574 ILE ILE A . n 
A 1 575 ARG 575 575 575 ARG ARG A . n 
A 1 576 TYR 576 576 576 TYR TYR A . n 
A 1 577 GLY 577 577 577 GLY GLY A . n 
A 1 578 THR 578 578 578 THR THR A . n 
A 1 579 ALA 579 579 579 ALA ALA A . n 
A 1 580 THR 580 580 580 THR THR A . n 
A 1 581 HIS 581 581 581 HIS HIS A . n 
A 1 582 THR 582 582 582 THR THR A . n 
A 1 583 VAL 583 583 583 VAL VAL A . n 
A 1 584 ASN 584 584 584 ASN ASN A . n 
A 1 585 THR 585 585 585 THR THR A . n 
A 1 586 ASP 586 586 586 ASP ASP A . n 
A 1 587 GLN 587 587 587 GLN GLN A . n 
A 1 588 ARG 588 588 588 ARG ARG A . n 
A 1 589 ARG 589 589 589 ARG ARG A . n 
A 1 590 ILE 590 590 590 ILE ILE A . n 
A 1 591 PRO 591 591 591 PRO PRO A . n 
A 1 592 LEU 592 592 592 LEU LEU A . n 
A 1 593 THR 593 593 593 THR THR A . n 
A 1 594 LEU 594 594 594 LEU LEU A . n 
A 1 595 THR 595 595 595 THR THR A . n 
A 1 596 ASN 596 596 596 ASN ASN A . n 
A 1 597 ASN 597 597 597 ASN ASN A . n 
A 1 598 GLY 598 598 598 GLY GLY A . n 
A 1 599 GLY 599 599 599 GLY GLY A . n 
A 1 600 ASN 600 600 600 ASN ASN A . n 
A 1 601 SER 601 601 601 SER SER A . n 
A 1 602 TYR 602 602 602 TYR TYR A . n 
A 1 603 SER 603 603 603 SER SER A . n 
A 1 604 PHE 604 604 604 PHE PHE A . n 
A 1 605 GLN 605 605 605 GLN GLN A . n 
A 1 606 VAL 606 606 606 VAL VAL A . n 
A 1 607 PRO 607 607 607 PRO PRO A . n 
A 1 608 SER 608 608 608 SER SER A . n 
A 1 609 ASP 609 609 609 ASP ASP A . n 
A 1 610 SER 610 610 610 SER SER A . n 
A 1 611 GLY 611 611 611 GLY GLY A . n 
A 1 612 VAL 612 612 612 VAL VAL A . n 
A 1 613 ALA 613 613 613 ALA ALA A . n 
A 1 614 LEU 614 614 614 LEU LEU A . n 
A 1 615 PRO 615 615 615 PRO PRO A . n 
A 1 616 GLY 616 616 616 GLY GLY A . n 
A 1 617 TYR 617 617 617 TYR TYR A . n 
A 1 618 TRP 618 618 618 TRP TRP A . n 
A 1 619 MET 619 619 619 MET MET A . n 
A 1 620 LEU 620 620 620 LEU LEU A . n 
A 1 621 PHE 621 621 621 PHE PHE A . n 
A 1 622 VAL 622 622 622 VAL VAL A . n 
A 1 623 MET 623 623 623 MET MET A . n 
A 1 624 ASN 624 624 624 ASN ASN A . n 
A 1 625 SER 625 625 625 SER SER A . n 
A 1 626 ALA 626 626 626 ALA ALA A . n 
A 1 627 GLY 627 627 627 GLY GLY A . n 
A 1 628 VAL 628 628 628 VAL VAL A . n 
A 1 629 PRO 629 629 629 PRO PRO A . n 
A 1 630 SER 630 630 630 SER SER A . n 
A 1 631 VAL 631 631 631 VAL VAL A . n 
A 1 632 ALA 632 632 632 ALA ALA A . n 
A 1 633 SER 633 633 633 SER SER A . n 
A 1 634 THR 634 634 634 THR THR A . n 
A 1 635 ILE 635 635 635 ILE ILE A . n 
A 1 636 ARG 636 636 636 ARG ARG A . n 
A 1 637 VAL 637 637 637 VAL VAL A . n 
A 1 638 THR 638 638 638 THR THR A . n 
A 1 639 GLN 639 639 639 GLN GLN A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CU  1   700  700 CU  CU  A . 
C 3 NA  1   702  702 NA  NA  A . 
D 4 HOH 1   703  703 HOH HOH A . 
D 4 HOH 2   704  704 HOH HOH A . 
D 4 HOH 3   705  705 HOH HOH A . 
D 4 HOH 4   706  706 HOH HOH A . 
D 4 HOH 5   707  2   HOH HOH A . 
D 4 HOH 6   708  3   HOH HOH A . 
D 4 HOH 7   709  4   HOH HOH A . 
D 4 HOH 8   710  5   HOH HOH A . 
D 4 HOH 9   711  6   HOH HOH A . 
D 4 HOH 10  712  7   HOH HOH A . 
D 4 HOH 11  713  8   HOH HOH A . 
D 4 HOH 12  714  10  HOH HOH A . 
D 4 HOH 13  715  12  HOH HOH A . 
D 4 HOH 14  716  13  HOH HOH A . 
D 4 HOH 15  717  14  HOH HOH A . 
D 4 HOH 16  718  15  HOH HOH A . 
D 4 HOH 17  719  16  HOH HOH A . 
D 4 HOH 18  720  17  HOH HOH A . 
D 4 HOH 19  721  18  HOH HOH A . 
D 4 HOH 20  722  19  HOH HOH A . 
D 4 HOH 21  723  20  HOH HOH A . 
D 4 HOH 22  724  22  HOH HOH A . 
D 4 HOH 23  725  23  HOH HOH A . 
D 4 HOH 24  726  24  HOH HOH A . 
D 4 HOH 25  727  25  HOH HOH A . 
D 4 HOH 26  728  26  HOH HOH A . 
D 4 HOH 27  729  27  HOH HOH A . 
D 4 HOH 28  730  28  HOH HOH A . 
D 4 HOH 29  731  29  HOH HOH A . 
D 4 HOH 30  732  30  HOH HOH A . 
D 4 HOH 31  733  31  HOH HOH A . 
D 4 HOH 32  734  32  HOH HOH A . 
D 4 HOH 33  735  33  HOH HOH A . 
D 4 HOH 34  736  34  HOH HOH A . 
D 4 HOH 35  737  35  HOH HOH A . 
D 4 HOH 36  738  36  HOH HOH A . 
D 4 HOH 37  739  37  HOH HOH A . 
D 4 HOH 38  740  38  HOH HOH A . 
D 4 HOH 39  741  39  HOH HOH A . 
D 4 HOH 40  742  40  HOH HOH A . 
D 4 HOH 41  743  41  HOH HOH A . 
D 4 HOH 42  744  42  HOH HOH A . 
D 4 HOH 43  745  43  HOH HOH A . 
D 4 HOH 44  746  44  HOH HOH A . 
D 4 HOH 45  747  45  HOH HOH A . 
D 4 HOH 46  748  46  HOH HOH A . 
D 4 HOH 47  749  47  HOH HOH A . 
D 4 HOH 48  750  48  HOH HOH A . 
D 4 HOH 49  751  49  HOH HOH A . 
D 4 HOH 50  752  50  HOH HOH A . 
D 4 HOH 51  753  51  HOH HOH A . 
D 4 HOH 52  754  52  HOH HOH A . 
D 4 HOH 53  755  53  HOH HOH A . 
D 4 HOH 54  756  54  HOH HOH A . 
D 4 HOH 55  757  55  HOH HOH A . 
D 4 HOH 56  758  56  HOH HOH A . 
D 4 HOH 57  759  57  HOH HOH A . 
D 4 HOH 58  760  58  HOH HOH A . 
D 4 HOH 59  761  59  HOH HOH A . 
D 4 HOH 60  762  60  HOH HOH A . 
D 4 HOH 61  763  61  HOH HOH A . 
D 4 HOH 62  764  62  HOH HOH A . 
D 4 HOH 63  765  63  HOH HOH A . 
D 4 HOH 64  766  64  HOH HOH A . 
D 4 HOH 65  767  65  HOH HOH A . 
D 4 HOH 66  768  66  HOH HOH A . 
D 4 HOH 67  769  67  HOH HOH A . 
D 4 HOH 68  770  68  HOH HOH A . 
D 4 HOH 69  771  69  HOH HOH A . 
D 4 HOH 70  772  70  HOH HOH A . 
D 4 HOH 71  773  71  HOH HOH A . 
D 4 HOH 72  774  72  HOH HOH A . 
D 4 HOH 73  775  73  HOH HOH A . 
D 4 HOH 74  776  74  HOH HOH A . 
D 4 HOH 75  777  75  HOH HOH A . 
D 4 HOH 76  778  76  HOH HOH A . 
D 4 HOH 77  779  77  HOH HOH A . 
D 4 HOH 78  780  78  HOH HOH A . 
D 4 HOH 79  781  79  HOH HOH A . 
D 4 HOH 80  782  80  HOH HOH A . 
D 4 HOH 81  783  81  HOH HOH A . 
D 4 HOH 82  784  82  HOH HOH A . 
D 4 HOH 83  785  83  HOH HOH A . 
D 4 HOH 84  786  84  HOH HOH A . 
D 4 HOH 85  787  85  HOH HOH A . 
D 4 HOH 86  788  86  HOH HOH A . 
D 4 HOH 87  789  88  HOH HOH A . 
D 4 HOH 88  790  89  HOH HOH A . 
D 4 HOH 89  791  90  HOH HOH A . 
D 4 HOH 90  792  91  HOH HOH A . 
D 4 HOH 91  793  92  HOH HOH A . 
D 4 HOH 92  794  93  HOH HOH A . 
D 4 HOH 93  795  94  HOH HOH A . 
D 4 HOH 94  796  95  HOH HOH A . 
D 4 HOH 95  797  96  HOH HOH A . 
D 4 HOH 96  798  97  HOH HOH A . 
D 4 HOH 97  799  98  HOH HOH A . 
D 4 HOH 98  800  99  HOH HOH A . 
D 4 HOH 99  801  100 HOH HOH A . 
D 4 HOH 100 802  101 HOH HOH A . 
D 4 HOH 101 803  102 HOH HOH A . 
D 4 HOH 102 804  103 HOH HOH A . 
D 4 HOH 103 805  104 HOH HOH A . 
D 4 HOH 104 806  105 HOH HOH A . 
D 4 HOH 105 807  106 HOH HOH A . 
D 4 HOH 106 808  107 HOH HOH A . 
D 4 HOH 107 809  108 HOH HOH A . 
D 4 HOH 108 810  109 HOH HOH A . 
D 4 HOH 109 811  110 HOH HOH A . 
D 4 HOH 110 812  111 HOH HOH A . 
D 4 HOH 111 813  112 HOH HOH A . 
D 4 HOH 112 814  113 HOH HOH A . 
D 4 HOH 113 815  114 HOH HOH A . 
D 4 HOH 114 816  115 HOH HOH A . 
D 4 HOH 115 817  116 HOH HOH A . 
D 4 HOH 116 818  117 HOH HOH A . 
D 4 HOH 117 819  118 HOH HOH A . 
D 4 HOH 118 820  119 HOH HOH A . 
D 4 HOH 119 821  120 HOH HOH A . 
D 4 HOH 120 822  121 HOH HOH A . 
D 4 HOH 121 823  122 HOH HOH A . 
D 4 HOH 122 824  123 HOH HOH A . 
D 4 HOH 123 825  125 HOH HOH A . 
D 4 HOH 124 826  126 HOH HOH A . 
D 4 HOH 125 827  127 HOH HOH A . 
D 4 HOH 126 828  128 HOH HOH A . 
D 4 HOH 127 829  129 HOH HOH A . 
D 4 HOH 128 830  131 HOH HOH A . 
D 4 HOH 129 831  132 HOH HOH A . 
D 4 HOH 130 832  135 HOH HOH A . 
D 4 HOH 131 833  136 HOH HOH A . 
D 4 HOH 132 834  137 HOH HOH A . 
D 4 HOH 133 835  138 HOH HOH A . 
D 4 HOH 134 836  139 HOH HOH A . 
D 4 HOH 135 837  140 HOH HOH A . 
D 4 HOH 136 838  141 HOH HOH A . 
D 4 HOH 137 839  142 HOH HOH A . 
D 4 HOH 138 840  143 HOH HOH A . 
D 4 HOH 139 841  144 HOH HOH A . 
D 4 HOH 140 842  145 HOH HOH A . 
D 4 HOH 141 843  146 HOH HOH A . 
D 4 HOH 142 844  147 HOH HOH A . 
D 4 HOH 143 845  148 HOH HOH A . 
D 4 HOH 144 846  149 HOH HOH A . 
D 4 HOH 145 847  150 HOH HOH A . 
D 4 HOH 146 848  151 HOH HOH A . 
D 4 HOH 147 849  153 HOH HOH A . 
D 4 HOH 148 850  154 HOH HOH A . 
D 4 HOH 149 851  155 HOH HOH A . 
D 4 HOH 150 852  156 HOH HOH A . 
D 4 HOH 151 853  157 HOH HOH A . 
D 4 HOH 152 854  158 HOH HOH A . 
D 4 HOH 153 855  159 HOH HOH A . 
D 4 HOH 154 856  160 HOH HOH A . 
D 4 HOH 155 857  161 HOH HOH A . 
D 4 HOH 156 858  162 HOH HOH A . 
D 4 HOH 157 859  163 HOH HOH A . 
D 4 HOH 158 860  164 HOH HOH A . 
D 4 HOH 159 861  165 HOH HOH A . 
D 4 HOH 160 862  166 HOH HOH A . 
D 4 HOH 161 863  167 HOH HOH A . 
D 4 HOH 162 864  168 HOH HOH A . 
D 4 HOH 163 865  169 HOH HOH A . 
D 4 HOH 164 866  171 HOH HOH A . 
D 4 HOH 165 867  172 HOH HOH A . 
D 4 HOH 166 868  173 HOH HOH A . 
D 4 HOH 167 869  174 HOH HOH A . 
D 4 HOH 168 870  175 HOH HOH A . 
D 4 HOH 169 871  176 HOH HOH A . 
D 4 HOH 170 872  177 HOH HOH A . 
D 4 HOH 171 873  178 HOH HOH A . 
D 4 HOH 172 874  179 HOH HOH A . 
D 4 HOH 173 875  181 HOH HOH A . 
D 4 HOH 174 876  182 HOH HOH A . 
D 4 HOH 175 877  183 HOH HOH A . 
D 4 HOH 176 878  184 HOH HOH A . 
D 4 HOH 177 879  185 HOH HOH A . 
D 4 HOH 178 880  186 HOH HOH A . 
D 4 HOH 179 881  189 HOH HOH A . 
D 4 HOH 180 882  190 HOH HOH A . 
D 4 HOH 181 883  191 HOH HOH A . 
D 4 HOH 182 884  192 HOH HOH A . 
D 4 HOH 183 885  193 HOH HOH A . 
D 4 HOH 184 886  194 HOH HOH A . 
D 4 HOH 185 887  195 HOH HOH A . 
D 4 HOH 186 888  196 HOH HOH A . 
D 4 HOH 187 889  197 HOH HOH A . 
D 4 HOH 188 890  198 HOH HOH A . 
D 4 HOH 189 891  199 HOH HOH A . 
D 4 HOH 190 892  200 HOH HOH A . 
D 4 HOH 191 893  201 HOH HOH A . 
D 4 HOH 192 894  202 HOH HOH A . 
D 4 HOH 193 895  203 HOH HOH A . 
D 4 HOH 194 896  204 HOH HOH A . 
D 4 HOH 195 897  205 HOH HOH A . 
D 4 HOH 196 898  206 HOH HOH A . 
D 4 HOH 197 899  207 HOH HOH A . 
D 4 HOH 198 900  208 HOH HOH A . 
D 4 HOH 199 901  209 HOH HOH A . 
D 4 HOH 200 902  211 HOH HOH A . 
D 4 HOH 201 903  212 HOH HOH A . 
D 4 HOH 202 904  213 HOH HOH A . 
D 4 HOH 203 905  215 HOH HOH A . 
D 4 HOH 204 906  216 HOH HOH A . 
D 4 HOH 205 907  217 HOH HOH A . 
D 4 HOH 206 908  219 HOH HOH A . 
D 4 HOH 207 909  220 HOH HOH A . 
D 4 HOH 208 910  223 HOH HOH A . 
D 4 HOH 209 911  224 HOH HOH A . 
D 4 HOH 210 912  225 HOH HOH A . 
D 4 HOH 211 913  226 HOH HOH A . 
D 4 HOH 212 914  228 HOH HOH A . 
D 4 HOH 213 915  229 HOH HOH A . 
D 4 HOH 214 916  231 HOH HOH A . 
D 4 HOH 215 917  232 HOH HOH A . 
D 4 HOH 216 918  233 HOH HOH A . 
D 4 HOH 217 919  234 HOH HOH A . 
D 4 HOH 218 920  235 HOH HOH A . 
D 4 HOH 219 921  236 HOH HOH A . 
D 4 HOH 220 922  237 HOH HOH A . 
D 4 HOH 221 923  238 HOH HOH A . 
D 4 HOH 222 924  240 HOH HOH A . 
D 4 HOH 223 925  241 HOH HOH A . 
D 4 HOH 224 926  242 HOH HOH A . 
D 4 HOH 225 927  245 HOH HOH A . 
D 4 HOH 226 928  246 HOH HOH A . 
D 4 HOH 227 929  247 HOH HOH A . 
D 4 HOH 228 930  248 HOH HOH A . 
D 4 HOH 229 931  249 HOH HOH A . 
D 4 HOH 230 932  252 HOH HOH A . 
D 4 HOH 231 933  253 HOH HOH A . 
D 4 HOH 232 934  254 HOH HOH A . 
D 4 HOH 233 935  255 HOH HOH A . 
D 4 HOH 234 936  256 HOH HOH A . 
D 4 HOH 235 937  257 HOH HOH A . 
D 4 HOH 236 938  258 HOH HOH A . 
D 4 HOH 237 939  259 HOH HOH A . 
D 4 HOH 238 940  260 HOH HOH A . 
D 4 HOH 239 941  261 HOH HOH A . 
D 4 HOH 240 942  262 HOH HOH A . 
D 4 HOH 241 943  263 HOH HOH A . 
D 4 HOH 242 944  266 HOH HOH A . 
D 4 HOH 243 945  270 HOH HOH A . 
D 4 HOH 244 946  271 HOH HOH A . 
D 4 HOH 245 947  272 HOH HOH A . 
D 4 HOH 246 948  273 HOH HOH A . 
D 4 HOH 247 949  274 HOH HOH A . 
D 4 HOH 248 950  275 HOH HOH A . 
D 4 HOH 249 951  276 HOH HOH A . 
D 4 HOH 250 952  277 HOH HOH A . 
D 4 HOH 251 953  278 HOH HOH A . 
D 4 HOH 252 954  279 HOH HOH A . 
D 4 HOH 253 955  280 HOH HOH A . 
D 4 HOH 254 956  281 HOH HOH A . 
D 4 HOH 255 957  282 HOH HOH A . 
D 4 HOH 256 958  283 HOH HOH A . 
D 4 HOH 257 959  284 HOH HOH A . 
D 4 HOH 258 960  285 HOH HOH A . 
D 4 HOH 259 961  286 HOH HOH A . 
D 4 HOH 260 962  287 HOH HOH A . 
D 4 HOH 261 963  288 HOH HOH A . 
D 4 HOH 262 964  289 HOH HOH A . 
D 4 HOH 263 965  290 HOH HOH A . 
D 4 HOH 264 966  291 HOH HOH A . 
D 4 HOH 265 967  292 HOH HOH A . 
D 4 HOH 266 968  293 HOH HOH A . 
D 4 HOH 267 969  294 HOH HOH A . 
D 4 HOH 268 970  297 HOH HOH A . 
D 4 HOH 269 971  299 HOH HOH A . 
D 4 HOH 270 972  300 HOH HOH A . 
D 4 HOH 271 973  301 HOH HOH A . 
D 4 HOH 272 974  303 HOH HOH A . 
D 4 HOH 273 975  304 HOH HOH A . 
D 4 HOH 274 976  306 HOH HOH A . 
D 4 HOH 275 977  309 HOH HOH A . 
D 4 HOH 276 978  310 HOH HOH A . 
D 4 HOH 277 979  311 HOH HOH A . 
D 4 HOH 278 980  313 HOH HOH A . 
D 4 HOH 279 981  318 HOH HOH A . 
D 4 HOH 280 982  320 HOH HOH A . 
D 4 HOH 281 983  323 HOH HOH A . 
D 4 HOH 282 984  324 HOH HOH A . 
D 4 HOH 283 985  325 HOH HOH A . 
D 4 HOH 284 986  326 HOH HOH A . 
D 4 HOH 285 987  327 HOH HOH A . 
D 4 HOH 286 988  328 HOH HOH A . 
D 4 HOH 287 989  330 HOH HOH A . 
D 4 HOH 288 990  332 HOH HOH A . 
D 4 HOH 289 991  335 HOH HOH A . 
D 4 HOH 290 992  336 HOH HOH A . 
D 4 HOH 291 993  337 HOH HOH A . 
D 4 HOH 292 994  341 HOH HOH A . 
D 4 HOH 293 995  342 HOH HOH A . 
D 4 HOH 294 996  343 HOH HOH A . 
D 4 HOH 295 997  344 HOH HOH A . 
D 4 HOH 296 998  345 HOH HOH A . 
D 4 HOH 297 999  346 HOH HOH A . 
D 4 HOH 298 1000 350 HOH HOH A . 
D 4 HOH 299 1001 351 HOH HOH A . 
D 4 HOH 300 1002 352 HOH HOH A . 
D 4 HOH 301 1003 353 HOH HOH A . 
D 4 HOH 302 1004 354 HOH HOH A . 
D 4 HOH 303 1005 355 HOH HOH A . 
D 4 HOH 304 1006 356 HOH HOH A . 
D 4 HOH 305 1007 357 HOH HOH A . 
D 4 HOH 306 1008 358 HOH HOH A . 
D 4 HOH 307 1009 360 HOH HOH A . 
D 4 HOH 308 1010 361 HOH HOH A . 
D 4 HOH 309 1011 362 HOH HOH A . 
D 4 HOH 310 1012 363 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 581 ? A HIS 581 ? 1_555 CU ? B CU . ? A CU 700 ? 1_555 NE2 ? A HIS 496 ? A HIS 496 ? 1_555 91.0  ? 
2  NE2 ? A HIS 581 ? A HIS 581 ? 1_555 CU ? B CU . ? A CU 700 ? 1_555 OH  ? A TYR 272 ? A TYR 272 ? 1_555 99.5  ? 
3  NE2 ? A HIS 496 ? A HIS 496 ? 1_555 CU ? B CU . ? A CU 700 ? 1_555 OH  ? A TYR 272 ? A TYR 272 ? 1_555 168.8 ? 
4  NE2 ? A HIS 581 ? A HIS 581 ? 1_555 CU ? B CU . ? A CU 700 ? 1_555 OH  ? A TYR 495 ? A TYR 495 ? 1_555 106.2 ? 
5  NE2 ? A HIS 496 ? A HIS 496 ? 1_555 CU ? B CU . ? A CU 700 ? 1_555 OH  ? A TYR 495 ? A TYR 495 ? 1_555 102.1 ? 
6  OH  ? A TYR 272 ? A TYR 272 ? 1_555 CU ? B CU . ? A CU 700 ? 1_555 OH  ? A TYR 495 ? A TYR 495 ? 1_555 78.9  ? 
7  O   ? A ASN 34  ? A ASN 34  ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 OD1 ? A ASP 32  ? A ASP 32  ? 1_555 91.5  ? 
8  O   ? A ASN 34  ? A ASN 34  ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 O   ? A THR 37  ? A THR 37  ? 1_555 85.2  ? 
9  OD1 ? A ASP 32  ? A ASP 32  ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 O   ? A THR 37  ? A THR 37  ? 1_555 140.7 ? 
10 O   ? A ASN 34  ? A ASN 34  ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 O   ? A ALA 141 ? A ALA 141 ? 1_555 113.3 ? 
11 OD1 ? A ASP 32  ? A ASP 32  ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 O   ? A ALA 141 ? A ALA 141 ? 1_555 139.0 ? 
12 O   ? A THR 37  ? A THR 37  ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 O   ? A ALA 141 ? A ALA 141 ? 1_555 76.3  ? 
13 O   ? A ASN 34  ? A ASN 34  ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 OE2 ? A GLU 142 ? A GLU 142 ? 1_555 84.0  ? 
14 OD1 ? A ASP 32  ? A ASP 32  ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 OE2 ? A GLU 142 ? A GLU 142 ? 1_555 76.5  ? 
15 O   ? A THR 37  ? A THR 37  ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 OE2 ? A GLU 142 ? A GLU 142 ? 1_555 141.5 ? 
16 O   ? A ALA 141 ? A ALA 141 ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 OE2 ? A GLU 142 ? A GLU 142 ? 1_555 74.5  ? 
17 O   ? A ASN 34  ? A ASN 34  ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 O   ? A LYS 29  ? A LYS 29  ? 1_555 162.6 ? 
18 OD1 ? A ASP 32  ? A ASP 32  ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 O   ? A LYS 29  ? A LYS 29  ? 1_555 72.7  ? 
19 O   ? A THR 37  ? A THR 37  ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 O   ? A LYS 29  ? A LYS 29  ? 1_555 102.3 ? 
20 O   ? A ALA 141 ? A ALA 141 ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 O   ? A LYS 29  ? A LYS 29  ? 1_555 83.9  ? 
21 OE2 ? A GLU 142 ? A GLU 142 ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 O   ? A LYS 29  ? A LYS 29  ? 1_555 98.9  ? 
22 O   ? A ASN 34  ? A ASN 34  ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 OG1 ? A THR 37  ? A THR 37  ? 1_555 73.3  ? 
23 OD1 ? A ASP 32  ? A ASP 32  ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 OG1 ? A THR 37  ? A THR 37  ? 1_555 69.5  ? 
24 O   ? A THR 37  ? A THR 37  ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 OG1 ? A THR 37  ? A THR 37  ? 1_555 72.0  ? 
25 O   ? A ALA 141 ? A ALA 141 ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 OG1 ? A THR 37  ? A THR 37  ? 1_555 146.9 ? 
26 OE2 ? A GLU 142 ? A GLU 142 ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 OG1 ? A THR 37  ? A THR 37  ? 1_555 138.1 ? 
27 O   ? A LYS 29  ? A LYS 29  ? 1_555 NA ? C NA . ? A NA 702 ? 1_555 OG1 ? A THR 37  ? A THR 37  ? 1_555 93.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-01-31 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Derived calculations'      
5 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status 
2 4 'Structure model' struct_conf          
3 4 'Structure model' struct_conf_type     
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_database_status.process_site' 
# 
_software.name             PROLSQ 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
700 
;SHEET
THE SHEET PRESENTED AS *S9* ON SHEET RECORDS BELOW IS
ACTUALLY A SEVEN-STRANDED BETA-BARREL.  THIS IS REPRESENTED
BY AN EIGHT-STRANDED SHEET IN WHICH THE FIRST AND LAST
STRANDS ARE IDENTICAL.
DOMAIN 3 (RESIDUES 553 - 639) HAS A VERY COMPLICATED
HYDROGEN BONDING NETWORK WHICH IS DIFFICULT TO DESCRIBE.
IN THE SHEET RECORDS BELOW, THIS IS SIMPLIFIED BY REGARDING
SEVERAL PAIRS OF BETA-STRANDS AS ONE.
;
285 
;THE ENTRY COORDINATES
ARE NOT PRESENTED IN THE STANDARD CRYSTAL FRAME.
;
# 
_pdbx_entry_details.entry_id             1GOG 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       
;THERE IS SOME UNCERTAINTY AS TO THE EXACT TYPING OF THE
FUNGUS DACTYLIUM DENDROIDES.  (SEE REFERENCE 2).
;
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 SG  A CYS 228 ? ? CE1 A TYR 272 ? ? 1.78 
2 1 OD2 A ASP 32  ? ? OG1 A THR 37  ? ? 2.14 
3 1 OG  A SER 20  ? ? O   A HOH 999 ? ? 2.17 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    ND2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    ASN 
_pdbx_validate_symm_contact.auth_seq_id_1     12 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    NH1 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    ARG 
_pdbx_validate_symm_contact.auth_seq_id_2     548 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_545 
_pdbx_validate_symm_contact.dist              2.14 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CE1 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            HIS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             581 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            NE2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            HIS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             581 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.249 
_pdbx_validate_rmsd_bond.bond_target_value         1.317 
_pdbx_validate_rmsd_bond.bond_deviation            -0.068 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.011 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1   1 CB  A SER 2   ? ? CA  A SER 2   ? ? C   A SER 2   ? ? 122.77 110.10 12.67  1.90 N 
2   1 NE  A ARG 11  ? ? CZ  A ARG 11  ? ? NH1 A ARG 11  ? ? 125.02 120.30 4.72   0.50 N 
3   1 CB  A SER 20  ? ? CA  A SER 20  ? ? C   A SER 20  ? ? 95.94  110.10 -14.16 1.90 N 
4   1 N   A SER 20  ? ? CA  A SER 20  ? ? CB  A SER 20  ? ? 122.91 110.50 12.41  1.50 N 
5   1 O   A ASP 36  ? ? C   A ASP 36  ? ? N   A THR 37  ? ? 133.92 122.70 11.22  1.60 Y 
6   1 CG  A MET 70  ? ? SD  A MET 70  ? ? CE  A MET 70  ? ? 109.87 100.20 9.67   1.60 N 
7   1 NE  A ARG 73  ? ? CZ  A ARG 73  ? ? NH1 A ARG 73  ? ? 129.52 120.30 9.22   0.50 N 
8   1 NE  A ARG 73  ? ? CZ  A ARG 73  ? ? NH2 A ARG 73  ? ? 114.59 120.30 -5.71  0.50 N 
9   1 NH1 A ARG 84  ? ? CZ  A ARG 84  ? ? NH2 A ARG 84  ? ? 126.17 119.40 6.77   1.10 N 
10  1 NE  A ARG 84  ? ? CZ  A ARG 84  ? ? NH1 A ARG 84  ? ? 123.71 120.30 3.41   0.50 N 
11  1 NE  A ARG 84  ? ? CZ  A ARG 84  ? ? NH2 A ARG 84  ? ? 110.11 120.30 -10.19 0.50 N 
12  1 CB  A TYR 88  ? ? CG  A TYR 88  ? ? CD2 A TYR 88  ? ? 115.66 121.00 -5.34  0.60 N 
13  1 CG  A TYR 88  ? ? CD2 A TYR 88  ? ? CE2 A TYR 88  ? ? 116.29 121.30 -5.01  0.80 N 
14  1 CB  A ASP 92  ? ? CG  A ASP 92  ? ? OD1 A ASP 92  ? ? 125.01 118.30 6.71   0.90 N 
15  1 CB  A ASP 92  ? ? CG  A ASP 92  ? ? OD2 A ASP 92  ? ? 112.48 118.30 -5.82  0.90 N 
16  1 N   A SER 98  ? ? CA  A SER 98  ? ? CB  A SER 98  ? ? 99.55  110.50 -10.95 1.50 N 
17  1 N   A SER 114 ? ? CA  A SER 114 ? ? CB  A SER 114 ? ? 127.80 110.50 17.30  1.50 N 
18  1 O   A THR 118 ? ? C   A THR 118 ? ? N   A ARG 119 ? ? 133.07 122.70 10.37  1.60 Y 
19  1 CD  A ARG 119 ? ? NE  A ARG 119 ? ? CZ  A ARG 119 ? ? 133.27 123.60 9.67   1.40 N 
20  1 NE  A ARG 119 ? ? CZ  A ARG 119 ? ? NH1 A ARG 119 ? ? 125.58 120.30 5.28   0.50 N 
21  1 NE  A ARG 119 ? ? CZ  A ARG 119 ? ? NH2 A ARG 119 ? ? 114.16 120.30 -6.14  0.50 N 
22  1 NH1 A ARG 122 ? ? CZ  A ARG 122 ? ? NH2 A ARG 122 ? ? 111.67 119.40 -7.73  1.10 N 
23  1 NE  A ARG 122 ? ? CZ  A ARG 122 ? ? NH1 A ARG 122 ? ? 124.87 120.30 4.57   0.50 N 
24  1 NE  A ARG 122 ? ? CZ  A ARG 122 ? ? NH2 A ARG 122 ? ? 123.45 120.30 3.15   0.50 N 
25  1 NE  A ARG 125 ? ? CZ  A ARG 125 ? ? NH2 A ARG 125 ? ? 116.03 120.30 -4.27  0.50 N 
26  1 NE  A ARG 160 ? ? CZ  A ARG 160 ? ? NH1 A ARG 160 ? ? 124.04 120.30 3.74   0.50 N 
27  1 NE  A ARG 160 ? ? CZ  A ARG 160 ? ? NH2 A ARG 160 ? ? 116.60 120.30 -3.70  0.50 N 
28  1 N   A ALA 173 ? ? CA  A ALA 173 ? ? CB  A ALA 173 ? ? 118.80 110.10 8.70   1.40 N 
29  1 CB  A TYR 189 ? ? CG  A TYR 189 ? ? CD1 A TYR 189 ? ? 126.24 121.00 5.24   0.60 N 
30  1 NE  A ARG 190 ? ? CZ  A ARG 190 ? ? NH1 A ARG 190 ? ? 127.95 120.30 7.65   0.50 N 
31  1 NE  A ARG 190 ? ? CZ  A ARG 190 ? ? NH2 A ARG 190 ? ? 112.65 120.30 -7.65  0.50 N 
32  1 CB  A PHE 194 ? ? CG  A PHE 194 ? ? CD2 A PHE 194 ? ? 116.42 120.80 -4.38  0.70 N 
33  1 CA  A GLY 199 ? ? C   A GLY 199 ? ? O   A GLY 199 ? ? 109.46 120.60 -11.14 1.80 N 
34  1 CB  A ASP 216 ? ? CA  A ASP 216 ? ? C   A ASP 216 ? ? 130.28 110.40 19.88  2.00 N 
35  1 CB  A ASP 216 ? ? CG  A ASP 216 ? ? OD1 A ASP 216 ? ? 112.33 118.30 -5.97  0.90 N 
36  1 CB  A ASP 216 ? ? CG  A ASP 216 ? ? OD2 A ASP 216 ? ? 124.35 118.30 6.05   0.90 N 
37  1 N   A HIS 224 ? ? CA  A HIS 224 ? ? CB  A HIS 224 ? ? 99.63  110.60 -10.97 1.80 N 
38  1 N   A PRO 229 ? ? CA  A PRO 229 ? ? CB  A PRO 229 ? ? 95.46  103.30 -7.84  1.20 N 
39  1 CB  A ASP 254 ? ? CG  A ASP 254 ? ? OD1 A ASP 254 ? ? 123.96 118.30 5.66   0.90 N 
40  1 CB  A ASP 258 ? ? CG  A ASP 258 ? ? OD1 A ASP 258 ? ? 126.99 118.30 8.69   0.90 N 
41  1 CB  A ASP 265 ? ? CG  A ASP 265 ? ? OD2 A ASP 265 ? ? 129.22 118.30 10.92  0.90 N 
42  1 CB  A ARG 270 ? ? CA  A ARG 270 ? ? C   A ARG 270 ? ? 97.85  110.40 -12.55 2.00 N 
43  1 NE  A ARG 282 ? ? CZ  A ARG 282 ? ? NH1 A ARG 282 ? ? 126.66 120.30 6.36   0.50 N 
44  1 NE  A ARG 282 ? ? CZ  A ARG 282 ? ? NH2 A ARG 282 ? ? 117.20 120.30 -3.10  0.50 N 
45  1 CA  A GLY 288 ? ? C   A GLY 288 ? ? O   A GLY 288 ? ? 108.67 120.60 -11.93 1.80 N 
46  1 N   A SER 311 ? ? CA  A SER 311 ? ? CB  A SER 311 ? ? 101.18 110.50 -9.32  1.50 N 
47  1 O   A ASN 333 ? ? C   A ASN 333 ? ? N   A HIS 334 ? ? 133.69 122.70 10.99  1.60 Y 
48  1 CB  A PHE 338 ? ? CG  A PHE 338 ? ? CD2 A PHE 338 ? ? 113.35 120.80 -7.45  0.70 N 
49  1 NE  A ARG 371 ? ? CZ  A ARG 371 ? ? NH1 A ARG 371 ? ? 116.92 120.30 -3.38  0.50 N 
50  1 NE  A ARG 375 ? ? CZ  A ARG 375 ? ? NH1 A ARG 375 ? ? 123.51 120.30 3.21   0.50 N 
51  1 NE  A ARG 375 ? ? CZ  A ARG 375 ? ? NH2 A ARG 375 ? ? 115.96 120.30 -4.34  0.50 N 
52  1 CB  A ASN 385 ? ? CG  A ASN 385 ? ? OD1 A ASN 385 ? ? 108.84 121.60 -12.76 2.00 N 
53  1 OD1 A ASP 390 ? ? CG  A ASP 390 ? ? OD2 A ASP 390 ? ? 137.39 123.30 14.09  1.90 N 
54  1 CB  A ASP 390 ? ? CG  A ASP 390 ? ? OD2 A ASP 390 ? ? 107.15 118.30 -11.15 0.90 N 
55  1 CB  A ASP 404 ? ? CG  A ASP 404 ? ? OD1 A ASP 404 ? ? 125.11 118.30 6.81   0.90 N 
56  1 CB  A ASP 404 ? ? CG  A ASP 404 ? ? OD2 A ASP 404 ? ? 110.71 118.30 -7.59  0.90 N 
57  1 CB  A TYR 405 ? ? CG  A TYR 405 ? ? CD1 A TYR 405 ? ? 126.20 121.00 5.20   0.60 N 
58  1 N   A SER 408 ? ? CA  A SER 408 ? ? CB  A SER 408 ? ? 97.03  110.50 -13.47 1.50 N 
59  1 CB  A ASP 409 ? ? CG  A ASP 409 ? ? OD1 A ASP 409 ? ? 124.06 118.30 5.76   0.90 N 
60  1 CB  A ASP 409 ? ? CG  A ASP 409 ? ? OD2 A ASP 409 ? ? 111.05 118.30 -7.25  0.90 N 
61  1 N   A SER 432 ? ? CA  A SER 432 ? ? CB  A SER 432 ? ? 99.12  110.50 -11.38 1.50 N 
62  1 CB  A ASP 449 ? ? CG  A ASP 449 ? ? OD1 A ASP 449 ? ? 124.32 118.30 6.02   0.90 N 
63  1 NE  A ARG 459 ? ? CZ  A ARG 459 ? ? NH1 A ARG 459 ? ? 127.88 120.30 7.58   0.50 N 
64  1 NE  A ARG 459 ? ? CZ  A ARG 459 ? ? NH2 A ARG 459 ? ? 115.35 120.30 -4.95  0.50 N 
65  1 CA  A ARG 460 ? ? CB  A ARG 460 ? ? CG  A ARG 460 ? ? 99.98  113.40 -13.42 2.20 N 
66  1 NH1 A ARG 460 ? ? CZ  A ARG 460 ? ? NH2 A ARG 460 ? ? 131.45 119.40 12.05  1.10 N 
67  1 NE  A ARG 460 ? ? CZ  A ARG 460 ? ? NH1 A ARG 460 ? ? 116.32 120.30 -3.98  0.50 N 
68  1 NE  A ARG 460 ? ? CZ  A ARG 460 ? ? NH2 A ARG 460 ? ? 112.23 120.30 -8.07  0.50 N 
69  1 CB  A ASP 466 ? ? CG  A ASP 466 ? ? OD1 A ASP 466 ? ? 124.42 118.30 6.12   0.90 N 
70  1 OE1 A GLU 474 ? ? CD  A GLU 474 ? ? OE2 A GLU 474 ? ? 131.60 123.30 8.30   1.20 N 
71  1 CB  A TYR 476 ? ? CG  A TYR 476 ? ? CD2 A TYR 476 ? ? 116.21 121.00 -4.79  0.60 N 
72  1 CD1 A TYR 476 ? ? CE1 A TYR 476 ? ? CZ  A TYR 476 ? ? 114.08 119.80 -5.72  0.90 N 
73  1 CB  A PHE 483 ? ? CG  A PHE 483 ? ? CD2 A PHE 483 ? ? 115.20 120.80 -5.60  0.70 N 
74  1 N   A SER 490 ? ? CA  A SER 490 ? ? CB  A SER 490 ? ? 100.61 110.50 -9.89  1.50 N 
75  1 NH1 A ARG 493 ? ? CZ  A ARG 493 ? ? NH2 A ARG 493 ? ? 127.63 119.40 8.23   1.10 N 
76  1 NE  A ARG 493 ? ? CZ  A ARG 493 ? ? NH2 A ARG 493 ? ? 112.97 120.30 -7.33  0.50 N 
77  1 N   A TYR 495 ? ? CA  A TYR 495 ? ? CB  A TYR 495 ? ? 98.49  110.60 -12.11 1.80 N 
78  1 CB  A TYR 495 ? ? CG  A TYR 495 ? ? CD1 A TYR 495 ? ? 115.26 121.00 -5.74  0.60 N 
79  1 CE1 A HIS 496 ? ? NE2 A HIS 496 ? ? CD2 A HIS 496 ? ? 114.37 109.00 5.37   0.70 N 
80  1 N   A SER 499 ? ? CA  A SER 499 ? ? CB  A SER 499 ? ? 120.19 110.50 9.69   1.50 N 
81  1 CD  A ARG 506 ? ? NE  A ARG 506 ? ? CZ  A ARG 506 ? ? 134.69 123.60 11.09  1.40 N 
82  1 CB  A PHE 523 ? ? CG  A PHE 523 ? ? CD2 A PHE 523 ? ? 115.08 120.80 -5.72  0.70 N 
83  1 CB  A PHE 523 ? ? CG  A PHE 523 ? ? CD1 A PHE 523 ? ? 127.34 120.80 6.54   0.70 N 
84  1 CB  A TYR 532 ? ? CG  A TYR 532 ? ? CD2 A TYR 532 ? ? 115.04 121.00 -5.96  0.60 N 
85  1 CB  A TYR 532 ? ? CG  A TYR 532 ? ? CD1 A TYR 532 ? ? 127.38 121.00 6.38   0.60 N 
86  1 NE  A ARG 543 ? ? CZ  A ARG 543 ? ? NH1 A ARG 543 ? ? 126.38 120.30 6.08   0.50 N 
87  1 NE  A ARG 543 ? ? CZ  A ARG 543 ? ? NH2 A ARG 543 ? ? 112.43 120.30 -7.87  0.50 N 
88  1 CD  A ARG 548 ? ? NE  A ARG 548 ? ? CZ  A ARG 548 ? ? 145.23 123.60 21.63  1.40 N 
89  1 NE  A ARG 548 ? ? CZ  A ARG 548 ? ? NH2 A ARG 548 ? ? 124.18 120.30 3.88   0.50 N 
90  1 CB  A ASP 565 ? ? CG  A ASP 565 ? ? OD1 A ASP 565 ? ? 125.04 118.30 6.74   0.90 N 
91  1 O   A SER 566 ? ? C   A SER 566 ? ? N   A SER 567 ? ? 136.15 122.70 13.45  1.60 Y 
92  1 CE1 A HIS 581 ? ? NE2 A HIS 581 ? ? CD2 A HIS 581 ? ? 114.48 109.00 5.48   0.70 N 
93  1 CB  A ASP 586 ? ? CG  A ASP 586 ? ? OD1 A ASP 586 ? ? 112.14 118.30 -6.16  0.90 N 
94  1 NE  A ARG 589 ? ? CZ  A ARG 589 ? ? NH1 A ARG 589 ? ? 124.93 120.30 4.63   0.50 N 
95  1 NE  A ARG 589 ? ? CZ  A ARG 589 ? ? NH2 A ARG 589 ? ? 116.97 120.30 -3.33  0.50 N 
96  1 CG  A TYR 602 ? ? CD1 A TYR 602 ? ? CE1 A TYR 602 ? ? 116.41 121.30 -4.89  0.80 N 
97  1 CB  A PHE 604 ? ? CG  A PHE 604 ? ? CD2 A PHE 604 ? ? 114.51 120.80 -6.29  0.70 N 
98  1 O   A TYR 617 ? ? C   A TYR 617 ? ? N   A TRP 618 ? ? 132.75 122.70 10.05  1.60 Y 
99  1 CB  A ASN 624 ? ? CA  A ASN 624 ? ? C   A ASN 624 ? ? 122.74 110.40 12.34  2.00 N 
100 1 N   A SER 633 ? ? CA  A SER 633 ? ? CB  A SER 633 ? ? 119.52 110.50 9.02   1.50 N 
101 1 NE  A ARG 636 ? ? CZ  A ARG 636 ? ? NH2 A ARG 636 ? ? 117.27 120.30 -3.03  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 12  ? ? -55.53  -75.75  
2  1 LYS A 60  ? ? 71.81   -30.78  
3  1 SER A 187 ? ? -120.69 -84.03  
4  1 SER A 188 ? ? -166.13 -148.09 
5  1 MET A 226 ? ? -77.77  21.92   
6  1 SER A 432 ? ? 47.06   -123.18 
7  1 ASP A 466 ? ? -82.81  39.60   
8  1 THR A 468 ? ? 36.13   49.69   
9  1 VAL A 494 ? ? -118.63 -136.66 
10 1 LEU A 514 ? ? 81.16   48.45   
11 1 PHE A 523 ? ? -89.77  48.74   
12 1 THR A 582 ? ? 77.48   -10.19  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     439 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.090 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'COPPER (II) ION' CU  
3 'SODIUM ION'      NA  
4 water             HOH 
#