data_1GPN
# 
_entry.id   1GPN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GPN         
PDBE  EBI-8811     
WWPDB D_1290008811 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1ACJ unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH TACRINE' 
PDB 1ACL unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH DECAMETHONIUM' 
PDB 1AMN unspecified 
'TRANSITION STATE ANALOG: ACETYLCHOLINESTERASE COMPLEXED WITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1AX9 unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, LAUE DATA' 
PDB 1CFJ unspecified 
'METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O- ISOPROPYLMETHYLPHOSPHONOFLUORIDATE (GB, SARIN)' 
PDB 1DX6 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-GALANTHAMINE AT 2.3A RESOLUTION' 
PDB 1E3Q unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH BW284C51' 
PDB 1E66 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-HUPRINE X AT 2.1A RESOLUTION' 
PDB 1EA5 unspecified 'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7 ) FROM TORPEDO CALIFORNICA AT 1.8A RESOLUTION' 
PDB 1EEA unspecified ACETYLCHOLINESTERASE 
PDB 1EVE unspecified 
'THREE DIMENSIONAL STRUCTURE OF THE ANTI- ALZHEIMER DRUG, E2020 (ARICEPT), COMPLEXED WITH ITS TARGET ACETYLCHOLINESTERASE' 
PDB 1FSS unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH FASCICULIN- II' 
PDB 1GPK unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXE WITH (+)-HUPERZINE A AT 2.1A RESOLUTION' 
PDB 1HBJ unspecified 
;X-RAY CRYSTAL STRUCTURE OF COMPLEX BETWEEN TORPEDO CALIFORNICA ACHE AND A REVERSIBLE INHIBITOR, 4-AMINO-5-FLUORO-2-METHYL-3-( 3-TRIFLUOROACETYLBENZYLTHIOMETHYL)QUINOLINE
;
PDB 1OCE unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH MF268' 
PDB 1QID unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT A) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIE unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIF unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT C) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIG unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT D) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIH unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT E) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QII unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT F) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIJ unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT G) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIK unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT H) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIM unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT I) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QTI unspecified ACETYLCHOLINESTERASE 
PDB 1SOM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE INHIBITED BY NERVE AGENT GD (SOMAN).' 
PDB 1VOT unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE A' 
PDB 1VXO unspecified 
;METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 1VXR unspecified 
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 2ACE unspecified 'NATIVE ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 2ACK unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, MONOCHROMATIC DATA' 
PDB 2DFP unspecified 'X-RAY STRUCTURE OF AGED DI-ISOPROPYL- PHOSPHORO-FLUORIDATE (DFP) BOUND TO ACETYLCHOLINESTERASE' 
PDB 3ACE unspecified 'THEORETICAL MODEL OF (R)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 4ACE unspecified 'THEORETICAL MODEL OF (S)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GPN 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2001-11-07 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dvir, H.'      1 
'Harel, M.'     2 
'Jiang, H.L.'   3 
'Silman, I.'    4 
'Sussman, J.L.' 5 
# 
_citation.id                        primary 
_citation.title                     
;X-Ray Structures of Torpedo Californica Acetylcholinesterase Complexed with (+)-Huperzine a and (-)-Huperzine B: Structural Evidence for an Active Site Rearrangement
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            41 
_citation.page_first                10810 
_citation.page_last                 ? 
_citation.year                      2002 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12196020 
_citation.pdbx_database_id_DOI      10.1021/BI020151+ 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Dvir, H.'      1  ? 
primary 'Jiang, H.L.'   2  ? 
primary 'Wong, D.M.'    3  ? 
primary 'Harel, M.'     4  ? 
primary 'Chetrit, M.'   5  ? 
primary 'He, X.C.'      6  ? 
primary 'Jin, G.Y.'     7  ? 
primary 'Yu, G.L.'      8  ? 
primary 'Tang, X.C.'    9  ? 
primary 'Silman, I.'    10 ? 
primary 'Bai, D.L.'     11 ? 
primary 'Sussman, J.L.' 12 ? 
# 
_cell.entry_id           1GPN 
_cell.length_a           111.722 
_cell.length_b           111.722 
_cell.length_c           137.124 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GPN 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE                     60736.516 1   3.1.1.7 ? 'RESIDUES 22-558' 
'HUPERZINE B BOUND AT THE BOTTOM OF THE ACTIVE SITE GORGE' 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2   ?       ? ?                 ? 
3 non-polymer syn 'HUPERZINE B'                            256.343   1   ?       ? ?                 ? 
4 water       nat water                                    18.015    289 ?       ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'PACIFIC ELECTRIC RAY' 
_entity_src_nat.pdbx_organism_scientific   'TORPEDO CALIFORNICA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    'PURIFIED FROM THE ELECTRIC ORGAN' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1GPN 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 537 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  558 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
HUB non-polymer                  . 'HUPERZINE B'                            ? 'C16 H20 N2 O'   256.343 
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1GPN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.80 
_exptl_crystal.density_percent_sol   66.6 
_exptl_crystal.description           'DATA WERE COLLECTED USING THE ROTATION METHOD' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.60 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 5.60' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           120.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   BRUKER-AXS 
_diffrn_detector.pdbx_collection_date   2000-05-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9326 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             0.9326 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1GPN 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.350 
_reflns.number_obs                   41627 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.3 
_reflns.pdbx_Rmerge_I_obs            0.05800 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.9000 
_reflns.B_iso_Wilson_estimate        44.255 
_reflns.pdbx_redundancy              15.900 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.35 
_reflns_shell.d_res_low              2.43 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.22500 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.600 
_reflns_shell.pdbx_redundancy        16.00 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1GPN 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     40834 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1000 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.35 
_refine.ls_percent_reflns_obs                    98.0 
_refine.ls_R_factor_obs                          0.1862 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1862 
_refine.ls_R_factor_R_free                       0.2161 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  2045 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -9.116 
_refine.aniso_B[2][2]                            -9.116 
_refine.aniso_B[3][3]                            18.233 
_refine.aniso_B[1][2]                            -5.513 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1EA5' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4134 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         47 
_refine_hist.number_atoms_solvent             289 
_refine_hist.number_atoms_total               4470 
_refine_hist.d_res_high                       2.35 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.529 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM  PROTEIN.TOP      
'X-RAY DIFFRACTION' 2 WATER_REP.PARAM    WATER.TOP        
'X-RAY DIFFRACTION' 3 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 
'X-RAY DIFFRACTION' 4 HUPB.PAR           HUPB.TOP         
# 
_struct.entry_id                  1GPN 
_struct.title                     'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE B AT 2.35A RESOLUTION' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GPN 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;HYDROLASE, CHOLINESTERASE, HUPERZINE A, HUPERZINE B, ALZHEIMER'S DISEASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  2  PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  3  LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  4  GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  5  VAL A 150 ? LEU A 156 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P6  6  ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  7  GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  8  SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  9  SER A 215 ? PHE A 219 ? SER A 215 PHE A 219 5 ? 5  
HELX_P HELX_P10 10 VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P11 11 SER A 258 ? LYS A 269 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P12 12 LYS A 270 ? GLU A 278 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 13 TRP A 279 ? LEU A 282 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P14 14 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 15 GLY A 328 ? TYR A 334 ? GLY A 328 TYR A 334 1 ? 7  
HELX_P HELX_P16 16 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 17 ASN A 364 ? THR A 376 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P18 18 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 19 VAL A 400 ? GLY A 415 ? VAL A 400 GLY A 415 1 ? 16 
HELX_P HELX_P20 20 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 21 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 22 GLY A 449 ? VAL A 453 ? GLY A 449 VAL A 453 5 ? 5  
HELX_P HELX_P23 23 VAL A 453 ? ASN A 457 ? VAL A 453 ASN A 457 5 ? 5  
HELX_P HELX_P24 24 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P25 25 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P26 26 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94   1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf2 disulf ?   ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265  1_555 ? ? ? ? ? ? ? 2.018 ? ?               
disulf3 disulf ?   ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521  1_555 ? ? ? ? ? ? ? 2.043 ? ?               
covale1 covale one ? A ASN 59  ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 59  A NAG 1536 1_555 ? ? ? ? ? ? ? 1.460 ? N-Glycosylation 
covale2 covale one ? A ASN 416 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 416 A NAG 1537 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.24 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AB 1  THR A 18  ? PRO A 21  ? THR A 18  PRO A 21  
AB 2  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
AB 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
AB 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AB 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AB 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AB 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AB 8  ILE A 319 ? ASN A 324 ? ILE A 319 ASN A 324 
AB 9  THR A 418 ? PHE A 423 ? THR A 418 PHE A 423 
AB 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AB 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
AC 1  VAL A 236 ? SER A 237 ? VAL A 236 SER A 237 
AC 2  VAL A 295 ? ILE A 296 ? VAL A 295 ILE A 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N THR A 10  ? N THR A 10  O GLY A 13  ? O GLY A 13  
AA 2  3  N MET A 16  ? N MET A 16  O TRP A 58  ? O TRP A 58  
AB 1  2  N VAL A 20  ? N VAL A 20  O ILE A 27  ? O ILE A 27  
AB 2  3  N ILE A 33  ? N ILE A 33  O LEU A 97  ? O LEU A 97  
AB 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AB 4  5  N VAL A 142 ? N VAL A 142 O THR A 110 ? O THR A 110 
AB 5  6  O THR A 109 ? O THR A 109 N ASP A 190 ? N ASP A 190 
AB 6  7  N ILE A 196 ? N ILE A 196 O ARG A 221 ? O ARG A 221 
AB 7  8  N LEU A 224 ? N LEU A 224 O LEU A 320 ? O LEU A 320 
AB 8  9  N LEU A 321 ? N LEU A 321 O TYR A 419 ? O TYR A 419 
AB 9  10 N PHE A 422 ? N PHE A 422 O ILE A 503 ? O ILE A 503 
AB 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
AC 1  2  O VAL A 236 ? O VAL A 236 N ILE A 296 ? N ILE A 296 
# 
_database_PDB_matrix.entry_id          1GPN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GPN 
_atom_sites.fract_transf_matrix[1][1]   0.008951 
_atom_sites.fract_transf_matrix[1][2]   0.005168 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010335 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007293 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -12.541 87.975 34.464 1.00 59.58 ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -11.964 88.252 35.810 1.00 59.39 ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -10.993 87.159 36.268 1.00 58.88 ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.269 85.964 36.180 1.00 57.93 ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -13.077 88.395 36.850 1.00 60.13 ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -12.559 88.325 38.175 1.00 61.61 ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -9.856  87.612 36.773 1.00 58.10 ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -8.794  86.768 37.269 1.00 56.41 ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.265  85.832 38.397 1.00 55.25 ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.679  84.775 38.611 1.00 55.56 ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -7.669  87.681 37.754 1.00 58.32 ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.309  87.042 37.930 1.00 62.42 ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.259  88.054 38.369 1.00 64.39 ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -5.559  88.858 39.277 1.00 66.84 ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.133  88.048 37.826 1.00 66.62 ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.324 86.194 39.110 1.00 52.84 ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -10.787 85.343 40.201 1.00 51.68 ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -11.826 84.328 39.764 1.00 51.29 ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.439 83.655 40.593 1.00 52.43 ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.356 86.186 41.349 1.00 51.16 ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.420 87.224 41.986 1.00 51.12 ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -11.126 87.818 43.210 1.00 51.36 ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -9.092  86.597 42.403 1.00 49.59 ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.016 84.199 38.463 1.00 49.82 ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -12.991 83.253 37.966 1.00 50.33 ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.322 82.185 37.137 1.00 48.96 ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -11.611 82.497 36.185 1.00 48.51 ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.036 83.972 37.127 1.00 52.91 ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.294 84.260 37.931 1.00 56.68 ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -16.168 85.302 37.225 1.00 57.80 ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.032 82.935 38.130 1.00 57.94 ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.537 80.925 37.499 1.00 46.21 ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -11.918 79.845 36.745 1.00 44.19 ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -12.922 78.745 36.478 1.00 43.81 ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.628 78.292 37.382 1.00 43.41 ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.711 79.214 37.506 1.00 44.75 ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -10.077 78.112 36.648 1.00 43.18 ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.678  80.275 37.856 1.00 43.15 ? 8    VAL A CG2 1 
ATOM   39   N N   A ASN A 1 9   ? -12.996 78.313 35.229 0.50 42.89 ? 9    ASN A N   1 
ATOM   40   N N   B ASN A 1 9   ? -12.997 78.325 35.218 0.50 44.59 ? 9    ASN A N   1 
ATOM   41   C CA  A ASN A 1 9   ? -13.904 77.238 34.888 0.50 42.18 ? 9    ASN A CA  1 
ATOM   42   C CA  B ASN A 1 9   ? -13.906 77.258 34.813 0.50 45.17 ? 9    ASN A CA  1 
ATOM   43   C C   A ASN A 1 9   ? -13.092 75.961 34.805 0.50 42.17 ? 9    ASN A C   1 
ATOM   44   C C   B ASN A 1 9   ? -13.096 75.955 34.787 0.50 44.08 ? 9    ASN A C   1 
ATOM   45   O O   A ASN A 1 9   ? -12.175 75.849 33.991 0.50 42.01 ? 9    ASN A O   1 
ATOM   46   O O   B ASN A 1 9   ? -12.168 75.825 33.989 0.50 43.70 ? 9    ASN A O   1 
ATOM   47   C CB  A ASN A 1 9   ? -14.590 77.497 33.549 0.50 39.99 ? 9    ASN A CB  1 
ATOM   48   C CB  B ASN A 1 9   ? -14.473 77.519 33.399 0.50 46.75 ? 9    ASN A CB  1 
ATOM   49   C CG  A ASN A 1 9   ? -15.553 76.398 33.184 0.50 38.64 ? 9    ASN A CG  1 
ATOM   50   C CG  B ASN A 1 9   ? -15.114 78.910 33.240 0.50 50.19 ? 9    ASN A CG  1 
ATOM   51   O OD1 A ASN A 1 9   ? -16.333 75.942 34.021 0.50 37.88 ? 9    ASN A OD1 1 
ATOM   52   O OD1 B ASN A 1 9   ? -14.426 79.938 33.226 0.50 52.35 ? 9    ASN A OD1 1 
ATOM   53   N ND2 A ASN A 1 9   ? -15.508 75.962 31.937 0.50 39.15 ? 9    ASN A ND2 1 
ATOM   54   N ND2 B ASN A 1 9   ? -16.437 78.938 33.101 0.50 51.54 ? 9    ASN A ND2 1 
ATOM   55   N N   . THR A 1 10  ? -13.425 74.999 35.649 1.00 42.76 ? 10   THR A N   1 
ATOM   56   C CA  . THR A 1 10  ? -12.696 73.725 35.652 1.00 43.36 ? 10   THR A CA  1 
ATOM   57   C C   . THR A 1 10  ? -13.592 72.615 35.106 1.00 44.68 ? 10   THR A C   1 
ATOM   58   O O   . THR A 1 10  ? -14.783 72.837 34.857 1.00 45.75 ? 10   THR A O   1 
ATOM   59   C CB  . THR A 1 10  ? -12.252 73.305 37.071 1.00 40.69 ? 10   THR A CB  1 
ATOM   60   O OG1 . THR A 1 10  ? -13.375 72.759 37.769 1.00 37.37 ? 10   THR A OG1 1 
ATOM   61   C CG2 . THR A 1 10  ? -11.695 74.501 37.833 1.00 39.04 ? 10   THR A CG2 1 
ATOM   62   N N   . LYS A 1 11  ? -13.016 71.423 34.935 1.00 44.16 ? 11   LYS A N   1 
ATOM   63   C CA  . LYS A 1 11  ? -13.765 70.274 34.437 1.00 42.40 ? 11   LYS A CA  1 
ATOM   64   C C   . LYS A 1 11  ? -14.819 69.850 35.442 1.00 42.37 ? 11   LYS A C   1 
ATOM   65   O O   . LYS A 1 11  ? -15.724 69.114 35.098 1.00 43.21 ? 11   LYS A O   1 
ATOM   66   C CB  . LYS A 1 11  ? -12.818 69.102 34.134 1.00 41.26 ? 11   LYS A CB  1 
ATOM   67   C CG  . LYS A 1 11  ? -11.828 69.427 33.018 1.00 42.02 ? 11   LYS A CG  1 
ATOM   68   C CD  . LYS A 1 11  ? -10.612 68.501 32.994 1.00 39.31 ? 11   LYS A CD  1 
ATOM   69   C CE  . LYS A 1 11  ? -9.724  68.848 31.786 1.00 37.75 ? 11   LYS A CE  1 
ATOM   70   N NZ  . LYS A 1 11  ? -8.678  67.808 31.535 1.00 38.81 ? 11   LYS A NZ  1 
ATOM   71   N N   . SER A 1 12  ? -14.712 70.302 36.687 1.00 43.28 ? 12   SER A N   1 
ATOM   72   C CA  . SER A 1 12  ? -15.721 69.936 37.689 1.00 45.16 ? 12   SER A CA  1 
ATOM   73   C C   . SER A 1 12  ? -16.742 71.060 37.828 1.00 44.70 ? 12   SER A C   1 
ATOM   74   O O   . SER A 1 12  ? -17.758 70.917 38.514 1.00 43.70 ? 12   SER A O   1 
ATOM   75   C CB  . SER A 1 12  ? -15.080 69.696 39.062 1.00 46.55 ? 12   SER A CB  1 
ATOM   76   O OG  . SER A 1 12  ? -14.132 68.646 39.013 1.00 51.01 ? 12   SER A OG  1 
ATOM   77   N N   . GLY A 1 13  ? -16.467 72.180 37.171 1.00 45.12 ? 13   GLY A N   1 
ATOM   78   C CA  . GLY A 1 13  ? -17.364 73.311 37.272 1.00 45.34 ? 13   GLY A CA  1 
ATOM   79   C C   . GLY A 1 13  ? -16.588 74.592 37.499 1.00 45.85 ? 13   GLY A C   1 
ATOM   80   O O   . GLY A 1 13  ? -15.346 74.592 37.576 1.00 46.15 ? 13   GLY A O   1 
ATOM   81   N N   . LYS A 1 14  ? -17.330 75.683 37.638 1.00 45.41 ? 14   LYS A N   1 
ATOM   82   C CA  . LYS A 1 14  ? -16.763 77.017 37.816 1.00 45.07 ? 14   LYS A CA  1 
ATOM   83   C C   . LYS A 1 14  ? -16.479 77.338 39.296 1.00 45.16 ? 14   LYS A C   1 
ATOM   84   O O   . LYS A 1 14  ? -17.264 76.979 40.187 1.00 43.54 ? 14   LYS A O   1 
ATOM   85   C CB  . LYS A 1 14  ? -17.755 78.014 37.222 1.00 46.75 ? 14   LYS A CB  1 
ATOM   86   C CG  . LYS A 1 14  ? -17.206 79.363 36.828 1.00 50.91 ? 14   LYS A CG  1 
ATOM   87   C CD  . LYS A 1 14  ? -17.941 79.880 35.564 1.00 49.54 ? 14   LYS A CD  1 
ATOM   88   N N   . VAL A 1 15  ? -15.343 77.984 39.556 1.00 43.49 ? 15   VAL A N   1 
ATOM   89   C CA  . VAL A 1 15  ? -14.983 78.376 40.915 1.00 44.11 ? 15   VAL A CA  1 
ATOM   90   C C   . VAL A 1 15  ? -14.651 79.854 40.965 1.00 43.26 ? 15   VAL A C   1 
ATOM   91   O O   . VAL A 1 15  ? -14.110 80.409 40.013 1.00 42.63 ? 15   VAL A O   1 
ATOM   92   C CB  . VAL A 1 15  ? -13.720 77.607 41.475 1.00 43.66 ? 15   VAL A CB  1 
ATOM   93   C CG1 . VAL A 1 15  ? -13.960 76.117 41.496 1.00 43.68 ? 15   VAL A CG1 1 
ATOM   94   C CG2 . VAL A 1 15  ? -12.510 77.924 40.635 1.00 43.20 ? 15   VAL A CG2 1 
ATOM   95   N N   A MET A 1 16  ? -14.980 80.491 42.083 0.50 44.30 ? 16   MET A N   1 
ATOM   96   N N   B MET A 1 16  ? -14.979 80.498 42.079 0.50 44.62 ? 16   MET A N   1 
ATOM   97   C CA  A MET A 1 16  ? -14.681 81.922 42.249 0.50 44.81 ? 16   MET A CA  1 
ATOM   98   C CA  B MET A 1 16  ? -14.680 81.910 42.263 0.50 44.24 ? 16   MET A CA  1 
ATOM   99   C C   A MET A 1 16  ? -13.713 82.073 43.433 0.50 43.51 ? 16   MET A C   1 
ATOM   100  C C   B MET A 1 16  ? -13.722 82.086 43.429 0.50 43.88 ? 16   MET A C   1 
ATOM   101  O O   A MET A 1 16  ? -14.020 81.682 44.554 0.50 42.35 ? 16   MET A O   1 
ATOM   102  O O   B MET A 1 16  ? -13.999 81.659 44.558 0.50 42.01 ? 16   MET A O   1 
ATOM   103  C CB  A MET A 1 16  ? -15.958 82.718 42.532 0.50 45.51 ? 16   MET A CB  1 
ATOM   104  C CB  B MET A 1 16  ? -15.969 82.723 42.497 0.50 46.74 ? 16   MET A CB  1 
ATOM   105  C CG  A MET A 1 16  ? -15.747 84.211 42.813 0.50 48.92 ? 16   MET A CG  1 
ATOM   106  C CG  B MET A 1 16  ? -15.687 84.195 42.851 0.50 46.64 ? 16   MET A CG  1 
ATOM   107  S SD  A MET A 1 16  ? -17.119 85.090 43.502 0.50 48.54 ? 16   MET A SD  1 
ATOM   108  S SD  B MET A 1 16  ? -15.383 85.249 41.384 0.50 52.05 ? 16   MET A SD  1 
ATOM   109  C CE  A MET A 1 16  ? -17.264 84.371 45.177 0.50 46.47 ? 16   MET A CE  1 
ATOM   110  C CE  B MET A 1 16  ? -16.844 86.288 41.320 0.50 50.51 ? 16   MET A CE  1 
ATOM   111  N N   . GLY A 1 17  ? -12.566 82.673 43.152 1.00 43.68 ? 17   GLY A N   1 
ATOM   112  C CA  . GLY A 1 17  ? -11.570 82.873 44.180 1.00 44.77 ? 17   GLY A CA  1 
ATOM   113  C C   . GLY A 1 17  ? -11.679 84.203 44.893 1.00 46.50 ? 17   GLY A C   1 
ATOM   114  O O   . GLY A 1 17  ? -12.741 84.828 44.903 1.00 46.75 ? 17   GLY A O   1 
ATOM   115  N N   . THR A 1 18  ? -10.565 84.625 45.489 1.00 46.51 ? 18   THR A N   1 
ATOM   116  C CA  . THR A 1 18  ? -10.493 85.865 46.235 1.00 47.15 ? 18   THR A CA  1 
ATOM   117  C C   . THR A 1 18  ? -9.086  86.409 46.135 1.00 48.07 ? 18   THR A C   1 
ATOM   118  O O   . THR A 1 18  ? -8.151  85.642 45.957 1.00 50.17 ? 18   THR A O   1 
ATOM   119  C CB  . THR A 1 18  ? -10.797 85.622 47.697 1.00 47.21 ? 18   THR A CB  1 
ATOM   120  O OG1 . THR A 1 18  ? -10.684 86.852 48.414 1.00 47.66 ? 18   THR A OG1 1 
ATOM   121  C CG2 . THR A 1 18  ? -9.792  84.621 48.285 1.00 49.43 ? 18   THR A CG2 1 
ATOM   122  N N   . ARG A 1 19  ? -8.931  87.727 46.224 1.00 48.86 ? 19   ARG A N   1 
ATOM   123  C CA  . ARG A 1 19  ? -7.609  88.347 46.163 1.00 48.75 ? 19   ARG A CA  1 
ATOM   124  C C   . ARG A 1 19  ? -7.042  88.363 47.573 1.00 49.21 ? 19   ARG A C   1 
ATOM   125  O O   . ARG A 1 19  ? -7.769  88.614 48.532 1.00 48.12 ? 19   ARG A O   1 
ATOM   126  C CB  . ARG A 1 19  ? -7.702  89.797 45.678 1.00 49.87 ? 19   ARG A CB  1 
ATOM   127  C CG  . ARG A 1 19  ? -7.427  90.023 44.201 1.00 53.08 ? 19   ARG A CG  1 
ATOM   128  N N   . VAL A 1 20  ? -5.757  88.072 47.730 1.00 49.02 ? 20   VAL A N   1 
ATOM   129  C CA  . VAL A 1 20  ? -5.198  88.145 49.073 1.00 48.04 ? 20   VAL A CA  1 
ATOM   130  C C   . VAL A 1 20  ? -3.937  88.964 49.037 1.00 46.54 ? 20   VAL A C   1 
ATOM   131  O O   . VAL A 1 20  ? -3.138  88.882 48.097 1.00 47.22 ? 20   VAL A O   1 
ATOM   132  C CB  . VAL A 1 20  ? -4.883  86.746 49.717 1.00 48.11 ? 20   VAL A CB  1 
ATOM   133  C CG1 . VAL A 1 20  ? -6.136  85.885 49.735 1.00 48.79 ? 20   VAL A CG1 1 
ATOM   134  C CG2 . VAL A 1 20  ? -3.753  86.064 48.992 1.00 48.39 ? 20   VAL A CG2 1 
ATOM   135  N N   . PRO A 1 21  ? -3.760  89.807 50.048 1.00 45.48 ? 21   PRO A N   1 
ATOM   136  C CA  . PRO A 1 21  ? -2.554  90.628 50.079 1.00 45.49 ? 21   PRO A CA  1 
ATOM   137  C C   . PRO A 1 21  ? -1.372  89.761 50.524 1.00 45.36 ? 21   PRO A C   1 
ATOM   138  O O   . PRO A 1 21  ? -1.539  88.783 51.275 1.00 44.11 ? 21   PRO A O   1 
ATOM   139  C CB  . PRO A 1 21  ? -2.907  91.726 51.091 1.00 45.12 ? 21   PRO A CB  1 
ATOM   140  C CG  . PRO A 1 21  ? -3.834  91.020 52.044 1.00 44.75 ? 21   PRO A CG  1 
ATOM   141  C CD  . PRO A 1 21  ? -4.701  90.177 51.121 1.00 45.52 ? 21   PRO A CD  1 
ATOM   142  N N   . VAL A 1 22  ? -0.185  90.118 50.054 1.00 43.78 ? 22   VAL A N   1 
ATOM   143  C CA  . VAL A 1 22  ? 1.009   89.383 50.412 1.00 45.06 ? 22   VAL A CA  1 
ATOM   144  C C   . VAL A 1 22  ? 2.175   90.318 50.141 1.00 45.83 ? 22   VAL A C   1 
ATOM   145  O O   . VAL A 1 22  ? 2.310   90.822 49.028 1.00 44.47 ? 22   VAL A O   1 
ATOM   146  C CB  . VAL A 1 22  ? 1.145   88.064 49.548 1.00 44.71 ? 22   VAL A CB  1 
ATOM   147  C CG1 . VAL A 1 22  ? 0.895   88.380 48.070 1.00 41.80 ? 22   VAL A CG1 1 
ATOM   148  C CG2 . VAL A 1 22  ? 2.529   87.445 49.725 1.00 40.22 ? 22   VAL A CG2 1 
ATOM   149  N N   . LEU A 1 23  ? 2.983   90.559 51.175 1.00 46.95 ? 23   LEU A N   1 
ATOM   150  C CA  . LEU A 1 23  ? 4.164   91.416 51.095 1.00 49.11 ? 23   LEU A CA  1 
ATOM   151  C C   . LEU A 1 23  ? 3.926   92.705 50.289 1.00 50.68 ? 23   LEU A C   1 
ATOM   152  O O   . LEU A 1 23  ? 4.682   93.028 49.368 1.00 49.09 ? 23   LEU A O   1 
ATOM   153  C CB  . LEU A 1 23  ? 5.331   90.618 50.487 1.00 48.60 ? 23   LEU A CB  1 
ATOM   154  C CG  . LEU A 1 23  ? 5.720   89.311 51.207 1.00 47.69 ? 23   LEU A CG  1 
ATOM   155  C CD1 . LEU A 1 23  ? 6.821   88.634 50.437 1.00 46.83 ? 23   LEU A CD1 1 
ATOM   156  C CD2 . LEU A 1 23  ? 6.161   89.585 52.658 1.00 46.98 ? 23   LEU A CD2 1 
ATOM   157  N N   A SER A 1 24  ? 2.874   93.435 50.646 0.50 51.21 ? 24   SER A N   1 
ATOM   158  N N   B SER A 1 24  ? 2.872   93.426 50.652 0.50 51.33 ? 24   SER A N   1 
ATOM   159  C CA  A SER A 1 24  ? 2.515   94.684 49.967 0.50 53.29 ? 24   SER A CA  1 
ATOM   160  C CA  B SER A 1 24  ? 2.520   94.670 49.975 0.50 53.52 ? 24   SER A CA  1 
ATOM   161  C C   A SER A 1 24  ? 2.231   94.469 48.479 0.50 53.80 ? 24   SER A C   1 
ATOM   162  C C   B SER A 1 24  ? 2.261   94.448 48.481 0.50 53.94 ? 24   SER A C   1 
ATOM   163  O O   A SER A 1 24  ? 2.794   95.169 47.634 0.50 55.14 ? 24   SER A O   1 
ATOM   164  O O   B SER A 1 24  ? 2.713   95.224 47.630 0.50 54.98 ? 24   SER A O   1 
ATOM   165  C CB  A SER A 1 24  ? 3.630   95.714 50.161 0.50 53.62 ? 24   SER A CB  1 
ATOM   166  C CB  B SER A 1 24  ? 3.624   95.737 50.122 0.50 53.18 ? 24   SER A CB  1 
ATOM   167  O OG  A SER A 1 24  ? 4.713   95.487 49.248 0.50 52.92 ? 24   SER A OG  1 
ATOM   168  O OG  B SER A 1 24  ? 3.826   96.021 51.535 0.50 53.94 ? 24   SER A OG  1 
ATOM   169  N N   . SER A 1 25  ? 1.449   93.438 48.172 1.00 53.88 ? 25   SER A N   1 
ATOM   170  C CA  . SER A 1 25  ? 1.081   93.114 46.797 1.00 52.00 ? 25   SER A CA  1 
ATOM   171  C C   . SER A 1 25  ? -0.108  92.176 46.921 1.00 51.45 ? 25   SER A C   1 
ATOM   172  O O   . SER A 1 25  ? -0.703  92.068 47.993 1.00 50.88 ? 25   SER A O   1 
ATOM   173  C CB  . SER A 1 25  ? 2.233   92.440 46.050 1.00 53.32 ? 25   SER A CB  1 
ATOM   174  O OG  . SER A 1 25  ? 1.978   92.418 44.648 1.00 52.63 ? 25   SER A OG  1 
ATOM   175  N N   . HIS A 1 26  ? -0.480  91.499 45.850 1.00 51.97 ? 26   HIS A N   1 
ATOM   176  C CA  . HIS A 1 26  ? -1.639  90.622 45.954 1.00 53.85 ? 26   HIS A CA  1 
ATOM   177  C C   . HIS A 1 26  ? -1.546  89.463 44.961 1.00 53.66 ? 26   HIS A C   1 
ATOM   178  O O   . HIS A 1 26  ? -0.845  89.562 43.948 1.00 53.49 ? 26   HIS A O   1 
ATOM   179  C CB  . HIS A 1 26  ? -2.909  91.435 45.665 1.00 57.14 ? 26   HIS A CB  1 
ATOM   180  C CG  . HIS A 1 26  ? -2.970  91.962 44.256 1.00 63.57 ? 26   HIS A CG  1 
ATOM   181  N ND1 . HIS A 1 26  ? -3.533  91.248 43.212 1.00 65.81 ? 26   HIS A ND1 1 
ATOM   182  C CD2 . HIS A 1 26  ? -2.437  93.079 43.697 1.00 64.89 ? 26   HIS A CD2 1 
ATOM   183  C CE1 . HIS A 1 26  ? -3.337  91.899 42.075 1.00 66.70 ? 26   HIS A CE1 1 
ATOM   184  N NE2 . HIS A 1 26  ? -2.672  93.011 42.342 1.00 67.47 ? 26   HIS A NE2 1 
ATOM   185  N N   . ILE A 1 27  ? -2.226  88.362 45.287 1.00 52.10 ? 27   ILE A N   1 
ATOM   186  C CA  . ILE A 1 27  ? -2.301  87.195 44.420 1.00 50.86 ? 27   ILE A CA  1 
ATOM   187  C C   . ILE A 1 27  ? -3.704  86.625 44.583 1.00 49.94 ? 27   ILE A C   1 
ATOM   188  O O   . ILE A 1 27  ? -4.451  87.066 45.466 1.00 49.31 ? 27   ILE A O   1 
ATOM   189  C CB  . ILE A 1 27  ? -1.287  86.126 44.795 1.00 51.39 ? 27   ILE A CB  1 
ATOM   190  C CG1 . ILE A 1 27  ? -1.521  85.707 46.238 1.00 51.51 ? 27   ILE A CG1 1 
ATOM   191  C CG2 . ILE A 1 27  ? 0.117   86.633 44.557 1.00 52.61 ? 27   ILE A CG2 1 
ATOM   192  C CD1 . ILE A 1 27  ? -0.559  84.693 46.693 1.00 56.04 ? 27   ILE A CD1 1 
ATOM   193  N N   . SER A 1 28  ? -4.055  85.654 43.743 1.00 47.51 ? 28   SER A N   1 
ATOM   194  C CA  . SER A 1 28  ? -5.377  85.049 43.808 1.00 46.10 ? 28   SER A CA  1 
ATOM   195  C C   . SER A 1 28  ? -5.299  83.775 44.619 1.00 45.64 ? 28   SER A C   1 
ATOM   196  O O   . SER A 1 28  ? -4.266  83.107 44.626 1.00 45.54 ? 28   SER A O   1 
ATOM   197  C CB  . SER A 1 28  ? -5.882  84.696 42.404 1.00 46.68 ? 28   SER A CB  1 
ATOM   198  O OG  . SER A 1 28  ? -5.488  85.656 41.435 1.00 45.43 ? 28   SER A OG  1 
ATOM   199  N N   . ALA A 1 29  ? -6.394  83.436 45.290 1.00 45.10 ? 29   ALA A N   1 
ATOM   200  C CA  . ALA A 1 29  ? -6.454  82.221 46.083 1.00 44.47 ? 29   ALA A CA  1 
ATOM   201  C C   . ALA A 1 29  ? -7.811  81.598 45.900 1.00 44.88 ? 29   ALA A C   1 
ATOM   202  O O   . ALA A 1 29  ? -8.841  82.278 45.984 1.00 45.59 ? 29   ALA A O   1 
ATOM   203  C CB  . ALA A 1 29  ? -6.231  82.521 47.564 1.00 43.91 ? 29   ALA A CB  1 
ATOM   204  N N   . PHE A 1 30  ? -7.808  80.297 45.640 1.00 43.37 ? 30   PHE A N   1 
ATOM   205  C CA  . PHE A 1 30  ? -9.041  79.554 45.486 1.00 41.22 ? 30   PHE A CA  1 
ATOM   206  C C   . PHE A 1 30  ? -8.988  78.569 46.623 1.00 41.98 ? 30   PHE A C   1 
ATOM   207  O O   . PHE A 1 30  ? -8.322  77.540 46.548 1.00 44.01 ? 30   PHE A O   1 
ATOM   208  C CB  . PHE A 1 30  ? -9.061  78.868 44.121 1.00 40.16 ? 30   PHE A CB  1 
ATOM   209  C CG  . PHE A 1 30  ? -8.985  79.841 42.971 1.00 38.62 ? 30   PHE A CG  1 
ATOM   210  C CD1 . PHE A 1 30  ? -7.752  80.349 42.558 1.00 35.71 ? 30   PHE A CD1 1 
ATOM   211  C CD2 . PHE A 1 30  ? -10.160 80.294 42.342 1.00 36.26 ? 30   PHE A CD2 1 
ATOM   212  C CE1 . PHE A 1 30  ? -7.672  81.289 41.545 1.00 37.03 ? 30   PHE A CE1 1 
ATOM   213  C CE2 . PHE A 1 30  ? -10.108 81.234 41.328 1.00 35.43 ? 30   PHE A CE2 1 
ATOM   214  C CZ  . PHE A 1 30  ? -8.856  81.745 40.917 1.00 37.74 ? 30   PHE A CZ  1 
ATOM   215  N N   . LEU A 1 31  ? -9.667  78.918 47.703 1.00 42.80 ? 31   LEU A N   1 
ATOM   216  C CA  . LEU A 1 31  ? -9.662  78.108 48.903 1.00 42.13 ? 31   LEU A CA  1 
ATOM   217  C C   . LEU A 1 31  ? -10.864 77.210 48.990 1.00 42.35 ? 31   LEU A C   1 
ATOM   218  O O   . LEU A 1 31  ? -11.962 77.578 48.563 1.00 43.62 ? 31   LEU A O   1 
ATOM   219  C CB  . LEU A 1 31  ? -9.613  79.025 50.135 1.00 40.25 ? 31   LEU A CB  1 
ATOM   220  C CG  . LEU A 1 31  ? -8.558  80.134 49.996 1.00 40.86 ? 31   LEU A CG  1 
ATOM   221  C CD1 . LEU A 1 31  ? -8.615  81.087 51.207 1.00 39.36 ? 31   LEU A CD1 1 
ATOM   222  C CD2 . LEU A 1 31  ? -7.175  79.510 49.851 1.00 36.83 ? 31   LEU A CD2 1 
ATOM   223  N N   . GLY A 1 32  ? -10.649 76.032 49.564 1.00 41.37 ? 32   GLY A N   1 
ATOM   224  C CA  . GLY A 1 32  ? -11.731 75.083 49.747 1.00 41.30 ? 32   GLY A CA  1 
ATOM   225  C C   . GLY A 1 32  ? -12.371 74.489 48.498 1.00 41.49 ? 32   GLY A C   1 
ATOM   226  O O   . GLY A 1 32  ? -13.592 74.367 48.450 1.00 41.43 ? 32   GLY A O   1 
ATOM   227  N N   . ILE A 1 33  ? -11.574 74.147 47.484 1.00 40.57 ? 33   ILE A N   1 
ATOM   228  C CA  . ILE A 1 33  ? -12.124 73.526 46.277 1.00 39.80 ? 33   ILE A CA  1 
ATOM   229  C C   . ILE A 1 33  ? -12.226 72.027 46.580 1.00 39.17 ? 33   ILE A C   1 
ATOM   230  O O   . ILE A 1 33  ? -11.237 71.407 46.942 1.00 39.71 ? 33   ILE A O   1 
ATOM   231  C CB  . ILE A 1 33  ? -11.193 73.738 45.047 1.00 38.69 ? 33   ILE A CB  1 
ATOM   232  C CG1 . ILE A 1 33  ? -11.137 75.225 44.679 1.00 38.05 ? 33   ILE A CG1 1 
ATOM   233  C CG2 . ILE A 1 33  ? -11.689 72.925 43.867 1.00 36.77 ? 33   ILE A CG2 1 
ATOM   234  C CD1 . ILE A 1 33  ? -10.147 75.553 43.594 1.00 34.82 ? 33   ILE A CD1 1 
ATOM   235  N N   . PRO A 1 34  ? -13.428 71.441 46.453 1.00 39.06 ? 34   PRO A N   1 
ATOM   236  C CA  . PRO A 1 34  ? -13.685 70.014 46.709 1.00 39.25 ? 34   PRO A CA  1 
ATOM   237  C C   . PRO A 1 34  ? -13.129 69.133 45.580 1.00 39.69 ? 34   PRO A C   1 
ATOM   238  O O   . PRO A 1 34  ? -13.263 69.489 44.402 1.00 40.13 ? 34   PRO A O   1 
ATOM   239  C CB  . PRO A 1 34  ? -15.212 69.950 46.776 1.00 39.20 ? 34   PRO A CB  1 
ATOM   240  C CG  . PRO A 1 34  ? -15.607 70.966 45.726 1.00 38.52 ? 34   PRO A CG  1 
ATOM   241  C CD  . PRO A 1 34  ? -14.650 72.126 45.987 1.00 38.55 ? 34   PRO A CD  1 
ATOM   242  N N   . PHE A 1 35  ? -12.502 67.999 45.917 1.00 38.57 ? 35   PHE A N   1 
ATOM   243  C CA  . PHE A 1 35  ? -11.968 67.122 44.867 1.00 37.70 ? 35   PHE A CA  1 
ATOM   244  C C   . PHE A 1 35  ? -12.548 65.710 44.979 1.00 37.08 ? 35   PHE A C   1 
ATOM   245  O O   . PHE A 1 35  ? -12.240 64.825 44.170 1.00 38.48 ? 35   PHE A O   1 
ATOM   246  C CB  . PHE A 1 35  ? -10.420 67.094 44.888 1.00 36.68 ? 35   PHE A CB  1 
ATOM   247  C CG  . PHE A 1 35  ? -9.835  66.593 46.185 1.00 37.15 ? 35   PHE A CG  1 
ATOM   248  C CD1 . PHE A 1 35  ? -9.822  65.231 46.477 1.00 35.37 ? 35   PHE A CD1 1 
ATOM   249  C CD2 . PHE A 1 35  ? -9.344  67.490 47.137 1.00 34.73 ? 35   PHE A CD2 1 
ATOM   250  C CE1 . PHE A 1 35  ? -9.329  64.765 47.702 1.00 37.33 ? 35   PHE A CE1 1 
ATOM   251  C CE2 . PHE A 1 35  ? -8.854  67.038 48.356 1.00 35.92 ? 35   PHE A CE2 1 
ATOM   252  C CZ  . PHE A 1 35  ? -8.847  65.669 48.644 1.00 37.17 ? 35   PHE A CZ  1 
ATOM   253  N N   . ALA A 1 36  ? -13.408 65.510 45.968 1.00 36.72 ? 36   ALA A N   1 
ATOM   254  C CA  . ALA A 1 36  ? -14.050 64.218 46.165 1.00 38.17 ? 36   ALA A CA  1 
ATOM   255  C C   . ALA A 1 36  ? -15.381 64.418 46.855 1.00 40.59 ? 36   ALA A C   1 
ATOM   256  O O   . ALA A 1 36  ? -15.642 65.475 47.435 1.00 42.36 ? 36   ALA A O   1 
ATOM   257  C CB  . ALA A 1 36  ? -13.174 63.314 47.034 1.00 37.51 ? 36   ALA A CB  1 
ATOM   258  N N   . GLU A 1 37  ? -16.230 63.399 46.801 1.00 42.00 ? 37   GLU A N   1 
ATOM   259  C CA  . GLU A 1 37  ? -17.503 63.479 47.488 1.00 41.74 ? 37   GLU A CA  1 
ATOM   260  C C   . GLU A 1 37  ? -17.199 63.361 48.983 1.00 41.88 ? 37   GLU A C   1 
ATOM   261  O O   . GLU A 1 37  ? -16.246 62.684 49.368 1.00 39.73 ? 37   GLU A O   1 
ATOM   262  C CB  . GLU A 1 37  ? -18.411 62.318 47.060 1.00 43.14 ? 37   GLU A CB  1 
ATOM   263  C CG  . GLU A 1 37  ? -19.032 62.466 45.666 1.00 47.12 ? 37   GLU A CG  1 
ATOM   264  C CD  . GLU A 1 37  ? -19.870 63.732 45.532 1.00 48.60 ? 37   GLU A CD  1 
ATOM   265  O OE1 . GLU A 1 37  ? -20.795 63.908 46.347 1.00 49.43 ? 37   GLU A OE1 1 
ATOM   266  O OE2 . GLU A 1 37  ? -19.594 64.549 44.622 1.00 51.34 ? 37   GLU A OE2 1 
ATOM   267  N N   . PRO A 1 38  ? -17.997 64.028 49.841 1.00 42.79 ? 38   PRO A N   1 
ATOM   268  C CA  . PRO A 1 38  ? -17.804 63.972 51.297 1.00 42.82 ? 38   PRO A CA  1 
ATOM   269  C C   . PRO A 1 38  ? -17.807 62.516 51.764 1.00 44.63 ? 38   PRO A C   1 
ATOM   270  O O   . PRO A 1 38  ? -18.784 61.789 51.544 1.00 44.29 ? 38   PRO A O   1 
ATOM   271  C CB  . PRO A 1 38  ? -19.010 64.737 51.831 1.00 41.92 ? 38   PRO A CB  1 
ATOM   272  C CG  . PRO A 1 38  ? -19.183 65.806 50.801 1.00 42.70 ? 38   PRO A CG  1 
ATOM   273  C CD  . PRO A 1 38  ? -18.990 65.060 49.483 1.00 41.64 ? 38   PRO A CD  1 
ATOM   274  N N   . PRO A 1 39  ? -16.725 62.077 52.437 1.00 44.88 ? 39   PRO A N   1 
ATOM   275  C CA  . PRO A 1 39  ? -16.585 60.698 52.940 1.00 44.81 ? 39   PRO A CA  1 
ATOM   276  C C   . PRO A 1 39  ? -17.414 60.429 54.196 1.00 44.66 ? 39   PRO A C   1 
ATOM   277  O O   . PRO A 1 39  ? -16.918 59.833 55.145 1.00 43.62 ? 39   PRO A O   1 
ATOM   278  C CB  . PRO A 1 39  ? -15.086 60.570 53.239 1.00 44.93 ? 39   PRO A CB  1 
ATOM   279  C CG  . PRO A 1 39  ? -14.466 61.873 52.763 1.00 47.63 ? 39   PRO A CG  1 
ATOM   280  C CD  . PRO A 1 39  ? -15.563 62.889 52.813 1.00 44.44 ? 39   PRO A CD  1 
ATOM   281  N N   . VAL A 1 40  ? -18.676 60.851 54.188 1.00 45.08 ? 40   VAL A N   1 
ATOM   282  C CA  . VAL A 1 40  ? -19.544 60.694 55.358 1.00 45.02 ? 40   VAL A CA  1 
ATOM   283  C C   . VAL A 1 40  ? -20.468 59.482 55.367 1.00 44.90 ? 40   VAL A C   1 
ATOM   284  O O   . VAL A 1 40  ? -20.638 58.808 54.352 1.00 45.87 ? 40   VAL A O   1 
ATOM   285  C CB  . VAL A 1 40  ? -20.395 61.943 55.540 1.00 44.31 ? 40   VAL A CB  1 
ATOM   286  C CG1 . VAL A 1 40  ? -19.476 63.155 55.757 1.00 42.57 ? 40   VAL A CG1 1 
ATOM   287  C CG2 . VAL A 1 40  ? -21.262 62.154 54.295 1.00 42.74 ? 40   VAL A CG2 1 
ATOM   288  N N   . GLY A 1 41  ? -21.054 59.214 56.532 1.00 44.35 ? 41   GLY A N   1 
ATOM   289  C CA  . GLY A 1 41  ? -21.970 58.096 56.688 1.00 44.14 ? 41   GLY A CA  1 
ATOM   290  C C   . GLY A 1 41  ? -21.426 56.749 56.253 1.00 45.37 ? 41   GLY A C   1 
ATOM   291  O O   . GLY A 1 41  ? -20.362 56.314 56.698 1.00 45.28 ? 41   GLY A O   1 
ATOM   292  N N   . ASN A 1 42  ? -22.165 56.075 55.380 1.00 44.95 ? 42   ASN A N   1 
ATOM   293  C CA  . ASN A 1 42  ? -21.739 54.785 54.888 1.00 44.57 ? 42   ASN A CA  1 
ATOM   294  C C   . ASN A 1 42  ? -20.433 54.880 54.098 1.00 43.85 ? 42   ASN A C   1 
ATOM   295  O O   . ASN A 1 42  ? -19.806 53.860 53.827 1.00 43.31 ? 42   ASN A O   1 
ATOM   296  C CB  . ASN A 1 42  ? -22.836 54.158 54.032 1.00 47.03 ? 42   ASN A CB  1 
ATOM   297  C CG  . ASN A 1 42  ? -24.049 53.747 54.855 1.00 50.77 ? 42   ASN A CG  1 
ATOM   298  N N   A MET A 1 43  ? -20.022 56.092 53.731 0.50 43.11 ? 43   MET A N   1 
ATOM   299  N N   B MET A 1 43  ? -20.016 56.089 53.744 0.50 42.32 ? 43   MET A N   1 
ATOM   300  C CA  A MET A 1 43  ? -18.771 56.244 53.002 0.50 42.43 ? 43   MET A CA  1 
ATOM   301  C CA  B MET A 1 43  ? -18.770 56.260 52.991 0.50 43.82 ? 43   MET A CA  1 
ATOM   302  C C   A MET A 1 43  ? -17.531 56.289 53.911 0.50 42.14 ? 43   MET A C   1 
ATOM   303  C C   B MET A 1 43  ? -17.533 56.269 53.913 0.50 43.01 ? 43   MET A C   1 
ATOM   304  O O   A MET A 1 43  ? -16.405 56.117 53.434 0.50 42.82 ? 43   MET A O   1 
ATOM   305  O O   B MET A 1 43  ? -16.400 56.186 53.425 0.50 41.99 ? 43   MET A O   1 
ATOM   306  C CB  A MET A 1 43  ? -18.785 57.558 52.161 0.50 45.67 ? 43   MET A CB  1 
ATOM   307  C CB  B MET A 1 43  ? -18.832 57.498 52.131 0.50 42.60 ? 43   MET A CB  1 
ATOM   308  C CG  A MET A 1 43  ? -19.652 57.521 50.888 0.50 48.60 ? 43   MET A CG  1 
ATOM   309  C CG  B MET A 1 43  ? -19.901 57.419 51.043 0.50 43.30 ? 43   MET A CG  1 
ATOM   310  S SD  A MET A 1 43  ? -19.443 59.008 49.830 0.50 52.53 ? 43   MET A SD  1 
ATOM   311  S SD  B MET A 1 43  ? -19.591 56.064 49.913 0.50 43.61 ? 43   MET A SD  1 
ATOM   312  C CE  A MET A 1 43  ? -20.722 54.816 50.525 0.50 44.76 ? 43   MET A CE  1 
ATOM   313  C CE  B MET A 1 43  ? -17.974 58.587 48.927 0.50 51.04 ? 43   MET A CE  1 
ATOM   314  N N   . ARG A 1 44  ? -17.741 56.442 55.220 1.00 41.63 ? 44   ARG A N   1 
ATOM   315  C CA  . ARG A 1 44  ? -16.619 56.474 56.184 1.00 40.38 ? 44   ARG A CA  1 
ATOM   316  C C   . ARG A 1 44  ? -15.786 55.191 56.034 1.00 39.41 ? 44   ARG A C   1 
ATOM   317  O O   . ARG A 1 44  ? -16.332 54.095 56.000 1.00 39.93 ? 44   ARG A O   1 
ATOM   318  C CB  . ARG A 1 44  ? -17.118 56.587 57.641 1.00 38.23 ? 44   ARG A CB  1 
ATOM   319  C CG  . ARG A 1 44  ? -15.969 56.470 58.677 1.00 39.63 ? 44   ARG A CG  1 
ATOM   320  C CD  . ARG A 1 44  ? -16.425 56.473 60.135 1.00 37.40 ? 44   ARG A CD  1 
ATOM   321  N NE  . ARG A 1 44  ? -17.065 57.714 60.565 1.00 35.24 ? 44   ARG A NE  1 
ATOM   322  C CZ  . ARG A 1 44  ? -17.724 57.843 61.715 1.00 36.37 ? 44   ARG A CZ  1 
ATOM   323  N NH1 . ARG A 1 44  ? -17.829 56.810 62.534 1.00 36.17 ? 44   ARG A NH1 1 
ATOM   324  N NH2 . ARG A 1 44  ? -18.251 59.013 62.069 1.00 36.82 ? 44   ARG A NH2 1 
ATOM   325  N N   . PHE A 1 45  ? -14.468 55.347 55.947 1.00 39.62 ? 45   PHE A N   1 
ATOM   326  C CA  . PHE A 1 45  ? -13.515 54.246 55.767 1.00 39.68 ? 45   PHE A CA  1 
ATOM   327  C C   . PHE A 1 45  ? -13.426 53.781 54.320 1.00 40.60 ? 45   PHE A C   1 
ATOM   328  O O   . PHE A 1 45  ? -12.470 53.072 53.965 1.00 40.52 ? 45   PHE A O   1 
ATOM   329  C CB  . PHE A 1 45  ? -13.844 53.006 56.623 1.00 40.20 ? 45   PHE A CB  1 
ATOM   330  C CG  . PHE A 1 45  ? -13.976 53.279 58.101 1.00 41.40 ? 45   PHE A CG  1 
ATOM   331  C CD1 . PHE A 1 45  ? -13.007 54.004 58.791 1.00 41.36 ? 45   PHE A CD1 1 
ATOM   332  C CD2 . PHE A 1 45  ? -15.092 52.808 58.808 1.00 41.56 ? 45   PHE A CD2 1 
ATOM   333  C CE1 . PHE A 1 45  ? -13.150 54.259 60.162 1.00 41.80 ? 45   PHE A CE1 1 
ATOM   334  C CE2 . PHE A 1 45  ? -15.242 53.056 60.170 1.00 40.19 ? 45   PHE A CE2 1 
ATOM   335  C CZ  . PHE A 1 45  ? -14.276 53.781 60.850 1.00 40.95 ? 45   PHE A CZ  1 
ATOM   336  N N   . ARG A 1 46  ? -14.402 54.145 53.480 1.00 41.09 ? 46   ARG A N   1 
ATOM   337  C CA  . ARG A 1 46  ? -14.364 53.702 52.074 1.00 43.22 ? 46   ARG A CA  1 
ATOM   338  C C   . ARG A 1 46  ? -13.399 54.530 51.233 1.00 42.51 ? 46   ARG A C   1 
ATOM   339  O O   . ARG A 1 46  ? -12.984 55.621 51.646 1.00 41.62 ? 46   ARG A O   1 
ATOM   340  C CB  . ARG A 1 46  ? -15.765 53.761 51.417 1.00 44.14 ? 46   ARG A CB  1 
ATOM   341  C CG  . ARG A 1 46  ? -16.711 52.629 51.832 1.00 46.73 ? 46   ARG A CG  1 
ATOM   342  C CD  . ARG A 1 46  ? -17.937 52.548 50.912 1.00 49.84 ? 46   ARG A CD  1 
ATOM   343  N N   . ARG A 1 47  ? -13.040 54.002 50.063 1.00 41.49 ? 47   ARG A N   1 
ATOM   344  C CA  . ARG A 1 47  ? -12.182 54.717 49.130 1.00 41.17 ? 47   ARG A CA  1 
ATOM   345  C C   . ARG A 1 47  ? -12.901 56.019 48.733 1.00 40.85 ? 47   ARG A C   1 
ATOM   346  O O   . ARG A 1 47  ? -14.123 56.068 48.667 1.00 39.77 ? 47   ARG A O   1 
ATOM   347  C CB  . ARG A 1 47  ? -11.933 53.871 47.898 1.00 41.78 ? 47   ARG A CB  1 
ATOM   348  C CG  . ARG A 1 47  ? -11.162 52.591 48.182 1.00 46.30 ? 47   ARG A CG  1 
ATOM   349  C CD  . ARG A 1 47  ? -10.678 52.019 46.879 1.00 49.47 ? 47   ARG A CD  1 
ATOM   350  N NE  . ARG A 1 47  ? -9.864  50.811 47.006 1.00 53.86 ? 47   ARG A NE  1 
ATOM   351  C CZ  . ARG A 1 47  ? -10.340 49.616 47.345 1.00 57.58 ? 47   ARG A CZ  1 
ATOM   352  N NH1 . ARG A 1 47  ? -11.646 49.447 47.612 1.00 56.12 ? 47   ARG A NH1 1 
ATOM   353  N NH2 . ARG A 1 47  ? -9.511  48.578 47.382 1.00 56.23 ? 47   ARG A NH2 1 
ATOM   354  N N   . PRO A 1 48  ? -12.149 57.094 48.466 1.00 40.24 ? 48   PRO A N   1 
ATOM   355  C CA  . PRO A 1 48  ? -12.865 58.320 48.103 1.00 40.23 ? 48   PRO A CA  1 
ATOM   356  C C   . PRO A 1 48  ? -13.589 58.221 46.751 1.00 41.18 ? 48   PRO A C   1 
ATOM   357  O O   . PRO A 1 48  ? -13.157 57.477 45.867 1.00 41.17 ? 48   PRO A O   1 
ATOM   358  C CB  . PRO A 1 48  ? -11.750 59.374 48.093 1.00 38.56 ? 48   PRO A CB  1 
ATOM   359  C CG  . PRO A 1 48  ? -10.545 58.580 47.591 1.00 36.15 ? 48   PRO A CG  1 
ATOM   360  C CD  . PRO A 1 48  ? -10.681 57.264 48.357 1.00 39.98 ? 48   PRO A CD  1 
ATOM   361  N N   . GLU A 1 49  ? -14.696 58.949 46.608 1.00 41.50 ? 49   GLU A N   1 
ATOM   362  C CA  . GLU A 1 49  ? -15.434 58.987 45.349 1.00 42.33 ? 49   GLU A CA  1 
ATOM   363  C C   . GLU A 1 49  ? -15.150 60.356 44.724 1.00 41.80 ? 49   GLU A C   1 
ATOM   364  O O   . GLU A 1 49  ? -15.112 61.385 45.423 1.00 41.02 ? 49   GLU A O   1 
ATOM   365  C CB  . GLU A 1 49  ? -16.943 58.795 45.577 1.00 43.26 ? 49   GLU A CB  1 
ATOM   366  C CG  . GLU A 1 49  ? -17.385 57.319 45.458 1.00 46.80 ? 49   GLU A CG  1 
ATOM   367  N N   . PRO A 1 50  ? -14.932 60.386 43.404 1.00 41.08 ? 50   PRO A N   1 
ATOM   368  C CA  . PRO A 1 50  ? -14.646 61.648 42.718 1.00 41.69 ? 50   PRO A CA  1 
ATOM   369  C C   . PRO A 1 50  ? -15.806 62.585 42.901 1.00 42.43 ? 50   PRO A C   1 
ATOM   370  O O   . PRO A 1 50  ? -16.936 62.137 42.994 1.00 44.06 ? 50   PRO A O   1 
ATOM   371  C CB  . PRO A 1 50  ? -14.426 61.222 41.264 1.00 41.28 ? 50   PRO A CB  1 
ATOM   372  C CG  . PRO A 1 50  ? -15.247 59.965 41.138 1.00 42.34 ? 50   PRO A CG  1 
ATOM   373  C CD  . PRO A 1 50  ? -15.044 59.260 42.455 1.00 41.92 ? 50   PRO A CD  1 
ATOM   374  N N   . LYS A 1 51  ? -15.530 63.879 42.982 1.00 43.19 ? 51   LYS A N   1 
ATOM   375  C CA  . LYS A 1 51  ? -16.580 64.883 43.190 1.00 45.01 ? 51   LYS A CA  1 
ATOM   376  C C   . LYS A 1 51  ? -17.495 65.048 41.963 1.00 45.87 ? 51   LYS A C   1 
ATOM   377  O O   . LYS A 1 51  ? -17.013 65.144 40.842 1.00 44.59 ? 51   LYS A O   1 
ATOM   378  C CB  . LYS A 1 51  ? -15.927 66.232 43.545 1.00 43.91 ? 51   LYS A CB  1 
ATOM   379  C CG  . LYS A 1 51  ? -16.875 67.378 43.780 1.00 44.99 ? 51   LYS A CG  1 
ATOM   380  C CD  . LYS A 1 51  ? -17.799 67.153 44.950 1.00 45.70 ? 51   LYS A CD  1 
ATOM   381  C CE  . LYS A 1 51  ? -18.693 68.378 45.196 1.00 47.69 ? 51   LYS A CE  1 
ATOM   382  N NZ  . LYS A 1 51  ? -19.518 68.281 46.468 1.00 49.56 ? 51   LYS A NZ  1 
ATOM   383  N N   . LYS A 1 52  ? -18.812 65.062 42.186 1.00 47.48 ? 52   LYS A N   1 
ATOM   384  C CA  . LYS A 1 52  ? -19.786 65.247 41.099 1.00 47.65 ? 52   LYS A CA  1 
ATOM   385  C C   . LYS A 1 52  ? -19.702 66.698 40.635 1.00 47.28 ? 52   LYS A C   1 
ATOM   386  O O   . LYS A 1 52  ? -19.751 67.619 41.455 1.00 48.93 ? 52   LYS A O   1 
ATOM   387  C CB  . LYS A 1 52  ? -21.216 64.989 41.591 1.00 48.14 ? 52   LYS A CB  1 
ATOM   388  C CG  . LYS A 1 52  ? -21.494 63.576 42.075 1.00 49.56 ? 52   LYS A CG  1 
ATOM   389  N N   . PRO A 1 53  ? -19.574 66.929 39.321 1.00 47.63 ? 53   PRO A N   1 
ATOM   390  C CA  . PRO A 1 53  ? -19.498 68.319 38.835 1.00 48.51 ? 53   PRO A CA  1 
ATOM   391  C C   . PRO A 1 53  ? -20.733 69.124 39.293 1.00 48.90 ? 53   PRO A C   1 
ATOM   392  O O   . PRO A 1 53  ? -21.812 68.567 39.516 1.00 48.89 ? 53   PRO A O   1 
ATOM   393  C CB  . PRO A 1 53  ? -19.445 68.163 37.312 1.00 47.47 ? 53   PRO A CB  1 
ATOM   394  C CG  . PRO A 1 53  ? -18.876 66.776 37.119 1.00 48.87 ? 53   PRO A CG  1 
ATOM   395  C CD  . PRO A 1 53  ? -19.539 65.969 38.206 1.00 47.01 ? 53   PRO A CD  1 
ATOM   396  N N   . TRP A 1 54  ? -20.570 70.433 39.420 1.00 48.47 ? 54   TRP A N   1 
ATOM   397  C CA  . TRP A 1 54  ? -21.658 71.285 39.866 1.00 49.22 ? 54   TRP A CA  1 
ATOM   398  C C   . TRP A 1 54  ? -21.965 72.400 38.866 1.00 51.11 ? 54   TRP A C   1 
ATOM   399  O O   . TRP A 1 54  ? -21.120 72.803 38.065 1.00 49.62 ? 54   TRP A O   1 
ATOM   400  C CB  . TRP A 1 54  ? -21.295 71.917 41.218 1.00 47.33 ? 54   TRP A CB  1 
ATOM   401  C CG  . TRP A 1 54  ? -20.062 72.766 41.133 1.00 45.53 ? 54   TRP A CG  1 
ATOM   402  C CD1 . TRP A 1 54  ? -19.982 74.055 40.680 1.00 45.67 ? 54   TRP A CD1 1 
ATOM   403  C CD2 . TRP A 1 54  ? -18.712 72.348 41.386 1.00 44.70 ? 54   TRP A CD2 1 
ATOM   404  N NE1 . TRP A 1 54  ? -18.668 74.462 40.624 1.00 45.89 ? 54   TRP A NE1 1 
ATOM   405  C CE2 . TRP A 1 54  ? -17.868 73.432 41.051 1.00 44.96 ? 54   TRP A CE2 1 
ATOM   406  C CE3 . TRP A 1 54  ? -18.135 71.160 41.858 1.00 45.03 ? 54   TRP A CE3 1 
ATOM   407  C CZ2 . TRP A 1 54  ? -16.475 73.366 41.181 1.00 44.79 ? 54   TRP A CZ2 1 
ATOM   408  C CZ3 . TRP A 1 54  ? -16.746 71.091 41.987 1.00 43.96 ? 54   TRP A CZ3 1 
ATOM   409  C CH2 . TRP A 1 54  ? -15.933 72.188 41.648 1.00 45.13 ? 54   TRP A CH2 1 
ATOM   410  N N   . SER A 1 55  ? -23.195 72.894 38.919 1.00 53.93 ? 55   SER A N   1 
ATOM   411  C CA  . SER A 1 55  ? -23.592 74.006 38.065 1.00 56.47 ? 55   SER A CA  1 
ATOM   412  C C   . SER A 1 55  ? -23.340 75.246 38.901 1.00 56.28 ? 55   SER A C   1 
ATOM   413  O O   . SER A 1 55  ? -23.042 75.145 40.097 1.00 57.00 ? 55   SER A O   1 
ATOM   414  C CB  . SER A 1 55  ? -25.076 73.918 37.710 1.00 57.63 ? 55   SER A CB  1 
ATOM   415  O OG  . SER A 1 55  ? -25.255 73.131 36.546 1.00 61.10 ? 55   SER A OG  1 
ATOM   416  N N   . GLY A 1 56  ? -23.450 76.416 38.290 1.00 55.98 ? 56   GLY A N   1 
ATOM   417  C CA  . GLY A 1 56  ? -23.233 77.624 39.062 1.00 54.65 ? 56   GLY A CA  1 
ATOM   418  C C   . GLY A 1 56  ? -21.775 77.807 39.438 1.00 53.63 ? 56   GLY A C   1 
ATOM   419  O O   . GLY A 1 56  ? -20.899 77.109 38.925 1.00 53.03 ? 56   GLY A O   1 
ATOM   420  N N   . VAL A 1 57  ? -21.526 78.738 40.350 1.00 51.59 ? 57   VAL A N   1 
ATOM   421  C CA  . VAL A 1 57  ? -20.180 79.067 40.769 1.00 50.32 ? 57   VAL A CA  1 
ATOM   422  C C   . VAL A 1 57  ? -19.904 78.667 42.206 1.00 51.01 ? 57   VAL A C   1 
ATOM   423  O O   . VAL A 1 57  ? -20.631 79.062 43.123 1.00 50.16 ? 57   VAL A O   1 
ATOM   424  C CB  . VAL A 1 57  ? -19.945 80.569 40.636 1.00 49.47 ? 57   VAL A CB  1 
ATOM   425  C CG1 . VAL A 1 57  ? -18.480 80.896 40.869 1.00 49.47 ? 57   VAL A CG1 1 
ATOM   426  C CG2 . VAL A 1 57  ? -20.404 81.028 39.265 1.00 47.71 ? 57   VAL A CG2 1 
ATOM   427  N N   . TRP A 1 58  ? -18.848 77.877 42.396 1.00 50.60 ? 58   TRP A N   1 
ATOM   428  C CA  . TRP A 1 58  ? -18.453 77.434 43.728 1.00 49.67 ? 58   TRP A CA  1 
ATOM   429  C C   . TRP A 1 58  ? -17.686 78.557 44.443 1.00 48.80 ? 58   TRP A C   1 
ATOM   430  O O   . TRP A 1 58  ? -16.717 79.099 43.881 1.00 47.48 ? 58   TRP A O   1 
ATOM   431  C CB  . TRP A 1 58  ? -17.572 76.181 43.618 1.00 49.48 ? 58   TRP A CB  1 
ATOM   432  C CG  . TRP A 1 58  ? -17.202 75.616 44.948 1.00 48.62 ? 58   TRP A CG  1 
ATOM   433  C CD1 . TRP A 1 58  ? -16.266 76.108 45.826 1.00 47.08 ? 58   TRP A CD1 1 
ATOM   434  C CD2 . TRP A 1 58  ? -17.851 74.531 45.617 1.00 47.76 ? 58   TRP A CD2 1 
ATOM   435  N NE1 . TRP A 1 58  ? -16.309 75.399 46.998 1.00 48.26 ? 58   TRP A NE1 1 
ATOM   436  C CE2 . TRP A 1 58  ? -17.269 74.424 46.897 1.00 48.21 ? 58   TRP A CE2 1 
ATOM   437  C CE3 . TRP A 1 58  ? -18.870 73.635 45.257 1.00 49.12 ? 58   TRP A CE3 1 
ATOM   438  C CZ2 . TRP A 1 58  ? -17.674 73.456 47.822 1.00 47.95 ? 58   TRP A CZ2 1 
ATOM   439  C CZ3 . TRP A 1 58  ? -19.272 72.672 46.175 1.00 48.45 ? 58   TRP A CZ3 1 
ATOM   440  C CH2 . TRP A 1 58  ? -18.673 72.591 47.443 1.00 48.26 ? 58   TRP A CH2 1 
ATOM   441  N N   . ASN A 1 59  ? -18.119 78.910 45.661 1.00 48.78 ? 59   ASN A N   1 
ATOM   442  C CA  . ASN A 1 59  ? -17.449 79.964 46.441 1.00 51.73 ? 59   ASN A CA  1 
ATOM   443  C C   . ASN A 1 59  ? -16.137 79.434 47.030 1.00 50.25 ? 59   ASN A C   1 
ATOM   444  O O   . ASN A 1 59  ? -16.147 78.717 48.029 1.00 50.28 ? 59   ASN A O   1 
ATOM   445  C CB  . ASN A 1 59  ? -18.350 80.486 47.585 1.00 55.97 ? 59   ASN A CB  1 
ATOM   446  C CG  . ASN A 1 59  ? -17.722 81.669 48.334 1.00 63.06 ? 59   ASN A CG  1 
ATOM   447  O OD1 . ASN A 1 59  ? -16.928 82.397 47.741 1.00 64.84 ? 59   ASN A OD1 1 
ATOM   448  N ND2 . ASN A 1 59  ? -18.079 81.883 49.609 1.00 71.48 ? 59   ASN A ND2 1 
ATOM   449  N N   . ALA A 1 60  ? -15.015 79.785 46.403 1.00 49.04 ? 60   ALA A N   1 
ATOM   450  C CA  . ALA A 1 60  ? -13.693 79.344 46.862 1.00 47.84 ? 60   ALA A CA  1 
ATOM   451  C C   . ALA A 1 60  ? -12.951 80.521 47.456 1.00 47.01 ? 60   ALA A C   1 
ATOM   452  O O   . ALA A 1 60  ? -11.799 80.779 47.117 1.00 46.94 ? 60   ALA A O   1 
ATOM   453  C CB  . ALA A 1 60  ? -12.890 78.775 45.695 1.00 47.16 ? 60   ALA A CB  1 
ATOM   454  N N   . SER A 1 61  ? -13.619 81.230 48.357 1.00 46.58 ? 61   SER A N   1 
ATOM   455  C CA  . SER A 1 61  ? -13.029 82.412 48.967 1.00 46.05 ? 61   SER A CA  1 
ATOM   456  C C   . SER A 1 61  ? -12.583 82.183 50.406 1.00 45.08 ? 61   SER A C   1 
ATOM   457  O O   . SER A 1 61  ? -11.861 82.993 50.964 1.00 43.96 ? 61   SER A O   1 
ATOM   458  C CB  . SER A 1 61  ? -14.034 83.564 48.908 1.00 43.29 ? 61   SER A CB  1 
ATOM   459  O OG  . SER A 1 61  ? -15.176 83.207 49.653 1.00 43.80 ? 61   SER A OG  1 
ATOM   460  N N   . THR A 1 62  ? -13.006 81.078 51.007 1.00 45.86 ? 62   THR A N   1 
ATOM   461  C CA  . THR A 1 62  ? -12.617 80.807 52.385 1.00 46.88 ? 62   THR A CA  1 
ATOM   462  C C   . THR A 1 62  ? -12.105 79.384 52.607 1.00 45.85 ? 62   THR A C   1 
ATOM   463  O O   . THR A 1 62  ? -12.508 78.453 51.922 1.00 46.39 ? 62   THR A O   1 
ATOM   464  C CB  . THR A 1 62  ? -13.800 81.052 53.327 1.00 48.39 ? 62   THR A CB  1 
ATOM   465  O OG1 . THR A 1 62  ? -14.854 80.142 53.004 1.00 49.24 ? 62   THR A OG1 1 
ATOM   466  C CG2 . THR A 1 62  ? -14.324 82.487 53.166 1.00 50.93 ? 62   THR A CG2 1 
ATOM   467  N N   . TYR A 1 63  ? -11.193 79.229 53.559 1.00 44.66 ? 63   TYR A N   1 
ATOM   468  C CA  . TYR A 1 63  ? -10.659 77.916 53.890 1.00 43.45 ? 63   TYR A CA  1 
ATOM   469  C C   . TYR A 1 63  ? -11.787 76.936 54.247 1.00 44.25 ? 63   TYR A C   1 
ATOM   470  O O   . TYR A 1 63  ? -12.829 77.312 54.797 1.00 44.64 ? 63   TYR A O   1 
ATOM   471  C CB  . TYR A 1 63  ? -9.711  77.990 55.089 1.00 40.87 ? 63   TYR A CB  1 
ATOM   472  C CG  . TYR A 1 63  ? -8.296  78.381 54.763 1.00 42.07 ? 63   TYR A CG  1 
ATOM   473  C CD1 . TYR A 1 63  ? -7.659  77.879 53.627 1.00 39.96 ? 63   TYR A CD1 1 
ATOM   474  C CD2 . TYR A 1 63  ? -7.540  79.157 55.657 1.00 42.17 ? 63   TYR A CD2 1 
ATOM   475  C CE1 . TYR A 1 63  ? -6.308  78.120 53.397 1.00 41.54 ? 63   TYR A CE1 1 
ATOM   476  C CE2 . TYR A 1 63  ? -6.171  79.407 55.429 1.00 41.07 ? 63   TYR A CE2 1 
ATOM   477  C CZ  . TYR A 1 63  ? -5.570  78.875 54.306 1.00 40.29 ? 63   TYR A CZ  1 
ATOM   478  O OH  . TYR A 1 63  ? -4.220  79.005 54.122 1.00 44.03 ? 63   TYR A OH  1 
ATOM   479  N N   . PRO A 1 64  ? -11.574 75.649 53.953 1.00 42.38 ? 64   PRO A N   1 
ATOM   480  C CA  . PRO A 1 64  ? -12.551 74.606 54.238 1.00 40.08 ? 64   PRO A CA  1 
ATOM   481  C C   . PRO A 1 64  ? -12.374 74.082 55.664 1.00 40.42 ? 64   PRO A C   1 
ATOM   482  O O   . PRO A 1 64  ? -11.482 74.522 56.390 1.00 39.75 ? 64   PRO A O   1 
ATOM   483  C CB  . PRO A 1 64  ? -12.181 73.546 53.218 1.00 39.74 ? 64   PRO A CB  1 
ATOM   484  C CG  . PRO A 1 64  ? -10.676 73.603 53.275 1.00 39.70 ? 64   PRO A CG  1 
ATOM   485  C CD  . PRO A 1 64  ? -10.408 75.098 53.230 1.00 40.31 ? 64   PRO A CD  1 
ATOM   486  N N   . ASN A 1 65  ? -13.222 73.136 56.053 1.00 39.30 ? 65   ASN A N   1 
ATOM   487  C CA  . ASN A 1 65  ? -13.109 72.505 57.357 1.00 41.46 ? 65   ASN A CA  1 
ATOM   488  C C   . ASN A 1 65  ? -11.826 71.622 57.358 1.00 41.28 ? 65   ASN A C   1 
ATOM   489  O O   . ASN A 1 65  ? -11.263 71.303 56.300 1.00 41.10 ? 65   ASN A O   1 
ATOM   490  C CB  . ASN A 1 65  ? -14.336 71.609 57.610 1.00 43.87 ? 65   ASN A CB  1 
ATOM   491  C CG  . ASN A 1 65  ? -15.670 72.407 57.696 1.00 47.64 ? 65   ASN A CG  1 
ATOM   492  O OD1 . ASN A 1 65  ? -16.678 71.987 57.128 1.00 49.99 ? 65   ASN A OD1 1 
ATOM   493  N ND2 . ASN A 1 65  ? -15.669 73.539 58.412 1.00 47.94 ? 65   ASN A ND2 1 
ATOM   494  N N   . ASN A 1 66  ? -11.368 71.239 58.544 1.00 40.56 ? 66   ASN A N   1 
ATOM   495  C CA  . ASN A 1 66  ? -10.205 70.366 58.681 1.00 39.62 ? 66   ASN A CA  1 
ATOM   496  C C   . ASN A 1 66  ? -10.795 68.994 58.999 1.00 39.23 ? 66   ASN A C   1 
ATOM   497  O O   . ASN A 1 66  ? -11.881 68.905 59.587 1.00 39.50 ? 66   ASN A O   1 
ATOM   498  C CB  . ASN A 1 66  ? -9.319  70.816 59.842 1.00 40.61 ? 66   ASN A CB  1 
ATOM   499  C CG  . ASN A 1 66  ? -8.729  72.212 59.637 1.00 42.87 ? 66   ASN A CG  1 
ATOM   500  O OD1 . ASN A 1 66  ? -8.679  73.009 60.568 1.00 43.77 ? 66   ASN A OD1 1 
ATOM   501  N ND2 . ASN A 1 66  ? -8.264  72.498 58.429 1.00 41.40 ? 66   ASN A ND2 1 
ATOM   502  N N   . CYS A 1 67  ? -10.093 67.935 58.612 1.00 36.47 ? 67   CYS A N   1 
ATOM   503  C CA  . CYS A 1 67  ? -10.572 66.592 58.871 1.00 36.23 ? 67   CYS A CA  1 
ATOM   504  C C   . CYS A 1 67  ? -10.618 66.301 60.362 1.00 36.90 ? 67   CYS A C   1 
ATOM   505  O O   . CYS A 1 67  ? -9.882  66.903 61.160 1.00 37.06 ? 67   CYS A O   1 
ATOM   506  C CB  . CYS A 1 67  ? -9.677  65.558 58.163 1.00 35.18 ? 67   CYS A CB  1 
ATOM   507  S SG  . CYS A 1 67  ? -9.702  65.696 56.346 0.80 32.91 ? 67   CYS A SG  1 
ATOM   508  N N   . GLN A 1 68  ? -11.489 65.376 60.748 1.00 37.68 ? 68   GLN A N   1 
ATOM   509  C CA  . GLN A 1 68  ? -11.602 65.007 62.152 1.00 38.17 ? 68   GLN A CA  1 
ATOM   510  C C   . GLN A 1 68  ? -10.251 64.437 62.622 1.00 39.41 ? 68   GLN A C   1 
ATOM   511  O O   . GLN A 1 68  ? -9.690  63.518 61.985 1.00 40.83 ? 68   GLN A O   1 
ATOM   512  C CB  . GLN A 1 68  ? -12.716 63.983 62.306 1.00 39.05 ? 68   GLN A CB  1 
ATOM   513  C CG  . GLN A 1 68  ? -14.107 64.569 62.139 1.00 39.32 ? 68   GLN A CG  1 
ATOM   514  C CD  . GLN A 1 68  ? -14.574 65.342 63.373 1.00 42.25 ? 68   GLN A CD  1 
ATOM   515  O OE1 . GLN A 1 68  ? -15.686 65.878 63.400 1.00 41.83 ? 68   GLN A OE1 1 
ATOM   516  N NE2 . GLN A 1 68  ? -13.723 65.409 64.395 1.00 40.11 ? 68   GLN A NE2 1 
ATOM   517  N N   . GLN A 1 69  ? -9.731  64.976 63.728 1.00 37.61 ? 69   GLN A N   1 
ATOM   518  C CA  . GLN A 1 69  ? -8.434  64.543 64.252 1.00 36.95 ? 69   GLN A CA  1 
ATOM   519  C C   . GLN A 1 69  ? -8.202  64.820 65.738 1.00 38.57 ? 69   GLN A C   1 
ATOM   520  O O   . GLN A 1 69  ? -8.852  65.681 66.358 1.00 38.18 ? 69   GLN A O   1 
ATOM   521  C CB  . GLN A 1 69  ? -7.295  65.225 63.482 1.00 35.07 ? 69   GLN A CB  1 
ATOM   522  C CG  . GLN A 1 69  ? -7.439  66.748 63.439 1.00 33.65 ? 69   GLN A CG  1 
ATOM   523  C CD  . GLN A 1 69  ? -6.426  67.443 62.532 1.00 35.99 ? 69   GLN A CD  1 
ATOM   524  O OE1 . GLN A 1 69  ? -5.255  67.642 62.906 1.00 35.33 ? 69   GLN A OE1 1 
ATOM   525  N NE2 . GLN A 1 69  ? -6.870  67.814 61.325 1.00 34.24 ? 69   GLN A NE2 1 
ATOM   526  N N   . TYR A 1 70  ? -7.250  64.067 66.284 1.00 37.21 ? 70   TYR A N   1 
ATOM   527  C CA  . TYR A 1 70  ? -6.806  64.213 67.648 1.00 37.34 ? 70   TYR A CA  1 
ATOM   528  C C   . TYR A 1 70  ? -6.273  65.636 67.761 1.00 38.08 ? 70   TYR A C   1 
ATOM   529  O O   . TYR A 1 70  ? -5.495  66.082 66.918 1.00 38.26 ? 70   TYR A O   1 
ATOM   530  C CB  . TYR A 1 70  ? -5.664  63.246 67.929 1.00 38.16 ? 70   TYR A CB  1 
ATOM   531  C CG  . TYR A 1 70  ? -5.023  63.473 69.270 1.00 38.90 ? 70   TYR A CG  1 
ATOM   532  C CD1 . TYR A 1 70  ? -5.629  63.020 70.461 1.00 39.57 ? 70   TYR A CD1 1 
ATOM   533  C CD2 . TYR A 1 70  ? -3.808  64.143 69.358 1.00 38.01 ? 70   TYR A CD2 1 
ATOM   534  C CE1 . TYR A 1 70  ? -5.015  63.241 71.707 1.00 39.30 ? 70   TYR A CE1 1 
ATOM   535  C CE2 . TYR A 1 70  ? -3.192  64.357 70.572 1.00 40.18 ? 70   TYR A CE2 1 
ATOM   536  C CZ  . TYR A 1 70  ? -3.783  63.914 71.742 1.00 41.27 ? 70   TYR A CZ  1 
ATOM   537  O OH  . TYR A 1 70  ? -3.092  64.160 72.910 1.00 44.61 ? 70   TYR A OH  1 
ATOM   538  N N   . VAL A 1 71  ? -6.688  66.349 68.796 1.00 37.39 ? 71   VAL A N   1 
ATOM   539  C CA  . VAL A 1 71  ? -6.233  67.715 68.980 1.00 39.12 ? 71   VAL A CA  1 
ATOM   540  C C   . VAL A 1 71  ? -5.242  67.736 70.128 1.00 40.28 ? 71   VAL A C   1 
ATOM   541  O O   . VAL A 1 71  ? -5.521  67.209 71.203 1.00 42.90 ? 71   VAL A O   1 
ATOM   542  C CB  . VAL A 1 71  ? -7.416  68.650 69.315 1.00 38.48 ? 71   VAL A CB  1 
ATOM   543  C CG1 . VAL A 1 71  ? -6.897  70.028 69.720 1.00 38.54 ? 71   VAL A CG1 1 
ATOM   544  C CG2 . VAL A 1 71  ? -8.336  68.746 68.118 1.00 36.98 ? 71   VAL A CG2 1 
ATOM   545  N N   . ASP A 1 72  ? -4.088  68.344 69.905 1.00 41.17 ? 72   ASP A N   1 
ATOM   546  C CA  . ASP A 1 72  ? -3.063  68.401 70.935 1.00 41.57 ? 72   ASP A CA  1 
ATOM   547  C C   . ASP A 1 72  ? -3.413  69.407 72.032 1.00 41.38 ? 72   ASP A C   1 
ATOM   548  O O   . ASP A 1 72  ? -3.423  70.601 71.787 1.00 39.91 ? 72   ASP A O   1 
ATOM   549  C CB  . ASP A 1 72  ? -1.716  68.774 70.308 1.00 41.59 ? 72   ASP A CB  1 
ATOM   550  C CG  . ASP A 1 72  ? -0.588  68.870 71.341 1.00 40.91 ? 72   ASP A CG  1 
ATOM   551  O OD1 . ASP A 1 72  ? -0.724  68.325 72.465 1.00 39.73 ? 72   ASP A OD1 1 
ATOM   552  O OD2 . ASP A 1 72  ? 0.455   69.456 71.002 1.00 40.39 ? 72   ASP A OD2 1 
ATOM   553  N N   . GLU A 1 73  ? -3.705  68.904 73.232 1.00 42.76 ? 73   GLU A N   1 
ATOM   554  C CA  . GLU A 1 73  ? -4.019  69.751 74.381 1.00 46.11 ? 73   GLU A CA  1 
ATOM   555  C C   . GLU A 1 73  ? -2.976  69.572 75.500 1.00 45.73 ? 73   GLU A C   1 
ATOM   556  O O   . GLU A 1 73  ? -3.255  69.819 76.666 1.00 45.66 ? 73   GLU A O   1 
ATOM   557  C CB  . GLU A 1 73  ? -5.417  69.437 74.927 1.00 46.48 ? 73   GLU A CB  1 
ATOM   558  C CG  . GLU A 1 73  ? -6.524  69.764 73.973 1.00 51.65 ? 73   GLU A CG  1 
ATOM   559  C CD  . GLU A 1 73  ? -7.900  69.667 74.614 1.00 57.62 ? 73   GLU A CD  1 
ATOM   560  O OE1 . GLU A 1 73  ? -8.894  69.658 73.852 1.00 60.11 ? 73   GLU A OE1 1 
ATOM   561  O OE2 . GLU A 1 73  ? -8.004  69.616 75.870 1.00 59.59 ? 73   GLU A OE2 1 
ATOM   562  N N   . GLN A 1 74  ? -1.782  69.122 75.137 1.00 45.48 ? 74   GLN A N   1 
ATOM   563  C CA  . GLN A 1 74  ? -0.710  68.945 76.106 1.00 46.04 ? 74   GLN A CA  1 
ATOM   564  C C   . GLN A 1 74  ? -0.231  70.307 76.693 1.00 44.61 ? 74   GLN A C   1 
ATOM   565  O O   . GLN A 1 74  ? 0.255   70.343 77.812 1.00 44.99 ? 74   GLN A O   1 
ATOM   566  C CB  . GLN A 1 74  ? 0.460   68.189 75.446 1.00 45.08 ? 74   GLN A CB  1 
ATOM   567  C CG  . GLN A 1 74  ? 1.691   67.942 76.314 1.00 48.55 ? 74   GLN A CG  1 
ATOM   568  C CD  . GLN A 1 74  ? 1.362   67.254 77.629 1.00 51.63 ? 74   GLN A CD  1 
ATOM   569  O OE1 . GLN A 1 74  ? 0.481   66.397 77.693 1.00 54.62 ? 74   GLN A OE1 1 
ATOM   570  N NE2 . GLN A 1 74  ? 2.081   67.614 78.679 1.00 53.10 ? 74   GLN A NE2 1 
ATOM   571  N N   . PHE A 1 75  ? -0.360  71.407 75.945 1.00 42.47 ? 75   PHE A N   1 
ATOM   572  C CA  . PHE A 1 75  ? 0.060   72.742 76.432 1.00 42.11 ? 75   PHE A CA  1 
ATOM   573  C C   . PHE A 1 75  ? -0.967  73.801 75.995 1.00 42.76 ? 75   PHE A C   1 
ATOM   574  O O   . PHE A 1 75  ? -0.675  74.673 75.171 1.00 41.60 ? 75   PHE A O   1 
ATOM   575  C CB  . PHE A 1 75  ? 1.436   73.115 75.880 1.00 40.05 ? 75   PHE A CB  1 
ATOM   576  C CG  . PHE A 1 75  ? 2.510   72.121 76.210 1.00 40.43 ? 75   PHE A CG  1 
ATOM   577  C CD1 . PHE A 1 75  ? 2.966   71.976 77.524 1.00 37.18 ? 75   PHE A CD1 1 
ATOM   578  C CD2 . PHE A 1 75  ? 3.046   71.304 75.211 1.00 38.54 ? 75   PHE A CD2 1 
ATOM   579  C CE1 . PHE A 1 75  ? 3.932   71.034 77.844 1.00 36.97 ? 75   PHE A CE1 1 
ATOM   580  C CE2 . PHE A 1 75  ? 4.024   70.349 75.521 1.00 39.92 ? 75   PHE A CE2 1 
ATOM   581  C CZ  . PHE A 1 75  ? 4.468   70.216 76.847 1.00 38.41 ? 75   PHE A CZ  1 
ATOM   582  N N   . PRO A 1 76  ? -2.188  73.729 76.557 1.00 44.01 ? 76   PRO A N   1 
ATOM   583  C CA  . PRO A 1 76  ? -3.279  74.659 76.233 1.00 44.95 ? 76   PRO A CA  1 
ATOM   584  C C   . PRO A 1 76  ? -2.794  76.098 76.250 1.00 45.91 ? 76   PRO A C   1 
ATOM   585  O O   . PRO A 1 76  ? -2.194  76.532 77.222 1.00 46.16 ? 76   PRO A O   1 
ATOM   586  C CB  . PRO A 1 76  ? -4.317  74.381 77.321 1.00 43.13 ? 76   PRO A CB  1 
ATOM   587  C CG  . PRO A 1 76  ? -4.050  72.943 77.700 1.00 44.67 ? 76   PRO A CG  1 
ATOM   588  C CD  . PRO A 1 76  ? -2.542  72.873 77.706 1.00 43.11 ? 76   PRO A CD  1 
ATOM   589  N N   . GLY A 1 77  ? -3.039  76.828 75.168 1.00 47.04 ? 77   GLY A N   1 
ATOM   590  C CA  . GLY A 1 77  ? -2.607  78.215 75.119 1.00 47.86 ? 77   GLY A CA  1 
ATOM   591  C C   . GLY A 1 77  ? -1.199  78.461 74.595 1.00 48.10 ? 77   GLY A C   1 
ATOM   592  O O   . GLY A 1 77  ? -0.864  79.597 74.241 1.00 50.29 ? 77   GLY A O   1 
ATOM   593  N N   . PHE A 1 78  ? -0.369  77.421 74.532 1.00 45.29 ? 78   PHE A N   1 
ATOM   594  C CA  . PHE A 1 78  ? 0.998   77.573 74.057 1.00 42.79 ? 78   PHE A CA  1 
ATOM   595  C C   . PHE A 1 78  ? 1.079   77.644 72.524 1.00 43.68 ? 78   PHE A C   1 
ATOM   596  O O   . PHE A 1 78  ? 0.702   76.705 71.821 1.00 43.37 ? 78   PHE A O   1 
ATOM   597  C CB  . PHE A 1 78  ? 1.827   76.405 74.591 1.00 42.53 ? 78   PHE A CB  1 
ATOM   598  C CG  . PHE A 1 78  ? 3.286   76.476 74.250 1.00 40.22 ? 78   PHE A CG  1 
ATOM   599  C CD1 . PHE A 1 78  ? 4.032   77.609 74.559 1.00 39.06 ? 78   PHE A CD1 1 
ATOM   600  C CD2 . PHE A 1 78  ? 3.924   75.385 73.651 1.00 39.03 ? 78   PHE A CD2 1 
ATOM   601  C CE1 . PHE A 1 78  ? 5.403   77.658 74.276 1.00 38.75 ? 78   PHE A CE1 1 
ATOM   602  C CE2 . PHE A 1 78  ? 5.282   75.416 73.366 1.00 39.99 ? 78   PHE A CE2 1 
ATOM   603  C CZ  . PHE A 1 78  ? 6.027   76.560 73.680 1.00 40.24 ? 78   PHE A CZ  1 
ATOM   604  N N   . SER A 1 79  ? 1.600   78.744 71.996 1.00 43.02 ? 79   SER A N   1 
ATOM   605  C CA  . SER A 1 79  ? 1.684   78.894 70.542 1.00 42.44 ? 79   SER A CA  1 
ATOM   606  C C   . SER A 1 79  ? 2.471   77.761 69.887 1.00 41.72 ? 79   SER A C   1 
ATOM   607  O O   . SER A 1 79  ? 2.118   77.308 68.793 1.00 41.82 ? 79   SER A O   1 
ATOM   608  C CB  . SER A 1 79  ? 2.329   80.234 70.163 1.00 40.59 ? 79   SER A CB  1 
ATOM   609  O OG  . SER A 1 79  ? 3.664   80.317 70.646 1.00 42.28 ? 79   SER A OG  1 
ATOM   610  N N   . GLY A 1 80  ? 3.530   77.318 70.559 1.00 39.37 ? 80   GLY A N   1 
ATOM   611  C CA  . GLY A 1 80  ? 4.368   76.251 70.034 1.00 38.38 ? 80   GLY A CA  1 
ATOM   612  C C   . GLY A 1 80  ? 3.591   75.040 69.532 1.00 39.36 ? 80   GLY A C   1 
ATOM   613  O O   . GLY A 1 80  ? 3.858   74.524 68.435 1.00 37.65 ? 80   GLY A O   1 
ATOM   614  N N   . SER A 1 81  ? 2.629   74.579 70.329 1.00 39.28 ? 81   SER A N   1 
ATOM   615  C CA  . SER A 1 81  ? 1.831   73.440 69.932 1.00 40.86 ? 81   SER A CA  1 
ATOM   616  C C   . SER A 1 81  ? 0.510   73.815 69.259 1.00 41.89 ? 81   SER A C   1 
ATOM   617  O O   . SER A 1 81  ? 0.052   73.097 68.370 1.00 42.31 ? 81   SER A O   1 
ATOM   618  C CB  . SER A 1 81  ? 1.575   72.512 71.131 1.00 39.98 ? 81   SER A CB  1 
ATOM   619  O OG  . SER A 1 81  ? 0.975   73.207 72.198 1.00 41.76 ? 81   SER A OG  1 
ATOM   620  N N   . GLU A 1 82  ? -0.097  74.928 69.664 1.00 42.18 ? 82   GLU A N   1 
ATOM   621  C CA  . GLU A 1 82  ? -1.373  75.350 69.075 1.00 43.09 ? 82   GLU A CA  1 
ATOM   622  C C   . GLU A 1 82  ? -1.272  75.604 67.581 1.00 41.02 ? 82   GLU A C   1 
ATOM   623  O O   . GLU A 1 82  ? -2.218  75.341 66.851 1.00 38.95 ? 82   GLU A O   1 
ATOM   624  C CB  . GLU A 1 82  ? -1.904  76.622 69.746 1.00 46.47 ? 82   GLU A CB  1 
ATOM   625  C CG  . GLU A 1 82  ? -2.229  76.489 71.210 1.00 49.51 ? 82   GLU A CG  1 
ATOM   626  C CD  . GLU A 1 82  ? -3.391  75.568 71.458 1.00 53.70 ? 82   GLU A CD  1 
ATOM   627  O OE1 . GLU A 1 82  ? -3.745  75.370 72.644 1.00 56.64 ? 82   GLU A OE1 1 
ATOM   628  O OE2 . GLU A 1 82  ? -3.954  75.041 70.472 1.00 54.99 ? 82   GLU A OE2 1 
ATOM   629  N N   . MET A 1 83  ? -0.116  76.098 67.134 1.00 40.86 ? 83   MET A N   1 
ATOM   630  C CA  . MET A 1 83  ? 0.101   76.404 65.715 1.00 39.97 ? 83   MET A CA  1 
ATOM   631  C C   . MET A 1 83  ? -0.039  75.188 64.775 1.00 39.21 ? 83   MET A C   1 
ATOM   632  O O   . MET A 1 83  ? -0.071  75.337 63.552 1.00 37.76 ? 83   MET A O   1 
ATOM   633  C CB  . MET A 1 83  ? 1.487   77.040 65.510 1.00 39.31 ? 83   MET A CB  1 
ATOM   634  C CG  . MET A 1 83  ? 2.669   76.091 65.736 1.00 41.42 ? 83   MET A CG  1 
ATOM   635  S SD  . MET A 1 83  ? 4.285   76.864 65.391 1.00 44.96 ? 83   MET A SD  1 
ATOM   636  C CE  . MET A 1 83  ? 4.473   76.561 63.593 1.00 41.95 ? 83   MET A CE  1 
ATOM   637  N N   . TRP A 1 84  ? -0.106  73.995 65.352 1.00 38.09 ? 84   TRP A N   1 
ATOM   638  C CA  . TRP A 1 84  ? -0.240  72.778 64.577 1.00 37.51 ? 84   TRP A CA  1 
ATOM   639  C C   . TRP A 1 84  ? -1.650  72.200 64.646 1.00 37.71 ? 84   TRP A C   1 
ATOM   640  O O   . TRP A 1 84  ? -2.003  71.351 63.826 1.00 39.38 ? 84   TRP A O   1 
ATOM   641  C CB  . TRP A 1 84  ? 0.770   71.734 65.058 1.00 35.52 ? 84   TRP A CB  1 
ATOM   642  C CG  . TRP A 1 84  ? 2.169   72.213 64.978 1.00 35.77 ? 84   TRP A CG  1 
ATOM   643  C CD1 . TRP A 1 84  ? 2.906   72.750 65.984 1.00 34.52 ? 84   TRP A CD1 1 
ATOM   644  C CD2 . TRP A 1 84  ? 3.002   72.243 63.808 1.00 35.72 ? 84   TRP A CD2 1 
ATOM   645  N NE1 . TRP A 1 84  ? 4.145   73.114 65.523 1.00 33.26 ? 84   TRP A NE1 1 
ATOM   646  C CE2 . TRP A 1 84  ? 4.235   72.816 64.190 1.00 34.44 ? 84   TRP A CE2 1 
ATOM   647  C CE3 . TRP A 1 84  ? 2.825   71.840 62.471 1.00 34.03 ? 84   TRP A CE3 1 
ATOM   648  C CZ2 . TRP A 1 84  ? 5.297   73.006 63.282 1.00 34.12 ? 84   TRP A CZ2 1 
ATOM   649  C CZ3 . TRP A 1 84  ? 3.880   72.031 61.568 1.00 32.76 ? 84   TRP A CZ3 1 
ATOM   650  C CH2 . TRP A 1 84  ? 5.098   72.609 61.984 1.00 33.58 ? 84   TRP A CH2 1 
ATOM   651  N N   . ASN A 1 85  ? -2.442  72.634 65.623 1.00 37.70 ? 85   ASN A N   1 
ATOM   652  C CA  . ASN A 1 85  ? -3.806  72.130 65.769 1.00 38.62 ? 85   ASN A CA  1 
ATOM   653  C C   . ASN A 1 85  ? -4.742  72.731 64.717 1.00 39.18 ? 85   ASN A C   1 
ATOM   654  O O   . ASN A 1 85  ? -4.468  73.775 64.140 1.00 38.35 ? 85   ASN A O   1 
ATOM   655  C CB  . ASN A 1 85  ? -4.378  72.445 67.163 1.00 38.19 ? 85   ASN A CB  1 
ATOM   656  C CG  . ASN A 1 85  ? -3.867  71.495 68.259 1.00 40.33 ? 85   ASN A CG  1 
ATOM   657  O OD1 . ASN A 1 85  ? -3.688  70.292 68.031 1.00 39.88 ? 85   ASN A OD1 1 
ATOM   658  N ND2 . ASN A 1 85  ? -3.647  72.038 69.463 1.00 38.08 ? 85   ASN A ND2 1 
ATOM   659  N N   . PRO A 1 86  ? -5.864  72.054 64.448 1.00 40.04 ? 86   PRO A N   1 
ATOM   660  C CA  . PRO A 1 86  ? -6.848  72.529 63.468 1.00 39.46 ? 86   PRO A CA  1 
ATOM   661  C C   . PRO A 1 86  ? -7.257  73.969 63.818 1.00 40.51 ? 86   PRO A C   1 
ATOM   662  O O   . PRO A 1 86  ? -7.561  74.255 64.974 1.00 40.65 ? 86   PRO A O   1 
ATOM   663  C CB  . PRO A 1 86  ? -8.012  71.559 63.660 1.00 39.38 ? 86   PRO A CB  1 
ATOM   664  C CG  . PRO A 1 86  ? -7.339  70.288 64.062 1.00 39.42 ? 86   PRO A CG  1 
ATOM   665  C CD  . PRO A 1 86  ? -6.263  70.757 65.030 1.00 38.03 ? 86   PRO A CD  1 
ATOM   666  N N   . ASN A 1 87  ? -7.252  74.863 62.838 1.00 39.66 ? 87   ASN A N   1 
ATOM   667  C CA  . ASN A 1 87  ? -7.634  76.243 63.082 1.00 42.08 ? 87   ASN A CA  1 
ATOM   668  C C   . ASN A 1 87  ? -8.969  76.540 62.394 1.00 43.81 ? 87   ASN A C   1 
ATOM   669  O O   . ASN A 1 87  ? -9.325  77.702 62.166 1.00 44.39 ? 87   ASN A O   1 
ATOM   670  C CB  . ASN A 1 87  ? -6.546  77.204 62.589 1.00 41.54 ? 87   ASN A CB  1 
ATOM   671  C CG  . ASN A 1 87  ? -6.254  77.038 61.120 1.00 44.79 ? 87   ASN A CG  1 
ATOM   672  O OD1 . ASN A 1 87  ? -6.550  75.988 60.523 1.00 47.00 ? 87   ASN A OD1 1 
ATOM   673  N ND2 . ASN A 1 87  ? -5.664  78.056 60.521 1.00 43.30 ? 87   ASN A ND2 1 
ATOM   674  N N   A ARG A 1 88  ? -9.680  75.476 62.026 0.50 43.68 ? 88   ARG A N   1 
ATOM   675  N N   B ARG A 1 88  ? -9.701  75.484 62.071 0.50 43.45 ? 88   ARG A N   1 
ATOM   676  C CA  A ARG A 1 88  ? -11.022 75.611 61.466 0.50 44.12 ? 88   ARG A CA  1 
ATOM   677  C CA  B ARG A 1 88  ? -10.998 75.566 61.379 0.50 44.58 ? 88   ARG A CA  1 
ATOM   678  C C   A ARG A 1 88  ? -11.855 74.472 62.025 0.50 45.11 ? 88   ARG A C   1 
ATOM   679  C C   B ARG A 1 88  ? -11.862 74.483 62.051 0.50 44.82 ? 88   ARG A C   1 
ATOM   680  O O   A ARG A 1 88  ? -11.317 73.545 62.626 0.50 45.99 ? 88   ARG A O   1 
ATOM   681  O O   B ARG A 1 88  ? -11.323 73.538 62.625 0.50 45.75 ? 88   ARG A O   1 
ATOM   682  C CB  A ARG A 1 88  ? -10.949 75.520 59.935 0.50 42.38 ? 88   ARG A CB  1 
ATOM   683  C CB  B ARG A 1 88  ? -10.900 75.284 59.870 0.50 43.45 ? 88   ARG A CB  1 
ATOM   684  C CG  A ARG A 1 88  ? -9.855  76.099 59.122 0.50 43.40 ? 88   ARG A CG  1 
ATOM   685  C CG  B ARG A 1 88  ? -10.404 76.797 59.277 0.50 41.48 ? 88   ARG A CG  1 
ATOM   686  C CD  A ARG A 1 88  ? -10.239 77.563 59.046 0.50 43.52 ? 88   ARG A CD  1 
ATOM   687  C CD  B ARG A 1 88  ? -11.139 78.049 59.797 0.50 39.53 ? 88   ARG A CD  1 
ATOM   688  N NE  A ARG A 1 88  ? -10.829 79.270 59.053 0.50 38.97 ? 88   ARG A NE  1 
ATOM   689  N NE  B ARG A 1 88  ? -11.388 77.809 58.176 0.50 44.06 ? 88   ARG A NE  1 
ATOM   690  C CZ  A ARG A 1 88  ? -11.933 79.006 57.983 0.50 45.68 ? 88   ARG A CZ  1 
ATOM   691  C CZ  B ARG A 1 88  ? -9.700  79.972 59.154 0.50 37.87 ? 88   ARG A CZ  1 
ATOM   692  N NH1 A ARG A 1 88  ? -11.435 80.065 58.608 0.50 45.82 ? 88   ARG A NH1 1 
ATOM   693  N NH1 B ARG A 1 88  ? -8.730  79.595 59.982 0.50 36.86 ? 88   ARG A NH1 1 
ATOM   694  N NH2 A ARG A 1 88  ? -9.544  81.057 58.413 0.50 35.88 ? 88   ARG A NH2 1 
ATOM   695  N NH2 B ARG A 1 88  ? -12.955 79.151 57.148 0.50 44.39 ? 88   ARG A NH2 1 
ATOM   696  N N   . GLU A 1 89  ? -13.175 74.576 61.920 1.00 45.24 ? 89   GLU A N   1 
ATOM   697  C CA  . GLU A 1 89  ? -14.045 73.553 62.481 1.00 46.47 ? 89   GLU A CA  1 
ATOM   698  C C   . GLU A 1 89  ? -13.657 72.190 61.869 1.00 45.95 ? 89   GLU A C   1 
ATOM   699  O O   . GLU A 1 89  ? -13.316 72.108 60.688 1.00 46.13 ? 89   GLU A O   1 
ATOM   700  C CB  . GLU A 1 89  ? -15.504 73.909 62.161 1.00 49.07 ? 89   GLU A CB  1 
ATOM   701  C CG  . GLU A 1 89  ? -16.539 72.981 62.784 1.00 51.95 ? 89   GLU A CG  1 
ATOM   702  N N   . MET A 1 90  ? -13.675 71.128 62.662 1.00 43.78 ? 90   MET A N   1 
ATOM   703  C CA  . MET A 1 90  ? -13.330 69.830 62.122 1.00 43.37 ? 90   MET A CA  1 
ATOM   704  C C   . MET A 1 90  ? -14.594 69.192 61.564 1.00 43.10 ? 90   MET A C   1 
ATOM   705  O O   . MET A 1 90  ? -15.699 69.459 62.039 1.00 43.17 ? 90   MET A O   1 
ATOM   706  C CB  . MET A 1 90  ? -12.729 68.929 63.196 1.00 43.45 ? 90   MET A CB  1 
ATOM   707  C CG  . MET A 1 90  ? -11.348 69.357 63.676 1.00 43.32 ? 90   MET A CG  1 
ATOM   708  S SD  . MET A 1 90  ? -10.557 68.081 64.724 1.00 43.17 ? 90   MET A SD  1 
ATOM   709  C CE  . MET A 1 90  ? -11.611 68.142 66.234 1.00 38.68 ? 90   MET A CE  1 
ATOM   710  N N   . SER A 1 91  ? -14.430 68.333 60.567 1.00 42.26 ? 91   SER A N   1 
ATOM   711  C CA  . SER A 1 91  ? -15.573 67.684 59.934 1.00 41.25 ? 91   SER A CA  1 
ATOM   712  C C   . SER A 1 91  ? -15.114 66.551 59.026 1.00 40.88 ? 91   SER A C   1 
ATOM   713  O O   . SER A 1 91  ? -14.062 66.661 58.390 1.00 40.28 ? 91   SER A O   1 
ATOM   714  C CB  . SER A 1 91  ? -16.335 68.709 59.079 1.00 39.37 ? 91   SER A CB  1 
ATOM   715  O OG  . SER A 1 91  ? -17.451 68.117 58.452 1.00 37.54 ? 91   SER A OG  1 
ATOM   716  N N   . GLU A 1 92  ? -15.899 65.477 58.952 1.00 40.26 ? 92   GLU A N   1 
ATOM   717  C CA  . GLU A 1 92  ? -15.556 64.378 58.053 1.00 40.55 ? 92   GLU A CA  1 
ATOM   718  C C   . GLU A 1 92  ? -15.693 64.869 56.603 1.00 39.89 ? 92   GLU A C   1 
ATOM   719  O O   . GLU A 1 92  ? -15.168 64.253 55.668 1.00 39.87 ? 92   GLU A O   1 
ATOM   720  C CB  . GLU A 1 92  ? -16.457 63.164 58.285 1.00 40.65 ? 92   GLU A CB  1 
ATOM   721  C CG  . GLU A 1 92  ? -16.181 62.445 59.572 1.00 42.18 ? 92   GLU A CG  1 
ATOM   722  C CD  . GLU A 1 92  ? -16.932 61.117 59.677 1.00 44.73 ? 92   GLU A CD  1 
ATOM   723  O OE1 . GLU A 1 92  ? -16.459 60.092 59.128 1.00 43.14 ? 92   GLU A OE1 1 
ATOM   724  O OE2 . GLU A 1 92  ? -18.011 61.107 60.309 1.00 47.31 ? 92   GLU A OE2 1 
ATOM   725  N N   . ASP A 1 93  ? -16.427 65.967 56.420 1.00 39.65 ? 93   ASP A N   1 
ATOM   726  C CA  . ASP A 1 93  ? -16.579 66.574 55.095 1.00 39.79 ? 93   ASP A CA  1 
ATOM   727  C C   . ASP A 1 93  ? -15.388 67.516 55.051 1.00 38.45 ? 93   ASP A C   1 
ATOM   728  O O   . ASP A 1 93  ? -15.507 68.707 55.365 1.00 37.41 ? 93   ASP A O   1 
ATOM   729  C CB  . ASP A 1 93  ? -17.878 67.379 54.999 1.00 40.53 ? 93   ASP A CB  1 
ATOM   730  C CG  . ASP A 1 93  ? -18.035 68.085 53.655 1.00 42.41 ? 93   ASP A CG  1 
ATOM   731  O OD1 . ASP A 1 93  ? -17.077 68.122 52.849 1.00 43.56 ? 93   ASP A OD1 1 
ATOM   732  O OD2 . ASP A 1 93  ? -19.131 68.618 53.410 1.00 45.10 ? 93   ASP A OD2 1 
ATOM   733  N N   . CYS A 1 94  ? -14.245 66.980 54.638 1.00 38.30 ? 94   CYS A N   1 
ATOM   734  C CA  . CYS A 1 94  ? -13.012 67.755 54.651 1.00 36.93 ? 94   CYS A CA  1 
ATOM   735  C C   . CYS A 1 94  ? -12.114 67.576 53.440 1.00 36.90 ? 94   CYS A C   1 
ATOM   736  O O   . CYS A 1 94  ? -10.962 68.043 53.448 1.00 36.57 ? 94   CYS A O   1 
ATOM   737  C CB  . CYS A 1 94  ? -12.229 67.383 55.927 1.00 35.10 ? 94   CYS A CB  1 
ATOM   738  S SG  . CYS A 1 94  ? -11.706 65.630 55.933 0.80 33.45 ? 94   CYS A SG  1 
ATOM   739  N N   . LEU A 1 95  ? -12.617 66.917 52.396 1.00 36.77 ? 95   LEU A N   1 
ATOM   740  C CA  . LEU A 1 95  ? -11.783 66.691 51.229 1.00 37.25 ? 95   LEU A CA  1 
ATOM   741  C C   . LEU A 1 95  ? -11.800 67.857 50.240 1.00 37.44 ? 95   LEU A C   1 
ATOM   742  O O   . LEU A 1 95  ? -12.544 67.872 49.247 1.00 38.47 ? 95   LEU A O   1 
ATOM   743  C CB  . LEU A 1 95  ? -12.154 65.358 50.556 1.00 37.24 ? 95   LEU A CB  1 
ATOM   744  C CG  . LEU A 1 95  ? -11.978 64.109 51.443 1.00 39.17 ? 95   LEU A CG  1 
ATOM   745  C CD1 . LEU A 1 95  ? -12.200 62.832 50.619 1.00 36.40 ? 95   LEU A CD1 1 
ATOM   746  C CD2 . LEU A 1 95  ? -10.550 64.095 52.053 1.00 38.51 ? 95   LEU A CD2 1 
ATOM   747  N N   . TYR A 1 96  ? -10.933 68.824 50.521 1.00 36.87 ? 96   TYR A N   1 
ATOM   748  C CA  . TYR A 1 96  ? -10.806 70.029 49.720 1.00 35.97 ? 96   TYR A CA  1 
ATOM   749  C C   . TYR A 1 96  ? -9.346  70.352 49.500 1.00 36.37 ? 96   TYR A C   1 
ATOM   750  O O   . TYR A 1 96  ? -8.476  69.850 50.221 1.00 35.13 ? 96   TYR A O   1 
ATOM   751  C CB  . TYR A 1 96  ? -11.449 71.213 50.443 1.00 37.01 ? 96   TYR A CB  1 
ATOM   752  C CG  . TYR A 1 96  ? -12.893 70.993 50.732 1.00 39.25 ? 96   TYR A CG  1 
ATOM   753  C CD1 . TYR A 1 96  ? -13.297 70.251 51.849 1.00 39.02 ? 96   TYR A CD1 1 
ATOM   754  C CD2 . TYR A 1 96  ? -13.867 71.439 49.834 1.00 38.85 ? 96   TYR A CD2 1 
ATOM   755  C CE1 . TYR A 1 96  ? -14.645 69.943 52.052 1.00 41.09 ? 96   TYR A CE1 1 
ATOM   756  C CE2 . TYR A 1 96  ? -15.205 71.148 50.029 1.00 39.94 ? 96   TYR A CE2 1 
ATOM   757  C CZ  . TYR A 1 96  ? -15.590 70.396 51.128 1.00 41.27 ? 96   TYR A CZ  1 
ATOM   758  O OH  . TYR A 1 96  ? -16.915 70.047 51.263 1.00 41.85 ? 96   TYR A OH  1 
ATOM   759  N N   . LEU A 1 97  ? -9.085  71.196 48.508 1.00 34.46 ? 97   LEU A N   1 
ATOM   760  C CA  . LEU A 1 97  ? -7.730  71.622 48.230 1.00 36.16 ? 97   LEU A CA  1 
ATOM   761  C C   . LEU A 1 97  ? -7.702  73.155 48.075 1.00 35.12 ? 97   LEU A C   1 
ATOM   762  O O   . LEU A 1 97  ? -8.734  73.778 47.853 1.00 37.14 ? 97   LEU A O   1 
ATOM   763  C CB  . LEU A 1 97  ? -7.180  70.894 46.992 1.00 35.67 ? 97   LEU A CB  1 
ATOM   764  C CG  . LEU A 1 97  ? -7.893  70.895 45.633 1.00 38.01 ? 97   LEU A CG  1 
ATOM   765  C CD1 . LEU A 1 97  ? -7.680  72.213 44.917 1.00 36.91 ? 97   LEU A CD1 1 
ATOM   766  C CD2 . LEU A 1 97  ? -7.325  69.766 44.783 1.00 37.61 ? 97   LEU A CD2 1 
ATOM   767  N N   . ASN A 1 98  ? -6.523  73.743 48.218 1.00 34.02 ? 98   ASN A N   1 
ATOM   768  C CA  . ASN A 1 98  ? -6.328  75.186 48.140 1.00 35.17 ? 98   ASN A CA  1 
ATOM   769  C C   . ASN A 1 98  ? -5.290  75.507 47.074 1.00 35.95 ? 98   ASN A C   1 
ATOM   770  O O   . ASN A 1 98  ? -4.298  74.777 46.946 1.00 38.21 ? 98   ASN A O   1 
ATOM   771  C CB  . ASN A 1 98  ? -5.852  75.729 49.508 1.00 34.14 ? 98   ASN A CB  1 
ATOM   772  C CG  . ASN A 1 98  ? -6.737  75.261 50.667 1.00 36.27 ? 98   ASN A CG  1 
ATOM   773  O OD1 . ASN A 1 98  ? -7.948  75.523 50.702 1.00 36.19 ? 98   ASN A OD1 1 
ATOM   774  N ND2 . ASN A 1 98  ? -6.133  74.559 51.617 1.00 34.18 ? 98   ASN A ND2 1 
ATOM   775  N N   . ILE A 1 99  ? -5.510  76.592 46.319 1.00 35.84 ? 99   ILE A N   1 
ATOM   776  C CA  . ILE A 1 99  ? -4.574  76.993 45.263 1.00 36.79 ? 99   ILE A CA  1 
ATOM   777  C C   . ILE A 1 99  ? -4.204  78.481 45.304 1.00 39.26 ? 99   ILE A C   1 
ATOM   778  O O   . ILE A 1 99  ? -5.081  79.349 45.327 1.00 41.74 ? 99   ILE A O   1 
ATOM   779  C CB  . ILE A 1 99  ? -5.150  76.744 43.852 1.00 35.15 ? 99   ILE A CB  1 
ATOM   780  C CG1 . ILE A 1 99  ? -5.811  75.347 43.771 1.00 33.24 ? 99   ILE A CG1 1 
ATOM   781  C CG2 . ILE A 1 99  ? -4.033  76.959 42.820 1.00 30.85 ? 99   ILE A CG2 1 
ATOM   782  C CD1 . ILE A 1 99  ? -6.502  75.055 42.404 1.00 29.58 ? 99   ILE A CD1 1 
ATOM   783  N N   . TRP A 1 100 ? -2.912  78.778 45.297 1.00 39.60 ? 100  TRP A N   1 
ATOM   784  C CA  . TRP A 1 100 ? -2.476  80.163 45.287 1.00 39.83 ? 100  TRP A CA  1 
ATOM   785  C C   . TRP A 1 100 ? -1.917  80.416 43.897 1.00 41.19 ? 100  TRP A C   1 
ATOM   786  O O   . TRP A 1 100 ? -1.030  79.692 43.438 1.00 40.61 ? 100  TRP A O   1 
ATOM   787  C CB  . TRP A 1 100 ? -1.415  80.406 46.349 1.00 40.01 ? 100  TRP A CB  1 
ATOM   788  C CG  . TRP A 1 100 ? -2.011  80.533 47.725 1.00 40.97 ? 100  TRP A CG  1 
ATOM   789  C CD1 . TRP A 1 100 ? -2.444  81.683 48.336 1.00 40.63 ? 100  TRP A CD1 1 
ATOM   790  C CD2 . TRP A 1 100 ? -2.222  79.476 48.670 1.00 41.55 ? 100  TRP A CD2 1 
ATOM   791  N NE1 . TRP A 1 100 ? -2.902  81.406 49.605 1.00 40.17 ? 100  TRP A NE1 1 
ATOM   792  C CE2 . TRP A 1 100 ? -2.782  80.063 49.840 1.00 40.45 ? 100  TRP A CE2 1 
ATOM   793  C CE3 . TRP A 1 100 ? -1.996  78.091 48.647 1.00 41.08 ? 100  TRP A CE3 1 
ATOM   794  C CZ2 . TRP A 1 100 ? -3.118  79.312 50.976 1.00 40.34 ? 100  TRP A CZ2 1 
ATOM   795  C CZ3 . TRP A 1 100 ? -2.335  77.336 49.796 1.00 40.64 ? 100  TRP A CZ3 1 
ATOM   796  C CH2 . TRP A 1 100 ? -2.888  77.955 50.935 1.00 40.25 ? 100  TRP A CH2 1 
ATOM   797  N N   . VAL A 1 101 ? -2.447  81.440 43.231 1.00 40.10 ? 101  VAL A N   1 
ATOM   798  C CA  . VAL A 1 101 ? -2.044  81.769 41.873 1.00 39.97 ? 101  VAL A CA  1 
ATOM   799  C C   . VAL A 1 101 ? -1.468  83.176 41.708 1.00 40.99 ? 101  VAL A C   1 
ATOM   800  O O   . VAL A 1 101 ? -2.100  84.176 42.078 1.00 39.42 ? 101  VAL A O   1 
ATOM   801  C CB  . VAL A 1 101 ? -3.254  81.631 40.906 1.00 39.77 ? 101  VAL A CB  1 
ATOM   802  C CG1 . VAL A 1 101 ? -2.826  81.921 39.483 1.00 37.82 ? 101  VAL A CG1 1 
ATOM   803  C CG2 . VAL A 1 101 ? -3.861  80.233 41.022 1.00 39.30 ? 101  VAL A CG2 1 
ATOM   804  N N   . PRO A 1 102 ? -0.253  83.263 41.149 1.00 40.85 ? 102  PRO A N   1 
ATOM   805  C CA  . PRO A 1 102 ? 0.418   84.542 40.918 1.00 42.38 ? 102  PRO A CA  1 
ATOM   806  C C   . PRO A 1 102 ? -0.522  85.449 40.100 1.00 45.65 ? 102  PRO A C   1 
ATOM   807  O O   . PRO A 1 102 ? -1.332  84.961 39.301 1.00 45.63 ? 102  PRO A O   1 
ATOM   808  C CB  . PRO A 1 102 ? 1.654   84.138 40.122 1.00 40.16 ? 102  PRO A CB  1 
ATOM   809  C CG  . PRO A 1 102 ? 1.955   82.775 40.652 1.00 40.07 ? 102  PRO A CG  1 
ATOM   810  C CD  . PRO A 1 102 ? 0.593   82.138 40.707 1.00 39.52 ? 102  PRO A CD  1 
ATOM   811  N N   . SER A 1 103 ? -0.419  86.757 40.318 1.00 47.30 ? 103  SER A N   1 
ATOM   812  C CA  . SER A 1 103 ? -1.243  87.742 39.614 1.00 49.21 ? 103  SER A CA  1 
ATOM   813  C C   . SER A 1 103 ? -0.290  88.695 38.916 1.00 48.96 ? 103  SER A C   1 
ATOM   814  O O   . SER A 1 103 ? 0.550   89.297 39.563 1.00 49.45 ? 103  SER A O   1 
ATOM   815  C CB  . SER A 1 103 ? -2.099  88.516 40.607 1.00 49.16 ? 103  SER A CB  1 
ATOM   816  O OG  . SER A 1 103 ? -2.872  89.484 39.934 1.00 53.04 ? 103  SER A OG  1 
ATOM   817  N N   . PRO A 1 104 ? -0.423  88.869 37.590 1.00 49.01 ? 104  PRO A N   1 
ATOM   818  C CA  . PRO A 1 104 ? -1.396  88.253 36.677 1.00 48.66 ? 104  PRO A CA  1 
ATOM   819  C C   . PRO A 1 104 ? -1.277  86.721 36.564 1.00 48.33 ? 104  PRO A C   1 
ATOM   820  O O   . PRO A 1 104 ? -0.183  86.163 36.722 1.00 46.67 ? 104  PRO A O   1 
ATOM   821  C CB  . PRO A 1 104 ? -1.107  88.965 35.354 1.00 48.46 ? 104  PRO A CB  1 
ATOM   822  C CG  . PRO A 1 104 ? 0.392   89.130 35.396 1.00 47.00 ? 104  PRO A CG  1 
ATOM   823  C CD  . PRO A 1 104 ? 0.633   89.578 36.835 1.00 46.56 ? 104  PRO A CD  1 
ATOM   824  N N   . ARG A 1 105 ? -2.404  86.060 36.286 1.00 47.69 ? 105  ARG A N   1 
ATOM   825  C CA  . ARG A 1 105 ? -2.439  84.603 36.165 1.00 48.64 ? 105  ARG A CA  1 
ATOM   826  C C   . ARG A 1 105 ? -1.435  84.117 35.132 1.00 48.53 ? 105  ARG A C   1 
ATOM   827  O O   . ARG A 1 105 ? -1.441  84.581 34.002 1.00 49.81 ? 105  ARG A O   1 
ATOM   828  C CB  . ARG A 1 105 ? -3.843  84.119 35.772 1.00 47.56 ? 105  ARG A CB  1 
ATOM   829  C CG  . ARG A 1 105 ? -4.000  82.594 35.768 1.00 45.69 ? 105  ARG A CG  1 
ATOM   830  C CD  . ARG A 1 105 ? -5.346  82.163 35.196 1.00 43.85 ? 105  ARG A CD  1 
ATOM   831  N NE  . ARG A 1 105 ? -6.468  82.749 35.924 1.00 43.47 ? 105  ARG A NE  1 
ATOM   832  C CZ  . ARG A 1 105 ? -7.732  82.704 35.509 1.00 42.33 ? 105  ARG A CZ  1 
ATOM   833  N NH1 . ARG A 1 105 ? -8.026  82.090 34.367 1.00 42.12 ? 105  ARG A NH1 1 
ATOM   834  N NH2 . ARG A 1 105 ? -8.699  83.293 36.213 1.00 38.76 ? 105  ARG A NH2 1 
ATOM   835  N N   . PRO A 1 106 ? -0.564  83.165 35.509 1.00 48.48 ? 106  PRO A N   1 
ATOM   836  C CA  . PRO A 1 106 ? 0.450   82.619 34.602 1.00 47.33 ? 106  PRO A CA  1 
ATOM   837  C C   . PRO A 1 106 ? -0.265  81.811 33.546 1.00 47.02 ? 106  PRO A C   1 
ATOM   838  O O   . PRO A 1 106 ? -1.450  81.489 33.708 1.00 46.05 ? 106  PRO A O   1 
ATOM   839  C CB  . PRO A 1 106 ? 1.284   81.700 35.500 1.00 47.08 ? 106  PRO A CB  1 
ATOM   840  C CG  . PRO A 1 106 ? 0.948   82.133 36.892 1.00 47.04 ? 106  PRO A CG  1 
ATOM   841  C CD  . PRO A 1 106 ? -0.504  82.490 36.815 1.00 48.12 ? 106  PRO A CD  1 
ATOM   842  N N   . LYS A 1 107 ? 0.447   81.472 32.478 1.00 45.61 ? 107  LYS A N   1 
ATOM   843  C CA  . LYS A 1 107 ? -0.152  80.679 31.426 1.00 46.51 ? 107  LYS A CA  1 
ATOM   844  C C   . LYS A 1 107 ? 0.114   79.177 31.647 1.00 46.66 ? 107  LYS A C   1 
ATOM   845  O O   . LYS A 1 107 ? -0.795  78.353 31.557 1.00 43.93 ? 107  LYS A O   1 
ATOM   846  C CB  . LYS A 1 107 ? 0.384   81.118 30.061 1.00 47.85 ? 107  LYS A CB  1 
ATOM   847  C CG  . LYS A 1 107 ? 0.113   82.585 29.716 1.00 50.84 ? 107  LYS A CG  1 
ATOM   848  C CD  . LYS A 1 107 ? -1.347  82.951 29.945 1.00 53.19 ? 107  LYS A CD  1 
ATOM   849  C CE  . LYS A 1 107 ? -1.584  84.450 29.815 1.00 56.41 ? 107  LYS A CE  1 
ATOM   850  N NZ  . LYS A 1 107 ? -2.999  84.822 30.157 1.00 59.31 ? 107  LYS A NZ  1 
ATOM   851  N N   . SER A 1 108 ? 1.362   78.820 31.937 1.00 46.62 ? 108  SER A N   1 
ATOM   852  C CA  . SER A 1 108 ? 1.693   77.411 32.147 1.00 46.48 ? 108  SER A CA  1 
ATOM   853  C C   . SER A 1 108 ? 2.976   77.364 32.956 1.00 45.59 ? 108  SER A C   1 
ATOM   854  O O   . SER A 1 108 ? 4.058   77.123 32.405 1.00 45.77 ? 108  SER A O   1 
ATOM   855  C CB  . SER A 1 108 ? 1.904   76.716 30.800 1.00 45.21 ? 108  SER A CB  1 
ATOM   856  O OG  . SER A 1 108 ? 1.745   75.313 30.895 1.00 45.28 ? 108  SER A OG  1 
ATOM   857  N N   . THR A 1 109 ? 2.854   77.577 34.262 1.00 42.42 ? 109  THR A N   1 
ATOM   858  C CA  . THR A 1 109 ? 4.038   77.599 35.121 1.00 42.75 ? 109  THR A CA  1 
ATOM   859  C C   . THR A 1 109 ? 4.196   76.426 36.103 1.00 41.17 ? 109  THR A C   1 
ATOM   860  O O   . THR A 1 109 ? 3.288   75.590 36.265 1.00 41.57 ? 109  THR A O   1 
ATOM   861  C CB  . THR A 1 109 ? 4.101   78.928 35.928 1.00 41.35 ? 109  THR A CB  1 
ATOM   862  O OG1 . THR A 1 109 ? 5.411   79.084 36.475 1.00 45.58 ? 109  THR A OG1 1 
ATOM   863  C CG2 . THR A 1 109 ? 3.088   78.929 37.075 1.00 39.59 ? 109  THR A CG2 1 
ATOM   864  N N   . THR A 1 110 ? 5.359   76.385 36.751 1.00 39.79 ? 110  THR A N   1 
ATOM   865  C CA  . THR A 1 110 ? 5.674   75.353 37.736 1.00 39.17 ? 110  THR A CA  1 
ATOM   866  C C   . THR A 1 110 ? 4.625   75.247 38.855 1.00 38.18 ? 110  THR A C   1 
ATOM   867  O O   . THR A 1 110 ? 4.217   76.266 39.461 1.00 36.41 ? 110  THR A O   1 
ATOM   868  C CB  . THR A 1 110 ? 7.053   75.613 38.371 1.00 41.23 ? 110  THR A CB  1 
ATOM   869  O OG1 . THR A 1 110 ? 8.062   75.515 37.358 1.00 41.35 ? 110  THR A OG1 1 
ATOM   870  C CG2 . THR A 1 110 ? 7.332   74.596 39.509 1.00 38.61 ? 110  THR A CG2 1 
ATOM   871  N N   . VAL A 1 111 ? 4.198   74.010 39.127 1.00 35.76 ? 111  VAL A N   1 
ATOM   872  C CA  . VAL A 1 111 ? 3.199   73.741 40.161 1.00 34.35 ? 111  VAL A CA  1 
ATOM   873  C C   . VAL A 1 111 ? 3.814   72.950 41.333 1.00 35.03 ? 111  VAL A C   1 
ATOM   874  O O   . VAL A 1 111 ? 4.558   72.005 41.111 1.00 33.58 ? 111  VAL A O   1 
ATOM   875  C CB  . VAL A 1 111 ? 2.019   72.869 39.614 1.00 34.81 ? 111  VAL A CB  1 
ATOM   876  C CG1 . VAL A 1 111 ? 0.980   72.607 40.753 1.00 31.97 ? 111  VAL A CG1 1 
ATOM   877  C CG2 . VAL A 1 111 ? 1.364   73.541 38.411 1.00 33.80 ? 111  VAL A CG2 1 
ATOM   878  N N   . MET A 1 112 ? 3.481   73.328 42.565 1.00 35.20 ? 112  MET A N   1 
ATOM   879  C CA  . MET A 1 112 ? 3.950   72.610 43.744 1.00 36.15 ? 112  MET A CA  1 
ATOM   880  C C   . MET A 1 112 ? 2.739   72.194 44.576 1.00 37.42 ? 112  MET A C   1 
ATOM   881  O O   . MET A 1 112 ? 1.855   73.014 44.835 1.00 39.84 ? 112  MET A O   1 
ATOM   882  C CB  . MET A 1 112 ? 4.906   73.477 44.570 1.00 37.24 ? 112  MET A CB  1 
ATOM   883  C CG  . MET A 1 112 ? 6.254   73.669 43.864 1.00 38.44 ? 112  MET A CG  1 
ATOM   884  S SD  . MET A 1 112 ? 7.407   74.763 44.712 1.00 41.31 ? 112  MET A SD  1 
ATOM   885  C CE  . MET A 1 112 ? 8.123   73.662 45.907 1.00 41.96 ? 112  MET A CE  1 
ATOM   886  N N   . VAL A 1 113 ? 2.677   70.916 44.965 1.00 35.50 ? 113  VAL A N   1 
ATOM   887  C CA  . VAL A 1 113 ? 1.559   70.424 45.779 1.00 33.02 ? 113  VAL A CA  1 
ATOM   888  C C   . VAL A 1 113 ? 2.071   69.952 47.139 1.00 33.22 ? 113  VAL A C   1 
ATOM   889  O O   . VAL A 1 113 ? 2.858   69.017 47.239 1.00 32.43 ? 113  VAL A O   1 
ATOM   890  C CB  . VAL A 1 113 ? 0.791   69.242 45.088 1.00 31.84 ? 113  VAL A CB  1 
ATOM   891  C CG1 . VAL A 1 113 ? -0.433  68.846 45.935 1.00 27.59 ? 113  VAL A CG1 1 
ATOM   892  C CG2 . VAL A 1 113 ? 0.351   69.650 43.677 1.00 26.33 ? 113  VAL A CG2 1 
ATOM   893  N N   . TRP A 1 114 ? 1.584   70.612 48.182 1.00 33.81 ? 114  TRP A N   1 
ATOM   894  C CA  . TRP A 1 114 ? 1.961   70.356 49.565 1.00 31.94 ? 114  TRP A CA  1 
ATOM   895  C C   . TRP A 1 114 ? 1.088   69.305 50.256 1.00 31.65 ? 114  TRP A C   1 
ATOM   896  O O   . TRP A 1 114 ? -0.158  69.332 50.155 1.00 31.36 ? 114  TRP A O   1 
ATOM   897  C CB  . TRP A 1 114 ? 1.894   71.682 50.378 1.00 31.59 ? 114  TRP A CB  1 
ATOM   898  C CG  . TRP A 1 114 ? 2.117   71.485 51.878 1.00 32.30 ? 114  TRP A CG  1 
ATOM   899  C CD1 . TRP A 1 114 ? 1.186   71.603 52.886 1.00 33.30 ? 114  TRP A CD1 1 
ATOM   900  C CD2 . TRP A 1 114 ? 3.350   71.138 52.516 1.00 30.14 ? 114  TRP A CD2 1 
ATOM   901  N NE1 . TRP A 1 114 ? 1.776   71.355 54.115 1.00 30.93 ? 114  TRP A NE1 1 
ATOM   902  C CE2 . TRP A 1 114 ? 3.101   71.071 53.913 1.00 30.90 ? 114  TRP A CE2 1 
ATOM   903  C CE3 . TRP A 1 114 ? 4.648   70.887 52.044 1.00 31.16 ? 114  TRP A CE3 1 
ATOM   904  C CZ2 . TRP A 1 114 ? 4.105   70.763 54.840 1.00 31.34 ? 114  TRP A CZ2 1 
ATOM   905  C CZ3 . TRP A 1 114 ? 5.650   70.585 52.964 1.00 30.94 ? 114  TRP A CZ3 1 
ATOM   906  C CH2 . TRP A 1 114 ? 5.373   70.527 54.347 1.00 31.86 ? 114  TRP A CH2 1 
ATOM   907  N N   . ILE A 1 115 ? 1.751   68.407 50.990 1.00 31.31 ? 115  ILE A N   1 
ATOM   908  C CA  . ILE A 1 115 ? 1.071   67.349 51.743 1.00 29.27 ? 115  ILE A CA  1 
ATOM   909  C C   . ILE A 1 115 ? 1.488   67.437 53.221 1.00 30.91 ? 115  ILE A C   1 
ATOM   910  O O   . ILE A 1 115 ? 2.668   67.202 53.544 1.00 29.66 ? 115  ILE A O   1 
ATOM   911  C CB  . ILE A 1 115 ? 1.445   65.944 51.212 1.00 29.45 ? 115  ILE A CB  1 
ATOM   912  C CG1 . ILE A 1 115 ? 1.244   65.888 49.683 1.00 30.67 ? 115  ILE A CG1 1 
ATOM   913  C CG2 . ILE A 1 115 ? 0.609   64.876 51.942 1.00 25.77 ? 115  ILE A CG2 1 
ATOM   914  C CD1 . ILE A 1 115 ? 1.552   64.511 49.049 1.00 31.90 ? 115  ILE A CD1 1 
ATOM   915  N N   . TYR A 1 116 ? 0.532   67.765 54.107 1.00 30.57 ? 116  TYR A N   1 
ATOM   916  C CA  . TYR A 1 116 ? 0.820   67.889 55.540 1.00 30.45 ? 116  TYR A CA  1 
ATOM   917  C C   . TYR A 1 116 ? 1.159   66.529 56.173 1.00 31.47 ? 116  TYR A C   1 
ATOM   918  O O   . TYR A 1 116 ? 0.762   65.488 55.654 1.00 30.89 ? 116  TYR A O   1 
ATOM   919  C CB  . TYR A 1 116 ? -0.346  68.600 56.277 1.00 30.53 ? 116  TYR A CB  1 
ATOM   920  C CG  . TYR A 1 116 ? -1.747  67.988 56.144 1.00 31.61 ? 116  TYR A CG  1 
ATOM   921  C CD1 . TYR A 1 116 ? -2.067  66.756 56.753 1.00 31.34 ? 116  TYR A CD1 1 
ATOM   922  C CD2 . TYR A 1 116 ? -2.764  68.666 55.472 1.00 28.89 ? 116  TYR A CD2 1 
ATOM   923  C CE1 . TYR A 1 116 ? -3.361  66.231 56.689 1.00 31.08 ? 116  TYR A CE1 1 
ATOM   924  C CE2 . TYR A 1 116 ? -4.070  68.150 55.406 1.00 29.12 ? 116  TYR A CE2 1 
ATOM   925  C CZ  . TYR A 1 116 ? -4.365  66.935 56.009 1.00 32.90 ? 116  TYR A CZ  1 
ATOM   926  O OH  . TYR A 1 116 ? -5.648  66.403 55.923 1.00 31.52 ? 116  TYR A OH  1 
ATOM   927  N N   . GLY A 1 117 ? 1.887   66.532 57.295 1.00 32.30 ? 117  GLY A N   1 
ATOM   928  C CA  . GLY A 1 117 ? 2.309   65.272 57.873 1.00 30.82 ? 117  GLY A CA  1 
ATOM   929  C C   . GLY A 1 117 ? 2.344   64.972 59.355 1.00 33.23 ? 117  GLY A C   1 
ATOM   930  O O   . GLY A 1 117 ? 3.381   64.493 59.864 1.00 33.46 ? 117  GLY A O   1 
ATOM   931  N N   . GLY A 1 118 ? 1.226   65.212 60.046 1.00 32.27 ? 118  GLY A N   1 
ATOM   932  C CA  . GLY A 1 118 ? 1.175   64.888 61.453 1.00 31.98 ? 118  GLY A CA  1 
ATOM   933  C C   . GLY A 1 118 ? 1.025   63.382 61.749 1.00 32.18 ? 118  GLY A C   1 
ATOM   934  O O   . GLY A 1 118 ? -0.009  62.959 62.290 1.00 32.37 ? 118  GLY A O   1 
ATOM   935  N N   . GLY A 1 119 ? 2.039   62.581 61.401 1.00 30.38 ? 119  GLY A N   1 
ATOM   936  C CA  . GLY A 1 119 ? 2.014   61.145 61.700 1.00 31.31 ? 119  GLY A CA  1 
ATOM   937  C C   . GLY A 1 119 ? 0.809   60.331 61.242 1.00 31.06 ? 119  GLY A C   1 
ATOM   938  O O   . GLY A 1 119 ? 0.506   59.263 61.809 1.00 29.57 ? 119  GLY A O   1 
ATOM   939  N N   . PHE A 1 120 ? 0.144   60.820 60.192 1.00 29.85 ? 120  PHE A N   1 
ATOM   940  C CA  . PHE A 1 120 ? -1.052  60.177 59.637 1.00 30.43 ? 120  PHE A CA  1 
ATOM   941  C C   . PHE A 1 120 ? -2.235  60.212 60.611 1.00 31.22 ? 120  PHE A C   1 
ATOM   942  O O   . PHE A 1 120 ? -3.276  59.617 60.315 1.00 32.30 ? 120  PHE A O   1 
ATOM   943  C CB  . PHE A 1 120 ? -0.782  58.711 59.215 1.00 29.54 ? 120  PHE A CB  1 
ATOM   944  C CG  . PHE A 1 120 ? 0.219   58.560 58.085 1.00 27.92 ? 120  PHE A CG  1 
ATOM   945  C CD1 . PHE A 1 120 ? -0.087  58.997 56.797 1.00 25.37 ? 120  PHE A CD1 1 
ATOM   946  C CD2 . PHE A 1 120 ? 1.464   57.957 58.310 1.00 25.75 ? 120  PHE A CD2 1 
ATOM   947  C CE1 . PHE A 1 120 ? 0.828   58.836 55.743 1.00 25.08 ? 120  PHE A CE1 1 
ATOM   948  C CE2 . PHE A 1 120 ? 2.390   57.792 57.256 1.00 24.25 ? 120  PHE A CE2 1 
ATOM   949  C CZ  . PHE A 1 120 ? 2.076   58.229 55.972 1.00 21.31 ? 120  PHE A CZ  1 
ATOM   950  N N   . TYR A 1 121 ? -2.097  60.903 61.750 1.00 30.39 ? 121  TYR A N   1 
ATOM   951  C CA  . TYR A 1 121 ? -3.227  61.014 62.688 1.00 32.64 ? 121  TYR A CA  1 
ATOM   952  C C   . TYR A 1 121 ? -3.700  62.465 62.826 1.00 33.67 ? 121  TYR A C   1 
ATOM   953  O O   . TYR A 1 121 ? -4.734  62.734 63.466 1.00 34.69 ? 121  TYR A O   1 
ATOM   954  C CB  . TYR A 1 121 ? -2.873  60.474 64.084 1.00 31.64 ? 121  TYR A CB  1 
ATOM   955  C CG  . TYR A 1 121 ? -1.867  61.312 64.827 1.00 30.90 ? 121  TYR A CG  1 
ATOM   956  C CD1 . TYR A 1 121 ? -2.264  62.418 65.599 1.00 34.22 ? 121  TYR A CD1 1 
ATOM   957  C CD2 . TYR A 1 121 ? -0.519  61.000 64.764 1.00 32.11 ? 121  TYR A CD2 1 
ATOM   958  C CE1 . TYR A 1 121 ? -1.313  63.195 66.305 1.00 35.76 ? 121  TYR A CE1 1 
ATOM   959  C CE2 . TYR A 1 121 ? 0.437   61.745 65.450 1.00 34.35 ? 121  TYR A CE2 1 
ATOM   960  C CZ  . TYR A 1 121 ? 0.044   62.835 66.213 1.00 36.41 ? 121  TYR A CZ  1 
ATOM   961  O OH  . TYR A 1 121 ? 1.026   63.548 66.854 1.00 37.35 ? 121  TYR A OH  1 
ATOM   962  N N   . SER A 1 122 ? -2.938  63.393 62.255 1.00 31.88 ? 122  SER A N   1 
ATOM   963  C CA  . SER A 1 122 ? -3.307  64.806 62.330 1.00 33.66 ? 122  SER A CA  1 
ATOM   964  C C   . SER A 1 122 ? -2.711  65.609 61.178 1.00 33.93 ? 122  SER A C   1 
ATOM   965  O O   . SER A 1 122 ? -1.880  65.089 60.400 1.00 32.63 ? 122  SER A O   1 
ATOM   966  C CB  . SER A 1 122 ? -2.843  65.426 63.658 1.00 32.41 ? 122  SER A CB  1 
ATOM   967  O OG  . SER A 1 122 ? -1.427  65.342 63.751 1.00 35.18 ? 122  SER A OG  1 
ATOM   968  N N   . GLY A 1 123 ? -3.115  66.883 61.120 1.00 34.56 ? 123  GLY A N   1 
ATOM   969  C CA  . GLY A 1 123 ? -2.655  67.804 60.089 1.00 35.05 ? 123  GLY A CA  1 
ATOM   970  C C   . GLY A 1 123 ? -3.818  68.564 59.448 1.00 34.41 ? 123  GLY A C   1 
ATOM   971  O O   . GLY A 1 123 ? -4.931  68.054 59.393 1.00 34.10 ? 123  GLY A O   1 
ATOM   972  N N   . SER A 1 124 ? -3.558  69.779 58.972 1.00 33.91 ? 124  SER A N   1 
ATOM   973  C CA  . SER A 1 124 ? -4.572  70.626 58.328 1.00 35.05 ? 124  SER A CA  1 
ATOM   974  C C   . SER A 1 124 ? -3.885  71.402 57.217 1.00 35.56 ? 124  SER A C   1 
ATOM   975  O O   . SER A 1 124 ? -2.738  71.815 57.350 1.00 36.64 ? 124  SER A O   1 
ATOM   976  C CB  . SER A 1 124 ? -5.167  71.645 59.317 1.00 33.57 ? 124  SER A CB  1 
ATOM   977  O OG  . SER A 1 124 ? -5.690  71.030 60.482 1.00 34.22 ? 124  SER A OG  1 
ATOM   978  N N   . SER A 1 125 ? -4.588  71.621 56.122 1.00 37.10 ? 125  SER A N   1 
ATOM   979  C CA  . SER A 1 125 ? -4.008  72.362 55.017 1.00 38.30 ? 125  SER A CA  1 
ATOM   980  C C   . SER A 1 125 ? -4.134  73.867 55.261 1.00 38.68 ? 125  SER A C   1 
ATOM   981  O O   . SER A 1 125 ? -3.618  74.661 54.483 1.00 41.55 ? 125  SER A O   1 
ATOM   982  C CB  . SER A 1 125 ? -4.747  72.021 53.721 1.00 38.46 ? 125  SER A CB  1 
ATOM   983  O OG  . SER A 1 125 ? -6.084  72.501 53.780 1.00 35.09 ? 125  SER A OG  1 
ATOM   984  N N   . THR A 1 126 ? -4.801  74.242 56.347 1.00 38.31 ? 126  THR A N   1 
ATOM   985  C CA  . THR A 1 126 ? -5.089  75.638 56.651 1.00 38.31 ? 126  THR A CA  1 
ATOM   986  C C   . THR A 1 126 ? -4.248  76.321 57.723 1.00 39.07 ? 126  THR A C   1 
ATOM   987  O O   . THR A 1 126 ? -4.539  77.448 58.117 1.00 41.14 ? 126  THR A O   1 
ATOM   988  C CB  . THR A 1 126 ? -6.567  75.760 57.041 1.00 37.95 ? 126  THR A CB  1 
ATOM   989  O OG1 . THR A 1 126 ? -6.800  74.977 58.217 1.00 36.31 ? 126  THR A OG1 1 
ATOM   990  C CG2 . THR A 1 126 ? -7.465  75.228 55.924 1.00 36.75 ? 126  THR A CG2 1 
ATOM   991  N N   . LEU A 1 127 ? -3.216  75.652 58.203 1.00 38.75 ? 127  LEU A N   1 
ATOM   992  C CA  . LEU A 1 127 ? -2.350  76.234 59.221 1.00 40.12 ? 127  LEU A CA  1 
ATOM   993  C C   . LEU A 1 127 ? -1.648  77.459 58.675 1.00 40.25 ? 127  LEU A C   1 
ATOM   994  O O   . LEU A 1 127 ? -1.264  77.496 57.500 1.00 40.24 ? 127  LEU A O   1 
ATOM   995  C CB  . LEU A 1 127 ? -1.274  75.233 59.664 1.00 38.79 ? 127  LEU A CB  1 
ATOM   996  C CG  . LEU A 1 127 ? -1.743  73.861 60.143 1.00 41.11 ? 127  LEU A CG  1 
ATOM   997  C CD1 . LEU A 1 127 ? -0.503  73.019 60.494 1.00 39.78 ? 127  LEU A CD1 1 
ATOM   998  C CD2 . LEU A 1 127 ? -2.690  74.008 61.339 1.00 37.40 ? 127  LEU A CD2 1 
ATOM   999  N N   . ASP A 1 128 ? -1.440  78.450 59.535 1.00 40.28 ? 128  ASP A N   1 
ATOM   1000 C CA  . ASP A 1 128 ? -0.739  79.660 59.107 1.00 40.77 ? 128  ASP A CA  1 
ATOM   1001 C C   . ASP A 1 128 ? 0.660   79.301 58.559 1.00 40.23 ? 128  ASP A C   1 
ATOM   1002 O O   . ASP A 1 128 ? 1.157   79.912 57.604 1.00 39.39 ? 128  ASP A O   1 
ATOM   1003 C CB  . ASP A 1 128 ? -0.615  80.658 60.279 1.00 42.10 ? 128  ASP A CB  1 
ATOM   1004 C CG  . ASP A 1 128 ? -1.986  81.092 60.839 1.00 46.11 ? 128  ASP A CG  1 
ATOM   1005 O OD1 . ASP A 1 128 ? -2.969  81.196 60.072 1.00 45.98 ? 128  ASP A OD1 1 
ATOM   1006 O OD2 . ASP A 1 128 ? -2.086  81.337 62.055 1.00 48.59 ? 128  ASP A OD2 1 
ATOM   1007 N N   . VAL A 1 129 ? 1.284   78.289 59.153 1.00 39.00 ? 129  VAL A N   1 
ATOM   1008 C CA  . VAL A 1 129 ? 2.622   77.902 58.736 1.00 37.21 ? 129  VAL A CA  1 
ATOM   1009 C C   . VAL A 1 129 ? 2.594   77.235 57.353 1.00 38.31 ? 129  VAL A C   1 
ATOM   1010 O O   . VAL A 1 129 ? 3.651   77.003 56.751 1.00 36.56 ? 129  VAL A O   1 
ATOM   1011 C CB  . VAL A 1 129 ? 3.271   76.971 59.805 1.00 36.73 ? 129  VAL A CB  1 
ATOM   1012 C CG1 . VAL A 1 129 ? 2.621   75.574 59.785 1.00 33.07 ? 129  VAL A CG1 1 
ATOM   1013 C CG2 . VAL A 1 129 ? 4.725   76.892 59.585 1.00 35.85 ? 129  VAL A CG2 1 
ATOM   1014 N N   . TYR A 1 130 ? 1.388   76.957 56.842 1.00 37.97 ? 130  TYR A N   1 
ATOM   1015 C CA  . TYR A 1 130 ? 1.253   76.340 55.518 1.00 39.86 ? 130  TYR A CA  1 
ATOM   1016 C C   . TYR A 1 130 ? 0.687   77.311 54.476 1.00 40.21 ? 130  TYR A C   1 
ATOM   1017 O O   . TYR A 1 130 ? 0.293   76.883 53.393 1.00 39.24 ? 130  TYR A O   1 
ATOM   1018 C CB  . TYR A 1 130 ? 0.337   75.095 55.537 1.00 36.99 ? 130  TYR A CB  1 
ATOM   1019 C CG  . TYR A 1 130 ? 0.839   73.906 56.312 1.00 36.61 ? 130  TYR A CG  1 
ATOM   1020 C CD1 . TYR A 1 130 ? 2.207   73.698 56.534 1.00 36.24 ? 130  TYR A CD1 1 
ATOM   1021 C CD2 . TYR A 1 130 ? -0.071  72.976 56.846 1.00 37.12 ? 130  TYR A CD2 1 
ATOM   1022 C CE1 . TYR A 1 130 ? 2.657   72.588 57.283 1.00 36.52 ? 130  TYR A CE1 1 
ATOM   1023 C CE2 . TYR A 1 130 ? 0.360   71.879 57.584 1.00 36.48 ? 130  TYR A CE2 1 
ATOM   1024 C CZ  . TYR A 1 130 ? 1.722   71.687 57.810 1.00 37.80 ? 130  TYR A CZ  1 
ATOM   1025 O OH  . TYR A 1 130 ? 2.117   70.625 58.604 1.00 35.90 ? 130  TYR A OH  1 
ATOM   1026 N N   . ASN A 1 131 ? 0.638   78.601 54.801 1.00 41.58 ? 131  ASN A N   1 
ATOM   1027 C CA  . ASN A 1 131 ? 0.102   79.592 53.871 1.00 42.23 ? 131  ASN A CA  1 
ATOM   1028 C C   . ASN A 1 131 ? 0.984   79.686 52.628 1.00 41.28 ? 131  ASN A C   1 
ATOM   1029 O O   . ASN A 1 131 ? 2.095   80.206 52.692 1.00 40.76 ? 131  ASN A O   1 
ATOM   1030 C CB  . ASN A 1 131 ? 0.021   80.956 54.567 1.00 43.88 ? 131  ASN A CB  1 
ATOM   1031 C CG  . ASN A 1 131 ? -0.975  81.898 53.903 1.00 44.05 ? 131  ASN A CG  1 
ATOM   1032 O OD1 . ASN A 1 131 ? -1.060  81.981 52.676 1.00 45.68 ? 131  ASN A OD1 1 
ATOM   1033 N ND2 . ASN A 1 131 ? -1.728  82.620 54.718 1.00 45.43 ? 131  ASN A ND2 1 
ATOM   1034 N N   . GLY A 1 132 ? 0.471   79.205 51.495 1.00 41.96 ? 132  GLY A N   1 
ATOM   1035 C CA  . GLY A 1 132 ? 1.247   79.202 50.262 1.00 41.28 ? 132  GLY A CA  1 
ATOM   1036 C C   . GLY A 1 132 ? 1.426   80.523 49.520 1.00 41.55 ? 132  GLY A C   1 
ATOM   1037 O O   . GLY A 1 132 ? 2.179   80.592 48.535 1.00 39.43 ? 132  GLY A O   1 
ATOM   1038 N N   . LYS A 1 133 ? 0.781   81.585 50.001 1.00 42.94 ? 133  LYS A N   1 
ATOM   1039 C CA  . LYS A 1 133 ? 0.876   82.868 49.313 1.00 43.17 ? 133  LYS A CA  1 
ATOM   1040 C C   . LYS A 1 133 ? 2.290   83.437 49.189 1.00 43.31 ? 133  LYS A C   1 
ATOM   1041 O O   . LYS A 1 133 ? 2.611   84.039 48.160 1.00 44.80 ? 133  LYS A O   1 
ATOM   1042 C CB  . LYS A 1 133 ? -0.067  83.892 49.953 1.00 43.26 ? 133  LYS A CB  1 
ATOM   1043 C CG  . LYS A 1 133 ? 0.428   84.517 51.240 1.00 43.69 ? 133  LYS A CG  1 
ATOM   1044 C CD  . LYS A 1 133 ? -0.677  85.363 51.828 1.00 42.63 ? 133  LYS A CD  1 
ATOM   1045 C CE  . LYS A 1 133 ? -0.176  86.187 53.015 1.00 44.00 ? 133  LYS A CE  1 
ATOM   1046 N NZ  . LYS A 1 133 ? -1.258  87.075 53.552 1.00 42.70 ? 133  LYS A NZ  1 
ATOM   1047 N N   . TYR A 1 134 ? 3.144   83.241 50.193 1.00 42.25 ? 134  TYR A N   1 
ATOM   1048 C CA  . TYR A 1 134 ? 4.503   83.774 50.106 1.00 42.43 ? 134  TYR A CA  1 
ATOM   1049 C C   . TYR A 1 134 ? 5.322   83.050 49.046 1.00 43.07 ? 134  TYR A C   1 
ATOM   1050 O O   . TYR A 1 134 ? 6.043   83.670 48.259 1.00 45.46 ? 134  TYR A O   1 
ATOM   1051 C CB  . TYR A 1 134 ? 5.205   83.680 51.465 1.00 42.08 ? 134  TYR A CB  1 
ATOM   1052 C CG  . TYR A 1 134 ? 4.402   84.306 52.569 1.00 41.55 ? 134  TYR A CG  1 
ATOM   1053 C CD1 . TYR A 1 134 ? 4.159   85.694 52.592 1.00 43.46 ? 134  TYR A CD1 1 
ATOM   1054 C CD2 . TYR A 1 134 ? 3.826   83.517 53.558 1.00 40.73 ? 134  TYR A CD2 1 
ATOM   1055 C CE1 . TYR A 1 134 ? 3.354   86.275 53.581 1.00 39.40 ? 134  TYR A CE1 1 
ATOM   1056 C CE2 . TYR A 1 134 ? 3.025   84.074 54.544 1.00 39.79 ? 134  TYR A CE2 1 
ATOM   1057 C CZ  . TYR A 1 134 ? 2.791   85.455 54.555 1.00 42.43 ? 134  TYR A CZ  1 
ATOM   1058 O OH  . TYR A 1 134 ? 2.005   85.994 55.557 1.00 44.80 ? 134  TYR A OH  1 
ATOM   1059 N N   . LEU A 1 135 ? 5.221   81.729 49.023 1.00 42.24 ? 135  LEU A N   1 
ATOM   1060 C CA  . LEU A 1 135 ? 5.957   80.939 48.037 1.00 41.53 ? 135  LEU A CA  1 
ATOM   1061 C C   . LEU A 1 135 ? 5.406   81.140 46.628 1.00 41.60 ? 135  LEU A C   1 
ATOM   1062 O O   . LEU A 1 135 ? 6.166   81.294 45.662 1.00 41.64 ? 135  LEU A O   1 
ATOM   1063 C CB  . LEU A 1 135 ? 5.882   79.466 48.421 1.00 42.29 ? 135  LEU A CB  1 
ATOM   1064 C CG  . LEU A 1 135 ? 6.751   78.414 47.751 1.00 41.48 ? 135  LEU A CG  1 
ATOM   1065 C CD1 . LEU A 1 135 ? 8.187   78.855 47.710 1.00 40.71 ? 135  LEU A CD1 1 
ATOM   1066 C CD2 . LEU A 1 135 ? 6.604   77.120 48.535 1.00 41.34 ? 135  LEU A CD2 1 
ATOM   1067 N N   . ALA A 1 136 ? 4.083   81.151 46.501 1.00 42.65 ? 136  ALA A N   1 
ATOM   1068 C CA  . ALA A 1 136 ? 3.471   81.329 45.185 1.00 43.81 ? 136  ALA A CA  1 
ATOM   1069 C C   . ALA A 1 136 ? 3.931   82.660 44.595 1.00 45.73 ? 136  ALA A C   1 
ATOM   1070 O O   . ALA A 1 136 ? 4.395   82.742 43.445 1.00 45.53 ? 136  ALA A O   1 
ATOM   1071 C CB  . ALA A 1 136 ? 1.947   81.304 45.306 1.00 42.90 ? 136  ALA A CB  1 
ATOM   1072 N N   . TYR A 1 137 ? 3.812   83.693 45.421 1.00 46.21 ? 137  TYR A N   1 
ATOM   1073 C CA  . TYR A 1 137 ? 4.171   85.037 45.045 1.00 46.13 ? 137  TYR A CA  1 
ATOM   1074 C C   . TYR A 1 137 ? 5.653   85.214 44.774 1.00 45.80 ? 137  TYR A C   1 
ATOM   1075 O O   . TYR A 1 137 ? 6.050   85.661 43.688 1.00 45.06 ? 137  TYR A O   1 
ATOM   1076 C CB  . TYR A 1 137 ? 3.731   86.006 46.149 1.00 48.55 ? 137  TYR A CB  1 
ATOM   1077 C CG  . TYR A 1 137 ? 4.159   87.435 45.909 1.00 50.48 ? 137  TYR A CG  1 
ATOM   1078 C CD1 . TYR A 1 137 ? 3.545   88.211 44.914 1.00 52.62 ? 137  TYR A CD1 1 
ATOM   1079 C CD2 . TYR A 1 137 ? 5.190   88.011 46.663 1.00 51.38 ? 137  TYR A CD2 1 
ATOM   1080 C CE1 . TYR A 1 137 ? 3.942   89.526 44.674 1.00 52.98 ? 137  TYR A CE1 1 
ATOM   1081 C CE2 . TYR A 1 137 ? 5.606   89.326 46.438 1.00 52.73 ? 137  TYR A CE2 1 
ATOM   1082 C CZ  . TYR A 1 137 ? 4.975   90.083 45.439 1.00 55.28 ? 137  TYR A CZ  1 
ATOM   1083 O OH  . TYR A 1 137 ? 5.371   91.385 45.204 1.00 55.73 ? 137  TYR A OH  1 
ATOM   1084 N N   . THR A 1 138 ? 6.479   84.858 45.748 1.00 44.92 ? 138  THR A N   1 
ATOM   1085 C CA  . THR A 1 138 ? 7.917   85.050 45.594 1.00 44.68 ? 138  THR A CA  1 
ATOM   1086 C C   . THR A 1 138 ? 8.526   84.285 44.436 1.00 44.95 ? 138  THR A C   1 
ATOM   1087 O O   . THR A 1 138 ? 9.352   84.828 43.701 1.00 45.14 ? 138  THR A O   1 
ATOM   1088 C CB  . THR A 1 138 ? 8.694   84.648 46.878 1.00 44.75 ? 138  THR A CB  1 
ATOM   1089 O OG1 . THR A 1 138 ? 8.127   85.309 48.005 1.00 44.67 ? 138  THR A OG1 1 
ATOM   1090 C CG2 . THR A 1 138 ? 10.128  85.041 46.771 1.00 42.67 ? 138  THR A CG2 1 
ATOM   1091 N N   . GLU A 1 139 ? 8.123   83.027 44.263 1.00 44.24 ? 139  GLU A N   1 
ATOM   1092 C CA  . GLU A 1 139 ? 8.720   82.200 43.219 1.00 43.76 ? 139  GLU A CA  1 
ATOM   1093 C C   . GLU A 1 139 ? 7.889   82.049 41.948 1.00 44.56 ? 139  GLU A C   1 
ATOM   1094 O O   . GLU A 1 139 ? 8.287   81.326 41.026 1.00 43.90 ? 139  GLU A O   1 
ATOM   1095 C CB  . GLU A 1 139 ? 9.059   80.811 43.793 1.00 44.75 ? 139  GLU A CB  1 
ATOM   1096 C CG  . GLU A 1 139 ? 10.165  80.802 44.862 1.00 43.02 ? 139  GLU A CG  1 
ATOM   1097 C CD  . GLU A 1 139 ? 11.494  81.334 44.339 1.00 44.86 ? 139  GLU A CD  1 
ATOM   1098 O OE1 . GLU A 1 139 ? 11.884  80.979 43.197 1.00 46.28 ? 139  GLU A OE1 1 
ATOM   1099 O OE2 . GLU A 1 139 ? 12.162  82.099 45.070 1.00 43.63 ? 139  GLU A OE2 1 
ATOM   1100 N N   . GLU A 1 140 ? 6.741   82.725 41.903 1.00 43.21 ? 140  GLU A N   1 
ATOM   1101 C CA  . GLU A 1 140 ? 5.871   82.674 40.741 1.00 44.88 ? 140  GLU A CA  1 
ATOM   1102 C C   . GLU A 1 140 ? 5.415   81.261 40.388 1.00 45.19 ? 140  GLU A C   1 
ATOM   1103 O O   . GLU A 1 140 ? 5.422   80.889 39.219 1.00 47.00 ? 140  GLU A O   1 
ATOM   1104 C CB  . GLU A 1 140 ? 6.583   83.289 39.528 1.00 44.89 ? 140  GLU A CB  1 
ATOM   1105 N N   . VAL A 1 141 ? 5.043   80.464 41.389 1.00 43.30 ? 141  VAL A N   1 
ATOM   1106 C CA  . VAL A 1 141 ? 4.581   79.114 41.116 1.00 41.53 ? 141  VAL A CA  1 
ATOM   1107 C C   . VAL A 1 141 ? 3.143   79.067 41.561 1.00 41.03 ? 141  VAL A C   1 
ATOM   1108 O O   . VAL A 1 141 ? 2.703   79.915 42.345 1.00 39.67 ? 141  VAL A O   1 
ATOM   1109 C CB  . VAL A 1 141 ? 5.373   77.992 41.927 1.00 42.06 ? 141  VAL A CB  1 
ATOM   1110 C CG1 . VAL A 1 141 ? 6.878   78.045 41.631 1.00 40.19 ? 141  VAL A CG1 1 
ATOM   1111 C CG2 . VAL A 1 141 ? 5.121   78.123 43.418 1.00 41.75 ? 141  VAL A CG2 1 
ATOM   1112 N N   . VAL A 1 142 ? 2.403   78.095 41.033 1.00 40.54 ? 142  VAL A N   1 
ATOM   1113 C CA  . VAL A 1 142 ? 1.018   77.883 41.448 1.00 40.02 ? 142  VAL A CA  1 
ATOM   1114 C C   . VAL A 1 142 ? 1.191   76.915 42.622 1.00 39.41 ? 142  VAL A C   1 
ATOM   1115 O O   . VAL A 1 142 ? 1.773   75.837 42.467 1.00 40.85 ? 142  VAL A O   1 
ATOM   1116 C CB  . VAL A 1 142 ? 0.183   77.225 40.324 1.00 41.08 ? 142  VAL A CB  1 
ATOM   1117 C CG1 . VAL A 1 142 ? -1.159  76.756 40.860 1.00 37.56 ? 142  VAL A CG1 1 
ATOM   1118 C CG2 . VAL A 1 142 ? -0.024  78.233 39.189 1.00 40.18 ? 142  VAL A CG2 1 
ATOM   1119 N N   . LEU A 1 143 ? 0.729   77.314 43.799 1.00 39.16 ? 143  LEU A N   1 
ATOM   1120 C CA  . LEU A 1 143 ? 0.901   76.489 44.982 1.00 39.44 ? 143  LEU A CA  1 
ATOM   1121 C C   . LEU A 1 143 ? -0.403  75.837 45.416 1.00 38.77 ? 143  LEU A C   1 
ATOM   1122 O O   . LEU A 1 143 ? -1.409  76.508 45.684 1.00 39.62 ? 143  LEU A O   1 
ATOM   1123 C CB  . LEU A 1 143 ? 1.479   77.347 46.120 1.00 41.16 ? 143  LEU A CB  1 
ATOM   1124 C CG  . LEU A 1 143 ? 2.109   76.709 47.370 1.00 44.17 ? 143  LEU A CG  1 
ATOM   1125 C CD1 . LEU A 1 143 ? 1.051   75.953 48.168 1.00 43.01 ? 143  LEU A CD1 1 
ATOM   1126 C CD2 . LEU A 1 143 ? 3.247   75.756 46.953 1.00 44.22 ? 143  LEU A CD2 1 
ATOM   1127 N N   . VAL A 1 144 ? -0.384  74.516 45.480 1.00 36.90 ? 144  VAL A N   1 
ATOM   1128 C CA  . VAL A 1 144 ? -1.564  73.783 45.912 1.00 35.07 ? 144  VAL A CA  1 
ATOM   1129 C C   . VAL A 1 144 ? -1.301  73.058 47.240 1.00 35.27 ? 144  VAL A C   1 
ATOM   1130 O O   . VAL A 1 144 ? -0.208  72.520 47.450 1.00 33.25 ? 144  VAL A O   1 
ATOM   1131 C CB  . VAL A 1 144 ? -1.979  72.682 44.867 1.00 34.21 ? 144  VAL A CB  1 
ATOM   1132 C CG1 . VAL A 1 144 ? -3.245  71.966 45.336 1.00 31.06 ? 144  VAL A CG1 1 
ATOM   1133 C CG2 . VAL A 1 144 ? -2.207  73.300 43.482 1.00 33.00 ? 144  VAL A CG2 1 
ATOM   1134 N N   . SER A 1 145 ? -2.279  73.088 48.148 1.00 34.01 ? 145  SER A N   1 
ATOM   1135 C CA  . SER A 1 145 ? -2.157  72.291 49.361 1.00 35.08 ? 145  SER A CA  1 
ATOM   1136 C C   . SER A 1 145 ? -3.415  71.427 49.348 1.00 34.78 ? 145  SER A C   1 
ATOM   1137 O O   . SER A 1 145 ? -4.544  71.913 49.165 1.00 32.25 ? 145  SER A O   1 
ATOM   1138 C CB  . SER A 1 145 ? -2.060  73.130 50.665 1.00 34.77 ? 145  SER A CB  1 
ATOM   1139 O OG  . SER A 1 145 ? -3.214  73.922 50.916 1.00 34.93 ? 145  SER A OG  1 
ATOM   1140 N N   . LEU A 1 146 ? -3.227  70.128 49.519 1.00 35.00 ? 146  LEU A N   1 
ATOM   1141 C CA  . LEU A 1 146 ? -4.372  69.222 49.526 1.00 34.93 ? 146  LEU A CA  1 
ATOM   1142 C C   . LEU A 1 146 ? -4.692  68.793 50.962 1.00 35.02 ? 146  LEU A C   1 
ATOM   1143 O O   . LEU A 1 146 ? -4.057  69.234 51.913 1.00 36.47 ? 146  LEU A O   1 
ATOM   1144 C CB  . LEU A 1 146 ? -4.069  68.002 48.631 1.00 31.66 ? 146  LEU A CB  1 
ATOM   1145 C CG  . LEU A 1 146 ? -2.774  67.210 48.894 1.00 31.90 ? 146  LEU A CG  1 
ATOM   1146 C CD1 . LEU A 1 146 ? -2.872  66.466 50.231 1.00 29.55 ? 146  LEU A CD1 1 
ATOM   1147 C CD2 . LEU A 1 146 ? -2.533  66.199 47.735 1.00 30.34 ? 146  LEU A CD2 1 
ATOM   1148 N N   . SER A 1 147 ? -5.701  67.955 51.121 1.00 35.07 ? 147  SER A N   1 
ATOM   1149 C CA  . SER A 1 147 ? -6.041  67.450 52.432 1.00 35.33 ? 147  SER A CA  1 
ATOM   1150 C C   . SER A 1 147 ? -6.327  65.975 52.214 1.00 34.68 ? 147  SER A C   1 
ATOM   1151 O O   . SER A 1 147 ? -6.411  65.519 51.072 1.00 34.68 ? 147  SER A O   1 
ATOM   1152 C CB  . SER A 1 147 ? -7.276  68.144 52.995 1.00 34.66 ? 147  SER A CB  1 
ATOM   1153 O OG  . SER A 1 147 ? -8.412  67.823 52.209 1.00 41.81 ? 147  SER A OG  1 
ATOM   1154 N N   . TYR A 1 148 ? -6.429  65.230 53.304 1.00 33.39 ? 148  TYR A N   1 
ATOM   1155 C CA  . TYR A 1 148 ? -6.733  63.803 53.242 1.00 33.12 ? 148  TYR A CA  1 
ATOM   1156 C C   . TYR A 1 148 ? -7.097  63.329 54.632 1.00 32.51 ? 148  TYR A C   1 
ATOM   1157 O O   . TYR A 1 148 ? -6.613  63.864 55.647 1.00 32.96 ? 148  TYR A O   1 
ATOM   1158 C CB  . TYR A 1 148 ? -5.552  62.984 52.706 1.00 31.56 ? 148  TYR A CB  1 
ATOM   1159 C CG  . TYR A 1 148 ? -4.305  63.093 53.541 1.00 32.25 ? 148  TYR A CG  1 
ATOM   1160 C CD1 . TYR A 1 148 ? -3.424  64.174 53.393 1.00 30.46 ? 148  TYR A CD1 1 
ATOM   1161 C CD2 . TYR A 1 148 ? -3.998  62.110 54.494 1.00 31.73 ? 148  TYR A CD2 1 
ATOM   1162 C CE1 . TYR A 1 148 ? -2.247  64.272 54.191 1.00 31.79 ? 148  TYR A CE1 1 
ATOM   1163 C CE2 . TYR A 1 148 ? -2.840  62.193 55.278 1.00 31.73 ? 148  TYR A CE2 1 
ATOM   1164 C CZ  . TYR A 1 148 ? -1.971  63.269 55.129 1.00 31.86 ? 148  TYR A CZ  1 
ATOM   1165 O OH  . TYR A 1 148 ? -0.852  63.336 55.936 1.00 29.09 ? 148  TYR A OH  1 
ATOM   1166 N N   . ARG A 1 149 ? -7.986  62.352 54.681 1.00 31.93 ? 149  ARG A N   1 
ATOM   1167 C CA  . ARG A 1 149 ? -8.420  61.802 55.956 1.00 32.86 ? 149  ARG A CA  1 
ATOM   1168 C C   . ARG A 1 149 ? -7.240  61.225 56.771 1.00 31.76 ? 149  ARG A C   1 
ATOM   1169 O O   . ARG A 1 149 ? -6.373  60.526 56.231 1.00 30.92 ? 149  ARG A O   1 
ATOM   1170 C CB  . ARG A 1 149 ? -9.459  60.708 55.712 1.00 32.38 ? 149  ARG A CB  1 
ATOM   1171 C CG  . ARG A 1 149 ? -10.838 61.214 55.274 1.00 32.73 ? 149  ARG A CG  1 
ATOM   1172 C CD  . ARG A 1 149 ? -11.735 60.038 54.833 1.00 32.07 ? 149  ARG A CD  1 
ATOM   1173 N NE  . ARG A 1 149 ? -11.396 59.587 53.482 1.00 32.24 ? 149  ARG A NE  1 
ATOM   1174 C CZ  . ARG A 1 149 ? -11.906 58.507 52.896 1.00 34.32 ? 149  ARG A CZ  1 
ATOM   1175 N NH1 . ARG A 1 149 ? -12.785 57.739 53.545 1.00 33.95 ? 149  ARG A NH1 1 
ATOM   1176 N NH2 . ARG A 1 149 ? -11.558 58.209 51.643 1.00 34.78 ? 149  ARG A NH2 1 
ATOM   1177 N N   . VAL A 1 150 ? -7.227  61.521 58.070 1.00 31.17 ? 150  VAL A N   1 
ATOM   1178 C CA  . VAL A 1 150 ? -6.195  61.012 58.979 1.00 31.19 ? 150  VAL A CA  1 
ATOM   1179 C C   . VAL A 1 150 ? -6.860  60.108 60.032 1.00 32.49 ? 150  VAL A C   1 
ATOM   1180 O O   . VAL A 1 150 ? -8.105  59.953 60.058 1.00 30.78 ? 150  VAL A O   1 
ATOM   1181 C CB  . VAL A 1 150 ? -5.415  62.175 59.701 1.00 31.57 ? 150  VAL A CB  1 
ATOM   1182 C CG1 . VAL A 1 150 ? -4.591  62.997 58.669 1.00 28.54 ? 150  VAL A CG1 1 
ATOM   1183 C CG2 . VAL A 1 150 ? -6.381  63.094 60.436 1.00 27.72 ? 150  VAL A CG2 1 
ATOM   1184 N N   . GLY A 1 151 ? -6.027  59.508 60.882 1.00 32.35 ? 151  GLY A N   1 
ATOM   1185 C CA  . GLY A 1 151 ? -6.521  58.625 61.926 1.00 32.66 ? 151  GLY A CA  1 
ATOM   1186 C C   . GLY A 1 151 ? -7.274  57.420 61.363 1.00 35.46 ? 151  GLY A C   1 
ATOM   1187 O O   . GLY A 1 151 ? -7.021  56.970 60.238 1.00 34.15 ? 151  GLY A O   1 
ATOM   1188 N N   . ALA A 1 152 ? -8.196  56.882 62.154 1.00 35.30 ? 152  ALA A N   1 
ATOM   1189 C CA  . ALA A 1 152 ? -8.984  55.742 61.718 1.00 36.79 ? 152  ALA A CA  1 
ATOM   1190 C C   . ALA A 1 152 ? -9.758  56.066 60.425 1.00 37.26 ? 152  ALA A C   1 
ATOM   1191 O O   . ALA A 1 152 ? -9.927  55.212 59.547 1.00 37.81 ? 152  ALA A O   1 
ATOM   1192 C CB  . ALA A 1 152 ? -9.961  55.346 62.821 1.00 37.40 ? 152  ALA A CB  1 
ATOM   1193 N N   . PHE A 1 153 ? -10.207 57.310 60.312 1.00 35.66 ? 153  PHE A N   1 
ATOM   1194 C CA  . PHE A 1 153 ? -10.978 57.751 59.154 1.00 35.89 ? 153  PHE A CA  1 
ATOM   1195 C C   . PHE A 1 153 ? -10.212 57.567 57.855 1.00 35.79 ? 153  PHE A C   1 
ATOM   1196 O O   . PHE A 1 153 ? -10.813 57.285 56.811 1.00 34.51 ? 153  PHE A O   1 
ATOM   1197 C CB  . PHE A 1 153 ? -11.370 59.223 59.323 1.00 35.97 ? 153  PHE A CB  1 
ATOM   1198 C CG  . PHE A 1 153 ? -12.065 59.503 60.623 1.00 38.70 ? 153  PHE A CG  1 
ATOM   1199 C CD1 . PHE A 1 153 ? -13.443 59.300 60.751 1.00 39.43 ? 153  PHE A CD1 1 
ATOM   1200 C CD2 . PHE A 1 153 ? -11.330 59.912 61.748 1.00 39.57 ? 153  PHE A CD2 1 
ATOM   1201 C CE1 . PHE A 1 153 ? -14.089 59.494 61.972 1.00 40.97 ? 153  PHE A CE1 1 
ATOM   1202 C CE2 . PHE A 1 153 ? -11.949 60.114 62.986 1.00 38.57 ? 153  PHE A CE2 1 
ATOM   1203 C CZ  . PHE A 1 153 ? -13.331 59.908 63.110 1.00 41.98 ? 153  PHE A CZ  1 
ATOM   1204 N N   . GLY A 1 154 ? -8.887  57.731 57.916 1.00 34.76 ? 154  GLY A N   1 
ATOM   1205 C CA  . GLY A 1 154 ? -8.101  57.581 56.717 1.00 33.12 ? 154  GLY A CA  1 
ATOM   1206 C C   . GLY A 1 154 ? -7.315  56.294 56.620 1.00 31.95 ? 154  GLY A C   1 
ATOM   1207 O O   . GLY A 1 154 ? -6.860  55.938 55.533 1.00 34.14 ? 154  GLY A O   1 
ATOM   1208 N N   . PHE A 1 155 ? -7.158  55.573 57.719 1.00 31.67 ? 155  PHE A N   1 
ATOM   1209 C CA  . PHE A 1 155 ? -6.313  54.396 57.662 1.00 31.94 ? 155  PHE A CA  1 
ATOM   1210 C C   . PHE A 1 155 ? -6.751  53.126 58.377 1.00 32.71 ? 155  PHE A C   1 
ATOM   1211 O O   . PHE A 1 155 ? -5.959  52.189 58.502 1.00 29.50 ? 155  PHE A O   1 
ATOM   1212 C CB  . PHE A 1 155 ? -4.895  54.813 58.088 1.00 29.03 ? 155  PHE A CB  1 
ATOM   1213 C CG  . PHE A 1 155 ? -4.294  55.850 57.173 1.00 30.11 ? 155  PHE A CG  1 
ATOM   1214 C CD1 . PHE A 1 155 ? -3.678  55.476 55.985 1.00 29.68 ? 155  PHE A CD1 1 
ATOM   1215 C CD2 . PHE A 1 155 ? -4.455  57.202 57.437 1.00 30.08 ? 155  PHE A CD2 1 
ATOM   1216 C CE1 . PHE A 1 155 ? -3.230  56.425 55.063 1.00 30.64 ? 155  PHE A CE1 1 
ATOM   1217 C CE2 . PHE A 1 155 ? -4.018  58.172 56.530 1.00 31.04 ? 155  PHE A CE2 1 
ATOM   1218 C CZ  . PHE A 1 155 ? -3.399  57.779 55.332 1.00 30.48 ? 155  PHE A CZ  1 
ATOM   1219 N N   . LEU A 1 156 ? -8.000  53.081 58.837 1.00 34.64 ? 156  LEU A N   1 
ATOM   1220 C CA  . LEU A 1 156 ? -8.494  51.855 59.473 1.00 37.13 ? 156  LEU A CA  1 
ATOM   1221 C C   . LEU A 1 156 ? -8.344  50.784 58.386 1.00 38.21 ? 156  LEU A C   1 
ATOM   1222 O O   . LEU A 1 156 ? -8.816  50.971 57.266 1.00 36.67 ? 156  LEU A O   1 
ATOM   1223 C CB  . LEU A 1 156 ? -9.973  51.991 59.828 1.00 38.14 ? 156  LEU A CB  1 
ATOM   1224 C CG  . LEU A 1 156 ? -10.583 50.806 60.584 1.00 39.61 ? 156  LEU A CG  1 
ATOM   1225 C CD1 . LEU A 1 156 ? -10.455 51.060 62.086 1.00 41.14 ? 156  LEU A CD1 1 
ATOM   1226 C CD2 . LEU A 1 156 ? -12.067 50.649 60.197 1.00 39.69 ? 156  LEU A CD2 1 
ATOM   1227 N N   . ALA A 1 157 ? -7.703  49.661 58.688 1.00 38.67 ? 157  ALA A N   1 
ATOM   1228 C CA  . ALA A 1 157 ? -7.527  48.661 57.639 1.00 39.60 ? 157  ALA A CA  1 
ATOM   1229 C C   . ALA A 1 157 ? -7.942  47.225 57.987 1.00 40.83 ? 157  ALA A C   1 
ATOM   1230 O O   . ALA A 1 157 ? -7.376  46.597 58.888 1.00 40.30 ? 157  ALA A O   1 
ATOM   1231 C CB  . ALA A 1 157 ? -6.083  48.673 57.158 1.00 34.65 ? 157  ALA A CB  1 
ATOM   1232 N N   . LEU A 1 158 ? -8.941  46.727 57.258 1.00 40.62 ? 158  LEU A N   1 
ATOM   1233 C CA  . LEU A 1 158 ? -9.435  45.362 57.424 1.00 41.45 ? 158  LEU A CA  1 
ATOM   1234 C C   . LEU A 1 158 ? -9.274  44.745 56.046 1.00 41.88 ? 158  LEU A C   1 
ATOM   1235 O O   . LEU A 1 158 ? -10.220 44.600 55.289 1.00 42.49 ? 158  LEU A O   1 
ATOM   1236 C CB  . LEU A 1 158 ? -10.901 45.364 57.868 1.00 38.97 ? 158  LEU A CB  1 
ATOM   1237 C CG  . LEU A 1 158 ? -11.102 45.795 59.336 1.00 40.98 ? 158  LEU A CG  1 
ATOM   1238 C CD1 . LEU A 1 158 ? -12.584 46.089 59.618 1.00 38.40 ? 158  LEU A CD1 1 
ATOM   1239 C CD2 . LEU A 1 158 ? -10.560 44.703 60.279 1.00 38.05 ? 158  LEU A CD2 1 
ATOM   1240 N N   . HIS A 1 159 ? -8.037  44.417 55.721 1.00 43.33 ? 159  HIS A N   1 
ATOM   1241 C CA  . HIS A 1 159 ? -7.708  43.844 54.433 1.00 45.46 ? 159  HIS A CA  1 
ATOM   1242 C C   . HIS A 1 159 ? -8.649  42.711 54.056 1.00 47.61 ? 159  HIS A C   1 
ATOM   1243 O O   . HIS A 1 159 ? -8.890  41.788 54.848 1.00 46.85 ? 159  HIS A O   1 
ATOM   1244 C CB  . HIS A 1 159 ? -6.293  43.315 54.446 1.00 43.55 ? 159  HIS A CB  1 
ATOM   1245 C CG  . HIS A 1 159 ? -5.793  42.943 53.090 1.00 46.10 ? 159  HIS A CG  1 
ATOM   1246 N ND1 . HIS A 1 159 ? -5.768  43.838 52.039 1.00 47.08 ? 159  HIS A ND1 1 
ATOM   1247 C CD2 . HIS A 1 159 ? -5.286  41.784 52.612 1.00 44.63 ? 159  HIS A CD2 1 
ATOM   1248 C CE1 . HIS A 1 159 ? -5.268  43.244 50.970 1.00 45.08 ? 159  HIS A CE1 1 
ATOM   1249 N NE2 . HIS A 1 159 ? -4.968  41.998 51.291 1.00 46.58 ? 159  HIS A NE2 1 
ATOM   1250 N N   . GLY A 1 160 ? -9.171  42.785 52.836 1.00 48.67 ? 160  GLY A N   1 
ATOM   1251 C CA  . GLY A 1 160 ? -10.095 41.776 52.374 1.00 48.97 ? 160  GLY A CA  1 
ATOM   1252 C C   . GLY A 1 160 ? -11.485 42.346 52.219 1.00 50.35 ? 160  GLY A C   1 
ATOM   1253 O O   . GLY A 1 160 ? -12.226 41.937 51.324 1.00 52.20 ? 160  GLY A O   1 
ATOM   1254 N N   . SER A 1 161 ? -11.863 43.289 53.076 1.00 50.20 ? 161  SER A N   1 
ATOM   1255 C CA  . SER A 1 161 ? -13.192 43.858 52.950 1.00 51.10 ? 161  SER A CA  1 
ATOM   1256 C C   . SER A 1 161 ? -13.080 45.049 52.031 1.00 51.11 ? 161  SER A C   1 
ATOM   1257 O O   . SER A 1 161 ? -12.040 45.698 51.981 1.00 52.91 ? 161  SER A O   1 
ATOM   1258 C CB  . SER A 1 161 ? -13.725 44.307 54.295 1.00 51.05 ? 161  SER A CB  1 
ATOM   1259 O OG  . SER A 1 161 ? -13.139 45.533 54.640 1.00 55.56 ? 161  SER A OG  1 
ATOM   1260 N N   . GLN A 1 162 ? -14.135 45.341 51.289 1.00 49.90 ? 162  GLN A N   1 
ATOM   1261 C CA  . GLN A 1 162 ? -14.062 46.476 50.399 1.00 49.42 ? 162  GLN A CA  1 
ATOM   1262 C C   . GLN A 1 162 ? -14.583 47.702 51.132 1.00 49.23 ? 162  GLN A C   1 
ATOM   1263 O O   . GLN A 1 162 ? -14.424 48.822 50.661 1.00 49.46 ? 162  GLN A O   1 
ATOM   1264 C CB  . GLN A 1 162 ? -14.854 46.208 49.116 1.00 49.23 ? 162  GLN A CB  1 
ATOM   1265 N N   . GLU A 1 163 ? -15.179 47.485 52.301 1.00 48.92 ? 163  GLU A N   1 
ATOM   1266 C CA  . GLU A 1 163 ? -15.712 48.585 53.112 1.00 49.85 ? 163  GLU A CA  1 
ATOM   1267 C C   . GLU A 1 163 ? -14.624 49.436 53.818 1.00 48.46 ? 163  GLU A C   1 
ATOM   1268 O O   . GLU A 1 163 ? -14.737 50.661 53.877 1.00 47.47 ? 163  GLU A O   1 
ATOM   1269 C CB  . GLU A 1 163 ? -16.694 48.041 54.160 1.00 52.80 ? 163  GLU A CB  1 
ATOM   1270 C CG  . GLU A 1 163 ? -17.924 47.347 53.587 1.00 57.22 ? 163  GLU A CG  1 
ATOM   1271 C CD  . GLU A 1 163 ? -18.717 48.247 52.649 1.00 61.12 ? 163  GLU A CD  1 
ATOM   1272 O OE1 . GLU A 1 163 ? -19.071 49.376 53.049 1.00 62.27 ? 163  GLU A OE1 1 
ATOM   1273 O OE2 . GLU A 1 163 ? -18.985 47.822 51.504 1.00 63.38 ? 163  GLU A OE2 1 
ATOM   1274 N N   . ALA A 1 164 ? -13.589 48.789 54.356 1.00 45.54 ? 164  ALA A N   1 
ATOM   1275 C CA  . ALA A 1 164 ? -12.482 49.487 55.037 1.00 44.75 ? 164  ALA A CA  1 
ATOM   1276 C C   . ALA A 1 164 ? -11.211 48.776 54.623 1.00 42.91 ? 164  ALA A C   1 
ATOM   1277 O O   . ALA A 1 164 ? -10.593 48.059 55.418 1.00 44.32 ? 164  ALA A O   1 
ATOM   1278 C CB  . ALA A 1 164 ? -12.652 49.421 56.552 1.00 42.86 ? 164  ALA A CB  1 
ATOM   1279 N N   . PRO A 1 165 ? -10.802 48.973 53.362 1.00 41.74 ? 165  PRO A N   1 
ATOM   1280 C CA  . PRO A 1 165 ? -9.609  48.366 52.758 1.00 39.53 ? 165  PRO A CA  1 
ATOM   1281 C C   . PRO A 1 165 ? -8.287  48.877 53.269 1.00 40.51 ? 165  PRO A C   1 
ATOM   1282 O O   . PRO A 1 165 ? -7.263  48.186 53.158 1.00 40.93 ? 165  PRO A O   1 
ATOM   1283 C CB  . PRO A 1 165 ? -9.781  48.675 51.286 1.00 37.73 ? 165  PRO A CB  1 
ATOM   1284 C CG  . PRO A 1 165 ? -10.429 50.030 51.313 1.00 39.65 ? 165  PRO A CG  1 
ATOM   1285 C CD  . PRO A 1 165 ? -11.451 49.919 52.428 1.00 39.26 ? 165  PRO A CD  1 
ATOM   1286 N N   . GLY A 1 166 ? -8.303  50.086 53.824 1.00 38.14 ? 166  GLY A N   1 
ATOM   1287 C CA  . GLY A 1 166 ? -7.065  50.675 54.292 1.00 38.08 ? 166  GLY A CA  1 
ATOM   1288 C C   . GLY A 1 166 ? -6.494  51.596 53.212 1.00 37.64 ? 166  GLY A C   1 
ATOM   1289 O O   . GLY A 1 166 ? -6.935  51.568 52.042 1.00 36.01 ? 166  GLY A O   1 
ATOM   1290 N N   . ASN A 1 167 ? -5.557  52.447 53.624 1.00 35.32 ? 167  ASN A N   1 
ATOM   1291 C CA  . ASN A 1 167 ? -4.895  53.368 52.726 1.00 33.81 ? 167  ASN A CA  1 
ATOM   1292 C C   . ASN A 1 167 ? -5.800  54.400 52.068 1.00 33.18 ? 167  ASN A C   1 
ATOM   1293 O O   . ASN A 1 167 ? -5.356  55.113 51.154 1.00 33.04 ? 167  ASN A O   1 
ATOM   1294 C CB  . ASN A 1 167 ? -4.159  52.583 51.625 1.00 31.85 ? 167  ASN A CB  1 
ATOM   1295 C CG  . ASN A 1 167 ? -2.976  51.800 52.160 1.00 33.84 ? 167  ASN A CG  1 
ATOM   1296 O OD1 . ASN A 1 167 ? -2.336  52.203 53.140 1.00 33.29 ? 167  ASN A OD1 1 
ATOM   1297 N ND2 . ASN A 1 167 ? -2.647  50.689 51.497 1.00 31.92 ? 167  ASN A ND2 1 
ATOM   1298 N N   . VAL A 1 168 ? -7.048  54.513 52.508 1.00 32.46 ? 168  VAL A N   1 
ATOM   1299 C CA  . VAL A 1 168 ? -7.937  55.467 51.829 1.00 33.05 ? 168  VAL A CA  1 
ATOM   1300 C C   . VAL A 1 168 ? -7.450  56.927 51.915 1.00 32.82 ? 168  VAL A C   1 
ATOM   1301 O O   . VAL A 1 168 ? -7.702  57.721 50.997 1.00 35.59 ? 168  VAL A O   1 
ATOM   1302 C CB  . VAL A 1 168 ? -9.452  55.283 52.280 1.00 33.87 ? 168  VAL A CB  1 
ATOM   1303 C CG1 . VAL A 1 168 ? -9.815  53.766 52.207 1.00 33.32 ? 168  VAL A CG1 1 
ATOM   1304 C CG2 . VAL A 1 168 ? -9.712  55.836 53.681 1.00 30.64 ? 168  VAL A CG2 1 
ATOM   1305 N N   . GLY A 1 169 ? -6.705  57.268 52.971 1.00 32.84 ? 169  GLY A N   1 
ATOM   1306 C CA  . GLY A 1 169 ? -6.154  58.613 53.079 1.00 30.05 ? 169  GLY A CA  1 
ATOM   1307 C C   . GLY A 1 169 ? -5.127  58.854 51.977 1.00 31.13 ? 169  GLY A C   1 
ATOM   1308 O O   . GLY A 1 169 ? -4.980  59.983 51.470 1.00 30.27 ? 169  GLY A O   1 
ATOM   1309 N N   . LEU A 1 170 ? -4.383  57.810 51.610 1.00 30.17 ? 170  LEU A N   1 
ATOM   1310 C CA  . LEU A 1 170 ? -3.411  57.951 50.521 1.00 31.57 ? 170  LEU A CA  1 
ATOM   1311 C C   . LEU A 1 170 ? -4.216  58.073 49.223 1.00 31.75 ? 170  LEU A C   1 
ATOM   1312 O O   . LEU A 1 170 ? -3.825  58.801 48.308 1.00 31.82 ? 170  LEU A O   1 
ATOM   1313 C CB  . LEU A 1 170 ? -2.464  56.744 50.433 1.00 31.05 ? 170  LEU A CB  1 
ATOM   1314 C CG  . LEU A 1 170 ? -1.420  56.593 51.552 1.00 31.36 ? 170  LEU A CG  1 
ATOM   1315 C CD1 . LEU A 1 170 ? -0.814  55.192 51.497 1.00 28.45 ? 170  LEU A CD1 1 
ATOM   1316 C CD2 . LEU A 1 170 ? -0.337  57.679 51.404 1.00 30.59 ? 170  LEU A CD2 1 
ATOM   1317 N N   . LEU A 1 171 ? -5.347  57.376 49.144 1.00 31.39 ? 171  LEU A N   1 
ATOM   1318 C CA  . LEU A 1 171 ? -6.180  57.473 47.938 1.00 33.46 ? 171  LEU A CA  1 
ATOM   1319 C C   . LEU A 1 171 ? -6.766  58.895 47.830 1.00 34.68 ? 171  LEU A C   1 
ATOM   1320 O O   . LEU A 1 171 ? -6.901  59.423 46.723 1.00 31.83 ? 171  LEU A O   1 
ATOM   1321 C CB  . LEU A 1 171 ? -7.290  56.409 47.954 1.00 33.91 ? 171  LEU A CB  1 
ATOM   1322 C CG  . LEU A 1 171 ? -6.766  54.977 47.714 1.00 36.12 ? 171  LEU A CG  1 
ATOM   1323 C CD1 . LEU A 1 171 ? -7.961  54.032 47.684 1.00 34.54 ? 171  LEU A CD1 1 
ATOM   1324 C CD2 . LEU A 1 171 ? -5.936  54.890 46.394 1.00 30.99 ? 171  LEU A CD2 1 
ATOM   1325 N N   . ASP A 1 172 ? -7.084  59.517 48.984 1.00 35.06 ? 172  ASP A N   1 
ATOM   1326 C CA  . ASP A 1 172 ? -7.579  60.896 48.983 1.00 32.77 ? 172  ASP A CA  1 
ATOM   1327 C C   . ASP A 1 172 ? -6.465  61.767 48.345 1.00 33.70 ? 172  ASP A C   1 
ATOM   1328 O O   . ASP A 1 172 ? -6.716  62.633 47.485 1.00 32.25 ? 172  ASP A O   1 
ATOM   1329 C CB  . ASP A 1 172 ? -7.836  61.421 50.413 1.00 31.01 ? 172  ASP A CB  1 
ATOM   1330 C CG  . ASP A 1 172 ? -8.962  60.690 51.145 1.00 31.83 ? 172  ASP A CG  1 
ATOM   1331 O OD1 . ASP A 1 172 ? -9.792  60.013 50.505 1.00 32.74 ? 172  ASP A OD1 1 
ATOM   1332 O OD2 . ASP A 1 172 ? -9.034  60.799 52.390 1.00 33.12 ? 172  ASP A OD2 1 
ATOM   1333 N N   . GLN A 1 173 ? -5.221  61.540 48.761 1.00 33.45 ? 173  GLN A N   1 
ATOM   1334 C CA  . GLN A 1 173 ? -4.151  62.354 48.216 1.00 32.82 ? 173  GLN A CA  1 
ATOM   1335 C C   . GLN A 1 173 ? -4.082  62.150 46.722 1.00 32.51 ? 173  GLN A C   1 
ATOM   1336 O O   . GLN A 1 173 ? -3.966  63.104 45.957 1.00 32.51 ? 173  GLN A O   1 
ATOM   1337 C CB  . GLN A 1 173 ? -2.802  61.992 48.842 1.00 32.76 ? 173  GLN A CB  1 
ATOM   1338 C CG  . GLN A 1 173 ? -2.705  62.239 50.353 1.00 30.74 ? 173  GLN A CG  1 
ATOM   1339 C CD  . GLN A 1 173 ? -1.388  61.715 50.941 1.00 32.64 ? 173  GLN A CD  1 
ATOM   1340 O OE1 . GLN A 1 173 ? -0.431  61.377 50.201 1.00 29.46 ? 173  GLN A OE1 1 
ATOM   1341 N NE2 . GLN A 1 173 ? -1.325  61.656 52.274 1.00 30.65 ? 173  GLN A NE2 1 
ATOM   1342 N N   . ARG A 1 174 ? -4.164  60.891 46.304 1.00 33.58 ? 174  ARG A N   1 
ATOM   1343 C CA  . ARG A 1 174 ? -4.059  60.571 44.889 1.00 33.10 ? 174  ARG A CA  1 
ATOM   1344 C C   . ARG A 1 174 ? -5.177  61.234 44.077 1.00 33.63 ? 174  ARG A C   1 
ATOM   1345 O O   . ARG A 1 174 ? -4.942  61.670 42.951 1.00 31.03 ? 174  ARG A O   1 
ATOM   1346 C CB  . ARG A 1 174 ? -4.090  59.055 44.669 1.00 32.49 ? 174  ARG A CB  1 
ATOM   1347 C CG  . ARG A 1 174 ? -4.089  58.677 43.170 1.00 33.02 ? 174  ARG A CG  1 
ATOM   1348 C CD  . ARG A 1 174 ? -4.237  57.174 42.964 1.00 33.19 ? 174  ARG A CD  1 
ATOM   1349 N NE  . ARG A 1 174 ? -3.045  56.472 43.411 1.00 35.12 ? 174  ARG A NE  1 
ATOM   1350 C CZ  . ARG A 1 174 ? -2.927  55.152 43.535 1.00 36.41 ? 174  ARG A CZ  1 
ATOM   1351 N NH1 . ARG A 1 174 ? -3.927  54.322 43.253 1.00 36.58 ? 174  ARG A NH1 1 
ATOM   1352 N NH2 . ARG A 1 174 ? -1.778  54.657 43.936 1.00 39.82 ? 174  ARG A NH2 1 
ATOM   1353 N N   . MET A 1 175 ? -6.386  61.293 44.642 1.00 32.87 ? 175  MET A N   1 
ATOM   1354 C CA  . MET A 1 175 ? -7.500  61.922 43.943 1.00 34.93 ? 175  MET A CA  1 
ATOM   1355 C C   . MET A 1 175 ? -7.234  63.409 43.768 1.00 34.88 ? 175  MET A C   1 
ATOM   1356 O O   . MET A 1 175 ? -7.499  63.975 42.709 1.00 34.95 ? 175  MET A O   1 
ATOM   1357 C CB  . MET A 1 175 ? -8.821  61.717 44.692 1.00 36.46 ? 175  MET A CB  1 
ATOM   1358 C CG  . MET A 1 175 ? -10.056 62.008 43.787 1.00 39.22 ? 175  MET A CG  1 
ATOM   1359 S SD  . MET A 1 175 ? -11.574 61.154 44.323 1.00 44.82 ? 175  MET A SD  1 
ATOM   1360 C CE  . MET A 1 175 ? -11.328 59.607 43.522 1.00 35.95 ? 175  MET A CE  1 
ATOM   1361 N N   . ALA A 1 176 ? -6.704  64.046 44.804 1.00 33.22 ? 176  ALA A N   1 
ATOM   1362 C CA  . ALA A 1 176 ? -6.409  65.463 44.699 1.00 33.03 ? 176  ALA A CA  1 
ATOM   1363 C C   . ALA A 1 176 ? -5.309  65.640 43.644 1.00 32.60 ? 176  ALA A C   1 
ATOM   1364 O O   . ALA A 1 176 ? -5.349  66.563 42.847 1.00 33.05 ? 176  ALA A O   1 
ATOM   1365 C CB  . ALA A 1 176 ? -5.973  66.023 46.073 1.00 30.97 ? 176  ALA A CB  1 
ATOM   1366 N N   . LEU A 1 177 ? -4.330  64.747 43.613 1.00 33.72 ? 177  LEU A N   1 
ATOM   1367 C CA  . LEU A 1 177 ? -3.269  64.878 42.606 1.00 34.32 ? 177  LEU A CA  1 
ATOM   1368 C C   . LEU A 1 177 ? -3.854  64.700 41.208 1.00 34.54 ? 177  LEU A C   1 
ATOM   1369 O O   . LEU A 1 177 ? -3.381  65.310 40.243 1.00 33.19 ? 177  LEU A O   1 
ATOM   1370 C CB  . LEU A 1 177 ? -2.168  63.844 42.820 1.00 34.31 ? 177  LEU A CB  1 
ATOM   1371 C CG  . LEU A 1 177 ? -1.327  63.967 44.086 1.00 37.91 ? 177  LEU A CG  1 
ATOM   1372 C CD1 . LEU A 1 177 ? -0.285  62.834 44.071 1.00 38.75 ? 177  LEU A CD1 1 
ATOM   1373 C CD2 . LEU A 1 177 ? -0.628  65.331 44.163 1.00 38.97 ? 177  LEU A CD2 1 
ATOM   1374 N N   . GLN A 1 178 ? -4.884  63.862 41.106 1.00 34.90 ? 178  GLN A N   1 
ATOM   1375 C CA  . GLN A 1 178 ? -5.529  63.613 39.834 1.00 36.34 ? 178  GLN A CA  1 
ATOM   1376 C C   . GLN A 1 178 ? -6.279  64.867 39.393 1.00 35.52 ? 178  GLN A C   1 
ATOM   1377 O O   . GLN A 1 178 ? -6.227  65.258 38.232 1.00 35.75 ? 178  GLN A O   1 
ATOM   1378 C CB  . GLN A 1 178 ? -6.507  62.431 39.948 1.00 37.67 ? 178  GLN A CB  1 
ATOM   1379 C CG  . GLN A 1 178 ? -7.262  62.104 38.624 1.00 41.08 ? 178  GLN A CG  1 
ATOM   1380 C CD  . GLN A 1 178 ? -6.364  61.439 37.574 1.00 44.20 ? 178  GLN A CD  1 
ATOM   1381 O OE1 . GLN A 1 178 ? -6.003  60.278 37.714 1.00 47.73 ? 178  GLN A OE1 1 
ATOM   1382 N NE2 . GLN A 1 178 ? -5.999  62.178 36.526 1.00 46.43 ? 178  GLN A NE2 1 
ATOM   1383 N N   . TRP A 1 179 ? -6.970  65.496 40.328 1.00 35.15 ? 179  TRP A N   1 
ATOM   1384 C CA  . TRP A 1 179 ? -7.728  66.702 40.022 1.00 34.91 ? 179  TRP A CA  1 
ATOM   1385 C C   . TRP A 1 179 ? -6.756  67.784 39.555 1.00 36.07 ? 179  TRP A C   1 
ATOM   1386 O O   . TRP A 1 179 ? -7.000  68.485 38.559 1.00 36.30 ? 179  TRP A O   1 
ATOM   1387 C CB  . TRP A 1 179 ? -8.482  67.156 41.262 1.00 34.23 ? 179  TRP A CB  1 
ATOM   1388 C CG  . TRP A 1 179 ? -9.524  68.170 40.981 1.00 37.24 ? 179  TRP A CG  1 
ATOM   1389 C CD1 . TRP A 1 179 ? -10.848 67.943 40.691 1.00 37.59 ? 179  TRP A CD1 1 
ATOM   1390 C CD2 . TRP A 1 179 ? -9.333  69.591 40.906 1.00 36.37 ? 179  TRP A CD2 1 
ATOM   1391 N NE1 . TRP A 1 179 ? -11.488 69.143 40.435 1.00 36.66 ? 179  TRP A NE1 1 
ATOM   1392 C CE2 . TRP A 1 179 ? -10.583 70.166 40.557 1.00 36.46 ? 179  TRP A CE2 1 
ATOM   1393 C CE3 . TRP A 1 179 ? -8.227  70.431 41.089 1.00 33.76 ? 179  TRP A CE3 1 
ATOM   1394 C CZ2 . TRP A 1 179 ? -10.756 71.551 40.391 1.00 34.94 ? 179  TRP A CZ2 1 
ATOM   1395 C CZ3 . TRP A 1 179 ? -8.401  71.808 40.923 1.00 36.25 ? 179  TRP A CZ3 1 
ATOM   1396 C CH2 . TRP A 1 179 ? -9.658  72.350 40.575 1.00 35.61 ? 179  TRP A CH2 1 
ATOM   1397 N N   . VAL A 1 180 ? -5.643  67.912 40.270 1.00 36.13 ? 180  VAL A N   1 
ATOM   1398 C CA  . VAL A 1 180 ? -4.615  68.882 39.914 1.00 35.70 ? 180  VAL A CA  1 
ATOM   1399 C C   . VAL A 1 180 ? -4.087  68.566 38.509 1.00 36.67 ? 180  VAL A C   1 
ATOM   1400 O O   . VAL A 1 180 ? -3.902  69.463 37.665 1.00 36.39 ? 180  VAL A O   1 
ATOM   1401 C CB  . VAL A 1 180 ? -3.440  68.835 40.930 1.00 33.49 ? 180  VAL A CB  1 
ATOM   1402 C CG1 . VAL A 1 180 ? -2.207  69.566 40.377 1.00 30.56 ? 180  VAL A CG1 1 
ATOM   1403 C CG2 . VAL A 1 180 ? -3.876  69.467 42.217 1.00 33.66 ? 180  VAL A CG2 1 
ATOM   1404 N N   . HIS A 1 181 ? -3.847  67.287 38.255 1.00 38.24 ? 181  HIS A N   1 
ATOM   1405 C CA  . HIS A 1 181 ? -3.336  66.892 36.955 1.00 38.84 ? 181  HIS A CA  1 
ATOM   1406 C C   . HIS A 1 181 ? -4.322  67.236 35.856 1.00 38.43 ? 181  HIS A C   1 
ATOM   1407 O O   . HIS A 1 181 ? -3.934  67.658 34.766 1.00 38.94 ? 181  HIS A O   1 
ATOM   1408 C CB  . HIS A 1 181 ? -3.027  65.398 36.923 1.00 41.69 ? 181  HIS A CB  1 
ATOM   1409 C CG  . HIS A 1 181 ? -2.060  65.018 35.844 1.00 45.49 ? 181  HIS A CG  1 
ATOM   1410 N ND1 . HIS A 1 181 ? -2.453  64.412 34.666 1.00 44.71 ? 181  HIS A ND1 1 
ATOM   1411 C CD2 . HIS A 1 181 ? -0.724  65.220 35.738 1.00 46.11 ? 181  HIS A CD2 1 
ATOM   1412 C CE1 . HIS A 1 181 ? -1.401  64.257 33.882 1.00 47.24 ? 181  HIS A CE1 1 
ATOM   1413 N NE2 . HIS A 1 181 ? -0.338  64.738 34.507 1.00 48.63 ? 181  HIS A NE2 1 
ATOM   1414 N N   . ASP A 1 182 ? -5.604  67.082 36.156 1.00 37.65 ? 182  ASP A N   1 
ATOM   1415 C CA  . ASP A 1 182 ? -6.653  67.357 35.187 1.00 37.85 ? 182  ASP A CA  1 
ATOM   1416 C C   . ASP A 1 182 ? -7.069  68.827 35.057 1.00 39.55 ? 182  ASP A C   1 
ATOM   1417 O O   . ASP A 1 182 ? -7.489  69.260 33.980 1.00 40.78 ? 182  ASP A O   1 
ATOM   1418 C CB  . ASP A 1 182 ? -7.900  66.547 35.525 1.00 36.26 ? 182  ASP A CB  1 
ATOM   1419 C CG  . ASP A 1 182 ? -7.709  65.053 35.314 1.00 39.00 ? 182  ASP A CG  1 
ATOM   1420 O OD1 . ASP A 1 182 ? -6.756  64.619 34.612 1.00 40.54 ? 182  ASP A OD1 1 
ATOM   1421 O OD2 . ASP A 1 182 ? -8.547  64.299 35.830 1.00 39.93 ? 182  ASP A OD2 1 
ATOM   1422 N N   . ASN A 1 183 ? -6.929  69.604 36.124 1.00 37.77 ? 183  ASN A N   1 
ATOM   1423 C CA  . ASN A 1 183 ? -7.384  70.981 36.076 1.00 37.81 ? 183  ASN A CA  1 
ATOM   1424 C C   . ASN A 1 183 ? -6.410  72.111 36.305 1.00 37.72 ? 183  ASN A C   1 
ATOM   1425 O O   . ASN A 1 183 ? -6.717  73.243 35.961 1.00 39.63 ? 183  ASN A O   1 
ATOM   1426 C CB  . ASN A 1 183 ? -8.536  71.136 37.070 1.00 37.80 ? 183  ASN A CB  1 
ATOM   1427 C CG  . ASN A 1 183 ? -9.706  70.217 36.747 1.00 37.79 ? 183  ASN A CG  1 
ATOM   1428 O OD1 . ASN A 1 183 ? -10.540 70.520 35.887 1.00 36.68 ? 183  ASN A OD1 1 
ATOM   1429 N ND2 . ASN A 1 183 ? -9.760  69.082 37.421 1.00 34.10 ? 183  ASN A ND2 1 
ATOM   1430 N N   . ILE A 1 184 ? -5.237  71.841 36.870 1.00 38.77 ? 184  ILE A N   1 
ATOM   1431 C CA  . ILE A 1 184 ? -4.319  72.932 37.160 1.00 36.41 ? 184  ILE A CA  1 
ATOM   1432 C C   . ILE A 1 184 ? -3.996  73.841 35.971 1.00 37.97 ? 184  ILE A C   1 
ATOM   1433 O O   . ILE A 1 184 ? -3.621  75.003 36.164 1.00 38.14 ? 184  ILE A O   1 
ATOM   1434 C CB  . ILE A 1 184 ? -3.019  72.409 37.844 1.00 35.15 ? 184  ILE A CB  1 
ATOM   1435 C CG1 . ILE A 1 184 ? -2.473  73.510 38.752 1.00 34.92 ? 184  ILE A CG1 1 
ATOM   1436 C CG2 . ILE A 1 184 ? -1.982  71.957 36.830 1.00 31.29 ? 184  ILE A CG2 1 
ATOM   1437 C CD1 . ILE A 1 184 ? -3.432  73.815 39.928 1.00 35.93 ? 184  ILE A CD1 1 
ATOM   1438 N N   . GLN A 1 185 ? -4.153  73.332 34.746 1.00 37.08 ? 185  GLN A N   1 
ATOM   1439 C CA  . GLN A 1 185 ? -3.873  74.149 33.560 1.00 37.98 ? 185  GLN A CA  1 
ATOM   1440 C C   . GLN A 1 185 ? -4.808  75.357 33.519 1.00 37.69 ? 185  GLN A C   1 
ATOM   1441 O O   . GLN A 1 185 ? -4.437  76.413 33.027 1.00 35.95 ? 185  GLN A O   1 
ATOM   1442 C CB  . GLN A 1 185 ? -4.047  73.349 32.262 1.00 35.64 ? 185  GLN A CB  1 
ATOM   1443 C CG  . GLN A 1 185 ? -5.488  73.110 31.866 1.00 37.91 ? 185  GLN A CG  1 
ATOM   1444 C CD  . GLN A 1 185 ? -5.658  71.876 30.960 1.00 39.33 ? 185  GLN A CD  1 
ATOM   1445 O OE1 . GLN A 1 185 ? -5.428  70.752 31.399 1.00 40.23 ? 185  GLN A OE1 1 
ATOM   1446 N NE2 . GLN A 1 185 ? -6.061  72.086 29.707 1.00 34.51 ? 185  GLN A NE2 1 
ATOM   1447 N N   . PHE A 1 186 ? -6.011  75.191 34.047 1.00 35.78 ? 186  PHE A N   1 
ATOM   1448 C CA  . PHE A 1 186 ? -6.968  76.278 34.042 1.00 38.33 ? 186  PHE A CA  1 
ATOM   1449 C C   . PHE A 1 186 ? -6.604  77.428 34.981 1.00 40.43 ? 186  PHE A C   1 
ATOM   1450 O O   . PHE A 1 186 ? -7.144  78.535 34.845 1.00 42.01 ? 186  PHE A O   1 
ATOM   1451 C CB  . PHE A 1 186 ? -8.367  75.726 34.335 1.00 35.84 ? 186  PHE A CB  1 
ATOM   1452 C CG  . PHE A 1 186 ? -8.792  74.654 33.358 1.00 37.82 ? 186  PHE A CG  1 
ATOM   1453 C CD1 . PHE A 1 186 ? -8.776  74.904 31.984 1.00 38.02 ? 186  PHE A CD1 1 
ATOM   1454 C CD2 . PHE A 1 186 ? -9.136  73.376 33.800 1.00 37.31 ? 186  PHE A CD2 1 
ATOM   1455 C CE1 . PHE A 1 186 ? -9.092  73.890 31.057 1.00 37.92 ? 186  PHE A CE1 1 
ATOM   1456 C CE2 . PHE A 1 186 ? -9.448  72.363 32.902 1.00 39.54 ? 186  PHE A CE2 1 
ATOM   1457 C CZ  . PHE A 1 186 ? -9.427  72.612 31.515 1.00 39.45 ? 186  PHE A CZ  1 
ATOM   1458 N N   . PHE A 1 187 ? -5.679  77.171 35.914 1.00 39.83 ? 187  PHE A N   1 
ATOM   1459 C CA  . PHE A 1 187 ? -5.231  78.184 36.862 1.00 37.42 ? 187  PHE A CA  1 
ATOM   1460 C C   . PHE A 1 187 ? -3.837  78.665 36.453 1.00 37.56 ? 187  PHE A C   1 
ATOM   1461 O O   . PHE A 1 187 ? -3.177  79.381 37.194 1.00 35.36 ? 187  PHE A O   1 
ATOM   1462 C CB  . PHE A 1 187 ? -5.180  77.622 38.285 1.00 36.01 ? 187  PHE A CB  1 
ATOM   1463 C CG  . PHE A 1 187 ? -6.518  77.168 38.814 1.00 37.33 ? 187  PHE A CG  1 
ATOM   1464 C CD1 . PHE A 1 187 ? -7.043  75.926 38.461 1.00 36.03 ? 187  PHE A CD1 1 
ATOM   1465 C CD2 . PHE A 1 187 ? -7.239  77.971 39.697 1.00 36.66 ? 187  PHE A CD2 1 
ATOM   1466 C CE1 . PHE A 1 187 ? -8.258  75.491 38.985 1.00 37.70 ? 187  PHE A CE1 1 
ATOM   1467 C CE2 . PHE A 1 187 ? -8.462  77.549 40.231 1.00 35.93 ? 187  PHE A CE2 1 
ATOM   1468 C CZ  . PHE A 1 187 ? -8.978  76.304 39.877 1.00 35.04 ? 187  PHE A CZ  1 
ATOM   1469 N N   . GLY A 1 188 ? -3.395  78.255 35.268 1.00 36.49 ? 188  GLY A N   1 
ATOM   1470 C CA  . GLY A 1 188 ? -2.093  78.671 34.793 1.00 36.93 ? 188  GLY A CA  1 
ATOM   1471 C C   . GLY A 1 188 ? -0.940  77.762 35.161 1.00 38.00 ? 188  GLY A C   1 
ATOM   1472 O O   . GLY A 1 188 ? 0.223   78.117 34.944 1.00 38.27 ? 188  GLY A O   1 
ATOM   1473 N N   . GLY A 1 189 ? -1.246  76.589 35.714 1.00 38.06 ? 189  GLY A N   1 
ATOM   1474 C CA  . GLY A 1 189 ? -0.189  75.664 36.079 1.00 36.81 ? 189  GLY A CA  1 
ATOM   1475 C C   . GLY A 1 189 ? 0.069   74.637 34.981 1.00 36.77 ? 189  GLY A C   1 
ATOM   1476 O O   . GLY A 1 189 ? -0.849  74.282 34.252 1.00 36.69 ? 189  GLY A O   1 
ATOM   1477 N N   . ASP A 1 190 ? 1.317   74.196 34.847 1.00 34.90 ? 190  ASP A N   1 
ATOM   1478 C CA  . ASP A 1 190 ? 1.690   73.165 33.881 1.00 36.88 ? 190  ASP A CA  1 
ATOM   1479 C C   . ASP A 1 190 ? 1.509   71.794 34.557 1.00 36.23 ? 190  ASP A C   1 
ATOM   1480 O O   . ASP A 1 190 ? 2.289   71.390 35.412 1.00 39.00 ? 190  ASP A O   1 
ATOM   1481 C CB  . ASP A 1 190 ? 3.145   73.350 33.436 1.00 35.96 ? 190  ASP A CB  1 
ATOM   1482 C CG  . ASP A 1 190 ? 3.630   72.226 32.510 1.00 39.14 ? 190  ASP A CG  1 
ATOM   1483 O OD1 . ASP A 1 190 ? 2.853   71.290 32.180 1.00 40.49 ? 190  ASP A OD1 1 
ATOM   1484 O OD2 . ASP A 1 190 ? 4.809   72.268 32.111 1.00 38.37 ? 190  ASP A OD2 1 
ATOM   1485 N N   . PRO A 1 191 ? 0.480   71.053 34.167 1.00 36.95 ? 191  PRO A N   1 
ATOM   1486 C CA  . PRO A 1 191 ? 0.272   69.746 34.793 1.00 36.55 ? 191  PRO A CA  1 
ATOM   1487 C C   . PRO A 1 191 ? 1.407   68.734 34.564 1.00 38.40 ? 191  PRO A C   1 
ATOM   1488 O O   . PRO A 1 191 ? 1.423   67.672 35.196 1.00 38.99 ? 191  PRO A O   1 
ATOM   1489 C CB  . PRO A 1 191 ? -1.061  69.297 34.207 1.00 36.13 ? 191  PRO A CB  1 
ATOM   1490 C CG  . PRO A 1 191 ? -1.010  69.916 32.798 1.00 36.43 ? 191  PRO A CG  1 
ATOM   1491 C CD  . PRO A 1 191 ? -0.469  71.289 33.064 1.00 37.10 ? 191  PRO A CD  1 
ATOM   1492 N N   . LYS A 1 192 ? 2.368   69.059 33.697 1.00 38.77 ? 192  LYS A N   1 
ATOM   1493 C CA  . LYS A 1 192 ? 3.477   68.137 33.436 1.00 40.35 ? 192  LYS A CA  1 
ATOM   1494 C C   . LYS A 1 192 ? 4.705   68.542 34.239 1.00 40.18 ? 192  LYS A C   1 
ATOM   1495 O O   . LYS A 1 192 ? 5.769   67.911 34.163 1.00 38.27 ? 192  LYS A O   1 
ATOM   1496 C CB  . LYS A 1 192 ? 3.823   68.097 31.933 1.00 43.41 ? 192  LYS A CB  1 
ATOM   1497 C CG  . LYS A 1 192 ? 2.661   67.642 31.042 1.00 50.15 ? 192  LYS A CG  1 
ATOM   1498 C CD  . LYS A 1 192 ? 2.104   66.274 31.462 1.00 53.73 ? 192  LYS A CD  1 
ATOM   1499 C CE  . LYS A 1 192 ? 0.906   65.843 30.593 1.00 57.63 ? 192  LYS A CE  1 
ATOM   1500 N NZ  . LYS A 1 192 ? -0.264  66.760 30.745 1.00 58.30 ? 192  LYS A NZ  1 
ATOM   1501 N N   . THR A 1 193 ? 4.561   69.603 35.015 1.00 38.43 ? 193  THR A N   1 
ATOM   1502 C CA  . THR A 1 193 ? 5.673   70.033 35.822 1.00 38.68 ? 193  THR A CA  1 
ATOM   1503 C C   . THR A 1 193 ? 5.186   70.253 37.248 1.00 38.20 ? 193  THR A C   1 
ATOM   1504 O O   . THR A 1 193 ? 5.310   71.358 37.808 1.00 38.70 ? 193  THR A O   1 
ATOM   1505 C CB  . THR A 1 193 ? 6.288   71.309 35.235 1.00 40.59 ? 193  THR A CB  1 
ATOM   1506 O OG1 . THR A 1 193 ? 6.614   71.069 33.858 1.00 40.53 ? 193  THR A OG1 1 
ATOM   1507 C CG2 . THR A 1 193 ? 7.555   71.681 35.979 1.00 38.37 ? 193  THR A CG2 1 
ATOM   1508 N N   . VAL A 1 194 ? 4.598   69.191 37.808 1.00 35.58 ? 194  VAL A N   1 
ATOM   1509 C CA  . VAL A 1 194 ? 4.088   69.190 39.177 1.00 33.83 ? 194  VAL A CA  1 
ATOM   1510 C C   . VAL A 1 194 ? 5.054   68.503 40.129 1.00 34.80 ? 194  VAL A C   1 
ATOM   1511 O O   . VAL A 1 194 ? 5.490   67.367 39.893 1.00 37.44 ? 194  VAL A O   1 
ATOM   1512 C CB  . VAL A 1 194 ? 2.747   68.438 39.300 1.00 33.70 ? 194  VAL A CB  1 
ATOM   1513 C CG1 . VAL A 1 194 ? 2.359   68.316 40.768 1.00 32.42 ? 194  VAL A CG1 1 
ATOM   1514 C CG2 . VAL A 1 194 ? 1.660   69.160 38.517 1.00 32.13 ? 194  VAL A CG2 1 
ATOM   1515 N N   . THR A 1 195 ? 5.392   69.194 41.205 1.00 34.86 ? 195  THR A N   1 
ATOM   1516 C CA  . THR A 1 195 ? 6.274   68.644 42.211 1.00 32.71 ? 195  THR A CA  1 
ATOM   1517 C C   . THR A 1 195 ? 5.462   68.434 43.479 1.00 32.39 ? 195  THR A C   1 
ATOM   1518 O O   . THR A 1 195 ? 4.835   69.388 43.975 1.00 33.42 ? 195  THR A O   1 
ATOM   1519 C CB  . THR A 1 195 ? 7.459   69.605 42.525 1.00 31.99 ? 195  THR A CB  1 
ATOM   1520 O OG1 . THR A 1 195 ? 8.355   69.611 41.418 1.00 33.00 ? 195  THR A OG1 1 
ATOM   1521 C CG2 . THR A 1 195 ? 8.263   69.135 43.770 1.00 31.41 ? 195  THR A CG2 1 
ATOM   1522 N N   . ILE A 1 196 ? 5.421   67.199 43.985 1.00 30.15 ? 196  ILE A N   1 
ATOM   1523 C CA  . ILE A 1 196 ? 4.735   66.985 45.260 1.00 29.87 ? 196  ILE A CA  1 
ATOM   1524 C C   . ILE A 1 196 ? 5.795   67.124 46.367 1.00 29.73 ? 196  ILE A C   1 
ATOM   1525 O O   . ILE A 1 196 ? 6.952   66.716 46.200 1.00 28.80 ? 196  ILE A O   1 
ATOM   1526 C CB  . ILE A 1 196 ? 4.043   65.606 45.353 1.00 31.38 ? 196  ILE A CB  1 
ATOM   1527 C CG1 . ILE A 1 196 ? 5.033   64.477 45.073 1.00 31.82 ? 196  ILE A CG1 1 
ATOM   1528 C CG2 . ILE A 1 196 ? 2.863   65.561 44.385 1.00 30.60 ? 196  ILE A CG2 1 
ATOM   1529 C CD1 . ILE A 1 196 ? 4.401   63.105 45.225 1.00 33.39 ? 196  ILE A CD1 1 
ATOM   1530 N N   . PHE A 1 197 ? 5.436   67.786 47.460 1.00 30.86 ? 197  PHE A N   1 
ATOM   1531 C CA  . PHE A 1 197 ? 6.379   67.940 48.552 1.00 29.85 ? 197  PHE A CA  1 
ATOM   1532 C C   . PHE A 1 197 ? 5.645   67.862 49.859 1.00 29.77 ? 197  PHE A C   1 
ATOM   1533 O O   . PHE A 1 197 ? 4.493   68.255 49.951 1.00 30.52 ? 197  PHE A O   1 
ATOM   1534 C CB  . PHE A 1 197 ? 7.217   69.229 48.408 1.00 30.77 ? 197  PHE A CB  1 
ATOM   1535 C CG  . PHE A 1 197 ? 6.485   70.521 48.691 1.00 32.74 ? 197  PHE A CG  1 
ATOM   1536 C CD1 . PHE A 1 197 ? 5.311   70.860 48.009 1.00 31.61 ? 197  PHE A CD1 1 
ATOM   1537 C CD2 . PHE A 1 197 ? 7.054   71.471 49.557 1.00 32.70 ? 197  PHE A CD2 1 
ATOM   1538 C CE1 . PHE A 1 197 ? 4.716   72.129 48.179 1.00 33.18 ? 197  PHE A CE1 1 
ATOM   1539 C CE2 . PHE A 1 197 ? 6.468   72.757 49.742 1.00 32.60 ? 197  PHE A CE2 1 
ATOM   1540 C CZ  . PHE A 1 197 ? 5.301   73.089 49.055 1.00 32.07 ? 197  PHE A CZ  1 
ATOM   1541 N N   . GLY A 1 198 ? 6.291   67.300 50.869 1.00 30.81 ? 198  GLY A N   1 
ATOM   1542 C CA  . GLY A 1 198 ? 5.632   67.166 52.156 1.00 30.85 ? 198  GLY A CA  1 
ATOM   1543 C C   . GLY A 1 198 ? 6.627   66.895 53.264 1.00 31.05 ? 198  GLY A C   1 
ATOM   1544 O O   . GLY A 1 198 ? 7.777   66.518 53.013 1.00 30.06 ? 198  GLY A O   1 
ATOM   1545 N N   . GLU A 1 199 ? 6.191   67.098 54.504 1.00 31.14 ? 199  GLU A N   1 
ATOM   1546 C CA  . GLU A 1 199 ? 7.077   66.903 55.638 1.00 30.32 ? 199  GLU A CA  1 
ATOM   1547 C C   . GLU A 1 199 ? 6.563   65.806 56.559 1.00 29.81 ? 199  GLU A C   1 
ATOM   1548 O O   . GLU A 1 199 ? 5.351   65.652 56.729 1.00 30.44 ? 199  GLU A O   1 
ATOM   1549 C CB  . GLU A 1 199 ? 7.226   68.234 56.400 1.00 29.60 ? 199  GLU A CB  1 
ATOM   1550 C CG  . GLU A 1 199 ? 8.236   68.208 57.559 1.00 30.64 ? 199  GLU A CG  1 
ATOM   1551 C CD  . GLU A 1 199 ? 7.598   67.814 58.886 1.00 33.81 ? 199  GLU A CD  1 
ATOM   1552 O OE1 . GLU A 1 199 ? 6.355   67.781 58.931 1.00 32.69 ? 199  GLU A OE1 1 
ATOM   1553 O OE2 . GLU A 1 199 ? 8.331   67.553 59.877 1.00 33.36 ? 199  GLU A OE2 1 
ATOM   1554 N N   . SER A 1 200 ? 7.492   65.072 57.167 1.00 29.43 ? 200  SER A N   1 
ATOM   1555 C CA  . SER A 1 200 ? 7.171   63.980 58.078 1.00 30.20 ? 200  SER A CA  1 
ATOM   1556 C C   . SER A 1 200 ? 6.242   62.970 57.363 1.00 29.79 ? 200  SER A C   1 
ATOM   1557 O O   . SER A 1 200 ? 6.631   62.421 56.335 1.00 31.54 ? 200  SER A O   1 
ATOM   1558 C CB  . SER A 1 200 ? 6.543   64.546 59.363 1.00 30.98 ? 200  SER A CB  1 
ATOM   1559 O OG  . SER A 1 200 ? 6.560   63.583 60.418 1.00 33.54 ? 200  SER A OG  1 
ATOM   1560 N N   . ALA A 1 201 ? 5.034   62.725 57.870 1.00 28.59 ? 201  ALA A N   1 
ATOM   1561 C CA  . ALA A 1 201 ? 4.123   61.782 57.196 1.00 29.49 ? 201  ALA A CA  1 
ATOM   1562 C C   . ALA A 1 201 ? 3.841   62.237 55.751 1.00 30.00 ? 201  ALA A C   1 
ATOM   1563 O O   . ALA A 1 201 ? 3.502   61.416 54.886 1.00 29.17 ? 201  ALA A O   1 
ATOM   1564 C CB  . ALA A 1 201 ? 2.795   61.630 57.980 1.00 27.26 ? 201  ALA A CB  1 
ATOM   1565 N N   . GLY A 1 202 ? 3.992   63.545 55.515 1.00 29.64 ? 202  GLY A N   1 
ATOM   1566 C CA  . GLY A 1 202 ? 3.815   64.112 54.191 1.00 29.92 ? 202  GLY A CA  1 
ATOM   1567 C C   . GLY A 1 202 ? 5.015   63.694 53.350 1.00 31.37 ? 202  GLY A C   1 
ATOM   1568 O O   . GLY A 1 202 ? 4.888   63.434 52.139 1.00 30.70 ? 202  GLY A O   1 
ATOM   1569 N N   . GLY A 1 203 ? 6.189   63.620 53.983 1.00 30.64 ? 203  GLY A N   1 
ATOM   1570 C CA  . GLY A 1 203 ? 7.373   63.183 53.261 1.00 30.30 ? 203  GLY A CA  1 
ATOM   1571 C C   . GLY A 1 203 ? 7.282   61.684 52.955 1.00 31.99 ? 203  GLY A C   1 
ATOM   1572 O O   . GLY A 1 203 ? 7.652   61.230 51.863 1.00 30.51 ? 203  GLY A O   1 
ATOM   1573 N N   . ALA A 1 204 ? 6.788   60.902 53.920 1.00 30.84 ? 204  ALA A N   1 
ATOM   1574 C CA  . ALA A 1 204 ? 6.619   59.466 53.704 1.00 30.85 ? 204  ALA A CA  1 
ATOM   1575 C C   . ALA A 1 204 ? 5.564   59.273 52.592 1.00 32.06 ? 204  ALA A C   1 
ATOM   1576 O O   . ALA A 1 204 ? 5.739   58.417 51.711 1.00 32.39 ? 204  ALA A O   1 
ATOM   1577 C CB  . ALA A 1 204 ? 6.169   58.775 55.003 1.00 30.30 ? 204  ALA A CB  1 
ATOM   1578 N N   . SER A 1 205 ? 4.481   60.060 52.641 1.00 29.69 ? 205  SER A N   1 
ATOM   1579 C CA  . SER A 1 205 ? 3.439   60.004 51.613 1.00 30.48 ? 205  SER A CA  1 
ATOM   1580 C C   . SER A 1 205 ? 4.047   60.207 50.200 1.00 31.65 ? 205  SER A C   1 
ATOM   1581 O O   . SER A 1 205 ? 3.775   59.414 49.276 1.00 31.40 ? 205  SER A O   1 
ATOM   1582 C CB  . SER A 1 205 ? 2.368   61.088 51.854 1.00 28.95 ? 205  SER A CB  1 
ATOM   1583 O OG  . SER A 1 205 ? 1.486   60.739 52.905 1.00 28.66 ? 205  SER A OG  1 
ATOM   1584 N N   . VAL A 1 206 ? 4.862   61.261 50.051 1.00 29.62 ? 206  VAL A N   1 
ATOM   1585 C CA  . VAL A 1 206 ? 5.513   61.584 48.786 1.00 30.32 ? 206  VAL A CA  1 
ATOM   1586 C C   . VAL A 1 206 ? 6.267   60.355 48.282 1.00 31.06 ? 206  VAL A C   1 
ATOM   1587 O O   . VAL A 1 206 ? 6.166   60.007 47.108 1.00 32.88 ? 206  VAL A O   1 
ATOM   1588 C CB  . VAL A 1 206 ? 6.515   62.793 48.937 1.00 31.78 ? 206  VAL A CB  1 
ATOM   1589 C CG1 . VAL A 1 206 ? 7.430   62.901 47.713 1.00 29.44 ? 206  VAL A CG1 1 
ATOM   1590 C CG2 . VAL A 1 206 ? 5.736   64.122 49.121 1.00 32.13 ? 206  VAL A CG2 1 
ATOM   1591 N N   . GLY A 1 207 ? 7.009   59.699 49.170 1.00 28.43 ? 207  GLY A N   1 
ATOM   1592 C CA  . GLY A 1 207 ? 7.734   58.506 48.782 1.00 27.84 ? 207  GLY A CA  1 
ATOM   1593 C C   . GLY A 1 207 ? 6.800   57.372 48.381 1.00 29.60 ? 207  GLY A C   1 
ATOM   1594 O O   . GLY A 1 207 ? 7.109   56.585 47.494 1.00 29.33 ? 207  GLY A O   1 
ATOM   1595 N N   . MET A 1 208 ? 5.644   57.305 49.029 1.00 29.09 ? 208  MET A N   1 
ATOM   1596 C CA  . MET A 1 208 ? 4.664   56.272 48.745 1.00 30.23 ? 208  MET A CA  1 
ATOM   1597 C C   . MET A 1 208 ? 4.030   56.477 47.361 1.00 32.45 ? 208  MET A C   1 
ATOM   1598 O O   . MET A 1 208 ? 3.659   55.503 46.698 1.00 33.45 ? 208  MET A O   1 
ATOM   1599 C CB  . MET A 1 208 ? 3.596   56.246 49.855 1.00 28.73 ? 208  MET A CB  1 
ATOM   1600 C CG  . MET A 1 208 ? 4.165   55.781 51.204 1.00 29.10 ? 208  MET A CG  1 
ATOM   1601 S SD  . MET A 1 208 ? 3.062   55.892 52.621 1.00 30.78 ? 208  MET A SD  1 
ATOM   1602 C CE  . MET A 1 208 ? 3.870   54.784 53.741 1.00 26.33 ? 208  MET A CE  1 
ATOM   1603 N N   . HIS A 1 209 ? 3.900   57.731 46.925 1.00 30.75 ? 209  HIS A N   1 
ATOM   1604 C CA  . HIS A 1 209 ? 3.361   57.993 45.599 1.00 30.18 ? 209  HIS A CA  1 
ATOM   1605 C C   . HIS A 1 209 ? 4.439   57.713 44.546 1.00 30.49 ? 209  HIS A C   1 
ATOM   1606 O O   . HIS A 1 209 ? 4.124   57.378 43.410 1.00 30.23 ? 209  HIS A O   1 
ATOM   1607 C CB  . HIS A 1 209 ? 2.838   59.427 45.498 1.00 30.00 ? 209  HIS A CB  1 
ATOM   1608 C CG  . HIS A 1 209 ? 1.572   59.645 46.273 1.00 33.07 ? 209  HIS A CG  1 
ATOM   1609 N ND1 . HIS A 1 209 ? 0.433   58.892 46.060 1.00 32.57 ? 209  HIS A ND1 1 
ATOM   1610 C CD2 . HIS A 1 209 ? 1.272   60.505 47.281 1.00 31.58 ? 209  HIS A CD2 1 
ATOM   1611 C CE1 . HIS A 1 209 ? -0.514  59.277 46.900 1.00 33.04 ? 209  HIS A CE1 1 
ATOM   1612 N NE2 . HIS A 1 209 ? -0.030  60.255 47.651 1.00 34.14 ? 209  HIS A NE2 1 
ATOM   1613 N N   . ILE A 1 210 ? 5.710   57.842 44.930 1.00 30.79 ? 210  ILE A N   1 
ATOM   1614 C CA  . ILE A 1 210 ? 6.812   57.517 44.028 1.00 31.63 ? 210  ILE A CA  1 
ATOM   1615 C C   . ILE A 1 210 ? 6.807   55.978 43.826 1.00 32.10 ? 210  ILE A C   1 
ATOM   1616 O O   . ILE A 1 210 ? 7.066   55.473 42.728 1.00 29.39 ? 210  ILE A O   1 
ATOM   1617 C CB  . ILE A 1 210 ? 8.173   57.921 44.662 1.00 33.63 ? 210  ILE A CB  1 
ATOM   1618 C CG1 . ILE A 1 210 ? 8.363   59.437 44.578 1.00 31.59 ? 210  ILE A CG1 1 
ATOM   1619 C CG2 . ILE A 1 210 ? 9.342   57.169 43.980 1.00 30.34 ? 210  ILE A CG2 1 
ATOM   1620 C CD1 . ILE A 1 210 ? 9.558   59.912 45.367 1.00 29.47 ? 210  ILE A CD1 1 
ATOM   1621 N N   . LEU A 1 211 ? 6.502   55.247 44.901 1.00 31.62 ? 211  LEU A N   1 
ATOM   1622 C CA  . LEU A 1 211 ? 6.473   53.788 44.860 1.00 33.70 ? 211  LEU A CA  1 
ATOM   1623 C C   . LEU A 1 211 ? 5.245   53.188 44.181 1.00 33.76 ? 211  LEU A C   1 
ATOM   1624 O O   . LEU A 1 211 ? 5.367   52.345 43.292 1.00 33.63 ? 211  LEU A O   1 
ATOM   1625 C CB  . LEU A 1 211 ? 6.593   53.216 46.282 1.00 33.01 ? 211  LEU A CB  1 
ATOM   1626 C CG  . LEU A 1 211 ? 7.999   53.237 46.912 1.00 36.83 ? 211  LEU A CG  1 
ATOM   1627 C CD1 . LEU A 1 211 ? 7.865   53.060 48.409 1.00 38.03 ? 211  LEU A CD1 1 
ATOM   1628 C CD2 . LEU A 1 211 ? 8.873   52.112 46.347 1.00 38.24 ? 211  LEU A CD2 1 
ATOM   1629 N N   . SER A 1 212 ? 4.065   53.637 44.590 1.00 33.56 ? 212  SER A N   1 
ATOM   1630 C CA  . SER A 1 212 ? 2.805   53.129 44.052 1.00 33.73 ? 212  SER A CA  1 
ATOM   1631 C C   . SER A 1 212 ? 2.538   53.375 42.557 1.00 33.27 ? 212  SER A C   1 
ATOM   1632 O O   . SER A 1 212 ? 2.369   54.519 42.126 1.00 32.92 ? 212  SER A O   1 
ATOM   1633 C CB  . SER A 1 212 ? 1.648   53.691 44.865 1.00 32.38 ? 212  SER A CB  1 
ATOM   1634 O OG  . SER A 1 212 ? 0.447   53.052 44.514 1.00 32.23 ? 212  SER A OG  1 
ATOM   1635 N N   . PRO A 1 213 ? 2.454   52.288 41.759 1.00 33.53 ? 213  PRO A N   1 
ATOM   1636 C CA  . PRO A 1 213 ? 2.202   52.386 40.306 1.00 34.01 ? 213  PRO A CA  1 
ATOM   1637 C C   . PRO A 1 213 ? 1.036   53.296 39.971 1.00 33.25 ? 213  PRO A C   1 
ATOM   1638 O O   . PRO A 1 213 ? 1.112   54.067 39.031 1.00 32.13 ? 213  PRO A O   1 
ATOM   1639 C CB  . PRO A 1 213 ? 1.891   50.944 39.894 1.00 33.90 ? 213  PRO A CB  1 
ATOM   1640 C CG  . PRO A 1 213 ? 2.711   50.127 40.883 1.00 34.95 ? 213  PRO A CG  1 
ATOM   1641 C CD  . PRO A 1 213 ? 2.473   50.878 42.199 1.00 32.19 ? 213  PRO A CD  1 
ATOM   1642 N N   . GLY A 1 214 ? -0.039  53.207 40.751 1.00 32.78 ? 214  GLY A N   1 
ATOM   1643 C CA  . GLY A 1 214 ? -1.204  54.030 40.462 1.00 34.82 ? 214  GLY A CA  1 
ATOM   1644 C C   . GLY A 1 214 ? -1.063  55.526 40.709 1.00 37.28 ? 214  GLY A C   1 
ATOM   1645 O O   . GLY A 1 214 ? -1.951  56.286 40.331 1.00 39.39 ? 214  GLY A O   1 
ATOM   1646 N N   . SER A 1 215 ? 0.026   55.963 41.347 1.00 35.83 ? 215  SER A N   1 
ATOM   1647 C CA  . SER A 1 215 ? 0.209   57.391 41.612 1.00 35.15 ? 215  SER A CA  1 
ATOM   1648 C C   . SER A 1 215 ? 1.290   58.033 40.742 1.00 35.57 ? 215  SER A C   1 
ATOM   1649 O O   . SER A 1 215 ? 1.268   59.247 40.540 1.00 34.81 ? 215  SER A O   1 
ATOM   1650 C CB  . SER A 1 215 ? 0.604   57.640 43.092 1.00 32.24 ? 215  SER A CB  1 
ATOM   1651 O OG  . SER A 1 215 ? -0.427  57.306 43.991 1.00 30.27 ? 215  SER A OG  1 
ATOM   1652 N N   . ARG A 1 216 ? 2.221   57.225 40.237 1.00 35.29 ? 216  ARG A N   1 
ATOM   1653 C CA  . ARG A 1 216 ? 3.362   57.737 39.474 1.00 37.04 ? 216  ARG A CA  1 
ATOM   1654 C C   . ARG A 1 216 ? 3.132   58.711 38.328 1.00 36.92 ? 216  ARG A C   1 
ATOM   1655 O O   . ARG A 1 216 ? 3.899   59.652 38.153 1.00 37.76 ? 216  ARG A O   1 
ATOM   1656 C CB  . ARG A 1 216 ? 4.216   56.576 38.940 1.00 36.10 ? 216  ARG A CB  1 
ATOM   1657 C CG  . ARG A 1 216 ? 4.644   55.593 39.996 1.00 38.51 ? 216  ARG A CG  1 
ATOM   1658 C CD  . ARG A 1 216 ? 5.471   54.473 39.394 1.00 39.70 ? 216  ARG A CD  1 
ATOM   1659 N NE  . ARG A 1 216 ? 5.719   53.414 40.363 1.00 39.15 ? 216  ARG A NE  1 
ATOM   1660 C CZ  . ARG A 1 216 ? 6.214   52.219 40.051 1.00 39.92 ? 216  ARG A CZ  1 
ATOM   1661 N NH1 . ARG A 1 216 ? 6.518   51.932 38.781 1.00 39.69 ? 216  ARG A NH1 1 
ATOM   1662 N NH2 . ARG A 1 216 ? 6.401   51.312 41.004 1.00 36.78 ? 216  ARG A NH2 1 
ATOM   1663 N N   . ASP A 1 217 ? 2.095   58.497 37.539 1.00 37.30 ? 217  ASP A N   1 
ATOM   1664 C CA  . ASP A 1 217 ? 1.888   59.357 36.387 1.00 36.35 ? 217  ASP A CA  1 
ATOM   1665 C C   . ASP A 1 217 ? 1.295   60.709 36.734 1.00 37.41 ? 217  ASP A C   1 
ATOM   1666 O O   . ASP A 1 217 ? 1.240   61.585 35.893 1.00 37.50 ? 217  ASP A O   1 
ATOM   1667 C CB  . ASP A 1 217 ? 0.988   58.654 35.368 1.00 36.12 ? 217  ASP A CB  1 
ATOM   1668 C CG  . ASP A 1 217 ? 1.496   57.255 34.985 1.00 36.79 ? 217  ASP A CG  1 
ATOM   1669 O OD1 . ASP A 1 217 ? 2.641   56.863 35.341 1.00 36.59 ? 217  ASP A OD1 1 
ATOM   1670 O OD2 . ASP A 1 217 ? 0.733   56.535 34.311 1.00 37.21 ? 217  ASP A OD2 1 
ATOM   1671 N N   . LEU A 1 218 ? 0.873   60.894 37.976 1.00 35.49 ? 218  LEU A N   1 
ATOM   1672 C CA  . LEU A 1 218 ? 0.238   62.139 38.360 1.00 35.09 ? 218  LEU A CA  1 
ATOM   1673 C C   . LEU A 1 218 ? 1.154   63.317 38.754 1.00 36.32 ? 218  LEU A C   1 
ATOM   1674 O O   . LEU A 1 218 ? 0.652   64.391 39.089 1.00 36.84 ? 218  LEU A O   1 
ATOM   1675 C CB  . LEU A 1 218 ? -0.775  61.869 39.493 1.00 34.14 ? 218  LEU A CB  1 
ATOM   1676 C CG  . LEU A 1 218 ? -1.790  60.743 39.240 1.00 34.63 ? 218  LEU A CG  1 
ATOM   1677 C CD1 . LEU A 1 218 ? -2.692  60.601 40.454 1.00 32.58 ? 218  LEU A CD1 1 
ATOM   1678 C CD2 . LEU A 1 218 ? -2.626  61.050 37.984 1.00 36.04 ? 218  LEU A CD2 1 
ATOM   1679 N N   . PHE A 1 219 ? 2.474   63.139 38.714 1.00 35.04 ? 219  PHE A N   1 
ATOM   1680 C CA  . PHE A 1 219 ? 3.367   64.239 39.076 1.00 33.96 ? 219  PHE A CA  1 
ATOM   1681 C C   . PHE A 1 219 ? 4.709   64.029 38.407 1.00 34.65 ? 219  PHE A C   1 
ATOM   1682 O O   . PHE A 1 219 ? 5.007   62.945 37.914 1.00 33.43 ? 219  PHE A O   1 
ATOM   1683 C CB  . PHE A 1 219 ? 3.546   64.341 40.611 1.00 33.66 ? 219  PHE A CB  1 
ATOM   1684 C CG  . PHE A 1 219 ? 4.178   63.113 41.245 1.00 30.55 ? 219  PHE A CG  1 
ATOM   1685 C CD1 . PHE A 1 219 ? 3.410   61.966 41.503 1.00 29.99 ? 219  PHE A CD1 1 
ATOM   1686 C CD2 . PHE A 1 219 ? 5.535   63.104 41.573 1.00 29.20 ? 219  PHE A CD2 1 
ATOM   1687 C CE1 . PHE A 1 219 ? 4.004   60.814 42.089 1.00 31.62 ? 219  PHE A CE1 1 
ATOM   1688 C CE2 . PHE A 1 219 ? 6.140   61.969 42.156 1.00 31.18 ? 219  PHE A CE2 1 
ATOM   1689 C CZ  . PHE A 1 219 ? 5.363   60.815 42.416 1.00 27.96 ? 219  PHE A CZ  1 
ATOM   1690 N N   . ARG A 1 220 ? 5.533   65.069 38.420 1.00 35.82 ? 220  ARG A N   1 
ATOM   1691 C CA  . ARG A 1 220 ? 6.819   65.019 37.759 1.00 35.92 ? 220  ARG A CA  1 
ATOM   1692 C C   . ARG A 1 220 ? 8.022   64.789 38.676 1.00 36.94 ? 220  ARG A C   1 
ATOM   1693 O O   . ARG A 1 220 ? 8.897   63.975 38.368 1.00 35.82 ? 220  ARG A O   1 
ATOM   1694 C CB  . ARG A 1 220 ? 6.998   66.337 36.991 1.00 38.37 ? 220  ARG A CB  1 
ATOM   1695 C CG  . ARG A 1 220 ? 8.369   66.606 36.379 1.00 41.37 ? 220  ARG A CG  1 
ATOM   1696 C CD  . ARG A 1 220 ? 8.602   65.760 35.156 1.00 46.78 ? 220  ARG A CD  1 
ATOM   1697 N NE  . ARG A 1 220 ? 9.659   66.265 34.260 1.00 50.91 ? 220  ARG A NE  1 
ATOM   1698 C CZ  . ARG A 1 220 ? 9.491   67.208 33.323 1.00 52.22 ? 220  ARG A CZ  1 
ATOM   1699 N NH1 . ARG A 1 220 ? 8.309   67.790 33.140 1.00 51.91 ? 220  ARG A NH1 1 
ATOM   1700 N NH2 . ARG A 1 220 ? 10.497  67.523 32.508 1.00 52.34 ? 220  ARG A NH2 1 
ATOM   1701 N N   . ARG A 1 221 ? 8.078   65.538 39.777 1.00 35.69 ? 221  ARG A N   1 
ATOM   1702 C CA  . ARG A 1 221 ? 9.203   65.479 40.696 1.00 35.83 ? 221  ARG A CA  1 
ATOM   1703 C C   . ARG A 1 221 ? 8.716   65.441 42.130 1.00 33.98 ? 221  ARG A C   1 
ATOM   1704 O O   . ARG A 1 221 ? 7.532   65.645 42.392 1.00 32.52 ? 221  ARG A O   1 
ATOM   1705 C CB  . ARG A 1 221 ? 10.119  66.690 40.499 1.00 38.64 ? 221  ARG A CB  1 
ATOM   1706 C CG  . ARG A 1 221 ? 10.973  66.622 39.274 1.00 44.63 ? 221  ARG A CG  1 
ATOM   1707 C CD  . ARG A 1 221 ? 12.020  67.731 39.285 1.00 46.15 ? 221  ARG A CD  1 
ATOM   1708 N NE  . ARG A 1 221 ? 11.590  68.832 38.458 1.00 48.84 ? 221  ARG A NE  1 
ATOM   1709 C CZ  . ARG A 1 221 ? 11.572  68.809 37.134 1.00 48.76 ? 221  ARG A CZ  1 
ATOM   1710 N NH1 . ARG A 1 221 ? 11.977  67.745 36.467 1.00 46.11 ? 221  ARG A NH1 1 
ATOM   1711 N NH2 . ARG A 1 221 ? 11.108  69.856 36.479 1.00 50.87 ? 221  ARG A NH2 1 
ATOM   1712 N N   . ALA A 1 222 ? 9.648   65.209 43.054 1.00 31.58 ? 222  ALA A N   1 
ATOM   1713 C CA  . ALA A 1 222 ? 9.301   65.052 44.462 1.00 32.02 ? 222  ALA A CA  1 
ATOM   1714 C C   . ALA A 1 222 ? 10.319  65.589 45.454 1.00 31.26 ? 222  ALA A C   1 
ATOM   1715 O O   . ALA A 1 222 ? 11.526  65.507 45.230 1.00 32.15 ? 222  ALA A O   1 
ATOM   1716 C CB  . ALA A 1 222 ? 9.055   63.574 44.735 1.00 28.38 ? 222  ALA A CB  1 
ATOM   1717 N N   . ILE A 1 223 ? 9.793   66.140 46.546 1.00 31.50 ? 223  ILE A N   1 
ATOM   1718 C CA  . ILE A 1 223 ? 10.576  66.687 47.645 1.00 30.97 ? 223  ILE A CA  1 
ATOM   1719 C C   . ILE A 1 223 ? 10.047  66.027 48.930 1.00 31.48 ? 223  ILE A C   1 
ATOM   1720 O O   . ILE A 1 223 ? 8.830   66.004 49.168 1.00 30.66 ? 223  ILE A O   1 
ATOM   1721 C CB  . ILE A 1 223 ? 10.379  68.195 47.779 1.00 31.36 ? 223  ILE A CB  1 
ATOM   1722 C CG1 . ILE A 1 223 ? 10.964  68.908 46.557 1.00 31.91 ? 223  ILE A CG1 1 
ATOM   1723 C CG2 . ILE A 1 223 ? 11.020  68.692 49.102 1.00 30.05 ? 223  ILE A CG2 1 
ATOM   1724 C CD1 . ILE A 1 223 ? 10.655  70.416 46.559 1.00 31.90 ? 223  ILE A CD1 1 
ATOM   1725 N N   . LEU A 1 224 ? 10.964  65.496 49.735 1.00 29.22 ? 224  LEU A N   1 
ATOM   1726 C CA  . LEU A 1 224 ? 10.632  64.837 50.993 1.00 29.83 ? 224  LEU A CA  1 
ATOM   1727 C C   . LEU A 1 224 ? 11.392  65.499 52.145 1.00 30.22 ? 224  LEU A C   1 
ATOM   1728 O O   . LEU A 1 224 ? 12.632  65.543 52.160 1.00 29.68 ? 224  LEU A O   1 
ATOM   1729 C CB  . LEU A 1 224 ? 10.999  63.347 50.926 1.00 28.34 ? 224  LEU A CB  1 
ATOM   1730 C CG  . LEU A 1 224 ? 10.327  62.422 49.890 1.00 27.66 ? 224  LEU A CG  1 
ATOM   1731 C CD1 . LEU A 1 224 ? 10.917  62.672 48.476 1.00 26.38 ? 224  LEU A CD1 1 
ATOM   1732 C CD2 . LEU A 1 224 ? 10.551  60.974 50.318 1.00 24.74 ? 224  LEU A CD2 1 
ATOM   1733 N N   . GLN A 1 225 ? 10.639  66.017 53.105 1.00 31.12 ? 225  GLN A N   1 
ATOM   1734 C CA  . GLN A 1 225 ? 11.205  66.707 54.277 1.00 31.75 ? 225  GLN A CA  1 
ATOM   1735 C C   . GLN A 1 225 ? 10.999  65.916 55.581 1.00 31.90 ? 225  GLN A C   1 
ATOM   1736 O O   . GLN A 1 225 ? 9.869   65.778 56.067 1.00 32.24 ? 225  GLN A O   1 
ATOM   1737 C CB  . GLN A 1 225 ? 10.567  68.109 54.413 1.00 31.34 ? 225  GLN A CB  1 
ATOM   1738 C CG  . GLN A 1 225 ? 10.778  68.983 53.164 1.00 30.96 ? 225  GLN A CG  1 
ATOM   1739 C CD  . GLN A 1 225 ? 9.949   70.272 53.158 1.00 33.26 ? 225  GLN A CD  1 
ATOM   1740 O OE1 . GLN A 1 225 ? 9.687   70.840 52.104 1.00 36.14 ? 225  GLN A OE1 1 
ATOM   1741 N NE2 . GLN A 1 225 ? 9.536   70.732 54.334 1.00 33.58 ? 225  GLN A NE2 1 
ATOM   1742 N N   . SER A 1 226 ? 12.093  65.369 56.116 1.00 31.37 ? 226  SER A N   1 
ATOM   1743 C CA  . SER A 1 226 ? 12.057  64.630 57.378 1.00 31.18 ? 226  SER A CA  1 
ATOM   1744 C C   . SER A 1 226 ? 11.031  63.510 57.361 1.00 30.47 ? 226  SER A C   1 
ATOM   1745 O O   . SER A 1 226 ? 10.299  63.330 58.315 1.00 31.20 ? 226  SER A O   1 
ATOM   1746 C CB  . SER A 1 226 ? 11.726  65.583 58.550 1.00 32.08 ? 226  SER A CB  1 
ATOM   1747 O OG  . SER A 1 226 ? 12.562  66.732 58.569 1.00 30.56 ? 226  SER A OG  1 
ATOM   1748 N N   . GLY A 1 227 ? 10.976  62.754 56.277 1.00 30.61 ? 227  GLY A N   1 
ATOM   1749 C CA  . GLY A 1 227 ? 10.019  61.665 56.191 1.00 29.82 ? 227  GLY A CA  1 
ATOM   1750 C C   . GLY A 1 227 ? 10.425  60.818 55.015 1.00 30.91 ? 227  GLY A C   1 
ATOM   1751 O O   . GLY A 1 227 ? 10.881  61.330 54.004 1.00 30.53 ? 227  GLY A O   1 
ATOM   1752 N N   . SER A 1 228 ? 10.195  59.524 55.119 1.00 32.13 ? 228  SER A N   1 
ATOM   1753 C CA  . SER A 1 228 ? 10.629  58.589 54.092 1.00 31.72 ? 228  SER A CA  1 
ATOM   1754 C C   . SER A 1 228 ? 9.557   57.505 54.115 1.00 30.60 ? 228  SER A C   1 
ATOM   1755 O O   . SER A 1 228 ? 9.024   57.205 55.175 1.00 30.03 ? 228  SER A O   1 
ATOM   1756 C CB  . SER A 1 228 ? 11.999  58.050 54.538 1.00 31.12 ? 228  SER A CB  1 
ATOM   1757 O OG  . SER A 1 228 ? 12.711  57.503 53.482 1.00 39.30 ? 228  SER A OG  1 
ATOM   1758 N N   . PRO A 1 229 ? 9.257   56.872 52.967 1.00 30.09 ? 229  PRO A N   1 
ATOM   1759 C CA  . PRO A 1 229 ? 8.205   55.835 52.984 1.00 30.88 ? 229  PRO A CA  1 
ATOM   1760 C C   . PRO A 1 229 ? 8.471   54.585 53.825 1.00 32.39 ? 229  PRO A C   1 
ATOM   1761 O O   . PRO A 1 229 ? 7.537   53.948 54.320 1.00 32.11 ? 229  PRO A O   1 
ATOM   1762 C CB  . PRO A 1 229 ? 7.985   55.531 51.491 1.00 32.16 ? 229  PRO A CB  1 
ATOM   1763 C CG  . PRO A 1 229 ? 9.351   55.860 50.851 1.00 29.41 ? 229  PRO A CG  1 
ATOM   1764 C CD  . PRO A 1 229 ? 9.833   57.066 51.619 1.00 30.20 ? 229  PRO A CD  1 
ATOM   1765 N N   . ASN A 1 230 ? 9.752   54.272 53.994 1.00 31.60 ? 230  ASN A N   1 
ATOM   1766 C CA  . ASN A 1 230 ? 10.227  53.123 54.738 1.00 30.54 ? 230  ASN A CA  1 
ATOM   1767 C C   . ASN A 1 230 ? 10.427  53.447 56.220 1.00 32.34 ? 230  ASN A C   1 
ATOM   1768 O O   . ASN A 1 230 ? 11.063  52.661 56.946 1.00 32.62 ? 230  ASN A O   1 
ATOM   1769 C CB  . ASN A 1 230 ? 11.568  52.684 54.139 1.00 29.88 ? 230  ASN A CB  1 
ATOM   1770 C CG  . ASN A 1 230 ? 12.598  53.820 54.130 1.00 32.48 ? 230  ASN A CG  1 
ATOM   1771 O OD1 . ASN A 1 230 ? 12.296  54.959 53.733 1.00 33.16 ? 230  ASN A OD1 1 
ATOM   1772 N ND2 . ASN A 1 230 ? 13.814  53.518 54.558 1.00 30.60 ? 230  ASN A ND2 1 
ATOM   1773 N N   . CYS A 1 231 ? 9.917   54.592 56.683 1.00 30.45 ? 231  CYS A N   1 
ATOM   1774 C CA  . CYS A 1 231 ? 10.087  54.909 58.093 1.00 30.09 ? 231  CYS A CA  1 
ATOM   1775 C C   . CYS A 1 231 ? 9.377   53.854 58.922 1.00 31.13 ? 231  CYS A C   1 
ATOM   1776 O O   . CYS A 1 231 ? 8.285   53.373 58.565 1.00 31.25 ? 231  CYS A O   1 
ATOM   1777 C CB  . CYS A 1 231 ? 9.561   56.306 58.434 1.00 30.06 ? 231  CYS A CB  1 
ATOM   1778 S SG  . CYS A 1 231 ? 10.679  57.603 57.860 1.00 31.50 ? 231  CYS A SG  1 
ATOM   1779 N N   . PRO A 1 232 ? 9.983   53.490 60.060 1.00 31.50 ? 232  PRO A N   1 
ATOM   1780 C CA  . PRO A 1 232 ? 9.403   52.463 60.939 1.00 30.61 ? 232  PRO A CA  1 
ATOM   1781 C C   . PRO A 1 232 ? 7.975   52.717 61.433 1.00 31.29 ? 232  PRO A C   1 
ATOM   1782 O O   . PRO A 1 232 ? 7.259   51.780 61.802 1.00 32.08 ? 232  PRO A O   1 
ATOM   1783 C CB  . PRO A 1 232 ? 10.452  52.350 62.071 1.00 28.23 ? 232  PRO A CB  1 
ATOM   1784 C CG  . PRO A 1 232 ? 11.036  53.734 62.144 1.00 29.78 ? 232  PRO A CG  1 
ATOM   1785 C CD  . PRO A 1 232 ? 11.157  54.146 60.682 1.00 28.09 ? 232  PRO A CD  1 
ATOM   1786 N N   . TRP A 1 233 ? 7.542   53.973 61.400 1.00 31.65 ? 233  TRP A N   1 
ATOM   1787 C CA  . TRP A 1 233 ? 6.206   54.347 61.868 1.00 30.16 ? 233  TRP A CA  1 
ATOM   1788 C C   . TRP A 1 233 ? 5.219   54.625 60.731 1.00 32.63 ? 233  TRP A C   1 
ATOM   1789 O O   . TRP A 1 233 ? 4.012   54.828 60.982 1.00 33.19 ? 233  TRP A O   1 
ATOM   1790 C CB  . TRP A 1 233 ? 6.301   55.616 62.708 1.00 28.55 ? 233  TRP A CB  1 
ATOM   1791 C CG  . TRP A 1 233 ? 7.135   56.672 62.017 1.00 29.95 ? 233  TRP A CG  1 
ATOM   1792 C CD1 . TRP A 1 233 ? 8.465   56.944 62.232 1.00 28.52 ? 233  TRP A CD1 1 
ATOM   1793 C CD2 . TRP A 1 233 ? 6.714   57.547 60.965 1.00 28.04 ? 233  TRP A CD2 1 
ATOM   1794 N NE1 . TRP A 1 233 ? 8.888   57.930 61.379 1.00 28.09 ? 233  TRP A NE1 1 
ATOM   1795 C CE2 . TRP A 1 233 ? 7.839   58.324 60.593 1.00 29.83 ? 233  TRP A CE2 1 
ATOM   1796 C CE3 . TRP A 1 233 ? 5.497   57.753 60.302 1.00 29.45 ? 233  TRP A CE3 1 
ATOM   1797 C CZ2 . TRP A 1 233 ? 7.784   59.308 59.578 1.00 28.46 ? 233  TRP A CZ2 1 
ATOM   1798 C CZ3 . TRP A 1 233 ? 5.437   58.732 59.286 1.00 29.65 ? 233  TRP A CZ3 1 
ATOM   1799 C CH2 . TRP A 1 233 ? 6.582   59.496 58.939 1.00 28.63 ? 233  TRP A CH2 1 
ATOM   1800 N N   . ALA A 1 234 ? 5.724   54.629 59.497 1.00 31.28 ? 234  ALA A N   1 
ATOM   1801 C CA  . ALA A 1 234 ? 4.910   54.973 58.334 1.00 30.80 ? 234  ALA A CA  1 
ATOM   1802 C C   . ALA A 1 234 ? 4.015   53.886 57.749 1.00 31.54 ? 234  ALA A C   1 
ATOM   1803 O O   . ALA A 1 234 ? 3.215   54.167 56.868 1.00 31.13 ? 234  ALA A O   1 
ATOM   1804 C CB  . ALA A 1 234 ? 5.803   55.531 57.249 1.00 30.01 ? 234  ALA A CB  1 
ATOM   1805 N N   . SER A 1 235 ? 4.151   52.649 58.214 1.00 32.73 ? 235  SER A N   1 
ATOM   1806 C CA  . SER A 1 235 ? 3.312   51.575 57.698 1.00 32.72 ? 235  SER A CA  1 
ATOM   1807 C C   . SER A 1 235 ? 3.284   50.354 58.607 1.00 33.82 ? 235  SER A C   1 
ATOM   1808 O O   . SER A 1 235 ? 4.117   50.214 59.500 1.00 33.22 ? 235  SER A O   1 
ATOM   1809 C CB  . SER A 1 235 ? 3.773   51.155 56.292 1.00 31.91 ? 235  SER A CB  1 
ATOM   1810 O OG  . SER A 1 235 ? 4.997   50.455 56.325 1.00 31.32 ? 235  SER A OG  1 
ATOM   1811 N N   . VAL A 1 236 ? 2.279   49.508 58.395 1.00 34.16 ? 236  VAL A N   1 
ATOM   1812 C CA  . VAL A 1 236 ? 2.135   48.274 59.131 1.00 35.01 ? 236  VAL A CA  1 
ATOM   1813 C C   . VAL A 1 236 ? 1.730   47.166 58.174 1.00 36.14 ? 236  VAL A C   1 
ATOM   1814 O O   . VAL A 1 236 ? 1.331   47.408 57.025 1.00 36.52 ? 236  VAL A O   1 
ATOM   1815 C CB  . VAL A 1 236 ? 1.060   48.353 60.251 1.00 34.90 ? 236  VAL A CB  1 
ATOM   1816 C CG1 . VAL A 1 236 ? 1.518   49.335 61.335 1.00 31.75 ? 236  VAL A CG1 1 
ATOM   1817 C CG2 . VAL A 1 236 ? -0.325  48.714 59.663 1.00 31.78 ? 236  VAL A CG2 1 
ATOM   1818 N N   . SER A 1 237 ? 1.835   45.940 58.649 1.00 35.22 ? 237  SER A N   1 
ATOM   1819 C CA  . SER A 1 237 ? 1.443   44.799 57.842 1.00 36.99 ? 237  SER A CA  1 
ATOM   1820 C C   . SER A 1 237 ? -0.094  44.732 57.873 1.00 37.11 ? 237  SER A C   1 
ATOM   1821 O O   . SER A 1 237 ? -0.754  45.398 58.699 1.00 34.85 ? 237  SER A O   1 
ATOM   1822 C CB  . SER A 1 237 ? 2.007   43.514 58.452 1.00 35.92 ? 237  SER A CB  1 
ATOM   1823 O OG  . SER A 1 237 ? 1.337   43.258 59.681 1.00 36.57 ? 237  SER A OG  1 
ATOM   1824 N N   . VAL A 1 238 ? -0.647  43.923 56.975 1.00 37.34 ? 238  VAL A N   1 
ATOM   1825 C CA  . VAL A 1 238 ? -2.089  43.727 56.879 1.00 38.43 ? 238  VAL A CA  1 
ATOM   1826 C C   . VAL A 1 238 ? -2.624  43.154 58.190 1.00 38.27 ? 238  VAL A C   1 
ATOM   1827 O O   . VAL A 1 238 ? -3.706  43.537 58.667 1.00 38.65 ? 238  VAL A O   1 
ATOM   1828 C CB  . VAL A 1 238 ? -2.407  42.764 55.698 1.00 40.39 ? 238  VAL A CB  1 
ATOM   1829 C CG1 . VAL A 1 238 ? -3.738  42.071 55.923 1.00 44.23 ? 238  VAL A CG1 1 
ATOM   1830 C CG2 . VAL A 1 238 ? -2.455  43.549 54.408 1.00 40.69 ? 238  VAL A CG2 1 
ATOM   1831 N N   . ALA A 1 239 ? -1.849  42.238 58.770 1.00 38.57 ? 239  ALA A N   1 
ATOM   1832 C CA  . ALA A 1 239 ? -2.202  41.589 60.032 1.00 39.27 ? 239  ALA A CA  1 
ATOM   1833 C C   . ALA A 1 239 ? -2.237  42.579 61.208 1.00 39.02 ? 239  ALA A C   1 
ATOM   1834 O O   . ALA A 1 239 ? -3.183  42.584 61.989 1.00 39.70 ? 239  ALA A O   1 
ATOM   1835 C CB  . ALA A 1 239 ? -1.212  40.456 60.322 1.00 37.39 ? 239  ALA A CB  1 
ATOM   1836 N N   . GLU A 1 240 ? -1.200  43.408 61.343 1.00 40.04 ? 240  GLU A N   1 
ATOM   1837 C CA  . GLU A 1 240 ? -1.163  44.402 62.432 1.00 37.99 ? 240  GLU A CA  1 
ATOM   1838 C C   . GLU A 1 240 ? -2.281  45.421 62.242 1.00 36.05 ? 240  GLU A C   1 
ATOM   1839 O O   . GLU A 1 240 ? -2.913  45.855 63.218 1.00 35.00 ? 240  GLU A O   1 
ATOM   1840 C CB  . GLU A 1 240 ? 0.199   45.119 62.482 1.00 37.30 ? 240  GLU A CB  1 
ATOM   1841 C CG  . GLU A 1 240 ? 0.312   46.255 63.570 1.00 40.22 ? 240  GLU A CG  1 
ATOM   1842 C CD  . GLU A 1 240 ? -0.017  45.786 65.012 1.00 41.54 ? 240  GLU A CD  1 
ATOM   1843 O OE1 . GLU A 1 240 ? -0.202  44.562 65.232 1.00 40.32 ? 240  GLU A OE1 1 
ATOM   1844 O OE2 . GLU A 1 240 ? -0.099  46.647 65.924 1.00 42.49 ? 240  GLU A OE2 1 
ATOM   1845 N N   . GLY A 1 241 ? -2.533  45.797 60.985 1.00 35.95 ? 241  GLY A N   1 
ATOM   1846 C CA  . GLY A 1 241 ? -3.599  46.753 60.699 1.00 35.94 ? 241  GLY A CA  1 
ATOM   1847 C C   . GLY A 1 241 ? -4.945  46.206 61.144 1.00 37.22 ? 241  GLY A C   1 
ATOM   1848 O O   . GLY A 1 241 ? -5.763  46.908 61.745 1.00 35.99 ? 241  GLY A O   1 
ATOM   1849 N N   . ARG A 1 242 ? -5.156  44.928 60.847 1.00 38.25 ? 242  ARG A N   1 
ATOM   1850 C CA  . ARG A 1 242 ? -6.382  44.230 61.197 1.00 40.31 ? 242  ARG A CA  1 
ATOM   1851 C C   . ARG A 1 242 ? -6.483  44.159 62.718 1.00 39.04 ? 242  ARG A C   1 
ATOM   1852 O O   . ARG A 1 242 ? -7.540  44.456 63.301 1.00 38.72 ? 242  ARG A O   1 
ATOM   1853 C CB  . ARG A 1 242 ? -6.383  42.815 60.567 1.00 40.85 ? 242  ARG A CB  1 
ATOM   1854 C CG  . ARG A 1 242 ? -7.513  41.886 61.054 1.00 43.73 ? 242  ARG A CG  1 
ATOM   1855 C CD  . ARG A 1 242 ? -7.670  40.624 60.162 1.00 44.58 ? 242  ARG A CD  1 
ATOM   1856 N NE  . ARG A 1 242 ? -8.265  40.946 58.855 1.00 43.40 ? 242  ARG A NE  1 
ATOM   1857 C CZ  . ARG A 1 242 ? -9.558  41.204 58.660 1.00 43.30 ? 242  ARG A CZ  1 
ATOM   1858 N NH1 . ARG A 1 242 ? -10.407 41.172 59.687 1.00 42.71 ? 242  ARG A NH1 1 
ATOM   1859 N NH2 . ARG A 1 242 ? -10.003 41.509 57.441 1.00 42.25 ? 242  ARG A NH2 1 
ATOM   1860 N N   . ARG A 1 243 ? -5.386  43.778 63.364 1.00 36.76 ? 243  ARG A N   1 
ATOM   1861 C CA  . ARG A 1 243 ? -5.403  43.701 64.824 1.00 36.84 ? 243  ARG A CA  1 
ATOM   1862 C C   . ARG A 1 243 ? -5.797  45.039 65.460 1.00 36.92 ? 243  ARG A C   1 
ATOM   1863 O O   . ARG A 1 243 ? -6.591  45.080 66.414 1.00 36.21 ? 243  ARG A O   1 
ATOM   1864 C CB  . ARG A 1 243 ? -4.039  43.280 65.371 1.00 36.58 ? 243  ARG A CB  1 
ATOM   1865 C CG  . ARG A 1 243 ? -4.052  43.018 66.883 1.00 37.93 ? 243  ARG A CG  1 
ATOM   1866 C CD  . ARG A 1 243 ? -2.652  42.918 67.461 1.00 35.98 ? 243  ARG A CD  1 
ATOM   1867 N NE  . ARG A 1 243 ? -1.980  44.211 67.474 1.00 37.68 ? 243  ARG A NE  1 
ATOM   1868 C CZ  . ARG A 1 243 ? -2.323  45.238 68.250 1.00 37.80 ? 243  ARG A CZ  1 
ATOM   1869 N NH1 . ARG A 1 243 ? -3.342  45.126 69.090 1.00 37.00 ? 243  ARG A NH1 1 
ATOM   1870 N NH2 . ARG A 1 243 ? -1.640  46.378 68.183 1.00 36.34 ? 243  ARG A NH2 1 
ATOM   1871 N N   . ARG A 1 244 ? -5.251  46.133 64.924 1.00 36.54 ? 244  ARG A N   1 
ATOM   1872 C CA  . ARG A 1 244 ? -5.544  47.457 65.471 1.00 36.14 ? 244  ARG A CA  1 
ATOM   1873 C C   . ARG A 1 244 ? -6.995  47.871 65.236 1.00 36.26 ? 244  ARG A C   1 
ATOM   1874 O O   . ARG A 1 244 ? -7.583  48.552 66.090 1.00 37.03 ? 244  ARG A O   1 
ATOM   1875 C CB  . ARG A 1 244 ? -4.576  48.512 64.892 1.00 34.17 ? 244  ARG A CB  1 
ATOM   1876 C CG  . ARG A 1 244 ? -3.124  48.263 65.302 1.00 33.14 ? 244  ARG A CG  1 
ATOM   1877 C CD  . ARG A 1 244 ? -2.180  49.327 64.759 1.00 32.17 ? 244  ARG A CD  1 
ATOM   1878 N NE  . ARG A 1 244 ? -0.785  49.011 65.067 1.00 33.41 ? 244  ARG A NE  1 
ATOM   1879 C CZ  . ARG A 1 244 ? 0.238   49.844 64.887 1.00 29.84 ? 244  ARG A CZ  1 
ATOM   1880 N NH1 . ARG A 1 244 ? 0.039   51.064 64.406 1.00 31.25 ? 244  ARG A NH1 1 
ATOM   1881 N NH2 . ARG A 1 244 ? 1.470   49.443 65.151 1.00 28.85 ? 244  ARG A NH2 1 
ATOM   1882 N N   . ALA A 1 245 ? -7.571  47.470 64.099 1.00 35.02 ? 245  ALA A N   1 
ATOM   1883 C CA  . ALA A 1 245 ? -8.975  47.802 63.798 1.00 36.80 ? 245  ALA A CA  1 
ATOM   1884 C C   . ALA A 1 245 ? -9.891  47.065 64.772 1.00 38.24 ? 245  ALA A C   1 
ATOM   1885 O O   . ALA A 1 245 ? -10.837 47.639 65.316 1.00 37.71 ? 245  ALA A O   1 
ATOM   1886 C CB  . ALA A 1 245 ? -9.321  47.403 62.367 1.00 38.34 ? 245  ALA A CB  1 
ATOM   1887 N N   . VAL A 1 246 ? -9.600  45.781 64.982 1.00 38.80 ? 246  VAL A N   1 
ATOM   1888 C CA  . VAL A 1 246 ? -10.373 44.965 65.911 1.00 39.69 ? 246  VAL A CA  1 
ATOM   1889 C C   . VAL A 1 246 ? -10.255 45.555 67.323 1.00 40.50 ? 246  VAL A C   1 
ATOM   1890 O O   . VAL A 1 246 ? -11.252 45.725 68.030 1.00 42.08 ? 246  VAL A O   1 
ATOM   1891 C CB  . VAL A 1 246 ? -9.870  43.481 65.896 1.00 40.11 ? 246  VAL A CB  1 
ATOM   1892 C CG1 . VAL A 1 246 ? -10.564 42.674 66.982 1.00 37.17 ? 246  VAL A CG1 1 
ATOM   1893 C CG2 . VAL A 1 246 ? -10.117 42.857 64.501 1.00 38.05 ? 246  VAL A CG2 1 
ATOM   1894 N N   . GLU A 1 247 ? -9.039  45.904 67.721 1.00 39.61 ? 247  GLU A N   1 
ATOM   1895 C CA  . GLU A 1 247 ? -8.826  46.479 69.041 1.00 38.59 ? 247  GLU A CA  1 
ATOM   1896 C C   . GLU A 1 247 ? -9.604  47.796 69.193 1.00 37.75 ? 247  GLU A C   1 
ATOM   1897 O O   . GLU A 1 247 ? -10.144 48.099 70.266 1.00 37.47 ? 247  GLU A O   1 
ATOM   1898 C CB  . GLU A 1 247 ? -7.324  46.663 69.255 1.00 40.27 ? 247  GLU A CB  1 
ATOM   1899 C CG  . GLU A 1 247 ? -6.903  47.020 70.650 1.00 45.44 ? 247  GLU A CG  1 
ATOM   1900 C CD  . GLU A 1 247 ? -7.395  46.019 71.700 1.00 48.65 ? 247  GLU A CD  1 
ATOM   1901 O OE1 . GLU A 1 247 ? -7.556  44.811 71.377 1.00 47.76 ? 247  GLU A OE1 1 
ATOM   1902 O OE2 . GLU A 1 247 ? -7.608  46.462 72.853 1.00 49.32 ? 247  GLU A OE2 1 
ATOM   1903 N N   . LEU A 1 248 ? -9.706  48.570 68.114 1.00 38.42 ? 248  LEU A N   1 
ATOM   1904 C CA  . LEU A 1 248 ? -10.457 49.827 68.179 1.00 38.54 ? 248  LEU A CA  1 
ATOM   1905 C C   . LEU A 1 248 ? -11.911 49.463 68.489 1.00 40.03 ? 248  LEU A C   1 
ATOM   1906 O O   . LEU A 1 248 ? -12.532 50.055 69.374 1.00 39.77 ? 248  LEU A O   1 
ATOM   1907 C CB  . LEU A 1 248 ? -10.391 50.596 66.842 1.00 37.22 ? 248  LEU A CB  1 
ATOM   1908 C CG  . LEU A 1 248 ? -11.049 51.994 66.846 1.00 36.81 ? 248  LEU A CG  1 
ATOM   1909 C CD1 . LEU A 1 248 ? -10.263 52.931 67.778 1.00 36.91 ? 248  LEU A CD1 1 
ATOM   1910 C CD2 . LEU A 1 248 ? -11.087 52.588 65.464 1.00 32.87 ? 248  LEU A CD2 1 
ATOM   1911 N N   . GLY A 1 249 ? -12.435 48.467 67.771 1.00 40.57 ? 249  GLY A N   1 
ATOM   1912 C CA  . GLY A 1 249 ? -13.809 48.040 67.976 1.00 41.52 ? 249  GLY A CA  1 
ATOM   1913 C C   . GLY A 1 249 ? -14.027 47.560 69.393 1.00 43.25 ? 249  GLY A C   1 
ATOM   1914 O O   . GLY A 1 249 ? -15.042 47.856 70.035 1.00 41.19 ? 249  GLY A O   1 
ATOM   1915 N N   . ARG A 1 250 ? -13.058 46.808 69.886 1.00 44.05 ? 250  ARG A N   1 
ATOM   1916 C CA  . ARG A 1 250 ? -13.142 46.320 71.240 1.00 47.19 ? 250  ARG A CA  1 
ATOM   1917 C C   . ARG A 1 250 ? -13.241 47.495 72.238 1.00 47.52 ? 250  ARG A C   1 
ATOM   1918 O O   . ARG A 1 250 ? -13.928 47.402 73.250 1.00 47.46 ? 250  ARG A O   1 
ATOM   1919 C CB  . ARG A 1 250 ? -11.930 45.451 71.535 1.00 49.41 ? 250  ARG A CB  1 
ATOM   1920 C CG  . ARG A 1 250 ? -11.954 44.888 72.918 1.00 54.30 ? 250  ARG A CG  1 
ATOM   1921 C CD  . ARG A 1 250 ? -10.713 44.075 73.219 1.00 58.06 ? 250  ARG A CD  1 
ATOM   1922 N NE  . ARG A 1 250 ? -10.718 42.778 72.552 1.00 61.81 ? 250  ARG A NE  1 
ATOM   1923 C CZ  . ARG A 1 250 ? -10.189 42.538 71.360 1.00 63.94 ? 250  ARG A CZ  1 
ATOM   1924 N NH1 . ARG A 1 250 ? -9.609  43.520 70.672 1.00 64.92 ? 250  ARG A NH1 1 
ATOM   1925 N NH2 . ARG A 1 250 ? -10.190 41.298 70.886 1.00 64.31 ? 250  ARG A NH2 1 
ATOM   1926 N N   . ASN A 1 251 ? -12.581 48.608 71.925 1.00 48.09 ? 251  ASN A N   1 
ATOM   1927 C CA  . ASN A 1 251 ? -12.589 49.801 72.781 1.00 46.58 ? 251  ASN A CA  1 
ATOM   1928 C C   . ASN A 1 251 ? -13.925 50.527 72.770 1.00 48.11 ? 251  ASN A C   1 
ATOM   1929 O O   . ASN A 1 251 ? -14.246 51.270 73.700 1.00 47.75 ? 251  ASN A O   1 
ATOM   1930 C CB  . ASN A 1 251 ? -11.511 50.778 72.313 1.00 44.98 ? 251  ASN A CB  1 
ATOM   1931 C CG  . ASN A 1 251 ? -10.203 50.611 73.055 1.00 42.48 ? 251  ASN A CG  1 
ATOM   1932 O OD1 . ASN A 1 251 ? -9.924  51.349 74.012 1.00 40.84 ? 251  ASN A OD1 1 
ATOM   1933 N ND2 . ASN A 1 251 ? -9.399  49.640 72.634 1.00 36.61 ? 251  ASN A ND2 1 
ATOM   1934 N N   . LEU A 1 252 ? -14.695 50.344 71.702 1.00 49.80 ? 252  LEU A N   1 
ATOM   1935 C CA  . LEU A 1 252 ? -15.999 50.997 71.597 1.00 50.85 ? 252  LEU A CA  1 
ATOM   1936 C C   . LEU A 1 252 ? -17.128 49.976 71.745 1.00 51.29 ? 252  LEU A C   1 
ATOM   1937 O O   . LEU A 1 252 ? -18.256 50.202 71.313 1.00 51.99 ? 252  LEU A O   1 
ATOM   1938 C CB  . LEU A 1 252 ? -16.106 51.740 70.267 1.00 50.19 ? 252  LEU A CB  1 
ATOM   1939 C CG  . LEU A 1 252 ? -15.004 52.802 70.167 1.00 50.88 ? 252  LEU A CG  1 
ATOM   1940 C CD1 . LEU A 1 252 ? -14.958 53.400 68.777 1.00 51.59 ? 252  LEU A CD1 1 
ATOM   1941 C CD2 . LEU A 1 252 ? -15.239 53.878 71.198 1.00 49.71 ? 252  LEU A CD2 1 
ATOM   1942 N N   . ASN A 1 253 ? -16.799 48.854 72.372 1.00 51.52 ? 253  ASN A N   1 
ATOM   1943 C CA  . ASN A 1 253 ? -17.746 47.776 72.617 1.00 53.41 ? 253  ASN A CA  1 
ATOM   1944 C C   . ASN A 1 253 ? -18.505 47.351 71.382 1.00 51.73 ? 253  ASN A C   1 
ATOM   1945 O O   . ASN A 1 253 ? -19.717 47.217 71.400 1.00 52.68 ? 253  ASN A O   1 
ATOM   1946 C CB  . ASN A 1 253 ? -18.718 48.187 73.720 1.00 54.83 ? 253  ASN A CB  1 
ATOM   1947 C CG  . ASN A 1 253 ? -18.015 48.390 75.039 1.00 58.78 ? 253  ASN A CG  1 
ATOM   1948 O OD1 . ASN A 1 253 ? -17.897 49.514 75.523 1.00 61.06 ? 253  ASN A OD1 1 
ATOM   1949 N ND2 . ASN A 1 253 ? -17.516 47.294 75.623 1.00 58.68 ? 253  ASN A ND2 1 
ATOM   1950 N N   . CYS A 1 254 ? -17.774 47.137 70.305 1.00 49.43 ? 254  CYS A N   1 
ATOM   1951 C CA  . CYS A 1 254 ? -18.390 46.731 69.064 1.00 47.69 ? 254  CYS A CA  1 
ATOM   1952 C C   . CYS A 1 254 ? -18.507 45.222 68.979 1.00 48.24 ? 254  CYS A C   1 
ATOM   1953 O O   . CYS A 1 254 ? -17.756 44.481 69.615 1.00 47.03 ? 254  CYS A O   1 
ATOM   1954 C CB  . CYS A 1 254 ? -17.559 47.203 67.871 1.00 44.61 ? 254  CYS A CB  1 
ATOM   1955 S SG  . CYS A 1 254 ? -17.645 48.954 67.447 0.60 35.79 ? 254  CYS A SG  1 
ATOM   1956 N N   . ASN A 1 255 ? -19.457 44.782 68.165 1.00 49.70 ? 255  ASN A N   1 
ATOM   1957 C CA  . ASN A 1 255 ? -19.676 43.365 67.905 1.00 50.58 ? 255  ASN A CA  1 
ATOM   1958 C C   . ASN A 1 255 ? -18.472 43.029 67.020 1.00 49.73 ? 255  ASN A C   1 
ATOM   1959 O O   . ASN A 1 255 ? -18.262 43.702 66.001 1.00 49.70 ? 255  ASN A O   1 
ATOM   1960 C CB  . ASN A 1 255 ? -20.981 43.207 67.108 1.00 53.24 ? 255  ASN A CB  1 
ATOM   1961 C CG  . ASN A 1 255 ? -21.291 41.762 66.746 1.00 55.68 ? 255  ASN A CG  1 
ATOM   1962 O OD1 . ASN A 1 255 ? -20.412 40.982 66.354 1.00 56.32 ? 255  ASN A OD1 1 
ATOM   1963 N ND2 . ASN A 1 255 ? -22.562 41.405 66.853 1.00 57.53 ? 255  ASN A ND2 1 
ATOM   1964 N N   . LEU A 1 256 ? -17.683 42.024 67.393 1.00 48.88 ? 256  LEU A N   1 
ATOM   1965 C CA  . LEU A 1 256 ? -16.508 41.650 66.598 1.00 50.64 ? 256  LEU A CA  1 
ATOM   1966 C C   . LEU A 1 256 ? -16.681 40.316 65.862 1.00 52.13 ? 256  LEU A C   1 
ATOM   1967 O O   . LEU A 1 256 ? -15.696 39.676 65.485 1.00 51.52 ? 256  LEU A O   1 
ATOM   1968 C CB  . LEU A 1 256 ? -15.271 41.557 67.492 1.00 48.90 ? 256  LEU A CB  1 
ATOM   1969 C CG  . LEU A 1 256 ? -15.105 42.695 68.502 1.00 49.63 ? 256  LEU A CG  1 
ATOM   1970 C CD1 . LEU A 1 256 ? -13.863 42.451 69.357 1.00 48.92 ? 256  LEU A CD1 1 
ATOM   1971 C CD2 . LEU A 1 256 ? -15.014 44.038 67.759 1.00 48.79 ? 256  LEU A CD2 1 
ATOM   1972 N N   . ASN A 1 257 ? -17.929 39.907 65.639 1.00 53.29 ? 257  ASN A N   1 
ATOM   1973 C CA  . ASN A 1 257 ? -18.189 38.637 64.975 1.00 53.67 ? 257  ASN A CA  1 
ATOM   1974 C C   . ASN A 1 257 ? -17.705 38.602 63.522 1.00 53.66 ? 257  ASN A C   1 
ATOM   1975 O O   . ASN A 1 257 ? -17.245 37.566 63.045 1.00 53.07 ? 257  ASN A O   1 
ATOM   1976 C CB  . ASN A 1 257 ? -19.688 38.302 65.074 1.00 55.59 ? 257  ASN A CB  1 
ATOM   1977 N N   . SER A 1 258 ? -17.804 39.724 62.812 1.00 52.96 ? 258  SER A N   1 
ATOM   1978 C CA  . SER A 1 258 ? -17.325 39.762 61.429 1.00 51.19 ? 258  SER A CA  1 
ATOM   1979 C C   . SER A 1 258 ? -16.818 41.154 61.068 1.00 51.32 ? 258  SER A C   1 
ATOM   1980 O O   . SER A 1 258 ? -17.051 42.128 61.800 1.00 50.64 ? 258  SER A O   1 
ATOM   1981 C CB  . SER A 1 258 ? -18.439 39.386 60.445 1.00 49.54 ? 258  SER A CB  1 
ATOM   1982 O OG  . SER A 1 258 ? -19.464 40.371 60.426 1.00 47.53 ? 258  SER A OG  1 
ATOM   1983 N N   . ASP A 1 259 ? -16.130 41.242 59.931 1.00 50.59 ? 259  ASP A N   1 
ATOM   1984 C CA  . ASP A 1 259 ? -15.628 42.524 59.471 1.00 49.50 ? 259  ASP A CA  1 
ATOM   1985 C C   . ASP A 1 259 ? -16.819 43.440 59.275 1.00 48.95 ? 259  ASP A C   1 
ATOM   1986 O O   . ASP A 1 259 ? -16.791 44.596 59.683 1.00 48.54 ? 259  ASP A O   1 
ATOM   1987 C CB  . ASP A 1 259 ? -14.876 42.371 58.148 1.00 49.40 ? 259  ASP A CB  1 
ATOM   1988 C CG  . ASP A 1 259 ? -13.433 41.918 58.335 1.00 50.18 ? 259  ASP A CG  1 
ATOM   1989 O OD1 . ASP A 1 259 ? -13.023 41.628 59.479 1.00 50.24 ? 259  ASP A OD1 1 
ATOM   1990 O OD2 . ASP A 1 259 ? -12.701 41.857 57.326 1.00 52.64 ? 259  ASP A OD2 1 
ATOM   1991 N N   . GLU A 1 260 ? -17.875 42.912 58.662 1.00 49.55 ? 260  GLU A N   1 
ATOM   1992 C CA  . GLU A 1 260 ? -19.078 43.701 58.402 1.00 48.61 ? 260  GLU A CA  1 
ATOM   1993 C C   . GLU A 1 260 ? -19.707 44.182 59.706 1.00 48.03 ? 260  GLU A C   1 
ATOM   1994 O O   . GLU A 1 260 ? -20.210 45.305 59.780 1.00 47.41 ? 260  GLU A O   1 
ATOM   1995 C CB  . GLU A 1 260 ? -20.091 42.881 57.581 1.00 49.16 ? 260  GLU A CB  1 
ATOM   1996 N N   . GLU A 1 261 ? -19.683 43.337 60.734 1.00 47.93 ? 261  GLU A N   1 
ATOM   1997 C CA  . GLU A 1 261 ? -20.245 43.726 62.028 1.00 49.23 ? 261  GLU A CA  1 
ATOM   1998 C C   . GLU A 1 261 ? -19.404 44.870 62.635 1.00 47.16 ? 261  GLU A C   1 
ATOM   1999 O O   . GLU A 1 261 ? -19.955 45.885 63.087 1.00 43.78 ? 261  GLU A O   1 
ATOM   2000 C CB  . GLU A 1 261 ? -20.254 42.528 62.994 1.00 53.80 ? 261  GLU A CB  1 
ATOM   2001 C CG  . GLU A 1 261 ? -21.221 41.396 62.617 1.00 60.78 ? 261  GLU A CG  1 
ATOM   2002 C CD  . GLU A 1 261 ? -22.643 41.611 63.156 1.00 65.48 ? 261  GLU A CD  1 
ATOM   2003 O OE1 . GLU A 1 261 ? -23.157 42.761 63.107 1.00 66.60 ? 261  GLU A OE1 1 
ATOM   2004 O OE2 . GLU A 1 261 ? -23.248 40.617 63.623 1.00 67.92 ? 261  GLU A OE2 1 
ATOM   2005 N N   . LEU A 1 262 ? -18.075 44.686 62.634 1.00 45.59 ? 262  LEU A N   1 
ATOM   2006 C CA  . LEU A 1 262 ? -17.132 45.668 63.169 1.00 44.58 ? 262  LEU A CA  1 
ATOM   2007 C C   . LEU A 1 262 ? -17.242 47.006 62.439 1.00 44.20 ? 262  LEU A C   1 
ATOM   2008 O O   . LEU A 1 262 ? -17.409 48.060 63.064 1.00 42.77 ? 262  LEU A O   1 
ATOM   2009 C CB  . LEU A 1 262 ? -15.700 45.127 63.075 1.00 44.54 ? 262  LEU A CB  1 
ATOM   2010 C CG  . LEU A 1 262 ? -14.530 46.027 63.515 1.00 44.72 ? 262  LEU A CG  1 
ATOM   2011 C CD1 . LEU A 1 262 ? -14.813 46.677 64.862 1.00 42.22 ? 262  LEU A CD1 1 
ATOM   2012 C CD2 . LEU A 1 262 ? -13.253 45.188 63.594 1.00 42.67 ? 262  LEU A CD2 1 
ATOM   2013 N N   . ILE A 1 263 ? -17.191 46.962 61.114 1.00 44.23 ? 263  ILE A N   1 
ATOM   2014 C CA  . ILE A 1 263 ? -17.277 48.188 60.337 1.00 45.45 ? 263  ILE A CA  1 
ATOM   2015 C C   . ILE A 1 263 ? -18.578 48.961 60.573 1.00 45.66 ? 263  ILE A C   1 
ATOM   2016 O O   . ILE A 1 263 ? -18.549 50.180 60.736 1.00 46.72 ? 263  ILE A O   1 
ATOM   2017 C CB  . ILE A 1 263 ? -17.119 47.897 58.831 1.00 46.20 ? 263  ILE A CB  1 
ATOM   2018 C CG1 . ILE A 1 263 ? -15.710 47.357 58.556 1.00 46.50 ? 263  ILE A CG1 1 
ATOM   2019 C CG2 . ILE A 1 263 ? -17.400 49.166 58.011 1.00 46.22 ? 263  ILE A CG2 1 
ATOM   2020 C CD1 . ILE A 1 263 ? -15.494 46.929 57.117 1.00 47.65 ? 263  ILE A CD1 1 
ATOM   2021 N N   . HIS A 1 264 ? -19.713 48.260 60.592 1.00 45.79 ? 264  HIS A N   1 
ATOM   2022 C CA  . HIS A 1 264 ? -21.020 48.903 60.796 1.00 45.37 ? 264  HIS A CA  1 
ATOM   2023 C C   . HIS A 1 264 ? -21.036 49.655 62.120 1.00 44.46 ? 264  HIS A C   1 
ATOM   2024 O O   . HIS A 1 264 ? -21.466 50.801 62.188 1.00 46.20 ? 264  HIS A O   1 
ATOM   2025 C CB  . HIS A 1 264 ? -22.151 47.862 60.782 1.00 45.57 ? 264  HIS A CB  1 
ATOM   2026 N N   . CYS A 1 265 ? -20.566 49.000 63.175 1.00 43.41 ? 265  CYS A N   1 
ATOM   2027 C CA  . CYS A 1 265 ? -20.506 49.617 64.503 1.00 43.13 ? 265  CYS A CA  1 
ATOM   2028 C C   . CYS A 1 265 ? -19.660 50.904 64.475 1.00 43.41 ? 265  CYS A C   1 
ATOM   2029 O O   . CYS A 1 265 ? -20.103 51.973 64.948 1.00 41.52 ? 265  CYS A O   1 
ATOM   2030 C CB  . CYS A 1 265 ? -19.903 48.625 65.493 1.00 41.21 ? 265  CYS A CB  1 
ATOM   2031 S SG  . CYS A 1 265 ? -19.622 49.253 67.173 0.60 40.23 ? 265  CYS A SG  1 
ATOM   2032 N N   . LEU A 1 266 ? -18.455 50.799 63.901 1.00 43.32 ? 266  LEU A N   1 
ATOM   2033 C CA  . LEU A 1 266 ? -17.556 51.954 63.811 1.00 43.21 ? 266  LEU A CA  1 
ATOM   2034 C C   . LEU A 1 266 ? -18.214 53.088 63.022 1.00 43.52 ? 266  LEU A C   1 
ATOM   2035 O O   . LEU A 1 266 ? -17.997 54.262 63.307 1.00 43.91 ? 266  LEU A O   1 
ATOM   2036 C CB  . LEU A 1 266 ? -16.207 51.540 63.189 1.00 39.84 ? 266  LEU A CB  1 
ATOM   2037 C CG  . LEU A 1 266 ? -15.374 50.556 64.038 1.00 38.35 ? 266  LEU A CG  1 
ATOM   2038 C CD1 . LEU A 1 266 ? -14.160 50.102 63.264 1.00 39.02 ? 266  LEU A CD1 1 
ATOM   2039 C CD2 . LEU A 1 266 ? -14.950 51.202 65.354 1.00 37.58 ? 266  LEU A CD2 1 
ATOM   2040 N N   . ARG A 1 267 ? -19.054 52.759 62.054 1.00 44.36 ? 267  ARG A N   1 
ATOM   2041 C CA  . ARG A 1 267 ? -19.690 53.835 61.307 1.00 47.03 ? 267  ARG A CA  1 
ATOM   2042 C C   . ARG A 1 267 ? -20.817 54.512 62.070 1.00 48.62 ? 267  ARG A C   1 
ATOM   2043 O O   . ARG A 1 267 ? -21.212 55.626 61.726 1.00 48.65 ? 267  ARG A O   1 
ATOM   2044 C CB  . ARG A 1 267 ? -20.207 53.327 59.970 1.00 46.66 ? 267  ARG A CB  1 
ATOM   2045 C CG  . ARG A 1 267 ? -19.113 53.113 58.959 1.00 46.55 ? 267  ARG A CG  1 
ATOM   2046 C CD  . ARG A 1 267 ? -19.675 52.562 57.702 1.00 47.84 ? 267  ARG A CD  1 
ATOM   2047 N NE  . ARG A 1 267 ? -18.628 52.339 56.730 1.00 51.00 ? 267  ARG A NE  1 
ATOM   2048 C CZ  . ARG A 1 267 ? -18.751 51.537 55.677 1.00 52.20 ? 267  ARG A CZ  1 
ATOM   2049 N NH1 . ARG A 1 267 ? -19.892 50.879 55.471 1.00 51.69 ? 267  ARG A NH1 1 
ATOM   2050 N NH2 . ARG A 1 267 ? -17.728 51.391 54.836 1.00 51.80 ? 267  ARG A NH2 1 
ATOM   2051 N N   . GLU A 1 268 ? -21.326 53.851 63.108 1.00 49.95 ? 268  GLU A N   1 
ATOM   2052 C CA  . GLU A 1 268 ? -22.409 54.428 63.897 1.00 51.65 ? 268  GLU A CA  1 
ATOM   2053 C C   . GLU A 1 268 ? -21.870 55.296 65.025 1.00 51.65 ? 268  GLU A C   1 
ATOM   2054 O O   . GLU A 1 268 ? -22.641 55.932 65.736 1.00 53.08 ? 268  GLU A O   1 
ATOM   2055 C CB  . GLU A 1 268 ? -23.317 53.326 64.483 1.00 52.48 ? 268  GLU A CB  1 
ATOM   2056 C CG  . GLU A 1 268 ? -24.280 52.678 63.469 1.00 54.59 ? 268  GLU A CG  1 
ATOM   2057 N N   . LYS A 1 269 ? -20.551 55.314 65.200 1.00 50.17 ? 269  LYS A N   1 
ATOM   2058 C CA  . LYS A 1 269 ? -19.933 56.121 66.253 1.00 47.97 ? 269  LYS A CA  1 
ATOM   2059 C C   . LYS A 1 269 ? -19.614 57.519 65.741 1.00 46.65 ? 269  LYS A C   1 
ATOM   2060 O O   . LYS A 1 269 ? -19.261 57.706 64.572 1.00 44.53 ? 269  LYS A O   1 
ATOM   2061 C CB  . LYS A 1 269 ? -18.627 55.486 66.730 1.00 48.98 ? 269  LYS A CB  1 
ATOM   2062 C CG  . LYS A 1 269 ? -18.758 54.089 67.287 1.00 49.45 ? 269  LYS A CG  1 
ATOM   2063 C CD  . LYS A 1 269 ? -19.611 54.079 68.547 1.00 50.90 ? 269  LYS A CD  1 
ATOM   2064 C CE  . LYS A 1 269 ? -19.715 52.680 69.144 1.00 52.94 ? 269  LYS A CE  1 
ATOM   2065 N NZ  . LYS A 1 269 ? -20.732 52.635 70.248 1.00 56.10 ? 269  LYS A NZ  1 
ATOM   2066 N N   . LYS A 1 270 ? -19.734 58.496 66.632 1.00 46.26 ? 270  LYS A N   1 
ATOM   2067 C CA  . LYS A 1 270 ? -19.430 59.881 66.302 1.00 46.13 ? 270  LYS A CA  1 
ATOM   2068 C C   . LYS A 1 270 ? -17.911 59.996 66.147 1.00 44.48 ? 270  LYS A C   1 
ATOM   2069 O O   . LYS A 1 270 ? -17.156 59.242 66.761 1.00 44.86 ? 270  LYS A O   1 
ATOM   2070 C CB  . LYS A 1 270 ? -19.915 60.827 67.415 1.00 47.04 ? 270  LYS A CB  1 
ATOM   2071 C CG  . LYS A 1 270 ? -21.440 60.931 67.528 1.00 49.11 ? 270  LYS A CG  1 
ATOM   2072 C CD  . LYS A 1 270 ? -21.862 61.679 68.796 1.00 48.75 ? 270  LYS A CD  1 
ATOM   2073 N N   . PRO A 1 271 ? -17.450 60.951 65.334 1.00 43.15 ? 271  PRO A N   1 
ATOM   2074 C CA  . PRO A 1 271 ? -16.015 61.129 65.125 1.00 43.48 ? 271  PRO A CA  1 
ATOM   2075 C C   . PRO A 1 271 ? -15.175 61.132 66.412 1.00 42.99 ? 271  PRO A C   1 
ATOM   2076 O O   . PRO A 1 271 ? -14.183 60.398 66.512 1.00 41.15 ? 271  PRO A O   1 
ATOM   2077 C CB  . PRO A 1 271 ? -15.938 62.472 64.375 1.00 44.19 ? 271  PRO A CB  1 
ATOM   2078 C CG  . PRO A 1 271 ? -17.221 62.478 63.587 1.00 42.36 ? 271  PRO A CG  1 
ATOM   2079 C CD  . PRO A 1 271 ? -18.225 61.962 64.591 1.00 41.30 ? 271  PRO A CD  1 
ATOM   2080 N N   . GLN A 1 272 ? -15.579 61.937 67.392 1.00 42.03 ? 272  GLN A N   1 
ATOM   2081 C CA  . GLN A 1 272 ? -14.802 62.055 68.624 1.00 43.20 ? 272  GLN A CA  1 
ATOM   2082 C C   . GLN A 1 272 ? -14.707 60.773 69.443 1.00 42.55 ? 272  GLN A C   1 
ATOM   2083 O O   . GLN A 1 272 ? -13.769 60.584 70.210 1.00 42.26 ? 272  GLN A O   1 
ATOM   2084 C CB  . GLN A 1 272 ? -15.342 63.208 69.480 1.00 43.20 ? 272  GLN A CB  1 
ATOM   2085 C CG  . GLN A 1 272 ? -14.449 63.586 70.679 1.00 45.15 ? 272  GLN A CG  1 
ATOM   2086 C CD  . GLN A 1 272 ? -12.980 63.841 70.292 1.00 45.94 ? 272  GLN A CD  1 
ATOM   2087 O OE1 . GLN A 1 272 ? -12.689 64.541 69.301 1.00 44.41 ? 272  GLN A OE1 1 
ATOM   2088 N NE2 . GLN A 1 272 ? -12.049 63.276 71.085 1.00 42.21 ? 272  GLN A NE2 1 
ATOM   2089 N N   . GLU A 1 273 ? -15.660 59.872 69.269 1.00 42.85 ? 273  GLU A N   1 
ATOM   2090 C CA  . GLU A 1 273 ? -15.603 58.619 70.017 1.00 43.37 ? 273  GLU A CA  1 
ATOM   2091 C C   . GLU A 1 273 ? -14.458 57.759 69.502 1.00 42.14 ? 273  GLU A C   1 
ATOM   2092 O O   . GLU A 1 273 ? -13.846 56.999 70.249 1.00 42.23 ? 273  GLU A O   1 
ATOM   2093 C CB  . GLU A 1 273 ? -16.917 57.854 69.882 1.00 45.22 ? 273  GLU A CB  1 
ATOM   2094 C CG  . GLU A 1 273 ? -18.116 58.614 70.419 1.00 49.13 ? 273  GLU A CG  1 
ATOM   2095 C CD  . GLU A 1 273 ? -19.410 57.876 70.163 1.00 51.97 ? 273  GLU A CD  1 
ATOM   2096 O OE1 . GLU A 1 273 ? -19.720 56.923 70.914 1.00 52.41 ? 273  GLU A OE1 1 
ATOM   2097 O OE2 . GLU A 1 273 ? -20.105 58.244 69.193 1.00 53.18 ? 273  GLU A OE2 1 
ATOM   2098 N N   . LEU A 1 274 ? -14.199 57.852 68.205 1.00 40.96 ? 274  LEU A N   1 
ATOM   2099 C CA  . LEU A 1 274 ? -13.112 57.099 67.615 1.00 40.13 ? 274  LEU A CA  1 
ATOM   2100 C C   . LEU A 1 274 ? -11.783 57.727 68.070 1.00 38.44 ? 274  LEU A C   1 
ATOM   2101 O O   . LEU A 1 274 ? -10.855 57.027 68.481 1.00 36.61 ? 274  LEU A O   1 
ATOM   2102 C CB  . LEU A 1 274 ? -13.220 57.128 66.089 1.00 42.74 ? 274  LEU A CB  1 
ATOM   2103 C CG  . LEU A 1 274 ? -13.955 55.997 65.336 1.00 45.91 ? 274  LEU A CG  1 
ATOM   2104 C CD1 . LEU A 1 274 ? -15.322 55.732 65.915 1.00 47.27 ? 274  LEU A CD1 1 
ATOM   2105 C CD2 . LEU A 1 274 ? -14.099 56.405 63.869 1.00 47.46 ? 274  LEU A CD2 1 
ATOM   2106 N N   . ILE A 1 275 ? -11.716 59.052 68.011 1.00 36.40 ? 275  ILE A N   1 
ATOM   2107 C CA  . ILE A 1 275 ? -10.518 59.783 68.389 1.00 36.85 ? 275  ILE A CA  1 
ATOM   2108 C C   . ILE A 1 275 ? -10.195 59.546 69.879 1.00 37.48 ? 275  ILE A C   1 
ATOM   2109 O O   . ILE A 1 275 ? -9.036  59.353 70.246 1.00 36.48 ? 275  ILE A O   1 
ATOM   2110 C CB  . ILE A 1 275 ? -10.709 61.288 68.080 1.00 37.37 ? 275  ILE A CB  1 
ATOM   2111 C CG1 . ILE A 1 275 ? -10.900 61.466 66.568 1.00 37.22 ? 275  ILE A CG1 1 
ATOM   2112 C CG2 . ILE A 1 275 ? -9.525  62.109 68.597 1.00 34.83 ? 275  ILE A CG2 1 
ATOM   2113 C CD1 . ILE A 1 275 ? -11.385 62.850 66.138 1.00 37.80 ? 275  ILE A CD1 1 
ATOM   2114 N N   . ASP A 1 276 ? -11.224 59.496 70.717 1.00 36.26 ? 276  ASP A N   1 
ATOM   2115 C CA  . ASP A 1 276 ? -11.019 59.275 72.130 1.00 36.49 ? 276  ASP A CA  1 
ATOM   2116 C C   . ASP A 1 276 ? -10.260 58.006 72.478 1.00 36.42 ? 276  ASP A C   1 
ATOM   2117 O O   . ASP A 1 276 ? -9.545  57.980 73.465 1.00 37.06 ? 276  ASP A O   1 
ATOM   2118 C CB  . ASP A 1 276 ? -12.363 59.247 72.880 1.00 38.85 ? 276  ASP A CB  1 
ATOM   2119 C CG  . ASP A 1 276 ? -12.928 60.636 73.153 1.00 39.32 ? 276  ASP A CG  1 
ATOM   2120 O OD1 . ASP A 1 276 ? -12.213 61.649 73.015 1.00 38.98 ? 276  ASP A OD1 1 
ATOM   2121 O OD2 . ASP A 1 276 ? -14.110 60.709 73.527 1.00 42.75 ? 276  ASP A OD2 1 
ATOM   2122 N N   . VAL A 1 277 ? -10.410 56.940 71.699 1.00 36.39 ? 277  VAL A N   1 
ATOM   2123 C CA  . VAL A 1 277 ? -9.709  55.691 72.039 1.00 34.74 ? 277  VAL A CA  1 
ATOM   2124 C C   . VAL A 1 277 ? -8.613  55.284 71.035 1.00 34.80 ? 277  VAL A C   1 
ATOM   2125 O O   . VAL A 1 277 ? -8.012  54.213 71.164 1.00 35.35 ? 277  VAL A O   1 
ATOM   2126 C CB  . VAL A 1 277 ? -10.731 54.515 72.181 1.00 35.30 ? 277  VAL A CB  1 
ATOM   2127 C CG1 . VAL A 1 277 ? -11.731 54.817 73.309 1.00 32.45 ? 277  VAL A CG1 1 
ATOM   2128 C CG2 . VAL A 1 277 ? -11.500 54.316 70.861 1.00 33.54 ? 277  VAL A CG2 1 
ATOM   2129 N N   . GLU A 1 278 ? -8.370  56.143 70.044 1.00 33.93 ? 278  GLU A N   1 
ATOM   2130 C CA  . GLU A 1 278 ? -7.372  55.919 68.987 1.00 33.97 ? 278  GLU A CA  1 
ATOM   2131 C C   . GLU A 1 278 ? -5.984  55.474 69.472 1.00 35.00 ? 278  GLU A C   1 
ATOM   2132 O O   . GLU A 1 278 ? -5.378  54.555 68.911 1.00 33.98 ? 278  GLU A O   1 
ATOM   2133 C CB  . GLU A 1 278 ? -7.208  57.208 68.156 1.00 35.13 ? 278  GLU A CB  1 
ATOM   2134 C CG  . GLU A 1 278 ? -6.033  57.167 67.171 1.00 34.81 ? 278  GLU A CG  1 
ATOM   2135 C CD  . GLU A 1 278 ? -5.860  58.450 66.340 1.00 37.50 ? 278  GLU A CD  1 
ATOM   2136 O OE1 . GLU A 1 278 ? -6.830  59.223 66.166 1.00 34.39 ? 278  GLU A OE1 1 
ATOM   2137 O OE2 . GLU A 1 278 ? -4.730  58.672 65.840 1.00 39.53 ? 278  GLU A OE2 1 
ATOM   2138 N N   . TRP A 1 279 ? -5.472  56.148 70.496 1.00 34.46 ? 279  TRP A N   1 
ATOM   2139 C CA  . TRP A 1 279 ? -4.160  55.824 71.013 1.00 34.42 ? 279  TRP A CA  1 
ATOM   2140 C C   . TRP A 1 279 ? -4.123  54.568 71.849 1.00 34.71 ? 279  TRP A C   1 
ATOM   2141 O O   . TRP A 1 279 ? -3.051  54.154 72.268 1.00 39.17 ? 279  TRP A O   1 
ATOM   2142 C CB  . TRP A 1 279 ? -3.597  57.005 71.815 1.00 33.03 ? 279  TRP A CB  1 
ATOM   2143 C CG  . TRP A 1 279 ? -3.375  58.210 70.957 1.00 34.81 ? 279  TRP A CG  1 
ATOM   2144 C CD1 . TRP A 1 279 ? -4.228  59.265 70.790 1.00 33.53 ? 279  TRP A CD1 1 
ATOM   2145 C CD2 . TRP A 1 279 ? -2.233  58.480 70.128 1.00 34.34 ? 279  TRP A CD2 1 
ATOM   2146 N NE1 . TRP A 1 279 ? -3.690  60.174 69.918 1.00 34.14 ? 279  TRP A NE1 1 
ATOM   2147 C CE2 . TRP A 1 279 ? -2.465  59.723 69.495 1.00 36.80 ? 279  TRP A CE2 1 
ATOM   2148 C CE3 . TRP A 1 279 ? -1.039  57.798 69.865 1.00 36.66 ? 279  TRP A CE3 1 
ATOM   2149 C CZ2 . TRP A 1 279 ? -1.543  60.306 68.598 1.00 37.23 ? 279  TRP A CZ2 1 
ATOM   2150 C CZ3 . TRP A 1 279 ? -0.110  58.375 68.969 1.00 38.69 ? 279  TRP A CZ3 1 
ATOM   2151 C CH2 . TRP A 1 279 ? -0.375  59.624 68.352 1.00 36.43 ? 279  TRP A CH2 1 
ATOM   2152 N N   . ASN A 1 280 ? -5.262  53.932 72.078 1.00 34.93 ? 280  ASN A N   1 
ATOM   2153 C CA  . ASN A 1 280 ? -5.269  52.714 72.882 1.00 34.93 ? 280  ASN A CA  1 
ATOM   2154 C C   . ASN A 1 280 ? -4.892  51.436 72.121 1.00 35.17 ? 280  ASN A C   1 
ATOM   2155 O O   . ASN A 1 280 ? -4.669  50.389 72.739 1.00 34.94 ? 280  ASN A O   1 
ATOM   2156 C CB  . ASN A 1 280 ? -6.655  52.507 73.518 1.00 35.22 ? 280  ASN A CB  1 
ATOM   2157 C CG  . ASN A 1 280 ? -7.019  53.608 74.504 1.00 37.56 ? 280  ASN A CG  1 
ATOM   2158 O OD1 . ASN A 1 280 ? -6.142  54.337 74.981 1.00 38.83 ? 280  ASN A OD1 1 
ATOM   2159 N ND2 . ASN A 1 280 ? -8.312  53.729 74.827 1.00 34.49 ? 280  ASN A ND2 1 
ATOM   2160 N N   . VAL A 1 281 ? -4.797  51.506 70.798 1.00 34.41 ? 281  VAL A N   1 
ATOM   2161 C CA  . VAL A 1 281 ? -4.528  50.297 70.017 1.00 34.88 ? 281  VAL A CA  1 
ATOM   2162 C C   . VAL A 1 281 ? -3.078  49.969 69.669 1.00 35.87 ? 281  VAL A C   1 
ATOM   2163 O O   . VAL A 1 281 ? -2.809  48.935 69.052 1.00 34.50 ? 281  VAL A O   1 
ATOM   2164 C CB  . VAL A 1 281 ? -5.373  50.304 68.691 1.00 35.56 ? 281  VAL A CB  1 
ATOM   2165 C CG1 . VAL A 1 281 ? -6.836  50.663 69.003 1.00 33.52 ? 281  VAL A CG1 1 
ATOM   2166 C CG2 . VAL A 1 281 ? -4.793  51.285 67.701 1.00 31.30 ? 281  VAL A CG2 1 
ATOM   2167 N N   . LEU A 1 282 ? -2.147  50.848 70.026 1.00 36.84 ? 282  LEU A N   1 
ATOM   2168 C CA  . LEU A 1 282 ? -0.731  50.592 69.751 1.00 37.16 ? 282  LEU A CA  1 
ATOM   2169 C C   . LEU A 1 282 ? -0.358  49.287 70.444 1.00 38.22 ? 282  LEU A C   1 
ATOM   2170 O O   . LEU A 1 282 ? -0.838  48.994 71.544 1.00 36.74 ? 282  LEU A O   1 
ATOM   2171 C CB  . LEU A 1 282 ? 0.158   51.732 70.296 1.00 36.86 ? 282  LEU A CB  1 
ATOM   2172 C CG  . LEU A 1 282 ? 0.077   53.048 69.507 1.00 36.93 ? 282  LEU A CG  1 
ATOM   2173 C CD1 . LEU A 1 282 ? 0.907   54.116 70.196 1.00 35.57 ? 282  LEU A CD1 1 
ATOM   2174 C CD2 . LEU A 1 282 ? 0.561   52.818 68.070 1.00 36.04 ? 282  LEU A CD2 1 
ATOM   2175 N N   . PRO A 1 283 ? 0.508   48.487 69.817 1.00 38.21 ? 283  PRO A N   1 
ATOM   2176 C CA  . PRO A 1 283 ? 0.910   47.214 70.423 1.00 37.26 ? 283  PRO A CA  1 
ATOM   2177 C C   . PRO A 1 283 ? 1.896   47.365 71.586 1.00 38.40 ? 283  PRO A C   1 
ATOM   2178 O O   . PRO A 1 283 ? 1.908   46.528 72.494 1.00 37.03 ? 283  PRO A O   1 
ATOM   2179 C CB  . PRO A 1 283 ? 1.518   46.450 69.243 1.00 36.99 ? 283  PRO A CB  1 
ATOM   2180 C CG  . PRO A 1 283 ? 2.165   47.572 68.450 1.00 37.31 ? 283  PRO A CG  1 
ATOM   2181 C CD  . PRO A 1 283 ? 1.098   48.656 68.475 1.00 37.24 ? 283  PRO A CD  1 
ATOM   2182 N N   . PHE A 1 284 ? 2.720   48.414 71.564 1.00 37.59 ? 284  PHE A N   1 
ATOM   2183 C CA  . PHE A 1 284 ? 3.708   48.621 72.632 1.00 37.49 ? 284  PHE A CA  1 
ATOM   2184 C C   . PHE A 1 284 ? 3.680   50.012 73.232 1.00 35.61 ? 284  PHE A C   1 
ATOM   2185 O O   . PHE A 1 284 ? 3.150   50.944 72.637 1.00 35.56 ? 284  PHE A O   1 
ATOM   2186 C CB  . PHE A 1 284 ? 5.128   48.429 72.111 1.00 38.28 ? 284  PHE A CB  1 
ATOM   2187 C CG  . PHE A 1 284 ? 5.311   47.216 71.296 1.00 41.76 ? 284  PHE A CG  1 
ATOM   2188 C CD1 . PHE A 1 284 ? 5.219   45.953 71.878 1.00 42.57 ? 284  PHE A CD1 1 
ATOM   2189 C CD2 . PHE A 1 284 ? 5.592   47.324 69.931 1.00 42.91 ? 284  PHE A CD2 1 
ATOM   2190 C CE1 . PHE A 1 284 ? 5.407   44.798 71.112 1.00 44.30 ? 284  PHE A CE1 1 
ATOM   2191 C CE2 . PHE A 1 284 ? 5.781   46.191 69.151 1.00 45.07 ? 284  PHE A CE2 1 
ATOM   2192 C CZ  . PHE A 1 284 ? 5.689   44.914 69.743 1.00 45.41 ? 284  PHE A CZ  1 
ATOM   2193 N N   . ASP A 1 285 ? 4.268   50.144 74.414 1.00 34.07 ? 285  ASP A N   1 
ATOM   2194 C CA  . ASP A 1 285 ? 4.407   51.453 75.055 1.00 33.33 ? 285  ASP A CA  1 
ATOM   2195 C C   . ASP A 1 285 ? 5.543   52.023 74.183 1.00 32.98 ? 285  ASP A C   1 
ATOM   2196 O O   . ASP A 1 285 ? 6.614   51.427 74.074 1.00 33.37 ? 285  ASP A O   1 
ATOM   2197 C CB  . ASP A 1 285 ? 4.878   51.258 76.484 1.00 33.89 ? 285  ASP A CB  1 
ATOM   2198 C CG  . ASP A 1 285 ? 4.957   52.554 77.265 1.00 36.53 ? 285  ASP A CG  1 
ATOM   2199 O OD1 . ASP A 1 285 ? 4.512   53.619 76.740 1.00 32.44 ? 285  ASP A OD1 1 
ATOM   2200 O OD2 . ASP A 1 285 ? 5.461   52.471 78.421 1.00 34.97 ? 285  ASP A OD2 1 
ATOM   2201 N N   . SER A 1 286 ? 5.326   53.168 73.562 1.00 32.91 ? 286  SER A N   1 
ATOM   2202 C CA  . SER A 1 286 ? 6.332   53.668 72.642 1.00 32.98 ? 286  SER A CA  1 
ATOM   2203 C C   . SER A 1 286 ? 6.142   55.114 72.245 1.00 33.02 ? 286  SER A C   1 
ATOM   2204 O O   . SER A 1 286 ? 5.099   55.730 72.517 1.00 31.88 ? 286  SER A O   1 
ATOM   2205 C CB  . SER A 1 286 ? 6.265   52.830 71.364 1.00 34.42 ? 286  SER A CB  1 
ATOM   2206 O OG  . SER A 1 286 ? 4.912   52.809 70.899 1.00 35.56 ? 286  SER A OG  1 
ATOM   2207 N N   . ILE A 1 287 ? 7.160   55.655 71.588 1.00 31.72 ? 287  ILE A N   1 
ATOM   2208 C CA  . ILE A 1 287 ? 7.063   57.018 71.103 1.00 31.79 ? 287  ILE A CA  1 
ATOM   2209 C C   . ILE A 1 287 ? 7.361   56.958 69.620 1.00 31.58 ? 287  ILE A C   1 
ATOM   2210 O O   . ILE A 1 287 ? 8.021   56.027 69.148 1.00 29.67 ? 287  ILE A O   1 
ATOM   2211 C CB  . ILE A 1 287 ? 8.056   57.984 71.809 1.00 32.94 ? 287  ILE A CB  1 
ATOM   2212 C CG1 . ILE A 1 287 ? 9.485   57.451 71.697 1.00 29.89 ? 287  ILE A CG1 1 
ATOM   2213 C CG2 . ILE A 1 287 ? 7.634   58.189 73.257 1.00 32.00 ? 287  ILE A CG2 1 
ATOM   2214 C CD1 . ILE A 1 287 ? 10.503  58.443 72.195 1.00 31.52 ? 287  ILE A CD1 1 
ATOM   2215 N N   . PHE A 1 288 ? 6.888   57.971 68.905 1.00 30.28 ? 288  PHE A N   1 
ATOM   2216 C CA  . PHE A 1 288 ? 7.041   58.049 67.467 1.00 32.30 ? 288  PHE A CA  1 
ATOM   2217 C C   . PHE A 1 288 ? 6.340   56.845 66.806 1.00 32.40 ? 288  PHE A C   1 
ATOM   2218 O O   . PHE A 1 288 ? 6.830   56.282 65.831 1.00 32.89 ? 288  PHE A O   1 
ATOM   2219 C CB  . PHE A 1 288 ? 8.526   58.114 67.048 1.00 30.64 ? 288  PHE A CB  1 
ATOM   2220 C CG  . PHE A 1 288 ? 8.776   59.083 65.897 1.00 31.45 ? 288  PHE A CG  1 
ATOM   2221 C CD1 . PHE A 1 288 ? 7.948   59.066 64.760 1.00 28.95 ? 288  PHE A CD1 1 
ATOM   2222 C CD2 . PHE A 1 288 ? 9.791   60.033 65.969 1.00 28.49 ? 288  PHE A CD2 1 
ATOM   2223 C CE1 . PHE A 1 288 ? 8.126   59.977 63.729 1.00 27.91 ? 288  PHE A CE1 1 
ATOM   2224 C CE2 . PHE A 1 288 ? 9.991   60.949 64.950 1.00 26.96 ? 288  PHE A CE2 1 
ATOM   2225 C CZ  . PHE A 1 288 ? 9.154   60.929 63.818 1.00 29.24 ? 288  PHE A CZ  1 
ATOM   2226 N N   . ARG A 1 289 ? 5.221   56.422 67.388 1.00 32.13 ? 289  ARG A N   1 
ATOM   2227 C CA  . ARG A 1 289 ? 4.414   55.337 66.822 1.00 32.57 ? 289  ARG A CA  1 
ATOM   2228 C C   . ARG A 1 289 ? 2.965   55.835 66.825 1.00 32.89 ? 289  ARG A C   1 
ATOM   2229 O O   . ARG A 1 289 ? 2.470   56.357 67.835 1.00 31.63 ? 289  ARG A O   1 
ATOM   2230 C CB  . ARG A 1 289 ? 4.553   54.051 67.633 1.00 31.31 ? 289  ARG A CB  1 
ATOM   2231 C CG  . ARG A 1 289 ? 5.923   53.406 67.497 1.00 31.20 ? 289  ARG A CG  1 
ATOM   2232 C CD  . ARG A 1 289 ? 6.217   53.012 66.044 1.00 32.28 ? 289  ARG A CD  1 
ATOM   2233 N NE  . ARG A 1 289 ? 7.468   52.252 65.955 1.00 30.90 ? 289  ARG A NE  1 
ATOM   2234 C CZ  . ARG A 1 289 ? 8.691   52.783 65.878 1.00 31.52 ? 289  ARG A CZ  1 
ATOM   2235 N NH1 . ARG A 1 289 ? 8.876   54.110 65.868 1.00 27.24 ? 289  ARG A NH1 1 
ATOM   2236 N NH2 . ARG A 1 289 ? 9.737   51.975 65.811 1.00 26.78 ? 289  ARG A NH2 1 
ATOM   2237 N N   . PHE A 1 290 ? 2.309   55.689 65.677 1.00 32.18 ? 290  PHE A N   1 
ATOM   2238 C CA  . PHE A 1 290 ? 0.943   56.156 65.486 1.00 32.78 ? 290  PHE A CA  1 
ATOM   2239 C C   . PHE A 1 290 ? 0.048   54.984 65.099 1.00 33.11 ? 290  PHE A C   1 
ATOM   2240 O O   . PHE A 1 290 ? 0.475   54.059 64.411 1.00 33.38 ? 290  PHE A O   1 
ATOM   2241 C CB  . PHE A 1 290 ? 0.982   57.256 64.428 1.00 31.70 ? 290  PHE A CB  1 
ATOM   2242 C CG  . PHE A 1 290 ? 2.183   58.158 64.572 1.00 31.61 ? 290  PHE A CG  1 
ATOM   2243 C CD1 . PHE A 1 290 ? 2.401   58.860 65.762 1.00 32.04 ? 290  PHE A CD1 1 
ATOM   2244 C CD2 . PHE A 1 290 ? 3.108   58.290 63.538 1.00 30.79 ? 290  PHE A CD2 1 
ATOM   2245 C CE1 . PHE A 1 290 ? 3.516   59.678 65.915 1.00 32.92 ? 290  PHE A CE1 1 
ATOM   2246 C CE2 . PHE A 1 290 ? 4.226   59.106 63.676 1.00 32.00 ? 290  PHE A CE2 1 
ATOM   2247 C CZ  . PHE A 1 290 ? 4.438   59.808 64.866 1.00 31.52 ? 290  PHE A CZ  1 
ATOM   2248 N N   . SER A 1 291 ? -1.192  55.038 65.554 1.00 33.17 ? 291  SER A N   1 
ATOM   2249 C CA  . SER A 1 291 ? -2.145  53.947 65.360 1.00 35.49 ? 291  SER A CA  1 
ATOM   2250 C C   . SER A 1 291 ? -2.613  53.567 63.948 1.00 35.27 ? 291  SER A C   1 
ATOM   2251 O O   . SER A 1 291 ? -2.505  52.405 63.553 1.00 34.25 ? 291  SER A O   1 
ATOM   2252 C CB  . SER A 1 291 ? -3.381  54.201 66.228 1.00 35.34 ? 291  SER A CB  1 
ATOM   2253 O OG  . SER A 1 291 ? -3.020  54.217 67.587 1.00 36.48 ? 291  SER A OG  1 
ATOM   2254 N N   . PHE A 1 292 ? -3.146  54.531 63.209 1.00 32.19 ? 292  PHE A N   1 
ATOM   2255 C CA  . PHE A 1 292 ? -3.650  54.239 61.878 1.00 32.87 ? 292  PHE A CA  1 
ATOM   2256 C C   . PHE A 1 292 ? -2.806  54.837 60.789 1.00 33.31 ? 292  PHE A C   1 
ATOM   2257 O O   . PHE A 1 292 ? -2.870  56.041 60.506 1.00 33.28 ? 292  PHE A O   1 
ATOM   2258 C CB  . PHE A 1 292 ? -5.096  54.700 61.804 1.00 31.05 ? 292  PHE A CB  1 
ATOM   2259 C CG  . PHE A 1 292 ? -5.941  54.005 62.804 1.00 31.41 ? 292  PHE A CG  1 
ATOM   2260 C CD1 . PHE A 1 292 ? -6.224  52.645 62.641 1.00 29.86 ? 292  PHE A CD1 1 
ATOM   2261 C CD2 . PHE A 1 292 ? -6.297  54.639 63.995 1.00 29.51 ? 292  PHE A CD2 1 
ATOM   2262 C CE1 . PHE A 1 292 ? -6.844  51.902 63.659 1.00 32.18 ? 292  PHE A CE1 1 
ATOM   2263 C CE2 . PHE A 1 292 ? -6.915  53.916 65.034 1.00 33.58 ? 292  PHE A CE2 1 
ATOM   2264 C CZ  . PHE A 1 292 ? -7.189  52.539 64.871 1.00 32.51 ? 292  PHE A CZ  1 
ATOM   2265 N N   . VAL A 1 293 ? -2.013  53.961 60.185 1.00 31.49 ? 293  VAL A N   1 
ATOM   2266 C CA  . VAL A 1 293 ? -1.102  54.356 59.138 1.00 31.18 ? 293  VAL A CA  1 
ATOM   2267 C C   . VAL A 1 293 ? -1.258  53.455 57.912 1.00 32.98 ? 293  VAL A C   1 
ATOM   2268 O O   . VAL A 1 293 ? -1.977  52.459 57.955 1.00 32.81 ? 293  VAL A O   1 
ATOM   2269 C CB  . VAL A 1 293 ? 0.376   54.263 59.667 1.00 30.34 ? 293  VAL A CB  1 
ATOM   2270 C CG1 . VAL A 1 293 ? 0.555   55.153 60.915 1.00 25.57 ? 293  VAL A CG1 1 
ATOM   2271 C CG2 . VAL A 1 293 ? 0.733   52.799 60.007 1.00 27.41 ? 293  VAL A CG2 1 
ATOM   2272 N N   . PRO A 1 294 ? -0.595  53.812 56.797 1.00 32.90 ? 294  PRO A N   1 
ATOM   2273 C CA  . PRO A 1 294 ? -0.652  53.021 55.573 1.00 33.41 ? 294  PRO A CA  1 
ATOM   2274 C C   . PRO A 1 294 ? -0.380  51.530 55.856 1.00 35.06 ? 294  PRO A C   1 
ATOM   2275 O O   . PRO A 1 294 ? 0.377   51.179 56.769 1.00 34.88 ? 294  PRO A O   1 
ATOM   2276 C CB  . PRO A 1 294 ? 0.444   53.650 54.719 1.00 33.40 ? 294  PRO A CB  1 
ATOM   2277 C CG  . PRO A 1 294 ? 0.280   55.102 55.019 1.00 33.71 ? 294  PRO A CG  1 
ATOM   2278 C CD  . PRO A 1 294 ? 0.046   55.124 56.544 1.00 33.04 ? 294  PRO A CD  1 
ATOM   2279 N N   . VAL A 1 295 ? -0.979  50.666 55.042 1.00 34.70 ? 295  VAL A N   1 
ATOM   2280 C CA  . VAL A 1 295 ? -0.834  49.223 55.186 1.00 35.19 ? 295  VAL A CA  1 
ATOM   2281 C C   . VAL A 1 295 ? -0.234  48.622 53.891 1.00 34.61 ? 295  VAL A C   1 
ATOM   2282 O O   . VAL A 1 295 ? -0.605  49.019 52.773 1.00 33.17 ? 295  VAL A O   1 
ATOM   2283 C CB  . VAL A 1 295 ? -2.240  48.619 55.516 1.00 35.91 ? 295  VAL A CB  1 
ATOM   2284 C CG1 . VAL A 1 295 ? -3.183  48.825 54.323 1.00 35.97 ? 295  VAL A CG1 1 
ATOM   2285 C CG2 . VAL A 1 295 ? -2.135  47.165 55.873 1.00 37.76 ? 295  VAL A CG2 1 
ATOM   2286 N N   . ILE A 1 296 ? 0.737   47.716 54.040 1.00 34.51 ? 296  ILE A N   1 
ATOM   2287 C CA  . ILE A 1 296 ? 1.383   47.050 52.894 1.00 34.17 ? 296  ILE A CA  1 
ATOM   2288 C C   . ILE A 1 296 ? 0.365   45.989 52.454 1.00 37.14 ? 296  ILE A C   1 
ATOM   2289 O O   . ILE A 1 296 ? 0.323   44.869 52.973 1.00 36.82 ? 296  ILE A O   1 
ATOM   2290 C CB  . ILE A 1 296 ? 2.720   46.412 53.337 1.00 35.14 ? 296  ILE A CB  1 
ATOM   2291 C CG1 . ILE A 1 296 ? 3.579   47.482 54.034 1.00 33.23 ? 296  ILE A CG1 1 
ATOM   2292 C CG2 . ILE A 1 296 ? 3.516   45.913 52.104 1.00 33.38 ? 296  ILE A CG2 1 
ATOM   2293 C CD1 . ILE A 1 296 ? 3.845   48.748 53.122 1.00 28.19 ? 296  ILE A CD1 1 
ATOM   2294 N N   . ASP A 1 297 ? -0.461  46.373 51.486 1.00 37.42 ? 297  ASP A N   1 
ATOM   2295 C CA  . ASP A 1 297 ? -1.597  45.566 51.057 1.00 39.78 ? 297  ASP A CA  1 
ATOM   2296 C C   . ASP A 1 297 ? -1.571  44.754 49.774 1.00 39.32 ? 297  ASP A C   1 
ATOM   2297 O O   . ASP A 1 297 ? -2.479  43.966 49.554 1.00 39.30 ? 297  ASP A O   1 
ATOM   2298 C CB  . ASP A 1 297 ? -2.807  46.496 50.968 1.00 39.01 ? 297  ASP A CB  1 
ATOM   2299 C CG  . ASP A 1 297 ? -2.630  47.542 49.869 1.00 41.62 ? 297  ASP A CG  1 
ATOM   2300 O OD1 . ASP A 1 297 ? -1.473  47.692 49.390 1.00 39.84 ? 297  ASP A OD1 1 
ATOM   2301 O OD2 . ASP A 1 297 ? -3.624  48.207 49.485 1.00 45.03 ? 297  ASP A OD2 1 
ATOM   2302 N N   . GLY A 1 298 ? -0.590  44.961 48.906 1.00 39.98 ? 298  GLY A N   1 
ATOM   2303 C CA  . GLY A 1 298 ? -0.593  44.221 47.654 1.00 40.72 ? 298  GLY A CA  1 
ATOM   2304 C C   . GLY A 1 298 ? -1.309  44.962 46.521 1.00 43.23 ? 298  GLY A C   1 
ATOM   2305 O O   . GLY A 1 298 ? -1.233  44.532 45.370 1.00 44.61 ? 298  GLY A O   1 
ATOM   2306 N N   . GLU A 1 299 ? -2.012  46.058 46.831 1.00 42.62 ? 299  GLU A N   1 
ATOM   2307 C CA  . GLU A 1 299 ? -2.714  46.867 45.822 1.00 42.23 ? 299  GLU A CA  1 
ATOM   2308 C C   . GLU A 1 299 ? -1.938  48.191 45.662 1.00 40.40 ? 299  GLU A C   1 
ATOM   2309 O O   . GLU A 1 299 ? -1.178  48.382 44.713 1.00 40.46 ? 299  GLU A O   1 
ATOM   2310 C CB  . GLU A 1 299 ? -4.152  47.190 46.278 1.00 45.08 ? 299  GLU A CB  1 
ATOM   2311 C CG  . GLU A 1 299 ? -4.941  46.013 46.888 1.00 51.03 ? 299  GLU A CG  1 
ATOM   2312 N N   . PHE A 1 300 ? -2.146  49.110 46.602 1.00 37.98 ? 300  PHE A N   1 
ATOM   2313 C CA  . PHE A 1 300 ? -1.454  50.378 46.582 1.00 35.34 ? 300  PHE A CA  1 
ATOM   2314 C C   . PHE A 1 300 ? 0.069   50.123 46.571 1.00 35.96 ? 300  PHE A C   1 
ATOM   2315 O O   . PHE A 1 300 ? 0.806   50.782 45.840 1.00 35.07 ? 300  PHE A O   1 
ATOM   2316 C CB  . PHE A 1 300 ? -1.887  51.208 47.792 1.00 34.71 ? 300  PHE A CB  1 
ATOM   2317 C CG  . PHE A 1 300 ? -1.457  52.639 47.714 1.00 35.53 ? 300  PHE A CG  1 
ATOM   2318 C CD1 . PHE A 1 300 ? -0.148  52.999 48.013 1.00 36.03 ? 300  PHE A CD1 1 
ATOM   2319 C CD2 . PHE A 1 300 ? -2.340  53.622 47.272 1.00 35.35 ? 300  PHE A CD2 1 
ATOM   2320 C CE1 . PHE A 1 300 ? 0.277   54.322 47.865 1.00 35.15 ? 300  PHE A CE1 1 
ATOM   2321 C CE2 . PHE A 1 300 ? -1.935  54.936 47.121 1.00 33.61 ? 300  PHE A CE2 1 
ATOM   2322 C CZ  . PHE A 1 300 ? -0.619  55.288 47.419 1.00 35.05 ? 300  PHE A CZ  1 
ATOM   2323 N N   . PHE A 1 301 ? 0.529   49.166 47.385 1.00 36.39 ? 301  PHE A N   1 
ATOM   2324 C CA  . PHE A 1 301 ? 1.945   48.764 47.431 1.00 35.81 ? 301  PHE A CA  1 
ATOM   2325 C C   . PHE A 1 301 ? 1.941   47.314 46.917 1.00 37.81 ? 301  PHE A C   1 
ATOM   2326 O O   . PHE A 1 301 ? 1.513   46.399 47.612 1.00 37.80 ? 301  PHE A O   1 
ATOM   2327 C CB  . PHE A 1 301 ? 2.491   48.836 48.864 1.00 33.88 ? 301  PHE A CB  1 
ATOM   2328 C CG  . PHE A 1 301 ? 2.393   50.214 49.478 1.00 32.91 ? 301  PHE A CG  1 
ATOM   2329 C CD1 . PHE A 1 301 ? 3.258   51.238 49.081 1.00 32.32 ? 301  PHE A CD1 1 
ATOM   2330 C CD2 . PHE A 1 301 ? 1.436   50.493 50.453 1.00 31.78 ? 301  PHE A CD2 1 
ATOM   2331 C CE1 . PHE A 1 301 ? 3.171   52.525 49.657 1.00 33.48 ? 301  PHE A CE1 1 
ATOM   2332 C CE2 . PHE A 1 301 ? 1.341   51.775 51.035 1.00 32.78 ? 301  PHE A CE2 1 
ATOM   2333 C CZ  . PHE A 1 301 ? 2.209   52.786 50.636 1.00 30.86 ? 301  PHE A CZ  1 
ATOM   2334 N N   . PRO A 1 302 ? 2.420   47.094 45.687 1.00 37.82 ? 302  PRO A N   1 
ATOM   2335 C CA  . PRO A 1 302 ? 2.425   45.733 45.133 1.00 39.22 ? 302  PRO A CA  1 
ATOM   2336 C C   . PRO A 1 302 ? 3.133   44.670 45.971 1.00 39.41 ? 302  PRO A C   1 
ATOM   2337 O O   . PRO A 1 302 ? 2.640   43.554 46.081 1.00 37.99 ? 302  PRO A O   1 
ATOM   2338 C CB  . PRO A 1 302 ? 3.059   45.916 43.740 1.00 38.47 ? 302  PRO A CB  1 
ATOM   2339 C CG  . PRO A 1 302 ? 2.771   47.395 43.408 1.00 40.38 ? 302  PRO A CG  1 
ATOM   2340 C CD  . PRO A 1 302 ? 3.019   48.057 44.745 1.00 37.48 ? 302  PRO A CD  1 
ATOM   2341 N N   . THR A 1 303 ? 4.292   45.006 46.537 1.00 39.30 ? 303  THR A N   1 
ATOM   2342 C CA  . THR A 1 303 ? 5.033   44.067 47.375 1.00 39.54 ? 303  THR A CA  1 
ATOM   2343 C C   . THR A 1 303 ? 5.618   44.874 48.540 1.00 39.41 ? 303  THR A C   1 
ATOM   2344 O O   . THR A 1 303 ? 5.333   46.074 48.658 1.00 39.06 ? 303  THR A O   1 
ATOM   2345 C CB  . THR A 1 303 ? 6.190   43.380 46.592 1.00 41.61 ? 303  THR A CB  1 
ATOM   2346 O OG1 . THR A 1 303 ? 7.224   44.334 46.305 1.00 42.86 ? 303  THR A OG1 1 
ATOM   2347 C CG2 . THR A 1 303 ? 5.684   42.815 45.276 1.00 40.67 ? 303  THR A CG2 1 
ATOM   2348 N N   . SER A 1 304 ? 6.435   44.242 49.389 1.00 37.37 ? 304  SER A N   1 
ATOM   2349 C CA  . SER A 1 304 ? 7.034   44.957 50.522 1.00 37.60 ? 304  SER A CA  1 
ATOM   2350 C C   . SER A 1 304 ? 7.834   46.169 49.994 1.00 37.15 ? 304  SER A C   1 
ATOM   2351 O O   . SER A 1 304 ? 8.292   46.174 48.832 1.00 36.30 ? 304  SER A O   1 
ATOM   2352 C CB  . SER A 1 304 ? 7.966   44.039 51.315 1.00 36.05 ? 304  SER A CB  1 
ATOM   2353 O OG  . SER A 1 304 ? 9.132   43.740 50.563 1.00 39.17 ? 304  SER A OG  1 
ATOM   2354 N N   . LEU A 1 305 ? 7.998   47.188 50.837 1.00 35.50 ? 305  LEU A N   1 
ATOM   2355 C CA  . LEU A 1 305 ? 8.708   48.386 50.415 1.00 36.72 ? 305  LEU A CA  1 
ATOM   2356 C C   . LEU A 1 305 ? 10.166  48.108 50.047 1.00 37.88 ? 305  LEU A C   1 
ATOM   2357 O O   . LEU A 1 305 ? 10.675  48.608 49.027 1.00 39.13 ? 305  LEU A O   1 
ATOM   2358 C CB  . LEU A 1 305 ? 8.625   49.449 51.509 1.00 34.58 ? 305  LEU A CB  1 
ATOM   2359 C CG  . LEU A 1 305 ? 7.202   49.841 51.907 1.00 38.04 ? 305  LEU A CG  1 
ATOM   2360 C CD1 . LEU A 1 305 ? 7.267   50.997 52.891 1.00 35.08 ? 305  LEU A CD1 1 
ATOM   2361 C CD2 . LEU A 1 305 ? 6.366   50.221 50.662 1.00 37.04 ? 305  LEU A CD2 1 
ATOM   2362 N N   . GLU A 1 306 ? 10.827  47.302 50.868 1.00 38.05 ? 306  GLU A N   1 
ATOM   2363 C CA  . GLU A 1 306 ? 12.225  46.961 50.653 1.00 38.48 ? 306  GLU A CA  1 
ATOM   2364 C C   . GLU A 1 306 ? 12.478  46.244 49.314 1.00 37.86 ? 306  GLU A C   1 
ATOM   2365 O O   . GLU A 1 306 ? 13.457  46.542 48.631 1.00 36.62 ? 306  GLU A O   1 
ATOM   2366 C CB  . GLU A 1 306 ? 12.721  46.116 51.835 1.00 38.99 ? 306  GLU A CB  1 
ATOM   2367 C CG  . GLU A 1 306 ? 14.233  45.897 51.876 1.00 45.93 ? 306  GLU A CG  1 
ATOM   2368 C CD  . GLU A 1 306 ? 15.071  47.190 51.826 1.00 50.45 ? 306  GLU A CD  1 
ATOM   2369 O OE1 . GLU A 1 306 ? 14.590  48.280 52.235 1.00 52.32 ? 306  GLU A OE1 1 
ATOM   2370 O OE2 . GLU A 1 306 ? 16.241  47.100 51.392 1.00 53.77 ? 306  GLU A OE2 1 
ATOM   2371 N N   . SER A 1 307 ? 11.609  45.306 48.929 1.00 37.50 ? 307  SER A N   1 
ATOM   2372 C CA  . SER A 1 307 ? 11.811  44.633 47.642 1.00 38.75 ? 307  SER A CA  1 
ATOM   2373 C C   . SER A 1 307 ? 11.519  45.614 46.514 1.00 38.71 ? 307  SER A C   1 
ATOM   2374 O O   . SER A 1 307 ? 12.205  45.597 45.488 1.00 40.62 ? 307  SER A O   1 
ATOM   2375 C CB  . SER A 1 307 ? 10.940  43.380 47.493 1.00 38.67 ? 307  SER A CB  1 
ATOM   2376 O OG  . SER A 1 307 ? 9.575   43.669 47.640 1.00 43.76 ? 307  SER A OG  1 
ATOM   2377 N N   . MET A 1 308 ? 10.520  46.485 46.693 1.00 38.49 ? 308  MET A N   1 
ATOM   2378 C CA  . MET A 1 308 ? 10.234  47.482 45.663 1.00 36.82 ? 308  MET A CA  1 
ATOM   2379 C C   . MET A 1 308 ? 11.476  48.374 45.517 1.00 36.78 ? 308  MET A C   1 
ATOM   2380 O O   . MET A 1 308 ? 11.969  48.599 44.413 1.00 36.18 ? 308  MET A O   1 
ATOM   2381 C CB  . MET A 1 308 ? 9.026   48.329 46.057 1.00 36.42 ? 308  MET A CB  1 
ATOM   2382 C CG  . MET A 1 308 ? 7.714   47.609 45.959 1.00 34.93 ? 308  MET A CG  1 
ATOM   2383 S SD  . MET A 1 308 ? 6.269   48.700 46.197 1.00 38.81 ? 308  MET A SD  1 
ATOM   2384 C CE  . MET A 1 308 ? 6.298   49.631 44.545 1.00 35.44 ? 308  MET A CE  1 
ATOM   2385 N N   . LEU A 1 309 ? 11.996  48.860 46.642 1.00 36.87 ? 309  LEU A N   1 
ATOM   2386 C CA  . LEU A 1 309 ? 13.178  49.707 46.612 1.00 39.07 ? 309  LEU A CA  1 
ATOM   2387 C C   . LEU A 1 309 ? 14.377  48.980 45.995 1.00 41.56 ? 309  LEU A C   1 
ATOM   2388 O O   . LEU A 1 309 ? 15.139  49.556 45.208 1.00 42.21 ? 309  LEU A O   1 
ATOM   2389 C CB  . LEU A 1 309 ? 13.548  50.165 48.021 1.00 37.44 ? 309  LEU A CB  1 
ATOM   2390 C CG  . LEU A 1 309 ? 12.643  51.217 48.660 1.00 41.48 ? 309  LEU A CG  1 
ATOM   2391 C CD1 . LEU A 1 309 ? 13.130  51.494 50.086 1.00 39.89 ? 309  LEU A CD1 1 
ATOM   2392 C CD2 . LEU A 1 309 ? 12.634  52.507 47.811 1.00 38.60 ? 309  LEU A CD2 1 
ATOM   2393 N N   . ASN A 1 310 ? 14.541  47.714 46.361 1.00 43.29 ? 310  ASN A N   1 
ATOM   2394 C CA  . ASN A 1 310 ? 15.645  46.921 45.862 1.00 44.57 ? 310  ASN A CA  1 
ATOM   2395 C C   . ASN A 1 310 ? 15.607  46.634 44.383 1.00 43.00 ? 310  ASN A C   1 
ATOM   2396 O O   . ASN A 1 310 ? 16.646  46.598 43.732 1.00 42.41 ? 310  ASN A O   1 
ATOM   2397 C CB  . ASN A 1 310 ? 15.741  45.606 46.637 1.00 47.61 ? 310  ASN A CB  1 
ATOM   2398 C CG  . ASN A 1 310 ? 16.648  45.723 47.825 1.00 50.16 ? 310  ASN A CG  1 
ATOM   2399 O OD1 . ASN A 1 310 ? 16.429  45.083 48.858 1.00 53.75 ? 310  ASN A OD1 1 
ATOM   2400 N ND2 . ASN A 1 310 ? 17.687  46.551 47.694 1.00 50.15 ? 310  ASN A ND2 1 
ATOM   2401 N N   . SER A 1 311 ? 14.416  46.428 43.846 1.00 42.25 ? 311  SER A N   1 
ATOM   2402 C CA  . SER A 1 311 ? 14.308  46.130 42.427 1.00 41.79 ? 311  SER A CA  1 
ATOM   2403 C C   . SER A 1 311 ? 14.137  47.371 41.555 1.00 41.62 ? 311  SER A C   1 
ATOM   2404 O O   . SER A 1 311 ? 13.994  47.253 40.345 1.00 42.72 ? 311  SER A O   1 
ATOM   2405 C CB  . SER A 1 311 ? 13.131  45.176 42.186 1.00 41.73 ? 311  SER A CB  1 
ATOM   2406 O OG  . SER A 1 311 ? 11.912  45.743 42.657 1.00 44.67 ? 311  SER A OG  1 
ATOM   2407 N N   . GLY A 1 312 ? 14.152  48.562 42.146 1.00 40.76 ? 312  GLY A N   1 
ATOM   2408 C CA  . GLY A 1 312 ? 13.954  49.750 41.333 1.00 39.19 ? 312  GLY A CA  1 
ATOM   2409 C C   . GLY A 1 312 ? 12.500  49.855 40.871 1.00 38.15 ? 312  GLY A C   1 
ATOM   2410 O O   . GLY A 1 312 ? 12.188  50.516 39.888 1.00 38.12 ? 312  GLY A O   1 
ATOM   2411 N N   . ASN A 1 313 ? 11.595  49.205 41.586 1.00 37.40 ? 313  ASN A N   1 
ATOM   2412 C CA  . ASN A 1 313 ? 10.192  49.257 41.225 1.00 36.38 ? 313  ASN A CA  1 
ATOM   2413 C C   . ASN A 1 313 ? 9.562   50.551 41.769 1.00 37.14 ? 313  ASN A C   1 
ATOM   2414 O O   . ASN A 1 313 ? 8.878   50.534 42.808 1.00 36.78 ? 313  ASN A O   1 
ATOM   2415 C CB  . ASN A 1 313 ? 9.471   48.042 41.798 1.00 35.94 ? 313  ASN A CB  1 
ATOM   2416 C CG  . ASN A 1 313 ? 8.032   47.972 41.347 1.00 38.05 ? 313  ASN A CG  1 
ATOM   2417 O OD1 . ASN A 1 313 ? 7.589   48.821 40.571 1.00 37.58 ? 313  ASN A OD1 1 
ATOM   2418 N ND2 . ASN A 1 313 ? 7.290   46.970 41.824 1.00 35.00 ? 313  ASN A ND2 1 
ATOM   2419 N N   . PHE A 1 314 ? 9.791   51.665 41.067 1.00 36.18 ? 314  PHE A N   1 
ATOM   2420 C CA  . PHE A 1 314 ? 9.274   52.970 41.483 1.00 35.05 ? 314  PHE A CA  1 
ATOM   2421 C C   . PHE A 1 314 ? 9.496   54.067 40.439 1.00 35.97 ? 314  PHE A C   1 
ATOM   2422 O O   . PHE A 1 314 ? 10.306  53.909 39.535 1.00 33.76 ? 314  PHE A O   1 
ATOM   2423 C CB  . PHE A 1 314 ? 9.923   53.391 42.819 1.00 33.96 ? 314  PHE A CB  1 
ATOM   2424 C CG  . PHE A 1 314 ? 11.443  53.317 42.830 1.00 32.49 ? 314  PHE A CG  1 
ATOM   2425 C CD1 . PHE A 1 314 ? 12.210  54.279 42.181 1.00 30.67 ? 314  PHE A CD1 1 
ATOM   2426 C CD2 . PHE A 1 314 ? 12.099  52.294 43.536 1.00 32.65 ? 314  PHE A CD2 1 
ATOM   2427 C CE1 . PHE A 1 314 ? 13.616  54.239 42.233 1.00 32.28 ? 314  PHE A CE1 1 
ATOM   2428 C CE2 . PHE A 1 314 ? 13.493  52.242 43.598 1.00 32.25 ? 314  PHE A CE2 1 
ATOM   2429 C CZ  . PHE A 1 314 ? 14.256  53.217 42.948 1.00 33.62 ? 314  PHE A CZ  1 
ATOM   2430 N N   . LYS A 1 315 ? 8.780   55.186 40.567 1.00 36.56 ? 315  LYS A N   1 
ATOM   2431 C CA  . LYS A 1 315 ? 8.945   56.278 39.610 1.00 36.97 ? 315  LYS A CA  1 
ATOM   2432 C C   . LYS A 1 315 ? 10.396  56.776 39.606 1.00 38.03 ? 315  LYS A C   1 
ATOM   2433 O O   . LYS A 1 315 ? 10.986  57.017 40.666 1.00 37.60 ? 315  LYS A O   1 
ATOM   2434 C CB  . LYS A 1 315 ? 7.989   57.438 39.927 1.00 36.63 ? 315  LYS A CB  1 
ATOM   2435 C CG  . LYS A 1 315 ? 8.038   58.578 38.914 1.00 35.48 ? 315  LYS A CG  1 
ATOM   2436 C CD  . LYS A 1 315 ? 7.302   59.810 39.461 1.00 38.49 ? 315  LYS A CD  1 
ATOM   2437 C CE  . LYS A 1 315 ? 7.155   60.917 38.432 1.00 36.68 ? 315  LYS A CE  1 
ATOM   2438 N NZ  . LYS A 1 315 ? 6.355   60.425 37.263 1.00 35.09 ? 315  LYS A NZ  1 
ATOM   2439 N N   . LYS A 1 316 ? 10.966  56.904 38.408 1.00 37.55 ? 316  LYS A N   1 
ATOM   2440 C CA  . LYS A 1 316 ? 12.338  57.360 38.260 1.00 39.52 ? 316  LYS A CA  1 
ATOM   2441 C C   . LYS A 1 316 ? 12.351  58.812 37.802 1.00 39.55 ? 316  LYS A C   1 
ATOM   2442 O O   . LYS A 1 316 ? 11.949  59.140 36.691 1.00 40.29 ? 316  LYS A O   1 
ATOM   2443 C CB  . LYS A 1 316 ? 13.060  56.440 37.280 1.00 43.42 ? 316  LYS A CB  1 
ATOM   2444 C CG  . LYS A 1 316 ? 12.970  54.993 37.774 1.00 47.36 ? 316  LYS A CG  1 
ATOM   2445 C CD  . LYS A 1 316 ? 13.753  54.015 36.944 1.00 52.08 ? 316  LYS A CD  1 
ATOM   2446 C CE  . LYS A 1 316 ? 13.686  52.609 37.567 1.00 53.88 ? 316  LYS A CE  1 
ATOM   2447 N NZ  . LYS A 1 316 ? 12.280  52.103 37.607 1.00 56.26 ? 316  LYS A NZ  1 
ATOM   2448 N N   . THR A 1 317 ? 12.810  59.694 38.673 1.00 38.35 ? 317  THR A N   1 
ATOM   2449 C CA  . THR A 1 317 ? 12.804  61.096 38.349 1.00 38.06 ? 317  THR A CA  1 
ATOM   2450 C C   . THR A 1 317 ? 13.809  61.702 39.291 1.00 38.03 ? 317  THR A C   1 
ATOM   2451 O O   . THR A 1 317 ? 14.682  60.976 39.791 1.00 38.07 ? 317  THR A O   1 
ATOM   2452 C CB  . THR A 1 317 ? 11.370  61.678 38.583 1.00 37.88 ? 317  THR A CB  1 
ATOM   2453 O OG1 . THR A 1 317 ? 11.361  63.074 38.283 1.00 39.26 ? 317  THR A OG1 1 
ATOM   2454 C CG2 . THR A 1 317 ? 10.914  61.456 40.039 1.00 37.31 ? 317  THR A CG2 1 
ATOM   2455 N N   . GLN A 1 318 ? 13.709  63.008 39.532 1.00 36.40 ? 318  GLN A N   1 
ATOM   2456 C CA  . GLN A 1 318 ? 14.628  63.669 40.458 1.00 36.97 ? 318  GLN A CA  1 
ATOM   2457 C C   . GLN A 1 318 ? 13.921  63.879 41.795 1.00 36.30 ? 318  GLN A C   1 
ATOM   2458 O O   . GLN A 1 318 ? 12.707  64.039 41.855 1.00 35.96 ? 318  GLN A O   1 
ATOM   2459 C CB  . GLN A 1 318 ? 15.072  65.044 39.944 1.00 37.70 ? 318  GLN A CB  1 
ATOM   2460 C CG  . GLN A 1 318 ? 15.618  65.092 38.519 1.00 40.24 ? 318  GLN A CG  1 
ATOM   2461 C CD  . GLN A 1 318 ? 14.498  65.111 37.458 1.00 42.36 ? 318  GLN A CD  1 
ATOM   2462 O OE1 . GLN A 1 318 ? 13.440  65.711 37.665 1.00 40.79 ? 318  GLN A OE1 1 
ATOM   2463 N NE2 . GLN A 1 318 ? 14.739  64.454 36.324 1.00 40.91 ? 318  GLN A NE2 1 
ATOM   2464 N N   . ILE A 1 319 ? 14.684  63.874 42.876 1.00 36.24 ? 319  ILE A N   1 
ATOM   2465 C CA  . ILE A 1 319 ? 14.106  64.112 44.194 1.00 35.67 ? 319  ILE A CA  1 
ATOM   2466 C C   . ILE A 1 319 ? 15.003  65.048 44.979 1.00 34.82 ? 319  ILE A C   1 
ATOM   2467 O O   . ILE A 1 319 ? 16.217  65.122 44.752 1.00 33.13 ? 319  ILE A O   1 
ATOM   2468 C CB  . ILE A 1 319 ? 13.942  62.811 45.031 1.00 35.36 ? 319  ILE A CB  1 
ATOM   2469 C CG1 . ILE A 1 319 ? 15.317  62.163 45.268 1.00 33.67 ? 319  ILE A CG1 1 
ATOM   2470 C CG2 . ILE A 1 319 ? 12.969  61.839 44.331 1.00 33.16 ? 319  ILE A CG2 1 
ATOM   2471 C CD1 . ILE A 1 319 ? 15.266  60.948 46.172 1.00 31.25 ? 319  ILE A CD1 1 
ATOM   2472 N N   . LEU A 1 320 ? 14.397  65.787 45.890 1.00 33.00 ? 320  LEU A N   1 
ATOM   2473 C CA  . LEU A 1 320 ? 15.177  66.664 46.732 1.00 33.96 ? 320  LEU A CA  1 
ATOM   2474 C C   . LEU A 1 320 ? 14.641  66.366 48.137 1.00 33.56 ? 320  LEU A C   1 
ATOM   2475 O O   . LEU A 1 320 ? 13.424  66.331 48.359 1.00 33.41 ? 320  LEU A O   1 
ATOM   2476 C CB  . LEU A 1 320 ? 14.985  68.119 46.297 1.00 33.90 ? 320  LEU A CB  1 
ATOM   2477 C CG  . LEU A 1 320 ? 15.732  69.127 47.155 1.00 35.98 ? 320  LEU A CG  1 
ATOM   2478 C CD1 . LEU A 1 320 ? 16.021  70.400 46.327 1.00 35.71 ? 320  LEU A CD1 1 
ATOM   2479 C CD2 . LEU A 1 320 ? 14.900  69.421 48.410 1.00 33.91 ? 320  LEU A CD2 1 
ATOM   2480 N N   . LEU A 1 321 ? 15.544  66.114 49.074 1.00 31.45 ? 321  LEU A N   1 
ATOM   2481 C CA  . LEU A 1 321 ? 15.110  65.743 50.404 1.00 32.66 ? 321  LEU A CA  1 
ATOM   2482 C C   . LEU A 1 321 ? 16.177  65.999 51.462 1.00 32.63 ? 321  LEU A C   1 
ATOM   2483 O O   . LEU A 1 321 ? 17.349  66.236 51.151 1.00 31.27 ? 321  LEU A O   1 
ATOM   2484 C CB  . LEU A 1 321 ? 14.726  64.240 50.421 1.00 32.49 ? 321  LEU A CB  1 
ATOM   2485 C CG  . LEU A 1 321 ? 15.845  63.171 50.297 1.00 32.44 ? 321  LEU A CG  1 
ATOM   2486 C CD1 . LEU A 1 321 ? 15.214  61.751 50.333 1.00 31.21 ? 321  LEU A CD1 1 
ATOM   2487 C CD2 . LEU A 1 321 ? 16.643  63.350 48.990 1.00 31.33 ? 321  LEU A CD2 1 
ATOM   2488 N N   . GLY A 1 322 ? 15.761  65.918 52.720 1.00 31.11 ? 322  GLY A N   1 
ATOM   2489 C CA  . GLY A 1 322 ? 16.698  66.136 53.791 1.00 30.89 ? 322  GLY A CA  1 
ATOM   2490 C C   . GLY A 1 322 ? 16.044  65.999 55.142 1.00 32.15 ? 322  GLY A C   1 
ATOM   2491 O O   . GLY A 1 322 ? 14.854  65.675 55.245 1.00 30.85 ? 322  GLY A O   1 
ATOM   2492 N N   . VAL A 1 323 ? 16.839  66.285 56.176 1.00 31.92 ? 323  VAL A N   1 
ATOM   2493 C CA  . VAL A 1 323 ? 16.418  66.159 57.557 1.00 31.56 ? 323  VAL A CA  1 
ATOM   2494 C C   . VAL A 1 323 ? 16.866  67.334 58.423 1.00 33.50 ? 323  VAL A C   1 
ATOM   2495 O O   . VAL A 1 323 ? 17.718  68.134 58.023 1.00 32.79 ? 323  VAL A O   1 
ATOM   2496 C CB  . VAL A 1 323 ? 17.010  64.885 58.154 1.00 31.17 ? 323  VAL A CB  1 
ATOM   2497 C CG1 . VAL A 1 323 ? 16.635  63.667 57.277 1.00 29.21 ? 323  VAL A CG1 1 
ATOM   2498 C CG2 . VAL A 1 323 ? 18.540  65.027 58.246 1.00 30.25 ? 323  VAL A CG2 1 
ATOM   2499 N N   . ASN A 1 324 ? 16.288  67.419 59.619 1.00 33.92 ? 324  ASN A N   1 
ATOM   2500 C CA  . ASN A 1 324 ? 16.637  68.472 60.568 1.00 34.28 ? 324  ASN A CA  1 
ATOM   2501 C C   . ASN A 1 324 ? 17.588  67.894 61.609 1.00 35.07 ? 324  ASN A C   1 
ATOM   2502 O O   . ASN A 1 324 ? 17.643  66.672 61.795 1.00 33.81 ? 324  ASN A O   1 
ATOM   2503 C CB  . ASN A 1 324 ? 15.381  69.022 61.228 1.00 32.66 ? 324  ASN A CB  1 
ATOM   2504 C CG  . ASN A 1 324 ? 14.478  69.739 60.234 1.00 35.41 ? 324  ASN A CG  1 
ATOM   2505 O OD1 . ASN A 1 324 ? 14.826  69.871 59.048 1.00 32.37 ? 324  ASN A OD1 1 
ATOM   2506 N ND2 . ASN A 1 324 ? 13.309  70.207 60.706 1.00 34.65 ? 324  ASN A ND2 1 
ATOM   2507 N N   . LYS A 1 325 ? 18.331  68.770 62.286 1.00 35.95 ? 325  LYS A N   1 
ATOM   2508 C CA  . LYS A 1 325 ? 19.298  68.336 63.279 1.00 35.64 ? 325  LYS A CA  1 
ATOM   2509 C C   . LYS A 1 325 ? 18.773  67.552 64.498 1.00 35.27 ? 325  LYS A C   1 
ATOM   2510 O O   . LYS A 1 325 ? 19.434  66.609 64.946 1.00 33.33 ? 325  LYS A O   1 
ATOM   2511 C CB  . LYS A 1 325 ? 20.128  69.538 63.751 1.00 38.00 ? 325  LYS A CB  1 
ATOM   2512 C CG  . LYS A 1 325 ? 21.211  69.176 64.779 1.00 39.35 ? 325  LYS A CG  1 
ATOM   2513 C CD  . LYS A 1 325 ? 22.105  70.345 65.072 1.00 43.03 ? 325  LYS A CD  1 
ATOM   2514 C CE  . LYS A 1 325 ? 22.592  70.353 66.513 1.00 48.42 ? 325  LYS A CE  1 
ATOM   2515 N NZ  . LYS A 1 325 ? 21.538  70.900 67.484 1.00 50.50 ? 325  LYS A NZ  1 
ATOM   2516 N N   . ASP A 1 326 ? 17.614  67.929 65.039 1.00 33.84 ? 326  ASP A N   1 
ATOM   2517 C CA  . ASP A 1 326 ? 17.084  67.231 66.212 1.00 33.90 ? 326  ASP A CA  1 
ATOM   2518 C C   . ASP A 1 326 ? 15.636  66.753 66.016 1.00 35.46 ? 326  ASP A C   1 
ATOM   2519 O O   . ASP A 1 326 ? 14.693  67.226 66.690 1.00 35.17 ? 326  ASP A O   1 
ATOM   2520 C CB  . ASP A 1 326 ? 17.179  68.152 67.423 1.00 35.43 ? 326  ASP A CB  1 
ATOM   2521 C CG  . ASP A 1 326 ? 18.589  68.757 67.592 1.00 37.02 ? 326  ASP A CG  1 
ATOM   2522 O OD1 . ASP A 1 326 ? 19.505  68.043 68.080 1.00 36.09 ? 326  ASP A OD1 1 
ATOM   2523 O OD2 . ASP A 1 326 ? 18.778  69.943 67.224 1.00 35.01 ? 326  ASP A OD2 1 
ATOM   2524 N N   . GLU A 1 327 ? 15.476  65.824 65.078 1.00 32.36 ? 327  GLU A N   1 
ATOM   2525 C CA  . GLU A 1 327 ? 14.183  65.270 64.758 1.00 32.69 ? 327  GLU A CA  1 
ATOM   2526 C C   . GLU A 1 327 ? 13.511  64.607 65.981 1.00 33.75 ? 327  GLU A C   1 
ATOM   2527 O O   . GLU A 1 327 ? 12.265  64.650 66.105 1.00 31.37 ? 327  GLU A O   1 
ATOM   2528 C CB  . GLU A 1 327 ? 14.331  64.216 63.636 1.00 33.11 ? 327  GLU A CB  1 
ATOM   2529 C CG  . GLU A 1 327 ? 15.028  64.698 62.354 1.00 33.72 ? 327  GLU A CG  1 
ATOM   2530 C CD  . GLU A 1 327 ? 14.106  65.533 61.473 1.00 33.50 ? 327  GLU A CD  1 
ATOM   2531 O OE1 . GLU A 1 327 ? 13.103  66.072 61.987 1.00 34.51 ? 327  GLU A OE1 1 
ATOM   2532 O OE2 . GLU A 1 327 ? 14.374  65.655 60.264 1.00 36.13 ? 327  GLU A OE2 1 
ATOM   2533 N N   . GLY A 1 328 ? 14.305  64.012 66.881 1.00 30.72 ? 328  GLY A N   1 
ATOM   2534 C CA  . GLY A 1 328 ? 13.679  63.317 67.988 1.00 32.51 ? 328  GLY A CA  1 
ATOM   2535 C C   . GLY A 1 328 ? 13.116  64.096 69.167 1.00 33.51 ? 328  GLY A C   1 
ATOM   2536 O O   . GLY A 1 328 ? 12.199  63.615 69.827 1.00 33.31 ? 328  GLY A O   1 
ATOM   2537 N N   . SER A 1 329 ? 13.618  65.304 69.428 1.00 35.63 ? 329  SER A N   1 
ATOM   2538 C CA  . SER A 1 329 ? 13.170  66.055 70.610 1.00 33.59 ? 329  SER A CA  1 
ATOM   2539 C C   . SER A 1 329 ? 11.676  66.181 70.906 1.00 33.47 ? 329  SER A C   1 
ATOM   2540 O O   . SER A 1 329 ? 11.265  66.061 72.065 1.00 32.44 ? 329  SER A O   1 
ATOM   2541 C CB  . SER A 1 329 ? 13.825  67.444 70.638 1.00 32.94 ? 329  SER A CB  1 
ATOM   2542 O OG  . SER A 1 329 ? 13.381  68.263 69.584 1.00 33.24 ? 329  SER A OG  1 
ATOM   2543 N N   A PHE A 1 330 ? 10.863  66.415 69.877 0.65 32.62 ? 330  PHE A N   1 
ATOM   2544 N N   B PHE A 1 330 ? 10.864  66.411 69.880 0.35 32.85 ? 330  PHE A N   1 
ATOM   2545 C CA  A PHE A 1 330 ? 9.417   66.574 70.069 0.65 32.32 ? 330  PHE A CA  1 
ATOM   2546 C CA  B PHE A 1 330 ? 9.428   66.558 70.085 0.35 32.65 ? 330  PHE A CA  1 
ATOM   2547 C C   A PHE A 1 330 ? 8.792   65.332 70.722 0.65 33.59 ? 330  PHE A C   1 
ATOM   2548 C C   B PHE A 1 330 ? 8.803   65.329 70.733 0.35 33.47 ? 330  PHE A C   1 
ATOM   2549 O O   A PHE A 1 330 ? 8.017   65.431 71.684 0.65 34.92 ? 330  PHE A O   1 
ATOM   2550 O O   B PHE A 1 330 ? 8.031   65.436 71.692 0.35 34.26 ? 330  PHE A O   1 
ATOM   2551 C CB  A PHE A 1 330 ? 8.756   66.851 68.712 0.65 32.82 ? 330  PHE A CB  1 
ATOM   2552 C CB  B PHE A 1 330 ? 8.734   66.837 68.752 0.35 32.67 ? 330  PHE A CB  1 
ATOM   2553 C CG  A PHE A 1 330 ? 7.272   66.989 68.772 0.65 33.53 ? 330  PHE A CG  1 
ATOM   2554 C CG  B PHE A 1 330 ? 7.981   68.125 68.727 0.35 32.45 ? 330  PHE A CG  1 
ATOM   2555 C CD1 A PHE A 1 330 ? 6.680   68.206 69.128 0.65 34.85 ? 330  PHE A CD1 1 
ATOM   2556 C CD1 B PHE A 1 330 ? 8.020   68.938 67.611 0.35 32.99 ? 330  PHE A CD1 1 
ATOM   2557 C CD2 A PHE A 1 330 ? 6.446   65.888 68.501 0.65 33.51 ? 330  PHE A CD2 1 
ATOM   2558 C CD2 B PHE A 1 330 ? 7.235   68.532 69.826 0.35 33.08 ? 330  PHE A CD2 1 
ATOM   2559 C CE1 A PHE A 1 330 ? 5.271   68.312 69.212 0.65 32.92 ? 330  PHE A CE1 1 
ATOM   2560 C CE1 B PHE A 1 330 ? 7.333   70.139 67.590 0.35 33.29 ? 330  PHE A CE1 1 
ATOM   2561 C CE2 A PHE A 1 330 ? 5.051   66.002 68.587 0.65 32.34 ? 330  PHE A CE2 1 
ATOM   2562 C CE2 B PHE A 1 330 ? 6.543   69.731 69.811 0.35 31.84 ? 330  PHE A CE2 1 
ATOM   2563 C CZ  A PHE A 1 330 ? 4.479   67.212 68.941 0.65 32.42 ? 330  PHE A CZ  1 
ATOM   2564 C CZ  B PHE A 1 330 ? 6.593   70.535 68.691 0.35 33.32 ? 330  PHE A CZ  1 
ATOM   2565 N N   . PHE A 1 331 ? 9.162   64.159 70.222 1.00 33.25 ? 331  PHE A N   1 
ATOM   2566 C CA  . PHE A 1 331 ? 8.611   62.924 70.726 1.00 34.47 ? 331  PHE A CA  1 
ATOM   2567 C C   . PHE A 1 331 ? 9.073   62.507 72.089 1.00 34.96 ? 331  PHE A C   1 
ATOM   2568 O O   . PHE A 1 331 ? 8.356   61.779 72.757 1.00 36.14 ? 331  PHE A O   1 
ATOM   2569 C CB  . PHE A 1 331 ? 8.810   61.819 69.685 1.00 32.16 ? 331  PHE A CB  1 
ATOM   2570 C CG  . PHE A 1 331 ? 8.269   62.197 68.353 1.00 30.61 ? 331  PHE A CG  1 
ATOM   2571 C CD1 . PHE A 1 331 ? 9.041   62.957 67.472 1.00 29.10 ? 331  PHE A CD1 1 
ATOM   2572 C CD2 . PHE A 1 331 ? 6.939   61.916 68.028 1.00 30.26 ? 331  PHE A CD2 1 
ATOM   2573 C CE1 . PHE A 1 331 ? 8.492   63.458 66.260 1.00 31.20 ? 331  PHE A CE1 1 
ATOM   2574 C CE2 . PHE A 1 331 ? 6.381   62.398 66.848 1.00 30.18 ? 331  PHE A CE2 1 
ATOM   2575 C CZ  . PHE A 1 331 ? 7.159   63.176 65.956 1.00 31.51 ? 331  PHE A CZ  1 
ATOM   2576 N N   . LEU A 1 332 ? 10.266  62.950 72.493 1.00 35.86 ? 332  LEU A N   1 
ATOM   2577 C CA  . LEU A 1 332 ? 10.777  62.661 73.831 1.00 34.64 ? 332  LEU A CA  1 
ATOM   2578 C C   . LEU A 1 332 ? 10.014  63.601 74.794 1.00 34.77 ? 332  LEU A C   1 
ATOM   2579 O O   . LEU A 1 332 ? 9.588   63.187 75.871 1.00 34.67 ? 332  LEU A O   1 
ATOM   2580 C CB  . LEU A 1 332 ? 12.293  62.909 73.903 1.00 34.05 ? 332  LEU A CB  1 
ATOM   2581 C CG  . LEU A 1 332 ? 13.135  61.875 73.136 1.00 33.88 ? 332  LEU A CG  1 
ATOM   2582 C CD1 . LEU A 1 332 ? 14.556  62.393 72.857 1.00 29.77 ? 332  LEU A CD1 1 
ATOM   2583 C CD2 . LEU A 1 332 ? 13.154  60.596 73.945 1.00 29.83 ? 332  LEU A CD2 1 
ATOM   2584 N N   . LEU A 1 333 ? 9.812   64.852 74.388 1.00 34.74 ? 333  LEU A N   1 
ATOM   2585 C CA  . LEU A 1 333 ? 9.054   65.795 75.217 1.00 36.12 ? 333  LEU A CA  1 
ATOM   2586 C C   . LEU A 1 333 ? 7.648   65.256 75.533 1.00 37.60 ? 333  LEU A C   1 
ATOM   2587 O O   . LEU A 1 333 ? 7.194   65.299 76.681 1.00 37.61 ? 333  LEU A O   1 
ATOM   2588 C CB  . LEU A 1 333 ? 8.925   67.148 74.515 1.00 34.78 ? 333  LEU A CB  1 
ATOM   2589 C CG  . LEU A 1 333 ? 7.988   68.101 75.272 1.00 38.24 ? 333  LEU A CG  1 
ATOM   2590 C CD1 . LEU A 1 333 ? 8.506   68.347 76.726 1.00 35.73 ? 333  LEU A CD1 1 
ATOM   2591 C CD2 . LEU A 1 333 ? 7.878   69.419 74.496 1.00 38.12 ? 333  LEU A CD2 1 
ATOM   2592 N N   . TYR A 1 334 ? 6.977   64.727 74.509 1.00 37.82 ? 334  TYR A N   1 
ATOM   2593 C CA  . TYR A 1 334 ? 5.650   64.174 74.679 1.00 39.41 ? 334  TYR A CA  1 
ATOM   2594 C C   . TYR A 1 334 ? 5.631   62.708 75.107 1.00 41.56 ? 334  TYR A C   1 
ATOM   2595 O O   . TYR A 1 334 ? 5.084   61.851 74.406 1.00 45.81 ? 334  TYR A O   1 
ATOM   2596 C CB  . TYR A 1 334 ? 4.852   64.303 73.384 1.00 37.40 ? 334  TYR A CB  1 
ATOM   2597 C CG  . TYR A 1 334 ? 4.328   65.695 73.117 1.00 38.37 ? 334  TYR A CG  1 
ATOM   2598 C CD1 . TYR A 1 334 ? 5.202   66.768 72.902 1.00 36.11 ? 334  TYR A CD1 1 
ATOM   2599 C CD2 . TYR A 1 334 ? 2.957   65.933 73.035 1.00 35.08 ? 334  TYR A CD2 1 
ATOM   2600 C CE1 . TYR A 1 334 ? 4.717   68.042 72.600 1.00 35.46 ? 334  TYR A CE1 1 
ATOM   2601 C CE2 . TYR A 1 334 ? 2.453   67.207 72.730 1.00 35.52 ? 334  TYR A CE2 1 
ATOM   2602 C CZ  . TYR A 1 334 ? 3.338   68.254 72.506 1.00 35.23 ? 334  TYR A CZ  1 
ATOM   2603 O OH  . TYR A 1 334 ? 2.847   69.483 72.131 1.00 33.20 ? 334  TYR A OH  1 
ATOM   2604 N N   . GLY A 1 335 ? 6.230   62.378 76.233 1.00 42.77 ? 335  GLY A N   1 
ATOM   2605 C CA  . GLY A 1 335 ? 6.155   60.987 76.626 1.00 42.08 ? 335  GLY A CA  1 
ATOM   2606 C C   . GLY A 1 335 ? 7.282   60.342 77.392 1.00 40.26 ? 335  GLY A C   1 
ATOM   2607 O O   . GLY A 1 335 ? 7.021   59.630 78.357 1.00 42.44 ? 335  GLY A O   1 
ATOM   2608 N N   . ALA A 1 336 ? 8.519   60.569 76.976 1.00 38.08 ? 336  ALA A N   1 
ATOM   2609 C CA  . ALA A 1 336 ? 9.638   59.938 77.646 1.00 36.87 ? 336  ALA A CA  1 
ATOM   2610 C C   . ALA A 1 336 ? 9.823   60.475 79.046 1.00 36.51 ? 336  ALA A C   1 
ATOM   2611 O O   . ALA A 1 336 ? 9.738   61.679 79.287 1.00 34.65 ? 336  ALA A O   1 
ATOM   2612 C CB  . ALA A 1 336 ? 10.914  60.121 76.842 1.00 35.77 ? 336  ALA A CB  1 
ATOM   2613 N N   . PRO A 1 337 ? 10.060  59.576 80.001 1.00 37.22 ? 337  PRO A N   1 
ATOM   2614 C CA  . PRO A 1 337 ? 10.254  60.042 81.379 1.00 39.01 ? 337  PRO A CA  1 
ATOM   2615 C C   . PRO A 1 337 ? 11.507  60.923 81.477 1.00 40.14 ? 337  PRO A C   1 
ATOM   2616 O O   . PRO A 1 337 ? 12.545  60.629 80.857 1.00 40.26 ? 337  PRO A O   1 
ATOM   2617 C CB  . PRO A 1 337 ? 10.373  58.740 82.174 1.00 38.18 ? 337  PRO A CB  1 
ATOM   2618 C CG  . PRO A 1 337 ? 10.994  57.796 81.173 1.00 38.91 ? 337  PRO A CG  1 
ATOM   2619 C CD  . PRO A 1 337 ? 10.252  58.122 79.888 1.00 35.08 ? 337  PRO A CD  1 
ATOM   2620 N N   . GLY A 1 338 ? 11.380  62.025 82.224 1.00 42.14 ? 338  GLY A N   1 
ATOM   2621 C CA  . GLY A 1 338 ? 12.491  62.947 82.414 1.00 40.81 ? 338  GLY A CA  1 
ATOM   2622 C C   . GLY A 1 338 ? 12.506  64.232 81.593 1.00 40.68 ? 338  GLY A C   1 
ATOM   2623 O O   . GLY A 1 338 ? 13.206  65.181 81.952 1.00 41.36 ? 338  GLY A O   1 
ATOM   2624 N N   . PHE A 1 339 ? 11.759  64.280 80.494 1.00 39.82 ? 339  PHE A N   1 
ATOM   2625 C CA  . PHE A 1 339 ? 11.738  65.474 79.648 1.00 39.42 ? 339  PHE A CA  1 
ATOM   2626 C C   . PHE A 1 339 ? 10.542  66.331 80.001 1.00 39.45 ? 339  PHE A C   1 
ATOM   2627 O O   . PHE A 1 339 ? 9.462   65.795 80.189 1.00 40.88 ? 339  PHE A O   1 
ATOM   2628 C CB  . PHE A 1 339 ? 11.629  65.111 78.155 1.00 36.18 ? 339  PHE A CB  1 
ATOM   2629 C CG  . PHE A 1 339 ? 12.793  64.338 77.630 1.00 35.78 ? 339  PHE A CG  1 
ATOM   2630 C CD1 . PHE A 1 339 ? 12.898  62.960 77.855 1.00 33.68 ? 339  PHE A CD1 1 
ATOM   2631 C CD2 . PHE A 1 339 ? 13.794  64.986 76.902 1.00 33.98 ? 339  PHE A CD2 1 
ATOM   2632 C CE1 . PHE A 1 339 ? 13.990  62.243 77.355 1.00 33.69 ? 339  PHE A CE1 1 
ATOM   2633 C CE2 . PHE A 1 339 ? 14.890  64.286 76.400 1.00 32.47 ? 339  PHE A CE2 1 
ATOM   2634 C CZ  . PHE A 1 339 ? 14.993  62.914 76.623 1.00 33.39 ? 339  PHE A CZ  1 
ATOM   2635 N N   . SER A 1 340 ? 10.725  67.650 80.072 1.00 38.58 ? 340  SER A N   1 
ATOM   2636 C CA  . SER A 1 340 ? 9.619   68.569 80.381 1.00 39.33 ? 340  SER A CA  1 
ATOM   2637 C C   . SER A 1 340 ? 9.876   69.793 79.536 1.00 39.04 ? 340  SER A C   1 
ATOM   2638 O O   . SER A 1 340 ? 11.014  70.050 79.170 1.00 38.89 ? 340  SER A O   1 
ATOM   2639 C CB  . SER A 1 340 ? 9.623   68.988 81.851 1.00 39.84 ? 340  SER A CB  1 
ATOM   2640 O OG  . SER A 1 340 ? 9.740   67.870 82.698 1.00 47.92 ? 340  SER A OG  1 
ATOM   2641 N N   . LYS A 1 341 ? 8.830   70.560 79.249 1.00 39.90 ? 341  LYS A N   1 
ATOM   2642 C CA  . LYS A 1 341 ? 8.977   71.732 78.418 1.00 40.30 ? 341  LYS A CA  1 
ATOM   2643 C C   . LYS A 1 341 ? 9.767   72.870 79.063 1.00 41.04 ? 341  LYS A C   1 
ATOM   2644 O O   . LYS A 1 341 ? 10.512  73.575 78.374 1.00 39.42 ? 341  LYS A O   1 
ATOM   2645 C CB  . LYS A 1 341 ? 7.600   72.249 77.992 1.00 41.12 ? 341  LYS A CB  1 
ATOM   2646 C CG  . LYS A 1 341 ? 7.690   73.295 76.876 1.00 40.34 ? 341  LYS A CG  1 
ATOM   2647 C CD  . LYS A 1 341 ? 6.321   73.745 76.358 1.00 40.85 ? 341  LYS A CD  1 
ATOM   2648 C CE  . LYS A 1 341 ? 5.564   74.585 77.387 1.00 40.65 ? 341  LYS A CE  1 
ATOM   2649 N NZ  . LYS A 1 341 ? 6.403   75.681 77.983 1.00 39.62 ? 341  LYS A NZ  1 
ATOM   2650 N N   . ASP A 1 342 ? 9.606   73.037 80.376 1.00 39.75 ? 342  ASP A N   1 
ATOM   2651 C CA  . ASP A 1 342 ? 10.252  74.126 81.108 1.00 39.50 ? 342  ASP A CA  1 
ATOM   2652 C C   . ASP A 1 342 ? 11.545  73.849 81.867 1.00 40.13 ? 342  ASP A C   1 
ATOM   2653 O O   . ASP A 1 342 ? 11.951  74.658 82.693 1.00 38.03 ? 342  ASP A O   1 
ATOM   2654 C CB  . ASP A 1 342 ? 9.255   74.751 82.083 1.00 38.89 ? 342  ASP A CB  1 
ATOM   2655 C CG  . ASP A 1 342 ? 7.965   75.185 81.405 1.00 39.05 ? 342  ASP A CG  1 
ATOM   2656 O OD1 . ASP A 1 342 ? 7.932   75.281 80.144 1.00 37.14 ? 342  ASP A OD1 1 
ATOM   2657 O OD2 . ASP A 1 342 ? 6.986   75.449 82.141 1.00 38.69 ? 342  ASP A OD2 1 
ATOM   2658 N N   . SER A 1 343 ? 12.184  72.708 81.644 1.00 41.45 ? 343  SER A N   1 
ATOM   2659 C CA  . SER A 1 343 ? 13.463  72.450 82.313 1.00 43.37 ? 343  SER A CA  1 
ATOM   2660 C C   . SER A 1 343 ? 14.430  72.082 81.199 1.00 44.96 ? 343  SER A C   1 
ATOM   2661 O O   . SER A 1 343 ? 14.011  71.879 80.057 1.00 45.09 ? 343  SER A O   1 
ATOM   2662 C CB  . SER A 1 343 ? 13.370  71.277 83.285 1.00 42.90 ? 343  SER A CB  1 
ATOM   2663 O OG  . SER A 1 343 ? 13.274  70.045 82.592 1.00 49.18 ? 343  SER A OG  1 
ATOM   2664 N N   . GLU A 1 344 ? 15.714  71.997 81.523 1.00 45.28 ? 344  GLU A N   1 
ATOM   2665 C CA  . GLU A 1 344 ? 16.722  71.635 80.537 1.00 46.30 ? 344  GLU A CA  1 
ATOM   2666 C C   . GLU A 1 344 ? 16.650  70.144 80.229 1.00 43.77 ? 344  GLU A C   1 
ATOM   2667 O O   . GLU A 1 344 ? 17.373  69.639 79.379 1.00 42.36 ? 344  GLU A O   1 
ATOM   2668 C CB  . GLU A 1 344 ? 18.114  71.940 81.059 1.00 49.97 ? 344  GLU A CB  1 
ATOM   2669 C CG  . GLU A 1 344 ? 18.506  73.387 81.099 1.00 56.52 ? 344  GLU A CG  1 
ATOM   2670 C CD  . GLU A 1 344 ? 19.935  73.499 81.580 1.00 61.69 ? 344  GLU A CD  1 
ATOM   2671 O OE1 . GLU A 1 344 ? 20.854  73.464 80.731 1.00 64.04 ? 344  GLU A OE1 1 
ATOM   2672 O OE2 . GLU A 1 344 ? 20.140  73.569 82.815 1.00 63.85 ? 344  GLU A OE2 1 
ATOM   2673 N N   . SER A 1 345 ? 15.811  69.442 80.970 1.00 42.21 ? 345  SER A N   1 
ATOM   2674 C CA  . SER A 1 345 ? 15.618  68.021 80.763 1.00 42.82 ? 345  SER A CA  1 
ATOM   2675 C C   . SER A 1 345 ? 16.891  67.180 80.816 1.00 43.83 ? 345  SER A C   1 
ATOM   2676 O O   . SER A 1 345 ? 17.112  66.341 79.933 1.00 44.49 ? 345  SER A O   1 
ATOM   2677 C CB  . SER A 1 345 ? 14.907  67.780 79.417 1.00 42.68 ? 345  SER A CB  1 
ATOM   2678 O OG  . SER A 1 345 ? 13.550  68.182 79.462 1.00 44.14 ? 345  SER A OG  1 
ATOM   2679 N N   . LYS A 1 346 ? 17.731  67.390 81.828 1.00 44.61 ? 346  LYS A N   1 
ATOM   2680 C CA  . LYS A 1 346 ? 18.933  66.578 81.955 1.00 43.95 ? 346  LYS A CA  1 
ATOM   2681 C C   . LYS A 1 346 ? 18.408  65.189 82.325 1.00 43.21 ? 346  LYS A C   1 
ATOM   2682 O O   . LYS A 1 346 ? 17.579  65.031 83.213 1.00 40.54 ? 346  LYS A O   1 
ATOM   2683 C CB  . LYS A 1 346 ? 19.858  67.156 83.026 1.00 47.11 ? 346  LYS A CB  1 
ATOM   2684 C CG  . LYS A 1 346 ? 20.491  68.520 82.640 1.00 49.70 ? 346  LYS A CG  1 
ATOM   2685 C CD  . LYS A 1 346 ? 21.244  69.131 83.851 1.00 52.68 ? 346  LYS A CD  1 
ATOM   2686 C CE  . LYS A 1 346 ? 21.689  70.589 83.624 1.00 54.73 ? 346  LYS A CE  1 
ATOM   2687 N NZ  . LYS A 1 346 ? 22.443  71.139 84.813 1.00 58.39 ? 346  LYS A NZ  1 
ATOM   2688 N N   . ILE A 1 347 ? 18.903  64.177 81.635 1.00 43.08 ? 347  ILE A N   1 
ATOM   2689 C CA  . ILE A 1 347 ? 18.409  62.825 81.827 1.00 43.68 ? 347  ILE A CA  1 
ATOM   2690 C C   . ILE A 1 347 ? 19.288  61.852 82.619 1.00 44.37 ? 347  ILE A C   1 
ATOM   2691 O O   . ILE A 1 347 ? 20.488  61.697 82.357 1.00 43.51 ? 347  ILE A O   1 
ATOM   2692 C CB  . ILE A 1 347 ? 18.081  62.219 80.416 1.00 43.78 ? 347  ILE A CB  1 
ATOM   2693 C CG1 . ILE A 1 347 ? 16.975  63.049 79.754 1.00 43.86 ? 347  ILE A CG1 1 
ATOM   2694 C CG2 . ILE A 1 347 ? 17.614  60.794 80.525 1.00 44.99 ? 347  ILE A CG2 1 
ATOM   2695 C CD1 . ILE A 1 347 ? 15.727  63.151 80.608 1.00 41.02 ? 347  ILE A CD1 1 
ATOM   2696 N N   . SER A 1 348 ? 18.669  61.172 83.572 1.00 45.17 ? 348  SER A N   1 
ATOM   2697 C CA  . SER A 1 348 ? 19.396  60.198 84.361 1.00 47.02 ? 348  SER A CA  1 
ATOM   2698 C C   . SER A 1 348 ? 19.675  58.958 83.503 1.00 48.41 ? 348  SER A C   1 
ATOM   2699 O O   . SER A 1 348 ? 19.088  58.759 82.440 1.00 48.09 ? 348  SER A O   1 
ATOM   2700 C CB  . SER A 1 348 ? 18.598  59.803 85.601 1.00 46.03 ? 348  SER A CB  1 
ATOM   2701 O OG  . SER A 1 348 ? 17.589  58.865 85.289 1.00 47.49 ? 348  SER A OG  1 
ATOM   2702 N N   . ARG A 1 349 ? 20.596  58.139 83.976 1.00 48.56 ? 349  ARG A N   1 
ATOM   2703 C CA  . ARG A 1 349 ? 20.975  56.930 83.294 1.00 50.05 ? 349  ARG A CA  1 
ATOM   2704 C C   . ARG A 1 349 ? 19.758  56.022 83.201 1.00 51.33 ? 349  ARG A C   1 
ATOM   2705 O O   . ARG A 1 349 ? 19.568  55.309 82.216 1.00 52.20 ? 349  ARG A O   1 
ATOM   2706 C CB  . ARG A 1 349 ? 22.066  56.241 84.097 1.00 51.42 ? 349  ARG A CB  1 
ATOM   2707 C CG  . ARG A 1 349 ? 22.812  55.217 83.332 1.00 52.88 ? 349  ARG A CG  1 
ATOM   2708 C CD  . ARG A 1 349 ? 23.522  55.877 82.195 1.00 54.58 ? 349  ARG A CD  1 
ATOM   2709 N NE  . ARG A 1 349 ? 23.614  54.925 81.114 1.00 56.59 ? 349  ARG A NE  1 
ATOM   2710 C CZ  . ARG A 1 349 ? 23.652  55.256 79.836 1.00 57.11 ? 349  ARG A CZ  1 
ATOM   2711 N NH1 . ARG A 1 349 ? 23.613  56.533 79.475 1.00 56.18 ? 349  ARG A NH1 1 
ATOM   2712 N NH2 . ARG A 1 349 ? 23.700  54.298 78.925 1.00 57.55 ? 349  ARG A NH2 1 
ATOM   2713 N N   . GLU A 1 350 ? 18.940  56.057 84.243 1.00 51.99 ? 350  GLU A N   1 
ATOM   2714 C CA  . GLU A 1 350 ? 17.745  55.241 84.316 1.00 53.49 ? 350  GLU A CA  1 
ATOM   2715 C C   . GLU A 1 350 ? 16.652  55.709 83.344 1.00 52.21 ? 350  GLU A C   1 
ATOM   2716 O O   . GLU A 1 350 ? 15.971  54.886 82.717 1.00 50.27 ? 350  GLU A O   1 
ATOM   2717 C CB  . GLU A 1 350 ? 17.245  55.224 85.762 1.00 57.82 ? 350  GLU A CB  1 
ATOM   2718 C CG  . GLU A 1 350 ? 15.855  54.669 85.943 1.00 66.41 ? 350  GLU A CG  1 
ATOM   2719 C CD  . GLU A 1 350 ? 15.771  53.664 87.090 1.00 72.92 ? 350  GLU A CD  1 
ATOM   2720 O OE1 . GLU A 1 350 ? 16.388  53.919 88.161 1.00 74.64 ? 350  GLU A OE1 1 
ATOM   2721 O OE2 . GLU A 1 350 ? 15.076  52.622 86.915 1.00 75.90 ? 350  GLU A OE2 1 
ATOM   2722 N N   . ASP A 1 351 ? 16.476  57.023 83.214 1.00 49.92 ? 351  ASP A N   1 
ATOM   2723 C CA  . ASP A 1 351 ? 15.483  57.519 82.275 1.00 48.18 ? 351  ASP A CA  1 
ATOM   2724 C C   . ASP A 1 351 ? 15.996  57.317 80.841 1.00 46.63 ? 351  ASP A C   1 
ATOM   2725 O O   . ASP A 1 351 ? 15.212  57.090 79.908 1.00 45.91 ? 351  ASP A O   1 
ATOM   2726 C CB  . ASP A 1 351 ? 15.151  58.978 82.571 1.00 47.61 ? 351  ASP A CB  1 
ATOM   2727 C CG  . ASP A 1 351 ? 14.190  59.114 83.755 1.00 47.12 ? 351  ASP A CG  1 
ATOM   2728 O OD1 . ASP A 1 351 ? 13.607  58.094 84.172 1.00 47.75 ? 351  ASP A OD1 1 
ATOM   2729 O OD2 . ASP A 1 351 ? 14.003  60.226 84.267 1.00 46.86 ? 351  ASP A OD2 1 
ATOM   2730 N N   . PHE A 1 352 ? 17.317  57.354 80.683 1.00 44.59 ? 352  PHE A N   1 
ATOM   2731 C CA  . PHE A 1 352 ? 17.913  57.136 79.384 1.00 43.57 ? 352  PHE A CA  1 
ATOM   2732 C C   . PHE A 1 352 ? 17.461  55.764 78.906 1.00 43.69 ? 352  PHE A C   1 
ATOM   2733 O O   . PHE A 1 352 ? 16.973  55.606 77.783 1.00 44.26 ? 352  PHE A O   1 
ATOM   2734 C CB  . PHE A 1 352 ? 19.437  57.149 79.479 1.00 41.47 ? 352  PHE A CB  1 
ATOM   2735 C CG  . PHE A 1 352 ? 20.126  56.865 78.172 1.00 39.86 ? 352  PHE A CG  1 
ATOM   2736 C CD1 . PHE A 1 352 ? 20.360  57.892 77.250 1.00 38.20 ? 352  PHE A CD1 1 
ATOM   2737 C CD2 . PHE A 1 352 ? 20.498  55.566 77.839 1.00 37.39 ? 352  PHE A CD2 1 
ATOM   2738 C CE1 . PHE A 1 352 ? 20.953  57.629 76.018 1.00 37.03 ? 352  PHE A CE1 1 
ATOM   2739 C CE2 . PHE A 1 352 ? 21.093  55.285 76.607 1.00 39.43 ? 352  PHE A CE2 1 
ATOM   2740 C CZ  . PHE A 1 352 ? 21.324  56.321 75.688 1.00 38.70 ? 352  PHE A CZ  1 
ATOM   2741 N N   . MET A 1 353 ? 17.615  54.775 79.777 1.00 44.35 ? 353  MET A N   1 
ATOM   2742 C CA  . MET A 1 353 ? 17.257  53.402 79.440 1.00 45.95 ? 353  MET A CA  1 
ATOM   2743 C C   . MET A 1 353 ? 15.766  53.232 79.209 1.00 44.40 ? 353  MET A C   1 
ATOM   2744 O O   . MET A 1 353 ? 15.360  52.489 78.316 1.00 43.95 ? 353  MET A O   1 
ATOM   2745 C CB  . MET A 1 353 ? 17.782  52.440 80.510 1.00 49.50 ? 353  MET A CB  1 
ATOM   2746 C CG  . MET A 1 353 ? 19.320  52.385 80.530 1.00 54.46 ? 353  MET A CG  1 
ATOM   2747 S SD  . MET A 1 353 ? 19.989  51.063 81.567 1.00 63.17 ? 353  MET A SD  1 
ATOM   2748 C CE  . MET A 1 353 ? 19.562  51.688 83.177 1.00 56.52 ? 353  MET A CE  1 
ATOM   2749 N N   . SER A 1 354 ? 14.945  53.906 80.004 1.00 42.29 ? 354  SER A N   1 
ATOM   2750 C CA  . SER A 1 354 ? 13.507  53.850 79.765 1.00 41.85 ? 354  SER A CA  1 
ATOM   2751 C C   . SER A 1 354 ? 13.220  54.415 78.358 1.00 40.74 ? 354  SER A C   1 
ATOM   2752 O O   . SER A 1 354 ? 12.402  53.860 77.605 1.00 38.12 ? 354  SER A O   1 
ATOM   2753 C CB  . SER A 1 354 ? 12.767  54.686 80.800 1.00 41.31 ? 354  SER A CB  1 
ATOM   2754 O OG  . SER A 1 354 ? 12.746  53.990 82.021 1.00 46.74 ? 354  SER A OG  1 
ATOM   2755 N N   . GLY A 1 355 ? 13.904  55.520 78.027 1.00 39.16 ? 355  GLY A N   1 
ATOM   2756 C CA  . GLY A 1 355 ? 13.738  56.146 76.731 1.00 37.19 ? 355  GLY A CA  1 
ATOM   2757 C C   . GLY A 1 355 ? 14.107  55.189 75.615 1.00 36.15 ? 355  GLY A C   1 
ATOM   2758 O O   . GLY A 1 355 ? 13.391  55.075 74.604 1.00 34.56 ? 355  GLY A O   1 
ATOM   2759 N N   . VAL A 1 356 ? 15.209  54.471 75.801 1.00 36.31 ? 356  VAL A N   1 
ATOM   2760 C CA  . VAL A 1 356 ? 15.648  53.538 74.768 1.00 37.41 ? 356  VAL A CA  1 
ATOM   2761 C C   . VAL A 1 356 ? 14.560  52.531 74.467 1.00 37.99 ? 356  VAL A C   1 
ATOM   2762 O O   . VAL A 1 356 ? 14.275  52.247 73.298 1.00 37.57 ? 356  VAL A O   1 
ATOM   2763 C CB  . VAL A 1 356 ? 16.937  52.774 75.180 1.00 37.67 ? 356  VAL A CB  1 
ATOM   2764 C CG1 . VAL A 1 356 ? 17.213  51.614 74.202 1.00 34.38 ? 356  VAL A CG1 1 
ATOM   2765 C CG2 . VAL A 1 356 ? 18.122  53.737 75.187 1.00 35.21 ? 356  VAL A CG2 1 
ATOM   2766 N N   . LYS A 1 357 ? 13.946  52.012 75.525 1.00 39.14 ? 357  LYS A N   1 
ATOM   2767 C CA  . LYS A 1 357 ? 12.889  51.024 75.374 1.00 40.74 ? 357  LYS A CA  1 
ATOM   2768 C C   . LYS A 1 357 ? 11.655  51.602 74.693 1.00 38.78 ? 357  LYS A C   1 
ATOM   2769 O O   . LYS A 1 357 ? 10.981  50.908 73.927 1.00 38.38 ? 357  LYS A O   1 
ATOM   2770 C CB  . LYS A 1 357 ? 12.469  50.433 76.723 1.00 43.27 ? 357  LYS A CB  1 
ATOM   2771 C CG  . LYS A 1 357 ? 11.583  49.204 76.490 1.00 49.46 ? 357  LYS A CG  1 
ATOM   2772 C CD  . LYS A 1 357 ? 11.066  48.546 77.757 1.00 54.43 ? 357  LYS A CD  1 
ATOM   2773 C CE  . LYS A 1 357 ? 11.007  47.021 77.561 1.00 55.42 ? 357  LYS A CE  1 
ATOM   2774 N NZ  . LYS A 1 357 ? 10.597  46.662 76.176 1.00 56.17 ? 357  LYS A NZ  1 
ATOM   2775 N N   . LEU A 1 358 ? 11.350  52.866 74.962 1.00 37.44 ? 358  LEU A N   1 
ATOM   2776 C CA  . LEU A 1 358 ? 10.184  53.482 74.328 1.00 37.29 ? 358  LEU A CA  1 
ATOM   2777 C C   . LEU A 1 358 ? 10.475  53.762 72.861 1.00 36.84 ? 358  LEU A C   1 
ATOM   2778 O O   . LEU A 1 358 ? 9.570   53.738 72.029 1.00 34.43 ? 358  LEU A O   1 
ATOM   2779 C CB  . LEU A 1 358 ? 9.810   54.794 75.020 1.00 36.75 ? 358  LEU A CB  1 
ATOM   2780 C CG  . LEU A 1 358 ? 9.246   54.699 76.436 1.00 39.00 ? 358  LEU A CG  1 
ATOM   2781 C CD1 . LEU A 1 358 ? 9.106   56.141 77.070 1.00 35.45 ? 358  LEU A CD1 1 
ATOM   2782 C CD2 . LEU A 1 358 ? 7.886   53.943 76.368 1.00 36.33 ? 358  LEU A CD2 1 
ATOM   2783 N N   . SER A 1 359 ? 11.751  54.013 72.559 1.00 37.17 ? 359  SER A N   1 
ATOM   2784 C CA  . SER A 1 359 ? 12.192  54.336 71.202 1.00 37.02 ? 359  SER A CA  1 
ATOM   2785 C C   . SER A 1 359 ? 12.328  53.160 70.240 1.00 38.06 ? 359  SER A C   1 
ATOM   2786 O O   . SER A 1 359 ? 12.162  53.330 69.037 1.00 37.72 ? 359  SER A O   1 
ATOM   2787 C CB  . SER A 1 359 ? 13.524  55.082 71.249 1.00 35.99 ? 359  SER A CB  1 
ATOM   2788 O OG  . SER A 1 359 ? 13.449  56.177 72.131 1.00 38.03 ? 359  SER A OG  1 
ATOM   2789 N N   . VAL A 1 360 ? 12.639  51.972 70.744 1.00 38.23 ? 360  VAL A N   1 
ATOM   2790 C CA  . VAL A 1 360 ? 12.779  50.816 69.853 1.00 38.77 ? 360  VAL A CA  1 
ATOM   2791 C C   . VAL A 1 360 ? 11.919  49.732 70.478 1.00 41.10 ? 360  VAL A C   1 
ATOM   2792 O O   . VAL A 1 360 ? 12.424  48.699 70.949 1.00 40.27 ? 360  VAL A O   1 
ATOM   2793 C CB  . VAL A 1 360 ? 14.240  50.354 69.799 1.00 38.22 ? 360  VAL A CB  1 
ATOM   2794 C CG1 . VAL A 1 360 ? 14.451  49.392 68.638 1.00 35.76 ? 360  VAL A CG1 1 
ATOM   2795 C CG2 . VAL A 1 360 ? 15.152  51.573 69.692 1.00 38.83 ? 360  VAL A CG2 1 
ATOM   2796 N N   . PRO A 1 361 ? 10.592  49.951 70.478 1.00 42.02 ? 361  PRO A N   1 
ATOM   2797 C CA  . PRO A 1 361 ? 9.606   49.021 71.060 1.00 42.94 ? 361  PRO A CA  1 
ATOM   2798 C C   . PRO A 1 361 ? 9.611   47.590 70.539 1.00 45.59 ? 361  PRO A C   1 
ATOM   2799 O O   . PRO A 1 361 ? 9.301   46.655 71.281 1.00 45.82 ? 361  PRO A O   1 
ATOM   2800 C CB  . PRO A 1 361 ? 8.277   49.736 70.827 1.00 42.66 ? 361  PRO A CB  1 
ATOM   2801 C CG  . PRO A 1 361 ? 8.514   50.474 69.539 1.00 40.01 ? 361  PRO A CG  1 
ATOM   2802 C CD  . PRO A 1 361 ? 9.934   50.990 69.660 1.00 39.09 ? 361  PRO A CD  1 
ATOM   2803 N N   . HIS A 1 362 ? 9.994   47.407 69.280 1.00 47.18 ? 362  HIS A N   1 
ATOM   2804 C CA  . HIS A 1 362 ? 10.025  46.069 68.709 1.00 50.33 ? 362  HIS A CA  1 
ATOM   2805 C C   . HIS A 1 362 ? 11.261  45.233 69.092 1.00 51.14 ? 362  HIS A C   1 
ATOM   2806 O O   . HIS A 1 362 ? 11.292  44.019 68.850 1.00 51.38 ? 362  HIS A O   1 
ATOM   2807 C CB  . HIS A 1 362 ? 9.933   46.162 67.184 1.00 52.04 ? 362  HIS A CB  1 
ATOM   2808 C CG  . HIS A 1 362 ? 10.944  47.088 66.575 1.00 54.09 ? 362  HIS A CG  1 
ATOM   2809 N ND1 . HIS A 1 362 ? 10.987  48.438 66.868 1.00 53.89 ? 362  HIS A ND1 1 
ATOM   2810 C CD2 . HIS A 1 362 ? 11.937  46.864 65.678 1.00 53.10 ? 362  HIS A CD2 1 
ATOM   2811 C CE1 . HIS A 1 362 ? 11.962  49.003 66.175 1.00 55.29 ? 362  HIS A CE1 1 
ATOM   2812 N NE2 . HIS A 1 362 ? 12.554  48.070 65.444 1.00 54.72 ? 362  HIS A NE2 1 
ATOM   2813 N N   . ALA A 1 363 ? 12.261  45.867 69.705 1.00 49.77 ? 363  ALA A N   1 
ATOM   2814 C CA  . ALA A 1 363 ? 13.504  45.180 70.057 1.00 48.40 ? 363  ALA A CA  1 
ATOM   2815 C C   . ALA A 1 363 ? 13.505  44.314 71.305 1.00 48.06 ? 363  ALA A C   1 
ATOM   2816 O O   . ALA A 1 363 ? 12.810  44.613 72.264 1.00 49.10 ? 363  ALA A O   1 
ATOM   2817 C CB  . ALA A 1 363 ? 14.617  46.208 70.183 1.00 48.48 ? 363  ALA A CB  1 
ATOM   2818 N N   . ASN A 1 364 ? 14.292  43.236 71.286 1.00 47.94 ? 364  ASN A N   1 
ATOM   2819 C CA  . ASN A 1 364 ? 14.452  42.390 72.474 1.00 47.98 ? 364  ASN A CA  1 
ATOM   2820 C C   . ASN A 1 364 ? 15.579  43.028 73.315 1.00 47.83 ? 364  ASN A C   1 
ATOM   2821 O O   . ASN A 1 364 ? 16.201  44.017 72.897 1.00 47.22 ? 364  ASN A O   1 
ATOM   2822 C CB  . ASN A 1 364 ? 14.837  40.943 72.111 1.00 47.97 ? 364  ASN A CB  1 
ATOM   2823 C CG  . ASN A 1 364 ? 16.045  40.862 71.195 1.00 48.62 ? 364  ASN A CG  1 
ATOM   2824 O OD1 . ASN A 1 364 ? 16.903  41.737 71.207 1.00 50.51 ? 364  ASN A OD1 1 
ATOM   2825 N ND2 . ASN A 1 364 ? 16.119  39.803 70.401 1.00 46.31 ? 364  ASN A ND2 1 
ATOM   2826 N N   . ASP A 1 365 ? 15.852  42.454 74.482 1.00 47.49 ? 365  ASP A N   1 
ATOM   2827 C CA  . ASP A 1 365 ? 16.864  42.999 75.375 1.00 47.42 ? 365  ASP A CA  1 
ATOM   2828 C C   . ASP A 1 365 ? 18.248  43.158 74.767 1.00 44.62 ? 365  ASP A C   1 
ATOM   2829 O O   . ASP A 1 365 ? 18.954  44.131 75.035 1.00 43.01 ? 365  ASP A O   1 
ATOM   2830 C CB  . ASP A 1 365 ? 16.927  42.164 76.654 1.00 52.41 ? 365  ASP A CB  1 
ATOM   2831 C CG  . ASP A 1 365 ? 15.623  42.229 77.448 1.00 58.37 ? 365  ASP A CG  1 
ATOM   2832 O OD1 . ASP A 1 365 ? 14.783  43.120 77.143 1.00 61.60 ? 365  ASP A OD1 1 
ATOM   2833 O OD2 . ASP A 1 365 ? 15.433  41.403 78.378 1.00 61.65 ? 365  ASP A OD2 1 
ATOM   2834 N N   . LEU A 1 366 ? 18.641  42.209 73.942 1.00 42.26 ? 366  LEU A N   1 
ATOM   2835 C CA  . LEU A 1 366 ? 19.942  42.307 73.318 1.00 42.61 ? 366  LEU A CA  1 
ATOM   2836 C C   . LEU A 1 366 ? 19.962  43.552 72.412 1.00 41.67 ? 366  LEU A C   1 
ATOM   2837 O O   . LEU A 1 366 ? 20.942  44.316 72.376 1.00 40.54 ? 366  LEU A O   1 
ATOM   2838 C CB  . LEU A 1 366 ? 20.214  41.051 72.507 1.00 43.26 ? 366  LEU A CB  1 
ATOM   2839 C CG  . LEU A 1 366 ? 21.563  41.037 71.787 1.00 45.94 ? 366  LEU A CG  1 
ATOM   2840 C CD1 . LEU A 1 366 ? 22.727  41.146 72.803 1.00 44.31 ? 366  LEU A CD1 1 
ATOM   2841 C CD2 . LEU A 1 366 ? 21.650  39.757 70.982 1.00 45.31 ? 366  LEU A CD2 1 
ATOM   2842 N N   . GLY A 1 367 ? 18.868  43.752 71.685 1.00 40.61 ? 367  GLY A N   1 
ATOM   2843 C CA  . GLY A 1 367 ? 18.768  44.901 70.812 1.00 38.96 ? 367  GLY A CA  1 
ATOM   2844 C C   . GLY A 1 367 ? 18.786  46.203 71.596 1.00 37.47 ? 367  GLY A C   1 
ATOM   2845 O O   . GLY A 1 367 ? 19.419  47.168 71.175 1.00 35.44 ? 367  GLY A O   1 
ATOM   2846 N N   . LEU A 1 368 ? 18.088  46.236 72.729 1.00 36.20 ? 368  LEU A N   1 
ATOM   2847 C CA  . LEU A 1 368 ? 18.057  47.437 73.551 1.00 37.86 ? 368  LEU A CA  1 
ATOM   2848 C C   . LEU A 1 368 ? 19.470  47.705 74.071 1.00 39.76 ? 368  LEU A C   1 
ATOM   2849 O O   . LEU A 1 368 ? 19.889  48.870 74.172 1.00 39.76 ? 368  LEU A O   1 
ATOM   2850 C CB  . LEU A 1 368 ? 17.077  47.269 74.715 1.00 36.64 ? 368  LEU A CB  1 
ATOM   2851 C CG  . LEU A 1 368 ? 15.625  47.052 74.270 1.00 38.42 ? 368  LEU A CG  1 
ATOM   2852 C CD1 . LEU A 1 368 ? 14.745  46.691 75.450 1.00 36.52 ? 368  LEU A CD1 1 
ATOM   2853 C CD2 . LEU A 1 368 ? 15.129  48.326 73.574 1.00 37.96 ? 368  LEU A CD2 1 
ATOM   2854 N N   . ASP A 1 369 ? 20.198  46.629 74.391 1.00 39.50 ? 369  ASP A N   1 
ATOM   2855 C CA  . ASP A 1 369 ? 21.581  46.755 74.848 1.00 41.24 ? 369  ASP A CA  1 
ATOM   2856 C C   . ASP A 1 369 ? 22.464  47.322 73.736 1.00 39.08 ? 369  ASP A C   1 
ATOM   2857 O O   . ASP A 1 369 ? 23.322  48.163 73.985 1.00 39.49 ? 369  ASP A O   1 
ATOM   2858 C CB  . ASP A 1 369 ? 22.175  45.394 75.261 1.00 44.73 ? 369  ASP A CB  1 
ATOM   2859 C CG  . ASP A 1 369 ? 21.692  44.924 76.613 1.00 48.21 ? 369  ASP A CG  1 
ATOM   2860 O OD1 . ASP A 1 369 ? 21.154  45.751 77.387 1.00 49.84 ? 369  ASP A OD1 1 
ATOM   2861 O OD2 . ASP A 1 369 ? 21.869  43.719 76.907 1.00 52.60 ? 369  ASP A OD2 1 
ATOM   2862 N N   . ALA A 1 370 ? 22.267  46.842 72.516 1.00 36.71 ? 370  ALA A N   1 
ATOM   2863 C CA  . ALA A 1 370 ? 23.077  47.316 71.402 1.00 36.56 ? 370  ALA A CA  1 
ATOM   2864 C C   . ALA A 1 370 ? 22.915  48.821 71.211 1.00 36.99 ? 370  ALA A C   1 
ATOM   2865 O O   . ALA A 1 370 ? 23.914  49.531 71.063 1.00 38.09 ? 370  ALA A O   1 
ATOM   2866 C CB  . ALA A 1 370 ? 22.716  46.580 70.131 1.00 34.63 ? 370  ALA A CB  1 
ATOM   2867 N N   . VAL A 1 371 ? 21.671  49.308 71.242 1.00 35.84 ? 371  VAL A N   1 
ATOM   2868 C CA  . VAL A 1 371 ? 21.387  50.735 71.074 1.00 35.12 ? 371  VAL A CA  1 
ATOM   2869 C C   . VAL A 1 371 ? 22.043  51.523 72.215 1.00 37.05 ? 371  VAL A C   1 
ATOM   2870 O O   . VAL A 1 371 ? 22.807  52.492 71.990 1.00 36.30 ? 371  VAL A O   1 
ATOM   2871 C CB  . VAL A 1 371 ? 19.833  51.019 71.089 1.00 36.33 ? 371  VAL A CB  1 
ATOM   2872 C CG1 . VAL A 1 371 ? 19.566  52.510 70.967 1.00 33.30 ? 371  VAL A CG1 1 
ATOM   2873 C CG2 . VAL A 1 371 ? 19.115  50.238 69.967 1.00 32.91 ? 371  VAL A CG2 1 
ATOM   2874 N N   . THR A 1 372 ? 21.740  51.105 73.443 1.00 37.63 ? 372  THR A N   1 
ATOM   2875 C CA  . THR A 1 372 ? 22.296  51.749 74.631 1.00 38.74 ? 372  THR A CA  1 
ATOM   2876 C C   . THR A 1 372 ? 23.823  51.860 74.535 1.00 39.63 ? 372  THR A C   1 
ATOM   2877 O O   . THR A 1 372 ? 24.398  52.925 74.744 1.00 39.71 ? 372  THR A O   1 
ATOM   2878 C CB  . THR A 1 372 ? 21.915  50.961 75.895 1.00 38.77 ? 372  THR A CB  1 
ATOM   2879 O OG1 . THR A 1 372 ? 20.490  50.927 76.002 1.00 39.74 ? 372  THR A OG1 1 
ATOM   2880 C CG2 . THR A 1 372 ? 22.512  51.604 77.144 1.00 35.93 ? 372  THR A CG2 1 
ATOM   2881 N N   . LEU A 1 373 ? 24.477  50.759 74.190 1.00 41.25 ? 373  LEU A N   1 
ATOM   2882 C CA  . LEU A 1 373 ? 25.932  50.766 74.053 1.00 43.91 ? 373  LEU A CA  1 
ATOM   2883 C C   . LEU A 1 373 ? 26.378  51.816 73.055 1.00 44.51 ? 373  LEU A C   1 
ATOM   2884 O O   . LEU A 1 373 ? 27.289  52.591 73.318 1.00 44.30 ? 373  LEU A O   1 
ATOM   2885 C CB  . LEU A 1 373 ? 26.438  49.401 73.565 1.00 46.23 ? 373  LEU A CB  1 
ATOM   2886 C CG  . LEU A 1 373 ? 27.886  49.384 73.044 1.00 49.35 ? 373  LEU A CG  1 
ATOM   2887 C CD1 . LEU A 1 373 ? 28.843  49.533 74.234 1.00 50.75 ? 373  LEU A CD1 1 
ATOM   2888 C CD2 . LEU A 1 373 ? 28.177  48.092 72.278 1.00 49.71 ? 373  LEU A CD2 1 
ATOM   2889 N N   . GLN A 1 374 ? 25.711  51.820 71.905 1.00 44.88 ? 374  GLN A N   1 
ATOM   2890 C CA  . GLN A 1 374 ? 26.022  52.710 70.799 1.00 45.69 ? 374  GLN A CA  1 
ATOM   2891 C C   . GLN A 1 374 ? 25.862  54.201 71.087 1.00 45.36 ? 374  GLN A C   1 
ATOM   2892 O O   . GLN A 1 374 ? 26.581  55.020 70.521 1.00 45.05 ? 374  GLN A O   1 
ATOM   2893 C CB  . GLN A 1 374 ? 25.140  52.324 69.610 1.00 49.09 ? 374  GLN A CB  1 
ATOM   2894 C CG  . GLN A 1 374 ? 25.661  52.724 68.270 1.00 52.69 ? 374  GLN A CG  1 
ATOM   2895 C CD  . GLN A 1 374 ? 26.910  51.938 67.863 1.00 56.62 ? 374  GLN A CD  1 
ATOM   2896 O OE1 . GLN A 1 374 ? 27.519  52.248 66.834 1.00 60.27 ? 374  GLN A OE1 1 
ATOM   2897 N NE2 . GLN A 1 374 ? 27.293  50.924 68.658 1.00 54.26 ? 374  GLN A NE2 1 
ATOM   2898 N N   . TYR A 1 375 ? 24.935  54.561 71.966 1.00 43.75 ? 375  TYR A N   1 
ATOM   2899 C CA  . TYR A 1 375 ? 24.706  55.974 72.239 1.00 43.57 ? 375  TYR A CA  1 
ATOM   2900 C C   . TYR A 1 375 ? 25.124  56.503 73.613 1.00 44.23 ? 375  TYR A C   1 
ATOM   2901 O O   . TYR A 1 375 ? 24.724  57.591 74.013 1.00 45.30 ? 375  TYR A O   1 
ATOM   2902 C CB  . TYR A 1 375 ? 23.223  56.312 71.973 1.00 40.33 ? 375  TYR A CB  1 
ATOM   2903 C CG  . TYR A 1 375 ? 22.880  56.400 70.488 1.00 38.89 ? 375  TYR A CG  1 
ATOM   2904 C CD1 . TYR A 1 375 ? 22.578  55.249 69.743 1.00 37.42 ? 375  TYR A CD1 1 
ATOM   2905 C CD2 . TYR A 1 375 ? 22.893  57.627 69.824 1.00 36.68 ? 375  TYR A CD2 1 
ATOM   2906 C CE1 . TYR A 1 375 ? 22.300  55.327 68.382 1.00 36.46 ? 375  TYR A CE1 1 
ATOM   2907 C CE2 . TYR A 1 375 ? 22.615  57.714 68.465 1.00 36.05 ? 375  TYR A CE2 1 
ATOM   2908 C CZ  . TYR A 1 375 ? 22.320  56.562 67.752 1.00 37.56 ? 375  TYR A CZ  1 
ATOM   2909 O OH  . TYR A 1 375 ? 22.050  56.647 66.412 1.00 37.41 ? 375  TYR A OH  1 
ATOM   2910 N N   . THR A 1 376 ? 25.927  55.736 74.332 1.00 44.38 ? 376  THR A N   1 
ATOM   2911 C CA  . THR A 1 376 ? 26.385  56.139 75.654 1.00 41.96 ? 376  THR A CA  1 
ATOM   2912 C C   . THR A 1 376 ? 27.861  56.492 75.613 1.00 41.57 ? 376  THR A C   1 
ATOM   2913 O O   . THR A 1 376 ? 28.652  55.836 74.948 1.00 38.32 ? 376  THR A O   1 
ATOM   2914 C CB  . THR A 1 376 ? 26.217  54.982 76.687 1.00 41.99 ? 376  THR A CB  1 
ATOM   2915 O OG1 . THR A 1 376 ? 24.833  54.652 76.823 1.00 40.61 ? 376  THR A OG1 1 
ATOM   2916 C CG2 . THR A 1 376 ? 26.757  55.374 78.045 1.00 39.59 ? 376  THR A CG2 1 
ATOM   2917 N N   . ASP A 1 377 ? 28.221  57.556 76.308 1.00 42.87 ? 377  ASP A N   1 
ATOM   2918 C CA  . ASP A 1 377 ? 29.619  57.933 76.431 1.00 43.59 ? 377  ASP A CA  1 
ATOM   2919 C C   . ASP A 1 377 ? 29.947  57.236 77.768 1.00 44.53 ? 377  ASP A C   1 
ATOM   2920 O O   . ASP A 1 377 ? 29.569  57.736 78.842 1.00 41.27 ? 377  ASP A O   1 
ATOM   2921 C CB  . ASP A 1 377 ? 29.750  59.441 76.593 1.00 45.67 ? 377  ASP A CB  1 
ATOM   2922 C CG  . ASP A 1 377 ? 31.162  59.857 76.931 1.00 48.64 ? 377  ASP A CG  1 
ATOM   2923 O OD1 . ASP A 1 377 ? 31.958  58.971 77.333 1.00 48.05 ? 377  ASP A OD1 1 
ATOM   2924 O OD2 . ASP A 1 377 ? 31.475  61.068 76.815 1.00 50.16 ? 377  ASP A OD2 1 
ATOM   2925 N N   . TRP A 1 378 ? 30.613  56.082 77.702 1.00 45.17 ? 378  TRP A N   1 
ATOM   2926 C CA  . TRP A 1 378 ? 30.924  55.313 78.906 1.00 48.07 ? 378  TRP A CA  1 
ATOM   2927 C C   . TRP A 1 378 ? 31.924  55.920 79.864 1.00 49.28 ? 378  TRP A C   1 
ATOM   2928 O O   . TRP A 1 378 ? 32.123  55.405 80.958 1.00 49.86 ? 378  TRP A O   1 
ATOM   2929 C CB  . TRP A 1 378 ? 31.324  53.884 78.543 1.00 48.07 ? 378  TRP A CB  1 
ATOM   2930 C CG  . TRP A 1 378 ? 30.160  53.161 77.950 1.00 49.53 ? 378  TRP A CG  1 
ATOM   2931 C CD1 . TRP A 1 378 ? 29.969  52.845 76.634 1.00 49.02 ? 378  TRP A CD1 1 
ATOM   2932 C CD2 . TRP A 1 378 ? 28.968  52.769 78.635 1.00 48.38 ? 378  TRP A CD2 1 
ATOM   2933 N NE1 . TRP A 1 378 ? 28.728  52.282 76.457 1.00 50.70 ? 378  TRP A NE1 1 
ATOM   2934 C CE2 . TRP A 1 378 ? 28.093  52.218 77.670 1.00 49.75 ? 378  TRP A CE2 1 
ATOM   2935 C CE3 . TRP A 1 378 ? 28.558  52.824 79.970 1.00 48.45 ? 378  TRP A CE3 1 
ATOM   2936 C CZ2 . TRP A 1 378 ? 26.822  51.730 77.997 1.00 49.00 ? 378  TRP A CZ2 1 
ATOM   2937 C CZ3 . TRP A 1 378 ? 27.293  52.339 80.303 1.00 49.98 ? 378  TRP A CZ3 1 
ATOM   2938 C CH2 . TRP A 1 378 ? 26.442  51.795 79.319 1.00 50.94 ? 378  TRP A CH2 1 
ATOM   2939 N N   . MET A 1 379 ? 32.543  57.022 79.465 1.00 51.57 ? 379  MET A N   1 
ATOM   2940 C CA  . MET A 1 379 ? 33.455  57.714 80.357 1.00 53.76 ? 379  MET A CA  1 
ATOM   2941 C C   . MET A 1 379 ? 32.673  58.706 81.215 1.00 53.52 ? 379  MET A C   1 
ATOM   2942 O O   . MET A 1 379 ? 33.059  59.012 82.339 1.00 54.63 ? 379  MET A O   1 
ATOM   2943 C CB  . MET A 1 379 ? 34.505  58.473 79.566 1.00 57.83 ? 379  MET A CB  1 
ATOM   2944 C CG  . MET A 1 379 ? 35.582  57.582 79.010 1.00 65.19 ? 379  MET A CG  1 
ATOM   2945 S SD  . MET A 1 379 ? 37.145  58.457 78.990 1.00 73.38 ? 379  MET A SD  1 
ATOM   2946 C CE  . MET A 1 379 ? 36.969  59.339 77.350 1.00 69.06 ? 379  MET A CE  1 
ATOM   2947 N N   . ASP A 1 380 ? 31.542  59.171 80.696 1.00 52.47 ? 380  ASP A N   1 
ATOM   2948 C CA  . ASP A 1 380 ? 30.734  60.175 81.378 1.00 49.80 ? 380  ASP A CA  1 
ATOM   2949 C C   . ASP A 1 380 ? 29.250  59.767 81.260 1.00 49.31 ? 380  ASP A C   1 
ATOM   2950 O O   . ASP A 1 380 ? 28.395  60.558 80.848 1.00 48.04 ? 380  ASP A O   1 
ATOM   2951 C CB  . ASP A 1 380 ? 31.046  61.501 80.679 1.00 48.36 ? 380  ASP A CB  1 
ATOM   2952 C CG  . ASP A 1 380 ? 30.581  62.705 81.437 1.00 50.08 ? 380  ASP A CG  1 
ATOM   2953 O OD1 . ASP A 1 380 ? 30.284  62.584 82.643 1.00 50.99 ? 380  ASP A OD1 1 
ATOM   2954 O OD2 . ASP A 1 380 ? 30.528  63.788 80.812 1.00 50.05 ? 380  ASP A OD2 1 
ATOM   2955 N N   . ASP A 1 381 ? 28.959  58.528 81.653 1.00 49.52 ? 381  ASP A N   1 
ATOM   2956 C CA  . ASP A 1 381 ? 27.610  57.958 81.540 1.00 51.33 ? 381  ASP A CA  1 
ATOM   2957 C C   . ASP A 1 381 ? 26.511  58.490 82.461 1.00 52.00 ? 381  ASP A C   1 
ATOM   2958 O O   . ASP A 1 381 ? 25.342  58.082 82.359 1.00 51.71 ? 381  ASP A O   1 
ATOM   2959 C CB  . ASP A 1 381 ? 27.681  56.430 81.657 1.00 51.55 ? 381  ASP A CB  1 
ATOM   2960 C CG  . ASP A 1 381 ? 28.149  55.968 83.020 1.00 53.32 ? 381  ASP A CG  1 
ATOM   2961 O OD1 . ASP A 1 381 ? 29.218  56.422 83.497 1.00 53.89 ? 381  ASP A OD1 1 
ATOM   2962 O OD2 . ASP A 1 381 ? 27.444  55.137 83.613 1.00 55.45 ? 381  ASP A OD2 1 
ATOM   2963 N N   . ASN A 1 382 ? 26.872  59.399 83.355 1.00 52.51 ? 382  ASN A N   1 
ATOM   2964 C CA  . ASN A 1 382 ? 25.885  59.987 84.247 1.00 53.01 ? 382  ASN A CA  1 
ATOM   2965 C C   . ASN A 1 382 ? 25.689  61.453 83.926 1.00 51.73 ? 382  ASN A C   1 
ATOM   2966 O O   . ASN A 1 382 ? 24.979  62.156 84.642 1.00 53.00 ? 382  ASN A O   1 
ATOM   2967 C CB  . ASN A 1 382 ? 26.296  59.811 85.704 1.00 55.26 ? 382  ASN A CB  1 
ATOM   2968 C CG  . ASN A 1 382 ? 25.910  58.458 86.241 1.00 57.38 ? 382  ASN A CG  1 
ATOM   2969 O OD1 . ASN A 1 382 ? 26.660  57.842 86.991 1.00 61.90 ? 382  ASN A OD1 1 
ATOM   2970 N ND2 . ASN A 1 382 ? 24.725  57.985 85.864 1.00 59.22 ? 382  ASN A ND2 1 
ATOM   2971 N N   . ASN A 1 383 ? 26.327  61.912 82.848 1.00 49.55 ? 383  ASN A N   1 
ATOM   2972 C CA  . ASN A 1 383 ? 26.182  63.291 82.409 1.00 46.66 ? 383  ASN A CA  1 
ATOM   2973 C C   . ASN A 1 383 ? 24.764  63.434 81.814 1.00 47.04 ? 383  ASN A C   1 
ATOM   2974 O O   . ASN A 1 383 ? 24.451  62.864 80.759 1.00 45.50 ? 383  ASN A O   1 
ATOM   2975 C CB  . ASN A 1 383 ? 27.236  63.605 81.364 1.00 45.83 ? 383  ASN A CB  1 
ATOM   2976 C CG  . ASN A 1 383 ? 27.095  64.995 80.815 1.00 46.38 ? 383  ASN A CG  1 
ATOM   2977 O OD1 . ASN A 1 383 ? 25.987  65.528 80.731 1.00 46.65 ? 383  ASN A OD1 1 
ATOM   2978 N ND2 . ASN A 1 383 ? 28.209  65.592 80.417 1.00 45.65 ? 383  ASN A ND2 1 
ATOM   2979 N N   . GLY A 1 384 ? 23.912  64.173 82.527 1.00 45.59 ? 384  GLY A N   1 
ATOM   2980 C CA  . GLY A 1 384 ? 22.534  64.393 82.121 1.00 44.60 ? 384  GLY A CA  1 
ATOM   2981 C C   . GLY A 1 384 ? 22.321  65.022 80.756 1.00 44.28 ? 384  GLY A C   1 
ATOM   2982 O O   . GLY A 1 384 ? 21.345  64.681 80.079 1.00 44.66 ? 384  GLY A O   1 
ATOM   2983 N N   . ILE A 1 385 ? 23.210  65.928 80.354 1.00 43.02 ? 385  ILE A N   1 
ATOM   2984 C CA  . ILE A 1 385 ? 23.114  66.586 79.051 1.00 42.28 ? 385  ILE A CA  1 
ATOM   2985 C C   . ILE A 1 385 ? 23.401  65.565 77.931 1.00 43.50 ? 385  ILE A C   1 
ATOM   2986 O O   . ILE A 1 385 ? 22.736  65.549 76.890 1.00 42.80 ? 385  ILE A O   1 
ATOM   2987 C CB  . ILE A 1 385 ? 24.158  67.727 78.913 1.00 42.19 ? 385  ILE A CB  1 
ATOM   2988 C CG1 . ILE A 1 385 ? 23.911  68.818 79.959 1.00 44.19 ? 385  ILE A CG1 1 
ATOM   2989 C CG2 . ILE A 1 385 ? 24.086  68.349 77.538 1.00 39.48 ? 385  ILE A CG2 1 
ATOM   2990 C CD1 . ILE A 1 385 ? 22.598  69.526 79.791 1.00 47.47 ? 385  ILE A CD1 1 
ATOM   2991 N N   . LYS A 1 386 ? 24.416  64.738 78.149 1.00 43.42 ? 386  LYS A N   1 
ATOM   2992 C CA  . LYS A 1 386 ? 24.820  63.748 77.169 1.00 43.49 ? 386  LYS A CA  1 
ATOM   2993 C C   . LYS A 1 386 ? 23.761  62.677 76.982 1.00 42.71 ? 386  LYS A C   1 
ATOM   2994 O O   . LYS A 1 386 ? 23.541  62.214 75.861 1.00 41.41 ? 386  LYS A O   1 
ATOM   2995 C CB  . LYS A 1 386 ? 26.147  63.128 77.586 1.00 44.35 ? 386  LYS A CB  1 
ATOM   2996 C CG  . LYS A 1 386 ? 27.349  63.906 77.111 1.00 44.22 ? 386  LYS A CG  1 
ATOM   2997 C CD  . LYS A 1 386 ? 28.578  63.438 77.861 1.00 47.46 ? 386  LYS A CD  1 
ATOM   2998 C CE  . LYS A 1 386 ? 29.864  64.052 77.305 1.00 49.10 ? 386  LYS A CE  1 
ATOM   2999 N NZ  . LYS A 1 386 ? 31.044  63.643 78.127 1.00 50.50 ? 386  LYS A NZ  1 
ATOM   3000 N N   . ASN A 1 387 ? 23.118  62.290 78.084 1.00 40.73 ? 387  ASN A N   1 
ATOM   3001 C CA  . ASN A 1 387 ? 22.065  61.309 78.046 1.00 40.54 ? 387  ASN A CA  1 
ATOM   3002 C C   . ASN A 1 387 ? 20.860  61.893 77.272 1.00 40.30 ? 387  ASN A C   1 
ATOM   3003 O O   . ASN A 1 387 ? 20.256  61.217 76.444 1.00 40.89 ? 387  ASN A O   1 
ATOM   3004 C CB  . ASN A 1 387 ? 21.667  60.913 79.481 1.00 40.24 ? 387  ASN A CB  1 
ATOM   3005 C CG  . ASN A 1 387 ? 22.724  60.037 80.163 1.00 43.22 ? 387  ASN A CG  1 
ATOM   3006 O OD1 . ASN A 1 387 ? 23.569  59.435 79.494 1.00 43.22 ? 387  ASN A OD1 1 
ATOM   3007 N ND2 . ASN A 1 387 ? 22.678  59.965 81.498 1.00 42.32 ? 387  ASN A ND2 1 
ATOM   3008 N N   . ARG A 1 388 ? 20.529  63.151 77.538 1.00 39.12 ? 388  ARG A N   1 
ATOM   3009 C CA  . ARG A 1 388 ? 19.415  63.816 76.872 1.00 39.76 ? 388  ARG A CA  1 
ATOM   3010 C C   . ARG A 1 388 ? 19.684  63.880 75.363 1.00 40.32 ? 388  ARG A C   1 
ATOM   3011 O O   . ARG A 1 388 ? 18.869  63.425 74.551 1.00 40.70 ? 388  ARG A O   1 
ATOM   3012 C CB  . ARG A 1 388 ? 19.227  65.226 77.446 1.00 37.45 ? 388  ARG A CB  1 
ATOM   3013 C CG  . ARG A 1 388 ? 18.129  66.049 76.780 1.00 38.06 ? 388  ARG A CG  1 
ATOM   3014 C CD  . ARG A 1 388 ? 18.753  67.252 76.098 1.00 40.20 ? 388  ARG A CD  1 
ATOM   3015 N NE  . ARG A 1 388 ? 18.873  68.349 77.027 1.00 42.18 ? 388  ARG A NE  1 
ATOM   3016 C CZ  . ARG A 1 388 ? 19.742  69.357 76.929 1.00 43.89 ? 388  ARG A CZ  1 
ATOM   3017 N NH1 . ARG A 1 388 ? 20.611  69.434 75.929 1.00 40.15 ? 388  ARG A NH1 1 
ATOM   3018 N NH2 . ARG A 1 388 ? 19.720  70.310 77.851 1.00 44.45 ? 388  ARG A NH2 1 
ATOM   3019 N N   . ASP A 1 389 ? 20.839  64.420 74.995 1.00 39.09 ? 389  ASP A N   1 
ATOM   3020 C CA  . ASP A 1 389 ? 21.222  64.532 73.593 1.00 38.10 ? 389  ASP A CA  1 
ATOM   3021 C C   . ASP A 1 389 ? 21.358  63.175 72.857 1.00 37.95 ? 389  ASP A C   1 
ATOM   3022 O O   . ASP A 1 389 ? 20.980  63.056 71.693 1.00 37.56 ? 389  ASP A O   1 
ATOM   3023 C CB  . ASP A 1 389 ? 22.516  65.337 73.515 1.00 36.83 ? 389  ASP A CB  1 
ATOM   3024 C CG  . ASP A 1 389 ? 22.301  66.805 73.854 1.00 37.91 ? 389  ASP A CG  1 
ATOM   3025 O OD1 . ASP A 1 389 ? 21.133  67.261 73.923 1.00 37.38 ? 389  ASP A OD1 1 
ATOM   3026 O OD2 . ASP A 1 389 ? 23.302  67.513 74.029 1.00 38.92 ? 389  ASP A OD2 1 
ATOM   3027 N N   . GLY A 1 390 ? 21.883  62.158 73.536 1.00 38.84 ? 390  GLY A N   1 
ATOM   3028 C CA  . GLY A 1 390 ? 22.028  60.841 72.924 1.00 37.59 ? 390  GLY A CA  1 
ATOM   3029 C C   . GLY A 1 390 ? 20.655  60.243 72.606 1.00 38.15 ? 390  GLY A C   1 
ATOM   3030 O O   . GLY A 1 390 ? 20.485  59.630 71.545 1.00 36.56 ? 390  GLY A O   1 
ATOM   3031 N N   . LEU A 1 391 ? 19.696  60.413 73.527 1.00 36.00 ? 391  LEU A N   1 
ATOM   3032 C CA  . LEU A 1 391 ? 18.323  59.930 73.349 1.00 36.55 ? 391  LEU A CA  1 
ATOM   3033 C C   . LEU A 1 391 ? 17.699  60.679 72.182 1.00 36.28 ? 391  LEU A C   1 
ATOM   3034 O O   . LEU A 1 391 ? 17.030  60.088 71.350 1.00 36.61 ? 391  LEU A O   1 
ATOM   3035 C CB  . LEU A 1 391 ? 17.466  60.165 74.613 1.00 35.78 ? 391  LEU A CB  1 
ATOM   3036 C CG  . LEU A 1 391 ? 17.042  58.877 75.317 1.00 40.61 ? 391  LEU A CG  1 
ATOM   3037 C CD1 . LEU A 1 391 ? 16.159  59.188 76.514 1.00 41.38 ? 391  LEU A CD1 1 
ATOM   3038 C CD2 . LEU A 1 391 ? 16.307  57.960 74.319 1.00 40.90 ? 391  LEU A CD2 1 
ATOM   3039 N N   . ASP A 1 392 ? 17.925  61.987 72.129 1.00 36.62 ? 392  ASP A N   1 
ATOM   3040 C CA  . ASP A 1 392 ? 17.404  62.799 71.035 1.00 37.18 ? 392  ASP A CA  1 
ATOM   3041 C C   . ASP A 1 392 ? 17.914  62.195 69.714 1.00 36.21 ? 392  ASP A C   1 
ATOM   3042 O O   . ASP A 1 392 ? 17.151  61.977 68.787 1.00 34.88 ? 392  ASP A O   1 
ATOM   3043 C CB  . ASP A 1 392 ? 17.889  64.241 71.183 1.00 39.42 ? 392  ASP A CB  1 
ATOM   3044 C CG  . ASP A 1 392 ? 17.113  65.229 70.312 1.00 44.79 ? 392  ASP A CG  1 
ATOM   3045 O OD1 . ASP A 1 392 ? 16.516  64.819 69.291 1.00 46.71 ? 392  ASP A OD1 1 
ATOM   3046 O OD2 . ASP A 1 392 ? 17.123  66.440 70.644 1.00 49.22 ? 392  ASP A OD2 1 
ATOM   3047 N N   . ASP A 1 393 ? 19.208  61.903 69.643 1.00 36.48 ? 393  ASP A N   1 
ATOM   3048 C CA  . ASP A 1 393 ? 19.775  61.318 68.437 1.00 35.74 ? 393  ASP A CA  1 
ATOM   3049 C C   . ASP A 1 393 ? 19.205  59.931 68.106 1.00 35.48 ? 393  ASP A C   1 
ATOM   3050 O O   . ASP A 1 393 ? 18.998  59.598 66.944 1.00 34.89 ? 393  ASP A O   1 
ATOM   3051 C CB  . ASP A 1 393 ? 21.287  61.208 68.574 1.00 37.61 ? 393  ASP A CB  1 
ATOM   3052 C CG  . ASP A 1 393 ? 21.999  62.530 68.316 1.00 39.79 ? 393  ASP A CG  1 
ATOM   3053 O OD1 . ASP A 1 393 ? 21.405  63.451 67.722 1.00 41.39 ? 393  ASP A OD1 1 
ATOM   3054 O OD2 . ASP A 1 393 ? 23.175  62.639 68.697 1.00 43.37 ? 393  ASP A OD2 1 
ATOM   3055 N N   . ILE A 1 394 ? 18.989  59.113 69.127 1.00 32.35 ? 394  ILE A N   1 
ATOM   3056 C CA  . ILE A 1 394 ? 18.445  57.782 68.913 1.00 32.86 ? 394  ILE A CA  1 
ATOM   3057 C C   . ILE A 1 394 ? 17.083  57.874 68.192 1.00 33.08 ? 394  ILE A C   1 
ATOM   3058 O O   . ILE A 1 394 ? 16.845  57.206 67.188 1.00 33.33 ? 394  ILE A O   1 
ATOM   3059 C CB  . ILE A 1 394 ? 18.244  57.059 70.268 1.00 32.18 ? 394  ILE A CB  1 
ATOM   3060 C CG1 . ILE A 1 394 ? 19.589  56.527 70.774 1.00 31.09 ? 394  ILE A CG1 1 
ATOM   3061 C CG2 . ILE A 1 394 ? 17.181  55.939 70.143 1.00 28.34 ? 394  ILE A CG2 1 
ATOM   3062 C CD1 . ILE A 1 394 ? 19.534  56.151 72.244 1.00 30.80 ? 394  ILE A CD1 1 
ATOM   3063 N N   . VAL A 1 395 ? 16.210  58.717 68.722 1.00 31.10 ? 395  VAL A N   1 
ATOM   3064 C CA  . VAL A 1 395 ? 14.890  58.889 68.182 1.00 31.91 ? 395  VAL A CA  1 
ATOM   3065 C C   . VAL A 1 395 ? 14.916  59.440 66.759 1.00 31.88 ? 395  VAL A C   1 
ATOM   3066 O O   . VAL A 1 395 ? 14.234  58.906 65.868 1.00 32.33 ? 395  VAL A O   1 
ATOM   3067 C CB  . VAL A 1 395 ? 14.041  59.790 69.121 1.00 32.03 ? 395  VAL A CB  1 
ATOM   3068 C CG1 . VAL A 1 395 ? 12.604  59.940 68.549 1.00 30.64 ? 395  VAL A CG1 1 
ATOM   3069 C CG2 . VAL A 1 395 ? 13.993  59.166 70.520 1.00 30.08 ? 395  VAL A CG2 1 
ATOM   3070 N N   . GLY A 1 396 ? 15.719  60.475 66.544 1.00 30.38 ? 396  GLY A N   1 
ATOM   3071 C CA  . GLY A 1 396 ? 15.837  61.064 65.225 1.00 30.73 ? 396  GLY A CA  1 
ATOM   3072 C C   . GLY A 1 396 ? 16.505  60.124 64.223 1.00 32.04 ? 396  GLY A C   1 
ATOM   3073 O O   . GLY A 1 396 ? 16.056  60.010 63.066 1.00 33.89 ? 396  GLY A O   1 
ATOM   3074 N N   . ASP A 1 397 ? 17.569  59.445 64.647 1.00 30.97 ? 397  ASP A N   1 
ATOM   3075 C CA  . ASP A 1 397 ? 18.277  58.524 63.769 1.00 30.74 ? 397  ASP A CA  1 
ATOM   3076 C C   . ASP A 1 397 ? 17.402  57.342 63.379 1.00 31.60 ? 397  ASP A C   1 
ATOM   3077 O O   . ASP A 1 397 ? 17.241  57.042 62.194 1.00 32.12 ? 397  ASP A O   1 
ATOM   3078 C CB  . ASP A 1 397 ? 19.551  58.004 64.435 1.00 30.90 ? 397  ASP A CB  1 
ATOM   3079 C CG  . ASP A 1 397 ? 20.647  59.066 64.521 1.00 32.76 ? 397  ASP A CG  1 
ATOM   3080 O OD1 . ASP A 1 397 ? 20.528  60.130 63.862 1.00 30.87 ? 397  ASP A OD1 1 
ATOM   3081 O OD2 . ASP A 1 397 ? 21.641  58.819 65.242 1.00 31.36 ? 397  ASP A OD2 1 
ATOM   3082 N N   . HIS A 1 398 ? 16.811  56.683 64.370 1.00 31.82 ? 398  HIS A N   1 
ATOM   3083 C CA  . HIS A 1 398 ? 15.960  55.529 64.099 1.00 31.98 ? 398  HIS A CA  1 
ATOM   3084 C C   . HIS A 1 398 ? 14.685  55.845 63.293 1.00 33.42 ? 398  HIS A C   1 
ATOM   3085 O O   . HIS A 1 398 ? 14.336  55.124 62.357 1.00 33.72 ? 398  HIS A O   1 
ATOM   3086 C CB  . HIS A 1 398 ? 15.576  54.852 65.420 1.00 29.82 ? 398  HIS A CB  1 
ATOM   3087 C CG  . HIS A 1 398 ? 14.498  53.822 65.281 1.00 32.53 ? 398  HIS A CG  1 
ATOM   3088 N ND1 . HIS A 1 398 ? 14.638  52.689 64.505 1.00 32.19 ? 398  HIS A ND1 1 
ATOM   3089 C CD2 . HIS A 1 398 ? 13.257  53.753 65.826 1.00 32.63 ? 398  HIS A CD2 1 
ATOM   3090 C CE1 . HIS A 1 398 ? 13.535  51.967 64.577 1.00 29.79 ? 398  HIS A CE1 1 
ATOM   3091 N NE2 . HIS A 1 398 ? 12.680  52.588 65.373 1.00 32.93 ? 398  HIS A NE2 1 
ATOM   3092 N N   . ASN A 1 399 ? 14.010  56.933 63.641 1.00 32.68 ? 399  ASN A N   1 
ATOM   3093 C CA  . ASN A 1 399 ? 12.749  57.272 63.001 1.00 32.59 ? 399  ASN A CA  1 
ATOM   3094 C C   . ASN A 1 399 ? 12.742  58.125 61.735 1.00 33.60 ? 399  ASN A C   1 
ATOM   3095 O O   . ASN A 1 399 ? 11.808  58.053 60.943 1.00 33.73 ? 399  ASN A O   1 
ATOM   3096 C CB  . ASN A 1 399 ? 11.837  57.919 64.042 1.00 31.25 ? 399  ASN A CB  1 
ATOM   3097 C CG  . ASN A 1 399 ? 11.412  56.943 65.117 1.00 32.19 ? 399  ASN A CG  1 
ATOM   3098 O OD1 . ASN A 1 399 ? 10.624  56.045 64.865 1.00 33.62 ? 399  ASN A OD1 1 
ATOM   3099 N ND2 . ASN A 1 399 ? 11.948  57.102 66.314 1.00 30.63 ? 399  ASN A ND2 1 
ATOM   3100 N N   . VAL A 1 400 ? 13.782  58.916 61.529 1.00 33.12 ? 400  VAL A N   1 
ATOM   3101 C CA  . VAL A 1 400 ? 13.805  59.808 60.377 1.00 31.87 ? 400  VAL A CA  1 
ATOM   3102 C C   . VAL A 1 400 ? 15.077  59.716 59.514 1.00 32.95 ? 400  VAL A C   1 
ATOM   3103 O O   . VAL A 1 400 ? 15.049  59.323 58.344 1.00 32.87 ? 400  VAL A O   1 
ATOM   3104 C CB  . VAL A 1 400 ? 13.666  61.277 60.864 1.00 28.90 ? 400  VAL A CB  1 
ATOM   3105 C CG1 . VAL A 1 400 ? 13.786  62.238 59.706 1.00 27.10 ? 400  VAL A CG1 1 
ATOM   3106 C CG2 . VAL A 1 400 ? 12.331  61.450 61.608 1.00 27.56 ? 400  VAL A CG2 1 
ATOM   3107 N N   . ILE A 1 401 ? 16.205  60.059 60.111 1.00 33.51 ? 401  ILE A N   1 
ATOM   3108 C CA  . ILE A 1 401 ? 17.434  60.097 59.350 1.00 32.89 ? 401  ILE A CA  1 
ATOM   3109 C C   . ILE A 1 401 ? 17.896  58.808 58.711 1.00 31.99 ? 401  ILE A C   1 
ATOM   3110 O O   . ILE A 1 401 ? 18.041  58.755 57.494 1.00 33.55 ? 401  ILE A O   1 
ATOM   3111 C CB  . ILE A 1 401 ? 18.566  60.709 60.178 1.00 32.41 ? 401  ILE A CB  1 
ATOM   3112 C CG1 . ILE A 1 401 ? 18.104  62.069 60.726 1.00 32.59 ? 401  ILE A CG1 1 
ATOM   3113 C CG2 . ILE A 1 401 ? 19.818  60.850 59.303 1.00 31.40 ? 401  ILE A CG2 1 
ATOM   3114 C CD1 . ILE A 1 401 ? 19.153  62.823 61.561 1.00 34.48 ? 401  ILE A CD1 1 
ATOM   3115 N N   . CYS A 1 402 ? 18.128  57.765 59.490 1.00 31.06 ? 402  CYS A N   1 
ATOM   3116 C CA  . CYS A 1 402 ? 18.598  56.523 58.886 1.00 30.27 ? 402  CYS A CA  1 
ATOM   3117 C C   . CYS A 1 402 ? 17.592  55.918 57.897 1.00 29.90 ? 402  CYS A C   1 
ATOM   3118 O O   . CYS A 1 402 ? 17.982  55.400 56.862 1.00 30.81 ? 402  CYS A O   1 
ATOM   3119 C CB  . CYS A 1 402 ? 19.045  55.565 59.995 1.00 31.38 ? 402  CYS A CB  1 
ATOM   3120 S SG  . CYS A 1 402 ? 20.503  56.288 60.859 1.00 35.11 ? 402  CYS A SG  1 
ATOM   3121 N N   . PRO A 1 403 ? 16.278  55.969 58.195 1.00 32.15 ? 403  PRO A N   1 
ATOM   3122 C CA  . PRO A 1 403 ? 15.367  55.397 57.180 1.00 31.99 ? 403  PRO A CA  1 
ATOM   3123 C C   . PRO A 1 403 ? 15.486  56.251 55.905 1.00 31.82 ? 403  PRO A C   1 
ATOM   3124 O O   . PRO A 1 403 ? 15.473  55.731 54.790 1.00 33.40 ? 403  PRO A O   1 
ATOM   3125 C CB  . PRO A 1 403 ? 13.972  55.545 57.815 1.00 30.43 ? 403  PRO A CB  1 
ATOM   3126 C CG  . PRO A 1 403 ? 14.255  55.428 59.274 1.00 30.97 ? 403  PRO A CG  1 
ATOM   3127 C CD  . PRO A 1 403 ? 15.567  56.209 59.471 1.00 29.79 ? 403  PRO A CD  1 
ATOM   3128 N N   . LEU A 1 404 ? 15.629  57.562 56.058 1.00 30.94 ? 404  LEU A N   1 
ATOM   3129 C CA  . LEU A 1 404 ? 15.720  58.411 54.871 1.00 31.42 ? 404  LEU A CA  1 
ATOM   3130 C C   . LEU A 1 404 ? 17.020  58.154 54.092 1.00 33.02 ? 404  LEU A C   1 
ATOM   3131 O O   . LEU A 1 404 ? 17.032  58.126 52.846 1.00 30.80 ? 404  LEU A O   1 
ATOM   3132 C CB  . LEU A 1 404 ? 15.595  59.893 55.258 1.00 30.27 ? 404  LEU A CB  1 
ATOM   3133 C CG  . LEU A 1 404 ? 15.613  60.839 54.041 1.00 33.09 ? 404  LEU A CG  1 
ATOM   3134 C CD1 . LEU A 1 404 ? 14.668  62.056 54.258 1.00 29.60 ? 404  LEU A CD1 1 
ATOM   3135 C CD2 . LEU A 1 404 ? 17.099  61.266 53.768 1.00 28.02 ? 404  LEU A CD2 1 
ATOM   3136 N N   . MET A 1 405 ? 18.117  57.962 54.825 1.00 31.93 ? 405  MET A N   1 
ATOM   3137 C CA  . MET A 1 405 ? 19.388  57.679 54.178 1.00 33.00 ? 405  MET A CA  1 
ATOM   3138 C C   . MET A 1 405 ? 19.306  56.332 53.438 1.00 33.34 ? 405  MET A C   1 
ATOM   3139 O O   . MET A 1 405 ? 19.881  56.173 52.361 1.00 33.12 ? 405  MET A O   1 
ATOM   3140 C CB  . MET A 1 405 ? 20.535  57.683 55.204 1.00 30.60 ? 405  MET A CB  1 
ATOM   3141 C CG  . MET A 1 405 ? 20.837  59.077 55.752 1.00 30.76 ? 405  MET A CG  1 
ATOM   3142 S SD  . MET A 1 405 ? 21.050  60.320 54.391 1.00 33.86 ? 405  MET A SD  1 
ATOM   3143 C CE  . MET A 1 405 ? 22.489  59.554 53.514 1.00 26.49 ? 405  MET A CE  1 
ATOM   3144 N N   . HIS A 1 406 ? 18.574  55.371 53.993 1.00 33.57 ? 406  HIS A N   1 
ATOM   3145 C CA  . HIS A 1 406 ? 18.454  54.073 53.324 1.00 34.34 ? 406  HIS A CA  1 
ATOM   3146 C C   . HIS A 1 406 ? 17.660  54.283 52.021 1.00 35.26 ? 406  HIS A C   1 
ATOM   3147 O O   . HIS A 1 406 ? 18.021  53.759 50.962 1.00 34.52 ? 406  HIS A O   1 
ATOM   3148 C CB  . HIS A 1 406 ? 17.744  53.051 54.229 1.00 34.90 ? 406  HIS A CB  1 
ATOM   3149 C CG  . HIS A 1 406 ? 17.621  51.679 53.625 1.00 39.63 ? 406  HIS A CG  1 
ATOM   3150 N ND1 . HIS A 1 406 ? 18.705  50.838 53.445 1.00 39.54 ? 406  HIS A ND1 1 
ATOM   3151 C CD2 . HIS A 1 406 ? 16.549  51.021 53.114 1.00 37.77 ? 406  HIS A CD2 1 
ATOM   3152 C CE1 . HIS A 1 406 ? 18.306  49.730 52.847 1.00 39.19 ? 406  HIS A CE1 1 
ATOM   3153 N NE2 . HIS A 1 406 ? 17.004  49.816 52.633 1.00 38.85 ? 406  HIS A NE2 1 
ATOM   3154 N N   . PHE A 1 407 ? 16.579  55.054 52.109 1.00 34.19 ? 407  PHE A N   1 
ATOM   3155 C CA  . PHE A 1 407 ? 15.756  55.335 50.946 1.00 34.82 ? 407  PHE A CA  1 
ATOM   3156 C C   . PHE A 1 407 ? 16.563  56.087 49.878 1.00 35.38 ? 407  PHE A C   1 
ATOM   3157 O O   . PHE A 1 407 ? 16.506  55.740 48.700 1.00 33.78 ? 407  PHE A O   1 
ATOM   3158 C CB  . PHE A 1 407 ? 14.539  56.199 51.328 1.00 34.08 ? 407  PHE A CB  1 
ATOM   3159 C CG  . PHE A 1 407 ? 13.762  56.706 50.144 1.00 34.75 ? 407  PHE A CG  1 
ATOM   3160 C CD1 . PHE A 1 407 ? 12.839  55.887 49.485 1.00 36.13 ? 407  PHE A CD1 1 
ATOM   3161 C CD2 . PHE A 1 407 ? 13.959  57.991 49.677 1.00 34.23 ? 407  PHE A CD2 1 
ATOM   3162 C CE1 . PHE A 1 407 ? 12.114  56.357 48.366 1.00 35.74 ? 407  PHE A CE1 1 
ATOM   3163 C CE2 . PHE A 1 407 ? 13.251  58.473 48.564 1.00 35.94 ? 407  PHE A CE2 1 
ATOM   3164 C CZ  . PHE A 1 407 ? 12.322  57.651 47.904 1.00 36.02 ? 407  PHE A CZ  1 
ATOM   3165 N N   . VAL A 1 408 ? 17.312  57.109 50.282 1.00 35.33 ? 408  VAL A N   1 
ATOM   3166 C CA  . VAL A 1 408 ? 18.028  57.884 49.291 1.00 38.49 ? 408  VAL A CA  1 
ATOM   3167 C C   . VAL A 1 408 ? 19.081  57.057 48.590 1.00 39.63 ? 408  VAL A C   1 
ATOM   3168 O O   . VAL A 1 408 ? 19.281  57.193 47.377 1.00 39.81 ? 408  VAL A O   1 
ATOM   3169 C CB  . VAL A 1 408 ? 18.670  59.160 49.891 1.00 38.83 ? 408  VAL A CB  1 
ATOM   3170 C CG1 . VAL A 1 408 ? 19.720  58.811 50.885 1.00 40.97 ? 408  VAL A CG1 1 
ATOM   3171 C CG2 . VAL A 1 408 ? 19.289  59.983 48.782 1.00 44.47 ? 408  VAL A CG2 1 
ATOM   3172 N N   . ASN A 1 409 ? 19.745  56.184 49.334 1.00 40.11 ? 409  ASN A N   1 
ATOM   3173 C CA  . ASN A 1 409 ? 20.758  55.363 48.718 1.00 41.03 ? 409  ASN A CA  1 
ATOM   3174 C C   . ASN A 1 409 ? 20.106  54.333 47.778 1.00 41.39 ? 409  ASN A C   1 
ATOM   3175 O O   . ASN A 1 409 ? 20.580  54.126 46.657 1.00 40.81 ? 409  ASN A O   1 
ATOM   3176 C CB  . ASN A 1 409 ? 21.647  54.741 49.800 1.00 41.79 ? 409  ASN A CB  1 
ATOM   3177 C CG  . ASN A 1 409 ? 22.849  55.662 50.167 1.00 45.28 ? 409  ASN A CG  1 
ATOM   3178 O OD1 . ASN A 1 409 ? 23.710  55.930 49.320 1.00 50.45 ? 409  ASN A OD1 1 
ATOM   3179 N ND2 . ASN A 1 409 ? 22.904  56.142 51.411 1.00 43.06 ? 409  ASN A ND2 1 
ATOM   3180 N N   . LYS A 1 410 ? 18.998  53.728 48.185 1.00 39.84 ? 410  LYS A N   1 
ATOM   3181 C CA  . LYS A 1 410 ? 18.332  52.772 47.299 1.00 41.53 ? 410  LYS A CA  1 
ATOM   3182 C C   . LYS A 1 410 ? 17.804  53.466 46.021 1.00 41.32 ? 410  LYS A C   1 
ATOM   3183 O O   . LYS A 1 410 ? 17.962  52.956 44.895 1.00 40.56 ? 410  LYS A O   1 
ATOM   3184 C CB  . LYS A 1 410 ? 17.166  52.100 48.026 1.00 42.23 ? 410  LYS A CB  1 
ATOM   3185 C CG  . LYS A 1 410 ? 17.596  51.107 49.071 1.00 43.88 ? 410  LYS A CG  1 
ATOM   3186 C CD  . LYS A 1 410 ? 18.265  49.918 48.417 1.00 46.00 ? 410  LYS A CD  1 
ATOM   3187 C CE  . LYS A 1 410 ? 18.818  48.950 49.430 1.00 48.83 ? 410  LYS A CE  1 
ATOM   3188 N NZ  . LYS A 1 410 ? 19.604  47.880 48.740 1.00 50.30 ? 410  LYS A NZ  1 
ATOM   3189 N N   . TYR A 1 411 ? 17.208  54.642 46.213 1.00 39.90 ? 411  TYR A N   1 
ATOM   3190 C CA  . TYR A 1 411 ? 16.639  55.427 45.128 1.00 38.69 ? 411  TYR A CA  1 
ATOM   3191 C C   . TYR A 1 411 ? 17.674  55.911 44.132 1.00 38.74 ? 411  TYR A C   1 
ATOM   3192 O O   . TYR A 1 411 ? 17.509  55.768 42.932 1.00 39.91 ? 411  TYR A O   1 
ATOM   3193 C CB  . TYR A 1 411 ? 15.895  56.658 45.672 1.00 36.17 ? 411  TYR A CB  1 
ATOM   3194 C CG  . TYR A 1 411 ? 15.057  57.320 44.604 1.00 34.62 ? 411  TYR A CG  1 
ATOM   3195 C CD1 . TYR A 1 411 ? 13.780  56.841 44.319 1.00 32.57 ? 411  TYR A CD1 1 
ATOM   3196 C CD2 . TYR A 1 411 ? 15.584  58.336 43.795 1.00 33.96 ? 411  TYR A CD2 1 
ATOM   3197 C CE1 . TYR A 1 411 ? 13.044  57.328 43.257 1.00 34.97 ? 411  TYR A CE1 1 
ATOM   3198 C CE2 . TYR A 1 411 ? 14.863  58.840 42.722 1.00 32.59 ? 411  TYR A CE2 1 
ATOM   3199 C CZ  . TYR A 1 411 ? 13.583  58.322 42.452 1.00 36.45 ? 411  TYR A CZ  1 
ATOM   3200 O OH  . TYR A 1 411 ? 12.842  58.741 41.365 1.00 36.38 ? 411  TYR A OH  1 
ATOM   3201 N N   . THR A 1 412 ? 18.742  56.492 44.641 1.00 39.52 ? 412  THR A N   1 
ATOM   3202 C CA  . THR A 1 412 ? 19.781  57.030 43.785 1.00 40.46 ? 412  THR A CA  1 
ATOM   3203 C C   . THR A 1 412 ? 20.375  56.003 42.815 1.00 41.51 ? 412  THR A C   1 
ATOM   3204 O O   . THR A 1 412 ? 20.829  56.378 41.740 1.00 42.54 ? 412  THR A O   1 
ATOM   3205 C CB  . THR A 1 412 ? 20.861  57.712 44.654 1.00 40.23 ? 412  THR A CB  1 
ATOM   3206 O OG1 . THR A 1 412 ? 20.263  58.836 45.313 1.00 41.36 ? 412  THR A OG1 1 
ATOM   3207 C CG2 . THR A 1 412 ? 22.042  58.183 43.829 1.00 39.27 ? 412  THR A CG2 1 
ATOM   3208 N N   . LYS A 1 413 ? 20.355  54.718 43.159 1.00 41.96 ? 413  LYS A N   1 
ATOM   3209 C CA  . LYS A 1 413 ? 20.881  53.726 42.231 1.00 43.08 ? 413  LYS A CA  1 
ATOM   3210 C C   . LYS A 1 413 ? 20.060  53.752 40.933 1.00 44.45 ? 413  LYS A C   1 
ATOM   3211 O O   . LYS A 1 413 ? 20.602  53.485 39.857 1.00 44.96 ? 413  LYS A O   1 
ATOM   3212 C CB  . LYS A 1 413 ? 20.822  52.303 42.818 1.00 44.49 ? 413  LYS A CB  1 
ATOM   3213 C CG  . LYS A 1 413 ? 21.891  51.977 43.876 1.00 44.34 ? 413  LYS A CG  1 
ATOM   3214 N N   . PHE A 1 414 ? 18.764  54.066 41.019 1.00 42.21 ? 414  PHE A N   1 
ATOM   3215 C CA  . PHE A 1 414 ? 17.920  54.074 39.817 1.00 41.18 ? 414  PHE A CA  1 
ATOM   3216 C C   . PHE A 1 414 ? 17.346  55.437 39.393 1.00 41.70 ? 414  PHE A C   1 
ATOM   3217 O O   . PHE A 1 414 ? 16.797  55.560 38.305 1.00 42.10 ? 414  PHE A O   1 
ATOM   3218 C CB  . PHE A 1 414 ? 16.735  53.133 40.007 1.00 40.60 ? 414  PHE A CB  1 
ATOM   3219 C CG  . PHE A 1 414 ? 17.106  51.697 40.155 1.00 42.04 ? 414  PHE A CG  1 
ATOM   3220 C CD1 . PHE A 1 414 ? 17.250  50.882 39.034 1.00 42.22 ? 414  PHE A CD1 1 
ATOM   3221 C CD2 . PHE A 1 414 ? 17.294  51.148 41.418 1.00 40.76 ? 414  PHE A CD2 1 
ATOM   3222 C CE1 . PHE A 1 414 ? 17.579  49.524 39.182 1.00 44.04 ? 414  PHE A CE1 1 
ATOM   3223 C CE2 . PHE A 1 414 ? 17.619  49.814 41.583 1.00 41.70 ? 414  PHE A CE2 1 
ATOM   3224 C CZ  . PHE A 1 414 ? 17.765  48.991 40.464 1.00 44.48 ? 414  PHE A CZ  1 
ATOM   3225 N N   . GLY A 1 415 ? 17.457  56.453 40.243 1.00 41.29 ? 415  GLY A N   1 
ATOM   3226 C CA  . GLY A 1 415 ? 16.888  57.744 39.907 1.00 40.53 ? 415  GLY A CA  1 
ATOM   3227 C C   . GLY A 1 415 ? 17.613  58.583 38.881 1.00 40.22 ? 415  GLY A C   1 
ATOM   3228 O O   . GLY A 1 415 ? 18.655  58.204 38.355 1.00 39.33 ? 415  GLY A O   1 
ATOM   3229 N N   . ASN A 1 416 ? 17.046  59.751 38.616 1.00 41.08 ? 416  ASN A N   1 
ATOM   3230 C CA  . ASN A 1 416 ? 17.607  60.672 37.634 1.00 42.26 ? 416  ASN A CA  1 
ATOM   3231 C C   . ASN A 1 416 ? 18.177  61.956 38.241 1.00 40.74 ? 416  ASN A C   1 
ATOM   3232 O O   . ASN A 1 416 ? 18.395  62.931 37.533 1.00 40.92 ? 416  ASN A O   1 
ATOM   3233 C CB  . ASN A 1 416 ? 16.542  61.009 36.566 1.00 44.74 ? 416  ASN A CB  1 
ATOM   3234 C CG  . ASN A 1 416 ? 17.113  61.816 35.398 1.00 48.19 ? 416  ASN A CG  1 
ATOM   3235 O OD1 . ASN A 1 416 ? 16.684  62.946 35.139 1.00 47.41 ? 416  ASN A OD1 1 
ATOM   3236 N ND2 . ASN A 1 416 ? 18.082  61.232 34.697 1.00 50.52 ? 416  ASN A ND2 1 
ATOM   3237 N N   . GLY A 1 417 ? 18.438  61.949 39.549 1.00 40.22 ? 417  GLY A N   1 
ATOM   3238 C CA  . GLY A 1 417 ? 19.008  63.122 40.197 1.00 38.25 ? 417  GLY A CA  1 
ATOM   3239 C C   . GLY A 1 417 ? 18.547  63.264 41.637 1.00 38.68 ? 417  GLY A C   1 
ATOM   3240 O O   . GLY A 1 417 ? 17.351  63.302 41.886 1.00 36.72 ? 417  GLY A O   1 
ATOM   3241 N N   . THR A 1 418 ? 19.496  63.346 42.573 1.00 37.78 ? 418  THR A N   1 
ATOM   3242 C CA  . THR A 1 418 ? 19.187  63.466 43.985 1.00 38.52 ? 418  THR A CA  1 
ATOM   3243 C C   . THR A 1 418 ? 19.940  64.640 44.609 1.00 39.35 ? 418  THR A C   1 
ATOM   3244 O O   . THR A 1 418 ? 21.138  64.828 44.339 1.00 38.34 ? 418  THR A O   1 
ATOM   3245 C CB  . THR A 1 418 ? 19.606  62.181 44.763 1.00 40.68 ? 418  THR A CB  1 
ATOM   3246 O OG1 . THR A 1 418 ? 18.953  61.027 44.207 1.00 37.49 ? 418  THR A OG1 1 
ATOM   3247 C CG2 . THR A 1 418 ? 19.252  62.324 46.250 1.00 38.16 ? 418  THR A CG2 1 
ATOM   3248 N N   . TYR A 1 419 ? 19.233  65.420 45.435 1.00 38.17 ? 419  TYR A N   1 
ATOM   3249 C CA  . TYR A 1 419 ? 19.820  66.550 46.147 1.00 37.88 ? 419  TYR A CA  1 
ATOM   3250 C C   . TYR A 1 419 ? 19.429  66.409 47.618 1.00 38.84 ? 419  TYR A C   1 
ATOM   3251 O O   . TYR A 1 419 ? 18.249  66.452 47.964 1.00 39.14 ? 419  TYR A O   1 
ATOM   3252 C CB  . TYR A 1 419 ? 19.312  67.881 45.584 1.00 38.30 ? 419  TYR A CB  1 
ATOM   3253 C CG  . TYR A 1 419 ? 19.772  68.131 44.169 1.00 40.18 ? 419  TYR A CG  1 
ATOM   3254 C CD1 . TYR A 1 419 ? 21.002  68.741 43.911 1.00 41.08 ? 419  TYR A CD1 1 
ATOM   3255 C CD2 . TYR A 1 419 ? 19.015  67.685 43.083 1.00 38.65 ? 419  TYR A CD2 1 
ATOM   3256 C CE1 . TYR A 1 419 ? 21.468  68.890 42.605 1.00 40.45 ? 419  TYR A CE1 1 
ATOM   3257 C CE2 . TYR A 1 419 ? 19.467  67.829 41.791 1.00 39.72 ? 419  TYR A CE2 1 
ATOM   3258 C CZ  . TYR A 1 419 ? 20.696  68.430 41.555 1.00 40.62 ? 419  TYR A CZ  1 
ATOM   3259 O OH  . TYR A 1 419 ? 21.155  68.549 40.262 1.00 42.79 ? 419  TYR A OH  1 
ATOM   3260 N N   . LEU A 1 420 ? 20.440  66.259 48.474 1.00 38.51 ? 420  LEU A N   1 
ATOM   3261 C CA  . LEU A 1 420 ? 20.252  66.055 49.902 1.00 36.32 ? 420  LEU A CA  1 
ATOM   3262 C C   . LEU A 1 420 ? 20.677  67.235 50.769 1.00 37.01 ? 420  LEU A C   1 
ATOM   3263 O O   . LEU A 1 420 ? 21.716  67.852 50.523 1.00 38.89 ? 420  LEU A O   1 
ATOM   3264 C CB  . LEU A 1 420 ? 21.029  64.804 50.310 1.00 33.37 ? 420  LEU A CB  1 
ATOM   3265 C CG  . LEU A 1 420 ? 20.941  64.355 51.770 1.00 37.07 ? 420  LEU A CG  1 
ATOM   3266 C CD1 . LEU A 1 420 ? 19.477  64.005 52.100 1.00 34.80 ? 420  LEU A CD1 1 
ATOM   3267 C CD2 . LEU A 1 420 ? 21.877  63.147 52.004 1.00 33.86 ? 420  LEU A CD2 1 
ATOM   3268 N N   . TYR A 1 421 ? 19.878  67.559 51.785 1.00 35.62 ? 421  TYR A N   1 
ATOM   3269 C CA  . TYR A 1 421 ? 20.223  68.667 52.693 1.00 35.89 ? 421  TYR A CA  1 
ATOM   3270 C C   . TYR A 1 421 ? 20.123  68.279 54.174 1.00 36.63 ? 421  TYR A C   1 
ATOM   3271 O O   . TYR A 1 421 ? 19.458  67.303 54.532 1.00 34.82 ? 421  TYR A O   1 
ATOM   3272 C CB  . TYR A 1 421 ? 19.304  69.878 52.470 1.00 34.27 ? 421  TYR A CB  1 
ATOM   3273 C CG  . TYR A 1 421 ? 17.887  69.662 52.947 1.00 34.13 ? 421  TYR A CG  1 
ATOM   3274 C CD1 . TYR A 1 421 ? 17.567  69.747 54.305 1.00 34.45 ? 421  TYR A CD1 1 
ATOM   3275 C CD2 . TYR A 1 421 ? 16.862  69.352 52.039 1.00 32.65 ? 421  TYR A CD2 1 
ATOM   3276 C CE1 . TYR A 1 421 ? 16.246  69.526 54.764 1.00 35.20 ? 421  TYR A CE1 1 
ATOM   3277 C CE2 . TYR A 1 421 ? 15.559  69.132 52.466 1.00 31.75 ? 421  TYR A CE2 1 
ATOM   3278 C CZ  . TYR A 1 421 ? 15.252  69.217 53.835 1.00 34.49 ? 421  TYR A CZ  1 
ATOM   3279 O OH  . TYR A 1 421 ? 13.976  68.967 54.279 1.00 33.21 ? 421  TYR A OH  1 
ATOM   3280 N N   . PHE A 1 422 ? 20.751  69.094 55.018 1.00 36.14 ? 422  PHE A N   1 
ATOM   3281 C CA  . PHE A 1 422 ? 20.745  68.918 56.456 1.00 35.92 ? 422  PHE A CA  1 
ATOM   3282 C C   . PHE A 1 422 ? 20.442  70.297 57.022 1.00 38.12 ? 422  PHE A C   1 
ATOM   3283 O O   . PHE A 1 422 ? 21.305  71.191 57.021 1.00 39.25 ? 422  PHE A O   1 
ATOM   3284 C CB  . PHE A 1 422 ? 22.114  68.446 56.943 1.00 37.04 ? 422  PHE A CB  1 
ATOM   3285 C CG  . PHE A 1 422 ? 22.179  68.201 58.431 1.00 38.23 ? 422  PHE A CG  1 
ATOM   3286 C CD1 . PHE A 1 422 ? 21.545  67.098 58.993 1.00 39.63 ? 422  PHE A CD1 1 
ATOM   3287 C CD2 . PHE A 1 422 ? 22.876  69.075 59.267 1.00 37.20 ? 422  PHE A CD2 1 
ATOM   3288 C CE1 . PHE A 1 422 ? 21.601  66.856 60.391 1.00 40.58 ? 422  PHE A CE1 1 
ATOM   3289 C CE2 . PHE A 1 422 ? 22.945  68.855 60.644 1.00 38.85 ? 422  PHE A CE2 1 
ATOM   3290 C CZ  . PHE A 1 422 ? 22.306  67.739 61.218 1.00 39.31 ? 422  PHE A CZ  1 
ATOM   3291 N N   . PHE A 1 423 ? 19.208  70.471 57.481 1.00 36.87 ? 423  PHE A N   1 
ATOM   3292 C CA  . PHE A 1 423 ? 18.741  71.733 58.034 1.00 36.16 ? 423  PHE A CA  1 
ATOM   3293 C C   . PHE A 1 423 ? 19.095  71.832 59.524 1.00 37.38 ? 423  PHE A C   1 
ATOM   3294 O O   . PHE A 1 423 ? 18.557  71.073 60.353 1.00 38.97 ? 423  PHE A O   1 
ATOM   3295 C CB  . PHE A 1 423 ? 17.222  71.829 57.835 1.00 34.68 ? 423  PHE A CB  1 
ATOM   3296 C CG  . PHE A 1 423 ? 16.628  73.095 58.348 1.00 34.93 ? 423  PHE A CG  1 
ATOM   3297 C CD1 . PHE A 1 423 ? 16.688  74.263 57.591 1.00 34.63 ? 423  PHE A CD1 1 
ATOM   3298 C CD2 . PHE A 1 423 ? 16.029  73.135 59.609 1.00 33.05 ? 423  PHE A CD2 1 
ATOM   3299 C CE1 . PHE A 1 423 ? 16.154  75.465 58.092 1.00 35.36 ? 423  PHE A CE1 1 
ATOM   3300 C CE2 . PHE A 1 423 ? 15.496  74.317 60.119 1.00 32.01 ? 423  PHE A CE2 1 
ATOM   3301 C CZ  . PHE A 1 423 ? 15.556  75.485 59.361 1.00 34.72 ? 423  PHE A CZ  1 
ATOM   3302 N N   . ASN A 1 424 ? 19.973  72.774 59.878 1.00 37.33 ? 424  ASN A N   1 
ATOM   3303 C CA  . ASN A 1 424 ? 20.380  72.907 61.274 1.00 38.74 ? 424  ASN A CA  1 
ATOM   3304 C C   . ASN A 1 424 ? 20.391  74.322 61.828 1.00 39.32 ? 424  ASN A C   1 
ATOM   3305 O O   . ASN A 1 424 ? 21.288  74.698 62.591 1.00 39.92 ? 424  ASN A O   1 
ATOM   3306 C CB  . ASN A 1 424 ? 21.748  72.230 61.522 1.00 37.63 ? 424  ASN A CB  1 
ATOM   3307 C CG  . ASN A 1 424 ? 22.877  72.833 60.688 1.00 39.70 ? 424  ASN A CG  1 
ATOM   3308 O OD1 . ASN A 1 424 ? 22.651  73.675 59.822 1.00 39.44 ? 424  ASN A OD1 1 
ATOM   3309 N ND2 . ASN A 1 424 ? 24.103  72.384 60.941 1.00 39.42 ? 424  ASN A ND2 1 
ATOM   3310 N N   . HIS A 1 425 ? 19.388  75.109 61.467 1.00 38.58 ? 425  HIS A N   1 
ATOM   3311 C CA  . HIS A 1 425 ? 19.316  76.450 62.008 1.00 39.14 ? 425  HIS A CA  1 
ATOM   3312 C C   . HIS A 1 425 ? 18.162  76.529 62.997 1.00 39.94 ? 425  HIS A C   1 
ATOM   3313 O O   . HIS A 1 425 ? 17.018  76.213 62.656 1.00 39.50 ? 425  HIS A O   1 
ATOM   3314 C CB  . HIS A 1 425 ? 19.080  77.497 60.916 1.00 39.74 ? 425  HIS A CB  1 
ATOM   3315 C CG  . HIS A 1 425 ? 18.837  78.873 61.456 1.00 40.32 ? 425  HIS A CG  1 
ATOM   3316 N ND1 . HIS A 1 425 ? 19.851  79.671 61.940 1.00 40.89 ? 425  HIS A ND1 1 
ATOM   3317 C CD2 . HIS A 1 425 ? 17.687  79.558 61.679 1.00 42.85 ? 425  HIS A CD2 1 
ATOM   3318 C CE1 . HIS A 1 425 ? 19.341  80.784 62.443 1.00 41.67 ? 425  HIS A CE1 1 
ATOM   3319 N NE2 . HIS A 1 425 ? 18.028  80.741 62.299 1.00 43.41 ? 425  HIS A NE2 1 
ATOM   3320 N N   . ARG A 1 426 ? 18.456  76.941 64.225 1.00 39.55 ? 426  ARG A N   1 
ATOM   3321 C CA  . ARG A 1 426 ? 17.396  77.101 65.212 1.00 41.14 ? 426  ARG A CA  1 
ATOM   3322 C C   . ARG A 1 426 ? 16.892  78.545 65.102 1.00 40.75 ? 426  ARG A C   1 
ATOM   3323 O O   . ARG A 1 426 ? 17.666  79.488 65.267 1.00 41.36 ? 426  ARG A O   1 
ATOM   3324 C CB  . ARG A 1 426 ? 17.893  76.850 66.637 1.00 41.04 ? 426  ARG A CB  1 
ATOM   3325 C CG  . ARG A 1 426 ? 16.741  76.977 67.646 1.00 41.98 ? 426  ARG A CG  1 
ATOM   3326 C CD  . ARG A 1 426 ? 17.191  76.759 69.044 1.00 41.92 ? 426  ARG A CD  1 
ATOM   3327 N NE  . ARG A 1 426 ? 16.246  77.273 70.027 1.00 44.97 ? 426  ARG A NE  1 
ATOM   3328 C CZ  . ARG A 1 426 ? 15.321  76.546 70.646 1.00 45.77 ? 426  ARG A CZ  1 
ATOM   3329 N NH1 . ARG A 1 426 ? 15.184  75.239 70.384 1.00 44.60 ? 426  ARG A NH1 1 
ATOM   3330 N NH2 . ARG A 1 426 ? 14.552  77.126 71.560 1.00 46.17 ? 426  ARG A NH2 1 
ATOM   3331 N N   . ALA A 1 427 ? 15.600  78.701 64.830 1.00 40.44 ? 427  ALA A N   1 
ATOM   3332 C CA  . ALA A 1 427 ? 14.984  80.012 64.665 1.00 41.51 ? 427  ALA A CA  1 
ATOM   3333 C C   . ALA A 1 427 ? 15.108  80.866 65.919 1.00 43.05 ? 427  ALA A C   1 
ATOM   3334 O O   . ALA A 1 427 ? 14.871  80.401 67.040 1.00 43.27 ? 427  ALA A O   1 
ATOM   3335 C CB  . ALA A 1 427 ? 13.520  79.865 64.278 1.00 39.11 ? 427  ALA A CB  1 
ATOM   3336 N N   . SER A 1 428 ? 15.473  82.127 65.706 1.00 43.69 ? 428  SER A N   1 
ATOM   3337 C CA  . SER A 1 428 ? 15.665  83.089 66.792 1.00 45.39 ? 428  SER A CA  1 
ATOM   3338 C C   . SER A 1 428 ? 14.392  83.327 67.600 1.00 45.47 ? 428  SER A C   1 
ATOM   3339 O O   . SER A 1 428 ? 14.465  83.627 68.796 1.00 44.24 ? 428  SER A O   1 
ATOM   3340 C CB  . SER A 1 428 ? 16.168  84.427 66.226 1.00 44.27 ? 428  SER A CB  1 
ATOM   3341 O OG  . SER A 1 428 ? 15.242  84.913 65.260 1.00 44.47 ? 428  SER A OG  1 
ATOM   3342 N N   . ASN A 1 429 ? 13.234  83.177 66.959 1.00 45.22 ? 429  ASN A N   1 
ATOM   3343 C CA  . ASN A 1 429 ? 11.971  83.411 67.652 1.00 45.88 ? 429  ASN A CA  1 
ATOM   3344 C C   . ASN A 1 429 ? 11.277  82.136 68.104 1.00 45.99 ? 429  ASN A C   1 
ATOM   3345 O O   . ASN A 1 429 ? 10.063  82.138 68.330 1.00 45.12 ? 429  ASN A O   1 
ATOM   3346 C CB  . ASN A 1 429 ? 11.010  84.189 66.751 1.00 45.21 ? 429  ASN A CB  1 
ATOM   3347 C CG  . ASN A 1 429 ? 10.872  83.551 65.381 1.00 47.15 ? 429  ASN A CG  1 
ATOM   3348 O OD1 . ASN A 1 429 ? 11.283  82.402 65.180 1.00 44.07 ? 429  ASN A OD1 1 
ATOM   3349 N ND2 . ASN A 1 429 ? 10.292  84.293 64.426 1.00 46.03 ? 429  ASN A ND2 1 
ATOM   3350 N N   . LEU A 1 430 ? 12.032  81.054 68.249 1.00 46.19 ? 430  LEU A N   1 
ATOM   3351 C CA  . LEU A 1 430 ? 11.438  79.781 68.656 1.00 45.85 ? 430  LEU A CA  1 
ATOM   3352 C C   . LEU A 1 430 ? 10.956  79.832 70.121 1.00 45.63 ? 430  LEU A C   1 
ATOM   3353 O O   . LEU A 1 430 ? 11.695  80.282 71.001 1.00 45.29 ? 430  LEU A O   1 
ATOM   3354 C CB  . LEU A 1 430 ? 12.473  78.679 68.475 1.00 46.17 ? 430  LEU A CB  1 
ATOM   3355 C CG  . LEU A 1 430 ? 11.940  77.272 68.253 1.00 49.36 ? 430  LEU A CG  1 
ATOM   3356 C CD1 . LEU A 1 430 ? 11.471  77.130 66.820 1.00 48.60 ? 430  LEU A CD1 1 
ATOM   3357 C CD2 . LEU A 1 430 ? 13.036  76.255 68.548 1.00 50.07 ? 430  LEU A CD2 1 
ATOM   3358 N N   . VAL A 1 431 ? 9.722   79.391 70.383 1.00 43.74 ? 431  VAL A N   1 
ATOM   3359 C CA  . VAL A 1 431 ? 9.187   79.411 71.751 1.00 43.15 ? 431  VAL A CA  1 
ATOM   3360 C C   . VAL A 1 431 ? 9.435   78.105 72.516 1.00 43.40 ? 431  VAL A C   1 
ATOM   3361 O O   . VAL A 1 431 ? 9.219   78.030 73.735 1.00 42.74 ? 431  VAL A O   1 
ATOM   3362 C CB  . VAL A 1 431 ? 7.653   79.731 71.769 1.00 44.48 ? 431  VAL A CB  1 
ATOM   3363 C CG1 . VAL A 1 431 ? 7.405   81.127 71.189 1.00 42.91 ? 431  VAL A CG1 1 
ATOM   3364 C CG2 . VAL A 1 431 ? 6.875   78.685 70.968 1.00 43.67 ? 431  VAL A CG2 1 
ATOM   3365 N N   . TRP A 1 432 ? 9.891   77.078 71.799 1.00 41.41 ? 432  TRP A N   1 
ATOM   3366 C CA  . TRP A 1 432 ? 10.195  75.793 72.421 1.00 38.71 ? 432  TRP A CA  1 
ATOM   3367 C C   . TRP A 1 432 ? 11.532  75.928 73.153 1.00 38.33 ? 432  TRP A C   1 
ATOM   3368 O O   . TRP A 1 432 ? 12.369  76.749 72.774 1.00 38.26 ? 432  TRP A O   1 
ATOM   3369 C CB  . TRP A 1 432 ? 10.250  74.681 71.354 1.00 36.37 ? 432  TRP A CB  1 
ATOM   3370 C CG  . TRP A 1 432 ? 8.878   74.335 70.792 1.00 33.86 ? 432  TRP A CG  1 
ATOM   3371 C CD1 . TRP A 1 432 ? 8.361   74.716 69.581 1.00 32.88 ? 432  TRP A CD1 1 
ATOM   3372 C CD2 . TRP A 1 432 ? 7.858   73.551 71.430 1.00 32.99 ? 432  TRP A CD2 1 
ATOM   3373 N NE1 . TRP A 1 432 ? 7.088   74.211 69.424 1.00 32.49 ? 432  TRP A NE1 1 
ATOM   3374 C CE2 . TRP A 1 432 ? 6.750   73.496 70.541 1.00 34.19 ? 432  TRP A CE2 1 
ATOM   3375 C CE3 . TRP A 1 432 ? 7.769   72.892 72.660 1.00 32.93 ? 432  TRP A CE3 1 
ATOM   3376 C CZ2 . TRP A 1 432 ? 5.566   72.801 70.847 1.00 34.94 ? 432  TRP A CZ2 1 
ATOM   3377 C CZ3 . TRP A 1 432 ? 6.588   72.192 72.971 1.00 34.93 ? 432  TRP A CZ3 1 
ATOM   3378 C CH2 . TRP A 1 432 ? 5.505   72.157 72.063 1.00 36.67 ? 432  TRP A CH2 1 
ATOM   3379 N N   . PRO A 1 433 ? 11.743  75.137 74.223 1.00 37.52 ? 433  PRO A N   1 
ATOM   3380 C CA  . PRO A 1 433 ? 13.005  75.227 74.968 1.00 37.39 ? 433  PRO A CA  1 
ATOM   3381 C C   . PRO A 1 433 ? 14.208  74.938 74.090 1.00 39.20 ? 433  PRO A C   1 
ATOM   3382 O O   . PRO A 1 433 ? 14.108  74.199 73.108 1.00 39.10 ? 433  PRO A O   1 
ATOM   3383 C CB  . PRO A 1 433 ? 12.838  74.187 76.081 1.00 37.50 ? 433  PRO A CB  1 
ATOM   3384 C CG  . PRO A 1 433 ? 11.904  73.161 75.451 1.00 36.26 ? 433  PRO A CG  1 
ATOM   3385 C CD  . PRO A 1 433 ? 10.893  74.051 74.750 1.00 36.20 ? 433  PRO A CD  1 
ATOM   3386 N N   . GLU A 1 434 ? 15.344  75.516 74.464 1.00 40.10 ? 434  GLU A N   1 
ATOM   3387 C CA  . GLU A 1 434 ? 16.591  75.345 73.725 1.00 42.31 ? 434  GLU A CA  1 
ATOM   3388 C C   . GLU A 1 434 ? 17.064  73.892 73.609 1.00 41.06 ? 434  GLU A C   1 
ATOM   3389 O O   . GLU A 1 434 ? 17.651  73.496 72.589 1.00 41.12 ? 434  GLU A O   1 
ATOM   3390 C CB  . GLU A 1 434 ? 17.707  76.195 74.360 1.00 43.49 ? 434  GLU A CB  1 
ATOM   3391 C CG  . GLU A 1 434 ? 17.665  77.673 73.962 1.00 46.85 ? 434  GLU A CG  1 
ATOM   3392 N N   . TRP A 1 435 ? 16.805  73.092 74.638 1.00 39.76 ? 435  TRP A N   1 
ATOM   3393 C CA  . TRP A 1 435 ? 17.261  71.713 74.583 1.00 40.55 ? 435  TRP A CA  1 
ATOM   3394 C C   . TRP A 1 435 ? 16.673  70.942 73.385 1.00 39.28 ? 435  TRP A C   1 
ATOM   3395 O O   . TRP A 1 435 ? 17.242  69.940 72.962 1.00 38.55 ? 435  TRP A O   1 
ATOM   3396 C CB  . TRP A 1 435 ? 16.981  70.965 75.908 1.00 39.44 ? 435  TRP A CB  1 
ATOM   3397 C CG  . TRP A 1 435 ? 15.539  70.608 76.200 1.00 42.65 ? 435  TRP A CG  1 
ATOM   3398 C CD1 . TRP A 1 435 ? 14.679  71.282 77.018 1.00 43.69 ? 435  TRP A CD1 1 
ATOM   3399 C CD2 . TRP A 1 435 ? 14.802  69.473 75.694 1.00 42.93 ? 435  TRP A CD2 1 
ATOM   3400 N NE1 . TRP A 1 435 ? 13.457  70.641 77.060 1.00 45.07 ? 435  TRP A NE1 1 
ATOM   3401 C CE2 . TRP A 1 435 ? 13.503  69.533 76.255 1.00 41.98 ? 435  TRP A CE2 1 
ATOM   3402 C CE3 . TRP A 1 435 ? 15.118  68.418 74.819 1.00 42.41 ? 435  TRP A CE3 1 
ATOM   3403 C CZ2 . TRP A 1 435 ? 12.511  68.587 75.968 1.00 43.16 ? 435  TRP A CZ2 1 
ATOM   3404 C CZ3 . TRP A 1 435 ? 14.124  67.466 74.527 1.00 43.90 ? 435  TRP A CZ3 1 
ATOM   3405 C CH2 . TRP A 1 435 ? 12.833  67.562 75.103 1.00 43.55 ? 435  TRP A CH2 1 
ATOM   3406 N N   . MET A 1 436 ? 15.564  71.422 72.828 1.00 38.21 ? 436  MET A N   1 
ATOM   3407 C CA  . MET A 1 436 ? 14.952  70.739 71.689 1.00 38.19 ? 436  MET A CA  1 
ATOM   3408 C C   . MET A 1 436 ? 15.676  70.982 70.361 1.00 36.92 ? 436  MET A C   1 
ATOM   3409 O O   . MET A 1 436 ? 15.472  70.242 69.397 1.00 37.10 ? 436  MET A O   1 
ATOM   3410 C CB  . MET A 1 436 ? 13.465  71.092 71.600 1.00 35.89 ? 436  MET A CB  1 
ATOM   3411 C CG  . MET A 1 436 ? 12.672  70.475 72.766 1.00 35.67 ? 436  MET A CG  1 
ATOM   3412 S SD  . MET A 1 436 ? 10.978  71.043 72.879 1.00 37.87 ? 436  MET A SD  1 
ATOM   3413 C CE  . MET A 1 436 ? 10.168  69.932 71.688 1.00 33.82 ? 436  MET A CE  1 
ATOM   3414 N N   . GLY A 1 437 ? 16.549  71.986 70.323 1.00 36.39 ? 437  GLY A N   1 
ATOM   3415 C CA  . GLY A 1 437 ? 17.326  72.249 69.111 1.00 35.15 ? 437  GLY A CA  1 
ATOM   3416 C C   . GLY A 1 437 ? 16.568  72.592 67.834 1.00 34.39 ? 437  GLY A C   1 
ATOM   3417 O O   . GLY A 1 437 ? 15.642  73.393 67.849 1.00 34.86 ? 437  GLY A O   1 
ATOM   3418 N N   . VAL A 1 438 ? 16.984  71.994 66.725 1.00 33.14 ? 438  VAL A N   1 
ATOM   3419 C CA  . VAL A 1 438 ? 16.344  72.220 65.436 1.00 33.13 ? 438  VAL A CA  1 
ATOM   3420 C C   . VAL A 1 438 ? 15.290  71.099 65.314 1.00 33.47 ? 438  VAL A C   1 
ATOM   3421 O O   . VAL A 1 438 ? 15.543  69.983 64.829 1.00 31.74 ? 438  VAL A O   1 
ATOM   3422 C CB  . VAL A 1 438 ? 17.388  72.159 64.322 1.00 33.35 ? 438  VAL A CB  1 
ATOM   3423 C CG1 . VAL A 1 438 ? 16.764  72.553 62.981 1.00 32.82 ? 438  VAL A CG1 1 
ATOM   3424 C CG2 . VAL A 1 438 ? 18.557  73.084 64.684 1.00 32.52 ? 438  VAL A CG2 1 
ATOM   3425 N N   . ILE A 1 439 ? 14.106  71.455 65.794 1.00 31.22 ? 439  ILE A N   1 
ATOM   3426 C CA  . ILE A 1 439 ? 12.935  70.611 65.897 1.00 31.13 ? 439  ILE A CA  1 
ATOM   3427 C C   . ILE A 1 439 ? 12.246  70.113 64.627 1.00 32.49 ? 439  ILE A C   1 
ATOM   3428 O O   . ILE A 1 439 ? 12.222  70.784 63.576 1.00 31.97 ? 439  ILE A O   1 
ATOM   3429 C CB  . ILE A 1 439 ? 11.909  71.342 66.756 1.00 29.77 ? 439  ILE A CB  1 
ATOM   3430 C CG1 . ILE A 1 439 ? 12.574  71.717 68.097 1.00 30.67 ? 439  ILE A CG1 1 
ATOM   3431 C CG2 . ILE A 1 439 ? 10.677  70.509 66.954 1.00 29.15 ? 439  ILE A CG2 1 
ATOM   3432 C CD1 . ILE A 1 439 ? 11.778  72.645 68.935 1.00 27.07 ? 439  ILE A CD1 1 
ATOM   3433 N N   . HIS A 1 440 ? 11.678  68.919 64.770 1.00 31.62 ? 440  HIS A N   1 
ATOM   3434 C CA  . HIS A 1 440 ? 10.922  68.251 63.719 1.00 33.55 ? 440  HIS A CA  1 
ATOM   3435 C C   . HIS A 1 440 ? 9.827   69.210 63.269 1.00 33.82 ? 440  HIS A C   1 
ATOM   3436 O O   . HIS A 1 440 ? 9.047   69.679 64.084 1.00 35.34 ? 440  HIS A O   1 
ATOM   3437 C CB  . HIS A 1 440 ? 10.282  66.981 64.282 1.00 31.36 ? 440  HIS A CB  1 
ATOM   3438 C CG  . HIS A 1 440 ? 9.754   66.050 63.239 1.00 31.48 ? 440  HIS A CG  1 
ATOM   3439 N ND1 . HIS A 1 440 ? 10.510  65.637 62.164 1.00 30.78 ? 440  HIS A ND1 1 
ATOM   3440 C CD2 . HIS A 1 440 ? 8.568   65.396 63.142 1.00 31.45 ? 440  HIS A CD2 1 
ATOM   3441 C CE1 . HIS A 1 440 ? 9.817   64.765 61.451 1.00 30.29 ? 440  HIS A CE1 1 
ATOM   3442 N NE2 . HIS A 1 440 ? 8.637   64.599 62.023 1.00 31.24 ? 440  HIS A NE2 1 
ATOM   3443 N N   . GLY A 1 441 ? 9.778   69.499 61.978 1.00 34.03 ? 441  GLY A N   1 
ATOM   3444 C CA  . GLY A 1 441 ? 8.751   70.386 61.462 1.00 35.51 ? 441  GLY A CA  1 
ATOM   3445 C C   . GLY A 1 441 ? 9.143   71.852 61.412 1.00 36.57 ? 441  GLY A C   1 
ATOM   3446 O O   . GLY A 1 441 ? 8.433   72.667 60.821 1.00 36.46 ? 441  GLY A O   1 
ATOM   3447 N N   . TYR A 1 442 ? 10.278  72.213 61.998 1.00 36.06 ? 442  TYR A N   1 
ATOM   3448 C CA  . TYR A 1 442 ? 10.608  73.612 61.982 1.00 35.06 ? 442  TYR A CA  1 
ATOM   3449 C C   . TYR A 1 442 ? 11.374  74.183 60.808 1.00 36.08 ? 442  TYR A C   1 
ATOM   3450 O O   . TYR A 1 442 ? 11.777  75.345 60.840 1.00 38.62 ? 442  TYR A O   1 
ATOM   3451 C CB  . TYR A 1 442 ? 11.205  74.011 63.336 1.00 35.39 ? 442  TYR A CB  1 
ATOM   3452 C CG  . TYR A 1 442 ? 10.086  74.217 64.330 1.00 32.49 ? 442  TYR A CG  1 
ATOM   3453 C CD1 . TYR A 1 442 ? 9.456   73.123 64.949 1.00 34.37 ? 442  TYR A CD1 1 
ATOM   3454 C CD2 . TYR A 1 442 ? 9.541   75.487 64.529 1.00 33.86 ? 442  TYR A CD2 1 
ATOM   3455 C CE1 . TYR A 1 442 ? 8.292   73.299 65.744 1.00 32.82 ? 442  TYR A CE1 1 
ATOM   3456 C CE2 . TYR A 1 442 ? 8.378   75.672 65.305 1.00 31.95 ? 442  TYR A CE2 1 
ATOM   3457 C CZ  . TYR A 1 442 ? 7.763   74.575 65.902 1.00 32.45 ? 442  TYR A CZ  1 
ATOM   3458 O OH  . TYR A 1 442 ? 6.597   74.764 66.600 1.00 32.56 ? 442  TYR A OH  1 
ATOM   3459 N N   . GLU A 1 443 ? 11.552  73.390 59.752 1.00 34.42 ? 443  GLU A N   1 
ATOM   3460 C CA  . GLU A 1 443 ? 12.186  73.904 58.539 1.00 33.38 ? 443  GLU A CA  1 
ATOM   3461 C C   . GLU A 1 443 ? 11.012  74.386 57.657 1.00 34.04 ? 443  GLU A C   1 
ATOM   3462 O O   . GLU A 1 443 ? 11.182  75.192 56.743 1.00 33.34 ? 443  GLU A O   1 
ATOM   3463 C CB  . GLU A 1 443 ? 12.946  72.810 57.783 1.00 31.84 ? 443  GLU A CB  1 
ATOM   3464 C CG  . GLU A 1 443 ? 12.050  71.968 56.830 1.00 30.39 ? 443  GLU A CG  1 
ATOM   3465 C CD  . GLU A 1 443 ? 11.108  70.993 57.562 1.00 30.26 ? 443  GLU A CD  1 
ATOM   3466 O OE1 . GLU A 1 443 ? 11.169  70.891 58.803 1.00 29.44 ? 443  GLU A OE1 1 
ATOM   3467 O OE2 . GLU A 1 443 ? 10.312  70.312 56.889 1.00 28.92 ? 443  GLU A OE2 1 
ATOM   3468 N N   . ILE A 1 444 ? 9.814   73.890 57.945 1.00 34.05 ? 444  ILE A N   1 
ATOM   3469 C CA  . ILE A 1 444 ? 8.649   74.246 57.143 1.00 35.37 ? 444  ILE A CA  1 
ATOM   3470 C C   . ILE A 1 444 ? 8.438   75.764 56.999 1.00 36.83 ? 444  ILE A C   1 
ATOM   3471 O O   . ILE A 1 444 ? 8.281   76.281 55.887 1.00 36.64 ? 444  ILE A O   1 
ATOM   3472 C CB  . ILE A 1 444 ? 7.359   73.580 57.718 1.00 35.40 ? 444  ILE A CB  1 
ATOM   3473 C CG1 . ILE A 1 444 ? 7.470   72.045 57.634 1.00 34.05 ? 444  ILE A CG1 1 
ATOM   3474 C CG2 . ILE A 1 444 ? 6.110   74.075 56.936 1.00 32.57 ? 444  ILE A CG2 1 
ATOM   3475 C CD1 . ILE A 1 444 ? 6.284   71.309 58.286 1.00 30.44 ? 444  ILE A CD1 1 
ATOM   3476 N N   . GLU A 1 445 ? 8.457   76.473 58.124 1.00 37.52 ? 445  GLU A N   1 
ATOM   3477 C CA  . GLU A 1 445 ? 8.260   77.918 58.114 1.00 39.01 ? 445  GLU A CA  1 
ATOM   3478 C C   . GLU A 1 445 ? 9.239   78.643 57.188 1.00 38.62 ? 445  GLU A C   1 
ATOM   3479 O O   . GLU A 1 445 ? 8.912   79.696 56.640 1.00 37.62 ? 445  GLU A O   1 
ATOM   3480 C CB  . GLU A 1 445 ? 8.325   78.486 59.545 1.00 39.10 ? 445  GLU A CB  1 
ATOM   3481 C CG  . GLU A 1 445 ? 9.605   78.216 60.319 1.00 38.38 ? 445  GLU A CG  1 
ATOM   3482 C CD  . GLU A 1 445 ? 9.377   78.395 61.822 1.00 38.76 ? 445  GLU A CD  1 
ATOM   3483 O OE1 . GLU A 1 445 ? 8.412   77.789 62.354 1.00 36.91 ? 445  GLU A OE1 1 
ATOM   3484 O OE2 . GLU A 1 445 ? 10.151  79.136 62.466 1.00 37.69 ? 445  GLU A OE2 1 
ATOM   3485 N N   . PHE A 1 446 ? 10.427  78.077 57.001 1.00 37.90 ? 446  PHE A N   1 
ATOM   3486 C CA  . PHE A 1 446 ? 11.393  78.680 56.102 1.00 38.85 ? 446  PHE A CA  1 
ATOM   3487 C C   . PHE A 1 446 ? 11.027  78.310 54.666 1.00 40.73 ? 446  PHE A C   1 
ATOM   3488 O O   . PHE A 1 446 ? 11.194  79.132 53.739 1.00 39.26 ? 446  PHE A O   1 
ATOM   3489 C CB  . PHE A 1 446 ? 12.820  78.199 56.392 1.00 41.75 ? 446  PHE A CB  1 
ATOM   3490 C CG  . PHE A 1 446 ? 13.434  78.841 57.598 1.00 44.15 ? 446  PHE A CG  1 
ATOM   3491 C CD1 . PHE A 1 446 ? 13.136  78.375 58.884 1.00 44.32 ? 446  PHE A CD1 1 
ATOM   3492 C CD2 . PHE A 1 446 ? 14.251  79.971 57.456 1.00 44.35 ? 446  PHE A CD2 1 
ATOM   3493 C CE1 . PHE A 1 446 ? 13.638  79.033 60.028 1.00 44.30 ? 446  PHE A CE1 1 
ATOM   3494 C CE2 . PHE A 1 446 ? 14.758  80.640 58.583 1.00 44.24 ? 446  PHE A CE2 1 
ATOM   3495 C CZ  . PHE A 1 446 ? 14.449  80.170 59.874 1.00 44.41 ? 446  PHE A CZ  1 
ATOM   3496 N N   . VAL A 1 447 ? 10.540  77.077 54.476 1.00 39.35 ? 447  VAL A N   1 
ATOM   3497 C CA  . VAL A 1 447 ? 10.169  76.637 53.143 1.00 38.43 ? 447  VAL A CA  1 
ATOM   3498 C C   . VAL A 1 447 ? 8.985   77.485 52.675 1.00 38.58 ? 447  VAL A C   1 
ATOM   3499 O O   . VAL A 1 447 ? 8.918   77.866 51.501 1.00 35.76 ? 447  VAL A O   1 
ATOM   3500 C CB  . VAL A 1 447 ? 9.790   75.121 53.116 1.00 39.71 ? 447  VAL A CB  1 
ATOM   3501 C CG1 . VAL A 1 447 ? 9.108   74.765 51.787 1.00 37.93 ? 447  VAL A CG1 1 
ATOM   3502 C CG2 . VAL A 1 447 ? 11.051  74.258 53.295 1.00 36.26 ? 447  VAL A CG2 1 
ATOM   3503 N N   . PHE A 1 448 ? 8.067   77.802 53.592 1.00 37.60 ? 448  PHE A N   1 
ATOM   3504 C CA  . PHE A 1 448 ? 6.912   78.605 53.215 1.00 37.85 ? 448  PHE A CA  1 
ATOM   3505 C C   . PHE A 1 448 ? 7.151   80.128 53.302 1.00 39.33 ? 448  PHE A C   1 
ATOM   3506 O O   . PHE A 1 448 ? 6.233   80.931 53.109 1.00 38.38 ? 448  PHE A O   1 
ATOM   3507 C CB  . PHE A 1 448 ? 5.677   78.181 54.020 1.00 37.62 ? 448  PHE A CB  1 
ATOM   3508 C CG  . PHE A 1 448 ? 5.024   76.917 53.498 1.00 37.45 ? 448  PHE A CG  1 
ATOM   3509 C CD1 . PHE A 1 448 ? 5.654   75.669 53.649 1.00 34.64 ? 448  PHE A CD1 1 
ATOM   3510 C CD2 . PHE A 1 448 ? 3.805   76.979 52.803 1.00 36.62 ? 448  PHE A CD2 1 
ATOM   3511 C CE1 . PHE A 1 448 ? 5.081   74.499 53.109 1.00 34.89 ? 448  PHE A CE1 1 
ATOM   3512 C CE2 . PHE A 1 448 ? 3.221   75.813 52.252 1.00 37.91 ? 448  PHE A CE2 1 
ATOM   3513 C CZ  . PHE A 1 448 ? 3.864   74.574 52.406 1.00 36.78 ? 448  PHE A CZ  1 
ATOM   3514 N N   . GLY A 1 449 ? 8.392   80.512 53.588 1.00 40.08 ? 449  GLY A N   1 
ATOM   3515 C CA  . GLY A 1 449 ? 8.749   81.916 53.630 1.00 41.52 ? 449  GLY A CA  1 
ATOM   3516 C C   . GLY A 1 449 ? 8.201   82.851 54.693 1.00 42.98 ? 449  GLY A C   1 
ATOM   3517 O O   . GLY A 1 449 ? 8.167   84.063 54.464 1.00 43.20 ? 449  GLY A O   1 
ATOM   3518 N N   . LEU A 1 450 ? 7.782   82.338 55.846 1.00 43.39 ? 450  LEU A N   1 
ATOM   3519 C CA  . LEU A 1 450 ? 7.286   83.222 56.895 1.00 43.96 ? 450  LEU A CA  1 
ATOM   3520 C C   . LEU A 1 450 ? 8.335   84.244 57.369 1.00 45.82 ? 450  LEU A C   1 
ATOM   3521 O O   . LEU A 1 450 ? 7.980   85.322 57.844 1.00 46.96 ? 450  LEU A O   1 
ATOM   3522 C CB  . LEU A 1 450 ? 6.754   82.417 58.081 1.00 40.23 ? 450  LEU A CB  1 
ATOM   3523 C CG  . LEU A 1 450 ? 5.290   82.009 57.860 1.00 40.85 ? 450  LEU A CG  1 
ATOM   3524 C CD1 . LEU A 1 450 ? 5.239   81.033 56.702 1.00 40.69 ? 450  LEU A CD1 1 
ATOM   3525 C CD2 . LEU A 1 450 ? 4.701   81.370 59.097 1.00 38.88 ? 450  LEU A CD2 1 
ATOM   3526 N N   . PRO A 1 451 ? 9.638   83.920 57.253 1.00 47.65 ? 451  PRO A N   1 
ATOM   3527 C CA  . PRO A 1 451 ? 10.634  84.904 57.700 1.00 48.79 ? 451  PRO A CA  1 
ATOM   3528 C C   . PRO A 1 451 ? 10.587  86.227 56.925 1.00 50.38 ? 451  PRO A C   1 
ATOM   3529 O O   . PRO A 1 451 ? 11.129  87.238 57.387 1.00 51.14 ? 451  PRO A O   1 
ATOM   3530 C CB  . PRO A 1 451 ? 11.957  84.167 57.512 1.00 47.16 ? 451  PRO A CB  1 
ATOM   3531 C CG  . PRO A 1 451 ? 11.570  82.755 57.870 1.00 48.42 ? 451  PRO A CG  1 
ATOM   3532 C CD  . PRO A 1 451 ? 10.271  82.596 57.082 1.00 48.12 ? 451  PRO A CD  1 
ATOM   3533 N N   . LEU A 1 452 ? 9.954   86.219 55.753 1.00 50.39 ? 452  LEU A N   1 
ATOM   3534 C CA  . LEU A 1 452 ? 9.837   87.427 54.938 1.00 50.54 ? 452  LEU A CA  1 
ATOM   3535 C C   . LEU A 1 452 ? 8.822   88.397 55.526 1.00 51.89 ? 452  LEU A C   1 
ATOM   3536 O O   . LEU A 1 452 ? 8.757   89.546 55.102 1.00 53.14 ? 452  LEU A O   1 
ATOM   3537 C CB  . LEU A 1 452 ? 9.399   87.094 53.516 1.00 48.02 ? 452  LEU A CB  1 
ATOM   3538 C CG  . LEU A 1 452 ? 10.414  86.684 52.461 1.00 48.45 ? 452  LEU A CG  1 
ATOM   3539 C CD1 . LEU A 1 452 ? 11.190  85.420 52.882 1.00 46.66 ? 452  LEU A CD1 1 
ATOM   3540 C CD2 . LEU A 1 452 ? 9.630   86.455 51.147 1.00 46.94 ? 452  LEU A CD2 1 
ATOM   3541 N N   . VAL A 1 453 ? 8.029   87.931 56.488 1.00 53.10 ? 453  VAL A N   1 
ATOM   3542 C CA  . VAL A 1 453 ? 7.011   88.770 57.134 1.00 54.76 ? 453  VAL A CA  1 
ATOM   3543 C C   . VAL A 1 453 ? 7.580   89.470 58.382 1.00 56.29 ? 453  VAL A C   1 
ATOM   3544 O O   . VAL A 1 453 ? 7.800   88.843 59.420 1.00 55.48 ? 453  VAL A O   1 
ATOM   3545 C CB  . VAL A 1 453 ? 5.770   87.925 57.555 1.00 54.91 ? 453  VAL A CB  1 
ATOM   3546 C CG1 . VAL A 1 453 ? 4.766   88.802 58.274 1.00 53.60 ? 453  VAL A CG1 1 
ATOM   3547 C CG2 . VAL A 1 453 ? 5.125   87.271 56.320 1.00 54.09 ? 453  VAL A CG2 1 
ATOM   3548 N N   . LYS A 1 454 ? 7.803   90.776 58.262 1.00 58.58 ? 454  LYS A N   1 
ATOM   3549 C CA  . LYS A 1 454 ? 8.361   91.616 59.332 1.00 59.37 ? 454  LYS A CA  1 
ATOM   3550 C C   . LYS A 1 454 ? 7.809   91.377 60.744 1.00 58.45 ? 454  LYS A C   1 
ATOM   3551 O O   . LYS A 1 454 ? 8.564   91.169 61.691 1.00 56.98 ? 454  LYS A O   1 
ATOM   3552 C CB  . LYS A 1 454 ? 8.175   93.097 58.954 1.00 61.70 ? 454  LYS A CB  1 
ATOM   3553 C CG  . LYS A 1 454 ? 8.658   94.087 60.018 1.00 64.57 ? 454  LYS A CG  1 
ATOM   3554 N N   . GLU A 1 455 ? 6.491   91.421 60.879 1.00 58.72 ? 455  GLU A N   1 
ATOM   3555 C CA  . GLU A 1 455 ? 5.844   91.226 62.165 1.00 59.59 ? 455  GLU A CA  1 
ATOM   3556 C C   . GLU A 1 455 ? 6.198   89.886 62.795 1.00 59.53 ? 455  GLU A C   1 
ATOM   3557 O O   . GLU A 1 455 ? 5.985   89.681 63.989 1.00 59.41 ? 455  GLU A O   1 
ATOM   3558 C CB  . GLU A 1 455 ? 4.323   91.311 62.013 1.00 61.49 ? 455  GLU A CB  1 
ATOM   3559 C CG  . GLU A 1 455 ? 3.823   92.455 61.166 1.00 66.43 ? 455  GLU A CG  1 
ATOM   3560 C CD  . GLU A 1 455 ? 4.029   92.220 59.674 1.00 69.78 ? 455  GLU A CD  1 
ATOM   3561 O OE1 . GLU A 1 455 ? 5.178   92.339 59.186 1.00 71.38 ? 455  GLU A OE1 1 
ATOM   3562 O OE2 . GLU A 1 455 ? 3.033   91.905 58.983 1.00 71.85 ? 455  GLU A OE2 1 
ATOM   3563 N N   . LEU A 1 456 ? 6.723   88.960 62.002 1.00 58.95 ? 456  LEU A N   1 
ATOM   3564 C CA  . LEU A 1 456 ? 7.061   87.655 62.549 1.00 58.73 ? 456  LEU A CA  1 
ATOM   3565 C C   . LEU A 1 456 ? 8.366   87.636 63.330 1.00 58.78 ? 456  LEU A C   1 
ATOM   3566 O O   . LEU A 1 456 ? 8.713   86.626 63.937 1.00 60.33 ? 456  LEU A O   1 
ATOM   3567 C CB  . LEU A 1 456 ? 7.060   86.587 61.448 1.00 57.05 ? 456  LEU A CB  1 
ATOM   3568 C CG  . LEU A 1 456 ? 5.663   86.385 60.852 1.00 56.89 ? 456  LEU A CG  1 
ATOM   3569 C CD1 . LEU A 1 456 ? 5.650   85.140 59.956 1.00 55.37 ? 456  LEU A CD1 1 
ATOM   3570 C CD2 . LEU A 1 456 ? 4.637   86.267 61.989 1.00 51.68 ? 456  LEU A CD2 1 
ATOM   3571 N N   . ASN A 1 457 ? 9.095   88.744 63.303 1.00 58.61 ? 457  ASN A N   1 
ATOM   3572 C CA  . ASN A 1 457 ? 10.312  88.868 64.094 1.00 58.50 ? 457  ASN A CA  1 
ATOM   3573 C C   . ASN A 1 457 ? 11.518  88.009 63.740 1.00 57.57 ? 457  ASN A C   1 
ATOM   3574 O O   . ASN A 1 457 ? 12.245  87.616 64.649 1.00 58.51 ? 457  ASN A O   1 
ATOM   3575 C CB  . ASN A 1 457 ? 10.011  88.604 65.590 1.00 60.20 ? 457  ASN A CB  1 
ATOM   3576 C CG  . ASN A 1 457 ? 8.949   89.537 66.172 1.00 62.27 ? 457  ASN A CG  1 
ATOM   3577 O OD1 . ASN A 1 457 ? 8.879   90.711 65.819 1.00 62.82 ? 457  ASN A OD1 1 
ATOM   3578 N ND2 . ASN A 1 457 ? 8.131   89.012 67.092 1.00 62.82 ? 457  ASN A ND2 1 
ATOM   3579 N N   . TYR A 1 458 ? 11.758  87.678 62.479 1.00 54.86 ? 458  TYR A N   1 
ATOM   3580 C CA  . TYR A 1 458 ? 12.959  86.877 62.195 1.00 52.16 ? 458  TYR A CA  1 
ATOM   3581 C C   . TYR A 1 458 ? 14.108  87.851 61.906 1.00 52.00 ? 458  TYR A C   1 
ATOM   3582 O O   . TYR A 1 458 ? 13.890  89.041 61.689 1.00 51.84 ? 458  TYR A O   1 
ATOM   3583 C CB  . TYR A 1 458 ? 12.758  85.946 60.983 1.00 48.90 ? 458  TYR A CB  1 
ATOM   3584 C CG  . TYR A 1 458 ? 11.792  84.778 61.191 1.00 48.23 ? 458  TYR A CG  1 
ATOM   3585 C CD1 . TYR A 1 458 ? 12.250  83.510 61.581 1.00 46.28 ? 458  TYR A CD1 1 
ATOM   3586 C CD2 . TYR A 1 458 ? 10.420  84.934 60.963 1.00 46.56 ? 458  TYR A CD2 1 
ATOM   3587 C CE1 . TYR A 1 458 ? 11.350  82.424 61.731 1.00 45.76 ? 458  TYR A CE1 1 
ATOM   3588 C CE2 . TYR A 1 458 ? 9.521   83.863 61.114 1.00 45.04 ? 458  TYR A CE2 1 
ATOM   3589 C CZ  . TYR A 1 458 ? 9.987   82.618 61.496 1.00 44.96 ? 458  TYR A CZ  1 
ATOM   3590 O OH  . TYR A 1 458 ? 9.075   81.591 61.658 1.00 43.23 ? 458  TYR A OH  1 
ATOM   3591 N N   . THR A 1 459 ? 15.335  87.356 61.913 1.00 51.76 ? 459  THR A N   1 
ATOM   3592 C CA  . THR A 1 459 ? 16.464  88.224 61.623 1.00 50.97 ? 459  THR A CA  1 
ATOM   3593 C C   . THR A 1 459 ? 16.583  88.372 60.118 1.00 51.88 ? 459  THR A C   1 
ATOM   3594 O O   . THR A 1 459 ? 15.906  87.670 59.365 1.00 52.91 ? 459  THR A O   1 
ATOM   3595 C CB  . THR A 1 459 ? 17.768  87.628 62.118 1.00 49.53 ? 459  THR A CB  1 
ATOM   3596 O OG1 . THR A 1 459 ? 18.033  86.432 61.383 1.00 47.56 ? 459  THR A OG1 1 
ATOM   3597 C CG2 . THR A 1 459 ? 17.682  87.314 63.609 1.00 49.61 ? 459  THR A CG2 1 
ATOM   3598 N N   . ALA A 1 460 ? 17.453  89.279 59.687 1.00 51.73 ? 460  ALA A N   1 
ATOM   3599 C CA  . ALA A 1 460 ? 17.679  89.521 58.273 1.00 50.71 ? 460  ALA A CA  1 
ATOM   3600 C C   . ALA A 1 460 ? 18.304  88.275 57.686 1.00 50.44 ? 460  ALA A C   1 
ATOM   3601 O O   . ALA A 1 460 ? 18.030  87.896 56.540 1.00 50.58 ? 460  ALA A O   1 
ATOM   3602 C CB  . ALA A 1 460 ? 18.623  90.706 58.086 1.00 50.46 ? 460  ALA A CB  1 
ATOM   3603 N N   . GLU A 1 461 ? 19.160  87.645 58.479 1.00 50.43 ? 461  GLU A N   1 
ATOM   3604 C CA  . GLU A 1 461 ? 19.842  86.432 58.049 1.00 51.03 ? 461  GLU A CA  1 
ATOM   3605 C C   . GLU A 1 461 ? 18.818  85.324 57.809 1.00 49.31 ? 461  GLU A C   1 
ATOM   3606 O O   . GLU A 1 461 ? 18.906  84.581 56.829 1.00 48.58 ? 461  GLU A O   1 
ATOM   3607 C CB  . GLU A 1 461 ? 20.860  85.973 59.105 1.00 53.93 ? 461  GLU A CB  1 
ATOM   3608 C CG  . GLU A 1 461 ? 21.936  86.999 59.476 1.00 56.87 ? 461  GLU A CG  1 
ATOM   3609 C CD  . GLU A 1 461 ? 21.417  88.151 60.340 1.00 59.13 ? 461  GLU A CD  1 
ATOM   3610 O OE1 . GLU A 1 461 ? 22.236  88.999 60.740 1.00 62.76 ? 461  GLU A OE1 1 
ATOM   3611 O OE2 . GLU A 1 461 ? 20.204  88.224 60.626 1.00 60.62 ? 461  GLU A OE2 1 
ATOM   3612 N N   . GLU A 1 462 ? 17.843  85.225 58.702 1.00 47.75 ? 462  GLU A N   1 
ATOM   3613 C CA  . GLU A 1 462 ? 16.822  84.212 58.566 1.00 48.24 ? 462  GLU A CA  1 
ATOM   3614 C C   . GLU A 1 462 ? 15.974  84.452 57.316 1.00 49.36 ? 462  GLU A C   1 
ATOM   3615 O O   . GLU A 1 462 ? 15.679  83.506 56.574 1.00 47.96 ? 462  GLU A O   1 
ATOM   3616 C CB  . GLU A 1 462 ? 15.992  84.157 59.845 1.00 45.80 ? 462  GLU A CB  1 
ATOM   3617 C CG  . GLU A 1 462 ? 16.872  83.735 61.013 1.00 46.96 ? 462  GLU A CG  1 
ATOM   3618 C CD  . GLU A 1 462 ? 16.137  83.597 62.330 1.00 48.26 ? 462  GLU A CD  1 
ATOM   3619 O OE1 . GLU A 1 462 ? 15.284  84.458 62.638 1.00 49.08 ? 462  GLU A OE1 1 
ATOM   3620 O OE2 . GLU A 1 462 ? 16.435  82.628 63.066 1.00 48.40 ? 462  GLU A OE2 1 
ATOM   3621 N N   . GLU A 1 463 ? 15.630  85.714 57.056 1.00 49.67 ? 463  GLU A N   1 
ATOM   3622 C CA  . GLU A 1 463 ? 14.850  86.039 55.870 1.00 50.32 ? 463  GLU A CA  1 
ATOM   3623 C C   . GLU A 1 463 ? 15.622  85.622 54.640 1.00 49.52 ? 463  GLU A C   1 
ATOM   3624 O O   . GLU A 1 463 ? 15.051  85.089 53.675 1.00 50.28 ? 463  GLU A O   1 
ATOM   3625 C CB  . GLU A 1 463 ? 14.579  87.529 55.753 1.00 52.88 ? 463  GLU A CB  1 
ATOM   3626 C CG  . GLU A 1 463 ? 13.758  87.838 54.522 1.00 57.00 ? 463  GLU A CG  1 
ATOM   3627 C CD  . GLU A 1 463 ? 13.666  89.306 54.213 1.00 60.14 ? 463  GLU A CD  1 
ATOM   3628 O OE1 . GLU A 1 463 ? 13.920  90.127 55.124 1.00 63.21 ? 463  GLU A OE1 1 
ATOM   3629 O OE2 . GLU A 1 463 ? 13.317  89.634 53.055 1.00 61.57 ? 463  GLU A OE2 1 
ATOM   3630 N N   . ALA A 1 464 ? 16.923  85.883 54.662 1.00 47.01 ? 464  ALA A N   1 
ATOM   3631 C CA  . ALA A 1 464 ? 17.751  85.502 53.531 1.00 46.21 ? 464  ALA A CA  1 
ATOM   3632 C C   . ALA A 1 464 ? 17.799  83.961 53.393 1.00 44.63 ? 464  ALA A C   1 
ATOM   3633 O O   . ALA A 1 464 ? 17.842  83.433 52.289 1.00 45.03 ? 464  ALA A O   1 
ATOM   3634 C CB  . ALA A 1 464 ? 19.163  86.086 53.695 1.00 45.12 ? 464  ALA A CB  1 
ATOM   3635 N N   . LEU A 1 465 ? 17.781  83.242 54.509 1.00 42.70 ? 465  LEU A N   1 
ATOM   3636 C CA  . LEU A 1 465 ? 17.814  81.778 54.449 1.00 42.18 ? 465  LEU A CA  1 
ATOM   3637 C C   . LEU A 1 465 ? 16.502  81.285 53.816 1.00 41.29 ? 465  LEU A C   1 
ATOM   3638 O O   . LEU A 1 465 ? 16.512  80.446 52.907 1.00 40.79 ? 465  LEU A O   1 
ATOM   3639 C CB  . LEU A 1 465 ? 17.997  81.179 55.856 1.00 41.02 ? 465  LEU A CB  1 
ATOM   3640 C CG  . LEU A 1 465 ? 18.030  79.660 56.030 1.00 41.20 ? 465  LEU A CG  1 
ATOM   3641 C CD1 . LEU A 1 465 ? 19.074  79.010 55.104 1.00 41.49 ? 465  LEU A CD1 1 
ATOM   3642 C CD2 . LEU A 1 465 ? 18.328  79.356 57.485 1.00 41.66 ? 465  LEU A CD2 1 
ATOM   3643 N N   . SER A 1 466 ? 15.384  81.833 54.271 1.00 39.26 ? 466  SER A N   1 
ATOM   3644 C CA  . SER A 1 466 ? 14.095  81.448 53.725 1.00 41.36 ? 466  SER A CA  1 
ATOM   3645 C C   . SER A 1 466 ? 14.056  81.670 52.206 1.00 43.18 ? 466  SER A C   1 
ATOM   3646 O O   . SER A 1 466 ? 13.652  80.778 51.441 1.00 44.25 ? 466  SER A O   1 
ATOM   3647 C CB  . SER A 1 466 ? 12.996  82.249 54.412 1.00 42.35 ? 466  SER A CB  1 
ATOM   3648 O OG  . SER A 1 466 ? 11.710  81.912 53.942 1.00 42.82 ? 466  SER A OG  1 
ATOM   3649 N N   . ARG A 1 467 ? 14.502  82.842 51.757 1.00 43.24 ? 467  ARG A N   1 
ATOM   3650 C CA  . ARG A 1 467 ? 14.496  83.131 50.330 1.00 43.49 ? 467  ARG A CA  1 
ATOM   3651 C C   . ARG A 1 467 ? 15.365  82.134 49.581 1.00 43.48 ? 467  ARG A C   1 
ATOM   3652 O O   . ARG A 1 467 ? 14.998  81.681 48.486 1.00 43.46 ? 467  ARG A O   1 
ATOM   3653 C CB  . ARG A 1 467 ? 14.972  84.567 50.058 1.00 45.36 ? 467  ARG A CB  1 
ATOM   3654 C CG  . ARG A 1 467 ? 13.920  85.625 50.360 1.00 45.82 ? 467  ARG A CG  1 
ATOM   3655 C CD  . ARG A 1 467 ? 14.492  87.039 50.273 1.00 47.66 ? 467  ARG A CD  1 
ATOM   3656 N NE  . ARG A 1 467 ? 13.476  88.048 50.566 1.00 48.90 ? 467  ARG A NE  1 
ATOM   3657 C CZ  . ARG A 1 467 ? 12.467  88.341 49.748 1.00 50.96 ? 467  ARG A CZ  1 
ATOM   3658 N NH1 . ARG A 1 467 ? 12.354  87.705 48.577 1.00 49.99 ? 467  ARG A NH1 1 
ATOM   3659 N NH2 . ARG A 1 467 ? 11.555  89.244 50.109 1.00 48.86 ? 467  ARG A NH2 1 
ATOM   3660 N N   A ARG A 1 468 ? 16.503  81.782 50.169 0.50 42.70 ? 468  ARG A N   1 
ATOM   3661 N N   B ARG A 1 468 ? 16.512  81.788 50.162 0.50 42.88 ? 468  ARG A N   1 
ATOM   3662 C CA  A ARG A 1 468 ? 17.420  80.840 49.542 0.50 43.10 ? 468  ARG A CA  1 
ATOM   3663 C CA  B ARG A 1 468 ? 17.409  80.826 49.531 0.50 43.41 ? 468  ARG A CA  1 
ATOM   3664 C C   A ARG A 1 468 ? 16.728  79.461 49.396 0.50 42.52 ? 468  ARG A C   1 
ATOM   3665 C C   B ARG A 1 468 ? 16.775  79.450 49.419 0.50 42.36 ? 468  ARG A C   1 
ATOM   3666 O O   A ARG A 1 468 ? 16.917  78.772 48.400 0.50 41.96 ? 468  ARG A O   1 
ATOM   3667 O O   B ARG A 1 468 ? 16.802  78.812 48.352 0.50 42.08 ? 468  ARG A O   1 
ATOM   3668 C CB  A ARG A 1 468 ? 18.684  80.646 50.357 0.50 44.78 ? 468  ARG A CB  1 
ATOM   3669 C CB  B ARG A 1 468 ? 18.695  80.758 50.375 0.50 44.12 ? 468  ARG A CB  1 
ATOM   3670 C CG  A ARG A 1 468 ? 19.944  80.313 49.631 0.50 45.31 ? 468  ARG A CG  1 
ATOM   3671 C CG  B ARG A 1 468 ? 19.847  81.552 49.998 0.50 46.61 ? 468  ARG A CG  1 
ATOM   3672 C CD  A ARG A 1 468 ? 21.095  81.103 50.765 0.50 49.20 ? 468  ARG A CD  1 
ATOM   3673 C CD  B ARG A 1 468 ? 21.104  80.255 50.628 0.50 48.30 ? 468  ARG A CD  1 
ATOM   3674 N NE  A ARG A 1 468 ? 21.516  79.748 50.395 0.50 50.92 ? 468  ARG A NE  1 
ATOM   3675 N NE  B ARG A 1 468 ? 21.040  81.366 51.580 0.50 48.02 ? 468  ARG A NE  1 
ATOM   3676 C CZ  A ARG A 1 468 ? 21.705  81.419 52.731 0.50 48.36 ? 468  ARG A CZ  1 
ATOM   3677 C CZ  B ARG A 1 468 ? 22.202  78.924 51.186 0.50 49.77 ? 468  ARG A CZ  1 
ATOM   3678 N NH1 A ARG A 1 468 ? 22.504  80.423 53.094 0.50 48.82 ? 468  ARG A NH1 1 
ATOM   3679 N NH1 B ARG A 1 468 ? 22.546  79.300 52.404 0.50 50.00 ? 468  ARG A NH1 1 
ATOM   3680 N NH2 A ARG A 1 468 ? 21.557  82.466 53.531 0.50 46.50 ? 468  ARG A NH2 1 
ATOM   3681 N NH2 B ARG A 1 468 ? 22.558  77.727 50.749 0.50 49.52 ? 468  ARG A NH2 1 
ATOM   3682 N N   . ILE A 1 469 ? 16.068  79.033 50.465 1.00 41.25 ? 469  ILE A N   1 
ATOM   3683 C CA  . ILE A 1 469 ? 15.404  77.744 50.470 1.00 40.75 ? 469  ILE A CA  1 
ATOM   3684 C C   . ILE A 1 469 ? 14.221  77.719 49.491 1.00 40.36 ? 469  ILE A C   1 
ATOM   3685 O O   . ILE A 1 469 ? 14.101  76.797 48.676 1.00 38.92 ? 469  ILE A O   1 
ATOM   3686 C CB  . ILE A 1 469 ? 14.960  77.365 51.920 1.00 39.81 ? 469  ILE A CB  1 
ATOM   3687 C CG1 . ILE A 1 469 ? 16.209  76.982 52.749 1.00 37.25 ? 469  ILE A CG1 1 
ATOM   3688 C CG2 . ILE A 1 469 ? 13.948  76.219 51.879 1.00 37.08 ? 469  ILE A CG2 1 
ATOM   3689 C CD1 . ILE A 1 469 ? 15.949  76.770 54.242 1.00 33.52 ? 469  ILE A CD1 1 
ATOM   3690 N N   . MET A 1 470 ? 13.365  78.734 49.556 1.00 40.54 ? 470  MET A N   1 
ATOM   3691 C CA  . MET A 1 470 ? 12.217  78.813 48.643 1.00 42.16 ? 470  MET A CA  1 
ATOM   3692 C C   . MET A 1 470 ? 12.670  78.779 47.183 1.00 41.46 ? 470  MET A C   1 
ATOM   3693 O O   . MET A 1 470 ? 12.035  78.142 46.329 1.00 40.02 ? 470  MET A O   1 
ATOM   3694 C CB  . MET A 1 470 ? 11.413  80.101 48.880 1.00 41.84 ? 470  MET A CB  1 
ATOM   3695 C CG  . MET A 1 470 ? 10.566  80.084 50.140 1.00 42.98 ? 470  MET A CG  1 
ATOM   3696 S SD  . MET A 1 470 ? 9.380   81.473 50.109 1.00 45.81 ? 470  MET A SD  1 
ATOM   3697 C CE  . MET A 1 470 ? 10.561  82.775 50.385 1.00 42.84 ? 470  MET A CE  1 
ATOM   3698 N N   . HIS A 1 471 ? 13.784  79.457 46.902 1.00 41.19 ? 471  HIS A N   1 
ATOM   3699 C CA  . HIS A 1 471 ? 14.279  79.500 45.540 1.00 41.12 ? 471  HIS A CA  1 
ATOM   3700 C C   . HIS A 1 471 ? 14.904  78.155 45.177 1.00 40.77 ? 471  HIS A C   1 
ATOM   3701 O O   . HIS A 1 471 ? 14.815  77.721 44.025 1.00 42.21 ? 471  HIS A O   1 
ATOM   3702 C CB  . HIS A 1 471 ? 15.272  80.656 45.344 1.00 41.53 ? 471  HIS A CB  1 
ATOM   3703 C CG  . HIS A 1 471 ? 15.500  80.994 43.904 1.00 42.48 ? 471  HIS A CG  1 
ATOM   3704 N ND1 . HIS A 1 471 ? 14.479  81.406 43.072 1.00 43.64 ? 471  HIS A ND1 1 
ATOM   3705 C CD2 . HIS A 1 471 ? 16.604  80.893 43.127 1.00 40.74 ? 471  HIS A CD2 1 
ATOM   3706 C CE1 . HIS A 1 471 ? 14.944  81.539 41.842 1.00 41.98 ? 471  HIS A CE1 1 
ATOM   3707 N NE2 . HIS A 1 471 ? 16.230  81.234 41.849 1.00 41.77 ? 471  HIS A NE2 1 
ATOM   3708 N N   . TYR A 1 472 ? 15.525  77.490 46.150 1.00 39.99 ? 472  TYR A N   1 
ATOM   3709 C CA  . TYR A 1 472 ? 16.090  76.158 45.889 1.00 40.81 ? 472  TYR A CA  1 
ATOM   3710 C C   . TYR A 1 472 ? 14.918  75.204 45.573 1.00 39.06 ? 472  TYR A C   1 
ATOM   3711 O O   . TYR A 1 472 ? 14.958  74.456 44.600 1.00 38.69 ? 472  TYR A O   1 
ATOM   3712 C CB  . TYR A 1 472 ? 16.792  75.580 47.118 1.00 43.20 ? 472  TYR A CB  1 
ATOM   3713 C CG  . TYR A 1 472 ? 18.214  76.004 47.360 1.00 46.17 ? 472  TYR A CG  1 
ATOM   3714 C CD1 . TYR A 1 472 ? 19.103  76.239 46.300 1.00 47.77 ? 472  TYR A CD1 1 
ATOM   3715 C CD2 . TYR A 1 472 ? 18.706  76.072 48.664 1.00 47.26 ? 472  TYR A CD2 1 
ATOM   3716 C CE1 . TYR A 1 472 ? 20.455  76.529 46.551 1.00 48.05 ? 472  TYR A CE1 1 
ATOM   3717 C CE2 . TYR A 1 472 ? 20.037  76.349 48.922 1.00 48.27 ? 472  TYR A CE2 1 
ATOM   3718 C CZ  . TYR A 1 472 ? 20.904  76.577 47.875 1.00 49.34 ? 472  TYR A CZ  1 
ATOM   3719 O OH  . TYR A 1 472 ? 22.218  76.847 48.172 1.00 51.67 ? 472  TYR A OH  1 
ATOM   3720 N N   . TRP A 1 473 ? 13.887  75.220 46.423 1.00 37.26 ? 473  TRP A N   1 
ATOM   3721 C CA  . TRP A 1 473 ? 12.739  74.343 46.222 1.00 36.36 ? 473  TRP A CA  1 
ATOM   3722 C C   . TRP A 1 473 ? 12.048  74.638 44.879 1.00 36.82 ? 473  TRP A C   1 
ATOM   3723 O O   . TRP A 1 473 ? 11.744  73.724 44.112 1.00 36.94 ? 473  TRP A O   1 
ATOM   3724 C CB  . TRP A 1 473 ? 11.715  74.512 47.350 1.00 32.75 ? 473  TRP A CB  1 
ATOM   3725 C CG  . TRP A 1 473 ? 11.828  73.561 48.542 1.00 32.54 ? 473  TRP A CG  1 
ATOM   3726 C CD1 . TRP A 1 473 ? 10.777  72.945 49.204 1.00 31.37 ? 473  TRP A CD1 1 
ATOM   3727 C CD2 . TRP A 1 473 ? 13.007  73.245 49.304 1.00 31.17 ? 473  TRP A CD2 1 
ATOM   3728 N NE1 . TRP A 1 473 ? 11.232  72.281 50.331 1.00 29.82 ? 473  TRP A NE1 1 
ATOM   3729 C CE2 . TRP A 1 473 ? 12.593  72.445 50.415 1.00 31.65 ? 473  TRP A CE2 1 
ATOM   3730 C CE3 . TRP A 1 473 ? 14.372  73.556 49.163 1.00 30.89 ? 473  TRP A CE3 1 
ATOM   3731 C CZ2 . TRP A 1 473 ? 13.499  71.967 51.376 1.00 30.46 ? 473  TRP A CZ2 1 
ATOM   3732 C CZ3 . TRP A 1 473 ? 15.277  73.077 50.125 1.00 31.21 ? 473  TRP A CZ3 1 
ATOM   3733 C CH2 . TRP A 1 473 ? 14.831  72.289 51.216 1.00 32.22 ? 473  TRP A CH2 1 
ATOM   3734 N N   . ALA A 1 474 ? 11.816  75.918 44.588 1.00 38.01 ? 474  ALA A N   1 
ATOM   3735 C CA  . ALA A 1 474 ? 11.117  76.298 43.356 1.00 36.68 ? 474  ALA A CA  1 
ATOM   3736 C C   . ALA A 1 474 ? 11.928  76.050 42.099 1.00 34.93 ? 474  ALA A C   1 
ATOM   3737 O O   . ALA A 1 474 ? 11.379  75.652 41.098 1.00 36.45 ? 474  ALA A O   1 
ATOM   3738 C CB  . ALA A 1 474 ? 10.679  77.760 43.428 1.00 36.37 ? 474  ALA A CB  1 
ATOM   3739 N N   . THR A 1 475 ? 13.231  76.268 42.145 1.00 36.14 ? 475  THR A N   1 
ATOM   3740 C CA  . THR A 1 475 ? 14.057  76.034 40.967 1.00 36.32 ? 475  THR A CA  1 
ATOM   3741 C C   . THR A 1 475 ? 14.154  74.539 40.685 1.00 37.64 ? 475  THR A C   1 
ATOM   3742 O O   . THR A 1 475 ? 14.220  74.106 39.525 1.00 36.73 ? 475  THR A O   1 
ATOM   3743 C CB  . THR A 1 475 ? 15.471  76.589 41.163 1.00 36.34 ? 475  THR A CB  1 
ATOM   3744 O OG1 . THR A 1 475 ? 15.390  78.003 41.359 1.00 36.06 ? 475  THR A OG1 1 
ATOM   3745 C CG2 . THR A 1 475 ? 16.331  76.298 39.938 1.00 31.49 ? 475  THR A CG2 1 
ATOM   3746 N N   . PHE A 1 476 ? 14.186  73.748 41.757 1.00 37.97 ? 476  PHE A N   1 
ATOM   3747 C CA  . PHE A 1 476 ? 14.254  72.314 41.591 1.00 37.66 ? 476  PHE A CA  1 
ATOM   3748 C C   . PHE A 1 476 ? 12.911  71.852 41.013 1.00 37.46 ? 476  PHE A C   1 
ATOM   3749 O O   . PHE A 1 476 ? 12.873  71.007 40.116 1.00 36.86 ? 476  PHE A O   1 
ATOM   3750 C CB  . PHE A 1 476 ? 14.493  71.613 42.932 1.00 37.78 ? 476  PHE A CB  1 
ATOM   3751 C CG  . PHE A 1 476 ? 14.212  70.130 42.888 1.00 36.06 ? 476  PHE A CG  1 
ATOM   3752 C CD1 . PHE A 1 476 ? 15.142  69.249 42.350 1.00 35.14 ? 476  PHE A CD1 1 
ATOM   3753 C CD2 . PHE A 1 476 ? 12.983  69.627 43.325 1.00 35.18 ? 476  PHE A CD2 1 
ATOM   3754 C CE1 . PHE A 1 476 ? 14.857  67.888 42.247 1.00 35.05 ? 476  PHE A CE1 1 
ATOM   3755 C CE2 . PHE A 1 476 ? 12.687  68.260 43.226 1.00 33.54 ? 476  PHE A CE2 1 
ATOM   3756 C CZ  . PHE A 1 476 ? 13.615  67.393 42.692 1.00 33.66 ? 476  PHE A CZ  1 
ATOM   3757 N N   . ALA A 1 477 ? 11.812  72.414 41.514 1.00 36.42 ? 477  ALA A N   1 
ATOM   3758 C CA  . ALA A 1 477 ? 10.500  72.000 41.029 1.00 36.40 ? 477  ALA A CA  1 
ATOM   3759 C C   . ALA A 1 477 ? 10.369  72.282 39.543 1.00 38.52 ? 477  ALA A C   1 
ATOM   3760 O O   . ALA A 1 477 ? 9.787   71.495 38.794 1.00 39.48 ? 477  ALA A O   1 
ATOM   3761 C CB  . ALA A 1 477 ? 9.409   72.702 41.786 1.00 32.26 ? 477  ALA A CB  1 
ATOM   3762 N N   . LYS A 1 478 ? 10.939  73.402 39.111 1.00 40.43 ? 478  LYS A N   1 
ATOM   3763 C CA  . LYS A 1 478 ? 10.860  73.792 37.716 1.00 42.08 ? 478  LYS A CA  1 
ATOM   3764 C C   . LYS A 1 478 ? 11.823  73.053 36.796 1.00 41.82 ? 478  LYS A C   1 
ATOM   3765 O O   . LYS A 1 478 ? 11.461  72.669 35.676 1.00 40.90 ? 478  LYS A O   1 
ATOM   3766 C CB  . LYS A 1 478 ? 11.098  75.304 37.601 1.00 45.77 ? 478  LYS A CB  1 
ATOM   3767 C CG  . LYS A 1 478 ? 11.103  75.841 36.170 1.00 49.77 ? 478  LYS A CG  1 
ATOM   3768 C CD  . LYS A 1 478 ? 11.374  77.344 36.168 1.00 55.14 ? 478  LYS A CD  1 
ATOM   3769 C CE  . LYS A 1 478 ? 11.489  77.891 34.746 1.00 59.07 ? 478  LYS A CE  1 
ATOM   3770 N NZ  . LYS A 1 478 ? 11.833  79.358 34.715 1.00 62.35 ? 478  LYS A NZ  1 
ATOM   3771 N N   . THR A 1 479 ? 13.041  72.827 37.272 1.00 40.76 ? 479  THR A N   1 
ATOM   3772 C CA  . THR A 1 479 ? 14.049  72.204 36.432 1.00 40.87 ? 479  THR A CA  1 
ATOM   3773 C C   . THR A 1 479 ? 14.589  70.848 36.823 1.00 41.55 ? 479  THR A C   1 
ATOM   3774 O O   . THR A 1 479 ? 15.228  70.198 36.019 1.00 41.39 ? 479  THR A O   1 
ATOM   3775 C CB  . THR A 1 479 ? 15.267  73.133 36.300 1.00 40.65 ? 479  THR A CB  1 
ATOM   3776 O OG1 . THR A 1 479 ? 15.958  73.180 37.554 1.00 40.07 ? 479  THR A OG1 1 
ATOM   3777 C CG2 . THR A 1 479 ? 14.833  74.544 35.914 1.00 37.56 ? 479  THR A CG2 1 
ATOM   3778 N N   . GLY A 1 480 ? 14.347  70.413 38.050 1.00 42.39 ? 480  GLY A N   1 
ATOM   3779 C CA  . GLY A 1 480 ? 14.901  69.136 38.475 1.00 40.78 ? 480  GLY A CA  1 
ATOM   3780 C C   . GLY A 1 480 ? 16.297  69.357 39.051 1.00 40.04 ? 480  GLY A C   1 
ATOM   3781 O O   . GLY A 1 480 ? 17.023  68.395 39.305 1.00 39.33 ? 480  GLY A O   1 
ATOM   3782 N N   . ASN A 1 481 ? 16.663  70.631 39.245 1.00 39.58 ? 481  ASN A N   1 
ATOM   3783 C CA  . ASN A 1 481 ? 17.962  71.051 39.802 1.00 40.76 ? 481  ASN A CA  1 
ATOM   3784 C C   . ASN A 1 481 ? 17.701  72.313 40.646 1.00 41.18 ? 481  ASN A C   1 
ATOM   3785 O O   . ASN A 1 481 ? 17.139  73.286 40.144 1.00 41.34 ? 481  ASN A O   1 
ATOM   3786 C CB  . ASN A 1 481 ? 18.945  71.398 38.677 1.00 40.89 ? 481  ASN A CB  1 
ATOM   3787 C CG  . ASN A 1 481 ? 20.363  71.592 39.177 1.00 42.20 ? 481  ASN A CG  1 
ATOM   3788 O OD1 . ASN A 1 481 ? 20.580  71.988 40.330 1.00 43.91 ? 481  ASN A OD1 1 
ATOM   3789 N ND2 . ASN A 1 481 ? 21.347  71.314 38.310 1.00 39.42 ? 481  ASN A ND2 1 
ATOM   3790 N N   . PRO A 1 482 ? 18.098  72.317 41.933 1.00 41.14 ? 482  PRO A N   1 
ATOM   3791 C CA  . PRO A 1 482 ? 17.855  73.505 42.765 1.00 43.07 ? 482  PRO A CA  1 
ATOM   3792 C C   . PRO A 1 482 ? 18.729  74.724 42.446 1.00 44.42 ? 482  PRO A C   1 
ATOM   3793 O O   . PRO A 1 482 ? 18.440  75.839 42.880 1.00 44.35 ? 482  PRO A O   1 
ATOM   3794 C CB  . PRO A 1 482 ? 18.110  72.989 44.181 1.00 40.98 ? 482  PRO A CB  1 
ATOM   3795 C CG  . PRO A 1 482 ? 19.226  72.028 43.972 1.00 40.52 ? 482  PRO A CG  1 
ATOM   3796 C CD  . PRO A 1 482 ? 18.786  71.268 42.708 1.00 40.87 ? 482  PRO A CD  1 
ATOM   3797 N N   . ASN A 1 483 ? 19.791  74.492 41.688 1.00 46.19 ? 483  ASN A N   1 
ATOM   3798 C CA  . ASN A 1 483 ? 20.739  75.528 41.335 1.00 49.83 ? 483  ASN A CA  1 
ATOM   3799 C C   . ASN A 1 483 ? 20.348  76.365 40.125 1.00 53.15 ? 483  ASN A C   1 
ATOM   3800 O O   . ASN A 1 483 ? 19.928  75.830 39.101 1.00 52.69 ? 483  ASN A O   1 
ATOM   3801 C CB  . ASN A 1 483 ? 22.098  74.892 41.067 1.00 47.97 ? 483  ASN A CB  1 
ATOM   3802 C CG  . ASN A 1 483 ? 22.657  74.188 42.274 1.00 47.84 ? 483  ASN A CG  1 
ATOM   3803 O OD1 . ASN A 1 483 ? 23.002  74.829 43.272 1.00 47.68 ? 483  ASN A OD1 1 
ATOM   3804 N ND2 . ASN A 1 483 ? 22.749  72.859 42.199 1.00 45.40 ? 483  ASN A ND2 1 
ATOM   3805 N N   . GLU A 1 484 ? 20.492  77.681 40.255 1.00 58.20 ? 484  GLU A N   1 
ATOM   3806 C CA  . GLU A 1 484 ? 20.216  78.609 39.154 1.00 63.21 ? 484  GLU A CA  1 
ATOM   3807 C C   . GLU A 1 484 ? 21.255  78.356 38.047 1.00 65.44 ? 484  GLU A C   1 
ATOM   3808 O O   . GLU A 1 484 ? 22.471  78.432 38.285 1.00 64.46 ? 484  GLU A O   1 
ATOM   3809 C CB  . GLU A 1 484 ? 20.348  80.051 39.645 1.00 65.04 ? 484  GLU A CB  1 
ATOM   3810 C CG  . GLU A 1 484 ? 19.086  80.625 40.235 1.00 68.76 ? 484  GLU A CG  1 
ATOM   3811 C CD  . GLU A 1 484 ? 18.223  81.253 39.170 1.00 71.01 ? 484  GLU A CD  1 
ATOM   3812 O OE1 . GLU A 1 484 ? 18.290  80.794 38.009 1.00 72.98 ? 484  GLU A OE1 1 
ATOM   3813 O OE2 . GLU A 1 484 ? 17.474  82.199 39.489 1.00 73.18 ? 484  GLU A OE2 1 
ATOM   3814 N N   . PRO A 1 485 ? 20.792  78.044 36.827 1.00 67.79 ? 485  PRO A N   1 
ATOM   3815 C CA  . PRO A 1 485 ? 21.741  77.791 35.734 1.00 70.32 ? 485  PRO A CA  1 
ATOM   3816 C C   . PRO A 1 485 ? 22.668  78.997 35.575 1.00 72.91 ? 485  PRO A C   1 
ATOM   3817 O O   . PRO A 1 485 ? 22.212  80.152 35.625 1.00 73.08 ? 485  PRO A O   1 
ATOM   3818 C CB  . PRO A 1 485 ? 20.837  77.608 34.512 1.00 70.09 ? 485  PRO A CB  1 
ATOM   3819 C CG  . PRO A 1 485 ? 19.517  77.167 35.107 1.00 69.98 ? 485  PRO A CG  1 
ATOM   3820 C CD  . PRO A 1 485 ? 19.401  78.027 36.342 1.00 68.67 ? 485  PRO A CD  1 
ATOM   3821 N N   . HIS A 1 486 ? 23.962  78.734 35.406 1.00 74.55 ? 486  HIS A N   1 
ATOM   3822 C CA  . HIS A 1 486 ? 24.939  79.803 35.229 1.00 76.24 ? 486  HIS A CA  1 
ATOM   3823 C C   . HIS A 1 486 ? 24.713  80.944 36.224 1.00 77.08 ? 486  HIS A C   1 
ATOM   3824 O O   . HIS A 1 486 ? 24.436  82.079 35.837 1.00 77.83 ? 486  HIS A O   1 
ATOM   3825 C CB  . HIS A 1 486 ? 24.871  80.347 33.789 1.00 76.65 ? 486  HIS A CB  1 
ATOM   3826 N N   . SER A 1 487 ? 24.819  80.635 37.510 1.00 77.27 ? 487  SER A N   1 
ATOM   3827 C CA  . SER A 1 487 ? 24.648  81.645 38.546 1.00 76.91 ? 487  SER A CA  1 
ATOM   3828 C C   . SER A 1 487 ? 25.978  81.931 39.246 1.00 76.43 ? 487  SER A C   1 
ATOM   3829 O O   . SER A 1 487 ? 26.878  81.088 39.269 1.00 75.33 ? 487  SER A O   1 
ATOM   3830 C CB  . SER A 1 487 ? 23.620  81.180 39.575 1.00 77.66 ? 487  SER A CB  1 
ATOM   3831 O OG  . SER A 1 487 ? 24.056  81.490 40.889 1.00 77.98 ? 487  SER A OG  1 
ATOM   3832 N N   . LYS A 1 491 ? 27.185  76.277 44.753 1.00 45.83 ? 491  LYS A N   1 
ATOM   3833 C CA  . LYS A 1 491 ? 26.447  75.184 44.128 1.00 48.00 ? 491  LYS A CA  1 
ATOM   3834 C C   . LYS A 1 491 ? 26.122  73.977 45.024 1.00 48.02 ? 491  LYS A C   1 
ATOM   3835 O O   . LYS A 1 491 ? 27.007  73.410 45.681 1.00 48.23 ? 491  LYS A O   1 
ATOM   3836 C CB  . LYS A 1 491 ? 27.184  74.684 42.891 1.00 49.05 ? 491  LYS A CB  1 
ATOM   3837 C CG  . LYS A 1 491 ? 26.699  75.337 41.587 1.00 53.39 ? 491  LYS A CG  1 
ATOM   3838 N N   . TRP A 1 492 ? 24.836  73.609 45.050 1.00 44.95 ? 492  TRP A N   1 
ATOM   3839 C CA  . TRP A 1 492 ? 24.352  72.464 45.804 1.00 41.02 ? 492  TRP A CA  1 
ATOM   3840 C C   . TRP A 1 492 ? 24.731  71.261 44.950 1.00 41.22 ? 492  TRP A C   1 
ATOM   3841 O O   . TRP A 1 492 ? 24.147  71.034 43.898 1.00 41.56 ? 492  TRP A O   1 
ATOM   3842 C CB  . TRP A 1 492 ? 22.836  72.537 45.928 1.00 40.34 ? 492  TRP A CB  1 
ATOM   3843 C CG  . TRP A 1 492 ? 22.201  71.490 46.835 1.00 38.67 ? 492  TRP A CG  1 
ATOM   3844 C CD1 . TRP A 1 492 ? 22.671  70.230 47.110 1.00 37.13 ? 492  TRP A CD1 1 
ATOM   3845 C CD2 . TRP A 1 492 ? 20.936  71.593 47.490 1.00 37.36 ? 492  TRP A CD2 1 
ATOM   3846 N NE1 . TRP A 1 492 ? 21.774  69.546 47.889 1.00 37.45 ? 492  TRP A NE1 1 
ATOM   3847 C CE2 . TRP A 1 492 ? 20.697  70.357 48.137 1.00 38.57 ? 492  TRP A CE2 1 
ATOM   3848 C CE3 . TRP A 1 492 ? 19.979  72.609 47.594 1.00 36.56 ? 492  TRP A CE3 1 
ATOM   3849 C CZ2 . TRP A 1 492 ? 19.536  70.114 48.876 1.00 35.83 ? 492  TRP A CZ2 1 
ATOM   3850 C CZ3 . TRP A 1 492 ? 18.832  72.371 48.325 1.00 33.79 ? 492  TRP A CZ3 1 
ATOM   3851 C CH2 . TRP A 1 492 ? 18.618  71.130 48.958 1.00 36.49 ? 492  TRP A CH2 1 
ATOM   3852 N N   . PRO A 1 493 ? 25.727  70.474 45.380 1.00 41.75 ? 493  PRO A N   1 
ATOM   3853 C CA  . PRO A 1 493 ? 26.110  69.311 44.566 1.00 40.66 ? 493  PRO A CA  1 
ATOM   3854 C C   . PRO A 1 493 ? 25.093  68.181 44.540 1.00 41.63 ? 493  PRO A C   1 
ATOM   3855 O O   . PRO A 1 493 ? 24.295  67.992 45.467 1.00 41.82 ? 493  PRO A O   1 
ATOM   3856 C CB  . PRO A 1 493 ? 27.440  68.862 45.189 1.00 39.80 ? 493  PRO A CB  1 
ATOM   3857 C CG  . PRO A 1 493 ? 27.279  69.251 46.607 1.00 40.25 ? 493  PRO A CG  1 
ATOM   3858 C CD  . PRO A 1 493 ? 26.628  70.625 46.535 1.00 39.88 ? 493  PRO A CD  1 
ATOM   3859 N N   . LEU A 1 494 ? 25.138  67.431 43.457 1.00 42.28 ? 494  LEU A N   1 
ATOM   3860 C CA  . LEU A 1 494 ? 24.268  66.301 43.262 1.00 43.58 ? 494  LEU A CA  1 
ATOM   3861 C C   . LEU A 1 494 ? 24.738  65.194 44.219 1.00 44.78 ? 494  LEU A C   1 
ATOM   3862 O O   . LEU A 1 494 ? 25.952  65.015 44.424 1.00 43.93 ? 494  LEU A O   1 
ATOM   3863 C CB  . LEU A 1 494 ? 24.398  65.862 41.808 1.00 43.73 ? 494  LEU A CB  1 
ATOM   3864 C CG  . LEU A 1 494 ? 23.427  64.930 41.093 1.00 46.28 ? 494  LEU A CG  1 
ATOM   3865 C CD1 . LEU A 1 494 ? 22.008  65.485 41.055 1.00 44.23 ? 494  LEU A CD1 1 
ATOM   3866 C CD2 . LEU A 1 494 ? 23.954  64.741 39.671 1.00 45.29 ? 494  LEU A CD2 1 
ATOM   3867 N N   . PHE A 1 495 ? 23.782  64.490 44.834 1.00 43.89 ? 495  PHE A N   1 
ATOM   3868 C CA  . PHE A 1 495 ? 24.107  63.380 45.721 1.00 43.11 ? 495  PHE A CA  1 
ATOM   3869 C C   . PHE A 1 495 ? 24.288  62.156 44.832 1.00 43.66 ? 495  PHE A C   1 
ATOM   3870 O O   . PHE A 1 495 ? 23.410  61.813 44.058 1.00 44.68 ? 495  PHE A O   1 
ATOM   3871 C CB  . PHE A 1 495 ? 22.979  63.107 46.735 1.00 41.91 ? 495  PHE A CB  1 
ATOM   3872 C CG  . PHE A 1 495 ? 23.157  61.811 47.517 1.00 39.46 ? 495  PHE A CG  1 
ATOM   3873 C CD1 . PHE A 1 495 ? 22.891  60.576 46.924 1.00 37.12 ? 495  PHE A CD1 1 
ATOM   3874 C CD2 . PHE A 1 495 ? 23.609  61.834 48.839 1.00 38.79 ? 495  PHE A CD2 1 
ATOM   3875 C CE1 . PHE A 1 495 ? 23.071  59.388 47.627 1.00 38.01 ? 495  PHE A CE1 1 
ATOM   3876 C CE2 . PHE A 1 495 ? 23.794  60.649 49.554 1.00 38.25 ? 495  PHE A CE2 1 
ATOM   3877 C CZ  . PHE A 1 495 ? 23.525  59.422 48.947 1.00 37.67 ? 495  PHE A CZ  1 
ATOM   3878 N N   . THR A 1 496 ? 25.424  61.490 44.956 1.00 45.44 ? 496  THR A N   1 
ATOM   3879 C CA  . THR A 1 496 ? 25.710  60.313 44.142 1.00 46.84 ? 496  THR A CA  1 
ATOM   3880 C C   . THR A 1 496 ? 26.048  59.128 45.020 1.00 48.41 ? 496  THR A C   1 
ATOM   3881 O O   . THR A 1 496 ? 26.477  59.281 46.159 1.00 48.55 ? 496  THR A O   1 
ATOM   3882 C CB  . THR A 1 496 ? 26.910  60.564 43.206 1.00 46.03 ? 496  THR A CB  1 
ATOM   3883 O OG1 . THR A 1 496 ? 28.063  60.874 44.004 1.00 46.27 ? 496  THR A OG1 1 
ATOM   3884 C CG2 . THR A 1 496 ? 26.616  61.728 42.249 1.00 41.42 ? 496  THR A CG2 1 
ATOM   3885 N N   . THR A 1 497 ? 25.861  57.943 44.465 1.00 51.78 ? 497  THR A N   1 
ATOM   3886 C CA  . THR A 1 497 ? 26.137  56.699 45.170 1.00 54.62 ? 497  THR A CA  1 
ATOM   3887 C C   . THR A 1 497 ? 27.567  56.726 45.708 1.00 54.43 ? 497  THR A C   1 
ATOM   3888 O O   . THR A 1 497 ? 27.824  56.371 46.860 1.00 53.60 ? 497  THR A O   1 
ATOM   3889 C CB  . THR A 1 497 ? 26.013  55.509 44.205 1.00 56.43 ? 497  THR A CB  1 
ATOM   3890 O OG1 . THR A 1 497 ? 24.953  55.763 43.277 1.00 60.19 ? 497  THR A OG1 1 
ATOM   3891 C CG2 . THR A 1 497 ? 25.716  54.243 44.962 1.00 57.64 ? 497  THR A CG2 1 
ATOM   3892 N N   . LYS A 1 498 ? 28.484  57.171 44.851 1.00 54.04 ? 498  LYS A N   1 
ATOM   3893 C CA  . LYS A 1 498 ? 29.893  57.239 45.169 1.00 53.65 ? 498  LYS A CA  1 
ATOM   3894 C C   . LYS A 1 498 ? 30.278  58.288 46.211 1.00 53.12 ? 498  LYS A C   1 
ATOM   3895 O O   . LYS A 1 498 ? 30.733  57.945 47.300 1.00 52.62 ? 498  LYS A O   1 
ATOM   3896 C CB  . LYS A 1 498 ? 30.679  57.482 43.882 1.00 53.66 ? 498  LYS A CB  1 
ATOM   3897 C CG  . LYS A 1 498 ? 32.186  57.326 44.034 1.00 56.19 ? 498  LYS A CG  1 
ATOM   3898 N N   . GLU A 1 499 ? 30.095  59.560 45.876 1.00 53.12 ? 499  GLU A N   1 
ATOM   3899 C CA  . GLU A 1 499 ? 30.469  60.654 46.771 1.00 53.35 ? 499  GLU A CA  1 
ATOM   3900 C C   . GLU A 1 499 ? 29.504  60.904 47.939 1.00 51.79 ? 499  GLU A C   1 
ATOM   3901 O O   . GLU A 1 499 ? 29.932  61.234 49.039 1.00 51.14 ? 499  GLU A O   1 
ATOM   3902 C CB  . GLU A 1 499 ? 30.611  61.941 45.964 1.00 57.53 ? 499  GLU A CB  1 
ATOM   3903 C CG  . GLU A 1 499 ? 31.289  61.782 44.615 1.00 63.02 ? 499  GLU A CG  1 
ATOM   3904 C CD  . GLU A 1 499 ? 32.780  61.683 44.741 1.00 66.57 ? 499  GLU A CD  1 
ATOM   3905 O OE1 . GLU A 1 499 ? 33.254  60.650 45.257 1.00 69.46 ? 499  GLU A OE1 1 
ATOM   3906 O OE2 . GLU A 1 499 ? 33.477  62.645 44.336 1.00 68.50 ? 499  GLU A OE2 1 
ATOM   3907 N N   . GLN A 1 500 ? 28.204  60.781 47.689 1.00 50.68 ? 500  GLN A N   1 
ATOM   3908 C CA  . GLN A 1 500 ? 27.191  60.972 48.734 1.00 49.37 ? 500  GLN A CA  1 
ATOM   3909 C C   . GLN A 1 500 ? 27.211  62.346 49.415 1.00 46.50 ? 500  GLN A C   1 
ATOM   3910 O O   . GLN A 1 500 ? 26.968  62.484 50.612 1.00 43.99 ? 500  GLN A O   1 
ATOM   3911 C CB  . GLN A 1 500 ? 27.332  59.838 49.751 1.00 50.91 ? 500  GLN A CB  1 
ATOM   3912 C CG  . GLN A 1 500 ? 27.297  58.508 49.021 1.00 55.10 ? 500  GLN A CG  1 
ATOM   3913 C CD  . GLN A 1 500 ? 27.358  57.288 49.911 1.00 57.64 ? 500  GLN A CD  1 
ATOM   3914 O OE1 . GLN A 1 500 ? 27.755  56.201 49.459 1.00 59.44 ? 500  GLN A OE1 1 
ATOM   3915 N NE2 . GLN A 1 500 ? 26.960  57.443 51.162 1.00 55.57 ? 500  GLN A NE2 1 
ATOM   3916 N N   . LYS A 1 501 ? 27.450  63.371 48.611 1.00 45.07 ? 501  LYS A N   1 
ATOM   3917 C CA  . LYS A 1 501 ? 27.527  64.736 49.108 1.00 43.94 ? 501  LYS A CA  1 
ATOM   3918 C C   . LYS A 1 501 ? 26.176  65.345 49.465 1.00 42.41 ? 501  LYS A C   1 
ATOM   3919 O O   . LYS A 1 501 ? 25.124  64.999 48.884 1.00 41.87 ? 501  LYS A O   1 
ATOM   3920 C CB  . LYS A 1 501 ? 28.205  65.629 48.062 1.00 46.03 ? 501  LYS A CB  1 
ATOM   3921 C CG  . LYS A 1 501 ? 29.565  65.114 47.561 1.00 51.09 ? 501  LYS A CG  1 
ATOM   3922 C CD  . LYS A 1 501 ? 30.210  66.118 46.593 1.00 54.13 ? 501  LYS A CD  1 
ATOM   3923 C CE  . LYS A 1 501 ? 31.637  65.729 46.224 1.00 56.90 ? 501  LYS A CE  1 
ATOM   3924 N NZ  . LYS A 1 501 ? 32.257  66.769 45.348 1.00 59.86 ? 501  LYS A NZ  1 
ATOM   3925 N N   . PHE A 1 502 ? 26.208  66.255 50.426 1.00 37.88 ? 502  PHE A N   1 
ATOM   3926 C CA  . PHE A 1 502 ? 25.001  66.945 50.820 1.00 38.57 ? 502  PHE A CA  1 
ATOM   3927 C C   . PHE A 1 502 ? 25.411  68.304 51.350 1.00 39.03 ? 502  PHE A C   1 
ATOM   3928 O O   . PHE A 1 502 ? 26.599  68.565 51.540 1.00 38.37 ? 502  PHE A O   1 
ATOM   3929 C CB  . PHE A 1 502 ? 24.222  66.168 51.894 1.00 35.99 ? 502  PHE A CB  1 
ATOM   3930 C CG  . PHE A 1 502 ? 24.931  66.060 53.232 1.00 35.32 ? 502  PHE A CG  1 
ATOM   3931 C CD1 . PHE A 1 502 ? 25.819  65.011 53.487 1.00 33.18 ? 502  PHE A CD1 1 
ATOM   3932 C CD2 . PHE A 1 502 ? 24.632  66.950 54.260 1.00 33.72 ? 502  PHE A CD2 1 
ATOM   3933 C CE1 . PHE A 1 502 ? 26.389  64.839 54.743 1.00 32.23 ? 502  PHE A CE1 1 
ATOM   3934 C CE2 . PHE A 1 502 ? 25.195  66.793 55.531 1.00 33.89 ? 502  PHE A CE2 1 
ATOM   3935 C CZ  . PHE A 1 502 ? 26.075  65.729 55.772 1.00 33.77 ? 502  PHE A CZ  1 
ATOM   3936 N N   . ILE A 1 503 ? 24.440  69.181 51.576 1.00 39.45 ? 503  ILE A N   1 
ATOM   3937 C CA  . ILE A 1 503 ? 24.783  70.491 52.101 1.00 39.99 ? 503  ILE A CA  1 
ATOM   3938 C C   . ILE A 1 503 ? 23.998  70.809 53.374 1.00 41.24 ? 503  ILE A C   1 
ATOM   3939 O O   . ILE A 1 503 ? 22.965  70.192 53.666 1.00 38.65 ? 503  ILE A O   1 
ATOM   3940 C CB  . ILE A 1 503 ? 24.473  71.627 51.091 1.00 40.91 ? 503  ILE A CB  1 
ATOM   3941 C CG1 . ILE A 1 503 ? 22.952  71.726 50.897 1.00 40.91 ? 503  ILE A CG1 1 
ATOM   3942 C CG2 . ILE A 1 503 ? 25.224  71.392 49.770 1.00 40.20 ? 503  ILE A CG2 1 
ATOM   3943 C CD1 . ILE A 1 503 ? 22.504  73.025 50.313 1.00 42.71 ? 503  ILE A CD1 1 
ATOM   3944 N N   . ASP A 1 504 ? 24.512  71.785 54.118 1.00 42.88 ? 504  ASP A N   1 
ATOM   3945 C CA  . ASP A 1 504 ? 23.871  72.275 55.326 1.00 45.87 ? 504  ASP A CA  1 
ATOM   3946 C C   . ASP A 1 504 ? 22.959  73.411 54.873 1.00 45.07 ? 504  ASP A C   1 
ATOM   3947 O O   . ASP A 1 504 ? 23.220  74.068 53.867 1.00 45.24 ? 504  ASP A O   1 
ATOM   3948 C CB  . ASP A 1 504 ? 24.879  72.909 56.302 1.00 50.26 ? 504  ASP A CB  1 
ATOM   3949 C CG  . ASP A 1 504 ? 25.855  71.913 56.889 1.00 55.83 ? 504  ASP A CG  1 
ATOM   3950 O OD1 . ASP A 1 504 ? 25.439  70.771 57.198 1.00 58.29 ? 504  ASP A OD1 1 
ATOM   3951 O OD2 . ASP A 1 504 ? 27.043  72.289 57.066 1.00 57.77 ? 504  ASP A OD2 1 
ATOM   3952 N N   . LEU A 1 505 ? 21.895  73.644 55.616 1.00 44.41 ? 505  LEU A N   1 
ATOM   3953 C CA  . LEU A 1 505 ? 21.025  74.753 55.313 1.00 44.80 ? 505  LEU A CA  1 
ATOM   3954 C C   . LEU A 1 505 ? 20.929  75.537 56.602 1.00 45.98 ? 505  LEU A C   1 
ATOM   3955 O O   . LEU A 1 505 ? 20.315  75.087 57.573 1.00 46.15 ? 505  LEU A O   1 
ATOM   3956 C CB  . LEU A 1 505 ? 19.643  74.286 54.877 1.00 44.50 ? 505  LEU A CB  1 
ATOM   3957 C CG  . LEU A 1 505 ? 19.528  73.808 53.437 1.00 43.72 ? 505  LEU A CG  1 
ATOM   3958 C CD1 . LEU A 1 505 ? 18.140  73.234 53.220 1.00 42.51 ? 505  LEU A CD1 1 
ATOM   3959 C CD2 . LEU A 1 505 ? 19.791  74.971 52.480 1.00 42.76 ? 505  LEU A CD2 1 
ATOM   3960 N N   . ASN A 1 506 ? 21.587  76.691 56.621 1.00 47.50 ? 506  ASN A N   1 
ATOM   3961 C CA  . ASN A 1 506 ? 21.571  77.570 57.778 1.00 50.16 ? 506  ASN A CA  1 
ATOM   3962 C C   . ASN A 1 506 ? 22.025  78.943 57.308 1.00 51.10 ? 506  ASN A C   1 
ATOM   3963 O O   . ASN A 1 506 ? 22.161  79.166 56.110 1.00 52.28 ? 506  ASN A O   1 
ATOM   3964 C CB  . ASN A 1 506 ? 22.488  77.031 58.876 1.00 49.33 ? 506  ASN A CB  1 
ATOM   3965 C CG  . ASN A 1 506 ? 23.884  76.812 58.391 1.00 48.87 ? 506  ASN A CG  1 
ATOM   3966 O OD1 . ASN A 1 506 ? 24.444  77.671 57.732 1.00 50.48 ? 506  ASN A OD1 1 
ATOM   3967 N ND2 . ASN A 1 506 ? 24.462  75.663 58.716 1.00 48.71 ? 506  ASN A ND2 1 
ATOM   3968 N N   . THR A 1 507 ? 22.269  79.862 58.233 1.00 53.16 ? 507  THR A N   1 
ATOM   3969 C CA  . THR A 1 507 ? 22.662  81.218 57.848 1.00 54.44 ? 507  THR A CA  1 
ATOM   3970 C C   . THR A 1 507 ? 24.155  81.438 57.639 1.00 55.59 ? 507  THR A C   1 
ATOM   3971 O O   . THR A 1 507 ? 24.578  82.538 57.307 1.00 56.98 ? 507  THR A O   1 
ATOM   3972 C CB  . THR A 1 507 ? 22.156  82.238 58.870 1.00 53.87 ? 507  THR A CB  1 
ATOM   3973 O OG1 . THR A 1 507 ? 22.695  81.918 60.155 1.00 55.75 ? 507  THR A OG1 1 
ATOM   3974 C CG2 . THR A 1 507 ? 20.638  82.213 58.951 1.00 53.87 ? 507  THR A CG2 1 
ATOM   3975 N N   . GLU A 1 508 ? 24.952  80.395 57.828 1.00 56.89 ? 508  GLU A N   1 
ATOM   3976 C CA  . GLU A 1 508 ? 26.397  80.484 57.629 1.00 58.21 ? 508  GLU A CA  1 
ATOM   3977 C C   . GLU A 1 508 ? 26.655  80.193 56.149 1.00 59.19 ? 508  GLU A C   1 
ATOM   3978 O O   . GLU A 1 508 ? 25.732  79.839 55.418 1.00 59.24 ? 508  GLU A O   1 
ATOM   3979 C CB  . GLU A 1 508 ? 27.116  79.454 58.507 1.00 57.94 ? 508  GLU A CB  1 
ATOM   3980 C CG  . GLU A 1 508 ? 26.939  79.676 60.011 1.00 59.44 ? 508  GLU A CG  1 
ATOM   3981 C CD  . GLU A 1 508 ? 27.438  78.488 60.837 1.00 60.36 ? 508  GLU A CD  1 
ATOM   3982 N N   . PRO A 1 509 ? 27.902  80.355 55.677 1.00 60.15 ? 509  PRO A N   1 
ATOM   3983 C CA  . PRO A 1 509 ? 28.139  80.070 54.255 1.00 60.23 ? 509  PRO A CA  1 
ATOM   3984 C C   . PRO A 1 509 ? 27.986  78.571 53.975 1.00 59.60 ? 509  PRO A C   1 
ATOM   3985 O O   . PRO A 1 509 ? 28.555  77.741 54.677 1.00 60.01 ? 509  PRO A O   1 
ATOM   3986 C CB  . PRO A 1 509 ? 29.574  80.571 54.029 1.00 60.13 ? 509  PRO A CB  1 
ATOM   3987 C CG  . PRO A 1 509 ? 29.722  81.661 55.056 1.00 60.30 ? 509  PRO A CG  1 
ATOM   3988 C CD  . PRO A 1 509 ? 29.056  81.048 56.278 1.00 61.08 ? 509  PRO A CD  1 
ATOM   3989 N N   . MET A 1 510 ? 27.221  78.229 52.947 1.00 59.81 ? 510  MET A N   1 
ATOM   3990 C CA  . MET A 1 510 ? 26.988  76.832 52.604 1.00 59.46 ? 510  MET A CA  1 
ATOM   3991 C C   . MET A 1 510 ? 28.254  76.000 52.692 1.00 57.69 ? 510  MET A C   1 
ATOM   3992 O O   . MET A 1 510 ? 29.309  76.441 52.281 1.00 58.58 ? 510  MET A O   1 
ATOM   3993 C CB  . MET A 1 510 ? 26.421  76.725 51.185 1.00 62.19 ? 510  MET A CB  1 
ATOM   3994 C CG  . MET A 1 510 ? 26.113  75.292 50.727 1.00 64.22 ? 510  MET A CG  1 
ATOM   3995 S SD  . MET A 1 510 ? 26.376  75.043 48.934 1.00 67.55 ? 510  MET A SD  1 
ATOM   3996 C CE  . MET A 1 510 ? 24.898  75.724 48.261 1.00 66.60 ? 510  MET A CE  1 
ATOM   3997 N N   . LYS A 1 511 ? 28.143  74.799 53.248 1.00 55.67 ? 511  LYS A N   1 
ATOM   3998 C CA  . LYS A 1 511 ? 29.273  73.872 53.356 1.00 52.46 ? 511  LYS A CA  1 
ATOM   3999 C C   . LYS A 1 511 ? 28.778  72.524 52.835 1.00 50.78 ? 511  LYS A C   1 
ATOM   4000 O O   . LYS A 1 511 ? 27.654  72.119 53.127 1.00 51.34 ? 511  LYS A O   1 
ATOM   4001 C CB  . LYS A 1 511 ? 29.736  73.709 54.811 1.00 52.09 ? 511  LYS A CB  1 
ATOM   4002 C CG  . LYS A 1 511 ? 30.195  74.997 55.475 1.00 52.49 ? 511  LYS A CG  1 
ATOM   4003 N N   . VAL A 1 512 ? 29.608  71.859 52.040 1.00 48.55 ? 512  VAL A N   1 
ATOM   4004 C CA  . VAL A 1 512 ? 29.299  70.559 51.473 1.00 46.56 ? 512  VAL A CA  1 
ATOM   4005 C C   . VAL A 1 512 ? 29.912  69.499 52.383 1.00 47.32 ? 512  VAL A C   1 
ATOM   4006 O O   . VAL A 1 512 ? 31.048  69.651 52.835 1.00 46.89 ? 512  VAL A O   1 
ATOM   4007 C CB  . VAL A 1 512 ? 29.897  70.406 50.052 1.00 45.64 ? 512  VAL A CB  1 
ATOM   4008 C CG1 . VAL A 1 512 ? 29.721  68.971 49.556 1.00 44.46 ? 512  VAL A CG1 1 
ATOM   4009 C CG2 . VAL A 1 512 ? 29.224  71.389 49.094 1.00 44.55 ? 512  VAL A CG2 1 
ATOM   4010 N N   . HIS A 1 513 ? 29.154  68.439 52.657 1.00 46.37 ? 513  HIS A N   1 
ATOM   4011 C CA  . HIS A 1 513 ? 29.612  67.344 53.512 1.00 45.47 ? 513  HIS A CA  1 
ATOM   4012 C C   . HIS A 1 513 ? 29.338  66.030 52.796 1.00 45.49 ? 513  HIS A C   1 
ATOM   4013 O O   . HIS A 1 513 ? 28.764  66.010 51.706 1.00 45.33 ? 513  HIS A O   1 
ATOM   4014 C CB  . HIS A 1 513 ? 28.852  67.339 54.839 1.00 46.09 ? 513  HIS A CB  1 
ATOM   4015 C CG  . HIS A 1 513 ? 28.952  68.619 55.604 1.00 48.72 ? 513  HIS A CG  1 
ATOM   4016 N ND1 . HIS A 1 513 ? 30.078  68.975 56.318 1.00 49.70 ? 513  HIS A ND1 1 
ATOM   4017 C CD2 . HIS A 1 513 ? 28.068  69.633 55.764 1.00 50.27 ? 513  HIS A CD2 1 
ATOM   4018 C CE1 . HIS A 1 513 ? 29.881  70.150 56.887 1.00 50.44 ? 513  HIS A CE1 1 
ATOM   4019 N NE2 . HIS A 1 513 ? 28.669  70.572 56.567 1.00 51.50 ? 513  HIS A NE2 1 
ATOM   4020 N N   . GLN A 1 514 ? 29.730  64.932 53.426 1.00 44.57 ? 514  GLN A N   1 
ATOM   4021 C CA  . GLN A 1 514 ? 29.529  63.617 52.850 1.00 45.80 ? 514  GLN A CA  1 
ATOM   4022 C C   . GLN A 1 514 ? 29.097  62.554 53.866 1.00 44.38 ? 514  GLN A C   1 
ATOM   4023 O O   . GLN A 1 514 ? 29.401  62.643 55.047 1.00 41.69 ? 514  GLN A O   1 
ATOM   4024 C CB  . GLN A 1 514 ? 30.810  63.143 52.174 1.00 47.80 ? 514  GLN A CB  1 
ATOM   4025 C CG  . GLN A 1 514 ? 31.176  63.893 50.903 1.00 51.94 ? 514  GLN A CG  1 
ATOM   4026 C CD  . GLN A 1 514 ? 32.493  63.393 50.301 1.00 52.66 ? 514  GLN A CD  1 
ATOM   4027 O OE1 . GLN A 1 514 ? 33.580  63.696 50.798 1.00 54.72 ? 514  GLN A OE1 1 
ATOM   4028 N NE2 . GLN A 1 514 ? 32.392  62.608 49.244 1.00 54.07 ? 514  GLN A NE2 1 
ATOM   4029 N N   . ARG A 1 515 ? 28.380  61.551 53.371 1.00 44.08 ? 515  ARG A N   1 
ATOM   4030 C CA  . ARG A 1 515 ? 27.915  60.428 54.180 1.00 43.39 ? 515  ARG A CA  1 
ATOM   4031 C C   . ARG A 1 515 ? 27.218  60.800 55.493 1.00 41.58 ? 515  ARG A C   1 
ATOM   4032 O O   . ARG A 1 515 ? 27.684  60.431 56.575 1.00 38.17 ? 515  ARG A O   1 
ATOM   4033 C CB  . ARG A 1 515 ? 29.100  59.505 54.460 1.00 45.04 ? 515  ARG A CB  1 
ATOM   4034 C CG  . ARG A 1 515 ? 29.694  58.857 53.203 1.00 47.58 ? 515  ARG A CG  1 
ATOM   4035 C CD  . ARG A 1 515 ? 30.829  57.883 53.540 1.00 49.51 ? 515  ARG A CD  1 
ATOM   4036 N NE  . ARG A 1 515 ? 31.371  57.239 52.342 1.00 50.85 ? 515  ARG A NE  1 
ATOM   4037 N N   . LEU A 1 516 ? 26.098  61.520 55.373 1.00 40.42 ? 516  LEU A N   1 
ATOM   4038 C CA  . LEU A 1 516 ? 25.284  61.969 56.511 1.00 40.51 ? 516  LEU A CA  1 
ATOM   4039 C C   . LEU A 1 516 ? 25.020  60.883 57.568 1.00 40.77 ? 516  LEU A C   1 
ATOM   4040 O O   . LEU A 1 516 ? 24.314  59.918 57.306 1.00 39.90 ? 516  LEU A O   1 
ATOM   4041 C CB  . LEU A 1 516 ? 23.940  62.495 55.998 1.00 41.78 ? 516  LEU A CB  1 
ATOM   4042 C CG  . LEU A 1 516 ? 22.882  63.041 56.966 1.00 41.46 ? 516  LEU A CG  1 
ATOM   4043 C CD1 . LEU A 1 516 ? 23.490  64.013 57.956 1.00 42.17 ? 516  LEU A CD1 1 
ATOM   4044 C CD2 . LEU A 1 516 ? 21.830  63.753 56.143 1.00 43.30 ? 516  LEU A CD2 1 
ATOM   4045 N N   . ARG A 1 517 ? 25.577  61.073 58.764 1.00 42.06 ? 517  ARG A N   1 
ATOM   4046 C CA  . ARG A 1 517 ? 25.446  60.139 59.886 1.00 40.60 ? 517  ARG A CA  1 
ATOM   4047 C C   . ARG A 1 517 ? 25.656  58.681 59.498 1.00 39.46 ? 517  ARG A C   1 
ATOM   4048 O O   . ARG A 1 517 ? 25.015  57.776 60.034 1.00 39.29 ? 517  ARG A O   1 
ATOM   4049 C CB  . ARG A 1 517 ? 24.088  60.342 60.576 1.00 43.50 ? 517  ARG A CB  1 
ATOM   4050 C CG  . ARG A 1 517 ? 24.094  61.655 61.388 1.00 48.27 ? 517  ARG A CG  1 
ATOM   4051 C CD  . ARG A 1 517 ? 22.890  61.865 62.260 1.00 49.08 ? 517  ARG A CD  1 
ATOM   4052 N NE  . ARG A 1 517 ? 22.942  61.096 63.498 1.00 52.22 ? 517  ARG A NE  1 
ATOM   4053 C CZ  . ARG A 1 517 ? 23.785  61.326 64.505 1.00 52.84 ? 517  ARG A CZ  1 
ATOM   4054 N NH1 . ARG A 1 517 ? 24.666  62.323 64.409 1.00 54.23 ? 517  ARG A NH1 1 
ATOM   4055 N NH2 . ARG A 1 517 ? 23.731  60.575 65.615 1.00 46.31 ? 517  ARG A NH2 1 
ATOM   4056 N N   . VAL A 1 518 ? 26.588  58.447 58.582 1.00 37.12 ? 518  VAL A N   1 
ATOM   4057 C CA  . VAL A 1 518 ? 26.828  57.090 58.128 1.00 35.57 ? 518  VAL A CA  1 
ATOM   4058 C C   . VAL A 1 518 ? 27.171  56.138 59.271 1.00 37.32 ? 518  VAL A C   1 
ATOM   4059 O O   . VAL A 1 518 ? 26.744  54.980 59.260 1.00 37.26 ? 518  VAL A O   1 
ATOM   4060 C CB  . VAL A 1 518 ? 27.948  57.043 57.051 1.00 35.07 ? 518  VAL A CB  1 
ATOM   4061 C CG1 . VAL A 1 518 ? 29.311  57.452 57.660 1.00 30.93 ? 518  VAL A CG1 1 
ATOM   4062 C CG2 . VAL A 1 518 ? 28.007  55.659 56.443 1.00 31.39 ? 518  VAL A CG2 1 
ATOM   4063 N N   . GLN A 1 519 ? 27.915  56.623 60.266 1.00 38.47 ? 519  GLN A N   1 
ATOM   4064 C CA  . GLN A 1 519 ? 28.315  55.772 61.382 1.00 41.21 ? 519  GLN A CA  1 
ATOM   4065 C C   . GLN A 1 519 ? 27.098  55.164 62.109 1.00 40.55 ? 519  GLN A C   1 
ATOM   4066 O O   . GLN A 1 519 ? 27.051  53.958 62.386 1.00 40.69 ? 519  GLN A O   1 
ATOM   4067 C CB  . GLN A 1 519 ? 29.183  56.566 62.375 1.00 41.44 ? 519  GLN A CB  1 
ATOM   4068 C CG  . GLN A 1 519 ? 29.950  55.661 63.329 1.00 44.86 ? 519  GLN A CG  1 
ATOM   4069 C CD  . GLN A 1 519 ? 31.092  54.900 62.625 1.00 48.87 ? 519  GLN A CD  1 
ATOM   4070 O OE1 . GLN A 1 519 ? 31.475  53.801 63.046 1.00 50.87 ? 519  GLN A OE1 1 
ATOM   4071 N NE2 . GLN A 1 519 ? 31.643  55.493 61.560 1.00 46.76 ? 519  GLN A NE2 1 
ATOM   4072 N N   . MET A 1 520 ? 26.118  56.008 62.410 1.00 38.74 ? 520  MET A N   1 
ATOM   4073 C CA  . MET A 1 520 ? 24.910  55.564 63.104 1.00 39.34 ? 520  MET A CA  1 
ATOM   4074 C C   . MET A 1 520 ? 23.925  54.833 62.182 1.00 38.10 ? 520  MET A C   1 
ATOM   4075 O O   . MET A 1 520 ? 23.265  53.886 62.591 1.00 37.68 ? 520  MET A O   1 
ATOM   4076 C CB  . MET A 1 520 ? 24.221  56.767 63.767 1.00 40.86 ? 520  MET A CB  1 
ATOM   4077 C CG  . MET A 1 520 ? 25.077  57.424 64.864 1.00 44.34 ? 520  MET A CG  1 
ATOM   4078 S SD  . MET A 1 520 ? 25.593  56.250 66.193 1.00 49.77 ? 520  MET A SD  1 
ATOM   4079 C CE  . MET A 1 520 ? 27.242  55.833 65.683 1.00 49.92 ? 520  MET A CE  1 
ATOM   4080 N N   . CYS A 1 521 ? 23.849  55.233 60.922 1.00 35.70 ? 521  CYS A N   1 
ATOM   4081 C CA  . CYS A 1 521 ? 22.916  54.563 60.043 1.00 35.52 ? 521  CYS A CA  1 
ATOM   4082 C C   . CYS A 1 521 ? 23.350  53.166 59.655 1.00 35.10 ? 521  CYS A C   1 
ATOM   4083 O O   . CYS A 1 521 ? 22.506  52.324 59.351 1.00 34.98 ? 521  CYS A O   1 
ATOM   4084 C CB  . CYS A 1 521 ? 22.629  55.427 58.827 1.00 35.35 ? 521  CYS A CB  1 
ATOM   4085 S SG  . CYS A 1 521 ? 21.714  56.915 59.338 1.00 35.90 ? 521  CYS A SG  1 
ATOM   4086 N N   . VAL A 1 522 ? 24.653  52.891 59.660 1.00 35.80 ? 522  VAL A N   1 
ATOM   4087 C CA  . VAL A 1 522 ? 25.083  51.521 59.374 1.00 35.36 ? 522  VAL A CA  1 
ATOM   4088 C C   . VAL A 1 522 ? 24.546  50.667 60.544 1.00 35.31 ? 522  VAL A C   1 
ATOM   4089 O O   . VAL A 1 522 ? 24.114  49.539 60.347 1.00 34.97 ? 522  VAL A O   1 
ATOM   4090 C CB  . VAL A 1 522 ? 26.636  51.393 59.267 1.00 38.39 ? 522  VAL A CB  1 
ATOM   4091 C CG1 . VAL A 1 522 ? 27.061  49.905 59.368 1.00 38.71 ? 522  VAL A CG1 1 
ATOM   4092 C CG2 . VAL A 1 522 ? 27.120  51.962 57.914 1.00 34.47 ? 522  VAL A CG2 1 
ATOM   4093 N N   . PHE A 1 523 ? 24.538  51.217 61.754 1.00 34.28 ? 523  PHE A N   1 
ATOM   4094 C CA  . PHE A 1 523 ? 23.997  50.489 62.909 1.00 35.60 ? 523  PHE A CA  1 
ATOM   4095 C C   . PHE A 1 523 ? 22.484  50.237 62.752 1.00 36.17 ? 523  PHE A C   1 
ATOM   4096 O O   . PHE A 1 523 ? 22.016  49.097 62.877 1.00 35.83 ? 523  PHE A O   1 
ATOM   4097 C CB  . PHE A 1 523 ? 24.239  51.278 64.219 1.00 34.79 ? 523  PHE A CB  1 
ATOM   4098 C CG  . PHE A 1 523 ? 23.441  50.772 65.399 1.00 33.28 ? 523  PHE A CG  1 
ATOM   4099 C CD1 . PHE A 1 523 ? 23.879  49.670 66.131 1.00 34.72 ? 523  PHE A CD1 1 
ATOM   4100 C CD2 . PHE A 1 523 ? 22.240  51.386 65.763 1.00 34.13 ? 523  PHE A CD2 1 
ATOM   4101 C CE1 . PHE A 1 523 ? 23.143  49.173 67.213 1.00 32.99 ? 523  PHE A CE1 1 
ATOM   4102 C CE2 . PHE A 1 523 ? 21.483  50.910 66.835 1.00 33.38 ? 523  PHE A CE2 1 
ATOM   4103 C CZ  . PHE A 1 523 ? 21.938  49.791 67.568 1.00 36.44 ? 523  PHE A CZ  1 
ATOM   4104 N N   . TRP A 1 524 ? 21.724  51.298 62.484 1.00 36.01 ? 524  TRP A N   1 
ATOM   4105 C CA  . TRP A 1 524 ? 20.277  51.150 62.327 1.00 36.59 ? 524  TRP A CA  1 
ATOM   4106 C C   . TRP A 1 524 ? 19.823  50.428 61.077 1.00 36.61 ? 524  TRP A C   1 
ATOM   4107 O O   . TRP A 1 524 ? 18.839  49.699 61.112 1.00 36.83 ? 524  TRP A O   1 
ATOM   4108 C CB  . TRP A 1 524 ? 19.555  52.506 62.355 1.00 32.88 ? 524  TRP A CB  1 
ATOM   4109 C CG  . TRP A 1 524 ? 19.628  53.199 63.674 1.00 31.25 ? 524  TRP A CG  1 
ATOM   4110 C CD1 . TRP A 1 524 ? 20.452  54.222 63.998 1.00 30.87 ? 524  TRP A CD1 1 
ATOM   4111 C CD2 . TRP A 1 524 ? 18.890  52.881 64.863 1.00 28.50 ? 524  TRP A CD2 1 
ATOM   4112 N NE1 . TRP A 1 524 ? 20.285  54.567 65.309 1.00 31.26 ? 524  TRP A NE1 1 
ATOM   4113 C CE2 . TRP A 1 524 ? 19.329  53.760 65.868 1.00 28.99 ? 524  TRP A CE2 1 
ATOM   4114 C CE3 . TRP A 1 524 ? 17.912  51.940 65.174 1.00 27.20 ? 524  TRP A CE3 1 
ATOM   4115 C CZ2 . TRP A 1 524 ? 18.819  53.731 67.178 1.00 28.66 ? 524  TRP A CZ2 1 
ATOM   4116 C CZ3 . TRP A 1 524 ? 17.402  51.905 66.475 1.00 29.66 ? 524  TRP A CZ3 1 
ATOM   4117 C CH2 . TRP A 1 524 ? 17.857  52.799 67.462 1.00 29.35 ? 524  TRP A CH2 1 
ATOM   4118 N N   . ASN A 1 525 ? 20.531  50.609 59.974 1.00 36.98 ? 525  ASN A N   1 
ATOM   4119 C CA  . ASN A 1 525 ? 20.080  49.978 58.748 1.00 38.93 ? 525  ASN A CA  1 
ATOM   4120 C C   . ASN A 1 525 ? 20.675  48.611 58.452 1.00 39.16 ? 525  ASN A C   1 
ATOM   4121 O O   . ASN A 1 525 ? 20.080  47.826 57.744 1.00 39.03 ? 525  ASN A O   1 
ATOM   4122 C CB  . ASN A 1 525 ? 20.328  50.906 57.549 1.00 37.27 ? 525  ASN A CB  1 
ATOM   4123 C CG  . ASN A 1 525 ? 19.595  52.235 57.674 1.00 40.25 ? 525  ASN A CG  1 
ATOM   4124 O OD1 . ASN A 1 525 ? 18.544  52.320 58.309 1.00 39.80 ? 525  ASN A OD1 1 
ATOM   4125 N ND2 . ASN A 1 525 ? 20.144  53.280 57.057 1.00 39.43 ? 525  ASN A ND2 1 
ATOM   4126 N N   . GLN A 1 526 ? 21.840  48.314 58.994 1.00 39.14 ? 526  GLN A N   1 
ATOM   4127 C CA  . GLN A 1 526 ? 22.455  47.039 58.683 1.00 39.64 ? 526  GLN A CA  1 
ATOM   4128 C C   . GLN A 1 526 ? 22.617  46.134 59.886 1.00 39.01 ? 526  GLN A C   1 
ATOM   4129 O O   . GLN A 1 526 ? 22.148  45.000 59.872 1.00 39.09 ? 526  GLN A O   1 
ATOM   4130 C CB  . GLN A 1 526 ? 23.803  47.278 57.981 1.00 41.06 ? 526  GLN A CB  1 
ATOM   4131 C CG  . GLN A 1 526 ? 23.656  48.153 56.697 1.00 47.07 ? 526  GLN A CG  1 
ATOM   4132 C CD  . GLN A 1 526 ? 24.998  48.526 56.041 1.00 46.50 ? 526  GLN A CD  1 
ATOM   4133 N N   . PHE A 1 527 ? 23.234  46.636 60.952 1.00 38.34 ? 527  PHE A N   1 
ATOM   4134 C CA  . PHE A 1 527 ? 23.450  45.800 62.116 1.00 36.68 ? 527  PHE A CA  1 
ATOM   4135 C C   . PHE A 1 527 ? 22.229  45.437 62.972 1.00 37.42 ? 527  PHE A C   1 
ATOM   4136 O O   . PHE A 1 527 ? 21.942  44.248 63.171 1.00 38.33 ? 527  PHE A O   1 
ATOM   4137 C CB  . PHE A 1 527 ? 24.517  46.415 63.029 1.00 36.06 ? 527  PHE A CB  1 
ATOM   4138 C CG  . PHE A 1 527 ? 24.874  45.537 64.198 1.00 33.17 ? 527  PHE A CG  1 
ATOM   4139 C CD1 . PHE A 1 527 ? 25.605  44.364 64.004 1.00 33.21 ? 527  PHE A CD1 1 
ATOM   4140 C CD2 . PHE A 1 527 ? 24.420  45.842 65.473 1.00 31.65 ? 527  PHE A CD2 1 
ATOM   4141 C CE1 . PHE A 1 527 ? 25.873  43.505 65.061 1.00 33.72 ? 527  PHE A CE1 1 
ATOM   4142 C CE2 . PHE A 1 527 ? 24.682  44.988 66.543 1.00 33.25 ? 527  PHE A CE2 1 
ATOM   4143 C CZ  . PHE A 1 527 ? 25.408  43.817 66.336 1.00 34.49 ? 527  PHE A CZ  1 
ATOM   4144 N N   . LEU A 1 528 ? 21.511  46.434 63.484 1.00 36.15 ? 528  LEU A N   1 
ATOM   4145 C CA  . LEU A 1 528 ? 20.383  46.124 64.350 1.00 37.41 ? 528  LEU A CA  1 
ATOM   4146 C C   . LEU A 1 528 ? 19.349  45.178 63.725 1.00 39.34 ? 528  LEU A C   1 
ATOM   4147 O O   . LEU A 1 528 ? 18.914  44.228 64.369 1.00 39.97 ? 528  LEU A O   1 
ATOM   4148 C CB  . LEU A 1 528 ? 19.699  47.407 64.832 1.00 34.20 ? 528  LEU A CB  1 
ATOM   4149 C CG  . LEU A 1 528 ? 18.661  47.215 65.951 1.00 36.63 ? 528  LEU A CG  1 
ATOM   4150 C CD1 . LEU A 1 528 ? 19.288  46.501 67.196 1.00 35.16 ? 528  LEU A CD1 1 
ATOM   4151 C CD2 . LEU A 1 528 ? 18.111  48.585 66.351 1.00 35.71 ? 528  LEU A CD2 1 
ATOM   4152 N N   . PRO A 1 529 ? 18.933  45.436 62.470 1.00 40.56 ? 529  PRO A N   1 
ATOM   4153 C CA  . PRO A 1 529 ? 17.946  44.556 61.828 1.00 42.27 ? 529  PRO A CA  1 
ATOM   4154 C C   . PRO A 1 529 ? 18.467  43.119 61.823 1.00 42.30 ? 529  PRO A C   1 
ATOM   4155 O O   . PRO A 1 529 ? 17.747  42.169 62.129 1.00 41.69 ? 529  PRO A O   1 
ATOM   4156 C CB  . PRO A 1 529 ? 17.830  45.126 60.406 1.00 40.93 ? 529  PRO A CB  1 
ATOM   4157 C CG  . PRO A 1 529 ? 18.258  46.564 60.559 1.00 41.22 ? 529  PRO A CG  1 
ATOM   4158 C CD  . PRO A 1 529 ? 19.393  46.488 61.540 1.00 40.26 ? 529  PRO A CD  1 
ATOM   4159 N N   . LYS A 1 530 ? 19.738  42.974 61.485 1.00 42.85 ? 530  LYS A N   1 
ATOM   4160 C CA  . LYS A 1 530 ? 20.365  41.658 61.456 1.00 45.15 ? 530  LYS A CA  1 
ATOM   4161 C C   . LYS A 1 530 ? 20.308  41.008 62.862 1.00 45.67 ? 530  LYS A C   1 
ATOM   4162 O O   . LYS A 1 530 ? 19.938  39.843 63.012 1.00 45.86 ? 530  LYS A O   1 
ATOM   4163 C CB  . LYS A 1 530 ? 21.815  41.811 60.977 1.00 45.73 ? 530  LYS A CB  1 
ATOM   4164 C CG  . LYS A 1 530 ? 22.497  40.531 60.571 1.00 47.52 ? 530  LYS A CG  1 
ATOM   4165 N N   . LEU A 1 531 ? 20.640  41.774 63.893 1.00 44.99 ? 531  LEU A N   1 
ATOM   4166 C CA  . LEU A 1 531 ? 20.629  41.253 65.250 1.00 45.48 ? 531  LEU A CA  1 
ATOM   4167 C C   . LEU A 1 531 ? 19.234  40.835 65.718 1.00 46.74 ? 531  LEU A C   1 
ATOM   4168 O O   . LEU A 1 531 ? 19.069  39.788 66.352 1.00 46.11 ? 531  LEU A O   1 
ATOM   4169 C CB  . LEU A 1 531 ? 21.225  42.302 66.191 1.00 43.60 ? 531  LEU A CB  1 
ATOM   4170 C CG  . LEU A 1 531 ? 21.252  42.081 67.703 1.00 42.48 ? 531  LEU A CG  1 
ATOM   4171 C CD1 . LEU A 1 531 ? 22.220  43.073 68.342 1.00 42.03 ? 531  LEU A CD1 1 
ATOM   4172 C CD2 . LEU A 1 531 ? 19.866  42.270 68.283 1.00 42.13 ? 531  LEU A CD2 1 
ATOM   4173 N N   . LEU A 1 532 ? 18.234  41.655 65.415 1.00 47.21 ? 532  LEU A N   1 
ATOM   4174 C CA  . LEU A 1 532 ? 16.875  41.347 65.825 1.00 48.95 ? 532  LEU A CA  1 
ATOM   4175 C C   . LEU A 1 532 ? 16.357  40.112 65.084 1.00 51.04 ? 532  LEU A C   1 
ATOM   4176 O O   . LEU A 1 532 ? 15.546  39.360 65.625 1.00 51.78 ? 532  LEU A O   1 
ATOM   4177 C CB  . LEU A 1 532 ? 15.947  42.554 65.589 1.00 45.80 ? 532  LEU A CB  1 
ATOM   4178 C CG  . LEU A 1 532 ? 16.218  43.793 66.456 1.00 44.07 ? 532  LEU A CG  1 
ATOM   4179 C CD1 . LEU A 1 532 ? 15.397  44.997 65.987 1.00 40.78 ? 532  LEU A CD1 1 
ATOM   4180 C CD2 . LEU A 1 532 ? 15.918  43.460 67.892 1.00 43.49 ? 532  LEU A CD2 1 
ATOM   4181 N N   . ASN A 1 533 ? 16.835  39.887 63.864 1.00 53.78 ? 533  ASN A N   1 
ATOM   4182 C CA  . ASN A 1 533 ? 16.394  38.723 63.090 1.00 57.45 ? 533  ASN A CA  1 
ATOM   4183 C C   . ASN A 1 533 ? 17.098  37.432 63.513 1.00 59.80 ? 533  ASN A C   1 
ATOM   4184 O O   . ASN A 1 533 ? 16.535  36.348 63.397 1.00 60.43 ? 533  ASN A O   1 
ATOM   4185 C CB  . ASN A 1 533 ? 16.613  38.947 61.587 1.00 57.34 ? 533  ASN A CB  1 
ATOM   4186 N N   . ALA A 1 534 ? 18.328  37.544 63.998 1.00 61.68 ? 534  ALA A N   1 
ATOM   4187 C CA  . ALA A 1 534 ? 19.064  36.367 64.413 1.00 63.29 ? 534  ALA A CA  1 
ATOM   4188 C C   . ALA A 1 534 ? 18.593  35.931 65.781 1.00 65.50 ? 534  ALA A C   1 
ATOM   4189 O O   . ALA A 1 534 ? 18.545  34.746 66.076 1.00 66.56 ? 534  ALA A O   1 
ATOM   4190 C CB  . ALA A 1 534 ? 20.549  36.661 64.446 1.00 62.08 ? 534  ALA A CB  1 
ATOM   4191 N N   . THR A 1 535 ? 18.234  36.901 66.612 1.00 68.02 ? 535  THR A N   1 
ATOM   4192 C CA  . THR A 1 535 ? 17.783  36.626 67.971 1.00 69.67 ? 535  THR A CA  1 
ATOM   4193 C C   . THR A 1 535 ? 16.255  36.566 68.072 1.00 71.67 ? 535  THR A C   1 
ATOM   4194 O O   . THR A 1 535 ? 15.614  36.217 67.053 1.00 72.21 ? 535  THR A O   1 
ATOM   4195 C CB  . THR A 1 535 ? 18.325  37.699 68.962 1.00 70.02 ? 535  THR A CB  1 
ATOM   4196 O OG1 . THR A 1 535 ? 17.740  38.973 68.669 1.00 69.06 ? 535  THR A OG1 1 
ATOM   4197 C CG2 . THR A 1 535 ? 19.840  37.809 68.848 1.00 69.46 ? 535  THR A CG2 1 
HETATM 4198 C C1  . NAG B 2 .   ? -18.858 83.066 49.963 1.00 76.00 ? 1536 NAG A C1  1 
HETATM 4199 C C2  . NAG B 2 .   ? -18.215 83.899 51.114 1.00 78.89 ? 1536 NAG A C2  1 
HETATM 4200 C C3  . NAG B 2 .   ? -19.091 85.144 51.395 1.00 80.46 ? 1536 NAG A C3  1 
HETATM 4201 C C4  . NAG B 2 .   ? -19.301 85.936 50.101 1.00 80.36 ? 1536 NAG A C4  1 
HETATM 4202 C C5  . NAG B 2 .   ? -19.895 85.016 49.027 1.00 79.46 ? 1536 NAG A C5  1 
HETATM 4203 C C6  . NAG B 2 .   ? -20.063 85.708 47.686 1.00 78.90 ? 1536 NAG A C6  1 
HETATM 4204 C C7  . NAG B 2 .   ? -18.718 83.235 53.440 1.00 81.83 ? 1536 NAG A C7  1 
HETATM 4205 C C8  . NAG B 2 .   ? -18.460 84.449 54.326 1.00 81.79 ? 1536 NAG A C8  1 
HETATM 4206 N N2  . NAG B 2 .   ? -17.993 83.100 52.322 1.00 81.18 ? 1536 NAG A N2  1 
HETATM 4207 O O3  . NAG B 2 .   ? -18.470 85.983 52.357 1.00 82.12 ? 1536 NAG A O3  1 
HETATM 4208 O O4  . NAG B 2 .   ? -20.169 87.035 50.339 1.00 80.75 ? 1536 NAG A O4  1 
HETATM 4209 O O5  . NAG B 2 .   ? -19.019 83.893 48.803 1.00 78.34 ? 1536 NAG A O5  1 
HETATM 4210 O O6  . NAG B 2 .   ? -20.744 84.865 46.769 1.00 78.59 ? 1536 NAG A O6  1 
HETATM 4211 O O7  . NAG B 2 .   ? -19.543 82.387 53.807 1.00 82.18 ? 1536 NAG A O7  1 
HETATM 4212 C C1  . NAG C 2 .   ? 18.682  61.914 33.567 1.00 53.89 ? 1537 NAG A C1  1 
HETATM 4213 C C2  . NAG C 2 .   ? 20.202  61.831 33.704 1.00 55.38 ? 1537 NAG A C2  1 
HETATM 4214 C C3  . NAG C 2 .   ? 20.910  62.410 32.477 1.00 57.29 ? 1537 NAG A C3  1 
HETATM 4215 C C4  . NAG C 2 .   ? 20.346  61.817 31.163 1.00 58.28 ? 1537 NAG A C4  1 
HETATM 4216 C C5  . NAG C 2 .   ? 18.817  61.943 31.154 1.00 58.09 ? 1537 NAG A C5  1 
HETATM 4217 C C6  . NAG C 2 .   ? 18.197  61.281 29.932 1.00 57.01 ? 1537 NAG A C6  1 
HETATM 4218 C C7  . NAG C 2 .   ? 21.048  61.939 35.972 1.00 56.41 ? 1537 NAG A C7  1 
HETATM 4219 C C8  . NAG C 2 .   ? 21.543  62.811 37.113 1.00 54.54 ? 1537 NAG A C8  1 
HETATM 4220 N N2  . NAG C 2 .   ? 20.613  62.572 34.880 1.00 56.81 ? 1537 NAG A N2  1 
HETATM 4221 O O3  . NAG C 2 .   ? 22.300  62.136 32.580 1.00 57.52 ? 1537 NAG A O3  1 
HETATM 4222 O O4  . NAG C 2 .   ? 20.893  62.498 30.032 1.00 60.01 ? 1537 NAG A O4  1 
HETATM 4223 O O5  . NAG C 2 .   ? 18.255  61.305 32.334 1.00 56.86 ? 1537 NAG A O5  1 
HETATM 4224 O O6  . NAG C 2 .   ? 17.223  60.306 30.284 1.00 59.97 ? 1537 NAG A O6  1 
HETATM 4225 O O7  . NAG C 2 .   ? 21.057  60.708 36.090 1.00 55.45 ? 1537 NAG A O7  1 
HETATM 4226 C C1  . HUB D 3 .   ? 1.068   68.771 61.163 1.00 31.48 ? 1538 HUB A C1  1 
HETATM 4227 O O1  . HUB D 3 .   ? 0.440   69.208 60.196 1.00 33.46 ? 1538 HUB A O1  1 
HETATM 4228 N N1  . HUB D 3 .   ? 2.353   68.265 60.983 1.00 33.74 ? 1538 HUB A N1  1 
HETATM 4229 C C2  . HUB D 3 .   ? 0.544   68.745 62.517 1.00 31.60 ? 1538 HUB A C2  1 
HETATM 4230 C C3  . HUB D 3 .   ? 1.302   68.245 63.545 1.00 31.10 ? 1538 HUB A C3  1 
HETATM 4231 C C4  . HUB D 3 .   ? 2.635   67.728 63.356 1.00 32.94 ? 1538 HUB A C4  1 
HETATM 4232 C C5  . HUB D 3 .   ? 3.149   67.734 62.013 1.00 32.93 ? 1538 HUB A C5  1 
HETATM 4233 C C6  . HUB D 3 .   ? 4.520   67.211 61.630 1.00 34.50 ? 1538 HUB A C6  1 
HETATM 4234 C C7  . HUB D 3 .   ? 5.312   66.528 62.852 1.00 34.18 ? 1538 HUB A C7  1 
HETATM 4235 C C8  . HUB D 3 .   ? 4.889   65.046 63.024 1.00 33.61 ? 1538 HUB A C8  1 
HETATM 4236 C C9  . HUB D 3 .   ? 5.125   69.456 65.431 1.00 34.92 ? 1538 HUB A C9  1 
HETATM 4237 C C10 . HUB D 3 .   ? 5.432   68.738 64.106 1.00 36.48 ? 1538 HUB A C10 1 
HETATM 4238 C C11 . HUB D 3 .   ? 5.024   67.256 64.187 1.00 34.12 ? 1538 HUB A C11 1 
HETATM 4239 C C12 . HUB D 3 .   ? 3.516   67.141 64.569 1.00 35.05 ? 1538 HUB A C12 1 
HETATM 4240 N N2  . HUB D 3 .   ? 3.239   67.879 65.858 1.00 37.65 ? 1538 HUB A N2  1 
HETATM 4241 C C13 . HUB D 3 .   ? 3.112   65.642 64.749 1.00 33.87 ? 1538 HUB A C13 1 
HETATM 4242 C C14 . HUB D 3 .   ? 3.887   64.648 63.892 1.00 33.93 ? 1538 HUB A C14 1 
HETATM 4243 C C15 . HUB D 3 .   ? 3.465   63.214 64.087 1.00 33.56 ? 1538 HUB A C15 1 
HETATM 4244 C C90 . HUB D 3 .   ? 3.651   69.386 65.801 1.00 35.57 ? 1538 HUB A C90 1 
HETATM 4245 O O   . HOH E 4 .   ? -6.087  83.676 38.739 1.00 37.35 ? 2001 HOH A O   1 
HETATM 4246 O O   . HOH E 4 .   ? -5.737  88.670 42.039 1.00 59.00 ? 2002 HOH A O   1 
HETATM 4247 O O   . HOH E 4 .   ? -6.088  66.040 31.717 1.00 47.64 ? 2003 HOH A O   1 
HETATM 4248 O O   . HOH E 4 .   ? -0.154  61.224 72.646 1.00 54.37 ? 2004 HOH A O   1 
HETATM 4249 O O   . HOH E 4 .   ? 6.375   92.711 47.774 1.00 58.08 ? 2005 HOH A O   1 
HETATM 4250 O O   . HOH E 4 .   ? -3.930  85.341 39.351 1.00 39.74 ? 2006 HOH A O   1 
HETATM 4251 O O   . HOH E 4 .   ? -12.533 64.253 41.619 1.00 42.17 ? 2007 HOH A O   1 
HETATM 4252 O O   . HOH E 4 .   ? -15.202 67.462 49.193 1.00 32.82 ? 2008 HOH A O   1 
HETATM 4253 O O   . HOH E 4 .   ? 7.141   45.659 62.365 1.00 59.33 ? 2009 HOH A O   1 
HETATM 4254 O O   . HOH E 4 .   ? -15.715 60.327 48.759 1.00 43.29 ? 2010 HOH A O   1 
HETATM 4255 O O   . HOH E 4 .   ? -21.245 61.556 50.218 1.00 54.01 ? 2011 HOH A O   1 
HETATM 4256 O O   . HOH E 4 .   ? -24.659 57.661 54.337 1.00 60.16 ? 2012 HOH A O   1 
HETATM 4257 O O   . HOH E 4 .   ? -24.362 55.972 58.880 1.00 65.71 ? 2013 HOH A O   1 
HETATM 4258 O O   . HOH E 4 .   ? -21.472 60.975 62.916 1.00 63.24 ? 2014 HOH A O   1 
HETATM 4259 O O   . HOH E 4 .   ? 1.679   62.337 70.768 1.00 55.75 ? 2015 HOH A O   1 
HETATM 4260 O O   . HOH E 4 .   ? -10.474 55.803 44.959 1.00 50.42 ? 2016 HOH A O   1 
HETATM 4261 O O   . HOH E 4 .   ? -17.980 68.706 48.705 1.00 45.83 ? 2017 HOH A O   1 
HETATM 4262 O O   . HOH E 4 .   ? -25.070 71.561 40.558 1.00 60.66 ? 2018 HOH A O   1 
HETATM 4263 O O   . HOH E 4 .   ? 8.496   88.825 42.756 1.00 59.85 ? 2019 HOH A O   1 
HETATM 4264 O O   . HOH E 4 .   ? 11.219  79.230 39.829 1.00 61.56 ? 2020 HOH A O   1 
HETATM 4265 O O   . HOH E 4 .   ? -20.149 75.293 37.235 1.00 47.46 ? 2021 HOH A O   1 
HETATM 4266 O O   . HOH E 4 .   ? -24.034 80.273 41.631 1.00 65.49 ? 2022 HOH A O   1 
HETATM 4267 O O   . HOH E 4 .   ? -20.269 77.395 47.158 1.00 53.66 ? 2023 HOH A O   1 
HETATM 4268 O O   . HOH E 4 .   ? -19.068 77.175 49.538 1.00 53.15 ? 2024 HOH A O   1 
HETATM 4269 O O   . HOH E 4 .   ? -14.412 78.135 50.053 1.00 57.69 ? 2025 HOH A O   1 
HETATM 4270 O O   . HOH E 4 .   ? -10.310 81.614 55.358 1.00 41.72 ? 2026 HOH A O   1 
HETATM 4271 O O   . HOH E 4 .   ? -7.572  70.297 56.325 1.00 36.00 ? 2027 HOH A O   1 
HETATM 4272 O O   . HOH E 4 .   ? -12.321 63.137 59.161 1.00 37.65 ? 2028 HOH A O   1 
HETATM 4273 O O   . HOH E 4 .   ? -16.565 68.330 65.238 1.00 59.44 ? 2029 HOH A O   1 
HETATM 4274 O O   . HOH E 4 .   ? -9.460  62.251 59.611 1.00 34.49 ? 2030 HOH A O   1 
HETATM 4275 O O   . HOH E 4 .   ? -8.804  61.044 63.465 1.00 32.36 ? 2031 HOH A O   1 
HETATM 4276 O O   . HOH E 4 .   ? -0.919  65.589 72.857 1.00 47.28 ? 2032 HOH A O   1 
HETATM 4277 O O   . HOH E 4 .   ? -8.748  65.099 70.540 1.00 43.51 ? 2033 HOH A O   1 
HETATM 4278 O O   . HOH E 4 .   ? -7.887  66.621 72.308 1.00 62.81 ? 2034 HOH A O   1 
HETATM 4279 O O   . HOH E 4 .   ? -4.968  80.248 31.914 1.00 50.01 ? 2035 HOH A O   1 
HETATM 4280 O O   . HOH E 4 .   ? -3.344  69.095 79.311 1.00 56.21 ? 2036 HOH A O   1 
HETATM 4281 O O   . HOH E 4 .   ? 3.918   64.824 79.601 1.00 61.00 ? 2037 HOH A O   1 
HETATM 4282 O O   . HOH E 4 .   ? -1.394  72.191 73.135 1.00 42.11 ? 2038 HOH A O   1 
HETATM 4283 O O   . HOH E 4 .   ? 1.017   70.442 68.328 1.00 54.08 ? 2039 HOH A O   1 
HETATM 4284 O O   . HOH E 4 .   ? 0.582   77.378 61.998 1.00 40.03 ? 2040 HOH A O   1 
HETATM 4285 O O   . HOH E 4 .   ? -1.215  79.573 66.736 1.00 63.85 ? 2041 HOH A O   1 
HETATM 4286 O O   . HOH E 4 .   ? -3.220  76.192 64.285 1.00 47.80 ? 2042 HOH A O   1 
HETATM 4287 O O   . HOH E 4 .   ? -3.633  68.204 66.028 1.00 50.05 ? 2043 HOH A O   1 
HETATM 4288 O O   . HOH E 4 .   ? -5.640  76.866 66.581 1.00 56.14 ? 2044 HOH A O   1 
HETATM 4289 O O   . HOH E 4 .   ? 16.579  48.217 56.336 1.00 51.77 ? 2045 HOH A O   1 
HETATM 4290 O O   . HOH E 4 .   ? -10.884 72.413 66.898 1.00 58.36 ? 2046 HOH A O   1 
HETATM 4291 O O   . HOH E 4 .   ? -6.916  81.191 59.215 1.00 50.14 ? 2047 HOH A O   1 
HETATM 4292 O O   . HOH E 4 .   ? 4.940   47.652 62.871 1.00 44.02 ? 2048 HOH A O   1 
HETATM 4293 O O   . HOH E 4 .   ? 2.443   39.641 59.117 1.00 54.90 ? 2049 HOH A O   1 
HETATM 4294 O O   . HOH E 4 .   ? -4.800  38.431 60.356 1.00 59.49 ? 2050 HOH A O   1 
HETATM 4295 O O   . HOH E 4 .   ? -1.902  39.535 64.754 1.00 69.75 ? 2051 HOH A O   1 
HETATM 4296 O O   . HOH E 4 .   ? 3.638   44.454 65.674 1.00 56.51 ? 2052 HOH A O   1 
HETATM 4297 O O   . HOH E 4 .   ? -14.477 76.907 60.346 1.00 69.93 ? 2053 HOH A O   1 
HETATM 4298 O O   . HOH E 4 .   ? -14.796 59.961 57.042 1.00 33.66 ? 2054 HOH A O   1 
HETATM 4299 O O   . HOH E 4 .   ? -13.457 62.438 56.766 1.00 36.79 ? 2055 HOH A O   1 
HETATM 4300 O O   . HOH E 4 .   ? -17.929 65.568 61.107 1.00 44.11 ? 2056 HOH A O   1 
HETATM 4301 O O   . HOH E 4 .   ? -20.085 59.791 59.097 1.00 48.42 ? 2057 HOH A O   1 
HETATM 4302 O O   . HOH E 4 .   ? -15.375 66.459 51.663 1.00 36.39 ? 2058 HOH A O   1 
HETATM 4303 O O   . HOH E 4 .   ? -9.525  70.066 54.577 1.00 37.03 ? 2059 HOH A O   1 
HETATM 4304 O O   . HOH E 4 .   ? -1.222  92.125 38.652 1.00 76.81 ? 2060 HOH A O   1 
HETATM 4305 O O   . HOH E 4 .   ? -4.538  87.504 34.630 1.00 58.07 ? 2061 HOH A O   1 
HETATM 4306 O O   . HOH E 4 .   ? 3.764   81.662 32.068 1.00 47.33 ? 2062 HOH A O   1 
HETATM 4307 O O   . HOH E 4 .   ? -2.598  76.769 30.911 1.00 41.29 ? 2063 HOH A O   1 
HETATM 4308 O O   . HOH E 4 .   ? 4.224   43.747 55.658 1.00 48.42 ? 2064 HOH A O   1 
HETATM 4309 O O   . HOH E 4 .   ? -0.667  74.691 31.382 1.00 46.59 ? 2065 HOH A O   1 
HETATM 4310 O O   . HOH E 4 .   ? 20.905  71.264 71.874 1.00 53.45 ? 2066 HOH A O   1 
HETATM 4311 O O   . HOH E 4 .   ? 0.256   65.799 68.520 1.00 39.71 ? 2067 HOH A O   1 
HETATM 4312 O O   . HOH E 4 .   ? -6.647  61.575 64.880 1.00 30.00 ? 2068 HOH A O   1 
HETATM 4313 O O   . HOH E 4 .   ? 3.113   63.504 69.585 1.00 51.92 ? 2069 HOH A O   1 
HETATM 4314 O O   . HOH E 4 .   ? 1.085   64.583 70.195 1.00 56.26 ? 2070 HOH A O   1 
HETATM 4315 O O   . HOH E 4 .   ? -7.198  68.042 57.701 1.00 32.52 ? 2071 HOH A O   1 
HETATM 4316 O O   . HOH E 4 .   ? -3.989  70.039 62.206 1.00 27.01 ? 2072 HOH A O   1 
HETATM 4317 O O   . HOH E 4 .   ? -8.156  71.411 52.636 1.00 46.40 ? 2073 HOH A O   1 
HETATM 4318 O O   . HOH E 4 .   ? -1.944  75.320 52.768 1.00 40.17 ? 2074 HOH A O   1 
HETATM 4319 O O   . HOH E 4 .   ? 13.636  76.232 79.354 1.00 55.56 ? 2075 HOH A O   1 
HETATM 4320 O O   . HOH E 4 .   ? 19.630  73.870 76.972 1.00 57.37 ? 2076 HOH A O   1 
HETATM 4321 O O   . HOH E 4 .   ? -2.232  77.933 62.288 1.00 41.47 ? 2077 HOH A O   1 
HETATM 4322 O O   . HOH E 4 .   ? -4.648  80.231 62.710 1.00 49.78 ? 2078 HOH A O   1 
HETATM 4323 O O   . HOH E 4 .   ? -4.187  80.546 58.285 1.00 57.99 ? 2079 HOH A O   1 
HETATM 4324 O O   . HOH E 4 .   ? 0.816   83.361 57.977 1.00 54.08 ? 2080 HOH A O   1 
HETATM 4325 O O   . HOH E 4 .   ? 3.611   68.418 58.286 1.00 29.15 ? 2081 HOH A O   1 
HETATM 4326 O O   . HOH E 4 .   ? 4.126   80.444 51.224 1.00 35.50 ? 2082 HOH A O   1 
HETATM 4327 O O   . HOH E 4 .   ? -3.712  85.664 53.881 1.00 48.85 ? 2083 HOH A O   1 
HETATM 4328 O O   . HOH E 4 .   ? 24.805  47.961 77.359 1.00 68.21 ? 2084 HOH A O   1 
HETATM 4329 O O   . HOH E 4 .   ? 11.445  87.309 44.064 1.00 63.16 ? 2085 HOH A O   1 
HETATM 4330 O O   . HOH E 4 .   ? 13.158  83.251 47.215 1.00 48.76 ? 2086 HOH A O   1 
HETATM 4331 O O   . HOH E 4 .   ? 8.772   79.763 38.094 1.00 63.51 ? 2087 HOH A O   1 
HETATM 4332 O O   . HOH E 4 .   ? 24.787  66.110 64.687 1.00 48.18 ? 2088 HOH A O   1 
HETATM 4333 O O   . HOH E 4 .   ? -1.513  69.525 52.726 1.00 29.89 ? 2089 HOH A O   1 
HETATM 4334 O O   . HOH E 4 .   ? -0.687  63.094 58.712 1.00 26.11 ? 2090 HOH A O   1 
HETATM 4335 O O   . HOH E 4 .   ? -13.469 57.874 56.405 1.00 31.36 ? 2091 HOH A O   1 
HETATM 4336 O O   . HOH E 4 .   ? -4.355  51.856 56.301 1.00 33.23 ? 2092 HOH A O   1 
HETATM 4337 O O   . HOH E 4 .   ? -3.775  51.007 59.576 1.00 31.78 ? 2093 HOH A O   1 
HETATM 4338 O O   . HOH E 4 .   ? -5.708  45.020 57.369 1.00 38.26 ? 2094 HOH A O   1 
HETATM 4339 O O   . HOH E 4 .   ? -6.482  49.532 61.025 1.00 28.95 ? 2095 HOH A O   1 
HETATM 4340 O O   . HOH E 4 .   ? -6.634  46.166 51.667 1.00 57.58 ? 2096 HOH A O   1 
HETATM 4341 O O   . HOH E 4 .   ? -9.366  45.031 51.162 1.00 48.12 ? 2097 HOH A O   1 
HETATM 4342 O O   . HOH E 4 .   ? 18.035  77.816 78.385 1.00 59.93 ? 2098 HOH A O   1 
HETATM 4343 O O   . HOH E 4 .   ? -13.894 51.293 49.405 1.00 43.04 ? 2099 HOH A O   1 
HETATM 4344 O O   . HOH E 4 .   ? -22.826 48.289 53.908 1.00 72.45 ? 2100 HOH A O   1 
HETATM 4345 O O   . HOH E 4 .   ? -7.059  50.266 49.444 1.00 49.53 ? 2101 HOH A O   1 
HETATM 4346 O O   . HOH E 4 .   ? -10.021 51.909 54.787 1.00 33.09 ? 2102 HOH A O   1 
HETATM 4347 O O   . HOH E 4 .   ? -7.990  57.897 44.519 1.00 43.14 ? 2103 HOH A O   1 
HETATM 4348 O O   . HOH E 4 .   ? 14.789  92.848 60.287 1.00 67.61 ? 2104 HOH A O   1 
HETATM 4349 O O   . HOH E 4 .   ? -3.463  51.388 43.792 1.00 46.05 ? 2105 HOH A O   1 
HETATM 4350 O O   . HOH E 4 .   ? -4.451  64.051 34.108 1.00 53.54 ? 2106 HOH A O   1 
HETATM 4351 O O   . HOH E 4 .   ? -9.787  64.817 38.144 1.00 45.48 ? 2107 HOH A O   1 
HETATM 4352 O O   . HOH E 4 .   ? -8.734  61.628 35.123 1.00 47.94 ? 2108 HOH A O   1 
HETATM 4353 O O   . HOH E 4 .   ? 24.499  70.091 39.951 1.00 64.30 ? 2109 HOH A O   1 
HETATM 4354 O O   . HOH E 4 .   ? 28.207  64.702 39.083 1.00 69.50 ? 2110 HOH A O   1 
HETATM 4355 O O   . HOH E 4 .   ? -12.075 66.960 36.846 1.00 35.11 ? 2111 HOH A O   1 
HETATM 4356 O O   . HOH E 4 .   ? 24.593  59.904 39.833 1.00 49.70 ? 2112 HOH A O   1 
HETATM 4357 O O   . HOH E 4 .   ? -4.194  70.491 33.927 1.00 34.81 ? 2113 HOH A O   1 
HETATM 4358 O O   . HOH E 4 .   ? 34.083  67.261 48.895 1.00 67.21 ? 2114 HOH A O   1 
HETATM 4359 O O   . HOH E 4 .   ? 26.672  67.783 59.158 1.00 54.39 ? 2115 HOH A O   1 
HETATM 4360 O O   . HOH E 4 .   ? -7.714  79.758 31.871 1.00 58.44 ? 2116 HOH A O   1 
HETATM 4361 O O   . HOH E 4 .   ? 3.614   66.726 36.572 1.00 35.38 ? 2117 HOH A O   1 
HETATM 4362 O O   . HOH E 4 .   ? 25.749  66.127 60.358 1.00 60.66 ? 2118 HOH A O   1 
HETATM 4363 O O   . HOH E 4 .   ? 7.505   70.402 39.150 1.00 34.77 ? 2119 HOH A O   1 
HETATM 4364 O O   . HOH E 4 .   ? 4.984   61.427 60.981 1.00 32.57 ? 2120 HOH A O   1 
HETATM 4365 O O   . HOH E 4 .   ? -4.830  55.820 39.121 1.00 52.32 ? 2121 HOH A O   1 
HETATM 4366 O O   . HOH E 4 .   ? -1.436  51.079 42.496 1.00 42.03 ? 2122 HOH A O   1 
HETATM 4367 O O   . HOH E 4 .   ? 2.398   54.300 36.339 1.00 36.62 ? 2123 HOH A O   1 
HETATM 4368 O O   . HOH E 4 .   ? 0.009   57.178 37.921 1.00 47.75 ? 2124 HOH A O   1 
HETATM 4369 O O   . HOH E 4 .   ? 5.860   57.437 35.749 1.00 51.84 ? 2125 HOH A O   1 
HETATM 4370 O O   . HOH E 4 .   ? -0.882  66.406 40.018 1.00 39.88 ? 2126 HOH A O   1 
HETATM 4371 O O   . HOH E 4 .   ? 11.447  64.320 35.216 1.00 47.01 ? 2127 HOH A O   1 
HETATM 4372 O O   . HOH E 4 .   ? 12.907  65.681 33.428 1.00 50.02 ? 2128 HOH A O   1 
HETATM 4373 O O   . HOH E 4 .   ? 11.314  70.241 34.012 1.00 46.04 ? 2129 HOH A O   1 
HETATM 4374 O O   . HOH E 4 .   ? 7.315   52.226 56.338 1.00 28.42 ? 2130 HOH A O   1 
HETATM 4375 O O   . HOH E 4 .   ? 12.549  51.282 58.822 1.00 62.01 ? 2131 HOH A O   1 
HETATM 4376 O O   . HOH E 4 .   ? 14.195  50.915 55.869 1.00 50.57 ? 2132 HOH A O   1 
HETATM 4377 O O   . HOH E 4 .   ? 8.937   49.006 63.486 1.00 52.84 ? 2133 HOH A O   1 
HETATM 4378 O O   . HOH E 4 .   ? 4.899   50.445 62.047 1.00 31.85 ? 2134 HOH A O   1 
HETATM 4379 O O   . HOH E 4 .   ? 6.522   48.131 55.700 1.00 35.91 ? 2135 HOH A O   1 
HETATM 4380 O O   . HOH E 4 .   ? 3.420   45.896 61.098 1.00 32.64 ? 2136 HOH A O   1 
HETATM 4381 O O   . HOH E 4 .   ? 0.253   40.602 57.496 1.00 45.30 ? 2137 HOH A O   1 
HETATM 4382 O O   . HOH E 4 .   ? -4.653  40.098 62.838 1.00 50.45 ? 2138 HOH A O   1 
HETATM 4383 O O   . HOH E 4 .   ? 0.181   41.326 64.321 1.00 59.28 ? 2139 HOH A O   1 
HETATM 4384 O O   . HOH E 4 .   ? -9.963  40.238 62.274 1.00 64.35 ? 2140 HOH A O   1 
HETATM 4385 O O   . HOH E 4 .   ? -5.694  40.386 57.439 1.00 61.61 ? 2141 HOH A O   1 
HETATM 4386 O O   . HOH E 4 .   ? 4.497   49.717 66.592 1.00 44.01 ? 2142 HOH A O   1 
HETATM 4387 O O   . HOH E 4 .   ? 3.561   51.408 64.352 1.00 34.20 ? 2143 HOH A O   1 
HETATM 4388 O O   . HOH E 4 .   ? 3.601   47.474 65.172 1.00 35.37 ? 2144 HOH A O   1 
HETATM 4389 O O   . HOH E 4 .   ? -6.932  49.028 73.666 1.00 53.23 ? 2145 HOH A O   1 
HETATM 4390 O O   . HOH E 4 .   ? -21.393 49.441 70.274 1.00 55.43 ? 2146 HOH A O   1 
HETATM 4391 O O   . HOH E 4 .   ? -17.410 50.487 78.184 1.00 57.18 ? 2147 HOH A O   1 
HETATM 4392 O O   . HOH E 4 .   ? -21.640 46.335 67.150 1.00 48.31 ? 2148 HOH A O   1 
HETATM 4393 O O   . HOH E 4 .   ? -13.170 40.674 62.540 1.00 57.67 ? 2149 HOH A O   1 
HETATM 4394 O O   . HOH E 4 .   ? -20.715 46.734 55.959 1.00 68.62 ? 2150 HOH A O   1 
HETATM 4395 O O   . HOH E 4 .   ? -24.735 44.376 60.644 1.00 61.64 ? 2151 HOH A O   1 
HETATM 4396 O O   . HOH E 4 .   ? -20.015 56.984 59.673 1.00 41.01 ? 2152 HOH A O   1 
HETATM 4397 O O   . HOH E 4 .   ? -22.547 51.319 56.864 1.00 62.41 ? 2153 HOH A O   1 
HETATM 4398 O O   . HOH E 4 .   ? -14.243 65.357 67.182 1.00 50.00 ? 2154 HOH A O   1 
HETATM 4399 O O   . HOH E 4 .   ? -10.530 65.812 68.453 1.00 44.85 ? 2155 HOH A O   1 
HETATM 4400 O O   . HOH E 4 .   ? -17.490 63.949 67.193 1.00 49.35 ? 2156 HOH A O   1 
HETATM 4401 O O   . HOH E 4 .   ? -15.434 56.854 72.707 1.00 47.92 ? 2157 HOH A O   1 
HETATM 4402 O O   . HOH E 4 .   ? -21.511 61.342 72.239 1.00 67.57 ? 2158 HOH A O   1 
HETATM 4403 O O   . HOH E 4 .   ? -15.094 63.033 74.415 1.00 56.70 ? 2159 HOH A O   1 
HETATM 4404 O O   . HOH E 4 .   ? -8.901  58.489 64.442 1.00 33.58 ? 2160 HOH A O   1 
HETATM 4405 O O   . HOH E 4 .   ? -2.204  57.708 66.689 1.00 37.63 ? 2161 HOH A O   1 
HETATM 4406 O O   . HOH E 4 .   ? -1.923  52.079 73.099 1.00 49.26 ? 2162 HOH A O   1 
HETATM 4407 O O   . HOH E 4 .   ? 3.449   50.409 69.227 1.00 33.46 ? 2163 HOH A O   1 
HETATM 4408 O O   . HOH E 4 .   ? 5.407   47.842 75.683 1.00 46.82 ? 2164 HOH A O   1 
HETATM 4409 O O   . HOH E 4 .   ? 4.369   56.055 78.090 1.00 43.39 ? 2165 HOH A O   1 
HETATM 4410 O O   . HOH E 4 .   ? 5.157   54.210 80.569 1.00 42.19 ? 2166 HOH A O   1 
HETATM 4411 O O   . HOH E 4 .   ? 2.977   54.434 74.598 1.00 45.08 ? 2167 HOH A O   1 
HETATM 4412 O O   . HOH E 4 .   ? 8.595   49.555 74.746 1.00 48.03 ? 2168 HOH A O   1 
HETATM 4413 O O   . HOH E 4 .   ? 10.561  55.534 68.336 1.00 28.63 ? 2169 HOH A O   1 
HETATM 4414 O O   . HOH E 4 .   ? 5.067   59.533 69.836 1.00 27.99 ? 2170 HOH A O   1 
HETATM 4415 O O   . HOH E 4 .   ? 3.743   57.031 70.189 1.00 39.02 ? 2171 HOH A O   1 
HETATM 4416 O O   . HOH E 4 .   ? 7.693   48.957 65.839 1.00 48.45 ? 2172 HOH A O   1 
HETATM 4417 O O   . HOH E 4 .   ? 3.029   53.969 63.514 1.00 32.93 ? 2173 HOH A O   1 
HETATM 4418 O O   . HOH E 4 .   ? -3.890  57.052 63.788 1.00 31.63 ? 2174 HOH A O   1 
HETATM 4419 O O   . HOH E 4 .   ? -1.740  57.713 62.365 1.00 28.66 ? 2175 HOH A O   1 
HETATM 4420 O O   . HOH E 4 .   ? 1.302   43.198 54.957 1.00 38.52 ? 2176 HOH A O   1 
HETATM 4421 O O   . HOH E 4 .   ? -0.536  41.069 51.303 1.00 61.99 ? 2177 HOH A O   1 
HETATM 4422 O O   . HOH E 4 .   ? 1.824   41.892 50.593 1.00 49.35 ? 2178 HOH A O   1 
HETATM 4423 O O   . HOH E 4 .   ? 4.040   41.481 51.767 1.00 49.40 ? 2179 HOH A O   1 
HETATM 4424 O O   . HOH E 4 .   ? 7.195   46.545 53.466 1.00 44.00 ? 2180 HOH A O   1 
HETATM 4425 O O   . HOH E 4 .   ? 8.605   44.993 43.596 1.00 49.45 ? 2181 HOH A O   1 
HETATM 4426 O O   . HOH E 4 .   ? 4.805   46.409 40.371 1.00 46.99 ? 2182 HOH A O   1 
HETATM 4427 O O   . HOH E 4 .   ? 6.483   62.464 35.042 1.00 42.53 ? 2183 HOH A O   1 
HETATM 4428 O O   . HOH E 4 .   ? 9.394   50.694 36.950 1.00 52.22 ? 2184 HOH A O   1 
HETATM 4429 O O   . HOH E 4 .   ? 9.712   55.763 35.925 1.00 40.96 ? 2185 HOH A O   1 
HETATM 4430 O O   . HOH E 4 .   ? 13.606  68.673 56.958 1.00 32.67 ? 2186 HOH A O   1 
HETATM 4431 O O   . HOH E 4 .   ? 22.002  66.917 69.713 1.00 53.13 ? 2187 HOH A O   1 
HETATM 4432 O O   . HOH E 4 .   ? 21.100  69.357 70.879 1.00 53.91 ? 2188 HOH A O   1 
HETATM 4433 O O   . HOH E 4 .   ? 17.681  64.270 64.273 1.00 47.35 ? 2189 HOH A O   1 
HETATM 4434 O O   . HOH E 4 .   ? 11.805  67.194 67.285 1.00 34.27 ? 2190 HOH A O   1 
HETATM 4435 O O   . HOH E 4 .   ? 5.996   60.953 71.749 1.00 46.20 ? 2191 HOH A O   1 
HETATM 4436 O O   . HOH E 4 .   ? 6.123   66.464 78.962 1.00 54.11 ? 2192 HOH A O   1 
HETATM 4437 O O   . HOH E 4 .   ? 7.686   63.474 78.977 1.00 41.22 ? 2193 HOH A O   1 
HETATM 4438 O O   . HOH E 4 .   ? 13.385  59.147 78.809 1.00 40.51 ? 2194 HOH A O   1 
HETATM 4439 O O   . HOH E 4 .   ? 7.217   65.512 81.461 1.00 53.44 ? 2195 HOH A O   1 
HETATM 4440 O O   . HOH E 4 .   ? 12.143  67.190 83.158 1.00 49.23 ? 2196 HOH A O   1 
HETATM 4441 O O   . HOH E 4 .   ? 10.492  76.391 78.124 1.00 50.39 ? 2197 HOH A O   1 
HETATM 4442 O O   . HOH E 4 .   ? 3.655   78.043 78.300 1.00 63.78 ? 2198 HOH A O   1 
HETATM 4443 O O   . HOH E 4 .   ? 21.176  72.481 78.477 1.00 48.49 ? 2199 HOH A O   1 
HETATM 4444 O O   . HOH E 4 .   ? 16.881  72.106 84.176 1.00 57.15 ? 2200 HOH A O   1 
HETATM 4445 O O   . HOH E 4 .   ? 15.070  65.039 84.017 1.00 47.77 ? 2201 HOH A O   1 
HETATM 4446 O O   . HOH E 4 .   ? 17.005  69.267 83.976 1.00 51.96 ? 2202 HOH A O   1 
HETATM 4447 O O   . HOH E 4 .   ? 23.107  51.849 80.909 1.00 43.00 ? 2203 HOH A O   1 
HETATM 4448 O O   . HOH E 4 .   ? 12.130  60.747 86.023 1.00 52.85 ? 2204 HOH A O   1 
HETATM 4449 O O   . HOH E 4 .   ? 9.548   42.932 71.980 1.00 75.72 ? 2205 HOH A O   1 
HETATM 4450 O O   . HOH E 4 .   ? 14.750  48.430 63.697 1.00 47.10 ? 2206 HOH A O   1 
HETATM 4451 O O   . HOH E 4 .   ? 13.891  39.802 75.104 1.00 56.81 ? 2207 HOH A O   1 
HETATM 4452 O O   . HOH E 4 .   ? 17.499  39.398 74.019 1.00 53.91 ? 2208 HOH A O   1 
HETATM 4453 O O   . HOH E 4 .   ? 25.141  44.581 77.480 1.00 56.55 ? 2209 HOH A O   1 
HETATM 4454 O O   . HOH E 4 .   ? 17.877  46.372 78.791 1.00 58.51 ? 2210 HOH A O   1 
HETATM 4455 O O   . HOH E 4 .   ? 26.444  59.135 77.640 1.00 51.28 ? 2211 HOH A O   1 
HETATM 4456 O O   . HOH E 4 .   ? 22.523  59.392 86.131 1.00 54.57 ? 2212 HOH A O   1 
HETATM 4457 O O   . HOH E 4 .   ? 28.520  68.326 78.700 1.00 60.73 ? 2213 HOH A O   1 
HETATM 4458 O O   . HOH E 4 .   ? 22.675  72.245 76.432 1.00 54.39 ? 2214 HOH A O   1 
HETATM 4459 O O   . HOH E 4 .   ? 25.812  66.269 74.401 1.00 51.64 ? 2215 HOH A O   1 
HETATM 4460 O O   . HOH E 4 .   ? 23.496  70.311 73.614 1.00 52.64 ? 2216 HOH A O   1 
HETATM 4461 O O   . HOH E 4 .   ? 21.844  64.550 70.020 1.00 81.79 ? 2217 HOH A O   1 
HETATM 4462 O O   . HOH E 4 .   ? 17.187  63.732 66.908 1.00 40.02 ? 2218 HOH A O   1 
HETATM 4463 O O   . HOH E 4 .   ? 18.324  67.235 72.885 1.00 48.17 ? 2219 HOH A O   1 
HETATM 4464 O O   . HOH E 4 .   ? 18.967  65.292 68.645 1.00 47.96 ? 2220 HOH A O   1 
HETATM 4465 O O   . HOH E 4 .   ? 24.699  64.692 67.088 1.00 62.49 ? 2221 HOH A O   1 
HETATM 4466 O O   . HOH E 4 .   ? 24.021  65.536 69.227 1.00 57.05 ? 2222 HOH A O   1 
HETATM 4467 O O   . HOH E 4 .   ? 25.214  60.331 68.730 1.00 65.60 ? 2223 HOH A O   1 
HETATM 4468 O O   . HOH E 4 .   ? 19.730  62.704 65.127 1.00 47.03 ? 2224 HOH A O   1 
HETATM 4469 O O   . HOH E 4 .   ? 15.566  52.643 61.511 1.00 39.49 ? 2225 HOH A O   1 
HETATM 4470 O O   . HOH E 4 .   ? 21.445  51.994 53.980 1.00 47.41 ? 2226 HOH A O   1 
HETATM 4471 O O   . HOH E 4 .   ? 17.881  50.266 44.740 1.00 33.14 ? 2227 HOH A O   1 
HETATM 4472 O O   . HOH E 4 .   ? 20.714  46.442 51.550 1.00 59.49 ? 2228 HOH A O   1 
HETATM 4473 O O   . HOH E 4 .   ? 20.764  58.922 40.789 1.00 50.72 ? 2229 HOH A O   1 
HETATM 4474 O O   . HOH E 4 .   ? 16.459  57.526 36.011 1.00 48.67 ? 2230 HOH A O   1 
HETATM 4475 O O   . HOH E 4 .   ? 20.409  55.789 36.364 1.00 55.79 ? 2231 HOH A O   1 
HETATM 4476 O O   . HOH E 4 .   ? 18.939  58.257 35.180 1.00 55.21 ? 2232 HOH A O   1 
HETATM 4477 O O   . HOH E 4 .   ? 19.009  65.652 36.703 1.00 54.02 ? 2233 HOH A O   1 
HETATM 4478 O O   . HOH E 4 .   ? 18.241  59.804 41.758 1.00 33.76 ? 2234 HOH A O   1 
HETATM 4479 O O   . HOH E 4 .   ? 19.503  67.429 38.422 1.00 53.89 ? 2235 HOH A O   1 
HETATM 4480 O O   . HOH E 4 .   ? 23.295  68.395 36.859 1.00 64.68 ? 2236 HOH A O   1 
HETATM 4481 O O   . HOH E 4 .   ? 25.033  70.487 63.065 1.00 60.66 ? 2237 HOH A O   1 
HETATM 4482 O O   . HOH E 4 .   ? 24.605  76.530 62.784 1.00 66.41 ? 2238 HOH A O   1 
HETATM 4483 O O   . HOH E 4 .   ? 22.302  79.145 61.378 1.00 43.56 ? 2239 HOH A O   1 
HETATM 4484 O O   . HOH E 4 .   ? 14.359  76.341 63.701 1.00 37.19 ? 2240 HOH A O   1 
HETATM 4485 O O   . HOH E 4 .   ? 21.315  77.946 64.658 1.00 57.79 ? 2241 HOH A O   1 
HETATM 4486 O O   . HOH E 4 .   ? 16.224  80.036 69.540 1.00 50.47 ? 2242 HOH A O   1 
HETATM 4487 O O   . HOH E 4 .   ? 13.871  86.623 66.330 1.00 61.07 ? 2243 HOH A O   1 
HETATM 4488 O O   . HOH E 4 .   ? 11.582  83.995 71.641 1.00 62.55 ? 2244 HOH A O   1 
HETATM 4489 O O   . HOH E 4 .   ? 9.978   79.947 65.159 1.00 44.62 ? 2245 HOH A O   1 
HETATM 4490 O O   . HOH E 4 .   ? 14.596  80.583 71.011 1.00 62.10 ? 2246 HOH A O   1 
HETATM 4491 O O   . HOH E 4 .   ? 8.481   76.640 76.081 1.00 42.65 ? 2247 HOH A O   1 
HETATM 4492 O O   . HOH E 4 .   ? 12.973  79.560 75.030 1.00 55.10 ? 2248 HOH A O   1 
HETATM 4493 O O   . HOH E 4 .   ? 15.439  77.177 77.147 1.00 49.71 ? 2249 HOH A O   1 
HETATM 4494 O O   . HOH E 4 .   ? 16.435  74.063 77.323 1.00 47.94 ? 2250 HOH A O   1 
HETATM 4495 O O   . HOH E 4 .   ? 13.788  74.303 66.003 1.00 44.27 ? 2251 HOH A O   1 
HETATM 4496 O O   . HOH E 4 .   ? 12.212  77.368 62.564 1.00 36.03 ? 2252 HOH A O   1 
HETATM 4497 O O   . HOH E 4 .   ? 10.715  68.506 59.581 1.00 29.53 ? 2253 HOH A O   1 
HETATM 4498 O O   . HOH E 4 .   ? 7.825   75.707 60.739 1.00 30.69 ? 2254 HOH A O   1 
HETATM 4499 O O   . HOH E 4 .   ? 8.279   94.672 63.301 1.00 66.16 ? 2255 HOH A O   1 
HETATM 4500 O O   . HOH E 4 .   ? 1.317   88.271 60.256 1.00 62.15 ? 2256 HOH A O   1 
HETATM 4501 O O   . HOH E 4 .   ? 13.992  91.153 65.066 1.00 56.84 ? 2257 HOH A O   1 
HETATM 4502 O O   . HOH E 4 .   ? 19.964  84.681 62.517 1.00 57.58 ? 2258 HOH A O   1 
HETATM 4503 O O   . HOH E 4 .   ? 18.422  91.390 61.892 1.00 52.50 ? 2259 HOH A O   1 
HETATM 4504 O O   . HOH E 4 .   ? 21.731  89.253 55.462 1.00 64.95 ? 2260 HOH A O   1 
HETATM 4505 O O   . HOH E 4 .   ? 21.191  83.859 55.796 1.00 51.46 ? 2261 HOH A O   1 
HETATM 4506 O O   . HOH E 4 .   ? 14.254  91.493 58.376 1.00 64.44 ? 2262 HOH A O   1 
HETATM 4507 O O   . HOH E 4 .   ? 12.033  91.123 57.215 1.00 71.79 ? 2263 HOH A O   1 
HETATM 4508 O O   . HOH E 4 .   ? 25.506  80.886 51.719 1.00 58.62 ? 2264 HOH A O   1 
HETATM 4509 O O   . HOH E 4 .   ? 23.321  77.096 53.904 1.00 54.96 ? 2265 HOH A O   1 
HETATM 4510 O O   . HOH E 4 .   ? 18.641  79.318 46.147 1.00 49.35 ? 2266 HOH A O   1 
HETATM 4511 O O   . HOH E 4 .   ? 10.060  81.164 36.426 1.00 63.92 ? 2267 HOH A O   1 
HETATM 4512 O O   . HOH E 4 .   ? 19.079  78.697 43.628 1.00 59.17 ? 2268 HOH A O   1 
HETATM 4513 O O   . HOH E 4 .   ? 28.100  65.531 42.623 1.00 52.09 ? 2269 HOH A O   1 
HETATM 4514 O O   . HOH E 4 .   ? 27.068  67.854 40.901 1.00 63.35 ? 2270 HOH A O   1 
HETATM 4515 O O   . HOH E 4 .   ? 21.970  61.772 41.832 1.00 35.74 ? 2271 HOH A O   1 
HETATM 4516 O O   . HOH E 4 .   ? 27.523  63.094 45.829 1.00 38.27 ? 2272 HOH A O   1 
HETATM 4517 O O   . HOH E 4 .   ? 24.843  57.695 41.379 1.00 46.66 ? 2273 HOH A O   1 
HETATM 4518 O O   . HOH E 4 .   ? 28.038  57.350 41.835 1.00 59.56 ? 2274 HOH A O   1 
HETATM 4519 O O   . HOH E 4 .   ? 35.060  64.758 45.101 1.00 53.81 ? 2275 HOH A O   1 
HETATM 4520 O O   . HOH E 4 .   ? 25.123  58.346 52.230 1.00 55.48 ? 2276 HOH A O   1 
HETATM 4521 O O   . HOH E 4 .   ? 31.693  69.891 45.967 1.00 63.46 ? 2277 HOH A O   1 
HETATM 4522 O O   . HOH E 4 .   ? 23.337  66.687 47.705 1.00 42.42 ? 2278 HOH A O   1 
HETATM 4523 O O   . HOH E 4 .   ? 35.247  65.816 47.124 1.00 71.34 ? 2279 HOH A O   1 
HETATM 4524 O O   . HOH E 4 .   ? 27.307  69.967 59.924 1.00 52.98 ? 2280 HOH A O   1 
HETATM 4525 O O   . HOH E 4 .   ? 31.381  58.430 49.976 1.00 50.69 ? 2281 HOH A O   1 
HETATM 4526 O O   . HOH E 4 .   ? 25.166  61.201 52.748 1.00 44.13 ? 2282 HOH A O   1 
HETATM 4527 O O   . HOH E 4 .   ? 27.118  63.245 59.330 1.00 46.14 ? 2283 HOH A O   1 
HETATM 4528 O O   . HOH E 4 .   ? 28.677  59.364 61.067 1.00 46.26 ? 2284 HOH A O   1 
HETATM 4529 O O   . HOH E 4 .   ? 26.738  58.983 62.747 1.00 42.12 ? 2285 HOH A O   1 
HETATM 4530 O O   . HOH E 4 .   ? 15.963  50.068 62.395 1.00 46.55 ? 2286 HOH A O   1 
HETATM 4531 O O   . HOH E 4 .   ? 17.724  41.164 58.015 1.00 59.95 ? 2287 HOH A O   1 
HETATM 4532 O O   . HOH E 4 .   ? 19.630  58.179 32.978 1.00 57.71 ? 2288 HOH A O   1 
HETATM 4533 O O   . HOH E 4 .   ? 0.870   68.040 66.733 1.00 44.88 ? 2289 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 SER 490 490 ?   ?   ?   A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1   1536 1536 NAG NAG A . 
C 2 NAG 1   1537 1537 NAG NAG A . 
D 3 HUB 1   1538 1538 HUB HUB A . 
E 4 HOH 1   2001 2001 HOH HOH A . 
E 4 HOH 2   2002 2002 HOH HOH A . 
E 4 HOH 3   2003 2003 HOH HOH A . 
E 4 HOH 4   2004 2004 HOH HOH A . 
E 4 HOH 5   2005 2005 HOH HOH A . 
E 4 HOH 6   2006 2006 HOH HOH A . 
E 4 HOH 7   2007 2007 HOH HOH A . 
E 4 HOH 8   2008 2008 HOH HOH A . 
E 4 HOH 9   2009 2009 HOH HOH A . 
E 4 HOH 10  2010 2010 HOH HOH A . 
E 4 HOH 11  2011 2011 HOH HOH A . 
E 4 HOH 12  2012 2012 HOH HOH A . 
E 4 HOH 13  2013 2013 HOH HOH A . 
E 4 HOH 14  2014 2014 HOH HOH A . 
E 4 HOH 15  2015 2015 HOH HOH A . 
E 4 HOH 16  2016 2016 HOH HOH A . 
E 4 HOH 17  2017 2017 HOH HOH A . 
E 4 HOH 18  2018 2018 HOH HOH A . 
E 4 HOH 19  2019 2019 HOH HOH A . 
E 4 HOH 20  2020 2020 HOH HOH A . 
E 4 HOH 21  2021 2021 HOH HOH A . 
E 4 HOH 22  2022 2022 HOH HOH A . 
E 4 HOH 23  2023 2023 HOH HOH A . 
E 4 HOH 24  2024 2024 HOH HOH A . 
E 4 HOH 25  2025 2025 HOH HOH A . 
E 4 HOH 26  2026 2026 HOH HOH A . 
E 4 HOH 27  2027 2027 HOH HOH A . 
E 4 HOH 28  2028 2028 HOH HOH A . 
E 4 HOH 29  2029 2029 HOH HOH A . 
E 4 HOH 30  2030 2030 HOH HOH A . 
E 4 HOH 31  2031 2031 HOH HOH A . 
E 4 HOH 32  2032 2032 HOH HOH A . 
E 4 HOH 33  2033 2033 HOH HOH A . 
E 4 HOH 34  2034 2034 HOH HOH A . 
E 4 HOH 35  2035 2035 HOH HOH A . 
E 4 HOH 36  2036 2036 HOH HOH A . 
E 4 HOH 37  2037 2037 HOH HOH A . 
E 4 HOH 38  2038 2038 HOH HOH A . 
E 4 HOH 39  2039 2039 HOH HOH A . 
E 4 HOH 40  2040 2040 HOH HOH A . 
E 4 HOH 41  2041 2041 HOH HOH A . 
E 4 HOH 42  2042 2042 HOH HOH A . 
E 4 HOH 43  2043 2043 HOH HOH A . 
E 4 HOH 44  2044 2044 HOH HOH A . 
E 4 HOH 45  2045 2045 HOH HOH A . 
E 4 HOH 46  2046 2046 HOH HOH A . 
E 4 HOH 47  2047 2047 HOH HOH A . 
E 4 HOH 48  2048 2048 HOH HOH A . 
E 4 HOH 49  2049 2049 HOH HOH A . 
E 4 HOH 50  2050 2050 HOH HOH A . 
E 4 HOH 51  2051 2051 HOH HOH A . 
E 4 HOH 52  2052 2052 HOH HOH A . 
E 4 HOH 53  2053 2053 HOH HOH A . 
E 4 HOH 54  2054 2054 HOH HOH A . 
E 4 HOH 55  2055 2055 HOH HOH A . 
E 4 HOH 56  2056 2056 HOH HOH A . 
E 4 HOH 57  2057 2057 HOH HOH A . 
E 4 HOH 58  2058 2058 HOH HOH A . 
E 4 HOH 59  2059 2059 HOH HOH A . 
E 4 HOH 60  2060 2060 HOH HOH A . 
E 4 HOH 61  2061 2061 HOH HOH A . 
E 4 HOH 62  2062 2062 HOH HOH A . 
E 4 HOH 63  2063 2063 HOH HOH A . 
E 4 HOH 64  2064 2064 HOH HOH A . 
E 4 HOH 65  2065 2065 HOH HOH A . 
E 4 HOH 66  2066 2066 HOH HOH A . 
E 4 HOH 67  2067 2067 HOH HOH A . 
E 4 HOH 68  2068 2068 HOH HOH A . 
E 4 HOH 69  2069 2069 HOH HOH A . 
E 4 HOH 70  2070 2070 HOH HOH A . 
E 4 HOH 71  2071 2071 HOH HOH A . 
E 4 HOH 72  2072 2072 HOH HOH A . 
E 4 HOH 73  2073 2073 HOH HOH A . 
E 4 HOH 74  2074 2074 HOH HOH A . 
E 4 HOH 75  2075 2075 HOH HOH A . 
E 4 HOH 76  2076 2076 HOH HOH A . 
E 4 HOH 77  2077 2077 HOH HOH A . 
E 4 HOH 78  2078 2078 HOH HOH A . 
E 4 HOH 79  2079 2079 HOH HOH A . 
E 4 HOH 80  2080 2080 HOH HOH A . 
E 4 HOH 81  2081 2081 HOH HOH A . 
E 4 HOH 82  2082 2082 HOH HOH A . 
E 4 HOH 83  2083 2083 HOH HOH A . 
E 4 HOH 84  2084 2084 HOH HOH A . 
E 4 HOH 85  2085 2085 HOH HOH A . 
E 4 HOH 86  2086 2086 HOH HOH A . 
E 4 HOH 87  2087 2087 HOH HOH A . 
E 4 HOH 88  2088 2088 HOH HOH A . 
E 4 HOH 89  2089 2089 HOH HOH A . 
E 4 HOH 90  2090 2090 HOH HOH A . 
E 4 HOH 91  2091 2091 HOH HOH A . 
E 4 HOH 92  2092 2092 HOH HOH A . 
E 4 HOH 93  2093 2093 HOH HOH A . 
E 4 HOH 94  2094 2094 HOH HOH A . 
E 4 HOH 95  2095 2095 HOH HOH A . 
E 4 HOH 96  2096 2096 HOH HOH A . 
E 4 HOH 97  2097 2097 HOH HOH A . 
E 4 HOH 98  2098 2098 HOH HOH A . 
E 4 HOH 99  2099 2099 HOH HOH A . 
E 4 HOH 100 2100 2100 HOH HOH A . 
E 4 HOH 101 2101 2101 HOH HOH A . 
E 4 HOH 102 2102 2102 HOH HOH A . 
E 4 HOH 103 2103 2103 HOH HOH A . 
E 4 HOH 104 2104 2104 HOH HOH A . 
E 4 HOH 105 2105 2105 HOH HOH A . 
E 4 HOH 106 2106 2106 HOH HOH A . 
E 4 HOH 107 2107 2107 HOH HOH A . 
E 4 HOH 108 2108 2108 HOH HOH A . 
E 4 HOH 109 2109 2109 HOH HOH A . 
E 4 HOH 110 2110 2110 HOH HOH A . 
E 4 HOH 111 2111 2111 HOH HOH A . 
E 4 HOH 112 2112 2112 HOH HOH A . 
E 4 HOH 113 2113 2113 HOH HOH A . 
E 4 HOH 114 2114 2114 HOH HOH A . 
E 4 HOH 115 2115 2115 HOH HOH A . 
E 4 HOH 116 2116 2116 HOH HOH A . 
E 4 HOH 117 2117 2117 HOH HOH A . 
E 4 HOH 118 2118 2118 HOH HOH A . 
E 4 HOH 119 2119 2119 HOH HOH A . 
E 4 HOH 120 2120 2120 HOH HOH A . 
E 4 HOH 121 2121 2121 HOH HOH A . 
E 4 HOH 122 2122 2122 HOH HOH A . 
E 4 HOH 123 2123 2123 HOH HOH A . 
E 4 HOH 124 2124 2124 HOH HOH A . 
E 4 HOH 125 2125 2125 HOH HOH A . 
E 4 HOH 126 2126 2126 HOH HOH A . 
E 4 HOH 127 2127 2127 HOH HOH A . 
E 4 HOH 128 2128 2128 HOH HOH A . 
E 4 HOH 129 2129 2129 HOH HOH A . 
E 4 HOH 130 2130 2130 HOH HOH A . 
E 4 HOH 131 2131 2131 HOH HOH A . 
E 4 HOH 132 2132 2132 HOH HOH A . 
E 4 HOH 133 2133 2133 HOH HOH A . 
E 4 HOH 134 2134 2134 HOH HOH A . 
E 4 HOH 135 2135 2135 HOH HOH A . 
E 4 HOH 136 2136 2136 HOH HOH A . 
E 4 HOH 137 2137 2137 HOH HOH A . 
E 4 HOH 138 2138 2138 HOH HOH A . 
E 4 HOH 139 2139 2139 HOH HOH A . 
E 4 HOH 140 2140 2140 HOH HOH A . 
E 4 HOH 141 2141 2141 HOH HOH A . 
E 4 HOH 142 2142 2142 HOH HOH A . 
E 4 HOH 143 2143 2143 HOH HOH A . 
E 4 HOH 144 2144 2144 HOH HOH A . 
E 4 HOH 145 2145 2145 HOH HOH A . 
E 4 HOH 146 2146 2146 HOH HOH A . 
E 4 HOH 147 2147 2147 HOH HOH A . 
E 4 HOH 148 2148 2148 HOH HOH A . 
E 4 HOH 149 2149 2149 HOH HOH A . 
E 4 HOH 150 2150 2150 HOH HOH A . 
E 4 HOH 151 2151 2151 HOH HOH A . 
E 4 HOH 152 2152 2152 HOH HOH A . 
E 4 HOH 153 2153 2153 HOH HOH A . 
E 4 HOH 154 2154 2154 HOH HOH A . 
E 4 HOH 155 2155 2155 HOH HOH A . 
E 4 HOH 156 2156 2156 HOH HOH A . 
E 4 HOH 157 2157 2157 HOH HOH A . 
E 4 HOH 158 2158 2158 HOH HOH A . 
E 4 HOH 159 2159 2159 HOH HOH A . 
E 4 HOH 160 2160 2160 HOH HOH A . 
E 4 HOH 161 2161 2161 HOH HOH A . 
E 4 HOH 162 2162 2162 HOH HOH A . 
E 4 HOH 163 2163 2163 HOH HOH A . 
E 4 HOH 164 2164 2164 HOH HOH A . 
E 4 HOH 165 2165 2165 HOH HOH A . 
E 4 HOH 166 2166 2166 HOH HOH A . 
E 4 HOH 167 2167 2167 HOH HOH A . 
E 4 HOH 168 2168 2168 HOH HOH A . 
E 4 HOH 169 2169 2169 HOH HOH A . 
E 4 HOH 170 2170 2170 HOH HOH A . 
E 4 HOH 171 2171 2171 HOH HOH A . 
E 4 HOH 172 2172 2172 HOH HOH A . 
E 4 HOH 173 2173 2173 HOH HOH A . 
E 4 HOH 174 2174 2174 HOH HOH A . 
E 4 HOH 175 2175 2175 HOH HOH A . 
E 4 HOH 176 2176 2176 HOH HOH A . 
E 4 HOH 177 2177 2177 HOH HOH A . 
E 4 HOH 178 2178 2178 HOH HOH A . 
E 4 HOH 179 2179 2179 HOH HOH A . 
E 4 HOH 180 2180 2180 HOH HOH A . 
E 4 HOH 181 2181 2181 HOH HOH A . 
E 4 HOH 182 2182 2182 HOH HOH A . 
E 4 HOH 183 2183 2183 HOH HOH A . 
E 4 HOH 184 2184 2184 HOH HOH A . 
E 4 HOH 185 2185 2185 HOH HOH A . 
E 4 HOH 186 2186 2186 HOH HOH A . 
E 4 HOH 187 2187 2187 HOH HOH A . 
E 4 HOH 188 2188 2188 HOH HOH A . 
E 4 HOH 189 2189 2189 HOH HOH A . 
E 4 HOH 190 2190 2190 HOH HOH A . 
E 4 HOH 191 2191 2191 HOH HOH A . 
E 4 HOH 192 2192 2192 HOH HOH A . 
E 4 HOH 193 2193 2193 HOH HOH A . 
E 4 HOH 194 2194 2194 HOH HOH A . 
E 4 HOH 195 2195 2195 HOH HOH A . 
E 4 HOH 196 2196 2196 HOH HOH A . 
E 4 HOH 197 2197 2197 HOH HOH A . 
E 4 HOH 198 2198 2198 HOH HOH A . 
E 4 HOH 199 2199 2199 HOH HOH A . 
E 4 HOH 200 2200 2200 HOH HOH A . 
E 4 HOH 201 2201 2201 HOH HOH A . 
E 4 HOH 202 2202 2202 HOH HOH A . 
E 4 HOH 203 2203 2203 HOH HOH A . 
E 4 HOH 204 2204 2204 HOH HOH A . 
E 4 HOH 205 2205 2205 HOH HOH A . 
E 4 HOH 206 2206 2206 HOH HOH A . 
E 4 HOH 207 2207 2207 HOH HOH A . 
E 4 HOH 208 2208 2208 HOH HOH A . 
E 4 HOH 209 2209 2209 HOH HOH A . 
E 4 HOH 210 2210 2210 HOH HOH A . 
E 4 HOH 211 2211 2211 HOH HOH A . 
E 4 HOH 212 2212 2212 HOH HOH A . 
E 4 HOH 213 2213 2213 HOH HOH A . 
E 4 HOH 214 2214 2214 HOH HOH A . 
E 4 HOH 215 2215 2215 HOH HOH A . 
E 4 HOH 216 2216 2216 HOH HOH A . 
E 4 HOH 217 2217 2217 HOH HOH A . 
E 4 HOH 218 2218 2218 HOH HOH A . 
E 4 HOH 219 2219 2219 HOH HOH A . 
E 4 HOH 220 2220 2220 HOH HOH A . 
E 4 HOH 221 2221 2221 HOH HOH A . 
E 4 HOH 222 2222 2222 HOH HOH A . 
E 4 HOH 223 2223 2223 HOH HOH A . 
E 4 HOH 224 2224 2224 HOH HOH A . 
E 4 HOH 225 2225 2225 HOH HOH A . 
E 4 HOH 226 2226 2226 HOH HOH A . 
E 4 HOH 227 2227 2227 HOH HOH A . 
E 4 HOH 228 2228 2228 HOH HOH A . 
E 4 HOH 229 2229 2229 HOH HOH A . 
E 4 HOH 230 2230 2230 HOH HOH A . 
E 4 HOH 231 2231 2231 HOH HOH A . 
E 4 HOH 232 2232 2232 HOH HOH A . 
E 4 HOH 233 2233 2233 HOH HOH A . 
E 4 HOH 234 2234 2234 HOH HOH A . 
E 4 HOH 235 2235 2235 HOH HOH A . 
E 4 HOH 236 2236 2236 HOH HOH A . 
E 4 HOH 237 2237 2237 HOH HOH A . 
E 4 HOH 238 2238 2238 HOH HOH A . 
E 4 HOH 239 2239 2239 HOH HOH A . 
E 4 HOH 240 2240 2240 HOH HOH A . 
E 4 HOH 241 2241 2241 HOH HOH A . 
E 4 HOH 242 2242 2242 HOH HOH A . 
E 4 HOH 243 2243 2243 HOH HOH A . 
E 4 HOH 244 2244 2244 HOH HOH A . 
E 4 HOH 245 2245 2245 HOH HOH A . 
E 4 HOH 246 2246 2246 HOH HOH A . 
E 4 HOH 247 2247 2247 HOH HOH A . 
E 4 HOH 248 2248 2248 HOH HOH A . 
E 4 HOH 249 2249 2249 HOH HOH A . 
E 4 HOH 250 2250 2250 HOH HOH A . 
E 4 HOH 251 2251 2251 HOH HOH A . 
E 4 HOH 252 2252 2252 HOH HOH A . 
E 4 HOH 253 2253 2253 HOH HOH A . 
E 4 HOH 254 2254 2254 HOH HOH A . 
E 4 HOH 255 2255 2255 HOH HOH A . 
E 4 HOH 256 2256 2256 HOH HOH A . 
E 4 HOH 257 2257 2257 HOH HOH A . 
E 4 HOH 258 2258 2258 HOH HOH A . 
E 4 HOH 259 2259 2259 HOH HOH A . 
E 4 HOH 260 2260 2260 HOH HOH A . 
E 4 HOH 261 2261 2261 HOH HOH A . 
E 4 HOH 262 2262 2262 HOH HOH A . 
E 4 HOH 263 2263 2263 HOH HOH A . 
E 4 HOH 264 2264 2264 HOH HOH A . 
E 4 HOH 265 2265 2265 HOH HOH A . 
E 4 HOH 266 2266 2266 HOH HOH A . 
E 4 HOH 267 2267 2267 HOH HOH A . 
E 4 HOH 268 2268 2268 HOH HOH A . 
E 4 HOH 269 2269 2269 HOH HOH A . 
E 4 HOH 270 2270 2270 HOH HOH A . 
E 4 HOH 271 2271 2271 HOH HOH A . 
E 4 HOH 272 2272 2272 HOH HOH A . 
E 4 HOH 273 2273 2273 HOH HOH A . 
E 4 HOH 274 2274 2274 HOH HOH A . 
E 4 HOH 275 2275 2275 HOH HOH A . 
E 4 HOH 276 2276 2276 HOH HOH A . 
E 4 HOH 277 2277 2277 HOH HOH A . 
E 4 HOH 278 2278 2278 HOH HOH A . 
E 4 HOH 279 2279 2279 HOH HOH A . 
E 4 HOH 280 2280 2280 HOH HOH A . 
E 4 HOH 281 2281 2281 HOH HOH A . 
E 4 HOH 282 2282 2282 HOH HOH A . 
E 4 HOH 283 2283 2283 HOH HOH A . 
E 4 HOH 284 2284 2284 HOH HOH A . 
E 4 HOH 285 2285 2285 HOH HOH A . 
E 4 HOH 286 2286 2286 HOH HOH A . 
E 4 HOH 287 2287 2287 HOH HOH A . 
E 4 HOH 288 2288 2288 HOH HOH A . 
E 4 HOH 289 2289 2289 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 59  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 416 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-08-29 
2 'Structure model' 1 1 2011-06-02 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Derived calculations'      
5 4 'Structure model' Other                       
6 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp                 
2 4 'Structure model' entity                    
3 4 'Structure model' pdbx_chem_comp_identifier 
4 4 'Structure model' pdbx_database_status      
5 4 'Structure model' pdbx_entity_nonpoly       
6 4 'Structure model' struct_conn               
7 4 'Structure model' struct_site               
8 4 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_chem_comp.name'                      
2 4 'Structure model' '_chem_comp.type'                      
3 4 'Structure model' '_entity.pdbx_description'             
4 4 'Structure model' '_pdbx_database_status.status_code_sf' 
5 4 'Structure model' '_pdbx_entity_nonpoly.name'            
6 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'  
7 4 'Structure model' '_struct_conn.pdbx_role'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.0 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CNS       phasing          .   ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 ND1 A HIS 181  ? ? O A HOH 2106 ? ? 2.11 
2 1 O   A HOH 2066 ? ? O A HOH 2188 ? ? 2.16 
3 1 O   A HOH 2015 ? ? O A HOH 2069 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 SD A MET 43  ? A CE  A MET 43  ? A 4.438 1.774 2.664 0.056 N 
2  1 SD A MET 43  ? B CE  A MET 43  ? B 3.155 1.774 1.381 0.056 N 
3  1 CB A ARG 88  ? B CG  A ARG 88  ? B 1.699 1.521 0.178 0.027 N 
4  1 CD A ARG 88  ? A NE  A ARG 88  ? A 1.806 1.460 0.346 0.017 N 
5  1 CD A ARG 88  ? B NE  A ARG 88  ? B 1.657 1.460 0.197 0.017 N 
6  1 NE A ARG 88  ? A CZ  A ARG 88  ? A 1.560 1.326 0.234 0.013 N 
7  1 NE A ARG 88  ? B CZ  A ARG 88  ? B 2.913 1.326 1.587 0.013 N 
8  1 CZ A ARG 88  ? A NH2 A ARG 88  ? A 3.178 1.326 1.852 0.013 N 
9  1 CZ A ARG 88  ? B NH2 A ARG 88  ? B 3.911 1.326 2.585 0.013 N 
10 1 CG A ARG 468 ? A CD  A ARG 468 ? A 1.799 1.515 0.284 0.025 N 
11 1 CG A ARG 468 ? B CD  A ARG 468 ? B 1.913 1.515 0.398 0.025 N 
12 1 NE A ARG 468 ? A CZ  A ARG 468 ? A 2.878 1.326 1.552 0.013 N 
13 1 NE A ARG 468 ? B CZ  A ARG 468 ? B 2.733 1.326 1.407 0.013 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CG  A MET 43  ? A SD A MET 43  ? A CE  A MET 43  ? A 27.41  100.20 -72.79 1.60 N 
2  1 CG  A MET 43  ? B SD A MET 43  ? B CE  A MET 43  ? B 71.39  100.20 -28.81 1.60 N 
3  1 CG  A ARG 88  ? A CD A ARG 88  ? A NE  A ARG 88  ? A 174.65 111.80 62.85  2.10 N 
4  1 CG  A ARG 88  ? B CD A ARG 88  ? B NE  A ARG 88  ? B 67.93  111.80 -43.87 2.10 N 
5  1 CD  A ARG 88  ? A NE A ARG 88  ? A CZ  A ARG 88  ? A 93.93  123.60 -29.67 1.40 N 
6  1 CD  A ARG 88  ? B NE A ARG 88  ? B CZ  A ARG 88  ? B 58.47  123.60 -65.13 1.40 N 
7  1 NH1 A ARG 88  ? A CZ A ARG 88  ? A NH2 A ARG 88  ? A 30.56  119.40 -88.84 1.10 N 
8  1 NH1 A ARG 88  ? B CZ A ARG 88  ? B NH2 A ARG 88  ? B 150.11 119.40 30.71  1.10 N 
9  1 NE  A ARG 88  ? A CZ A ARG 88  ? A NH1 A ARG 88  ? A 43.62  120.30 -76.68 0.50 N 
10 1 NE  A ARG 88  ? B CZ A ARG 88  ? B NH1 A ARG 88  ? B 114.91 120.30 -5.39  0.50 N 
11 1 NE  A ARG 88  ? A CZ A ARG 88  ? A NH2 A ARG 88  ? A 42.77  120.30 -77.53 0.50 N 
12 1 NE  A ARG 88  ? B CZ A ARG 88  ? B NH2 A ARG 88  ? B 35.86  120.30 -84.44 0.50 N 
13 1 CB  A ARG 468 ? B CG A ARG 468 ? B CD  A ARG 468 ? B 93.74  111.60 -17.86 2.60 N 
14 1 CG  A ARG 468 ? A CD A ARG 468 ? A NE  A ARG 468 ? A 67.59  111.80 -44.21 2.10 N 
15 1 CG  A ARG 468 ? B CD A ARG 468 ? B NE  A ARG 468 ? B 70.79  111.80 -41.01 2.10 N 
16 1 CD  A ARG 468 ? A NE A ARG 468 ? A CZ  A ARG 468 ? A 43.75  123.60 -79.85 1.40 N 
17 1 CD  A ARG 468 ? B NE A ARG 468 ? B CZ  A ARG 468 ? B 37.80  123.60 -85.80 1.40 N 
18 1 NE  A ARG 468 ? A CZ A ARG 468 ? A NH1 A ARG 468 ? A 79.97  120.30 -40.33 0.50 N 
19 1 NE  A ARG 468 ? B CZ A ARG 468 ? B NH1 A ARG 468 ? B 73.94  120.30 -46.36 0.50 N 
20 1 NE  A ARG 468 ? A CZ A ARG 468 ? A NH2 A ARG 468 ? A 160.18 120.30 39.88  0.50 N 
21 1 NE  A ARG 468 ? B CZ A ARG 468 ? B NH2 A ARG 468 ? B 166.03 120.30 45.73  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 25  ? ? -163.56 -166.10 
2  1 SER A 25  ? ? -165.42 -166.10 
3  1 PRO A 39  ? ? -76.08  46.21   
4  1 PHE A 45  ? ? 80.03   -16.39  
5  1 ALA A 60  ? ? -108.77 50.02   
6  1 SER A 108 ? ? -158.55 78.86   
7  1 SER A 200 ? ? 55.21   -120.09 
8  1 GLU A 299 ? ? -108.21 -78.98  
9  1 THR A 317 ? ? -160.12 -158.50 
10 1 VAL A 400 ? ? -128.66 -63.23  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     88 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    A 
_pdbx_validate_planes.rmsd            0.357 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2009 ? 6.15 . 
2 1 O ? A HOH 2110 ? 5.81 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 14  ? CE  ? A LYS 14  CE  
2  1 Y 1 A LYS 14  ? NZ  ? A LYS 14  NZ  
3  1 Y 1 A ARG 19  ? CD  ? A ARG 19  CD  
4  1 Y 1 A ARG 19  ? NE  ? A ARG 19  NE  
5  1 Y 1 A ARG 19  ? CZ  ? A ARG 19  CZ  
6  1 Y 1 A ARG 19  ? NH1 ? A ARG 19  NH1 
7  1 Y 1 A ARG 19  ? NH2 ? A ARG 19  NH2 
8  1 Y 1 A ASN 42  ? OD1 ? A ASN 42  OD1 
9  1 Y 1 A ASN 42  ? ND2 ? A ASN 42  ND2 
10 1 Y 1 A ARG 46  ? NE  ? A ARG 46  NE  
11 1 Y 1 A ARG 46  ? CZ  ? A ARG 46  CZ  
12 1 Y 1 A ARG 46  ? NH1 ? A ARG 46  NH1 
13 1 Y 1 A ARG 46  ? NH2 ? A ARG 46  NH2 
14 1 Y 1 A GLU 49  ? CD  ? A GLU 49  CD  
15 1 Y 1 A GLU 49  ? OE1 ? A GLU 49  OE1 
16 1 Y 1 A GLU 49  ? OE2 ? A GLU 49  OE2 
17 1 Y 1 A LYS 52  ? CD  ? A LYS 52  CD  
18 1 Y 1 A LYS 52  ? CE  ? A LYS 52  CE  
19 1 Y 1 A LYS 52  ? NZ  ? A LYS 52  NZ  
20 1 Y 1 A GLU 89  ? CD  ? A GLU 89  CD  
21 1 Y 1 A GLU 89  ? OE1 ? A GLU 89  OE1 
22 1 Y 1 A GLU 89  ? OE2 ? A GLU 89  OE2 
23 1 Y 1 A GLU 140 ? CG  ? A GLU 140 CG  
24 1 Y 1 A GLU 140 ? CD  ? A GLU 140 CD  
25 1 Y 1 A GLU 140 ? OE1 ? A GLU 140 OE1 
26 1 Y 1 A GLU 140 ? OE2 ? A GLU 140 OE2 
27 1 Y 1 A GLN 162 ? CG  ? A GLN 162 CG  
28 1 Y 1 A GLN 162 ? CD  ? A GLN 162 CD  
29 1 Y 1 A GLN 162 ? OE1 ? A GLN 162 OE1 
30 1 Y 1 A GLN 162 ? NE2 ? A GLN 162 NE2 
31 1 Y 1 A ASN 257 ? CG  ? A ASN 257 CG  
32 1 Y 1 A ASN 257 ? OD1 ? A ASN 257 OD1 
33 1 Y 1 A ASN 257 ? ND2 ? A ASN 257 ND2 
34 1 Y 1 A GLU 260 ? CG  ? A GLU 260 CG  
35 1 Y 1 A GLU 260 ? CD  ? A GLU 260 CD  
36 1 Y 1 A GLU 260 ? OE1 ? A GLU 260 OE1 
37 1 Y 1 A GLU 260 ? OE2 ? A GLU 260 OE2 
38 1 Y 1 A HIS 264 ? CG  ? A HIS 264 CG  
39 1 Y 1 A HIS 264 ? ND1 ? A HIS 264 ND1 
40 1 Y 1 A HIS 264 ? CD2 ? A HIS 264 CD2 
41 1 Y 1 A HIS 264 ? CE1 ? A HIS 264 CE1 
42 1 Y 1 A HIS 264 ? NE2 ? A HIS 264 NE2 
43 1 Y 1 A GLU 268 ? CD  ? A GLU 268 CD  
44 1 Y 1 A GLU 268 ? OE1 ? A GLU 268 OE1 
45 1 Y 1 A GLU 268 ? OE2 ? A GLU 268 OE2 
46 1 Y 1 A LYS 270 ? CE  ? A LYS 270 CE  
47 1 Y 1 A LYS 270 ? NZ  ? A LYS 270 NZ  
48 1 Y 1 A GLU 299 ? CD  ? A GLU 299 CD  
49 1 Y 1 A GLU 299 ? OE1 ? A GLU 299 OE1 
50 1 Y 1 A GLU 299 ? OE2 ? A GLU 299 OE2 
51 1 Y 1 A LYS 413 ? CD  ? A LYS 413 CD  
52 1 Y 1 A LYS 413 ? CE  ? A LYS 413 CE  
53 1 Y 1 A LYS 413 ? NZ  ? A LYS 413 NZ  
54 1 Y 1 A GLU 434 ? CD  ? A GLU 434 CD  
55 1 Y 1 A GLU 434 ? OE1 ? A GLU 434 OE1 
56 1 Y 1 A GLU 434 ? OE2 ? A GLU 434 OE2 
57 1 Y 1 A LYS 454 ? CD  ? A LYS 454 CD  
58 1 Y 1 A LYS 454 ? CE  ? A LYS 454 CE  
59 1 Y 1 A LYS 454 ? NZ  ? A LYS 454 NZ  
60 1 Y 1 A HIS 486 ? CG  ? A HIS 486 CG  
61 1 Y 1 A HIS 486 ? ND1 ? A HIS 486 ND1 
62 1 Y 1 A HIS 486 ? CD2 ? A HIS 486 CD2 
63 1 Y 1 A HIS 486 ? CE1 ? A HIS 486 CE1 
64 1 Y 1 A HIS 486 ? NE2 ? A HIS 486 NE2 
65 1 Y 1 A LYS 491 ? CD  ? A LYS 491 CD  
66 1 Y 1 A LYS 491 ? CE  ? A LYS 491 CE  
67 1 Y 1 A LYS 491 ? NZ  ? A LYS 491 NZ  
68 1 Y 1 A LYS 498 ? CD  ? A LYS 498 CD  
69 1 Y 1 A LYS 498 ? CE  ? A LYS 498 CE  
70 1 Y 1 A LYS 498 ? NZ  ? A LYS 498 NZ  
71 1 Y 1 A GLU 508 ? OE1 ? A GLU 508 OE1 
72 1 Y 1 A GLU 508 ? OE2 ? A GLU 508 OE2 
73 1 Y 1 A LYS 511 ? CD  ? A LYS 511 CD  
74 1 Y 1 A LYS 511 ? CE  ? A LYS 511 CE  
75 1 Y 1 A LYS 511 ? NZ  ? A LYS 511 NZ  
76 1 Y 1 A ARG 515 ? CZ  ? A ARG 515 CZ  
77 1 Y 1 A ARG 515 ? NH1 ? A ARG 515 NH1 
78 1 Y 1 A ARG 515 ? NH2 ? A ARG 515 NH2 
79 1 Y 1 A GLN 526 ? OE1 ? A GLN 526 OE1 
80 1 Y 1 A GLN 526 ? NE2 ? A GLN 526 NE2 
81 1 Y 1 A LYS 530 ? CD  ? A LYS 530 CD  
82 1 Y 1 A LYS 530 ? CE  ? A LYS 530 CE  
83 1 Y 1 A LYS 530 ? NZ  ? A LYS 530 NZ  
84 1 Y 1 A ASN 533 ? CG  ? A ASN 533 CG  
85 1 Y 1 A ASN 533 ? OD1 ? A ASN 533 OD1 
86 1 Y 1 A ASN 533 ? ND2 ? A ASN 533 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 1   ? A ASP 1   
2 1 Y 1 A ASP 2   ? A ASP 2   
3 1 Y 1 A HIS 3   ? A HIS 3   
4 1 Y 1 A GLN 488 ? A GLN 488 
5 1 Y 1 A GLU 489 ? A GLU 489 
6 1 Y 1 A SER 490 ? A SER 490 
7 1 Y 1 A ALA 536 ? A ALA 536 
8 1 Y 1 A CYS 537 ? A CYS 537 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
3 'HUPERZINE B'                            HUB 
4 water                                    HOH 
#