data_1GPW
# 
_entry.id   1GPW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.312 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GPW         
PDBE  EBI-8837     
WWPDB D_1290008837 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1THF 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'CYCLASE SUBUNIT OF IMIDAZOLEGLYCEROLPHOSPHATE SYNTHASE FROM THERMOTOGA MARITIMA' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GPW 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2001-11-12 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Walker, M.'             1 
'Beismann-Driemeyer, S.' 2 
'Sterner, R.'            3 
'Wilmanns, M.'           4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Structural Evidence for Ammonia Tunneling Across the (Beta Alpha)(8) Barrel of the Imidazole Glycerol Phosphate Synthase Bienzyme Complex.
;
Structure    10  185   ? 2002 STRUE6 UK 0969-2126 2005 ? 11839304 '10.1016/S0969-2126(02)00702-5' 
1       'Imidazole Glycerol Phosphate Synthase from Thermotoga Maritima' J.Biol.Chem. 276 20387 ? 2001 JBCHA3 US 0021-9258 0071 ? 
11264293 10.1074/JBC.M102012200          
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Douangamath, A.'        1 ? 
primary 'Walker, M.'             2 ? 
primary 'Beismann-Driemeyer, S.' 3 ? 
primary 'Vega-Fernandez, M.C.'   4 ? 
primary 'Sterner, R.'            5 ? 
primary 'Wilmanns, M.'           6 ? 
1       'Beismann-Driemeyer, S.' 7 ? 
1       'Sterner, R.'            8 ? 
# 
_cell.entry_id           1GPW 
_cell.length_a           74.000 
_cell.length_b           91.900 
_cell.length_c           131.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         105.90 
_cell.angle_gamma        90.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GPW 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HISF PROTEIN'          27752.887 3   ? YES ? ? 
2 polymer     man 'AMIDOTRANSFERASE HISH' 23130.564 3   ? ?   ? ? 
3 non-polymer syn 'PHOSPHATE ION'         94.971    6   ? ?   ? ? 
4 water       nat water                   18.015    459 ? ?   ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MLAKRIIACLNVKDGRVVKGTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKVAEQIDIPFTVG
GGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQAVVVAIDAKRVDGEFMVFTYSGKKNTGILLRDWVVEV
EKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADAALAASVFHFREIDVRELKEY
LKKHGVNVRLEGL
;
;MLAKRIIACLNVKDGRVVKGTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKVAEQIDIPFTVG
GGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQAVVVAIDAKRVDGEFMVFTYSGKKNTGILLRDWVVEV
EKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADAALAASVFHFREIDVRELKEY
LKKHGVNVRLEGL
;
A,C,E ? 
2 'polypeptide(L)' no no 
;MRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDERYV
VGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDG
EIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSLSRR
;
;MRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDERYV
VGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDG
EIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSLSRR
;
B,D,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LEU n 
1 3   ALA n 
1 4   LYS n 
1 5   ARG n 
1 6   ILE n 
1 7   ILE n 
1 8   ALA n 
1 9   CYS n 
1 10  LEU n 
1 11  ASN n 
1 12  VAL n 
1 13  LYS n 
1 14  ASP n 
1 15  GLY n 
1 16  ARG n 
1 17  VAL n 
1 18  VAL n 
1 19  LYS n 
1 20  GLY n 
1 21  THR n 
1 22  ASN n 
1 23  PHE n 
1 24  GLU n 
1 25  ASN n 
1 26  LEU n 
1 27  ARG n 
1 28  ASP n 
1 29  SER n 
1 30  GLY n 
1 31  ASP n 
1 32  PRO n 
1 33  VAL n 
1 34  GLU n 
1 35  LEU n 
1 36  GLY n 
1 37  LYS n 
1 38  PHE n 
1 39  TYR n 
1 40  SER n 
1 41  GLU n 
1 42  ILE n 
1 43  GLY n 
1 44  ILE n 
1 45  ASP n 
1 46  GLU n 
1 47  LEU n 
1 48  VAL n 
1 49  PHE n 
1 50  LEU n 
1 51  ASP n 
1 52  ILE n 
1 53  THR n 
1 54  ALA n 
1 55  SER n 
1 56  VAL n 
1 57  GLU n 
1 58  LYS n 
1 59  ARG n 
1 60  LYS n 
1 61  THR n 
1 62  MET n 
1 63  LEU n 
1 64  GLU n 
1 65  LEU n 
1 66  VAL n 
1 67  GLU n 
1 68  LYS n 
1 69  VAL n 
1 70  ALA n 
1 71  GLU n 
1 72  GLN n 
1 73  ILE n 
1 74  ASP n 
1 75  ILE n 
1 76  PRO n 
1 77  PHE n 
1 78  THR n 
1 79  VAL n 
1 80  GLY n 
1 81  GLY n 
1 82  GLY n 
1 83  ILE n 
1 84  HIS n 
1 85  ASP n 
1 86  PHE n 
1 87  GLU n 
1 88  THR n 
1 89  ALA n 
1 90  SER n 
1 91  GLU n 
1 92  LEU n 
1 93  ILE n 
1 94  LEU n 
1 95  ARG n 
1 96  GLY n 
1 97  ALA n 
1 98  ASP n 
1 99  LYS n 
1 100 VAL n 
1 101 SER n 
1 102 ILE n 
1 103 ASN n 
1 104 THR n 
1 105 ALA n 
1 106 ALA n 
1 107 VAL n 
1 108 GLU n 
1 109 ASN n 
1 110 PRO n 
1 111 SER n 
1 112 LEU n 
1 113 ILE n 
1 114 THR n 
1 115 GLN n 
1 116 ILE n 
1 117 ALA n 
1 118 GLN n 
1 119 THR n 
1 120 PHE n 
1 121 GLY n 
1 122 SER n 
1 123 GLN n 
1 124 ALA n 
1 125 VAL n 
1 126 VAL n 
1 127 VAL n 
1 128 ALA n 
1 129 ILE n 
1 130 ASP n 
1 131 ALA n 
1 132 LYS n 
1 133 ARG n 
1 134 VAL n 
1 135 ASP n 
1 136 GLY n 
1 137 GLU n 
1 138 PHE n 
1 139 MET n 
1 140 VAL n 
1 141 PHE n 
1 142 THR n 
1 143 TYR n 
1 144 SER n 
1 145 GLY n 
1 146 LYS n 
1 147 LYS n 
1 148 ASN n 
1 149 THR n 
1 150 GLY n 
1 151 ILE n 
1 152 LEU n 
1 153 LEU n 
1 154 ARG n 
1 155 ASP n 
1 156 TRP n 
1 157 VAL n 
1 158 VAL n 
1 159 GLU n 
1 160 VAL n 
1 161 GLU n 
1 162 LYS n 
1 163 ARG n 
1 164 GLY n 
1 165 ALA n 
1 166 GLY n 
1 167 GLU n 
1 168 ILE n 
1 169 LEU n 
1 170 LEU n 
1 171 THR n 
1 172 SER n 
1 173 ILE n 
1 174 ASP n 
1 175 ARG n 
1 176 ASP n 
1 177 GLY n 
1 178 THR n 
1 179 LYS n 
1 180 SER n 
1 181 GLY n 
1 182 TYR n 
1 183 ASP n 
1 184 THR n 
1 185 GLU n 
1 186 MET n 
1 187 ILE n 
1 188 ARG n 
1 189 PHE n 
1 190 VAL n 
1 191 ARG n 
1 192 PRO n 
1 193 LEU n 
1 194 THR n 
1 195 THR n 
1 196 LEU n 
1 197 PRO n 
1 198 ILE n 
1 199 ILE n 
1 200 ALA n 
1 201 SER n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 GLY n 
1 206 LYS n 
1 207 MET n 
1 208 GLU n 
1 209 HIS n 
1 210 PHE n 
1 211 LEU n 
1 212 GLU n 
1 213 ALA n 
1 214 PHE n 
1 215 LEU n 
1 216 ALA n 
1 217 GLY n 
1 218 ALA n 
1 219 ASP n 
1 220 ALA n 
1 221 ALA n 
1 222 LEU n 
1 223 ALA n 
1 224 ALA n 
1 225 SER n 
1 226 VAL n 
1 227 PHE n 
1 228 HIS n 
1 229 PHE n 
1 230 ARG n 
1 231 GLU n 
1 232 ILE n 
1 233 ASP n 
1 234 VAL n 
1 235 ARG n 
1 236 GLU n 
1 237 LEU n 
1 238 LYS n 
1 239 GLU n 
1 240 TYR n 
1 241 LEU n 
1 242 LYS n 
1 243 LYS n 
1 244 HIS n 
1 245 GLY n 
1 246 VAL n 
1 247 ASN n 
1 248 VAL n 
1 249 ARG n 
1 250 LEU n 
1 251 GLU n 
1 252 GLY n 
1 253 LEU n 
2 1   MET n 
2 2   ARG n 
2 3   ILE n 
2 4   GLY n 
2 5   ILE n 
2 6   ILE n 
2 7   SER n 
2 8   VAL n 
2 9   GLY n 
2 10  PRO n 
2 11  GLY n 
2 12  ASN n 
2 13  ILE n 
2 14  MET n 
2 15  ASN n 
2 16  LEU n 
2 17  TYR n 
2 18  ARG n 
2 19  GLY n 
2 20  VAL n 
2 21  LYS n 
2 22  ARG n 
2 23  ALA n 
2 24  SER n 
2 25  GLU n 
2 26  ASN n 
2 27  PHE n 
2 28  GLU n 
2 29  ASP n 
2 30  VAL n 
2 31  SER n 
2 32  ILE n 
2 33  GLU n 
2 34  LEU n 
2 35  VAL n 
2 36  GLU n 
2 37  SER n 
2 38  PRO n 
2 39  ARG n 
2 40  ASN n 
2 41  ASP n 
2 42  LEU n 
2 43  TYR n 
2 44  ASP n 
2 45  LEU n 
2 46  LEU n 
2 47  PHE n 
2 48  ILE n 
2 49  PRO n 
2 50  GLY n 
2 51  VAL n 
2 52  GLY n 
2 53  HIS n 
2 54  PHE n 
2 55  GLY n 
2 56  GLU n 
2 57  GLY n 
2 58  MET n 
2 59  ARG n 
2 60  ARG n 
2 61  LEU n 
2 62  ARG n 
2 63  GLU n 
2 64  ASN n 
2 65  ASP n 
2 66  LEU n 
2 67  ILE n 
2 68  ASP n 
2 69  PHE n 
2 70  VAL n 
2 71  ARG n 
2 72  LYS n 
2 73  HIS n 
2 74  VAL n 
2 75  GLU n 
2 76  ASP n 
2 77  GLU n 
2 78  ARG n 
2 79  TYR n 
2 80  VAL n 
2 81  VAL n 
2 82  GLY n 
2 83  VAL n 
2 84  CYS n 
2 85  LEU n 
2 86  GLY n 
2 87  MET n 
2 88  GLN n 
2 89  LEU n 
2 90  LEU n 
2 91  PHE n 
2 92  GLU n 
2 93  GLU n 
2 94  SER n 
2 95  GLU n 
2 96  GLU n 
2 97  ALA n 
2 98  PRO n 
2 99  GLY n 
2 100 VAL n 
2 101 LYS n 
2 102 GLY n 
2 103 LEU n 
2 104 SER n 
2 105 LEU n 
2 106 ILE n 
2 107 GLU n 
2 108 GLY n 
2 109 ASN n 
2 110 VAL n 
2 111 VAL n 
2 112 LYS n 
2 113 LEU n 
2 114 ARG n 
2 115 SER n 
2 116 ARG n 
2 117 ARG n 
2 118 LEU n 
2 119 PRO n 
2 120 HIS n 
2 121 MET n 
2 122 GLY n 
2 123 TRP n 
2 124 ASN n 
2 125 GLU n 
2 126 VAL n 
2 127 ILE n 
2 128 PHE n 
2 129 LYS n 
2 130 ASP n 
2 131 THR n 
2 132 PHE n 
2 133 PRO n 
2 134 ASN n 
2 135 GLY n 
2 136 TYR n 
2 137 TYR n 
2 138 TYR n 
2 139 PHE n 
2 140 VAL n 
2 141 HIS n 
2 142 THR n 
2 143 TYR n 
2 144 ARG n 
2 145 ALA n 
2 146 VAL n 
2 147 CYS n 
2 148 GLU n 
2 149 GLU n 
2 150 GLU n 
2 151 HIS n 
2 152 VAL n 
2 153 LEU n 
2 154 GLY n 
2 155 THR n 
2 156 THR n 
2 157 GLU n 
2 158 TYR n 
2 159 ASP n 
2 160 GLY n 
2 161 GLU n 
2 162 ILE n 
2 163 PHE n 
2 164 PRO n 
2 165 SER n 
2 166 ALA n 
2 167 VAL n 
2 168 ARG n 
2 169 LYS n 
2 170 GLY n 
2 171 ARG n 
2 172 ILE n 
2 173 LEU n 
2 174 GLY n 
2 175 PHE n 
2 176 GLN n 
2 177 PHE n 
2 178 HIS n 
2 179 PRO n 
2 180 GLU n 
2 181 LYS n 
2 182 SER n 
2 183 SER n 
2 184 LYS n 
2 185 ILE n 
2 186 GLY n 
2 187 ARG n 
2 188 LYS n 
2 189 LEU n 
2 190 LEU n 
2 191 GLU n 
2 192 LYS n 
2 193 VAL n 
2 194 ILE n 
2 195 GLU n 
2 196 CYS n 
2 197 SER n 
2 198 LEU n 
2 199 SER n 
2 200 ARG n 
2 201 ARG n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'THERMOTOGA MARITIMA' 2336 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? W3110 
'W3110 DELTA-TRPEA2' ? ? ? ? ? ? ? ? ? ? RBSIISPHI-THISH ? ? 
2 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'THERMOTOGA MARITIMA' 2336 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? W3110 
'W3110 DELTA-TRPEA2' ? ? ? ? ? ? ? ? ? ? RBSIISPHI-THISH ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP Q9X0C6     1 ? ? Q9X0C6 ? 
2 UNP HIS5_THEMA 2 ? ? Q9X0C8 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1GPW A 1 ? 253 ? Q9X0C6 1 ? 253 ? 1 253 
2 2 1GPW B 1 ? 201 ? Q9X0C8 1 ? 201 ? 1 201 
3 1 1GPW C 1 ? 253 ? Q9X0C6 1 ? 253 ? 1 253 
4 2 1GPW D 1 ? 201 ? Q9X0C8 1 ? 201 ? 1 201 
5 1 1GPW E 1 ? 253 ? Q9X0C6 1 ? 253 ? 1 253 
6 2 1GPW F 1 ? 201 ? Q9X0C8 1 ? 201 ? 1 201 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1GPW ASN A 11 ? UNP Q9X0C6 ASP 11 'engineered mutation' 11 1 
3 1GPW ASN C 11 ? UNP Q9X0C6 ASP 11 'engineered mutation' 11 2 
5 1GPW ASN E 11 ? UNP Q9X0C6 ASP 11 'engineered mutation' 11 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1GPW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.81 
_exptl_crystal.density_percent_sol   56.17 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;PROTEIN SOLUTION: 10 MM TRIS (PH 8.0), 1 MM DTT, 1 MM EDTA, 28.8 MG/ML PROTEIN COMPLEX. PRECIPITATE SOLUTION: 15 %[W/V] PEG-8000, 0.9 M AMMONIUM NITRATE, 0.1 M HEPES/HCL (PH 8.5), 10 MM DTT, 5% [V/V] MPD
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'X-RAY RESEARCH' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                'BENT MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    TRIANGULAR 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.88 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X11' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   X11 
_diffrn_source.pdbx_wavelength             0.88 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1GPW 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.370 
_reflns.number_obs                   65356 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            0.04800 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        28.0000 
_reflns.B_iso_Wilson_estimate        46.2 
_reflns.pdbx_redundancy              2.900 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.37 
_reflns_shell.d_res_low              2.45 
_reflns_shell.percent_possible_all   78.8 
_reflns_shell.Rmerge_I_obs           0.16800 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.500 
_reflns_shell.pdbx_redundancy        2.50 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1GPW 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     65356 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.0 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    97.8 
_refine.ls_R_factor_obs                          0.226 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.226 
_refine.ls_R_factor_R_free                       0.290 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3327 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               58.4 
_refine.aniso_B[1][1]                            22.48 
_refine.aniso_B[2][2]                            -9.16 
_refine.aniso_B[3][3]                            -13.33 
_refine.aniso_B[1][2]                            0.0 
_refine.aniso_B[1][3]                            7.36 
_refine.aniso_B[2][3]                            0.0 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.320971 
_refine.solvent_model_param_bsol                 59.6192 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1THF 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1GPW 
_refine_analyze.Luzzati_coordinate_error_obs    0.35 
_refine_analyze.Luzzati_sigma_a_obs             0.33 
_refine_analyze.Luzzati_d_res_low_obs           6.00 
_refine_analyze.Luzzati_coordinate_error_free   0.47 
_refine_analyze.Luzzati_sigma_a_free            0.47 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10643 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             459 
_refine_hist.number_atoms_total               11132 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.5   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.8  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.82  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             9.63  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            9.73  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             13.34 2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            13.92 2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.55 
_refine_ls_shell.number_reflns_R_work             9566 
_refine_ls_shell.R_factor_R_work                  0.311 
_refine_ls_shell.percent_reflns_obs               91.1 
_refine_ls_shell.R_factor_R_free                  0.406 
_refine_ls_shell.R_factor_R_free_error            0.018 
_refine_ls_shell.percent_reflns_R_free            5.2 
_refine_ls_shell.number_reflns_R_free             529 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 ION.PARA          PROTEIN.TOP 
'X-RAY DIFFRACTION' 2 WATER_REP.PARAM   WATER.TOP   
'X-RAY DIFFRACTION' 3 PROTEIN_REP.PARAM ION.TOP     
# 
_struct.entry_id                  1GPW 
_struct.title                     
;Structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex.
;
_struct.pdbx_descriptor           'HISF PROTEIN, AMIDOTRANSFERASE HISH' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GPW 
_struct_keywords.pdbx_keywords   LYASE/TRANSFERASE 
_struct_keywords.text            
;LYASE/TRANSFERASE, COMPLEX (LYASE-TRANSFERASE), HISTIDINE BIOSYNTHESIS, GLUTAMINASE, GLUTAMINE AMIDOTRANSFERASE, CYCLASE, AMMONIA CHANNEL, LYASE-TRANSFERASE complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;THE BIOLOGICALLY RELEVANT UNITS ARE THE                      
 FOLLOWING HETERODIMERS:HISF/HISH CHAIN A/CHAIN B                     
 , HISF/HISH CHAIN C/CHAIN D, HISF/HISHCHAIN E/                       
 CHAIN F. THERE ARE SIGNIFICANT CONFORMATIONAL                        
 DIFFERENCESIN THE THREE HETERO-DIMERS, HENCE THEY                    
 CANNOT BE RELATED BYUNIQUE SETS OF NCS OPERATORS.
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 31  ? GLY A 43  ? ASP A 31  GLY A 43  1 ? 13 
HELX_P HELX_P2  AA2 GLU A 57  ? GLU A 71  ? GLU A 57  GLU A 71  1 ? 15 
HELX_P HELX_P3  AA3 ASP A 85  ? GLY A 96  ? ASP A 85  GLY A 96  1 ? 12 
HELX_P HELX_P4  AA4 ASN A 103 ? ASN A 109 ? ASN A 103 ASN A 109 1 ? 7  
HELX_P HELX_P5  AA5 PRO A 110 ? GLY A 121 ? PRO A 110 GLY A 121 1 ? 12 
HELX_P HELX_P6  AA6 LEU A 153 ? GLY A 164 ? LEU A 153 GLY A 164 1 ? 12 
HELX_P HELX_P7  AA7 ASP A 183 ? ARG A 191 ? ASP A 183 ARG A 191 1 ? 9  
HELX_P HELX_P8  AA8 PRO A 192 ? THR A 194 ? PRO A 192 THR A 194 5 ? 3  
HELX_P HELX_P9  AA9 LYS A 206 ? ALA A 216 ? LYS A 206 ALA A 216 1 ? 11 
HELX_P HELX_P10 AB1 ALA A 224 ? PHE A 229 ? ALA A 224 PHE A 229 1 ? 6  
HELX_P HELX_P11 AB2 ASP A 233 ? HIS A 244 ? ASP A 233 HIS A 244 1 ? 12 
HELX_P HELX_P12 AB3 ILE B 13  ? SER B 24  ? ILE B 13  SER B 24  1 ? 12 
HELX_P HELX_P13 AB4 PHE B 54  ? ASN B 64  ? PHE B 54  ASN B 64  1 ? 11 
HELX_P HELX_P14 AB5 LEU B 66  ? ASP B 76  ? LEU B 66  ASP B 76  1 ? 11 
HELX_P HELX_P15 AB6 CYS B 84  ? LEU B 89  ? CYS B 84  LEU B 89  1 ? 6  
HELX_P HELX_P16 AB7 HIS B 178 ? LYS B 181 ? HIS B 178 LYS B 181 5 ? 4  
HELX_P HELX_P17 AB8 SER B 182 ? SER B 197 ? SER B 182 SER B 197 1 ? 16 
HELX_P HELX_P18 AB9 ASP C 31  ? GLY C 43  ? ASP C 31  GLY C 43  1 ? 13 
HELX_P HELX_P19 AC1 GLU C 57  ? GLU C 71  ? GLU C 57  GLU C 71  1 ? 15 
HELX_P HELX_P20 AC2 ASP C 85  ? ARG C 95  ? ASP C 85  ARG C 95  1 ? 11 
HELX_P HELX_P21 AC3 ASN C 103 ? GLU C 108 ? ASN C 103 GLU C 108 1 ? 6  
HELX_P HELX_P22 AC4 PRO C 110 ? GLY C 121 ? PRO C 110 GLY C 121 1 ? 12 
HELX_P HELX_P23 AC5 LEU C 153 ? ARG C 163 ? LEU C 153 ARG C 163 1 ? 11 
HELX_P HELX_P24 AC6 ASP C 183 ? ARG C 191 ? ASP C 183 ARG C 191 1 ? 9  
HELX_P HELX_P25 AC7 PRO C 192 ? THR C 194 ? PRO C 192 THR C 194 5 ? 3  
HELX_P HELX_P26 AC8 LYS C 206 ? ALA C 216 ? LYS C 206 ALA C 216 1 ? 11 
HELX_P HELX_P27 AC9 ALA C 224 ? PHE C 229 ? ALA C 224 PHE C 229 1 ? 6  
HELX_P HELX_P28 AD1 ASP C 233 ? HIS C 244 ? ASP C 233 HIS C 244 1 ? 12 
HELX_P HELX_P29 AD2 ILE D 13  ? GLU D 25  ? ILE D 13  GLU D 25  1 ? 13 
HELX_P HELX_P30 AD3 PHE D 54  ? ASN D 64  ? PHE D 54  ASN D 64  1 ? 11 
HELX_P HELX_P31 AD4 LEU D 66  ? ASP D 76  ? LEU D 66  ASP D 76  1 ? 11 
HELX_P HELX_P32 AD5 CYS D 84  ? LEU D 89  ? CYS D 84  LEU D 89  1 ? 6  
HELX_P HELX_P33 AD6 GLU D 148 ? GLU D 150 ? GLU D 148 GLU D 150 5 ? 3  
HELX_P HELX_P34 AD7 HIS D 178 ? LYS D 181 ? HIS D 178 LYS D 181 5 ? 4  
HELX_P HELX_P35 AD8 SER D 182 ? SER D 197 ? SER D 182 SER D 197 1 ? 16 
HELX_P HELX_P36 AD9 ASP E 31  ? GLY E 43  ? ASP E 31  GLY E 43  1 ? 13 
HELX_P HELX_P37 AE1 GLU E 57  ? GLU E 71  ? GLU E 57  GLU E 71  1 ? 15 
HELX_P HELX_P38 AE2 ASP E 85  ? GLY E 96  ? ASP E 85  GLY E 96  1 ? 12 
HELX_P HELX_P39 AE3 ASN E 103 ? ASN E 109 ? ASN E 103 ASN E 109 1 ? 7  
HELX_P HELX_P40 AE4 PRO E 110 ? GLY E 121 ? PRO E 110 GLY E 121 1 ? 12 
HELX_P HELX_P41 AE5 ARG E 133 ? GLU E 137 ? ARG E 133 GLU E 137 5 ? 5  
HELX_P HELX_P42 AE6 TYR E 143 ? LYS E 146 ? TYR E 143 LYS E 146 5 ? 4  
HELX_P HELX_P43 AE7 LEU E 153 ? GLY E 164 ? LEU E 153 GLY E 164 1 ? 12 
HELX_P HELX_P44 AE8 ASP E 183 ? ARG E 191 ? ASP E 183 ARG E 191 1 ? 9  
HELX_P HELX_P45 AE9 PRO E 192 ? THR E 194 ? PRO E 192 THR E 194 5 ? 3  
HELX_P HELX_P46 AF1 LYS E 206 ? ALA E 216 ? LYS E 206 ALA E 216 1 ? 11 
HELX_P HELX_P47 AF2 ALA E 224 ? ARG E 230 ? ALA E 224 ARG E 230 1 ? 7  
HELX_P HELX_P48 AF3 ASP E 233 ? LYS E 243 ? ASP E 233 LYS E 243 1 ? 11 
HELX_P HELX_P49 AF4 ILE F 13  ? GLU F 25  ? ILE F 13  GLU F 25  1 ? 13 
HELX_P HELX_P50 AF5 PHE F 54  ? GLU F 63  ? PHE F 54  GLU F 63  1 ? 10 
HELX_P HELX_P51 AF6 LEU F 66  ? ASP F 76  ? LEU F 66  ASP F 76  1 ? 11 
HELX_P HELX_P52 AF7 CYS F 84  ? LEU F 89  ? CYS F 84  LEU F 89  1 ? 6  
HELX_P HELX_P53 AF8 HIS F 178 ? LYS F 181 ? HIS F 178 LYS F 181 5 ? 4  
HELX_P HELX_P54 AF9 SER F 182 ? SER F 197 ? SER F 182 SER F 197 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 9  ? 
AA2 ? 9  ? 
AA3 ? 9  ? 
AA4 ? 2  ? 
AA5 ? 2  ? 
AA6 ? 8  ? 
AA7 ? 8  ? 
AA8 ? 9  ? 
AA9 ? 2  ? 
AB1 ? 11 ? 
AB2 ? 9  ? 
AB3 ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? anti-parallel 
AA1 3  4  ? parallel      
AA1 4  5  ? parallel      
AA1 5  6  ? parallel      
AA1 6  7  ? parallel      
AA1 7  8  ? anti-parallel 
AA1 8  9  ? anti-parallel 
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? parallel      
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? anti-parallel 
AA2 8  9  ? anti-parallel 
AA3 1  2  ? parallel      
AA3 2  3  ? parallel      
AA3 3  4  ? parallel      
AA3 4  5  ? parallel      
AA3 5  6  ? anti-parallel 
AA3 6  7  ? anti-parallel 
AA3 7  8  ? anti-parallel 
AA3 8  9  ? anti-parallel 
AA4 1  2  ? anti-parallel 
AA5 1  2  ? anti-parallel 
AA6 1  2  ? anti-parallel 
AA6 2  3  ? parallel      
AA6 3  4  ? parallel      
AA6 4  5  ? parallel      
AA6 5  6  ? parallel      
AA6 6  7  ? anti-parallel 
AA6 7  8  ? anti-parallel 
AA7 1  2  ? anti-parallel 
AA7 2  3  ? parallel      
AA7 3  4  ? parallel      
AA7 4  5  ? parallel      
AA7 5  6  ? parallel      
AA7 6  7  ? anti-parallel 
AA7 7  8  ? anti-parallel 
AA8 1  2  ? parallel      
AA8 2  3  ? parallel      
AA8 3  4  ? parallel      
AA8 4  5  ? parallel      
AA8 5  6  ? anti-parallel 
AA8 6  7  ? anti-parallel 
AA8 7  8  ? anti-parallel 
AA8 8  9  ? anti-parallel 
AA9 1  2  ? anti-parallel 
AB1 1  2  ? anti-parallel 
AB1 2  3  ? anti-parallel 
AB1 3  4  ? parallel      
AB1 4  5  ? parallel      
AB1 5  6  ? parallel      
AB1 6  7  ? parallel      
AB1 7  8  ? parallel      
AB1 8  9  ? parallel      
AB1 9  10 ? parallel      
AB1 10 11 ? parallel      
AB2 1  2  ? parallel      
AB2 2  3  ? parallel      
AB2 3  4  ? parallel      
AB2 4  5  ? parallel      
AB2 5  6  ? anti-parallel 
AB2 6  7  ? anti-parallel 
AB2 7  8  ? anti-parallel 
AB2 8  9  ? anti-parallel 
AB3 1  2  ? anti-parallel 
AB3 2  3  ? parallel      
AB3 3  4  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  ARG A 27  ? ASP A 28  ? ARG A 27  ASP A 28  
AA1 2  ARG A 16  ? LYS A 19  ? ARG A 16  LYS A 19  
AA1 3  ARG A 5   ? LYS A 13  ? ARG A 5   LYS A 13  
AA1 4  GLU A 46  ? ASP A 51  ? GLU A 46  ASP A 51  
AA1 5  PHE A 77  ? GLY A 80  ? PHE A 77  GLY A 80  
AA1 6  LYS A 99  ? ILE A 102 ? LYS A 99  ILE A 102 
AA1 7  VAL A 125 ? VAL A 134 ? VAL A 125 VAL A 134 
AA1 8  GLU A 137 ? THR A 142 ? GLU A 137 THR A 142 
AA1 9  LYS A 147 ? LEU A 152 ? LYS A 147 LEU A 152 
AA2 1  ARG A 27  ? ASP A 28  ? ARG A 27  ASP A 28  
AA2 2  ARG A 16  ? LYS A 19  ? ARG A 16  LYS A 19  
AA2 3  ARG A 5   ? LYS A 13  ? ARG A 5   LYS A 13  
AA2 4  ALA A 220 ? ALA A 223 ? ALA A 220 ALA A 223 
AA2 5  ILE A 198 ? SER A 201 ? ILE A 198 SER A 201 
AA2 6  GLU A 167 ? SER A 172 ? GLU A 167 SER A 172 
AA2 7  VAL A 125 ? VAL A 134 ? VAL A 125 VAL A 134 
AA2 8  GLU A 137 ? THR A 142 ? GLU A 137 THR A 142 
AA2 9  LYS A 147 ? LEU A 152 ? LYS A 147 LEU A 152 
AA3 1  SER B 31  ? VAL B 35  ? SER B 31  VAL B 35  
AA3 2  ARG B 2   ? ILE B 6   ? ARG B 2   ILE B 6   
AA3 3  LEU B 45  ? ILE B 48  ? LEU B 45  ILE B 48  
AA3 4  TYR B 79  ? VAL B 83  ? TYR B 79  VAL B 83  
AA3 5  ILE B 172 ? PHE B 175 ? ILE B 172 PHE B 175 
AA3 6  GLU B 161 ? LYS B 169 ? GLU B 161 LYS B 169 
AA3 7  VAL B 152 ? TYR B 158 ? VAL B 152 TYR B 158 
AA3 8  HIS B 120 ? PHE B 128 ? HIS B 120 PHE B 128 
AA3 9  GLY B 135 ? HIS B 141 ? GLY B 135 HIS B 141 
AA4 1  GLU B 93  ? SER B 94  ? GLU B 93  SER B 94  
AA4 2  ALA B 97  ? LYS B 101 ? ALA B 97  LYS B 101 
AA5 1  GLY B 108 ? LYS B 112 ? GLY B 108 LYS B 112 
AA5 2  TYR B 143 ? CYS B 147 ? TYR B 143 CYS B 147 
AA6 1  ARG C 16  ? VAL C 17  ? ARG C 16  VAL C 17  
AA6 2  ARG C 5   ? LYS C 13  ? ARG C 5   LYS C 13  
AA6 3  GLU C 46  ? ASP C 51  ? GLU C 46  ASP C 51  
AA6 4  PHE C 77  ? GLY C 80  ? PHE C 77  GLY C 80  
AA6 5  LYS C 99  ? ILE C 102 ? LYS C 99  ILE C 102 
AA6 6  VAL C 125 ? VAL C 134 ? VAL C 125 VAL C 134 
AA6 7  GLU C 137 ? THR C 142 ? GLU C 137 THR C 142 
AA6 8  LYS C 147 ? LEU C 152 ? LYS C 147 LEU C 152 
AA7 1  ARG C 16  ? VAL C 17  ? ARG C 16  VAL C 17  
AA7 2  ARG C 5   ? LYS C 13  ? ARG C 5   LYS C 13  
AA7 3  ALA C 220 ? ALA C 223 ? ALA C 220 ALA C 223 
AA7 4  ILE C 198 ? SER C 201 ? ILE C 198 SER C 201 
AA7 5  GLU C 167 ? SER C 172 ? GLU C 167 SER C 172 
AA7 6  VAL C 125 ? VAL C 134 ? VAL C 125 VAL C 134 
AA7 7  GLU C 137 ? THR C 142 ? GLU C 137 THR C 142 
AA7 8  LYS C 147 ? LEU C 152 ? LYS C 147 LEU C 152 
AA8 1  SER D 31  ? VAL D 35  ? SER D 31  VAL D 35  
AA8 2  ARG D 2   ? ILE D 6   ? ARG D 2   ILE D 6   
AA8 3  LEU D 45  ? ILE D 48  ? LEU D 45  ILE D 48  
AA8 4  TYR D 79  ? VAL D 83  ? TYR D 79  VAL D 83  
AA8 5  ILE D 172 ? PHE D 175 ? ILE D 172 PHE D 175 
AA8 6  GLU D 161 ? LYS D 169 ? GLU D 161 LYS D 169 
AA8 7  VAL D 152 ? TYR D 158 ? VAL D 152 TYR D 158 
AA8 8  HIS D 120 ? PHE D 128 ? HIS D 120 PHE D 128 
AA8 9  GLY D 135 ? HIS D 141 ? GLY D 135 HIS D 141 
AA9 1  ASN D 109 ? LYS D 112 ? ASN D 109 LYS D 112 
AA9 2  TYR D 143 ? VAL D 146 ? TYR D 143 VAL D 146 
AB1 1  ASN E 148 ? LEU E 152 ? ASN E 148 LEU E 152 
AB1 2  MET E 139 ? PHE E 141 ? MET E 139 PHE E 141 
AB1 3  VAL E 125 ? LYS E 132 ? VAL E 125 LYS E 132 
AB1 4  GLU E 167 ? SER E 172 ? GLU E 167 SER E 172 
AB1 5  ILE E 198 ? SER E 201 ? ILE E 198 SER E 201 
AB1 6  ALA E 220 ? ALA E 223 ? ALA E 220 ALA E 223 
AB1 7  ARG E 5   ? ASN E 11  ? ARG E 5   ASN E 11  
AB1 8  GLU E 46  ? LEU E 50  ? GLU E 46  LEU E 50  
AB1 9  PHE E 77  ? GLY E 80  ? PHE E 77  GLY E 80  
AB1 10 LYS E 99  ? ILE E 102 ? LYS E 99  ILE E 102 
AB1 11 VAL E 125 ? LYS E 132 ? VAL E 125 LYS E 132 
AB2 1  SER F 31  ? VAL F 35  ? SER F 31  VAL F 35  
AB2 2  ARG F 2   ? ILE F 6   ? ARG F 2   ILE F 6   
AB2 3  LEU F 45  ? ILE F 48  ? LEU F 45  ILE F 48  
AB2 4  TYR F 79  ? VAL F 83  ? TYR F 79  VAL F 83  
AB2 5  ILE F 172 ? PHE F 175 ? ILE F 172 PHE F 175 
AB2 6  GLU F 161 ? LYS F 169 ? GLU F 161 LYS F 169 
AB2 7  VAL F 152 ? TYR F 158 ? VAL F 152 TYR F 158 
AB2 8  HIS F 120 ? PHE F 128 ? HIS F 120 PHE F 128 
AB2 9  GLY F 135 ? HIS F 141 ? GLY F 135 HIS F 141 
AB3 1  ALA F 97  ? LYS F 101 ? ALA F 97  LYS F 101 
AB3 2  PHE F 91  ? SER F 94  ? PHE F 91  SER F 94  
AB3 3  ILE F 106 ? LYS F 112 ? ILE F 106 LYS F 112 
AB3 4  TYR F 143 ? VAL F 146 ? TYR F 143 VAL F 146 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  O ARG A 27  ? O ARG A 27  N LYS A 19  ? N LYS A 19  
AA1 2  3  O ARG A 16  ? O ARG A 16  N LYS A 13  ? N LYS A 13  
AA1 3  4  N LEU A 10  ? N LEU A 10  O VAL A 48  ? O VAL A 48  
AA1 4  5  N LEU A 47  ? N LEU A 47  O THR A 78  ? O THR A 78  
AA1 5  6  N VAL A 79  ? N VAL A 79  O SER A 101 ? O SER A 101 
AA1 6  7  N VAL A 100 ? N VAL A 100 O VAL A 126 ? O VAL A 126 
AA1 7  8  N VAL A 134 ? N VAL A 134 O GLU A 137 ? O GLU A 137 
AA1 8  9  N VAL A 140 ? N VAL A 140 O ILE A 151 ? O ILE A 151 
AA2 1  2  O ARG A 27  ? O ARG A 27  N LYS A 19  ? N LYS A 19  
AA2 2  3  O ARG A 16  ? O ARG A 16  N LYS A 13  ? N LYS A 13  
AA2 3  4  N ILE A 7   ? N ILE A 7   O ALA A 221 ? O ALA A 221 
AA2 4  5  O ALA A 220 ? O ALA A 220 N ALA A 200 ? N ALA A 200 
AA2 5  6  O ILE A 199 ? O ILE A 199 N ILE A 168 ? N ILE A 168 
AA2 6  7  O LEU A 169 ? O LEU A 169 N ILE A 129 ? N ILE A 129 
AA2 7  8  N VAL A 134 ? N VAL A 134 O GLU A 137 ? O GLU A 137 
AA2 8  9  N VAL A 140 ? N VAL A 140 O ILE A 151 ? O ILE A 151 
AA3 1  2  O GLU B 33  ? O GLU B 33  N ILE B 5   ? N ILE B 5   
AA3 2  3  N GLY B 4   ? N GLY B 4   O LEU B 45  ? O LEU B 45  
AA3 3  4  N LEU B 46  ? N LEU B 46  O VAL B 81  ? O VAL B 81  
AA3 4  5  N GLY B 82  ? N GLY B 82  O LEU B 173 ? O LEU B 173 
AA3 5  6  O GLY B 174 ? O GLY B 174 N VAL B 167 ? N VAL B 167 
AA3 6  7  O GLU B 161 ? O GLU B 161 N TYR B 158 ? N TYR B 158 
AA3 7  8  O THR B 155 ? O THR B 155 N ILE B 127 ? N ILE B 127 
AA3 8  9  N VAL B 126 ? N VAL B 126 O GLY B 135 ? O GLY B 135 
AA4 1  2  N SER B 94  ? N SER B 94  O ALA B 97  ? O ALA B 97  
AA5 1  2  N VAL B 111 ? N VAL B 111 O ARG B 144 ? O ARG B 144 
AA6 1  2  O ARG C 16  ? O ARG C 16  N LYS C 13  ? N LYS C 13  
AA6 2  3  N VAL C 12  ? N VAL C 12  O LEU C 50  ? O LEU C 50  
AA6 3  4  N PHE C 49  ? N PHE C 49  O THR C 78  ? O THR C 78  
AA6 4  5  N VAL C 79  ? N VAL C 79  O SER C 101 ? O SER C 101 
AA6 5  6  N VAL C 100 ? N VAL C 100 O VAL C 126 ? O VAL C 126 
AA6 6  7  N VAL C 134 ? N VAL C 134 O GLU C 137 ? O GLU C 137 
AA6 7  8  N VAL C 140 ? N VAL C 140 O ILE C 151 ? O ILE C 151 
AA7 1  2  O ARG C 16  ? O ARG C 16  N LYS C 13  ? N LYS C 13  
AA7 2  3  N CYS C 9   ? N CYS C 9   O ALA C 223 ? O ALA C 223 
AA7 3  4  O LEU C 222 ? O LEU C 222 N ALA C 200 ? N ALA C 200 
AA7 4  5  O ILE C 199 ? O ILE C 199 N ILE C 168 ? N ILE C 168 
AA7 5  6  O LEU C 169 ? O LEU C 169 N ILE C 129 ? N ILE C 129 
AA7 6  7  N VAL C 134 ? N VAL C 134 O GLU C 137 ? O GLU C 137 
AA7 7  8  N VAL C 140 ? N VAL C 140 O ILE C 151 ? O ILE C 151 
AA8 1  2  O SER D 31  ? O SER D 31  N ILE D 3   ? N ILE D 3   
AA8 2  3  N GLY D 4   ? N GLY D 4   O LEU D 45  ? O LEU D 45  
AA8 3  4  N ILE D 48  ? N ILE D 48  O VAL D 81  ? O VAL D 81  
AA8 4  5  N VAL D 80  ? N VAL D 80  O LEU D 173 ? O LEU D 173 
AA8 5  6  O GLY D 174 ? O GLY D 174 N VAL D 167 ? N VAL D 167 
AA8 6  7  O PHE D 163 ? O PHE D 163 N THR D 156 ? N THR D 156 
AA8 7  8  O THR D 155 ? O THR D 155 N ILE D 127 ? N ILE D 127 
AA8 8  9  N GLY D 122 ? N GLY D 122 O PHE D 139 ? O PHE D 139 
AA9 1  2  N VAL D 111 ? N VAL D 111 O ARG D 144 ? O ARG D 144 
AB1 1  2  O ILE E 151 ? O ILE E 151 N VAL E 140 ? N VAL E 140 
AB1 2  3  O PHE E 141 ? O PHE E 141 N ASP E 130 ? N ASP E 130 
AB1 3  4  N ILE E 129 ? N ILE E 129 O LEU E 169 ? O LEU E 169 
AB1 4  5  N LEU E 170 ? N LEU E 170 O SER E 201 ? O SER E 201 
AB1 5  6  N ALA E 200 ? N ALA E 200 O LEU E 222 ? O LEU E 222 
AB1 6  7  O ALA E 221 ? O ALA E 221 N ARG E 5   ? N ARG E 5   
AB1 7  8  N LEU E 10  ? N LEU E 10  O VAL E 48  ? O VAL E 48  
AB1 8  9  N LEU E 47  ? N LEU E 47  O THR E 78  ? O THR E 78  
AB1 9  10 N VAL E 79  ? N VAL E 79  O SER E 101 ? O SER E 101 
AB1 10 11 N VAL E 100 ? N VAL E 100 O VAL E 126 ? O VAL E 126 
AB2 1  2  O SER F 31  ? O SER F 31  N ILE F 3   ? N ILE F 3   
AB2 2  3  N GLY F 4   ? N GLY F 4   O LEU F 45  ? O LEU F 45  
AB2 3  4  N LEU F 46  ? N LEU F 46  O TYR F 79  ? O TYR F 79  
AB2 4  5  N VAL F 80  ? N VAL F 80  O LEU F 173 ? O LEU F 173 
AB2 5  6  O ILE F 172 ? O ILE F 172 N LYS F 169 ? N LYS F 169 
AB2 6  7  O ALA F 166 ? O ALA F 166 N LEU F 153 ? N LEU F 153 
AB2 7  8  O THR F 155 ? O THR F 155 N ILE F 127 ? N ILE F 127 
AB2 8  9  N GLY F 122 ? N GLY F 122 O PHE F 139 ? O PHE F 139 
AB3 1  2  O ALA F 97  ? O ALA F 97  N SER F 94  ? N SER F 94  
AB3 2  3  N GLU F 93  ? N GLU F 93  O VAL F 110 ? O VAL F 110 
AB3 3  4  N VAL F 111 ? N VAL F 111 O ARG F 144 ? O ARG F 144 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PO4 301 ? 6 'binding site for residue PO4 A 301' 
AC2 Software A PO4 302 ? 6 'binding site for residue PO4 A 302' 
AC3 Software C PO4 301 ? 7 'binding site for residue PO4 C 301' 
AC4 Software C PO4 302 ? 4 'binding site for residue PO4 C 302' 
AC5 Software C PO4 303 ? 3 'binding site for residue PO4 C 303' 
AC6 Software E PO4 301 ? 3 'binding site for residue PO4 E 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 GLY A 81  ? GLY A 81  . ? 1_555 ? 
2  AC1 6 GLY A 82  ? GLY A 82  . ? 1_555 ? 
3  AC1 6 HIS A 84  ? HIS A 84  . ? 1_555 ? 
4  AC1 6 ASN A 103 ? ASN A 103 . ? 1_555 ? 
5  AC1 6 THR A 104 ? THR A 104 . ? 1_555 ? 
6  AC1 6 HOH M .   ? HOH A 425 . ? 1_555 ? 
7  AC2 6 ASP A 176 ? ASP A 176 . ? 1_555 ? 
8  AC2 6 GLY A 177 ? GLY A 177 . ? 1_555 ? 
9  AC2 6 GLY A 203 ? GLY A 203 . ? 1_555 ? 
10 AC2 6 ALA A 223 ? ALA A 223 . ? 1_555 ? 
11 AC2 6 ALA A 224 ? ALA A 224 . ? 1_555 ? 
12 AC2 6 HOH M .   ? HOH A 421 . ? 1_555 ? 
13 AC3 7 ASP C 176 ? ASP C 176 . ? 1_555 ? 
14 AC3 7 GLY C 177 ? GLY C 177 . ? 1_555 ? 
15 AC3 7 GLY C 203 ? GLY C 203 . ? 1_555 ? 
16 AC3 7 ALA C 224 ? ALA C 224 . ? 1_555 ? 
17 AC3 7 SER C 225 ? SER C 225 . ? 1_555 ? 
18 AC3 7 HOH O .   ? HOH C 411 . ? 1_555 ? 
19 AC3 7 HOH O .   ? HOH C 452 . ? 1_555 ? 
20 AC4 4 GLY C 82  ? GLY C 82  . ? 1_555 ? 
21 AC4 4 ASN C 103 ? ASN C 103 . ? 1_555 ? 
22 AC4 4 THR C 104 ? THR C 104 . ? 1_555 ? 
23 AC4 4 HOH O .   ? HOH C 418 . ? 1_555 ? 
24 AC5 3 LYS C 37  ? LYS C 37  . ? 1_555 ? 
25 AC5 3 GLN C 72  ? GLN C 72  . ? 1_555 ? 
26 AC5 3 ASP C 74  ? ASP C 74  . ? 1_555 ? 
27 AC6 3 GLY E 81  ? GLY E 81  . ? 1_555 ? 
28 AC6 3 GLY E 82  ? GLY E 82  . ? 1_555 ? 
29 AC6 3 THR E 104 ? THR E 104 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1GPW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GPW 
_atom_sites.fract_transf_matrix[1][1]   0.013513 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003849 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010881 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007937 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . MET A 1 1   ? 4.491   1.306   33.646  1.00 48.81  ? 1   MET A N   1 
ATOM   2     C CA  . MET A 1 1   ? 3.541   0.750   34.653  1.00 57.92  ? 1   MET A CA  1 
ATOM   3     C C   . MET A 1 1   ? 4.125   0.888   36.054  1.00 46.65  ? 1   MET A C   1 
ATOM   4     O O   . MET A 1 1   ? 5.312   0.647   36.274  1.00 43.45  ? 1   MET A O   1 
ATOM   5     C CB  . MET A 1 1   ? 3.251   -0.731  34.350  1.00 56.05  ? 1   MET A CB  1 
ATOM   6     C CG  . MET A 1 1   ? 2.079   -1.342  35.137  1.00 80.88  ? 1   MET A CG  1 
ATOM   7     S SD  . MET A 1 1   ? 1.751   -3.130  34.772  1.00 66.32  ? 1   MET A SD  1 
ATOM   8     C CE  . MET A 1 1   ? 2.258   -3.220  32.989  1.00 71.31  ? 1   MET A CE  1 
ATOM   9     N N   . LEU A 1 2   ? 3.285   1.290   36.998  1.00 44.93  ? 2   LEU A N   1 
ATOM   10    C CA  . LEU A 1 2   ? 3.713   1.443   38.381  1.00 46.47  ? 2   LEU A CA  1 
ATOM   11    C C   . LEU A 1 2   ? 4.105   0.055   38.882  1.00 39.92  ? 2   LEU A C   1 
ATOM   12    O O   . LEU A 1 2   ? 3.384   -0.910  38.659  1.00 48.34  ? 2   LEU A O   1 
ATOM   13    C CB  . LEU A 1 2   ? 2.562   2.008   39.217  1.00 44.08  ? 2   LEU A CB  1 
ATOM   14    C CG  . LEU A 1 2   ? 2.849   2.497   40.635  1.00 62.71  ? 2   LEU A CG  1 
ATOM   15    C CD1 . LEU A 1 2   ? 3.770   3.724   40.598  1.00 39.91  ? 2   LEU A CD1 1 
ATOM   16    C CD2 . LEU A 1 2   ? 1.534   2.845   41.317  1.00 50.17  ? 2   LEU A CD2 1 
ATOM   17    N N   . ALA A 1 3   ? 5.242   -0.046  39.554  1.00 35.03  ? 3   ALA A N   1 
ATOM   18    C CA  . ALA A 1 3   ? 5.715   -1.332  40.053  1.00 39.97  ? 3   ALA A CA  1 
ATOM   19    C C   . ALA A 1 3   ? 5.177   -1.762  41.411  1.00 45.14  ? 3   ALA A C   1 
ATOM   20    O O   . ALA A 1 3   ? 4.862   -0.933  42.263  1.00 47.33  ? 3   ALA A O   1 
ATOM   21    C CB  . ALA A 1 3   ? 7.239   -1.338  40.089  1.00 40.08  ? 3   ALA A CB  1 
ATOM   22    N N   . LYS A 1 4   ? 5.041   -3.074  41.582  1.00 49.38  ? 4   LYS A N   1 
ATOM   23    C CA  . LYS A 1 4   ? 4.612   -3.661  42.848  1.00 42.77  ? 4   LYS A CA  1 
ATOM   24    C C   . LYS A 1 4   ? 5.894   -3.548  43.652  1.00 38.33  ? 4   LYS A C   1 
ATOM   25    O O   . LYS A 1 4   ? 6.971   -3.840  43.129  1.00 42.32  ? 4   LYS A O   1 
ATOM   26    C CB  . LYS A 1 4   ? 4.242   -5.130  42.664  1.00 41.00  ? 4   LYS A CB  1 
ATOM   27    C CG  . LYS A 1 4   ? 3.030   -5.327  41.803  1.00 50.31  ? 4   LYS A CG  1 
ATOM   28    C CD  . LYS A 1 4   ? 1.826   -4.697  42.451  1.00 50.09  ? 4   LYS A CD  1 
ATOM   29    C CE  . LYS A 1 4   ? 0.591   -4.870  41.605  1.00 48.27  ? 4   LYS A CE  1 
ATOM   30    N NZ  . LYS A 1 4   ? -0.556  -4.121  42.191  1.00 66.65  ? 4   LYS A NZ  1 
ATOM   31    N N   . ARG A 1 5   ? 5.790   -3.142  44.911  1.00 32.89  ? 5   ARG A N   1 
ATOM   32    C CA  . ARG A 1 5   ? 6.986   -2.941  45.729  1.00 42.00  ? 5   ARG A CA  1 
ATOM   33    C C   . ARG A 1 5   ? 7.420   -4.011  46.742  1.00 32.19  ? 5   ARG A C   1 
ATOM   34    O O   . ARG A 1 5   ? 6.597   -4.722  47.318  1.00 34.24  ? 5   ARG A O   1 
ATOM   35    C CB  . ARG A 1 5   ? 6.866   -1.593  46.457  1.00 33.28  ? 5   ARG A CB  1 
ATOM   36    C CG  . ARG A 1 5   ? 6.793   -0.375  45.545  1.00 40.57  ? 5   ARG A CG  1 
ATOM   37    C CD  . ARG A 1 5   ? 6.278   0.825   46.305  1.00 36.68  ? 5   ARG A CD  1 
ATOM   38    N NE  . ARG A 1 5   ? 4.869   0.663   46.609  1.00 32.46  ? 5   ARG A NE  1 
ATOM   39    C CZ  . ARG A 1 5   ? 4.266   1.103   47.706  1.00 44.04  ? 5   ARG A CZ  1 
ATOM   40    N NH1 . ARG A 1 5   ? 4.937   1.749   48.651  1.00 31.62  ? 5   ARG A NH1 1 
ATOM   41    N NH2 . ARG A 1 5   ? 2.972   0.887   47.854  1.00 38.07  ? 5   ARG A NH2 1 
ATOM   42    N N   . ILE A 1 6   ? 8.734   -4.110  46.934  1.00 24.45  ? 6   ILE A N   1 
ATOM   43    C CA  . ILE A 1 6   ? 9.318   -5.025  47.911  1.00 29.43  ? 6   ILE A CA  1 
ATOM   44    C C   . ILE A 1 6   ? 9.842   -4.121  49.022  1.00 45.26  ? 6   ILE A C   1 
ATOM   45    O O   . ILE A 1 6   ? 10.765  -3.339  48.806  1.00 41.78  ? 6   ILE A O   1 
ATOM   46    C CB  . ILE A 1 6   ? 10.504  -5.825  47.357  1.00 32.31  ? 6   ILE A CB  1 
ATOM   47    C CG1 . ILE A 1 6   ? 10.064  -6.717  46.190  1.00 34.80  ? 6   ILE A CG1 1 
ATOM   48    C CG2 . ILE A 1 6   ? 11.096  -6.660  48.466  1.00 28.18  ? 6   ILE A CG2 1 
ATOM   49    C CD1 . ILE A 1 6   ? 9.019   -7.754  46.544  1.00 39.33  ? 6   ILE A CD1 1 
ATOM   50    N N   . ILE A 1 7   ? 9.252   -4.216  50.204  1.00 37.68  ? 7   ILE A N   1 
ATOM   51    C CA  . ILE A 1 7   ? 9.666   -3.354  51.298  1.00 38.62  ? 7   ILE A CA  1 
ATOM   52    C C   . ILE A 1 7   ? 10.378  -4.060  52.451  1.00 40.60  ? 7   ILE A C   1 
ATOM   53    O O   . ILE A 1 7   ? 10.016  -5.151  52.857  1.00 44.57  ? 7   ILE A O   1 
ATOM   54    C CB  . ILE A 1 7   ? 8.458   -2.554  51.841  1.00 39.47  ? 7   ILE A CB  1 
ATOM   55    C CG1 . ILE A 1 7   ? 7.803   -1.781  50.686  1.00 39.38  ? 7   ILE A CG1 1 
ATOM   56    C CG2 . ILE A 1 7   ? 8.909   -1.596  52.947  1.00 43.81  ? 7   ILE A CG2 1 
ATOM   57    C CD1 . ILE A 1 7   ? 6.644   -0.886  51.092  1.00 28.96  ? 7   ILE A CD1 1 
ATOM   58    N N   . ALA A 1 8   ? 11.414  -3.412  52.960  1.00 45.55  ? 8   ALA A N   1 
ATOM   59    C CA  . ALA A 1 8   ? 12.194  -3.951  54.053  1.00 45.74  ? 8   ALA A CA  1 
ATOM   60    C C   . ALA A 1 8   ? 11.949  -3.181  55.336  1.00 39.80  ? 8   ALA A C   1 
ATOM   61    O O   . ALA A 1 8   ? 12.116  -1.966  55.384  1.00 41.65  ? 8   ALA A O   1 
ATOM   62    C CB  . ALA A 1 8   ? 13.662  -3.892  53.705  1.00 47.01  ? 8   ALA A CB  1 
ATOM   63    N N   . CYS A 1 9   ? 11.555  -3.893  56.382  1.00 42.86  ? 9   CYS A N   1 
ATOM   64    C CA  . CYS A 1 9   ? 11.325  -3.257  57.663  1.00 42.70  ? 9   CYS A CA  1 
ATOM   65    C C   . CYS A 1 9   ? 12.527  -3.441  58.591  1.00 40.66  ? 9   CYS A C   1 
ATOM   66    O O   . CYS A 1 9   ? 13.139  -4.502  58.629  1.00 47.54  ? 9   CYS A O   1 
ATOM   67    C CB  . CYS A 1 9   ? 10.082  -3.834  58.319  1.00 39.48  ? 9   CYS A CB  1 
ATOM   68    S SG  . CYS A 1 9   ? 9.746   -3.094  59.907  1.00 48.98  ? 9   CYS A SG  1 
ATOM   69    N N   . LEU A 1 10  ? 12.863  -2.384  59.321  1.00 53.57  ? 10  LEU A N   1 
ATOM   70    C CA  . LEU A 1 10  ? 13.968  -2.373  60.285  1.00 45.87  ? 10  LEU A CA  1 
ATOM   71    C C   . LEU A 1 10  ? 13.392  -1.929  61.619  1.00 39.33  ? 10  LEU A C   1 
ATOM   72    O O   . LEU A 1 10  ? 13.043  -0.758  61.777  1.00 55.27  ? 10  LEU A O   1 
ATOM   73    C CB  . LEU A 1 10  ? 15.057  -1.371  59.875  1.00 43.24  ? 10  LEU A CB  1 
ATOM   74    C CG  . LEU A 1 10  ? 15.884  -1.718  58.635  1.00 68.21  ? 10  LEU A CG  1 
ATOM   75    C CD1 . LEU A 1 10  ? 16.871  -0.606  58.288  1.00 57.75  ? 10  LEU A CD1 1 
ATOM   76    C CD2 . LEU A 1 10  ? 16.630  -3.014  58.917  1.00 87.98  ? 10  LEU A CD2 1 
ATOM   77    N N   . ASN A 1 11  ? 13.257  -2.860  62.558  1.00 38.37  ? 11  ASN A N   1 
ATOM   78    C CA  . ASN A 1 11  ? 12.748  -2.531  63.891  1.00 40.19  ? 11  ASN A CA  1 
ATOM   79    C C   . ASN A 1 11  ? 13.972  -1.939  64.571  1.00 44.09  ? 11  ASN A C   1 
ATOM   80    O O   . ASN A 1 11  ? 15.020  -2.559  64.583  1.00 45.54  ? 11  ASN A O   1 
ATOM   81    C CB  . ASN A 1 11  ? 12.329  -3.790  64.646  1.00 48.19  ? 11  ASN A CB  1 
ATOM   82    C CG  . ASN A 1 11  ? 11.475  -4.722  63.810  1.00 53.04  ? 11  ASN A CG  1 
ATOM   83    O OD1 . ASN A 1 11  ? 10.253  -4.711  63.898  1.00 43.11  ? 11  ASN A OD1 1 
ATOM   84    N ND2 . ASN A 1 11  ? 12.129  -5.538  62.987  1.00 55.57  ? 11  ASN A ND2 1 
ATOM   85    N N   . VAL A 1 12  ? 13.861  -0.740  65.118  1.00 52.82  ? 12  VAL A N   1 
ATOM   86    C CA  . VAL A 1 12  ? 15.018  -0.130  65.760  1.00 46.19  ? 12  VAL A CA  1 
ATOM   87    C C   . VAL A 1 12  ? 14.725  0.357   67.180  1.00 56.20  ? 12  VAL A C   1 
ATOM   88    O O   . VAL A 1 12  ? 13.577  0.647   67.523  1.00 49.84  ? 12  VAL A O   1 
ATOM   89    C CB  . VAL A 1 12  ? 15.548  1.042   64.913  1.00 51.66  ? 12  VAL A CB  1 
ATOM   90    C CG1 . VAL A 1 12  ? 15.959  0.536   63.557  1.00 36.51  ? 12  VAL A CG1 1 
ATOM   91    C CG2 . VAL A 1 12  ? 14.490  2.120   64.781  1.00 34.71  ? 12  VAL A CG2 1 
ATOM   92    N N   . LYS A 1 13  ? 15.767  0.419   68.006  1.00 42.50  ? 13  LYS A N   1 
ATOM   93    C CA  . LYS A 1 13  ? 15.627  0.878   69.386  1.00 50.81  ? 13  LYS A CA  1 
ATOM   94    C C   . LYS A 1 13  ? 16.833  1.717   69.753  1.00 33.64  ? 13  LYS A C   1 
ATOM   95    O O   . LYS A 1 13  ? 17.957  1.356   69.443  1.00 49.06  ? 13  LYS A O   1 
ATOM   96    C CB  . LYS A 1 13  ? 15.534  -0.301  70.343  1.00 37.71  ? 13  LYS A CB  1 
ATOM   97    C CG  . LYS A 1 13  ? 15.001  0.073   71.708  1.00 41.80  ? 13  LYS A CG  1 
ATOM   98    C CD  . LYS A 1 13  ? 15.181  -1.074  72.681  1.00 60.78  ? 13  LYS A CD  1 
ATOM   99    C CE  . LYS A 1 13  ? 14.185  -0.997  73.810  1.00 71.10  ? 13  LYS A CE  1 
ATOM   100   N NZ  . LYS A 1 13  ? 14.143  0.358   74.409  1.00 84.20  ? 13  LYS A NZ  1 
ATOM   101   N N   . ASP A 1 14  ? 16.598  2.837   70.419  1.00 39.27  ? 14  ASP A N   1 
ATOM   102   C CA  . ASP A 1 14  ? 17.687  3.744   70.810  1.00 63.79  ? 14  ASP A CA  1 
ATOM   103   C C   . ASP A 1 14  ? 18.786  3.870   69.730  1.00 56.36  ? 14  ASP A C   1 
ATOM   104   O O   . ASP A 1 14  ? 19.979  3.751   70.027  1.00 59.15  ? 14  ASP A O   1 
ATOM   105   C CB  . ASP A 1 14  ? 18.317  3.292   72.142  1.00 54.37  ? 14  ASP A CB  1 
ATOM   106   C CG  . ASP A 1 14  ? 17.292  3.154   73.265  1.00 58.84  ? 14  ASP A CG  1 
ATOM   107   O OD1 . ASP A 1 14  ? 16.641  4.159   73.628  1.00 59.69  ? 14  ASP A OD1 1 
ATOM   108   O OD2 . ASP A 1 14  ? 17.141  2.028   73.790  1.00 69.43  ? 14  ASP A OD2 1 
ATOM   109   N N   . GLY A 1 15  ? 18.380  4.089   68.479  1.00 58.57  ? 15  GLY A N   1 
ATOM   110   C CA  . GLY A 1 15  ? 19.349  4.260   67.410  1.00 43.75  ? 15  GLY A CA  1 
ATOM   111   C C   . GLY A 1 15  ? 19.956  3.039   66.753  1.00 38.62  ? 15  GLY A C   1 
ATOM   112   O O   . GLY A 1 15  ? 20.660  3.173   65.754  1.00 60.33  ? 15  GLY A O   1 
ATOM   113   N N   . ARG A 1 16  ? 19.722  1.852   67.297  1.00 49.95  ? 16  ARG A N   1 
ATOM   114   C CA  . ARG A 1 16  ? 20.275  0.650   66.690  1.00 47.96  ? 16  ARG A CA  1 
ATOM   115   C C   . ARG A 1 16  ? 19.216  -0.315  66.202  1.00 48.50  ? 16  ARG A C   1 
ATOM   116   O O   . ARG A 1 16  ? 18.041  -0.193  66.535  1.00 47.39  ? 16  ARG A O   1 
ATOM   117   C CB  . ARG A 1 16  ? 21.214  -0.073  67.654  1.00 60.15  ? 16  ARG A CB  1 
ATOM   118   C CG  . ARG A 1 16  ? 22.612  0.526   67.653  1.00 52.32  ? 16  ARG A CG  1 
ATOM   119   C CD  . ARG A 1 16  ? 23.635  -0.406  68.239  1.00 66.12  ? 16  ARG A CD  1 
ATOM   120   N NE  . ARG A 1 16  ? 24.238  -1.298  67.252  1.00 62.89  ? 16  ARG A NE  1 
ATOM   121   C CZ  . ARG A 1 16  ? 24.981  -0.886  66.232  1.00 57.62  ? 16  ARG A CZ  1 
ATOM   122   N NH1 . ARG A 1 16  ? 25.203  0.409   66.058  1.00 65.63  ? 16  ARG A NH1 1 
ATOM   123   N NH2 . ARG A 1 16  ? 25.526  -1.767  65.403  1.00 53.99  ? 16  ARG A NH2 1 
ATOM   124   N N   . VAL A 1 17  ? 19.648  -1.274  65.394  1.00 52.88  ? 17  VAL A N   1 
ATOM   125   C CA  . VAL A 1 17  ? 18.742  -2.264  64.843  1.00 48.41  ? 17  VAL A CA  1 
ATOM   126   C C   . VAL A 1 17  ? 18.593  -3.394  65.839  1.00 52.59  ? 17  VAL A C   1 
ATOM   127   O O   . VAL A 1 17  ? 19.577  -3.901  66.375  1.00 53.71  ? 17  VAL A O   1 
ATOM   128   C CB  . VAL A 1 17  ? 19.274  -2.813  63.507  1.00 47.61  ? 17  VAL A CB  1 
ATOM   129   C CG1 . VAL A 1 17  ? 18.218  -3.691  62.842  1.00 74.44  ? 17  VAL A CG1 1 
ATOM   130   C CG2 . VAL A 1 17  ? 19.633  -1.663  62.588  1.00 57.45  ? 17  VAL A CG2 1 
ATOM   131   N N   . VAL A 1 18  ? 17.354  -3.782  66.104  1.00 52.30  ? 18  VAL A N   1 
ATOM   132   C CA  . VAL A 1 18  ? 17.099  -4.857  67.051  1.00 53.12  ? 18  VAL A CA  1 
ATOM   133   C C   . VAL A 1 18  ? 16.352  -6.005  66.388  1.00 75.61  ? 18  VAL A C   1 
ATOM   134   O O   . VAL A 1 18  ? 15.547  -5.787  65.470  1.00 85.30  ? 18  VAL A O   1 
ATOM   135   C CB  . VAL A 1 18  ? 16.283  -4.344  68.255  1.00 53.87  ? 18  VAL A CB  1 
ATOM   136   C CG1 . VAL A 1 18  ? 17.095  -3.299  69.024  1.00 35.28  ? 18  VAL A CG1 1 
ATOM   137   C CG2 . VAL A 1 18  ? 14.971  -3.739  67.782  1.00 44.45  ? 18  VAL A CG2 1 
ATOM   138   N N   . LYS A 1 19  ? 16.636  -7.227  66.836  1.00 80.90  ? 19  LYS A N   1 
ATOM   139   C CA  . LYS A 1 19  ? 15.968  -8.419  66.310  1.00 78.12  ? 19  LYS A CA  1 
ATOM   140   C C   . LYS A 1 19  ? 15.934  -9.551  67.332  1.00 81.81  ? 19  LYS A C   1 
ATOM   141   O O   . LYS A 1 19  ? 16.976  -10.077 67.742  1.00 63.99  ? 19  LYS A O   1 
ATOM   142   C CB  . LYS A 1 19  ? 16.641  -8.917  65.021  1.00 81.05  ? 19  LYS A CB  1 
ATOM   143   C CG  . LYS A 1 19  ? 16.043  -10.231 64.470  1.00 69.22  ? 19  LYS A CG  1 
ATOM   144   C CD  . LYS A 1 19  ? 16.526  -10.526 63.042  1.00 74.24  ? 19  LYS A CD  1 
ATOM   145   C CE  . LYS A 1 19  ? 18.040  -10.340 62.915  1.00 80.71  ? 19  LYS A CE  1 
ATOM   146   N NZ  . LYS A 1 19  ? 18.568  -10.630 61.543  1.00 87.32  ? 19  LYS A NZ  1 
ATOM   147   N N   . GLY A 1 20  ? 14.717  -9.906  67.737  1.00 87.19  ? 20  GLY A N   1 
ATOM   148   C CA  . GLY A 1 20  ? 14.513  -10.979 68.690  1.00 84.94  ? 20  GLY A CA  1 
ATOM   149   C C   . GLY A 1 20  ? 13.142  -11.604 68.464  1.00 98.02  ? 20  GLY A C   1 
ATOM   150   O O   . GLY A 1 20  ? 12.665  -11.705 67.330  1.00 99.37  ? 20  GLY A O   1 
ATOM   151   N N   . THR A 1 21  ? 12.497  -12.017 69.550  1.00 100.32 ? 21  THR A N   1 
ATOM   152   C CA  . THR A 1 21  ? 11.173  -12.636 69.480  1.00 94.99  ? 21  THR A CA  1 
ATOM   153   C C   . THR A 1 21  ? 10.227  -11.856 70.383  1.00 91.73  ? 21  THR A C   1 
ATOM   154   O O   . THR A 1 21  ? 9.027   -12.135 70.446  1.00 80.19  ? 21  THR A O   1 
ATOM   155   C CB  . THR A 1 21  ? 11.233  -14.128 69.934  1.00 86.97  ? 21  THR A CB  1 
ATOM   156   O OG1 . THR A 1 21  ? 11.901  -14.900 68.926  1.00 90.81  ? 21  THR A OG1 1 
ATOM   157   C CG2 . THR A 1 21  ? 9.837   -14.697 70.149  1.00 91.95  ? 21  THR A CG2 1 
ATOM   158   N N   . ASN A 1 22  ? 10.773  -10.854 71.063  1.00 91.26  ? 22  ASN A N   1 
ATOM   159   C CA  . ASN A 1 22  ? 9.979   -10.041 71.980  1.00 89.19  ? 22  ASN A CA  1 
ATOM   160   C C   . ASN A 1 22  ? 10.975  -9.222  72.782  1.00 89.03  ? 22  ASN A C   1 
ATOM   161   O O   . ASN A 1 22  ? 12.180  -9.262  72.496  1.00 93.35  ? 22  ASN A O   1 
ATOM   162   C CB  . ASN A 1 22  ? 9.203   -10.971 72.912  1.00 95.81  ? 22  ASN A CB  1 
ATOM   163   C CG  . ASN A 1 22  ? 7.948   -10.339 73.466  1.00 103.15 ? 22  ASN A CG  1 
ATOM   164   O OD1 . ASN A 1 22  ? 8.003   -9.532  74.402  1.00 103.15 ? 22  ASN A OD1 1 
ATOM   165   N ND2 . ASN A 1 22  ? 6.798   -10.699 72.886  1.00 92.66  ? 22  ASN A ND2 1 
ATOM   166   N N   . PHE A 1 23  ? 10.489  -8.455  73.756  1.00 86.28  ? 23  PHE A N   1 
ATOM   167   C CA  . PHE A 1 23  ? 11.400  -7.701  74.614  1.00 90.37  ? 23  PHE A CA  1 
ATOM   168   C C   . PHE A 1 23  ? 12.337  -8.788  75.166  1.00 99.99  ? 23  PHE A C   1 
ATOM   169   O O   . PHE A 1 23  ? 13.542  -8.569  75.350  1.00 100.42 ? 23  PHE A O   1 
ATOM   170   C CB  . PHE A 1 23  ? 10.633  -7.039  75.771  1.00 97.53  ? 23  PHE A CB  1 
ATOM   171   C CG  . PHE A 1 23  ? 9.659   -5.975  75.335  1.00 96.86  ? 23  PHE A CG  1 
ATOM   172   C CD1 . PHE A 1 23  ? 8.917   -5.277  76.282  1.00 96.20  ? 23  PHE A CD1 1 
ATOM   173   C CD2 . PHE A 1 23  ? 9.492   -5.662  73.983  1.00 87.05  ? 23  PHE A CD2 1 
ATOM   174   C CE1 . PHE A 1 23  ? 8.015   -4.275  75.898  1.00 92.43  ? 23  PHE A CE1 1 
ATOM   175   C CE2 . PHE A 1 23  ? 8.598   -4.666  73.584  1.00 98.05  ? 23  PHE A CE2 1 
ATOM   176   C CZ  . PHE A 1 23  ? 7.856   -3.969  74.543  1.00 90.03  ? 23  PHE A CZ  1 
ATOM   177   N N   . GLU A 1 24  ? 11.751  -9.966  75.406  1.00 99.10  ? 24  GLU A N   1 
ATOM   178   C CA  . GLU A 1 24  ? 12.463  -11.140 75.913  1.00 101.20 ? 24  GLU A CA  1 
ATOM   179   C C   . GLU A 1 24  ? 13.969  -10.914 75.891  1.00 88.86  ? 24  GLU A C   1 
ATOM   180   O O   . GLU A 1 24  ? 14.543  -10.316 76.813  1.00 85.72  ? 24  GLU A O   1 
ATOM   181   C CB  . GLU A 1 24  ? 12.106  -12.381 75.056  1.00 87.96  ? 24  GLU A CB  1 
ATOM   182   N N   . ASN A 1 25  ? 14.592  -11.398 74.821  1.00 92.88  ? 25  ASN A N   1 
ATOM   183   C CA  . ASN A 1 25  ? 16.021  -11.258 74.629  1.00 86.06  ? 25  ASN A CA  1 
ATOM   184   C C   . ASN A 1 25  ? 16.190  -10.379 73.403  1.00 90.90  ? 25  ASN A C   1 
ATOM   185   O O   . ASN A 1 25  ? 16.924  -10.720 72.470  1.00 88.92  ? 25  ASN A O   1 
ATOM   186   C CB  . ASN A 1 25  ? 16.657  -12.628 74.401  1.00 101.54 ? 25  ASN A CB  1 
ATOM   187   N N   . LEU A 1 26  ? 15.482  -9.251  73.395  1.00 78.61  ? 26  LEU A N   1 
ATOM   188   C CA  . LEU A 1 26  ? 15.579  -8.318  72.277  1.00 80.77  ? 26  LEU A CA  1 
ATOM   189   C C   . LEU A 1 26  ? 17.080  -8.052  72.134  1.00 72.11  ? 26  LEU A C   1 
ATOM   190   O O   . LEU A 1 26  ? 17.701  -7.492  73.035  1.00 78.25  ? 26  LEU A O   1 
ATOM   191   C CB  . LEU A 1 26  ? 14.809  -7.030  72.612  1.00 76.14  ? 26  LEU A CB  1 
ATOM   192   C CG  . LEU A 1 26  ? 14.314  -6.117  71.478  1.00 91.81  ? 26  LEU A CG  1 
ATOM   193   C CD1 . LEU A 1 26  ? 13.501  -6.933  70.476  1.00 73.44  ? 26  LEU A CD1 1 
ATOM   194   C CD2 . LEU A 1 26  ? 13.467  -4.981  72.066  1.00 64.56  ? 26  LEU A CD2 1 
ATOM   195   N N   . ARG A 1 27  ? 17.671  -8.486  71.024  1.00 74.24  ? 27  ARG A N   1 
ATOM   196   C CA  . ARG A 1 27  ? 19.105  -8.302  70.809  1.00 58.87  ? 27  ARG A CA  1 
ATOM   197   C C   . ARG A 1 27  ? 19.495  -7.259  69.760  1.00 74.09  ? 27  ARG A C   1 
ATOM   198   O O   . ARG A 1 27  ? 18.669  -6.846  68.934  1.00 83.80  ? 27  ARG A O   1 
ATOM   199   C CB  . ARG A 1 27  ? 19.754  -9.642  70.463  1.00 40.95  ? 27  ARG A CB  1 
ATOM   200   C CG  . ARG A 1 27  ? 20.340  -10.367 71.671  1.00 81.49  ? 27  ARG A CG  1 
ATOM   201   C CD  . ARG A 1 27  ? 19.574  -11.644 72.026  1.00 90.69  ? 27  ARG A CD  1 
ATOM   202   N NE  . ARG A 1 27  ? 19.608  -12.632 70.941  1.00 89.34  ? 27  ARG A NE  1 
ATOM   203   C CZ  . ARG A 1 27  ? 20.726  -13.126 70.404  1.00 103.15 ? 27  ARG A CZ  1 
ATOM   204   N NH1 . ARG A 1 27  ? 21.927  -12.731 70.845  1.00 64.17  ? 27  ARG A NH1 1 
ATOM   205   N NH2 . ARG A 1 27  ? 20.642  -14.022 69.423  1.00 87.12  ? 27  ARG A NH2 1 
ATOM   206   N N   . ASP A 1 28  ? 20.772  -6.862  69.793  1.00 69.61  ? 28  ASP A N   1 
ATOM   207   C CA  . ASP A 1 28  ? 21.338  -5.860  68.894  1.00 69.28  ? 28  ASP A CA  1 
ATOM   208   C C   . ASP A 1 28  ? 21.792  -6.413  67.541  1.00 82.14  ? 28  ASP A C   1 
ATOM   209   O O   . ASP A 1 28  ? 22.729  -7.220  67.476  1.00 92.28  ? 28  ASP A O   1 
ATOM   210   C CB  . ASP A 1 28  ? 22.523  -5.176  69.585  1.00 80.64  ? 28  ASP A CB  1 
ATOM   211   C CG  . ASP A 1 28  ? 22.962  -3.909  68.881  1.00 63.69  ? 28  ASP A CG  1 
ATOM   212   O OD1 . ASP A 1 28  ? 23.486  -3.984  67.742  1.00 65.06  ? 28  ASP A OD1 1 
ATOM   213   O OD2 . ASP A 1 28  ? 22.772  -2.832  69.484  1.00 73.04  ? 28  ASP A OD2 1 
ATOM   214   N N   . SER A 1 29  ? 21.154  -5.950  66.460  1.00 84.48  ? 29  SER A N   1 
ATOM   215   C CA  . SER A 1 29  ? 21.487  -6.411  65.112  1.00 69.53  ? 29  SER A CA  1 
ATOM   216   C C   . SER A 1 29  ? 22.140  -5.409  64.145  1.00 66.70  ? 29  SER A C   1 
ATOM   217   O O   . SER A 1 29  ? 21.958  -5.525  62.936  1.00 74.50  ? 29  SER A O   1 
ATOM   218   C CB  . SER A 1 29  ? 20.240  -7.003  64.456  1.00 65.82  ? 29  SER A CB  1 
ATOM   219   O OG  . SER A 1 29  ? 19.710  -8.054  65.256  1.00 74.93  ? 29  SER A OG  1 
ATOM   220   N N   . GLY A 1 30  ? 22.891  -4.430  64.650  1.00 69.07  ? 30  GLY A N   1 
ATOM   221   C CA  . GLY A 1 30  ? 23.563  -3.508  63.734  1.00 61.32  ? 30  GLY A CA  1 
ATOM   222   C C   . GLY A 1 30  ? 23.143  -2.051  63.613  1.00 50.58  ? 30  GLY A C   1 
ATOM   223   O O   . GLY A 1 30  ? 22.218  -1.589  64.283  1.00 45.60  ? 30  GLY A O   1 
ATOM   224   N N   . ASP A 1 31  ? 23.844  -1.332  62.735  1.00 55.07  ? 31  ASP A N   1 
ATOM   225   C CA  . ASP A 1 31  ? 23.597  0.094   62.483  1.00 57.28  ? 31  ASP A CA  1 
ATOM   226   C C   . ASP A 1 31  ? 22.505  0.316   61.424  1.00 57.35  ? 31  ASP A C   1 
ATOM   227   O O   . ASP A 1 31  ? 22.646  -0.098  60.275  1.00 51.18  ? 31  ASP A O   1 
ATOM   228   C CB  . ASP A 1 31  ? 24.901  0.776   62.040  1.00 49.49  ? 31  ASP A CB  1 
ATOM   229   C CG  . ASP A 1 31  ? 24.705  2.237   61.645  1.00 48.72  ? 31  ASP A CG  1 
ATOM   230   O OD1 . ASP A 1 31  ? 24.109  3.011   62.423  1.00 71.69  ? 31  ASP A OD1 1 
ATOM   231   O OD2 . ASP A 1 31  ? 25.161  2.620   60.552  1.00 63.37  ? 31  ASP A OD2 1 
ATOM   232   N N   . PRO A 1 32  ? 21.407  0.993   61.810  1.00 60.84  ? 32  PRO A N   1 
ATOM   233   C CA  . PRO A 1 32  ? 20.271  1.284   60.927  1.00 52.37  ? 32  PRO A CA  1 
ATOM   234   C C   . PRO A 1 32  ? 20.644  1.907   59.592  1.00 51.11  ? 32  PRO A C   1 
ATOM   235   O O   . PRO A 1 32  ? 20.175  1.475   58.546  1.00 44.20  ? 32  PRO A O   1 
ATOM   236   C CB  . PRO A 1 32  ? 19.386  2.194   61.779  1.00 53.04  ? 32  PRO A CB  1 
ATOM   237   C CG  . PRO A 1 32  ? 20.365  2.835   62.740  1.00 60.89  ? 32  PRO A CG  1 
ATOM   238   C CD  . PRO A 1 32  ? 21.250  1.681   63.105  1.00 56.95  ? 32  PRO A CD  1 
ATOM   239   N N   . VAL A 1 33  ? 21.507  2.909   59.629  1.00 49.32  ? 33  VAL A N   1 
ATOM   240   C CA  . VAL A 1 33  ? 21.922  3.584   58.417  1.00 59.59  ? 33  VAL A CA  1 
ATOM   241   C C   . VAL A 1 33  ? 22.612  2.648   57.419  1.00 61.78  ? 33  VAL A C   1 
ATOM   242   O O   . VAL A 1 33  ? 22.175  2.512   56.273  1.00 68.40  ? 33  VAL A O   1 
ATOM   243   C CB  . VAL A 1 33  ? 22.872  4.748   58.748  1.00 45.58  ? 33  VAL A CB  1 
ATOM   244   C CG1 . VAL A 1 33  ? 23.148  5.562   57.510  1.00 43.94  ? 33  VAL A CG1 1 
ATOM   245   C CG2 . VAL A 1 33  ? 22.265  5.609   59.823  1.00 55.59  ? 33  VAL A CG2 1 
ATOM   246   N N   . GLU A 1 34  ? 23.691  2.010   57.862  1.00 60.37  ? 34  GLU A N   1 
ATOM   247   C CA  . GLU A 1 34  ? 24.471  1.112   57.018  1.00 57.34  ? 34  GLU A CA  1 
ATOM   248   C C   . GLU A 1 34  ? 23.658  -0.072  56.473  1.00 55.40  ? 34  GLU A C   1 
ATOM   249   O O   . GLU A 1 34  ? 23.923  -0.565  55.376  1.00 54.17  ? 34  GLU A O   1 
ATOM   250   C CB  . GLU A 1 34  ? 25.692  0.604   57.803  1.00 64.38  ? 34  GLU A CB  1 
ATOM   251   C CG  . GLU A 1 34  ? 27.015  0.664   57.034  1.00 84.94  ? 34  GLU A CG  1 
ATOM   252   C CD  . GLU A 1 34  ? 27.617  2.071   56.971  1.00 86.02  ? 34  GLU A CD  1 
ATOM   253   O OE1 . GLU A 1 34  ? 26.890  3.061   57.234  1.00 63.23  ? 34  GLU A OE1 1 
ATOM   254   O OE2 . GLU A 1 34  ? 28.824  2.179   56.648  1.00 72.38  ? 34  GLU A OE2 1 
ATOM   255   N N   . LEU A 1 35  ? 22.672  -0.526  57.235  1.00 51.26  ? 35  LEU A N   1 
ATOM   256   C CA  . LEU A 1 35  ? 21.838  -1.636  56.805  1.00 39.37  ? 35  LEU A CA  1 
ATOM   257   C C   . LEU A 1 35  ? 20.873  -1.161  55.712  1.00 57.56  ? 35  LEU A C   1 
ATOM   258   O O   . LEU A 1 35  ? 20.523  -1.909  54.797  1.00 48.17  ? 35  LEU A O   1 
ATOM   259   C CB  . LEU A 1 35  ? 21.069  -2.189  58.008  1.00 58.55  ? 35  LEU A CB  1 
ATOM   260   C CG  . LEU A 1 35  ? 20.204  -3.444  57.830  1.00 66.87  ? 35  LEU A CG  1 
ATOM   261   C CD1 . LEU A 1 35  ? 21.016  -4.556  57.191  1.00 60.16  ? 35  LEU A CD1 1 
ATOM   262   C CD2 . LEU A 1 35  ? 19.678  -3.885  59.187  1.00 61.41  ? 35  LEU A CD2 1 
ATOM   263   N N   . GLY A 1 36  ? 20.446  0.093   55.821  1.00 50.10  ? 36  GLY A N   1 
ATOM   264   C CA  . GLY A 1 36  ? 19.557  0.672   54.835  1.00 35.00  ? 36  GLY A CA  1 
ATOM   265   C C   . GLY A 1 36  ? 20.279  0.849   53.516  1.00 38.34  ? 36  GLY A C   1 
ATOM   266   O O   . GLY A 1 36  ? 19.696  0.628   52.467  1.00 59.10  ? 36  GLY A O   1 
ATOM   267   N N   . LYS A 1 37  ? 21.550  1.245   53.566  1.00 50.49  ? 37  LYS A N   1 
ATOM   268   C CA  . LYS A 1 37  ? 22.353  1.433   52.358  1.00 54.40  ? 37  LYS A CA  1 
ATOM   269   C C   . LYS A 1 37  ? 22.575  0.090   51.677  1.00 47.64  ? 37  LYS A C   1 
ATOM   270   O O   . LYS A 1 37  ? 22.724  0.009   50.460  1.00 42.26  ? 37  LYS A O   1 
ATOM   271   C CB  . LYS A 1 37  ? 23.710  2.060   52.706  1.00 54.74  ? 37  LYS A CB  1 
ATOM   272   C CG  . LYS A 1 37  ? 23.710  3.583   52.783  1.00 55.33  ? 37  LYS A CG  1 
ATOM   273   C CD  . LYS A 1 37  ? 24.920  4.138   53.538  1.00 54.13  ? 37  LYS A CD  1 
ATOM   274   C CE  . LYS A 1 37  ? 26.250  3.784   52.888  1.00 73.90  ? 37  LYS A CE  1 
ATOM   275   N NZ  . LYS A 1 37  ? 27.401  4.362   53.645  1.00 53.94  ? 37  LYS A NZ  1 
ATOM   276   N N   . PHE A 1 38  ? 22.608  -0.967  52.478  1.00 42.81  ? 38  PHE A N   1 
ATOM   277   C CA  . PHE A 1 38  ? 22.804  -2.297  51.937  1.00 47.58  ? 38  PHE A CA  1 
ATOM   278   C C   . PHE A 1 38  ? 21.502  -2.768  51.275  1.00 51.27  ? 38  PHE A C   1 
ATOM   279   O O   . PHE A 1 38  ? 21.525  -3.417  50.234  1.00 41.84  ? 38  PHE A O   1 
ATOM   280   C CB  . PHE A 1 38  ? 23.219  -3.261  53.051  1.00 46.75  ? 38  PHE A CB  1 
ATOM   281   C CG  . PHE A 1 38  ? 23.123  -4.702  52.661  1.00 55.08  ? 38  PHE A CG  1 
ATOM   282   C CD1 . PHE A 1 38  ? 23.879  -5.203  51.603  1.00 52.94  ? 38  PHE A CD1 1 
ATOM   283   C CD2 . PHE A 1 38  ? 22.247  -5.555  53.322  1.00 56.10  ? 38  PHE A CD2 1 
ATOM   284   C CE1 . PHE A 1 38  ? 23.763  -6.533  51.207  1.00 47.87  ? 38  PHE A CE1 1 
ATOM   285   C CE2 . PHE A 1 38  ? 22.125  -6.892  52.931  1.00 51.16  ? 38  PHE A CE2 1 
ATOM   286   C CZ  . PHE A 1 38  ? 22.884  -7.377  51.875  1.00 40.04  ? 38  PHE A CZ  1 
ATOM   287   N N   . TYR A 1 39  ? 20.373  -2.436  51.895  1.00 51.73  ? 39  TYR A N   1 
ATOM   288   C CA  . TYR A 1 39  ? 19.079  -2.808  51.356  1.00 51.20  ? 39  TYR A CA  1 
ATOM   289   C C   . TYR A 1 39  ? 18.845  -2.100  50.035  1.00 50.35  ? 39  TYR A C   1 
ATOM   290   O O   . TYR A 1 39  ? 18.214  -2.657  49.134  1.00 58.83  ? 39  TYR A O   1 
ATOM   291   C CB  . TYR A 1 39  ? 17.948  -2.457  52.330  1.00 37.02  ? 39  TYR A CB  1 
ATOM   292   C CG  . TYR A 1 39  ? 17.733  -3.471  53.428  1.00 39.35  ? 39  TYR A CG  1 
ATOM   293   C CD1 . TYR A 1 39  ? 18.026  -4.816  53.227  1.00 53.28  ? 39  TYR A CD1 1 
ATOM   294   C CD2 . TYR A 1 39  ? 17.228  -3.089  54.668  1.00 49.67  ? 39  TYR A CD2 1 
ATOM   295   C CE1 . TYR A 1 39  ? 17.826  -5.754  54.234  1.00 52.34  ? 39  TYR A CE1 1 
ATOM   296   C CE2 . TYR A 1 39  ? 17.022  -4.016  55.680  1.00 37.71  ? 39  TYR A CE2 1 
ATOM   297   C CZ  . TYR A 1 39  ? 17.324  -5.350  55.459  1.00 54.66  ? 39  TYR A CZ  1 
ATOM   298   O OH  . TYR A 1 39  ? 17.115  -6.286  56.452  1.00 43.37  ? 39  TYR A OH  1 
ATOM   299   N N   . SER A 1 40  ? 19.360  -0.876  49.919  1.00 46.98  ? 40  SER A N   1 
ATOM   300   C CA  . SER A 1 40  ? 19.204  -0.092  48.693  1.00 45.37  ? 40  SER A CA  1 
ATOM   301   C C   . SER A 1 40  ? 20.111  -0.563  47.563  1.00 49.56  ? 40  SER A C   1 
ATOM   302   O O   . SER A 1 40  ? 19.880  -0.238  46.392  1.00 51.25  ? 40  SER A O   1 
ATOM   303   C CB  . SER A 1 40  ? 19.482  1.388   48.959  1.00 48.94  ? 40  SER A CB  1 
ATOM   304   O OG  . SER A 1 40  ? 19.560  2.098   47.739  1.00 42.67  ? 40  SER A OG  1 
ATOM   305   N N   . GLU A 1 41  ? 21.148  -1.314  47.917  1.00 44.44  ? 41  GLU A N   1 
ATOM   306   C CA  . GLU A 1 41  ? 22.095  -1.827  46.936  1.00 57.02  ? 41  GLU A CA  1 
ATOM   307   C C   . GLU A 1 41  ? 21.609  -3.118  46.280  1.00 41.40  ? 41  GLU A C   1 
ATOM   308   O O   . GLU A 1 41  ? 21.922  -3.381  45.120  1.00 64.81  ? 41  GLU A O   1 
ATOM   309   C CB  . GLU A 1 41  ? 23.446  -2.084  47.598  1.00 58.05  ? 41  GLU A CB  1 
ATOM   310   C CG  . GLU A 1 41  ? 24.355  -0.885  47.700  1.00 75.77  ? 41  GLU A CG  1 
ATOM   311   C CD  . GLU A 1 41  ? 25.474  -1.113  48.713  1.00 98.38  ? 41  GLU A CD  1 
ATOM   312   O OE1 . GLU A 1 41  ? 25.248  -0.844  49.919  1.00 72.87  ? 41  GLU A OE1 1 
ATOM   313   O OE2 . GLU A 1 41  ? 26.569  -1.584  48.309  1.00 101.79 ? 41  GLU A OE2 1 
ATOM   314   N N   . ILE A 1 42  ? 20.842  -3.914  47.022  1.00 51.91  ? 42  ILE A N   1 
ATOM   315   C CA  . ILE A 1 42  ? 20.329  -5.185  46.512  1.00 45.28  ? 42  ILE A CA  1 
ATOM   316   C C   . ILE A 1 42  ? 19.001  -5.086  45.784  1.00 48.40  ? 42  ILE A C   1 
ATOM   317   O O   . ILE A 1 42  ? 18.568  -6.043  45.147  1.00 55.00  ? 42  ILE A O   1 
ATOM   318   C CB  . ILE A 1 42  ? 20.163  -6.228  47.637  1.00 46.36  ? 42  ILE A CB  1 
ATOM   319   C CG1 . ILE A 1 42  ? 19.251  -5.676  48.731  1.00 35.97  ? 42  ILE A CG1 1 
ATOM   320   C CG2 . ILE A 1 42  ? 21.530  -6.647  48.165  1.00 42.88  ? 42  ILE A CG2 1 
ATOM   321   C CD1 . ILE A 1 42  ? 18.991  -6.655  49.878  1.00 36.84  ? 42  ILE A CD1 1 
ATOM   322   N N   . GLY A 1 43  ? 18.336  -3.947  45.899  1.00 47.08  ? 43  GLY A N   1 
ATOM   323   C CA  . GLY A 1 43  ? 17.075  -3.801  45.204  1.00 44.14  ? 43  GLY A CA  1 
ATOM   324   C C   . GLY A 1 43  ? 15.813  -3.523  45.990  1.00 32.55  ? 43  GLY A C   1 
ATOM   325   O O   . GLY A 1 43  ? 14.745  -3.470  45.394  1.00 43.52  ? 43  GLY A O   1 
ATOM   326   N N   . ILE A 1 44  ? 15.905  -3.372  47.309  1.00 45.01  ? 44  ILE A N   1 
ATOM   327   C CA  . ILE A 1 44  ? 14.712  -3.054  48.101  1.00 39.82  ? 44  ILE A CA  1 
ATOM   328   C C   . ILE A 1 44  ? 14.191  -1.694  47.607  1.00 55.15  ? 44  ILE A C   1 
ATOM   329   O O   . ILE A 1 44  ? 14.969  -0.759  47.388  1.00 39.98  ? 44  ILE A O   1 
ATOM   330   C CB  . ILE A 1 44  ? 15.046  -3.005  49.607  1.00 43.29  ? 44  ILE A CB  1 
ATOM   331   C CG1 . ILE A 1 44  ? 15.340  -4.424  50.104  1.00 44.05  ? 44  ILE A CG1 1 
ATOM   332   C CG2 . ILE A 1 44  ? 13.928  -2.343  50.382  1.00 33.14  ? 44  ILE A CG2 1 
ATOM   333   C CD1 . ILE A 1 44  ? 14.205  -5.405  49.917  1.00 40.88  ? 44  ILE A CD1 1 
ATOM   334   N N   . ASP A 1 45  ? 12.879  -1.592  47.420  1.00 47.78  ? 45  ASP A N   1 
ATOM   335   C CA  . ASP A 1 45  ? 12.267  -0.370  46.897  1.00 43.97  ? 45  ASP A CA  1 
ATOM   336   C C   . ASP A 1 45  ? 11.926  0.702   47.925  1.00 38.23  ? 45  ASP A C   1 
ATOM   337   O O   . ASP A 1 45  ? 11.842  1.876   47.586  1.00 48.38  ? 45  ASP A O   1 
ATOM   338   C CB  . ASP A 1 45  ? 11.010  -0.729  46.090  1.00 31.24  ? 45  ASP A CB  1 
ATOM   339   C CG  . ASP A 1 45  ? 11.270  -1.813  45.048  1.00 33.34  ? 45  ASP A CG  1 
ATOM   340   O OD1 . ASP A 1 45  ? 12.176  -1.636  44.215  1.00 40.56  ? 45  ASP A OD1 1 
ATOM   341   O OD2 . ASP A 1 45  ? 10.570  -2.845  45.060  1.00 37.36  ? 45  ASP A OD2 1 
ATOM   342   N N   . GLU A 1 46  ? 11.716  0.302   49.174  1.00 40.34  ? 46  GLU A N   1 
ATOM   343   C CA  . GLU A 1 46  ? 11.380  1.249   50.224  1.00 38.40  ? 46  GLU A CA  1 
ATOM   344   C C   . GLU A 1 46  ? 11.766  0.703   51.581  1.00 49.01  ? 46  GLU A C   1 
ATOM   345   O O   . GLU A 1 46  ? 11.949  -0.498  51.751  1.00 55.84  ? 46  GLU A O   1 
ATOM   346   C CB  . GLU A 1 46  ? 9.876   1.580   50.216  1.00 37.13  ? 46  GLU A CB  1 
ATOM   347   C CG  . GLU A 1 46  ? 9.466   2.691   49.260  1.00 46.80  ? 46  GLU A CG  1 
ATOM   348   C CD  . GLU A 1 46  ? 7.977   3.049   49.347  1.00 57.57  ? 46  GLU A CD  1 
ATOM   349   O OE1 . GLU A 1 46  ? 7.488   3.387   50.451  1.00 43.59  ? 46  GLU A OE1 1 
ATOM   350   O OE2 . GLU A 1 46  ? 7.297   3.002   48.297  1.00 46.42  ? 46  GLU A OE2 1 
ATOM   351   N N   . LEU A 1 47  ? 11.882  1.595   52.552  1.00 49.30  ? 47  LEU A N   1 
ATOM   352   C CA  . LEU A 1 47  ? 12.244  1.201   53.900  1.00 31.03  ? 47  LEU A CA  1 
ATOM   353   C C   . LEU A 1 47  ? 11.203  1.644   54.928  1.00 29.59  ? 47  LEU A C   1 
ATOM   354   O O   . LEU A 1 47  ? 10.618  2.716   54.827  1.00 33.87  ? 47  LEU A O   1 
ATOM   355   C CB  . LEU A 1 47  ? 13.614  1.789   54.245  1.00 31.60  ? 47  LEU A CB  1 
ATOM   356   C CG  . LEU A 1 47  ? 14.773  1.375   53.329  1.00 51.38  ? 47  LEU A CG  1 
ATOM   357   C CD1 . LEU A 1 47  ? 15.995  2.224   53.613  1.00 32.13  ? 47  LEU A CD1 1 
ATOM   358   C CD2 . LEU A 1 47  ? 15.083  -0.115  53.528  1.00 37.05  ? 47  LEU A CD2 1 
ATOM   359   N N   . VAL A 1 48  ? 10.940  0.786   55.897  1.00 34.29  ? 48  VAL A N   1 
ATOM   360   C CA  . VAL A 1 48  ? 10.020  1.129   56.967  1.00 33.44  ? 48  VAL A CA  1 
ATOM   361   C C   . VAL A 1 48  ? 10.815  0.983   58.269  1.00 40.79  ? 48  VAL A C   1 
ATOM   362   O O   . VAL A 1 48  ? 11.277  -0.112  58.594  1.00 44.28  ? 48  VAL A O   1 
ATOM   363   C CB  . VAL A 1 48  ? 8.793   0.184   57.028  1.00 37.61  ? 48  VAL A CB  1 
ATOM   364   C CG1 . VAL A 1 48  ? 7.939   0.542   58.228  1.00 33.32  ? 48  VAL A CG1 1 
ATOM   365   C CG2 . VAL A 1 48  ? 7.971   0.294   55.771  1.00 42.74  ? 48  VAL A CG2 1 
ATOM   366   N N   . PHE A 1 49  ? 10.998  2.086   58.991  1.00 49.14  ? 49  PHE A N   1 
ATOM   367   C CA  . PHE A 1 49  ? 11.720  2.082   60.269  1.00 43.05  ? 49  PHE A CA  1 
ATOM   368   C C   . PHE A 1 49  ? 10.711  2.079   61.423  1.00 48.70  ? 49  PHE A C   1 
ATOM   369   O O   . PHE A 1 49  ? 9.980   3.049   61.592  1.00 53.03  ? 49  PHE A O   1 
ATOM   370   C CB  . PHE A 1 49  ? 12.604  3.327   60.393  1.00 40.72  ? 49  PHE A CB  1 
ATOM   371   C CG  . PHE A 1 49  ? 13.836  3.292   59.540  1.00 45.75  ? 49  PHE A CG  1 
ATOM   372   C CD1 . PHE A 1 49  ? 14.925  2.516   59.904  1.00 40.49  ? 49  PHE A CD1 1 
ATOM   373   C CD2 . PHE A 1 49  ? 13.903  4.018   58.361  1.00 38.51  ? 49  PHE A CD2 1 
ATOM   374   C CE1 . PHE A 1 49  ? 16.055  2.457   59.105  1.00 43.26  ? 49  PHE A CE1 1 
ATOM   375   C CE2 . PHE A 1 49  ? 15.026  3.964   57.561  1.00 34.26  ? 49  PHE A CE2 1 
ATOM   376   C CZ  . PHE A 1 49  ? 16.107  3.179   57.934  1.00 39.55  ? 49  PHE A CZ  1 
ATOM   377   N N   . LEU A 1 50  ? 10.669  0.994   62.203  1.00 55.79  ? 50  LEU A N   1 
ATOM   378   C CA  . LEU A 1 50  ? 9.745   0.869   63.343  1.00 53.71  ? 50  LEU A CA  1 
ATOM   379   C C   . LEU A 1 50  ? 10.496  0.933   64.680  1.00 45.22  ? 50  LEU A C   1 
ATOM   380   O O   . LEU A 1 50  ? 11.160  -0.018  65.096  1.00 46.35  ? 50  LEU A O   1 
ATOM   381   C CB  . LEU A 1 50  ? 8.955   -0.441  63.245  1.00 41.83  ? 50  LEU A CB  1 
ATOM   382   C CG  . LEU A 1 50  ? 7.490   -0.319  62.834  1.00 68.40  ? 50  LEU A CG  1 
ATOM   383   C CD1 . LEU A 1 50  ? 7.369   0.627   61.648  1.00 62.09  ? 50  LEU A CD1 1 
ATOM   384   C CD2 . LEU A 1 50  ? 6.933   -1.698  62.496  1.00 50.88  ? 50  LEU A CD2 1 
ATOM   385   N N   . ASP A 1 51  ? 10.359  2.062   65.360  1.00 49.35  ? 51  ASP A N   1 
ATOM   386   C CA  . ASP A 1 51  ? 11.061  2.296   66.609  1.00 50.84  ? 51  ASP A CA  1 
ATOM   387   C C   . ASP A 1 51  ? 10.262  1.990   67.865  1.00 47.63  ? 51  ASP A C   1 
ATOM   388   O O   . ASP A 1 51  ? 9.063   2.255   67.940  1.00 53.68  ? 51  ASP A O   1 
ATOM   389   C CB  . ASP A 1 51  ? 11.564  3.746   66.617  1.00 46.41  ? 51  ASP A CB  1 
ATOM   390   C CG  . ASP A 1 51  ? 12.200  4.137   67.926  1.00 60.72  ? 51  ASP A CG  1 
ATOM   391   O OD1 . ASP A 1 51  ? 11.459  4.499   68.866  1.00 45.51  ? 51  ASP A OD1 1 
ATOM   392   O OD2 . ASP A 1 51  ? 13.440  4.075   68.012  1.00 45.41  ? 51  ASP A OD2 1 
ATOM   393   N N   . ILE A 1 52  ? 10.950  1.418   68.847  1.00 43.95  ? 52  ILE A N   1 
ATOM   394   C CA  . ILE A 1 52  ? 10.354  1.058   70.129  1.00 48.66  ? 52  ILE A CA  1 
ATOM   395   C C   . ILE A 1 52  ? 11.193  1.592   71.302  1.00 53.78  ? 52  ILE A C   1 
ATOM   396   O O   . ILE A 1 52  ? 11.080  1.114   72.432  1.00 63.80  ? 52  ILE A O   1 
ATOM   397   C CB  . ILE A 1 52  ? 10.221  -0.472  70.255  1.00 50.22  ? 52  ILE A CB  1 
ATOM   398   C CG1 . ILE A 1 52  ? 11.559  -1.147  69.923  1.00 48.93  ? 52  ILE A CG1 1 
ATOM   399   C CG2 . ILE A 1 52  ? 9.134   -0.971  69.323  1.00 51.55  ? 52  ILE A CG2 1 
ATOM   400   C CD1 . ILE A 1 52  ? 11.549  -2.653  70.072  1.00 33.53  ? 52  ILE A CD1 1 
ATOM   401   N N   . THR A 1 53  ? 12.024  2.588   71.014  1.00 52.12  ? 53  THR A N   1 
ATOM   402   C CA  . THR A 1 53  ? 12.889  3.220   72.000  1.00 51.31  ? 53  THR A CA  1 
ATOM   403   C C   . THR A 1 53  ? 12.184  3.430   73.335  1.00 64.32  ? 53  THR A C   1 
ATOM   404   O O   . THR A 1 53  ? 10.978  3.632   73.376  1.00 59.24  ? 53  THR A O   1 
ATOM   405   C CB  . THR A 1 53  ? 13.411  4.579   71.470  1.00 46.84  ? 53  THR A CB  1 
ATOM   406   O OG1 . THR A 1 53  ? 14.334  4.346   70.403  1.00 40.59  ? 53  THR A OG1 1 
ATOM   407   C CG2 . THR A 1 53  ? 14.113  5.364   72.561  1.00 43.35  ? 53  THR A CG2 1 
ATOM   408   N N   . ALA A 1 54  ? 12.971  3.385   74.411  1.00 73.92  ? 54  ALA A N   1 
ATOM   409   C CA  . ALA A 1 54  ? 12.513  3.550   75.795  1.00 76.15  ? 54  ALA A CA  1 
ATOM   410   C C   . ALA A 1 54  ? 11.157  4.219   75.963  1.00 67.45  ? 54  ALA A C   1 
ATOM   411   O O   . ALA A 1 54  ? 10.190  3.553   76.315  1.00 69.38  ? 54  ALA A O   1 
ATOM   412   C CB  . ALA A 1 54  ? 13.576  4.311   76.613  1.00 72.58  ? 54  ALA A CB  1 
ATOM   413   N N   . SER A 1 55  ? 11.102  5.529   75.745  1.00 49.07  ? 55  SER A N   1 
ATOM   414   C CA  . SER A 1 55  ? 9.863   6.306   75.853  1.00 70.07  ? 55  SER A CA  1 
ATOM   415   C C   . SER A 1 55  ? 10.124  7.801   76.045  1.00 86.26  ? 55  SER A C   1 
ATOM   416   O O   . SER A 1 55  ? 9.830   8.601   75.140  1.00 77.62  ? 55  SER A O   1 
ATOM   417   C CB  . SER A 1 55  ? 8.966   5.807   76.998  1.00 96.47  ? 55  SER A CB  1 
ATOM   418   O OG  . SER A 1 55  ? 8.252   4.631   76.638  1.00 83.00  ? 55  SER A OG  1 
ATOM   419   N N   . VAL A 1 56  ? 10.651  8.194   77.211  1.00 82.75  ? 56  VAL A N   1 
ATOM   420   C CA  . VAL A 1 56  ? 10.929  9.616   77.419  1.00 83.64  ? 56  VAL A CA  1 
ATOM   421   C C   . VAL A 1 56  ? 11.837  10.014  76.268  1.00 74.66  ? 56  VAL A C   1 
ATOM   422   O O   . VAL A 1 56  ? 11.731  11.117  75.719  1.00 78.54  ? 56  VAL A O   1 
ATOM   423   C CB  . VAL A 1 56  ? 11.635  9.903   78.785  1.00 65.39  ? 56  VAL A CB  1 
ATOM   424   C CG1 . VAL A 1 56  ? 10.834  9.271   79.910  1.00 90.74  ? 56  VAL A CG1 1 
ATOM   425   C CG2 . VAL A 1 56  ? 13.060  9.378   78.790  1.00 69.32  ? 56  VAL A CG2 1 
ATOM   426   N N   . GLU A 1 57  ? 12.692  9.071   75.883  1.00 57.90  ? 57  GLU A N   1 
ATOM   427   C CA  . GLU A 1 57  ? 13.645  9.261   74.795  1.00 68.63  ? 57  GLU A CA  1 
ATOM   428   C C   . GLU A 1 57  ? 13.099  8.962   73.396  1.00 62.77  ? 57  GLU A C   1 
ATOM   429   O O   . GLU A 1 57  ? 13.775  9.218   72.397  1.00 60.77  ? 57  GLU A O   1 
ATOM   430   C CB  . GLU A 1 57  ? 14.894  8.406   75.051  1.00 69.16  ? 57  GLU A CB  1 
ATOM   431   C CG  . GLU A 1 57  ? 15.867  9.063   76.003  1.00 90.67  ? 57  GLU A CG  1 
ATOM   432   C CD  . GLU A 1 57  ? 16.388  10.378  75.438  1.00 103.15 ? 57  GLU A CD  1 
ATOM   433   O OE1 . GLU A 1 57  ? 17.332  10.345  74.607  1.00 103.15 ? 57  GLU A OE1 1 
ATOM   434   O OE2 . GLU A 1 57  ? 15.840  11.443  75.805  1.00 98.73  ? 57  GLU A OE2 1 
ATOM   435   N N   . LYS A 1 58  ? 11.887  8.425   73.319  1.00 56.07  ? 58  LYS A N   1 
ATOM   436   C CA  . LYS A 1 58  ? 11.306  8.108   72.018  1.00 65.47  ? 58  LYS A CA  1 
ATOM   437   C C   . LYS A 1 58  ? 11.344  9.255   71.011  1.00 64.01  ? 58  LYS A C   1 
ATOM   438   O O   . LYS A 1 58  ? 11.723  9.072   69.858  1.00 56.98  ? 58  LYS A O   1 
ATOM   439   C CB  . LYS A 1 58  ? 9.847   7.640   72.166  1.00 69.23  ? 58  LYS A CB  1 
ATOM   440   C CG  . LYS A 1 58  ? 9.025   7.757   70.868  1.00 54.42  ? 58  LYS A CG  1 
ATOM   441   C CD  . LYS A 1 58  ? 8.131   6.561   70.629  1.00 37.47  ? 58  LYS A CD  1 
ATOM   442   C CE  . LYS A 1 58  ? 8.940   5.381   70.128  1.00 53.46  ? 58  LYS A CE  1 
ATOM   443   N NZ  . LYS A 1 58  ? 8.146   4.136   70.115  1.00 50.28  ? 58  LYS A NZ  1 
ATOM   444   N N   . ARG A 1 59  ? 10.961  10.440  71.453  1.00 55.31  ? 59  ARG A N   1 
ATOM   445   C CA  . ARG A 1 59  ? 10.901  11.579  70.562  1.00 47.69  ? 59  ARG A CA  1 
ATOM   446   C C   . ARG A 1 59  ? 12.221  12.132  70.051  1.00 60.56  ? 59  ARG A C   1 
ATOM   447   O O   . ARG A 1 59  ? 12.300  12.601  68.907  1.00 70.57  ? 59  ARG A O   1 
ATOM   448   C CB  . ARG A 1 59  ? 10.093  12.685  71.228  1.00 59.50  ? 59  ARG A CB  1 
ATOM   449   C CG  . ARG A 1 59  ? 9.502   13.684  70.263  1.00 51.99  ? 59  ARG A CG  1 
ATOM   450   C CD  . ARG A 1 59  ? 8.259   14.324  70.858  1.00 58.78  ? 59  ARG A CD  1 
ATOM   451   N NE  . ARG A 1 59  ? 7.838   15.478  70.076  1.00 69.10  ? 59  ARG A NE  1 
ATOM   452   C CZ  . ARG A 1 59  ? 6.729   16.170  70.299  1.00 63.82  ? 59  ARG A CZ  1 
ATOM   453   N NH1 . ARG A 1 59  ? 5.917   15.820  71.288  1.00 58.73  ? 59  ARG A NH1 1 
ATOM   454   N NH2 . ARG A 1 59  ? 6.441   17.213  69.534  1.00 49.63  ? 59  ARG A NH2 1 
ATOM   455   N N   . LYS A 1 60  ? 13.262  12.089  70.872  1.00 61.57  ? 60  LYS A N   1 
ATOM   456   C CA  . LYS A 1 60  ? 14.546  12.618  70.425  1.00 50.15  ? 60  LYS A CA  1 
ATOM   457   C C   . LYS A 1 60  ? 15.362  11.571  69.683  1.00 47.90  ? 60  LYS A C   1 
ATOM   458   O O   . LYS A 1 60  ? 16.180  11.910  68.827  1.00 51.58  ? 60  LYS A O   1 
ATOM   459   C CB  . LYS A 1 60  ? 15.343  13.154  71.611  1.00 64.36  ? 60  LYS A CB  1 
ATOM   460   N N   . THR A 1 61  ? 15.146  10.299  70.004  1.00 52.18  ? 61  THR A N   1 
ATOM   461   C CA  . THR A 1 61  ? 15.904  9.244   69.347  1.00 58.00  ? 61  THR A CA  1 
ATOM   462   C C   . THR A 1 61  ? 15.451  9.068   67.900  1.00 54.34  ? 61  THR A C   1 
ATOM   463   O O   . THR A 1 61  ? 16.252  8.737   67.021  1.00 60.00  ? 61  THR A O   1 
ATOM   464   C CB  . THR A 1 61  ? 15.768  7.898   70.096  1.00 60.04  ? 61  THR A CB  1 
ATOM   465   O OG1 . THR A 1 61  ? 16.074  8.090   71.485  1.00 67.20  ? 61  THR A OG1 1 
ATOM   466   C CG2 . THR A 1 61  ? 16.733  6.856   69.509  1.00 42.93  ? 61  THR A CG2 1 
ATOM   467   N N   . MET A 1 62  ? 14.164  9.299   67.659  1.00 60.01  ? 62  MET A N   1 
ATOM   468   C CA  . MET A 1 62  ? 13.600  9.171   66.320  1.00 56.31  ? 62  MET A CA  1 
ATOM   469   C C   . MET A 1 62  ? 14.075  10.283  65.392  1.00 53.83  ? 62  MET A C   1 
ATOM   470   O O   . MET A 1 62  ? 14.352  10.031  64.222  1.00 64.15  ? 62  MET A O   1 
ATOM   471   C CB  . MET A 1 62  ? 12.072  9.133   66.385  1.00 42.07  ? 62  MET A CB  1 
ATOM   472   C CG  . MET A 1 62  ? 11.545  7.789   66.863  1.00 37.74  ? 62  MET A CG  1 
ATOM   473   S SD  . MET A 1 62  ? 9.749   7.593   66.832  1.00 55.88  ? 62  MET A SD  1 
ATOM   474   C CE  . MET A 1 62  ? 9.481   7.140   65.111  1.00 39.90  ? 62  MET A CE  1 
ATOM   475   N N   . LEU A 1 63  ? 14.192  11.502  65.917  1.00 57.46  ? 63  LEU A N   1 
ATOM   476   C CA  . LEU A 1 63  ? 14.664  12.625  65.117  1.00 45.91  ? 63  LEU A CA  1 
ATOM   477   C C   . LEU A 1 63  ? 16.110  12.371  64.699  1.00 51.37  ? 63  LEU A C   1 
ATOM   478   O O   . LEU A 1 63  ? 16.503  12.628  63.561  1.00 52.90  ? 63  LEU A O   1 
ATOM   479   C CB  . LEU A 1 63  ? 14.566  13.925  65.913  1.00 43.83  ? 63  LEU A CB  1 
ATOM   480   C CG  . LEU A 1 63  ? 13.142  14.316  66.300  1.00 50.58  ? 63  LEU A CG  1 
ATOM   481   C CD1 . LEU A 1 63  ? 13.136  15.710  66.922  1.00 56.25  ? 63  LEU A CD1 1 
ATOM   482   C CD2 . LEU A 1 63  ? 12.260  14.291  65.059  1.00 57.71  ? 63  LEU A CD2 1 
ATOM   483   N N   . GLU A 1 64  ? 16.892  11.841  65.626  1.00 51.93  ? 64  GLU A N   1 
ATOM   484   C CA  . GLU A 1 64  ? 18.290  11.538  65.367  1.00 49.95  ? 64  GLU A CA  1 
ATOM   485   C C   . GLU A 1 64  ? 18.368  10.485  64.266  1.00 43.38  ? 64  GLU A C   1 
ATOM   486   O O   . GLU A 1 64  ? 19.207  10.568  63.375  1.00 53.15  ? 64  GLU A O   1 
ATOM   487   C CB  . GLU A 1 64  ? 18.932  11.010  66.653  1.00 53.23  ? 64  GLU A CB  1 
ATOM   488   C CG  . GLU A 1 64  ? 20.449  11.007  66.692  1.00 76.59  ? 64  GLU A CG  1 
ATOM   489   C CD  . GLU A 1 64  ? 20.988  10.599  68.072  1.00 103.15 ? 64  GLU A CD  1 
ATOM   490   O OE1 . GLU A 1 64  ? 20.452  11.107  69.098  1.00 78.29  ? 64  GLU A OE1 1 
ATOM   491   O OE2 . GLU A 1 64  ? 21.950  9.785   68.127  1.00 91.53  ? 64  GLU A OE2 1 
ATOM   492   N N   . LEU A 1 65  ? 17.481  9.498   64.343  1.00 47.91  ? 65  LEU A N   1 
ATOM   493   C CA  . LEU A 1 65  ? 17.422  8.405   63.372  1.00 42.00  ? 65  LEU A CA  1 
ATOM   494   C C   . LEU A 1 65  ? 17.128  8.921   61.968  1.00 46.82  ? 65  LEU A C   1 
ATOM   495   O O   . LEU A 1 65  ? 17.853  8.604   61.029  1.00 43.91  ? 65  LEU A O   1 
ATOM   496   C CB  . LEU A 1 65  ? 16.349  7.394   63.784  1.00 34.11  ? 65  LEU A CB  1 
ATOM   497   C CG  . LEU A 1 65  ? 16.184  6.169   62.880  1.00 50.86  ? 65  LEU A CG  1 
ATOM   498   C CD1 . LEU A 1 65  ? 17.441  5.306   62.959  1.00 44.60  ? 65  LEU A CD1 1 
ATOM   499   C CD2 . LEU A 1 65  ? 14.966  5.372   63.300  1.00 46.25  ? 65  LEU A CD2 1 
ATOM   500   N N   . VAL A 1 66  ? 16.059  9.706   61.834  1.00 39.09  ? 66  VAL A N   1 
ATOM   501   C CA  . VAL A 1 66  ? 15.673  10.283  60.551  1.00 39.43  ? 66  VAL A CA  1 
ATOM   502   C C   . VAL A 1 66  ? 16.843  11.029  59.931  1.00 48.11  ? 66  VAL A C   1 
ATOM   503   O O   . VAL A 1 66  ? 17.230  10.786  58.786  1.00 50.51  ? 66  VAL A O   1 
ATOM   504   C CB  . VAL A 1 66  ? 14.508  11.288  60.710  1.00 51.46  ? 66  VAL A CB  1 
ATOM   505   C CG1 . VAL A 1 66  ? 14.281  12.045  59.404  1.00 42.85  ? 66  VAL A CG1 1 
ATOM   506   C CG2 . VAL A 1 66  ? 13.242  10.559  61.124  1.00 39.92  ? 66  VAL A CG2 1 
ATOM   507   N N   . GLU A 1 67  ? 17.405  11.956  60.693  1.00 56.06  ? 67  GLU A N   1 
ATOM   508   C CA  . GLU A 1 67  ? 18.535  12.731  60.212  1.00 51.82  ? 67  GLU A CA  1 
ATOM   509   C C   . GLU A 1 67  ? 19.717  11.863  59.770  1.00 43.59  ? 67  GLU A C   1 
ATOM   510   O O   . GLU A 1 67  ? 20.281  12.101  58.709  1.00 47.91  ? 67  GLU A O   1 
ATOM   511   C CB  . GLU A 1 67  ? 18.972  13.712  61.289  1.00 55.82  ? 67  GLU A CB  1 
ATOM   512   C CG  . GLU A 1 67  ? 20.213  14.489  60.949  1.00 52.05  ? 67  GLU A CG  1 
ATOM   513   C CD  . GLU A 1 67  ? 20.597  15.440  62.060  1.00 81.88  ? 67  GLU A CD  1 
ATOM   514   O OE1 . GLU A 1 67  ? 21.781  15.848  62.108  1.00 99.84  ? 67  GLU A OE1 1 
ATOM   515   O OE2 . GLU A 1 67  ? 19.713  15.783  62.878  1.00 68.49  ? 67  GLU A OE2 1 
ATOM   516   N N   . LYS A 1 68  ? 20.091  10.867  60.574  1.00 39.65  ? 68  LYS A N   1 
ATOM   517   C CA  . LYS A 1 68  ? 21.203  9.975   60.221  1.00 35.64  ? 68  LYS A CA  1 
ATOM   518   C C   . LYS A 1 68  ? 20.922  9.243   58.892  1.00 57.37  ? 68  LYS A C   1 
ATOM   519   O O   . LYS A 1 68  ? 21.808  9.081   58.047  1.00 40.61  ? 68  LYS A O   1 
ATOM   520   C CB  . LYS A 1 68  ? 21.448  8.941   61.338  1.00 60.65  ? 68  LYS A CB  1 
ATOM   521   C CG  . LYS A 1 68  ? 21.971  9.490   62.708  1.00 67.69  ? 68  LYS A CG  1 
ATOM   522   C CD  . LYS A 1 68  ? 23.448  9.946   62.674  1.00 67.16  ? 68  LYS A CD  1 
ATOM   523   C CE  . LYS A 1 68  ? 23.640  11.250  61.891  1.00 79.56  ? 68  LYS A CE  1 
ATOM   524   N NZ  . LYS A 1 68  ? 25.074  11.645  61.711  1.00 85.08  ? 68  LYS A NZ  1 
ATOM   525   N N   . VAL A 1 69  ? 19.679  8.800   58.721  1.00 49.73  ? 69  VAL A N   1 
ATOM   526   C CA  . VAL A 1 69  ? 19.246  8.106   57.508  1.00 54.54  ? 69  VAL A CA  1 
ATOM   527   C C   . VAL A 1 69  ? 19.157  9.054   56.293  1.00 48.89  ? 69  VAL A C   1 
ATOM   528   O O   . VAL A 1 69  ? 19.678  8.755   55.217  1.00 48.87  ? 69  VAL A O   1 
ATOM   529   C CB  . VAL A 1 69  ? 17.868  7.436   57.742  1.00 53.04  ? 69  VAL A CB  1 
ATOM   530   C CG1 . VAL A 1 69  ? 17.281  6.939   56.433  1.00 44.35  ? 69  VAL A CG1 1 
ATOM   531   C CG2 . VAL A 1 69  ? 18.020  6.294   58.732  1.00 34.77  ? 69  VAL A CG2 1 
ATOM   532   N N   . ALA A 1 70  ? 18.515  10.202  56.481  1.00 48.24  ? 70  ALA A N   1 
ATOM   533   C CA  . ALA A 1 70  ? 18.351  11.173  55.405  1.00 36.78  ? 70  ALA A CA  1 
ATOM   534   C C   . ALA A 1 70  ? 19.636  11.630  54.712  1.00 42.89  ? 70  ALA A C   1 
ATOM   535   O O   . ALA A 1 70  ? 19.602  12.002  53.537  1.00 45.25  ? 70  ALA A O   1 
ATOM   536   C CB  . ALA A 1 70  ? 17.571  12.386  55.908  1.00 35.76  ? 70  ALA A CB  1 
ATOM   537   N N   . GLU A 1 71  ? 20.766  11.604  55.410  1.00 42.51  ? 71  GLU A N   1 
ATOM   538   C CA  . GLU A 1 71  ? 22.007  12.036  54.777  1.00 51.33  ? 71  GLU A CA  1 
ATOM   539   C C   . GLU A 1 71  ? 22.730  10.950  54.014  1.00 50.66  ? 71  GLU A C   1 
ATOM   540   O O   . GLU A 1 71  ? 23.717  11.220  53.332  1.00 58.44  ? 71  GLU A O   1 
ATOM   541   C CB  . GLU A 1 71  ? 22.983  12.653  55.787  1.00 66.50  ? 71  GLU A CB  1 
ATOM   542   C CG  . GLU A 1 71  ? 22.624  12.458  57.232  1.00 82.77  ? 71  GLU A CG  1 
ATOM   543   C CD  . GLU A 1 71  ? 23.518  13.275  58.152  1.00 96.78  ? 71  GLU A CD  1 
ATOM   544   O OE1 . GLU A 1 71  ? 23.674  14.493  57.885  1.00 86.75  ? 71  GLU A OE1 1 
ATOM   545   O OE2 . GLU A 1 71  ? 24.051  12.700  59.135  1.00 75.02  ? 71  GLU A OE2 1 
ATOM   546   N N   . GLN A 1 72  ? 22.262  9.718   54.115  1.00 46.76  ? 72  GLN A N   1 
ATOM   547   C CA  . GLN A 1 72  ? 22.939  8.674   53.379  1.00 57.48  ? 72  GLN A CA  1 
ATOM   548   C C   . GLN A 1 72  ? 22.072  7.844   52.459  1.00 53.05  ? 72  GLN A C   1 
ATOM   549   O O   . GLN A 1 72  ? 22.576  7.286   51.492  1.00 61.83  ? 72  GLN A O   1 
ATOM   550   C CB  . GLN A 1 72  ? 23.704  7.754   54.335  1.00 57.22  ? 72  GLN A CB  1 
ATOM   551   C CG  . GLN A 1 72  ? 25.097  8.274   54.665  1.00 54.71  ? 72  GLN A CG  1 
ATOM   552   C CD  . GLN A 1 72  ? 25.946  7.249   55.381  1.00 70.74  ? 72  GLN A CD  1 
ATOM   553   O OE1 . GLN A 1 72  ? 25.799  7.028   56.590  1.00 49.58  ? 72  GLN A OE1 1 
ATOM   554   N NE2 . GLN A 1 72  ? 26.837  6.600   54.634  1.00 53.13  ? 72  GLN A NE2 1 
ATOM   555   N N   . ILE A 1 73  ? 20.775  7.777   52.736  1.00 44.97  ? 73  ILE A N   1 
ATOM   556   C CA  . ILE A 1 73  ? 19.880  6.959   51.924  1.00 48.49  ? 73  ILE A CA  1 
ATOM   557   C C   . ILE A 1 73  ? 19.395  7.588   50.614  1.00 48.48  ? 73  ILE A C   1 
ATOM   558   O O   . ILE A 1 73  ? 19.143  8.794   50.532  1.00 46.42  ? 73  ILE A O   1 
ATOM   559   C CB  . ILE A 1 73  ? 18.671  6.504   52.767  1.00 51.23  ? 73  ILE A CB  1 
ATOM   560   C CG1 . ILE A 1 73  ? 19.170  5.872   54.065  1.00 83.73  ? 73  ILE A CG1 1 
ATOM   561   C CG2 . ILE A 1 73  ? 17.882  5.438   52.037  1.00 70.39  ? 73  ILE A CG2 1 
ATOM   562   C CD1 . ILE A 1 73  ? 20.005  4.609   53.867  1.00 66.29  ? 73  ILE A CD1 1 
ATOM   563   N N   . ASP A 1 74  ? 19.267  6.743   49.593  1.00 45.29  ? 74  ASP A N   1 
ATOM   564   C CA  . ASP A 1 74  ? 18.834  7.163   48.268  1.00 44.18  ? 74  ASP A CA  1 
ATOM   565   C C   . ASP A 1 74  ? 17.507  6.554   47.818  1.00 44.38  ? 74  ASP A C   1 
ATOM   566   O O   . ASP A 1 74  ? 17.228  6.499   46.625  1.00 43.54  ? 74  ASP A O   1 
ATOM   567   C CB  . ASP A 1 74  ? 19.909  6.828   47.234  1.00 39.72  ? 74  ASP A CB  1 
ATOM   568   C CG  . ASP A 1 74  ? 20.292  5.366   47.256  1.00 42.39  ? 74  ASP A CG  1 
ATOM   569   O OD1 . ASP A 1 74  ? 19.496  4.557   47.759  1.00 49.02  ? 74  ASP A OD1 1 
ATOM   570   O OD2 . ASP A 1 74  ? 21.379  5.018   46.766  1.00 51.52  ? 74  ASP A OD2 1 
ATOM   571   N N   . ILE A 1 75  ? 16.711  6.059   48.762  1.00 43.65  ? 75  ILE A N   1 
ATOM   572   C CA  . ILE A 1 75  ? 15.391  5.520   48.434  1.00 34.49  ? 75  ILE A CA  1 
ATOM   573   C C   . ILE A 1 75  ? 14.432  6.042   49.486  1.00 32.76  ? 75  ILE A C   1 
ATOM   574   O O   . ILE A 1 75  ? 14.857  6.488   50.539  1.00 49.77  ? 75  ILE A O   1 
ATOM   575   C CB  . ILE A 1 75  ? 15.339  3.968   48.407  1.00 39.98  ? 75  ILE A CB  1 
ATOM   576   C CG1 . ILE A 1 75  ? 15.792  3.382   49.741  1.00 26.83  ? 75  ILE A CG1 1 
ATOM   577   C CG2 . ILE A 1 75  ? 16.150  3.456   47.248  1.00 28.38  ? 75  ILE A CG2 1 
ATOM   578   C CD1 . ILE A 1 75  ? 15.511  1.911   49.849  1.00 37.86  ? 75  ILE A CD1 1 
ATOM   579   N N   . PRO A 1 76  ? 13.124  5.999   49.214  1.00 41.23  ? 76  PRO A N   1 
ATOM   580   C CA  . PRO A 1 76  ? 12.117  6.490   50.163  1.00 38.87  ? 76  PRO A CA  1 
ATOM   581   C C   . PRO A 1 76  ? 12.026  5.691   51.458  1.00 34.17  ? 76  PRO A C   1 
ATOM   582   O O   . PRO A 1 76  ? 12.280  4.489   51.472  1.00 34.47  ? 76  PRO A O   1 
ATOM   583   C CB  . PRO A 1 76  ? 10.813  6.405   49.365  1.00 50.30  ? 76  PRO A CB  1 
ATOM   584   C CG  . PRO A 1 76  ? 11.265  6.363   47.927  1.00 48.21  ? 76  PRO A CG  1 
ATOM   585   C CD  . PRO A 1 76  ? 12.484  5.507   47.985  1.00 42.53  ? 76  PRO A CD  1 
ATOM   586   N N   . PHE A 1 77  ? 11.662  6.359   52.548  1.00 37.35  ? 77  PHE A N   1 
ATOM   587   C CA  . PHE A 1 77  ? 11.513  5.661   53.818  1.00 40.91  ? 77  PHE A CA  1 
ATOM   588   C C   . PHE A 1 77  ? 10.412  6.226   54.692  1.00 38.18  ? 77  PHE A C   1 
ATOM   589   O O   . PHE A 1 77  ? 10.150  7.425   54.693  1.00 51.50  ? 77  PHE A O   1 
ATOM   590   C CB  . PHE A 1 77  ? 12.838  5.614   54.607  1.00 37.03  ? 77  PHE A CB  1 
ATOM   591   C CG  . PHE A 1 77  ? 13.283  6.938   55.173  1.00 30.98  ? 77  PHE A CG  1 
ATOM   592   C CD1 . PHE A 1 77  ? 14.051  7.815   54.417  1.00 40.71  ? 77  PHE A CD1 1 
ATOM   593   C CD2 . PHE A 1 77  ? 12.972  7.284   56.481  1.00 32.80  ? 77  PHE A CD2 1 
ATOM   594   C CE1 . PHE A 1 77  ? 14.513  9.025   54.959  1.00 50.66  ? 77  PHE A CE1 1 
ATOM   595   C CE2 . PHE A 1 77  ? 13.425  8.492   57.037  1.00 65.03  ? 77  PHE A CE2 1 
ATOM   596   C CZ  . PHE A 1 77  ? 14.198  9.362   56.271  1.00 40.89  ? 77  PHE A CZ  1 
ATOM   597   N N   . THR A 1 78  ? 9.755   5.338   55.424  1.00 41.69  ? 78  THR A N   1 
ATOM   598   C CA  . THR A 1 78  ? 8.689   5.721   56.335  1.00 50.35  ? 78  THR A CA  1 
ATOM   599   C C   . THR A 1 78  ? 9.216   5.514   57.744  1.00 40.21  ? 78  THR A C   1 
ATOM   600   O O   . THR A 1 78  ? 10.069  4.663   57.975  1.00 39.81  ? 78  THR A O   1 
ATOM   601   C CB  . THR A 1 78  ? 7.431   4.850   56.136  1.00 34.35  ? 78  THR A CB  1 
ATOM   602   O OG1 . THR A 1 78  ? 6.941   5.025   54.805  1.00 51.11  ? 78  THR A OG1 1 
ATOM   603   C CG2 . THR A 1 78  ? 6.342   5.223   57.127  1.00 32.30  ? 78  THR A CG2 1 
ATOM   604   N N   . VAL A 1 79  ? 8.708   6.308   58.674  1.00 39.65  ? 79  VAL A N   1 
ATOM   605   C CA  . VAL A 1 79  ? 9.110   6.217   60.063  1.00 32.81  ? 79  VAL A CA  1 
ATOM   606   C C   . VAL A 1 79  ? 7.850   6.129   60.900  1.00 30.47  ? 79  VAL A C   1 
ATOM   607   O O   . VAL A 1 79  ? 6.853   6.768   60.585  1.00 46.83  ? 79  VAL A O   1 
ATOM   608   C CB  . VAL A 1 79  ? 9.917   7.456   60.475  1.00 49.44  ? 79  VAL A CB  1 
ATOM   609   C CG1 . VAL A 1 79  ? 10.340  7.346   61.927  1.00 49.37  ? 79  VAL A CG1 1 
ATOM   610   C CG2 . VAL A 1 79  ? 11.128  7.596   59.574  1.00 53.15  ? 79  VAL A CG2 1 
ATOM   611   N N   . GLY A 1 80  ? 7.889   5.334   61.961  1.00 39.66  ? 80  GLY A N   1 
ATOM   612   C CA  . GLY A 1 80  ? 6.719   5.199   62.804  1.00 38.48  ? 80  GLY A CA  1 
ATOM   613   C C   . GLY A 1 80  ? 6.943   4.450   64.106  1.00 50.73  ? 80  GLY A C   1 
ATOM   614   O O   . GLY A 1 80  ? 8.038   3.962   64.387  1.00 40.84  ? 80  GLY A O   1 
ATOM   615   N N   . GLY A 1 81  ? 5.880   4.359   64.899  1.00 49.69  ? 81  GLY A N   1 
ATOM   616   C CA  . GLY A 1 81  ? 5.943   3.677   66.170  1.00 35.02  ? 81  GLY A CA  1 
ATOM   617   C C   . GLY A 1 81  ? 6.021   4.692   67.281  1.00 51.45  ? 81  GLY A C   1 
ATOM   618   O O   . GLY A 1 81  ? 7.100   5.185   67.602  1.00 58.66  ? 81  GLY A O   1 
ATOM   619   N N   . GLY A 1 82  ? 4.879   5.024   67.863  1.00 52.91  ? 82  GLY A N   1 
ATOM   620   C CA  . GLY A 1 82  ? 4.874   5.993   68.944  1.00 56.15  ? 82  GLY A CA  1 
ATOM   621   C C   . GLY A 1 82  ? 4.723   7.438   68.491  1.00 62.93  ? 82  GLY A C   1 
ATOM   622   O O   . GLY A 1 82  ? 5.066   8.362   69.230  1.00 53.92  ? 82  GLY A O   1 
ATOM   623   N N   . ILE A 1 83  ? 4.240   7.642   67.272  1.00 47.68  ? 83  ILE A N   1 
ATOM   624   C CA  . ILE A 1 83  ? 4.015   8.999   66.772  1.00 59.77  ? 83  ILE A CA  1 
ATOM   625   C C   . ILE A 1 83  ? 2.566   9.274   67.150  1.00 53.58  ? 83  ILE A C   1 
ATOM   626   O O   . ILE A 1 83  ? 1.647   8.808   66.476  1.00 44.56  ? 83  ILE A O   1 
ATOM   627   C CB  . ILE A 1 83  ? 4.184   9.079   65.241  1.00 55.63  ? 83  ILE A CB  1 
ATOM   628   C CG1 . ILE A 1 83  ? 5.655   8.884   64.872  1.00 41.63  ? 83  ILE A CG1 1 
ATOM   629   C CG2 . ILE A 1 83  ? 3.674   10.408  64.725  1.00 41.72  ? 83  ILE A CG2 1 
ATOM   630   C CD1 . ILE A 1 83  ? 5.903   8.835   63.370  1.00 46.83  ? 83  ILE A CD1 1 
ATOM   631   N N   . HIS A 1 84  ? 2.372   10.027  68.230  1.00 42.92  ? 84  HIS A N   1 
ATOM   632   C CA  . HIS A 1 84  ? 1.033   10.302  68.736  1.00 61.64  ? 84  HIS A CA  1 
ATOM   633   C C   . HIS A 1 84  ? 0.325   11.640  68.439  1.00 61.74  ? 84  HIS A C   1 
ATOM   634   O O   . HIS A 1 84  ? -0.813  11.855  68.888  1.00 51.65  ? 84  HIS A O   1 
ATOM   635   C CB  . HIS A 1 84  ? 1.033   10.042  70.244  1.00 45.32  ? 84  HIS A CB  1 
ATOM   636   C CG  . HIS A 1 84  ? 1.390   8.629   70.610  1.00 93.59  ? 84  HIS A CG  1 
ATOM   637   N ND1 . HIS A 1 84  ? 1.017   7.544   69.840  1.00 96.50  ? 84  HIS A ND1 1 
ATOM   638   C CD2 . HIS A 1 84  ? 2.049   8.122   71.680  1.00 64.49  ? 84  HIS A CD2 1 
ATOM   639   C CE1 . HIS A 1 84  ? 1.430   6.432   70.421  1.00 90.56  ? 84  HIS A CE1 1 
ATOM   640   N NE2 . HIS A 1 84  ? 2.058   6.755   71.539  1.00 86.99  ? 84  HIS A NE2 1 
ATOM   641   N N   . ASP A 1 85  ? 0.968   12.525  67.683  1.00 46.51  ? 85  ASP A N   1 
ATOM   642   C CA  . ASP A 1 85  ? 0.357   13.810  67.360  1.00 40.15  ? 85  ASP A CA  1 
ATOM   643   C C   . ASP A 1 85  ? 0.991   14.478  66.153  1.00 47.17  ? 85  ASP A C   1 
ATOM   644   O O   . ASP A 1 85  ? 2.009   14.026  65.635  1.00 50.33  ? 85  ASP A O   1 
ATOM   645   C CB  . ASP A 1 85  ? 0.455   14.753  68.552  1.00 48.64  ? 85  ASP A CB  1 
ATOM   646   C CG  . ASP A 1 85  ? 1.863   14.856  69.082  1.00 61.00  ? 85  ASP A CG  1 
ATOM   647   O OD1 . ASP A 1 85  ? 2.761   15.329  68.337  1.00 72.18  ? 85  ASP A OD1 1 
ATOM   648   O OD2 . ASP A 1 85  ? 2.075   14.451  70.248  1.00 88.13  ? 85  ASP A OD2 1 
ATOM   649   N N   . PHE A 1 86  ? 0.378   15.580  65.734  1.00 50.38  ? 86  PHE A N   1 
ATOM   650   C CA  . PHE A 1 86  ? 0.826   16.345  64.581  1.00 46.06  ? 86  PHE A CA  1 
ATOM   651   C C   . PHE A 1 86  ? 2.246   16.883  64.741  1.00 58.51  ? 86  PHE A C   1 
ATOM   652   O O   . PHE A 1 86  ? 3.024   16.892  63.785  1.00 65.47  ? 86  PHE A O   1 
ATOM   653   C CB  . PHE A 1 86  ? -0.133  17.508  64.323  1.00 43.36  ? 86  PHE A CB  1 
ATOM   654   C CG  . PHE A 1 86  ? 0.202   18.295  63.096  1.00 62.75  ? 86  PHE A CG  1 
ATOM   655   C CD1 . PHE A 1 86  ? -0.145  17.821  61.833  1.00 43.40  ? 86  PHE A CD1 1 
ATOM   656   C CD2 . PHE A 1 86  ? 0.927   19.478  63.193  1.00 47.19  ? 86  PHE A CD2 1 
ATOM   657   C CE1 . PHE A 1 86  ? 0.231   18.509  60.679  1.00 42.51  ? 86  PHE A CE1 1 
ATOM   658   C CE2 . PHE A 1 86  ? 1.310   20.177  62.045  1.00 58.60  ? 86  PHE A CE2 1 
ATOM   659   C CZ  . PHE A 1 86  ? 0.963   19.690  60.785  1.00 61.79  ? 86  PHE A CZ  1 
ATOM   660   N N   . GLU A 1 87  ? 2.575   17.354  65.939  1.00 57.60  ? 87  GLU A N   1 
ATOM   661   C CA  . GLU A 1 87  ? 3.909   17.885  66.201  1.00 67.72  ? 87  GLU A CA  1 
ATOM   662   C C   . GLU A 1 87  ? 4.959   16.830  65.856  1.00 60.09  ? 87  GLU A C   1 
ATOM   663   O O   . GLU A 1 87  ? 5.775   17.027  64.946  1.00 54.65  ? 87  GLU A O   1 
ATOM   664   C CB  . GLU A 1 87  ? 4.041   18.287  67.680  1.00 75.15  ? 87  GLU A CB  1 
ATOM   665   C CG  . GLU A 1 87  ? 3.509   19.674  68.014  1.00 77.81  ? 87  GLU A CG  1 
ATOM   666   C CD  . GLU A 1 87  ? 2.085   19.901  67.521  1.00 103.15 ? 87  GLU A CD  1 
ATOM   667   O OE1 . GLU A 1 87  ? 1.187   19.090  67.861  1.00 68.04  ? 87  GLU A OE1 1 
ATOM   668   O OE2 . GLU A 1 87  ? 1.868   20.903  66.793  1.00 83.65  ? 87  GLU A OE2 1 
ATOM   669   N N   . THR A 1 88  ? 4.924   15.709  66.574  1.00 42.19  ? 88  THR A N   1 
ATOM   670   C CA  . THR A 1 88  ? 5.875   14.634  66.336  1.00 43.96  ? 88  THR A CA  1 
ATOM   671   C C   . THR A 1 88  ? 5.997   14.296  64.846  1.00 42.26  ? 88  THR A C   1 
ATOM   672   O O   . THR A 1 88  ? 7.105   14.140  64.332  1.00 58.83  ? 88  THR A O   1 
ATOM   673   C CB  . THR A 1 88  ? 5.483   13.363  67.108  1.00 59.93  ? 88  THR A CB  1 
ATOM   674   O OG1 . THR A 1 88  ? 4.980   13.726  68.398  1.00 67.13  ? 88  THR A OG1 1 
ATOM   675   C CG2 . THR A 1 88  ? 6.702   12.471  67.302  1.00 52.39  ? 88  THR A CG2 1 
ATOM   676   N N   . ALA A 1 89  ? 4.865   14.202  64.152  1.00 39.30  ? 89  ALA A N   1 
ATOM   677   C CA  . ALA A 1 89  ? 4.864   13.883  62.727  1.00 41.73  ? 89  ALA A CA  1 
ATOM   678   C C   . ALA A 1 89  ? 5.566   14.933  61.877  1.00 42.00  ? 89  ALA A C   1 
ATOM   679   O O   . ALA A 1 89  ? 6.421   14.606  61.048  1.00 46.01  ? 89  ALA A O   1 
ATOM   680   C CB  . ALA A 1 89  ? 3.443   13.694  62.237  1.00 38.44  ? 89  ALA A CB  1 
ATOM   681   N N   . SER A 1 90  ? 5.203   16.197  62.088  1.00 57.46  ? 90  SER A N   1 
ATOM   682   C CA  . SER A 1 90  ? 5.783   17.307  61.339  1.00 43.43  ? 90  SER A CA  1 
ATOM   683   C C   . SER A 1 90  ? 7.282   17.467  61.526  1.00 43.50  ? 90  SER A C   1 
ATOM   684   O O   . SER A 1 90  ? 7.973   17.923  60.618  1.00 49.69  ? 90  SER A O   1 
ATOM   685   C CB  . SER A 1 90  ? 5.099   18.623  61.718  1.00 53.62  ? 90  SER A CB  1 
ATOM   686   O OG  . SER A 1 90  ? 5.740   19.720  61.074  1.00 51.38  ? 90  SER A OG  1 
ATOM   687   N N   . GLU A 1 91  ? 7.790   17.103  62.698  1.00 46.41  ? 91  GLU A N   1 
ATOM   688   C CA  . GLU A 1 91  ? 9.224   17.237  62.954  1.00 48.91  ? 91  GLU A CA  1 
ATOM   689   C C   . GLU A 1 91  ? 10.004  16.125  62.259  1.00 45.28  ? 91  GLU A C   1 
ATOM   690   O O   . GLU A 1 91  ? 11.123  16.334  61.784  1.00 47.95  ? 91  GLU A O   1 
ATOM   691   C CB  . GLU A 1 91  ? 9.490   17.219  64.458  1.00 59.49  ? 91  GLU A CB  1 
ATOM   692   C CG  . GLU A 1 91  ? 8.494   18.071  65.253  1.00 67.36  ? 91  GLU A CG  1 
ATOM   693   C CD  . GLU A 1 91  ? 8.793   18.105  66.746  1.00 87.43  ? 91  GLU A CD  1 
ATOM   694   O OE1 . GLU A 1 91  ? 7.872   18.434  67.537  1.00 68.34  ? 91  GLU A OE1 1 
ATOM   695   O OE2 . GLU A 1 91  ? 9.954   17.812  67.124  1.00 86.35  ? 91  GLU A OE2 1 
ATOM   696   N N   . LEU A 1 92  ? 9.398   14.942  62.194  1.00 52.28  ? 92  LEU A N   1 
ATOM   697   C CA  . LEU A 1 92  ? 10.015  13.793  61.544  1.00 45.20  ? 92  LEU A CA  1 
ATOM   698   C C   . LEU A 1 92  ? 10.060  14.006  60.034  1.00 29.98  ? 92  LEU A C   1 
ATOM   699   O O   . LEU A 1 92  ? 11.048  13.691  59.382  1.00 48.81  ? 92  LEU A O   1 
ATOM   700   C CB  . LEU A 1 92  ? 9.221   12.527  61.886  1.00 48.95  ? 92  LEU A CB  1 
ATOM   701   C CG  . LEU A 1 92  ? 9.247   12.166  63.376  1.00 40.74  ? 92  LEU A CG  1 
ATOM   702   C CD1 . LEU A 1 92  ? 8.119   11.207  63.713  1.00 47.45  ? 92  LEU A CD1 1 
ATOM   703   C CD2 . LEU A 1 92  ? 10.601  11.565  63.727  1.00 45.38  ? 92  LEU A CD2 1 
ATOM   704   N N   . ILE A 1 93  ? 8.983   14.562  59.491  1.00 43.27  ? 93  ILE A N   1 
ATOM   705   C CA  . ILE A 1 93  ? 8.887   14.819  58.064  1.00 32.21  ? 93  ILE A CA  1 
ATOM   706   C C   . ILE A 1 93  ? 9.786   15.971  57.670  1.00 40.02  ? 93  ILE A C   1 
ATOM   707   O O   . ILE A 1 93  ? 10.496  15.901  56.666  1.00 45.81  ? 93  ILE A O   1 
ATOM   708   C CB  . ILE A 1 93  ? 7.449   15.152  57.663  1.00 39.82  ? 93  ILE A CB  1 
ATOM   709   C CG1 . ILE A 1 93  ? 6.544   13.967  58.007  1.00 65.01  ? 93  ILE A CG1 1 
ATOM   710   C CG2 . ILE A 1 93  ? 7.375   15.483  56.172  1.00 40.58  ? 93  ILE A CG2 1 
ATOM   711   C CD1 . ILE A 1 93  ? 5.077   14.198  57.732  1.00 47.48  ? 93  ILE A CD1 1 
ATOM   712   N N   . LEU A 1 94  ? 9.752   17.041  58.457  1.00 57.55  ? 94  LEU A N   1 
ATOM   713   C CA  . LEU A 1 94  ? 10.582  18.195  58.168  1.00 37.72  ? 94  LEU A CA  1 
ATOM   714   C C   . LEU A 1 94  ? 12.019  17.786  58.331  1.00 36.83  ? 94  LEU A C   1 
ATOM   715   O O   . LEU A 1 94  ? 12.901  18.289  57.649  1.00 46.06  ? 94  LEU A O   1 
ATOM   716   C CB  . LEU A 1 94  ? 10.249  19.345  59.114  1.00 57.23  ? 94  LEU A CB  1 
ATOM   717   C CG  . LEU A 1 94  ? 9.091   20.229  58.644  1.00 63.01  ? 94  LEU A CG  1 
ATOM   718   C CD1 . LEU A 1 94  ? 8.754   21.265  59.697  1.00 50.11  ? 94  LEU A CD1 1 
ATOM   719   C CD2 . LEU A 1 94  ? 9.493   20.907  57.348  1.00 50.75  ? 94  LEU A CD2 1 
ATOM   720   N N   . ARG A 1 95  ? 12.245  16.847  59.235  1.00 44.76  ? 95  ARG A N   1 
ATOM   721   C CA  . ARG A 1 95  ? 13.590  16.354  59.498  1.00 52.05  ? 95  ARG A CA  1 
ATOM   722   C C   . ARG A 1 95  ? 14.210  15.556  58.347  1.00 61.09  ? 95  ARG A C   1 
ATOM   723   O O   . ARG A 1 95  ? 15.434  15.436  58.266  1.00 55.80  ? 95  ARG A O   1 
ATOM   724   C CB  . ARG A 1 95  ? 13.580  15.495  60.763  1.00 55.57  ? 95  ARG A CB  1 
ATOM   725   C CG  . ARG A 1 95  ? 14.950  15.061  61.225  1.00 61.94  ? 95  ARG A CG  1 
ATOM   726   C CD  . ARG A 1 95  ? 15.934  16.224  61.195  1.00 68.82  ? 95  ARG A CD  1 
ATOM   727   N NE  . ARG A 1 95  ? 16.856  16.159  62.316  1.00 86.12  ? 95  ARG A NE  1 
ATOM   728   C CZ  . ARG A 1 95  ? 16.608  16.698  63.507  1.00 88.68  ? 95  ARG A CZ  1 
ATOM   729   N NH1 . ARG A 1 95  ? 15.467  17.350  63.719  1.00 67.01  ? 95  ARG A NH1 1 
ATOM   730   N NH2 . ARG A 1 95  ? 17.492  16.565  64.488  1.00 65.47  ? 95  ARG A NH2 1 
ATOM   731   N N   . GLY A 1 96  ? 13.372  15.001  57.473  1.00 50.96  ? 96  GLY A N   1 
ATOM   732   C CA  . GLY A 1 96  ? 13.884  14.223  56.358  1.00 53.56  ? 96  GLY A CA  1 
ATOM   733   C C   . GLY A 1 96  ? 13.094  12.972  55.982  1.00 54.20  ? 96  GLY A C   1 
ATOM   734   O O   . GLY A 1 96  ? 13.361  12.374  54.943  1.00 49.77  ? 96  GLY A O   1 
ATOM   735   N N   . ALA A 1 97  ? 12.139  12.570  56.819  1.00 39.45  ? 97  ALA A N   1 
ATOM   736   C CA  . ALA A 1 97  ? 11.326  11.387  56.558  1.00 37.96  ? 97  ALA A CA  1 
ATOM   737   C C   . ALA A 1 97  ? 10.383  11.629  55.379  1.00 46.99  ? 97  ALA A C   1 
ATOM   738   O O   . ALA A 1 97  ? 9.844   12.723  55.221  1.00 53.96  ? 97  ALA A O   1 
ATOM   739   C CB  . ALA A 1 97  ? 10.513  11.017  57.800  1.00 32.43  ? 97  ALA A CB  1 
ATOM   740   N N   . ASP A 1 98  ? 10.178  10.601  54.565  1.00 41.43  ? 98  ASP A N   1 
ATOM   741   C CA  . ASP A 1 98  ? 9.301   10.702  53.406  1.00 46.42  ? 98  ASP A CA  1 
ATOM   742   C C   . ASP A 1 98  ? 7.853   10.510  53.825  1.00 48.11  ? 98  ASP A C   1 
ATOM   743   O O   . ASP A 1 98  ? 6.960   11.184  53.314  1.00 41.74  ? 98  ASP A O   1 
ATOM   744   C CB  . ASP A 1 98  ? 9.699   9.665   52.353  1.00 37.40  ? 98  ASP A CB  1 
ATOM   745   C CG  . ASP A 1 98  ? 11.115  9.888   51.819  1.00 53.63  ? 98  ASP A CG  1 
ATOM   746   O OD1 . ASP A 1 98  ? 11.359  10.935  51.178  1.00 59.15  ? 98  ASP A OD1 1 
ATOM   747   O OD2 . ASP A 1 98  ? 11.992  9.024   52.047  1.00 50.64  ? 98  ASP A OD2 1 
ATOM   748   N N   . LYS A 1 99  ? 7.623   9.595   54.761  1.00 39.92  ? 99  LYS A N   1 
ATOM   749   C CA  . LYS A 1 99  ? 6.278   9.336   55.252  1.00 30.61  ? 99  LYS A CA  1 
ATOM   750   C C   . LYS A 1 99  ? 6.334   8.940   56.712  1.00 46.54  ? 99  LYS A C   1 
ATOM   751   O O   . LYS A 1 99  ? 7.359   8.476   57.208  1.00 32.81  ? 99  LYS A O   1 
ATOM   752   C CB  . LYS A 1 99  ? 5.603   8.183   54.494  1.00 44.91  ? 99  LYS A CB  1 
ATOM   753   C CG  . LYS A 1 99  ? 5.649   8.220   52.978  1.00 32.25  ? 99  LYS A CG  1 
ATOM   754   C CD  . LYS A 1 99  ? 4.732   7.147   52.420  1.00 50.17  ? 99  LYS A CD  1 
ATOM   755   C CE  . LYS A 1 99  ? 5.146   6.682   51.034  1.00 51.37  ? 99  LYS A CE  1 
ATOM   756   N NZ  . LYS A 1 99  ? 6.432   5.933   51.092  1.00 62.35  ? 99  LYS A NZ  1 
ATOM   757   N N   . VAL A 1 100 ? 5.221   9.125   57.403  1.00 27.54  ? 100 VAL A N   1 
ATOM   758   C CA  . VAL A 1 100 ? 5.153   8.731   58.793  1.00 42.61  ? 100 VAL A CA  1 
ATOM   759   C C   . VAL A 1 100 ? 4.080   7.683   58.884  1.00 33.16  ? 100 VAL A C   1 
ATOM   760   O O   . VAL A 1 100 ? 3.156   7.647   58.088  1.00 44.90  ? 100 VAL A O   1 
ATOM   761   C CB  . VAL A 1 100 ? 4.770   9.889   59.740  1.00 50.20  ? 100 VAL A CB  1 
ATOM   762   C CG1 . VAL A 1 100 ? 5.904   10.908  59.820  1.00 45.62  ? 100 VAL A CG1 1 
ATOM   763   C CG2 . VAL A 1 100 ? 3.474   10.522  59.265  1.00 51.80  ? 100 VAL A CG2 1 
ATOM   764   N N   . SER A 1 101 ? 4.206   6.828   59.875  1.00 39.51  ? 101 SER A N   1 
ATOM   765   C CA  . SER A 1 101 ? 3.241   5.790   60.058  1.00 29.14  ? 101 SER A CA  1 
ATOM   766   C C   . SER A 1 101 ? 2.622   5.965   61.432  1.00 43.33  ? 101 SER A C   1 
ATOM   767   O O   . SER A 1 101 ? 3.334   6.076   62.423  1.00 45.78  ? 101 SER A O   1 
ATOM   768   C CB  . SER A 1 101 ? 3.931   4.441   59.945  1.00 33.94  ? 101 SER A CB  1 
ATOM   769   O OG  . SER A 1 101 ? 2.985   3.403   60.024  1.00 43.40  ? 101 SER A OG  1 
ATOM   770   N N   . ILE A 1 102 ? 1.294   6.008   61.474  1.00 42.35  ? 102 ILE A N   1 
ATOM   771   C CA  . ILE A 1 102 ? 0.547   6.147   62.717  1.00 25.18  ? 102 ILE A CA  1 
ATOM   772   C C   . ILE A 1 102 ? -0.502  5.042   62.778  1.00 46.04  ? 102 ILE A C   1 
ATOM   773   O O   . ILE A 1 102 ? -1.126  4.711   61.767  1.00 46.84  ? 102 ILE A O   1 
ATOM   774   C CB  . ILE A 1 102 ? -0.152  7.511   62.792  1.00 41.86  ? 102 ILE A CB  1 
ATOM   775   C CG1 . ILE A 1 102 ? -0.976  7.737   61.522  1.00 43.45  ? 102 ILE A CG1 1 
ATOM   776   C CG2 . ILE A 1 102 ? 0.881   8.619   62.982  1.00 47.73  ? 102 ILE A CG2 1 
ATOM   777   C CD1 . ILE A 1 102 ? -1.608  9.093   61.437  1.00 46.33  ? 102 ILE A CD1 1 
ATOM   778   N N   . ASN A 1 103 ? -0.691  4.465   63.962  1.00 46.69  ? 103 ASN A N   1 
ATOM   779   C CA  . ASN A 1 103 ? -1.675  3.400   64.151  1.00 44.48  ? 103 ASN A CA  1 
ATOM   780   C C   . ASN A 1 103 ? -2.574  3.705   65.342  1.00 45.57  ? 103 ASN A C   1 
ATOM   781   O O   . ASN A 1 103 ? -3.705  4.147   65.172  1.00 61.83  ? 103 ASN A O   1 
ATOM   782   C CB  . ASN A 1 103 ? -0.961  2.060   64.356  1.00 30.23  ? 103 ASN A CB  1 
ATOM   783   C CG  . ASN A 1 103 ? -1.911  0.918   64.671  1.00 34.33  ? 103 ASN A CG  1 
ATOM   784   O OD1 . ASN A 1 103 ? -1.523  -0.242  64.594  1.00 66.85  ? 103 ASN A OD1 1 
ATOM   785   N ND2 . ASN A 1 103 ? -3.143  1.231   65.040  1.00 40.81  ? 103 ASN A ND2 1 
ATOM   786   N N   . THR A 1 104 ? -2.060  3.460   66.545  1.00 58.84  ? 104 THR A N   1 
ATOM   787   C CA  . THR A 1 104 ? -2.792  3.701   67.785  1.00 45.35  ? 104 THR A CA  1 
ATOM   788   C C   . THR A 1 104 ? -3.306  5.138   67.922  1.00 44.26  ? 104 THR A C   1 
ATOM   789   O O   . THR A 1 104 ? -4.423  5.373   68.371  1.00 45.82  ? 104 THR A O   1 
ATOM   790   C CB  . THR A 1 104 ? -1.898  3.373   68.996  1.00 48.20  ? 104 THR A CB  1 
ATOM   791   O OG1 . THR A 1 104 ? -1.682  1.957   69.059  1.00 46.50  ? 104 THR A OG1 1 
ATOM   792   C CG2 . THR A 1 104 ? -2.536  3.858   70.296  1.00 36.91  ? 104 THR A CG2 1 
ATOM   793   N N   . ALA A 1 105 ? -2.488  6.100   67.539  1.00 43.59  ? 105 ALA A N   1 
ATOM   794   C CA  . ALA A 1 105 ? -2.892  7.489   67.643  1.00 39.54  ? 105 ALA A CA  1 
ATOM   795   C C   . ALA A 1 105 ? -3.873  7.871   66.542  1.00 57.05  ? 105 ALA A C   1 
ATOM   796   O O   . ALA A 1 105 ? -4.545  8.902   66.630  1.00 65.07  ? 105 ALA A O   1 
ATOM   797   C CB  . ALA A 1 105 ? -1.669  8.389   67.597  1.00 71.23  ? 105 ALA A CB  1 
ATOM   798   N N   . ALA A 1 106 ? -3.956  7.041   65.505  1.00 54.72  ? 106 ALA A N   1 
ATOM   799   C CA  . ALA A 1 106 ? -4.875  7.303   64.399  1.00 55.38  ? 106 ALA A CA  1 
ATOM   800   C C   . ALA A 1 106 ? -6.279  6.837   64.761  1.00 41.77  ? 106 ALA A C   1 
ATOM   801   O O   . ALA A 1 106 ? -7.260  7.520   64.476  1.00 60.48  ? 106 ALA A O   1 
ATOM   802   C CB  . ALA A 1 106 ? -4.395  6.591   63.124  1.00 49.27  ? 106 ALA A CB  1 
ATOM   803   N N   . VAL A 1 107 ? -6.362  5.672   65.395  1.00 42.13  ? 107 VAL A N   1 
ATOM   804   C CA  . VAL A 1 107 ? -7.644  5.091   65.795  1.00 48.23  ? 107 VAL A CA  1 
ATOM   805   C C   . VAL A 1 107 ? -8.348  5.899   66.882  1.00 59.66  ? 107 VAL A C   1 
ATOM   806   O O   . VAL A 1 107 ? -9.578  6.030   66.886  1.00 51.91  ? 107 VAL A O   1 
ATOM   807   C CB  . VAL A 1 107 ? -7.466  3.648   66.323  1.00 48.32  ? 107 VAL A CB  1 
ATOM   808   C CG1 . VAL A 1 107 ? -8.782  3.132   66.868  1.00 47.25  ? 107 VAL A CG1 1 
ATOM   809   C CG2 . VAL A 1 107 ? -6.956  2.740   65.210  1.00 41.71  ? 107 VAL A CG2 1 
ATOM   810   N N   . GLU A 1 108 ? -7.564  6.430   67.809  1.00 46.95  ? 108 GLU A N   1 
ATOM   811   C CA  . GLU A 1 108 ? -8.127  7.208   68.889  1.00 61.36  ? 108 GLU A CA  1 
ATOM   812   C C   . GLU A 1 108 ? -8.513  8.596   68.405  1.00 56.99  ? 108 GLU A C   1 
ATOM   813   O O   . GLU A 1 108 ? -9.437  9.195   68.941  1.00 51.37  ? 108 GLU A O   1 
ATOM   814   C CB  . GLU A 1 108 ? -7.137  7.278   70.045  1.00 44.74  ? 108 GLU A CB  1 
ATOM   815   C CG  . GLU A 1 108 ? -6.737  5.901   70.533  1.00 55.69  ? 108 GLU A CG  1 
ATOM   816   C CD  . GLU A 1 108 ? -5.872  5.951   71.763  1.00 61.50  ? 108 GLU A CD  1 
ATOM   817   O OE1 . GLU A 1 108 ? -5.078  6.913   71.871  1.00 53.05  ? 108 GLU A OE1 1 
ATOM   818   O OE2 . GLU A 1 108 ? -5.981  5.027   72.603  1.00 39.90  ? 108 GLU A OE2 1 
ATOM   819   N N   . ASN A 1 109 ? -7.817  9.092   67.383  1.00 58.75  ? 109 ASN A N   1 
ATOM   820   C CA  . ASN A 1 109 ? -8.127  10.400  66.818  1.00 46.81  ? 109 ASN A CA  1 
ATOM   821   C C   . ASN A 1 109 ? -7.961  10.398  65.300  1.00 53.41  ? 109 ASN A C   1 
ATOM   822   O O   . ASN A 1 109 ? -6.913  10.781  64.777  1.00 50.91  ? 109 ASN A O   1 
ATOM   823   C CB  . ASN A 1 109 ? -7.234  11.488  67.415  1.00 56.90  ? 109 ASN A CB  1 
ATOM   824   C CG  . ASN A 1 109 ? -7.477  12.857  66.774  1.00 59.52  ? 109 ASN A CG  1 
ATOM   825   O OD1 . ASN A 1 109 ? -6.630  13.751  66.845  1.00 62.82  ? 109 ASN A OD1 1 
ATOM   826   N ND2 . ASN A 1 109 ? -8.637  13.021  66.144  1.00 52.98  ? 109 ASN A ND2 1 
ATOM   827   N N   . PRO A 1 110 ? -9.001  9.976   64.573  1.00 43.75  ? 110 PRO A N   1 
ATOM   828   C CA  . PRO A 1 110 ? -8.947  9.932   63.115  1.00 38.54  ? 110 PRO A CA  1 
ATOM   829   C C   . PRO A 1 110 ? -8.615  11.268  62.476  1.00 57.58  ? 110 PRO A C   1 
ATOM   830   O O   . PRO A 1 110 ? -8.109  11.306  61.353  1.00 52.33  ? 110 PRO A O   1 
ATOM   831   C CB  . PRO A 1 110 ? -10.336 9.429   62.739  1.00 44.71  ? 110 PRO A CB  1 
ATOM   832   C CG  . PRO A 1 110 ? -10.671 8.518   63.870  1.00 33.92  ? 110 PRO A CG  1 
ATOM   833   C CD  . PRO A 1 110 ? -10.233 9.338   65.066  1.00 51.76  ? 110 PRO A CD  1 
ATOM   834   N N   . SER A 1 111 ? -8.893  12.361  63.190  1.00 57.02  ? 111 SER A N   1 
ATOM   835   C CA  . SER A 1 111 ? -8.616  13.715  62.678  1.00 50.71  ? 111 SER A CA  1 
ATOM   836   C C   . SER A 1 111 ? -7.121  13.935  62.481  1.00 46.29  ? 111 SER A C   1 
ATOM   837   O O   . SER A 1 111 ? -6.704  14.847  61.761  1.00 43.87  ? 111 SER A O   1 
ATOM   838   C CB  . SER A 1 111 ? -9.144  14.779  63.645  1.00 54.94  ? 111 SER A CB  1 
ATOM   839   O OG  . SER A 1 111 ? -10.524 14.613  63.896  1.00 71.23  ? 111 SER A OG  1 
ATOM   840   N N   . LEU A 1 112 ? -6.319  13.112  63.147  1.00 40.99  ? 112 LEU A N   1 
ATOM   841   C CA  . LEU A 1 112 ? -4.865  13.200  63.034  1.00 46.49  ? 112 LEU A CA  1 
ATOM   842   C C   . LEU A 1 112 ? -4.441  12.884  61.607  1.00 37.36  ? 112 LEU A C   1 
ATOM   843   O O   . LEU A 1 112 ? -3.628  13.594  61.007  1.00 49.40  ? 112 LEU A O   1 
ATOM   844   C CB  . LEU A 1 112 ? -4.203  12.211  63.989  1.00 47.21  ? 112 LEU A CB  1 
ATOM   845   C CG  . LEU A 1 112 ? -2.685  12.131  63.883  1.00 57.88  ? 112 LEU A CG  1 
ATOM   846   C CD1 . LEU A 1 112 ? -2.082  13.521  64.111  1.00 54.41  ? 112 LEU A CD1 1 
ATOM   847   C CD2 . LEU A 1 112 ? -2.152  11.125  64.902  1.00 41.43  ? 112 LEU A CD2 1 
ATOM   848   N N   . ILE A 1 113 ? -4.994  11.800  61.075  1.00 51.59  ? 113 ILE A N   1 
ATOM   849   C CA  . ILE A 1 113 ? -4.704  11.384  59.710  1.00 44.91  ? 113 ILE A CA  1 
ATOM   850   C C   . ILE A 1 113 ? -4.880  12.628  58.846  1.00 40.90  ? 113 ILE A C   1 
ATOM   851   O O   . ILE A 1 113 ? -4.007  12.992  58.055  1.00 54.31  ? 113 ILE A O   1 
ATOM   852   C CB  . ILE A 1 113 ? -5.712  10.303  59.236  1.00 55.44  ? 113 ILE A CB  1 
ATOM   853   C CG1 . ILE A 1 113 ? -5.686  9.094   60.179  1.00 51.27  ? 113 ILE A CG1 1 
ATOM   854   C CG2 . ILE A 1 113 ? -5.393  9.882   57.823  1.00 48.96  ? 113 ILE A CG2 1 
ATOM   855   C CD1 . ILE A 1 113 ? -6.768  8.086   59.913  1.00 33.23  ? 113 ILE A CD1 1 
ATOM   856   N N   . THR A 1 114 ? -6.015  13.291  59.034  1.00 42.73  ? 114 THR A N   1 
ATOM   857   C CA  . THR A 1 114 ? -6.356  14.487  58.274  1.00 38.72  ? 114 THR A CA  1 
ATOM   858   C C   . THR A 1 114 ? -5.400  15.649  58.507  1.00 51.99  ? 114 THR A C   1 
ATOM   859   O O   . THR A 1 114 ? -4.982  16.305  57.553  1.00 48.80  ? 114 THR A O   1 
ATOM   860   C CB  . THR A 1 114 ? -7.778  14.952  58.595  1.00 39.07  ? 114 THR A CB  1 
ATOM   861   O OG1 . THR A 1 114 ? -8.650  13.818  58.617  1.00 45.61  ? 114 THR A OG1 1 
ATOM   862   C CG2 . THR A 1 114 ? -8.269  15.919  57.528  1.00 62.18  ? 114 THR A CG2 1 
ATOM   863   N N   . GLN A 1 115 ? -5.049  15.908  59.762  1.00 41.02  ? 115 GLN A N   1 
ATOM   864   C CA  . GLN A 1 115 ? -4.130  17.002  60.055  1.00 50.63  ? 115 GLN A CA  1 
ATOM   865   C C   . GLN A 1 115 ? -2.813  16.865  59.297  1.00 46.51  ? 115 GLN A C   1 
ATOM   866   O O   . GLN A 1 115 ? -2.280  17.848  58.795  1.00 56.19  ? 115 GLN A O   1 
ATOM   867   C CB  . GLN A 1 115 ? -3.809  17.073  61.546  1.00 71.77  ? 115 GLN A CB  1 
ATOM   868   C CG  . GLN A 1 115 ? -4.981  17.256  62.467  1.00 56.20  ? 115 GLN A CG  1 
ATOM   869   C CD  . GLN A 1 115 ? -4.532  17.237  63.913  1.00 85.59  ? 115 GLN A CD  1 
ATOM   870   O OE1 . GLN A 1 115 ? -5.319  16.962  64.829  1.00 62.14  ? 115 GLN A OE1 1 
ATOM   871   N NE2 . GLN A 1 115 ? -3.254  17.537  64.129  1.00 56.97  ? 115 GLN A NE2 1 
ATOM   872   N N   . ILE A 1 116 ? -2.270  15.655  59.231  1.00 46.35  ? 116 ILE A N   1 
ATOM   873   C CA  . ILE A 1 116 ? -1.011  15.478  58.524  1.00 46.50  ? 116 ILE A CA  1 
ATOM   874   C C   . ILE A 1 116 ? -1.196  15.648  57.023  1.00 27.03  ? 116 ILE A C   1 
ATOM   875   O O   . ILE A 1 116 ? -0.383  16.286  56.351  1.00 50.44  ? 116 ILE A O   1 
ATOM   876   C CB  . ILE A 1 116 ? -0.403  14.087  58.790  1.00 39.55  ? 116 ILE A CB  1 
ATOM   877   C CG1 . ILE A 1 116 ? -0.272  13.858  60.297  1.00 42.14  ? 116 ILE A CG1 1 
ATOM   878   C CG2 . ILE A 1 116 ? 0.953   13.980  58.116  1.00 33.68  ? 116 ILE A CG2 1 
ATOM   879   C CD1 . ILE A 1 116 ? 0.386   12.540  60.680  1.00 35.90  ? 116 ILE A CD1 1 
ATOM   880   N N   . ALA A 1 117 ? -2.270  15.073  56.493  1.00 55.93  ? 117 ALA A N   1 
ATOM   881   C CA  . ALA A 1 117 ? -2.543  15.162  55.063  1.00 43.28  ? 117 ALA A CA  1 
ATOM   882   C C   . ALA A 1 117 ? -2.724  16.610  54.607  1.00 59.13  ? 117 ALA A C   1 
ATOM   883   O O   . ALA A 1 117 ? -2.188  17.001  53.571  1.00 55.95  ? 117 ALA A O   1 
ATOM   884   C CB  . ALA A 1 117 ? -3.778  14.329  54.712  1.00 44.81  ? 117 ALA A CB  1 
ATOM   885   N N   . GLN A 1 118 ? -3.458  17.404  55.387  1.00 46.42  ? 118 GLN A N   1 
ATOM   886   C CA  . GLN A 1 118 ? -3.711  18.814  55.060  1.00 49.39  ? 118 GLN A CA  1 
ATOM   887   C C   . GLN A 1 118 ? -2.473  19.687  54.951  1.00 54.71  ? 118 GLN A C   1 
ATOM   888   O O   . GLN A 1 118 ? -2.475  20.701  54.235  1.00 58.84  ? 118 GLN A O   1 
ATOM   889   C CB  . GLN A 1 118 ? -4.658  19.442  56.088  1.00 44.11  ? 118 GLN A CB  1 
ATOM   890   C CG  . GLN A 1 118 ? -6.120  19.369  55.685  1.00 77.95  ? 118 GLN A CG  1 
ATOM   891   C CD  . GLN A 1 118 ? -7.069  19.519  56.854  1.00 72.18  ? 118 GLN A CD  1 
ATOM   892   O OE1 . GLN A 1 118 ? -8.279  19.668  56.665  1.00 78.17  ? 118 GLN A OE1 1 
ATOM   893   N NE2 . GLN A 1 118 ? -6.532  19.466  58.074  1.00 78.43  ? 118 GLN A NE2 1 
ATOM   894   N N   . THR A 1 119 ? -1.420  19.310  55.664  1.00 52.37  ? 119 THR A N   1 
ATOM   895   C CA  . THR A 1 119 ? -0.187  20.087  55.633  1.00 51.41  ? 119 THR A CA  1 
ATOM   896   C C   . THR A 1 119 ? 0.849   19.466  54.703  1.00 54.77  ? 119 THR A C   1 
ATOM   897   O O   . THR A 1 119 ? 1.423   20.148  53.852  1.00 59.81  ? 119 THR A O   1 
ATOM   898   C CB  . THR A 1 119 ? 0.433   20.192  57.039  1.00 55.74  ? 119 THR A CB  1 
ATOM   899   O OG1 . THR A 1 119 ? -0.525  20.753  57.948  1.00 51.08  ? 119 THR A OG1 1 
ATOM   900   C CG2 . THR A 1 119 ? 1.682   21.051  57.006  1.00 39.72  ? 119 THR A CG2 1 
ATOM   901   N N   . PHE A 1 120 ? 1.079   18.165  54.853  1.00 52.55  ? 120 PHE A N   1 
ATOM   902   C CA  . PHE A 1 120 ? 2.078   17.485  54.039  1.00 46.26  ? 120 PHE A CA  1 
ATOM   903   C C   . PHE A 1 120 ? 1.546   16.687  52.860  1.00 55.36  ? 120 PHE A C   1 
ATOM   904   O O   . PHE A 1 120 ? 2.313   16.321  51.965  1.00 45.13  ? 120 PHE A O   1 
ATOM   905   C CB  . PHE A 1 120 ? 2.913   16.595  54.946  1.00 42.74  ? 120 PHE A CB  1 
ATOM   906   C CG  . PHE A 1 120 ? 3.619   17.355  56.021  1.00 44.04  ? 120 PHE A CG  1 
ATOM   907   C CD1 . PHE A 1 120 ? 4.766   18.086  55.733  1.00 44.90  ? 120 PHE A CD1 1 
ATOM   908   C CD2 . PHE A 1 120 ? 3.114   17.385  57.312  1.00 43.50  ? 120 PHE A CD2 1 
ATOM   909   C CE1 . PHE A 1 120 ? 5.397   18.834  56.714  1.00 38.57  ? 120 PHE A CE1 1 
ATOM   910   C CE2 . PHE A 1 120 ? 3.747   18.138  58.303  1.00 53.32  ? 120 PHE A CE2 1 
ATOM   911   C CZ  . PHE A 1 120 ? 4.888   18.861  57.998  1.00 30.20  ? 120 PHE A CZ  1 
ATOM   912   N N   . GLY A 1 121 ? 0.240   16.420  52.865  1.00 58.23  ? 121 GLY A N   1 
ATOM   913   C CA  . GLY A 1 121 ? -0.379  15.668  51.787  1.00 37.53  ? 121 GLY A CA  1 
ATOM   914   C C   . GLY A 1 121 ? -0.508  14.186  52.078  1.00 58.10  ? 121 GLY A C   1 
ATOM   915   O O   . GLY A 1 121 ? 0.393   13.593  52.696  1.00 57.82  ? 121 GLY A O   1 
ATOM   916   N N   . SER A 1 122 ? -1.625  13.592  51.643  1.00 37.55  ? 122 SER A N   1 
ATOM   917   C CA  . SER A 1 122 ? -1.889  12.166  51.837  1.00 41.89  ? 122 SER A CA  1 
ATOM   918   C C   . SER A 1 122 ? -0.645  11.330  51.585  1.00 41.24  ? 122 SER A C   1 
ATOM   919   O O   . SER A 1 122 ? -0.374  10.379  52.299  1.00 49.64  ? 122 SER A O   1 
ATOM   920   C CB  . SER A 1 122 ? -3.002  11.701  50.901  1.00 46.38  ? 122 SER A CB  1 
ATOM   921   O OG  . SER A 1 122 ? -4.254  12.204  51.315  1.00 53.29  ? 122 SER A OG  1 
ATOM   922   N N   . GLN A 1 123 ? 0.107   11.701  50.559  1.00 44.31  ? 123 GLN A N   1 
ATOM   923   C CA  . GLN A 1 123 ? 1.338   11.012  50.193  1.00 53.02  ? 123 GLN A CA  1 
ATOM   924   C C   . GLN A 1 123 ? 2.304   10.809  51.352  1.00 57.36  ? 123 GLN A C   1 
ATOM   925   O O   . GLN A 1 123 ? 3.253   10.028  51.248  1.00 57.61  ? 123 GLN A O   1 
ATOM   926   C CB  . GLN A 1 123 ? 2.068   11.802  49.115  1.00 39.04  ? 123 GLN A CB  1 
ATOM   927   C CG  . GLN A 1 123 ? 2.093   13.285  49.410  1.00 65.83  ? 123 GLN A CG  1 
ATOM   928   C CD  . GLN A 1 123 ? 0.968   14.043  48.694  1.00 72.98  ? 123 GLN A CD  1 
ATOM   929   O OE1 . GLN A 1 123 ? 1.205   14.706  47.688  1.00 62.99  ? 123 GLN A OE1 1 
ATOM   930   N NE2 . GLN A 1 123 ? -0.253  13.929  49.202  1.00 50.59  ? 123 GLN A NE2 1 
ATOM   931   N N   . ALA A 1 124 ? 2.078   11.508  52.454  1.00 54.03  ? 124 ALA A N   1 
ATOM   932   C CA  . ALA A 1 124 ? 2.988   11.400  53.576  1.00 53.93  ? 124 ALA A CA  1 
ATOM   933   C C   . ALA A 1 124 ? 2.402   10.647  54.743  1.00 41.59  ? 124 ALA A C   1 
ATOM   934   O O   . ALA A 1 124 ? 3.053   10.483  55.763  1.00 44.75  ? 124 ALA A O   1 
ATOM   935   C CB  . ALA A 1 124 ? 3.427   12.796  54.012  1.00 58.12  ? 124 ALA A CB  1 
ATOM   936   N N   . VAL A 1 125 ? 1.182   10.165  54.592  1.00 40.69  ? 125 VAL A N   1 
ATOM   937   C CA  . VAL A 1 125 ? 0.551   9.455   55.683  1.00 51.68  ? 125 VAL A CA  1 
ATOM   938   C C   . VAL A 1 125 ? 0.313   7.977   55.456  1.00 49.11  ? 125 VAL A C   1 
ATOM   939   O O   . VAL A 1 125 ? -0.430  7.584   54.573  1.00 51.68  ? 125 VAL A O   1 
ATOM   940   C CB  . VAL A 1 125 ? -0.802  10.092  56.053  1.00 46.78  ? 125 VAL A CB  1 
ATOM   941   C CG1 . VAL A 1 125 ? -1.517  9.243   57.098  1.00 39.90  ? 125 VAL A CG1 1 
ATOM   942   C CG2 . VAL A 1 125 ? -0.581  11.484  56.583  1.00 59.67  ? 125 VAL A CG2 1 
ATOM   943   N N   . VAL A 1 126 ? 0.951   7.158   56.273  1.00 45.79  ? 126 VAL A N   1 
ATOM   944   C CA  . VAL A 1 126 ? 0.742   5.738   56.187  1.00 28.67  ? 126 VAL A CA  1 
ATOM   945   C C   . VAL A 1 126 ? 0.024   5.392   57.462  1.00 34.72  ? 126 VAL A C   1 
ATOM   946   O O   . VAL A 1 126 ? 0.444   5.800   58.526  1.00 55.89  ? 126 VAL A O   1 
ATOM   947   C CB  . VAL A 1 126 ? 2.047   4.959   56.156  1.00 32.57  ? 126 VAL A CB  1 
ATOM   948   C CG1 . VAL A 1 126 ? 1.756   3.478   56.260  1.00 27.80  ? 126 VAL A CG1 1 
ATOM   949   C CG2 . VAL A 1 126 ? 2.796   5.264   54.877  1.00 33.13  ? 126 VAL A CG2 1 
ATOM   950   N N   . VAL A 1 127 ? -1.093  4.695   57.363  1.00 34.95  ? 127 VAL A N   1 
ATOM   951   C CA  . VAL A 1 127 ? -1.779  4.279   58.565  1.00 33.57  ? 127 VAL A CA  1 
ATOM   952   C C   . VAL A 1 127 ? -1.508  2.794   58.663  1.00 40.14  ? 127 VAL A C   1 
ATOM   953   O O   . VAL A 1 127 ? -1.817  2.044   57.748  1.00 37.53  ? 127 VAL A O   1 
ATOM   954   C CB  . VAL A 1 127 ? -3.298  4.506   58.499  1.00 30.40  ? 127 VAL A CB  1 
ATOM   955   C CG1 . VAL A 1 127 ? -3.971  3.840   59.678  1.00 24.08  ? 127 VAL A CG1 1 
ATOM   956   C CG2 . VAL A 1 127 ? -3.595  5.980   58.515  1.00 36.67  ? 127 VAL A CG2 1 
ATOM   957   N N   . ALA A 1 128 ? -0.889  2.383   59.759  1.00 36.79  ? 128 ALA A N   1 
ATOM   958   C CA  . ALA A 1 128 ? -0.601  0.984   59.981  1.00 39.92  ? 128 ALA A CA  1 
ATOM   959   C C   . ALA A 1 128 ? -1.824  0.428   60.678  1.00 45.62  ? 128 ALA A C   1 
ATOM   960   O O   . ALA A 1 128 ? -2.280  0.984   61.668  1.00 49.48  ? 128 ALA A O   1 
ATOM   961   C CB  . ALA A 1 128 ? 0.616   0.830   60.857  1.00 36.31  ? 128 ALA A CB  1 
ATOM   962   N N   . ILE A 1 129 ? -2.368  -0.657  60.144  1.00 47.80  ? 129 ILE A N   1 
ATOM   963   C CA  . ILE A 1 129 ? -3.543  -1.278  60.724  1.00 35.62  ? 129 ILE A CA  1 
ATOM   964   C C   . ILE A 1 129 ? -3.183  -2.691  61.143  1.00 42.43  ? 129 ILE A C   1 
ATOM   965   O O   . ILE A 1 129 ? -2.820  -3.512  60.307  1.00 56.22  ? 129 ILE A O   1 
ATOM   966   C CB  . ILE A 1 129 ? -4.704  -1.335  59.711  1.00 47.16  ? 129 ILE A CB  1 
ATOM   967   C CG1 . ILE A 1 129 ? -5.060  0.082   59.243  1.00 40.02  ? 129 ILE A CG1 1 
ATOM   968   C CG2 . ILE A 1 129 ? -5.900  -2.029  60.343  1.00 32.10  ? 129 ILE A CG2 1 
ATOM   969   C CD1 . ILE A 1 129 ? -6.164  0.138   58.197  1.00 44.65  ? 129 ILE A CD1 1 
ATOM   970   N N   . ASP A 1 130 ? -3.262  -2.961  62.440  1.00 36.96  ? 130 ASP A N   1 
ATOM   971   C CA  . ASP A 1 130 ? -2.951  -4.278  62.965  1.00 35.35  ? 130 ASP A CA  1 
ATOM   972   C C   . ASP A 1 130 ? -4.286  -4.977  63.207  1.00 42.54  ? 130 ASP A C   1 
ATOM   973   O O   . ASP A 1 130 ? -5.106  -4.520  64.009  1.00 44.14  ? 130 ASP A O   1 
ATOM   974   C CB  . ASP A 1 130 ? -2.135  -4.166  64.267  1.00 42.09  ? 130 ASP A CB  1 
ATOM   975   C CG  . ASP A 1 130 ? -0.778  -3.476  64.058  1.00 58.55  ? 130 ASP A CG  1 
ATOM   976   O OD1 . ASP A 1 130 ? -0.034  -3.882  63.138  1.00 43.59  ? 130 ASP A OD1 1 
ATOM   977   O OD2 . ASP A 1 130 ? -0.447  -2.528  64.817  1.00 65.19  ? 130 ASP A OD2 1 
ATOM   978   N N   . ALA A 1 131 ? -4.509  -6.079  62.499  1.00 40.67  ? 131 ALA A N   1 
ATOM   979   C CA  . ALA A 1 131 ? -5.763  -6.805  62.616  1.00 31.69  ? 131 ALA A CA  1 
ATOM   980   C C   . ALA A 1 131 ? -5.630  -8.303  62.896  1.00 39.81  ? 131 ALA A C   1 
ATOM   981   O O   . ALA A 1 131 ? -4.606  -8.925  62.600  1.00 35.32  ? 131 ALA A O   1 
ATOM   982   C CB  . ALA A 1 131 ? -6.579  -6.582  61.360  1.00 47.15  ? 131 ALA A CB  1 
ATOM   983   N N   . LYS A 1 132 ? -6.702  -8.864  63.454  1.00 34.28  ? 132 LYS A N   1 
ATOM   984   C CA  . LYS A 1 132 ? -6.783  -10.272 63.817  1.00 30.95  ? 132 LYS A CA  1 
ATOM   985   C C   . LYS A 1 132 ? -8.239  -10.753 63.813  1.00 39.68  ? 132 LYS A C   1 
ATOM   986   O O   . LYS A 1 132 ? -9.163  -9.956  63.954  1.00 44.51  ? 132 LYS A O   1 
ATOM   987   C CB  . LYS A 1 132 ? -6.177  -10.474 65.211  1.00 26.03  ? 132 LYS A CB  1 
ATOM   988   C CG  . LYS A 1 132 ? -6.925  -11.481 66.083  1.00 57.81  ? 132 LYS A CG  1 
ATOM   989   C CD  . LYS A 1 132 ? -6.638  -11.279 67.575  1.00 53.79  ? 132 LYS A CD  1 
ATOM   990   C CE  . LYS A 1 132 ? -5.282  -11.825 67.971  1.00 53.71  ? 132 LYS A CE  1 
ATOM   991   N NZ  . LYS A 1 132 ? -5.023  -11.634 69.432  1.00 62.21  ? 132 LYS A NZ  1 
ATOM   992   N N   . ARG A 1 133 ? -8.440  -12.059 63.662  1.00 42.00  ? 133 ARG A N   1 
ATOM   993   C CA  . ARG A 1 133 ? -9.789  -12.631 63.660  1.00 47.30  ? 133 ARG A CA  1 
ATOM   994   C C   . ARG A 1 133 ? -10.253 -12.813 65.102  1.00 54.81  ? 133 ARG A C   1 
ATOM   995   O O   . ARG A 1 133 ? -9.503  -13.300 65.956  1.00 56.53  ? 133 ARG A O   1 
ATOM   996   C CB  . ARG A 1 133 ? -9.808  -14.004 62.973  1.00 37.19  ? 133 ARG A CB  1 
ATOM   997   C CG  . ARG A 1 133 ? -9.292  -14.033 61.547  1.00 55.84  ? 133 ARG A CG  1 
ATOM   998   C CD  . ARG A 1 133 ? -8.932  -15.465 61.140  1.00 35.74  ? 133 ARG A CD  1 
ATOM   999   N NE  . ARG A 1 133 ? -8.498  -15.581 59.746  1.00 51.39  ? 133 ARG A NE  1 
ATOM   1000  C CZ  . ARG A 1 133 ? -7.381  -15.058 59.239  1.00 49.65  ? 133 ARG A CZ  1 
ATOM   1001  N NH1 . ARG A 1 133 ? -6.539  -14.363 60.002  1.00 33.26  ? 133 ARG A NH1 1 
ATOM   1002  N NH2 . ARG A 1 133 ? -7.106  -15.233 57.955  1.00 38.35  ? 133 ARG A NH2 1 
ATOM   1003  N N   . VAL A 1 134 ? -11.487 -12.414 65.378  1.00 50.07  ? 134 VAL A N   1 
ATOM   1004  C CA  . VAL A 1 134 ? -12.038 -12.572 66.714  1.00 49.33  ? 134 VAL A CA  1 
ATOM   1005  C C   . VAL A 1 134 ? -13.510 -12.897 66.590  1.00 51.81  ? 134 VAL A C   1 
ATOM   1006  O O   . VAL A 1 134 ? -14.311 -12.048 66.197  1.00 56.49  ? 134 VAL A O   1 
ATOM   1007  C CB  . VAL A 1 134 ? -11.874 -11.301 67.569  1.00 49.68  ? 134 VAL A CB  1 
ATOM   1008  C CG1 . VAL A 1 134 ? -12.413 -11.559 68.974  1.00 43.50  ? 134 VAL A CG1 1 
ATOM   1009  C CG2 . VAL A 1 134 ? -10.411 -10.886 67.608  1.00 35.55  ? 134 VAL A CG2 1 
ATOM   1010  N N   . ASP A 1 135 ? -13.854 -14.130 66.942  1.00 51.19  ? 135 ASP A N   1 
ATOM   1011  C CA  . ASP A 1 135 ? -15.221 -14.605 66.849  1.00 53.23  ? 135 ASP A CA  1 
ATOM   1012  C C   . ASP A 1 135 ? -15.725 -14.455 65.427  1.00 52.31  ? 135 ASP A C   1 
ATOM   1013  O O   . ASP A 1 135 ? -16.815 -13.945 65.219  1.00 63.79  ? 135 ASP A O   1 
ATOM   1014  C CB  . ASP A 1 135 ? -16.149 -13.817 67.776  1.00 71.31  ? 135 ASP A CB  1 
ATOM   1015  C CG  . ASP A 1 135 ? -15.847 -14.043 69.238  1.00 87.10  ? 135 ASP A CG  1 
ATOM   1016  O OD1 . ASP A 1 135 ? -15.452 -15.181 69.581  1.00 103.15 ? 135 ASP A OD1 1 
ATOM   1017  O OD2 . ASP A 1 135 ? -16.027 -13.087 70.040  1.00 72.55  ? 135 ASP A OD2 1 
ATOM   1018  N N   . GLY A 1 136 ? -14.930 -14.870 64.447  1.00 66.14  ? 136 GLY A N   1 
ATOM   1019  C CA  . GLY A 1 136 ? -15.372 -14.771 63.064  1.00 60.65  ? 136 GLY A CA  1 
ATOM   1020  C C   . GLY A 1 136 ? -15.295 -13.417 62.364  1.00 58.83  ? 136 GLY A C   1 
ATOM   1021  O O   . GLY A 1 136 ? -15.552 -13.345 61.159  1.00 49.56  ? 136 GLY A O   1 
ATOM   1022  N N   . GLU A 1 137 ? -14.969 -12.344 63.089  1.00 49.54  ? 137 GLU A N   1 
ATOM   1023  C CA  . GLU A 1 137 ? -14.855 -11.019 62.461  1.00 51.80  ? 137 GLU A CA  1 
ATOM   1024  C C   . GLU A 1 137 ? -13.411 -10.527 62.497  1.00 50.44  ? 137 GLU A C   1 
ATOM   1025  O O   . GLU A 1 137 ? -12.625 -10.961 63.336  1.00 50.10  ? 137 GLU A O   1 
ATOM   1026  C CB  . GLU A 1 137 ? -15.739 -9.977  63.169  1.00 49.80  ? 137 GLU A CB  1 
ATOM   1027  C CG  . GLU A 1 137 ? -17.253 -10.167 63.023  1.00 70.28  ? 137 GLU A CG  1 
ATOM   1028  C CD  . GLU A 1 137 ? -17.735 -10.081 61.583  1.00 57.46  ? 137 GLU A CD  1 
ATOM   1029  O OE1 . GLU A 1 137 ? -17.613 -8.997  60.963  1.00 73.44  ? 137 GLU A OE1 1 
ATOM   1030  O OE2 . GLU A 1 137 ? -18.232 -11.107 61.064  1.00 84.09  ? 137 GLU A OE2 1 
ATOM   1031  N N   . PHE A 1 138 ? -13.063 -9.635  61.574  1.00 56.87  ? 138 PHE A N   1 
ATOM   1032  C CA  . PHE A 1 138 ? -11.719 -9.056  61.530  1.00 55.35  ? 138 PHE A CA  1 
ATOM   1033  C C   . PHE A 1 138 ? -11.722 -7.796  62.403  1.00 58.45  ? 138 PHE A C   1 
ATOM   1034  O O   . PHE A 1 138 ? -12.340 -6.789  62.047  1.00 48.42  ? 138 PHE A O   1 
ATOM   1035  C CB  . PHE A 1 138 ? -11.325 -8.695  60.091  1.00 43.57  ? 138 PHE A CB  1 
ATOM   1036  C CG  . PHE A 1 138 ? -10.779 -9.852  59.299  1.00 60.40  ? 138 PHE A CG  1 
ATOM   1037  C CD1 . PHE A 1 138 ? -9.625  -10.518 59.715  1.00 27.96  ? 138 PHE A CD1 1 
ATOM   1038  C CD2 . PHE A 1 138 ? -11.401 -10.268 58.119  1.00 44.27  ? 138 PHE A CD2 1 
ATOM   1039  C CE1 . PHE A 1 138 ? -9.096  -11.576 58.971  1.00 36.76  ? 138 PHE A CE1 1 
ATOM   1040  C CE2 . PHE A 1 138 ? -10.876 -11.330 57.366  1.00 46.95  ? 138 PHE A CE2 1 
ATOM   1041  C CZ  . PHE A 1 138 ? -9.723  -11.983 57.792  1.00 40.94  ? 138 PHE A CZ  1 
ATOM   1042  N N   . MET A 1 139 ? -11.030 -7.868  63.540  1.00 36.24  ? 139 MET A N   1 
ATOM   1043  C CA  . MET A 1 139 ? -10.954 -6.760  64.490  1.00 47.01  ? 139 MET A CA  1 
ATOM   1044  C C   . MET A 1 139 ? -9.633  -6.007  64.469  1.00 47.35  ? 139 MET A C   1 
ATOM   1045  O O   . MET A 1 139 ? -8.577  -6.590  64.228  1.00 50.95  ? 139 MET A O   1 
ATOM   1046  C CB  . MET A 1 139 ? -11.203 -7.277  65.907  1.00 43.84  ? 139 MET A CB  1 
ATOM   1047  C CG  . MET A 1 139 ? -12.491 -8.071  66.047  1.00 46.21  ? 139 MET A CG  1 
ATOM   1048  S SD  . MET A 1 139 ? -13.922 -7.163  65.444  1.00 63.03  ? 139 MET A SD  1 
ATOM   1049  C CE  . MET A 1 139 ? -14.325 -6.170  66.906  1.00 51.67  ? 139 MET A CE  1 
ATOM   1050  N N   . VAL A 1 140 ? -9.715  -4.707  64.733  1.00 46.17  ? 140 VAL A N   1 
ATOM   1051  C CA  . VAL A 1 140 ? -8.561  -3.819  64.777  1.00 40.02  ? 140 VAL A CA  1 
ATOM   1052  C C   . VAL A 1 140 ? -7.981  -3.832  66.190  1.00 42.35  ? 140 VAL A C   1 
ATOM   1053  O O   . VAL A 1 140 ? -8.730  -3.845  67.165  1.00 49.18  ? 140 VAL A O   1 
ATOM   1054  C CB  . VAL A 1 140 ? -8.965  -2.373  64.439  1.00 42.15  ? 140 VAL A CB  1 
ATOM   1055  C CG1 . VAL A 1 140 ? -7.792  -1.454  64.628  1.00 38.68  ? 140 VAL A CG1 1 
ATOM   1056  C CG2 . VAL A 1 140 ? -9.488  -2.294  63.017  1.00 36.08  ? 140 VAL A CG2 1 
ATOM   1057  N N   . PHE A 1 141 ? -6.656  -3.830  66.296  1.00 42.10  ? 141 PHE A N   1 
ATOM   1058  C CA  . PHE A 1 141 ? -5.986  -3.842  67.588  1.00 37.02  ? 141 PHE A CA  1 
ATOM   1059  C C   . PHE A 1 141 ? -4.942  -2.737  67.678  1.00 41.77  ? 141 PHE A C   1 
ATOM   1060  O O   . PHE A 1 141 ? -4.233  -2.451  66.720  1.00 41.67  ? 141 PHE A O   1 
ATOM   1061  C CB  . PHE A 1 141 ? -5.309  -5.196  67.845  1.00 40.23  ? 141 PHE A CB  1 
ATOM   1062  C CG  . PHE A 1 141 ? -6.262  -6.311  68.221  1.00 39.43  ? 141 PHE A CG  1 
ATOM   1063  C CD1 . PHE A 1 141 ? -7.185  -6.804  67.309  1.00 42.30  ? 141 PHE A CD1 1 
ATOM   1064  C CD2 . PHE A 1 141 ? -6.220  -6.877  69.488  1.00 30.47  ? 141 PHE A CD2 1 
ATOM   1065  C CE1 . PHE A 1 141 ? -8.046  -7.840  67.657  1.00 45.25  ? 141 PHE A CE1 1 
ATOM   1066  C CE2 . PHE A 1 141 ? -7.085  -7.920  69.845  1.00 34.60  ? 141 PHE A CE2 1 
ATOM   1067  C CZ  . PHE A 1 141 ? -7.991  -8.397  68.934  1.00 36.06  ? 141 PHE A CZ  1 
ATOM   1068  N N   . THR A 1 142 ? -4.847  -2.125  68.851  1.00 39.44  ? 142 THR A N   1 
ATOM   1069  C CA  . THR A 1 142 ? -3.898  -1.048  69.078  1.00 40.41  ? 142 THR A CA  1 
ATOM   1070  C C   . THR A 1 142 ? -2.975  -1.472  70.191  1.00 37.04  ? 142 THR A C   1 
ATOM   1071  O O   . THR A 1 142 ? -3.095  -2.589  70.685  1.00 39.38  ? 142 THR A O   1 
ATOM   1072  C CB  . THR A 1 142 ? -4.612  0.230   69.494  1.00 55.05  ? 142 THR A CB  1 
ATOM   1073  O OG1 . THR A 1 142 ? -5.348  -0.021  70.694  1.00 52.12  ? 142 THR A OG1 1 
ATOM   1074  C CG2 . THR A 1 142 ? -5.566  0.688   68.397  1.00 42.89  ? 142 THR A CG2 1 
ATOM   1075  N N   . TYR A 1 143 ? -2.068  -0.578  70.579  1.00 35.80  ? 143 TYR A N   1 
ATOM   1076  C CA  . TYR A 1 143 ? -1.093  -0.851  71.624  1.00 33.99  ? 143 TYR A CA  1 
ATOM   1077  C C   . TYR A 1 143 ? -0.345  -2.119  71.283  1.00 39.61  ? 143 TYR A C   1 
ATOM   1078  O O   . TYR A 1 143 ? -0.338  -3.082  72.047  1.00 52.43  ? 143 TYR A O   1 
ATOM   1079  C CB  . TYR A 1 143 ? -1.786  -0.977  72.975  1.00 35.47  ? 143 TYR A CB  1 
ATOM   1080  C CG  . TYR A 1 143 ? -2.351  0.337   73.415  1.00 41.22  ? 143 TYR A CG  1 
ATOM   1081  C CD1 . TYR A 1 143 ? -1.552  1.273   74.065  1.00 38.44  ? 143 TYR A CD1 1 
ATOM   1082  C CD2 . TYR A 1 143 ? -3.648  0.702   73.069  1.00 41.04  ? 143 TYR A CD2 1 
ATOM   1083  C CE1 . TYR A 1 143 ? -2.022  2.541   74.347  1.00 43.46  ? 143 TYR A CE1 1 
ATOM   1084  C CE2 . TYR A 1 143 ? -4.129  1.972   73.345  1.00 51.57  ? 143 TYR A CE2 1 
ATOM   1085  C CZ  . TYR A 1 143 ? -3.306  2.888   73.979  1.00 39.36  ? 143 TYR A CZ  1 
ATOM   1086  O OH  . TYR A 1 143 ? -3.754  4.159   74.195  1.00 45.41  ? 143 TYR A OH  1 
ATOM   1087  N N   . SER A 1 144 ? 0.276   -2.099  70.112  1.00 37.86  ? 144 SER A N   1 
ATOM   1088  C CA  . SER A 1 144 ? 1.036   -3.224  69.614  1.00 47.40  ? 144 SER A CA  1 
ATOM   1089  C C   . SER A 1 144 ? 0.264   -4.536  69.701  1.00 40.23  ? 144 SER A C   1 
ATOM   1090  O O   . SER A 1 144 ? 0.776   -5.540  70.179  1.00 48.28  ? 144 SER A O   1 
ATOM   1091  C CB  . SER A 1 144 ? 2.364   -3.316  70.367  1.00 54.03  ? 144 SER A CB  1 
ATOM   1092  O OG  . SER A 1 144 ? 3.207   -2.226  70.017  1.00 45.12  ? 144 SER A OG  1 
ATOM   1093  N N   . GLY A 1 145 ? -0.982  -4.507  69.243  1.00 48.63  ? 145 GLY A N   1 
ATOM   1094  C CA  . GLY A 1 145 ? -1.815  -5.699  69.238  1.00 46.88  ? 145 GLY A CA  1 
ATOM   1095  C C   . GLY A 1 145 ? -2.333  -6.210  70.568  1.00 52.25  ? 145 GLY A C   1 
ATOM   1096  O O   . GLY A 1 145 ? -2.819  -7.340  70.651  1.00 54.85  ? 145 GLY A O   1 
ATOM   1097  N N   . LYS A 1 146 ? -2.261  -5.382  71.606  1.00 55.12  ? 146 LYS A N   1 
ATOM   1098  C CA  . LYS A 1 146 ? -2.710  -5.804  72.926  1.00 54.05  ? 146 LYS A CA  1 
ATOM   1099  C C   . LYS A 1 146 ? -4.073  -5.304  73.368  1.00 48.06  ? 146 LYS A C   1 
ATOM   1100  O O   . LYS A 1 146 ? -4.507  -5.587  74.478  1.00 46.86  ? 146 LYS A O   1 
ATOM   1101  C CB  . LYS A 1 146 ? -1.655  -5.436  73.965  1.00 55.50  ? 146 LYS A CB  1 
ATOM   1102  C CG  . LYS A 1 146 ? -0.381  -6.252  73.824  1.00 40.11  ? 146 LYS A CG  1 
ATOM   1103  C CD  . LYS A 1 146 ? 0.689   -5.722  74.734  1.00 72.06  ? 146 LYS A CD  1 
ATOM   1104  C CE  . LYS A 1 146 ? 1.991   -6.495  74.597  1.00 55.50  ? 146 LYS A CE  1 
ATOM   1105  N NZ  . LYS A 1 146 ? 3.071   -5.743  75.306  1.00 75.93  ? 146 LYS A NZ  1 
ATOM   1106  N N   . LYS A 1 147 ? -4.753  -4.562  72.506  1.00 49.16  ? 147 LYS A N   1 
ATOM   1107  C CA  . LYS A 1 147 ? -6.074  -4.076  72.844  1.00 33.28  ? 147 LYS A CA  1 
ATOM   1108  C C   . LYS A 1 147 ? -7.006  -4.220  71.657  1.00 42.97  ? 147 LYS A C   1 
ATOM   1109  O O   . LYS A 1 147 ? -6.683  -3.817  70.544  1.00 54.21  ? 147 LYS A O   1 
ATOM   1110  C CB  . LYS A 1 147 ? -6.017  -2.614  73.279  1.00 46.89  ? 147 LYS A CB  1 
ATOM   1111  C CG  . LYS A 1 147 ? -7.381  -2.006  73.589  1.00 41.15  ? 147 LYS A CG  1 
ATOM   1112  C CD  . LYS A 1 147 ? -7.287  -0.500  73.781  1.00 61.40  ? 147 LYS A CD  1 
ATOM   1113  C CE  . LYS A 1 147 ? -8.656  0.158   73.827  1.00 49.08  ? 147 LYS A CE  1 
ATOM   1114  N NZ  . LYS A 1 147 ? -8.552  1.623   74.121  1.00 47.69  ? 147 LYS A NZ  1 
ATOM   1115  N N   . ASN A 1 148 ? -8.161  -4.820  71.896  1.00 43.30  ? 148 ASN A N   1 
ATOM   1116  C CA  . ASN A 1 148 ? -9.152  -4.968  70.852  1.00 53.10  ? 148 ASN A CA  1 
ATOM   1117  C C   . ASN A 1 148 ? -9.974  -3.678  70.915  1.00 45.80  ? 148 ASN A C   1 
ATOM   1118  O O   . ASN A 1 148 ? -10.662 -3.418  71.900  1.00 51.02  ? 148 ASN A O   1 
ATOM   1119  C CB  . ASN A 1 148 ? -10.025 -6.197  71.128  1.00 41.30  ? 148 ASN A CB  1 
ATOM   1120  C CG  . ASN A 1 148 ? -11.101 -6.412  70.070  1.00 51.52  ? 148 ASN A CG  1 
ATOM   1121  O OD1 . ASN A 1 148 ? -11.796 -7.427  70.082  1.00 53.86  ? 148 ASN A OD1 1 
ATOM   1122  N ND2 . ASN A 1 148 ? -11.248 -5.458  69.160  1.00 44.01  ? 148 ASN A ND2 1 
ATOM   1123  N N   . THR A 1 149 ? -9.870  -2.867  69.870  1.00 39.45  ? 149 THR A N   1 
ATOM   1124  C CA  . THR A 1 149 ? -10.582 -1.599  69.786  1.00 38.43  ? 149 THR A CA  1 
ATOM   1125  C C   . THR A 1 149 ? -12.077 -1.767  69.559  1.00 39.09  ? 149 THR A C   1 
ATOM   1126  O O   . THR A 1 149 ? -12.836 -0.826  69.746  1.00 50.78  ? 149 THR A O   1 
ATOM   1127  C CB  . THR A 1 149 ? -10.045 -0.729  68.635  1.00 43.58  ? 149 THR A CB  1 
ATOM   1128  O OG1 . THR A 1 149 ? -10.244 -1.411  67.390  1.00 52.58  ? 149 THR A OG1 1 
ATOM   1129  C CG2 . THR A 1 149 ? -8.572  -0.442  68.822  1.00 41.46  ? 149 THR A CG2 1 
ATOM   1130  N N   . GLY A 1 150 ? -12.499 -2.956  69.141  1.00 56.48  ? 150 GLY A N   1 
ATOM   1131  C CA  . GLY A 1 150 ? -13.914 -3.186  68.896  1.00 51.22  ? 150 GLY A CA  1 
ATOM   1132  C C   . GLY A 1 150 ? -14.398 -2.651  67.550  1.00 65.04  ? 150 GLY A C   1 
ATOM   1133  O O   . GLY A 1 150 ? -15.572 -2.806  67.190  1.00 54.20  ? 150 GLY A O   1 
ATOM   1134  N N   . ILE A 1 151 ? -13.494 -2.003  66.818  1.00 53.90  ? 151 ILE A N   1 
ATOM   1135  C CA  . ILE A 1 151 ? -13.794 -1.454  65.506  1.00 47.02  ? 151 ILE A CA  1 
ATOM   1136  C C   . ILE A 1 151 ? -13.520 -2.571  64.501  1.00 60.58  ? 151 ILE A C   1 
ATOM   1137  O O   . ILE A 1 151 ? -12.510 -3.268  64.602  1.00 53.60  ? 151 ILE A O   1 
ATOM   1138  C CB  . ILE A 1 151 ? -12.861 -0.262  65.157  1.00 50.49  ? 151 ILE A CB  1 
ATOM   1139  C CG1 . ILE A 1 151 ? -12.953 0.831   66.220  1.00 44.83  ? 151 ILE A CG1 1 
ATOM   1140  C CG2 . ILE A 1 151 ? -13.241 0.319   63.813  1.00 44.00  ? 151 ILE A CG2 1 
ATOM   1141  C CD1 . ILE A 1 151 ? -12.072 2.032   65.927  1.00 40.84  ? 151 ILE A CD1 1 
ATOM   1142  N N   . LEU A 1 152 ? -14.416 -2.747  63.540  1.00 59.57  ? 152 LEU A N   1 
ATOM   1143  C CA  . LEU A 1 152 ? -14.233 -3.770  62.519  1.00 47.24  ? 152 LEU A CA  1 
ATOM   1144  C C   . LEU A 1 152 ? -13.238 -3.286  61.485  1.00 50.86  ? 152 LEU A C   1 
ATOM   1145  O O   . LEU A 1 152 ? -13.140 -2.090  61.223  1.00 45.86  ? 152 LEU A O   1 
ATOM   1146  C CB  . LEU A 1 152 ? -15.553 -4.069  61.823  1.00 32.70  ? 152 LEU A CB  1 
ATOM   1147  C CG  . LEU A 1 152 ? -16.609 -4.714  62.701  1.00 55.08  ? 152 LEU A CG  1 
ATOM   1148  C CD1 . LEU A 1 152 ? -17.940 -4.767  61.956  1.00 52.40  ? 152 LEU A CD1 1 
ATOM   1149  C CD2 . LEU A 1 152 ? -16.139 -6.096  63.089  1.00 56.29  ? 152 LEU A CD2 1 
ATOM   1150  N N   . LEU A 1 153 ? -12.504 -4.218  60.892  1.00 44.16  ? 153 LEU A N   1 
ATOM   1151  C CA  . LEU A 1 153 ? -11.543 -3.860  59.869  1.00 46.76  ? 153 LEU A CA  1 
ATOM   1152  C C   . LEU A 1 153 ? -12.268 -3.243  58.678  1.00 38.80  ? 153 LEU A C   1 
ATOM   1153  O O   . LEU A 1 153 ? -11.780 -2.293  58.072  1.00 49.90  ? 153 LEU A O   1 
ATOM   1154  C CB  . LEU A 1 153 ? -10.747 -5.092  59.418  1.00 36.83  ? 153 LEU A CB  1 
ATOM   1155  C CG  . LEU A 1 153 ? -9.704  -4.903  58.308  1.00 38.78  ? 153 LEU A CG  1 
ATOM   1156  C CD1 . LEU A 1 153 ? -8.755  -3.772  58.640  1.00 22.96  ? 153 LEU A CD1 1 
ATOM   1157  C CD2 . LEU A 1 153 ? -8.943  -6.188  58.118  1.00 33.94  ? 153 LEU A CD2 1 
ATOM   1158  N N   . ARG A 1 154 ? -13.442 -3.761  58.350  1.00 41.22  ? 154 ARG A N   1 
ATOM   1159  C CA  . ARG A 1 154 ? -14.176 -3.230  57.200  1.00 52.35  ? 154 ARG A CA  1 
ATOM   1160  C C   . ARG A 1 154 ? -14.570 -1.760  57.303  1.00 43.49  ? 154 ARG A C   1 
ATOM   1161  O O   . ARG A 1 154 ? -14.444 -1.016  56.334  1.00 61.38  ? 154 ARG A O   1 
ATOM   1162  C CB  . ARG A 1 154 ? -15.418 -4.080  56.906  1.00 49.95  ? 154 ARG A CB  1 
ATOM   1163  C CG  . ARG A 1 154 ? -16.610 -3.917  57.844  1.00 63.85  ? 154 ARG A CG  1 
ATOM   1164  C CD  . ARG A 1 154 ? -17.549 -5.097  57.621  1.00 70.21  ? 154 ARG A CD  1 
ATOM   1165  N NE  . ARG A 1 154 ? -17.430 -5.547  56.232  1.00 94.22  ? 154 ARG A NE  1 
ATOM   1166  C CZ  . ARG A 1 154 ? -17.715 -6.768  55.788  1.00 74.24  ? 154 ARG A CZ  1 
ATOM   1167  N NH1 . ARG A 1 154 ? -18.157 -7.709  56.621  1.00 73.82  ? 154 ARG A NH1 1 
ATOM   1168  N NH2 . ARG A 1 154 ? -17.526 -7.054  54.505  1.00 62.50  ? 154 ARG A NH2 1 
ATOM   1169  N N   . ASP A 1 155 ? -15.037 -1.332  58.466  1.00 47.14  ? 155 ASP A N   1 
ATOM   1170  C CA  . ASP A 1 155 ? -15.427 0.068   58.637  1.00 60.76  ? 155 ASP A CA  1 
ATOM   1171  C C   . ASP A 1 155 ? -14.200 0.973   58.747  1.00 48.44  ? 155 ASP A C   1 
ATOM   1172  O O   . ASP A 1 155 ? -14.192 2.096   58.241  1.00 55.39  ? 155 ASP A O   1 
ATOM   1173  C CB  . ASP A 1 155 ? -16.306 0.227   59.890  1.00 40.78  ? 155 ASP A CB  1 
ATOM   1174  C CG  . ASP A 1 155 ? -17.475 -0.739  59.901  1.00 37.08  ? 155 ASP A CG  1 
ATOM   1175  O OD1 . ASP A 1 155 ? -18.120 -0.920  58.851  1.00 59.73  ? 155 ASP A OD1 1 
ATOM   1176  O OD2 . ASP A 1 155 ? -17.761 -1.320  60.962  1.00 58.40  ? 155 ASP A OD2 1 
ATOM   1177  N N   . TRP A 1 156 ? -13.155 0.461   59.388  1.00 55.71  ? 156 TRP A N   1 
ATOM   1178  C CA  . TRP A 1 156 ? -11.927 1.221   59.590  1.00 40.79  ? 156 TRP A CA  1 
ATOM   1179  C C   . TRP A 1 156 ? -11.095 1.563   58.333  1.00 49.91  ? 156 TRP A C   1 
ATOM   1180  O O   . TRP A 1 156 ? -10.590 2.679   58.228  1.00 39.44  ? 156 TRP A O   1 
ATOM   1181  C CB  . TRP A 1 156 ? -11.055 0.502   60.625  1.00 41.92  ? 156 TRP A CB  1 
ATOM   1182  C CG  . TRP A 1 156 ? -9.887  1.309   61.075  1.00 49.90  ? 156 TRP A CG  1 
ATOM   1183  C CD1 . TRP A 1 156 ? -8.595  0.897   61.156  1.00 51.29  ? 156 TRP A CD1 1 
ATOM   1184  C CD2 . TRP A 1 156 ? -9.899  2.682   61.466  1.00 37.75  ? 156 TRP A CD2 1 
ATOM   1185  N NE1 . TRP A 1 156 ? -7.796  1.928   61.563  1.00 41.75  ? 156 TRP A NE1 1 
ATOM   1186  C CE2 . TRP A 1 156 ? -8.570  3.039   61.762  1.00 59.74  ? 156 TRP A CE2 1 
ATOM   1187  C CE3 . TRP A 1 156 ? -10.904 3.650   61.586  1.00 43.86  ? 156 TRP A CE3 1 
ATOM   1188  C CZ2 . TRP A 1 156 ? -8.212  4.328   62.176  1.00 52.84  ? 156 TRP A CZ2 1 
ATOM   1189  C CZ3 . TRP A 1 156 ? -10.552 4.926   61.993  1.00 60.93  ? 156 TRP A CZ3 1 
ATOM   1190  C CH2 . TRP A 1 156 ? -9.213  5.256   62.282  1.00 54.17  ? 156 TRP A CH2 1 
ATOM   1191  N N   . VAL A 1 157 ? -10.942 0.638   57.380  1.00 41.10  ? 157 VAL A N   1 
ATOM   1192  C CA  . VAL A 1 157 ? -10.154 0.983   56.190  1.00 39.77  ? 157 VAL A CA  1 
ATOM   1193  C C   . VAL A 1 157 ? -10.906 2.078   55.435  1.00 42.82  ? 157 VAL A C   1 
ATOM   1194  O O   . VAL A 1 157 ? -10.301 2.994   54.882  1.00 45.38  ? 157 VAL A O   1 
ATOM   1195  C CB  . VAL A 1 157 ? -9.877  -0.246  55.254  1.00 30.90  ? 157 VAL A CB  1 
ATOM   1196  C CG1 . VAL A 1 157 ? -9.852  -1.515  56.059  1.00 31.41  ? 157 VAL A CG1 1 
ATOM   1197  C CG2 . VAL A 1 157 ? -10.885 -0.332  54.149  1.00 51.93  ? 157 VAL A CG2 1 
ATOM   1198  N N   . VAL A 1 158 ? -12.231 1.989   55.441  1.00 49.81  ? 158 VAL A N   1 
ATOM   1199  C CA  . VAL A 1 158 ? -13.058 2.990   54.787  1.00 48.14  ? 158 VAL A CA  1 
ATOM   1200  C C   . VAL A 1 158 ? -12.870 4.325   55.519  1.00 53.87  ? 158 VAL A C   1 
ATOM   1201  O O   . VAL A 1 158 ? -12.630 5.359   54.893  1.00 57.99  ? 158 VAL A O   1 
ATOM   1202  C CB  . VAL A 1 158 ? -14.555 2.586   54.812  1.00 62.40  ? 158 VAL A CB  1 
ATOM   1203  C CG1 . VAL A 1 158 ? -15.408 3.698   54.233  1.00 49.70  ? 158 VAL A CG1 1 
ATOM   1204  C CG2 . VAL A 1 158 ? -14.760 1.303   54.025  1.00 39.24  ? 158 VAL A CG2 1 
ATOM   1205  N N   . GLU A 1 159 ? -12.964 4.304   56.844  1.00 46.60  ? 159 GLU A N   1 
ATOM   1206  C CA  . GLU A 1 159 ? -12.785 5.529   57.621  1.00 45.88  ? 159 GLU A CA  1 
ATOM   1207  C C   . GLU A 1 159 ? -11.387 6.100   57.390  1.00 54.55  ? 159 GLU A C   1 
ATOM   1208  O O   . GLU A 1 159 ? -11.206 7.308   57.213  1.00 60.61  ? 159 GLU A O   1 
ATOM   1209  C CB  . GLU A 1 159 ? -12.988 5.242   59.105  1.00 40.75  ? 159 GLU A CB  1 
ATOM   1210  C CG  . GLU A 1 159 ? -13.041 6.481   59.993  1.00 59.95  ? 159 GLU A CG  1 
ATOM   1211  C CD  . GLU A 1 159 ? -14.130 7.464   59.580  1.00 63.77  ? 159 GLU A CD  1 
ATOM   1212  O OE1 . GLU A 1 159 ? -15.264 7.024   59.309  1.00 51.61  ? 159 GLU A OE1 1 
ATOM   1213  O OE2 . GLU A 1 159 ? -13.851 8.683   59.536  1.00 69.64  ? 159 GLU A OE2 1 
ATOM   1214  N N   . VAL A 1 160 ? -10.396 5.219   57.376  1.00 55.61  ? 160 VAL A N   1 
ATOM   1215  C CA  . VAL A 1 160 ? -9.019  5.630   57.171  1.00 49.69  ? 160 VAL A CA  1 
ATOM   1216  C C   . VAL A 1 160 ? -8.836  6.370   55.847  1.00 37.03  ? 160 VAL A C   1 
ATOM   1217  O O   . VAL A 1 160 ? -8.234  7.437   55.809  1.00 62.69  ? 160 VAL A O   1 
ATOM   1218  C CB  . VAL A 1 160 ? -8.077  4.386   57.268  1.00 53.66  ? 160 VAL A CB  1 
ATOM   1219  C CG1 . VAL A 1 160 ? -6.810  4.581   56.468  1.00 37.71  ? 160 VAL A CG1 1 
ATOM   1220  C CG2 . VAL A 1 160 ? -7.738  4.141   58.718  1.00 48.19  ? 160 VAL A CG2 1 
ATOM   1221  N N   . GLU A 1 161 ? -9.352  5.816   54.761  1.00 48.65  ? 161 GLU A N   1 
ATOM   1222  C CA  . GLU A 1 161 ? -9.209  6.465   53.465  1.00 43.69  ? 161 GLU A CA  1 
ATOM   1223  C C   . GLU A 1 161 ? -9.971  7.780   53.416  1.00 55.48  ? 161 GLU A C   1 
ATOM   1224  O O   . GLU A 1 161 ? -9.518  8.749   52.811  1.00 46.51  ? 161 GLU A O   1 
ATOM   1225  C CB  . GLU A 1 161 ? -9.726  5.564   52.342  1.00 49.42  ? 161 GLU A CB  1 
ATOM   1226  C CG  . GLU A 1 161 ? -9.430  6.121   50.957  1.00 31.12  ? 161 GLU A CG  1 
ATOM   1227  C CD  . GLU A 1 161 ? -10.088 5.331   49.847  1.00 64.96  ? 161 GLU A CD  1 
ATOM   1228  O OE1 . GLU A 1 161 ? -9.950  4.090   49.831  1.00 55.77  ? 161 GLU A OE1 1 
ATOM   1229  O OE2 . GLU A 1 161 ? -10.738 5.959   48.978  1.00 64.99  ? 161 GLU A OE2 1 
ATOM   1230  N N   . LYS A 1 162 ? -11.140 7.793   54.042  1.00 42.82  ? 162 LYS A N   1 
ATOM   1231  C CA  . LYS A 1 162 ? -11.981 8.972   54.070  1.00 56.20  ? 162 LYS A CA  1 
ATOM   1232  C C   . LYS A 1 162 ? -11.278 10.150  54.739  1.00 59.51  ? 162 LYS A C   1 
ATOM   1233  O O   . LYS A 1 162 ? -11.416 11.290  54.291  1.00 42.15  ? 162 LYS A O   1 
ATOM   1234  C CB  . LYS A 1 162 ? -13.292 8.664   54.802  1.00 56.61  ? 162 LYS A CB  1 
ATOM   1235  C CG  . LYS A 1 162 ? -14.216 9.875   54.961  1.00 61.63  ? 162 LYS A CG  1 
ATOM   1236  C CD  . LYS A 1 162 ? -15.492 9.515   55.719  1.00 54.31  ? 162 LYS A CD  1 
ATOM   1237  C CE  . LYS A 1 162 ? -16.408 10.727  55.897  1.00 69.00  ? 162 LYS A CE  1 
ATOM   1238  N NZ  . LYS A 1 162 ? -17.698 10.386  56.567  1.00 67.43  ? 162 LYS A NZ  1 
ATOM   1239  N N   . ARG A 1 163 ? -10.533 9.856   55.810  1.00 51.27  ? 163 ARG A N   1 
ATOM   1240  C CA  . ARG A 1 163 ? -9.807  10.869  56.572  1.00 39.79  ? 163 ARG A CA  1 
ATOM   1241  C C   . ARG A 1 163 ? -8.653  11.437  55.778  1.00 36.48  ? 163 ARG A C   1 
ATOM   1242  O O   . ARG A 1 163 ? -8.130  12.498  56.105  1.00 49.70  ? 163 ARG A O   1 
ATOM   1243  C CB  . ARG A 1 163 ? -9.279  10.278  57.881  1.00 38.50  ? 163 ARG A CB  1 
ATOM   1244  C CG  . ARG A 1 163 ? -10.356 9.949   58.894  1.00 55.27  ? 163 ARG A CG  1 
ATOM   1245  C CD  . ARG A 1 163 ? -10.983 11.209  59.433  1.00 42.62  ? 163 ARG A CD  1 
ATOM   1246  N NE  . ARG A 1 163 ? -12.125 10.947  60.306  1.00 49.96  ? 163 ARG A NE  1 
ATOM   1247  C CZ  . ARG A 1 163 ? -12.688 11.874  61.075  1.00 40.03  ? 163 ARG A CZ  1 
ATOM   1248  N NH1 . ARG A 1 163 ? -12.209 13.109  61.076  1.00 69.15  ? 163 ARG A NH1 1 
ATOM   1249  N NH2 . ARG A 1 163 ? -13.725 11.577  61.835  1.00 60.08  ? 163 ARG A NH2 1 
ATOM   1250  N N   . GLY A 1 164 ? -8.237  10.716  54.744  1.00 48.26  ? 164 GLY A N   1 
ATOM   1251  C CA  . GLY A 1 164 ? -7.149  11.201  53.923  1.00 34.43  ? 164 GLY A CA  1 
ATOM   1252  C C   . GLY A 1 164 ? -5.869  10.390  53.833  1.00 49.13  ? 164 GLY A C   1 
ATOM   1253  O O   . GLY A 1 164 ? -4.952  10.790  53.112  1.00 45.86  ? 164 GLY A O   1 
ATOM   1254  N N   . ALA A 1 165 ? -5.780  9.267   54.540  1.00 42.16  ? 165 ALA A N   1 
ATOM   1255  C CA  . ALA A 1 165 ? -4.567  8.447   54.482  1.00 43.83  ? 165 ALA A CA  1 
ATOM   1256  C C   . ALA A 1 165 ? -4.175  8.167   53.032  1.00 46.55  ? 165 ALA A C   1 
ATOM   1257  O O   . ALA A 1 165 ? -5.036  8.055   52.159  1.00 58.11  ? 165 ALA A O   1 
ATOM   1258  C CB  . ALA A 1 165 ? -4.783  7.136   55.220  1.00 36.16  ? 165 ALA A CB  1 
ATOM   1259  N N   . GLY A 1 166 ? -2.877  8.051   52.772  1.00 47.30  ? 166 GLY A N   1 
ATOM   1260  C CA  . GLY A 1 166 ? -2.431  7.779   51.417  1.00 42.74  ? 166 GLY A CA  1 
ATOM   1261  C C   . GLY A 1 166 ? -1.953  6.357   51.162  1.00 41.30  ? 166 GLY A C   1 
ATOM   1262  O O   . GLY A 1 166 ? -1.681  5.990   50.023  1.00 47.04  ? 166 GLY A O   1 
ATOM   1263  N N   . GLU A 1 167 ? -1.868  5.548   52.214  1.00 44.28  ? 167 GLU A N   1 
ATOM   1264  C CA  . GLU A 1 167 ? -1.393  4.174   52.089  1.00 39.00  ? 167 GLU A CA  1 
ATOM   1265  C C   . GLU A 1 167 ? -1.708  3.425   53.378  1.00 50.27  ? 167 GLU A C   1 
ATOM   1266  O O   . GLU A 1 167 ? -1.799  4.031   54.446  1.00 57.72  ? 167 GLU A O   1 
ATOM   1267  C CB  . GLU A 1 167 ? 0.113   4.197   51.837  1.00 35.07  ? 167 GLU A CB  1 
ATOM   1268  C CG  . GLU A 1 167 ? 0.765   2.871   51.515  1.00 48.14  ? 167 GLU A CG  1 
ATOM   1269  C CD  . GLU A 1 167 ? 2.175   3.047   50.933  1.00 73.22  ? 167 GLU A CD  1 
ATOM   1270  O OE1 . GLU A 1 167 ? 3.026   3.719   51.564  1.00 53.74  ? 167 GLU A OE1 1 
ATOM   1271  O OE2 . GLU A 1 167 ? 2.439   2.511   49.834  1.00 53.24  ? 167 GLU A OE2 1 
ATOM   1272  N N   . ILE A 1 168 ? -1.892  2.117   53.276  1.00 33.06  ? 168 ILE A N   1 
ATOM   1273  C CA  . ILE A 1 168 ? -2.192  1.313   54.437  1.00 33.03  ? 168 ILE A CA  1 
ATOM   1274  C C   . ILE A 1 168 ? -1.150  0.237   54.615  1.00 39.54  ? 168 ILE A C   1 
ATOM   1275  O O   . ILE A 1 168 ? -0.756  -0.413  53.659  1.00 50.22  ? 168 ILE A O   1 
ATOM   1276  C CB  . ILE A 1 168 ? -3.561  0.613   54.319  1.00 41.87  ? 168 ILE A CB  1 
ATOM   1277  C CG1 . ILE A 1 168 ? -4.692  1.642   54.378  1.00 44.82  ? 168 ILE A CG1 1 
ATOM   1278  C CG2 . ILE A 1 168 ? -3.713  -0.418  55.431  1.00 39.31  ? 168 ILE A CG2 1 
ATOM   1279  C CD1 . ILE A 1 168 ? -6.079  1.056   54.157  1.00 48.51  ? 168 ILE A CD1 1 
ATOM   1280  N N   . LEU A 1 169 ? -0.695  0.065   55.846  1.00 44.37  ? 169 LEU A N   1 
ATOM   1281  C CA  . LEU A 1 169 ? 0.275   -0.962  56.165  1.00 30.60  ? 169 LEU A CA  1 
ATOM   1282  C C   . LEU A 1 169 ? -0.588  -1.934  56.954  1.00 41.07  ? 169 LEU A C   1 
ATOM   1283  O O   . LEU A 1 169 ? -0.893  -1.695  58.121  1.00 44.74  ? 169 LEU A O   1 
ATOM   1284  C CB  . LEU A 1 169 ? 1.400   -0.402  57.038  1.00 37.20  ? 169 LEU A CB  1 
ATOM   1285  C CG  . LEU A 1 169 ? 2.696   -1.216  57.014  1.00 43.57  ? 169 LEU A CG  1 
ATOM   1286  C CD1 . LEU A 1 169 ? 3.711   -0.574  57.904  1.00 47.44  ? 169 LEU A CD1 1 
ATOM   1287  C CD2 . LEU A 1 169 ? 2.440   -2.639  57.453  1.00 53.47  ? 169 LEU A CD2 1 
ATOM   1288  N N   . LEU A 1 170 ? -1.003  -3.008  56.292  1.00 41.75  ? 170 LEU A N   1 
ATOM   1289  C CA  . LEU A 1 170 ? -1.871  -4.011  56.884  1.00 40.13  ? 170 LEU A CA  1 
ATOM   1290  C C   . LEU A 1 170 ? -1.118  -5.222  57.425  1.00 43.18  ? 170 LEU A C   1 
ATOM   1291  O O   . LEU A 1 170 ? -0.598  -6.032  56.671  1.00 40.40  ? 170 LEU A O   1 
ATOM   1292  C CB  . LEU A 1 170 ? -2.883  -4.465  55.842  1.00 28.62  ? 170 LEU A CB  1 
ATOM   1293  C CG  . LEU A 1 170 ? -3.880  -5.534  56.272  1.00 45.33  ? 170 LEU A CG  1 
ATOM   1294  C CD1 . LEU A 1 170 ? -4.879  -4.950  57.270  1.00 38.42  ? 170 LEU A CD1 1 
ATOM   1295  C CD2 . LEU A 1 170 ? -4.592  -6.064  55.036  1.00 48.41  ? 170 LEU A CD2 1 
ATOM   1296  N N   . THR A 1 171 ? -1.079  -5.341  58.743  1.00 37.53  ? 171 THR A N   1 
ATOM   1297  C CA  . THR A 1 171 ? -0.390  -6.447  59.374  1.00 40.57  ? 171 THR A CA  1 
ATOM   1298  C C   . THR A 1 171 ? -1.364  -7.427  59.999  1.00 42.52  ? 171 THR A C   1 
ATOM   1299  O O   . THR A 1 171 ? -2.325  -7.028  60.658  1.00 44.64  ? 171 THR A O   1 
ATOM   1300  C CB  . THR A 1 171 ? 0.554   -5.964  60.483  1.00 41.50  ? 171 THR A CB  1 
ATOM   1301  O OG1 . THR A 1 171 ? 1.484   -5.017  59.947  1.00 47.03  ? 171 THR A OG1 1 
ATOM   1302  C CG2 . THR A 1 171 ? 1.322   -7.131  61.058  1.00 38.16  ? 171 THR A CG2 1 
ATOM   1303  N N   . SER A 1 172 ? -1.126  -8.712  59.776  1.00 35.96  ? 172 SER A N   1 
ATOM   1304  C CA  . SER A 1 172 ? -1.967  -9.730  60.379  1.00 44.32  ? 172 SER A CA  1 
ATOM   1305  C C   . SER A 1 172 ? -1.254  -10.211 61.644  1.00 39.88  ? 172 SER A C   1 
ATOM   1306  O O   . SER A 1 172 ? -0.208  -10.820 61.564  1.00 50.04  ? 172 SER A O   1 
ATOM   1307  C CB  . SER A 1 172 ? -2.171  -10.902 59.426  1.00 32.98  ? 172 SER A CB  1 
ATOM   1308  O OG  . SER A 1 172 ? -2.817  -11.978 60.086  1.00 43.74  ? 172 SER A OG  1 
ATOM   1309  N N   . ILE A 1 173 ? -1.808  -9.913  62.808  1.00 41.28  ? 173 ILE A N   1 
ATOM   1310  C CA  . ILE A 1 173 ? -1.199  -10.342 64.061  1.00 48.97  ? 173 ILE A CA  1 
ATOM   1311  C C   . ILE A 1 173 ? -1.031  -11.864 64.055  1.00 62.44  ? 173 ILE A C   1 
ATOM   1312  O O   . ILE A 1 173 ? -0.076  -12.399 64.617  1.00 56.46  ? 173 ILE A O   1 
ATOM   1313  C CB  . ILE A 1 173 ? -2.077  -9.931  65.258  1.00 39.17  ? 173 ILE A CB  1 
ATOM   1314  C CG1 . ILE A 1 173 ? -2.194  -8.410  65.306  1.00 30.27  ? 173 ILE A CG1 1 
ATOM   1315  C CG2 . ILE A 1 173 ? -1.495  -10.471 66.553  1.00 46.49  ? 173 ILE A CG2 1 
ATOM   1316  C CD1 . ILE A 1 173 ? -3.140  -7.921  66.361  1.00 47.15  ? 173 ILE A CD1 1 
ATOM   1317  N N   . ASP A 1 174 ? -1.966  -12.550 63.399  1.00 71.47  ? 174 ASP A N   1 
ATOM   1318  C CA  . ASP A 1 174 ? -1.944  -14.004 63.309  1.00 63.22  ? 174 ASP A CA  1 
ATOM   1319  C C   . ASP A 1 174 ? -0.665  -14.567 62.662  1.00 58.96  ? 174 ASP A C   1 
ATOM   1320  O O   . ASP A 1 174 ? -0.053  -15.493 63.198  1.00 62.70  ? 174 ASP A O   1 
ATOM   1321  C CB  . ASP A 1 174 ? -3.192  -14.502 62.543  1.00 62.15  ? 174 ASP A CB  1 
ATOM   1322  C CG  . ASP A 1 174 ? -4.509  -14.298 63.330  1.00 86.77  ? 174 ASP A CG  1 
ATOM   1323  O OD1 . ASP A 1 174 ? -4.584  -14.779 64.487  1.00 57.89  ? 174 ASP A OD1 1 
ATOM   1324  O OD2 . ASP A 1 174 ? -5.471  -13.673 62.797  1.00 47.11  ? 174 ASP A OD2 1 
ATOM   1325  N N   . ARG A 1 175 ? -0.242  -14.000 61.536  1.00 50.57  ? 175 ARG A N   1 
ATOM   1326  C CA  . ARG A 1 175 ? 0.939   -14.502 60.824  1.00 51.30  ? 175 ARG A CA  1 
ATOM   1327  C C   . ARG A 1 175 ? 2.260   -13.774 61.092  1.00 47.22  ? 175 ARG A C   1 
ATOM   1328  O O   . ARG A 1 175 ? 3.326   -14.242 60.694  1.00 50.01  ? 175 ARG A O   1 
ATOM   1329  C CB  . ARG A 1 175 ? 0.692   -14.461 59.311  1.00 40.85  ? 175 ARG A CB  1 
ATOM   1330  C CG  . ARG A 1 175 ? -0.641  -14.995 58.828  1.00 47.67  ? 175 ARG A CG  1 
ATOM   1331  C CD  . ARG A 1 175 ? -0.852  -16.433 59.208  1.00 59.85  ? 175 ARG A CD  1 
ATOM   1332  N NE  . ARG A 1 175 ? -1.696  -17.115 58.239  1.00 78.37  ? 175 ARG A NE  1 
ATOM   1333  C CZ  . ARG A 1 175 ? -1.297  -17.474 57.017  1.00 99.49  ? 175 ARG A CZ  1 
ATOM   1334  N NH1 . ARG A 1 175 ? -0.054  -17.213 56.613  1.00 77.05  ? 175 ARG A NH1 1 
ATOM   1335  N NH2 . ARG A 1 175 ? -2.141  -18.100 56.193  1.00 87.83  ? 175 ARG A NH2 1 
ATOM   1336  N N   . ASP A 1 176 ? 2.193   -12.632 61.758  1.00 44.87  ? 176 ASP A N   1 
ATOM   1337  C CA  . ASP A 1 176 ? 3.388   -11.832 62.024  1.00 60.15  ? 176 ASP A CA  1 
ATOM   1338  C C   . ASP A 1 176 ? 4.524   -12.542 62.761  1.00 57.28  ? 176 ASP A C   1 
ATOM   1339  O O   . ASP A 1 176 ? 4.357   -12.960 63.913  1.00 66.94  ? 176 ASP A O   1 
ATOM   1340  C CB  . ASP A 1 176 ? 2.996   -10.566 62.783  1.00 65.48  ? 176 ASP A CB  1 
ATOM   1341  C CG  . ASP A 1 176 ? 3.997   -9.440  62.599  1.00 76.84  ? 176 ASP A CG  1 
ATOM   1342  O OD1 . ASP A 1 176 ? 4.660   -9.381  61.534  1.00 75.19  ? 176 ASP A OD1 1 
ATOM   1343  O OD2 . ASP A 1 176 ? 4.106   -8.595  63.516  1.00 96.27  ? 176 ASP A OD2 1 
ATOM   1344  N N   . GLY A 1 177 ? 5.668   -12.657 62.074  1.00 66.30  ? 177 GLY A N   1 
ATOM   1345  C CA  . GLY A 1 177 ? 6.864   -13.288 62.619  1.00 49.62  ? 177 GLY A CA  1 
ATOM   1346  C C   . GLY A 1 177 ? 6.883   -14.805 62.549  1.00 61.93  ? 177 GLY A C   1 
ATOM   1347  O O   . GLY A 1 177 ? 7.766   -15.444 63.133  1.00 60.86  ? 177 GLY A O   1 
ATOM   1348  N N   . THR A 1 178 ? 5.934   -15.383 61.816  1.00 51.70  ? 178 THR A N   1 
ATOM   1349  C CA  . THR A 1 178 ? 5.820   -16.830 61.709  1.00 50.71  ? 178 THR A CA  1 
ATOM   1350  C C   . THR A 1 178 ? 6.417   -17.506 60.478  1.00 50.68  ? 178 THR A C   1 
ATOM   1351  O O   . THR A 1 178 ? 6.513   -18.735 60.448  1.00 65.60  ? 178 THR A O   1 
ATOM   1352  C CB  . THR A 1 178 ? 4.362   -17.260 61.777  1.00 51.54  ? 178 THR A CB  1 
ATOM   1353  O OG1 . THR A 1 178 ? 3.695   -16.840 60.582  1.00 50.19  ? 178 THR A OG1 1 
ATOM   1354  C CG2 . THR A 1 178 ? 3.694   -16.647 62.988  1.00 33.57  ? 178 THR A CG2 1 
ATOM   1355  N N   . LYS A 1 179 ? 6.788   -16.734 59.462  1.00 53.78  ? 179 LYS A N   1 
ATOM   1356  C CA  . LYS A 1 179 ? 7.384   -17.312 58.252  1.00 48.60  ? 179 LYS A CA  1 
ATOM   1357  C C   . LYS A 1 179 ? 6.501   -18.341 57.532  1.00 52.77  ? 179 LYS A C   1 
ATOM   1358  O O   . LYS A 1 179 ? 6.963   -19.059 56.639  1.00 48.33  ? 179 LYS A O   1 
ATOM   1359  C CB  . LYS A 1 179 ? 8.734   -17.956 58.596  1.00 52.10  ? 179 LYS A CB  1 
ATOM   1360  C CG  . LYS A 1 179 ? 9.846   -16.956 58.921  1.00 46.22  ? 179 LYS A CG  1 
ATOM   1361  C CD  . LYS A 1 179 ? 11.154  -17.678 59.192  1.00 73.60  ? 179 LYS A CD  1 
ATOM   1362  C CE  . LYS A 1 179 ? 12.370  -16.789 58.947  1.00 65.38  ? 179 LYS A CE  1 
ATOM   1363  N NZ  . LYS A 1 179 ? 13.604  -17.632 58.912  1.00 70.94  ? 179 LYS A NZ  1 
ATOM   1364  N N   . SER A 1 180 ? 5.229   -18.392 57.913  1.00 59.61  ? 180 SER A N   1 
ATOM   1365  C CA  . SER A 1 180 ? 4.265   -19.326 57.334  1.00 55.28  ? 180 SER A CA  1 
ATOM   1366  C C   . SER A 1 180 ? 3.706   -18.864 55.980  1.00 58.74  ? 180 SER A C   1 
ATOM   1367  O O   . SER A 1 180 ? 3.342   -19.680 55.134  1.00 52.49  ? 180 SER A O   1 
ATOM   1368  C CB  . SER A 1 180 ? 3.092   -19.491 58.287  1.00 64.33  ? 180 SER A CB  1 
ATOM   1369  O OG  . SER A 1 180 ? 2.296   -18.307 58.267  1.00 67.55  ? 180 SER A OG  1 
ATOM   1370  N N   . GLY A 1 181 ? 3.624   -17.553 55.797  1.00 49.15  ? 181 GLY A N   1 
ATOM   1371  C CA  . GLY A 1 181 ? 3.086   -16.983 54.570  1.00 41.16  ? 181 GLY A CA  1 
ATOM   1372  C C   . GLY A 1 181 ? 2.216   -15.806 54.968  1.00 32.73  ? 181 GLY A C   1 
ATOM   1373  O O   . GLY A 1 181 ? 1.801   -15.722 56.120  1.00 37.26  ? 181 GLY A O   1 
ATOM   1374  N N   . TYR A 1 182 ? 1.959   -14.886 54.042  1.00 41.74  ? 182 TYR A N   1 
ATOM   1375  C CA  . TYR A 1 182 ? 1.117   -13.721 54.335  1.00 36.25  ? 182 TYR A CA  1 
ATOM   1376  C C   . TYR A 1 182 ? -0.319  -14.183 54.509  1.00 37.25  ? 182 TYR A C   1 
ATOM   1377  O O   . TYR A 1 182 ? -0.705  -15.233 54.003  1.00 41.41  ? 182 TYR A O   1 
ATOM   1378  C CB  . TYR A 1 182 ? 1.154   -12.692 53.192  1.00 28.40  ? 182 TYR A CB  1 
ATOM   1379  C CG  . TYR A 1 182 ? 2.435   -11.897 53.057  1.00 33.39  ? 182 TYR A CG  1 
ATOM   1380  C CD1 . TYR A 1 182 ? 2.790   -10.933 53.999  1.00 24.56  ? 182 TYR A CD1 1 
ATOM   1381  C CD2 . TYR A 1 182 ? 3.295   -12.116 51.987  1.00 27.91  ? 182 TYR A CD2 1 
ATOM   1382  C CE1 . TYR A 1 182 ? 3.967   -10.219 53.881  1.00 27.43  ? 182 TYR A CE1 1 
ATOM   1383  C CE2 . TYR A 1 182 ? 4.475   -11.405 51.856  1.00 37.44  ? 182 TYR A CE2 1 
ATOM   1384  C CZ  . TYR A 1 182 ? 4.808   -10.460 52.806  1.00 35.78  ? 182 TYR A CZ  1 
ATOM   1385  O OH  . TYR A 1 182 ? 5.986   -9.774  52.674  1.00 35.44  ? 182 TYR A OH  1 
ATOM   1386  N N   . ASP A 1 183 ? -1.108  -13.394 55.226  1.00 45.11  ? 183 ASP A N   1 
ATOM   1387  C CA  . ASP A 1 183 ? -2.518  -13.700 55.435  1.00 34.06  ? 183 ASP A CA  1 
ATOM   1388  C C   . ASP A 1 183 ? -3.276  -13.192 54.200  1.00 44.70  ? 183 ASP A C   1 
ATOM   1389  O O   . ASP A 1 183 ? -3.903  -12.134 54.244  1.00 40.94  ? 183 ASP A O   1 
ATOM   1390  C CB  . ASP A 1 183 ? -3.019  -12.971 56.671  1.00 38.05  ? 183 ASP A CB  1 
ATOM   1391  C CG  . ASP A 1 183 ? -4.393  -13.403 57.086  1.00 42.62  ? 183 ASP A CG  1 
ATOM   1392  O OD1 . ASP A 1 183 ? -5.094  -14.063 56.286  1.00 42.50  ? 183 ASP A OD1 1 
ATOM   1393  O OD2 . ASP A 1 183 ? -4.774  -13.073 58.225  1.00 44.28  ? 183 ASP A OD2 1 
ATOM   1394  N N   . THR A 1 184 ? -3.212  -13.945 53.103  1.00 38.71  ? 184 THR A N   1 
ATOM   1395  C CA  . THR A 1 184 ? -3.869  -13.558 51.857  1.00 30.10  ? 184 THR A CA  1 
ATOM   1396  C C   . THR A 1 184 ? -5.385  -13.414 51.955  1.00 34.49  ? 184 THR A C   1 
ATOM   1397  O O   . THR A 1 184 ? -5.995  -12.682 51.178  1.00 45.19  ? 184 THR A O   1 
ATOM   1398  C CB  . THR A 1 184 ? -3.532  -14.542 50.720  1.00 27.86  ? 184 THR A CB  1 
ATOM   1399  O OG1 . THR A 1 184 ? -3.968  -15.855 51.073  1.00 38.13  ? 184 THR A OG1 1 
ATOM   1400  C CG2 . THR A 1 184 ? -2.038  -14.551 50.458  1.00 37.04  ? 184 THR A CG2 1 
ATOM   1401  N N   . GLU A 1 185 ? -5.995  -14.118 52.900  1.00 37.24  ? 185 GLU A N   1 
ATOM   1402  C CA  . GLU A 1 185 ? -7.431  -14.018 53.084  1.00 33.73  ? 185 GLU A CA  1 
ATOM   1403  C C   . GLU A 1 185 ? -7.776  -12.596 53.573  1.00 41.72  ? 185 GLU A C   1 
ATOM   1404  O O   . GLU A 1 185 ? -8.675  -11.953 53.040  1.00 41.31  ? 185 GLU A O   1 
ATOM   1405  C CB  . GLU A 1 185 ? -7.900  -15.067 54.092  1.00 28.18  ? 185 GLU A CB  1 
ATOM   1406  C CG  . GLU A 1 185 ? -9.357  -14.946 54.449  1.00 40.93  ? 185 GLU A CG  1 
ATOM   1407  C CD  . GLU A 1 185 ? -9.777  -15.907 55.526  1.00 35.76  ? 185 GLU A CD  1 
ATOM   1408  O OE1 . GLU A 1 185 ? -9.181  -15.883 56.608  1.00 60.05  ? 185 GLU A OE1 1 
ATOM   1409  O OE2 . GLU A 1 185 ? -10.711 -16.694 55.305  1.00 85.08  ? 185 GLU A OE2 1 
ATOM   1410  N N   . MET A 1 186 ? -7.050  -12.111 54.582  1.00 35.10  ? 186 MET A N   1 
ATOM   1411  C CA  . MET A 1 186 ? -7.269  -10.766 55.113  1.00 39.71  ? 186 MET A CA  1 
ATOM   1412  C C   . MET A 1 186 ? -7.044  -9.711  54.033  1.00 40.15  ? 186 MET A C   1 
ATOM   1413  O O   . MET A 1 186 ? -7.766  -8.717  53.970  1.00 45.43  ? 186 MET A O   1 
ATOM   1414  C CB  . MET A 1 186 ? -6.327  -10.471 56.289  1.00 36.75  ? 186 MET A CB  1 
ATOM   1415  C CG  . MET A 1 186 ? -6.502  -9.070  56.877  1.00 50.35  ? 186 MET A CG  1 
ATOM   1416  S SD  . MET A 1 186 ? -5.290  -8.541  58.120  1.00 49.59  ? 186 MET A SD  1 
ATOM   1417  C CE  . MET A 1 186 ? -5.795  -9.528  59.537  1.00 41.07  ? 186 MET A CE  1 
ATOM   1418  N N   . ILE A 1 187 ? -6.043  -9.934  53.187  1.00 35.91  ? 187 ILE A N   1 
ATOM   1419  C CA  . ILE A 1 187 ? -5.722  -8.993  52.123  1.00 31.58  ? 187 ILE A CA  1 
ATOM   1420  C C   . ILE A 1 187 ? -6.875  -8.842  51.136  1.00 44.36  ? 187 ILE A C   1 
ATOM   1421  O O   . ILE A 1 187 ? -7.216  -7.724  50.748  1.00 37.13  ? 187 ILE A O   1 
ATOM   1422  C CB  . ILE A 1 187 ? -4.448  -9.430  51.344  1.00 40.59  ? 187 ILE A CB  1 
ATOM   1423  C CG1 . ILE A 1 187 ? -3.274  -9.604  52.312  1.00 45.16  ? 187 ILE A CG1 1 
ATOM   1424  C CG2 . ILE A 1 187 ? -4.087  -8.395  50.287  1.00 26.46  ? 187 ILE A CG2 1 
ATOM   1425  C CD1 . ILE A 1 187 ? -1.977  -10.044 51.653  1.00 40.27  ? 187 ILE A CD1 1 
ATOM   1426  N N   . ARG A 1 188 ? -7.464  -9.974  50.741  1.00 33.83  ? 188 ARG A N   1 
ATOM   1427  C CA  . ARG A 1 188 ? -8.577  -10.014 49.798  1.00 35.82  ? 188 ARG A CA  1 
ATOM   1428  C C   . ARG A 1 188 ? -9.821  -9.383  50.404  1.00 40.06  ? 188 ARG A C   1 
ATOM   1429  O O   . ARG A 1 188 ? -10.652 -8.815  49.707  1.00 39.74  ? 188 ARG A O   1 
ATOM   1430  C CB  . ARG A 1 188 ? -8.870  -11.464 49.391  1.00 29.71  ? 188 ARG A CB  1 
ATOM   1431  C CG  . ARG A 1 188 ? -7.818  -12.063 48.480  1.00 48.48  ? 188 ARG A CG  1 
ATOM   1432  C CD  . ARG A 1 188 ? -7.803  -13.578 48.549  1.00 48.42  ? 188 ARG A CD  1 
ATOM   1433  N NE  . ARG A 1 188 ? -6.781  -14.160 47.686  1.00 43.61  ? 188 ARG A NE  1 
ATOM   1434  C CZ  . ARG A 1 188 ? -6.831  -14.157 46.357  1.00 46.71  ? 188 ARG A CZ  1 
ATOM   1435  N NH1 . ARG A 1 188 ? -7.859  -13.596 45.733  1.00 49.44  ? 188 ARG A NH1 1 
ATOM   1436  N NH2 . ARG A 1 188 ? -5.866  -14.728 45.651  1.00 26.82  ? 188 ARG A NH2 1 
ATOM   1437  N N   . PHE A 1 189 ? -9.944  -9.500  51.716  1.00 39.41  ? 189 PHE A N   1 
ATOM   1438  C CA  . PHE A 1 189 ? -11.065 -8.925  52.437  1.00 42.21  ? 189 PHE A CA  1 
ATOM   1439  C C   . PHE A 1 189 ? -11.014 -7.403  52.300  1.00 48.28  ? 189 PHE A C   1 
ATOM   1440  O O   . PHE A 1 189 ? -12.023 -6.761  52.026  1.00 48.49  ? 189 PHE A O   1 
ATOM   1441  C CB  . PHE A 1 189 ? -10.952 -9.325  53.903  1.00 39.45  ? 189 PHE A CB  1 
ATOM   1442  C CG  . PHE A 1 189 ? -12.005 -8.739  54.794  1.00 40.11  ? 189 PHE A CG  1 
ATOM   1443  C CD1 . PHE A 1 189 ? -13.209 -9.397  54.991  1.00 44.46  ? 189 PHE A CD1 1 
ATOM   1444  C CD2 . PHE A 1 189 ? -11.754 -7.573  55.508  1.00 51.06  ? 189 PHE A CD2 1 
ATOM   1445  C CE1 . PHE A 1 189 ? -14.141 -8.913  55.891  1.00 46.17  ? 189 PHE A CE1 1 
ATOM   1446  C CE2 . PHE A 1 189 ? -12.683 -7.079  56.413  1.00 48.54  ? 189 PHE A CE2 1 
ATOM   1447  C CZ  . PHE A 1 189 ? -13.876 -7.750  56.606  1.00 49.16  ? 189 PHE A CZ  1 
ATOM   1448  N N   . VAL A 1 190 ? -9.820  -6.843  52.477  1.00 46.80  ? 190 VAL A N   1 
ATOM   1449  C CA  . VAL A 1 190 ? -9.605  -5.402  52.409  1.00 42.07  ? 190 VAL A CA  1 
ATOM   1450  C C   . VAL A 1 190 ? -9.504  -4.809  51.003  1.00 45.35  ? 190 VAL A C   1 
ATOM   1451  O O   . VAL A 1 190 ? -9.914  -3.675  50.781  1.00 42.57  ? 190 VAL A O   1 
ATOM   1452  C CB  . VAL A 1 190 ? -8.325  -5.004  53.193  1.00 30.33  ? 190 VAL A CB  1 
ATOM   1453  C CG1 . VAL A 1 190 ? -8.117  -3.509  53.133  1.00 35.07  ? 190 VAL A CG1 1 
ATOM   1454  C CG2 . VAL A 1 190 ? -8.436  -5.459  54.631  1.00 30.01  ? 190 VAL A CG2 1 
ATOM   1455  N N   . ARG A 1 191 ? -8.956  -5.572  50.063  1.00 37.35  ? 191 ARG A N   1 
ATOM   1456  C CA  . ARG A 1 191 ? -8.773  -5.101  48.691  1.00 44.12  ? 191 ARG A CA  1 
ATOM   1457  C C   . ARG A 1 191 ? -9.959  -4.362  48.089  1.00 34.25  ? 191 ARG A C   1 
ATOM   1458  O O   . ARG A 1 191 ? -9.806  -3.266  47.565  1.00 43.16  ? 191 ARG A O   1 
ATOM   1459  C CB  . ARG A 1 191 ? -8.398  -6.269  47.772  1.00 37.13  ? 191 ARG A CB  1 
ATOM   1460  C CG  . ARG A 1 191 ? -8.113  -5.870  46.333  1.00 30.51  ? 191 ARG A CG  1 
ATOM   1461  C CD  . ARG A 1 191 ? -6.902  -4.975  46.233  1.00 32.86  ? 191 ARG A CD  1 
ATOM   1462  N NE  . ARG A 1 191 ? -7.168  -3.622  46.707  1.00 37.69  ? 191 ARG A NE  1 
ATOM   1463  C CZ  . ARG A 1 191 ? -6.255  -2.662  46.767  1.00 44.17  ? 191 ARG A CZ  1 
ATOM   1464  N NH1 . ARG A 1 191 ? -5.014  -2.907  46.393  1.00 35.46  ? 191 ARG A NH1 1 
ATOM   1465  N NH2 . ARG A 1 191 ? -6.587  -1.449  47.180  1.00 46.53  ? 191 ARG A NH2 1 
ATOM   1466  N N   . PRO A 1 192 ? -11.157 -4.960  48.148  1.00 35.78  ? 192 PRO A N   1 
ATOM   1467  C CA  . PRO A 1 192 ? -12.354 -4.327  47.593  1.00 50.78  ? 192 PRO A CA  1 
ATOM   1468  C C   . PRO A 1 192 ? -12.867 -3.105  48.344  1.00 57.46  ? 192 PRO A C   1 
ATOM   1469  O O   . PRO A 1 192 ? -13.503 -2.245  47.737  1.00 62.06  ? 192 PRO A O   1 
ATOM   1470  C CB  . PRO A 1 192 ? -13.372 -5.462  47.600  1.00 44.04  ? 192 PRO A CB  1 
ATOM   1471  C CG  . PRO A 1 192 ? -12.970 -6.241  48.813  1.00 45.23  ? 192 PRO A CG  1 
ATOM   1472  C CD  . PRO A 1 192 ? -11.478 -6.303  48.662  1.00 38.68  ? 192 PRO A CD  1 
ATOM   1473  N N   . LEU A 1 193 ? -12.581 -3.022  49.646  1.00 56.60  ? 193 LEU A N   1 
ATOM   1474  C CA  . LEU A 1 193 ? -13.054 -1.914  50.484  1.00 46.17  ? 193 LEU A CA  1 
ATOM   1475  C C   . LEU A 1 193 ? -12.353 -0.573  50.288  1.00 46.34  ? 193 LEU A C   1 
ATOM   1476  O O   . LEU A 1 193 ? -12.870 0.461   50.705  1.00 60.86  ? 193 LEU A O   1 
ATOM   1477  C CB  . LEU A 1 193 ? -12.963 -2.297  51.966  1.00 41.27  ? 193 LEU A CB  1 
ATOM   1478  C CG  . LEU A 1 193 ? -13.623 -3.608  52.393  1.00 55.54  ? 193 LEU A CG  1 
ATOM   1479  C CD1 . LEU A 1 193 ? -13.348 -3.854  53.866  1.00 48.77  ? 193 LEU A CD1 1 
ATOM   1480  C CD2 . LEU A 1 193 ? -15.119 -3.555  52.127  1.00 51.03  ? 193 LEU A CD2 1 
ATOM   1481  N N   . THR A 1 194 ? -11.187 -0.580  49.654  1.00 44.35  ? 194 THR A N   1 
ATOM   1482  C CA  . THR A 1 194 ? -10.444 0.655   49.456  1.00 34.98  ? 194 THR A CA  1 
ATOM   1483  C C   . THR A 1 194 ? -9.619  0.691   48.175  1.00 41.07  ? 194 THR A C   1 
ATOM   1484  O O   . THR A 1 194 ? -9.262  -0.341  47.615  1.00 51.75  ? 194 THR A O   1 
ATOM   1485  C CB  . THR A 1 194 ? -9.494  0.920   50.646  1.00 31.12  ? 194 THR A CB  1 
ATOM   1486  O OG1 . THR A 1 194 ? -8.579  1.968   50.308  1.00 43.90  ? 194 THR A OG1 1 
ATOM   1487  C CG2 . THR A 1 194 ? -8.693  -0.341  50.989  1.00 48.63  ? 194 THR A CG2 1 
ATOM   1488  N N   . THR A 1 195 ? -9.310  1.902   47.729  1.00 49.11  ? 195 THR A N   1 
ATOM   1489  C CA  . THR A 1 195 ? -8.514  2.111   46.531  1.00 40.12  ? 195 THR A CA  1 
ATOM   1490  C C   . THR A 1 195 ? -7.093  2.491   46.930  1.00 41.41  ? 195 THR A C   1 
ATOM   1491  O O   . THR A 1 195 ? -6.208  2.630   46.082  1.00 63.42  ? 195 THR A O   1 
ATOM   1492  C CB  . THR A 1 195 ? -9.097  3.243   45.681  1.00 65.32  ? 195 THR A CB  1 
ATOM   1493  O OG1 . THR A 1 195 ? -10.525 3.165   45.717  1.00 54.16  ? 195 THR A OG1 1 
ATOM   1494  C CG2 . THR A 1 195 ? -8.613  3.122   44.238  1.00 70.85  ? 195 THR A CG2 1 
ATOM   1495  N N   . LEU A 1 196 ? -6.878  2.676   48.226  1.00 45.03  ? 196 LEU A N   1 
ATOM   1496  C CA  . LEU A 1 196 ? -5.552  3.020   48.724  1.00 44.07  ? 196 LEU A CA  1 
ATOM   1497  C C   . LEU A 1 196 ? -4.585  1.851   48.577  1.00 45.87  ? 196 LEU A C   1 
ATOM   1498  O O   . LEU A 1 196 ? -4.985  0.685   48.605  1.00 33.78  ? 196 LEU A O   1 
ATOM   1499  C CB  . LEU A 1 196 ? -5.620  3.398   50.198  1.00 39.90  ? 196 LEU A CB  1 
ATOM   1500  C CG  . LEU A 1 196 ? -6.205  4.754   50.564  1.00 46.97  ? 196 LEU A CG  1 
ATOM   1501  C CD1 . LEU A 1 196 ? -6.433  4.814   52.067  1.00 39.07  ? 196 LEU A CD1 1 
ATOM   1502  C CD2 . LEU A 1 196 ? -5.256  5.857   50.096  1.00 60.32  ? 196 LEU A CD2 1 
ATOM   1503  N N   . PRO A 1 197 ? -3.296  2.159   48.408  1.00 40.81  ? 197 PRO A N   1 
ATOM   1504  C CA  . PRO A 1 197 ? -2.230  1.164   48.265  1.00 42.72  ? 197 PRO A CA  1 
ATOM   1505  C C   . PRO A 1 197 ? -2.163  0.287   49.520  1.00 30.45  ? 197 PRO A C   1 
ATOM   1506  O O   . PRO A 1 197 ? -2.315  0.777   50.635  1.00 40.36  ? 197 PRO A O   1 
ATOM   1507  C CB  . PRO A 1 197 ? -0.983  2.023   48.114  1.00 37.05  ? 197 PRO A CB  1 
ATOM   1508  C CG  . PRO A 1 197 ? -1.505  3.238   47.435  1.00 57.61  ? 197 PRO A CG  1 
ATOM   1509  C CD  . PRO A 1 197 ? -2.781  3.514   48.166  1.00 34.69  ? 197 PRO A CD  1 
ATOM   1510  N N   . ILE A 1 198 ? -1.955  -1.009  49.342  1.00 44.00  ? 198 ILE A N   1 
ATOM   1511  C CA  . ILE A 1 198 ? -1.866  -1.904  50.492  1.00 43.28  ? 198 ILE A CA  1 
ATOM   1512  C C   . ILE A 1 198 ? -0.492  -2.549  50.630  1.00 44.67  ? 198 ILE A C   1 
ATOM   1513  O O   . ILE A 1 198 ? 0.002   -3.202  49.715  1.00 37.79  ? 198 ILE A O   1 
ATOM   1514  C CB  . ILE A 1 198 ? -2.918  -3.040  50.421  1.00 54.65  ? 198 ILE A CB  1 
ATOM   1515  C CG1 . ILE A 1 198 ? -4.332  -2.454  50.462  1.00 42.86  ? 198 ILE A CG1 1 
ATOM   1516  C CG2 . ILE A 1 198 ? -2.722  -4.011  51.584  1.00 42.41  ? 198 ILE A CG2 1 
ATOM   1517  C CD1 . ILE A 1 198 ? -5.423  -3.472  50.292  1.00 34.03  ? 198 ILE A CD1 1 
ATOM   1518  N N   . ILE A 1 199 ? 0.144   -2.337  51.773  1.00 46.50  ? 199 ILE A N   1 
ATOM   1519  C CA  . ILE A 1 199 ? 1.427   -2.973  52.009  1.00 35.64  ? 199 ILE A CA  1 
ATOM   1520  C C   . ILE A 1 199 ? 1.107   -4.199  52.853  1.00 35.89  ? 199 ILE A C   1 
ATOM   1521  O O   . ILE A 1 199 ? 0.555   -4.069  53.942  1.00 37.49  ? 199 ILE A O   1 
ATOM   1522  C CB  . ILE A 1 199 ? 2.388   -2.095  52.804  1.00 27.02  ? 199 ILE A CB  1 
ATOM   1523  C CG1 . ILE A 1 199 ? 2.536   -0.728  52.147  1.00 29.53  ? 199 ILE A CG1 1 
ATOM   1524  C CG2 . ILE A 1 199 ? 3.737   -2.775  52.866  1.00 32.37  ? 199 ILE A CG2 1 
ATOM   1525  C CD1 . ILE A 1 199 ? 3.360   0.249   52.962  1.00 35.14  ? 199 ILE A CD1 1 
ATOM   1526  N N   . ALA A 1 200 ? 1.423   -5.386  52.341  1.00 35.78  ? 200 ALA A N   1 
ATOM   1527  C CA  . ALA A 1 200 ? 1.171   -6.620  53.080  1.00 37.00  ? 200 ALA A CA  1 
ATOM   1528  C C   . ALA A 1 200 ? 2.316   -6.846  54.065  1.00 29.54  ? 200 ALA A C   1 
ATOM   1529  O O   . ALA A 1 200 ? 3.479   -6.816  53.690  1.00 37.10  ? 200 ALA A O   1 
ATOM   1530  C CB  . ALA A 1 200 ? 1.063   -7.792  52.124  1.00 35.09  ? 200 ALA A CB  1 
ATOM   1531  N N   . SER A 1 201 ? 1.986   -7.079  55.326  1.00 38.91  ? 201 SER A N   1 
ATOM   1532  C CA  . SER A 1 201 ? 3.011   -7.285  56.332  1.00 30.67  ? 201 SER A CA  1 
ATOM   1533  C C   . SER A 1 201 ? 2.719   -8.446  57.254  1.00 37.82  ? 201 SER A C   1 
ATOM   1534  O O   . SER A 1 201 ? 1.608   -8.577  57.752  1.00 26.81  ? 201 SER A O   1 
ATOM   1535  C CB  . SER A 1 201 ? 3.176   -6.018  57.178  1.00 40.89  ? 201 SER A CB  1 
ATOM   1536  O OG  . SER A 1 201 ? 4.177   -6.181  58.165  1.00 35.73  ? 201 SER A OG  1 
ATOM   1537  N N   . GLY A 1 202 ? 3.726   -9.286  57.478  1.00 36.12  ? 202 GLY A N   1 
ATOM   1538  C CA  . GLY A 1 202 ? 3.555   -10.397 58.392  1.00 29.40  ? 202 GLY A CA  1 
ATOM   1539  C C   . GLY A 1 202 ? 3.434   -11.788 57.812  1.00 45.26  ? 202 GLY A C   1 
ATOM   1540  O O   . GLY A 1 202 ? 2.499   -12.082 57.073  1.00 37.11  ? 202 GLY A O   1 
ATOM   1541  N N   . GLY A 1 203 ? 4.393   -12.646 58.152  1.00 44.73  ? 203 GLY A N   1 
ATOM   1542  C CA  . GLY A 1 203 ? 4.368   -14.020 57.687  1.00 36.35  ? 203 GLY A CA  1 
ATOM   1543  C C   . GLY A 1 203 ? 5.346   -14.378 56.592  1.00 46.64  ? 203 GLY A C   1 
ATOM   1544  O O   . GLY A 1 203 ? 5.527   -15.555 56.293  1.00 36.81  ? 203 GLY A O   1 
ATOM   1545  N N   . ALA A 1 204 ? 5.985   -13.379 55.993  1.00 47.74  ? 204 ALA A N   1 
ATOM   1546  C CA  . ALA A 1 204 ? 6.932   -13.636 54.913  1.00 39.91  ? 204 ALA A CA  1 
ATOM   1547  C C   . ALA A 1 204 ? 7.927   -14.724 55.311  1.00 50.29  ? 204 ALA A C   1 
ATOM   1548  O O   . ALA A 1 204 ? 8.563   -14.640 56.360  1.00 43.98  ? 204 ALA A O   1 
ATOM   1549  C CB  . ALA A 1 204 ? 7.664   -12.349 54.535  1.00 35.51  ? 204 ALA A CB  1 
ATOM   1550  N N   . GLY A 1 205 ? 8.039   -15.753 54.470  1.00 52.94  ? 205 GLY A N   1 
ATOM   1551  C CA  . GLY A 1 205 ? 8.953   -16.851 54.737  1.00 44.78  ? 205 GLY A CA  1 
ATOM   1552  C C   . GLY A 1 205 ? 9.777   -17.289 53.532  1.00 49.09  ? 205 GLY A C   1 
ATOM   1553  O O   . GLY A 1 205 ? 10.920  -17.722 53.685  1.00 44.78  ? 205 GLY A O   1 
ATOM   1554  N N   . LYS A 1 206 ? 9.201   -17.194 52.335  1.00 44.04  ? 206 LYS A N   1 
ATOM   1555  C CA  . LYS A 1 206 ? 9.906   -17.571 51.110  1.00 41.79  ? 206 LYS A CA  1 
ATOM   1556  C C   . LYS A 1 206 ? 9.373   -16.811 49.897  1.00 42.14  ? 206 LYS A C   1 
ATOM   1557  O O   . LYS A 1 206 ? 8.324   -16.165 49.966  1.00 45.01  ? 206 LYS A O   1 
ATOM   1558  C CB  . LYS A 1 206 ? 9.804   -19.081 50.860  1.00 47.49  ? 206 LYS A CB  1 
ATOM   1559  C CG  . LYS A 1 206 ? 8.396   -19.623 50.767  1.00 51.44  ? 206 LYS A CG  1 
ATOM   1560  C CD  . LYS A 1 206 ? 8.419   -21.089 50.396  1.00 52.34  ? 206 LYS A CD  1 
ATOM   1561  C CE  . LYS A 1 206 ? 7.092   -21.768 50.687  1.00 44.22  ? 206 LYS A CE  1 
ATOM   1562  N NZ  . LYS A 1 206 ? 7.144   -23.215 50.369  1.00 45.45  ? 206 LYS A NZ  1 
ATOM   1563  N N   . MET A 1 207 ? 10.095  -16.903 48.788  1.00 28.28  ? 207 MET A N   1 
ATOM   1564  C CA  . MET A 1 207 ? 9.718   -16.206 47.567  1.00 42.22  ? 207 MET A CA  1 
ATOM   1565  C C   . MET A 1 207 ? 8.257   -16.335 47.141  1.00 44.32  ? 207 MET A C   1 
ATOM   1566  O O   . MET A 1 207 ? 7.616   -15.335 46.835  1.00 37.49  ? 207 MET A O   1 
ATOM   1567  C CB  . MET A 1 207 ? 10.627  -16.637 46.407  1.00 40.99  ? 207 MET A CB  1 
ATOM   1568  C CG  . MET A 1 207 ? 12.088  -16.247 46.592  1.00 42.61  ? 207 MET A CG  1 
ATOM   1569  S SD  . MET A 1 207 ? 13.083  -16.466 45.092  1.00 54.37  ? 207 MET A SD  1 
ATOM   1570  C CE  . MET A 1 207 ? 13.805  -18.069 45.368  1.00 47.16  ? 207 MET A CE  1 
ATOM   1571  N N   . GLU A 1 208 ? 7.725   -17.552 47.125  1.00 35.45  ? 208 GLU A N   1 
ATOM   1572  C CA  . GLU A 1 208 ? 6.348   -17.755 46.698  1.00 34.09  ? 208 GLU A CA  1 
ATOM   1573  C C   . GLU A 1 208 ? 5.297   -17.018 47.534  1.00 45.91  ? 208 GLU A C   1 
ATOM   1574  O O   . GLU A 1 208 ? 4.225   -16.691 47.029  1.00 41.56  ? 208 GLU A O   1 
ATOM   1575  C CB  . GLU A 1 208 ? 6.029   -19.256 46.633  1.00 37.96  ? 208 GLU A CB  1 
ATOM   1576  C CG  . GLU A 1 208 ? 6.878   -20.024 45.623  1.00 33.77  ? 208 GLU A CG  1 
ATOM   1577  C CD  . GLU A 1 208 ? 8.166   -20.588 46.208  1.00 50.72  ? 208 GLU A CD  1 
ATOM   1578  O OE1 . GLU A 1 208 ? 8.714   -19.989 47.162  1.00 39.18  ? 208 GLU A OE1 1 
ATOM   1579  O OE2 . GLU A 1 208 ? 8.641   -21.627 45.701  1.00 42.05  ? 208 GLU A OE2 1 
ATOM   1580  N N   . HIS A 1 209 ? 5.598   -16.752 48.801  1.00 38.76  ? 209 HIS A N   1 
ATOM   1581  C CA  . HIS A 1 209 ? 4.669   -16.031 49.676  1.00 45.69  ? 209 HIS A CA  1 
ATOM   1582  C C   . HIS A 1 209 ? 4.406   -14.634 49.116  1.00 51.15  ? 209 HIS A C   1 
ATOM   1583  O O   . HIS A 1 209 ? 3.316   -14.077 49.280  1.00 41.23  ? 209 HIS A O   1 
ATOM   1584  C CB  . HIS A 1 209 ? 5.254   -15.910 51.085  1.00 30.81  ? 209 HIS A CB  1 
ATOM   1585  C CG  . HIS A 1 209 ? 5.314   -17.210 51.823  1.00 54.44  ? 209 HIS A CG  1 
ATOM   1586  N ND1 . HIS A 1 209 ? 6.254   -17.470 52.798  1.00 41.27  ? 209 HIS A ND1 1 
ATOM   1587  C CD2 . HIS A 1 209 ? 4.538   -18.315 51.744  1.00 31.92  ? 209 HIS A CD2 1 
ATOM   1588  C CE1 . HIS A 1 209 ? 6.053   -18.679 53.287  1.00 38.97  ? 209 HIS A CE1 1 
ATOM   1589  N NE2 . HIS A 1 209 ? 5.018   -19.212 52.666  1.00 47.75  ? 209 HIS A NE2 1 
ATOM   1590  N N   . PHE A 1 210 ? 5.420   -14.070 48.465  1.00 32.55  ? 210 PHE A N   1 
ATOM   1591  C CA  . PHE A 1 210 ? 5.293   -12.752 47.868  1.00 39.50  ? 210 PHE A CA  1 
ATOM   1592  C C   . PHE A 1 210 ? 4.359   -12.827 46.678  1.00 34.33  ? 210 PHE A C   1 
ATOM   1593  O O   . PHE A 1 210 ? 3.557   -11.921 46.460  1.00 46.44  ? 210 PHE A O   1 
ATOM   1594  C CB  . PHE A 1 210 ? 6.663   -12.204 47.439  1.00 33.06  ? 210 PHE A CB  1 
ATOM   1595  C CG  . PHE A 1 210 ? 7.512   -11.739 48.587  1.00 38.27  ? 210 PHE A CG  1 
ATOM   1596  C CD1 . PHE A 1 210 ? 8.155   -12.654 49.412  1.00 30.08  ? 210 PHE A CD1 1 
ATOM   1597  C CD2 . PHE A 1 210 ? 7.644   -10.382 48.864  1.00 31.67  ? 210 PHE A CD2 1 
ATOM   1598  C CE1 . PHE A 1 210 ? 8.911   -12.227 50.488  1.00 40.54  ? 210 PHE A CE1 1 
ATOM   1599  C CE2 . PHE A 1 210 ? 8.394   -9.948  49.932  1.00 26.64  ? 210 PHE A CE2 1 
ATOM   1600  C CZ  . PHE A 1 210 ? 9.032   -10.871 50.748  1.00 44.88  ? 210 PHE A CZ  1 
ATOM   1601  N N   . LEU A 1 211 ? 4.449   -13.912 45.916  1.00 38.60  ? 211 LEU A N   1 
ATOM   1602  C CA  . LEU A 1 211 ? 3.581   -14.078 44.761  1.00 40.55  ? 211 LEU A CA  1 
ATOM   1603  C C   . LEU A 1 211 ? 2.138   -14.206 45.232  1.00 32.49  ? 211 LEU A C   1 
ATOM   1604  O O   . LEU A 1 211 ? 1.213   -13.718 44.584  1.00 40.28  ? 211 LEU A O   1 
ATOM   1605  C CB  . LEU A 1 211 ? 3.989   -15.311 43.948  1.00 34.49  ? 211 LEU A CB  1 
ATOM   1606  C CG  . LEU A 1 211 ? 3.034   -15.792 42.849  1.00 37.18  ? 211 LEU A CG  1 
ATOM   1607  C CD1 . LEU A 1 211 ? 2.736   -14.680 41.853  1.00 35.02  ? 211 LEU A CD1 1 
ATOM   1608  C CD2 . LEU A 1 211 ? 3.666   -16.975 42.144  1.00 46.00  ? 211 LEU A CD2 1 
ATOM   1609  N N   . GLU A 1 212 ? 1.963   -14.846 46.379  1.00 30.32  ? 212 GLU A N   1 
ATOM   1610  C CA  . GLU A 1 212 ? 0.647   -15.048 46.962  1.00 31.25  ? 212 GLU A CA  1 
ATOM   1611  C C   . GLU A 1 212 ? 0.020   -13.730 47.433  1.00 46.25  ? 212 GLU A C   1 
ATOM   1612  O O   . GLU A 1 212 ? -1.166  -13.480 47.205  1.00 37.25  ? 212 GLU A O   1 
ATOM   1613  C CB  . GLU A 1 212 ? 0.753   -16.047 48.129  1.00 43.27  ? 212 GLU A CB  1 
ATOM   1614  C CG  . GLU A 1 212 ? 1.206   -17.448 47.710  1.00 35.84  ? 212 GLU A CG  1 
ATOM   1615  C CD  . GLU A 1 212 ? 1.731   -18.298 48.869  1.00 45.94  ? 212 GLU A CD  1 
ATOM   1616  O OE1 . GLU A 1 212 ? 2.023   -19.494 48.646  1.00 48.43  ? 212 GLU A OE1 1 
ATOM   1617  O OE2 . GLU A 1 212 ? 1.860   -17.774 49.996  1.00 50.69  ? 212 GLU A OE2 1 
ATOM   1618  N N   . ALA A 1 213 ? 0.826   -12.886 48.073  1.00 32.57  ? 213 ALA A N   1 
ATOM   1619  C CA  . ALA A 1 213 ? 0.351   -11.607 48.581  1.00 31.53  ? 213 ALA A CA  1 
ATOM   1620  C C   . ALA A 1 213 ? -0.107  -10.712 47.437  1.00 44.09  ? 213 ALA A C   1 
ATOM   1621  O O   . ALA A 1 213 ? -1.140  -10.045 47.527  1.00 33.76  ? 213 ALA A O   1 
ATOM   1622  C CB  . ALA A 1 213 ? 1.445   -10.920 49.385  1.00 31.80  ? 213 ALA A CB  1 
ATOM   1623  N N   . PHE A 1 214 ? 0.665   -10.706 46.358  1.00 24.23  ? 214 PHE A N   1 
ATOM   1624  C CA  . PHE A 1 214 ? 0.321   -9.884  45.209  1.00 34.21  ? 214 PHE A CA  1 
ATOM   1625  C C   . PHE A 1 214 ? -0.911  -10.399 44.457  1.00 35.91  ? 214 PHE A C   1 
ATOM   1626  O O   . PHE A 1 214 ? -1.669  -9.611  43.897  1.00 46.24  ? 214 PHE A O   1 
ATOM   1627  C CB  . PHE A 1 214 ? 1.526   -9.751  44.266  1.00 24.57  ? 214 PHE A CB  1 
ATOM   1628  C CG  . PHE A 1 214 ? 2.663   -8.949  44.844  1.00 39.98  ? 214 PHE A CG  1 
ATOM   1629  C CD1 . PHE A 1 214 ? 2.481   -7.617  45.202  1.00 39.96  ? 214 PHE A CD1 1 
ATOM   1630  C CD2 . PHE A 1 214 ? 3.921   -9.523  45.024  1.00 34.00  ? 214 PHE A CD2 1 
ATOM   1631  C CE1 . PHE A 1 214 ? 3.543   -6.864  45.732  1.00 45.93  ? 214 PHE A CE1 1 
ATOM   1632  C CE2 . PHE A 1 214 ? 4.985   -8.788  45.550  1.00 36.70  ? 214 PHE A CE2 1 
ATOM   1633  C CZ  . PHE A 1 214 ? 4.799   -7.457  45.905  1.00 40.91  ? 214 PHE A CZ  1 
ATOM   1634  N N   . LEU A 1 215 ? -1.122  -11.710 44.448  1.00 34.01  ? 215 LEU A N   1 
ATOM   1635  C CA  . LEU A 1 215 ? -2.297  -12.256 43.779  1.00 42.73  ? 215 LEU A CA  1 
ATOM   1636  C C   . LEU A 1 215 ? -3.532  -11.878 44.595  1.00 45.33  ? 215 LEU A C   1 
ATOM   1637  O O   . LEU A 1 215 ? -4.641  -11.809 44.061  1.00 48.97  ? 215 LEU A O   1 
ATOM   1638  C CB  . LEU A 1 215 ? -2.208  -13.786 43.653  1.00 49.02  ? 215 LEU A CB  1 
ATOM   1639  C CG  . LEU A 1 215 ? -1.267  -14.401 42.605  1.00 57.74  ? 215 LEU A CG  1 
ATOM   1640  C CD1 . LEU A 1 215 ? -1.137  -15.893 42.819  1.00 43.73  ? 215 LEU A CD1 1 
ATOM   1641  C CD2 . LEU A 1 215 ? -1.803  -14.115 41.208  1.00 48.50  ? 215 LEU A CD2 1 
ATOM   1642  N N   . ALA A 1 216 ? -3.331  -11.624 45.887  1.00 45.58  ? 216 ALA A N   1 
ATOM   1643  C CA  . ALA A 1 216 ? -4.424  -11.244 46.778  1.00 42.28  ? 216 ALA A CA  1 
ATOM   1644  C C   . ALA A 1 216 ? -4.800  -9.771  46.618  1.00 38.84  ? 216 ALA A C   1 
ATOM   1645  O O   . ALA A 1 216 ? -5.858  -9.335  47.074  1.00 39.19  ? 216 ALA A O   1 
ATOM   1646  C CB  . ALA A 1 216 ? -4.047  -11.533 48.224  1.00 35.89  ? 216 ALA A CB  1 
ATOM   1647  N N   . GLY A 1 217 ? -3.930  -9.005  45.979  1.00 29.57  ? 217 GLY A N   1 
ATOM   1648  C CA  . GLY A 1 217 ? -4.231  -7.603  45.780  1.00 43.06  ? 217 GLY A CA  1 
ATOM   1649  C C   . GLY A 1 217 ? -3.279  -6.612  46.415  1.00 43.88  ? 217 GLY A C   1 
ATOM   1650  O O   . GLY A 1 217 ? -3.459  -5.408  46.275  1.00 45.47  ? 217 GLY A O   1 
ATOM   1651  N N   . ALA A 1 218 ? -2.266  -7.107  47.111  1.00 41.83  ? 218 ALA A N   1 
ATOM   1652  C CA  . ALA A 1 218 ? -1.299  -6.219  47.737  1.00 44.38  ? 218 ALA A CA  1 
ATOM   1653  C C   . ALA A 1 218 ? -0.518  -5.434  46.692  1.00 43.35  ? 218 ALA A C   1 
ATOM   1654  O O   . ALA A 1 218 ? -0.203  -5.936  45.609  1.00 34.72  ? 218 ALA A O   1 
ATOM   1655  C CB  . ALA A 1 218 ? -0.333  -7.012  48.618  1.00 34.28  ? 218 ALA A CB  1 
ATOM   1656  N N   . ASP A 1 219 ? -0.204  -4.195  47.044  1.00 41.55  ? 219 ASP A N   1 
ATOM   1657  C CA  . ASP A 1 219 ? 0.557   -3.295  46.189  1.00 44.06  ? 219 ASP A CA  1 
ATOM   1658  C C   . ASP A 1 219 ? 2.028   -3.386  46.558  1.00 35.00  ? 219 ASP A C   1 
ATOM   1659  O O   . ASP A 1 219 ? 2.898   -2.988  45.790  1.00 37.59  ? 219 ASP A O   1 
ATOM   1660  C CB  . ASP A 1 219 ? 0.065   -1.860  46.386  1.00 32.44  ? 219 ASP A CB  1 
ATOM   1661  C CG  . ASP A 1 219 ? -1.375  -1.688  45.962  1.00 52.66  ? 219 ASP A CG  1 
ATOM   1662  O OD1 . ASP A 1 219 ? -1.625  -1.726  44.739  1.00 42.79  ? 219 ASP A OD1 1 
ATOM   1663  O OD2 . ASP A 1 219 ? -2.256  -1.530  46.843  1.00 46.00  ? 219 ASP A OD2 1 
ATOM   1664  N N   . ALA A 1 220 ? 2.291   -3.924  47.746  1.00 38.61  ? 220 ALA A N   1 
ATOM   1665  C CA  . ALA A 1 220 ? 3.648   -4.055  48.237  1.00 31.26  ? 220 ALA A CA  1 
ATOM   1666  C C   . ALA A 1 220 ? 3.732   -5.111  49.326  1.00 30.23  ? 220 ALA A C   1 
ATOM   1667  O O   . ALA A 1 220 ? 2.791   -5.322  50.081  1.00 33.86  ? 220 ALA A O   1 
ATOM   1668  C CB  . ALA A 1 220 ? 4.138   -2.708  48.769  1.00 28.00  ? 220 ALA A CB  1 
ATOM   1669  N N   . ALA A 1 221 ? 4.872   -5.780  49.397  1.00 35.06  ? 221 ALA A N   1 
ATOM   1670  C CA  . ALA A 1 221 ? 5.071   -6.810  50.402  1.00 38.20  ? 221 ALA A CA  1 
ATOM   1671  C C   . ALA A 1 221 ? 6.227   -6.404  51.302  1.00 26.80  ? 221 ALA A C   1 
ATOM   1672  O O   . ALA A 1 221 ? 7.326   -6.152  50.830  1.00 29.06  ? 221 ALA A O   1 
ATOM   1673  C CB  . ALA A 1 221 ? 5.359   -8.138  49.734  1.00 34.50  ? 221 ALA A CB  1 
ATOM   1674  N N   . LEU A 1 222 ? 5.957   -6.330  52.597  1.00 28.64  ? 222 LEU A N   1 
ATOM   1675  C CA  . LEU A 1 222 ? 6.971   -5.958  53.581  1.00 37.16  ? 222 LEU A CA  1 
ATOM   1676  C C   . LEU A 1 222 ? 7.411   -7.172  54.386  1.00 53.80  ? 222 LEU A C   1 
ATOM   1677  O O   . LEU A 1 222 ? 6.618   -8.066  54.682  1.00 41.91  ? 222 LEU A O   1 
ATOM   1678  C CB  . LEU A 1 222 ? 6.433   -4.882  54.539  1.00 33.69  ? 222 LEU A CB  1 
ATOM   1679  C CG  . LEU A 1 222 ? 7.276   -4.352  55.709  1.00 34.12  ? 222 LEU A CG  1 
ATOM   1680  C CD1 . LEU A 1 222 ? 6.656   -3.077  56.215  1.00 46.26  ? 222 LEU A CD1 1 
ATOM   1681  C CD2 . LEU A 1 222 ? 7.341   -5.359  56.859  1.00 48.20  ? 222 LEU A CD2 1 
ATOM   1682  N N   . ALA A 1 223 ? 8.691   -7.186  54.735  1.00 52.08  ? 223 ALA A N   1 
ATOM   1683  C CA  . ALA A 1 223 ? 9.278   -8.251  55.528  1.00 51.92  ? 223 ALA A CA  1 
ATOM   1684  C C   . ALA A 1 223 ? 10.584  -7.722  56.110  1.00 41.89  ? 223 ALA A C   1 
ATOM   1685  O O   . ALA A 1 223 ? 11.154  -6.759  55.610  1.00 39.38  ? 223 ALA A O   1 
ATOM   1686  C CB  . ALA A 1 223 ? 9.534   -9.477  54.664  1.00 36.37  ? 223 ALA A CB  1 
ATOM   1687  N N   . ALA A 1 224 ? 11.048  -8.351  57.178  1.00 56.14  ? 224 ALA A N   1 
ATOM   1688  C CA  . ALA A 1 224 ? 12.285  -7.942  57.819  1.00 59.96  ? 224 ALA A CA  1 
ATOM   1689  C C   . ALA A 1 224 ? 13.229  -9.133  57.929  1.00 62.21  ? 224 ALA A C   1 
ATOM   1690  O O   . ALA A 1 224 ? 14.343  -9.101  57.411  1.00 67.39  ? 224 ALA A O   1 
ATOM   1691  C CB  . ALA A 1 224 ? 11.987  -7.386  59.194  1.00 62.15  ? 224 ALA A CB  1 
ATOM   1692  N N   . SER A 1 225 ? 12.773  -10.186 58.603  1.00 67.05  ? 225 SER A N   1 
ATOM   1693  C CA  . SER A 1 225 ? 13.583  -11.389 58.781  1.00 73.42  ? 225 SER A CA  1 
ATOM   1694  C C   . SER A 1 225 ? 14.289  -11.785 57.484  1.00 71.16  ? 225 SER A C   1 
ATOM   1695  O O   . SER A 1 225 ? 15.484  -11.530 57.288  1.00 69.96  ? 225 SER A O   1 
ATOM   1696  C CB  . SER A 1 225 ? 12.706  -12.571 59.254  1.00 86.67  ? 225 SER A CB  1 
ATOM   1697  O OG  . SER A 1 225 ? 12.203  -12.395 60.581  1.00 93.40  ? 225 SER A OG  1 
ATOM   1698  N N   . VAL A 1 226 ? 13.512  -12.392 56.597  1.00 50.46  ? 226 VAL A N   1 
ATOM   1699  C CA  . VAL A 1 226 ? 13.976  -12.893 55.314  1.00 47.66  ? 226 VAL A CA  1 
ATOM   1700  C C   . VAL A 1 226 ? 15.084  -12.176 54.533  1.00 49.01  ? 226 VAL A C   1 
ATOM   1701  O O   . VAL A 1 226 ? 15.978  -12.838 54.018  1.00 51.73  ? 226 VAL A O   1 
ATOM   1702  C CB  . VAL A 1 226 ? 12.774  -13.108 54.394  1.00 50.93  ? 226 VAL A CB  1 
ATOM   1703  C CG1 . VAL A 1 226 ? 11.860  -14.166 54.996  1.00 38.03  ? 226 VAL A CG1 1 
ATOM   1704  C CG2 . VAL A 1 226 ? 12.032  -11.806 54.205  1.00 45.01  ? 226 VAL A CG2 1 
ATOM   1705  N N   . PHE A 1 227 ? 15.043  -10.851 54.416  1.00 58.98  ? 227 PHE A N   1 
ATOM   1706  C CA  . PHE A 1 227 ? 16.090  -10.143 53.655  1.00 54.24  ? 227 PHE A CA  1 
ATOM   1707  C C   . PHE A 1 227 ? 17.375  -10.000 54.461  1.00 73.31  ? 227 PHE A C   1 
ATOM   1708  O O   . PHE A 1 227 ? 18.487  -10.115 53.922  1.00 66.84  ? 227 PHE A O   1 
ATOM   1709  C CB  . PHE A 1 227 ? 15.646  -8.732  53.245  1.00 44.99  ? 227 PHE A CB  1 
ATOM   1710  C CG  . PHE A 1 227 ? 14.350  -8.688  52.513  1.00 40.70  ? 227 PHE A CG  1 
ATOM   1711  C CD1 . PHE A 1 227 ? 14.081  -9.587  51.489  1.00 55.88  ? 227 PHE A CD1 1 
ATOM   1712  C CD2 . PHE A 1 227 ? 13.399  -7.737  52.836  1.00 38.30  ? 227 PHE A CD2 1 
ATOM   1713  C CE1 . PHE A 1 227 ? 12.885  -9.537  50.804  1.00 46.67  ? 227 PHE A CE1 1 
ATOM   1714  C CE2 . PHE A 1 227 ? 12.201  -7.679  52.155  1.00 61.49  ? 227 PHE A CE2 1 
ATOM   1715  C CZ  . PHE A 1 227 ? 11.942  -8.582  51.136  1.00 46.43  ? 227 PHE A CZ  1 
ATOM   1716  N N   . HIS A 1 228 ? 17.200  -9.714  55.751  1.00 77.10  ? 228 HIS A N   1 
ATOM   1717  C CA  . HIS A 1 228 ? 18.309  -9.530  56.679  1.00 70.85  ? 228 HIS A CA  1 
ATOM   1718  C C   . HIS A 1 228 ? 19.178  -10.800 56.665  1.00 76.28  ? 228 HIS A C   1 
ATOM   1719  O O   . HIS A 1 228 ? 20.301  -10.785 56.145  1.00 72.43  ? 228 HIS A O   1 
ATOM   1720  C CB  . HIS A 1 228 ? 17.732  -9.250  58.075  1.00 65.99  ? 228 HIS A CB  1 
ATOM   1721  C CG  . HIS A 1 228 ? 18.613  -8.410  58.953  1.00 93.52  ? 228 HIS A CG  1 
ATOM   1722  N ND1 . HIS A 1 228 ? 18.211  -7.970  60.198  1.00 88.44  ? 228 HIS A ND1 1 
ATOM   1723  C CD2 . HIS A 1 228 ? 19.884  -7.967  58.789  1.00 80.93  ? 228 HIS A CD2 1 
ATOM   1724  C CE1 . HIS A 1 228 ? 19.199  -7.297  60.764  1.00 67.13  ? 228 HIS A CE1 1 
ATOM   1725  N NE2 . HIS A 1 228 ? 20.225  -7.281  59.932  1.00 59.63  ? 228 HIS A NE2 1 
ATOM   1726  N N   . PHE A 1 229 ? 18.635  -11.896 57.203  1.00 77.55  ? 229 PHE A N   1 
ATOM   1727  C CA  . PHE A 1 229 ? 19.335  -13.192 57.277  1.00 74.85  ? 229 PHE A CA  1 
ATOM   1728  C C   . PHE A 1 229 ? 19.915  -13.641 55.929  1.00 70.17  ? 229 PHE A C   1 
ATOM   1729  O O   . PHE A 1 229 ? 20.738  -14.562 55.878  1.00 85.43  ? 229 PHE A O   1 
ATOM   1730  C CB  . PHE A 1 229 ? 18.391  -14.316 57.744  1.00 66.75  ? 229 PHE A CB  1 
ATOM   1731  C CG  . PHE A 1 229 ? 17.734  -14.078 59.077  1.00 89.35  ? 229 PHE A CG  1 
ATOM   1732  C CD1 . PHE A 1 229 ? 17.071  -12.879 59.353  1.00 94.01  ? 229 PHE A CD1 1 
ATOM   1733  C CD2 . PHE A 1 229 ? 17.701  -15.098 60.032  1.00 101.32 ? 229 PHE A CD2 1 
ATOM   1734  C CE1 . PHE A 1 229 ? 16.380  -12.704 60.559  1.00 103.07 ? 229 PHE A CE1 1 
ATOM   1735  C CE2 . PHE A 1 229 ? 17.012  -14.932 61.243  1.00 93.35  ? 229 PHE A CE2 1 
ATOM   1736  C CZ  . PHE A 1 229 ? 16.349  -13.734 61.506  1.00 79.99  ? 229 PHE A CZ  1 
ATOM   1737  N N   . ARG A 1 230 ? 19.471  -13.013 54.847  1.00 57.71  ? 230 ARG A N   1 
ATOM   1738  C CA  . ARG A 1 230 ? 19.924  -13.366 53.498  1.00 63.57  ? 230 ARG A CA  1 
ATOM   1739  C C   . ARG A 1 230 ? 19.118  -14.571 52.961  1.00 70.73  ? 230 ARG A C   1 
ATOM   1740  O O   . ARG A 1 230 ? 19.385  -15.068 51.860  1.00 60.57  ? 230 ARG A O   1 
ATOM   1741  C CB  . ARG A 1 230 ? 21.419  -13.705 53.509  1.00 64.16  ? 230 ARG A CB  1 
ATOM   1742  C CG  . ARG A 1 230 ? 22.174  -13.279 52.258  1.00 85.23  ? 230 ARG A CG  1 
ATOM   1743  C CD  . ARG A 1 230 ? 22.093  -11.774 52.086  1.00 88.90  ? 230 ARG A CD  1 
ATOM   1744  N NE  . ARG A 1 230 ? 23.303  -11.196 51.496  1.00 101.27 ? 230 ARG A NE  1 
ATOM   1745  C CZ  . ARG A 1 230 ? 24.466  -11.063 52.136  1.00 103.15 ? 230 ARG A CZ  1 
ATOM   1746  N NH1 . ARG A 1 230 ? 24.591  -11.473 53.397  1.00 92.04  ? 230 ARG A NH1 1 
ATOM   1747  N NH2 . ARG A 1 230 ? 25.503  -10.493 51.521  1.00 103.15 ? 230 ARG A NH2 1 
ATOM   1748  N N   . GLU A 1 231 ? 18.136  -15.024 53.747  1.00 53.54  ? 231 GLU A N   1 
ATOM   1749  C CA  . GLU A 1 231 ? 17.285  -16.158 53.387  1.00 63.73  ? 231 GLU A CA  1 
ATOM   1750  C C   . GLU A 1 231 ? 16.629  -15.971 52.026  1.00 59.50  ? 231 GLU A C   1 
ATOM   1751  O O   . GLU A 1 231 ? 16.212  -16.939 51.384  1.00 54.00  ? 231 GLU A O   1 
ATOM   1752  C CB  . GLU A 1 231 ? 16.209  -16.365 54.460  1.00 63.48  ? 231 GLU A CB  1 
ATOM   1753  C CG  . GLU A 1 231 ? 16.774  -16.737 55.816  1.00 44.60  ? 231 GLU A CG  1 
ATOM   1754  C CD  . GLU A 1 231 ? 15.766  -16.599 56.943  1.00 69.15  ? 231 GLU A CD  1 
ATOM   1755  O OE1 . GLU A 1 231 ? 16.167  -16.771 58.120  1.00 93.93  ? 231 GLU A OE1 1 
ATOM   1756  O OE2 . GLU A 1 231 ? 14.577  -16.323 56.661  1.00 77.22  ? 231 GLU A OE2 1 
ATOM   1757  N N   . ILE A 1 232 ? 16.548  -14.713 51.600  1.00 63.29  ? 232 ILE A N   1 
ATOM   1758  C CA  . ILE A 1 232 ? 15.963  -14.351 50.316  1.00 47.32  ? 232 ILE A CA  1 
ATOM   1759  C C   . ILE A 1 232 ? 16.835  -13.316 49.612  1.00 50.84  ? 232 ILE A C   1 
ATOM   1760  O O   . ILE A 1 232 ? 17.187  -12.286 50.184  1.00 54.14  ? 232 ILE A O   1 
ATOM   1761  C CB  . ILE A 1 232 ? 14.544  -13.742 50.479  1.00 56.52  ? 232 ILE A CB  1 
ATOM   1762  C CG1 . ILE A 1 232 ? 13.579  -14.789 51.030  1.00 57.18  ? 232 ILE A CG1 1 
ATOM   1763  C CG2 . ILE A 1 232 ? 14.051  -13.210 49.146  1.00 41.23  ? 232 ILE A CG2 1 
ATOM   1764  C CD1 . ILE A 1 232 ? 12.130  -14.324 51.120  1.00 54.57  ? 232 ILE A CD1 1 
ATOM   1765  N N   . ASP A 1 233 ? 17.196  -13.605 48.373  1.00 44.58  ? 233 ASP A N   1 
ATOM   1766  C CA  . ASP A 1 233 ? 17.981  -12.672 47.592  1.00 48.68  ? 233 ASP A CA  1 
ATOM   1767  C C   . ASP A 1 233 ? 16.920  -11.841 46.877  1.00 46.41  ? 233 ASP A C   1 
ATOM   1768  O O   . ASP A 1 233 ? 16.065  -12.386 46.191  1.00 56.35  ? 233 ASP A O   1 
ATOM   1769  C CB  . ASP A 1 233 ? 18.859  -13.421 46.582  1.00 38.57  ? 233 ASP A CB  1 
ATOM   1770  C CG  . ASP A 1 233 ? 19.751  -12.492 45.777  1.00 72.70  ? 233 ASP A CG  1 
ATOM   1771  O OD1 . ASP A 1 233 ? 20.665  -11.867 46.378  1.00 68.10  ? 233 ASP A OD1 1 
ATOM   1772  O OD2 . ASP A 1 233 ? 19.533  -12.385 44.546  1.00 51.42  ? 233 ASP A OD2 1 
ATOM   1773  N N   . VAL A 1 234 ? 16.962  -10.528 47.056  1.00 42.75  ? 234 VAL A N   1 
ATOM   1774  C CA  . VAL A 1 234 ? 15.982  -9.654  46.439  1.00 45.23  ? 234 VAL A CA  1 
ATOM   1775  C C   . VAL A 1 234 ? 15.995  -9.737  44.910  1.00 40.31  ? 234 VAL A C   1 
ATOM   1776  O O   . VAL A 1 234 ? 14.938  -9.700  44.286  1.00 48.34  ? 234 VAL A O   1 
ATOM   1777  C CB  . VAL A 1 234 ? 16.191  -8.208  46.917  1.00 48.98  ? 234 VAL A CB  1 
ATOM   1778  C CG1 . VAL A 1 234 ? 15.274  -7.263  46.179  1.00 32.17  ? 234 VAL A CG1 1 
ATOM   1779  C CG2 . VAL A 1 234 ? 15.926  -8.140  48.414  1.00 34.84  ? 234 VAL A CG2 1 
ATOM   1780  N N   . ARG A 1 235 ? 17.182  -9.865  44.320  1.00 40.77  ? 235 ARG A N   1 
ATOM   1781  C CA  . ARG A 1 235 ? 17.325  -9.987  42.866  1.00 38.68  ? 235 ARG A CA  1 
ATOM   1782  C C   . ARG A 1 235 ? 16.551  -11.229 42.382  1.00 47.65  ? 235 ARG A C   1 
ATOM   1783  O O   . ARG A 1 235 ? 15.741  -11.152 41.456  1.00 51.55  ? 235 ARG A O   1 
ATOM   1784  C CB  . ARG A 1 235 ? 18.806  -10.135 42.497  1.00 54.81  ? 235 ARG A CB  1 
ATOM   1785  C CG  . ARG A 1 235 ? 19.321  -9.265  41.338  1.00 66.62  ? 235 ARG A CG  1 
ATOM   1786  C CD  . ARG A 1 235 ? 18.702  -9.572  39.969  1.00 67.89  ? 235 ARG A CD  1 
ATOM   1787  N NE  . ARG A 1 235 ? 19.327  -8.803  38.881  1.00 77.03  ? 235 ARG A NE  1 
ATOM   1788  C CZ  . ARG A 1 235 ? 19.549  -7.481  38.903  1.00 103.15 ? 235 ARG A CZ  1 
ATOM   1789  N NH1 . ARG A 1 235 ? 19.205  -6.749  39.964  1.00 103.15 ? 235 ARG A NH1 1 
ATOM   1790  N NH2 . ARG A 1 235 ? 20.113  -6.872  37.857  1.00 95.58  ? 235 ARG A NH2 1 
ATOM   1791  N N   . GLU A 1 236 ? 16.812  -12.372 43.008  1.00 41.39  ? 236 GLU A N   1 
ATOM   1792  C CA  . GLU A 1 236 ? 16.127  -13.613 42.650  1.00 43.97  ? 236 GLU A CA  1 
ATOM   1793  C C   . GLU A 1 236 ? 14.613  -13.445 42.771  1.00 58.59  ? 236 GLU A C   1 
ATOM   1794  O O   . GLU A 1 236 ? 13.861  -13.850 41.881  1.00 50.33  ? 236 GLU A O   1 
ATOM   1795  C CB  . GLU A 1 236 ? 16.545  -14.752 43.578  1.00 54.54  ? 236 GLU A CB  1 
ATOM   1796  C CG  . GLU A 1 236 ? 17.904  -15.367 43.307  1.00 68.48  ? 236 GLU A CG  1 
ATOM   1797  C CD  . GLU A 1 236 ? 18.186  -16.526 44.254  1.00 82.68  ? 236 GLU A CD  1 
ATOM   1798  O OE1 . GLU A 1 236 ? 17.246  -17.320 44.511  1.00 64.91  ? 236 GLU A OE1 1 
ATOM   1799  O OE2 . GLU A 1 236 ? 19.339  -16.644 44.735  1.00 75.76  ? 236 GLU A OE2 1 
ATOM   1800  N N   . LEU A 1 237 ? 14.179  -12.862 43.887  1.00 44.46  ? 237 LEU A N   1 
ATOM   1801  C CA  . LEU A 1 237 ? 12.769  -12.639 44.140  1.00 29.82  ? 237 LEU A CA  1 
ATOM   1802  C C   . LEU A 1 237 ? 12.095  -11.793 43.068  1.00 35.36  ? 237 LEU A C   1 
ATOM   1803  O O   . LEU A 1 237 ? 11.016  -12.131 42.598  1.00 40.62  ? 237 LEU A O   1 
ATOM   1804  C CB  . LEU A 1 237 ? 12.580  -11.978 45.500  1.00 46.96  ? 237 LEU A CB  1 
ATOM   1805  C CG  . LEU A 1 237 ? 11.138  -11.610 45.841  1.00 41.12  ? 237 LEU A CG  1 
ATOM   1806  C CD1 . LEU A 1 237 ? 10.280  -12.859 45.806  1.00 44.29  ? 237 LEU A CD1 1 
ATOM   1807  C CD2 . LEU A 1 237 ? 11.076  -10.948 47.197  1.00 38.89  ? 237 LEU A CD2 1 
ATOM   1808  N N   . LYS A 1 238 ? 12.721  -10.696 42.673  1.00 28.32  ? 238 LYS A N   1 
ATOM   1809  C CA  . LYS A 1 238 ? 12.122  -9.846  41.658  1.00 33.39  ? 238 LYS A CA  1 
ATOM   1810  C C   . LYS A 1 238 ? 12.021  -10.535 40.303  1.00 33.99  ? 238 LYS A C   1 
ATOM   1811  O O   . LYS A 1 238 ? 11.078  -10.301 39.554  1.00 47.04  ? 238 LYS A O   1 
ATOM   1812  C CB  . LYS A 1 238 ? 12.899  -8.542  41.532  1.00 36.59  ? 238 LYS A CB  1 
ATOM   1813  C CG  . LYS A 1 238 ? 12.806  -7.660  42.765  1.00 42.65  ? 238 LYS A CG  1 
ATOM   1814  C CD  . LYS A 1 238 ? 13.414  -6.300  42.508  1.00 44.30  ? 238 LYS A CD  1 
ATOM   1815  C CE  . LYS A 1 238 ? 13.016  -5.307  43.580  1.00 42.82  ? 238 LYS A CE  1 
ATOM   1816  N NZ  . LYS A 1 238 ? 13.397  -3.932  43.188  1.00 46.46  ? 238 LYS A NZ  1 
ATOM   1817  N N   . GLU A 1 239 ? 12.986  -11.398 39.998  1.00 46.85  ? 239 GLU A N   1 
ATOM   1818  C CA  . GLU A 1 239 ? 12.995  -12.120 38.735  1.00 28.99  ? 239 GLU A CA  1 
ATOM   1819  C C   . GLU A 1 239 ? 11.942  -13.226 38.764  1.00 48.46  ? 239 GLU A C   1 
ATOM   1820  O O   . GLU A 1 239 ? 11.318  -13.541 37.746  1.00 37.67  ? 239 GLU A O   1 
ATOM   1821  C CB  . GLU A 1 239 ? 14.399  -12.675 38.460  1.00 41.93  ? 239 GLU A CB  1 
ATOM   1822  C CG  . GLU A 1 239 ? 15.420  -11.568 38.160  1.00 48.94  ? 239 GLU A CG  1 
ATOM   1823  C CD  . GLU A 1 239 ? 16.862  -12.048 38.010  1.00 83.07  ? 239 GLU A CD  1 
ATOM   1824  O OE1 . GLU A 1 239 ? 17.404  -12.679 38.953  1.00 68.02  ? 239 GLU A OE1 1 
ATOM   1825  O OE2 . GLU A 1 239 ? 17.465  -11.767 36.944  1.00 96.31  ? 239 GLU A OE2 1 
ATOM   1826  N N   . TYR A 1 240 ? 11.723  -13.789 39.944  1.00 34.92  ? 240 TYR A N   1 
ATOM   1827  C CA  . TYR A 1 240 ? 10.727  -14.829 40.105  1.00 38.62  ? 240 TYR A CA  1 
ATOM   1828  C C   . TYR A 1 240 ? 9.336   -14.232 39.952  1.00 44.01  ? 240 TYR A C   1 
ATOM   1829  O O   . TYR A 1 240 ? 8.472   -14.800 39.288  1.00 52.99  ? 240 TYR A O   1 
ATOM   1830  C CB  . TYR A 1 240 ? 10.847  -15.461 41.482  1.00 40.95  ? 240 TYR A CB  1 
ATOM   1831  C CG  . TYR A 1 240 ? 9.720   -16.402 41.799  1.00 49.22  ? 240 TYR A CG  1 
ATOM   1832  C CD1 . TYR A 1 240 ? 9.742   -17.716 41.352  1.00 32.57  ? 240 TYR A CD1 1 
ATOM   1833  C CD2 . TYR A 1 240 ? 8.629   -15.975 42.554  1.00 23.17  ? 240 TYR A CD2 1 
ATOM   1834  C CE1 . TYR A 1 240 ? 8.708   -18.593 41.653  1.00 30.30  ? 240 TYR A CE1 1 
ATOM   1835  C CE2 . TYR A 1 240 ? 7.593   -16.834 42.861  1.00 38.03  ? 240 TYR A CE2 1 
ATOM   1836  C CZ  . TYR A 1 240 ? 7.633   -18.147 42.411  1.00 49.56  ? 240 TYR A CZ  1 
ATOM   1837  O OH  . TYR A 1 240 ? 6.606   -19.012 42.727  1.00 49.71  ? 240 TYR A OH  1 
ATOM   1838  N N   . LEU A 1 241 ? 9.117   -13.086 40.581  1.00 47.87  ? 241 LEU A N   1 
ATOM   1839  C CA  . LEU A 1 241 ? 7.830   -12.434 40.501  1.00 35.99  ? 241 LEU A CA  1 
ATOM   1840  C C   . LEU A 1 241 ? 7.529   -11.990 39.073  1.00 41.66  ? 241 LEU A C   1 
ATOM   1841  O O   . LEU A 1 241 ? 6.397   -12.122 38.603  1.00 41.52  ? 241 LEU A O   1 
ATOM   1842  C CB  . LEU A 1 241 ? 7.799   -11.247 41.454  1.00 27.26  ? 241 LEU A CB  1 
ATOM   1843  C CG  . LEU A 1 241 ? 7.953   -11.708 42.900  1.00 35.15  ? 241 LEU A CG  1 
ATOM   1844  C CD1 . LEU A 1 241 ? 8.077   -10.523 43.839  1.00 26.24  ? 241 LEU A CD1 1 
ATOM   1845  C CD2 . LEU A 1 241 ? 6.766   -12.574 43.259  1.00 31.30  ? 241 LEU A CD2 1 
ATOM   1846  N N   . LYS A 1 242 ? 8.540   -11.472 38.382  1.00 31.22  ? 242 LYS A N   1 
ATOM   1847  C CA  . LYS A 1 242 ? 8.355   -11.021 37.006  1.00 39.27  ? 242 LYS A CA  1 
ATOM   1848  C C   . LYS A 1 242 ? 8.022   -12.196 36.073  1.00 48.15  ? 242 LYS A C   1 
ATOM   1849  O O   . LYS A 1 242 ? 7.192   -12.081 35.165  1.00 33.71  ? 242 LYS A O   1 
ATOM   1850  C CB  . LYS A 1 242 ? 9.615   -10.310 36.510  1.00 31.43  ? 242 LYS A CB  1 
ATOM   1851  C CG  . LYS A 1 242 ? 9.587   -9.952  35.027  1.00 42.44  ? 242 LYS A CG  1 
ATOM   1852  C CD  . LYS A 1 242 ? 8.540   -8.883  34.701  1.00 59.34  ? 242 LYS A CD  1 
ATOM   1853  C CE  . LYS A 1 242 ? 8.989   -7.510  35.175  1.00 72.27  ? 242 LYS A CE  1 
ATOM   1854  N NZ  . LYS A 1 242 ? 7.954   -6.449  34.967  1.00 90.09  ? 242 LYS A NZ  1 
ATOM   1855  N N   . LYS A 1 243 ? 8.692   -13.319 36.300  1.00 40.29  ? 243 LYS A N   1 
ATOM   1856  C CA  . LYS A 1 243 ? 8.478   -14.508 35.500  1.00 42.00  ? 243 LYS A CA  1 
ATOM   1857  C C   . LYS A 1 243 ? 7.002   -14.924 35.549  1.00 40.02  ? 243 LYS A C   1 
ATOM   1858  O O   . LYS A 1 243 ? 6.445   -15.391 34.553  1.00 40.07  ? 243 LYS A O   1 
ATOM   1859  C CB  . LYS A 1 243 ? 9.357   -15.652 36.016  1.00 33.24  ? 243 LYS A CB  1 
ATOM   1860  C CG  . LYS A 1 243 ? 9.198   -16.925 35.203  1.00 53.64  ? 243 LYS A CG  1 
ATOM   1861  C CD  . LYS A 1 243 ? 9.886   -18.113 35.826  1.00 46.34  ? 243 LYS A CD  1 
ATOM   1862  C CE  . LYS A 1 243 ? 9.789   -19.312 34.906  1.00 43.73  ? 243 LYS A CE  1 
ATOM   1863  N NZ  . LYS A 1 243 ? 10.410  -20.534 35.508  1.00 89.03  ? 243 LYS A NZ  1 
ATOM   1864  N N   . HIS A 1 244 ? 6.369   -14.722 36.702  1.00 31.16  ? 244 HIS A N   1 
ATOM   1865  C CA  . HIS A 1 244 ? 4.980   -15.109 36.882  1.00 34.93  ? 244 HIS A CA  1 
ATOM   1866  C C   . HIS A 1 244 ? 3.914   -14.012 36.815  1.00 26.13  ? 244 HIS A C   1 
ATOM   1867  O O   . HIS A 1 244 ? 2.919   -14.064 37.517  1.00 41.50  ? 244 HIS A O   1 
ATOM   1868  C CB  . HIS A 1 244 ? 4.850   -15.913 38.180  1.00 31.04  ? 244 HIS A CB  1 
ATOM   1869  C CG  . HIS A 1 244 ? 5.708   -17.142 38.207  1.00 35.85  ? 244 HIS A CG  1 
ATOM   1870  N ND1 . HIS A 1 244 ? 5.531   -18.194 37.335  1.00 38.53  ? 244 HIS A ND1 1 
ATOM   1871  C CD2 . HIS A 1 244 ? 6.779   -17.467 38.970  1.00 47.31  ? 244 HIS A CD2 1 
ATOM   1872  C CE1 . HIS A 1 244 ? 6.455   -19.112 37.556  1.00 40.07  ? 244 HIS A CE1 1 
ATOM   1873  N NE2 . HIS A 1 244 ? 7.226   -18.696 38.544  1.00 44.04  ? 244 HIS A NE2 1 
ATOM   1874  N N   . GLY A 1 245 ? 4.131   -13.021 35.962  1.00 43.53  ? 245 GLY A N   1 
ATOM   1875  C CA  . GLY A 1 245 ? 3.154   -11.966 35.770  1.00 37.04  ? 245 GLY A CA  1 
ATOM   1876  C C   . GLY A 1 245 ? 3.081   -10.762 36.682  1.00 39.82  ? 245 GLY A C   1 
ATOM   1877  O O   . GLY A 1 245 ? 2.157   -9.969  36.548  1.00 43.00  ? 245 GLY A O   1 
ATOM   1878  N N   . VAL A 1 246 ? 4.018   -10.604 37.607  1.00 40.15  ? 246 VAL A N   1 
ATOM   1879  C CA  . VAL A 1 246 ? 3.960   -9.451  38.497  1.00 35.23  ? 246 VAL A CA  1 
ATOM   1880  C C   . VAL A 1 246 ? 4.930   -8.391  38.013  1.00 32.00  ? 246 VAL A C   1 
ATOM   1881  O O   . VAL A 1 246 ? 6.085   -8.689  37.734  1.00 37.91  ? 246 VAL A O   1 
ATOM   1882  C CB  . VAL A 1 246 ? 4.322   -9.811  39.952  1.00 53.77  ? 246 VAL A CB  1 
ATOM   1883  C CG1 . VAL A 1 246 ? 4.030   -8.618  40.862  1.00 30.66  ? 246 VAL A CG1 1 
ATOM   1884  C CG2 . VAL A 1 246 ? 3.554   -11.049 40.402  1.00 38.55  ? 246 VAL A CG2 1 
ATOM   1885  N N   . ASN A 1 247 ? 4.448   -7.162  37.889  1.00 32.86  ? 247 ASN A N   1 
ATOM   1886  C CA  . ASN A 1 247 ? 5.296   -6.061  37.447  1.00 40.05  ? 247 ASN A CA  1 
ATOM   1887  C C   . ASN A 1 247 ? 6.115   -5.526  38.631  1.00 37.74  ? 247 ASN A C   1 
ATOM   1888  O O   . ASN A 1 247 ? 5.573   -4.890  39.529  1.00 40.67  ? 247 ASN A O   1 
ATOM   1889  C CB  . ASN A 1 247 ? 4.445   -4.941  36.850  1.00 38.84  ? 247 ASN A CB  1 
ATOM   1890  C CG  . ASN A 1 247 ? 5.287   -3.856  36.212  1.00 56.25  ? 247 ASN A CG  1 
ATOM   1891  O OD1 . ASN A 1 247 ? 6.135   -4.132  35.359  1.00 59.29  ? 247 ASN A OD1 1 
ATOM   1892  N ND2 . ASN A 1 247 ? 5.056   -2.612  36.617  1.00 52.32  ? 247 ASN A ND2 1 
ATOM   1893  N N   . VAL A 1 248 ? 7.417   -5.798  38.615  1.00 41.41  ? 248 VAL A N   1 
ATOM   1894  C CA  . VAL A 1 248 ? 8.320   -5.373  39.677  1.00 38.67  ? 248 VAL A CA  1 
ATOM   1895  C C   . VAL A 1 248 ? 9.460   -4.478  39.164  1.00 59.72  ? 248 VAL A C   1 
ATOM   1896  O O   . VAL A 1 248 ? 9.731   -4.419  37.963  1.00 42.36  ? 248 VAL A O   1 
ATOM   1897  C CB  . VAL A 1 248 ? 8.942   -6.597  40.401  1.00 40.81  ? 248 VAL A CB  1 
ATOM   1898  C CG1 . VAL A 1 248 ? 7.889   -7.322  41.227  1.00 28.47  ? 248 VAL A CG1 1 
ATOM   1899  C CG2 . VAL A 1 248 ? 9.560   -7.534  39.381  1.00 35.24  ? 248 VAL A CG2 1 
ATOM   1900  N N   . ARG A 1 249 ? 10.113  -3.782  40.097  1.00 57.29  ? 249 ARG A N   1 
ATOM   1901  C CA  . ARG A 1 249 ? 11.222  -2.891  39.785  1.00 46.96  ? 249 ARG A CA  1 
ATOM   1902  C C   . ARG A 1 249 ? 12.441  -3.762  39.573  1.00 48.97  ? 249 ARG A C   1 
ATOM   1903  O O   . ARG A 1 249 ? 13.082  -4.216  40.522  1.00 53.25  ? 249 ARG A O   1 
ATOM   1904  C CB  . ARG A 1 249 ? 11.471  -1.927  40.947  1.00 59.10  ? 249 ARG A CB  1 
ATOM   1905  C CG  . ARG A 1 249 ? 11.833  -0.497  40.538  1.00 61.30  ? 249 ARG A CG  1 
ATOM   1906  C CD  . ARG A 1 249 ? 13.269  -0.129  40.886  1.00 52.06  ? 249 ARG A CD  1 
ATOM   1907  N NE  . ARG A 1 249 ? 13.631  -0.535  42.241  1.00 44.14  ? 249 ARG A NE  1 
ATOM   1908  C CZ  . ARG A 1 249 ? 14.805  -0.298  42.805  1.00 35.72  ? 249 ARG A CZ  1 
ATOM   1909  N NH1 . ARG A 1 249 ? 15.739  0.359   42.144  1.00 38.29  ? 249 ARG A NH1 1 
ATOM   1910  N NH2 . ARG A 1 249 ? 15.056  -0.755  44.013  1.00 36.92  ? 249 ARG A NH2 1 
ATOM   1911  N N   . LEU A 1 250 ? 12.749  -4.015  38.313  1.00 51.42  ? 250 LEU A N   1 
ATOM   1912  C CA  . LEU A 1 250 ? 13.886  -4.843  37.980  1.00 62.58  ? 250 LEU A CA  1 
ATOM   1913  C C   . LEU A 1 250 ? 14.998  -3.930  37.515  1.00 67.59  ? 250 LEU A C   1 
ATOM   1914  O O   . LEU A 1 250 ? 14.875  -3.262  36.491  1.00 69.79  ? 250 LEU A O   1 
ATOM   1915  C CB  . LEU A 1 250 ? 13.499  -5.816  36.874  1.00 76.62  ? 250 LEU A CB  1 
ATOM   1916  C CG  . LEU A 1 250 ? 13.703  -7.306  37.125  1.00 70.12  ? 250 LEU A CG  1 
ATOM   1917  C CD1 . LEU A 1 250 ? 12.884  -8.085  36.092  1.00 78.65  ? 250 LEU A CD1 1 
ATOM   1918  C CD2 . LEU A 1 250 ? 15.196  -7.658  37.049  1.00 75.36  ? 250 LEU A CD2 1 
ATOM   1919  N N   . GLU A 1 251 ? 16.073  -3.885  38.291  1.00 74.11  ? 251 GLU A N   1 
ATOM   1920  C CA  . GLU A 1 251 ? 17.212  -3.046  37.948  1.00 86.77  ? 251 GLU A CA  1 
ATOM   1921  C C   . GLU A 1 251 ? 17.787  -3.589  36.640  1.00 95.08  ? 251 GLU A C   1 
ATOM   1922  O O   . GLU A 1 251 ? 17.089  -3.624  35.610  1.00 95.61  ? 251 GLU A O   1 
ATOM   1923  C CB  . GLU A 1 251 ? 18.253  -3.102  39.077  1.00 96.06  ? 251 GLU A CB  1 
ATOM   1924  C CG  . GLU A 1 251 ? 17.700  -2.659  40.429  1.00 84.39  ? 251 GLU A CG  1 
ATOM   1925  C CD  . GLU A 1 251 ? 18.302  -3.424  41.597  1.00 84.79  ? 251 GLU A CD  1 
ATOM   1926  O OE1 . GLU A 1 251 ? 19.509  -3.245  41.888  1.00 81.95  ? 251 GLU A OE1 1 
ATOM   1927  O OE2 . GLU A 1 251 ? 17.552  -4.212  42.223  1.00 87.39  ? 251 GLU A OE2 1 
ATOM   1928  N N   . GLY A 1 252 ? 19.043  -4.026  36.670  1.00 96.77  ? 252 GLY A N   1 
ATOM   1929  C CA  . GLY A 1 252 ? 19.644  -4.551  35.458  1.00 94.07  ? 252 GLY A CA  1 
ATOM   1930  C C   . GLY A 1 252 ? 21.115  -4.212  35.341  1.00 96.84  ? 252 GLY A C   1 
ATOM   1931  O O   . GLY A 1 252 ? 21.604  -3.269  35.978  1.00 91.47  ? 252 GLY A O   1 
ATOM   1932  N N   . LEU A 1 253 ? 21.820  -4.982  34.516  1.00 98.96  ? 253 LEU A N   1 
ATOM   1933  C CA  . LEU A 1 253 ? 23.253  -4.791  34.306  1.00 99.77  ? 253 LEU A CA  1 
ATOM   1934  C C   . LEU A 1 253 ? 23.556  -4.534  32.832  1.00 99.74  ? 253 LEU A C   1 
ATOM   1935  O O   . LEU A 1 253 ? 24.000  -3.402  32.511  1.00 94.64  ? 253 LEU A O   1 
ATOM   1936  C CB  . LEU A 1 253 ? 24.023  -6.038  34.795  1.00 87.96  ? 253 LEU A CB  1 
ATOM   1937  O OXT . LEU A 1 253 ? 23.349  -5.469  32.016  1.00 102.43 ? 253 LEU A OXT 1 
ATOM   1938  N N   . MET B 2 1   ? 33.775  23.828  37.818  1.00 72.72  ? 1   MET B N   1 
ATOM   1939  C CA  . MET B 2 1   ? 32.305  23.558  37.893  1.00 71.41  ? 1   MET B CA  1 
ATOM   1940  C C   . MET B 2 1   ? 31.654  24.130  39.148  1.00 66.53  ? 1   MET B C   1 
ATOM   1941  O O   . MET B 2 1   ? 32.073  23.829  40.271  1.00 55.49  ? 1   MET B O   1 
ATOM   1942  C CB  . MET B 2 1   ? 32.043  22.049  37.837  1.00 78.73  ? 1   MET B CB  1 
ATOM   1943  C CG  . MET B 2 1   ? 31.187  21.627  36.653  1.00 84.16  ? 1   MET B CG  1 
ATOM   1944  S SD  . MET B 2 1   ? 29.455  22.070  36.921  1.00 94.27  ? 1   MET B SD  1 
ATOM   1945  C CE  . MET B 2 1   ? 28.772  20.384  37.281  1.00 79.49  ? 1   MET B CE  1 
ATOM   1946  N N   . ARG B 2 2   ? 30.634  24.959  38.932  1.00 50.64  ? 2   ARG B N   1 
ATOM   1947  C CA  . ARG B 2 2   ? 29.863  25.580  40.000  1.00 43.52  ? 2   ARG B CA  1 
ATOM   1948  C C   . ARG B 2 2   ? 28.414  25.117  39.873  1.00 61.29  ? 2   ARG B C   1 
ATOM   1949  O O   . ARG B 2 2   ? 27.744  25.434  38.879  1.00 44.16  ? 2   ARG B O   1 
ATOM   1950  C CB  . ARG B 2 2   ? 29.890  27.109  39.876  1.00 62.66  ? 2   ARG B CB  1 
ATOM   1951  C CG  . ARG B 2 2   ? 31.180  27.801  40.297  1.00 59.05  ? 2   ARG B CG  1 
ATOM   1952  C CD  . ARG B 2 2   ? 31.217  29.236  39.769  1.00 50.74  ? 2   ARG B CD  1 
ATOM   1953  N NE  . ARG B 2 2   ? 30.051  30.026  40.156  1.00 40.02  ? 2   ARG B NE  1 
ATOM   1954  C CZ  . ARG B 2 2   ? 29.739  30.317  41.414  1.00 52.03  ? 2   ARG B CZ  1 
ATOM   1955  N NH1 . ARG B 2 2   ? 30.512  29.876  42.399  1.00 52.54  ? 2   ARG B NH1 1 
ATOM   1956  N NH2 . ARG B 2 2   ? 28.669  31.059  41.692  1.00 53.69  ? 2   ARG B NH2 1 
ATOM   1957  N N   . ILE B 2 3   ? 27.927  24.367  40.862  1.00 45.30  ? 3   ILE B N   1 
ATOM   1958  C CA  . ILE B 2 3   ? 26.538  23.911  40.841  1.00 52.82  ? 3   ILE B CA  1 
ATOM   1959  C C   . ILE B 2 3   ? 25.758  24.641  41.922  1.00 50.68  ? 3   ILE B C   1 
ATOM   1960  O O   . ILE B 2 3   ? 26.227  24.767  43.045  1.00 54.42  ? 3   ILE B O   1 
ATOM   1961  C CB  . ILE B 2 3   ? 26.406  22.384  41.093  1.00 51.81  ? 3   ILE B CB  1 
ATOM   1962  C CG1 . ILE B 2 3   ? 26.843  21.614  39.853  1.00 52.93  ? 3   ILE B CG1 1 
ATOM   1963  C CG2 . ILE B 2 3   ? 24.970  22.028  41.453  1.00 40.11  ? 3   ILE B CG2 1 
ATOM   1964  C CD1 . ILE B 2 3   ? 26.839  20.121  40.043  1.00 59.17  ? 3   ILE B CD1 1 
ATOM   1965  N N   . GLY B 2 4   ? 24.569  25.118  41.572  1.00 53.89  ? 4   GLY B N   1 
ATOM   1966  C CA  . GLY B 2 4   ? 23.739  25.824  42.534  1.00 45.77  ? 4   GLY B CA  1 
ATOM   1967  C C   . GLY B 2 4   ? 22.369  25.179  42.656  1.00 48.82  ? 4   GLY B C   1 
ATOM   1968  O O   . GLY B 2 4   ? 21.849  24.632  41.696  1.00 50.61  ? 4   GLY B O   1 
ATOM   1969  N N   . ILE B 2 5   ? 21.773  25.263  43.838  1.00 46.09  ? 5   ILE B N   1 
ATOM   1970  C CA  . ILE B 2 5   ? 20.480  24.668  44.076  1.00 35.65  ? 5   ILE B CA  1 
ATOM   1971  C C   . ILE B 2 5   ? 19.503  25.614  44.788  1.00 49.20  ? 5   ILE B C   1 
ATOM   1972  O O   . ILE B 2 5   ? 19.646  25.886  45.982  1.00 52.47  ? 5   ILE B O   1 
ATOM   1973  C CB  . ILE B 2 5   ? 20.667  23.369  44.914  1.00 51.36  ? 5   ILE B CB  1 
ATOM   1974  C CG1 . ILE B 2 5   ? 21.596  22.416  44.160  1.00 44.67  ? 5   ILE B CG1 1 
ATOM   1975  C CG2 . ILE B 2 5   ? 19.323  22.711  45.201  1.00 40.67  ? 5   ILE B CG2 1 
ATOM   1976  C CD1 . ILE B 2 5   ? 21.968  21.176  44.911  1.00 49.84  ? 5   ILE B CD1 1 
ATOM   1977  N N   . ILE B 2 6   ? 18.511  26.127  44.066  1.00 48.26  ? 6   ILE B N   1 
ATOM   1978  C CA  . ILE B 2 6   ? 17.524  26.993  44.704  1.00 37.38  ? 6   ILE B CA  1 
ATOM   1979  C C   . ILE B 2 6   ? 16.927  26.204  45.887  1.00 45.63  ? 6   ILE B C   1 
ATOM   1980  O O   . ILE B 2 6   ? 16.471  25.068  45.727  1.00 57.85  ? 6   ILE B O   1 
ATOM   1981  C CB  . ILE B 2 6   ? 16.397  27.427  43.701  1.00 32.30  ? 6   ILE B CB  1 
ATOM   1982  C CG1 . ILE B 2 6   ? 16.888  28.567  42.802  1.00 40.22  ? 6   ILE B CG1 1 
ATOM   1983  C CG2 . ILE B 2 6   ? 15.184  27.955  44.457  1.00 40.65  ? 6   ILE B CG2 1 
ATOM   1984  C CD1 . ILE B 2 6   ? 18.047  28.215  41.899  1.00 68.67  ? 6   ILE B CD1 1 
ATOM   1985  N N   . SER B 2 7   ? 16.940  26.810  47.072  1.00 54.84  ? 7   SER B N   1 
ATOM   1986  C CA  . SER B 2 7   ? 16.446  26.152  48.279  1.00 45.09  ? 7   SER B CA  1 
ATOM   1987  C C   . SER B 2 7   ? 15.340  26.889  49.017  1.00 48.77  ? 7   SER B C   1 
ATOM   1988  O O   . SER B 2 7   ? 15.228  26.789  50.236  1.00 47.46  ? 7   SER B O   1 
ATOM   1989  C CB  . SER B 2 7   ? 17.616  25.896  49.244  1.00 60.20  ? 7   SER B CB  1 
ATOM   1990  O OG  . SER B 2 7   ? 18.357  27.078  49.512  1.00 53.97  ? 7   SER B OG  1 
ATOM   1991  N N   . VAL B 2 8   ? 14.507  27.609  48.277  1.00 53.59  ? 8   VAL B N   1 
ATOM   1992  C CA  . VAL B 2 8   ? 13.408  28.352  48.884  1.00 54.54  ? 8   VAL B CA  1 
ATOM   1993  C C   . VAL B 2 8   ? 12.027  27.736  48.635  1.00 64.82  ? 8   VAL B C   1 
ATOM   1994  O O   . VAL B 2 8   ? 11.214  27.651  49.562  1.00 55.11  ? 8   VAL B O   1 
ATOM   1995  C CB  . VAL B 2 8   ? 13.402  29.821  48.397  1.00 79.87  ? 8   VAL B CB  1 
ATOM   1996  C CG1 . VAL B 2 8   ? 14.416  30.638  49.184  1.00 57.01  ? 8   VAL B CG1 1 
ATOM   1997  C CG2 . VAL B 2 8   ? 13.732  29.879  46.903  1.00 81.01  ? 8   VAL B CG2 1 
ATOM   1998  N N   . GLY B 2 9   ? 11.772  27.322  47.385  1.00 83.78  ? 9   GLY B N   1 
ATOM   1999  C CA  . GLY B 2 9   ? 10.501  26.708  46.999  1.00 46.84  ? 9   GLY B CA  1 
ATOM   2000  C C   . GLY B 2 9   ? 10.108  25.708  48.064  1.00 59.78  ? 9   GLY B C   1 
ATOM   2001  O O   . GLY B 2 9   ? 10.991  25.188  48.743  1.00 62.90  ? 9   GLY B O   1 
ATOM   2002  N N   . PRO B 2 10  ? 8.811   25.390  48.229  1.00 58.65  ? 10  PRO B N   1 
ATOM   2003  C CA  . PRO B 2 10  ? 8.410   24.434  49.267  1.00 57.00  ? 10  PRO B CA  1 
ATOM   2004  C C   . PRO B 2 10  ? 8.930   23.014  49.101  1.00 52.62  ? 10  PRO B C   1 
ATOM   2005  O O   . PRO B 2 10  ? 9.463   22.637  48.050  1.00 46.93  ? 10  PRO B O   1 
ATOM   2006  C CB  . PRO B 2 10  ? 6.895   24.494  49.213  1.00 40.28  ? 10  PRO B CB  1 
ATOM   2007  C CG  . PRO B 2 10  ? 6.661   24.637  47.746  1.00 66.75  ? 10  PRO B CG  1 
ATOM   2008  C CD  . PRO B 2 10  ? 7.682   25.674  47.325  1.00 61.08  ? 10  PRO B CD  1 
ATOM   2009  N N   . GLY B 2 11  ? 8.760   22.236  50.165  1.00 41.50  ? 11  GLY B N   1 
ATOM   2010  C CA  . GLY B 2 11  ? 9.181   20.853  50.153  1.00 63.41  ? 11  GLY B CA  1 
ATOM   2011  C C   . GLY B 2 11  ? 10.617  20.611  50.550  1.00 49.55  ? 11  GLY B C   1 
ATOM   2012  O O   . GLY B 2 11  ? 11.363  21.535  50.855  1.00 64.07  ? 11  GLY B O   1 
ATOM   2013  N N   . ASN B 2 12  ? 11.001  19.347  50.565  1.00 51.94  ? 12  ASN B N   1 
ATOM   2014  C CA  . ASN B 2 12  ? 12.356  18.995  50.901  1.00 33.43  ? 12  ASN B CA  1 
ATOM   2015  C C   . ASN B 2 12  ? 13.188  19.226  49.649  1.00 51.16  ? 12  ASN B C   1 
ATOM   2016  O O   . ASN B 2 12  ? 12.767  18.899  48.530  1.00 57.22  ? 12  ASN B O   1 
ATOM   2017  C CB  . ASN B 2 12  ? 12.421  17.537  51.324  1.00 50.65  ? 12  ASN B CB  1 
ATOM   2018  C CG  . ASN B 2 12  ? 13.793  17.130  51.786  1.00 47.58  ? 12  ASN B CG  1 
ATOM   2019  O OD1 . ASN B 2 12  ? 14.786  17.349  51.096  1.00 51.45  ? 12  ASN B OD1 1 
ATOM   2020  N ND2 . ASN B 2 12  ? 13.858  16.518  52.957  1.00 50.56  ? 12  ASN B ND2 1 
ATOM   2021  N N   . ILE B 2 13  ? 14.360  19.818  49.836  1.00 51.97  ? 13  ILE B N   1 
ATOM   2022  C CA  . ILE B 2 13  ? 15.258  20.086  48.730  1.00 42.87  ? 13  ILE B CA  1 
ATOM   2023  C C   . ILE B 2 13  ? 16.652  19.654  49.141  1.00 45.11  ? 13  ILE B C   1 
ATOM   2024  O O   . ILE B 2 13  ? 17.569  19.587  48.321  1.00 53.06  ? 13  ILE B O   1 
ATOM   2025  C CB  . ILE B 2 13  ? 15.244  21.587  48.353  1.00 43.26  ? 13  ILE B CB  1 
ATOM   2026  C CG1 . ILE B 2 13  ? 15.446  22.451  49.601  1.00 42.36  ? 13  ILE B CG1 1 
ATOM   2027  C CG2 . ILE B 2 13  ? 13.918  21.947  47.689  1.00 70.09  ? 13  ILE B CG2 1 
ATOM   2028  C CD1 . ILE B 2 13  ? 16.895  22.736  49.913  1.00 49.25  ? 13  ILE B CD1 1 
ATOM   2029  N N   . MET B 2 14  ? 16.812  19.361  50.423  1.00 35.50  ? 14  MET B N   1 
ATOM   2030  C CA  . MET B 2 14  ? 18.100  18.926  50.910  1.00 42.50  ? 14  MET B CA  1 
ATOM   2031  C C   . MET B 2 14  ? 18.449  17.566  50.327  1.00 32.25  ? 14  MET B C   1 
ATOM   2032  O O   . MET B 2 14  ? 19.612  17.301  50.041  1.00 46.67  ? 14  MET B O   1 
ATOM   2033  C CB  . MET B 2 14  ? 18.097  18.893  52.429  1.00 35.75  ? 14  MET B CB  1 
ATOM   2034  C CG  . MET B 2 14  ? 18.333  20.267  53.021  1.00 66.61  ? 14  MET B CG  1 
ATOM   2035  S SD  . MET B 2 14  ? 19.855  20.929  52.358  1.00 56.78  ? 14  MET B SD  1 
ATOM   2036  C CE  . MET B 2 14  ? 21.071  19.941  53.283  1.00 55.91  ? 14  MET B CE  1 
ATOM   2037  N N   . ASN B 2 15  ? 17.440  16.718  50.134  1.00 39.33  ? 15  ASN B N   1 
ATOM   2038  C CA  . ASN B 2 15  ? 17.664  15.405  49.541  1.00 31.99  ? 15  ASN B CA  1 
ATOM   2039  C C   . ASN B 2 15  ? 18.279  15.614  48.166  1.00 27.13  ? 15  ASN B C   1 
ATOM   2040  O O   . ASN B 2 15  ? 19.279  14.982  47.828  1.00 43.40  ? 15  ASN B O   1 
ATOM   2041  C CB  . ASN B 2 15  ? 16.359  14.615  49.401  1.00 34.06  ? 15  ASN B CB  1 
ATOM   2042  C CG  . ASN B 2 15  ? 15.755  14.239  50.739  1.00 47.18  ? 15  ASN B CG  1 
ATOM   2043  O OD1 . ASN B 2 15  ? 16.470  14.003  51.711  1.00 63.25  ? 15  ASN B OD1 1 
ATOM   2044  N ND2 . ASN B 2 15  ? 14.430  14.164  50.792  1.00 47.50  ? 15  ASN B ND2 1 
ATOM   2045  N N   . LEU B 2 16  ? 17.682  16.508  47.377  1.00 40.98  ? 16  LEU B N   1 
ATOM   2046  C CA  . LEU B 2 16  ? 18.192  16.804  46.037  1.00 49.79  ? 16  LEU B CA  1 
ATOM   2047  C C   . LEU B 2 16  ? 19.642  17.245  46.167  1.00 36.73  ? 16  LEU B C   1 
ATOM   2048  O O   . LEU B 2 16  ? 20.514  16.723  45.483  1.00 48.20  ? 16  LEU B O   1 
ATOM   2049  C CB  . LEU B 2 16  ? 17.358  17.911  45.364  1.00 59.65  ? 16  LEU B CB  1 
ATOM   2050  C CG  . LEU B 2 16  ? 17.509  18.180  43.852  1.00 53.59  ? 16  LEU B CG  1 
ATOM   2051  C CD1 . LEU B 2 16  ? 18.881  18.742  43.537  1.00 60.97  ? 16  LEU B CD1 1 
ATOM   2052  C CD2 . LEU B 2 16  ? 17.281  16.896  43.081  1.00 60.27  ? 16  LEU B CD2 1 
ATOM   2053  N N   . TYR B 2 17  ? 19.883  18.201  47.060  1.00 48.55  ? 17  TYR B N   1 
ATOM   2054  C CA  . TYR B 2 17  ? 21.219  18.712  47.312  1.00 38.76  ? 17  TYR B CA  1 
ATOM   2055  C C   . TYR B 2 17  ? 22.165  17.565  47.644  1.00 42.24  ? 17  TYR B C   1 
ATOM   2056  O O   . TYR B 2 17  ? 23.249  17.473  47.078  1.00 49.14  ? 17  TYR B O   1 
ATOM   2057  C CB  . TYR B 2 17  ? 21.197  19.712  48.472  1.00 60.59  ? 17  TYR B CB  1 
ATOM   2058  C CG  . TYR B 2 17  ? 22.569  19.993  49.070  1.00 47.58  ? 17  TYR B CG  1 
ATOM   2059  C CD1 . TYR B 2 17  ? 23.501  20.780  48.397  1.00 59.17  ? 17  TYR B CD1 1 
ATOM   2060  C CD2 . TYR B 2 17  ? 22.942  19.433  50.288  1.00 47.32  ? 17  TYR B CD2 1 
ATOM   2061  C CE1 . TYR B 2 17  ? 24.774  21.001  48.920  1.00 57.23  ? 17  TYR B CE1 1 
ATOM   2062  C CE2 . TYR B 2 17  ? 24.204  19.642  50.816  1.00 74.80  ? 17  TYR B CE2 1 
ATOM   2063  C CZ  . TYR B 2 17  ? 25.121  20.428  50.129  1.00 69.35  ? 17  TYR B CZ  1 
ATOM   2064  O OH  . TYR B 2 17  ? 26.386  20.625  50.651  1.00 74.50  ? 17  TYR B OH  1 
ATOM   2065  N N   . ARG B 2 18  ? 21.761  16.686  48.557  1.00 47.87  ? 18  ARG B N   1 
ATOM   2066  C CA  . ARG B 2 18  ? 22.620  15.561  48.927  1.00 48.99  ? 18  ARG B CA  1 
ATOM   2067  C C   . ARG B 2 18  ? 22.848  14.605  47.767  1.00 53.66  ? 18  ARG B C   1 
ATOM   2068  O O   . ARG B 2 18  ? 23.983  14.192  47.496  1.00 44.78  ? 18  ARG B O   1 
ATOM   2069  C CB  . ARG B 2 18  ? 22.043  14.805  50.122  1.00 48.68  ? 18  ARG B CB  1 
ATOM   2070  C CG  . ARG B 2 18  ? 22.137  15.592  51.414  1.00 49.60  ? 18  ARG B CG  1 
ATOM   2071  C CD  . ARG B 2 18  ? 21.998  14.720  52.636  1.00 49.33  ? 18  ARG B CD  1 
ATOM   2072  N NE  . ARG B 2 18  ? 21.040  15.291  53.575  1.00 77.09  ? 18  ARG B NE  1 
ATOM   2073  C CZ  . ARG B 2 18  ? 19.721  15.295  53.392  1.00 73.13  ? 18  ARG B CZ  1 
ATOM   2074  N NH1 . ARG B 2 18  ? 19.198  14.749  52.303  1.00 76.72  ? 18  ARG B NH1 1 
ATOM   2075  N NH2 . ARG B 2 18  ? 18.924  15.850  54.297  1.00 69.46  ? 18  ARG B NH2 1 
ATOM   2076  N N   . GLY B 2 19  ? 21.768  14.255  47.079  1.00 50.78  ? 19  GLY B N   1 
ATOM   2077  C CA  . GLY B 2 19  ? 21.903  13.366  45.947  1.00 39.96  ? 19  GLY B CA  1 
ATOM   2078  C C   . GLY B 2 19  ? 22.903  13.967  44.988  1.00 41.70  ? 19  GLY B C   1 
ATOM   2079  O O   . GLY B 2 19  ? 23.758  13.264  44.468  1.00 53.99  ? 19  GLY B O   1 
ATOM   2080  N N   . VAL B 2 20  ? 22.804  15.275  44.772  1.00 43.47  ? 20  VAL B N   1 
ATOM   2081  C CA  . VAL B 2 20  ? 23.702  15.985  43.860  1.00 45.71  ? 20  VAL B CA  1 
ATOM   2082  C C   . VAL B 2 20  ? 25.150  16.083  44.334  1.00 47.31  ? 20  VAL B C   1 
ATOM   2083  O O   . VAL B 2 20  ? 26.071  16.007  43.527  1.00 42.26  ? 20  VAL B O   1 
ATOM   2084  C CB  . VAL B 2 20  ? 23.177  17.407  43.561  1.00 62.52  ? 20  VAL B CB  1 
ATOM   2085  C CG1 . VAL B 2 20  ? 24.214  18.201  42.759  1.00 47.33  ? 20  VAL B CG1 1 
ATOM   2086  C CG2 . VAL B 2 20  ? 21.867  17.312  42.776  1.00 40.50  ? 20  VAL B CG2 1 
ATOM   2087  N N   . LYS B 2 21  ? 25.356  16.271  45.635  1.00 44.91  ? 21  LYS B N   1 
ATOM   2088  C CA  . LYS B 2 21  ? 26.706  16.345  46.150  1.00 44.60  ? 21  LYS B CA  1 
ATOM   2089  C C   . LYS B 2 21  ? 27.314  14.966  46.027  1.00 46.22  ? 21  LYS B C   1 
ATOM   2090  O O   . LYS B 2 21  ? 28.485  14.810  45.666  1.00 50.63  ? 21  LYS B O   1 
ATOM   2091  C CB  . LYS B 2 21  ? 26.728  16.803  47.615  1.00 59.77  ? 21  LYS B CB  1 
ATOM   2092  C CG  . LYS B 2 21  ? 28.138  16.825  48.206  1.00 56.02  ? 21  LYS B CG  1 
ATOM   2093  C CD  . LYS B 2 21  ? 28.256  17.716  49.443  1.00 91.11  ? 21  LYS B CD  1 
ATOM   2094  C CE  . LYS B 2 21  ? 29.686  17.685  50.044  1.00 77.13  ? 21  LYS B CE  1 
ATOM   2095  N NZ  . LYS B 2 21  ? 30.769  17.985  49.037  1.00 55.19  ? 21  LYS B NZ  1 
ATOM   2096  N N   . ARG B 2 22  ? 26.508  13.956  46.310  1.00 42.24  ? 22  ARG B N   1 
ATOM   2097  C CA  . ARG B 2 22  ? 26.997  12.599  46.216  1.00 46.53  ? 22  ARG B CA  1 
ATOM   2098  C C   . ARG B 2 22  ? 27.323  12.273  44.765  1.00 44.23  ? 22  ARG B C   1 
ATOM   2099  O O   . ARG B 2 22  ? 28.182  11.451  44.474  1.00 55.38  ? 22  ARG B O   1 
ATOM   2100  C CB  . ARG B 2 22  ? 25.959  11.620  46.759  1.00 39.23  ? 22  ARG B CB  1 
ATOM   2101  C CG  . ARG B 2 22  ? 26.582  10.518  47.589  1.00 67.57  ? 22  ARG B CG  1 
ATOM   2102  C CD  . ARG B 2 22  ? 25.585  9.445   48.012  1.00 66.20  ? 22  ARG B CD  1 
ATOM   2103  N NE  . ARG B 2 22  ? 24.584  9.945   48.947  1.00 80.40  ? 22  ARG B NE  1 
ATOM   2104  C CZ  . ARG B 2 22  ? 23.473  10.581  48.594  1.00 57.61  ? 22  ARG B CZ  1 
ATOM   2105  N NH1 . ARG B 2 22  ? 23.209  10.797  47.318  1.00 61.33  ? 22  ARG B NH1 1 
ATOM   2106  N NH2 . ARG B 2 22  ? 22.624  10.996  49.523  1.00 66.19  ? 22  ARG B NH2 1 
ATOM   2107  N N   . ALA B 2 23  ? 26.645  12.933  43.843  1.00 52.56  ? 23  ALA B N   1 
ATOM   2108  C CA  . ALA B 2 23  ? 26.889  12.672  42.441  1.00 45.29  ? 23  ALA B CA  1 
ATOM   2109  C C   . ALA B 2 23  ? 28.101  13.447  41.958  1.00 54.81  ? 23  ALA B C   1 
ATOM   2110  O O   . ALA B 2 23  ? 28.963  12.904  41.262  1.00 55.73  ? 23  ALA B O   1 
ATOM   2111  C CB  . ALA B 2 23  ? 25.667  13.045  41.631  1.00 58.85  ? 23  ALA B CB  1 
ATOM   2112  N N   . SER B 2 24  ? 28.171  14.720  42.337  1.00 61.57  ? 24  SER B N   1 
ATOM   2113  C CA  . SER B 2 24  ? 29.281  15.574  41.924  1.00 73.03  ? 24  SER B CA  1 
ATOM   2114  C C   . SER B 2 24  ? 30.585  15.116  42.541  1.00 60.63  ? 24  SER B C   1 
ATOM   2115  O O   . SER B 2 24  ? 31.629  15.715  42.291  1.00 82.06  ? 24  SER B O   1 
ATOM   2116  C CB  . SER B 2 24  ? 29.022  17.033  42.307  1.00 60.04  ? 24  SER B CB  1 
ATOM   2117  O OG  . SER B 2 24  ? 29.037  17.196  43.711  1.00 67.98  ? 24  SER B OG  1 
ATOM   2118  N N   . GLU B 2 25  ? 30.510  14.055  43.342  1.00 67.55  ? 25  GLU B N   1 
ATOM   2119  C CA  . GLU B 2 25  ? 31.675  13.467  44.014  1.00 71.97  ? 25  GLU B CA  1 
ATOM   2120  C C   . GLU B 2 25  ? 32.827  13.210  43.056  1.00 59.88  ? 25  GLU B C   1 
ATOM   2121  O O   . GLU B 2 25  ? 33.810  13.946  43.037  1.00 74.38  ? 25  GLU B O   1 
ATOM   2122  C CB  . GLU B 2 25  ? 31.295  12.122  44.652  1.00 90.67  ? 25  GLU B CB  1 
ATOM   2123  C CG  . GLU B 2 25  ? 31.661  11.947  46.121  1.00 65.16  ? 25  GLU B CG  1 
ATOM   2124  C CD  . GLU B 2 25  ? 31.227  10.582  46.653  1.00 103.15 ? 25  GLU B CD  1 
ATOM   2125  O OE1 . GLU B 2 25  ? 30.122  10.115  46.265  1.00 77.73  ? 25  GLU B OE1 1 
ATOM   2126  O OE2 . GLU B 2 25  ? 31.977  9.974   47.464  1.00 102.64 ? 25  GLU B OE2 1 
ATOM   2127  N N   . ASN B 2 26  ? 32.684  12.144  42.271  1.00 65.90  ? 26  ASN B N   1 
ATOM   2128  C CA  . ASN B 2 26  ? 33.694  11.719  41.309  1.00 68.78  ? 26  ASN B CA  1 
ATOM   2129  C C   . ASN B 2 26  ? 33.894  12.679  40.153  1.00 73.10  ? 26  ASN B C   1 
ATOM   2130  O O   . ASN B 2 26  ? 33.826  12.278  38.989  1.00 82.46  ? 26  ASN B O   1 
ATOM   2131  C CB  . ASN B 2 26  ? 33.334  10.344  40.742  1.00 78.17  ? 26  ASN B CB  1 
ATOM   2132  C CG  . ASN B 2 26  ? 33.222  9.283   41.817  1.00 91.23  ? 26  ASN B CG  1 
ATOM   2133  O OD1 . ASN B 2 26  ? 34.230  8.827   42.377  1.00 48.06  ? 26  ASN B OD1 1 
ATOM   2134  N ND2 . ASN B 2 26  ? 31.984  8.891   42.125  1.00 87.80  ? 26  ASN B ND2 1 
ATOM   2135  N N   . PHE B 2 27  ? 34.127  13.944  40.467  1.00 63.52  ? 27  PHE B N   1 
ATOM   2136  C CA  . PHE B 2 27  ? 34.364  14.943  39.439  1.00 68.35  ? 27  PHE B CA  1 
ATOM   2137  C C   . PHE B 2 27  ? 35.341  15.967  39.975  1.00 65.63  ? 27  PHE B C   1 
ATOM   2138  O O   . PHE B 2 27  ? 35.423  16.200  41.181  1.00 69.84  ? 27  PHE B O   1 
ATOM   2139  C CB  . PHE B 2 27  ? 33.066  15.650  39.028  1.00 71.77  ? 27  PHE B CB  1 
ATOM   2140  C CG  . PHE B 2 27  ? 32.103  14.778  38.259  1.00 57.63  ? 27  PHE B CG  1 
ATOM   2141  C CD1 . PHE B 2 27  ? 31.280  13.873  38.917  1.00 70.27  ? 27  PHE B CD1 1 
ATOM   2142  C CD2 . PHE B 2 27  ? 32.018  14.868  36.870  1.00 82.17  ? 27  PHE B CD2 1 
ATOM   2143  C CE1 . PHE B 2 27  ? 30.385  13.070  38.200  1.00 83.44  ? 27  PHE B CE1 1 
ATOM   2144  C CE2 . PHE B 2 27  ? 31.126  14.068  36.148  1.00 61.67  ? 27  PHE B CE2 1 
ATOM   2145  C CZ  . PHE B 2 27  ? 30.310  13.170  36.818  1.00 57.92  ? 27  PHE B CZ  1 
ATOM   2146  N N   . GLU B 2 28  ? 36.074  16.584  39.058  1.00 86.46  ? 28  GLU B N   1 
ATOM   2147  C CA  . GLU B 2 28  ? 37.065  17.599  39.392  1.00 81.75  ? 28  GLU B CA  1 
ATOM   2148  C C   . GLU B 2 28  ? 36.403  18.924  39.703  1.00 72.15  ? 28  GLU B C   1 
ATOM   2149  O O   . GLU B 2 28  ? 35.290  19.186  39.245  1.00 94.81  ? 28  GLU B O   1 
ATOM   2150  C CB  . GLU B 2 28  ? 38.027  17.783  38.218  1.00 85.95  ? 28  GLU B CB  1 
ATOM   2151  C CG  . GLU B 2 28  ? 38.897  16.574  37.965  1.00 93.27  ? 28  GLU B CG  1 
ATOM   2152  C CD  . GLU B 2 28  ? 39.794  16.287  39.147  1.00 81.43  ? 28  GLU B CD  1 
ATOM   2153  O OE1 . GLU B 2 28  ? 41.029  16.456  39.022  1.00 74.58  ? 28  GLU B OE1 1 
ATOM   2154  O OE2 . GLU B 2 28  ? 39.254  15.905  40.202  1.00 69.28  ? 28  GLU B OE2 1 
ATOM   2155  N N   . ASP B 2 29  ? 37.099  19.746  40.483  1.00 78.49  ? 29  ASP B N   1 
ATOM   2156  C CA  . ASP B 2 29  ? 36.646  21.081  40.879  1.00 83.54  ? 29  ASP B CA  1 
ATOM   2157  C C   . ASP B 2 29  ? 35.160  21.336  40.591  1.00 91.97  ? 29  ASP B C   1 
ATOM   2158  O O   . ASP B 2 29  ? 34.803  22.107  39.687  1.00 84.53  ? 29  ASP B O   1 
ATOM   2159  C CB  . ASP B 2 29  ? 37.510  22.129  40.165  1.00 93.66  ? 29  ASP B CB  1 
ATOM   2160  C CG  . ASP B 2 29  ? 39.009  21.914  40.398  1.00 100.94 ? 29  ASP B CG  1 
ATOM   2161  O OD1 . ASP B 2 29  ? 39.505  20.775  40.174  1.00 77.04  ? 29  ASP B OD1 1 
ATOM   2162  O OD2 . ASP B 2 29  ? 39.691  22.890  40.799  1.00 86.40  ? 29  ASP B OD2 1 
ATOM   2163  N N   . VAL B 2 30  ? 34.298  20.676  41.363  1.00 91.04  ? 30  VAL B N   1 
ATOM   2164  C CA  . VAL B 2 30  ? 32.856  20.805  41.201  1.00 79.80  ? 30  VAL B CA  1 
ATOM   2165  C C   . VAL B 2 30  ? 32.287  21.081  42.581  1.00 69.11  ? 30  VAL B C   1 
ATOM   2166  O O   . VAL B 2 30  ? 32.405  20.256  43.481  1.00 77.07  ? 30  VAL B O   1 
ATOM   2167  C CB  . VAL B 2 30  ? 32.265  19.504  40.604  1.00 83.19  ? 30  VAL B CB  1 
ATOM   2168  C CG1 . VAL B 2 30  ? 32.731  18.306  41.436  1.00 100.05 ? 30  VAL B CG1 1 
ATOM   2169  C CG2 . VAL B 2 30  ? 30.743  19.581  40.541  1.00 52.86  ? 30  VAL B CG2 1 
ATOM   2170  N N   . SER B 2 31  ? 31.690  22.259  42.746  1.00 81.97  ? 31  SER B N   1 
ATOM   2171  C CA  . SER B 2 31  ? 31.130  22.667  44.031  1.00 76.99  ? 31  SER B CA  1 
ATOM   2172  C C   . SER B 2 31  ? 29.624  22.795  43.977  1.00 68.77  ? 31  SER B C   1 
ATOM   2173  O O   . SER B 2 31  ? 29.016  22.723  42.913  1.00 79.31  ? 31  SER B O   1 
ATOM   2174  C CB  . SER B 2 31  ? 31.700  24.014  44.457  1.00 70.89  ? 31  SER B CB  1 
ATOM   2175  O OG  . SER B 2 31  ? 31.187  25.025  43.609  1.00 68.18  ? 31  SER B OG  1 
ATOM   2176  N N   . ILE B 2 32  ? 29.030  23.021  45.138  1.00 54.61  ? 32  ILE B N   1 
ATOM   2177  C CA  . ILE B 2 32  ? 27.592  23.143  45.234  1.00 48.96  ? 32  ILE B CA  1 
ATOM   2178  C C   . ILE B 2 32  ? 27.229  24.251  46.209  1.00 42.25  ? 32  ILE B C   1 
ATOM   2179  O O   . ILE B 2 32  ? 27.798  24.346  47.287  1.00 49.02  ? 32  ILE B O   1 
ATOM   2180  C CB  . ILE B 2 32  ? 26.989  21.811  45.730  1.00 55.43  ? 32  ILE B CB  1 
ATOM   2181  C CG1 . ILE B 2 32  ? 27.602  20.663  44.940  1.00 65.45  ? 32  ILE B CG1 1 
ATOM   2182  C CG2 . ILE B 2 32  ? 25.480  21.814  45.575  1.00 49.77  ? 32  ILE B CG2 1 
ATOM   2183  C CD1 . ILE B 2 32  ? 27.202  19.290  45.431  1.00 74.08  ? 32  ILE B CD1 1 
ATOM   2184  N N   . GLU B 2 33  ? 26.275  25.084  45.824  1.00 42.55  ? 33  GLU B N   1 
ATOM   2185  C CA  . GLU B 2 33  ? 25.819  26.165  46.680  1.00 43.75  ? 33  GLU B CA  1 
ATOM   2186  C C   . GLU B 2 33  ? 24.297  26.171  46.735  1.00 53.44  ? 33  GLU B C   1 
ATOM   2187  O O   . GLU B 2 33  ? 23.629  25.914  45.738  1.00 50.41  ? 33  GLU B O   1 
ATOM   2188  C CB  . GLU B 2 33  ? 26.326  27.508  46.152  1.00 43.76  ? 33  GLU B CB  1 
ATOM   2189  C CG  . GLU B 2 33  ? 27.847  27.609  46.141  1.00 52.92  ? 33  GLU B CG  1 
ATOM   2190  C CD  . GLU B 2 33  ? 28.350  28.929  45.604  1.00 53.36  ? 33  GLU B CD  1 
ATOM   2191  O OE1 . GLU B 2 33  ? 27.881  29.989  46.075  1.00 83.24  ? 33  GLU B OE1 1 
ATOM   2192  O OE2 . GLU B 2 33  ? 29.223  28.915  44.716  1.00 60.55  ? 33  GLU B OE2 1 
ATOM   2193  N N   . LEU B 2 34  ? 23.756  26.424  47.920  1.00 55.16  ? 34  LEU B N   1 
ATOM   2194  C CA  . LEU B 2 34  ? 22.318  26.510  48.088  1.00 38.88  ? 34  LEU B CA  1 
ATOM   2195  C C   . LEU B 2 34  ? 21.943  27.940  47.700  1.00 44.80  ? 34  LEU B C   1 
ATOM   2196  O O   . LEU B 2 34  ? 22.176  28.868  48.464  1.00 58.42  ? 34  LEU B O   1 
ATOM   2197  C CB  . LEU B 2 34  ? 21.929  26.233  49.542  1.00 38.08  ? 34  LEU B CB  1 
ATOM   2198  C CG  . LEU B 2 34  ? 22.039  24.767  49.996  1.00 69.11  ? 34  LEU B CG  1 
ATOM   2199  C CD1 . LEU B 2 34  ? 21.735  24.641  51.479  1.00 48.94  ? 34  LEU B CD1 1 
ATOM   2200  C CD2 . LEU B 2 34  ? 21.069  23.912  49.187  1.00 45.82  ? 34  LEU B CD2 1 
ATOM   2201  N N   . VAL B 2 35  ? 21.399  28.110  46.495  1.00 54.17  ? 35  VAL B N   1 
ATOM   2202  C CA  . VAL B 2 35  ? 20.988  29.425  45.992  1.00 49.11  ? 35  VAL B CA  1 
ATOM   2203  C C   . VAL B 2 35  ? 19.711  29.879  46.689  1.00 49.65  ? 35  VAL B C   1 
ATOM   2204  O O   . VAL B 2 35  ? 18.606  29.539  46.263  1.00 51.91  ? 35  VAL B O   1 
ATOM   2205  C CB  . VAL B 2 35  ? 20.757  29.381  44.464  1.00 53.41  ? 35  VAL B CB  1 
ATOM   2206  C CG1 . VAL B 2 35  ? 20.315  30.748  43.941  1.00 44.86  ? 35  VAL B CG1 1 
ATOM   2207  C CG2 . VAL B 2 35  ? 22.036  28.937  43.773  1.00 47.73  ? 35  VAL B CG2 1 
ATOM   2208  N N   . GLU B 2 36  ? 19.884  30.644  47.767  1.00 53.06  ? 36  GLU B N   1 
ATOM   2209  C CA  . GLU B 2 36  ? 18.775  31.141  48.574  1.00 43.66  ? 36  GLU B CA  1 
ATOM   2210  C C   . GLU B 2 36  ? 18.320  32.547  48.195  1.00 46.12  ? 36  GLU B C   1 
ATOM   2211  O O   . GLU B 2 36  ? 17.377  33.085  48.771  1.00 57.25  ? 36  GLU B O   1 
ATOM   2212  C CB  . GLU B 2 36  ? 19.173  31.105  50.049  1.00 66.06  ? 36  GLU B CB  1 
ATOM   2213  C CG  . GLU B 2 36  ? 18.085  31.571  50.987  1.00 69.75  ? 36  GLU B CG  1 
ATOM   2214  C CD  . GLU B 2 36  ? 18.129  30.847  52.309  1.00 84.79  ? 36  GLU B CD  1 
ATOM   2215  O OE1 . GLU B 2 36  ? 19.182  30.925  52.976  1.00 73.69  ? 36  GLU B OE1 1 
ATOM   2216  O OE2 . GLU B 2 36  ? 17.114  30.199  52.681  1.00 82.96  ? 36  GLU B OE2 1 
ATOM   2217  N N   . SER B 2 37  ? 19.006  33.138  47.227  1.00 48.41  ? 37  SER B N   1 
ATOM   2218  C CA  . SER B 2 37  ? 18.688  34.475  46.748  1.00 53.87  ? 37  SER B CA  1 
ATOM   2219  C C   . SER B 2 37  ? 19.624  34.775  45.573  1.00 45.23  ? 37  SER B C   1 
ATOM   2220  O O   . SER B 2 37  ? 20.573  34.030  45.334  1.00 55.13  ? 37  SER B O   1 
ATOM   2221  C CB  . SER B 2 37  ? 18.841  35.510  47.885  1.00 69.86  ? 37  SER B CB  1 
ATOM   2222  O OG  . SER B 2 37  ? 20.137  35.489  48.475  1.00 80.66  ? 37  SER B OG  1 
ATOM   2223  N N   . PRO B 2 38  ? 19.378  35.869  44.828  1.00 59.32  ? 38  PRO B N   1 
ATOM   2224  C CA  . PRO B 2 38  ? 20.213  36.238  43.671  1.00 57.48  ? 38  PRO B CA  1 
ATOM   2225  C C   . PRO B 2 38  ? 21.699  36.440  43.984  1.00 68.53  ? 38  PRO B C   1 
ATOM   2226  O O   . PRO B 2 38  ? 22.061  37.307  44.784  1.00 73.10  ? 38  PRO B O   1 
ATOM   2227  C CB  . PRO B 2 38  ? 19.576  37.544  43.173  1.00 67.54  ? 38  PRO B CB  1 
ATOM   2228  C CG  . PRO B 2 38  ? 18.195  37.544  43.777  1.00 65.76  ? 38  PRO B CG  1 
ATOM   2229  C CD  . PRO B 2 38  ? 18.412  36.940  45.131  1.00 59.06  ? 38  PRO B CD  1 
ATOM   2230  N N   . ARG B 2 39  ? 22.559  35.647  43.354  1.00 83.44  ? 39  ARG B N   1 
ATOM   2231  C CA  . ARG B 2 39  ? 24.007  35.777  43.567  1.00 79.77  ? 39  ARG B CA  1 
ATOM   2232  C C   . ARG B 2 39  ? 24.481  36.812  42.566  1.00 83.42  ? 39  ARG B C   1 
ATOM   2233  O O   . ARG B 2 39  ? 23.682  37.325  41.769  1.00 70.04  ? 39  ARG B O   1 
ATOM   2234  C CB  . ARG B 2 39  ? 24.748  34.455  43.284  1.00 77.18  ? 39  ARG B CB  1 
ATOM   2235  C CG  . ARG B 2 39  ? 24.418  33.322  44.233  1.00 66.38  ? 39  ARG B CG  1 
ATOM   2236  C CD  . ARG B 2 39  ? 24.788  33.699  45.641  1.00 69.05  ? 39  ARG B CD  1 
ATOM   2237  N NE  . ARG B 2 39  ? 23.781  33.265  46.603  1.00 89.13  ? 39  ARG B NE  1 
ATOM   2238  C CZ  . ARG B 2 39  ? 23.811  32.102  47.251  1.00 99.26  ? 39  ARG B CZ  1 
ATOM   2239  N NH1 . ARG B 2 39  ? 24.809  31.246  47.036  1.00 74.73  ? 39  ARG B NH1 1 
ATOM   2240  N NH2 . ARG B 2 39  ? 22.846  31.805  48.127  1.00 77.68  ? 39  ARG B NH2 1 
ATOM   2241  N N   . ASN B 2 40  ? 25.779  37.109  42.609  1.00 76.31  ? 40  ASN B N   1 
ATOM   2242  C CA  . ASN B 2 40  ? 26.374  38.067  41.683  1.00 82.97  ? 40  ASN B CA  1 
ATOM   2243  C C   . ASN B 2 40  ? 26.775  37.285  40.448  1.00 86.71  ? 40  ASN B C   1 
ATOM   2244  O O   . ASN B 2 40  ? 26.561  37.730  39.324  1.00 76.24  ? 40  ASN B O   1 
ATOM   2245  C CB  . ASN B 2 40  ? 27.633  38.717  42.279  1.00 97.68  ? 40  ASN B CB  1 
ATOM   2246  C CG  . ASN B 2 40  ? 27.377  39.358  43.624  1.00 101.37 ? 40  ASN B CG  1 
ATOM   2247  O OD1 . ASN B 2 40  ? 26.264  39.816  43.891  1.00 103.15 ? 40  ASN B OD1 1 
ATOM   2248  N ND2 . ASN B 2 40  ? 28.405  39.408  44.477  1.00 91.87  ? 40  ASN B ND2 1 
ATOM   2249  N N   . ASP B 2 41  ? 27.357  36.106  40.672  1.00 91.58  ? 41  ASP B N   1 
ATOM   2250  C CA  . ASP B 2 41  ? 27.812  35.263  39.568  1.00 89.82  ? 41  ASP B CA  1 
ATOM   2251  C C   . ASP B 2 41  ? 26.792  34.199  39.175  1.00 77.51  ? 41  ASP B C   1 
ATOM   2252  O O   . ASP B 2 41  ? 25.887  33.863  39.945  1.00 65.44  ? 41  ASP B O   1 
ATOM   2253  C CB  . ASP B 2 41  ? 29.160  34.625  39.928  1.00 86.91  ? 41  ASP B CB  1 
ATOM   2254  C CG  . ASP B 2 41  ? 30.323  35.633  39.873  1.00 99.41  ? 41  ASP B CG  1 
ATOM   2255  O OD1 . ASP B 2 41  ? 30.856  35.911  38.761  1.00 82.72  ? 41  ASP B OD1 1 
ATOM   2256  O OD2 . ASP B 2 41  ? 30.695  36.153  40.949  1.00 74.99  ? 41  ASP B OD2 1 
ATOM   2257  N N   . LEU B 2 42  ? 26.937  33.690  37.959  1.00 73.96  ? 42  LEU B N   1 
ATOM   2258  C CA  . LEU B 2 42  ? 26.030  32.677  37.446  1.00 61.08  ? 42  LEU B CA  1 
ATOM   2259  C C   . LEU B 2 42  ? 26.691  31.317  37.515  1.00 60.92  ? 42  LEU B C   1 
ATOM   2260  O O   . LEU B 2 42  ? 27.889  31.184  37.275  1.00 51.60  ? 42  LEU B O   1 
ATOM   2261  C CB  . LEU B 2 42  ? 25.652  32.986  35.995  1.00 52.83  ? 42  LEU B CB  1 
ATOM   2262  C CG  . LEU B 2 42  ? 24.692  34.143  35.701  1.00 59.07  ? 42  LEU B CG  1 
ATOM   2263  C CD1 . LEU B 2 42  ? 24.691  34.430  34.216  1.00 63.06  ? 42  LEU B CD1 1 
ATOM   2264  C CD2 . LEU B 2 42  ? 23.295  33.794  36.167  1.00 58.67  ? 42  LEU B CD2 1 
ATOM   2265  N N   . TYR B 2 43  ? 25.890  30.311  37.841  1.00 57.60  ? 43  TYR B N   1 
ATOM   2266  C CA  . TYR B 2 43  ? 26.361  28.940  37.934  1.00 56.59  ? 43  TYR B CA  1 
ATOM   2267  C C   . TYR B 2 43  ? 26.409  28.259  36.580  1.00 46.21  ? 43  TYR B C   1 
ATOM   2268  O O   . TYR B 2 43  ? 25.753  28.680  35.631  1.00 58.36  ? 43  TYR B O   1 
ATOM   2269  C CB  . TYR B 2 43  ? 25.453  28.153  38.864  1.00 54.18  ? 43  TYR B CB  1 
ATOM   2270  C CG  . TYR B 2 43  ? 25.401  28.738  40.248  1.00 42.50  ? 43  TYR B CG  1 
ATOM   2271  C CD1 . TYR B 2 43  ? 24.527  29.773  40.549  1.00 50.60  ? 43  TYR B CD1 1 
ATOM   2272  C CD2 . TYR B 2 43  ? 26.251  28.268  41.256  1.00 37.86  ? 43  TYR B CD2 1 
ATOM   2273  C CE1 . TYR B 2 43  ? 24.492  30.328  41.829  1.00 60.03  ? 43  TYR B CE1 1 
ATOM   2274  C CE2 . TYR B 2 43  ? 26.232  28.815  42.530  1.00 34.02  ? 43  TYR B CE2 1 
ATOM   2275  C CZ  . TYR B 2 43  ? 25.349  29.843  42.812  1.00 47.28  ? 43  TYR B CZ  1 
ATOM   2276  O OH  . TYR B 2 43  ? 25.312  30.387  44.072  1.00 52.43  ? 43  TYR B OH  1 
ATOM   2277  N N   . ASP B 2 44  ? 27.192  27.197  36.500  1.00 51.21  ? 44  ASP B N   1 
ATOM   2278  C CA  . ASP B 2 44  ? 27.335  26.431  35.273  1.00 65.27  ? 44  ASP B CA  1 
ATOM   2279  C C   . ASP B 2 44  ? 26.129  25.499  35.112  1.00 67.15  ? 44  ASP B C   1 
ATOM   2280  O O   . ASP B 2 44  ? 25.709  25.175  33.991  1.00 59.30  ? 44  ASP B O   1 
ATOM   2281  C CB  . ASP B 2 44  ? 28.615  25.601  35.351  1.00 58.02  ? 44  ASP B CB  1 
ATOM   2282  C CG  . ASP B 2 44  ? 29.827  26.436  35.740  1.00 83.89  ? 44  ASP B CG  1 
ATOM   2283  O OD1 . ASP B 2 44  ? 30.573  26.870  34.833  1.00 66.55  ? 44  ASP B OD1 1 
ATOM   2284  O OD2 . ASP B 2 44  ? 30.027  26.671  36.955  1.00 72.56  ? 44  ASP B OD2 1 
ATOM   2285  N N   . LEU B 2 45  ? 25.587  25.077  36.253  1.00 68.89  ? 45  LEU B N   1 
ATOM   2286  C CA  . LEU B 2 45  ? 24.454  24.163  36.323  1.00 63.30  ? 45  LEU B CA  1 
ATOM   2287  C C   . LEU B 2 45  ? 23.567  24.615  37.485  1.00 58.05  ? 45  LEU B C   1 
ATOM   2288  O O   . LEU B 2 45  ? 24.053  24.803  38.605  1.00 64.90  ? 45  LEU B O   1 
ATOM   2289  C CB  . LEU B 2 45  ? 24.970  22.752  36.602  1.00 54.79  ? 45  LEU B CB  1 
ATOM   2290  C CG  . LEU B 2 45  ? 24.142  21.512  36.266  1.00 64.85  ? 45  LEU B CG  1 
ATOM   2291  C CD1 . LEU B 2 45  ? 24.648  20.426  37.175  1.00 57.24  ? 45  LEU B CD1 1 
ATOM   2292  C CD2 . LEU B 2 45  ? 22.637  21.713  36.469  1.00 41.00  ? 45  LEU B CD2 1 
ATOM   2293  N N   . LEU B 2 46  ? 22.275  24.784  37.235  1.00 47.77  ? 46  LEU B N   1 
ATOM   2294  C CA  . LEU B 2 46  ? 21.376  25.216  38.296  1.00 56.90  ? 46  LEU B CA  1 
ATOM   2295  C C   . LEU B 2 46  ? 20.212  24.229  38.434  1.00 61.30  ? 46  LEU B C   1 
ATOM   2296  O O   . LEU B 2 46  ? 19.757  23.676  37.437  1.00 58.53  ? 46  LEU B O   1 
ATOM   2297  C CB  . LEU B 2 46  ? 20.857  26.633  37.999  1.00 39.32  ? 46  LEU B CB  1 
ATOM   2298  C CG  . LEU B 2 46  ? 20.133  27.325  39.162  1.00 55.63  ? 46  LEU B CG  1 
ATOM   2299  C CD1 . LEU B 2 46  ? 21.098  27.476  40.342  1.00 62.46  ? 46  LEU B CD1 1 
ATOM   2300  C CD2 . LEU B 2 46  ? 19.606  28.673  38.739  1.00 38.31  ? 46  LEU B CD2 1 
ATOM   2301  N N   . PHE B 2 47  ? 19.752  23.997  39.667  1.00 46.07  ? 47  PHE B N   1 
ATOM   2302  C CA  . PHE B 2 47  ? 18.646  23.078  39.921  1.00 48.35  ? 47  PHE B CA  1 
ATOM   2303  C C   . PHE B 2 47  ? 17.459  23.794  40.535  1.00 42.09  ? 47  PHE B C   1 
ATOM   2304  O O   . PHE B 2 47  ? 17.628  24.612  41.429  1.00 71.48  ? 47  PHE B O   1 
ATOM   2305  C CB  . PHE B 2 47  ? 19.075  21.935  40.865  1.00 37.04  ? 47  PHE B CB  1 
ATOM   2306  C CG  . PHE B 2 47  ? 20.003  20.924  40.232  1.00 50.54  ? 47  PHE B CG  1 
ATOM   2307  C CD1 . PHE B 2 47  ? 21.385  21.088  40.286  1.00 52.45  ? 47  PHE B CD1 1 
ATOM   2308  C CD2 . PHE B 2 47  ? 19.492  19.823  39.555  1.00 40.61  ? 47  PHE B CD2 1 
ATOM   2309  C CE1 . PHE B 2 47  ? 22.242  20.166  39.668  1.00 59.31  ? 47  PHE B CE1 1 
ATOM   2310  C CE2 . PHE B 2 47  ? 20.336  18.907  38.938  1.00 26.18  ? 47  PHE B CE2 1 
ATOM   2311  C CZ  . PHE B 2 47  ? 21.708  19.074  38.991  1.00 56.19  ? 47  PHE B CZ  1 
ATOM   2312  N N   . ILE B 2 48  ? 16.254  23.492  40.060  1.00 59.74  ? 48  ILE B N   1 
ATOM   2313  C CA  . ILE B 2 48  ? 15.047  24.121  40.611  1.00 60.54  ? 48  ILE B CA  1 
ATOM   2314  C C   . ILE B 2 48  ? 14.137  23.027  41.171  1.00 63.62  ? 48  ILE B C   1 
ATOM   2315  O O   . ILE B 2 48  ? 13.184  22.604  40.521  1.00 63.01  ? 48  ILE B O   1 
ATOM   2316  C CB  . ILE B 2 48  ? 14.246  24.928  39.550  1.00 50.65  ? 48  ILE B CB  1 
ATOM   2317  C CG1 . ILE B 2 48  ? 15.148  25.909  38.812  1.00 44.46  ? 48  ILE B CG1 1 
ATOM   2318  C CG2 . ILE B 2 48  ? 13.174  25.742  40.234  1.00 38.64  ? 48  ILE B CG2 1 
ATOM   2319  C CD1 . ILE B 2 48  ? 16.109  25.277  37.864  1.00 56.03  ? 48  ILE B CD1 1 
ATOM   2320  N N   . PRO B 2 49  ? 14.419  22.568  42.398  1.00 65.49  ? 49  PRO B N   1 
ATOM   2321  C CA  . PRO B 2 49  ? 13.641  21.519  43.048  1.00 47.16  ? 49  PRO B CA  1 
ATOM   2322  C C   . PRO B 2 49  ? 12.384  22.040  43.692  1.00 42.28  ? 49  PRO B C   1 
ATOM   2323  O O   . PRO B 2 49  ? 11.849  23.083  43.323  1.00 56.09  ? 49  PRO B O   1 
ATOM   2324  C CB  . PRO B 2 49  ? 14.612  20.988  44.084  1.00 56.13  ? 49  PRO B CB  1 
ATOM   2325  C CG  . PRO B 2 49  ? 15.230  22.251  44.581  1.00 36.31  ? 49  PRO B CG  1 
ATOM   2326  C CD  . PRO B 2 49  ? 15.491  23.041  43.295  1.00 62.95  ? 49  PRO B CD  1 
ATOM   2327  N N   . GLY B 2 50  ? 11.921  21.301  44.682  1.00 48.05  ? 50  GLY B N   1 
ATOM   2328  C CA  . GLY B 2 50  ? 10.727  21.704  45.380  1.00 47.27  ? 50  GLY B CA  1 
ATOM   2329  C C   . GLY B 2 50  ? 9.707   20.612  45.245  1.00 46.51  ? 50  GLY B C   1 
ATOM   2330  O O   . GLY B 2 50  ? 9.851   19.727  44.416  1.00 54.89  ? 50  GLY B O   1 
ATOM   2331  N N   . VAL B 2 51  ? 8.690   20.673  46.089  1.00 56.52  ? 51  VAL B N   1 
ATOM   2332  C CA  . VAL B 2 51  ? 7.604   19.715  46.090  1.00 39.82  ? 51  VAL B CA  1 
ATOM   2333  C C   . VAL B 2 51  ? 6.454   20.376  46.822  1.00 56.41  ? 51  VAL B C   1 
ATOM   2334  O O   . VAL B 2 51  ? 6.552   20.636  48.023  1.00 52.57  ? 51  VAL B O   1 
ATOM   2335  C CB  . VAL B 2 51  ? 7.994   18.413  46.819  1.00 53.52  ? 51  VAL B CB  1 
ATOM   2336  C CG1 . VAL B 2 51  ? 6.744   17.672  47.283  1.00 47.08  ? 51  VAL B CG1 1 
ATOM   2337  C CG2 . VAL B 2 51  ? 8.801   17.526  45.883  1.00 40.39  ? 51  VAL B CG2 1 
ATOM   2338  N N   . GLY B 2 52  ? 5.374   20.661  46.092  1.00 57.63  ? 52  GLY B N   1 
ATOM   2339  C CA  . GLY B 2 52  ? 4.207   21.288  46.695  1.00 51.60  ? 52  GLY B CA  1 
ATOM   2340  C C   . GLY B 2 52  ? 3.318   21.981  45.682  1.00 56.17  ? 52  GLY B C   1 
ATOM   2341  O O   . GLY B 2 52  ? 3.379   21.691  44.489  1.00 56.68  ? 52  GLY B O   1 
ATOM   2342  N N   . HIS B 2 53  ? 2.494   22.904  46.168  1.00 65.04  ? 53  HIS B N   1 
ATOM   2343  C CA  . HIS B 2 53  ? 1.558   23.678  45.336  1.00 63.07  ? 53  HIS B CA  1 
ATOM   2344  C C   . HIS B 2 53  ? 2.281   24.547  44.299  1.00 46.39  ? 53  HIS B C   1 
ATOM   2345  O O   . HIS B 2 53  ? 3.277   25.179  44.605  1.00 67.94  ? 53  HIS B O   1 
ATOM   2346  C CB  . HIS B 2 53  ? 0.688   24.555  46.253  1.00 68.53  ? 53  HIS B CB  1 
ATOM   2347  C CG  . HIS B 2 53  ? -0.548  25.096  45.598  1.00 89.10  ? 53  HIS B CG  1 
ATOM   2348  N ND1 . HIS B 2 53  ? -0.529  26.175  44.737  1.00 88.96  ? 53  HIS B ND1 1 
ATOM   2349  C CD2 . HIS B 2 53  ? -1.845  24.716  45.693  1.00 73.81  ? 53  HIS B CD2 1 
ATOM   2350  C CE1 . HIS B 2 53  ? -1.759  26.436  44.332  1.00 84.58  ? 53  HIS B CE1 1 
ATOM   2351  N NE2 . HIS B 2 53  ? -2.577  25.565  44.898  1.00 91.51  ? 53  HIS B NE2 1 
ATOM   2352  N N   . PHE B 2 54  ? 1.777   24.569  43.070  1.00 61.06  ? 54  PHE B N   1 
ATOM   2353  C CA  . PHE B 2 54  ? 2.375   25.359  41.996  1.00 51.84  ? 54  PHE B CA  1 
ATOM   2354  C C   . PHE B 2 54  ? 2.412   26.848  42.329  1.00 64.80  ? 54  PHE B C   1 
ATOM   2355  O O   . PHE B 2 54  ? 3.344   27.561  41.935  1.00 59.36  ? 54  PHE B O   1 
ATOM   2356  C CB  . PHE B 2 54  ? 1.576   25.175  40.714  1.00 57.52  ? 54  PHE B CB  1 
ATOM   2357  C CG  . PHE B 2 54  ? 2.207   25.812  39.511  1.00 58.48  ? 54  PHE B CG  1 
ATOM   2358  C CD1 . PHE B 2 54  ? 3.181   25.139  38.788  1.00 34.49  ? 54  PHE B CD1 1 
ATOM   2359  C CD2 . PHE B 2 54  ? 1.803   27.075  39.085  1.00 57.25  ? 54  PHE B CD2 1 
ATOM   2360  C CE1 . PHE B 2 54  ? 3.741   25.707  37.657  1.00 39.78  ? 54  PHE B CE1 1 
ATOM   2361  C CE2 . PHE B 2 54  ? 2.354   27.655  37.956  1.00 39.34  ? 54  PHE B CE2 1 
ATOM   2362  C CZ  . PHE B 2 54  ? 3.324   26.971  37.238  1.00 60.59  ? 54  PHE B CZ  1 
ATOM   2363  N N   . GLY B 2 55  ? 1.374   27.317  43.021  1.00 48.98  ? 55  GLY B N   1 
ATOM   2364  C CA  . GLY B 2 55  ? 1.309   28.717  43.401  1.00 60.25  ? 55  GLY B CA  1 
ATOM   2365  C C   . GLY B 2 55  ? 2.584   29.004  44.148  1.00 62.17  ? 55  GLY B C   1 
ATOM   2366  O O   . GLY B 2 55  ? 3.430   29.782  43.702  1.00 64.58  ? 55  GLY B O   1 
ATOM   2367  N N   . GLU B 2 56  ? 2.708   28.350  45.298  1.00 68.25  ? 56  GLU B N   1 
ATOM   2368  C CA  . GLU B 2 56  ? 3.887   28.438  46.132  1.00 49.85  ? 56  GLU B CA  1 
ATOM   2369  C C   . GLU B 2 56  ? 5.021   27.925  45.248  1.00 65.75  ? 56  GLU B C   1 
ATOM   2370  O O   . GLU B 2 56  ? 4.789   27.159  44.312  1.00 83.65  ? 56  GLU B O   1 
ATOM   2371  C CB  . GLU B 2 56  ? 3.697   27.535  47.338  1.00 64.78  ? 56  GLU B CB  1 
ATOM   2372  C CG  . GLU B 2 56  ? 2.929   28.170  48.477  1.00 62.29  ? 56  GLU B CG  1 
ATOM   2373  C CD  . GLU B 2 56  ? 3.870   28.786  49.486  1.00 60.41  ? 56  GLU B CD  1 
ATOM   2374  O OE1 . GLU B 2 56  ? 4.648   29.682  49.102  1.00 76.90  ? 56  GLU B OE1 1 
ATOM   2375  O OE2 . GLU B 2 56  ? 3.844   28.362  50.658  1.00 63.42  ? 56  GLU B OE2 1 
ATOM   2376  N N   . GLY B 2 57  ? 6.251   28.324  45.531  1.00 78.85  ? 57  GLY B N   1 
ATOM   2377  C CA  . GLY B 2 57  ? 7.344   27.882  44.684  1.00 69.66  ? 57  GLY B CA  1 
ATOM   2378  C C   . GLY B 2 57  ? 7.457   28.995  43.672  1.00 68.20  ? 57  GLY B C   1 
ATOM   2379  O O   . GLY B 2 57  ? 8.546   29.492  43.374  1.00 74.99  ? 57  GLY B O   1 
ATOM   2380  N N   . MET B 2 58  ? 6.307   29.389  43.138  1.00 65.92  ? 58  MET B N   1 
ATOM   2381  C CA  . MET B 2 58  ? 6.259   30.499  42.201  1.00 70.93  ? 58  MET B CA  1 
ATOM   2382  C C   . MET B 2 58  ? 6.313   31.761  43.064  1.00 64.00  ? 58  MET B C   1 
ATOM   2383  O O   . MET B 2 58  ? 7.065   32.695  42.784  1.00 51.08  ? 58  MET B O   1 
ATOM   2384  C CB  . MET B 2 58  ? 4.961   30.462  41.396  1.00 57.17  ? 58  MET B CB  1 
ATOM   2385  C CG  . MET B 2 58  ? 5.054   29.592  40.165  1.00 55.54  ? 58  MET B CG  1 
ATOM   2386  S SD  . MET B 2 58  ? 6.232   30.279  39.018  1.00 57.55  ? 58  MET B SD  1 
ATOM   2387  C CE  . MET B 2 58  ? 7.712   29.552  39.575  1.00 81.71  ? 58  MET B CE  1 
ATOM   2388  N N   . ARG B 2 59  ? 5.518   31.745  44.131  1.00 54.53  ? 59  ARG B N   1 
ATOM   2389  C CA  . ARG B 2 59  ? 5.419   32.833  45.086  1.00 46.10  ? 59  ARG B CA  1 
ATOM   2390  C C   . ARG B 2 59  ? 6.647   32.882  45.995  1.00 74.85  ? 59  ARG B C   1 
ATOM   2391  O O   . ARG B 2 59  ? 6.785   33.803  46.811  1.00 66.67  ? 59  ARG B O   1 
ATOM   2392  C CB  . ARG B 2 59  ? 4.177   32.657  45.943  1.00 33.82  ? 59  ARG B CB  1 
ATOM   2393  C CG  . ARG B 2 59  ? 3.785   33.906  46.682  1.00 57.03  ? 59  ARG B CG  1 
ATOM   2394  C CD  . ARG B 2 59  ? 3.433   33.608  48.118  1.00 57.09  ? 59  ARG B CD  1 
ATOM   2395  N NE  . ARG B 2 59  ? 4.623   33.266  48.883  1.00 83.06  ? 59  ARG B NE  1 
ATOM   2396  C CZ  . ARG B 2 59  ? 4.596   32.784  50.123  1.00 78.51  ? 59  ARG B CZ  1 
ATOM   2397  N NH1 . ARG B 2 59  ? 3.433   32.587  50.734  1.00 76.13  ? 59  ARG B NH1 1 
ATOM   2398  N NH2 . ARG B 2 59  ? 5.731   32.499  50.751  1.00 71.68  ? 59  ARG B NH2 1 
ATOM   2399  N N   . ARG B 2 60  ? 7.518   31.878  45.876  1.00 67.19  ? 60  ARG B N   1 
ATOM   2400  C CA  . ARG B 2 60  ? 8.744   31.831  46.667  1.00 66.36  ? 60  ARG B CA  1 
ATOM   2401  C C   . ARG B 2 60  ? 9.899   32.251  45.775  1.00 60.95  ? 60  ARG B C   1 
ATOM   2402  O O   . ARG B 2 60  ? 10.905  32.770  46.256  1.00 73.52  ? 60  ARG B O   1 
ATOM   2403  C CB  . ARG B 2 60  ? 8.981   30.430  47.253  1.00 43.06  ? 60  ARG B CB  1 
ATOM   2404  C CG  . ARG B 2 60  ? 8.055   30.105  48.425  1.00 42.97  ? 60  ARG B CG  1 
ATOM   2405  C CD  . ARG B 2 60  ? 8.498   28.860  49.181  1.00 58.11  ? 60  ARG B CD  1 
ATOM   2406  N NE  . ARG B 2 60  ? 7.674   28.598  50.358  1.00 52.14  ? 60  ARG B NE  1 
ATOM   2407  C CZ  . ARG B 2 60  ? 7.877   27.593  51.204  1.00 40.80  ? 60  ARG B CZ  1 
ATOM   2408  N NH1 . ARG B 2 60  ? 8.877   26.754  51.009  1.00 51.15  ? 60  ARG B NH1 1 
ATOM   2409  N NH2 . ARG B 2 60  ? 7.078   27.421  52.243  1.00 36.04  ? 60  ARG B NH2 1 
ATOM   2410  N N   . LEU B 2 61  ? 9.756   32.034  44.473  1.00 58.70  ? 61  LEU B N   1 
ATOM   2411  C CA  . LEU B 2 61  ? 10.789  32.459  43.536  1.00 56.78  ? 61  LEU B CA  1 
ATOM   2412  C C   . LEU B 2 61  ? 10.658  33.973  43.378  1.00 72.27  ? 61  LEU B C   1 
ATOM   2413  O O   . LEU B 2 61  ? 11.657  34.693  43.321  1.00 64.85  ? 61  LEU B O   1 
ATOM   2414  C CB  . LEU B 2 61  ? 10.613  31.789  42.178  1.00 43.66  ? 61  LEU B CB  1 
ATOM   2415  C CG  . LEU B 2 61  ? 10.925  30.294  42.131  1.00 49.29  ? 61  LEU B CG  1 
ATOM   2416  C CD1 . LEU B 2 61  ? 10.822  29.815  40.709  1.00 44.58  ? 61  LEU B CD1 1 
ATOM   2417  C CD2 . LEU B 2 61  ? 12.319  30.026  42.657  1.00 51.85  ? 61  LEU B CD2 1 
ATOM   2418  N N   . ARG B 2 62  ? 9.413   34.449  43.313  1.00 75.41  ? 62  ARG B N   1 
ATOM   2419  C CA  . ARG B 2 62  ? 9.157   35.881  43.180  1.00 77.81  ? 62  ARG B CA  1 
ATOM   2420  C C   . ARG B 2 62  ? 9.668   36.538  44.462  1.00 73.67  ? 62  ARG B C   1 
ATOM   2421  O O   . ARG B 2 62  ? 10.628  37.302  44.442  1.00 84.61  ? 62  ARG B O   1 
ATOM   2422  C CB  . ARG B 2 62  ? 7.650   36.170  43.023  1.00 54.10  ? 62  ARG B CB  1 
ATOM   2423  C CG  . ARG B 2 62  ? 6.959   35.460  41.852  1.00 62.32  ? 62  ARG B CG  1 
ATOM   2424  C CD  . ARG B 2 62  ? 5.514   35.931  41.719  1.00 58.43  ? 62  ARG B CD  1 
ATOM   2425  N NE  . ARG B 2 62  ? 4.640   35.020  40.966  1.00 67.14  ? 62  ARG B NE  1 
ATOM   2426  C CZ  . ARG B 2 62  ? 4.713   34.780  39.655  1.00 55.64  ? 62  ARG B CZ  1 
ATOM   2427  N NH1 . ARG B 2 62  ? 5.631   35.366  38.892  1.00 57.56  ? 62  ARG B NH1 1 
ATOM   2428  N NH2 . ARG B 2 62  ? 3.832   33.968  39.095  1.00 66.97  ? 62  ARG B NH2 1 
ATOM   2429  N N   . GLU B 2 63  ? 9.024   36.220  45.580  1.00 67.99  ? 63  GLU B N   1 
ATOM   2430  C CA  . GLU B 2 63  ? 9.388   36.772  46.880  1.00 70.34  ? 63  GLU B CA  1 
ATOM   2431  C C   . GLU B 2 63  ? 10.908  36.969  47.121  1.00 69.30  ? 63  GLU B C   1 
ATOM   2432  O O   . GLU B 2 63  ? 11.332  38.052  47.530  1.00 80.84  ? 63  GLU B O   1 
ATOM   2433  C CB  . GLU B 2 63  ? 8.761   35.894  47.965  1.00 73.39  ? 63  GLU B CB  1 
ATOM   2434  C CG  . GLU B 2 63  ? 9.139   36.223  49.390  1.00 89.84  ? 63  GLU B CG  1 
ATOM   2435  C CD  . GLU B 2 63  ? 8.675   35.139  50.347  1.00 101.68 ? 63  GLU B CD  1 
ATOM   2436  O OE1 . GLU B 2 63  ? 8.932   33.945  50.037  1.00 99.11  ? 63  GLU B OE1 1 
ATOM   2437  O OE2 . GLU B 2 63  ? 8.070   35.474  51.399  1.00 74.88  ? 63  GLU B OE2 1 
ATOM   2438  N N   . ASN B 2 64  ? 11.727  35.949  46.866  1.00 69.40  ? 64  ASN B N   1 
ATOM   2439  C CA  . ASN B 2 64  ? 13.177  36.080  47.070  1.00 53.96  ? 64  ASN B CA  1 
ATOM   2440  C C   . ASN B 2 64  ? 13.898  36.437  45.773  1.00 60.19  ? 64  ASN B C   1 
ATOM   2441  O O   . ASN B 2 64  ? 15.064  36.092  45.569  1.00 62.71  ? 64  ASN B O   1 
ATOM   2442  C CB  . ASN B 2 64  ? 13.762  34.789  47.660  1.00 50.74  ? 64  ASN B CB  1 
ATOM   2443  C CG  . ASN B 2 64  ? 13.300  34.541  49.087  1.00 68.22  ? 64  ASN B CG  1 
ATOM   2444  O OD1 . ASN B 2 64  ? 13.544  35.354  49.981  1.00 69.21  ? 64  ASN B OD1 1 
ATOM   2445  N ND2 . ASN B 2 64  ? 12.616  33.418  49.304  1.00 62.10  ? 64  ASN B ND2 1 
ATOM   2446  N N   . ASP B 2 65  ? 13.179  37.136  44.904  1.00 59.61  ? 65  ASP B N   1 
ATOM   2447  C CA  . ASP B 2 65  ? 13.690  37.597  43.612  1.00 63.31  ? 65  ASP B CA  1 
ATOM   2448  C C   . ASP B 2 65  ? 14.666  36.661  42.921  1.00 60.37  ? 65  ASP B C   1 
ATOM   2449  O O   . ASP B 2 65  ? 15.809  37.034  42.675  1.00 50.45  ? 65  ASP B O   1 
ATOM   2450  C CB  . ASP B 2 65  ? 14.367  38.968  43.753  1.00 74.78  ? 65  ASP B CB  1 
ATOM   2451  C CG  . ASP B 2 65  ? 14.583  39.655  42.403  1.00 95.29  ? 65  ASP B CG  1 
ATOM   2452  O OD1 . ASP B 2 65  ? 13.605  40.236  41.878  1.00 103.15 ? 65  ASP B OD1 1 
ATOM   2453  O OD2 . ASP B 2 65  ? 15.716  39.613  41.860  1.00 82.06  ? 65  ASP B OD2 1 
ATOM   2454  N N   . LEU B 2 66  ? 14.219  35.448  42.605  1.00 75.32  ? 66  LEU B N   1 
ATOM   2455  C CA  . LEU B 2 66  ? 15.076  34.497  41.905  1.00 69.27  ? 66  LEU B CA  1 
ATOM   2456  C C   . LEU B 2 66  ? 14.638  34.379  40.452  1.00 61.41  ? 66  LEU B C   1 
ATOM   2457  O O   . LEU B 2 66  ? 15.410  33.944  39.594  1.00 58.00  ? 66  LEU B O   1 
ATOM   2458  C CB  . LEU B 2 66  ? 15.040  33.126  42.590  1.00 59.52  ? 66  LEU B CB  1 
ATOM   2459  C CG  . LEU B 2 66  ? 15.959  33.062  43.816  1.00 76.15  ? 66  LEU B CG  1 
ATOM   2460  C CD1 . LEU B 2 66  ? 15.903  31.690  44.465  1.00 68.57  ? 66  LEU B CD1 1 
ATOM   2461  C CD2 . LEU B 2 66  ? 17.378  33.396  43.381  1.00 45.00  ? 66  LEU B CD2 1 
ATOM   2462  N N   . ILE B 2 67  ? 13.403  34.796  40.178  1.00 66.92  ? 67  ILE B N   1 
ATOM   2463  C CA  . ILE B 2 67  ? 12.857  34.730  38.825  1.00 57.97  ? 67  ILE B CA  1 
ATOM   2464  C C   . ILE B 2 67  ? 13.807  35.358  37.818  1.00 55.06  ? 67  ILE B C   1 
ATOM   2465  O O   . ILE B 2 67  ? 14.282  34.689  36.892  1.00 55.02  ? 67  ILE B O   1 
ATOM   2466  C CB  . ILE B 2 67  ? 11.475  35.418  38.748  1.00 54.83  ? 67  ILE B CB  1 
ATOM   2467  C CG1 . ILE B 2 67  ? 10.462  34.620  39.574  1.00 58.86  ? 67  ILE B CG1 1 
ATOM   2468  C CG2 . ILE B 2 67  ? 11.006  35.485  37.307  1.00 59.83  ? 67  ILE B CG2 1 
ATOM   2469  C CD1 . ILE B 2 67  ? 9.053   35.136  39.498  1.00 59.34  ? 67  ILE B CD1 1 
ATOM   2470  N N   . ASP B 2 68  ? 14.107  36.638  38.009  1.00 63.48  ? 68  ASP B N   1 
ATOM   2471  C CA  . ASP B 2 68  ? 15.013  37.329  37.104  1.00 52.64  ? 68  ASP B CA  1 
ATOM   2472  C C   . ASP B 2 68  ? 16.360  36.614  37.057  1.00 56.91  ? 68  ASP B C   1 
ATOM   2473  O O   . ASP B 2 68  ? 16.970  36.504  35.983  1.00 51.40  ? 68  ASP B O   1 
ATOM   2474  C CB  . ASP B 2 68  ? 15.187  38.782  37.546  1.00 72.59  ? 68  ASP B CB  1 
ATOM   2475  C CG  . ASP B 2 68  ? 13.887  39.562  37.489  1.00 74.09  ? 68  ASP B CG  1 
ATOM   2476  O OD1 . ASP B 2 68  ? 13.204  39.479  36.435  1.00 78.05  ? 68  ASP B OD1 1 
ATOM   2477  O OD2 . ASP B 2 68  ? 13.553  40.256  38.481  1.00 69.30  ? 68  ASP B OD2 1 
ATOM   2478  N N   . PHE B 2 69  ? 16.806  36.117  38.219  1.00 59.69  ? 69  PHE B N   1 
ATOM   2479  C CA  . PHE B 2 69  ? 18.082  35.394  38.337  1.00 61.69  ? 69  PHE B CA  1 
ATOM   2480  C C   . PHE B 2 69  ? 18.092  34.116  37.496  1.00 59.65  ? 69  PHE B C   1 
ATOM   2481  O O   . PHE B 2 69  ? 19.032  33.874  36.738  1.00 49.49  ? 69  PHE B O   1 
ATOM   2482  C CB  . PHE B 2 69  ? 18.379  35.053  39.812  1.00 64.80  ? 69  PHE B CB  1 
ATOM   2483  C CG  . PHE B 2 69  ? 19.698  34.339  40.025  1.00 51.07  ? 69  PHE B CG  1 
ATOM   2484  C CD1 . PHE B 2 69  ? 20.871  34.813  39.436  1.00 80.01  ? 69  PHE B CD1 1 
ATOM   2485  C CD2 . PHE B 2 69  ? 19.770  33.201  40.820  1.00 56.65  ? 69  PHE B CD2 1 
ATOM   2486  C CE1 . PHE B 2 69  ? 22.099  34.160  39.635  1.00 74.49  ? 69  PHE B CE1 1 
ATOM   2487  C CE2 . PHE B 2 69  ? 20.984  32.543  41.026  1.00 56.70  ? 69  PHE B CE2 1 
ATOM   2488  C CZ  . PHE B 2 69  ? 22.152  33.022  40.433  1.00 56.26  ? 69  PHE B CZ  1 
ATOM   2489  N N   . VAL B 2 70  ? 17.039  33.307  37.637  1.00 62.37  ? 70  VAL B N   1 
ATOM   2490  C CA  . VAL B 2 70  ? 16.914  32.057  36.884  1.00 62.66  ? 70  VAL B CA  1 
ATOM   2491  C C   . VAL B 2 70  ? 16.936  32.367  35.402  1.00 54.84  ? 70  VAL B C   1 
ATOM   2492  O O   . VAL B 2 70  ? 17.669  31.747  34.620  1.00 46.65  ? 70  VAL B O   1 
ATOM   2493  C CB  . VAL B 2 70  ? 15.567  31.344  37.146  1.00 64.95  ? 70  VAL B CB  1 
ATOM   2494  C CG1 . VAL B 2 70  ? 15.573  29.995  36.451  1.00 51.70  ? 70  VAL B CG1 1 
ATOM   2495  C CG2 . VAL B 2 70  ? 15.319  31.183  38.624  1.00 48.90  ? 70  VAL B CG2 1 
ATOM   2496  N N   . ARG B 2 71  ? 16.106  33.335  35.029  1.00 50.96  ? 71  ARG B N   1 
ATOM   2497  C CA  . ARG B 2 71  ? 15.990  33.741  33.642  1.00 54.44  ? 71  ARG B CA  1 
ATOM   2498  C C   . ARG B 2 71  ? 17.319  34.124  32.988  1.00 60.18  ? 71  ARG B C   1 
ATOM   2499  O O   . ARG B 2 71  ? 17.501  33.916  31.789  1.00 61.81  ? 71  ARG B O   1 
ATOM   2500  C CB  . ARG B 2 71  ? 15.016  34.899  33.528  1.00 67.51  ? 71  ARG B CB  1 
ATOM   2501  C CG  . ARG B 2 71  ? 14.667  35.210  32.102  1.00 78.25  ? 71  ARG B CG  1 
ATOM   2502  C CD  . ARG B 2 71  ? 13.791  34.103  31.524  1.00 103.15 ? 71  ARG B CD  1 
ATOM   2503  N NE  . ARG B 2 71  ? 12.479  34.052  32.176  1.00 103.15 ? 71  ARG B NE  1 
ATOM   2504  C CZ  . ARG B 2 71  ? 11.322  33.935  31.524  1.00 92.12  ? 71  ARG B CZ  1 
ATOM   2505  N NH1 . ARG B 2 71  ? 11.307  33.856  30.192  1.00 67.27  ? 71  ARG B NH1 1 
ATOM   2506  N NH2 . ARG B 2 71  ? 10.179  33.902  32.206  1.00 83.18  ? 71  ARG B NH2 1 
ATOM   2507  N N   . LYS B 2 72  ? 18.242  34.690  33.771  1.00 66.30  ? 72  LYS B N   1 
ATOM   2508  C CA  . LYS B 2 72  ? 19.550  35.080  33.247  1.00 57.58  ? 72  LYS B CA  1 
ATOM   2509  C C   . LYS B 2 72  ? 20.415  33.850  32.987  1.00 54.67  ? 72  LYS B C   1 
ATOM   2510  O O   . LYS B 2 72  ? 21.356  33.878  32.185  1.00 50.78  ? 72  LYS B O   1 
ATOM   2511  C CB  . LYS B 2 72  ? 20.253  36.040  34.219  1.00 59.37  ? 72  LYS B CB  1 
ATOM   2512  C CG  . LYS B 2 72  ? 19.569  37.412  34.332  1.00 93.42  ? 72  LYS B CG  1 
ATOM   2513  C CD  . LYS B 2 72  ? 20.328  38.384  35.262  1.00 99.30  ? 72  LYS B CD  1 
ATOM   2514  C CE  . LYS B 2 72  ? 19.696  39.792  35.263  1.00 95.00  ? 72  LYS B CE  1 
ATOM   2515  N NZ  . LYS B 2 72  ? 18.444  39.924  36.085  1.00 68.86  ? 72  LYS B NZ  1 
ATOM   2516  N N   . HIS B 2 73  ? 20.094  32.759  33.669  1.00 65.51  ? 73  HIS B N   1 
ATOM   2517  C CA  . HIS B 2 73  ? 20.841  31.524  33.469  1.00 71.67  ? 73  HIS B CA  1 
ATOM   2518  C C   . HIS B 2 73  ? 20.535  30.922  32.107  1.00 63.65  ? 73  HIS B C   1 
ATOM   2519  O O   . HIS B 2 73  ? 21.434  30.519  31.365  1.00 43.28  ? 73  HIS B O   1 
ATOM   2520  C CB  . HIS B 2 73  ? 20.497  30.520  34.562  1.00 70.57  ? 73  HIS B CB  1 
ATOM   2521  C CG  . HIS B 2 73  ? 21.427  30.574  35.728  1.00 67.17  ? 73  HIS B CG  1 
ATOM   2522  N ND1 . HIS B 2 73  ? 22.763  30.251  35.621  1.00 59.72  ? 73  HIS B ND1 1 
ATOM   2523  C CD2 . HIS B 2 73  ? 21.219  30.911  37.021  1.00 56.42  ? 73  HIS B CD2 1 
ATOM   2524  C CE1 . HIS B 2 73  ? 23.336  30.383  36.803  1.00 66.72  ? 73  HIS B CE1 1 
ATOM   2525  N NE2 . HIS B 2 73  ? 22.421  30.781  37.670  1.00 58.06  ? 73  HIS B NE2 1 
ATOM   2526  N N   . VAL B 2 74  ? 19.259  30.864  31.771  1.00 53.71  ? 74  VAL B N   1 
ATOM   2527  C CA  . VAL B 2 74  ? 18.904  30.292  30.488  1.00 75.28  ? 74  VAL B CA  1 
ATOM   2528  C C   . VAL B 2 74  ? 19.619  31.070  29.381  1.00 71.86  ? 74  VAL B C   1 
ATOM   2529  O O   . VAL B 2 74  ? 20.321  30.500  28.540  1.00 72.31  ? 74  VAL B O   1 
ATOM   2530  C CB  . VAL B 2 74  ? 17.381  30.356  30.260  1.00 74.50  ? 74  VAL B CB  1 
ATOM   2531  C CG1 . VAL B 2 74  ? 17.008  29.600  28.980  1.00 73.64  ? 74  VAL B CG1 1 
ATOM   2532  C CG2 . VAL B 2 74  ? 16.658  29.784  31.468  1.00 65.47  ? 74  VAL B CG2 1 
ATOM   2533  N N   . GLU B 2 75  ? 19.457  32.386  29.407  1.00 71.78  ? 75  GLU B N   1 
ATOM   2534  C CA  . GLU B 2 75  ? 20.058  33.252  28.395  1.00 83.45  ? 75  GLU B CA  1 
ATOM   2535  C C   . GLU B 2 75  ? 21.558  33.045  28.144  1.00 75.78  ? 75  GLU B C   1 
ATOM   2536  O O   . GLU B 2 75  ? 21.982  32.998  26.987  1.00 75.46  ? 75  GLU B O   1 
ATOM   2537  C CB  . GLU B 2 75  ? 19.781  34.713  28.755  1.00 81.95  ? 75  GLU B CB  1 
ATOM   2538  C CG  . GLU B 2 75  ? 18.300  35.036  28.818  1.00 81.34  ? 75  GLU B CG  1 
ATOM   2539  C CD  . GLU B 2 75  ? 18.016  36.317  29.574  1.00 97.21  ? 75  GLU B CD  1 
ATOM   2540  O OE1 . GLU B 2 75  ? 18.508  37.393  29.153  1.00 78.09  ? 75  GLU B OE1 1 
ATOM   2541  O OE2 . GLU B 2 75  ? 17.293  36.241  30.598  1.00 103.15 ? 75  GLU B OE2 1 
ATOM   2542  N N   . ASP B 2 76  ? 22.356  32.924  29.210  1.00 80.17  ? 76  ASP B N   1 
ATOM   2543  C CA  . ASP B 2 76  ? 23.807  32.727  29.054  1.00 79.60  ? 76  ASP B CA  1 
ATOM   2544  C C   . ASP B 2 76  ? 24.135  31.297  28.648  1.00 76.41  ? 76  ASP B C   1 
ATOM   2545  O O   . ASP B 2 76  ? 25.308  30.913  28.575  1.00 65.30  ? 76  ASP B O   1 
ATOM   2546  C CB  . ASP B 2 76  ? 24.561  33.059  30.350  1.00 85.30  ? 76  ASP B CB  1 
ATOM   2547  C CG  . ASP B 2 76  ? 26.022  33.425  30.097  1.00 80.46  ? 76  ASP B CG  1 
ATOM   2548  O OD1 . ASP B 2 76  ? 26.884  33.115  30.957  1.00 75.16  ? 76  ASP B OD1 1 
ATOM   2549  O OD2 . ASP B 2 76  ? 26.304  34.033  29.030  1.00 85.44  ? 76  ASP B OD2 1 
ATOM   2550  N N   . GLU B 2 77  ? 23.092  30.511  28.384  1.00 81.60  ? 77  GLU B N   1 
ATOM   2551  C CA  . GLU B 2 77  ? 23.272  29.127  27.975  1.00 78.33  ? 77  GLU B CA  1 
ATOM   2552  C C   . GLU B 2 77  ? 23.791  28.333  29.166  1.00 62.11  ? 77  GLU B C   1 
ATOM   2553  O O   . GLU B 2 77  ? 24.752  27.563  29.052  1.00 67.95  ? 77  GLU B O   1 
ATOM   2554  C CB  . GLU B 2 77  ? 24.280  29.034  26.815  1.00 82.02  ? 77  GLU B CB  1 
ATOM   2555  C CG  . GLU B 2 77  ? 24.112  30.096  25.731  1.00 87.27  ? 77  GLU B CG  1 
ATOM   2556  C CD  . GLU B 2 77  ? 24.974  29.831  24.499  1.00 96.04  ? 77  GLU B CD  1 
ATOM   2557  O OE1 . GLU B 2 77  ? 24.630  28.930  23.689  1.00 98.15  ? 77  GLU B OE1 1 
ATOM   2558  O OE2 . GLU B 2 77  ? 26.002  30.523  24.343  1.00 99.10  ? 77  GLU B OE2 1 
ATOM   2559  N N   . ARG B 2 78  ? 23.171  28.549  30.317  1.00 50.86  ? 78  ARG B N   1 
ATOM   2560  C CA  . ARG B 2 78  ? 23.562  27.827  31.517  1.00 68.33  ? 78  ARG B CA  1 
ATOM   2561  C C   . ARG B 2 78  ? 22.495  26.777  31.746  1.00 61.50  ? 78  ARG B C   1 
ATOM   2562  O O   . ARG B 2 78  ? 21.306  27.099  31.750  1.00 76.49  ? 78  ARG B O   1 
ATOM   2563  C CB  . ARG B 2 78  ? 23.586  28.762  32.724  1.00 51.47  ? 78  ARG B CB  1 
ATOM   2564  C CG  . ARG B 2 78  ? 24.526  29.937  32.588  1.00 79.16  ? 78  ARG B CG  1 
ATOM   2565  C CD  . ARG B 2 78  ? 25.964  29.479  32.627  1.00 58.36  ? 78  ARG B CD  1 
ATOM   2566  N NE  . ARG B 2 78  ? 26.884  30.606  32.635  1.00 58.29  ? 78  ARG B NE  1 
ATOM   2567  C CZ  . ARG B 2 78  ? 27.994  30.648  33.357  1.00 43.62  ? 78  ARG B CZ  1 
ATOM   2568  N NH1 . ARG B 2 78  ? 28.322  29.629  34.139  1.00 77.43  ? 78  ARG B NH1 1 
ATOM   2569  N NH2 . ARG B 2 78  ? 28.784  31.701  33.285  1.00 73.65  ? 78  ARG B NH2 1 
ATOM   2570  N N   . TYR B 2 79  ? 22.884  25.523  31.932  1.00 68.15  ? 79  TYR B N   1 
ATOM   2571  C CA  . TYR B 2 79  ? 21.860  24.518  32.186  1.00 61.55  ? 79  TYR B CA  1 
ATOM   2572  C C   . TYR B 2 79  ? 20.947  25.003  33.293  1.00 49.71  ? 79  TYR B C   1 
ATOM   2573  O O   . TYR B 2 79  ? 21.362  25.738  34.176  1.00 75.28  ? 79  TYR B O   1 
ATOM   2574  C CB  . TYR B 2 79  ? 22.478  23.181  32.576  1.00 38.39  ? 79  TYR B CB  1 
ATOM   2575  C CG  . TYR B 2 79  ? 23.205  22.547  31.428  1.00 57.55  ? 79  TYR B CG  1 
ATOM   2576  C CD1 . TYR B 2 79  ? 24.501  22.935  31.108  1.00 48.13  ? 79  TYR B CD1 1 
ATOM   2577  C CD2 . TYR B 2 79  ? 22.574  21.588  30.624  1.00 63.57  ? 79  TYR B CD2 1 
ATOM   2578  C CE1 . TYR B 2 79  ? 25.157  22.393  30.016  1.00 73.89  ? 79  TYR B CE1 1 
ATOM   2579  C CE2 . TYR B 2 79  ? 23.217  21.031  29.531  1.00 60.92  ? 79  TYR B CE2 1 
ATOM   2580  C CZ  . TYR B 2 79  ? 24.511  21.439  29.229  1.00 70.70  ? 79  TYR B CZ  1 
ATOM   2581  O OH  . TYR B 2 79  ? 25.160  20.901  28.137  1.00 95.29  ? 79  TYR B OH  1 
ATOM   2582  N N   . VAL B 2 80  ? 19.687  24.618  33.212  1.00 53.09  ? 80  VAL B N   1 
ATOM   2583  C CA  . VAL B 2 80  ? 18.694  24.978  34.206  1.00 44.38  ? 80  VAL B CA  1 
ATOM   2584  C C   . VAL B 2 80  ? 17.872  23.708  34.291  1.00 63.44  ? 80  VAL B C   1 
ATOM   2585  O O   . VAL B 2 80  ? 17.114  23.375  33.376  1.00 61.77  ? 80  VAL B O   1 
ATOM   2586  C CB  . VAL B 2 80  ? 17.810  26.142  33.732  1.00 46.37  ? 80  VAL B CB  1 
ATOM   2587  C CG1 . VAL B 2 80  ? 16.745  26.433  34.761  1.00 43.73  ? 80  VAL B CG1 1 
ATOM   2588  C CG2 . VAL B 2 80  ? 18.668  27.374  33.469  1.00 45.49  ? 80  VAL B CG2 1 
ATOM   2589  N N   . VAL B 2 81  ? 18.040  22.989  35.390  1.00 57.75  ? 81  VAL B N   1 
ATOM   2590  C CA  . VAL B 2 81  ? 17.357  21.727  35.558  1.00 53.45  ? 81  VAL B CA  1 
ATOM   2591  C C   . VAL B 2 81  ? 16.307  21.720  36.647  1.00 45.71  ? 81  VAL B C   1 
ATOM   2592  O O   . VAL B 2 81  ? 16.612  21.873  37.823  1.00 55.98  ? 81  VAL B O   1 
ATOM   2593  C CB  . VAL B 2 81  ? 18.374  20.621  35.836  1.00 30.12  ? 81  VAL B CB  1 
ATOM   2594  C CG1 . VAL B 2 81  ? 17.696  19.290  35.803  1.00 57.95  ? 81  VAL B CG1 1 
ATOM   2595  C CG2 . VAL B 2 81  ? 19.486  20.678  34.816  1.00 30.56  ? 81  VAL B CG2 1 
ATOM   2596  N N   . GLY B 2 82  ? 15.058  21.546  36.239  1.00 45.85  ? 82  GLY B N   1 
ATOM   2597  C CA  . GLY B 2 82  ? 13.973  21.488  37.193  1.00 40.24  ? 82  GLY B CA  1 
ATOM   2598  C C   . GLY B 2 82  ? 13.788  20.046  37.629  1.00 46.59  ? 82  GLY B C   1 
ATOM   2599  O O   . GLY B 2 82  ? 14.120  19.108  36.901  1.00 42.34  ? 82  GLY B O   1 
ATOM   2600  N N   . VAL B 2 83  ? 13.261  19.863  38.827  1.00 48.97  ? 83  VAL B N   1 
ATOM   2601  C CA  . VAL B 2 83  ? 13.054  18.529  39.354  1.00 47.72  ? 83  VAL B CA  1 
ATOM   2602  C C   . VAL B 2 83  ? 11.770  18.526  40.143  1.00 48.35  ? 83  VAL B C   1 
ATOM   2603  O O   . VAL B 2 83  ? 11.651  19.201  41.165  1.00 56.50  ? 83  VAL B O   1 
ATOM   2604  C CB  . VAL B 2 83  ? 14.223  18.092  40.277  1.00 49.41  ? 83  VAL B CB  1 
ATOM   2605  C CG1 . VAL B 2 83  ? 13.972  16.710  40.812  1.00 39.70  ? 83  VAL B CG1 1 
ATOM   2606  C CG2 . VAL B 2 83  ? 15.531  18.129  39.514  1.00 39.01  ? 83  VAL B CG2 1 
ATOM   2607  N N   . CYS B 2 84  ? 10.803  17.767  39.652  1.00 43.80  ? 84  CYS B N   1 
ATOM   2608  C CA  . CYS B 2 84  ? 9.511   17.663  40.297  1.00 35.74  ? 84  CYS B CA  1 
ATOM   2609  C C   . CYS B 2 84  ? 8.796   19.011  40.202  1.00 40.04  ? 84  CYS B C   1 
ATOM   2610  O O   . CYS B 2 84  ? 8.764   19.611  39.133  1.00 49.61  ? 84  CYS B O   1 
ATOM   2611  C CB  . CYS B 2 84  ? 9.704   17.233  41.746  1.00 44.30  ? 84  CYS B CB  1 
ATOM   2612  S SG  . CYS B 2 84  ? 8.299   16.347  42.397  1.00 74.77  ? 84  CYS B SG  1 
ATOM   2613  N N   . LEU B 2 85  ? 8.235   19.491  41.307  1.00 41.52  ? 85  LEU B N   1 
ATOM   2614  C CA  . LEU B 2 85  ? 7.520   20.768  41.310  1.00 53.21  ? 85  LEU B CA  1 
ATOM   2615  C C   . LEU B 2 85  ? 8.227   21.796  40.449  1.00 49.04  ? 85  LEU B C   1 
ATOM   2616  O O   . LEU B 2 85  ? 7.584   22.589  39.772  1.00 58.29  ? 85  LEU B O   1 
ATOM   2617  C CB  . LEU B 2 85  ? 7.391   21.323  42.730  1.00 53.18  ? 85  LEU B CB  1 
ATOM   2618  C CG  . LEU B 2 85  ? 6.822   22.746  42.819  1.00 68.44  ? 85  LEU B CG  1 
ATOM   2619  C CD1 . LEU B 2 85  ? 5.327   22.734  42.493  1.00 69.13  ? 85  LEU B CD1 1 
ATOM   2620  C CD2 . LEU B 2 85  ? 7.076   23.304  44.209  1.00 47.75  ? 85  LEU B CD2 1 
ATOM   2621  N N   . GLY B 2 86  ? 9.557   21.757  40.478  1.00 58.10  ? 86  GLY B N   1 
ATOM   2622  C CA  . GLY B 2 86  ? 10.368  22.693  39.717  1.00 49.38  ? 86  GLY B CA  1 
ATOM   2623  C C   . GLY B 2 86  ? 10.413  22.446  38.224  1.00 57.25  ? 86  GLY B C   1 
ATOM   2624  O O   . GLY B 2 86  ? 10.876  23.294  37.452  1.00 55.10  ? 86  GLY B O   1 
ATOM   2625  N N   . MET B 2 87  ? 9.962   21.277  37.794  1.00 62.07  ? 87  MET B N   1 
ATOM   2626  C CA  . MET B 2 87  ? 9.958   21.013  36.362  1.00 55.53  ? 87  MET B CA  1 
ATOM   2627  C C   . MET B 2 87  ? 8.664   21.571  35.834  1.00 39.42  ? 87  MET B C   1 
ATOM   2628  O O   . MET B 2 87  ? 8.576   21.952  34.686  1.00 53.31  ? 87  MET B O   1 
ATOM   2629  C CB  . MET B 2 87  ? 10.012  19.527  36.067  1.00 48.68  ? 87  MET B CB  1 
ATOM   2630  C CG  . MET B 2 87  ? 9.953   19.219  34.591  1.00 61.17  ? 87  MET B CG  1 
ATOM   2631  S SD  . MET B 2 87  ? 9.580   17.476  34.286  1.00 60.14  ? 87  MET B SD  1 
ATOM   2632  C CE  . MET B 2 87  ? 7.798   17.507  34.310  1.00 53.27  ? 87  MET B CE  1 
ATOM   2633  N N   . GLN B 2 88  ? 7.661   21.621  36.695  1.00 38.39  ? 88  GLN B N   1 
ATOM   2634  C CA  . GLN B 2 88  ? 6.356   22.134  36.311  1.00 57.33  ? 88  GLN B CA  1 
ATOM   2635  C C   . GLN B 2 88  ? 6.378   23.658  36.321  1.00 71.18  ? 88  GLN B C   1 
ATOM   2636  O O   . GLN B 2 88  ? 5.562   24.314  35.651  1.00 79.99  ? 88  GLN B O   1 
ATOM   2637  C CB  . GLN B 2 88  ? 5.288   21.612  37.275  1.00 35.55  ? 88  GLN B CB  1 
ATOM   2638  C CG  . GLN B 2 88  ? 5.415   20.124  37.532  1.00 55.34  ? 88  GLN B CG  1 
ATOM   2639  C CD  . GLN B 2 88  ? 4.216   19.523  38.217  1.00 56.57  ? 88  GLN B CD  1 
ATOM   2640  O OE1 . GLN B 2 88  ? 3.760   20.009  39.258  1.00 70.10  ? 88  GLN B OE1 1 
ATOM   2641  N NE2 . GLN B 2 88  ? 3.699   18.437  37.643  1.00 72.49  ? 88  GLN B NE2 1 
ATOM   2642  N N   . LEU B 2 89  ? 7.309   24.216  37.095  1.00 71.76  ? 89  LEU B N   1 
ATOM   2643  C CA  . LEU B 2 89  ? 7.457   25.657  37.194  1.00 59.04  ? 89  LEU B CA  1 
ATOM   2644  C C   . LEU B 2 89  ? 8.122   26.179  35.926  1.00 50.90  ? 89  LEU B C   1 
ATOM   2645  O O   . LEU B 2 89  ? 8.192   27.387  35.710  1.00 58.14  ? 89  LEU B O   1 
ATOM   2646  C CB  . LEU B 2 89  ? 8.275   26.033  38.439  1.00 61.97  ? 89  LEU B CB  1 
ATOM   2647  C CG  . LEU B 2 89  ? 7.501   26.296  39.734  1.00 37.18  ? 89  LEU B CG  1 
ATOM   2648  C CD1 . LEU B 2 89  ? 6.519   25.174  39.996  1.00 57.29  ? 89  LEU B CD1 1 
ATOM   2649  C CD2 . LEU B 2 89  ? 8.468   26.443  40.893  1.00 49.02  ? 89  LEU B CD2 1 
ATOM   2650  N N   . LEU B 2 90  ? 8.601   25.268  35.081  1.00 48.89  ? 90  LEU B N   1 
ATOM   2651  C CA  . LEU B 2 90  ? 9.219   25.680  33.825  1.00 46.32  ? 90  LEU B CA  1 
ATOM   2652  C C   . LEU B 2 90  ? 8.120   26.079  32.821  1.00 63.31  ? 90  LEU B C   1 
ATOM   2653  O O   . LEU B 2 90  ? 8.405   26.695  31.791  1.00 71.77  ? 90  LEU B O   1 
ATOM   2654  C CB  . LEU B 2 90  ? 10.036  24.543  33.207  1.00 39.03  ? 90  LEU B CB  1 
ATOM   2655  C CG  . LEU B 2 90  ? 11.088  23.743  33.980  1.00 52.25  ? 90  LEU B CG  1 
ATOM   2656  C CD1 . LEU B 2 90  ? 11.763  22.783  32.996  1.00 46.10  ? 90  LEU B CD1 1 
ATOM   2657  C CD2 . LEU B 2 90  ? 12.125  24.660  34.613  1.00 45.95  ? 90  LEU B CD2 1 
ATOM   2658  N N   . PHE B 2 91  ? 6.870   25.725  33.125  1.00 67.65  ? 91  PHE B N   1 
ATOM   2659  C CA  . PHE B 2 91  ? 5.743   26.011  32.234  1.00 76.71  ? 91  PHE B CA  1 
ATOM   2660  C C   . PHE B 2 91  ? 4.908   27.257  32.544  1.00 72.11  ? 91  PHE B C   1 
ATOM   2661  O O   . PHE B 2 91  ? 5.183   27.985  33.499  1.00 77.23  ? 91  PHE B O   1 
ATOM   2662  C CB  . PHE B 2 91  ? 4.838   24.773  32.133  1.00 43.38  ? 91  PHE B CB  1 
ATOM   2663  C CG  . PHE B 2 91  ? 5.523   23.577  31.513  1.00 56.59  ? 91  PHE B CG  1 
ATOM   2664  C CD1 . PHE B 2 91  ? 6.139   22.608  32.315  1.00 64.70  ? 91  PHE B CD1 1 
ATOM   2665  C CD2 . PHE B 2 91  ? 5.597   23.442  30.130  1.00 54.55  ? 91  PHE B CD2 1 
ATOM   2666  C CE1 . PHE B 2 91  ? 6.820   21.528  31.747  1.00 41.70  ? 91  PHE B CE1 1 
ATOM   2667  C CE2 . PHE B 2 91  ? 6.275   22.368  29.548  1.00 49.29  ? 91  PHE B CE2 1 
ATOM   2668  C CZ  . PHE B 2 91  ? 6.889   21.408  30.360  1.00 68.67  ? 91  PHE B CZ  1 
ATOM   2669  N N   . GLU B 2 92  ? 3.873   27.477  31.732  1.00 80.97  ? 92  GLU B N   1 
ATOM   2670  C CA  . GLU B 2 92  ? 3.001   28.649  31.826  1.00 63.94  ? 92  GLU B CA  1 
ATOM   2671  C C   . GLU B 2 92  ? 1.985   28.762  32.974  1.00 66.93  ? 92  GLU B C   1 
ATOM   2672  O O   . GLU B 2 92  ? 1.949   29.781  33.671  1.00 57.98  ? 92  GLU B O   1 
ATOM   2673  C CB  . GLU B 2 92  ? 2.295   28.817  30.486  1.00 80.31  ? 92  GLU B CB  1 
ATOM   2674  C CG  . GLU B 2 92  ? 3.256   28.780  29.304  1.00 50.89  ? 92  GLU B CG  1 
ATOM   2675  C CD  . GLU B 2 92  ? 2.553   29.009  27.975  1.00 94.83  ? 92  GLU B CD  1 
ATOM   2676  O OE1 . GLU B 2 92  ? 1.355   28.647  27.866  1.00 74.89  ? 92  GLU B OE1 1 
ATOM   2677  O OE2 . GLU B 2 92  ? 3.202   29.537  27.036  1.00 83.89  ? 92  GLU B OE2 1 
ATOM   2678  N N   . GLU B 2 93  ? 1.134   27.755  33.152  1.00 66.23  ? 93  GLU B N   1 
ATOM   2679  C CA  . GLU B 2 93  ? 0.161   27.784  34.243  1.00 58.64  ? 93  GLU B CA  1 
ATOM   2680  C C   . GLU B 2 93  ? -0.328  26.385  34.610  1.00 52.24  ? 93  GLU B C   1 
ATOM   2681  O O   . GLU B 2 93  ? -0.053  25.418  33.896  1.00 53.62  ? 93  GLU B O   1 
ATOM   2682  C CB  . GLU B 2 93  ? -1.011  28.724  33.907  1.00 62.82  ? 93  GLU B CB  1 
ATOM   2683  C CG  . GLU B 2 93  ? -1.504  28.706  32.455  1.00 92.59  ? 93  GLU B CG  1 
ATOM   2684  C CD  . GLU B 2 93  ? -2.176  30.033  32.046  1.00 103.15 ? 93  GLU B CD  1 
ATOM   2685  O OE1 . GLU B 2 93  ? -3.028  30.531  32.818  1.00 78.38  ? 93  GLU B OE1 1 
ATOM   2686  O OE2 . GLU B 2 93  ? -1.852  30.577  30.956  1.00 83.57  ? 93  GLU B OE2 1 
ATOM   2687  N N   . SER B 2 94  ? -1.032  26.277  35.732  1.00 45.95  ? 94  SER B N   1 
ATOM   2688  C CA  . SER B 2 94  ? -1.510  24.981  36.204  1.00 63.09  ? 94  SER B CA  1 
ATOM   2689  C C   . SER B 2 94  ? -2.924  25.011  36.729  1.00 63.74  ? 94  SER B C   1 
ATOM   2690  O O   . SER B 2 94  ? -3.350  26.004  37.316  1.00 68.93  ? 94  SER B O   1 
ATOM   2691  C CB  . SER B 2 94  ? -0.605  24.456  37.328  1.00 64.18  ? 94  SER B CB  1 
ATOM   2692  O OG  . SER B 2 94  ? -1.228  23.372  38.015  1.00 49.64  ? 94  SER B OG  1 
ATOM   2693  N N   . GLU B 2 95  ? -3.643  23.912  36.538  1.00 52.22  ? 95  GLU B N   1 
ATOM   2694  C CA  . GLU B 2 95  ? -5.004  23.829  37.030  1.00 45.06  ? 95  GLU B CA  1 
ATOM   2695  C C   . GLU B 2 95  ? -4.952  23.859  38.547  1.00 71.24  ? 95  GLU B C   1 
ATOM   2696  O O   . GLU B 2 95  ? -5.992  23.898  39.226  1.00 62.91  ? 95  GLU B O   1 
ATOM   2697  C CB  . GLU B 2 95  ? -5.658  22.529  36.584  1.00 77.57  ? 95  GLU B CB  1 
ATOM   2698  C CG  . GLU B 2 95  ? -5.441  22.200  35.116  1.00 93.33  ? 95  GLU B CG  1 
ATOM   2699  C CD  . GLU B 2 95  ? -6.386  21.108  34.630  1.00 103.15 ? 95  GLU B CD  1 
ATOM   2700  O OE1 . GLU B 2 95  ? -6.604  20.119  35.385  1.00 80.79  ? 95  GLU B OE1 1 
ATOM   2701  O OE2 . GLU B 2 95  ? -6.903  21.246  33.492  1.00 92.20  ? 95  GLU B OE2 1 
ATOM   2702  N N   . GLU B 2 96  ? -3.732  23.825  39.084  1.00 59.43  ? 96  GLU B N   1 
ATOM   2703  C CA  . GLU B 2 96  ? -3.556  23.849  40.526  1.00 57.79  ? 96  GLU B CA  1 
ATOM   2704  C C   . GLU B 2 96  ? -3.744  25.281  40.997  1.00 50.63  ? 96  GLU B C   1 
ATOM   2705  O O   . GLU B 2 96  ? -4.439  25.538  41.983  1.00 59.19  ? 96  GLU B O   1 
ATOM   2706  C CB  . GLU B 2 96  ? -2.168  23.329  40.892  1.00 69.07  ? 96  GLU B CB  1 
ATOM   2707  C CG  . GLU B 2 96  ? -1.896  23.297  42.386  1.00 63.95  ? 96  GLU B CG  1 
ATOM   2708  C CD  . GLU B 2 96  ? -0.883  22.231  42.772  1.00 82.40  ? 96  GLU B CD  1 
ATOM   2709  O OE1 . GLU B 2 96  ? 0.252   22.248  42.231  1.00 49.19  ? 96  GLU B OE1 1 
ATOM   2710  O OE2 . GLU B 2 96  ? -1.235  21.379  43.618  1.00 45.46  ? 96  GLU B OE2 1 
ATOM   2711  N N   . ALA B 2 97  ? -3.111  26.200  40.274  1.00 49.88  ? 97  ALA B N   1 
ATOM   2712  C CA  . ALA B 2 97  ? -3.197  27.632  40.542  1.00 68.75  ? 97  ALA B CA  1 
ATOM   2713  C C   . ALA B 2 97  ? -3.588  28.280  39.209  1.00 74.43  ? 97  ALA B C   1 
ATOM   2714  O O   . ALA B 2 97  ? -2.730  28.811  38.473  1.00 79.21  ? 97  ALA B O   1 
ATOM   2715  C CB  . ALA B 2 97  ? -1.859  28.169  41.017  1.00 63.01  ? 97  ALA B CB  1 
ATOM   2716  N N   . PRO B 2 98  ? -4.894  28.243  38.883  1.00 63.21  ? 98  PRO B N   1 
ATOM   2717  C CA  . PRO B 2 98  ? -5.456  28.803  37.644  1.00 71.92  ? 98  PRO B CA  1 
ATOM   2718  C C   . PRO B 2 98  ? -4.863  30.149  37.202  1.00 88.21  ? 98  PRO B C   1 
ATOM   2719  O O   . PRO B 2 98  ? -4.231  30.249  36.132  1.00 67.86  ? 98  PRO B O   1 
ATOM   2720  C CB  . PRO B 2 98  ? -6.960  28.894  37.947  1.00 72.57  ? 98  PRO B CB  1 
ATOM   2721  C CG  . PRO B 2 98  ? -7.027  28.948  39.470  1.00 72.96  ? 98  PRO B CG  1 
ATOM   2722  C CD  . PRO B 2 98  ? -5.962  27.960  39.862  1.00 51.85  ? 98  PRO B CD  1 
ATOM   2723  N N   . GLY B 2 99  ? -5.055  31.182  38.019  1.00 75.76  ? 99  GLY B N   1 
ATOM   2724  C CA  . GLY B 2 99  ? -4.542  32.487  37.642  1.00 77.16  ? 99  GLY B CA  1 
ATOM   2725  C C   . GLY B 2 99  ? -3.035  32.505  37.479  1.00 82.63  ? 99  GLY B C   1 
ATOM   2726  O O   . GLY B 2 99  ? -2.499  32.867  36.432  1.00 90.25  ? 99  GLY B O   1 
ATOM   2727  N N   . VAL B 2 100 ? -2.354  32.077  38.532  1.00 88.51  ? 100 VAL B N   1 
ATOM   2728  C CA  . VAL B 2 100 ? -0.901  32.064  38.607  1.00 64.98  ? 100 VAL B CA  1 
ATOM   2729  C C   . VAL B 2 100 ? -0.099  31.621  37.388  1.00 70.91  ? 100 VAL B C   1 
ATOM   2730  O O   . VAL B 2 100 ? -0.217  30.482  36.928  1.00 77.30  ? 100 VAL B O   1 
ATOM   2731  C CB  . VAL B 2 100 ? -0.443  31.211  39.813  1.00 77.55  ? 100 VAL B CB  1 
ATOM   2732  C CG1 . VAL B 2 100 ? 1.053   31.413  40.058  1.00 77.85  ? 100 VAL B CG1 1 
ATOM   2733  C CG2 . VAL B 2 100 ? -1.269  31.578  41.067  1.00 66.33  ? 100 VAL B CG2 1 
ATOM   2734  N N   . LYS B 2 101 ? 0.719   32.533  36.872  1.00 48.87  ? 101 LYS B N   1 
ATOM   2735  C CA  . LYS B 2 101 ? 1.606   32.224  35.761  1.00 53.09  ? 101 LYS B CA  1 
ATOM   2736  C C   . LYS B 2 101 ? 2.865   31.582  36.371  1.00 58.50  ? 101 LYS B C   1 
ATOM   2737  O O   . LYS B 2 101 ? 3.137   31.727  37.559  1.00 59.02  ? 101 LYS B O   1 
ATOM   2738  C CB  . LYS B 2 101 ? 2.005   33.501  35.008  1.00 60.29  ? 101 LYS B CB  1 
ATOM   2739  C CG  . LYS B 2 101 ? 1.036   33.955  33.910  1.00 84.73  ? 101 LYS B CG  1 
ATOM   2740  C CD  . LYS B 2 101 ? 1.161   33.092  32.648  1.00 91.64  ? 101 LYS B CD  1 
ATOM   2741  C CE  . LYS B 2 101 ? 0.206   33.554  31.539  1.00 96.75  ? 101 LYS B CE  1 
ATOM   2742  N NZ  . LYS B 2 101 ? 0.048   32.562  30.407  1.00 77.69  ? 101 LYS B NZ  1 
ATOM   2743  N N   . GLY B 2 102 ? 3.633   30.870  35.563  1.00 59.34  ? 102 GLY B N   1 
ATOM   2744  C CA  . GLY B 2 102 ? 4.841   30.265  36.076  1.00 56.73  ? 102 GLY B CA  1 
ATOM   2745  C C   . GLY B 2 102 ? 6.012   30.925  35.381  1.00 69.02  ? 102 GLY B C   1 
ATOM   2746  O O   . GLY B 2 102 ? 5.863   32.008  34.820  1.00 70.46  ? 102 GLY B O   1 
ATOM   2747  N N   . LEU B 2 103 ? 7.176   30.286  35.421  1.00 71.38  ? 103 LEU B N   1 
ATOM   2748  C CA  . LEU B 2 103 ? 8.354   30.824  34.765  1.00 62.66  ? 103 LEU B CA  1 
ATOM   2749  C C   . LEU B 2 103 ? 8.057   30.976  33.279  1.00 48.04  ? 103 LEU B C   1 
ATOM   2750  O O   . LEU B 2 103 ? 8.288   32.036  32.706  1.00 78.09  ? 103 LEU B O   1 
ATOM   2751  C CB  . LEU B 2 103 ? 9.546   29.895  34.990  1.00 63.94  ? 103 LEU B CB  1 
ATOM   2752  C CG  . LEU B 2 103 ? 9.951   29.830  36.467  1.00 70.80  ? 103 LEU B CG  1 
ATOM   2753  C CD1 . LEU B 2 103 ? 10.752  28.578  36.743  1.00 57.16  ? 103 LEU B CD1 1 
ATOM   2754  C CD2 . LEU B 2 103 ? 10.755  31.069  36.823  1.00 52.08  ? 103 LEU B CD2 1 
ATOM   2755  N N   . SER B 2 104 ? 7.531   29.925  32.663  1.00 53.90  ? 104 SER B N   1 
ATOM   2756  C CA  . SER B 2 104 ? 7.184   29.947  31.238  1.00 68.54  ? 104 SER B CA  1 
ATOM   2757  C C   . SER B 2 104 ? 8.370   29.763  30.300  1.00 51.92  ? 104 SER B C   1 
ATOM   2758  O O   . SER B 2 104 ? 8.317   30.198  29.155  1.00 73.17  ? 104 SER B O   1 
ATOM   2759  C CB  . SER B 2 104 ? 6.482   31.264  30.871  1.00 76.04  ? 104 SER B CB  1 
ATOM   2760  O OG  . SER B 2 104 ? 5.410   31.550  31.758  1.00 78.98  ? 104 SER B OG  1 
ATOM   2761  N N   . LEU B 2 105 ? 9.429   29.117  30.775  1.00 62.79  ? 105 LEU B N   1 
ATOM   2762  C CA  . LEU B 2 105 ? 10.631  28.895  29.975  1.00 50.16  ? 105 LEU B CA  1 
ATOM   2763  C C   . LEU B 2 105 ? 10.411  27.827  28.921  1.00 60.29  ? 105 LEU B C   1 
ATOM   2764  O O   . LEU B 2 105 ? 11.207  27.664  27.988  1.00 49.68  ? 105 LEU B O   1 
ATOM   2765  C CB  . LEU B 2 105 ? 11.781  28.469  30.889  1.00 65.93  ? 105 LEU B CB  1 
ATOM   2766  C CG  . LEU B 2 105 ? 12.247  29.542  31.874  1.00 83.39  ? 105 LEU B CG  1 
ATOM   2767  C CD1 . LEU B 2 105 ? 12.490  28.940  33.269  1.00 61.13  ? 105 LEU B CD1 1 
ATOM   2768  C CD2 . LEU B 2 105 ? 13.497  30.198  31.302  1.00 66.41  ? 105 LEU B CD2 1 
ATOM   2769  N N   . ILE B 2 106 ? 9.340   27.069  29.109  1.00 55.57  ? 106 ILE B N   1 
ATOM   2770  C CA  . ILE B 2 106 ? 8.990   26.012  28.187  1.00 68.83  ? 106 ILE B CA  1 
ATOM   2771  C C   . ILE B 2 106 ? 7.503   26.147  27.888  1.00 72.21  ? 106 ILE B C   1 
ATOM   2772  O O   . ILE B 2 106 ? 6.689   26.440  28.778  1.00 66.90  ? 106 ILE B O   1 
ATOM   2773  C CB  . ILE B 2 106 ? 9.300   24.602  28.783  1.00 78.54  ? 106 ILE B CB  1 
ATOM   2774  C CG1 . ILE B 2 106 ? 10.806  24.456  29.034  1.00 78.53  ? 106 ILE B CG1 1 
ATOM   2775  C CG2 . ILE B 2 106 ? 8.848   23.519  27.816  1.00 64.04  ? 106 ILE B CG2 1 
ATOM   2776  C CD1 . ILE B 2 106 ? 11.218  23.115  29.624  1.00 79.69  ? 106 ILE B CD1 1 
ATOM   2777  N N   . GLU B 2 107 ? 7.174   25.954  26.615  1.00 81.87  ? 107 GLU B N   1 
ATOM   2778  C CA  . GLU B 2 107 ? 5.813   26.046  26.096  1.00 68.26  ? 107 GLU B CA  1 
ATOM   2779  C C   . GLU B 2 107 ? 4.946   24.901  26.581  1.00 51.50  ? 107 GLU B C   1 
ATOM   2780  O O   . GLU B 2 107 ? 5.203   23.751  26.277  1.00 51.19  ? 107 GLU B O   1 
ATOM   2781  C CB  . GLU B 2 107 ? 5.853   26.036  24.562  1.00 92.41  ? 107 GLU B CB  1 
ATOM   2782  C CG  . GLU B 2 107 ? 6.996   25.183  23.986  1.00 94.81  ? 107 GLU B CG  1 
ATOM   2783  C CD  . GLU B 2 107 ? 8.276   25.997  23.733  1.00 103.15 ? 107 GLU B CD  1 
ATOM   2784  O OE1 . GLU B 2 107 ? 8.526   26.988  24.473  1.00 89.11  ? 107 GLU B OE1 1 
ATOM   2785  O OE2 . GLU B 2 107 ? 9.036   25.637  22.794  1.00 100.89 ? 107 GLU B OE2 1 
ATOM   2786  N N   . GLY B 2 108 ? 3.908   25.224  27.328  1.00 42.04  ? 108 GLY B N   1 
ATOM   2787  C CA  . GLY B 2 108 ? 3.035   24.189  27.811  1.00 52.97  ? 108 GLY B CA  1 
ATOM   2788  C C   . GLY B 2 108 ? 2.356   24.645  29.074  1.00 59.54  ? 108 GLY B C   1 
ATOM   2789  O O   . GLY B 2 108 ? 2.564   25.775  29.535  1.00 60.73  ? 108 GLY B O   1 
ATOM   2790  N N   . ASN B 2 109 ? 1.528   23.772  29.628  1.00 46.48  ? 109 ASN B N   1 
ATOM   2791  C CA  . ASN B 2 109 ? 0.825   24.078  30.860  1.00 51.27  ? 109 ASN B CA  1 
ATOM   2792  C C   . ASN B 2 109 ? 0.858   22.813  31.716  1.00 51.53  ? 109 ASN B C   1 
ATOM   2793  O O   . ASN B 2 109 ? 1.445   21.807  31.315  1.00 50.52  ? 109 ASN B O   1 
ATOM   2794  C CB  . ASN B 2 109 ? -0.618  24.515  30.547  1.00 60.64  ? 109 ASN B CB  1 
ATOM   2795  C CG  . ASN B 2 109 ? -1.513  23.355  30.139  1.00 69.82  ? 109 ASN B CG  1 
ATOM   2796  O OD1 . ASN B 2 109 ? -1.162  22.546  29.271  1.00 74.64  ? 109 ASN B OD1 1 
ATOM   2797  N ND2 . ASN B 2 109 ? -2.684  23.271  30.767  1.00 78.76  ? 109 ASN B ND2 1 
ATOM   2798  N N   . VAL B 2 110 ? 0.248   22.857  32.890  1.00 44.54  ? 110 VAL B N   1 
ATOM   2799  C CA  . VAL B 2 110 ? 0.239   21.690  33.761  1.00 63.71  ? 110 VAL B CA  1 
ATOM   2800  C C   . VAL B 2 110 ? -1.173  21.260  34.096  1.00 50.24  ? 110 VAL B C   1 
ATOM   2801  O O   . VAL B 2 110 ? -1.944  22.021  34.685  1.00 65.34  ? 110 VAL B O   1 
ATOM   2802  C CB  . VAL B 2 110 ? 1.005   21.959  35.086  1.00 62.21  ? 110 VAL B CB  1 
ATOM   2803  C CG1 . VAL B 2 110 ? 0.693   20.863  36.093  1.00 49.43  ? 110 VAL B CG1 1 
ATOM   2804  C CG2 . VAL B 2 110 ? 2.506   22.009  34.819  1.00 33.18  ? 110 VAL B CG2 1 
ATOM   2805  N N   . VAL B 2 111 ? -1.504  20.031  33.724  1.00 59.44  ? 111 VAL B N   1 
ATOM   2806  C CA  . VAL B 2 111 ? -2.834  19.498  33.984  1.00 66.06  ? 111 VAL B CA  1 
ATOM   2807  C C   . VAL B 2 111 ? -2.797  18.322  34.970  1.00 65.25  ? 111 VAL B C   1 
ATOM   2808  O O   . VAL B 2 111 ? -1.795  17.625  35.093  1.00 58.89  ? 111 VAL B O   1 
ATOM   2809  C CB  . VAL B 2 111 ? -3.513  19.036  32.660  1.00 71.82  ? 111 VAL B CB  1 
ATOM   2810  C CG1 . VAL B 2 111 ? -4.902  18.509  32.938  1.00 54.90  ? 111 VAL B CG1 1 
ATOM   2811  C CG2 . VAL B 2 111 ? -3.579  20.195  31.679  1.00 60.79  ? 111 VAL B CG2 1 
ATOM   2812  N N   . LYS B 2 112 ? -3.909  18.120  35.664  1.00 56.80  ? 112 LYS B N   1 
ATOM   2813  C CA  . LYS B 2 112 ? -4.065  17.051  36.639  1.00 51.79  ? 112 LYS B CA  1 
ATOM   2814  C C   . LYS B 2 112 ? -4.222  15.723  35.908  1.00 58.83  ? 112 LYS B C   1 
ATOM   2815  O O   . LYS B 2 112 ? -5.056  15.609  35.010  1.00 71.65  ? 112 LYS B O   1 
ATOM   2816  C CB  . LYS B 2 112 ? -5.317  17.332  37.460  1.00 53.97  ? 112 LYS B CB  1 
ATOM   2817  C CG  . LYS B 2 112 ? -5.520  16.505  38.697  1.00 38.97  ? 112 LYS B CG  1 
ATOM   2818  C CD  . LYS B 2 112 ? -6.804  16.971  39.418  1.00 59.34  ? 112 LYS B CD  1 
ATOM   2819  C CE  . LYS B 2 112 ? -6.867  18.511  39.565  1.00 74.03  ? 112 LYS B CE  1 
ATOM   2820  N NZ  . LYS B 2 112 ? -8.018  19.000  40.397  1.00 65.71  ? 112 LYS B NZ  1 
ATOM   2821  N N   . LEU B 2 113 ? -3.417  14.729  36.274  1.00 64.63  ? 113 LEU B N   1 
ATOM   2822  C CA  . LEU B 2 113 ? -3.519  13.415  35.647  1.00 54.29  ? 113 LEU B CA  1 
ATOM   2823  C C   . LEU B 2 113 ? -4.996  13.013  35.680  1.00 58.96  ? 113 LEU B C   1 
ATOM   2824  O O   . LEU B 2 113 ? -5.723  13.385  36.603  1.00 51.68  ? 113 LEU B O   1 
ATOM   2825  C CB  . LEU B 2 113 ? -2.696  12.380  36.424  1.00 46.88  ? 113 LEU B CB  1 
ATOM   2826  C CG  . LEU B 2 113 ? -1.174  12.313  36.278  1.00 52.01  ? 113 LEU B CG  1 
ATOM   2827  C CD1 . LEU B 2 113 ? -0.625  11.395  37.350  1.00 70.43  ? 113 LEU B CD1 1 
ATOM   2828  C CD2 . LEU B 2 113 ? -0.775  11.807  34.900  1.00 54.00  ? 113 LEU B CD2 1 
ATOM   2829  N N   . ARG B 2 114 ? -5.447  12.264  34.680  1.00 56.16  ? 114 ARG B N   1 
ATOM   2830  C CA  . ARG B 2 114 ? -6.844  11.836  34.663  1.00 72.16  ? 114 ARG B CA  1 
ATOM   2831  C C   . ARG B 2 114 ? -6.944  10.400  35.158  1.00 61.94  ? 114 ARG B C   1 
ATOM   2832  O O   . ARG B 2 114 ? -7.307  9.488   34.415  1.00 96.71  ? 114 ARG B O   1 
ATOM   2833  C CB  . ARG B 2 114 ? -7.445  11.967  33.254  1.00 64.32  ? 114 ARG B CB  1 
ATOM   2834  C CG  . ARG B 2 114 ? -7.610  13.402  32.779  1.00 51.57  ? 114 ARG B CG  1 
ATOM   2835  C CD  . ARG B 2 114 ? -6.492  13.780  31.837  1.00 79.00  ? 114 ARG B CD  1 
ATOM   2836  N NE  . ARG B 2 114 ? -6.585  15.174  31.399  1.00 84.99  ? 114 ARG B NE  1 
ATOM   2837  C CZ  . ARG B 2 114 ? -5.874  15.689  30.394  1.00 91.69  ? 114 ARG B CZ  1 
ATOM   2838  N NH1 . ARG B 2 114 ? -5.018  14.926  29.719  1.00 54.02  ? 114 ARG B NH1 1 
ATOM   2839  N NH2 . ARG B 2 114 ? -6.016  16.970  30.062  1.00 65.39  ? 114 ARG B NH2 1 
ATOM   2840  N N   . SER B 2 115 ? -6.594  10.213  36.425  1.00 77.31  ? 115 SER B N   1 
ATOM   2841  C CA  . SER B 2 115 ? -6.628  8.912   37.074  1.00 55.90  ? 115 SER B CA  1 
ATOM   2842  C C   . SER B 2 115 ? -7.433  9.055   38.364  1.00 64.36  ? 115 SER B C   1 
ATOM   2843  O O   . SER B 2 115 ? -7.474  10.137  38.965  1.00 67.13  ? 115 SER B O   1 
ATOM   2844  C CB  . SER B 2 115 ? -5.204  8.454   37.382  1.00 40.32  ? 115 SER B CB  1 
ATOM   2845  O OG  . SER B 2 115 ? -5.197  7.162   37.952  1.00 52.54  ? 115 SER B OG  1 
ATOM   2846  N N   . ARG B 2 116 ? -8.089  7.974   38.775  1.00 70.18  ? 116 ARG B N   1 
ATOM   2847  C CA  . ARG B 2 116 ? -8.893  7.978   39.998  1.00 78.10  ? 116 ARG B CA  1 
ATOM   2848  C C   . ARG B 2 116 ? -8.029  7.728   41.234  1.00 68.48  ? 116 ARG B C   1 
ATOM   2849  O O   . ARG B 2 116 ? -8.486  7.903   42.365  1.00 82.36  ? 116 ARG B O   1 
ATOM   2850  C CB  . ARG B 2 116 ? -9.983  6.906   39.938  1.00 69.77  ? 116 ARG B CB  1 
ATOM   2851  C CG  . ARG B 2 116 ? -11.042 7.116   38.889  1.00 73.17  ? 116 ARG B CG  1 
ATOM   2852  C CD  . ARG B 2 116 ? -11.794 5.807   38.748  1.00 96.88  ? 116 ARG B CD  1 
ATOM   2853  N NE  . ARG B 2 116 ? -10.831 4.725   38.534  1.00 96.96  ? 116 ARG B NE  1 
ATOM   2854  C CZ  . ARG B 2 116 ? -11.112 3.431   38.617  1.00 98.29  ? 116 ARG B CZ  1 
ATOM   2855  N NH1 . ARG B 2 116 ? -12.347 3.031   38.912  1.00 97.83  ? 116 ARG B NH1 1 
ATOM   2856  N NH2 . ARG B 2 116 ? -10.146 2.537   38.426  1.00 96.07  ? 116 ARG B NH2 1 
ATOM   2857  N N   . ARG B 2 117 ? -6.803  7.273   41.021  1.00 60.93  ? 117 ARG B N   1 
ATOM   2858  C CA  . ARG B 2 117 ? -5.881  7.048   42.134  1.00 65.09  ? 117 ARG B CA  1 
ATOM   2859  C C   . ARG B 2 117 ? -4.968  8.280   42.031  1.00 65.38  ? 117 ARG B C   1 
ATOM   2860  O O   . ARG B 2 117 ? -3.771  8.168   41.769  1.00 48.77  ? 117 ARG B O   1 
ATOM   2861  C CB  . ARG B 2 117 ? -5.097  5.740   41.922  1.00 48.25  ? 117 ARG B CB  1 
ATOM   2862  C CG  . ARG B 2 117 ? -4.288  5.273   43.130  1.00 47.35  ? 117 ARG B CG  1 
ATOM   2863  C CD  . ARG B 2 117 ? -5.123  5.292   44.409  1.00 59.10  ? 117 ARG B CD  1 
ATOM   2864  N NE  . ARG B 2 117 ? -5.046  6.586   45.083  1.00 68.87  ? 117 ARG B NE  1 
ATOM   2865  C CZ  . ARG B 2 117 ? -5.826  6.966   46.093  1.00 64.99  ? 117 ARG B CZ  1 
ATOM   2866  N NH1 . ARG B 2 117 ? -6.761  6.147   46.552  1.00 47.69  ? 117 ARG B NH1 1 
ATOM   2867  N NH2 . ARG B 2 117 ? -5.667  8.168   46.641  1.00 37.66  ? 117 ARG B NH2 1 
ATOM   2868  N N   . LEU B 2 118 ? -5.580  9.454   42.222  1.00 70.63  ? 118 LEU B N   1 
ATOM   2869  C CA  . LEU B 2 118 ? -4.913  10.752  42.096  1.00 79.56  ? 118 LEU B CA  1 
ATOM   2870  C C   . LEU B 2 118 ? -3.415  10.829  42.337  1.00 76.93  ? 118 LEU B C   1 
ATOM   2871  O O   . LEU B 2 118 ? -2.670  11.085  41.383  1.00 93.99  ? 118 LEU B O   1 
ATOM   2872  C CB  . LEU B 2 118 ? -5.624  11.829  42.939  1.00 80.28  ? 118 LEU B CB  1 
ATOM   2873  C CG  . LEU B 2 118 ? -6.824  12.562  42.301  1.00 88.52  ? 118 LEU B CG  1 
ATOM   2874  C CD1 . LEU B 2 118 ? -6.398  13.173  40.966  1.00 64.09  ? 118 LEU B CD1 1 
ATOM   2875  C CD2 . LEU B 2 118 ? -8.001  11.600  42.103  1.00 72.26  ? 118 LEU B CD2 1 
ATOM   2876  N N   . PRO B 2 119 ? -2.938  10.603  43.585  1.00 65.63  ? 119 PRO B N   1 
ATOM   2877  C CA  . PRO B 2 119 ? -1.477  10.696  43.766  1.00 55.71  ? 119 PRO B CA  1 
ATOM   2878  C C   . PRO B 2 119 ? -0.693  9.599   43.048  1.00 40.45  ? 119 PRO B C   1 
ATOM   2879  O O   . PRO B 2 119 ? -0.763  8.443   43.448  1.00 43.21  ? 119 PRO B O   1 
ATOM   2880  C CB  . PRO B 2 119 ? -1.290  10.611  45.294  1.00 43.00  ? 119 PRO B CB  1 
ATOM   2881  C CG  . PRO B 2 119 ? -2.675  10.926  45.866  1.00 63.58  ? 119 PRO B CG  1 
ATOM   2882  C CD  . PRO B 2 119 ? -3.610  10.293  44.863  1.00 49.30  ? 119 PRO B CD  1 
ATOM   2883  N N   . HIS B 2 120 ? 0.032   9.954   41.987  1.00 39.82  ? 120 HIS B N   1 
ATOM   2884  C CA  . HIS B 2 120 ? 0.866   8.987   41.260  1.00 31.82  ? 120 HIS B CA  1 
ATOM   2885  C C   . HIS B 2 120 ? 2.126   8.833   42.122  1.00 45.22  ? 120 HIS B C   1 
ATOM   2886  O O   . HIS B 2 120 ? 3.041   9.643   42.048  1.00 43.37  ? 120 HIS B O   1 
ATOM   2887  C CB  . HIS B 2 120 ? 1.203   9.521   39.859  1.00 29.17  ? 120 HIS B CB  1 
ATOM   2888  C CG  . HIS B 2 120 ? 2.266   8.746   39.136  1.00 29.66  ? 120 HIS B CG  1 
ATOM   2889  N ND1 . HIS B 2 120 ? 2.432   7.385   39.274  1.00 41.98  ? 120 HIS B ND1 1 
ATOM   2890  C CD2 . HIS B 2 120 ? 3.195   9.144   38.234  1.00 27.95  ? 120 HIS B CD2 1 
ATOM   2891  C CE1 . HIS B 2 120 ? 3.416   6.980   38.491  1.00 35.21  ? 120 HIS B CE1 1 
ATOM   2892  N NE2 . HIS B 2 120 ? 3.895   8.029   37.848  1.00 29.79  ? 120 HIS B NE2 1 
ATOM   2893  N N   . MET B 2 121 ? 2.148   7.786   42.945  1.00 55.67  ? 121 MET B N   1 
ATOM   2894  C CA  . MET B 2 121 ? 3.242   7.525   43.875  1.00 39.72  ? 121 MET B CA  1 
ATOM   2895  C C   . MET B 2 121 ? 3.816   6.101   43.789  1.00 41.36  ? 121 MET B C   1 
ATOM   2896  O O   . MET B 2 121 ? 3.112   5.111   44.017  1.00 52.15  ? 121 MET B O   1 
ATOM   2897  C CB  . MET B 2 121 ? 2.730   7.829   45.296  1.00 50.66  ? 121 MET B CB  1 
ATOM   2898  C CG  . MET B 2 121 ? 3.678   7.560   46.446  1.00 33.87  ? 121 MET B CG  1 
ATOM   2899  S SD  . MET B 2 121 ? 3.120   8.342   48.006  1.00 46.04  ? 121 MET B SD  1 
ATOM   2900  C CE  . MET B 2 121 ? 1.576   7.606   48.240  1.00 31.40  ? 121 MET B CE  1 
ATOM   2901  N N   . GLY B 2 122 ? 5.097   6.010   43.451  1.00 36.78  ? 122 GLY B N   1 
ATOM   2902  C CA  . GLY B 2 122 ? 5.745   4.722   43.357  1.00 26.28  ? 122 GLY B CA  1 
ATOM   2903  C C   . GLY B 2 122 ? 6.819   4.699   42.296  1.00 41.73  ? 122 GLY B C   1 
ATOM   2904  O O   . GLY B 2 122 ? 7.094   5.707   41.667  1.00 45.18  ? 122 GLY B O   1 
ATOM   2905  N N   . TRP B 2 123 ? 7.435   3.542   42.105  1.00 39.89  ? 123 TRP B N   1 
ATOM   2906  C CA  . TRP B 2 123 ? 8.467   3.378   41.102  1.00 37.40  ? 123 TRP B CA  1 
ATOM   2907  C C   . TRP B 2 123 ? 7.780   3.081   39.777  1.00 48.38  ? 123 TRP B C   1 
ATOM   2908  O O   . TRP B 2 123 ? 6.913   2.223   39.709  1.00 43.82  ? 123 TRP B O   1 
ATOM   2909  C CB  . TRP B 2 123 ? 9.383   2.202   41.446  1.00 38.24  ? 123 TRP B CB  1 
ATOM   2910  C CG  . TRP B 2 123 ? 10.195  2.342   42.709  1.00 38.93  ? 123 TRP B CG  1 
ATOM   2911  C CD1 . TRP B 2 123 ? 9.802   2.027   43.975  1.00 39.72  ? 123 TRP B CD1 1 
ATOM   2912  C CD2 . TRP B 2 123 ? 11.557  2.782   42.808  1.00 33.29  ? 123 TRP B CD2 1 
ATOM   2913  N NE1 . TRP B 2 123 ? 10.834  2.232   44.858  1.00 41.59  ? 123 TRP B NE1 1 
ATOM   2914  C CE2 . TRP B 2 123 ? 11.924  2.696   44.173  1.00 33.87  ? 123 TRP B CE2 1 
ATOM   2915  C CE3 . TRP B 2 123 ? 12.505  3.237   41.876  1.00 36.23  ? 123 TRP B CE3 1 
ATOM   2916  C CZ2 . TRP B 2 123 ? 13.198  3.051   44.635  1.00 33.39  ? 123 TRP B CZ2 1 
ATOM   2917  C CZ3 . TRP B 2 123 ? 13.777  3.592   42.332  1.00 36.99  ? 123 TRP B CZ3 1 
ATOM   2918  C CH2 . TRP B 2 123 ? 14.111  3.493   43.705  1.00 41.48  ? 123 TRP B CH2 1 
ATOM   2919  N N   . ASN B 2 124 ? 8.164   3.785   38.724  1.00 46.68  ? 124 ASN B N   1 
ATOM   2920  C CA  . ASN B 2 124 ? 7.559   3.563   37.426  1.00 42.65  ? 124 ASN B CA  1 
ATOM   2921  C C   . ASN B 2 124 ? 8.690   3.641   36.421  1.00 54.19  ? 124 ASN B C   1 
ATOM   2922  O O   . ASN B 2 124 ? 9.744   4.206   36.713  1.00 54.29  ? 124 ASN B O   1 
ATOM   2923  C CB  . ASN B 2 124 ? 6.512   4.633   37.131  1.00 44.47  ? 124 ASN B CB  1 
ATOM   2924  C CG  . ASN B 2 124 ? 5.364   4.110   36.272  1.00 57.51  ? 124 ASN B CG  1 
ATOM   2925  O OD1 . ASN B 2 124 ? 5.577   3.355   35.327  1.00 39.67  ? 124 ASN B OD1 1 
ATOM   2926  N ND2 . ASN B 2 124 ? 4.139   4.532   36.592  1.00 41.01  ? 124 ASN B ND2 1 
ATOM   2927  N N   . GLU B 2 125 ? 8.484   3.076   35.238  1.00 46.97  ? 125 GLU B N   1 
ATOM   2928  C CA  . GLU B 2 125 ? 9.537   3.079   34.231  1.00 45.97  ? 125 GLU B CA  1 
ATOM   2929  C C   . GLU B 2 125 ? 9.571   4.356   33.413  1.00 44.35  ? 125 GLU B C   1 
ATOM   2930  O O   . GLU B 2 125 ? 8.539   4.939   33.091  1.00 44.02  ? 125 GLU B O   1 
ATOM   2931  C CB  . GLU B 2 125 ? 9.376   1.887   33.288  1.00 46.19  ? 125 GLU B CB  1 
ATOM   2932  C CG  . GLU B 2 125 ? 10.629  1.523   32.507  1.00 39.07  ? 125 GLU B CG  1 
ATOM   2933  C CD  . GLU B 2 125 ? 10.356  0.469   31.427  1.00 93.87  ? 125 GLU B CD  1 
ATOM   2934  O OE1 . GLU B 2 125 ? 11.336  -0.183  30.971  1.00 57.87  ? 125 GLU B OE1 1 
ATOM   2935  O OE2 . GLU B 2 125 ? 9.166   0.310   31.039  1.00 37.65  ? 125 GLU B OE2 1 
ATOM   2936  N N   . VAL B 2 126 ? 10.779  4.790   33.097  1.00 38.16  ? 126 VAL B N   1 
ATOM   2937  C CA  . VAL B 2 126 ? 10.969  5.971   32.287  1.00 38.50  ? 126 VAL B CA  1 
ATOM   2938  C C   . VAL B 2 126 ? 11.737  5.513   31.057  1.00 50.64  ? 126 VAL B C   1 
ATOM   2939  O O   . VAL B 2 126 ? 12.737  4.791   31.155  1.00 40.12  ? 126 VAL B O   1 
ATOM   2940  C CB  . VAL B 2 126 ? 11.772  7.071   33.041  1.00 56.27  ? 126 VAL B CB  1 
ATOM   2941  C CG1 . VAL B 2 126 ? 12.146  8.186   32.094  1.00 61.12  ? 126 VAL B CG1 1 
ATOM   2942  C CG2 . VAL B 2 126 ? 10.935  7.643   34.183  1.00 62.19  ? 126 VAL B CG2 1 
ATOM   2943  N N   . ILE B 2 127 ? 11.227  5.915   29.897  1.00 60.64  ? 127 ILE B N   1 
ATOM   2944  C CA  . ILE B 2 127 ? 11.825  5.590   28.609  1.00 58.32  ? 127 ILE B CA  1 
ATOM   2945  C C   . ILE B 2 127 ? 12.341  6.919   28.077  1.00 40.88  ? 127 ILE B C   1 
ATOM   2946  O O   . ILE B 2 127 ? 11.566  7.864   27.914  1.00 52.20  ? 127 ILE B O   1 
ATOM   2947  C CB  . ILE B 2 127 ? 10.758  5.003   27.640  1.00 47.20  ? 127 ILE B CB  1 
ATOM   2948  C CG1 . ILE B 2 127 ? 10.081  3.801   28.291  1.00 40.45  ? 127 ILE B CG1 1 
ATOM   2949  C CG2 . ILE B 2 127 ? 11.398  4.618   26.311  1.00 35.15  ? 127 ILE B CG2 1 
ATOM   2950  C CD1 . ILE B 2 127 ? 11.053  2.725   28.737  1.00 41.63  ? 127 ILE B CD1 1 
ATOM   2951  N N   . PHE B 2 128 ? 13.645  6.995   27.838  1.00 45.11  ? 128 PHE B N   1 
ATOM   2952  C CA  . PHE B 2 128 ? 14.278  8.227   27.353  1.00 59.83  ? 128 PHE B CA  1 
ATOM   2953  C C   . PHE B 2 128 ? 14.537  8.215   25.847  1.00 61.99  ? 128 PHE B C   1 
ATOM   2954  O O   . PHE B 2 128 ? 14.802  7.167   25.264  1.00 46.65  ? 128 PHE B O   1 
ATOM   2955  C CB  . PHE B 2 128 ? 15.621  8.463   28.070  1.00 58.04  ? 128 PHE B CB  1 
ATOM   2956  C CG  . PHE B 2 128 ? 15.489  8.955   29.490  1.00 65.55  ? 128 PHE B CG  1 
ATOM   2957  C CD1 . PHE B 2 128 ? 15.465  8.063   30.557  1.00 56.70  ? 128 PHE B CD1 1 
ATOM   2958  C CD2 . PHE B 2 128 ? 15.398  10.319  29.760  1.00 58.86  ? 128 PHE B CD2 1 
ATOM   2959  C CE1 . PHE B 2 128 ? 15.355  8.525   31.865  1.00 58.79  ? 128 PHE B CE1 1 
ATOM   2960  C CE2 . PHE B 2 128 ? 15.286  10.783  31.065  1.00 55.83  ? 128 PHE B CE2 1 
ATOM   2961  C CZ  . PHE B 2 128 ? 15.265  9.887   32.119  1.00 36.00  ? 128 PHE B CZ  1 
ATOM   2962  N N   . LYS B 2 129 ? 14.466  9.383   25.219  1.00 55.58  ? 129 LYS B N   1 
ATOM   2963  C CA  . LYS B 2 129 ? 14.734  9.452   23.790  1.00 51.96  ? 129 LYS B CA  1 
ATOM   2964  C C   . LYS B 2 129 ? 16.225  9.225   23.589  1.00 37.74  ? 129 LYS B C   1 
ATOM   2965  O O   . LYS B 2 129 ? 16.647  8.750   22.543  1.00 60.28  ? 129 LYS B O   1 
ATOM   2966  C CB  . LYS B 2 129 ? 14.309  10.801  23.199  1.00 36.04  ? 129 LYS B CB  1 
ATOM   2967  C CG  . LYS B 2 129 ? 12.805  11.010  23.143  1.00 50.71  ? 129 LYS B CG  1 
ATOM   2968  C CD  . LYS B 2 129 ? 12.395  12.045  22.097  1.00 50.30  ? 129 LYS B CD  1 
ATOM   2969  C CE  . LYS B 2 129 ? 10.885  12.349  22.165  1.00 76.62  ? 129 LYS B CE  1 
ATOM   2970  N NZ  . LYS B 2 129 ? 10.034  11.108  22.167  1.00 60.99  ? 129 LYS B NZ  1 
ATOM   2971  N N   . ASP B 2 130 ? 17.019  9.538   24.608  1.00 53.50  ? 130 ASP B N   1 
ATOM   2972  C CA  . ASP B 2 130 ? 18.471  9.351   24.534  1.00 64.68  ? 130 ASP B CA  1 
ATOM   2973  C C   . ASP B 2 130 ? 19.201  9.877   25.781  1.00 66.69  ? 130 ASP B C   1 
ATOM   2974  O O   . ASP B 2 130 ? 18.581  10.398  26.713  1.00 57.46  ? 130 ASP B O   1 
ATOM   2975  C CB  . ASP B 2 130 ? 19.018  10.098  23.316  1.00 59.46  ? 130 ASP B CB  1 
ATOM   2976  C CG  . ASP B 2 130 ? 18.723  11.584  23.381  1.00 65.51  ? 130 ASP B CG  1 
ATOM   2977  O OD1 . ASP B 2 130 ? 17.604  12.007  23.007  1.00 57.60  ? 130 ASP B OD1 1 
ATOM   2978  O OD2 . ASP B 2 130 ? 19.612  12.332  23.844  1.00 91.30  ? 130 ASP B OD2 1 
ATOM   2979  N N   . THR B 2 131 ? 20.526  9.732   25.773  1.00 65.46  ? 131 THR B N   1 
ATOM   2980  C CA  . THR B 2 131 ? 21.394  10.238  26.834  1.00 59.63  ? 131 THR B CA  1 
ATOM   2981  C C   . THR B 2 131 ? 21.330  9.559   28.206  1.00 53.35  ? 131 THR B C   1 
ATOM   2982  O O   . THR B 2 131 ? 22.290  8.922   28.625  1.00 57.94  ? 131 THR B O   1 
ATOM   2983  C CB  . THR B 2 131 ? 21.153  11.754  27.012  1.00 62.35  ? 131 THR B CB  1 
ATOM   2984  O OG1 . THR B 2 131 ? 21.117  12.378  25.718  1.00 58.44  ? 131 THR B OG1 1 
ATOM   2985  C CG2 . THR B 2 131 ? 22.278  12.392  27.848  1.00 77.66  ? 131 THR B CG2 1 
ATOM   2986  N N   . PHE B 2 132 ? 20.212  9.716   28.907  1.00 47.55  ? 132 PHE B N   1 
ATOM   2987  C CA  . PHE B 2 132 ? 20.034  9.132   30.236  1.00 55.15  ? 132 PHE B CA  1 
ATOM   2988  C C   . PHE B 2 132 ? 19.661  7.646   30.168  1.00 59.99  ? 132 PHE B C   1 
ATOM   2989  O O   . PHE B 2 132 ? 19.205  7.168   29.134  1.00 60.83  ? 132 PHE B O   1 
ATOM   2990  C CB  . PHE B 2 132 ? 18.956  9.913   30.982  1.00 56.02  ? 132 PHE B CB  1 
ATOM   2991  C CG  . PHE B 2 132 ? 19.162  11.401  30.947  1.00 61.92  ? 132 PHE B CG  1 
ATOM   2992  C CD1 . PHE B 2 132 ? 18.221  12.236  30.346  1.00 70.37  ? 132 PHE B CD1 1 
ATOM   2993  C CD2 . PHE B 2 132 ? 20.310  11.970  31.488  1.00 54.29  ? 132 PHE B CD2 1 
ATOM   2994  C CE1 . PHE B 2 132 ? 18.426  13.615  30.280  1.00 46.21  ? 132 PHE B CE1 1 
ATOM   2995  C CE2 . PHE B 2 132 ? 20.525  13.348  31.428  1.00 45.07  ? 132 PHE B CE2 1 
ATOM   2996  C CZ  . PHE B 2 132 ? 19.584  14.169  30.823  1.00 57.56  ? 132 PHE B CZ  1 
ATOM   2997  N N   . PRO B 2 133 ? 19.855  6.897   31.275  1.00 67.04  ? 133 PRO B N   1 
ATOM   2998  C CA  . PRO B 2 133 ? 19.546  5.461   31.344  1.00 52.00  ? 133 PRO B CA  1 
ATOM   2999  C C   . PRO B 2 133 ? 18.067  5.129   31.540  1.00 61.63  ? 133 PRO B C   1 
ATOM   3000  O O   . PRO B 2 133 ? 17.408  5.688   32.421  1.00 54.00  ? 133 PRO B O   1 
ATOM   3001  C CB  . PRO B 2 133 ? 20.386  4.993   32.522  1.00 53.24  ? 133 PRO B CB  1 
ATOM   3002  C CG  . PRO B 2 133 ? 20.303  6.165   33.445  1.00 59.63  ? 133 PRO B CG  1 
ATOM   3003  C CD  . PRO B 2 133 ? 20.490  7.354   32.528  1.00 47.90  ? 133 PRO B CD  1 
ATOM   3004  N N   . ASN B 2 134 ? 17.551  4.214   30.720  1.00 57.70  ? 134 ASN B N   1 
ATOM   3005  C CA  . ASN B 2 134 ? 16.152  3.804   30.823  1.00 53.68  ? 134 ASN B CA  1 
ATOM   3006  C C   . ASN B 2 134 ? 15.988  2.931   32.058  1.00 40.58  ? 134 ASN B C   1 
ATOM   3007  O O   . ASN B 2 134 ? 16.863  2.133   32.385  1.00 49.74  ? 134 ASN B O   1 
ATOM   3008  C CB  . ASN B 2 134 ? 15.722  2.996   29.592  1.00 51.17  ? 134 ASN B CB  1 
ATOM   3009  C CG  . ASN B 2 134 ? 15.820  3.792   28.294  1.00 79.71  ? 134 ASN B CG  1 
ATOM   3010  O OD1 . ASN B 2 134 ? 15.295  4.906   28.186  1.00 60.24  ? 134 ASN B OD1 1 
ATOM   3011  N ND2 . ASN B 2 134 ? 16.482  3.211   27.294  1.00 59.12  ? 134 ASN B ND2 1 
ATOM   3012  N N   . GLY B 2 135 ? 14.866  3.073   32.744  1.00 37.84  ? 135 GLY B N   1 
ATOM   3013  C CA  . GLY B 2 135 ? 14.644  2.256   33.918  1.00 42.94  ? 135 GLY B CA  1 
ATOM   3014  C C   . GLY B 2 135 ? 13.542  2.776   34.809  1.00 43.83  ? 135 GLY B C   1 
ATOM   3015  O O   . GLY B 2 135 ? 12.737  3.610   34.388  1.00 41.61  ? 135 GLY B O   1 
ATOM   3016  N N   . TYR B 2 136 ? 13.497  2.272   36.038  1.00 38.05  ? 136 TYR B N   1 
ATOM   3017  C CA  . TYR B 2 136 ? 12.485  2.707   37.004  1.00 55.15  ? 136 TYR B CA  1 
ATOM   3018  C C   . TYR B 2 136 ? 13.022  3.783   37.968  1.00 38.59  ? 136 TYR B C   1 
ATOM   3019  O O   . TYR B 2 136 ? 14.129  3.673   38.491  1.00 51.62  ? 136 TYR B O   1 
ATOM   3020  C CB  . TYR B 2 136 ? 11.951  1.514   37.818  1.00 40.53  ? 136 TYR B CB  1 
ATOM   3021  C CG  . TYR B 2 136 ? 10.962  0.635   37.083  1.00 43.39  ? 136 TYR B CG  1 
ATOM   3022  C CD1 . TYR B 2 136 ? 11.390  -0.283  36.125  1.00 53.56  ? 136 TYR B CD1 1 
ATOM   3023  C CD2 . TYR B 2 136 ? 9.595   0.728   37.337  1.00 45.53  ? 136 TYR B CD2 1 
ATOM   3024  C CE1 . TYR B 2 136 ? 10.484  -1.089  35.440  1.00 52.93  ? 136 TYR B CE1 1 
ATOM   3025  C CE2 . TYR B 2 136 ? 8.672   -0.068  36.651  1.00 62.38  ? 136 TYR B CE2 1 
ATOM   3026  C CZ  . TYR B 2 136 ? 9.128   -0.976  35.702  1.00 68.36  ? 136 TYR B CZ  1 
ATOM   3027  O OH  . TYR B 2 136 ? 8.231   -1.757  35.008  1.00 58.13  ? 136 TYR B OH  1 
ATOM   3028  N N   . TYR B 2 137 ? 12.229  4.829   38.171  1.00 44.17  ? 137 TYR B N   1 
ATOM   3029  C CA  . TYR B 2 137 ? 12.570  5.919   39.076  1.00 35.54  ? 137 TYR B CA  1 
ATOM   3030  C C   . TYR B 2 137 ? 11.380  6.101   40.000  1.00 36.50  ? 137 TYR B C   1 
ATOM   3031  O O   . TYR B 2 137 ? 10.301  5.566   39.737  1.00 38.67  ? 137 TYR B O   1 
ATOM   3032  C CB  . TYR B 2 137 ? 12.820  7.218   38.309  1.00 30.54  ? 137 TYR B CB  1 
ATOM   3033  C CG  . TYR B 2 137 ? 13.964  7.152   37.335  1.00 38.45  ? 137 TYR B CG  1 
ATOM   3034  C CD1 . TYR B 2 137 ? 13.801  6.567   36.082  1.00 39.03  ? 137 TYR B CD1 1 
ATOM   3035  C CD2 . TYR B 2 137 ? 15.207  7.692   37.654  1.00 31.36  ? 137 TYR B CD2 1 
ATOM   3036  C CE1 . TYR B 2 137 ? 14.842  6.528   35.172  1.00 40.50  ? 137 TYR B CE1 1 
ATOM   3037  C CE2 . TYR B 2 137 ? 16.255  7.659   36.753  1.00 35.55  ? 137 TYR B CE2 1 
ATOM   3038  C CZ  . TYR B 2 137 ? 16.068  7.078   35.512  1.00 54.91  ? 137 TYR B CZ  1 
ATOM   3039  O OH  . TYR B 2 137 ? 17.099  7.051   34.599  1.00 52.65  ? 137 TYR B OH  1 
ATOM   3040  N N   . TYR B 2 138 ? 11.572  6.865   41.071  1.00 42.28  ? 138 TYR B N   1 
ATOM   3041  C CA  . TYR B 2 138 ? 10.510  7.103   42.045  1.00 40.43  ? 138 TYR B CA  1 
ATOM   3042  C C   . TYR B 2 138 ? 9.734   8.390   41.780  1.00 44.52  ? 138 TYR B C   1 
ATOM   3043  O O   . TYR B 2 138 ? 10.323  9.462   41.667  1.00 42.65  ? 138 TYR B O   1 
ATOM   3044  C CB  . TYR B 2 138 ? 11.096  7.141   43.465  1.00 39.72  ? 138 TYR B CB  1 
ATOM   3045  C CG  . TYR B 2 138 ? 10.040  7.029   44.532  1.00 37.00  ? 138 TYR B CG  1 
ATOM   3046  C CD1 . TYR B 2 138 ? 9.306   5.854   44.682  1.00 26.00  ? 138 TYR B CD1 1 
ATOM   3047  C CD2 . TYR B 2 138 ? 9.719   8.113   45.342  1.00 40.83  ? 138 TYR B CD2 1 
ATOM   3048  C CE1 . TYR B 2 138 ? 8.272   5.758   45.601  1.00 33.08  ? 138 TYR B CE1 1 
ATOM   3049  C CE2 . TYR B 2 138 ? 8.679   8.026   46.275  1.00 42.23  ? 138 TYR B CE2 1 
ATOM   3050  C CZ  . TYR B 2 138 ? 7.961   6.842   46.390  1.00 25.57  ? 138 TYR B CZ  1 
ATOM   3051  O OH  . TYR B 2 138 ? 6.920   6.748   47.273  1.00 41.11  ? 138 TYR B OH  1 
ATOM   3052  N N   . PHE B 2 139 ? 8.409   8.271   41.720  1.00 35.22  ? 139 PHE B N   1 
ATOM   3053  C CA  . PHE B 2 139 ? 7.514   9.400   41.448  1.00 38.82  ? 139 PHE B CA  1 
ATOM   3054  C C   . PHE B 2 139 ? 6.558   9.732   42.595  1.00 40.11  ? 139 PHE B C   1 
ATOM   3055  O O   . PHE B 2 139 ? 6.103   8.836   43.311  1.00 50.64  ? 139 PHE B O   1 
ATOM   3056  C CB  . PHE B 2 139 ? 6.621   9.104   40.236  1.00 23.69  ? 139 PHE B CB  1 
ATOM   3057  C CG  . PHE B 2 139 ? 7.354   8.884   38.964  1.00 33.65  ? 139 PHE B CG  1 
ATOM   3058  C CD1 . PHE B 2 139 ? 8.136   7.757   38.781  1.00 27.95  ? 139 PHE B CD1 1 
ATOM   3059  C CD2 . PHE B 2 139 ? 7.217   9.783   37.913  1.00 32.47  ? 139 PHE B CD2 1 
ATOM   3060  C CE1 . PHE B 2 139 ? 8.764   7.526   37.569  1.00 38.56  ? 139 PHE B CE1 1 
ATOM   3061  C CE2 . PHE B 2 139 ? 7.841   9.557   36.696  1.00 31.47  ? 139 PHE B CE2 1 
ATOM   3062  C CZ  . PHE B 2 139 ? 8.612   8.431   36.520  1.00 36.89  ? 139 PHE B CZ  1 
ATOM   3063  N N   . VAL B 2 140 ? 6.239   11.018  42.743  1.00 43.88  ? 140 VAL B N   1 
ATOM   3064  C CA  . VAL B 2 140 ? 5.274   11.482  43.737  1.00 37.24  ? 140 VAL B CA  1 
ATOM   3065  C C   . VAL B 2 140 ? 4.662   12.816  43.310  1.00 53.25  ? 140 VAL B C   1 
ATOM   3066  O O   . VAL B 2 140 ? 5.031   13.869  43.830  1.00 58.89  ? 140 VAL B O   1 
ATOM   3067  C CB  . VAL B 2 140 ? 5.873   11.699  45.134  1.00 48.38  ? 140 VAL B CB  1 
ATOM   3068  C CG1 . VAL B 2 140 ? 4.740   11.993  46.110  1.00 38.24  ? 140 VAL B CG1 1 
ATOM   3069  C CG2 . VAL B 2 140 ? 6.669   10.489  45.586  1.00 45.89  ? 140 VAL B CG2 1 
ATOM   3070  N N   . HIS B 2 141 ? 3.736   12.776  42.354  1.00 56.01  ? 141 HIS B N   1 
ATOM   3071  C CA  . HIS B 2 141 ? 3.074   13.992  41.883  1.00 59.70  ? 141 HIS B CA  1 
ATOM   3072  C C   . HIS B 2 141 ? 1.601   13.747  41.583  1.00 62.03  ? 141 HIS B C   1 
ATOM   3073  O O   . HIS B 2 141 ? 1.160   12.604  41.515  1.00 65.86  ? 141 HIS B O   1 
ATOM   3074  C CB  . HIS B 2 141 ? 3.764   14.556  40.629  1.00 34.97  ? 141 HIS B CB  1 
ATOM   3075  C CG  . HIS B 2 141 ? 3.874   13.583  39.496  1.00 59.89  ? 141 HIS B CG  1 
ATOM   3076  N ND1 . HIS B 2 141 ? 3.887   13.979  38.175  1.00 62.70  ? 141 HIS B ND1 1 
ATOM   3077  C CD2 . HIS B 2 141 ? 4.046   12.240  39.483  1.00 59.64  ? 141 HIS B CD2 1 
ATOM   3078  C CE1 . HIS B 2 141 ? 4.065   12.928  37.399  1.00 47.65  ? 141 HIS B CE1 1 
ATOM   3079  N NE2 . HIS B 2 141 ? 4.169   11.859  38.167  1.00 58.40  ? 141 HIS B NE2 1 
ATOM   3080  N N   . THR B 2 142 ? 0.845   14.827  41.426  1.00 53.58  ? 142 THR B N   1 
ATOM   3081  C CA  . THR B 2 142 ? -0.565  14.731  41.113  1.00 45.55  ? 142 THR B CA  1 
ATOM   3082  C C   . THR B 2 142 ? -0.800  15.348  39.745  1.00 57.86  ? 142 THR B C   1 
ATOM   3083  O O   . THR B 2 142 ? -1.689  14.926  39.012  1.00 46.74  ? 142 THR B O   1 
ATOM   3084  C CB  . THR B 2 142 ? -1.410  15.469  42.141  1.00 67.37  ? 142 THR B CB  1 
ATOM   3085  O OG1 . THR B 2 142 ? -1.203  14.878  43.426  1.00 77.96  ? 142 THR B OG1 1 
ATOM   3086  C CG2 . THR B 2 142 ? -2.897  15.376  41.788  1.00 82.88  ? 142 THR B CG2 1 
ATOM   3087  N N   . TYR B 2 143 ? 0.016   16.346  39.406  1.00 49.63  ? 143 TYR B N   1 
ATOM   3088  C CA  . TYR B 2 143 ? -0.097  17.020  38.125  1.00 53.70  ? 143 TYR B CA  1 
ATOM   3089  C C   . TYR B 2 143 ? 1.003   16.594  37.172  1.00 41.86  ? 143 TYR B C   1 
ATOM   3090  O O   . TYR B 2 143 ? 2.025   16.067  37.591  1.00 48.06  ? 143 TYR B O   1 
ATOM   3091  C CB  . TYR B 2 143 ? -0.083  18.538  38.321  1.00 47.39  ? 143 TYR B CB  1 
ATOM   3092  C CG  . TYR B 2 143 ? -1.256  19.031  39.124  1.00 33.53  ? 143 TYR B CG  1 
ATOM   3093  C CD1 . TYR B 2 143 ? -1.258  18.933  40.509  1.00 45.05  ? 143 TYR B CD1 1 
ATOM   3094  C CD2 . TYR B 2 143 ? -2.396  19.545  38.494  1.00 50.63  ? 143 TYR B CD2 1 
ATOM   3095  C CE1 . TYR B 2 143 ? -2.365  19.329  41.260  1.00 53.09  ? 143 TYR B CE1 1 
ATOM   3096  C CE2 . TYR B 2 143 ? -3.516  19.948  39.232  1.00 36.95  ? 143 TYR B CE2 1 
ATOM   3097  C CZ  . TYR B 2 143 ? -3.490  19.834  40.616  1.00 65.18  ? 143 TYR B CZ  1 
ATOM   3098  O OH  . TYR B 2 143 ? -4.581  20.206  41.367  1.00 71.91  ? 143 TYR B OH  1 
ATOM   3099  N N   . ARG B 2 144 ? 0.783   16.834  35.886  1.00 42.92  ? 144 ARG B N   1 
ATOM   3100  C CA  . ARG B 2 144 ? 1.732   16.446  34.845  1.00 58.47  ? 144 ARG B CA  1 
ATOM   3101  C C   . ARG B 2 144 ? 2.017   17.582  33.871  1.00 49.40  ? 144 ARG B C   1 
ATOM   3102  O O   . ARG B 2 144 ? 1.504   18.686  34.007  1.00 67.87  ? 144 ARG B O   1 
ATOM   3103  C CB  . ARG B 2 144 ? 1.163   15.269  34.051  1.00 73.95  ? 144 ARG B CB  1 
ATOM   3104  C CG  . ARG B 2 144 ? -0.175  15.604  33.409  1.00 52.11  ? 144 ARG B CG  1 
ATOM   3105  C CD  . ARG B 2 144 ? -0.597  14.603  32.339  1.00 72.10  ? 144 ARG B CD  1 
ATOM   3106  N NE  . ARG B 2 144 ? 0.176   14.728  31.103  1.00 70.51  ? 144 ARG B NE  1 
ATOM   3107  C CZ  . ARG B 2 144 ? -0.264  14.334  29.905  1.00 74.81  ? 144 ARG B CZ  1 
ATOM   3108  N NH1 . ARG B 2 144 ? -1.474  13.796  29.783  1.00 73.50  ? 144 ARG B NH1 1 
ATOM   3109  N NH2 . ARG B 2 144 ? 0.502   14.465  28.830  1.00 55.44  ? 144 ARG B NH2 1 
ATOM   3110  N N   . ALA B 2 145 ? 2.819   17.290  32.859  1.00 52.15  ? 145 ALA B N   1 
ATOM   3111  C CA  . ALA B 2 145 ? 3.149   18.290  31.863  1.00 53.67  ? 145 ALA B CA  1 
ATOM   3112  C C   . ALA B 2 145 ? 2.392   18.035  30.571  1.00 61.54  ? 145 ALA B C   1 
ATOM   3113  O O   . ALA B 2 145 ? 2.129   16.891  30.208  1.00 57.88  ? 145 ALA B O   1 
ATOM   3114  C CB  . ALA B 2 145 ? 4.647   18.282  31.590  1.00 47.25  ? 145 ALA B CB  1 
ATOM   3115  N N   . VAL B 2 146 ? 2.046   19.130  29.899  1.00 66.27  ? 146 VAL B N   1 
ATOM   3116  C CA  . VAL B 2 146 ? 1.351   19.133  28.612  1.00 62.09  ? 146 VAL B CA  1 
ATOM   3117  C C   . VAL B 2 146 ? 2.231   20.039  27.741  1.00 57.43  ? 146 VAL B C   1 
ATOM   3118  O O   . VAL B 2 146 ? 2.169   21.261  27.853  1.00 81.53  ? 146 VAL B O   1 
ATOM   3119  C CB  . VAL B 2 146 ? -0.064  19.783  28.720  1.00 75.28  ? 146 VAL B CB  1 
ATOM   3120  C CG1 . VAL B 2 146 ? -0.705  19.863  27.345  1.00 63.87  ? 146 VAL B CG1 1 
ATOM   3121  C CG2 . VAL B 2 146 ? -0.955  18.994  29.683  1.00 58.86  ? 146 VAL B CG2 1 
ATOM   3122  N N   . CYS B 2 147 ? 3.072   19.459  26.896  1.00 58.50  ? 147 CYS B N   1 
ATOM   3123  C CA  . CYS B 2 147 ? 3.935   20.281  26.060  1.00 63.18  ? 147 CYS B CA  1 
ATOM   3124  C C   . CYS B 2 147 ? 4.038   19.673  24.681  1.00 67.95  ? 147 CYS B C   1 
ATOM   3125  O O   . CYS B 2 147 ? 3.689   18.516  24.492  1.00 71.72  ? 147 CYS B O   1 
ATOM   3126  C CB  . CYS B 2 147 ? 5.334   20.364  26.661  1.00 78.21  ? 147 CYS B CB  1 
ATOM   3127  S SG  . CYS B 2 147 ? 6.248   18.816  26.564  1.00 65.45  ? 147 CYS B SG  1 
ATOM   3128  N N   . GLU B 2 148 ? 4.531   20.445  23.718  1.00 75.49  ? 148 GLU B N   1 
ATOM   3129  C CA  . GLU B 2 148 ? 4.658   19.917  22.373  1.00 71.66  ? 148 GLU B CA  1 
ATOM   3130  C C   . GLU B 2 148 ? 5.570   18.714  22.455  1.00 66.33  ? 148 GLU B C   1 
ATOM   3131  O O   . GLU B 2 148 ? 6.259   18.506  23.452  1.00 61.62  ? 148 GLU B O   1 
ATOM   3132  C CB  . GLU B 2 148 ? 5.229   20.963  21.404  1.00 98.13  ? 148 GLU B CB  1 
ATOM   3133  C CG  . GLU B 2 148 ? 4.303   22.165  21.141  1.00 101.96 ? 148 GLU B CG  1 
ATOM   3134  C CD  . GLU B 2 148 ? 2.874   21.754  20.790  1.00 99.94  ? 148 GLU B CD  1 
ATOM   3135  O OE1 . GLU B 2 148 ? 2.702   20.722  20.082  1.00 95.50  ? 148 GLU B OE1 1 
ATOM   3136  O OE2 . GLU B 2 148 ? 1.930   22.467  21.215  1.00 62.03  ? 148 GLU B OE2 1 
ATOM   3137  N N   . GLU B 2 149 ? 5.554   17.917  21.400  1.00 70.09  ? 149 GLU B N   1 
ATOM   3138  C CA  . GLU B 2 149 ? 6.344   16.710  21.341  1.00 74.90  ? 149 GLU B CA  1 
ATOM   3139  C C   . GLU B 2 149 ? 7.823   17.060  21.348  1.00 71.10  ? 149 GLU B C   1 
ATOM   3140  O O   . GLU B 2 149 ? 8.653   16.365  21.949  1.00 73.38  ? 149 GLU B O   1 
ATOM   3141  C CB  . GLU B 2 149 ? 5.958   15.944  20.075  1.00 84.45  ? 149 GLU B CB  1 
ATOM   3142  C CG  . GLU B 2 149 ? 5.827   14.441  20.252  1.00 62.28  ? 149 GLU B CG  1 
ATOM   3143  C CD  . GLU B 2 149 ? 7.169   13.781  20.334  1.00 69.74  ? 149 GLU B CD  1 
ATOM   3144  O OE1 . GLU B 2 149 ? 8.071   14.230  19.589  1.00 65.00  ? 149 GLU B OE1 1 
ATOM   3145  O OE2 . GLU B 2 149 ? 7.321   12.818  21.126  1.00 83.90  ? 149 GLU B OE2 1 
ATOM   3146  N N   . GLU B 2 150 ? 8.136   18.159  20.677  1.00 82.48  ? 150 GLU B N   1 
ATOM   3147  C CA  . GLU B 2 150 ? 9.505   18.664  20.552  1.00 85.42  ? 150 GLU B CA  1 
ATOM   3148  C C   . GLU B 2 150 ? 10.327  18.640  21.862  1.00 83.78  ? 150 GLU B C   1 
ATOM   3149  O O   . GLU B 2 150 ? 11.528  18.324  21.863  1.00 55.66  ? 150 GLU B O   1 
ATOM   3150  C CB  . GLU B 2 150 ? 9.432   20.092  19.990  1.00 78.49  ? 150 GLU B CB  1 
ATOM   3151  C CG  . GLU B 2 150 ? 10.759  20.814  19.822  1.00 83.77  ? 150 GLU B CG  1 
ATOM   3152  C CD  . GLU B 2 150 ? 10.592  22.155  19.105  1.00 96.01  ? 150 GLU B CD  1 
ATOM   3153  O OE1 . GLU B 2 150 ? 9.717   22.958  19.528  1.00 67.27  ? 150 GLU B OE1 1 
ATOM   3154  O OE2 . GLU B 2 150 ? 11.341  22.395  18.122  1.00 74.13  ? 150 GLU B OE2 1 
ATOM   3155  N N   . HIS B 2 151 ? 9.673   18.958  22.973  1.00 76.96  ? 151 HIS B N   1 
ATOM   3156  C CA  . HIS B 2 151 ? 10.359  18.996  24.255  1.00 92.58  ? 151 HIS B CA  1 
ATOM   3157  C C   . HIS B 2 151 ? 10.303  17.700  25.097  1.00 93.28  ? 151 HIS B C   1 
ATOM   3158  O O   . HIS B 2 151 ? 11.056  17.548  26.076  1.00 79.46  ? 151 HIS B O   1 
ATOM   3159  C CB  . HIS B 2 151 ? 9.853   20.211  25.043  1.00 100.15 ? 151 HIS B CB  1 
ATOM   3160  C CG  . HIS B 2 151 ? 9.897   21.490  24.254  1.00 93.16  ? 151 HIS B CG  1 
ATOM   3161  N ND1 . HIS B 2 151 ? 10.878  21.753  23.318  1.00 67.80  ? 151 HIS B ND1 1 
ATOM   3162  C CD2 . HIS B 2 151 ? 9.072   22.565  24.244  1.00 83.40  ? 151 HIS B CD2 1 
ATOM   3163  C CE1 . HIS B 2 151 ? 10.651  22.930  22.764  1.00 72.79  ? 151 HIS B CE1 1 
ATOM   3164  N NE2 . HIS B 2 151 ? 9.561   23.444  23.307  1.00 60.33  ? 151 HIS B NE2 1 
ATOM   3165  N N   . VAL B 2 152 ? 9.435   16.762  24.716  1.00 76.04  ? 152 VAL B N   1 
ATOM   3166  C CA  . VAL B 2 152 ? 9.362   15.500  25.435  1.00 66.22  ? 152 VAL B CA  1 
ATOM   3167  C C   . VAL B 2 152 ? 10.750  14.841  25.345  1.00 64.92  ? 152 VAL B C   1 
ATOM   3168  O O   . VAL B 2 152 ? 11.330  14.732  24.255  1.00 56.03  ? 152 VAL B O   1 
ATOM   3169  C CB  . VAL B 2 152 ? 8.272   14.559  24.826  1.00 51.61  ? 152 VAL B CB  1 
ATOM   3170  C CG1 . VAL B 2 152 ? 8.301   13.204  25.519  1.00 50.15  ? 152 VAL B CG1 1 
ATOM   3171  C CG2 . VAL B 2 152 ? 6.881   15.186  24.989  1.00 46.67  ? 152 VAL B CG2 1 
ATOM   3172  N N   . LEU B 2 153 ? 11.288  14.440  26.498  1.00 50.60  ? 153 LEU B N   1 
ATOM   3173  C CA  . LEU B 2 153 ? 12.604  13.792  26.579  1.00 58.03  ? 153 LEU B CA  1 
ATOM   3174  C C   . LEU B 2 153 ? 12.477  12.426  27.248  1.00 43.17  ? 153 LEU B C   1 
ATOM   3175  O O   . LEU B 2 153 ? 13.266  11.521  26.992  1.00 38.54  ? 153 LEU B O   1 
ATOM   3176  C CB  . LEU B 2 153 ? 13.592  14.670  27.375  1.00 67.96  ? 153 LEU B CB  1 
ATOM   3177  C CG  . LEU B 2 153 ? 15.004  14.166  27.747  1.00 48.61  ? 153 LEU B CG  1 
ATOM   3178  C CD1 . LEU B 2 153 ? 14.962  13.397  29.033  1.00 72.51  ? 153 LEU B CD1 1 
ATOM   3179  C CD2 . LEU B 2 153 ? 15.589  13.309  26.642  1.00 49.34  ? 153 LEU B CD2 1 
ATOM   3180  N N   . GLY B 2 154 ? 11.475  12.290  28.108  1.00 46.15  ? 154 GLY B N   1 
ATOM   3181  C CA  . GLY B 2 154 ? 11.258  11.035  28.791  1.00 36.21  ? 154 GLY B CA  1 
ATOM   3182  C C   . GLY B 2 154 ? 9.785   10.741  28.936  1.00 44.34  ? 154 GLY B C   1 
ATOM   3183  O O   . GLY B 2 154 ? 9.006   11.633  29.270  1.00 42.22  ? 154 GLY B O   1 
ATOM   3184  N N   . THR B 2 155 ? 9.411   9.484   28.696  1.00 42.48  ? 155 THR B N   1 
ATOM   3185  C CA  . THR B 2 155 ? 8.015   9.049   28.788  1.00 50.56  ? 155 THR B CA  1 
ATOM   3186  C C   . THR B 2 155 ? 7.760   7.961   29.844  1.00 35.82  ? 155 THR B C   1 
ATOM   3187  O O   . THR B 2 155 ? 8.599   7.092   30.087  1.00 47.75  ? 155 THR B O   1 
ATOM   3188  C CB  . THR B 2 155 ? 7.525   8.568   27.397  1.00 61.80  ? 155 THR B CB  1 
ATOM   3189  O OG1 . THR B 2 155 ? 7.339   9.710   26.557  1.00 61.39  ? 155 THR B OG1 1 
ATOM   3190  C CG2 . THR B 2 155 ? 6.216   7.791   27.495  1.00 68.44  ? 155 THR B CG2 1 
ATOM   3191  N N   . THR B 2 156 ? 6.590   8.029   30.467  1.00 44.71  ? 156 THR B N   1 
ATOM   3192  C CA  . THR B 2 156 ? 6.190   7.084   31.507  1.00 47.35  ? 156 THR B CA  1 
ATOM   3193  C C   . THR B 2 156 ? 4.687   6.917   31.407  1.00 54.93  ? 156 THR B C   1 
ATOM   3194  O O   . THR B 2 156 ? 3.987   7.884   31.106  1.00 49.53  ? 156 THR B O   1 
ATOM   3195  C CB  . THR B 2 156 ? 6.500   7.647   32.926  1.00 42.66  ? 156 THR B CB  1 
ATOM   3196  O OG1 . THR B 2 156 ? 7.910   7.809   33.077  1.00 58.26  ? 156 THR B OG1 1 
ATOM   3197  C CG2 . THR B 2 156 ? 5.982   6.729   34.011  1.00 29.63  ? 156 THR B CG2 1 
ATOM   3198  N N   . GLU B 2 157 ? 4.180   5.712   31.656  1.00 52.24  ? 157 GLU B N   1 
ATOM   3199  C CA  . GLU B 2 157 ? 2.736   5.513   31.611  1.00 51.17  ? 157 GLU B CA  1 
ATOM   3200  C C   . GLU B 2 157 ? 2.224   5.120   32.984  1.00 45.86  ? 157 GLU B C   1 
ATOM   3201  O O   . GLU B 2 157 ? 2.842   4.332   33.688  1.00 51.48  ? 157 GLU B O   1 
ATOM   3202  C CB  . GLU B 2 157 ? 2.336   4.454   30.558  1.00 44.10  ? 157 GLU B CB  1 
ATOM   3203  C CG  . GLU B 2 157 ? 2.461   2.976   30.956  1.00 50.18  ? 157 GLU B CG  1 
ATOM   3204  C CD  . GLU B 2 157 ? 1.228   2.412   31.683  1.00 48.31  ? 157 GLU B CD  1 
ATOM   3205  O OE1 . GLU B 2 157 ? 1.185   1.185   31.900  1.00 71.07  ? 157 GLU B OE1 1 
ATOM   3206  O OE2 . GLU B 2 157 ? 0.302   3.173   32.038  1.00 66.05  ? 157 GLU B OE2 1 
ATOM   3207  N N   . TYR B 2 158 ? 1.090   5.688   33.362  1.00 40.84  ? 158 TYR B N   1 
ATOM   3208  C CA  . TYR B 2 158 ? 0.490   5.398   34.638  1.00 36.62  ? 158 TYR B CA  1 
ATOM   3209  C C   . TYR B 2 158 ? -1.037  5.326   34.496  1.00 62.32  ? 158 TYR B C   1 
ATOM   3210  O O   . TYR B 2 158 ? -1.702  6.334   34.214  1.00 51.61  ? 158 TYR B O   1 
ATOM   3211  C CB  . TYR B 2 158 ? 0.884   6.472   35.643  1.00 46.31  ? 158 TYR B CB  1 
ATOM   3212  C CG  . TYR B 2 158 ? 0.090   6.382   36.900  1.00 36.12  ? 158 TYR B CG  1 
ATOM   3213  C CD1 . TYR B 2 158 ? 0.216   5.281   37.743  1.00 38.63  ? 158 TYR B CD1 1 
ATOM   3214  C CD2 . TYR B 2 158 ? -0.856  7.343   37.205  1.00 30.84  ? 158 TYR B CD2 1 
ATOM   3215  C CE1 . TYR B 2 158 ? -0.597  5.140   38.854  1.00 42.99  ? 158 TYR B CE1 1 
ATOM   3216  C CE2 . TYR B 2 158 ? -1.668  7.211   38.305  1.00 43.49  ? 158 TYR B CE2 1 
ATOM   3217  C CZ  . TYR B 2 158 ? -1.540  6.108   39.119  1.00 29.68  ? 158 TYR B CZ  1 
ATOM   3218  O OH  . TYR B 2 158 ? -2.400  5.949   40.166  1.00 55.70  ? 158 TYR B OH  1 
ATOM   3219  N N   . ASP B 2 159 ? -1.581  4.124   34.684  1.00 54.50  ? 159 ASP B N   1 
ATOM   3220  C CA  . ASP B 2 159 ? -3.016  3.889   34.577  1.00 50.83  ? 159 ASP B CA  1 
ATOM   3221  C C   . ASP B 2 159 ? -3.491  4.127   33.145  1.00 59.50  ? 159 ASP B C   1 
ATOM   3222  O O   . ASP B 2 159 ? -4.535  4.743   32.915  1.00 56.54  ? 159 ASP B O   1 
ATOM   3223  C CB  . ASP B 2 159 ? -3.782  4.808   35.536  1.00 65.51  ? 159 ASP B CB  1 
ATOM   3224  C CG  . ASP B 2 159 ? -4.801  4.056   36.386  1.00 52.39  ? 159 ASP B CG  1 
ATOM   3225  O OD1 . ASP B 2 159 ? -5.571  4.719   37.120  1.00 80.27  ? 159 ASP B OD1 1 
ATOM   3226  O OD2 . ASP B 2 159 ? -4.835  2.805   36.331  1.00 68.25  ? 159 ASP B OD2 1 
ATOM   3227  N N   . GLY B 2 160 ? -2.714  3.646   32.178  1.00 57.34  ? 160 GLY B N   1 
ATOM   3228  C CA  . GLY B 2 160 ? -3.099  3.812   30.787  1.00 71.52  ? 160 GLY B CA  1 
ATOM   3229  C C   . GLY B 2 160 ? -2.655  5.138   30.215  1.00 75.63  ? 160 GLY B C   1 
ATOM   3230  O O   . GLY B 2 160 ? -2.394  5.248   29.006  1.00 74.59  ? 160 GLY B O   1 
ATOM   3231  N N   . GLU B 2 161 ? -2.564  6.146   31.082  1.00 69.58  ? 161 GLU B N   1 
ATOM   3232  C CA  . GLU B 2 161 ? -2.143  7.484   30.672  1.00 62.61  ? 161 GLU B CA  1 
ATOM   3233  C C   . GLU B 2 161 ? -0.644  7.582   30.439  1.00 58.90  ? 161 GLU B C   1 
ATOM   3234  O O   . GLU B 2 161 ? 0.158   7.194   31.294  1.00 63.91  ? 161 GLU B O   1 
ATOM   3235  C CB  . GLU B 2 161 ? -2.549  8.531   31.720  1.00 74.68  ? 161 GLU B CB  1 
ATOM   3236  C CG  . GLU B 2 161 ? -2.180  9.959   31.321  1.00 64.13  ? 161 GLU B CG  1 
ATOM   3237  C CD  . GLU B 2 161 ? -2.877  11.028  32.156  1.00 69.10  ? 161 GLU B CD  1 
ATOM   3238  O OE1 . GLU B 2 161 ? -2.891  12.194  31.703  1.00 66.91  ? 161 GLU B OE1 1 
ATOM   3239  O OE2 . GLU B 2 161 ? -3.402  10.722  33.249  1.00 58.35  ? 161 GLU B OE2 1 
ATOM   3240  N N   . ILE B 2 162 ? -0.278  8.100   29.273  1.00 52.84  ? 162 ILE B N   1 
ATOM   3241  C CA  . ILE B 2 162 ? 1.122   8.287   28.907  1.00 60.70  ? 162 ILE B CA  1 
ATOM   3242  C C   . ILE B 2 162 ? 1.421   9.764   29.092  1.00 51.16  ? 162 ILE B C   1 
ATOM   3243  O O   . ILE B 2 162 ? 0.664   10.614  28.627  1.00 61.66  ? 162 ILE B O   1 
ATOM   3244  C CB  . ILE B 2 162 ? 1.376   7.889   27.435  1.00 40.47  ? 162 ILE B CB  1 
ATOM   3245  C CG1 . ILE B 2 162 ? 1.140   6.391   27.267  1.00 71.75  ? 162 ILE B CG1 1 
ATOM   3246  C CG2 . ILE B 2 162 ? 2.796   8.237   27.029  1.00 53.37  ? 162 ILE B CG2 1 
ATOM   3247  C CD1 . ILE B 2 162 ? 1.275   5.895   25.852  1.00 82.31  ? 162 ILE B CD1 1 
ATOM   3248  N N   . PHE B 2 163 ? 2.508   10.077  29.788  1.00 68.31  ? 163 PHE B N   1 
ATOM   3249  C CA  . PHE B 2 163 ? 2.857   11.477  30.023  1.00 54.15  ? 163 PHE B CA  1 
ATOM   3250  C C   . PHE B 2 163 ? 4.352   11.726  29.991  1.00 35.21  ? 163 PHE B C   1 
ATOM   3251  O O   . PHE B 2 163 ? 5.137   10.813  30.213  1.00 68.09  ? 163 PHE B O   1 
ATOM   3252  C CB  . PHE B 2 163 ? 2.250   11.956  31.353  1.00 62.59  ? 163 PHE B CB  1 
ATOM   3253  C CG  . PHE B 2 163 ? 2.851   11.318  32.592  1.00 78.37  ? 163 PHE B CG  1 
ATOM   3254  C CD1 . PHE B 2 163 ? 3.897   11.941  33.278  1.00 57.53  ? 163 PHE B CD1 1 
ATOM   3255  C CD2 . PHE B 2 163 ? 2.327   10.131  33.109  1.00 58.32  ? 163 PHE B CD2 1 
ATOM   3256  C CE1 . PHE B 2 163 ? 4.404   11.402  34.460  1.00 43.84  ? 163 PHE B CE1 1 
ATOM   3257  C CE2 . PHE B 2 163 ? 2.831   9.586   34.292  1.00 50.33  ? 163 PHE B CE2 1 
ATOM   3258  C CZ  . PHE B 2 163 ? 3.873   10.228  34.969  1.00 57.03  ? 163 PHE B CZ  1 
ATOM   3259  N N   . PRO B 2 164 ? 4.769   12.967  29.681  1.00 59.00  ? 164 PRO B N   1 
ATOM   3260  C CA  . PRO B 2 164 ? 6.200   13.287  29.632  1.00 56.22  ? 164 PRO B CA  1 
ATOM   3261  C C   . PRO B 2 164 ? 6.769   13.350  31.057  1.00 57.70  ? 164 PRO B C   1 
ATOM   3262  O O   . PRO B 2 164 ? 6.432   14.234  31.838  1.00 44.62  ? 164 PRO B O   1 
ATOM   3263  C CB  . PRO B 2 164 ? 6.218   14.629  28.910  1.00 49.30  ? 164 PRO B CB  1 
ATOM   3264  C CG  . PRO B 2 164 ? 4.972   15.278  29.417  1.00 50.06  ? 164 PRO B CG  1 
ATOM   3265  C CD  . PRO B 2 164 ? 3.955   14.161  29.375  1.00 55.57  ? 164 PRO B CD  1 
ATOM   3266  N N   . SER B 2 165 ? 7.602   12.376  31.395  1.00 41.88  ? 165 SER B N   1 
ATOM   3267  C CA  . SER B 2 165 ? 8.191   12.313  32.724  1.00 67.06  ? 165 SER B CA  1 
ATOM   3268  C C   . SER B 2 165 ? 9.460   13.168  32.745  1.00 54.22  ? 165 SER B C   1 
ATOM   3269  O O   . SER B 2 165 ? 9.946   13.568  33.797  1.00 54.04  ? 165 SER B O   1 
ATOM   3270  C CB  . SER B 2 165 ? 8.496   10.856  33.081  1.00 31.94  ? 165 SER B CB  1 
ATOM   3271  O OG  . SER B 2 165 ? 9.185   10.214  32.024  1.00 50.80  ? 165 SER B OG  1 
ATOM   3272  N N   . ALA B 2 166 ? 9.976   13.432  31.550  1.00 63.44  ? 166 ALA B N   1 
ATOM   3273  C CA  . ALA B 2 166 ? 11.156  14.259  31.356  1.00 62.36  ? 166 ALA B CA  1 
ATOM   3274  C C   . ALA B 2 166 ? 10.751  15.362  30.385  1.00 60.63  ? 166 ALA B C   1 
ATOM   3275  O O   . ALA B 2 166 ? 9.759   15.241  29.666  1.00 66.42  ? 166 ALA B O   1 
ATOM   3276  C CB  . ALA B 2 166 ? 12.294  13.436  30.768  1.00 68.46  ? 166 ALA B CB  1 
ATOM   3277  N N   . VAL B 2 167 ? 11.524  16.435  30.360  1.00 55.67  ? 167 VAL B N   1 
ATOM   3278  C CA  . VAL B 2 167 ? 11.230  17.560  29.491  1.00 44.95  ? 167 VAL B CA  1 
ATOM   3279  C C   . VAL B 2 167 ? 12.554  18.163  29.087  1.00 48.01  ? 167 VAL B C   1 
ATOM   3280  O O   . VAL B 2 167 ? 13.544  18.010  29.799  1.00 64.87  ? 167 VAL B O   1 
ATOM   3281  C CB  . VAL B 2 167 ? 10.379  18.601  30.243  1.00 47.82  ? 167 VAL B CB  1 
ATOM   3282  C CG1 . VAL B 2 167 ? 10.453  19.937  29.560  1.00 86.00  ? 167 VAL B CG1 1 
ATOM   3283  C CG2 . VAL B 2 167 ? 8.936   18.134  30.313  1.00 66.59  ? 167 VAL B CG2 1 
ATOM   3284  N N   . ARG B 2 168 ? 12.585  18.829  27.938  1.00 62.88  ? 168 ARG B N   1 
ATOM   3285  C CA  . ARG B 2 168 ? 13.817  19.454  27.469  1.00 51.86  ? 168 ARG B CA  1 
ATOM   3286  C C   . ARG B 2 168 ? 13.627  20.510  26.372  1.00 61.28  ? 168 ARG B C   1 
ATOM   3287  O O   . ARG B 2 168 ? 12.809  20.359  25.464  1.00 69.30  ? 168 ARG B O   1 
ATOM   3288  C CB  . ARG B 2 168 ? 14.774  18.381  26.985  1.00 30.29  ? 168 ARG B CB  1 
ATOM   3289  C CG  . ARG B 2 168 ? 15.875  18.911  26.127  1.00 40.44  ? 168 ARG B CG  1 
ATOM   3290  C CD  . ARG B 2 168 ? 16.036  17.992  24.940  1.00 66.32  ? 168 ARG B CD  1 
ATOM   3291  N NE  . ARG B 2 168 ? 17.227  17.158  25.043  1.00 61.68  ? 168 ARG B NE  1 
ATOM   3292  C CZ  . ARG B 2 168 ? 17.337  15.956  24.497  1.00 56.66  ? 168 ARG B CZ  1 
ATOM   3293  N NH1 . ARG B 2 168 ? 16.310  15.449  23.820  1.00 76.31  ? 168 ARG B NH1 1 
ATOM   3294  N NH2 . ARG B 2 168 ? 18.474  15.273  24.602  1.00 56.39  ? 168 ARG B NH2 1 
ATOM   3295  N N   . LYS B 2 169 ? 14.391  21.588  26.483  1.00 77.84  ? 169 LYS B N   1 
ATOM   3296  C CA  . LYS B 2 169 ? 14.378  22.683  25.515  1.00 58.68  ? 169 LYS B CA  1 
ATOM   3297  C C   . LYS B 2 169 ? 15.809  23.236  25.492  1.00 74.84  ? 169 LYS B C   1 
ATOM   3298  O O   . LYS B 2 169 ? 16.109  24.268  26.110  1.00 60.59  ? 169 LYS B O   1 
ATOM   3299  C CB  . LYS B 2 169 ? 13.407  23.778  25.947  1.00 65.49  ? 169 LYS B CB  1 
ATOM   3300  C CG  . LYS B 2 169 ? 13.212  24.886  24.911  1.00 66.72  ? 169 LYS B CG  1 
ATOM   3301  C CD  . LYS B 2 169 ? 12.248  25.933  25.434  1.00 70.69  ? 169 LYS B CD  1 
ATOM   3302  C CE  . LYS B 2 169 ? 11.871  26.943  24.372  1.00 69.29  ? 169 LYS B CE  1 
ATOM   3303  N NZ  . LYS B 2 169 ? 10.948  27.978  24.929  1.00 59.71  ? 169 LYS B NZ  1 
ATOM   3304  N N   . GLY B 2 170 ? 16.691  22.515  24.808  1.00 63.44  ? 170 GLY B N   1 
ATOM   3305  C CA  . GLY B 2 170 ? 18.073  22.931  24.716  1.00 61.47  ? 170 GLY B CA  1 
ATOM   3306  C C   . GLY B 2 170 ? 18.903  22.571  25.933  1.00 77.79  ? 170 GLY B C   1 
ATOM   3307  O O   . GLY B 2 170 ? 19.257  21.395  26.156  1.00 67.26  ? 170 GLY B O   1 
ATOM   3308  N N   . ARG B 2 171 ? 19.242  23.600  26.707  1.00 69.46  ? 171 ARG B N   1 
ATOM   3309  C CA  . ARG B 2 171 ? 20.037  23.429  27.913  1.00 56.49  ? 171 ARG B CA  1 
ATOM   3310  C C   . ARG B 2 171 ? 19.169  23.419  29.159  1.00 61.84  ? 171 ARG B C   1 
ATOM   3311  O O   . ARG B 2 171 ? 19.673  23.235  30.266  1.00 60.64  ? 171 ARG B O   1 
ATOM   3312  C CB  . ARG B 2 171 ? 21.077  24.532  28.028  1.00 70.45  ? 171 ARG B CB  1 
ATOM   3313  C CG  . ARG B 2 171 ? 22.365  24.242  27.294  1.00 59.16  ? 171 ARG B CG  1 
ATOM   3314  C CD  . ARG B 2 171 ? 23.521  24.977  27.959  1.00 64.57  ? 171 ARG B CD  1 
ATOM   3315  N NE  . ARG B 2 171 ? 24.817  24.425  27.574  1.00 76.80  ? 171 ARG B NE  1 
ATOM   3316  C CZ  . ARG B 2 171 ? 25.284  24.405  26.328  1.00 91.52  ? 171 ARG B CZ  1 
ATOM   3317  N NH1 . ARG B 2 171 ? 24.555  24.918  25.334  1.00 68.53  ? 171 ARG B NH1 1 
ATOM   3318  N NH2 . ARG B 2 171 ? 26.473  23.860  26.073  1.00 67.07  ? 171 ARG B NH2 1 
ATOM   3319  N N   . ILE B 2 172 ? 17.870  23.652  28.975  1.00 56.57  ? 172 ILE B N   1 
ATOM   3320  C CA  . ILE B 2 172 ? 16.908  23.605  30.071  1.00 52.40  ? 172 ILE B CA  1 
ATOM   3321  C C   . ILE B 2 172 ? 16.482  22.138  30.141  1.00 62.20  ? 172 ILE B C   1 
ATOM   3322  O O   . ILE B 2 172 ? 16.190  21.517  29.110  1.00 70.92  ? 172 ILE B O   1 
ATOM   3323  C CB  . ILE B 2 172 ? 15.627  24.442  29.782  1.00 62.34  ? 172 ILE B CB  1 
ATOM   3324  C CG1 . ILE B 2 172 ? 15.942  25.941  29.779  1.00 69.45  ? 172 ILE B CG1 1 
ATOM   3325  C CG2 . ILE B 2 172 ? 14.555  24.122  30.818  1.00 52.15  ? 172 ILE B CG2 1 
ATOM   3326  C CD1 . ILE B 2 172 ? 14.728  26.828  29.523  1.00 44.87  ? 172 ILE B CD1 1 
ATOM   3327  N N   . LEU B 2 173 ? 16.455  21.576  31.340  1.00 65.78  ? 173 LEU B N   1 
ATOM   3328  C CA  . LEU B 2 173 ? 16.040  20.191  31.493  1.00 53.69  ? 173 LEU B CA  1 
ATOM   3329  C C   . LEU B 2 173 ? 15.066  20.064  32.638  1.00 42.06  ? 173 LEU B C   1 
ATOM   3330  O O   . LEU B 2 173 ? 15.165  20.776  33.639  1.00 66.37  ? 173 LEU B O   1 
ATOM   3331  C CB  . LEU B 2 173 ? 17.251  19.286  31.736  1.00 51.72  ? 173 LEU B CB  1 
ATOM   3332  C CG  . LEU B 2 173 ? 18.185  19.112  30.538  1.00 58.53  ? 173 LEU B CG  1 
ATOM   3333  C CD1 . LEU B 2 173 ? 19.302  18.150  30.877  1.00 51.32  ? 173 LEU B CD1 1 
ATOM   3334  C CD2 . LEU B 2 173 ? 17.385  18.575  29.359  1.00 69.44  ? 173 LEU B CD2 1 
ATOM   3335  N N   . GLY B 2 174 ? 14.110  19.161  32.478  1.00 57.10  ? 174 GLY B N   1 
ATOM   3336  C CA  . GLY B 2 174 ? 13.126  18.919  33.513  1.00 37.76  ? 174 GLY B CA  1 
ATOM   3337  C C   . GLY B 2 174 ? 12.990  17.423  33.736  1.00 61.75  ? 174 GLY B C   1 
ATOM   3338  O O   . GLY B 2 174 ? 13.165  16.639  32.798  1.00 49.49  ? 174 GLY B O   1 
ATOM   3339  N N   . PHE B 2 175 ? 12.718  17.031  34.982  1.00 55.56  ? 175 PHE B N   1 
ATOM   3340  C CA  . PHE B 2 175 ? 12.522  15.628  35.358  1.00 51.45  ? 175 PHE B CA  1 
ATOM   3341  C C   . PHE B 2 175 ? 11.398  15.646  36.378  1.00 59.93  ? 175 PHE B C   1 
ATOM   3342  O O   . PHE B 2 175 ? 11.440  16.418  37.342  1.00 58.86  ? 175 PHE B O   1 
ATOM   3343  C CB  . PHE B 2 175 ? 13.780  15.013  35.985  1.00 37.78  ? 175 PHE B CB  1 
ATOM   3344  C CG  . PHE B 2 175 ? 14.987  15.024  35.076  1.00 38.59  ? 175 PHE B CG  1 
ATOM   3345  C CD1 . PHE B 2 175 ? 15.873  16.100  35.082  1.00 44.60  ? 175 PHE B CD1 1 
ATOM   3346  C CD2 . PHE B 2 175 ? 15.226  13.973  34.198  1.00 38.94  ? 175 PHE B CD2 1 
ATOM   3347  C CE1 . PHE B 2 175 ? 16.978  16.128  34.230  1.00 30.53  ? 175 PHE B CE1 1 
ATOM   3348  C CE2 . PHE B 2 175 ? 16.334  13.996  33.338  1.00 53.71  ? 175 PHE B CE2 1 
ATOM   3349  C CZ  . PHE B 2 175 ? 17.209  15.079  33.359  1.00 36.40  ? 175 PHE B CZ  1 
ATOM   3350  N N   . GLN B 2 176 ? 10.391  14.803  36.153  1.00 49.81  ? 176 GLN B N   1 
ATOM   3351  C CA  . GLN B 2 176 ? 9.218   14.729  37.016  1.00 37.89  ? 176 GLN B CA  1 
ATOM   3352  C C   . GLN B 2 176 ? 9.427   13.844  38.246  1.00 36.13  ? 176 GLN B C   1 
ATOM   3353  O O   . GLN B 2 176 ? 8.697   13.950  39.233  1.00 43.20  ? 176 GLN B O   1 
ATOM   3354  C CB  . GLN B 2 176 ? 8.022   14.232  36.191  1.00 32.23  ? 176 GLN B CB  1 
ATOM   3355  C CG  . GLN B 2 176 ? 6.718   14.181  36.938  1.00 36.17  ? 176 GLN B CG  1 
ATOM   3356  C CD  . GLN B 2 176 ? 6.245   15.541  37.436  1.00 50.63  ? 176 GLN B CD  1 
ATOM   3357  O OE1 . GLN B 2 176 ? 5.781   16.388  36.663  1.00 55.94  ? 176 GLN B OE1 1 
ATOM   3358  N NE2 . GLN B 2 176 ? 6.361   15.757  38.738  1.00 55.15  ? 176 GLN B NE2 1 
ATOM   3359  N N   . PHE B 2 177 ? 10.433  12.985  38.191  1.00 37.60  ? 177 PHE B N   1 
ATOM   3360  C CA  . PHE B 2 177 ? 10.724  12.092  39.298  1.00 41.08  ? 177 PHE B CA  1 
ATOM   3361  C C   . PHE B 2 177 ? 11.786  12.650  40.258  1.00 51.14  ? 177 PHE B C   1 
ATOM   3362  O O   . PHE B 2 177 ? 12.386  13.695  40.004  1.00 60.08  ? 177 PHE B O   1 
ATOM   3363  C CB  . PHE B 2 177 ? 11.168  10.732  38.756  1.00 28.48  ? 177 PHE B CB  1 
ATOM   3364  C CG  . PHE B 2 177 ? 12.224  10.812  37.693  1.00 31.15  ? 177 PHE B CG  1 
ATOM   3365  C CD1 . PHE B 2 177 ? 11.874  10.904  36.349  1.00 41.20  ? 177 PHE B CD1 1 
ATOM   3366  C CD2 . PHE B 2 177 ? 13.571  10.793  38.030  1.00 40.57  ? 177 PHE B CD2 1 
ATOM   3367  C CE1 . PHE B 2 177 ? 12.852  10.974  35.357  1.00 27.22  ? 177 PHE B CE1 1 
ATOM   3368  C CE2 . PHE B 2 177 ? 14.557  10.864  37.045  1.00 37.39  ? 177 PHE B CE2 1 
ATOM   3369  C CZ  . PHE B 2 177 ? 14.197  10.954  35.708  1.00 49.11  ? 177 PHE B CZ  1 
ATOM   3370  N N   . HIS B 2 178 ? 11.996  11.948  41.367  1.00 49.02  ? 178 HIS B N   1 
ATOM   3371  C CA  . HIS B 2 178 ? 12.978  12.331  42.373  1.00 33.61  ? 178 HIS B CA  1 
ATOM   3372  C C   . HIS B 2 178 ? 14.257  11.518  42.198  1.00 39.78  ? 178 HIS B C   1 
ATOM   3373  O O   . HIS B 2 178 ? 14.442  10.484  42.829  1.00 49.60  ? 178 HIS B O   1 
ATOM   3374  C CB  . HIS B 2 178 ? 12.431  12.076  43.783  1.00 29.40  ? 178 HIS B CB  1 
ATOM   3375  C CG  . HIS B 2 178 ? 11.289  12.959  44.159  1.00 43.09  ? 178 HIS B CG  1 
ATOM   3376  N ND1 . HIS B 2 178 ? 10.670  12.888  45.388  1.00 75.04  ? 178 HIS B ND1 1 
ATOM   3377  C CD2 . HIS B 2 178 ? 10.659  13.943  43.476  1.00 64.96  ? 178 HIS B CD2 1 
ATOM   3378  C CE1 . HIS B 2 178 ? 9.707   13.791  45.447  1.00 56.52  ? 178 HIS B CE1 1 
ATOM   3379  N NE2 . HIS B 2 178 ? 9.679   14.444  44.299  1.00 85.37  ? 178 HIS B NE2 1 
ATOM   3380  N N   . PRO B 2 179 ? 15.167  11.978  41.343  1.00 45.43  ? 179 PRO B N   1 
ATOM   3381  C CA  . PRO B 2 179 ? 16.389  11.192  41.181  1.00 31.75  ? 179 PRO B CA  1 
ATOM   3382  C C   . PRO B 2 179 ? 17.131  10.865  42.487  1.00 54.20  ? 179 PRO B C   1 
ATOM   3383  O O   . PRO B 2 179 ? 17.827  9.856   42.566  1.00 40.89  ? 179 PRO B O   1 
ATOM   3384  C CB  . PRO B 2 179 ? 17.211  12.031  40.205  1.00 49.42  ? 179 PRO B CB  1 
ATOM   3385  C CG  . PRO B 2 179 ? 16.612  13.422  40.321  1.00 44.38  ? 179 PRO B CG  1 
ATOM   3386  C CD  . PRO B 2 179 ? 15.164  13.171  40.484  1.00 42.96  ? 179 PRO B CD  1 
ATOM   3387  N N   . GLU B 2 180 ? 16.961  11.710  43.505  1.00 46.91  ? 180 GLU B N   1 
ATOM   3388  C CA  . GLU B 2 180 ? 17.611  11.513  44.801  1.00 41.33  ? 180 GLU B CA  1 
ATOM   3389  C C   . GLU B 2 180 ? 17.049  10.297  45.522  1.00 43.62  ? 180 GLU B C   1 
ATOM   3390  O O   . GLU B 2 180 ? 17.666  9.772   46.448  1.00 50.49  ? 180 GLU B O   1 
ATOM   3391  C CB  . GLU B 2 180 ? 17.402  12.723  45.727  1.00 36.98  ? 180 GLU B CB  1 
ATOM   3392  C CG  . GLU B 2 180 ? 16.971  13.997  45.052  1.00 74.89  ? 180 GLU B CG  1 
ATOM   3393  C CD  . GLU B 2 180 ? 15.472  14.083  44.757  1.00 54.90  ? 180 GLU B CD  1 
ATOM   3394  O OE1 . GLU B 2 180 ? 14.674  14.251  45.699  1.00 62.03  ? 180 GLU B OE1 1 
ATOM   3395  O OE2 . GLU B 2 180 ? 15.097  13.999  43.573  1.00 54.94  ? 180 GLU B OE2 1 
ATOM   3396  N N   . LYS B 2 181 ? 15.862  9.874   45.111  1.00 39.38  ? 181 LYS B N   1 
ATOM   3397  C CA  . LYS B 2 181 ? 15.196  8.739   45.734  1.00 46.43  ? 181 LYS B CA  1 
ATOM   3398  C C   . LYS B 2 181 ? 15.138  7.524   44.824  1.00 34.29  ? 181 LYS B C   1 
ATOM   3399  O O   . LYS B 2 181 ? 14.478  6.537   45.141  1.00 45.99  ? 181 LYS B O   1 
ATOM   3400  C CB  . LYS B 2 181 ? 13.775  9.145   46.147  1.00 39.86  ? 181 LYS B CB  1 
ATOM   3401  C CG  . LYS B 2 181 ? 13.731  10.161  47.298  1.00 50.61  ? 181 LYS B CG  1 
ATOM   3402  C CD  . LYS B 2 181 ? 14.271  9.518   48.574  1.00 48.61  ? 181 LYS B CD  1 
ATOM   3403  C CE  . LYS B 2 181 ? 14.209  10.455  49.749  1.00 47.86  ? 181 LYS B CE  1 
ATOM   3404  N NZ  . LYS B 2 181 ? 14.635  9.722   50.958  1.00 51.01  ? 181 LYS B NZ  1 
ATOM   3405  N N   . SER B 2 182 ? 15.849  7.593   43.706  1.00 34.28  ? 182 SER B N   1 
ATOM   3406  C CA  . SER B 2 182 ? 15.834  6.514   42.741  1.00 33.52  ? 182 SER B CA  1 
ATOM   3407  C C   . SER B 2 182 ? 17.000  5.540   42.757  1.00 34.36  ? 182 SER B C   1 
ATOM   3408  O O   . SER B 2 182 ? 17.388  5.030   41.713  1.00 45.53  ? 182 SER B O   1 
ATOM   3409  C CB  . SER B 2 182 ? 15.667  7.089   41.335  1.00 36.52  ? 182 SER B CB  1 
ATOM   3410  O OG  . SER B 2 182 ? 14.447  7.799   41.219  1.00 50.80  ? 182 SER B OG  1 
ATOM   3411  N N   . SER B 2 183 ? 17.558  5.286   43.935  1.00 35.87  ? 183 SER B N   1 
ATOM   3412  C CA  . SER B 2 183 ? 18.645  4.327   44.090  1.00 27.27  ? 183 SER B CA  1 
ATOM   3413  C C   . SER B 2 183 ? 19.848  4.527   43.161  1.00 29.88  ? 183 SER B C   1 
ATOM   3414  O O   . SER B 2 183 ? 20.245  5.647   42.885  1.00 40.93  ? 183 SER B O   1 
ATOM   3415  C CB  . SER B 2 183 ? 18.065  2.912   43.924  1.00 35.46  ? 183 SER B CB  1 
ATOM   3416  O OG  . SER B 2 183 ? 18.999  1.896   44.226  1.00 42.57  ? 183 SER B OG  1 
ATOM   3417  N N   . LYS B 2 184 ? 20.433  3.428   42.696  1.00 39.96  ? 184 LYS B N   1 
ATOM   3418  C CA  . LYS B 2 184 ? 21.597  3.468   41.813  1.00 36.26  ? 184 LYS B CA  1 
ATOM   3419  C C   . LYS B 2 184 ? 21.289  4.172   40.498  1.00 37.47  ? 184 LYS B C   1 
ATOM   3420  O O   . LYS B 2 184 ? 22.089  4.960   40.005  1.00 42.76  ? 184 LYS B O   1 
ATOM   3421  C CB  . LYS B 2 184 ? 22.092  2.046   41.513  1.00 35.68  ? 184 LYS B CB  1 
ATOM   3422  C CG  . LYS B 2 184 ? 22.275  1.181   42.745  1.00 56.69  ? 184 LYS B CG  1 
ATOM   3423  C CD  . LYS B 2 184 ? 22.720  -0.239  42.415  1.00 76.65  ? 184 LYS B CD  1 
ATOM   3424  C CE  . LYS B 2 184 ? 24.166  -0.295  41.900  1.00 93.42  ? 184 LYS B CE  1 
ATOM   3425  N NZ  . LYS B 2 184 ? 24.732  -1.682  41.955  1.00 74.70  ? 184 LYS B NZ  1 
ATOM   3426  N N   . ILE B 2 185 ? 20.127  3.877   39.929  1.00 39.87  ? 185 ILE B N   1 
ATOM   3427  C CA  . ILE B 2 185 ? 19.726  4.474   38.662  1.00 38.86  ? 185 ILE B CA  1 
ATOM   3428  C C   . ILE B 2 185 ? 19.632  6.004   38.785  1.00 54.78  ? 185 ILE B C   1 
ATOM   3429  O O   . ILE B 2 185 ? 19.960  6.728   37.843  1.00 52.44  ? 185 ILE B O   1 
ATOM   3430  C CB  . ILE B 2 185 ? 18.369  3.847   38.170  1.00 59.53  ? 185 ILE B CB  1 
ATOM   3431  C CG1 . ILE B 2 185 ? 18.405  3.637   36.648  1.00 50.25  ? 185 ILE B CG1 1 
ATOM   3432  C CG2 . ILE B 2 185 ? 17.173  4.710   38.586  1.00 46.41  ? 185 ILE B CG2 1 
ATOM   3433  C CD1 . ILE B 2 185 ? 18.452  4.900   35.838  1.00 63.40  ? 185 ILE B CD1 1 
ATOM   3434  N N   . GLY B 2 186 ? 19.213  6.482   39.956  1.00 38.94  ? 186 GLY B N   1 
ATOM   3435  C CA  . GLY B 2 186 ? 19.093  7.909   40.181  1.00 42.72  ? 186 GLY B CA  1 
ATOM   3436  C C   . GLY B 2 186 ? 20.425  8.643   40.146  1.00 50.56  ? 186 GLY B C   1 
ATOM   3437  O O   . GLY B 2 186 ? 20.513  9.769   39.642  1.00 50.58  ? 186 GLY B O   1 
ATOM   3438  N N   . ARG B 2 187 ? 21.467  8.010   40.675  1.00 42.37  ? 187 ARG B N   1 
ATOM   3439  C CA  . ARG B 2 187 ? 22.779  8.626   40.702  1.00 42.34  ? 187 ARG B CA  1 
ATOM   3440  C C   . ARG B 2 187 ? 23.386  8.758   39.315  1.00 47.61  ? 187 ARG B C   1 
ATOM   3441  O O   . ARG B 2 187 ? 24.083  9.734   39.032  1.00 52.77  ? 187 ARG B O   1 
ATOM   3442  C CB  . ARG B 2 187 ? 23.735  7.837   41.587  1.00 50.75  ? 187 ARG B CB  1 
ATOM   3443  C CG  . ARG B 2 187 ? 25.157  8.428   41.571  1.00 83.85  ? 187 ARG B CG  1 
ATOM   3444  C CD  . ARG B 2 187 ? 26.211  7.347   41.747  1.00 75.28  ? 187 ARG B CD  1 
ATOM   3445  N NE  . ARG B 2 187 ? 26.902  7.445   43.031  1.00 97.01  ? 187 ARG B NE  1 
ATOM   3446  C CZ  . ARG B 2 187 ? 27.889  8.301   43.282  1.00 103.15 ? 187 ARG B CZ  1 
ATOM   3447  N NH1 . ARG B 2 187 ? 28.301  9.141   42.329  1.00 102.34 ? 187 ARG B NH1 1 
ATOM   3448  N NH2 . ARG B 2 187 ? 28.478  8.304   44.476  1.00 76.34  ? 187 ARG B NH2 1 
ATOM   3449  N N   . LYS B 2 188 ? 23.161  7.772   38.453  1.00 52.16  ? 188 LYS B N   1 
ATOM   3450  C CA  . LYS B 2 188 ? 23.699  7.875   37.102  1.00 54.09  ? 188 LYS B CA  1 
ATOM   3451  C C   . LYS B 2 188 ? 22.947  8.969   36.354  1.00 43.87  ? 188 LYS B C   1 
ATOM   3452  O O   . LYS B 2 188 ? 23.523  9.660   35.521  1.00 52.11  ? 188 LYS B O   1 
ATOM   3453  C CB  . LYS B 2 188 ? 23.579  6.556   36.331  1.00 57.69  ? 188 LYS B CB  1 
ATOM   3454  C CG  . LYS B 2 188 ? 24.155  6.665   34.913  1.00 83.34  ? 188 LYS B CG  1 
ATOM   3455  C CD  . LYS B 2 188 ? 24.292  5.314   34.199  1.00 101.46 ? 188 LYS B CD  1 
ATOM   3456  C CE  . LYS B 2 188 ? 24.867  5.498   32.790  1.00 59.59  ? 188 LYS B CE  1 
ATOM   3457  N NZ  . LYS B 2 188 ? 26.067  6.385   32.808  1.00 60.44  ? 188 LYS B NZ  1 
ATOM   3458  N N   . LEU B 2 189 ? 21.661  9.127   36.649  1.00 36.05  ? 189 LEU B N   1 
ATOM   3459  C CA  . LEU B 2 189 ? 20.871  10.168  35.999  1.00 49.58  ? 189 LEU B CA  1 
ATOM   3460  C C   . LEU B 2 189 ? 21.437  11.517  36.457  1.00 56.26  ? 189 LEU B C   1 
ATOM   3461  O O   . LEU B 2 189 ? 21.647  12.421  35.652  1.00 59.87  ? 189 LEU B O   1 
ATOM   3462  C CB  . LEU B 2 189 ? 19.398  10.056  36.400  1.00 39.30  ? 189 LEU B CB  1 
ATOM   3463  C CG  . LEU B 2 189 ? 18.334  10.979  35.782  1.00 59.77  ? 189 LEU B CG  1 
ATOM   3464  C CD1 . LEU B 2 189 ? 18.645  12.434  36.041  1.00 52.18  ? 189 LEU B CD1 1 
ATOM   3465  C CD2 . LEU B 2 189 ? 18.241  10.723  34.309  1.00 43.19  ? 189 LEU B CD2 1 
ATOM   3466  N N   . LEU B 2 190 ? 21.691  11.637  37.754  1.00 47.08  ? 190 LEU B N   1 
ATOM   3467  C CA  . LEU B 2 190 ? 22.241  12.866  38.312  1.00 55.52  ? 190 LEU B CA  1 
ATOM   3468  C C   . LEU B 2 190 ? 23.650  13.135  37.769  1.00 44.97  ? 190 LEU B C   1 
ATOM   3469  O O   . LEU B 2 190 ? 24.000  14.276  37.484  1.00 61.45  ? 190 LEU B O   1 
ATOM   3470  C CB  . LEU B 2 190 ? 22.261  12.772  39.843  1.00 25.96  ? 190 LEU B CB  1 
ATOM   3471  C CG  . LEU B 2 190 ? 21.426  13.766  40.666  1.00 51.03  ? 190 LEU B CG  1 
ATOM   3472  C CD1 . LEU B 2 190 ? 20.204  14.234  39.909  1.00 34.00  ? 190 LEU B CD1 1 
ATOM   3473  C CD2 . LEU B 2 190 ? 21.021  13.103  41.975  1.00 38.56  ? 190 LEU B CD2 1 
ATOM   3474  N N   . GLU B 2 191 ? 24.451  12.088  37.609  1.00 47.61  ? 191 GLU B N   1 
ATOM   3475  C CA  . GLU B 2 191 ? 25.804  12.255  37.105  1.00 37.43  ? 191 GLU B CA  1 
ATOM   3476  C C   . GLU B 2 191 ? 25.801  12.654  35.640  1.00 53.89  ? 191 GLU B C   1 
ATOM   3477  O O   . GLU B 2 191 ? 26.542  13.552  35.229  1.00 64.00  ? 191 GLU B O   1 
ATOM   3478  C CB  . GLU B 2 191 ? 26.600  10.965  37.262  1.00 44.24  ? 191 GLU B CB  1 
ATOM   3479  C CG  . GLU B 2 191 ? 26.740  10.475  38.690  1.00 43.72  ? 191 GLU B CG  1 
ATOM   3480  C CD  . GLU B 2 191 ? 27.722  9.314   38.806  1.00 69.62  ? 191 GLU B CD  1 
ATOM   3481  O OE1 . GLU B 2 191 ? 28.105  8.754   37.750  1.00 77.79  ? 191 GLU B OE1 1 
ATOM   3482  O OE2 . GLU B 2 191 ? 28.109  8.958   39.946  1.00 55.74  ? 191 GLU B OE2 1 
ATOM   3483  N N   . LYS B 2 192 ? 24.966  11.977  34.853  1.00 65.78  ? 192 LYS B N   1 
ATOM   3484  C CA  . LYS B 2 192 ? 24.868  12.250  33.426  1.00 56.13  ? 192 LYS B CA  1 
ATOM   3485  C C   . LYS B 2 192 ? 24.542  13.719  33.240  1.00 58.84  ? 192 LYS B C   1 
ATOM   3486  O O   . LYS B 2 192 ? 25.004  14.346  32.296  1.00 64.75  ? 192 LYS B O   1 
ATOM   3487  C CB  . LYS B 2 192 ? 23.792  11.370  32.781  1.00 55.24  ? 192 LYS B CB  1 
ATOM   3488  C CG  . LYS B 2 192 ? 23.625  11.571  31.273  1.00 54.92  ? 192 LYS B CG  1 
ATOM   3489  C CD  . LYS B 2 192 ? 24.942  11.417  30.520  1.00 68.62  ? 192 LYS B CD  1 
ATOM   3490  C CE  . LYS B 2 192 ? 25.591  10.062  30.801  1.00 83.34  ? 192 LYS B CE  1 
ATOM   3491  N NZ  . LYS B 2 192 ? 26.853  9.873   30.018  1.00 78.41  ? 192 LYS B NZ  1 
ATOM   3492  N N   . VAL B 2 193 ? 23.744  14.271  34.145  1.00 59.17  ? 193 VAL B N   1 
ATOM   3493  C CA  . VAL B 2 193 ? 23.415  15.688  34.076  1.00 60.75  ? 193 VAL B CA  1 
ATOM   3494  C C   . VAL B 2 193 ? 24.716  16.508  34.237  1.00 72.76  ? 193 VAL B C   1 
ATOM   3495  O O   . VAL B 2 193 ? 25.064  17.328  33.386  1.00 70.39  ? 193 VAL B O   1 
ATOM   3496  C CB  . VAL B 2 193 ? 22.442  16.063  35.187  1.00 52.10  ? 193 VAL B CB  1 
ATOM   3497  C CG1 . VAL B 2 193 ? 22.025  17.518  35.045  1.00 43.13  ? 193 VAL B CG1 1 
ATOM   3498  C CG2 . VAL B 2 193 ? 21.248  15.145  35.133  1.00 51.58  ? 193 VAL B CG2 1 
ATOM   3499  N N   . ILE B 2 194 ? 25.442  16.270  35.324  1.00 62.46  ? 194 ILE B N   1 
ATOM   3500  C CA  . ILE B 2 194 ? 26.683  16.986  35.565  1.00 59.43  ? 194 ILE B CA  1 
ATOM   3501  C C   . ILE B 2 194 ? 27.672  16.822  34.400  1.00 67.89  ? 194 ILE B C   1 
ATOM   3502  O O   . ILE B 2 194 ? 28.427  17.748  34.092  1.00 68.36  ? 194 ILE B O   1 
ATOM   3503  C CB  . ILE B 2 194 ? 27.332  16.507  36.880  1.00 53.91  ? 194 ILE B CB  1 
ATOM   3504  C CG1 . ILE B 2 194 ? 26.496  16.981  38.072  1.00 54.24  ? 194 ILE B CG1 1 
ATOM   3505  C CG2 . ILE B 2 194 ? 28.748  17.032  36.999  1.00 53.33  ? 194 ILE B CG2 1 
ATOM   3506  C CD1 . ILE B 2 194 ? 27.067  16.519  39.424  1.00 45.07  ? 194 ILE B CD1 1 
ATOM   3507  N N   . GLU B 2 195 ? 27.662  15.657  33.750  1.00 64.68  ? 195 GLU B N   1 
ATOM   3508  C CA  . GLU B 2 195 ? 28.564  15.392  32.627  1.00 46.30  ? 195 GLU B CA  1 
ATOM   3509  C C   . GLU B 2 195 ? 28.141  16.132  31.369  1.00 56.90  ? 195 GLU B C   1 
ATOM   3510  O O   . GLU B 2 195 ? 28.947  16.346  30.465  1.00 63.90  ? 195 GLU B O   1 
ATOM   3511  C CB  . GLU B 2 195 ? 28.626  13.893  32.331  1.00 49.56  ? 195 GLU B CB  1 
ATOM   3512  C CG  . GLU B 2 195 ? 29.641  13.133  33.169  1.00 69.82  ? 195 GLU B CG  1 
ATOM   3513  C CD  . GLU B 2 195 ? 29.327  11.642  33.273  1.00 88.37  ? 195 GLU B CD  1 
ATOM   3514  O OE1 . GLU B 2 195 ? 28.909  11.033  32.262  1.00 74.27  ? 195 GLU B OE1 1 
ATOM   3515  O OE2 . GLU B 2 195 ? 29.504  11.074  34.370  1.00 70.11  ? 195 GLU B OE2 1 
ATOM   3516  N N   . CYS B 2 196 ? 26.871  16.513  31.308  1.00 52.13  ? 196 CYS B N   1 
ATOM   3517  C CA  . CYS B 2 196 ? 26.353  17.243  30.160  1.00 56.87  ? 196 CYS B CA  1 
ATOM   3518  C C   . CYS B 2 196 ? 26.647  18.729  30.294  1.00 61.02  ? 196 CYS B C   1 
ATOM   3519  O O   . CYS B 2 196 ? 26.657  19.455  29.305  1.00 63.57  ? 196 CYS B O   1 
ATOM   3520  C CB  . CYS B 2 196 ? 24.842  17.043  30.027  1.00 73.45  ? 196 CYS B CB  1 
ATOM   3521  S SG  . CYS B 2 196 ? 24.328  15.414  29.417  1.00 66.57  ? 196 CYS B SG  1 
ATOM   3522  N N   . SER B 2 197 ? 26.886  19.174  31.523  1.00 59.49  ? 197 SER B N   1 
ATOM   3523  C CA  . SER B 2 197 ? 27.188  20.573  31.799  1.00 62.80  ? 197 SER B CA  1 
ATOM   3524  C C   . SER B 2 197 ? 28.689  20.852  31.707  1.00 66.49  ? 197 SER B C   1 
ATOM   3525  O O   . SER B 2 197 ? 29.120  22.005  31.800  1.00 71.86  ? 197 SER B O   1 
ATOM   3526  C CB  . SER B 2 197 ? 26.670  20.945  33.184  1.00 69.25  ? 197 SER B CB  1 
ATOM   3527  O OG  . SER B 2 197 ? 27.156  20.028  34.150  1.00 75.93  ? 197 SER B OG  1 
ATOM   3528  N N   . LEU B 2 198 ? 29.486  19.795  31.551  1.00 66.22  ? 198 LEU B N   1 
ATOM   3529  C CA  . LEU B 2 198 ? 30.932  19.960  31.407  1.00 68.96  ? 198 LEU B CA  1 
ATOM   3530  C C   . LEU B 2 198 ? 31.213  20.347  29.960  1.00 68.95  ? 198 LEU B C   1 
ATOM   3531  O O   . LEU B 2 198 ? 32.318  20.146  29.441  1.00 69.96  ? 198 LEU B O   1 
ATOM   3532  C CB  . LEU B 2 198 ? 31.693  18.667  31.738  1.00 56.08  ? 198 LEU B CB  1 
ATOM   3533  C CG  . LEU B 2 198 ? 31.703  18.128  33.175  1.00 61.58  ? 198 LEU B CG  1 
ATOM   3534  C CD1 . LEU B 2 198 ? 32.751  17.021  33.272  1.00 71.73  ? 198 LEU B CD1 1 
ATOM   3535  C CD2 . LEU B 2 198 ? 32.025  19.239  34.170  1.00 70.79  ? 198 LEU B CD2 1 
ATOM   3536  N N   . SER B 2 199 ? 30.195  20.897  29.308  1.00 82.67  ? 199 SER B N   1 
ATOM   3537  C CA  . SER B 2 199 ? 30.323  21.331  27.921  1.00 83.92  ? 199 SER B CA  1 
ATOM   3538  C C   . SER B 2 199 ? 29.440  22.544  27.562  1.00 93.02  ? 199 SER B C   1 
ATOM   3539  O O   . SER B 2 199 ? 28.194  22.480  27.607  1.00 84.57  ? 199 SER B O   1 
ATOM   3540  C CB  . SER B 2 199 ? 30.030  20.155  26.987  1.00 83.77  ? 199 SER B CB  1 
ATOM   3541  O OG  . SER B 2 199 ? 29.121  19.248  27.599  1.00 83.60  ? 199 SER B OG  1 
ATOM   3542  N N   . ARG B 2 200 ? 30.121  23.645  27.225  1.00 92.96  ? 200 ARG B N   1 
ATOM   3543  C CA  . ARG B 2 200 ? 29.524  24.932  26.817  1.00 100.22 ? 200 ARG B CA  1 
ATOM   3544  C C   . ARG B 2 200 ? 30.556  26.052  26.932  1.00 101.20 ? 200 ARG B C   1 
ATOM   3545  O O   . ARG B 2 200 ? 31.758  25.760  26.731  1.00 78.47  ? 200 ARG B O   1 
ATOM   3546  C CB  . ARG B 2 200 ? 28.275  25.310  27.642  1.00 91.60  ? 200 ARG B CB  1 
ATOM   3547  C CG  . ARG B 2 200 ? 28.308  24.968  29.126  1.00 81.68  ? 200 ARG B CG  1 
ATOM   3548  C CD  . ARG B 2 200 ? 29.655  25.239  29.774  1.00 75.40  ? 200 ARG B CD  1 
ATOM   3549  N NE  . ARG B 2 200 ? 29.469  25.844  31.082  1.00 89.16  ? 200 ARG B NE  1 
ATOM   3550  C CZ  . ARG B 2 200 ? 29.204  27.132  31.273  1.00 76.78  ? 200 ARG B CZ  1 
ATOM   3551  N NH1 . ARG B 2 200 ? 29.106  27.957  30.234  1.00 61.04  ? 200 ARG B NH1 1 
ATOM   3552  N NH2 . ARG B 2 200 ? 29.015  27.588  32.505  1.00 88.94  ? 200 ARG B NH2 1 
ATOM   3553  N N   . ARG B 2 201 ? 30.146  27.207  27.205  1.00 103.15 ? 201 ARG B N   1 
ATOM   3554  N N   . MET C 1 1   ? -16.784 23.148  89.160  1.00 51.62  ? 1   MET C N   1 
ATOM   3555  C CA  . MET C 1 1   ? -18.056 23.427  89.889  1.00 45.42  ? 1   MET C CA  1 
ATOM   3556  C C   . MET C 1 1   ? -18.947 22.202  89.861  1.00 48.13  ? 1   MET C C   1 
ATOM   3557  O O   . MET C 1 1   ? -19.066 21.534  88.839  1.00 52.69  ? 1   MET C O   1 
ATOM   3558  C CB  . MET C 1 1   ? -18.806 24.607  89.245  1.00 56.20  ? 1   MET C CB  1 
ATOM   3559  C CG  . MET C 1 1   ? -20.053 25.069  90.017  1.00 62.95  ? 1   MET C CG  1 
ATOM   3560  S SD  . MET C 1 1   ? -21.141 26.175  89.050  1.00 73.30  ? 1   MET C SD  1 
ATOM   3561  C CE  . MET C 1 1   ? -20.209 27.732  89.157  1.00 75.13  ? 1   MET C CE  1 
ATOM   3562  N N   . LEU C 1 2   ? -19.570 21.918  90.991  1.00 40.70  ? 2   LEU C N   1 
ATOM   3563  C CA  . LEU C 1 2   ? -20.467 20.789  91.111  1.00 33.18  ? 2   LEU C CA  1 
ATOM   3564  C C   . LEU C 1 2   ? -21.623 20.890  90.118  1.00 48.04  ? 2   LEU C C   1 
ATOM   3565  O O   . LEU C 1 2   ? -22.153 21.971  89.859  1.00 46.98  ? 2   LEU C O   1 
ATOM   3566  C CB  . LEU C 1 2   ? -21.011 20.723  92.533  1.00 38.44  ? 2   LEU C CB  1 
ATOM   3567  C CG  . LEU C 1 2   ? -20.649 19.507  93.378  1.00 48.48  ? 2   LEU C CG  1 
ATOM   3568  C CD1 . LEU C 1 2   ? -19.237 19.041  93.078  1.00 45.10  ? 2   LEU C CD1 1 
ATOM   3569  C CD2 . LEU C 1 2   ? -20.811 19.876  94.847  1.00 38.25  ? 2   LEU C CD2 1 
ATOM   3570  N N   . ALA C 1 3   ? -22.015 19.754  89.562  1.00 39.65  ? 3   ALA C N   1 
ATOM   3571  C CA  . ALA C 1 3   ? -23.105 19.727  88.618  1.00 40.32  ? 3   ALA C CA  1 
ATOM   3572  C C   . ALA C 1 3   ? -24.428 19.413  89.308  1.00 40.67  ? 3   ALA C C   1 
ATOM   3573  O O   . ALA C 1 3   ? -24.455 18.774  90.355  1.00 34.23  ? 3   ALA C O   1 
ATOM   3574  C CB  . ALA C 1 3   ? -22.819 18.685  87.540  1.00 67.05  ? 3   ALA C CB  1 
ATOM   3575  N N   . LYS C 1 4   ? -25.524 19.887  88.721  1.00 32.50  ? 4   LYS C N   1 
ATOM   3576  C CA  . LYS C 1 4   ? -26.856 19.602  89.245  1.00 44.44  ? 4   LYS C CA  1 
ATOM   3577  C C   . LYS C 1 4   ? -27.175 18.188  88.758  1.00 27.60  ? 4   LYS C C   1 
ATOM   3578  O O   . LYS C 1 4   ? -26.980 17.873  87.594  1.00 34.80  ? 4   LYS C O   1 
ATOM   3579  C CB  . LYS C 1 4   ? -27.881 20.594  88.697  1.00 40.09  ? 4   LYS C CB  1 
ATOM   3580  C CG  . LYS C 1 4   ? -27.583 22.034  89.041  1.00 43.62  ? 4   LYS C CG  1 
ATOM   3581  C CD  . LYS C 1 4   ? -27.578 22.262  90.539  1.00 38.04  ? 4   LYS C CD  1 
ATOM   3582  C CE  . LYS C 1 4   ? -27.203 23.706  90.845  1.00 37.98  ? 4   LYS C CE  1 
ATOM   3583  N NZ  . LYS C 1 4   ? -26.962 23.921  92.292  1.00 58.74  ? 4   LYS C NZ  1 
ATOM   3584  N N   . ARG C 1 5   ? -27.674 17.345  89.647  1.00 31.84  ? 5   ARG C N   1 
ATOM   3585  C CA  . ARG C 1 5   ? -27.948 15.970  89.280  1.00 33.46  ? 5   ARG C CA  1 
ATOM   3586  C C   . ARG C 1 5   ? -29.343 15.601  88.803  1.00 31.25  ? 5   ARG C C   1 
ATOM   3587  O O   . ARG C 1 5   ? -30.342 16.110  89.304  1.00 37.11  ? 5   ARG C O   1 
ATOM   3588  C CB  . ARG C 1 5   ? -27.577 15.059  90.452  1.00 31.50  ? 5   ARG C CB  1 
ATOM   3589  C CG  . ARG C 1 5   ? -26.099 15.003  90.751  1.00 34.07  ? 5   ARG C CG  1 
ATOM   3590  C CD  . ARG C 1 5   ? -25.832 14.347  92.093  1.00 43.87  ? 5   ARG C CD  1 
ATOM   3591  N NE  . ARG C 1 5   ? -25.964 15.286  93.199  1.00 39.64  ? 5   ARG C NE  1 
ATOM   3592  C CZ  . ARG C 1 5   ? -26.800 15.137  94.217  1.00 55.57  ? 5   ARG C CZ  1 
ATOM   3593  N NH1 . ARG C 1 5   ? -27.589 14.075  94.276  1.00 36.15  ? 5   ARG C NH1 1 
ATOM   3594  N NH2 . ARG C 1 5   ? -26.843 16.059  95.172  1.00 38.10  ? 5   ARG C NH2 1 
ATOM   3595  N N   . ILE C 1 6   ? -29.390 14.716  87.814  1.00 26.51  ? 6   ILE C N   1 
ATOM   3596  C CA  . ILE C 1 6   ? -30.645 14.183  87.310  1.00 37.28  ? 6   ILE C CA  1 
ATOM   3597  C C   . ILE C 1 6   ? -30.634 12.782  87.911  1.00 32.32  ? 6   ILE C C   1 
ATOM   3598  O O   . ILE C 1 6   ? -29.737 11.986  87.647  1.00 36.31  ? 6   ILE C O   1 
ATOM   3599  C CB  . ILE C 1 6   ? -30.681 14.082  85.774  1.00 45.73  ? 6   ILE C CB  1 
ATOM   3600  C CG1 . ILE C 1 6   ? -30.512 15.474  85.150  1.00 38.52  ? 6   ILE C CG1 1 
ATOM   3601  C CG2 . ILE C 1 6   ? -31.981 13.442  85.336  1.00 27.70  ? 6   ILE C CG2 1 
ATOM   3602  C CD1 . ILE C 1 6   ? -31.503 16.498  85.636  1.00 34.28  ? 6   ILE C CD1 1 
ATOM   3603  N N   . ILE C 1 7   ? -31.619 12.489  88.741  1.00 33.78  ? 7   ILE C N   1 
ATOM   3604  C CA  . ILE C 1 7   ? -31.656 11.204  89.412  1.00 39.23  ? 7   ILE C CA  1 
ATOM   3605  C C   . ILE C 1 7   ? -32.888 10.366  89.095  1.00 47.20  ? 7   ILE C C   1 
ATOM   3606  O O   . ILE C 1 7   ? -34.002 10.878  88.981  1.00 44.08  ? 7   ILE C O   1 
ATOM   3607  C CB  . ILE C 1 7   ? -31.556 11.400  90.946  1.00 35.59  ? 7   ILE C CB  1 
ATOM   3608  C CG1 . ILE C 1 7   ? -30.275 12.168  91.294  1.00 30.12  ? 7   ILE C CG1 1 
ATOM   3609  C CG2 . ILE C 1 7   ? -31.567 10.063  91.640  1.00 47.13  ? 7   ILE C CG2 1 
ATOM   3610  C CD1 . ILE C 1 7   ? -30.183 12.593  92.740  1.00 31.50  ? 7   ILE C CD1 1 
ATOM   3611  N N   . ALA C 1 8   ? -32.671 9.066   88.951  1.00 41.05  ? 8   ALA C N   1 
ATOM   3612  C CA  . ALA C 1 8   ? -33.757 8.143   88.662  1.00 36.26  ? 8   ALA C CA  1 
ATOM   3613  C C   . ALA C 1 8   ? -34.134 7.370   89.920  1.00 43.98  ? 8   ALA C C   1 
ATOM   3614  O O   . ALA C 1 8   ? -33.273 6.853   90.629  1.00 40.98  ? 8   ALA C O   1 
ATOM   3615  C CB  . ALA C 1 8   ? -33.349 7.186   87.564  1.00 35.76  ? 8   ALA C CB  1 
ATOM   3616  N N   . CYS C 1 9   ? -35.430 7.309   90.196  1.00 42.28  ? 9   CYS C N   1 
ATOM   3617  C CA  . CYS C 1 9   ? -35.931 6.591   91.355  1.00 45.60  ? 9   CYS C CA  1 
ATOM   3618  C C   . CYS C 1 9   ? -36.615 5.302   90.933  1.00 40.53  ? 9   CYS C C   1 
ATOM   3619  O O   . CYS C 1 9   ? -37.493 5.310   90.073  1.00 52.63  ? 9   CYS C O   1 
ATOM   3620  C CB  . CYS C 1 9   ? -36.926 7.448   92.126  1.00 32.62  ? 9   CYS C CB  1 
ATOM   3621  S SG  . CYS C 1 9   ? -37.532 6.662   93.632  1.00 56.42  ? 9   CYS C SG  1 
ATOM   3622  N N   . LEU C 1 10  ? -36.197 4.194   91.537  1.00 64.54  ? 10  LEU C N   1 
ATOM   3623  C CA  . LEU C 1 10  ? -36.779 2.886   91.251  1.00 52.28  ? 10  LEU C CA  1 
ATOM   3624  C C   . LEU C 1 10  ? -37.521 2.407   92.477  1.00 46.79  ? 10  LEU C C   1 
ATOM   3625  O O   . LEU C 1 10  ? -36.919 2.179   93.526  1.00 53.61  ? 10  LEU C O   1 
ATOM   3626  C CB  . LEU C 1 10  ? -35.689 1.875   90.890  1.00 47.89  ? 10  LEU C CB  1 
ATOM   3627  C CG  . LEU C 1 10  ? -34.844 2.229   89.668  1.00 49.57  ? 10  LEU C CG  1 
ATOM   3628  C CD1 . LEU C 1 10  ? -34.007 1.059   89.240  1.00 35.96  ? 10  LEU C CD1 1 
ATOM   3629  C CD2 . LEU C 1 10  ? -35.773 2.605   88.548  1.00 69.89  ? 10  LEU C CD2 1 
ATOM   3630  N N   . ASN C 1 11  ? -38.838 2.291   92.357  1.00 59.63  ? 11  ASN C N   1 
ATOM   3631  C CA  . ASN C 1 11  ? -39.659 1.810   93.464  1.00 51.06  ? 11  ASN C CA  1 
ATOM   3632  C C   . ASN C 1 11  ? -39.575 0.285   93.373  1.00 61.56  ? 11  ASN C C   1 
ATOM   3633  O O   . ASN C 1 11  ? -39.801 -0.286  92.301  1.00 46.66  ? 11  ASN C O   1 
ATOM   3634  C CB  . ASN C 1 11  ? -41.128 2.249   93.291  1.00 59.42  ? 11  ASN C CB  1 
ATOM   3635  C CG  . ASN C 1 11  ? -41.370 3.714   93.652  1.00 70.89  ? 11  ASN C CG  1 
ATOM   3636  O OD1 . ASN C 1 11  ? -41.504 4.071   94.827  1.00 57.44  ? 11  ASN C OD1 1 
ATOM   3637  N ND2 . ASN C 1 11  ? -41.433 4.569   92.633  1.00 76.54  ? 11  ASN C ND2 1 
ATOM   3638  N N   . VAL C 1 12  ? -39.230 -0.387  94.467  1.00 59.20  ? 12  VAL C N   1 
ATOM   3639  C CA  . VAL C 1 12  ? -39.173 -1.841  94.397  1.00 47.55  ? 12  VAL C CA  1 
ATOM   3640  C C   . VAL C 1 12  ? -39.900 -2.542  95.535  1.00 56.29  ? 12  VAL C C   1 
ATOM   3641  O O   . VAL C 1 12  ? -40.068 -1.997  96.630  1.00 55.42  ? 12  VAL C O   1 
ATOM   3642  C CB  . VAL C 1 12  ? -37.725 -2.356  94.349  1.00 52.57  ? 12  VAL C CB  1 
ATOM   3643  C CG1 . VAL C 1 12  ? -37.009 -1.789  93.150  1.00 42.63  ? 12  VAL C CG1 1 
ATOM   3644  C CG2 . VAL C 1 12  ? -37.005 -1.984  95.627  1.00 54.62  ? 12  VAL C CG2 1 
ATOM   3645  N N   . LYS C 1 13  ? -40.341 -3.762  95.246  1.00 64.88  ? 13  LYS C N   1 
ATOM   3646  C CA  . LYS C 1 13  ? -41.038 -4.603  96.212  1.00 59.86  ? 13  LYS C CA  1 
ATOM   3647  C C   . LYS C 1 13  ? -40.754 -6.061  95.897  1.00 70.28  ? 13  LYS C C   1 
ATOM   3648  O O   . LYS C 1 13  ? -40.863 -6.494  94.736  1.00 54.36  ? 13  LYS C O   1 
ATOM   3649  C CB  . LYS C 1 13  ? -42.540 -4.365  96.162  1.00 53.75  ? 13  LYS C CB  1 
ATOM   3650  C CG  . LYS C 1 13  ? -43.314 -5.237  97.133  1.00 72.44  ? 13  LYS C CG  1 
ATOM   3651  C CD  . LYS C 1 13  ? -44.679 -4.628  97.425  1.00 101.25 ? 13  LYS C CD  1 
ATOM   3652  C CE  . LYS C 1 13  ? -45.452 -5.414  98.488  1.00 103.15 ? 13  LYS C CE  1 
ATOM   3653  N NZ  . LYS C 1 13  ? -46.751 -4.742  98.840  1.00 103.15 ? 13  LYS C NZ  1 
ATOM   3654  N N   . ASP C 1 14  ? -40.384 -6.805  96.938  1.00 62.17  ? 14  ASP C N   1 
ATOM   3655  C CA  . ASP C 1 14  ? -40.069 -8.222  96.822  1.00 67.72  ? 14  ASP C CA  1 
ATOM   3656  C C   . ASP C 1 14  ? -39.233 -8.511  95.581  1.00 66.94  ? 14  ASP C C   1 
ATOM   3657  O O   . ASP C 1 14  ? -39.542 -9.423  94.811  1.00 71.97  ? 14  ASP C O   1 
ATOM   3658  C CB  . ASP C 1 14  ? -41.358 -9.066  96.803  1.00 73.11  ? 14  ASP C CB  1 
ATOM   3659  C CG  . ASP C 1 14  ? -42.075 -9.078  98.155  1.00 86.60  ? 14  ASP C CG  1 
ATOM   3660  O OD1 . ASP C 1 14  ? -41.617 -9.798  99.080  1.00 89.95  ? 14  ASP C OD1 1 
ATOM   3661  O OD2 . ASP C 1 14  ? -43.094 -8.358  98.298  1.00 75.10  ? 14  ASP C OD2 1 
ATOM   3662  N N   . GLY C 1 15  ? -38.194 -7.704  95.382  1.00 64.00  ? 15  GLY C N   1 
ATOM   3663  C CA  . GLY C 1 15  ? -37.286 -7.908  94.261  1.00 45.97  ? 15  GLY C CA  1 
ATOM   3664  C C   . GLY C 1 15  ? -37.603 -7.323  92.900  1.00 60.05  ? 15  GLY C C   1 
ATOM   3665  O O   . GLY C 1 15  ? -36.828 -7.513  91.957  1.00 59.22  ? 15  GLY C O   1 
ATOM   3666  N N   . ARG C 1 16  ? -38.713 -6.611  92.756  1.00 44.27  ? 16  ARG C N   1 
ATOM   3667  C CA  . ARG C 1 16  ? -39.004 -6.058  91.445  1.00 60.19  ? 16  ARG C CA  1 
ATOM   3668  C C   . ARG C 1 16  ? -39.343 -4.580  91.447  1.00 58.61  ? 16  ARG C C   1 
ATOM   3669  O O   . ARG C 1 16  ? -39.603 -3.998  92.495  1.00 76.55  ? 16  ARG C O   1 
ATOM   3670  C CB  . ARG C 1 16  ? -40.128 -6.852  90.775  1.00 83.66  ? 16  ARG C CB  1 
ATOM   3671  C CG  . ARG C 1 16  ? -39.759 -8.294  90.469  1.00 58.97  ? 16  ARG C CG  1 
ATOM   3672  C CD  . ARG C 1 16  ? -40.733 -8.862  89.484  1.00 71.37  ? 16  ARG C CD  1 
ATOM   3673  N NE  . ARG C 1 16  ? -40.616 -8.234  88.169  1.00 44.19  ? 16  ARG C NE  1 
ATOM   3674  C CZ  . ARG C 1 16  ? -39.520 -8.284  87.424  1.00 37.12  ? 16  ARG C CZ  1 
ATOM   3675  N NH1 . ARG C 1 16  ? -38.445 -8.919  87.871  1.00 49.60  ? 16  ARG C NH1 1 
ATOM   3676  N NH2 . ARG C 1 16  ? -39.509 -7.743  86.216  1.00 40.87  ? 16  ARG C NH2 1 
ATOM   3677  N N   . VAL C 1 17  ? -39.327 -3.981  90.261  1.00 65.64  ? 17  VAL C N   1 
ATOM   3678  C CA  . VAL C 1 17  ? -39.624 -2.557  90.090  1.00 70.53  ? 17  VAL C CA  1 
ATOM   3679  C C   . VAL C 1 17  ? -41.120 -2.303  89.956  1.00 66.75  ? 17  VAL C C   1 
ATOM   3680  O O   . VAL C 1 17  ? -41.660 -2.383  88.857  1.00 84.37  ? 17  VAL C O   1 
ATOM   3681  C CB  . VAL C 1 17  ? -38.931 -1.996  88.821  1.00 57.42  ? 17  VAL C CB  1 
ATOM   3682  C CG1 . VAL C 1 17  ? -39.431 -0.585  88.529  1.00 66.55  ? 17  VAL C CG1 1 
ATOM   3683  C CG2 . VAL C 1 17  ? -37.423 -2.002  89.010  1.00 70.83  ? 17  VAL C CG2 1 
ATOM   3684  N N   . VAL C 1 18  ? -41.782 -1.972  91.061  1.00 72.28  ? 18  VAL C N   1 
ATOM   3685  C CA  . VAL C 1 18  ? -43.220 -1.715  91.042  1.00 67.50  ? 18  VAL C CA  1 
ATOM   3686  C C   . VAL C 1 18  ? -43.594 -0.456  90.271  1.00 80.12  ? 18  VAL C C   1 
ATOM   3687  O O   . VAL C 1 18  ? -42.858 -0.046  89.361  1.00 91.08  ? 18  VAL C O   1 
ATOM   3688  C CB  . VAL C 1 18  ? -43.787 -1.626  92.478  1.00 81.52  ? 18  VAL C CB  1 
ATOM   3689  C CG1 . VAL C 1 18  ? -44.029 -3.042  93.022  1.00 86.57  ? 18  VAL C CG1 1 
ATOM   3690  C CG2 . VAL C 1 18  ? -42.808 -0.872  93.394  1.00 69.31  ? 18  VAL C CG2 1 
ATOM   3691  N N   . LYS C 1 19  ? -44.749 0.125   90.618  1.00 79.88  ? 19  LYS C N   1 
ATOM   3692  C CA  . LYS C 1 19  ? -45.271 1.357   90.003  1.00 80.70  ? 19  LYS C CA  1 
ATOM   3693  C C   . LYS C 1 19  ? -46.797 1.384   89.931  1.00 78.93  ? 19  LYS C C   1 
ATOM   3694  O O   . LYS C 1 19  ? -47.348 1.646   88.867  1.00 89.47  ? 19  LYS C O   1 
ATOM   3695  C CB  . LYS C 1 19  ? -44.691 1.562   88.587  1.00 80.68  ? 19  LYS C CB  1 
ATOM   3696  N N   . GLY C 1 20  ? -47.474 1.129   91.052  1.00 77.83  ? 20  GLY C N   1 
ATOM   3697  C CA  . GLY C 1 20  ? -48.929 1.132   91.058  1.00 91.59  ? 20  GLY C CA  1 
ATOM   3698  C C   . GLY C 1 20  ? -49.561 2.493   91.325  1.00 103.15 ? 20  GLY C C   1 
ATOM   3699  O O   . GLY C 1 20  ? -49.105 3.516   90.794  1.00 103.15 ? 20  GLY C O   1 
ATOM   3700  N N   . THR C 1 21  ? -50.635 2.515   92.115  1.00 103.15 ? 21  THR C N   1 
ATOM   3701  C CA  . THR C 1 21  ? -51.281 3.783   92.462  1.00 103.15 ? 21  THR C CA  1 
ATOM   3702  C C   . THR C 1 21  ? -51.111 3.955   93.986  1.00 103.15 ? 21  THR C C   1 
ATOM   3703  O O   . THR C 1 21  ? -52.056 4.290   94.713  1.00 97.73  ? 21  THR C O   1 
ATOM   3704  C CB  . THR C 1 21  ? -52.802 3.802   92.071  1.00 100.65 ? 21  THR C CB  1 
ATOM   3705  O OG1 . THR C 1 21  ? -52.958 3.480   90.680  1.00 78.69  ? 21  THR C OG1 1 
ATOM   3706  C CG2 . THR C 1 21  ? -53.401 5.194   92.320  1.00 65.51  ? 21  THR C CG2 1 
ATOM   3707  N N   . ASN C 1 22  ? -49.882 3.717   94.451  1.00 99.18  ? 22  ASN C N   1 
ATOM   3708  C CA  . ASN C 1 22  ? -49.529 3.815   95.873  1.00 103.15 ? 22  ASN C CA  1 
ATOM   3709  C C   . ASN C 1 22  ? -50.479 3.006   96.785  1.00 103.15 ? 22  ASN C C   1 
ATOM   3710  O O   . ASN C 1 22  ? -51.347 3.559   97.481  1.00 103.15 ? 22  ASN C O   1 
ATOM   3711  C CB  . ASN C 1 22  ? -49.462 5.294   96.296  1.00 95.77  ? 22  ASN C CB  1 
ATOM   3712  C CG  . ASN C 1 22  ? -48.035 5.854   96.253  1.00 103.15 ? 22  ASN C CG  1 
ATOM   3713  O OD1 . ASN C 1 22  ? -47.195 5.415   95.449  1.00 98.49  ? 22  ASN C OD1 1 
ATOM   3714  N ND2 . ASN C 1 22  ? -47.758 6.836   97.116  1.00 101.54 ? 22  ASN C ND2 1 
ATOM   3715  N N   . PHE C 1 23  ? -50.282 1.686   96.777  1.00 100.54 ? 23  PHE C N   1 
ATOM   3716  C CA  . PHE C 1 23  ? -51.091 0.750   97.555  1.00 92.33  ? 23  PHE C CA  1 
ATOM   3717  C C   . PHE C 1 23  ? -52.505 0.722   96.995  1.00 103.15 ? 23  PHE C C   1 
ATOM   3718  O O   . PHE C 1 23  ? -53.390 0.079   97.568  1.00 102.91 ? 23  PHE C O   1 
ATOM   3719  C CB  . PHE C 1 23  ? -51.118 1.143   99.033  1.00 84.64  ? 23  PHE C CB  1 
ATOM   3720  N N   . GLU C 1 24  ? -52.723 1.444   95.889  1.00 103.15 ? 24  GLU C N   1 
ATOM   3721  C CA  . GLU C 1 24  ? -54.042 1.465   95.234  1.00 103.15 ? 24  GLU C CA  1 
ATOM   3722  C C   . GLU C 1 24  ? -54.054 0.305   94.223  1.00 103.15 ? 24  GLU C C   1 
ATOM   3723  O O   . GLU C 1 24  ? -54.756 0.339   93.185  1.00 102.79 ? 24  GLU C O   1 
ATOM   3724  C CB  . GLU C 1 24  ? -54.272 2.792   94.530  1.00 86.12  ? 24  GLU C CB  1 
ATOM   3725  N N   . ASN C 1 25  ? -53.258 -0.719  94.564  1.00 103.15 ? 25  ASN C N   1 
ATOM   3726  C CA  . ASN C 1 25  ? -53.102 -1.934  93.774  1.00 103.15 ? 25  ASN C CA  1 
ATOM   3727  C C   . ASN C 1 25  ? -52.064 -1.717  92.666  1.00 103.15 ? 25  ASN C C   1 
ATOM   3728  O O   . ASN C 1 25  ? -52.389 -1.347  91.527  1.00 103.15 ? 25  ASN C O   1 
ATOM   3729  C CB  . ASN C 1 25  ? -54.467 -2.365  93.231  1.00 103.15 ? 25  ASN C CB  1 
ATOM   3730  C CG  . ASN C 1 25  ? -55.520 -2.484  94.345  1.00 103.15 ? 25  ASN C CG  1 
ATOM   3731  O OD1 . ASN C 1 25  ? -55.877 -1.487  94.984  1.00 94.13  ? 25  ASN C OD1 1 
ATOM   3732  N ND2 . ASN C 1 25  ? -56.005 -3.704  94.587  1.00 89.63  ? 25  ASN C ND2 1 
ATOM   3733  N N   . LEU C 1 26  ? -50.809 -1.955  93.060  1.00 99.51  ? 26  LEU C N   1 
ATOM   3734  C CA  . LEU C 1 26  ? -49.597 -1.806  92.248  1.00 86.64  ? 26  LEU C CA  1 
ATOM   3735  C C   . LEU C 1 26  ? -49.538 -2.687  91.001  1.00 79.50  ? 26  LEU C C   1 
ATOM   3736  O O   . LEU C 1 26  ? -50.350 -3.598  90.827  1.00 72.29  ? 26  LEU C O   1 
ATOM   3737  C CB  . LEU C 1 26  ? -48.366 -2.123  93.117  1.00 70.17  ? 26  LEU C CB  1 
ATOM   3738  C CG  . LEU C 1 26  ? -48.045 -1.378  94.420  1.00 60.91  ? 26  LEU C CG  1 
ATOM   3739  C CD1 . LEU C 1 26  ? -49.293 -1.001  95.214  1.00 66.80  ? 26  LEU C CD1 1 
ATOM   3740  C CD2 . LEU C 1 26  ? -47.153 -2.296  95.250  1.00 75.22  ? 26  LEU C CD2 1 
ATOM   3741  N N   . ARG C 1 27  ? -48.560 -2.414  90.138  1.00 75.55  ? 27  ARG C N   1 
ATOM   3742  C CA  . ARG C 1 27  ? -48.382 -3.209  88.921  1.00 83.63  ? 27  ARG C CA  1 
ATOM   3743  C C   . ARG C 1 27  ? -47.078 -4.005  89.043  1.00 80.49  ? 27  ARG C C   1 
ATOM   3744  O O   . ARG C 1 27  ? -46.844 -4.754  90.008  1.00 89.96  ? 27  ARG C O   1 
ATOM   3745  C CB  . ARG C 1 27  ? -48.256 -2.341  87.653  1.00 83.05  ? 27  ARG C CB  1 
ATOM   3746  C CG  . ARG C 1 27  ? -48.835 -0.930  87.670  1.00 67.60  ? 27  ARG C CG  1 
ATOM   3747  C CD  . ARG C 1 27  ? -48.179 -0.148  86.512  1.00 90.41  ? 27  ARG C CD  1 
ATOM   3748  N NE  . ARG C 1 27  ? -48.813 1.141   86.220  1.00 103.15 ? 27  ARG C NE  1 
ATOM   3749  C CZ  . ARG C 1 27  ? -48.475 1.922   85.192  1.00 100.41 ? 27  ARG C CZ  1 
ATOM   3750  N NH1 . ARG C 1 27  ? -47.507 1.545   84.357  1.00 93.15  ? 27  ARG C NH1 1 
ATOM   3751  N NH2 . ARG C 1 27  ? -49.107 3.076   84.992  1.00 87.47  ? 27  ARG C NH2 1 
ATOM   3752  N N   . ASP C 1 28  ? -46.225 -3.815  88.048  1.00 77.25  ? 28  ASP C N   1 
ATOM   3753  C CA  . ASP C 1 28  ? -44.943 -4.482  87.995  1.00 61.56  ? 28  ASP C CA  1 
ATOM   3754  C C   . ASP C 1 28  ? -44.272 -4.072  86.688  1.00 73.67  ? 28  ASP C C   1 
ATOM   3755  O O   . ASP C 1 28  ? -44.928 -3.978  85.637  1.00 66.62  ? 28  ASP C O   1 
ATOM   3756  C CB  . ASP C 1 28  ? -45.148 -5.999  88.074  1.00 61.73  ? 28  ASP C CB  1 
ATOM   3757  C CG  . ASP C 1 28  ? -43.856 -6.777  87.951  1.00 54.67  ? 28  ASP C CG  1 
ATOM   3758  O OD1 . ASP C 1 28  ? -43.363 -6.937  86.816  1.00 90.22  ? 28  ASP C OD1 1 
ATOM   3759  O OD2 . ASP C 1 28  ? -43.328 -7.226  88.989  1.00 59.28  ? 28  ASP C OD2 1 
ATOM   3760  N N   . SER C 1 29  ? -42.971 -3.790  86.780  1.00 80.55  ? 29  SER C N   1 
ATOM   3761  C CA  . SER C 1 29  ? -42.158 -3.402  85.631  1.00 80.73  ? 29  SER C CA  1 
ATOM   3762  C C   . SER C 1 29  ? -40.705 -3.852  85.826  1.00 67.26  ? 29  SER C C   1 
ATOM   3763  O O   . SER C 1 29  ? -40.267 -4.029  86.953  1.00 83.20  ? 29  SER C O   1 
ATOM   3764  C CB  . SER C 1 29  ? -42.209 -1.894  85.426  1.00 63.64  ? 29  SER C CB  1 
ATOM   3765  O OG  . SER C 1 29  ? -41.455 -1.541  84.277  1.00 103.15 ? 29  SER C OG  1 
ATOM   3766  N N   . GLY C 1 30  ? -39.993 -4.044  84.710  1.00 81.08  ? 30  GLY C N   1 
ATOM   3767  C CA  . GLY C 1 30  ? -38.600 -4.481  84.672  1.00 66.25  ? 30  GLY C CA  1 
ATOM   3768  C C   . GLY C 1 30  ? -37.868 -5.104  85.857  1.00 75.64  ? 30  GLY C C   1 
ATOM   3769  O O   . GLY C 1 30  ? -38.417 -5.349  86.928  1.00 70.16  ? 30  GLY C O   1 
ATOM   3770  N N   . ASP C 1 31  ? -36.594 -5.403  85.640  1.00 72.55  ? 31  ASP C N   1 
ATOM   3771  C CA  . ASP C 1 31  ? -35.762 -5.950  86.701  1.00 68.94  ? 31  ASP C CA  1 
ATOM   3772  C C   . ASP C 1 31  ? -34.928 -4.771  87.211  1.00 66.26  ? 31  ASP C C   1 
ATOM   3773  O O   . ASP C 1 31  ? -34.301 -4.065  86.417  1.00 58.27  ? 31  ASP C O   1 
ATOM   3774  C CB  . ASP C 1 31  ? -34.851 -7.055  86.158  1.00 55.68  ? 31  ASP C CB  1 
ATOM   3775  C CG  . ASP C 1 31  ? -33.570 -7.223  86.976  1.00 73.17  ? 31  ASP C CG  1 
ATOM   3776  O OD1 . ASP C 1 31  ? -33.648 -7.300  88.226  1.00 59.28  ? 31  ASP C OD1 1 
ATOM   3777  O OD2 . ASP C 1 31  ? -32.479 -7.285  86.359  1.00 62.39  ? 31  ASP C OD2 1 
ATOM   3778  N N   . PRO C 1 32  ? -34.924 -4.537  88.536  1.00 61.57  ? 32  PRO C N   1 
ATOM   3779  C CA  . PRO C 1 32  ? -34.161 -3.433  89.132  1.00 59.30  ? 32  PRO C CA  1 
ATOM   3780  C C   . PRO C 1 32  ? -32.696 -3.312  88.696  1.00 66.92  ? 32  PRO C C   1 
ATOM   3781  O O   . PRO C 1 32  ? -32.147 -2.214  88.657  1.00 64.79  ? 32  PRO C O   1 
ATOM   3782  C CB  . PRO C 1 32  ? -34.311 -3.672  90.641  1.00 49.90  ? 32  PRO C CB  1 
ATOM   3783  C CG  . PRO C 1 32  ? -34.659 -5.108  90.751  1.00 70.42  ? 32  PRO C CG  1 
ATOM   3784  C CD  . PRO C 1 32  ? -35.583 -5.332  89.588  1.00 52.17  ? 32  PRO C CD  1 
ATOM   3785  N N   . VAL C 1 33  ? -32.072 -4.428  88.335  1.00 66.76  ? 33  VAL C N   1 
ATOM   3786  C CA  . VAL C 1 33  ? -30.679 -4.404  87.919  1.00 50.02  ? 33  VAL C CA  1 
ATOM   3787  C C   . VAL C 1 33  ? -30.458 -3.920  86.480  1.00 49.82  ? 33  VAL C C   1 
ATOM   3788  O O   . VAL C 1 33  ? -29.551 -3.126  86.215  1.00 55.44  ? 33  VAL C O   1 
ATOM   3789  C CB  . VAL C 1 33  ? -30.039 -5.804  88.102  1.00 45.50  ? 33  VAL C CB  1 
ATOM   3790  C CG1 . VAL C 1 33  ? -28.626 -5.803  87.557  1.00 67.55  ? 33  VAL C CG1 1 
ATOM   3791  C CG2 . VAL C 1 33  ? -30.028 -6.176  89.575  1.00 49.15  ? 33  VAL C CG2 1 
ATOM   3792  N N   . GLU C 1 34  ? -31.277 -4.406  85.547  1.00 68.83  ? 34  GLU C N   1 
ATOM   3793  C CA  . GLU C 1 34  ? -31.151 -4.025  84.136  1.00 55.12  ? 34  GLU C CA  1 
ATOM   3794  C C   . GLU C 1 34  ? -31.704 -2.624  83.897  1.00 47.49  ? 34  GLU C C   1 
ATOM   3795  O O   . GLU C 1 34  ? -31.262 -1.916  82.991  1.00 45.81  ? 34  GLU C O   1 
ATOM   3796  C CB  . GLU C 1 34  ? -31.883 -5.034  83.242  1.00 80.90  ? 34  GLU C CB  1 
ATOM   3797  C CG  . GLU C 1 34  ? -30.965 -6.005  82.457  1.00 94.48  ? 34  GLU C CG  1 
ATOM   3798  C CD  . GLU C 1 34  ? -30.001 -6.784  83.355  1.00 102.94 ? 34  GLU C CD  1 
ATOM   3799  O OE1 . GLU C 1 34  ? -30.374 -7.062  84.523  1.00 89.44  ? 34  GLU C OE1 1 
ATOM   3800  O OE2 . GLU C 1 34  ? -28.878 -7.123  82.887  1.00 71.86  ? 34  GLU C OE2 1 
ATOM   3801  N N   . LEU C 1 35  ? -32.672 -2.233  84.718  1.00 49.96  ? 35  LEU C N   1 
ATOM   3802  C CA  . LEU C 1 35  ? -33.285 -0.913  84.631  1.00 48.90  ? 35  LEU C CA  1 
ATOM   3803  C C   . LEU C 1 35  ? -32.288 0.131   85.135  1.00 63.18  ? 35  LEU C C   1 
ATOM   3804  O O   . LEU C 1 35  ? -32.252 1.266   84.652  1.00 64.43  ? 35  LEU C O   1 
ATOM   3805  C CB  . LEU C 1 35  ? -34.547 -0.867  85.485  1.00 52.18  ? 35  LEU C CB  1 
ATOM   3806  C CG  . LEU C 1 35  ? -35.387 0.390   85.305  1.00 60.77  ? 35  LEU C CG  1 
ATOM   3807  C CD1 . LEU C 1 35  ? -35.921 0.432   83.883  1.00 53.66  ? 35  LEU C CD1 1 
ATOM   3808  C CD2 . LEU C 1 35  ? -36.512 0.395   86.305  1.00 50.24  ? 35  LEU C CD2 1 
ATOM   3809  N N   . GLY C 1 36  ? -31.479 -0.267  86.112  1.00 56.62  ? 36  GLY C N   1 
ATOM   3810  C CA  . GLY C 1 36  ? -30.480 0.630   86.654  1.00 54.78  ? 36  GLY C CA  1 
ATOM   3811  C C   . GLY C 1 36  ? -29.341 0.766   85.676  1.00 42.69  ? 36  GLY C C   1 
ATOM   3812  O O   . GLY C 1 36  ? -28.771 1.844   85.528  1.00 55.18  ? 36  GLY C O   1 
ATOM   3813  N N   . LYS C 1 37  ? -29.020 -0.340  85.008  1.00 50.94  ? 37  LYS C N   1 
ATOM   3814  C CA  . LYS C 1 37  ? -27.940 -0.391  84.024  1.00 48.67  ? 37  LYS C CA  1 
ATOM   3815  C C   . LYS C 1 37  ? -28.298 0.447   82.816  1.00 44.65  ? 37  LYS C C   1 
ATOM   3816  O O   . LYS C 1 37  ? -27.428 1.028   82.174  1.00 53.71  ? 37  LYS C O   1 
ATOM   3817  C CB  . LYS C 1 37  ? -27.684 -1.839  83.598  1.00 63.79  ? 37  LYS C CB  1 
ATOM   3818  C CG  . LYS C 1 37  ? -26.919 -2.650  84.630  1.00 52.56  ? 37  LYS C CG  1 
ATOM   3819  C CD  . LYS C 1 37  ? -27.055 -4.171  84.425  1.00 77.86  ? 37  LYS C CD  1 
ATOM   3820  C CE  . LYS C 1 37  ? -26.766 -4.594  82.995  1.00 54.32  ? 37  LYS C CE  1 
ATOM   3821  N NZ  . LYS C 1 37  ? -25.639 -3.796  82.453  1.00 70.18  ? 37  LYS C NZ  1 
ATOM   3822  N N   . PHE C 1 38  ? -29.592 0.504   82.518  1.00 47.09  ? 38  PHE C N   1 
ATOM   3823  C CA  . PHE C 1 38  ? -30.107 1.289   81.400  1.00 56.54  ? 38  PHE C CA  1 
ATOM   3824  C C   . PHE C 1 38  ? -30.020 2.792   81.742  1.00 46.38  ? 38  PHE C C   1 
ATOM   3825  O O   . PHE C 1 38  ? -29.573 3.599   80.927  1.00 43.38  ? 38  PHE C O   1 
ATOM   3826  C CB  . PHE C 1 38  ? -31.563 0.881   81.132  1.00 40.40  ? 38  PHE C CB  1 
ATOM   3827  C CG  . PHE C 1 38  ? -32.271 1.729   80.101  1.00 42.39  ? 38  PHE C CG  1 
ATOM   3828  C CD1 . PHE C 1 38  ? -31.857 1.737   78.772  1.00 37.05  ? 38  PHE C CD1 1 
ATOM   3829  C CD2 . PHE C 1 38  ? -33.392 2.476   80.454  1.00 40.58  ? 38  PHE C CD2 1 
ATOM   3830  C CE1 . PHE C 1 38  ? -32.553 2.472   77.804  1.00 52.74  ? 38  PHE C CE1 1 
ATOM   3831  C CE2 . PHE C 1 38  ? -34.098 3.217   79.488  1.00 61.88  ? 38  PHE C CE2 1 
ATOM   3832  C CZ  . PHE C 1 38  ? -33.677 3.211   78.164  1.00 41.87  ? 38  PHE C CZ  1 
ATOM   3833  N N   . TYR C 1 39  ? -30.447 3.148   82.954  1.00 50.79  ? 39  TYR C N   1 
ATOM   3834  C CA  . TYR C 1 39  ? -30.429 4.533   83.404  1.00 42.89  ? 39  TYR C CA  1 
ATOM   3835  C C   . TYR C 1 39  ? -29.027 5.108   83.443  1.00 47.93  ? 39  TYR C C   1 
ATOM   3836  O O   . TYR C 1 39  ? -28.835 6.293   83.199  1.00 51.54  ? 39  TYR C O   1 
ATOM   3837  C CB  . TYR C 1 39  ? -31.071 4.657   84.781  1.00 45.24  ? 39  TYR C CB  1 
ATOM   3838  C CG  . TYR C 1 39  ? -32.562 4.521   84.754  1.00 27.81  ? 39  TYR C CG  1 
ATOM   3839  C CD1 . TYR C 1 39  ? -33.270 4.680   83.566  1.00 57.64  ? 39  TYR C CD1 1 
ATOM   3840  C CD2 . TYR C 1 39  ? -33.274 4.266   85.914  1.00 39.41  ? 39  TYR C CD2 1 
ATOM   3841  C CE1 . TYR C 1 39  ? -34.655 4.584   83.532  1.00 41.99  ? 39  TYR C CE1 1 
ATOM   3842  C CE2 . TYR C 1 39  ? -34.657 4.169   85.898  1.00 42.65  ? 39  TYR C CE2 1 
ATOM   3843  C CZ  . TYR C 1 39  ? -35.342 4.327   84.697  1.00 46.64  ? 39  TYR C CZ  1 
ATOM   3844  O OH  . TYR C 1 39  ? -36.712 4.197   84.658  1.00 70.91  ? 39  TYR C OH  1 
ATOM   3845  N N   . SER C 1 40  ? -28.047 4.268   83.744  1.00 41.97  ? 40  SER C N   1 
ATOM   3846  C CA  . SER C 1 40  ? -26.668 4.726   83.782  1.00 49.10  ? 40  SER C CA  1 
ATOM   3847  C C   . SER C 1 40  ? -26.154 4.871   82.363  1.00 40.83  ? 40  SER C C   1 
ATOM   3848  O O   . SER C 1 40  ? -25.363 5.761   82.071  1.00 56.52  ? 40  SER C O   1 
ATOM   3849  C CB  . SER C 1 40  ? -25.775 3.735   84.534  1.00 52.03  ? 40  SER C CB  1 
ATOM   3850  O OG  . SER C 1 40  ? -24.412 4.134   84.446  1.00 41.63  ? 40  SER C OG  1 
ATOM   3851  N N   . GLU C 1 41  ? -26.593 3.979   81.481  1.00 59.12  ? 41  GLU C N   1 
ATOM   3852  C CA  . GLU C 1 41  ? -26.163 4.040   80.090  1.00 62.16  ? 41  GLU C CA  1 
ATOM   3853  C C   . GLU C 1 41  ? -26.653 5.331   79.421  1.00 41.99  ? 41  GLU C C   1 
ATOM   3854  O O   . GLU C 1 41  ? -25.884 5.994   78.731  1.00 55.81  ? 41  GLU C O   1 
ATOM   3855  C CB  . GLU C 1 41  ? -26.633 2.783   79.315  1.00 60.95  ? 41  GLU C CB  1 
ATOM   3856  C CG  . GLU C 1 41  ? -25.721 1.537   79.519  1.00 71.55  ? 41  GLU C CG  1 
ATOM   3857  C CD  . GLU C 1 41  ? -26.141 0.289   78.704  1.00 101.34 ? 41  GLU C CD  1 
ATOM   3858  O OE1 . GLU C 1 41  ? -27.157 -0.378  79.047  1.00 65.58  ? 41  GLU C OE1 1 
ATOM   3859  O OE2 . GLU C 1 41  ? -25.439 -0.028  77.709  1.00 99.33  ? 41  GLU C OE2 1 
ATOM   3860  N N   . ILE C 1 42  ? -27.907 5.714   79.653  1.00 39.15  ? 42  ILE C N   1 
ATOM   3861  C CA  . ILE C 1 42  ? -28.443 6.943   79.046  1.00 60.14  ? 42  ILE C CA  1 
ATOM   3862  C C   . ILE C 1 42  ? -27.961 8.280   79.645  1.00 57.90  ? 42  ILE C C   1 
ATOM   3863  O O   . ILE C 1 42  ? -28.186 9.340   79.055  1.00 62.33  ? 42  ILE C O   1 
ATOM   3864  C CB  . ILE C 1 42  ? -29.973 6.947   79.056  1.00 42.53  ? 42  ILE C CB  1 
ATOM   3865  C CG1 . ILE C 1 42  ? -30.483 6.878   80.492  1.00 54.15  ? 42  ILE C CG1 1 
ATOM   3866  C CG2 . ILE C 1 42  ? -30.491 5.778   78.239  1.00 60.54  ? 42  ILE C CG2 1 
ATOM   3867  C CD1 . ILE C 1 42  ? -31.966 6.622   80.608  1.00 54.23  ? 42  ILE C CD1 1 
ATOM   3868  N N   . GLY C 1 43  ? -27.319 8.251   80.808  1.00 43.48  ? 43  GLY C N   1 
ATOM   3869  C CA  . GLY C 1 43  ? -26.820 9.492   81.380  1.00 42.07  ? 43  GLY C CA  1 
ATOM   3870  C C   . GLY C 1 43  ? -27.330 9.938   82.733  1.00 32.23  ? 43  GLY C C   1 
ATOM   3871  O O   . GLY C 1 43  ? -27.077 11.054  83.156  1.00 44.52  ? 43  GLY C O   1 
ATOM   3872  N N   . ILE C 1 44  ? -28.071 9.079   83.404  1.00 36.55  ? 44  ILE C N   1 
ATOM   3873  C CA  . ILE C 1 44  ? -28.582 9.397   84.723  1.00 40.89  ? 44  ILE C CA  1 
ATOM   3874  C C   . ILE C 1 44  ? -27.378 9.544   85.654  1.00 46.40  ? 44  ILE C C   1 
ATOM   3875  O O   . ILE C 1 44  ? -26.387 8.837   85.509  1.00 44.58  ? 44  ILE C O   1 
ATOM   3876  C CB  . ILE C 1 44  ? -29.545 8.290   85.179  1.00 39.55  ? 44  ILE C CB  1 
ATOM   3877  C CG1 . ILE C 1 44  ? -30.888 8.492   84.463  1.00 36.83  ? 44  ILE C CG1 1 
ATOM   3878  C CG2 . ILE C 1 44  ? -29.686 8.270   86.685  1.00 36.29  ? 44  ILE C CG2 1 
ATOM   3879  C CD1 . ILE C 1 44  ? -31.619 9.778   84.832  1.00 34.78  ? 44  ILE C CD1 1 
ATOM   3880  N N   . ASP C 1 45  ? -27.457 10.472  86.598  1.00 38.16  ? 45  ASP C N   1 
ATOM   3881  C CA  . ASP C 1 45  ? -26.333 10.727  87.493  1.00 46.86  ? 45  ASP C CA  1 
ATOM   3882  C C   . ASP C 1 45  ? -26.332 9.903   88.765  1.00 40.51  ? 45  ASP C C   1 
ATOM   3883  O O   . ASP C 1 45  ? -25.274 9.550   89.283  1.00 45.43  ? 45  ASP C O   1 
ATOM   3884  C CB  . ASP C 1 45  ? -26.269 12.217  87.856  1.00 36.79  ? 45  ASP C CB  1 
ATOM   3885  C CG  . ASP C 1 45  ? -26.249 13.118  86.629  1.00 38.43  ? 45  ASP C CG  1 
ATOM   3886  O OD1 . ASP C 1 45  ? -25.421 12.894  85.721  1.00 37.08  ? 45  ASP C OD1 1 
ATOM   3887  O OD2 . ASP C 1 45  ? -27.066 14.058  86.584  1.00 40.62  ? 45  ASP C OD2 1 
ATOM   3888  N N   . GLU C 1 46  ? -27.511 9.605   89.280  1.00 40.21  ? 46  GLU C N   1 
ATOM   3889  C CA  . GLU C 1 46  ? -27.606 8.821   90.497  1.00 31.70  ? 46  GLU C CA  1 
ATOM   3890  C C   . GLU C 1 46  ? -28.863 7.981   90.464  1.00 41.47  ? 46  GLU C C   1 
ATOM   3891  O O   . GLU C 1 46  ? -29.770 8.232   89.663  1.00 41.18  ? 46  GLU C O   1 
ATOM   3892  C CB  . GLU C 1 46  ? -27.619 9.736   91.729  1.00 45.38  ? 46  GLU C CB  1 
ATOM   3893  C CG  . GLU C 1 46  ? -26.298 9.813   92.497  1.00 50.22  ? 46  GLU C CG  1 
ATOM   3894  C CD  . GLU C 1 46  ? -26.384 10.680  93.759  1.00 61.06  ? 46  GLU C CD  1 
ATOM   3895  O OE1 . GLU C 1 46  ? -27.175 10.365  94.671  1.00 51.33  ? 46  GLU C OE1 1 
ATOM   3896  O OE2 . GLU C 1 46  ? -25.656 11.685  93.840  1.00 58.18  ? 46  GLU C OE2 1 
ATOM   3897  N N   . LEU C 1 47  ? -28.903 6.970   91.330  1.00 44.67  ? 47  LEU C N   1 
ATOM   3898  C CA  . LEU C 1 47  ? -30.058 6.083   91.432  1.00 37.81  ? 47  LEU C CA  1 
ATOM   3899  C C   . LEU C 1 47  ? -30.551 6.026   92.869  1.00 41.35  ? 47  LEU C C   1 
ATOM   3900  O O   . LEU C 1 47  ? -29.798 6.230   93.809  1.00 40.15  ? 47  LEU C O   1 
ATOM   3901  C CB  . LEU C 1 47  ? -29.704 4.671   90.974  1.00 23.31  ? 47  LEU C CB  1 
ATOM   3902  C CG  . LEU C 1 47  ? -29.219 4.457   89.545  1.00 54.01  ? 47  LEU C CG  1 
ATOM   3903  C CD1 . LEU C 1 47  ? -28.824 2.972   89.366  1.00 33.85  ? 47  LEU C CD1 1 
ATOM   3904  C CD2 . LEU C 1 47  ? -30.309 4.877   88.550  1.00 35.93  ? 47  LEU C CD2 1 
ATOM   3905  N N   . VAL C 1 48  ? -31.833 5.756   93.027  1.00 43.91  ? 48  VAL C N   1 
ATOM   3906  C CA  . VAL C 1 48  ? -32.418 5.644   94.344  1.00 40.14  ? 48  VAL C CA  1 
ATOM   3907  C C   . VAL C 1 48  ? -33.411 4.489   94.293  1.00 51.85  ? 48  VAL C C   1 
ATOM   3908  O O   . VAL C 1 48  ? -34.366 4.505   93.521  1.00 50.47  ? 48  VAL C O   1 
ATOM   3909  C CB  . VAL C 1 48  ? -33.148 6.933   94.743  1.00 44.14  ? 48  VAL C CB  1 
ATOM   3910  C CG1 . VAL C 1 48  ? -33.583 6.851   96.183  1.00 31.74  ? 48  VAL C CG1 1 
ATOM   3911  C CG2 . VAL C 1 48  ? -32.241 8.127   94.539  1.00 47.20  ? 48  VAL C CG2 1 
ATOM   3912  N N   . PHE C 1 49  ? -33.152 3.463   95.093  1.00 55.04  ? 49  PHE C N   1 
ATOM   3913  C CA  . PHE C 1 49  ? -34.029 2.310   95.159  1.00 34.95  ? 49  PHE C CA  1 
ATOM   3914  C C   . PHE C 1 49  ? -34.793 2.456   96.459  1.00 30.98  ? 49  PHE C C   1 
ATOM   3915  O O   . PHE C 1 49  ? -34.205 2.750   97.491  1.00 38.11  ? 49  PHE C O   1 
ATOM   3916  C CB  . PHE C 1 49  ? -33.208 1.027   95.191  1.00 41.74  ? 49  PHE C CB  1 
ATOM   3917  C CG  . PHE C 1 49  ? -32.375 0.808   93.967  1.00 41.21  ? 49  PHE C CG  1 
ATOM   3918  C CD1 . PHE C 1 49  ? -32.910 0.182   92.849  1.00 37.01  ? 49  PHE C CD1 1 
ATOM   3919  C CD2 . PHE C 1 49  ? -31.048 1.222   93.934  1.00 38.35  ? 49  PHE C CD2 1 
ATOM   3920  C CE1 . PHE C 1 49  ? -32.127 -0.030  91.717  1.00 48.15  ? 49  PHE C CE1 1 
ATOM   3921  C CE2 . PHE C 1 49  ? -30.267 1.013   92.813  1.00 34.77  ? 49  PHE C CE2 1 
ATOM   3922  C CZ  . PHE C 1 49  ? -30.804 0.387   91.703  1.00 38.45  ? 49  PHE C CZ  1 
ATOM   3923  N N   . LEU C 1 50  ? -36.104 2.278   96.397  1.00 43.99  ? 50  LEU C N   1 
ATOM   3924  C CA  . LEU C 1 50  ? -36.970 2.374   97.568  1.00 54.65  ? 50  LEU C CA  1 
ATOM   3925  C C   . LEU C 1 50  ? -37.770 1.079   97.666  1.00 58.02  ? 50  LEU C C   1 
ATOM   3926  O O   . LEU C 1 50  ? -38.629 0.785   96.817  1.00 53.57  ? 50  LEU C O   1 
ATOM   3927  C CB  . LEU C 1 50  ? -37.935 3.559   97.432  1.00 66.93  ? 50  LEU C CB  1 
ATOM   3928  C CG  . LEU C 1 50  ? -37.569 4.890   98.087  1.00 77.99  ? 50  LEU C CG  1 
ATOM   3929  C CD1 . LEU C 1 50  ? -36.228 5.379   97.559  1.00 78.53  ? 50  LEU C CD1 1 
ATOM   3930  C CD2 . LEU C 1 50  ? -38.684 5.906   97.816  1.00 74.70  ? 50  LEU C CD2 1 
ATOM   3931  N N   . ASP C 1 51  ? -37.484 0.308   98.704  1.00 57.07  ? 51  ASP C N   1 
ATOM   3932  C CA  . ASP C 1 51  ? -38.156 -0.962  98.902  1.00 52.81  ? 51  ASP C CA  1 
ATOM   3933  C C   . ASP C 1 51  ? -39.371 -0.810  99.815  1.00 59.58  ? 51  ASP C C   1 
ATOM   3934  O O   . ASP C 1 51  ? -39.327 -0.077  100.810 1.00 46.55  ? 51  ASP C O   1 
ATOM   3935  C CB  . ASP C 1 51  ? -37.161 -1.978  99.476  1.00 54.07  ? 51  ASP C CB  1 
ATOM   3936  C CG  . ASP C 1 51  ? -37.752 -3.363  99.613  1.00 57.78  ? 51  ASP C CG  1 
ATOM   3937  O OD1 . ASP C 1 51  ? -38.558 -3.574  100.544 1.00 58.68  ? 51  ASP C OD1 1 
ATOM   3938  O OD2 . ASP C 1 51  ? -37.416 -4.237  98.781  1.00 56.49  ? 51  ASP C OD2 1 
ATOM   3939  N N   . ILE C 1 52  ? -40.450 -1.512  99.450  1.00 67.04  ? 52  ILE C N   1 
ATOM   3940  C CA  . ILE C 1 52  ? -41.716 -1.502  100.192 1.00 59.31  ? 52  ILE C CA  1 
ATOM   3941  C C   . ILE C 1 52  ? -42.230 -2.937  100.385 1.00 79.24  ? 52  ILE C C   1 
ATOM   3942  O O   . ILE C 1 52  ? -43.437 -3.183  100.574 1.00 73.47  ? 52  ILE C O   1 
ATOM   3943  C CB  . ILE C 1 52  ? -42.769 -0.659  99.443  1.00 65.04  ? 52  ILE C CB  1 
ATOM   3944  C CG1 . ILE C 1 52  ? -42.858 -1.110  97.986  1.00 68.48  ? 52  ILE C CG1 1 
ATOM   3945  C CG2 . ILE C 1 52  ? -42.371 0.814   99.475  1.00 61.87  ? 52  ILE C CG2 1 
ATOM   3946  C CD1 . ILE C 1 52  ? -43.799 -0.265  97.155  1.00 68.74  ? 52  ILE C CD1 1 
ATOM   3947  N N   . THR C 1 53  ? -41.279 -3.874  100.341 1.00 80.83  ? 53  THR C N   1 
ATOM   3948  C CA  . THR C 1 53  ? -41.509 -5.312  100.506 1.00 66.44  ? 53  THR C CA  1 
ATOM   3949  C C   . THR C 1 53  ? -42.161 -5.656  101.849 1.00 81.55  ? 53  THR C C   1 
ATOM   3950  O O   . THR C 1 53  ? -42.245 -4.808  102.748 1.00 56.12  ? 53  THR C O   1 
ATOM   3951  C CB  . THR C 1 53  ? -40.157 -6.074  100.431 1.00 71.34  ? 53  THR C CB  1 
ATOM   3952  O OG1 . THR C 1 53  ? -39.563 -5.870  99.144  1.00 85.41  ? 53  THR C OG1 1 
ATOM   3953  C CG2 . THR C 1 53  ? -40.339 -7.569  100.681 1.00 86.54  ? 53  THR C CG2 1 
ATOM   3954  N N   . ALA C 1 54  ? -42.617 -6.909  101.971 1.00 87.91  ? 54  ALA C N   1 
ATOM   3955  C CA  . ALA C 1 54  ? -43.222 -7.411  103.204 1.00 89.86  ? 54  ALA C CA  1 
ATOM   3956  C C   . ALA C 1 54  ? -42.212 -7.140  104.323 1.00 94.40  ? 54  ALA C C   1 
ATOM   3957  O O   . ALA C 1 54  ? -41.114 -6.629  104.066 1.00 103.15 ? 54  ALA C O   1 
ATOM   3958  C CB  . ALA C 1 54  ? -43.506 -8.919  103.089 1.00 76.52  ? 54  ALA C CB  1 
ATOM   3959  N N   . SER C 1 55  ? -42.549 -7.500  105.555 1.00 97.37  ? 55  SER C N   1 
ATOM   3960  C CA  . SER C 1 55  ? -41.647 -7.216  106.672 1.00 96.91  ? 55  SER C CA  1 
ATOM   3961  C C   . SER C 1 55  ? -40.908 -8.406  107.293 1.00 92.74  ? 55  SER C C   1 
ATOM   3962  O O   . SER C 1 55  ? -40.603 -8.370  108.484 1.00 88.41  ? 55  SER C O   1 
ATOM   3963  C CB  . SER C 1 55  ? -42.405 -6.451  107.783 1.00 101.00 ? 55  SER C CB  1 
ATOM   3964  O OG  . SER C 1 55  ? -43.480 -7.210  108.336 1.00 82.18  ? 55  SER C OG  1 
ATOM   3965  N N   . VAL C 1 56  ? -40.633 -9.453  106.510 1.00 85.82  ? 56  VAL C N   1 
ATOM   3966  C CA  . VAL C 1 56  ? -39.884 -10.610 107.025 1.00 86.53  ? 56  VAL C CA  1 
ATOM   3967  C C   . VAL C 1 56  ? -38.883 -11.055 105.964 1.00 85.54  ? 56  VAL C C   1 
ATOM   3968  O O   . VAL C 1 56  ? -37.920 -11.776 106.241 1.00 92.14  ? 56  VAL C O   1 
ATOM   3969  C CB  . VAL C 1 56  ? -40.791 -11.805 107.367 1.00 86.26  ? 56  VAL C CB  1 
ATOM   3970  C CG1 . VAL C 1 56  ? -39.932 -12.976 107.857 1.00 86.12  ? 56  VAL C CG1 1 
ATOM   3971  C CG2 . VAL C 1 56  ? -41.795 -11.419 108.454 1.00 83.34  ? 56  VAL C CG2 1 
ATOM   3972  N N   . GLU C 1 57  ? -39.132 -10.609 104.740 1.00 92.54  ? 57  GLU C N   1 
ATOM   3973  C CA  . GLU C 1 57  ? -38.281 -10.904 103.601 1.00 82.79  ? 57  GLU C CA  1 
ATOM   3974  C C   . GLU C 1 57  ? -37.597 -9.597  103.215 1.00 89.46  ? 57  GLU C C   1 
ATOM   3975  O O   . GLU C 1 57  ? -36.824 -9.560  102.252 1.00 82.95  ? 57  GLU C O   1 
ATOM   3976  C CB  . GLU C 1 57  ? -39.131 -11.389 102.422 1.00 88.40  ? 57  GLU C CB  1 
ATOM   3977  C CG  . GLU C 1 57  ? -39.402 -12.892 102.368 1.00 86.01  ? 57  GLU C CG  1 
ATOM   3978  C CD  . GLU C 1 57  ? -38.266 -13.678 101.709 1.00 103.15 ? 57  GLU C CD  1 
ATOM   3979  O OE1 . GLU C 1 57  ? -37.864 -13.334 100.570 1.00 103.15 ? 57  GLU C OE1 1 
ATOM   3980  O OE2 . GLU C 1 57  ? -37.780 -14.648 102.321 1.00 103.15 ? 57  GLU C OE2 1 
ATOM   3981  N N   . LYS C 1 58  ? -37.877 -8.526  103.965 1.00 79.96  ? 58  LYS C N   1 
ATOM   3982  C CA  . LYS C 1 58  ? -37.298 -7.226  103.639 1.00 73.22  ? 58  LYS C CA  1 
ATOM   3983  C C   . LYS C 1 58  ? -35.803 -7.123  103.919 1.00 68.25  ? 58  LYS C C   1 
ATOM   3984  O O   . LYS C 1 58  ? -35.002 -6.987  102.994 1.00 62.52  ? 58  LYS C O   1 
ATOM   3985  C CB  . LYS C 1 58  ? -38.037 -6.100  104.372 1.00 87.14  ? 58  LYS C CB  1 
ATOM   3986  C CG  . LYS C 1 58  ? -37.612 -4.682  103.903 1.00 97.31  ? 58  LYS C CG  1 
ATOM   3987  C CD  . LYS C 1 58  ? -38.522 -3.585  104.468 1.00 83.77  ? 58  LYS C CD  1 
ATOM   3988  C CE  . LYS C 1 58  ? -38.438 -2.295  103.641 1.00 64.25  ? 58  LYS C CE  1 
ATOM   3989  N NZ  . LYS C 1 58  ? -39.596 -1.388  103.915 1.00 69.50  ? 58  LYS C NZ  1 
ATOM   3990  N N   . ARG C 1 59  ? -35.427 -7.187  105.191 1.00 54.63  ? 59  ARG C N   1 
ATOM   3991  C CA  . ARG C 1 59  ? -34.021 -7.087  105.569 1.00 70.48  ? 59  ARG C CA  1 
ATOM   3992  C C   . ARG C 1 59  ? -33.066 -7.952  104.730 1.00 73.25  ? 59  ARG C C   1 
ATOM   3993  O O   . ARG C 1 59  ? -31.864 -7.658  104.651 1.00 73.94  ? 59  ARG C O   1 
ATOM   3994  C CB  . ARG C 1 59  ? -33.854 -7.420  107.052 1.00 68.82  ? 59  ARG C CB  1 
ATOM   3995  C CG  . ARG C 1 59  ? -32.491 -7.044  107.608 1.00 63.03  ? 59  ARG C CG  1 
ATOM   3996  C CD  . ARG C 1 59  ? -32.608 -6.576  109.058 1.00 72.10  ? 59  ARG C CD  1 
ATOM   3997  N NE  . ARG C 1 59  ? -31.309 -6.168  109.602 1.00 92.00  ? 59  ARG C NE  1 
ATOM   3998  C CZ  . ARG C 1 59  ? -31.109 -5.732  110.848 1.00 85.41  ? 59  ARG C CZ  1 
ATOM   3999  N NH1 . ARG C 1 59  ? -32.125 -5.633  111.706 1.00 55.65  ? 59  ARG C NH1 1 
ATOM   4000  N NH2 . ARG C 1 59  ? -29.882 -5.407  111.240 1.00 61.94  ? 59  ARG C NH2 1 
ATOM   4001  N N   . LYS C 1 60  ? -33.594 -9.002  104.099 1.00 69.40  ? 60  LYS C N   1 
ATOM   4002  C CA  . LYS C 1 60  ? -32.777 -9.894  103.271 1.00 58.51  ? 60  LYS C CA  1 
ATOM   4003  C C   . LYS C 1 60  ? -32.874 -9.462  101.814 1.00 61.74  ? 60  LYS C C   1 
ATOM   4004  O O   . LYS C 1 60  ? -31.864 -9.382  101.111 1.00 61.83  ? 60  LYS C O   1 
ATOM   4005  C CB  . LYS C 1 60  ? -33.254 -11.349 103.422 1.00 71.21  ? 60  LYS C CB  1 
ATOM   4006  C CG  . LYS C 1 60  ? -32.349 -12.410 102.780 1.00 78.10  ? 60  LYS C CG  1 
ATOM   4007  C CD  . LYS C 1 60  ? -32.550 -12.552 101.265 1.00 95.22  ? 60  LYS C CD  1 
ATOM   4008  C CE  . LYS C 1 60  ? -31.692 -13.690 100.685 1.00 96.02  ? 60  LYS C CE  1 
ATOM   4009  N NZ  . LYS C 1 60  ? -30.215 -13.385 100.561 1.00 73.05  ? 60  LYS C NZ  1 
ATOM   4010  N N   . THR C 1 61  ? -34.093 -9.189  101.364 1.00 53.89  ? 61  THR C N   1 
ATOM   4011  C CA  . THR C 1 61  ? -34.316 -8.749  99.998  1.00 58.41  ? 61  THR C CA  1 
ATOM   4012  C C   . THR C 1 61  ? -33.549 -7.458  99.695  1.00 55.19  ? 61  THR C C   1 
ATOM   4013  O O   . THR C 1 61  ? -33.132 -7.240  98.552  1.00 61.79  ? 61  THR C O   1 
ATOM   4014  C CB  . THR C 1 61  ? -35.814 -8.515  99.736  1.00 70.76  ? 61  THR C CB  1 
ATOM   4015  O OG1 . THR C 1 61  ? -36.526 -9.743  99.933  1.00 67.32  ? 61  THR C OG1 1 
ATOM   4016  C CG2 . THR C 1 61  ? -36.042 -8.021  98.308  1.00 59.19  ? 61  THR C CG2 1 
ATOM   4017  N N   . MET C 1 62  ? -33.356 -6.608  100.704 1.00 43.30  ? 62  MET C N   1 
ATOM   4018  C CA  . MET C 1 62  ? -32.630 -5.354  100.495 1.00 54.87  ? 62  MET C CA  1 
ATOM   4019  C C   . MET C 1 62  ? -31.137 -5.605  100.406 1.00 51.61  ? 62  MET C C   1 
ATOM   4020  O O   . MET C 1 62  ? -30.421 -4.896  99.693  1.00 62.14  ? 62  MET C O   1 
ATOM   4021  C CB  . MET C 1 62  ? -32.946 -4.330  101.597 1.00 59.61  ? 62  MET C CB  1 
ATOM   4022  C CG  . MET C 1 62  ? -34.329 -3.653  101.415 1.00 65.32  ? 62  MET C CG  1 
ATOM   4023  S SD  . MET C 1 62  ? -34.769 -2.338  102.616 1.00 62.76  ? 62  MET C SD  1 
ATOM   4024  C CE  . MET C 1 62  ? -33.548 -1.099  102.218 1.00 47.94  ? 62  MET C CE  1 
ATOM   4025  N N   . LEU C 1 63  ? -30.661 -6.625  101.110 1.00 49.79  ? 63  LEU C N   1 
ATOM   4026  C CA  . LEU C 1 63  ? -29.245 -6.958  101.045 1.00 48.71  ? 63  LEU C CA  1 
ATOM   4027  C C   . LEU C 1 63  ? -29.011 -7.716  99.737  1.00 36.80  ? 63  LEU C C   1 
ATOM   4028  O O   . LEU C 1 63  ? -27.948 -7.616  99.127  1.00 52.33  ? 63  LEU C O   1 
ATOM   4029  C CB  . LEU C 1 63  ? -28.838 -7.816  102.243 1.00 39.32  ? 63  LEU C CB  1 
ATOM   4030  C CG  . LEU C 1 63  ? -28.915 -7.154  103.625 1.00 68.98  ? 63  LEU C CG  1 
ATOM   4031  C CD1 . LEU C 1 63  ? -29.004 -8.244  104.690 1.00 43.78  ? 63  LEU C CD1 1 
ATOM   4032  C CD2 . LEU C 1 63  ? -27.694 -6.232  103.859 1.00 41.46  ? 63  LEU C CD2 1 
ATOM   4033  N N   . GLU C 1 64  ? -30.019 -8.469  99.309  1.00 52.63  ? 64  GLU C N   1 
ATOM   4034  C CA  . GLU C 1 64  ? -29.935 -9.226  98.061  1.00 51.39  ? 64  GLU C CA  1 
ATOM   4035  C C   . GLU C 1 64  ? -29.792 -8.209  96.926  1.00 50.62  ? 64  GLU C C   1 
ATOM   4036  O O   . GLU C 1 64  ? -28.882 -8.295  96.100  1.00 46.10  ? 64  GLU C O   1 
ATOM   4037  C CB  . GLU C 1 64  ? -31.215 -10.052 97.841  1.00 50.63  ? 64  GLU C CB  1 
ATOM   4038  C CG  . GLU C 1 64  ? -31.099 -11.108 96.724  1.00 95.76  ? 64  GLU C CG  1 
ATOM   4039  C CD  . GLU C 1 64  ? -32.459 -11.647 96.232  1.00 103.15 ? 64  GLU C CD  1 
ATOM   4040  O OE1 . GLU C 1 64  ? -33.366 -11.890 97.078  1.00 88.27  ? 64  GLU C OE1 1 
ATOM   4041  O OE2 . GLU C 1 64  ? -32.614 -11.837 94.997  1.00 86.20  ? 64  GLU C OE2 1 
ATOM   4042  N N   . LEU C 1 65  ? -30.708 -7.239  96.925  1.00 54.77  ? 65  LEU C N   1 
ATOM   4043  C CA  . LEU C 1 65  ? -30.772 -6.161  95.931  1.00 55.23  ? 65  LEU C CA  1 
ATOM   4044  C C   . LEU C 1 65  ? -29.505 -5.311  95.863  1.00 47.73  ? 65  LEU C C   1 
ATOM   4045  O O   . LEU C 1 65  ? -28.997 -5.025  94.781  1.00 50.04  ? 65  LEU C O   1 
ATOM   4046  C CB  . LEU C 1 65  ? -31.956 -5.239  96.233  1.00 48.63  ? 65  LEU C CB  1 
ATOM   4047  C CG  . LEU C 1 65  ? -32.239 -4.181  95.159  1.00 72.10  ? 65  LEU C CG  1 
ATOM   4048  C CD1 . LEU C 1 65  ? -32.852 -4.872  93.951  1.00 77.86  ? 65  LEU C CD1 1 
ATOM   4049  C CD2 . LEU C 1 65  ? -33.184 -3.095  95.681  1.00 52.14  ? 65  LEU C CD2 1 
ATOM   4050  N N   . VAL C 1 66  ? -29.001 -4.898  97.019  1.00 49.80  ? 66  VAL C N   1 
ATOM   4051  C CA  . VAL C 1 66  ? -27.802 -4.083  97.040  1.00 41.78  ? 66  VAL C CA  1 
ATOM   4052  C C   . VAL C 1 66  ? -26.691 -4.809  96.310  1.00 55.88  ? 66  VAL C C   1 
ATOM   4053  O O   . VAL C 1 66  ? -26.110 -4.279  95.358  1.00 49.15  ? 66  VAL C O   1 
ATOM   4054  C CB  . VAL C 1 66  ? -27.369 -3.776  98.485  1.00 45.62  ? 66  VAL C CB  1 
ATOM   4055  C CG1 . VAL C 1 66  ? -26.003 -3.087  98.501  1.00 52.84  ? 66  VAL C CG1 1 
ATOM   4056  C CG2 . VAL C 1 66  ? -28.417 -2.881  99.149  1.00 48.99  ? 66  VAL C CG2 1 
ATOM   4057  N N   . GLU C 1 67  ? -26.427 -6.038  96.745  1.00 49.25  ? 67  GLU C N   1 
ATOM   4058  C CA  . GLU C 1 67  ? -25.377 -6.863  96.167  1.00 48.48  ? 67  GLU C CA  1 
ATOM   4059  C C   . GLU C 1 67  ? -25.486 -6.995  94.646  1.00 41.65  ? 67  GLU C C   1 
ATOM   4060  O O   . GLU C 1 67  ? -24.491 -6.866  93.942  1.00 34.17  ? 67  GLU C O   1 
ATOM   4061  C CB  . GLU C 1 67  ? -25.386 -8.251  96.834  1.00 60.98  ? 67  GLU C CB  1 
ATOM   4062  C CG  . GLU C 1 67  ? -24.210 -9.136  96.437  1.00 55.00  ? 67  GLU C CG  1 
ATOM   4063  C CD  . GLU C 1 67  ? -24.076 -10.390 97.292  1.00 71.29  ? 67  GLU C CD  1 
ATOM   4064  O OE1 . GLU C 1 67  ? -23.231 -11.251 96.949  1.00 67.04  ? 67  GLU C OE1 1 
ATOM   4065  O OE2 . GLU C 1 67  ? -24.801 -10.514 98.308  1.00 69.98  ? 67  GLU C OE2 1 
ATOM   4066  N N   . LYS C 1 68  ? -26.699 -7.248  94.155  1.00 43.40  ? 68  LYS C N   1 
ATOM   4067  C CA  . LYS C 1 68  ? -26.972 -7.398  92.718  1.00 52.95  ? 68  LYS C CA  1 
ATOM   4068  C C   . LYS C 1 68  ? -26.698 -6.123  91.912  1.00 46.34  ? 68  LYS C C   1 
ATOM   4069  O O   . LYS C 1 68  ? -26.211 -6.180  90.786  1.00 45.80  ? 68  LYS C O   1 
ATOM   4070  C CB  . LYS C 1 68  ? -28.435 -7.809  92.504  1.00 67.01  ? 68  LYS C CB  1 
ATOM   4071  C CG  . LYS C 1 68  ? -28.719 -9.309  92.425  1.00 69.29  ? 68  LYS C CG  1 
ATOM   4072  C CD  . LYS C 1 68  ? -28.020 -10.124 93.508  1.00 79.26  ? 68  LYS C CD  1 
ATOM   4073  C CE  . LYS C 1 68  ? -26.697 -10.708 93.023  1.00 63.77  ? 68  LYS C CE  1 
ATOM   4074  N NZ  . LYS C 1 68  ? -26.153 -11.746 93.970  1.00 79.54  ? 68  LYS C NZ  1 
ATOM   4075  N N   . VAL C 1 69  ? -27.033 -4.978  92.498  1.00 56.74  ? 69  VAL C N   1 
ATOM   4076  C CA  . VAL C 1 69  ? -26.835 -3.683  91.856  1.00 42.77  ? 69  VAL C CA  1 
ATOM   4077  C C   . VAL C 1 69  ? -25.371 -3.298  91.948  1.00 38.56  ? 69  VAL C C   1 
ATOM   4078  O O   . VAL C 1 69  ? -24.765 -2.910  90.957  1.00 46.75  ? 69  VAL C O   1 
ATOM   4079  C CB  . VAL C 1 69  ? -27.693 -2.574  92.544  1.00 55.43  ? 69  VAL C CB  1 
ATOM   4080  C CG1 . VAL C 1 69  ? -27.260 -1.185  92.064  1.00 43.62  ? 69  VAL C CG1 1 
ATOM   4081  C CG2 . VAL C 1 69  ? -29.165 -2.798  92.257  1.00 37.68  ? 69  VAL C CG2 1 
ATOM   4082  N N   . ALA C 1 70  ? -24.809 -3.425  93.145  1.00 37.90  ? 70  ALA C N   1 
ATOM   4083  C CA  . ALA C 1 70  ? -23.413 -3.072  93.402  1.00 45.90  ? 70  ALA C CA  1 
ATOM   4084  C C   . ALA C 1 70  ? -22.405 -3.802  92.519  1.00 51.91  ? 70  ALA C C   1 
ATOM   4085  O O   . ALA C 1 70  ? -21.315 -3.286  92.262  1.00 48.63  ? 70  ALA C O   1 
ATOM   4086  C CB  . ALA C 1 70  ? -23.082 -3.310  94.867  1.00 54.42  ? 70  ALA C CB  1 
ATOM   4087  N N   . GLU C 1 71  ? -22.754 -4.994  92.047  1.00 49.64  ? 71  GLU C N   1 
ATOM   4088  C CA  . GLU C 1 71  ? -21.824 -5.716  91.194  1.00 62.10  ? 71  GLU C CA  1 
ATOM   4089  C C   . GLU C 1 71  ? -21.919 -5.331  89.725  1.00 52.40  ? 71  GLU C C   1 
ATOM   4090  O O   . GLU C 1 71  ? -21.106 -5.771  88.922  1.00 55.44  ? 71  GLU C O   1 
ATOM   4091  C CB  . GLU C 1 71  ? -21.986 -7.238  91.348  1.00 66.30  ? 71  GLU C CB  1 
ATOM   4092  C CG  . GLU C 1 71  ? -23.405 -7.756  91.256  1.00 83.22  ? 71  GLU C CG  1 
ATOM   4093  C CD  . GLU C 1 71  ? -23.448 -9.276  91.219  1.00 100.98 ? 71  GLU C CD  1 
ATOM   4094  O OE1 . GLU C 1 71  ? -22.749 -9.918  92.040  1.00 62.51  ? 71  GLU C OE1 1 
ATOM   4095  O OE2 . GLU C 1 71  ? -24.187 -9.834  90.372  1.00 86.66  ? 71  GLU C OE2 1 
ATOM   4096  N N   . GLN C 1 72  ? -22.892 -4.499  89.364  1.00 53.97  ? 72  GLN C N   1 
ATOM   4097  C CA  . GLN C 1 72  ? -22.995 -4.106  87.970  1.00 53.46  ? 72  GLN C CA  1 
ATOM   4098  C C   . GLN C 1 72  ? -23.133 -2.635  87.591  1.00 51.61  ? 72  GLN C C   1 
ATOM   4099  O O   . GLN C 1 72  ? -22.811 -2.289  86.461  1.00 56.37  ? 72  GLN C O   1 
ATOM   4100  C CB  . GLN C 1 72  ? -24.081 -4.928  87.268  1.00 52.45  ? 72  GLN C CB  1 
ATOM   4101  C CG  . GLN C 1 72  ? -23.545 -6.277  86.815  1.00 51.78  ? 72  GLN C CG  1 
ATOM   4102  C CD  . GLN C 1 72  ? -24.439 -6.978  85.826  1.00 61.65  ? 72  GLN C CD  1 
ATOM   4103  O OE1 . GLN C 1 72  ? -25.527 -7.449  86.171  1.00 56.01  ? 72  GLN C OE1 1 
ATOM   4104  N NE2 . GLN C 1 72  ? -23.987 -7.051  84.578  1.00 53.85  ? 72  GLN C NE2 1 
ATOM   4105  N N   . ILE C 1 73  ? -23.592 -1.772  88.500  1.00 61.66  ? 73  ILE C N   1 
ATOM   4106  C CA  . ILE C 1 73  ? -23.721 -0.339  88.183  1.00 46.71  ? 73  ILE C CA  1 
ATOM   4107  C C   . ILE C 1 73  ? -22.407 0.408   88.385  1.00 51.12  ? 73  ILE C C   1 
ATOM   4108  O O   . ILE C 1 73  ? -21.588 0.046   89.226  1.00 39.81  ? 73  ILE C O   1 
ATOM   4109  C CB  . ILE C 1 73  ? -24.810 0.375   89.035  1.00 48.93  ? 73  ILE C CB  1 
ATOM   4110  C CG1 . ILE C 1 73  ? -24.542 0.170   90.527  1.00 65.53  ? 73  ILE C CG1 1 
ATOM   4111  C CG2 . ILE C 1 73  ? -26.179 -0.136  88.648  1.00 50.35  ? 73  ILE C CG2 1 
ATOM   4112  C CD1 . ILE C 1 73  ? -23.287 0.872   91.076  1.00 67.07  ? 73  ILE C CD1 1 
ATOM   4113  N N   . ASP C 1 74  ? -22.222 1.470   87.624  1.00 27.48  ? 74  ASP C N   1 
ATOM   4114  C CA  . ASP C 1 74  ? -21.000 2.230   87.717  1.00 33.61  ? 74  ASP C CA  1 
ATOM   4115  C C   . ASP C 1 74  ? -21.237 3.661   88.119  1.00 28.03  ? 74  ASP C C   1 
ATOM   4116  O O   . ASP C 1 74  ? -20.462 4.529   87.754  1.00 39.23  ? 74  ASP C O   1 
ATOM   4117  C CB  . ASP C 1 74  ? -20.263 2.185   86.384  1.00 26.44  ? 74  ASP C CB  1 
ATOM   4118  C CG  . ASP C 1 74  ? -21.116 2.683   85.238  1.00 45.36  ? 74  ASP C CG  1 
ATOM   4119  O OD1 . ASP C 1 74  ? -22.356 2.747   85.388  1.00 34.21  ? 74  ASP C OD1 1 
ATOM   4120  O OD2 . ASP C 1 74  ? -20.548 3.003   84.179  1.00 59.58  ? 74  ASP C OD2 1 
ATOM   4121  N N   . ILE C 1 75  ? -22.321 3.896   88.849  1.00 34.08  ? 75  ILE C N   1 
ATOM   4122  C CA  . ILE C 1 75  ? -22.656 5.224   89.343  1.00 33.54  ? 75  ILE C CA  1 
ATOM   4123  C C   . ILE C 1 75  ? -23.233 5.106   90.749  1.00 38.67  ? 75  ILE C C   1 
ATOM   4124  O O   . ILE C 1 75  ? -23.679 4.032   91.149  1.00 43.09  ? 75  ILE C O   1 
ATOM   4125  C CB  . ILE C 1 75  ? -23.673 5.965   88.442  1.00 28.43  ? 75  ILE C CB  1 
ATOM   4126  C CG1 . ILE C 1 75  ? -25.013 5.228   88.409  1.00 46.70  ? 75  ILE C CG1 1 
ATOM   4127  C CG2 . ILE C 1 75  ? -23.106 6.117   87.060  1.00 30.51  ? 75  ILE C CG2 1 
ATOM   4128  C CD1 . ILE C 1 75  ? -26.146 6.057   87.799  1.00 44.25  ? 75  ILE C CD1 1 
ATOM   4129  N N   . PRO C 1 76  ? -23.217 6.211   91.521  1.00 47.62  ? 76  PRO C N   1 
ATOM   4130  C CA  . PRO C 1 76  ? -23.728 6.261   92.896  1.00 44.34  ? 76  PRO C CA  1 
ATOM   4131  C C   . PRO C 1 76  ? -25.185 5.847   93.009  1.00 41.77  ? 76  PRO C C   1 
ATOM   4132  O O   . PRO C 1 76  ? -25.995 6.201   92.158  1.00 45.09  ? 76  PRO C O   1 
ATOM   4133  C CB  . PRO C 1 76  ? -23.529 7.727   93.286  1.00 48.48  ? 76  PRO C CB  1 
ATOM   4134  C CG  . PRO C 1 76  ? -22.361 8.155   92.451  1.00 43.06  ? 76  PRO C CG  1 
ATOM   4135  C CD  . PRO C 1 76  ? -22.655 7.518   91.128  1.00 38.99  ? 76  PRO C CD  1 
ATOM   4136  N N   . PHE C 1 77  ? -25.522 5.088   94.049  1.00 43.05  ? 77  PHE C N   1 
ATOM   4137  C CA  . PHE C 1 77  ? -26.911 4.690   94.241  1.00 46.16  ? 77  PHE C CA  1 
ATOM   4138  C C   . PHE C 1 77  ? -27.289 4.698   95.704  1.00 36.89  ? 77  PHE C C   1 
ATOM   4139  O O   . PHE C 1 77  ? -26.440 4.588   96.578  1.00 45.22  ? 77  PHE C O   1 
ATOM   4140  C CB  . PHE C 1 77  ? -27.225 3.319   93.596  1.00 46.94  ? 77  PHE C CB  1 
ATOM   4141  C CG  . PHE C 1 77  ? -26.598 2.126   94.284  1.00 37.18  ? 77  PHE C CG  1 
ATOM   4142  C CD1 . PHE C 1 77  ? -25.304 1.731   93.986  1.00 38.45  ? 77  PHE C CD1 1 
ATOM   4143  C CD2 . PHE C 1 77  ? -27.341 1.348   95.167  1.00 38.21  ? 77  PHE C CD2 1 
ATOM   4144  C CE1 . PHE C 1 77  ? -24.759 0.570   94.552  1.00 38.97  ? 77  PHE C CE1 1 
ATOM   4145  C CE2 . PHE C 1 77  ? -26.801 0.186   95.736  1.00 41.21  ? 77  PHE C CE2 1 
ATOM   4146  C CZ  . PHE C 1 77  ? -25.508 -0.201  95.423  1.00 30.00  ? 77  PHE C CZ  1 
ATOM   4147  N N   . THR C 1 78  ? -28.577 4.849   95.967  1.00 49.85  ? 78  THR C N   1 
ATOM   4148  C CA  . THR C 1 78  ? -29.066 4.892   97.331  1.00 26.07  ? 78  THR C CA  1 
ATOM   4149  C C   . THR C 1 78  ? -30.166 3.866   97.551  1.00 43.45  ? 78  THR C C   1 
ATOM   4150  O O   . THR C 1 78  ? -30.889 3.503   96.619  1.00 47.39  ? 78  THR C O   1 
ATOM   4151  C CB  . THR C 1 78  ? -29.623 6.288   97.663  1.00 45.54  ? 78  THR C CB  1 
ATOM   4152  O OG1 . THR C 1 78  ? -28.584 7.262   97.524  1.00 45.07  ? 78  THR C OG1 1 
ATOM   4153  C CG2 . THR C 1 78  ? -30.165 6.329   99.089  1.00 50.74  ? 78  THR C CG2 1 
ATOM   4154  N N   . VAL C 1 79  ? -30.267 3.381   98.784  1.00 37.42  ? 79  VAL C N   1 
ATOM   4155  C CA  . VAL C 1 79  ? -31.301 2.432   99.152  1.00 39.58  ? 79  VAL C CA  1 
ATOM   4156  C C   . VAL C 1 79  ? -31.935 2.889   100.448 1.00 31.59  ? 79  VAL C C   1 
ATOM   4157  O O   . VAL C 1 79  ? -31.244 3.303   101.376 1.00 33.28  ? 79  VAL C O   1 
ATOM   4158  C CB  . VAL C 1 79  ? -30.756 0.994   99.315  1.00 44.58  ? 79  VAL C CB  1 
ATOM   4159  C CG1 . VAL C 1 79  ? -30.290 0.492   97.964  1.00 46.57  ? 79  VAL C CG1 1 
ATOM   4160  C CG2 . VAL C 1 79  ? -29.619 0.949   100.354 1.00 34.76  ? 79  VAL C CG2 1 
ATOM   4161  N N   . GLY C 1 80  ? -33.262 2.825   100.483 1.00 46.30  ? 80  GLY C N   1 
ATOM   4162  C CA  . GLY C 1 80  ? -34.010 3.240   101.651 1.00 45.55  ? 80  GLY C CA  1 
ATOM   4163  C C   . GLY C 1 80  ? -35.350 2.540   101.742 1.00 36.45  ? 80  GLY C C   1 
ATOM   4164  O O   . GLY C 1 80  ? -35.717 1.758   100.869 1.00 47.47  ? 80  GLY C O   1 
ATOM   4165  N N   . GLY C 1 81  ? -36.086 2.844   102.802 1.00 51.09  ? 81  GLY C N   1 
ATOM   4166  C CA  . GLY C 1 81  ? -37.377 2.231   103.019 1.00 41.28  ? 81  GLY C CA  1 
ATOM   4167  C C   . GLY C 1 81  ? -37.220 1.176   104.089 1.00 49.11  ? 81  GLY C C   1 
ATOM   4168  O O   . GLY C 1 81  ? -36.491 0.217   103.905 1.00 62.05  ? 81  GLY C O   1 
ATOM   4169  N N   . GLY C 1 82  ? -37.864 1.362   105.228 1.00 38.84  ? 82  GLY C N   1 
ATOM   4170  C CA  . GLY C 1 82  ? -37.758 0.362   106.268 1.00 63.16  ? 82  GLY C CA  1 
ATOM   4171  C C   . GLY C 1 82  ? -36.442 0.255   107.014 1.00 62.65  ? 82  GLY C C   1 
ATOM   4172  O O   . GLY C 1 82  ? -36.252 -0.674  107.800 1.00 67.41  ? 82  GLY C O   1 
ATOM   4173  N N   . ILE C 1 83  ? -35.512 1.172   106.774 1.00 69.62  ? 83  ILE C N   1 
ATOM   4174  C CA  . ILE C 1 83  ? -34.251 1.135   107.508 1.00 46.86  ? 83  ILE C CA  1 
ATOM   4175  C C   . ILE C 1 83  ? -34.598 1.759   108.856 1.00 61.37  ? 83  ILE C C   1 
ATOM   4176  O O   . ILE C 1 83  ? -34.775 2.975   108.967 1.00 61.51  ? 83  ILE C O   1 
ATOM   4177  C CB  . ILE C 1 83  ? -33.175 1.958   106.813 1.00 33.36  ? 83  ILE C CB  1 
ATOM   4178  C CG1 . ILE C 1 83  ? -32.858 1.340   105.457 1.00 33.15  ? 83  ILE C CG1 1 
ATOM   4179  C CG2 . ILE C 1 83  ? -31.937 2.001   107.663 1.00 56.11  ? 83  ILE C CG2 1 
ATOM   4180  C CD1 . ILE C 1 83  ? -31.805 2.089   104.676 1.00 42.42  ? 83  ILE C CD1 1 
ATOM   4181  N N   . HIS C 1 84  ? -34.723 0.922   109.880 1.00 60.66  ? 84  HIS C N   1 
ATOM   4182  C CA  . HIS C 1 84  ? -35.110 1.411   111.197 1.00 62.05  ? 84  HIS C CA  1 
ATOM   4183  C C   . HIS C 1 84  ? -33.989 1.600   112.210 1.00 51.35  ? 84  HIS C C   1 
ATOM   4184  O O   . HIS C 1 84  ? -34.158 2.327   113.196 1.00 59.14  ? 84  HIS C O   1 
ATOM   4185  C CB  . HIS C 1 84  ? -36.189 0.495   111.774 1.00 44.29  ? 84  HIS C CB  1 
ATOM   4186  C CG  . HIS C 1 84  ? -37.432 0.435   110.939 1.00 80.48  ? 84  HIS C CG  1 
ATOM   4187  N ND1 . HIS C 1 84  ? -38.311 1.495   110.833 1.00 80.73  ? 84  HIS C ND1 1 
ATOM   4188  C CD2 . HIS C 1 84  ? -37.925 -0.544  110.142 1.00 67.79  ? 84  HIS C CD2 1 
ATOM   4189  C CE1 . HIS C 1 84  ? -39.292 1.172   110.006 1.00 83.47  ? 84  HIS C CE1 1 
ATOM   4190  N NE2 . HIS C 1 84  ? -39.082 -0.060  109.571 1.00 86.07  ? 84  HIS C NE2 1 
ATOM   4191  N N   . ASP C 1 85  ? -32.842 0.969   111.975 1.00 55.34  ? 85  ASP C N   1 
ATOM   4192  C CA  . ASP C 1 85  ? -31.730 1.098   112.918 1.00 65.65  ? 85  ASP C CA  1 
ATOM   4193  C C   . ASP C 1 85  ? -30.348 1.143   112.277 1.00 49.56  ? 85  ASP C C   1 
ATOM   4194  O O   . ASP C 1 85  ? -30.200 0.928   111.072 1.00 61.72  ? 85  ASP C O   1 
ATOM   4195  C CB  . ASP C 1 85  ? -31.788 -0.040  113.959 1.00 55.03  ? 85  ASP C CB  1 
ATOM   4196  C CG  . ASP C 1 85  ? -31.994 -1.414  113.325 1.00 73.83  ? 85  ASP C CG  1 
ATOM   4197  O OD1 . ASP C 1 85  ? -31.310 -1.708  112.313 1.00 70.09  ? 85  ASP C OD1 1 
ATOM   4198  O OD2 . ASP C 1 85  ? -32.827 -2.203  113.847 1.00 69.13  ? 85  ASP C OD2 1 
ATOM   4199  N N   . PHE C 1 86  ? -29.344 1.438   113.100 1.00 47.76  ? 86  PHE C N   1 
ATOM   4200  C CA  . PHE C 1 86  ? -27.950 1.511   112.662 1.00 50.10  ? 86  PHE C CA  1 
ATOM   4201  C C   . PHE C 1 86  ? -27.466 0.165   112.121 1.00 61.17  ? 86  PHE C C   1 
ATOM   4202  O O   . PHE C 1 86  ? -26.657 0.108   111.192 1.00 65.80  ? 86  PHE C O   1 
ATOM   4203  C CB  . PHE C 1 86  ? -27.063 1.955   113.839 1.00 46.17  ? 86  PHE C CB  1 
ATOM   4204  C CG  . PHE C 1 86  ? -25.576 1.827   113.582 1.00 63.52  ? 86  PHE C CG  1 
ATOM   4205  C CD1 . PHE C 1 86  ? -24.954 2.561   112.578 1.00 61.56  ? 86  PHE C CD1 1 
ATOM   4206  C CD2 . PHE C 1 86  ? -24.792 0.975   114.362 1.00 75.78  ? 86  PHE C CD2 1 
ATOM   4207  C CE1 . PHE C 1 86  ? -23.572 2.453   112.351 1.00 53.28  ? 86  PHE C CE1 1 
ATOM   4208  C CE2 . PHE C 1 86  ? -23.410 0.861   114.140 1.00 67.30  ? 86  PHE C CE2 1 
ATOM   4209  C CZ  . PHE C 1 86  ? -22.804 1.602   113.131 1.00 51.59  ? 86  PHE C CZ  1 
ATOM   4210  N N   . GLU C 1 87  ? -27.969 -0.918  112.701 1.00 58.55  ? 87  GLU C N   1 
ATOM   4211  C CA  . GLU C 1 87  ? -27.561 -2.251  112.281 1.00 65.95  ? 87  GLU C CA  1 
ATOM   4212  C C   . GLU C 1 87  ? -27.972 -2.526  110.839 1.00 64.92  ? 87  GLU C C   1 
ATOM   4213  O O   . GLU C 1 87  ? -27.198 -3.102  110.075 1.00 68.08  ? 87  GLU C O   1 
ATOM   4214  C CB  . GLU C 1 87  ? -28.155 -3.321  113.206 1.00 61.35  ? 87  GLU C CB  1 
ATOM   4215  C CG  . GLU C 1 87  ? -27.704 -3.249  114.673 1.00 81.67  ? 87  GLU C CG  1 
ATOM   4216  C CD  . GLU C 1 87  ? -28.130 -1.956  115.378 1.00 91.11  ? 87  GLU C CD  1 
ATOM   4217  O OE1 . GLU C 1 87  ? -29.263 -1.464  115.125 1.00 80.34  ? 87  GLU C OE1 1 
ATOM   4218  O OE2 . GLU C 1 87  ? -27.333 -1.438  116.199 1.00 94.86  ? 87  GLU C OE2 1 
ATOM   4219  N N   . THR C 1 88  ? -29.183 -2.131  110.459 1.00 53.13  ? 88  THR C N   1 
ATOM   4220  C CA  . THR C 1 88  ? -29.612 -2.360  109.087 1.00 47.69  ? 88  THR C CA  1 
ATOM   4221  C C   . THR C 1 88  ? -28.844 -1.420  108.149 1.00 50.71  ? 88  THR C C   1 
ATOM   4222  O O   . THR C 1 88  ? -28.367 -1.841  107.096 1.00 49.72  ? 88  THR C O   1 
ATOM   4223  C CB  . THR C 1 88  ? -31.133 -2.132  108.915 1.00 64.06  ? 88  THR C CB  1 
ATOM   4224  O OG1 . THR C 1 88  ? -31.850 -2.968  109.837 1.00 66.46  ? 88  THR C OG1 1 
ATOM   4225  C CG2 . THR C 1 88  ? -31.570 -2.481  107.485 1.00 55.69  ? 88  THR C CG2 1 
ATOM   4226  N N   . ALA C 1 89  ? -28.708 -0.155  108.539 1.00 42.55  ? 89  ALA C N   1 
ATOM   4227  C CA  . ALA C 1 89  ? -27.993 0.815   107.707 1.00 54.86  ? 89  ALA C CA  1 
ATOM   4228  C C   . ALA C 1 89  ? -26.621 0.272   107.367 1.00 51.32  ? 89  ALA C C   1 
ATOM   4229  O O   . ALA C 1 89  ? -26.244 0.171   106.192 1.00 47.08  ? 89  ALA C O   1 
ATOM   4230  C CB  . ALA C 1 89  ? -27.852 2.148   108.440 1.00 46.08  ? 89  ALA C CB  1 
ATOM   4231  N N   . SER C 1 90  ? -25.891 -0.078  108.423 1.00 56.26  ? 90  SER C N   1 
ATOM   4232  C CA  . SER C 1 90  ? -24.544 -0.623  108.319 1.00 47.78  ? 90  SER C CA  1 
ATOM   4233  C C   . SER C 1 90  ? -24.436 -1.857  107.402 1.00 44.50  ? 90  SER C C   1 
ATOM   4234  O O   . SER C 1 90  ? -23.545 -1.916  106.556 1.00 45.01  ? 90  SER C O   1 
ATOM   4235  C CB  . SER C 1 90  ? -24.023 -0.957  109.722 1.00 48.30  ? 90  SER C CB  1 
ATOM   4236  O OG  . SER C 1 90  ? -22.629 -1.198  109.695 1.00 65.05  ? 90  SER C OG  1 
ATOM   4237  N N   . GLU C 1 91  ? -25.324 -2.840  107.554 1.00 36.53  ? 91  GLU C N   1 
ATOM   4238  C CA  . GLU C 1 91  ? -25.241 -4.019  106.688 1.00 48.62  ? 91  GLU C CA  1 
ATOM   4239  C C   . GLU C 1 91  ? -25.264 -3.530  105.254 1.00 46.26  ? 91  GLU C C   1 
ATOM   4240  O O   . GLU C 1 91  ? -24.360 -3.810  104.472 1.00 65.64  ? 91  GLU C O   1 
ATOM   4241  C CB  . GLU C 1 91  ? -26.440 -4.965  106.859 1.00 50.41  ? 91  GLU C CB  1 
ATOM   4242  C CG  . GLU C 1 91  ? -26.906 -5.217  108.275 1.00 54.42  ? 91  GLU C CG  1 
ATOM   4243  C CD  . GLU C 1 91  ? -28.287 -5.877  108.319 1.00 88.96  ? 91  GLU C CD  1 
ATOM   4244  O OE1 . GLU C 1 91  ? -29.154 -5.525  107.471 1.00 72.71  ? 91  GLU C OE1 1 
ATOM   4245  O OE2 . GLU C 1 91  ? -28.513 -6.732  109.210 1.00 75.78  ? 91  GLU C OE2 1 
ATOM   4246  N N   . LEU C 1 92  ? -26.319 -2.791  104.925 1.00 51.98  ? 92  LEU C N   1 
ATOM   4247  C CA  . LEU C 1 92  ? -26.533 -2.263  103.586 1.00 52.76  ? 92  LEU C CA  1 
ATOM   4248  C C   . LEU C 1 92  ? -25.377 -1.499  102.972 1.00 31.33  ? 92  LEU C C   1 
ATOM   4249  O O   . LEU C 1 92  ? -25.085 -1.666  101.802 1.00 49.42  ? 92  LEU C O   1 
ATOM   4250  C CB  . LEU C 1 92  ? -27.804 -1.415  103.573 1.00 42.65  ? 92  LEU C CB  1 
ATOM   4251  C CG  . LEU C 1 92  ? -29.038 -2.281  103.859 1.00 53.01  ? 92  LEU C CG  1 
ATOM   4252  C CD1 . LEU C 1 92  ? -30.247 -1.405  104.165 1.00 38.84  ? 92  LEU C CD1 1 
ATOM   4253  C CD2 . LEU C 1 92  ? -29.298 -3.203  102.672 1.00 35.99  ? 92  LEU C CD2 1 
ATOM   4254  N N   . ILE C 1 93  ? -24.706 -0.673  103.752 1.00 39.49  ? 93  ILE C N   1 
ATOM   4255  C CA  . ILE C 1 93  ? -23.583 0.082   103.220 1.00 38.45  ? 93  ILE C CA  1 
ATOM   4256  C C   . ILE C 1 93  ? -22.406 -0.855  102.944 1.00 52.60  ? 93  ILE C C   1 
ATOM   4257  O O   . ILE C 1 93  ? -21.767 -0.787  101.889 1.00 52.79  ? 93  ILE C O   1 
ATOM   4258  C CB  . ILE C 1 93  ? -23.152 1.181   104.207 1.00 41.33  ? 93  ILE C CB  1 
ATOM   4259  C CG1 . ILE C 1 93  ? -24.328 2.114   104.487 1.00 46.45  ? 93  ILE C CG1 1 
ATOM   4260  C CG2 . ILE C 1 93  ? -21.999 1.963   103.638 1.00 59.49  ? 93  ILE C CG2 1 
ATOM   4261  C CD1 . ILE C 1 93  ? -24.069 3.085   105.608 1.00 60.80  ? 93  ILE C CD1 1 
ATOM   4262  N N   . LEU C 1 94  ? -22.128 -1.741  103.897 1.00 56.34  ? 94  LEU C N   1 
ATOM   4263  C CA  . LEU C 1 94  ? -21.027 -2.688  103.752 1.00 59.31  ? 94  LEU C CA  1 
ATOM   4264  C C   . LEU C 1 94  ? -21.268 -3.591  102.570 1.00 44.11  ? 94  LEU C C   1 
ATOM   4265  O O   . LEU C 1 94  ? -20.332 -4.061  101.938 1.00 51.39  ? 94  LEU C O   1 
ATOM   4266  C CB  . LEU C 1 94  ? -20.890 -3.543  105.009 1.00 59.89  ? 94  LEU C CB  1 
ATOM   4267  C CG  . LEU C 1 94  ? -20.600 -2.769  106.293 1.00 66.29  ? 94  LEU C CG  1 
ATOM   4268  C CD1 . LEU C 1 94  ? -20.499 -3.733  107.455 1.00 72.70  ? 94  LEU C CD1 1 
ATOM   4269  C CD2 . LEU C 1 94  ? -19.321 -1.979  106.126 1.00 55.09  ? 94  LEU C CD2 1 
ATOM   4270  N N   . ARG C 1 95  ? -22.542 -3.818  102.273 1.00 59.05  ? 95  ARG C N   1 
ATOM   4271  C CA  . ARG C 1 95  ? -22.926 -4.686  101.173 1.00 52.98  ? 95  ARG C CA  1 
ATOM   4272  C C   . ARG C 1 95  ? -22.801 -4.012  99.798  1.00 60.83  ? 95  ARG C C   1 
ATOM   4273  O O   . ARG C 1 95  ? -23.032 -4.656  98.770  1.00 70.49  ? 95  ARG C O   1 
ATOM   4274  C CB  . ARG C 1 95  ? -24.356 -5.197  101.405 1.00 52.83  ? 95  ARG C CB  1 
ATOM   4275  C CG  . ARG C 1 95  ? -24.735 -6.416  100.582 1.00 60.25  ? 95  ARG C CG  1 
ATOM   4276  C CD  . ARG C 1 95  ? -23.712 -7.524  100.783 1.00 70.75  ? 95  ARG C CD  1 
ATOM   4277  N NE  . ARG C 1 95  ? -24.330 -8.784  101.184 1.00 90.18  ? 95  ARG C NE  1 
ATOM   4278  C CZ  . ARG C 1 95  ? -25.048 -8.952  102.292 1.00 94.88  ? 95  ARG C CZ  1 
ATOM   4279  N NH1 . ARG C 1 95  ? -25.243 -7.934  103.124 1.00 103.15 ? 95  ARG C NH1 1 
ATOM   4280  N NH2 . ARG C 1 95  ? -25.577 -10.142 102.567 1.00 90.91  ? 95  ARG C NH2 1 
ATOM   4281  N N   . GLY C 1 96  ? -22.442 -2.730  99.771  1.00 46.49  ? 96  GLY C N   1 
ATOM   4282  C CA  . GLY C 1 96  ? -22.280 -2.059  98.490  1.00 50.42  ? 96  GLY C CA  1 
ATOM   4283  C C   . GLY C 1 96  ? -22.997 -0.739  98.247  1.00 36.46  ? 96  GLY C C   1 
ATOM   4284  O O   . GLY C 1 96  ? -22.720 -0.067  97.258  1.00 36.71  ? 96  GLY C O   1 
ATOM   4285  N N   . ALA C 1 97  ? -23.908 -0.361  99.133  1.00 36.56  ? 97  ALA C N   1 
ATOM   4286  C CA  . ALA C 1 97  ? -24.639 0.883   98.963  1.00 43.60  ? 97  ALA C CA  1 
ATOM   4287  C C   . ALA C 1 97  ? -23.761 2.067   99.315  1.00 46.38  ? 97  ALA C C   1 
ATOM   4288  O O   . ALA C 1 97  ? -23.042 2.050   100.313 1.00 51.83  ? 97  ALA C O   1 
ATOM   4289  C CB  . ALA C 1 97  ? -25.893 0.887   99.823  1.00 34.60  ? 97  ALA C CB  1 
ATOM   4290  N N   . ASP C 1 98  ? -23.817 3.097   98.483  1.00 46.64  ? 98  ASP C N   1 
ATOM   4291  C CA  . ASP C 1 98  ? -23.024 4.285   98.716  1.00 56.49  ? 98  ASP C CA  1 
ATOM   4292  C C   . ASP C 1 98  ? -23.727 5.176   99.734  1.00 46.78  ? 98  ASP C C   1 
ATOM   4293  O O   . ASP C 1 98  ? -23.083 5.913   100.482 1.00 37.69  ? 98  ASP C O   1 
ATOM   4294  C CB  . ASP C 1 98  ? -22.813 5.013   97.392  1.00 47.50  ? 98  ASP C CB  1 
ATOM   4295  C CG  . ASP C 1 98  ? -22.238 4.097   96.318  1.00 71.55  ? 98  ASP C CG  1 
ATOM   4296  O OD1 . ASP C 1 98  ? -21.130 3.538   96.530  1.00 53.54  ? 98  ASP C OD1 1 
ATOM   4297  O OD2 . ASP C 1 98  ? -22.897 3.927   95.266  1.00 44.62  ? 98  ASP C OD2 1 
ATOM   4298  N N   . LYS C 1 99  ? -25.054 5.079   99.771  1.00 41.12  ? 99  LYS C N   1 
ATOM   4299  C CA  . LYS C 1 99  ? -25.857 5.876   100.693 1.00 32.98  ? 99  LYS C CA  1 
ATOM   4300  C C   . LYS C 1 99  ? -27.112 5.129   101.099 1.00 45.90  ? 99  LYS C C   1 
ATOM   4301  O O   . LYS C 1 99  ? -27.602 4.283   100.355 1.00 36.79  ? 99  LYS C O   1 
ATOM   4302  C CB  . LYS C 1 99  ? -26.273 7.206   100.045 1.00 42.47  ? 99  LYS C CB  1 
ATOM   4303  C CG  . LYS C 1 99  ? -25.122 8.045   99.479  1.00 46.84  ? 99  LYS C CG  1 
ATOM   4304  C CD  . LYS C 1 99  ? -25.589 9.429   99.060  1.00 57.71  ? 99  LYS C CD  1 
ATOM   4305  C CE  . LYS C 1 99  ? -26.419 9.409   97.775  1.00 66.44  ? 99  LYS C CE  1 
ATOM   4306  N NZ  . LYS C 1 99  ? -25.625 9.277   96.504  1.00 74.45  ? 99  LYS C NZ  1 
ATOM   4307  N N   . VAL C 1 100 ? -27.608 5.428   102.298 1.00 41.57  ? 100 VAL C N   1 
ATOM   4308  C CA  . VAL C 1 100 ? -28.855 4.846   102.796 1.00 51.00  ? 100 VAL C CA  1 
ATOM   4309  C C   . VAL C 1 100 ? -29.788 6.008   103.140 1.00 48.06  ? 100 VAL C C   1 
ATOM   4310  O O   . VAL C 1 100 ? -29.345 7.074   103.563 1.00 36.65  ? 100 VAL C O   1 
ATOM   4311  C CB  . VAL C 1 100 ? -28.657 3.950   104.062 1.00 51.02  ? 100 VAL C CB  1 
ATOM   4312  C CG1 . VAL C 1 100 ? -27.886 2.706   103.691 1.00 48.20  ? 100 VAL C CG1 1 
ATOM   4313  C CG2 . VAL C 1 100 ? -27.959 4.724   105.166 1.00 37.56  ? 100 VAL C CG2 1 
ATOM   4314  N N   . SER C 1 101 ? -31.082 5.797   102.957 1.00 50.03  ? 101 SER C N   1 
ATOM   4315  C CA  . SER C 1 101 ? -32.062 6.840   103.220 1.00 47.63  ? 101 SER C CA  1 
ATOM   4316  C C   . SER C 1 101 ? -33.027 6.459   104.332 1.00 41.94  ? 101 SER C C   1 
ATOM   4317  O O   . SER C 1 101 ? -33.718 5.446   104.242 1.00 46.83  ? 101 SER C O   1 
ATOM   4318  C CB  . SER C 1 101 ? -32.849 7.134   101.947 1.00 41.60  ? 101 SER C CB  1 
ATOM   4319  O OG  . SER C 1 101 ? -33.739 8.216   102.152 1.00 80.11  ? 101 SER C OG  1 
ATOM   4320  N N   . ILE C 1 102 ? -33.076 7.282   105.373 1.00 37.99  ? 102 ILE C N   1 
ATOM   4321  C CA  . ILE C 1 102 ? -33.955 7.035   106.506 1.00 37.81  ? 102 ILE C CA  1 
ATOM   4322  C C   . ILE C 1 102 ? -35.007 8.134   106.636 1.00 39.33  ? 102 ILE C C   1 
ATOM   4323  O O   . ILE C 1 102 ? -34.698 9.312   106.522 1.00 48.87  ? 102 ILE C O   1 
ATOM   4324  C CB  . ILE C 1 102 ? -33.137 6.941   107.807 1.00 40.82  ? 102 ILE C CB  1 
ATOM   4325  C CG1 . ILE C 1 102 ? -32.236 8.178   107.948 1.00 48.41  ? 102 ILE C CG1 1 
ATOM   4326  C CG2 . ILE C 1 102 ? -32.295 5.669   107.794 1.00 40.61  ? 102 ILE C CG2 1 
ATOM   4327  C CD1 . ILE C 1 102 ? -31.393 8.183   109.192 1.00 37.48  ? 102 ILE C CD1 1 
ATOM   4328  N N   . ASN C 1 103 ? -36.255 7.739   106.853 1.00 41.60  ? 103 ASN C N   1 
ATOM   4329  C CA  . ASN C 1 103 ? -37.343 8.693   106.994 1.00 35.28  ? 103 ASN C CA  1 
ATOM   4330  C C   . ASN C 1 103 ? -38.022 8.539   108.354 1.00 47.45  ? 103 ASN C C   1 
ATOM   4331  O O   . ASN C 1 103 ? -37.732 9.291   109.293 1.00 49.06  ? 103 ASN C O   1 
ATOM   4332  C CB  . ASN C 1 103 ? -38.355 8.491   105.857 1.00 38.90  ? 103 ASN C CB  1 
ATOM   4333  C CG  . ASN C 1 103 ? -39.502 9.500   105.883 1.00 41.84  ? 103 ASN C CG  1 
ATOM   4334  O OD1 . ASN C 1 103 ? -40.339 9.501   104.988 1.00 60.44  ? 103 ASN C OD1 1 
ATOM   4335  N ND2 . ASN C 1 103 ? -39.546 10.355  106.900 1.00 40.68  ? 103 ASN C ND2 1 
ATOM   4336  N N   . THR C 1 104 ? -38.921 7.565   108.456 1.00 40.25  ? 104 THR C N   1 
ATOM   4337  C CA  . THR C 1 104 ? -39.648 7.309   109.696 1.00 47.22  ? 104 THR C CA  1 
ATOM   4338  C C   . THR C 1 104 ? -38.738 7.027   110.884 1.00 41.47  ? 104 THR C C   1 
ATOM   4339  O O   . THR C 1 104 ? -38.941 7.555   111.974 1.00 59.57  ? 104 THR C O   1 
ATOM   4340  C CB  . THR C 1 104 ? -40.600 6.117   109.546 1.00 38.99  ? 104 THR C CB  1 
ATOM   4341  O OG1 . THR C 1 104 ? -41.583 6.419   108.553 1.00 58.38  ? 104 THR C OG1 1 
ATOM   4342  C CG2 . THR C 1 104 ? -41.301 5.823   110.861 1.00 39.87  ? 104 THR C CG2 1 
ATOM   4343  N N   . ALA C 1 105 ? -37.744 6.177   110.685 1.00 49.03  ? 105 ALA C N   1 
ATOM   4344  C CA  . ALA C 1 105 ? -36.844 5.862   111.774 1.00 53.68  ? 105 ALA C CA  1 
ATOM   4345  C C   . ALA C 1 105 ? -36.133 7.135   112.242 1.00 51.30  ? 105 ALA C C   1 
ATOM   4346  O O   . ALA C 1 105 ? -35.969 7.357   113.439 1.00 45.97  ? 105 ALA C O   1 
ATOM   4347  C CB  . ALA C 1 105 ? -35.830 4.813   111.329 1.00 55.25  ? 105 ALA C CB  1 
ATOM   4348  N N   . ALA C 1 106 ? -35.730 7.974   111.292 1.00 53.54  ? 106 ALA C N   1 
ATOM   4349  C CA  . ALA C 1 106 ? -35.030 9.209   111.619 1.00 53.72  ? 106 ALA C CA  1 
ATOM   4350  C C   . ALA C 1 106 ? -35.897 10.148  112.444 1.00 43.35  ? 106 ALA C C   1 
ATOM   4351  O O   . ALA C 1 106 ? -35.407 10.813  113.353 1.00 48.04  ? 106 ALA C O   1 
ATOM   4352  C CB  . ALA C 1 106 ? -34.563 9.911   110.338 1.00 56.22  ? 106 ALA C CB  1 
ATOM   4353  N N   . VAL C 1 107 ? -37.185 10.198  112.122 1.00 46.95  ? 107 VAL C N   1 
ATOM   4354  C CA  . VAL C 1 107 ? -38.123 11.060  112.828 1.00 46.02  ? 107 VAL C CA  1 
ATOM   4355  C C   . VAL C 1 107 ? -38.350 10.582  114.259 1.00 57.66  ? 107 VAL C C   1 
ATOM   4356  O O   . VAL C 1 107 ? -38.346 11.376  115.201 1.00 43.28  ? 107 VAL C O   1 
ATOM   4357  C CB  . VAL C 1 107 ? -39.492 11.100  112.107 1.00 62.31  ? 107 VAL C CB  1 
ATOM   4358  C CG1 . VAL C 1 107 ? -40.534 11.803  112.983 1.00 49.46  ? 107 VAL C CG1 1 
ATOM   4359  C CG2 . VAL C 1 107 ? -39.348 11.817  110.777 1.00 59.86  ? 107 VAL C CG2 1 
ATOM   4360  N N   . GLU C 1 108 ? -38.556 9.280   114.411 1.00 41.46  ? 108 GLU C N   1 
ATOM   4361  C CA  . GLU C 1 108 ? -38.788 8.706   115.725 1.00 60.28  ? 108 GLU C CA  1 
ATOM   4362  C C   . GLU C 1 108 ? -37.496 8.419   116.496 1.00 60.87  ? 108 GLU C C   1 
ATOM   4363  O O   . GLU C 1 108 ? -37.522 7.741   117.515 1.00 77.21  ? 108 GLU C O   1 
ATOM   4364  C CB  . GLU C 1 108 ? -39.617 7.429   115.584 1.00 54.24  ? 108 GLU C CB  1 
ATOM   4365  C CG  . GLU C 1 108 ? -41.121 7.666   115.480 1.00 53.61  ? 108 GLU C CG  1 
ATOM   4366  C CD  . GLU C 1 108 ? -41.836 6.516   114.800 1.00 65.14  ? 108 GLU C CD  1 
ATOM   4367  O OE1 . GLU C 1 108 ? -41.351 5.372   114.924 1.00 75.28  ? 108 GLU C OE1 1 
ATOM   4368  O OE2 . GLU C 1 108 ? -42.881 6.740   114.146 1.00 73.30  ? 108 GLU C OE2 1 
ATOM   4369  N N   . ASN C 1 109 ? -36.379 8.965   116.027 1.00 63.45  ? 109 ASN C N   1 
ATOM   4370  C CA  . ASN C 1 109 ? -35.087 8.744   116.656 1.00 54.49  ? 109 ASN C CA  1 
ATOM   4371  C C   . ASN C 1 109 ? -34.032 9.535   115.889 1.00 53.34  ? 109 ASN C C   1 
ATOM   4372  O O   . ASN C 1 109 ? -33.270 8.974   115.112 1.00 46.81  ? 109 ASN C O   1 
ATOM   4373  C CB  . ASN C 1 109 ? -34.748 7.246   116.613 1.00 52.64  ? 109 ASN C CB  1 
ATOM   4374  C CG  . ASN C 1 109 ? -33.468 6.903   117.369 1.00 79.14  ? 109 ASN C CG  1 
ATOM   4375  O OD1 . ASN C 1 109 ? -33.059 5.738   117.402 1.00 60.95  ? 109 ASN C OD1 1 
ATOM   4376  N ND2 . ASN C 1 109 ? -32.830 7.913   117.979 1.00 59.05  ? 109 ASN C ND2 1 
ATOM   4377  N N   . PRO C 1 110 ? -33.989 10.858  116.087 1.00 58.95  ? 110 PRO C N   1 
ATOM   4378  C CA  . PRO C 1 110 ? -33.018 11.719  115.401 1.00 47.25  ? 110 PRO C CA  1 
ATOM   4379  C C   . PRO C 1 110 ? -31.562 11.283  115.521 1.00 57.25  ? 110 PRO C C   1 
ATOM   4380  O O   . PRO C 1 110 ? -30.773 11.417  114.582 1.00 48.59  ? 110 PRO C O   1 
ATOM   4381  C CB  . PRO C 1 110 ? -33.274 13.077  116.038 1.00 60.35  ? 110 PRO C CB  1 
ATOM   4382  C CG  . PRO C 1 110 ? -34.770 13.056  116.213 1.00 52.55  ? 110 PRO C CG  1 
ATOM   4383  C CD  . PRO C 1 110 ? -35.002 11.670  116.788 1.00 49.58  ? 110 PRO C CD  1 
ATOM   4384  N N   . SER C 1 111 ? -31.213 10.756  116.684 1.00 58.94  ? 111 SER C N   1 
ATOM   4385  C CA  . SER C 1 111 ? -29.851 10.311  116.955 1.00 53.13  ? 111 SER C CA  1 
ATOM   4386  C C   . SER C 1 111 ? -29.319 9.286   115.950 1.00 49.86  ? 111 SER C C   1 
ATOM   4387  O O   . SER C 1 111 ? -28.105 9.147   115.776 1.00 60.51  ? 111 SER C O   1 
ATOM   4388  C CB  . SER C 1 111 ? -29.790 9.762   118.375 1.00 58.16  ? 111 SER C CB  1 
ATOM   4389  O OG  . SER C 1 111 ? -30.338 10.721  119.267 1.00 75.32  ? 111 SER C OG  1 
ATOM   4390  N N   . LEU C 1 112 ? -30.220 8.572   115.289 1.00 44.91  ? 112 LEU C N   1 
ATOM   4391  C CA  . LEU C 1 112 ? -29.823 7.577   114.299 1.00 45.43  ? 112 LEU C CA  1 
ATOM   4392  C C   . LEU C 1 112 ? -29.013 8.217   113.175 1.00 44.68  ? 112 LEU C C   1 
ATOM   4393  O O   . LEU C 1 112 ? -28.102 7.608   112.617 1.00 54.31  ? 112 LEU C O   1 
ATOM   4394  C CB  . LEU C 1 112 ? -31.060 6.897   113.715 1.00 37.94  ? 112 LEU C CB  1 
ATOM   4395  C CG  . LEU C 1 112 ? -30.816 5.846   112.633 1.00 44.49  ? 112 LEU C CG  1 
ATOM   4396  C CD1 . LEU C 1 112 ? -29.786 4.824   113.113 1.00 47.81  ? 112 LEU C CD1 1 
ATOM   4397  C CD2 . LEU C 1 112 ? -32.128 5.169   112.296 1.00 34.24  ? 112 LEU C CD2 1 
ATOM   4398  N N   . ILE C 1 113 ? -29.367 9.452   112.845 1.00 47.01  ? 113 ILE C N   1 
ATOM   4399  C CA  . ILE C 1 113 ? -28.688 10.194  111.800 1.00 55.38  ? 113 ILE C CA  1 
ATOM   4400  C C   . ILE C 1 113 ? -27.211 10.287  112.165 1.00 47.24  ? 113 ILE C C   1 
ATOM   4401  O O   . ILE C 1 113 ? -26.347 9.831   111.421 1.00 41.92  ? 113 ILE C O   1 
ATOM   4402  C CB  . ILE C 1 113 ? -29.286 11.627  111.665 1.00 57.87  ? 113 ILE C CB  1 
ATOM   4403  C CG1 . ILE C 1 113 ? -30.681 11.546  111.045 1.00 43.20  ? 113 ILE C CG1 1 
ATOM   4404  C CG2 . ILE C 1 113 ? -28.353 12.531  110.854 1.00 30.38  ? 113 ILE C CG2 1 
ATOM   4405  C CD1 . ILE C 1 113 ? -31.387 12.887  110.970 1.00 46.76  ? 113 ILE C CD1 1 
ATOM   4406  N N   . THR C 1 114 ? -26.946 10.875  113.327 1.00 47.65  ? 114 THR C N   1 
ATOM   4407  C CA  . THR C 1 114 ? -25.591 11.046  113.821 1.00 56.03  ? 114 THR C CA  1 
ATOM   4408  C C   . THR C 1 114 ? -24.887 9.693   113.908 1.00 58.49  ? 114 THR C C   1 
ATOM   4409  O O   . THR C 1 114 ? -23.766 9.521   113.430 1.00 54.96  ? 114 THR C O   1 
ATOM   4410  C CB  . THR C 1 114 ? -25.587 11.667  115.224 1.00 56.65  ? 114 THR C CB  1 
ATOM   4411  O OG1 . THR C 1 114 ? -26.628 12.644  115.328 1.00 53.66  ? 114 THR C OG1 1 
ATOM   4412  C CG2 . THR C 1 114 ? -24.246 12.344  115.490 1.00 60.78  ? 114 THR C CG2 1 
ATOM   4413  N N   . GLN C 1 115 ? -25.549 8.728   114.524 1.00 43.81  ? 115 GLN C N   1 
ATOM   4414  C CA  . GLN C 1 115 ? -24.951 7.414   114.652 1.00 60.83  ? 115 GLN C CA  1 
ATOM   4415  C C   . GLN C 1 115 ? -24.447 6.907   113.306 1.00 62.94  ? 115 GLN C C   1 
ATOM   4416  O O   . GLN C 1 115 ? -23.286 6.490   113.202 1.00 54.68  ? 115 GLN C O   1 
ATOM   4417  C CB  . GLN C 1 115 ? -25.952 6.431   115.257 1.00 58.33  ? 115 GLN C CB  1 
ATOM   4418  C CG  . GLN C 1 115 ? -25.476 4.989   115.238 1.00 72.86  ? 115 GLN C CG  1 
ATOM   4419  C CD  . GLN C 1 115 ? -26.190 4.136   116.260 1.00 74.41  ? 115 GLN C CD  1 
ATOM   4420  O OE1 . GLN C 1 115 ? -27.403 4.243   116.432 1.00 56.01  ? 115 GLN C OE1 1 
ATOM   4421  N NE2 . GLN C 1 115 ? -25.441 3.276   116.941 1.00 64.84  ? 115 GLN C NE2 1 
ATOM   4422  N N   . ILE C 1 116 ? -25.295 6.958   112.275 1.00 58.15  ? 116 ILE C N   1 
ATOM   4423  C CA  . ILE C 1 116 ? -24.881 6.480   110.957 1.00 54.22  ? 116 ILE C CA  1 
ATOM   4424  C C   . ILE C 1 116 ? -23.787 7.351   110.380 1.00 48.91  ? 116 ILE C C   1 
ATOM   4425  O O   . ILE C 1 116 ? -22.911 6.868   109.663 1.00 56.51  ? 116 ILE C O   1 
ATOM   4426  C CB  . ILE C 1 116 ? -26.041 6.433   109.937 1.00 53.97  ? 116 ILE C CB  1 
ATOM   4427  C CG1 . ILE C 1 116 ? -27.148 5.508   110.435 1.00 41.13  ? 116 ILE C CG1 1 
ATOM   4428  C CG2 . ILE C 1 116 ? -25.521 5.924   108.602 1.00 38.88  ? 116 ILE C CG2 1 
ATOM   4429  C CD1 . ILE C 1 116 ? -28.345 5.449   109.528 1.00 50.38  ? 116 ILE C CD1 1 
ATOM   4430  N N   . ALA C 1 117 ? -23.836 8.636   110.701 1.00 45.73  ? 117 ALA C N   1 
ATOM   4431  C CA  . ALA C 1 117 ? -22.839 9.581   110.221 1.00 46.30  ? 117 ALA C CA  1 
ATOM   4432  C C   . ALA C 1 117 ? -21.503 9.398   110.938 1.00 59.89  ? 117 ALA C C   1 
ATOM   4433  O O   . ALA C 1 117 ? -20.435 9.663   110.377 1.00 66.13  ? 117 ALA C O   1 
ATOM   4434  C CB  . ALA C 1 117 ? -23.341 10.991  110.425 1.00 53.09  ? 117 ALA C CB  1 
ATOM   4435  N N   . GLN C 1 118 ? -21.570 8.950   112.187 1.00 63.16  ? 118 GLN C N   1 
ATOM   4436  C CA  . GLN C 1 118 ? -20.379 8.739   112.999 1.00 64.21  ? 118 GLN C CA  1 
ATOM   4437  C C   . GLN C 1 118 ? -19.465 7.636   112.488 1.00 54.43  ? 118 GLN C C   1 
ATOM   4438  O O   . GLN C 1 118 ? -18.249 7.746   112.592 1.00 53.92  ? 118 GLN C O   1 
ATOM   4439  C CB  . GLN C 1 118 ? -20.784 8.429   114.445 1.00 43.81  ? 118 GLN C CB  1 
ATOM   4440  C CG  . GLN C 1 118 ? -20.665 9.618   115.365 1.00 69.96  ? 118 GLN C CG  1 
ATOM   4441  C CD  . GLN C 1 118 ? -21.400 9.434   116.679 1.00 99.99  ? 118 GLN C CD  1 
ATOM   4442  O OE1 . GLN C 1 118 ? -21.317 10.293  117.572 1.00 74.67  ? 118 GLN C OE1 1 
ATOM   4443  N NE2 . GLN C 1 118 ? -22.133 8.317   116.809 1.00 80.38  ? 118 GLN C NE2 1 
ATOM   4444  N N   . THR C 1 119 ? -20.049 6.569   111.954 1.00 53.29  ? 119 THR C N   1 
ATOM   4445  C CA  . THR C 1 119 ? -19.260 5.455   111.445 1.00 49.71  ? 119 THR C CA  1 
ATOM   4446  C C   . THR C 1 119 ? -19.033 5.530   109.938 1.00 52.65  ? 119 THR C C   1 
ATOM   4447  O O   . THR C 1 119 ? -17.984 5.120   109.447 1.00 52.77  ? 119 THR C O   1 
ATOM   4448  C CB  . THR C 1 119 ? -19.935 4.089   111.758 1.00 57.19  ? 119 THR C CB  1 
ATOM   4449  O OG1 . THR C 1 119 ? -19.936 3.862   113.171 1.00 71.42  ? 119 THR C OG1 1 
ATOM   4450  C CG2 . THR C 1 119 ? -19.194 2.935   111.060 1.00 42.86  ? 119 THR C CG2 1 
ATOM   4451  N N   . PHE C 1 120 ? -20.006 6.066   109.205 1.00 57.16  ? 120 PHE C N   1 
ATOM   4452  C CA  . PHE C 1 120 ? -19.902 6.131   107.744 1.00 49.93  ? 120 PHE C CA  1 
ATOM   4453  C C   . PHE C 1 120 ? -19.717 7.516   107.134 1.00 52.08  ? 120 PHE C C   1 
ATOM   4454  O O   . PHE C 1 120 ? -19.366 7.636   105.960 1.00 55.07  ? 120 PHE C O   1 
ATOM   4455  C CB  . PHE C 1 120 ? -21.130 5.457   107.134 1.00 33.46  ? 120 PHE C CB  1 
ATOM   4456  C CG  . PHE C 1 120 ? -21.258 4.010   107.498 1.00 43.46  ? 120 PHE C CG  1 
ATOM   4457  C CD1 . PHE C 1 120 ? -20.389 3.067   106.957 1.00 55.08  ? 120 PHE C CD1 1 
ATOM   4458  C CD2 . PHE C 1 120 ? -22.237 3.589   108.396 1.00 56.91  ? 120 PHE C CD2 1 
ATOM   4459  C CE1 . PHE C 1 120 ? -20.493 1.715   107.304 1.00 57.29  ? 120 PHE C CE1 1 
ATOM   4460  C CE2 . PHE C 1 120 ? -22.357 2.246   108.751 1.00 47.45  ? 120 PHE C CE2 1 
ATOM   4461  C CZ  . PHE C 1 120 ? -21.482 1.304   108.202 1.00 60.24  ? 120 PHE C CZ  1 
ATOM   4462  N N   . GLY C 1 121 ? -19.943 8.553   107.931 1.00 50.22  ? 121 GLY C N   1 
ATOM   4463  C CA  . GLY C 1 121 ? -19.796 9.912   107.443 1.00 48.57  ? 121 GLY C CA  1 
ATOM   4464  C C   . GLY C 1 121 ? -21.124 10.478  106.981 1.00 42.92  ? 121 GLY C C   1 
ATOM   4465  O O   . GLY C 1 121 ? -22.026 9.725   106.644 1.00 52.06  ? 121 GLY C O   1 
ATOM   4466  N N   . SER C 1 122 ? -21.251 11.802  106.977 1.00 55.11  ? 122 SER C N   1 
ATOM   4467  C CA  . SER C 1 122 ? -22.481 12.450  106.534 1.00 46.57  ? 122 SER C CA  1 
ATOM   4468  C C   . SER C 1 122 ? -22.892 12.027  105.120 1.00 42.05  ? 122 SER C C   1 
ATOM   4469  O O   . SER C 1 122 ? -24.079 11.894  104.823 1.00 39.47  ? 122 SER C O   1 
ATOM   4470  C CB  . SER C 1 122 ? -22.321 13.967  106.604 1.00 50.07  ? 122 SER C CB  1 
ATOM   4471  O OG  . SER C 1 122 ? -22.524 14.428  107.933 1.00 55.22  ? 122 SER C OG  1 
ATOM   4472  N N   . GLN C 1 123 ? -21.907 11.796  104.262 1.00 30.93  ? 123 GLN C N   1 
ATOM   4473  C CA  . GLN C 1 123 ? -22.159 11.386  102.883 1.00 51.18  ? 123 GLN C CA  1 
ATOM   4474  C C   . GLN C 1 123 ? -22.975 10.096  102.717 1.00 57.03  ? 123 GLN C C   1 
ATOM   4475  O O   . GLN C 1 123 ? -23.638 9.891   101.695 1.00 46.12  ? 123 GLN C O   1 
ATOM   4476  C CB  . GLN C 1 123 ? -20.836 11.221  102.137 1.00 33.72  ? 123 GLN C CB  1 
ATOM   4477  C CG  . GLN C 1 123 ? -19.802 10.346  102.833 1.00 44.95  ? 123 GLN C CG  1 
ATOM   4478  C CD  . GLN C 1 123 ? -18.925 11.128  103.806 1.00 79.95  ? 123 GLN C CD  1 
ATOM   4479  O OE1 . GLN C 1 123 ? -17.739 10.826  103.959 1.00 63.96  ? 123 GLN C OE1 1 
ATOM   4480  N NE2 . GLN C 1 123 ? -19.501 12.129  104.473 1.00 40.96  ? 123 GLN C NE2 1 
ATOM   4481  N N   . ALA C 1 124 ? -22.918 9.231   103.722 1.00 49.07  ? 124 ALA C N   1 
ATOM   4482  C CA  . ALA C 1 124 ? -23.627 7.965   103.682 1.00 60.29  ? 124 ALA C CA  1 
ATOM   4483  C C   . ALA C 1 124 ? -25.076 8.105   104.090 1.00 42.82  ? 124 ALA C C   1 
ATOM   4484  O O   . ALA C 1 124 ? -25.857 7.173   103.927 1.00 59.56  ? 124 ALA C O   1 
ATOM   4485  C CB  . ALA C 1 124 ? -22.936 6.961   104.602 1.00 60.99  ? 124 ALA C CB  1 
ATOM   4486  N N   . VAL C 1 125 ? -25.436 9.274   104.607 1.00 51.62  ? 125 VAL C N   1 
ATOM   4487  C CA  . VAL C 1 125 ? -26.790 9.501   105.092 1.00 37.13  ? 125 VAL C CA  1 
ATOM   4488  C C   . VAL C 1 125 ? -27.666 10.512  104.353 1.00 44.56  ? 125 VAL C C   1 
ATOM   4489  O O   . VAL C 1 125 ? -27.351 11.699  104.260 1.00 49.22  ? 125 VAL C O   1 
ATOM   4490  C CB  . VAL C 1 125 ? -26.747 9.902   106.580 1.00 44.56  ? 125 VAL C CB  1 
ATOM   4491  C CG1 . VAL C 1 125 ? -28.129 10.271  107.076 1.00 39.17  ? 125 VAL C CG1 1 
ATOM   4492  C CG2 . VAL C 1 125 ? -26.174 8.771   107.396 1.00 41.16  ? 125 VAL C CG2 1 
ATOM   4493  N N   . VAL C 1 126 ? -28.787 10.012  103.857 1.00 35.97  ? 126 VAL C N   1 
ATOM   4494  C CA  . VAL C 1 126 ? -29.775 10.816  103.173 1.00 34.98  ? 126 VAL C CA  1 
ATOM   4495  C C   . VAL C 1 126 ? -31.029 10.736  104.041 1.00 44.18  ? 126 VAL C C   1 
ATOM   4496  O O   . VAL C 1 126 ? -31.449 9.645   104.403 1.00 42.97  ? 126 VAL C O   1 
ATOM   4497  C CB  . VAL C 1 126 ? -30.127 10.231  101.781 1.00 36.20  ? 126 VAL C CB  1 
ATOM   4498  C CG1 . VAL C 1 126 ? -31.309 10.989  101.181 1.00 34.44  ? 126 VAL C CG1 1 
ATOM   4499  C CG2 . VAL C 1 126 ? -28.932 10.295  100.868 1.00 32.58  ? 126 VAL C CG2 1 
ATOM   4500  N N   . VAL C 1 127 ? -31.611 11.877  104.400 1.00 43.29  ? 127 VAL C N   1 
ATOM   4501  C CA  . VAL C 1 127 ? -32.842 11.872  105.179 1.00 28.31  ? 127 VAL C CA  1 
ATOM   4502  C C   . VAL C 1 127 ? -33.957 12.220  104.205 1.00 37.26  ? 127 VAL C C   1 
ATOM   4503  O O   . VAL C 1 127 ? -34.000 13.317  103.675 1.00 50.24  ? 127 VAL C O   1 
ATOM   4504  C CB  . VAL C 1 127 ? -32.837 12.923  106.310 1.00 42.16  ? 127 VAL C CB  1 
ATOM   4505  C CG1 . VAL C 1 127 ? -34.245 13.120  106.832 1.00 40.79  ? 127 VAL C CG1 1 
ATOM   4506  C CG2 . VAL C 1 127 ? -31.924 12.480  107.443 1.00 45.63  ? 127 VAL C CG2 1 
ATOM   4507  N N   . ALA C 1 128 ? -34.840 11.272  103.944 1.00 36.57  ? 128 ALA C N   1 
ATOM   4508  C CA  . ALA C 1 128 ? -35.949 11.501  103.041 1.00 39.62  ? 128 ALA C CA  1 
ATOM   4509  C C   . ALA C 1 128 ? -37.099 12.099  103.836 1.00 39.42  ? 128 ALA C C   1 
ATOM   4510  O O   . ALA C 1 128 ? -37.533 11.524  104.831 1.00 45.94  ? 128 ALA C O   1 
ATOM   4511  C CB  . ALA C 1 128 ? -36.376 10.195  102.421 1.00 42.15  ? 128 ALA C CB  1 
ATOM   4512  N N   . ILE C 1 129 ? -37.586 13.256  103.395 1.00 54.21  ? 129 ILE C N   1 
ATOM   4513  C CA  . ILE C 1 129 ? -38.688 13.949  104.076 1.00 55.13  ? 129 ILE C CA  1 
ATOM   4514  C C   . ILE C 1 129 ? -39.940 14.091  103.200 1.00 57.45  ? 129 ILE C C   1 
ATOM   4515  O O   . ILE C 1 129 ? -39.937 14.833  102.218 1.00 44.49  ? 129 ILE C O   1 
ATOM   4516  C CB  . ILE C 1 129 ? -38.269 15.379  104.527 1.00 41.93  ? 129 ILE C CB  1 
ATOM   4517  C CG1 . ILE C 1 129 ? -37.007 15.323  105.385 1.00 36.40  ? 129 ILE C CG1 1 
ATOM   4518  C CG2 . ILE C 1 129 ? -39.404 16.035  105.280 1.00 37.77  ? 129 ILE C CG2 1 
ATOM   4519  C CD1 . ILE C 1 129 ? -36.475 16.695  105.771 1.00 42.62  ? 129 ILE C CD1 1 
ATOM   4520  N N   . ASP C 1 130 ? -41.001 13.373  103.559 1.00 55.46  ? 130 ASP C N   1 
ATOM   4521  C CA  . ASP C 1 130 ? -42.267 13.451  102.836 1.00 53.15  ? 130 ASP C CA  1 
ATOM   4522  C C   . ASP C 1 130 ? -43.109 14.513  103.531 1.00 50.55  ? 130 ASP C C   1 
ATOM   4523  O O   . ASP C 1 130 ? -43.325 14.445  104.738 1.00 44.46  ? 130 ASP C O   1 
ATOM   4524  C CB  . ASP C 1 130 ? -43.009 12.109  102.874 1.00 47.23  ? 130 ASP C CB  1 
ATOM   4525  C CG  . ASP C 1 130 ? -42.248 11.009  102.172 1.00 51.61  ? 130 ASP C CG  1 
ATOM   4526  O OD1 . ASP C 1 130 ? -41.642 11.307  101.123 1.00 49.26  ? 130 ASP C OD1 1 
ATOM   4527  O OD2 . ASP C 1 130 ? -42.262 9.851   102.653 1.00 54.51  ? 130 ASP C OD2 1 
ATOM   4528  N N   . ALA C 1 131 ? -43.576 15.499  102.772 1.00 45.87  ? 131 ALA C N   1 
ATOM   4529  C CA  . ALA C 1 131 ? -44.377 16.574  103.342 1.00 38.00  ? 131 ALA C CA  1 
ATOM   4530  C C   . ALA C 1 131 ? -45.599 16.930  102.502 1.00 45.03  ? 131 ALA C C   1 
ATOM   4531  O O   . ALA C 1 131 ? -45.583 16.823  101.276 1.00 47.23  ? 131 ALA C O   1 
ATOM   4532  C CB  . ALA C 1 131 ? -43.512 17.798  103.556 1.00 32.01  ? 131 ALA C CB  1 
ATOM   4533  N N   . LYS C 1 132 ? -46.654 17.359  103.192 1.00 43.54  ? 132 LYS C N   1 
ATOM   4534  C CA  . LYS C 1 132 ? -47.919 17.738  102.583 1.00 37.99  ? 132 LYS C CA  1 
ATOM   4535  C C   . LYS C 1 132 ? -48.462 18.947  103.328 1.00 47.24  ? 132 LYS C C   1 
ATOM   4536  O O   . LYS C 1 132 ? -48.100 19.176  104.485 1.00 51.84  ? 132 LYS C O   1 
ATOM   4537  C CB  . LYS C 1 132 ? -48.923 16.593  102.706 1.00 52.05  ? 132 LYS C CB  1 
ATOM   4538  C CG  . LYS C 1 132 ? -50.364 17.020  102.443 1.00 77.80  ? 132 LYS C CG  1 
ATOM   4539  C CD  . LYS C 1 132 ? -51.386 16.027  102.993 1.00 64.54  ? 132 LYS C CD  1 
ATOM   4540  C CE  . LYS C 1 132 ? -51.365 14.724  102.236 1.00 53.43  ? 132 LYS C CE  1 
ATOM   4541  N NZ  . LYS C 1 132 ? -52.451 13.832  102.721 1.00 61.92  ? 132 LYS C NZ  1 
ATOM   4542  N N   . ARG C 1 133 ? -49.337 19.705  102.672 1.00 45.36  ? 133 ARG C N   1 
ATOM   4543  C CA  . ARG C 1 133 ? -49.946 20.892  103.269 1.00 47.07  ? 133 ARG C CA  1 
ATOM   4544  C C   . ARG C 1 133 ? -51.132 20.522  104.142 1.00 44.82  ? 133 ARG C C   1 
ATOM   4545  O O   . ARG C 1 133 ? -52.054 19.860  103.683 1.00 70.90  ? 133 ARG C O   1 
ATOM   4546  C CB  . ARG C 1 133 ? -50.452 21.851  102.190 1.00 55.35  ? 133 ARG C CB  1 
ATOM   4547  C CG  . ARG C 1 133 ? -49.389 22.561  101.382 1.00 54.32  ? 133 ARG C CG  1 
ATOM   4548  C CD  . ARG C 1 133 ? -50.018 23.184  100.148 1.00 36.86  ? 133 ARG C CD  1 
ATOM   4549  N NE  . ARG C 1 133 ? -49.034 23.822  99.285  1.00 33.99  ? 133 ARG C NE  1 
ATOM   4550  C CZ  . ARG C 1 133 ? -48.131 23.173  98.563  1.00 44.72  ? 133 ARG C CZ  1 
ATOM   4551  N NH1 . ARG C 1 133 ? -48.074 21.851  98.583  1.00 42.97  ? 133 ARG C NH1 1 
ATOM   4552  N NH2 . ARG C 1 133 ? -47.273 23.853  97.824  1.00 46.36  ? 133 ARG C NH2 1 
ATOM   4553  N N   . VAL C 1 134 ? -51.108 20.963  105.393 1.00 43.36  ? 134 VAL C N   1 
ATOM   4554  C CA  . VAL C 1 134 ? -52.191 20.709  106.340 1.00 46.01  ? 134 VAL C CA  1 
ATOM   4555  C C   . VAL C 1 134 ? -52.522 22.037  107.057 1.00 51.68  ? 134 VAL C C   1 
ATOM   4556  O O   . VAL C 1 134 ? -51.650 22.669  107.666 1.00 52.88  ? 134 VAL C O   1 
ATOM   4557  C CB  . VAL C 1 134 ? -51.776 19.626  107.380 1.00 59.92  ? 134 VAL C CB  1 
ATOM   4558  C CG1 . VAL C 1 134 ? -52.967 19.220  108.224 1.00 52.43  ? 134 VAL C CG1 1 
ATOM   4559  C CG2 . VAL C 1 134 ? -51.196 18.413  106.668 1.00 43.02  ? 134 VAL C CG2 1 
ATOM   4560  N N   . ASP C 1 135 ? -53.776 22.468  106.969 1.00 52.06  ? 135 ASP C N   1 
ATOM   4561  C CA  . ASP C 1 135 ? -54.191 23.724  107.593 1.00 61.19  ? 135 ASP C CA  1 
ATOM   4562  C C   . ASP C 1 135 ? -53.283 24.895  107.228 1.00 55.54  ? 135 ASP C C   1 
ATOM   4563  O O   . ASP C 1 135 ? -52.899 25.681  108.098 1.00 54.61  ? 135 ASP C O   1 
ATOM   4564  C CB  . ASP C 1 135 ? -54.224 23.598  109.118 1.00 61.25  ? 135 ASP C CB  1 
ATOM   4565  C CG  . ASP C 1 135 ? -55.302 22.654  109.599 1.00 99.40  ? 135 ASP C CG  1 
ATOM   4566  O OD1 . ASP C 1 135 ? -56.332 22.524  108.878 1.00 77.02  ? 135 ASP C OD1 1 
ATOM   4567  O OD2 . ASP C 1 135 ? -55.123 22.054  110.695 1.00 76.14  ? 135 ASP C OD2 1 
ATOM   4568  N N   . GLY C 1 136 ? -52.936 25.006  105.947 1.00 61.77  ? 136 GLY C N   1 
ATOM   4569  C CA  . GLY C 1 136 ? -52.082 26.095  105.509 1.00 50.02  ? 136 GLY C CA  1 
ATOM   4570  C C   . GLY C 1 136 ? -50.614 25.994  105.893 1.00 51.77  ? 136 GLY C C   1 
ATOM   4571  O O   . GLY C 1 136 ? -49.856 26.934  105.654 1.00 63.07  ? 136 GLY C O   1 
ATOM   4572  N N   . GLU C 1 137 ? -50.199 24.874  106.484 1.00 60.53  ? 137 GLU C N   1 
ATOM   4573  C CA  . GLU C 1 137 ? -48.800 24.700  106.871 1.00 52.85  ? 137 GLU C CA  1 
ATOM   4574  C C   . GLU C 1 137 ? -48.166 23.410  106.373 1.00 45.01  ? 137 GLU C C   1 
ATOM   4575  O O   . GLU C 1 137 ? -48.858 22.419  106.154 1.00 57.99  ? 137 GLU C O   1 
ATOM   4576  C CB  . GLU C 1 137 ? -48.656 24.800  108.391 1.00 56.21  ? 137 GLU C CB  1 
ATOM   4577  C CG  . GLU C 1 137 ? -48.742 26.233  108.876 1.00 76.02  ? 137 GLU C CG  1 
ATOM   4578  C CD  . GLU C 1 137 ? -48.110 26.428  110.225 1.00 86.70  ? 137 GLU C CD  1 
ATOM   4579  O OE1 . GLU C 1 137 ? -48.669 25.896  111.218 1.00 79.83  ? 137 GLU C OE1 1 
ATOM   4580  O OE2 . GLU C 1 137 ? -47.050 27.105  110.287 1.00 68.86  ? 137 GLU C OE2 1 
ATOM   4581  N N   . PHE C 1 138 ? -46.850 23.429  106.173 1.00 54.02  ? 138 PHE C N   1 
ATOM   4582  C CA  . PHE C 1 138 ? -46.133 22.241  105.705 1.00 39.63  ? 138 PHE C CA  1 
ATOM   4583  C C   . PHE C 1 138 ? -45.763 21.335  106.881 1.00 59.23  ? 138 PHE C C   1 
ATOM   4584  O O   . PHE C 1 138 ? -44.953 21.701  107.743 1.00 43.80  ? 138 PHE C O   1 
ATOM   4585  C CB  . PHE C 1 138 ? -44.851 22.626  104.951 1.00 56.18  ? 138 PHE C CB  1 
ATOM   4586  C CG  . PHE C 1 138 ? -45.083 23.179  103.568 1.00 43.60  ? 138 PHE C CG  1 
ATOM   4587  C CD1 . PHE C 1 138 ? -45.736 22.424  102.596 1.00 48.17  ? 138 PHE C CD1 1 
ATOM   4588  C CD2 . PHE C 1 138 ? -44.618 24.449  103.228 1.00 57.76  ? 138 PHE C CD2 1 
ATOM   4589  C CE1 . PHE C 1 138 ? -45.921 22.925  101.310 1.00 55.30  ? 138 PHE C CE1 1 
ATOM   4590  C CE2 . PHE C 1 138 ? -44.796 24.959  101.948 1.00 50.38  ? 138 PHE C CE2 1 
ATOM   4591  C CZ  . PHE C 1 138 ? -45.451 24.193  100.985 1.00 47.05  ? 138 PHE C CZ  1 
ATOM   4592  N N   . MET C 1 139 ? -46.360 20.149  106.906 1.00 42.59  ? 139 MET C N   1 
ATOM   4593  C CA  . MET C 1 139 ? -46.100 19.181  107.965 1.00 53.61  ? 139 MET C CA  1 
ATOM   4594  C C   . MET C 1 139 ? -45.356 17.943  107.443 1.00 55.10  ? 139 MET C C   1 
ATOM   4595  O O   . MET C 1 139 ? -45.513 17.540  106.285 1.00 44.81  ? 139 MET C O   1 
ATOM   4596  C CB  . MET C 1 139 ? -47.426 18.766  108.619 1.00 53.76  ? 139 MET C CB  1 
ATOM   4597  C CG  . MET C 1 139 ? -48.097 19.871  109.446 1.00 34.66  ? 139 MET C CG  1 
ATOM   4598  S SD  . MET C 1 139 ? -47.216 20.221  110.994 1.00 67.93  ? 139 MET C SD  1 
ATOM   4599  C CE  . MET C 1 139 ? -48.494 19.922  112.213 1.00 58.22  ? 139 MET C CE  1 
ATOM   4600  N N   . VAL C 1 140 ? -44.532 17.343  108.297 1.00 55.24  ? 140 VAL C N   1 
ATOM   4601  C CA  . VAL C 1 140 ? -43.799 16.146  107.900 1.00 44.41  ? 140 VAL C CA  1 
ATOM   4602  C C   . VAL C 1 140 ? -44.668 14.916  108.158 1.00 43.03  ? 140 VAL C C   1 
ATOM   4603  O O   . VAL C 1 140 ? -45.329 14.836  109.182 1.00 42.93  ? 140 VAL C O   1 
ATOM   4604  C CB  . VAL C 1 140 ? -42.491 16.019  108.691 1.00 37.53  ? 140 VAL C CB  1 
ATOM   4605  C CG1 . VAL C 1 140 ? -41.752 14.756  108.278 1.00 52.01  ? 140 VAL C CG1 1 
ATOM   4606  C CG2 . VAL C 1 140 ? -41.624 17.238  108.451 1.00 39.06  ? 140 VAL C CG2 1 
ATOM   4607  N N   . PHE C 1 141 ? -44.680 13.976  107.214 1.00 49.13  ? 141 PHE C N   1 
ATOM   4608  C CA  . PHE C 1 141 ? -45.455 12.742  107.343 1.00 42.32  ? 141 PHE C CA  1 
ATOM   4609  C C   . PHE C 1 141 ? -44.546 11.508  107.336 1.00 59.47  ? 141 PHE C C   1 
ATOM   4610  O O   . PHE C 1 141 ? -43.543 11.448  106.612 1.00 40.01  ? 141 PHE C O   1 
ATOM   4611  C CB  . PHE C 1 141 ? -46.479 12.615  106.206 1.00 40.70  ? 141 PHE C CB  1 
ATOM   4612  C CG  . PHE C 1 141 ? -47.734 13.439  106.404 1.00 53.65  ? 141 PHE C CG  1 
ATOM   4613  C CD1 . PHE C 1 141 ? -47.688 14.828  106.387 1.00 40.06  ? 141 PHE C CD1 1 
ATOM   4614  C CD2 . PHE C 1 141 ? -48.965 12.816  106.590 1.00 42.09  ? 141 PHE C CD2 1 
ATOM   4615  C CE1 . PHE C 1 141 ? -48.849 15.581  106.551 1.00 41.83  ? 141 PHE C CE1 1 
ATOM   4616  C CE2 . PHE C 1 141 ? -50.131 13.564  106.754 1.00 53.82  ? 141 PHE C CE2 1 
ATOM   4617  C CZ  . PHE C 1 141 ? -50.072 14.949  106.734 1.00 51.56  ? 141 PHE C CZ  1 
ATOM   4618  N N   . THR C 1 142 ? -44.918 10.517  108.141 1.00 57.80  ? 142 THR C N   1 
ATOM   4619  C CA  . THR C 1 142 ? -44.159 9.279   108.254 1.00 35.02  ? 142 THR C CA  1 
ATOM   4620  C C   . THR C 1 142 ? -45.003 8.078   107.821 1.00 47.59  ? 142 THR C C   1 
ATOM   4621  O O   . THR C 1 142 ? -46.120 8.251   107.343 1.00 57.40  ? 142 THR C O   1 
ATOM   4622  C CB  . THR C 1 142 ? -43.636 9.107   109.696 1.00 44.83  ? 142 THR C CB  1 
ATOM   4623  O OG1 . THR C 1 142 ? -44.711 9.232   110.635 1.00 50.83  ? 142 THR C OG1 1 
ATOM   4624  C CG2 . THR C 1 142 ? -42.624 10.185  110.000 1.00 41.92  ? 142 THR C CG2 1 
ATOM   4625  N N   . TYR C 1 143 ? -44.468 6.868   107.959 1.00 55.60  ? 143 TYR C N   1 
ATOM   4626  C CA  . TYR C 1 143 ? -45.184 5.652   107.555 1.00 50.93  ? 143 TYR C CA  1 
ATOM   4627  C C   . TYR C 1 143 ? -45.742 5.743   106.142 1.00 50.59  ? 143 TYR C C   1 
ATOM   4628  O O   . TYR C 1 143 ? -46.904 5.415   105.890 1.00 63.44  ? 143 TYR C O   1 
ATOM   4629  C CB  . TYR C 1 143 ? -46.304 5.318   108.553 1.00 38.49  ? 143 TYR C CB  1 
ATOM   4630  C CG  . TYR C 1 143 ? -45.739 4.937   109.891 1.00 43.44  ? 143 TYR C CG  1 
ATOM   4631  C CD1 . TYR C 1 143 ? -45.262 3.646   110.129 1.00 52.98  ? 143 TYR C CD1 1 
ATOM   4632  C CD2 . TYR C 1 143 ? -45.537 5.901   110.870 1.00 42.81  ? 143 TYR C CD2 1 
ATOM   4633  C CE1 . TYR C 1 143 ? -44.582 3.336   111.308 1.00 29.03  ? 143 TYR C CE1 1 
ATOM   4634  C CE2 . TYR C 1 143 ? -44.863 5.600   112.044 1.00 44.30  ? 143 TYR C CE2 1 
ATOM   4635  C CZ  . TYR C 1 143 ? -44.383 4.322   112.253 1.00 26.86  ? 143 TYR C CZ  1 
ATOM   4636  O OH  . TYR C 1 143 ? -43.654 4.065   113.391 1.00 51.69  ? 143 TYR C OH  1 
ATOM   4637  N N   . SER C 1 144 ? -44.890 6.187   105.224 1.00 60.92  ? 144 SER C N   1 
ATOM   4638  C CA  . SER C 1 144 ? -45.242 6.309   103.818 1.00 36.72  ? 144 SER C CA  1 
ATOM   4639  C C   . SER C 1 144 ? -46.382 7.285   103.587 1.00 52.55  ? 144 SER C C   1 
ATOM   4640  O O   . SER C 1 144 ? -47.306 6.998   102.831 1.00 47.86  ? 144 SER C O   1 
ATOM   4641  C CB  . SER C 1 144 ? -45.609 4.934   103.272 1.00 61.37  ? 144 SER C CB  1 
ATOM   4642  O OG  . SER C 1 144 ? -44.586 3.985   103.567 1.00 57.17  ? 144 SER C OG  1 
ATOM   4643  N N   . GLY C 1 145 ? -46.306 8.439   104.243 1.00 45.43  ? 145 GLY C N   1 
ATOM   4644  C CA  . GLY C 1 145 ? -47.333 9.453   104.103 1.00 51.21  ? 145 GLY C CA  1 
ATOM   4645  C C   . GLY C 1 145 ? -48.672 9.160   104.770 1.00 61.94  ? 145 GLY C C   1 
ATOM   4646  O O   . GLY C 1 145 ? -49.658 9.837   104.484 1.00 71.20  ? 145 GLY C O   1 
ATOM   4647  N N   . LYS C 1 146 ? -48.732 8.175   105.661 1.00 58.37  ? 146 LYS C N   1 
ATOM   4648  C CA  . LYS C 1 146 ? -49.999 7.852   106.316 1.00 65.57  ? 146 LYS C CA  1 
ATOM   4649  C C   . LYS C 1 146 ? -50.078 8.366   107.750 1.00 60.79  ? 146 LYS C C   1 
ATOM   4650  O O   . LYS C 1 146 ? -50.999 8.003   108.482 1.00 59.77  ? 146 LYS C O   1 
ATOM   4651  C CB  . LYS C 1 146 ? -50.231 6.337   106.326 1.00 71.17  ? 146 LYS C CB  1 
ATOM   4652  C CG  . LYS C 1 146 ? -49.992 5.650   104.998 1.00 68.35  ? 146 LYS C CG  1 
ATOM   4653  C CD  . LYS C 1 146 ? -49.977 4.139   105.164 1.00 86.77  ? 146 LYS C CD  1 
ATOM   4654  C CE  . LYS C 1 146 ? -49.563 3.425   103.875 1.00 78.09  ? 146 LYS C CE  1 
ATOM   4655  N NZ  . LYS C 1 146 ? -49.636 1.931   104.010 1.00 88.40  ? 146 LYS C NZ  1 
ATOM   4656  N N   . LYS C 1 147 ? -49.117 9.194   108.158 1.00 47.19  ? 147 LYS C N   1 
ATOM   4657  C CA  . LYS C 1 147 ? -49.122 9.735   109.515 1.00 46.42  ? 147 LYS C CA  1 
ATOM   4658  C C   . LYS C 1 147 ? -48.608 11.155  109.594 1.00 45.17  ? 147 LYS C C   1 
ATOM   4659  O O   . LYS C 1 147 ? -47.461 11.444  109.246 1.00 55.84  ? 147 LYS C O   1 
ATOM   4660  C CB  . LYS C 1 147 ? -48.280 8.871   110.466 1.00 66.48  ? 147 LYS C CB  1 
ATOM   4661  C CG  . LYS C 1 147 ? -48.342 9.321   111.941 1.00 59.77  ? 147 LYS C CG  1 
ATOM   4662  C CD  . LYS C 1 147 ? -47.478 8.458   112.849 1.00 48.00  ? 147 LYS C CD  1 
ATOM   4663  C CE  . LYS C 1 147 ? -47.605 8.893   114.302 1.00 62.07  ? 147 LYS C CE  1 
ATOM   4664  N NZ  . LYS C 1 147 ? -46.371 8.630   115.111 1.00 45.97  ? 147 LYS C NZ  1 
ATOM   4665  N N   . ASN C 1 148 ? -49.470 12.040  110.061 1.00 42.39  ? 148 ASN C N   1 
ATOM   4666  C CA  . ASN C 1 148 ? -49.107 13.426  110.228 1.00 51.64  ? 148 ASN C CA  1 
ATOM   4667  C C   . ASN C 1 148 ? -48.379 13.427  111.572 1.00 45.22  ? 148 ASN C C   1 
ATOM   4668  O O   . ASN C 1 148 ? -48.985 13.196  112.610 1.00 54.13  ? 148 ASN C O   1 
ATOM   4669  C CB  . ASN C 1 148 ? -50.375 14.286  110.263 1.00 38.63  ? 148 ASN C CB  1 
ATOM   4670  C CG  . ASN C 1 148 ? -50.085 15.759  110.487 1.00 52.26  ? 148 ASN C CG  1 
ATOM   4671  O OD1 . ASN C 1 148 ? -50.968 16.605  110.330 1.00 49.54  ? 148 ASN C OD1 1 
ATOM   4672  N ND2 . ASN C 1 148 ? -48.854 16.073  110.861 1.00 41.02  ? 148 ASN C ND2 1 
ATOM   4673  N N   . THR C 1 149 ? -47.070 13.651  111.538 1.00 52.31  ? 149 THR C N   1 
ATOM   4674  C CA  . THR C 1 149 ? -46.260 13.656  112.748 1.00 48.87  ? 149 THR C CA  1 
ATOM   4675  C C   . THR C 1 149 ? -46.601 14.853  113.607 1.00 42.53  ? 149 THR C C   1 
ATOM   4676  O O   . THR C 1 149 ? -46.411 14.835  114.814 1.00 61.85  ? 149 THR C O   1 
ATOM   4677  C CB  . THR C 1 149 ? -44.745 13.726  112.427 1.00 50.34  ? 149 THR C CB  1 
ATOM   4678  O OG1 . THR C 1 149 ? -44.411 15.042  111.978 1.00 49.68  ? 149 THR C OG1 1 
ATOM   4679  C CG2 . THR C 1 149 ? -44.376 12.736  111.343 1.00 42.62  ? 149 THR C CG2 1 
ATOM   4680  N N   . GLY C 1 150 ? -47.112 15.900  112.976 1.00 47.35  ? 150 GLY C N   1 
ATOM   4681  C CA  . GLY C 1 150 ? -47.439 17.106  113.708 1.00 38.08  ? 150 GLY C CA  1 
ATOM   4682  C C   . GLY C 1 150 ? -46.214 17.996  113.787 1.00 51.22  ? 150 GLY C C   1 
ATOM   4683  O O   . GLY C 1 150 ? -46.263 19.083  114.363 1.00 51.88  ? 150 GLY C O   1 
ATOM   4684  N N   . ILE C 1 151 ? -45.108 17.531  113.208 1.00 43.17  ? 151 ILE C N   1 
ATOM   4685  C CA  . ILE C 1 151 ? -43.861 18.294  113.206 1.00 52.02  ? 151 ILE C CA  1 
ATOM   4686  C C   . ILE C 1 151 ? -43.758 19.179  111.960 1.00 42.81  ? 151 ILE C C   1 
ATOM   4687  O O   . ILE C 1 151 ? -43.929 18.708  110.842 1.00 56.24  ? 151 ILE C O   1 
ATOM   4688  C CB  . ILE C 1 151 ? -42.636 17.356  113.258 1.00 46.31  ? 151 ILE C CB  1 
ATOM   4689  C CG1 . ILE C 1 151 ? -42.656 16.544  114.553 1.00 58.27  ? 151 ILE C CG1 1 
ATOM   4690  C CG2 . ILE C 1 151 ? -41.365 18.164  113.189 1.00 50.16  ? 151 ILE C CG2 1 
ATOM   4691  C CD1 . ILE C 1 151 ? -41.516 15.554  114.679 1.00 56.49  ? 151 ILE C CD1 1 
ATOM   4692  N N   . LEU C 1 152 ? -43.491 20.466  112.165 1.00 50.50  ? 152 LEU C N   1 
ATOM   4693  C CA  . LEU C 1 152 ? -43.367 21.406  111.055 1.00 58.49  ? 152 LEU C CA  1 
ATOM   4694  C C   . LEU C 1 152 ? -42.154 21.067  110.210 1.00 51.04  ? 152 LEU C C   1 
ATOM   4695  O O   . LEU C 1 152 ? -41.106 20.693  110.734 1.00 53.23  ? 152 LEU C O   1 
ATOM   4696  C CB  . LEU C 1 152 ? -43.228 22.839  111.575 1.00 50.15  ? 152 LEU C CB  1 
ATOM   4697  C CG  . LEU C 1 152 ? -44.464 23.443  112.242 1.00 67.14  ? 152 LEU C CG  1 
ATOM   4698  C CD1 . LEU C 1 152 ? -44.026 24.636  113.056 1.00 52.73  ? 152 LEU C CD1 1 
ATOM   4699  C CD2 . LEU C 1 152 ? -45.504 23.847  111.201 1.00 40.28  ? 152 LEU C CD2 1 
ATOM   4700  N N   . LEU C 1 153 ? -42.301 21.181  108.900 1.00 47.95  ? 153 LEU C N   1 
ATOM   4701  C CA  . LEU C 1 153 ? -41.185 20.897  108.015 1.00 46.45  ? 153 LEU C CA  1 
ATOM   4702  C C   . LEU C 1 153 ? -40.062 21.871  108.358 1.00 46.15  ? 153 LEU C C   1 
ATOM   4703  O O   . LEU C 1 153 ? -38.888 21.509  108.372 1.00 51.34  ? 153 LEU C O   1 
ATOM   4704  C CB  . LEU C 1 153 ? -41.613 21.081  106.553 1.00 43.37  ? 153 LEU C CB  1 
ATOM   4705  C CG  . LEU C 1 153 ? -40.553 20.944  105.455 1.00 39.93  ? 153 LEU C CG  1 
ATOM   4706  C CD1 . LEU C 1 153 ? -39.895 19.564  105.511 1.00 36.64  ? 153 LEU C CD1 1 
ATOM   4707  C CD2 . LEU C 1 153 ? -41.218 21.169  104.113 1.00 32.50  ? 153 LEU C CD2 1 
ATOM   4708  N N   . ARG C 1 154 ? -40.442 23.109  108.647 1.00 43.71  ? 154 ARG C N   1 
ATOM   4709  C CA  . ARG C 1 154 ? -39.493 24.163  108.975 1.00 47.05  ? 154 ARG C CA  1 
ATOM   4710  C C   . ARG C 1 154 ? -38.562 23.828  110.142 1.00 51.79  ? 154 ARG C C   1 
ATOM   4711  O O   . ARG C 1 154 ? -37.394 24.227  110.143 1.00 66.65  ? 154 ARG C O   1 
ATOM   4712  C CB  . ARG C 1 154 ? -40.252 25.459  109.267 1.00 41.11  ? 154 ARG C CB  1 
ATOM   4713  C CG  . ARG C 1 154 ? -39.394 26.568  109.813 1.00 49.78  ? 154 ARG C CG  1 
ATOM   4714  C CD  . ARG C 1 154 ? -40.246 27.744  110.257 1.00 54.65  ? 154 ARG C CD  1 
ATOM   4715  N NE  . ARG C 1 154 ? -41.483 27.307  110.895 1.00 52.57  ? 154 ARG C NE  1 
ATOM   4716  C CZ  . ARG C 1 154 ? -42.300 28.113  111.567 1.00 83.08  ? 154 ARG C CZ  1 
ATOM   4717  N NH1 . ARG C 1 154 ? -42.007 29.406  111.695 1.00 81.23  ? 154 ARG C NH1 1 
ATOM   4718  N NH2 . ARG C 1 154 ? -43.418 27.635  112.102 1.00 66.10  ? 154 ARG C NH2 1 
ATOM   4719  N N   . ASP C 1 155 ? -39.073 23.107  111.137 1.00 54.71  ? 155 ASP C N   1 
ATOM   4720  C CA  . ASP C 1 155 ? -38.255 22.734  112.286 1.00 51.45  ? 155 ASP C CA  1 
ATOM   4721  C C   . ASP C 1 155 ? -37.412 21.513  111.937 1.00 48.95  ? 155 ASP C C   1 
ATOM   4722  O O   . ASP C 1 155 ? -36.201 21.511  112.140 1.00 58.60  ? 155 ASP C O   1 
ATOM   4723  C CB  . ASP C 1 155 ? -39.130 22.415  113.512 1.00 35.28  ? 155 ASP C CB  1 
ATOM   4724  C CG  . ASP C 1 155 ? -39.955 23.609  113.985 1.00 49.10  ? 155 ASP C CG  1 
ATOM   4725  O OD1 . ASP C 1 155 ? -39.427 24.743  114.020 1.00 55.62  ? 155 ASP C OD1 1 
ATOM   4726  O OD2 . ASP C 1 155 ? -41.131 23.410  114.345 1.00 52.38  ? 155 ASP C OD2 1 
ATOM   4727  N N   . TRP C 1 156 ? -38.067 20.488  111.398 1.00 42.44  ? 156 TRP C N   1 
ATOM   4728  C CA  . TRP C 1 156 ? -37.428 19.233  111.026 1.00 42.29  ? 156 TRP C CA  1 
ATOM   4729  C C   . TRP C 1 156 ? -36.224 19.353  110.101 1.00 46.78  ? 156 TRP C C   1 
ATOM   4730  O O   . TRP C 1 156 ? -35.282 18.574  110.211 1.00 59.60  ? 156 TRP C O   1 
ATOM   4731  C CB  . TRP C 1 156 ? -38.457 18.288  110.394 1.00 37.36  ? 156 TRP C CB  1 
ATOM   4732  C CG  . TRP C 1 156 ? -37.924 16.916  110.097 1.00 40.13  ? 156 TRP C CG  1 
ATOM   4733  C CD1 . TRP C 1 156 ? -38.073 16.218  108.937 1.00 57.83  ? 156 TRP C CD1 1 
ATOM   4734  C CD2 . TRP C 1 156 ? -37.173 16.066  110.982 1.00 44.98  ? 156 TRP C CD2 1 
ATOM   4735  N NE1 . TRP C 1 156 ? -37.465 14.988  109.038 1.00 51.14  ? 156 TRP C NE1 1 
ATOM   4736  C CE2 . TRP C 1 156 ? -36.905 14.868  110.282 1.00 46.77  ? 156 TRP C CE2 1 
ATOM   4737  C CE3 . TRP C 1 156 ? -36.700 16.202  112.299 1.00 55.90  ? 156 TRP C CE3 1 
ATOM   4738  C CZ2 . TRP C 1 156 ? -36.184 13.808  110.851 1.00 51.71  ? 156 TRP C CZ2 1 
ATOM   4739  C CZ3 . TRP C 1 156 ? -35.979 15.147  112.867 1.00 48.65  ? 156 TRP C CZ3 1 
ATOM   4740  C CH2 . TRP C 1 156 ? -35.730 13.967  112.140 1.00 53.84  ? 156 TRP C CH2 1 
ATOM   4741  N N   . VAL C 1 157 ? -36.249 20.306  109.180 1.00 48.25  ? 157 VAL C N   1 
ATOM   4742  C CA  . VAL C 1 157 ? -35.122 20.469  108.271 1.00 49.08  ? 157 VAL C CA  1 
ATOM   4743  C C   . VAL C 1 157 ? -33.886 20.931  109.024 1.00 44.39  ? 157 VAL C C   1 
ATOM   4744  O O   . VAL C 1 157 ? -32.784 20.494  108.717 1.00 49.02  ? 157 VAL C O   1 
ATOM   4745  C CB  . VAL C 1 157 ? -35.432 21.471  107.132 1.00 40.46  ? 157 VAL C CB  1 
ATOM   4746  C CG1 . VAL C 1 157 ? -34.152 21.888  106.442 1.00 46.80  ? 157 VAL C CG1 1 
ATOM   4747  C CG2 . VAL C 1 157 ? -36.369 20.830  106.123 1.00 33.96  ? 157 VAL C CG2 1 
ATOM   4748  N N   . VAL C 1 158 ? -34.072 21.807  110.007 1.00 44.70  ? 158 VAL C N   1 
ATOM   4749  C CA  . VAL C 1 158 ? -32.960 22.311  110.807 1.00 49.57  ? 158 VAL C CA  1 
ATOM   4750  C C   . VAL C 1 158 ? -32.384 21.190  111.673 1.00 52.85  ? 158 VAL C C   1 
ATOM   4751  O O   . VAL C 1 158 ? -31.159 21.022  111.778 1.00 57.52  ? 158 VAL C O   1 
ATOM   4752  C CB  . VAL C 1 158 ? -33.398 23.440  111.753 1.00 44.57  ? 158 VAL C CB  1 
ATOM   4753  C CG1 . VAL C 1 158 ? -32.191 23.945  112.525 1.00 48.84  ? 158 VAL C CG1 1 
ATOM   4754  C CG2 . VAL C 1 158 ? -34.037 24.564  110.979 1.00 40.61  ? 158 VAL C CG2 1 
ATOM   4755  N N   . GLU C 1 159 ? -33.291 20.430  112.282 1.00 51.60  ? 159 GLU C N   1 
ATOM   4756  C CA  . GLU C 1 159 ? -32.948 19.309  113.154 1.00 49.90  ? 159 GLU C CA  1 
ATOM   4757  C C   . GLU C 1 159 ? -32.123 18.267  112.397 1.00 55.83  ? 159 GLU C C   1 
ATOM   4758  O O   . GLU C 1 159 ? -31.184 17.687  112.947 1.00 60.89  ? 159 GLU C O   1 
ATOM   4759  C CB  . GLU C 1 159 ? -34.234 18.676  113.706 1.00 44.76  ? 159 GLU C CB  1 
ATOM   4760  C CG  . GLU C 1 159 ? -34.049 17.681  114.845 1.00 47.37  ? 159 GLU C CG  1 
ATOM   4761  C CD  . GLU C 1 159 ? -33.321 18.275  116.038 1.00 68.21  ? 159 GLU C CD  1 
ATOM   4762  O OE1 . GLU C 1 159 ? -33.595 19.442  116.391 1.00 74.04  ? 159 GLU C OE1 1 
ATOM   4763  O OE2 . GLU C 1 159 ? -32.482 17.570  116.639 1.00 62.91  ? 159 GLU C OE2 1 
ATOM   4764  N N   . VAL C 1 160 ? -32.472 18.047  111.131 1.00 51.99  ? 160 VAL C N   1 
ATOM   4765  C CA  . VAL C 1 160 ? -31.775 17.081  110.290 1.00 50.69  ? 160 VAL C CA  1 
ATOM   4766  C C   . VAL C 1 160 ? -30.352 17.549  109.942 1.00 54.28  ? 160 VAL C C   1 
ATOM   4767  O O   . VAL C 1 160 ? -29.414 16.748  109.973 1.00 50.15  ? 160 VAL C O   1 
ATOM   4768  C CB  . VAL C 1 160 ? -32.595 16.786  108.998 1.00 51.00  ? 160 VAL C CB  1 
ATOM   4769  C CG1 . VAL C 1 160 ? -31.822 15.888  108.063 1.00 48.63  ? 160 VAL C CG1 1 
ATOM   4770  C CG2 . VAL C 1 160 ? -33.908 16.116  109.366 1.00 37.16  ? 160 VAL C CG2 1 
ATOM   4771  N N   . GLU C 1 161 ? -30.170 18.832  109.625 1.00 54.74  ? 161 GLU C N   1 
ATOM   4772  C CA  . GLU C 1 161 ? -28.818 19.307  109.317 1.00 59.40  ? 161 GLU C CA  1 
ATOM   4773  C C   . GLU C 1 161 ? -27.962 19.251  110.594 1.00 56.24  ? 161 GLU C C   1 
ATOM   4774  O O   . GLU C 1 161 ? -26.777 18.927  110.548 1.00 43.92  ? 161 GLU C O   1 
ATOM   4775  C CB  . GLU C 1 161 ? -28.827 20.742  108.761 1.00 45.96  ? 161 GLU C CB  1 
ATOM   4776  C CG  . GLU C 1 161 ? -27.447 21.176  108.246 1.00 44.80  ? 161 GLU C CG  1 
ATOM   4777  C CD  . GLU C 1 161 ? -27.407 22.578  107.628 1.00 46.41  ? 161 GLU C CD  1 
ATOM   4778  O OE1 . GLU C 1 161 ? -28.383 22.978  106.964 1.00 56.17  ? 161 GLU C OE1 1 
ATOM   4779  O OE2 . GLU C 1 161 ? -26.381 23.276  107.789 1.00 47.75  ? 161 GLU C OE2 1 
ATOM   4780  N N   . LYS C 1 162 ? -28.587 19.560  111.727 1.00 53.58  ? 162 LYS C N   1 
ATOM   4781  C CA  . LYS C 1 162 ? -27.916 19.553  113.025 1.00 59.91  ? 162 LYS C CA  1 
ATOM   4782  C C   . LYS C 1 162 ? -27.504 18.130  113.449 1.00 68.96  ? 162 LYS C C   1 
ATOM   4783  O O   . LYS C 1 162 ? -26.474 17.932  114.094 1.00 58.82  ? 162 LYS C O   1 
ATOM   4784  C CB  . LYS C 1 162 ? -28.843 20.170  114.078 1.00 45.28  ? 162 LYS C CB  1 
ATOM   4785  C CG  . LYS C 1 162 ? -28.307 20.111  115.495 1.00 63.34  ? 162 LYS C CG  1 
ATOM   4786  C CD  . LYS C 1 162 ? -29.236 20.859  116.450 1.00 96.33  ? 162 LYS C CD  1 
ATOM   4787  C CE  . LYS C 1 162 ? -28.839 20.701  117.922 1.00 73.98  ? 162 LYS C CE  1 
ATOM   4788  N NZ  . LYS C 1 162 ? -29.736 21.527  118.792 1.00 63.71  ? 162 LYS C NZ  1 
ATOM   4789  N N   . ARG C 1 163 ? -28.310 17.147  113.070 1.00 55.69  ? 163 ARG C N   1 
ATOM   4790  C CA  . ARG C 1 163 ? -28.042 15.760  113.404 1.00 45.38  ? 163 ARG C CA  1 
ATOM   4791  C C   . ARG C 1 163 ? -26.934 15.128  112.569 1.00 56.37  ? 163 ARG C C   1 
ATOM   4792  O O   . ARG C 1 163 ? -26.548 13.991  112.818 1.00 46.84  ? 163 ARG C O   1 
ATOM   4793  C CB  . ARG C 1 163 ? -29.323 14.943  113.261 1.00 50.82  ? 163 ARG C CB  1 
ATOM   4794  C CG  . ARG C 1 163 ? -30.377 15.313  114.273 1.00 53.57  ? 163 ARG C CG  1 
ATOM   4795  C CD  . ARG C 1 163 ? -29.822 15.199  115.695 1.00 57.78  ? 163 ARG C CD  1 
ATOM   4796  N NE  . ARG C 1 163 ? -30.893 15.234  116.680 1.00 66.86  ? 163 ARG C NE  1 
ATOM   4797  C CZ  . ARG C 1 163 ? -30.811 14.699  117.894 1.00 66.84  ? 163 ARG C CZ  1 
ATOM   4798  N NH1 . ARG C 1 163 ? -29.695 14.093  118.275 1.00 62.33  ? 163 ARG C NH1 1 
ATOM   4799  N NH2 . ARG C 1 163 ? -31.860 14.733  118.709 1.00 56.36  ? 163 ARG C NH2 1 
ATOM   4800  N N   . GLY C 1 164 ? -26.431 15.867  111.580 1.00 60.57  ? 164 GLY C N   1 
ATOM   4801  C CA  . GLY C 1 164 ? -25.362 15.363  110.733 1.00 48.81  ? 164 GLY C CA  1 
ATOM   4802  C C   . GLY C 1 164 ? -25.785 14.708  109.425 1.00 64.83  ? 164 GLY C C   1 
ATOM   4803  O O   . GLY C 1 164 ? -25.034 13.908  108.860 1.00 57.62  ? 164 GLY C O   1 
ATOM   4804  N N   . ALA C 1 165 ? -26.977 15.028  108.934 1.00 44.29  ? 165 ALA C N   1 
ATOM   4805  C CA  . ALA C 1 165 ? -27.426 14.444  107.675 1.00 48.77  ? 165 ALA C CA  1 
ATOM   4806  C C   . ALA C 1 165 ? -26.551 15.012  106.576 1.00 38.32  ? 165 ALA C C   1 
ATOM   4807  O O   . ALA C 1 165 ? -26.108 16.149  106.659 1.00 48.86  ? 165 ALA C O   1 
ATOM   4808  C CB  . ALA C 1 165 ? -28.885 14.780  107.416 1.00 45.60  ? 165 ALA C CB  1 
ATOM   4809  N N   . GLY C 1 166 ? -26.285 14.222  105.550 1.00 41.57  ? 166 GLY C N   1 
ATOM   4810  C CA  . GLY C 1 166 ? -25.439 14.718  104.486 1.00 48.91  ? 166 GLY C CA  1 
ATOM   4811  C C   . GLY C 1 166 ? -26.209 15.275  103.305 1.00 51.05  ? 166 GLY C C   1 
ATOM   4812  O O   . GLY C 1 166 ? -25.672 16.053  102.520 1.00 40.85  ? 166 GLY C O   1 
ATOM   4813  N N   . GLU C 1 167 ? -27.479 14.904  103.195 1.00 36.16  ? 167 GLU C N   1 
ATOM   4814  C CA  . GLU C 1 167 ? -28.290 15.329  102.066 1.00 46.44  ? 167 GLU C CA  1 
ATOM   4815  C C   . GLU C 1 167 ? -29.765 15.095  102.389 1.00 40.10  ? 167 GLU C C   1 
ATOM   4816  O O   . GLU C 1 167 ? -30.093 14.198  103.155 1.00 37.82  ? 167 GLU C O   1 
ATOM   4817  C CB  . GLU C 1 167 ? -27.842 14.504  100.861 1.00 55.68  ? 167 GLU C CB  1 
ATOM   4818  C CG  . GLU C 1 167 ? -28.399 14.838  99.503  1.00 60.82  ? 167 GLU C CG  1 
ATOM   4819  C CD  . GLU C 1 167 ? -27.624 14.100  98.413  1.00 67.27  ? 167 GLU C CD  1 
ATOM   4820  O OE1 . GLU C 1 167 ? -27.454 12.868  98.547  1.00 53.24  ? 167 GLU C OE1 1 
ATOM   4821  O OE2 . GLU C 1 167 ? -27.178 14.741  97.434  1.00 57.21  ? 167 GLU C OE2 1 
ATOM   4822  N N   . ILE C 1 168 ? -30.642 15.911  101.811 1.00 47.05  ? 168 ILE C N   1 
ATOM   4823  C CA  . ILE C 1 168 ? -32.071 15.791  102.046 1.00 36.47  ? 168 ILE C CA  1 
ATOM   4824  C C   . ILE C 1 168 ? -32.859 15.466  100.783 1.00 41.90  ? 168 ILE C C   1 
ATOM   4825  O O   . ILE C 1 168 ? -32.702 16.130  99.771  1.00 41.33  ? 168 ILE C O   1 
ATOM   4826  C CB  . ILE C 1 168 ? -32.669 17.096  102.627 1.00 47.79  ? 168 ILE C CB  1 
ATOM   4827  C CG1 . ILE C 1 168 ? -32.030 17.437  103.977 1.00 61.98  ? 168 ILE C CG1 1 
ATOM   4828  C CG2 . ILE C 1 168 ? -34.178 16.936  102.792 1.00 46.33  ? 168 ILE C CG2 1 
ATOM   4829  C CD1 . ILE C 1 168 ? -32.465 18.795  104.537 1.00 40.24  ? 168 ILE C CD1 1 
ATOM   4830  N N   . LEU C 1 169 ? -33.706 14.441  100.865 1.00 44.11  ? 169 LEU C N   1 
ATOM   4831  C CA  . LEU C 1 169 ? -34.576 14.024  99.760  1.00 47.33  ? 169 LEU C CA  1 
ATOM   4832  C C   . LEU C 1 169 ? -35.960 14.569  100.147 1.00 45.10  ? 169 LEU C C   1 
ATOM   4833  O O   . LEU C 1 169 ? -36.602 14.054  101.067 1.00 41.69  ? 169 LEU C O   1 
ATOM   4834  C CB  . LEU C 1 169 ? -34.608 12.491  99.655  1.00 42.38  ? 169 LEU C CB  1 
ATOM   4835  C CG  . LEU C 1 169 ? -35.065 11.881  98.324  1.00 46.68  ? 169 LEU C CG  1 
ATOM   4836  C CD1 . LEU C 1 169 ? -34.666 10.423  98.272  1.00 36.90  ? 169 LEU C CD1 1 
ATOM   4837  C CD2 . LEU C 1 169 ? -36.556 12.044  98.147  1.00 39.69  ? 169 LEU C CD2 1 
ATOM   4838  N N   . LEU C 1 170 ? -36.404 15.619  99.454  1.00 56.01  ? 170 LEU C N   1 
ATOM   4839  C CA  . LEU C 1 170 ? -37.679 16.283  99.761  1.00 44.40  ? 170 LEU C CA  1 
ATOM   4840  C C   . LEU C 1 170 ? -38.833 15.926  98.833  1.00 41.28  ? 170 LEU C C   1 
ATOM   4841  O O   . LEU C 1 170 ? -38.921 16.422  97.709  1.00 47.65  ? 170 LEU C O   1 
ATOM   4842  C CB  . LEU C 1 170 ? -37.469 17.801  99.752  1.00 29.98  ? 170 LEU C CB  1 
ATOM   4843  C CG  . LEU C 1 170 ? -38.633 18.768  100.017 1.00 45.24  ? 170 LEU C CG  1 
ATOM   4844  C CD1 . LEU C 1 170 ? -39.095 18.686  101.468 1.00 34.99  ? 170 LEU C CD1 1 
ATOM   4845  C CD2 . LEU C 1 170 ? -38.180 20.191  99.696  1.00 34.79  ? 170 LEU C CD2 1 
ATOM   4846  N N   . THR C 1 171 ? -39.741 15.088  99.313  1.00 43.07  ? 171 THR C N   1 
ATOM   4847  C CA  . THR C 1 171 ? -40.873 14.686  98.492  1.00 41.69  ? 171 THR C CA  1 
ATOM   4848  C C   . THR C 1 171 ? -42.183 15.365  98.871  1.00 36.04  ? 171 THR C C   1 
ATOM   4849  O O   . THR C 1 171 ? -42.553 15.440  100.038 1.00 40.78  ? 171 THR C O   1 
ATOM   4850  C CB  . THR C 1 171 ? -41.077 13.155  98.526  1.00 40.46  ? 171 THR C CB  1 
ATOM   4851  O OG1 . THR C 1 171 ? -39.838 12.503  98.234  1.00 49.92  ? 171 THR C OG1 1 
ATOM   4852  C CG2 . THR C 1 171 ? -42.106 12.725  97.473  1.00 50.99  ? 171 THR C CG2 1 
ATOM   4853  N N   . SER C 1 172 ? -42.880 15.871  97.861  1.00 44.60  ? 172 SER C N   1 
ATOM   4854  C CA  . SER C 1 172 ? -44.166 16.521  98.066  1.00 52.60  ? 172 SER C CA  1 
ATOM   4855  C C   . SER C 1 172 ? -45.244 15.464  97.820  1.00 43.26  ? 172 SER C C   1 
ATOM   4856  O O   . SER C 1 172 ? -45.458 15.051  96.687  1.00 46.93  ? 172 SER C O   1 
ATOM   4857  C CB  . SER C 1 172 ? -44.333 17.681  97.079  1.00 36.62  ? 172 SER C CB  1 
ATOM   4858  O OG  . SER C 1 172 ? -45.434 18.500  97.433  1.00 57.45  ? 172 SER C OG  1 
ATOM   4859  N N   . ILE C 1 173 ? -45.915 15.021  98.879  1.00 42.71  ? 173 ILE C N   1 
ATOM   4860  C CA  . ILE C 1 173 ? -46.951 14.006  98.728  1.00 44.03  ? 173 ILE C CA  1 
ATOM   4861  C C   . ILE C 1 173 ? -48.050 14.475  97.773  1.00 52.32  ? 173 ILE C C   1 
ATOM   4862  O O   . ILE C 1 173 ? -48.562 13.689  96.975  1.00 63.60  ? 173 ILE C O   1 
ATOM   4863  C CB  . ILE C 1 173 ? -47.604 13.639  100.080 1.00 55.75  ? 173 ILE C CB  1 
ATOM   4864  C CG1 . ILE C 1 173 ? -46.535 13.351  101.131 1.00 37.57  ? 173 ILE C CG1 1 
ATOM   4865  C CG2 . ILE C 1 173 ? -48.485 12.401  99.906  1.00 34.95  ? 173 ILE C CG2 1 
ATOM   4866  C CD1 . ILE C 1 173 ? -47.112 13.037  102.498 1.00 37.95  ? 173 ILE C CD1 1 
ATOM   4867  N N   . ASP C 1 174 ? -48.410 15.753  97.860  1.00 52.10  ? 174 ASP C N   1 
ATOM   4868  C CA  . ASP C 1 174 ? -49.444 16.320  96.995  1.00 62.20  ? 174 ASP C CA  1 
ATOM   4869  C C   . ASP C 1 174 ? -49.142 16.060  95.512  1.00 67.42  ? 174 ASP C C   1 
ATOM   4870  O O   . ASP C 1 174 ? -50.029 15.657  94.755  1.00 68.34  ? 174 ASP C O   1 
ATOM   4871  C CB  . ASP C 1 174 ? -49.582 17.835  97.232  1.00 58.26  ? 174 ASP C CB  1 
ATOM   4872  C CG  . ASP C 1 174 ? -50.237 18.175  98.583  1.00 87.65  ? 174 ASP C CG  1 
ATOM   4873  O OD1 . ASP C 1 174 ? -51.365 17.690  98.831  1.00 93.80  ? 174 ASP C OD1 1 
ATOM   4874  O OD2 . ASP C 1 174 ? -49.641 18.934  99.397  1.00 63.90  ? 174 ASP C OD2 1 
ATOM   4875  N N   . ARG C 1 175 ? -47.888 16.259  95.108  1.00 55.17  ? 175 ARG C N   1 
ATOM   4876  C CA  . ARG C 1 175 ? -47.492 16.067  93.717  1.00 37.17  ? 175 ARG C CA  1 
ATOM   4877  C C   . ARG C 1 175 ? -47.039 14.674  93.291  1.00 47.38  ? 175 ARG C C   1 
ATOM   4878  O O   . ARG C 1 175 ? -47.322 14.248  92.172  1.00 50.68  ? 175 ARG C O   1 
ATOM   4879  C CB  . ARG C 1 175 ? -46.371 17.043  93.347  1.00 38.53  ? 175 ARG C CB  1 
ATOM   4880  C CG  . ARG C 1 175 ? -46.635 18.487  93.677  1.00 46.86  ? 175 ARG C CG  1 
ATOM   4881  C CD  . ARG C 1 175 ? -48.082 18.876  93.407  1.00 82.50  ? 175 ARG C CD  1 
ATOM   4882  N NE  . ARG C 1 175 ? -48.251 20.324  93.359  1.00 70.07  ? 175 ARG C NE  1 
ATOM   4883  C CZ  . ARG C 1 175 ? -47.951 21.058  92.295  1.00 81.07  ? 175 ARG C CZ  1 
ATOM   4884  N NH1 . ARG C 1 175 ? -47.479 20.473  91.195  1.00 53.36  ? 175 ARG C NH1 1 
ATOM   4885  N NH2 . ARG C 1 175 ? -48.109 22.377  92.334  1.00 81.94  ? 175 ARG C NH2 1 
ATOM   4886  N N   . ASP C 1 176 ? -46.321 13.970  94.161  1.00 60.40  ? 176 ASP C N   1 
ATOM   4887  C CA  . ASP C 1 176 ? -45.796 12.651  93.807  1.00 59.17  ? 176 ASP C CA  1 
ATOM   4888  C C   . ASP C 1 176 ? -46.736 11.834  92.936  1.00 52.04  ? 176 ASP C C   1 
ATOM   4889  O O   . ASP C 1 176 ? -47.858 11.540  93.330  1.00 50.23  ? 176 ASP C O   1 
ATOM   4890  C CB  . ASP C 1 176 ? -45.415 11.854  95.061  1.00 40.44  ? 176 ASP C CB  1 
ATOM   4891  C CG  . ASP C 1 176 ? -44.623 10.599  94.732  1.00 51.19  ? 176 ASP C CG  1 
ATOM   4892  O OD1 . ASP C 1 176 ? -43.688 10.675  93.905  1.00 49.20  ? 176 ASP C OD1 1 
ATOM   4893  O OD2 . ASP C 1 176 ? -44.925 9.534   95.306  1.00 71.11  ? 176 ASP C OD2 1 
ATOM   4894  N N   . GLY C 1 177 ? -46.261 11.513  91.733  1.00 57.14  ? 177 GLY C N   1 
ATOM   4895  C CA  . GLY C 1 177 ? -47.027 10.720  90.788  1.00 57.03  ? 177 GLY C CA  1 
ATOM   4896  C C   . GLY C 1 177 ? -48.034 11.426  89.892  1.00 63.75  ? 177 GLY C C   1 
ATOM   4897  O O   . GLY C 1 177 ? -48.781 10.744  89.189  1.00 62.73  ? 177 GLY C O   1 
ATOM   4898  N N   . THR C 1 178 ? -48.058 12.760  89.876  1.00 52.92  ? 178 THR C N   1 
ATOM   4899  C CA  . THR C 1 178 ? -49.040 13.488  89.052  1.00 48.36  ? 178 THR C CA  1 
ATOM   4900  C C   . THR C 1 178 ? -48.594 14.002  87.687  1.00 63.79  ? 178 THR C C   1 
ATOM   4901  O O   . THR C 1 178 ? -49.421 14.198  86.796  1.00 65.17  ? 178 THR C O   1 
ATOM   4902  C CB  . THR C 1 178 ? -49.624 14.712  89.792  1.00 43.94  ? 178 THR C CB  1 
ATOM   4903  O OG1 . THR C 1 178 ? -48.584 15.668  90.037  1.00 55.81  ? 178 THR C OG1 1 
ATOM   4904  C CG2 . THR C 1 178 ? -50.248 14.298  91.102  1.00 37.54  ? 178 THR C CG2 1 
ATOM   4905  N N   . LYS C 1 179 ? -47.302 14.230  87.512  1.00 56.07  ? 179 LYS C N   1 
ATOM   4906  C CA  . LYS C 1 179 ? -46.818 14.750  86.244  1.00 52.62  ? 179 LYS C CA  1 
ATOM   4907  C C   . LYS C 1 179 ? -47.295 16.196  86.051  1.00 40.53  ? 179 LYS C C   1 
ATOM   4908  O O   . LYS C 1 179 ? -47.327 16.705  84.934  1.00 46.67  ? 179 LYS C O   1 
ATOM   4909  C CB  . LYS C 1 179 ? -47.325 13.901  85.077  1.00 46.82  ? 179 LYS C CB  1 
ATOM   4910  C CG  . LYS C 1 179 ? -46.889 12.467  85.083  1.00 42.11  ? 179 LYS C CG  1 
ATOM   4911  C CD  . LYS C 1 179 ? -47.285 11.821  83.766  1.00 60.13  ? 179 LYS C CD  1 
ATOM   4912  C CE  . LYS C 1 179 ? -47.279 10.308  83.850  1.00 59.55  ? 179 LYS C CE  1 
ATOM   4913  N NZ  . LYS C 1 179 ? -46.009 9.829   84.456  1.00 96.10  ? 179 LYS C NZ  1 
ATOM   4914  N N   . SER C 1 180 ? -47.676 16.855  87.136  1.00 44.76  ? 180 SER C N   1 
ATOM   4915  C CA  . SER C 1 180 ? -48.133 18.231  87.028  1.00 41.94  ? 180 SER C CA  1 
ATOM   4916  C C   . SER C 1 180 ? -47.004 19.223  87.307  1.00 48.31  ? 180 SER C C   1 
ATOM   4917  O O   . SER C 1 180 ? -47.156 20.423  87.098  1.00 51.86  ? 180 SER C O   1 
ATOM   4918  C CB  . SER C 1 180 ? -49.308 18.470  87.978  1.00 42.75  ? 180 SER C CB  1 
ATOM   4919  O OG  . SER C 1 180 ? -48.977 18.142  89.316  1.00 63.23  ? 180 SER C OG  1 
ATOM   4920  N N   . GLY C 1 181 ? -45.868 18.708  87.762  1.00 45.65  ? 181 GLY C N   1 
ATOM   4921  C CA  . GLY C 1 181 ? -44.725 19.553  88.069  1.00 36.03  ? 181 GLY C CA  1 
ATOM   4922  C C   . GLY C 1 181 ? -44.264 19.421  89.511  1.00 34.83  ? 181 GLY C C   1 
ATOM   4923  O O   . GLY C 1 181 ? -45.036 19.034  90.379  1.00 37.10  ? 181 GLY C O   1 
ATOM   4924  N N   . TYR C 1 182 ? -43.001 19.726  89.777  1.00 35.36  ? 182 TYR C N   1 
ATOM   4925  C CA  . TYR C 1 182 ? -42.485 19.639  91.139  1.00 29.23  ? 182 TYR C CA  1 
ATOM   4926  C C   . TYR C 1 182 ? -43.185 20.689  91.990  1.00 36.57  ? 182 TYR C C   1 
ATOM   4927  O O   . TYR C 1 182 ? -43.779 21.632  91.461  1.00 46.01  ? 182 TYR C O   1 
ATOM   4928  C CB  . TYR C 1 182 ? -40.977 19.904  91.167  1.00 28.28  ? 182 TYR C CB  1 
ATOM   4929  C CG  . TYR C 1 182 ? -40.104 18.793  90.628  1.00 31.65  ? 182 TYR C CG  1 
ATOM   4930  C CD1 . TYR C 1 182 ? -39.826 17.662  91.397  1.00 32.33  ? 182 TYR C CD1 1 
ATOM   4931  C CD2 . TYR C 1 182 ? -39.571 18.860  89.341  1.00 25.21  ? 182 TYR C CD2 1 
ATOM   4932  C CE1 . TYR C 1 182 ? -39.040 16.621  90.891  1.00 34.80  ? 182 TYR C CE1 1 
ATOM   4933  C CE2 . TYR C 1 182 ? -38.785 17.823  88.830  1.00 43.16  ? 182 TYR C CE2 1 
ATOM   4934  C CZ  . TYR C 1 182 ? -38.526 16.707  89.610  1.00 26.07  ? 182 TYR C CZ  1 
ATOM   4935  O OH  . TYR C 1 182 ? -37.777 15.674  89.100  1.00 40.50  ? 182 TYR C OH  1 
ATOM   4936  N N   . ASP C 1 183 ? -43.114 20.529  93.305  1.00 36.59  ? 183 ASP C N   1 
ATOM   4937  C CA  . ASP C 1 183 ? -43.714 21.491  94.225  1.00 33.81  ? 183 ASP C CA  1 
ATOM   4938  C C   . ASP C 1 183 ? -42.689 22.603  94.491  1.00 36.65  ? 183 ASP C C   1 
ATOM   4939  O O   . ASP C 1 183 ? -42.111 22.670  95.580  1.00 44.33  ? 183 ASP C O   1 
ATOM   4940  C CB  . ASP C 1 183 ? -44.064 20.799  95.539  1.00 35.59  ? 183 ASP C CB  1 
ATOM   4941  C CG  . ASP C 1 183 ? -45.102 21.544  96.324  1.00 40.27  ? 183 ASP C CG  1 
ATOM   4942  O OD1 . ASP C 1 183 ? -45.110 22.784  96.247  1.00 44.67  ? 183 ASP C OD1 1 
ATOM   4943  O OD2 . ASP C 1 183 ? -45.905 20.890  97.025  1.00 53.95  ? 183 ASP C OD2 1 
ATOM   4944  N N   . THR C 1 184 ? -42.458 23.463  93.498  1.00 31.07  ? 184 THR C N   1 
ATOM   4945  C CA  . THR C 1 184 ? -41.483 24.545  93.622  1.00 29.66  ? 184 THR C CA  1 
ATOM   4946  C C   . THR C 1 184 ? -41.724 25.419  94.837  1.00 34.17  ? 184 THR C C   1 
ATOM   4947  O O   . THR C 1 184 ? -40.780 25.918  95.431  1.00 40.87  ? 184 THR C O   1 
ATOM   4948  C CB  . THR C 1 184 ? -41.436 25.454  92.360  1.00 39.89  ? 184 THR C CB  1 
ATOM   4949  O OG1 . THR C 1 184 ? -42.744 25.952  92.069  1.00 40.91  ? 184 THR C OG1 1 
ATOM   4950  C CG2 . THR C 1 184 ? -40.885 24.690  91.165  1.00 33.60  ? 184 THR C CG2 1 
ATOM   4951  N N   . GLU C 1 185 ? -42.984 25.610  95.205  1.00 37.76  ? 185 GLU C N   1 
ATOM   4952  C CA  . GLU C 1 185 ? -43.297 26.398  96.381  1.00 34.69  ? 185 GLU C CA  1 
ATOM   4953  C C   . GLU C 1 185 ? -42.647 25.725  97.608  1.00 50.68  ? 185 GLU C C   1 
ATOM   4954  O O   . GLU C 1 185 ? -41.994 26.391  98.420  1.00 45.95  ? 185 GLU C O   1 
ATOM   4955  C CB  . GLU C 1 185 ? -44.817 26.501  96.555  1.00 40.01  ? 185 GLU C CB  1 
ATOM   4956  C CG  . GLU C 1 185 ? -45.278 27.373  97.725  1.00 48.57  ? 185 GLU C CG  1 
ATOM   4957  C CD  . GLU C 1 185 ? -46.812 27.494  97.809  1.00 65.87  ? 185 GLU C CD  1 
ATOM   4958  O OE1 . GLU C 1 185 ? -47.495 26.464  97.668  1.00 61.89  ? 185 GLU C OE1 1 
ATOM   4959  O OE2 . GLU C 1 185 ? -47.334 28.612  98.025  1.00 54.31  ? 185 GLU C OE2 1 
ATOM   4960  N N   . MET C 1 186 ? -42.812 24.405  97.727  1.00 40.37  ? 186 MET C N   1 
ATOM   4961  C CA  . MET C 1 186 ? -42.231 23.656  98.842  1.00 42.54  ? 186 MET C CA  1 
ATOM   4962  C C   . MET C 1 186 ? -40.700 23.662  98.796  1.00 42.02  ? 186 MET C C   1 
ATOM   4963  O O   . MET C 1 186 ? -40.039 23.749  99.830  1.00 46.29  ? 186 MET C O   1 
ATOM   4964  C CB  . MET C 1 186 ? -42.734 22.211  98.844  1.00 48.01  ? 186 MET C CB  1 
ATOM   4965  C CG  . MET C 1 186 ? -42.167 21.375  99.993  1.00 42.80  ? 186 MET C CG  1 
ATOM   4966  S SD  . MET C 1 186 ? -42.699 19.651  100.003 1.00 46.62  ? 186 MET C SD  1 
ATOM   4967  C CE  . MET C 1 186 ? -44.342 19.772  100.715 1.00 29.26  ? 186 MET C CE  1 
ATOM   4968  N N   . ILE C 1 187 ? -40.141 23.564  97.595  1.00 45.26  ? 187 ILE C N   1 
ATOM   4969  C CA  . ILE C 1 187 ? -38.698 23.586  97.430  1.00 31.89  ? 187 ILE C CA  1 
ATOM   4970  C C   . ILE C 1 187 ? -38.175 24.947  97.897  1.00 53.89  ? 187 ILE C C   1 
ATOM   4971  O O   . ILE C 1 187 ? -37.215 25.014  98.658  1.00 38.64  ? 187 ILE C O   1 
ATOM   4972  C CB  . ILE C 1 187 ? -38.303 23.369  95.964  1.00 24.51  ? 187 ILE C CB  1 
ATOM   4973  C CG1 . ILE C 1 187 ? -38.689 21.959  95.527  1.00 41.12  ? 187 ILE C CG1 1 
ATOM   4974  C CG2 . ILE C 1 187 ? -36.826 23.572  95.788  1.00 30.40  ? 187 ILE C CG2 1 
ATOM   4975  C CD1 . ILE C 1 187 ? -38.477 21.685  94.059  1.00 27.30  ? 187 ILE C CD1 1 
ATOM   4976  N N   . ARG C 1 188 ? -38.821 26.025  97.445  1.00 38.18  ? 188 ARG C N   1 
ATOM   4977  C CA  . ARG C 1 188 ? -38.421 27.379  97.818  1.00 42.10  ? 188 ARG C CA  1 
ATOM   4978  C C   . ARG C 1 188 ? -38.568 27.649  99.307  1.00 49.16  ? 188 ARG C C   1 
ATOM   4979  O O   . ARG C 1 188 ? -37.843 28.471  99.858  1.00 40.57  ? 188 ARG C O   1 
ATOM   4980  C CB  . ARG C 1 188 ? -39.241 28.415  97.053  1.00 34.39  ? 188 ARG C CB  1 
ATOM   4981  C CG  . ARG C 1 188 ? -38.839 28.589  95.630  1.00 35.04  ? 188 ARG C CG  1 
ATOM   4982  C CD  . ARG C 1 188 ? -39.913 29.316  94.871  1.00 32.31  ? 188 ARG C CD  1 
ATOM   4983  N NE  . ARG C 1 188 ? -39.595 29.337  93.458  1.00 34.30  ? 188 ARG C NE  1 
ATOM   4984  C CZ  . ARG C 1 188 ? -38.655 30.102  92.918  1.00 46.75  ? 188 ARG C CZ  1 
ATOM   4985  N NH1 . ARG C 1 188 ? -37.940 30.926  93.676  1.00 29.76  ? 188 ARG C NH1 1 
ATOM   4986  N NH2 . ARG C 1 188 ? -38.412 30.018  91.621  1.00 37.72  ? 188 ARG C NH2 1 
ATOM   4987  N N   . PHE C 1 189 ? -39.521 26.969  99.940  1.00 39.54  ? 189 PHE C N   1 
ATOM   4988  C CA  . PHE C 1 189 ? -39.781 27.109  101.373 1.00 47.78  ? 189 PHE C CA  1 
ATOM   4989  C C   . PHE C 1 189 ? -38.595 26.579  102.183 1.00 49.07  ? 189 PHE C C   1 
ATOM   4990  O O   . PHE C 1 189 ? -38.199 27.173  103.192 1.00 46.34  ? 189 PHE C O   1 
ATOM   4991  C CB  . PHE C 1 189 ? -41.047 26.326  101.750 1.00 43.59  ? 189 PHE C CB  1 
ATOM   4992  C CG  . PHE C 1 189 ? -41.402 26.397  103.218 1.00 68.34  ? 189 PHE C CG  1 
ATOM   4993  C CD1 . PHE C 1 189 ? -42.027 27.524  103.748 1.00 51.33  ? 189 PHE C CD1 1 
ATOM   4994  C CD2 . PHE C 1 189 ? -41.070 25.347  104.082 1.00 49.85  ? 189 PHE C CD2 1 
ATOM   4995  C CE1 . PHE C 1 189 ? -42.313 27.608  105.115 1.00 54.61  ? 189 PHE C CE1 1 
ATOM   4996  C CE2 . PHE C 1 189 ? -41.352 25.423  105.456 1.00 51.28  ? 189 PHE C CE2 1 
ATOM   4997  C CZ  . PHE C 1 189 ? -41.974 26.557  105.971 1.00 47.96  ? 189 PHE C CZ  1 
ATOM   4998  N N   . VAL C 1 190 ? -38.027 25.468  101.715 1.00 55.50  ? 190 VAL C N   1 
ATOM   4999  C CA  . VAL C 1 190 ? -36.895 24.809  102.363 1.00 42.28  ? 190 VAL C CA  1 
ATOM   5000  C C   . VAL C 1 190 ? -35.499 25.351  102.008 1.00 45.53  ? 190 VAL C C   1 
ATOM   5001  O O   . VAL C 1 190 ? -34.624 25.409  102.868 1.00 40.34  ? 190 VAL C O   1 
ATOM   5002  C CB  . VAL C 1 190 ? -36.925 23.281  102.066 1.00 31.84  ? 190 VAL C CB  1 
ATOM   5003  C CG1 . VAL C 1 190 ? -35.726 22.580  102.683 1.00 40.90  ? 190 VAL C CG1 1 
ATOM   5004  C CG2 . VAL C 1 190 ? -38.201 22.684  102.615 1.00 39.00  ? 190 VAL C CG2 1 
ATOM   5005  N N   . ARG C 1 191 ? -35.292 25.758  100.757 1.00 38.49  ? 191 ARG C N   1 
ATOM   5006  C CA  . ARG C 1 191 ? -33.979 26.238  100.316 1.00 44.48  ? 191 ARG C CA  1 
ATOM   5007  C C   . ARG C 1 191 ? -33.202 27.122  101.281 1.00 36.90  ? 191 ARG C C   1 
ATOM   5008  O O   . ARG C 1 191 ? -32.033 26.888  101.510 1.00 62.02  ? 191 ARG C O   1 
ATOM   5009  C CB  . ARG C 1 191 ? -34.078 26.952  98.966  1.00 41.65  ? 191 ARG C CB  1 
ATOM   5010  C CG  . ARG C 1 191 ? -32.720 27.351  98.341  1.00 40.87  ? 191 ARG C CG  1 
ATOM   5011  C CD  . ARG C 1 191 ? -31.826 26.147  98.023  1.00 26.14  ? 191 ARG C CD  1 
ATOM   5012  N NE  . ARG C 1 191 ? -31.164 25.615  99.211  1.00 49.34  ? 191 ARG C NE  1 
ATOM   5013  C CZ  . ARG C 1 191 ? -30.399 24.529  99.233  1.00 37.76  ? 191 ARG C CZ  1 
ATOM   5014  N NH1 . ARG C 1 191 ? -30.193 23.841  98.125  1.00 40.95  ? 191 ARG C NH1 1 
ATOM   5015  N NH2 . ARG C 1 191 ? -29.834 24.139  100.366 1.00 45.46  ? 191 ARG C NH2 1 
ATOM   5016  N N   . PRO C 1 192 ? -33.831 28.157  101.847 1.00 48.07  ? 192 PRO C N   1 
ATOM   5017  C CA  . PRO C 1 192 ? -33.096 29.022  102.776 1.00 43.42  ? 192 PRO C CA  1 
ATOM   5018  C C   . PRO C 1 192 ? -32.886 28.466  104.192 1.00 52.48  ? 192 PRO C C   1 
ATOM   5019  O O   . PRO C 1 192 ? -32.004 28.919  104.919 1.00 54.17  ? 192 PRO C O   1 
ATOM   5020  C CB  . PRO C 1 192 ? -33.935 30.291  102.779 1.00 49.32  ? 192 PRO C CB  1 
ATOM   5021  C CG  . PRO C 1 192 ? -35.324 29.756  102.625 1.00 43.33  ? 192 PRO C CG  1 
ATOM   5022  C CD  . PRO C 1 192 ? -35.159 28.722  101.544 1.00 46.50  ? 192 PRO C CD  1 
ATOM   5023  N N   . LEU C 1 193 ? -33.693 27.486  104.576 1.00 45.02  ? 193 LEU C N   1 
ATOM   5024  C CA  . LEU C 1 193 ? -33.622 26.887  105.905 1.00 39.36  ? 193 LEU C CA  1 
ATOM   5025  C C   . LEU C 1 193 ? -32.442 25.948  106.128 1.00 52.96  ? 193 LEU C C   1 
ATOM   5026  O O   . LEU C 1 193 ? -32.120 25.625  107.269 1.00 53.49  ? 193 LEU C O   1 
ATOM   5027  C CB  . LEU C 1 193 ? -34.902 26.095  106.191 1.00 34.89  ? 193 LEU C CB  1 
ATOM   5028  C CG  . LEU C 1 193 ? -36.284 26.738  106.068 1.00 49.93  ? 193 LEU C CG  1 
ATOM   5029  C CD1 . LEU C 1 193 ? -37.331 25.645  106.166 1.00 45.12  ? 193 LEU C CD1 1 
ATOM   5030  C CD2 . LEU C 1 193 ? -36.500 27.786  107.149 1.00 44.57  ? 193 LEU C CD2 1 
ATOM   5031  N N   . THR C 1 194 ? -31.808 25.493  105.054 1.00 51.47  ? 194 THR C N   1 
ATOM   5032  C CA  . THR C 1 194 ? -30.706 24.549  105.183 1.00 48.14  ? 194 THR C CA  1 
ATOM   5033  C C   . THR C 1 194 ? -29.606 24.798  104.167 1.00 51.64  ? 194 THR C C   1 
ATOM   5034  O O   . THR C 1 194 ? -29.834 25.462  103.159 1.00 51.74  ? 194 THR C O   1 
ATOM   5035  C CB  . THR C 1 194 ? -31.241 23.084  105.039 1.00 45.13  ? 194 THR C CB  1 
ATOM   5036  O OG1 . THR C 1 194 ? -30.157 22.182  104.789 1.00 46.30  ? 194 THR C OG1 1 
ATOM   5037  C CG2 . THR C 1 194 ? -32.250 22.990  103.912 1.00 39.23  ? 194 THR C CG2 1 
ATOM   5038  N N   . THR C 1 195 ? -28.412 24.276  104.442 1.00 46.43  ? 195 THR C N   1 
ATOM   5039  C CA  . THR C 1 195 ? -27.280 24.423  103.526 1.00 44.03  ? 195 THR C CA  1 
ATOM   5040  C C   . THR C 1 195 ? -26.974 23.084  102.857 1.00 43.73  ? 195 THR C C   1 
ATOM   5041  O O   . THR C 1 195 ? -26.166 23.009  101.935 1.00 43.78  ? 195 THR C O   1 
ATOM   5042  C CB  . THR C 1 195 ? -26.007 24.911  104.253 1.00 69.76  ? 195 THR C CB  1 
ATOM   5043  O OG1 . THR C 1 195 ? -25.595 23.932  105.216 1.00 63.12  ? 195 THR C OG1 1 
ATOM   5044  C CG2 . THR C 1 195 ? -26.275 26.236  104.969 1.00 60.87  ? 195 THR C CG2 1 
ATOM   5045  N N   . LEU C 1 196 ? -27.625 22.027  103.331 1.00 42.84  ? 196 LEU C N   1 
ATOM   5046  C CA  . LEU C 1 196 ? -27.434 20.696  102.765 1.00 46.04  ? 196 LEU C CA  1 
ATOM   5047  C C   . LEU C 1 196 ? -27.997 20.599  101.348 1.00 43.17  ? 196 LEU C C   1 
ATOM   5048  O O   . LEU C 1 196 ? -28.896 21.351  100.961 1.00 38.76  ? 196 LEU C O   1 
ATOM   5049  C CB  . LEU C 1 196 ? -28.134 19.639  103.621 1.00 36.17  ? 196 LEU C CB  1 
ATOM   5050  C CG  . LEU C 1 196 ? -27.714 19.445  105.077 1.00 61.10  ? 196 LEU C CG  1 
ATOM   5051  C CD1 . LEU C 1 196 ? -28.609 18.381  105.707 1.00 40.91  ? 196 LEU C CD1 1 
ATOM   5052  C CD2 . LEU C 1 196 ? -26.246 19.028  105.155 1.00 50.93  ? 196 LEU C CD2 1 
ATOM   5053  N N   . PRO C 1 197 ? -27.471 19.658  100.557 1.00 42.41  ? 197 PRO C N   1 
ATOM   5054  C CA  . PRO C 1 197 ? -27.945 19.470  99.185  1.00 36.68  ? 197 PRO C CA  1 
ATOM   5055  C C   . PRO C 1 197 ? -29.419 19.041  99.226  1.00 45.43  ? 197 PRO C C   1 
ATOM   5056  O O   . PRO C 1 197 ? -29.804 18.195  100.033 1.00 42.50  ? 197 PRO C O   1 
ATOM   5057  C CB  . PRO C 1 197 ? -27.051 18.346  98.657  1.00 41.85  ? 197 PRO C CB  1 
ATOM   5058  C CG  . PRO C 1 197 ? -25.824 18.419  99.527  1.00 44.89  ? 197 PRO C CG  1 
ATOM   5059  C CD  . PRO C 1 197 ? -26.374 18.731  100.878 1.00 42.33  ? 197 PRO C CD  1 
ATOM   5060  N N   . ILE C 1 198 ? -30.248 19.624  98.372  1.00 42.91  ? 198 ILE C N   1 
ATOM   5061  C CA  . ILE C 1 198 ? -31.649 19.229  98.345  1.00 44.53  ? 198 ILE C CA  1 
ATOM   5062  C C   . ILE C 1 198 ? -32.002 18.461  97.067  1.00 38.16  ? 198 ILE C C   1 
ATOM   5063  O O   . ILE C 1 198 ? -31.634 18.861  95.966  1.00 42.34  ? 198 ILE C O   1 
ATOM   5064  C CB  . ILE C 1 198 ? -32.572 20.455  98.480  1.00 39.22  ? 198 ILE C CB  1 
ATOM   5065  C CG1 . ILE C 1 198 ? -32.395 21.067  99.869  1.00 36.44  ? 198 ILE C CG1 1 
ATOM   5066  C CG2 . ILE C 1 198 ? -34.019 20.052  98.249  1.00 33.31  ? 198 ILE C CG2 1 
ATOM   5067  C CD1 . ILE C 1 198 ? -33.200 22.308  100.108 1.00 46.80  ? 198 ILE C CD1 1 
ATOM   5068  N N   . ILE C 1 199 ? -32.684 17.332  97.225  1.00 42.58  ? 199 ILE C N   1 
ATOM   5069  C CA  . ILE C 1 199 ? -33.108 16.546  96.071  1.00 41.65  ? 199 ILE C CA  1 
ATOM   5070  C C   . ILE C 1 199 ? -34.613 16.697  95.929  1.00 41.37  ? 199 ILE C C   1 
ATOM   5071  O O   . ILE C 1 199 ? -35.371 16.232  96.775  1.00 39.00  ? 199 ILE C O   1 
ATOM   5072  C CB  . ILE C 1 199 ? -32.808 15.056  96.231  1.00 40.48  ? 199 ILE C CB  1 
ATOM   5073  C CG1 . ILE C 1 199 ? -31.308 14.837  96.388  1.00 36.43  ? 199 ILE C CG1 1 
ATOM   5074  C CG2 . ILE C 1 199 ? -33.340 14.293  95.013  1.00 25.90  ? 199 ILE C CG2 1 
ATOM   5075  C CD1 . ILE C 1 199 ? -30.929 13.416  96.657  1.00 40.33  ? 199 ILE C CD1 1 
ATOM   5076  N N   . ALA C 1 200 ? -35.038 17.360  94.863  1.00 40.73  ? 200 ALA C N   1 
ATOM   5077  C CA  . ALA C 1 200 ? -36.457 17.562  94.619  1.00 36.97  ? 200 ALA C CA  1 
ATOM   5078  C C   . ALA C 1 200 ? -37.079 16.281  94.057  1.00 44.61  ? 200 ALA C C   1 
ATOM   5079  O O   . ALA C 1 200 ? -36.563 15.681  93.109  1.00 44.12  ? 200 ALA C O   1 
ATOM   5080  C CB  . ALA C 1 200 ? -36.663 18.727  93.644  1.00 36.23  ? 200 ALA C CB  1 
ATOM   5081  N N   . SER C 1 201 ? -38.190 15.866  94.649  1.00 38.12  ? 201 SER C N   1 
ATOM   5082  C CA  . SER C 1 201 ? -38.879 14.659  94.212  1.00 49.79  ? 201 SER C CA  1 
ATOM   5083  C C   . SER C 1 201 ? -40.393 14.843  94.157  1.00 33.41  ? 201 SER C C   1 
ATOM   5084  O O   . SER C 1 201 ? -40.966 15.529  94.996  1.00 37.09  ? 201 SER C O   1 
ATOM   5085  C CB  . SER C 1 201 ? -38.549 13.496  95.157  1.00 41.32  ? 201 SER C CB  1 
ATOM   5086  O OG  . SER C 1 201 ? -39.261 12.330  94.784  1.00 51.60  ? 201 SER C OG  1 
ATOM   5087  N N   . GLY C 1 202 ? -41.023 14.227  93.161  1.00 39.54  ? 202 GLY C N   1 
ATOM   5088  C CA  . GLY C 1 202 ? -42.465 14.297  93.031  1.00 34.11  ? 202 GLY C CA  1 
ATOM   5089  C C   . GLY C 1 202 ? -43.073 15.354  92.121  1.00 49.62  ? 202 GLY C C   1 
ATOM   5090  O O   . GLY C 1 202 ? -42.970 16.553  92.386  1.00 39.27  ? 202 GLY C O   1 
ATOM   5091  N N   . GLY C 1 203 ? -43.720 14.895  91.052  1.00 39.62  ? 203 GLY C N   1 
ATOM   5092  C CA  . GLY C 1 203 ? -44.374 15.800  90.129  1.00 39.15  ? 203 GLY C CA  1 
ATOM   5093  C C   . GLY C 1 203 ? -43.840 15.842  88.713  1.00 44.97  ? 203 GLY C C   1 
ATOM   5094  O O   . GLY C 1 203 ? -44.558 16.223  87.803  1.00 42.05  ? 203 GLY C O   1 
ATOM   5095  N N   . ALA C 1 204 ? -42.586 15.458  88.520  1.00 42.15  ? 204 ALA C N   1 
ATOM   5096  C CA  . ALA C 1 204 ? -41.974 15.485  87.199  1.00 42.90  ? 204 ALA C CA  1 
ATOM   5097  C C   . ALA C 1 204 ? -42.831 14.867  86.088  1.00 52.34  ? 204 ALA C C   1 
ATOM   5098  O O   . ALA C 1 204 ? -43.145 13.677  86.121  1.00 45.49  ? 204 ALA C O   1 
ATOM   5099  C CB  . ALA C 1 204 ? -40.613 14.807  87.252  1.00 40.55  ? 204 ALA C CB  1 
ATOM   5100  N N   . GLY C 1 205 ? -43.181 15.698  85.103  1.00 48.69  ? 205 GLY C N   1 
ATOM   5101  C CA  . GLY C 1 205 ? -43.987 15.270  83.968  1.00 49.22  ? 205 GLY C CA  1 
ATOM   5102  C C   . GLY C 1 205 ? -43.364 15.644  82.624  1.00 40.93  ? 205 GLY C C   1 
ATOM   5103  O O   . GLY C 1 205 ? -43.725 15.091  81.591  1.00 38.46  ? 205 GLY C O   1 
ATOM   5104  N N   . LYS C 1 206 ? -42.438 16.597  82.639  1.00 43.83  ? 206 LYS C N   1 
ATOM   5105  C CA  . LYS C 1 206 ? -41.743 17.031  81.431  1.00 36.65  ? 206 LYS C CA  1 
ATOM   5106  C C   . LYS C 1 206 ? -40.498 17.839  81.762  1.00 45.90  ? 206 LYS C C   1 
ATOM   5107  O O   . LYS C 1 206 ? -40.319 18.302  82.890  1.00 39.22  ? 206 LYS C O   1 
ATOM   5108  C CB  . LYS C 1 206 ? -42.662 17.843  80.511  1.00 46.61  ? 206 LYS C CB  1 
ATOM   5109  C CG  . LYS C 1 206 ? -43.237 19.101  81.114  1.00 40.44  ? 206 LYS C CG  1 
ATOM   5110  C CD  . LYS C 1 206 ? -44.194 19.745  80.127  1.00 63.57  ? 206 LYS C CD  1 
ATOM   5111  C CE  . LYS C 1 206 ? -44.754 21.038  80.640  1.00 34.04  ? 206 LYS C CE  1 
ATOM   5112  N NZ  . LYS C 1 206 ? -45.778 21.492  79.684  1.00 51.08  ? 206 LYS C NZ  1 
ATOM   5113  N N   . MET C 1 207 ? -39.641 17.997  80.761  1.00 39.71  ? 207 MET C N   1 
ATOM   5114  C CA  . MET C 1 207 ? -38.380 18.697  80.920  1.00 39.92  ? 207 MET C CA  1 
ATOM   5115  C C   . MET C 1 207 ? -38.454 20.062  81.585  1.00 45.47  ? 207 MET C C   1 
ATOM   5116  O O   . MET C 1 207 ? -37.684 20.347  82.496  1.00 34.71  ? 207 MET C O   1 
ATOM   5117  C CB  . MET C 1 207 ? -37.686 18.819  79.562  1.00 44.96  ? 207 MET C CB  1 
ATOM   5118  C CG  . MET C 1 207 ? -37.459 17.488  78.871  1.00 48.20  ? 207 MET C CG  1 
ATOM   5119  S SD  . MET C 1 207 ? -36.372 17.619  77.425  1.00 65.17  ? 207 MET C SD  1 
ATOM   5120  C CE  . MET C 1 207 ? -37.477 18.483  76.292  1.00 39.64  ? 207 MET C CE  1 
ATOM   5121  N N   . GLU C 1 208 ? -39.369 20.912  81.131  1.00 42.02  ? 208 GLU C N   1 
ATOM   5122  C CA  . GLU C 1 208 ? -39.487 22.239  81.707  1.00 33.28  ? 208 GLU C CA  1 
ATOM   5123  C C   . GLU C 1 208 ? -39.692 22.210  83.223  1.00 42.95  ? 208 GLU C C   1 
ATOM   5124  O O   . GLU C 1 208 ? -39.316 23.142  83.921  1.00 38.92  ? 208 GLU C O   1 
ATOM   5125  C CB  . GLU C 1 208 ? -40.611 23.017  81.024  1.00 37.05  ? 208 GLU C CB  1 
ATOM   5126  C CG  . GLU C 1 208 ? -40.322 23.347  79.573  1.00 35.51  ? 208 GLU C CG  1 
ATOM   5127  C CD  . GLU C 1 208 ? -40.966 22.379  78.602  1.00 54.58  ? 208 GLU C CD  1 
ATOM   5128  O OE1 . GLU C 1 208 ? -41.292 21.238  79.006  1.00 44.18  ? 208 GLU C OE1 1 
ATOM   5129  O OE2 . GLU C 1 208 ? -41.137 22.759  77.425  1.00 44.68  ? 208 GLU C OE2 1 
ATOM   5130  N N   . HIS C 1 209 ? -40.289 21.135  83.724  1.00 40.47  ? 209 HIS C N   1 
ATOM   5131  C CA  . HIS C 1 209 ? -40.528 20.969  85.155  1.00 35.83  ? 209 HIS C CA  1 
ATOM   5132  C C   . HIS C 1 209 ? -39.210 20.867  85.912  1.00 33.23  ? 209 HIS C C   1 
ATOM   5133  O O   . HIS C 1 209 ? -39.128 21.273  87.062  1.00 43.17  ? 209 HIS C O   1 
ATOM   5134  C CB  . HIS C 1 209 ? -41.353 19.708  85.407  1.00 40.94  ? 209 HIS C CB  1 
ATOM   5135  C CG  . HIS C 1 209 ? -42.767 19.813  84.940  1.00 53.91  ? 209 HIS C CG  1 
ATOM   5136  N ND1 . HIS C 1 209 ? -43.552 18.708  84.692  1.00 41.76  ? 209 HIS C ND1 1 
ATOM   5137  C CD2 . HIS C 1 209 ? -43.551 20.894  84.707  1.00 39.58  ? 209 HIS C CD2 1 
ATOM   5138  C CE1 . HIS C 1 209 ? -44.758 19.104  84.327  1.00 47.09  ? 209 HIS C CE1 1 
ATOM   5139  N NE2 . HIS C 1 209 ? -44.784 20.425  84.330  1.00 42.32  ? 209 HIS C NE2 1 
ATOM   5140  N N   . PHE C 1 210 ? -38.187 20.316  85.262  1.00 36.24  ? 210 PHE C N   1 
ATOM   5141  C CA  . PHE C 1 210 ? -36.869 20.173  85.873  1.00 41.79  ? 210 PHE C CA  1 
ATOM   5142  C C   . PHE C 1 210 ? -36.192 21.525  86.049  1.00 30.55  ? 210 PHE C C   1 
ATOM   5143  O O   . PHE C 1 210 ? -35.533 21.769  87.058  1.00 42.71  ? 210 PHE C O   1 
ATOM   5144  C CB  . PHE C 1 210 ? -35.976 19.254  85.034  1.00 34.95  ? 210 PHE C CB  1 
ATOM   5145  C CG  . PHE C 1 210 ? -36.265 17.788  85.223  1.00 57.29  ? 210 PHE C CG  1 
ATOM   5146  C CD1 . PHE C 1 210 ? -37.398 17.204  84.658  1.00 31.27  ? 210 PHE C CD1 1 
ATOM   5147  C CD2 . PHE C 1 210 ? -35.413 16.993  85.998  1.00 26.56  ? 210 PHE C CD2 1 
ATOM   5148  C CE1 . PHE C 1 210 ? -37.678 15.853  84.864  1.00 56.05  ? 210 PHE C CE1 1 
ATOM   5149  C CE2 . PHE C 1 210 ? -35.685 15.651  86.207  1.00 49.59  ? 210 PHE C CE2 1 
ATOM   5150  C CZ  . PHE C 1 210 ? -36.822 15.073  85.640  1.00 34.29  ? 210 PHE C CZ  1 
ATOM   5151  N N   . LEU C 1 211 ? -36.361 22.397  85.062  1.00 37.00  ? 211 LEU C N   1 
ATOM   5152  C CA  . LEU C 1 211 ? -35.786 23.733  85.112  1.00 41.12  ? 211 LEU C CA  1 
ATOM   5153  C C   . LEU C 1 211 ? -36.418 24.501  86.263  1.00 29.75  ? 211 LEU C C   1 
ATOM   5154  O O   . LEU C 1 211 ? -35.731 25.173  87.021  1.00 36.68  ? 211 LEU C O   1 
ATOM   5155  C CB  . LEU C 1 211 ? -36.035 24.476  83.797  1.00 45.12  ? 211 LEU C CB  1 
ATOM   5156  C CG  . LEU C 1 211 ? -35.678 25.967  83.767  1.00 44.54  ? 211 LEU C CG  1 
ATOM   5157  C CD1 . LEU C 1 211 ? -34.234 26.150  84.138  1.00 29.70  ? 211 LEU C CD1 1 
ATOM   5158  C CD2 . LEU C 1 211 ? -35.955 26.541  82.383  1.00 37.65  ? 211 LEU C CD2 1 
ATOM   5159  N N   . GLU C 1 212 ? -37.732 24.382  86.385  1.00 32.31  ? 212 GLU C N   1 
ATOM   5160  C CA  . GLU C 1 212 ? -38.473 25.046  87.442  1.00 27.22  ? 212 GLU C CA  1 
ATOM   5161  C C   . GLU C 1 212 ? -37.963 24.624  88.817  1.00 34.48  ? 212 GLU C C   1 
ATOM   5162  O O   . GLU C 1 212 ? -37.920 25.432  89.731  1.00 39.72  ? 212 GLU C O   1 
ATOM   5163  C CB  . GLU C 1 212 ? -39.966 24.738  87.296  1.00 37.27  ? 212 GLU C CB  1 
ATOM   5164  C CG  . GLU C 1 212 ? -40.545 25.182  85.942  1.00 36.33  ? 212 GLU C CG  1 
ATOM   5165  C CD  . GLU C 1 212 ? -41.926 24.607  85.640  1.00 50.40  ? 212 GLU C CD  1 
ATOM   5166  O OE1 . GLU C 1 212 ? -42.495 24.940  84.578  1.00 40.20  ? 212 GLU C OE1 1 
ATOM   5167  O OE2 . GLU C 1 212 ? -42.443 23.824  86.461  1.00 48.87  ? 212 GLU C OE2 1 
ATOM   5168  N N   . ALA C 1 213 ? -37.553 23.367  88.953  1.00 27.47  ? 213 ALA C N   1 
ATOM   5169  C CA  . ALA C 1 213 ? -37.043 22.861  90.226  1.00 34.78  ? 213 ALA C CA  1 
ATOM   5170  C C   . ALA C 1 213 ? -35.680 23.440  90.599  1.00 24.86  ? 213 ALA C C   1 
ATOM   5171  O O   . ALA C 1 213 ? -35.441 23.776  91.752  1.00 31.62  ? 213 ALA C O   1 
ATOM   5172  C CB  . ALA C 1 213 ? -36.975 21.327  90.204  1.00 44.06  ? 213 ALA C CB  1 
ATOM   5173  N N   . PHE C 1 214 ? -34.781 23.534  89.631  1.00 29.08  ? 214 PHE C N   1 
ATOM   5174  C CA  . PHE C 1 214 ? -33.472 24.103  89.899  1.00 35.18  ? 214 PHE C CA  1 
ATOM   5175  C C   . PHE C 1 214 ? -33.617 25.611  90.153  1.00 32.06  ? 214 PHE C C   1 
ATOM   5176  O O   . PHE C 1 214 ? -32.906 26.172  90.975  1.00 39.33  ? 214 PHE C O   1 
ATOM   5177  C CB  . PHE C 1 214 ? -32.511 23.814  88.739  1.00 27.23  ? 214 PHE C CB  1 
ATOM   5178  C CG  . PHE C 1 214 ? -32.134 22.347  88.602  1.00 47.68  ? 214 PHE C CG  1 
ATOM   5179  C CD1 . PHE C 1 214 ? -31.493 21.673  89.640  1.00 33.56  ? 214 PHE C CD1 1 
ATOM   5180  C CD2 . PHE C 1 214 ? -32.419 21.642  87.436  1.00 31.98  ? 214 PHE C CD2 1 
ATOM   5181  C CE1 . PHE C 1 214 ? -31.142 20.323  89.516  1.00 36.15  ? 214 PHE C CE1 1 
ATOM   5182  C CE2 . PHE C 1 214 ? -32.075 20.303  87.302  1.00 36.70  ? 214 PHE C CE2 1 
ATOM   5183  C CZ  . PHE C 1 214 ? -31.435 19.639  88.341  1.00 32.51  ? 214 PHE C CZ  1 
ATOM   5184  N N   . LEU C 1 215 ? -34.555 26.256  89.464  1.00 40.99  ? 215 LEU C N   1 
ATOM   5185  C CA  . LEU C 1 215 ? -34.804 27.690  89.654  1.00 46.14  ? 215 LEU C CA  1 
ATOM   5186  C C   . LEU C 1 215 ? -35.287 27.932  91.079  1.00 37.50  ? 215 LEU C C   1 
ATOM   5187  O O   . LEU C 1 215 ? -35.047 28.994  91.656  1.00 41.08  ? 215 LEU C O   1 
ATOM   5188  C CB  . LEU C 1 215 ? -35.871 28.217  88.682  1.00 37.58  ? 215 LEU C CB  1 
ATOM   5189  C CG  . LEU C 1 215 ? -35.553 28.308  87.191  1.00 42.52  ? 215 LEU C CG  1 
ATOM   5190  C CD1 . LEU C 1 215 ? -36.798 28.762  86.434  1.00 38.36  ? 215 LEU C CD1 1 
ATOM   5191  C CD2 . LEU C 1 215 ? -34.398 29.273  86.967  1.00 35.57  ? 215 LEU C CD2 1 
ATOM   5192  N N   . ALA C 1 216 ? -35.970 26.938  91.634  1.00 34.83  ? 216 ALA C N   1 
ATOM   5193  C CA  . ALA C 1 216 ? -36.478 27.027  92.988  1.00 34.29  ? 216 ALA C CA  1 
ATOM   5194  C C   . ALA C 1 216 ? -35.380 26.689  94.015  1.00 29.39  ? 216 ALA C C   1 
ATOM   5195  O O   . ALA C 1 216 ? -35.617 26.728  95.213  1.00 41.81  ? 216 ALA C O   1 
ATOM   5196  C CB  . ALA C 1 216 ? -37.682 26.106  93.148  1.00 33.06  ? 216 ALA C CB  1 
ATOM   5197  N N   . GLY C 1 217 ? -34.185 26.355  93.536  1.00 43.29  ? 217 GLY C N   1 
ATOM   5198  C CA  . GLY C 1 217 ? -33.074 26.064  94.430  1.00 37.47  ? 217 GLY C CA  1 
ATOM   5199  C C   . GLY C 1 217 ? -32.663 24.621  94.718  1.00 50.32  ? 217 GLY C C   1 
ATOM   5200  O O   . GLY C 1 217 ? -31.837 24.381  95.604  1.00 47.81  ? 217 GLY C O   1 
ATOM   5201  N N   . ALA C 1 218 ? -33.211 23.666  93.977  1.00 37.53  ? 218 ALA C N   1 
ATOM   5202  C CA  . ALA C 1 218 ? -32.879 22.266  94.182  1.00 35.08  ? 218 ALA C CA  1 
ATOM   5203  C C   . ALA C 1 218 ? -31.498 21.923  93.639  1.00 28.24  ? 218 ALA C C   1 
ATOM   5204  O O   . ALA C 1 218 ? -31.072 22.467  92.634  1.00 30.79  ? 218 ALA C O   1 
ATOM   5205  C CB  . ALA C 1 218 ? -33.941 21.381  93.528  1.00 29.61  ? 218 ALA C CB  1 
ATOM   5206  N N   . ASP C 1 219 ? -30.800 21.019  94.320  1.00 31.88  ? 219 ASP C N   1 
ATOM   5207  C CA  . ASP C 1 219 ? -29.469 20.587  93.896  1.00 23.59  ? 219 ASP C CA  1 
ATOM   5208  C C   . ASP C 1 219 ? -29.577 19.394  92.970  1.00 24.80  ? 219 ASP C C   1 
ATOM   5209  O O   . ASP C 1 219 ? -28.697 19.134  92.168  1.00 33.48  ? 219 ASP C O   1 
ATOM   5210  C CB  . ASP C 1 219 ? -28.610 20.229  95.104  1.00 37.06  ? 219 ASP C CB  1 
ATOM   5211  C CG  . ASP C 1 219 ? -28.257 21.437  95.937  1.00 49.89  ? 219 ASP C CG  1 
ATOM   5212  O OD1 . ASP C 1 219 ? -27.467 22.270  95.458  1.00 53.88  ? 219 ASP C OD1 1 
ATOM   5213  O OD2 . ASP C 1 219 ? -28.776 21.561  97.065  1.00 49.01  ? 219 ASP C OD2 1 
ATOM   5214  N N   . ALA C 1 220 ? -30.670 18.663  93.091  1.00 31.21  ? 220 ALA C N   1 
ATOM   5215  C CA  . ALA C 1 220 ? -30.902 17.525  92.231  1.00 30.30  ? 220 ALA C CA  1 
ATOM   5216  C C   . ALA C 1 220 ? -32.406 17.393  91.982  1.00 34.44  ? 220 ALA C C   1 
ATOM   5217  O O   . ALA C 1 220 ? -33.224 17.927  92.729  1.00 29.07  ? 220 ALA C O   1 
ATOM   5218  C CB  . ALA C 1 220 ? -30.340 16.260  92.868  1.00 30.23  ? 220 ALA C CB  1 
ATOM   5219  N N   . ALA C 1 221 ? -32.755 16.714  90.899  1.00 29.43  ? 221 ALA C N   1 
ATOM   5220  C CA  . ALA C 1 221 ? -34.147 16.480  90.554  1.00 34.20  ? 221 ALA C CA  1 
ATOM   5221  C C   . ALA C 1 221 ? -34.316 14.976  90.394  1.00 45.55  ? 221 ALA C C   1 
ATOM   5222  O O   . ALA C 1 221 ? -33.735 14.373  89.497  1.00 27.63  ? 221 ALA C O   1 
ATOM   5223  C CB  . ALA C 1 221 ? -34.508 17.195  89.258  1.00 28.82  ? 221 ALA C CB  1 
ATOM   5224  N N   . LEU C 1 222 ? -35.104 14.380  91.283  1.00 39.27  ? 222 LEU C N   1 
ATOM   5225  C CA  . LEU C 1 222 ? -35.355 12.938  91.261  1.00 35.72  ? 222 LEU C CA  1 
ATOM   5226  C C   . LEU C 1 222 ? -36.674 12.646  90.566  1.00 43.68  ? 222 LEU C C   1 
ATOM   5227  O O   . LEU C 1 222 ? -37.625 13.407  90.695  1.00 37.65  ? 222 LEU C O   1 
ATOM   5228  C CB  . LEU C 1 222 ? -35.412 12.385  92.693  1.00 29.93  ? 222 LEU C CB  1 
ATOM   5229  C CG  . LEU C 1 222 ? -35.884 10.938  92.877  1.00 43.58  ? 222 LEU C CG  1 
ATOM   5230  C CD1 . LEU C 1 222 ? -34.769 9.981   92.510  1.00 43.03  ? 222 LEU C CD1 1 
ATOM   5231  C CD2 . LEU C 1 222 ? -36.317 10.709  94.299  1.00 34.38  ? 222 LEU C CD2 1 
ATOM   5232  N N   . ALA C 1 223 ? -36.733 11.544  89.828  1.00 43.33  ? 223 ALA C N   1 
ATOM   5233  C CA  . ALA C 1 223 ? -37.974 11.169  89.153  1.00 45.94  ? 223 ALA C CA  1 
ATOM   5234  C C   . ALA C 1 223 ? -38.021 9.681   88.822  1.00 47.83  ? 223 ALA C C   1 
ATOM   5235  O O   . ALA C 1 223 ? -36.992 9.001   88.791  1.00 44.70  ? 223 ALA C O   1 
ATOM   5236  C CB  . ALA C 1 223 ? -38.164 12.001  87.882  1.00 31.81  ? 223 ALA C CB  1 
ATOM   5237  N N   . ALA C 1 224 ? -39.231 9.193   88.568  1.00 54.10  ? 224 ALA C N   1 
ATOM   5238  C CA  . ALA C 1 224 ? -39.469 7.789   88.233  1.00 53.45  ? 224 ALA C CA  1 
ATOM   5239  C C   . ALA C 1 224 ? -40.394 7.687   87.019  1.00 50.11  ? 224 ALA C C   1 
ATOM   5240  O O   . ALA C 1 224 ? -39.985 7.308   85.911  1.00 43.74  ? 224 ALA C O   1 
ATOM   5241  C CB  . ALA C 1 224 ? -40.101 7.087   89.423  1.00 43.40  ? 224 ALA C CB  1 
ATOM   5242  N N   . SER C 1 225 ? -41.651 8.045   87.252  1.00 59.35  ? 225 SER C N   1 
ATOM   5243  C CA  . SER C 1 225 ? -42.682 8.016   86.225  1.00 58.98  ? 225 SER C CA  1 
ATOM   5244  C C   . SER C 1 225 ? -42.181 8.335   84.815  1.00 48.83  ? 225 SER C C   1 
ATOM   5245  O O   . SER C 1 225 ? -42.262 7.494   83.925  1.00 58.00  ? 225 SER C O   1 
ATOM   5246  C CB  . SER C 1 225 ? -43.800 8.987   86.612  1.00 65.05  ? 225 SER C CB  1 
ATOM   5247  O OG  . SER C 1 225 ? -44.347 8.647   87.875  1.00 47.52  ? 225 SER C OG  1 
ATOM   5248  N N   . VAL C 1 226 ? -41.647 9.540   84.621  1.00 60.29  ? 226 VAL C N   1 
ATOM   5249  C CA  . VAL C 1 226 ? -41.173 9.981   83.307  1.00 39.93  ? 226 VAL C CA  1 
ATOM   5250  C C   . VAL C 1 226 ? -40.023 9.211   82.667  1.00 43.14  ? 226 VAL C C   1 
ATOM   5251  O O   . VAL C 1 226 ? -39.865 9.237   81.449  1.00 42.22  ? 226 VAL C O   1 
ATOM   5252  C CB  . VAL C 1 226 ? -40.795 11.481  83.325  1.00 45.70  ? 226 VAL C CB  1 
ATOM   5253  C CG1 . VAL C 1 226 ? -41.984 12.301  83.757  1.00 42.76  ? 226 VAL C CG1 1 
ATOM   5254  C CG2 . VAL C 1 226 ? -39.618 11.717  84.243  1.00 39.73  ? 226 VAL C CG2 1 
ATOM   5255  N N   . PHE C 1 227 ? -39.196 8.548   83.466  1.00 64.92  ? 227 PHE C N   1 
ATOM   5256  C CA  . PHE C 1 227 ? -38.097 7.782   82.873  1.00 68.82  ? 227 PHE C CA  1 
ATOM   5257  C C   . PHE C 1 227 ? -38.592 6.362   82.653  1.00 71.71  ? 227 PHE C C   1 
ATOM   5258  O O   . PHE C 1 227 ? -38.243 5.712   81.662  1.00 58.94  ? 227 PHE C O   1 
ATOM   5259  C CB  . PHE C 1 227 ? -36.865 7.792   83.780  1.00 45.17  ? 227 PHE C CB  1 
ATOM   5260  C CG  . PHE C 1 227 ? -36.269 9.154   83.955  1.00 52.46  ? 227 PHE C CG  1 
ATOM   5261  C CD1 . PHE C 1 227 ? -36.010 9.956   82.846  1.00 43.66  ? 227 PHE C CD1 1 
ATOM   5262  C CD2 . PHE C 1 227 ? -35.993 9.654   85.226  1.00 38.68  ? 227 PHE C CD2 1 
ATOM   5263  C CE1 . PHE C 1 227 ? -35.493 11.233  82.999  1.00 41.76  ? 227 PHE C CE1 1 
ATOM   5264  C CE2 . PHE C 1 227 ? -35.474 10.935  85.386  1.00 44.76  ? 227 PHE C CE2 1 
ATOM   5265  C CZ  . PHE C 1 227 ? -35.225 11.726  84.266  1.00 37.82  ? 227 PHE C CZ  1 
ATOM   5266  N N   . HIS C 1 228 ? -39.414 5.896   83.591  1.00 64.11  ? 228 HIS C N   1 
ATOM   5267  C CA  . HIS C 1 228 ? -40.003 4.570   83.500  1.00 66.29  ? 228 HIS C CA  1 
ATOM   5268  C C   . HIS C 1 228 ? -40.823 4.569   82.209  1.00 73.82  ? 228 HIS C C   1 
ATOM   5269  O O   . HIS C 1 228 ? -40.528 3.807   81.282  1.00 72.73  ? 228 HIS C O   1 
ATOM   5270  C CB  . HIS C 1 228 ? -40.881 4.310   84.730  1.00 61.30  ? 228 HIS C CB  1 
ATOM   5271  C CG  . HIS C 1 228 ? -40.100 4.115   85.999  1.00 103.15 ? 228 HIS C CG  1 
ATOM   5272  N ND1 . HIS C 1 228 ? -38.807 4.578   86.162  1.00 102.76 ? 228 HIS C ND1 1 
ATOM   5273  C CD2 . HIS C 1 228 ? -40.436 3.528   87.177  1.00 103.15 ? 228 HIS C CD2 1 
ATOM   5274  C CE1 . HIS C 1 228 ? -38.384 4.285   87.381  1.00 75.27  ? 228 HIS C CE1 1 
ATOM   5275  N NE2 . HIS C 1 228 ? -39.353 3.651   88.017  1.00 78.17  ? 228 HIS C NE2 1 
ATOM   5276  N N   . PHE C 1 229 ? -41.822 5.453   82.134  1.00 79.49  ? 229 PHE C N   1 
ATOM   5277  C CA  . PHE C 1 229 ? -42.668 5.585   80.938  1.00 69.92  ? 229 PHE C CA  1 
ATOM   5278  C C   . PHE C 1 229 ? -41.841 5.927   79.676  1.00 76.80  ? 229 PHE C C   1 
ATOM   5279  O O   . PHE C 1 229 ? -42.327 5.789   78.543  1.00 61.61  ? 229 PHE C O   1 
ATOM   5280  C CB  . PHE C 1 229 ? -43.718 6.687   81.141  1.00 79.66  ? 229 PHE C CB  1 
ATOM   5281  C CG  . PHE C 1 229 ? -44.854 6.311   82.065  1.00 88.13  ? 229 PHE C CG  1 
ATOM   5282  C CD1 . PHE C 1 229 ? -44.608 5.731   83.312  1.00 92.74  ? 229 PHE C CD1 1 
ATOM   5283  C CD2 . PHE C 1 229 ? -46.176 6.572   81.695  1.00 85.70  ? 229 PHE C CD2 1 
ATOM   5284  C CE1 . PHE C 1 229 ? -45.668 5.416   84.180  1.00 103.15 ? 229 PHE C CE1 1 
ATOM   5285  C CE2 . PHE C 1 229 ? -47.243 6.263   82.549  1.00 81.01  ? 229 PHE C CE2 1 
ATOM   5286  C CZ  . PHE C 1 229 ? -46.993 5.684   83.794  1.00 87.57  ? 229 PHE C CZ  1 
ATOM   5287  N N   . ARG C 1 230 ? -40.606 6.388   79.870  1.00 71.86  ? 230 ARG C N   1 
ATOM   5288  C CA  . ARG C 1 230 ? -39.735 6.747   78.749  1.00 68.68  ? 230 ARG C CA  1 
ATOM   5289  C C   . ARG C 1 230 ? -40.268 8.009   78.023  1.00 60.62  ? 230 ARG C C   1 
ATOM   5290  O O   . ARG C 1 230 ? -40.075 8.193   76.815  1.00 62.98  ? 230 ARG C O   1 
ATOM   5291  C CB  . ARG C 1 230 ? -39.647 5.549   77.801  1.00 71.14  ? 230 ARG C CB  1 
ATOM   5292  C CG  . ARG C 1 230 ? -38.601 5.633   76.710  1.00 86.68  ? 230 ARG C CG  1 
ATOM   5293  C CD  . ARG C 1 230 ? -37.187 5.501   77.248  1.00 96.19  ? 230 ARG C CD  1 
ATOM   5294  N NE  . ARG C 1 230 ? -36.242 5.148   76.184  1.00 99.20  ? 230 ARG C NE  1 
ATOM   5295  C CZ  . ARG C 1 230 ? -36.092 3.912   75.708  1.00 103.15 ? 230 ARG C CZ  1 
ATOM   5296  N NH1 . ARG C 1 230 ? -36.823 2.914   76.211  1.00 97.78  ? 230 ARG C NH1 1 
ATOM   5297  N NH2 . ARG C 1 230 ? -35.221 3.665   74.728  1.00 81.92  ? 230 ARG C NH2 1 
ATOM   5298  N N   . GLU C 1 231 ? -40.933 8.875   78.784  1.00 46.60  ? 231 GLU C N   1 
ATOM   5299  C CA  . GLU C 1 231 ? -41.504 10.114  78.260  1.00 54.02  ? 231 GLU C CA  1 
ATOM   5300  C C   . GLU C 1 231 ? -40.466 11.218  78.054  1.00 55.46  ? 231 GLU C C   1 
ATOM   5301  O O   . GLU C 1 231 ? -40.719 12.173  77.324  1.00 46.95  ? 231 GLU C O   1 
ATOM   5302  C CB  . GLU C 1 231 ? -42.567 10.648  79.211  1.00 50.98  ? 231 GLU C CB  1 
ATOM   5303  C CG  . GLU C 1 231 ? -43.740 9.726   79.453  1.00 57.28  ? 231 GLU C CG  1 
ATOM   5304  C CD  . GLU C 1 231 ? -44.793 10.377  80.325  1.00 64.08  ? 231 GLU C CD  1 
ATOM   5305  O OE1 . GLU C 1 231 ? -45.865 9.768   80.508  1.00 90.08  ? 231 GLU C OE1 1 
ATOM   5306  O OE2 . GLU C 1 231 ? -44.556 11.503  80.831  1.00 89.24  ? 231 GLU C OE2 1 
ATOM   5307  N N   . ILE C 1 232 ? -39.313 11.083  78.715  1.00 59.29  ? 232 ILE C N   1 
ATOM   5308  C CA  . ILE C 1 232 ? -38.223 12.053  78.629  1.00 32.78  ? 232 ILE C CA  1 
ATOM   5309  C C   . ILE C 1 232 ? -36.882 11.371  78.318  1.00 50.12  ? 232 ILE C C   1 
ATOM   5310  O O   . ILE C 1 232 ? -36.520 10.358  78.934  1.00 59.02  ? 232 ILE C O   1 
ATOM   5311  C CB  . ILE C 1 232 ? -38.047 12.852  79.972  1.00 43.43  ? 232 ILE C CB  1 
ATOM   5312  C CG1 . ILE C 1 232 ? -39.344 13.550  80.361  1.00 45.68  ? 232 ILE C CG1 1 
ATOM   5313  C CG2 . ILE C 1 232 ? -36.943 13.906  79.829  1.00 44.83  ? 232 ILE C CG2 1 
ATOM   5314  C CD1 . ILE C 1 232 ? -39.216 14.413  81.594  1.00 42.88  ? 232 ILE C CD1 1 
ATOM   5315  N N   . ASP C 1 233 ? -36.157 11.935  77.354  1.00 40.67  ? 233 ASP C N   1 
ATOM   5316  C CA  . ASP C 1 233 ? -34.829 11.458  76.972  1.00 50.57  ? 233 ASP C CA  1 
ATOM   5317  C C   . ASP C 1 233 ? -33.892 12.245  77.903  1.00 45.97  ? 233 ASP C C   1 
ATOM   5318  O O   . ASP C 1 233 ? -33.965 13.471  77.973  1.00 42.30  ? 233 ASP C O   1 
ATOM   5319  C CB  . ASP C 1 233 ? -34.543 11.823  75.509  1.00 55.93  ? 233 ASP C CB  1 
ATOM   5320  C CG  . ASP C 1 233 ? -33.199 11.313  75.019  1.00 57.81  ? 233 ASP C CG  1 
ATOM   5321  O OD1 . ASP C 1 233 ? -33.135 10.148  74.575  1.00 67.69  ? 233 ASP C OD1 1 
ATOM   5322  O OD2 . ASP C 1 233 ? -32.209 12.071  75.073  1.00 44.05  ? 233 ASP C OD2 1 
ATOM   5323  N N   . VAL C 1 234 ? -33.021 11.546  78.615  1.00 43.29  ? 234 VAL C N   1 
ATOM   5324  C CA  . VAL C 1 234 ? -32.115 12.195  79.550  1.00 47.58  ? 234 VAL C CA  1 
ATOM   5325  C C   . VAL C 1 234 ? -31.115 13.149  78.888  1.00 43.48  ? 234 VAL C C   1 
ATOM   5326  O O   . VAL C 1 234 ? -30.835 14.210  79.430  1.00 47.62  ? 234 VAL C O   1 
ATOM   5327  C CB  . VAL C 1 234 ? -31.400 11.125  80.420  1.00 37.86  ? 234 VAL C CB  1 
ATOM   5328  C CG1 . VAL C 1 234 ? -30.410 11.768  81.371  1.00 33.60  ? 234 VAL C CG1 1 
ATOM   5329  C CG2 . VAL C 1 234 ? -32.446 10.359  81.207  1.00 18.66  ? 234 VAL C CG2 1 
ATOM   5330  N N   . ARG C 1 235 ? -30.596 12.781  77.717  1.00 45.77  ? 235 ARG C N   1 
ATOM   5331  C CA  . ARG C 1 235 ? -29.653 13.625  76.981  1.00 41.05  ? 235 ARG C CA  1 
ATOM   5332  C C   . ARG C 1 235 ? -30.319 14.926  76.554  1.00 48.18  ? 235 ARG C C   1 
ATOM   5333  O O   . ARG C 1 235 ? -29.733 16.003  76.676  1.00 42.63  ? 235 ARG C O   1 
ATOM   5334  C CB  . ARG C 1 235 ? -29.143 12.899  75.739  1.00 49.70  ? 235 ARG C CB  1 
ATOM   5335  C CG  . ARG C 1 235 ? -27.712 12.464  75.840  1.00 68.46  ? 235 ARG C CG  1 
ATOM   5336  C CD  . ARG C 1 235 ? -26.782 13.425  75.134  1.00 90.49  ? 235 ARG C CD  1 
ATOM   5337  N NE  . ARG C 1 235 ? -25.382 13.162  75.479  1.00 96.22  ? 235 ARG C NE  1 
ATOM   5338  C CZ  . ARG C 1 235 ? -24.345 13.835  74.982  1.00 98.50  ? 235 ARG C CZ  1 
ATOM   5339  N NH1 . ARG C 1 235 ? -24.543 14.818  74.103  1.00 92.58  ? 235 ARG C NH1 1 
ATOM   5340  N NH2 . ARG C 1 235 ? -23.110 13.539  75.378  1.00 85.45  ? 235 ARG C NH2 1 
ATOM   5341  N N   . GLU C 1 236 ? -31.536 14.805  76.028  1.00 42.31  ? 236 GLU C N   1 
ATOM   5342  C CA  . GLU C 1 236 ? -32.328 15.956  75.595  1.00 45.58  ? 236 GLU C CA  1 
ATOM   5343  C C   . GLU C 1 236 ? -32.508 16.905  76.772  1.00 37.49  ? 236 GLU C C   1 
ATOM   5344  O O   . GLU C 1 236 ? -32.280 18.096  76.643  1.00 38.99  ? 236 GLU C O   1 
ATOM   5345  C CB  . GLU C 1 236 ? -33.721 15.520  75.121  1.00 51.10  ? 236 GLU C CB  1 
ATOM   5346  C CG  . GLU C 1 236 ? -33.838 15.150  73.656  1.00 86.06  ? 236 GLU C CG  1 
ATOM   5347  C CD  . GLU C 1 236 ? -35.283 14.844  73.246  1.00 85.04  ? 236 GLU C CD  1 
ATOM   5348  O OE1 . GLU C 1 236 ? -36.174 15.705  73.460  1.00 60.34  ? 236 GLU C OE1 1 
ATOM   5349  O OE2 . GLU C 1 236 ? -35.522 13.740  72.709  1.00 92.31  ? 236 GLU C OE2 1 
ATOM   5350  N N   . LEU C 1 237 ? -32.929 16.346  77.909  1.00 30.56  ? 237 LEU C N   1 
ATOM   5351  C CA  . LEU C 1 237 ? -33.165 17.093  79.140  1.00 30.93  ? 237 LEU C CA  1 
ATOM   5352  C C   . LEU C 1 237 ? -31.935 17.875  79.599  1.00 36.01  ? 237 LEU C C   1 
ATOM   5353  O O   . LEU C 1 237 ? -32.020 19.064  79.885  1.00 45.07  ? 237 LEU C O   1 
ATOM   5354  C CB  . LEU C 1 237 ? -33.606 16.140  80.247  1.00 32.24  ? 237 LEU C CB  1 
ATOM   5355  C CG  . LEU C 1 237 ? -33.847 16.778  81.610  1.00 40.80  ? 237 LEU C CG  1 
ATOM   5356  C CD1 . LEU C 1 237 ? -35.017 17.745  81.526  1.00 25.44  ? 237 LEU C CD1 1 
ATOM   5357  C CD2 . LEU C 1 237 ? -34.096 15.685  82.639  1.00 27.40  ? 237 LEU C CD2 1 
ATOM   5358  N N   . LYS C 1 238 ? -30.793 17.200  79.670  1.00 32.94  ? 238 LYS C N   1 
ATOM   5359  C CA  . LYS C 1 238 ? -29.562 17.844  80.077  1.00 29.70  ? 238 LYS C CA  1 
ATOM   5360  C C   . LYS C 1 238 ? -29.149 18.946  79.094  1.00 44.80  ? 238 LYS C C   1 
ATOM   5361  O O   . LYS C 1 238 ? -28.649 19.992  79.512  1.00 44.94  ? 238 LYS C O   1 
ATOM   5362  C CB  . LYS C 1 238 ? -28.448 16.807  80.211  1.00 42.01  ? 238 LYS C CB  1 
ATOM   5363  C CG  . LYS C 1 238 ? -28.601 15.869  81.400  1.00 36.14  ? 238 LYS C CG  1 
ATOM   5364  C CD  . LYS C 1 238 ? -27.343 15.034  81.583  1.00 41.75  ? 238 LYS C CD  1 
ATOM   5365  C CE  . LYS C 1 238 ? -27.363 14.249  82.878  1.00 38.90  ? 238 LYS C CE  1 
ATOM   5366  N NZ  . LYS C 1 238 ? -26.058 13.590  83.105  1.00 41.59  ? 238 LYS C NZ  1 
ATOM   5367  N N   . GLU C 1 239 ? -29.348 18.707  77.796  1.00 39.67  ? 239 GLU C N   1 
ATOM   5368  C CA  . GLU C 1 239 ? -29.015 19.697  76.766  1.00 38.88  ? 239 GLU C CA  1 
ATOM   5369  C C   . GLU C 1 239 ? -29.846 20.942  77.061  1.00 42.01  ? 239 GLU C C   1 
ATOM   5370  O O   . GLU C 1 239 ? -29.340 22.067  77.126  1.00 48.10  ? 239 GLU C O   1 
ATOM   5371  C CB  . GLU C 1 239 ? -29.403 19.195  75.372  1.00 62.13  ? 239 GLU C CB  1 
ATOM   5372  C CG  . GLU C 1 239 ? -28.600 18.038  74.803  1.00 89.98  ? 239 GLU C CG  1 
ATOM   5373  C CD  . GLU C 1 239 ? -27.247 18.464  74.278  1.00 103.15 ? 239 GLU C CD  1 
ATOM   5374  O OE1 . GLU C 1 239 ? -26.675 17.736  73.419  1.00 102.81 ? 239 GLU C OE1 1 
ATOM   5375  O OE2 . GLU C 1 239 ? -26.757 19.525  74.728  1.00 103.10 ? 239 GLU C OE2 1 
ATOM   5376  N N   . TYR C 1 240 ? -31.138 20.705  77.230  1.00 29.14  ? 240 TYR C N   1 
ATOM   5377  C CA  . TYR C 1 240 ? -32.114 21.738  77.522  1.00 40.63  ? 240 TYR C CA  1 
ATOM   5378  C C   . TYR C 1 240 ? -31.776 22.567  78.770  1.00 41.39  ? 240 TYR C C   1 
ATOM   5379  O O   . TYR C 1 240 ? -31.811 23.796  78.729  1.00 44.87  ? 240 TYR C O   1 
ATOM   5380  C CB  . TYR C 1 240 ? -33.479 21.076  77.680  1.00 33.43  ? 240 TYR C CB  1 
ATOM   5381  C CG  . TYR C 1 240 ? -34.569 22.002  78.128  1.00 47.76  ? 240 TYR C CG  1 
ATOM   5382  C CD1 . TYR C 1 240 ? -35.092 22.974  77.273  1.00 36.40  ? 240 TYR C CD1 1 
ATOM   5383  C CD2 . TYR C 1 240 ? -35.072 21.918  79.417  1.00 30.25  ? 240 TYR C CD2 1 
ATOM   5384  C CE1 . TYR C 1 240 ? -36.097 23.838  77.706  1.00 43.13  ? 240 TYR C CE1 1 
ATOM   5385  C CE2 . TYR C 1 240 ? -36.064 22.771  79.857  1.00 43.98  ? 240 TYR C CE2 1 
ATOM   5386  C CZ  . TYR C 1 240 ? -36.575 23.723  79.009  1.00 39.39  ? 240 TYR C CZ  1 
ATOM   5387  O OH  . TYR C 1 240 ? -37.569 24.541  79.477  1.00 52.51  ? 240 TYR C OH  1 
ATOM   5388  N N   . LEU C 1 241 ? -31.457 21.894  79.874  1.00 36.70  ? 241 LEU C N   1 
ATOM   5389  C CA  . LEU C 1 241 ? -31.131 22.584  81.110  1.00 29.89  ? 241 LEU C CA  1 
ATOM   5390  C C   . LEU C 1 241 ? -29.854 23.411  80.993  1.00 40.92  ? 241 LEU C C   1 
ATOM   5391  O O   . LEU C 1 241 ? -29.770 24.523  81.521  1.00 34.25  ? 241 LEU C O   1 
ATOM   5392  C CB  . LEU C 1 241 ? -31.019 21.574  82.251  1.00 38.71  ? 241 LEU C CB  1 
ATOM   5393  C CG  . LEU C 1 241 ? -32.377 20.996  82.644  1.00 32.87  ? 241 LEU C CG  1 
ATOM   5394  C CD1 . LEU C 1 241 ? -32.193 19.759  83.480  1.00 31.58  ? 241 LEU C CD1 1 
ATOM   5395  C CD2 . LEU C 1 241 ? -33.180 22.051  83.370  1.00 26.66  ? 241 LEU C CD2 1 
ATOM   5396  N N   . LYS C 1 242 ? -28.862 22.855  80.307  1.00 34.77  ? 242 LYS C N   1 
ATOM   5397  C CA  . LYS C 1 242 ? -27.597 23.542  80.091  1.00 36.37  ? 242 LYS C CA  1 
ATOM   5398  C C   . LYS C 1 242 ? -27.894 24.813  79.290  1.00 39.79  ? 242 LYS C C   1 
ATOM   5399  O O   . LYS C 1 242 ? -27.421 25.894  79.630  1.00 35.88  ? 242 LYS C O   1 
ATOM   5400  C CB  . LYS C 1 242 ? -26.633 22.626  79.331  1.00 32.38  ? 242 LYS C CB  1 
ATOM   5401  C CG  . LYS C 1 242 ? -25.466 23.322  78.688  1.00 39.05  ? 242 LYS C CG  1 
ATOM   5402  C CD  . LYS C 1 242 ? -24.617 24.093  79.690  1.00 56.37  ? 242 LYS C CD  1 
ATOM   5403  C CE  . LYS C 1 242 ? -23.763 23.186  80.564  1.00 67.28  ? 242 LYS C CE  1 
ATOM   5404  N NZ  . LYS C 1 242 ? -22.839 23.997  81.396  1.00 55.13  ? 242 LYS C NZ  1 
ATOM   5405  N N   . LYS C 1 243 ? -28.703 24.668  78.243  1.00 32.13  ? 243 LYS C N   1 
ATOM   5406  C CA  . LYS C 1 243 ? -29.090 25.792  77.393  1.00 36.90  ? 243 LYS C CA  1 
ATOM   5407  C C   . LYS C 1 243 ? -29.708 26.912  78.212  1.00 34.06  ? 243 LYS C C   1 
ATOM   5408  O O   . LYS C 1 243 ? -29.524 28.083  77.905  1.00 50.48  ? 243 LYS C O   1 
ATOM   5409  C CB  . LYS C 1 243 ? -30.102 25.348  76.325  1.00 36.00  ? 243 LYS C CB  1 
ATOM   5410  C CG  . LYS C 1 243 ? -30.559 26.465  75.416  1.00 44.78  ? 243 LYS C CG  1 
ATOM   5411  C CD  . LYS C 1 243 ? -31.650 26.031  74.444  1.00 52.91  ? 243 LYS C CD  1 
ATOM   5412  C CE  . LYS C 1 243 ? -32.085 27.200  73.553  1.00 39.76  ? 243 LYS C CE  1 
ATOM   5413  N NZ  . LYS C 1 243 ? -33.330 26.935  72.804  1.00 43.36  ? 243 LYS C NZ  1 
ATOM   5414  N N   . HIS C 1 244 ? -30.431 26.563  79.266  1.00 35.18  ? 244 HIS C N   1 
ATOM   5415  C CA  . HIS C 1 244 ? -31.060 27.587  80.065  1.00 39.64  ? 244 HIS C CA  1 
ATOM   5416  C C   . HIS C 1 244 ? -30.434 27.885  81.425  1.00 34.96  ? 244 HIS C C   1 
ATOM   5417  O O   . HIS C 1 244 ? -31.131 28.179  82.394  1.00 36.51  ? 244 HIS C O   1 
ATOM   5418  C CB  . HIS C 1 244 ? -32.544 27.278  80.170  1.00 26.50  ? 244 HIS C CB  1 
ATOM   5419  C CG  . HIS C 1 244 ? -33.214 27.192  78.835  1.00 42.18  ? 244 HIS C CG  1 
ATOM   5420  N ND1 . HIS C 1 244 ? -33.243 28.249  77.948  1.00 33.51  ? 244 HIS C ND1 1 
ATOM   5421  C CD2 . HIS C 1 244 ? -33.836 26.163  78.211  1.00 41.13  ? 244 HIS C CD2 1 
ATOM   5422  C CE1 . HIS C 1 244 ? -33.854 27.873  76.839  1.00 48.99  ? 244 HIS C CE1 1 
ATOM   5423  N NE2 . HIS C 1 244 ? -34.223 26.612  76.972  1.00 45.28  ? 244 HIS C NE2 1 
ATOM   5424  N N   . GLY C 1 245 ? -29.103 27.805  81.470  1.00 45.54  ? 245 GLY C N   1 
ATOM   5425  C CA  . GLY C 1 245 ? -28.349 28.136  82.670  1.00 39.18  ? 245 GLY C CA  1 
ATOM   5426  C C   . GLY C 1 245 ? -27.963 27.133  83.741  1.00 54.97  ? 245 GLY C C   1 
ATOM   5427  O O   . GLY C 1 245 ? -27.116 27.441  84.575  1.00 43.36  ? 245 GLY C O   1 
ATOM   5428  N N   . VAL C 1 246 ? -28.559 25.946  83.731  1.00 52.91  ? 246 VAL C N   1 
ATOM   5429  C CA  . VAL C 1 246 ? -28.276 24.940  84.751  1.00 39.42  ? 246 VAL C CA  1 
ATOM   5430  C C   . VAL C 1 246 ? -26.986 24.183  84.474  1.00 35.91  ? 246 VAL C C   1 
ATOM   5431  O O   . VAL C 1 246 ? -26.802 23.652  83.383  1.00 43.67  ? 246 VAL C O   1 
ATOM   5432  C CB  . VAL C 1 246 ? -29.423 23.921  84.834  1.00 51.99  ? 246 VAL C CB  1 
ATOM   5433  C CG1 . VAL C 1 246 ? -29.240 23.016  86.044  1.00 39.24  ? 246 VAL C CG1 1 
ATOM   5434  C CG2 . VAL C 1 246 ? -30.756 24.649  84.874  1.00 40.67  ? 246 VAL C CG2 1 
ATOM   5435  N N   . ASN C 1 247 ? -26.093 24.136  85.460  1.00 36.54  ? 247 ASN C N   1 
ATOM   5436  C CA  . ASN C 1 247 ? -24.831 23.413  85.299  1.00 39.76  ? 247 ASN C CA  1 
ATOM   5437  C C   . ASN C 1 247 ? -25.006 21.910  85.518  1.00 37.68  ? 247 ASN C C   1 
ATOM   5438  O O   . ASN C 1 247 ? -24.769 21.412  86.611  1.00 40.98  ? 247 ASN C O   1 
ATOM   5439  C CB  . ASN C 1 247 ? -23.777 23.924  86.273  1.00 31.72  ? 247 ASN C CB  1 
ATOM   5440  C CG  . ASN C 1 247 ? -22.414 23.357  85.977  1.00 37.46  ? 247 ASN C CG  1 
ATOM   5441  O OD1 . ASN C 1 247 ? -21.885 23.557  84.888  1.00 53.73  ? 247 ASN C OD1 1 
ATOM   5442  N ND2 . ASN C 1 247 ? -21.839 22.635  86.933  1.00 50.90  ? 247 ASN C ND2 1 
ATOM   5443  N N   . VAL C 1 248 ? -25.416 21.194  84.475  1.00 46.07  ? 248 VAL C N   1 
ATOM   5444  C CA  . VAL C 1 248 ? -25.636 19.756  84.574  1.00 29.13  ? 248 VAL C CA  1 
ATOM   5445  C C   . VAL C 1 248 ? -24.426 18.946  84.136  1.00 44.49  ? 248 VAL C C   1 
ATOM   5446  O O   . VAL C 1 248 ? -23.443 19.502  83.640  1.00 46.79  ? 248 VAL C O   1 
ATOM   5447  C CB  . VAL C 1 248 ? -26.863 19.309  83.744  1.00 34.11  ? 248 VAL C CB  1 
ATOM   5448  C CG1 . VAL C 1 248 ? -28.135 19.842  84.372  1.00 39.44  ? 248 VAL C CG1 1 
ATOM   5449  C CG2 . VAL C 1 248 ? -26.733 19.788  82.314  1.00 38.41  ? 248 VAL C CG2 1 
ATOM   5450  N N   . ARG C 1 249 ? -24.514 17.628  84.321  1.00 49.95  ? 249 ARG C N   1 
ATOM   5451  C CA  . ARG C 1 249 ? -23.438 16.703  83.983  1.00 37.58  ? 249 ARG C CA  1 
ATOM   5452  C C   . ARG C 1 249 ? -23.570 16.240  82.546  1.00 49.58  ? 249 ARG C C   1 
ATOM   5453  O O   . ARG C 1 249 ? -24.267 15.276  82.243  1.00 51.92  ? 249 ARG C O   1 
ATOM   5454  C CB  . ARG C 1 249 ? -23.476 15.503  84.935  1.00 46.28  ? 249 ARG C CB  1 
ATOM   5455  C CG  . ARG C 1 249 ? -22.134 14.794  85.127  1.00 72.58  ? 249 ARG C CG  1 
ATOM   5456  C CD  . ARG C 1 249 ? -21.937 13.595  84.204  1.00 44.22  ? 249 ARG C CD  1 
ATOM   5457  N NE  . ARG C 1 249 ? -22.927 12.554  84.463  1.00 59.31  ? 249 ARG C NE  1 
ATOM   5458  C CZ  . ARG C 1 249 ? -22.835 11.303  84.029  1.00 43.84  ? 249 ARG C CZ  1 
ATOM   5459  N NH1 . ARG C 1 249 ? -21.788 10.927  83.319  1.00 40.97  ? 249 ARG C NH1 1 
ATOM   5460  N NH2 . ARG C 1 249 ? -23.803 10.437  84.287  1.00 45.19  ? 249 ARG C NH2 1 
ATOM   5461  N N   . LEU C 1 250 ? -22.888 16.937  81.656  1.00 47.09  ? 250 LEU C N   1 
ATOM   5462  C CA  . LEU C 1 250 ? -22.947 16.608  80.248  1.00 60.70  ? 250 LEU C CA  1 
ATOM   5463  C C   . LEU C 1 250 ? -21.805 15.698  79.870  1.00 62.40  ? 250 LEU C C   1 
ATOM   5464  O O   . LEU C 1 250 ? -20.670 15.929  80.273  1.00 58.85  ? 250 LEU C O   1 
ATOM   5465  C CB  . LEU C 1 250 ? -22.850 17.878  79.415  1.00 50.67  ? 250 LEU C CB  1 
ATOM   5466  C CG  . LEU C 1 250 ? -23.801 18.959  79.898  1.00 55.59  ? 250 LEU C CG  1 
ATOM   5467  C CD1 . LEU C 1 250 ? -23.524 20.265  79.168  1.00 58.66  ? 250 LEU C CD1 1 
ATOM   5468  C CD2 . LEU C 1 250 ? -25.218 18.472  79.677  1.00 55.06  ? 250 LEU C CD2 1 
ATOM   5469  N N   . GLU C 1 251 ? -22.101 14.660  79.101  1.00 61.85  ? 251 GLU C N   1 
ATOM   5470  C CA  . GLU C 1 251 ? -21.048 13.766  78.660  1.00 77.67  ? 251 GLU C CA  1 
ATOM   5471  C C   . GLU C 1 251 ? -20.512 14.297  77.340  1.00 74.89  ? 251 GLU C C   1 
ATOM   5472  O O   . GLU C 1 251 ? -20.982 15.312  76.815  1.00 67.93  ? 251 GLU C O   1 
ATOM   5473  C CB  . GLU C 1 251 ? -21.571 12.333  78.468  1.00 82.54  ? 251 GLU C CB  1 
ATOM   5474  C CG  . GLU C 1 251 ? -22.021 11.654  79.742  1.00 54.14  ? 251 GLU C CG  1 
ATOM   5475  C CD  . GLU C 1 251 ? -23.521 11.461  79.784  1.00 85.90  ? 251 GLU C CD  1 
ATOM   5476  O OE1 . GLU C 1 251 ? -24.138 11.844  80.809  1.00 71.53  ? 251 GLU C OE1 1 
ATOM   5477  O OE2 . GLU C 1 251 ? -24.083 10.925  78.793  1.00 69.47  ? 251 GLU C OE2 1 
ATOM   5478  N N   . GLY C 1 252 ? -19.514 13.606  76.814  1.00 85.78  ? 252 GLY C N   1 
ATOM   5479  C CA  . GLY C 1 252 ? -18.934 13.998  75.550  1.00 90.52  ? 252 GLY C CA  1 
ATOM   5480  C C   . GLY C 1 252 ? -18.914 12.751  74.694  1.00 97.04  ? 252 GLY C C   1 
ATOM   5481  O O   . GLY C 1 252 ? -18.440 11.711  75.154  1.00 91.80  ? 252 GLY C O   1 
ATOM   5482  N N   . LEU C 1 253 ? -19.454 12.838  73.478  1.00 103.15 ? 253 LEU C N   1 
ATOM   5483  C CA  . LEU C 1 253 ? -19.472 11.697  72.547  1.00 103.15 ? 253 LEU C CA  1 
ATOM   5484  C C   . LEU C 1 253 ? -19.692 12.177  71.111  1.00 103.15 ? 253 LEU C C   1 
ATOM   5485  O O   . LEU C 1 253 ? -20.523 11.538  70.411  1.00 103.15 ? 253 LEU C O   1 
ATOM   5486  C CB  . LEU C 1 253 ? -20.573 10.674  72.913  1.00 98.64  ? 253 LEU C CB  1 
ATOM   5487  C CG  . LEU C 1 253 ? -20.433 9.806   74.182  1.00 103.15 ? 253 LEU C CG  1 
ATOM   5488  C CD1 . LEU C 1 253 ? -21.609 8.809   74.267  1.00 87.17  ? 253 LEU C CD1 1 
ATOM   5489  C CD2 . LEU C 1 253 ? -19.092 9.055   74.166  1.00 69.48  ? 253 LEU C CD2 1 
ATOM   5490  O OXT . LEU C 1 253 ? -19.022 13.166  70.700  1.00 103.15 ? 253 LEU C OXT 1 
ATOM   5491  N N   . MET D 2 1   ? 0.111   -8.895  81.333  1.00 63.78  ? 1   MET D N   1 
ATOM   5492  C CA  . MET D 2 1   ? -0.512  -7.794  82.128  1.00 75.11  ? 1   MET D CA  1 
ATOM   5493  C C   . MET D 2 1   ? -1.014  -8.314  83.477  1.00 61.78  ? 1   MET D C   1 
ATOM   5494  O O   . MET D 2 1   ? -2.087  -8.914  83.556  1.00 63.82  ? 1   MET D O   1 
ATOM   5495  C CB  . MET D 2 1   ? -1.670  -7.159  81.330  1.00 76.93  ? 1   MET D CB  1 
ATOM   5496  C CG  . MET D 2 1   ? -2.519  -6.135  82.110  1.00 92.34  ? 1   MET D CG  1 
ATOM   5497  S SD  . MET D 2 1   ? -1.555  -4.996  83.182  1.00 88.37  ? 1   MET D SD  1 
ATOM   5498  C CE  . MET D 2 1   ? -1.311  -3.523  82.130  1.00 54.12  ? 1   MET D CE  1 
ATOM   5499  N N   . ARG D 2 2   ? -0.214  -8.097  84.524  1.00 59.40  ? 2   ARG D N   1 
ATOM   5500  C CA  . ARG D 2 2   ? -0.549  -8.517  85.887  1.00 56.20  ? 2   ARG D CA  1 
ATOM   5501  C C   . ARG D 2 2   ? -1.085  -7.311  86.636  1.00 48.62  ? 2   ARG D C   1 
ATOM   5502  O O   . ARG D 2 2   ? -0.324  -6.398  86.965  1.00 50.99  ? 2   ARG D O   1 
ATOM   5503  C CB  . ARG D 2 2   ? 0.690   -9.026  86.641  1.00 60.27  ? 2   ARG D CB  1 
ATOM   5504  C CG  . ARG D 2 2   ? 1.210   -10.399 86.228  1.00 86.14  ? 2   ARG D CG  1 
ATOM   5505  C CD  . ARG D 2 2   ? 2.453   -10.822 87.056  1.00 89.47  ? 2   ARG D CD  1 
ATOM   5506  N NE  . ARG D 2 2   ? 2.185   -10.931 88.494  1.00 57.15  ? 2   ARG D NE  1 
ATOM   5507  C CZ  . ARG D 2 2   ? 1.270   -11.738 89.026  1.00 66.81  ? 2   ARG D CZ  1 
ATOM   5508  N NH1 . ARG D 2 2   ? 0.528   -12.517 88.240  1.00 60.81  ? 2   ARG D NH1 1 
ATOM   5509  N NH2 . ARG D 2 2   ? 1.083   -11.759 90.342  1.00 44.79  ? 2   ARG D NH2 1 
ATOM   5510  N N   . ILE D 2 3   ? -2.384  -7.294  86.899  1.00 43.19  ? 3   ILE D N   1 
ATOM   5511  C CA  . ILE D 2 3   ? -2.965  -6.178  87.632  1.00 49.46  ? 3   ILE D CA  1 
ATOM   5512  C C   . ILE D 2 3   ? -3.271  -6.577  89.071  1.00 44.58  ? 3   ILE D C   1 
ATOM   5513  O O   . ILE D 2 3   ? -3.969  -7.561  89.321  1.00 40.50  ? 3   ILE D O   1 
ATOM   5514  C CB  . ILE D 2 3   ? -4.281  -5.670  86.987  1.00 48.10  ? 3   ILE D CB  1 
ATOM   5515  C CG1 . ILE D 2 3   ? -4.033  -5.237  85.539  1.00 50.04  ? 3   ILE D CG1 1 
ATOM   5516  C CG2 . ILE D 2 3   ? -4.836  -4.502  87.800  1.00 41.07  ? 3   ILE D CG2 1 
ATOM   5517  C CD1 . ILE D 2 3   ? -5.267  -4.733  84.841  1.00 37.01  ? 3   ILE D CD1 1 
ATOM   5518  N N   . GLY D 2 4   ? -2.743  -5.797  90.007  1.00 39.39  ? 4   GLY D N   1 
ATOM   5519  C CA  . GLY D 2 4   ? -2.986  -6.054  91.412  1.00 47.87  ? 4   GLY D CA  1 
ATOM   5520  C C   . GLY D 2 4   ? -3.812  -4.949  92.063  1.00 50.30  ? 4   GLY D C   1 
ATOM   5521  O O   . GLY D 2 4   ? -3.661  -3.766  91.734  1.00 42.19  ? 4   GLY D O   1 
ATOM   5522  N N   . ILE D 2 5   ? -4.679  -5.331  92.994  1.00 43.67  ? 5   ILE D N   1 
ATOM   5523  C CA  . ILE D 2 5   ? -5.525  -4.376  93.692  1.00 39.08  ? 5   ILE D CA  1 
ATOM   5524  C C   . ILE D 2 5   ? -5.514  -4.638  95.204  1.00 39.54  ? 5   ILE D C   1 
ATOM   5525  O O   . ILE D 2 5   ? -6.022  -5.658  95.666  1.00 43.69  ? 5   ILE D O   1 
ATOM   5526  C CB  . ILE D 2 5   ? -6.987  -4.453  93.151  1.00 49.77  ? 5   ILE D CB  1 
ATOM   5527  C CG1 . ILE D 2 5   ? -7.028  -3.950  91.709  1.00 40.63  ? 5   ILE D CG1 1 
ATOM   5528  C CG2 . ILE D 2 5   ? -7.929  -3.636  94.024  1.00 36.92  ? 5   ILE D CG2 1 
ATOM   5529  C CD1 . ILE D 2 5   ? -8.388  -4.004  91.082  1.00 41.83  ? 5   ILE D CD1 1 
ATOM   5530  N N   . ILE D 2 6   ? -4.929  -3.717  95.966  1.00 31.70  ? 6   ILE D N   1 
ATOM   5531  C CA  . ILE D 2 6   ? -4.867  -3.842  97.419  1.00 32.56  ? 6   ILE D CA  1 
ATOM   5532  C C   . ILE D 2 6   ? -6.296  -3.894  97.969  1.00 48.83  ? 6   ILE D C   1 
ATOM   5533  O O   . ILE D 2 6   ? -7.106  -3.001  97.716  1.00 42.17  ? 6   ILE D O   1 
ATOM   5534  C CB  . ILE D 2 6   ? -4.070  -2.651  98.043  1.00 35.68  ? 6   ILE D CB  1 
ATOM   5535  C CG1 . ILE D 2 6   ? -2.586  -2.800  97.692  1.00 36.73  ? 6   ILE D CG1 1 
ATOM   5536  C CG2 . ILE D 2 6   ? -4.269  -2.597  99.553  1.00 38.08  ? 6   ILE D CG2 1 
ATOM   5537  C CD1 . ILE D 2 6   ? -1.733  -1.610  98.050  1.00 56.72  ? 6   ILE D CD1 1 
ATOM   5538  N N   . SER D 2 7   ? -6.600  -4.948  98.719  1.00 40.24  ? 7   SER D N   1 
ATOM   5539  C CA  . SER D 2 7   ? -7.943  -5.119  99.257  1.00 55.50  ? 7   SER D CA  1 
ATOM   5540  C C   . SER D 2 7   ? -8.096  -5.038  100.776 1.00 49.33  ? 7   SER D C   1 
ATOM   5541  O O   . SER D 2 7   ? -9.165  -5.352  101.308 1.00 59.99  ? 7   SER D O   1 
ATOM   5542  C CB  . SER D 2 7   ? -8.511  -6.448  98.768  1.00 35.94  ? 7   SER D CB  1 
ATOM   5543  O OG  . SER D 2 7   ? -7.665  -7.508  99.158  1.00 58.70  ? 7   SER D OG  1 
ATOM   5544  N N   . VAL D 2 8   ? -7.048  -4.605  101.471 1.00 60.97  ? 8   VAL D N   1 
ATOM   5545  C CA  . VAL D 2 8   ? -7.094  -4.499  102.928 1.00 54.11  ? 8   VAL D CA  1 
ATOM   5546  C C   . VAL D 2 8   ? -7.707  -3.189  103.385 1.00 64.71  ? 8   VAL D C   1 
ATOM   5547  O O   . VAL D 2 8   ? -8.716  -3.190  104.097 1.00 61.14  ? 8   VAL D O   1 
ATOM   5548  C CB  . VAL D 2 8   ? -5.672  -4.624  103.567 1.00 63.67  ? 8   VAL D CB  1 
ATOM   5549  C CG1 . VAL D 2 8   ? -5.060  -5.963  103.210 1.00 60.06  ? 8   VAL D CG1 1 
ATOM   5550  C CG2 . VAL D 2 8   ? -4.764  -3.495  103.090 1.00 48.03  ? 8   VAL D CG2 1 
ATOM   5551  N N   . GLY D 2 9   ? -7.080  -2.083  102.974 1.00 75.29  ? 9   GLY D N   1 
ATOM   5552  C CA  . GLY D 2 9   ? -7.521  -0.736  103.331 1.00 46.22  ? 9   GLY D CA  1 
ATOM   5553  C C   . GLY D 2 9   ? -9.019  -0.599  103.474 1.00 39.49  ? 9   GLY D C   1 
ATOM   5554  O O   . GLY D 2 9   ? -9.765  -1.348  102.833 1.00 61.85  ? 9   GLY D O   1 
ATOM   5555  N N   . PRO D 2 10  ? -9.488  0.365   104.289 1.00 43.65  ? 10  PRO D N   1 
ATOM   5556  C CA  . PRO D 2 10  ? -10.900 0.663   104.577 1.00 46.55  ? 10  PRO D CA  1 
ATOM   5557  C C   . PRO D 2 10  ? -11.766 1.037   103.379 1.00 42.96  ? 10  PRO D C   1 
ATOM   5558  O O   . PRO D 2 10  ? -11.258 1.401   102.328 1.00 52.47  ? 10  PRO D O   1 
ATOM   5559  C CB  . PRO D 2 10  ? -10.810 1.801   105.582 1.00 33.28  ? 10  PRO D CB  1 
ATOM   5560  C CG  . PRO D 2 10  ? -9.597  2.532   105.107 1.00 46.03  ? 10  PRO D CG  1 
ATOM   5561  C CD  . PRO D 2 10  ? -8.621  1.416   104.846 1.00 37.29  ? 10  PRO D CD  1 
ATOM   5562  N N   . GLY D 2 11  ? -13.079 0.948   103.565 1.00 47.20  ? 11  GLY D N   1 
ATOM   5563  C CA  . GLY D 2 11  ? -14.017 1.283   102.512 1.00 48.74  ? 11  GLY D CA  1 
ATOM   5564  C C   . GLY D 2 11  ? -14.255 0.195   101.477 1.00 64.74  ? 11  GLY D C   1 
ATOM   5565  O O   . GLY D 2 11  ? -13.521 -0.801  101.402 1.00 54.07  ? 11  GLY D O   1 
ATOM   5566  N N   . ASN D 2 12  ? -15.296 0.384   100.672 1.00 43.60  ? 12  ASN D N   1 
ATOM   5567  C CA  . ASN D 2 12  ? -15.617 -0.578  99.628  1.00 51.09  ? 12  ASN D CA  1 
ATOM   5568  C C   . ASN D 2 12  ? -14.465 -0.533  98.641  1.00 50.09  ? 12  ASN D C   1 
ATOM   5569  O O   . ASN D 2 12  ? -14.129 0.540   98.146  1.00 62.06  ? 12  ASN D O   1 
ATOM   5570  C CB  . ASN D 2 12  ? -16.906 -0.178  98.900  1.00 40.34  ? 12  ASN D CB  1 
ATOM   5571  C CG  . ASN D 2 12  ? -17.408 -1.259  97.933  1.00 50.62  ? 12  ASN D CG  1 
ATOM   5572  O OD1 . ASN D 2 12  ? -16.644 -1.821  97.140  1.00 57.65  ? 12  ASN D OD1 1 
ATOM   5573  N ND2 . ASN D 2 12  ? -18.712 -1.539  97.987  1.00 71.68  ? 12  ASN D ND2 1 
ATOM   5574  N N   . ILE D 2 13  ? -13.838 -1.671  98.370  1.00 42.60  ? 13  ILE D N   1 
ATOM   5575  C CA  . ILE D 2 13  ? -12.765 -1.676  97.391  1.00 36.76  ? 13  ILE D CA  1 
ATOM   5576  C C   . ILE D 2 13  ? -13.139 -2.583  96.211  1.00 31.03  ? 13  ILE D C   1 
ATOM   5577  O O   . ILE D 2 13  ? -12.484 -2.575  95.178  1.00 39.97  ? 13  ILE D O   1 
ATOM   5578  C CB  . ILE D 2 13  ? -11.404 -2.084  98.037  1.00 53.55  ? 13  ILE D CB  1 
ATOM   5579  C CG1 . ILE D 2 13  ? -11.519 -3.411  98.792  1.00 46.65  ? 13  ILE D CG1 1 
ATOM   5580  C CG2 . ILE D 2 13  ? -10.941 -0.986  98.973  1.00 46.24  ? 13  ILE D CG2 1 
ATOM   5581  C CD1 . ILE D 2 13  ? -11.397 -4.624  97.909  1.00 38.96  ? 13  ILE D CD1 1 
ATOM   5582  N N   . MET D 2 14  ? -14.222 -3.338  96.369  1.00 32.85  ? 14  MET D N   1 
ATOM   5583  C CA  . MET D 2 14  ? -14.709 -4.230  95.322  1.00 40.53  ? 14  MET D CA  1 
ATOM   5584  C C   . MET D 2 14  ? -15.249 -3.491  94.093  1.00 53.43  ? 14  MET D C   1 
ATOM   5585  O O   . MET D 2 14  ? -15.126 -3.989  92.976  1.00 49.47  ? 14  MET D O   1 
ATOM   5586  C CB  . MET D 2 14  ? -15.794 -5.161  95.872  1.00 35.32  ? 14  MET D CB  1 
ATOM   5587  C CG  . MET D 2 14  ? -15.256 -6.227  96.812  1.00 42.19  ? 14  MET D CG  1 
ATOM   5588  S SD  . MET D 2 14  ? -13.963 -7.250  96.021  1.00 56.76  ? 14  MET D SD  1 
ATOM   5589  C CE  . MET D 2 14  ? -15.002 -8.507  95.163  1.00 47.38  ? 14  MET D CE  1 
ATOM   5590  N N   . ASN D 2 15  ? -15.861 -2.323  94.291  1.00 48.25  ? 15  ASN D N   1 
ATOM   5591  C CA  . ASN D 2 15  ? -16.364 -1.558  93.161  1.00 31.19  ? 15  ASN D CA  1 
ATOM   5592  C C   . ASN D 2 15  ? -15.214 -1.270  92.210  1.00 36.63  ? 15  ASN D C   1 
ATOM   5593  O O   . ASN D 2 15  ? -15.316 -1.530  91.023  1.00 35.27  ? 15  ASN D O   1 
ATOM   5594  C CB  . ASN D 2 15  ? -16.977 -0.239  93.615  1.00 28.44  ? 15  ASN D CB  1 
ATOM   5595  C CG  . ASN D 2 15  ? -18.413 -0.385  94.049  1.00 42.08  ? 15  ASN D CG  1 
ATOM   5596  O OD1 . ASN D 2 15  ? -19.292 -0.726  93.248  1.00 60.78  ? 15  ASN D OD1 1 
ATOM   5597  N ND2 . ASN D 2 15  ? -18.670 -0.119  95.317  1.00 45.12  ? 15  ASN D ND2 1 
ATOM   5598  N N   . LEU D 2 16  ? -14.115 -0.739  92.736  1.00 40.02  ? 16  LEU D N   1 
ATOM   5599  C CA  . LEU D 2 16  ? -12.970 -0.432  91.894  1.00 42.77  ? 16  LEU D CA  1 
ATOM   5600  C C   . LEU D 2 16  ? -12.554 -1.730  91.218  1.00 56.76  ? 16  LEU D C   1 
ATOM   5601  O O   . LEU D 2 16  ? -12.265 -1.766  90.019  1.00 50.89  ? 16  LEU D O   1 
ATOM   5602  C CB  . LEU D 2 16  ? -11.809 0.109   92.725  1.00 50.37  ? 16  LEU D CB  1 
ATOM   5603  C CG  . LEU D 2 16  ? -10.787 1.010   92.014  1.00 54.86  ? 16  LEU D CG  1 
ATOM   5604  C CD1 . LEU D 2 16  ? -9.512  1.067   92.839  1.00 35.02  ? 16  LEU D CD1 1 
ATOM   5605  C CD2 . LEU D 2 16  ? -10.479 0.492   90.630  1.00 42.20  ? 16  LEU D CD2 1 
ATOM   5606  N N   . TYR D 2 17  ? -12.535 -2.803  92.000  1.00 43.68  ? 17  TYR D N   1 
ATOM   5607  C CA  . TYR D 2 17  ? -12.176 -4.104  91.473  1.00 56.55  ? 17  TYR D CA  1 
ATOM   5608  C C   . TYR D 2 17  ? -13.017 -4.430  90.236  1.00 54.44  ? 17  TYR D C   1 
ATOM   5609  O O   . TYR D 2 17  ? -12.477 -4.718  89.168  1.00 43.57  ? 17  TYR D O   1 
ATOM   5610  C CB  . TYR D 2 17  ? -12.393 -5.182  92.533  1.00 46.53  ? 17  TYR D CB  1 
ATOM   5611  C CG  . TYR D 2 17  ? -12.200 -6.575  92.001  1.00 46.95  ? 17  TYR D CG  1 
ATOM   5612  C CD1 . TYR D 2 17  ? -10.929 -7.046  91.675  1.00 40.67  ? 17  TYR D CD1 1 
ATOM   5613  C CD2 . TYR D 2 17  ? -13.290 -7.417  91.802  1.00 35.35  ? 17  TYR D CD2 1 
ATOM   5614  C CE1 . TYR D 2 17  ? -10.750 -8.330  91.165  1.00 55.02  ? 17  TYR D CE1 1 
ATOM   5615  C CE2 . TYR D 2 17  ? -13.124 -8.687  91.296  1.00 49.87  ? 17  TYR D CE2 1 
ATOM   5616  C CZ  . TYR D 2 17  ? -11.854 -9.139  90.981  1.00 47.81  ? 17  TYR D CZ  1 
ATOM   5617  O OH  . TYR D 2 17  ? -11.698 -10.401 90.481  1.00 72.92  ? 17  TYR D OH  1 
ATOM   5618  N N   . ARG D 2 18  ? -14.335 -4.385  90.389  1.00 36.92  ? 18  ARG D N   1 
ATOM   5619  C CA  . ARG D 2 18  ? -15.227 -4.677  89.280  1.00 54.57  ? 18  ARG D CA  1 
ATOM   5620  C C   . ARG D 2 18  ? -15.035 -3.714  88.105  1.00 55.54  ? 18  ARG D C   1 
ATOM   5621  O O   . ARG D 2 18  ? -15.102 -4.123  86.947  1.00 64.06  ? 18  ARG D O   1 
ATOM   5622  C CB  . ARG D 2 18  ? -16.687 -4.640  89.738  1.00 64.74  ? 18  ARG D CB  1 
ATOM   5623  C CG  . ARG D 2 18  ? -17.003 -5.529  90.945  1.00 66.79  ? 18  ARG D CG  1 
ATOM   5624  C CD  . ARG D 2 18  ? -18.500 -5.835  91.028  1.00 72.58  ? 18  ARG D CD  1 
ATOM   5625  N NE  . ARG D 2 18  ? -18.934 -6.205  92.374  1.00 77.21  ? 18  ARG D NE  1 
ATOM   5626  C CZ  . ARG D 2 18  ? -19.039 -5.348  93.385  1.00 76.38  ? 18  ARG D CZ  1 
ATOM   5627  N NH1 . ARG D 2 18  ? -18.746 -4.063  93.206  1.00 61.69  ? 18  ARG D NH1 1 
ATOM   5628  N NH2 . ARG D 2 18  ? -19.428 -5.770  94.580  1.00 78.05  ? 18  ARG D NH2 1 
ATOM   5629  N N   . GLY D 2 19  ? -14.795 -2.441  88.399  1.00 47.40  ? 19  GLY D N   1 
ATOM   5630  C CA  . GLY D 2 19  ? -14.604 -1.466  87.339  1.00 38.61  ? 19  GLY D CA  1 
ATOM   5631  C C   . GLY D 2 19  ? -13.338 -1.722  86.548  1.00 43.41  ? 19  GLY D C   1 
ATOM   5632  O O   . GLY D 2 19  ? -13.282 -1.476  85.350  1.00 41.12  ? 19  GLY D O   1 
ATOM   5633  N N   . VAL D 2 20  ? -12.308 -2.207  87.228  1.00 44.47  ? 20  VAL D N   1 
ATOM   5634  C CA  . VAL D 2 20  ? -11.039 -2.508  86.581  1.00 32.40  ? 20  VAL D CA  1 
ATOM   5635  C C   . VAL D 2 20  ? -11.179 -3.770  85.736  1.00 35.79  ? 20  VAL D C   1 
ATOM   5636  O O   . VAL D 2 20  ? -10.566 -3.890  84.688  1.00 36.77  ? 20  VAL D O   1 
ATOM   5637  C CB  . VAL D 2 20  ? -9.917  -2.686  87.624  1.00 39.80  ? 20  VAL D CB  1 
ATOM   5638  C CG1 . VAL D 2 20  ? -8.703  -3.355  86.995  1.00 45.10  ? 20  VAL D CG1 1 
ATOM   5639  C CG2 . VAL D 2 20  ? -9.527  -1.338  88.175  1.00 29.40  ? 20  VAL D CG2 1 
ATOM   5640  N N   . LYS D 2 21  ? -11.990 -4.709  86.196  1.00 32.30  ? 21  LYS D N   1 
ATOM   5641  C CA  . LYS D 2 21  ? -12.207 -5.925  85.441  1.00 40.81  ? 21  LYS D CA  1 
ATOM   5642  C C   . LYS D 2 21  ? -12.954 -5.551  84.159  1.00 50.80  ? 21  LYS D C   1 
ATOM   5643  O O   . LYS D 2 21  ? -12.658 -6.082  83.082  1.00 63.97  ? 21  LYS D O   1 
ATOM   5644  C CB  . LYS D 2 21  ? -13.012 -6.943  86.264  1.00 39.91  ? 21  LYS D CB  1 
ATOM   5645  C CG  . LYS D 2 21  ? -13.378 -8.197  85.474  1.00 67.16  ? 21  LYS D CG  1 
ATOM   5646  C CD  . LYS D 2 21  ? -14.096 -9.245  86.326  1.00 79.23  ? 21  LYS D CD  1 
ATOM   5647  C CE  . LYS D 2 21  ? -13.159 -9.846  87.375  1.00 89.62  ? 21  LYS D CE  1 
ATOM   5648  N NZ  . LYS D 2 21  ? -13.852 -10.863 88.216  1.00 96.01  ? 21  LYS D NZ  1 
ATOM   5649  N N   . ARG D 2 22  ? -13.906 -4.624  84.272  1.00 48.40  ? 22  ARG D N   1 
ATOM   5650  C CA  . ARG D 2 22  ? -14.669 -4.167  83.113  1.00 51.68  ? 22  ARG D CA  1 
ATOM   5651  C C   . ARG D 2 22  ? -13.766 -3.428  82.141  1.00 47.33  ? 22  ARG D C   1 
ATOM   5652  O O   . ARG D 2 22  ? -13.845 -3.634  80.932  1.00 56.31  ? 22  ARG D O   1 
ATOM   5653  C CB  . ARG D 2 22  ? -15.798 -3.221  83.520  1.00 37.31  ? 22  ARG D CB  1 
ATOM   5654  C CG  . ARG D 2 22  ? -16.947 -3.871  84.222  1.00 39.68  ? 22  ARG D CG  1 
ATOM   5655  C CD  . ARG D 2 22  ? -18.008 -2.842  84.522  1.00 37.57  ? 22  ARG D CD  1 
ATOM   5656  N NE  . ARG D 2 22  ? -18.662 -3.111  85.795  1.00 60.09  ? 22  ARG D NE  1 
ATOM   5657  C CZ  . ARG D 2 22  ? -18.545 -2.346  86.877  1.00 39.60  ? 22  ARG D CZ  1 
ATOM   5658  N NH1 . ARG D 2 22  ? -17.798 -1.244  86.859  1.00 36.23  ? 22  ARG D NH1 1 
ATOM   5659  N NH2 . ARG D 2 22  ? -19.182 -2.693  87.985  1.00 40.82  ? 22  ARG D NH2 1 
ATOM   5660  N N   . ALA D 2 23  ? -12.909 -2.571  82.682  1.00 35.77  ? 23  ALA D N   1 
ATOM   5661  C CA  . ALA D 2 23  ? -11.992 -1.783  81.875  1.00 31.14  ? 23  ALA D CA  1 
ATOM   5662  C C   . ALA D 2 23  ? -11.016 -2.637  81.076  1.00 42.67  ? 23  ALA D C   1 
ATOM   5663  O O   . ALA D 2 23  ? -10.683 -2.298  79.940  1.00 47.21  ? 23  ALA D O   1 
ATOM   5664  C CB  . ALA D 2 23  ? -11.215 -0.811  82.765  1.00 34.02  ? 23  ALA D CB  1 
ATOM   5665  N N   . SER D 2 24  ? -10.558 -3.739  81.669  1.00 44.68  ? 24  SER D N   1 
ATOM   5666  C CA  . SER D 2 24  ? -9.596  -4.612  81.003  1.00 58.10  ? 24  SER D CA  1 
ATOM   5667  C C   . SER D 2 24  ? -10.219 -5.541  79.961  1.00 57.52  ? 24  SER D C   1 
ATOM   5668  O O   . SER D 2 24  ? -9.505  -6.139  79.164  1.00 59.25  ? 24  SER D O   1 
ATOM   5669  C CB  . SER D 2 24  ? -8.822  -5.440  82.035  1.00 43.96  ? 24  SER D CB  1 
ATOM   5670  O OG  . SER D 2 24  ? -9.676  -6.327  82.740  1.00 56.11  ? 24  SER D OG  1 
ATOM   5671  N N   . GLU D 2 25  ? -11.543 -5.657  79.970  1.00 46.90  ? 25  GLU D N   1 
ATOM   5672  C CA  . GLU D 2 25  ? -12.256 -6.514  79.026  1.00 52.63  ? 25  GLU D CA  1 
ATOM   5673  C C   . GLU D 2 25  ? -11.593 -6.673  77.658  1.00 52.58  ? 25  GLU D C   1 
ATOM   5674  O O   . GLU D 2 25  ? -11.260 -7.775  77.239  1.00 51.86  ? 25  GLU D O   1 
ATOM   5675  C CB  . GLU D 2 25  ? -13.677 -5.993  78.797  1.00 39.04  ? 25  GLU D CB  1 
ATOM   5676  C CG  . GLU D 2 25  ? -14.680 -6.386  79.873  1.00 87.17  ? 25  GLU D CG  1 
ATOM   5677  C CD  . GLU D 2 25  ? -16.039 -5.759  79.639  1.00 85.61  ? 25  GLU D CD  1 
ATOM   5678  O OE1 . GLU D 2 25  ? -16.606 -5.978  78.542  1.00 73.99  ? 25  GLU D OE1 1 
ATOM   5679  O OE2 . GLU D 2 25  ? -16.534 -5.047  80.548  1.00 77.71  ? 25  GLU D OE2 1 
ATOM   5680  N N   . ASN D 2 26  ? -11.394 -5.564  76.961  1.00 62.16  ? 26  ASN D N   1 
ATOM   5681  C CA  . ASN D 2 26  ? -10.829 -5.633  75.628  1.00 50.09  ? 26  ASN D CA  1 
ATOM   5682  C C   . ASN D 2 26  ? -9.322  -5.869  75.527  1.00 53.09  ? 26  ASN D C   1 
ATOM   5683  O O   . ASN D 2 26  ? -8.772  -5.874  74.427  1.00 54.46  ? 26  ASN D O   1 
ATOM   5684  C CB  . ASN D 2 26  ? -11.265 -4.385  74.842  1.00 41.86  ? 26  ASN D CB  1 
ATOM   5685  C CG  . ASN D 2 26  ? -12.797 -4.237  74.794  1.00 61.42  ? 26  ASN D CG  1 
ATOM   5686  O OD1 . ASN D 2 26  ? -13.529 -5.226  74.669  1.00 48.03  ? 26  ASN D OD1 1 
ATOM   5687  N ND2 . ASN D 2 26  ? -13.280 -3.002  74.894  1.00 59.46  ? 26  ASN D ND2 1 
ATOM   5688  N N   . PHE D 2 27  ? -8.653  -6.103  76.654  1.00 43.74  ? 27  PHE D N   1 
ATOM   5689  C CA  . PHE D 2 27  ? -7.215  -6.329  76.613  1.00 38.33  ? 27  PHE D CA  1 
ATOM   5690  C C   . PHE D 2 27  ? -6.800  -7.803  76.661  1.00 43.15  ? 27  PHE D C   1 
ATOM   5691  O O   . PHE D 2 27  ? -7.478  -8.636  77.252  1.00 49.81  ? 27  PHE D O   1 
ATOM   5692  C CB  . PHE D 2 27  ? -6.526  -5.541  77.720  1.00 43.17  ? 27  PHE D CB  1 
ATOM   5693  C CG  . PHE D 2 27  ? -6.649  -4.049  77.571  1.00 44.26  ? 27  PHE D CG  1 
ATOM   5694  C CD1 . PHE D 2 27  ? -7.830  -3.395  77.906  1.00 46.13  ? 27  PHE D CD1 1 
ATOM   5695  C CD2 . PHE D 2 27  ? -5.573  -3.293  77.121  1.00 48.52  ? 27  PHE D CD2 1 
ATOM   5696  C CE1 . PHE D 2 27  ? -7.934  -2.015  77.800  1.00 37.79  ? 27  PHE D CE1 1 
ATOM   5697  C CE2 . PHE D 2 27  ? -5.667  -1.918  77.010  1.00 40.86  ? 27  PHE D CE2 1 
ATOM   5698  C CZ  . PHE D 2 27  ? -6.851  -1.276  77.352  1.00 45.35  ? 27  PHE D CZ  1 
ATOM   5699  N N   . GLU D 2 28  ? -5.679  -8.108  76.012  1.00 55.29  ? 28  GLU D N   1 
ATOM   5700  C CA  . GLU D 2 28  ? -5.144  -9.469  75.919  1.00 51.94  ? 28  GLU D CA  1 
ATOM   5701  C C   . GLU D 2 28  ? -4.259  -9.884  77.097  1.00 48.87  ? 28  GLU D C   1 
ATOM   5702  O O   . GLU D 2 28  ? -3.415  -9.121  77.563  1.00 60.81  ? 28  GLU D O   1 
ATOM   5703  C CB  . GLU D 2 28  ? -4.328  -9.618  74.624  1.00 50.70  ? 28  GLU D CB  1 
ATOM   5704  C CG  . GLU D 2 28  ? -5.108  -9.368  73.327  1.00 60.46  ? 28  GLU D CG  1 
ATOM   5705  C CD  . GLU D 2 28  ? -5.879  -10.588 72.849  1.00 60.79  ? 28  GLU D CD  1 
ATOM   5706  O OE1 . GLU D 2 28  ? -5.237  -11.543 72.375  1.00 68.37  ? 28  GLU D OE1 1 
ATOM   5707  O OE2 . GLU D 2 28  ? -7.123  -10.602 72.949  1.00 68.71  ? 28  GLU D OE2 1 
ATOM   5708  N N   . ASP D 2 29  ? -4.445  -11.108 77.571  1.00 52.95  ? 29  ASP D N   1 
ATOM   5709  C CA  . ASP D 2 29  ? -3.636  -11.615 78.672  1.00 71.47  ? 29  ASP D CA  1 
ATOM   5710  C C   . ASP D 2 29  ? -3.752  -10.745 79.924  1.00 69.60  ? 29  ASP D C   1 
ATOM   5711  O O   . ASP D 2 29  ? -2.766  -10.522 80.623  1.00 73.84  ? 29  ASP D O   1 
ATOM   5712  C CB  . ASP D 2 29  ? -2.164  -11.677 78.254  1.00 58.04  ? 29  ASP D CB  1 
ATOM   5713  C CG  . ASP D 2 29  ? -1.940  -12.517 77.008  1.00 76.11  ? 29  ASP D CG  1 
ATOM   5714  O OD1 . ASP D 2 29  ? -2.114  -13.757 77.078  1.00 86.18  ? 29  ASP D OD1 1 
ATOM   5715  O OD2 . ASP D 2 29  ? -1.587  -11.937 75.955  1.00 96.05  ? 29  ASP D OD2 1 
ATOM   5716  N N   . VAL D 2 30  ? -4.952  -10.262 80.216  1.00 64.56  ? 30  VAL D N   1 
ATOM   5717  C CA  . VAL D 2 30  ? -5.126  -9.422  81.382  1.00 63.76  ? 30  VAL D CA  1 
ATOM   5718  C C   . VAL D 2 30  ? -5.398  -10.288 82.591  1.00 67.76  ? 30  VAL D C   1 
ATOM   5719  O O   . VAL D 2 30  ? -6.159  -11.257 82.511  1.00 48.24  ? 30  VAL D O   1 
ATOM   5720  C CB  . VAL D 2 30  ? -6.288  -8.433  81.196  1.00 73.31  ? 30  VAL D CB  1 
ATOM   5721  C CG1 . VAL D 2 30  ? -7.431  -8.784  82.146  1.00 73.07  ? 30  VAL D CG1 1 
ATOM   5722  C CG2 . VAL D 2 30  ? -5.793  -7.012  81.451  1.00 84.43  ? 30  VAL D CG2 1 
ATOM   5723  N N   . SER D 2 31  ? -4.771  -9.930  83.709  1.00 54.99  ? 31  SER D N   1 
ATOM   5724  C CA  . SER D 2 31  ? -4.942  -10.671 84.954  1.00 56.97  ? 31  SER D CA  1 
ATOM   5725  C C   . SER D 2 31  ? -5.141  -9.700  86.122  1.00 52.86  ? 31  SER D C   1 
ATOM   5726  O O   . SER D 2 31  ? -4.416  -8.710  86.243  1.00 51.73  ? 31  SER D O   1 
ATOM   5727  C CB  . SER D 2 31  ? -3.722  -11.561 85.201  1.00 56.40  ? 31  SER D CB  1 
ATOM   5728  O OG  . SER D 2 31  ? -3.889  -12.328 86.372  1.00 45.67  ? 31  SER D OG  1 
ATOM   5729  N N   . ILE D 2 32  ? -6.123  -9.989  86.971  1.00 38.62  ? 32  ILE D N   1 
ATOM   5730  C CA  . ILE D 2 32  ? -6.442  -9.136  88.113  1.00 52.90  ? 32  ILE D CA  1 
ATOM   5731  C C   . ILE D 2 32  ? -6.562  -9.903  89.428  1.00 55.33  ? 32  ILE D C   1 
ATOM   5732  O O   . ILE D 2 32  ? -7.414  -10.791 89.572  1.00 46.79  ? 32  ILE D O   1 
ATOM   5733  C CB  . ILE D 2 32  ? -7.785  -8.410  87.914  1.00 53.30  ? 32  ILE D CB  1 
ATOM   5734  C CG1 . ILE D 2 32  ? -7.893  -7.869  86.485  1.00 78.32  ? 32  ILE D CG1 1 
ATOM   5735  C CG2 . ILE D 2 32  ? -7.903  -7.286  88.922  1.00 54.99  ? 32  ILE D CG2 1 
ATOM   5736  C CD1 . ILE D 2 32  ? -9.264  -7.299  86.138  1.00 58.56  ? 32  ILE D CD1 1 
ATOM   5737  N N   . GLU D 2 33  ? -5.738  -9.526  90.398  1.00 51.49  ? 33  GLU D N   1 
ATOM   5738  C CA  . GLU D 2 33  ? -5.735  -10.173 91.703  1.00 56.91  ? 33  GLU D CA  1 
ATOM   5739  C C   . GLU D 2 33  ? -5.910  -9.166  92.846  1.00 63.14  ? 33  GLU D C   1 
ATOM   5740  O O   . GLU D 2 33  ? -5.436  -8.027  92.759  1.00 50.17  ? 33  GLU D O   1 
ATOM   5741  C CB  . GLU D 2 33  ? -4.410  -10.917 91.910  1.00 56.61  ? 33  GLU D CB  1 
ATOM   5742  C CG  . GLU D 2 33  ? -4.258  -12.239 91.168  1.00 74.28  ? 33  GLU D CG  1 
ATOM   5743  C CD  . GLU D 2 33  ? -2.830  -12.806 91.272  1.00 94.12  ? 33  GLU D CD  1 
ATOM   5744  O OE1 . GLU D 2 33  ? -2.256  -12.811 92.388  1.00 76.50  ? 33  GLU D OE1 1 
ATOM   5745  O OE2 . GLU D 2 33  ? -2.282  -13.250 90.233  1.00 79.49  ? 33  GLU D OE2 1 
ATOM   5746  N N   . LEU D 2 34  ? -6.595  -9.590  93.908  1.00 43.38  ? 34  LEU D N   1 
ATOM   5747  C CA  . LEU D 2 34  ? -6.779  -8.742  95.083  1.00 58.35  ? 34  LEU D CA  1 
ATOM   5748  C C   . LEU D 2 34  ? -5.532  -8.991  95.929  1.00 62.99  ? 34  LEU D C   1 
ATOM   5749  O O   . LEU D 2 34  ? -5.202  -10.149 96.214  1.00 54.56  ? 34  LEU D O   1 
ATOM   5750  C CB  . LEU D 2 34  ? -8.015  -9.162  95.881  1.00 52.23  ? 34  LEU D CB  1 
ATOM   5751  C CG  . LEU D 2 34  ? -9.361  -9.143  95.161  1.00 55.29  ? 34  LEU D CG  1 
ATOM   5752  C CD1 . LEU D 2 34  ? -10.375 -9.968  95.944  1.00 40.17  ? 34  LEU D CD1 1 
ATOM   5753  C CD2 . LEU D 2 34  ? -9.820  -7.710  94.984  1.00 32.01  ? 34  LEU D CD2 1 
ATOM   5754  N N   . VAL D 2 35  ? -4.853  -7.918  96.329  1.00 36.73  ? 35  VAL D N   1 
ATOM   5755  C CA  . VAL D 2 35  ? -3.633  -8.029  97.119  1.00 49.95  ? 35  VAL D CA  1 
ATOM   5756  C C   . VAL D 2 35  ? -3.868  -7.896  98.621  1.00 46.41  ? 35  VAL D C   1 
ATOM   5757  O O   . VAL D 2 35  ? -4.225  -6.833  99.126  1.00 61.74  ? 35  VAL D O   1 
ATOM   5758  C CB  . VAL D 2 35  ? -2.602  -6.977  96.663  1.00 43.58  ? 35  VAL D CB  1 
ATOM   5759  C CG1 . VAL D 2 35  ? -1.303  -7.162  97.408  1.00 41.47  ? 35  VAL D CG1 1 
ATOM   5760  C CG2 . VAL D 2 35  ? -2.378  -7.098  95.158  1.00 44.03  ? 35  VAL D CG2 1 
ATOM   5761  N N   . GLU D 2 36  ? -3.629  -8.992  99.328  1.00 58.11  ? 36  GLU D N   1 
ATOM   5762  C CA  . GLU D 2 36  ? -3.820  -9.083  100.776 1.00 54.63  ? 36  GLU D CA  1 
ATOM   5763  C C   . GLU D 2 36  ? -2.505  -9.107  101.578 1.00 60.23  ? 36  GLU D C   1 
ATOM   5764  O O   . GLU D 2 36  ? -2.509  -8.842  102.775 1.00 49.33  ? 36  GLU D O   1 
ATOM   5765  C CB  . GLU D 2 36  ? -4.607  -10.359 101.074 1.00 54.01  ? 36  GLU D CB  1 
ATOM   5766  C CG  . GLU D 2 36  ? -5.716  -10.229 102.081 1.00 66.14  ? 36  GLU D CG  1 
ATOM   5767  C CD  . GLU D 2 36  ? -6.468  -11.527 102.231 1.00 63.59  ? 36  GLU D CD  1 
ATOM   5768  O OE1 . GLU D 2 36  ? -5.830  -12.526 102.636 1.00 69.71  ? 36  GLU D OE1 1 
ATOM   5769  O OE2 . GLU D 2 36  ? -7.687  -11.555 101.939 1.00 62.87  ? 36  GLU D OE2 1 
ATOM   5770  N N   . SER D 2 37  ? -1.397  -9.447  100.915 1.00 64.73  ? 37  SER D N   1 
ATOM   5771  C CA  . SER D 2 37  ? -0.070  -9.530  101.545 1.00 62.80  ? 37  SER D CA  1 
ATOM   5772  C C   . SER D 2 37  ? 1.016   -9.521  100.456 1.00 62.99  ? 37  SER D C   1 
ATOM   5773  O O   . SER D 2 37  ? 0.697   -9.428  99.275  1.00 53.07  ? 37  SER D O   1 
ATOM   5774  C CB  . SER D 2 37  ? 0.030   -10.819 102.373 1.00 72.89  ? 37  SER D CB  1 
ATOM   5775  O OG  . SER D 2 37  ? -0.224  -11.963 101.567 1.00 57.99  ? 37  SER D OG  1 
ATOM   5776  N N   . PRO D 2 38  ? 2.312   -9.613  100.832 1.00 72.72  ? 38  PRO D N   1 
ATOM   5777  C CA  . PRO D 2 38  ? 3.341   -9.604  99.775  1.00 61.95  ? 38  PRO D CA  1 
ATOM   5778  C C   . PRO D 2 38  ? 3.252   -10.853 98.891  1.00 59.83  ? 38  PRO D C   1 
ATOM   5779  O O   . PRO D 2 38  ? 3.325   -11.982 99.377  1.00 65.68  ? 38  PRO D O   1 
ATOM   5780  C CB  . PRO D 2 38  ? 4.656   -9.527  100.557 1.00 52.99  ? 38  PRO D CB  1 
ATOM   5781  C CG  . PRO D 2 38  ? 4.243   -8.889  101.881 1.00 70.82  ? 38  PRO D CG  1 
ATOM   5782  C CD  . PRO D 2 38  ? 2.932   -9.567  102.171 1.00 54.42  ? 38  PRO D CD  1 
ATOM   5783  N N   . ARG D 2 39  ? 3.094   -10.640 97.588  1.00 90.14  ? 39  ARG D N   1 
ATOM   5784  C CA  . ARG D 2 39  ? 2.955   -11.742 96.637  1.00 85.78  ? 39  ARG D CA  1 
ATOM   5785  C C   . ARG D 2 39  ? 4.181   -11.974 95.765  1.00 86.43  ? 39  ARG D C   1 
ATOM   5786  O O   . ARG D 2 39  ? 4.057   -12.170 94.548  1.00 70.24  ? 39  ARG D O   1 
ATOM   5787  C CB  . ARG D 2 39  ? 1.715   -11.512 95.763  1.00 72.30  ? 39  ARG D CB  1 
ATOM   5788  C CG  . ARG D 2 39  ? 0.469   -11.243 96.600  1.00 47.53  ? 39  ARG D CG  1 
ATOM   5789  C CD  . ARG D 2 39  ? -0.766  -11.931 96.052  1.00 49.30  ? 39  ARG D CD  1 
ATOM   5790  N NE  . ARG D 2 39  ? -1.952  -11.524 96.810  1.00 74.00  ? 39  ARG D NE  1 
ATOM   5791  C CZ  . ARG D 2 39  ? -2.226  -11.903 98.059  1.00 82.37  ? 39  ARG D CZ  1 
ATOM   5792  N NH1 . ARG D 2 39  ? -1.402  -12.718 98.713  1.00 103.15 ? 39  ARG D NH1 1 
ATOM   5793  N NH2 . ARG D 2 39  ? -3.319  -11.462 98.667  1.00 57.25  ? 39  ARG D NH2 1 
ATOM   5794  N N   . ASN D 2 40  ? 5.344   -11.938 96.425  1.00 75.26  ? 40  ASN D N   1 
ATOM   5795  C CA  . ASN D 2 40  ? 6.678   -12.163 95.850  1.00 81.93  ? 40  ASN D CA  1 
ATOM   5796  C C   . ASN D 2 40  ? 6.920   -11.776 94.381  1.00 88.42  ? 40  ASN D C   1 
ATOM   5797  O O   . ASN D 2 40  ? 8.054   -11.435 94.000  1.00 68.51  ? 40  ASN D O   1 
ATOM   5798  C CB  . ASN D 2 40  ? 7.083   -13.632 96.080  1.00 69.74  ? 40  ASN D CB  1 
ATOM   5799  N N   . ASP D 2 41  ? 5.874   -11.851 93.554  1.00 92.01  ? 41  ASP D N   1 
ATOM   5800  C CA  . ASP D 2 41  ? 5.976   -11.491 92.145  1.00 81.43  ? 41  ASP D CA  1 
ATOM   5801  C C   . ASP D 2 41  ? 5.190   -10.206 91.924  1.00 77.19  ? 41  ASP D C   1 
ATOM   5802  O O   . ASP D 2 41  ? 3.948   -10.184 92.011  1.00 55.85  ? 41  ASP D O   1 
ATOM   5803  C CB  . ASP D 2 41  ? 5.446   -12.623 91.244  1.00 84.15  ? 41  ASP D CB  1 
ATOM   5804  C CG  . ASP D 2 41  ? 6.409   -13.820 91.177  1.00 103.15 ? 41  ASP D CG  1 
ATOM   5805  O OD1 . ASP D 2 41  ? 7.648   -13.582 91.233  1.00 98.63  ? 41  ASP D OD1 1 
ATOM   5806  O OD2 . ASP D 2 41  ? 5.939   -14.988 91.048  1.00 66.05  ? 41  ASP D OD2 1 
ATOM   5807  N N   . LEU D 2 42  ? 5.942   -9.137  91.670  1.00 47.83  ? 42  LEU D N   1 
ATOM   5808  C CA  . LEU D 2 42  ? 5.387   -7.817  91.440  1.00 50.97  ? 42  LEU D CA  1 
ATOM   5809  C C   . LEU D 2 42  ? 4.381   -7.790  90.294  1.00 62.57  ? 42  LEU D C   1 
ATOM   5810  O O   . LEU D 2 42  ? 4.397   -8.648  89.403  1.00 50.34  ? 42  LEU D O   1 
ATOM   5811  C CB  . LEU D 2 42  ? 6.509   -6.810  91.149  1.00 58.77  ? 42  LEU D CB  1 
ATOM   5812  C CG  . LEU D 2 42  ? 7.608   -6.617  92.201  1.00 58.82  ? 42  LEU D CG  1 
ATOM   5813  C CD1 . LEU D 2 42  ? 8.462   -5.422  91.827  1.00 46.56  ? 42  LEU D CD1 1 
ATOM   5814  C CD2 . LEU D 2 42  ? 6.987   -6.396  93.568  1.00 49.80  ? 42  LEU D CD2 1 
ATOM   5815  N N   . TYR D 2 43  ? 3.498   -6.795  90.348  1.00 62.24  ? 43  TYR D N   1 
ATOM   5816  C CA  . TYR D 2 43  ? 2.466   -6.584  89.339  1.00 50.70  ? 43  TYR D CA  1 
ATOM   5817  C C   . TYR D 2 43  ? 2.933   -5.463  88.407  1.00 50.22  ? 43  TYR D C   1 
ATOM   5818  O O   . TYR D 2 43  ? 3.803   -4.665  88.774  1.00 47.46  ? 43  TYR D O   1 
ATOM   5819  C CB  . TYR D 2 43  ? 1.139   -6.188  90.002  1.00 36.34  ? 43  TYR D CB  1 
ATOM   5820  C CG  . TYR D 2 43  ? 0.552   -7.255  90.891  1.00 43.51  ? 43  TYR D CG  1 
ATOM   5821  C CD1 . TYR D 2 43  ? 0.954   -7.380  92.223  1.00 43.67  ? 43  TYR D CD1 1 
ATOM   5822  C CD2 . TYR D 2 43  ? -0.380  -8.171  90.393  1.00 36.88  ? 43  TYR D CD2 1 
ATOM   5823  C CE1 . TYR D 2 43  ? 0.446   -8.389  93.039  1.00 29.20  ? 43  TYR D CE1 1 
ATOM   5824  C CE2 . TYR D 2 43  ? -0.890  -9.185  91.197  1.00 35.16  ? 43  TYR D CE2 1 
ATOM   5825  C CZ  . TYR D 2 43  ? -0.470  -9.287  92.521  1.00 43.25  ? 43  TYR D CZ  1 
ATOM   5826  O OH  . TYR D 2 43  ? -0.958  -10.294 93.323  1.00 49.10  ? 43  TYR D OH  1 
ATOM   5827  N N   . ASP D 2 44  ? 2.369   -5.417  87.202  1.00 51.21  ? 44  ASP D N   1 
ATOM   5828  C CA  . ASP D 2 44  ? 2.723   -4.387  86.237  1.00 45.70  ? 44  ASP D CA  1 
ATOM   5829  C C   . ASP D 2 44  ? 1.959   -3.152  86.661  1.00 48.78  ? 44  ASP D C   1 
ATOM   5830  O O   . ASP D 2 44  ? 2.478   -2.034  86.629  1.00 53.22  ? 44  ASP D O   1 
ATOM   5831  C CB  . ASP D 2 44  ? 2.294   -4.788  84.823  1.00 40.38  ? 44  ASP D CB  1 
ATOM   5832  C CG  . ASP D 2 44  ? 3.049   -5.998  84.301  1.00 51.47  ? 44  ASP D CG  1 
ATOM   5833  O OD1 . ASP D 2 44  ? 4.259   -5.884  84.028  1.00 49.05  ? 44  ASP D OD1 1 
ATOM   5834  O OD2 . ASP D 2 44  ? 2.429   -7.067  84.163  1.00 48.05  ? 44  ASP D OD2 1 
ATOM   5835  N N   . LEU D 2 45  ? 0.720   -3.383  87.079  1.00 52.62  ? 45  LEU D N   1 
ATOM   5836  C CA  . LEU D 2 45  ? -0.168  -2.322  87.525  1.00 52.09  ? 45  LEU D CA  1 
ATOM   5837  C C   . LEU D 2 45  ? -0.654  -2.625  88.944  1.00 39.83  ? 45  LEU D C   1 
ATOM   5838  O O   . LEU D 2 45  ? -1.340  -3.624  89.160  1.00 39.43  ? 45  LEU D O   1 
ATOM   5839  C CB  . LEU D 2 45  ? -1.382  -2.232  86.590  1.00 47.35  ? 45  LEU D CB  1 
ATOM   5840  C CG  . LEU D 2 45  ? -1.968  -0.853  86.259  1.00 57.27  ? 45  LEU D CG  1 
ATOM   5841  C CD1 . LEU D 2 45  ? -3.450  -1.022  85.968  1.00 32.07  ? 45  LEU D CD1 1 
ATOM   5842  C CD2 . LEU D 2 45  ? -1.744  0.130   87.406  1.00 34.05  ? 45  LEU D CD2 1 
ATOM   5843  N N   . LEU D 2 46  ? -0.300  -1.765  89.897  1.00 38.53  ? 46  LEU D N   1 
ATOM   5844  C CA  . LEU D 2 46  ? -0.727  -1.933  91.291  1.00 43.66  ? 46  LEU D CA  1 
ATOM   5845  C C   . LEU D 2 46  ? -1.630  -0.792  91.748  1.00 52.33  ? 46  LEU D C   1 
ATOM   5846  O O   . LEU D 2 46  ? -1.253  0.375   91.643  1.00 41.17  ? 46  LEU D O   1 
ATOM   5847  C CB  . LEU D 2 46  ? 0.482   -2.003  92.230  1.00 52.28  ? 46  LEU D CB  1 
ATOM   5848  C CG  . LEU D 2 46  ? 0.181   -2.115  93.729  1.00 47.42  ? 46  LEU D CG  1 
ATOM   5849  C CD1 . LEU D 2 46  ? -0.606  -3.387  94.001  1.00 41.65  ? 46  LEU D CD1 1 
ATOM   5850  C CD2 . LEU D 2 46  ? 1.479   -2.107  94.520  1.00 50.74  ? 46  LEU D CD2 1 
ATOM   5851  N N   . PHE D 2 47  ? -2.814  -1.141  92.255  1.00 49.08  ? 47  PHE D N   1 
ATOM   5852  C CA  . PHE D 2 47  ? -3.783  -0.150  92.736  1.00 49.22  ? 47  PHE D CA  1 
ATOM   5853  C C   . PHE D 2 47  ? -3.872  -0.079  94.268  1.00 45.37  ? 47  PHE D C   1 
ATOM   5854  O O   . PHE D 2 47  ? -3.935  -1.102  94.952  1.00 50.24  ? 47  PHE D O   1 
ATOM   5855  C CB  . PHE D 2 47  ? -5.192  -0.447  92.198  1.00 39.21  ? 47  PHE D CB  1 
ATOM   5856  C CG  . PHE D 2 47  ? -5.434  0.013   90.779  1.00 55.28  ? 47  PHE D CG  1 
ATOM   5857  C CD1 . PHE D 2 47  ? -5.336  -0.880  89.712  1.00 48.21  ? 47  PHE D CD1 1 
ATOM   5858  C CD2 . PHE D 2 47  ? -5.805  1.325   90.516  1.00 41.42  ? 47  PHE D CD2 1 
ATOM   5859  C CE1 . PHE D 2 47  ? -5.612  -0.474  88.412  1.00 49.86  ? 47  PHE D CE1 1 
ATOM   5860  C CE2 . PHE D 2 47  ? -6.079  1.742   89.221  1.00 41.91  ? 47  PHE D CE2 1 
ATOM   5861  C CZ  . PHE D 2 47  ? -5.984  0.840   88.164  1.00 44.44  ? 47  PHE D CZ  1 
ATOM   5862  N N   . ILE D 2 48  ? -3.882  1.142   94.791  1.00 41.12  ? 48  ILE D N   1 
ATOM   5863  C CA  . ILE D 2 48  ? -4.000  1.380   96.223  1.00 43.97  ? 48  ILE D CA  1 
ATOM   5864  C C   . ILE D 2 48  ? -5.281  2.200   96.366  1.00 44.13  ? 48  ILE D C   1 
ATOM   5865  O O   . ILE D 2 48  ? -5.255  3.428   96.288  1.00 43.58  ? 48  ILE D O   1 
ATOM   5866  C CB  . ILE D 2 48  ? -2.813  2.209   96.774  1.00 51.21  ? 48  ILE D CB  1 
ATOM   5867  C CG1 . ILE D 2 48  ? -1.480  1.592   96.344  1.00 47.86  ? 48  ILE D CG1 1 
ATOM   5868  C CG2 . ILE D 2 48  ? -2.875  2.259   98.295  1.00 41.92  ? 48  ILE D CG2 1 
ATOM   5869  C CD1 . ILE D 2 48  ? -0.286  2.442   96.738  1.00 47.17  ? 48  ILE D CD1 1 
ATOM   5870  N N   . PRO D 2 49  ? -6.420  1.521   96.547  1.00 37.79  ? 49  PRO D N   1 
ATOM   5871  C CA  . PRO D 2 49  ? -7.733  2.141   96.697  1.00 35.92  ? 49  PRO D CA  1 
ATOM   5872  C C   . PRO D 2 49  ? -8.029  2.490   98.140  1.00 51.18  ? 49  PRO D C   1 
ATOM   5873  O O   . PRO D 2 49  ? -7.122  2.717   98.934  1.00 53.72  ? 49  PRO D O   1 
ATOM   5874  C CB  . PRO D 2 49  ? -8.666  1.058   96.192  1.00 45.55  ? 49  PRO D CB  1 
ATOM   5875  C CG  . PRO D 2 49  ? -8.028  -0.165  96.767  1.00 38.33  ? 49  PRO D CG  1 
ATOM   5876  C CD  . PRO D 2 49  ? -6.559  0.057   96.437  1.00 47.16  ? 49  PRO D CD  1 
ATOM   5877  N N   . GLY D 2 50  ? -9.314  2.534   98.467  1.00 48.63  ? 50  GLY D N   1 
ATOM   5878  C CA  . GLY D 2 50  ? -9.711  2.833   99.823  1.00 44.76  ? 50  GLY D CA  1 
ATOM   5879  C C   . GLY D 2 50  ? -10.513 4.093   100.054 1.00 43.09  ? 50  GLY D C   1 
ATOM   5880  O O   . GLY D 2 50  ? -10.437 5.072   99.309  1.00 45.57  ? 50  GLY D O   1 
ATOM   5881  N N   . VAL D 2 51  ? -11.284 4.051   101.130 1.00 56.56  ? 51  VAL D N   1 
ATOM   5882  C CA  . VAL D 2 51  ? -12.117 5.166   101.550 1.00 53.27  ? 51  VAL D CA  1 
ATOM   5883  C C   . VAL D 2 51  ? -12.204 5.145   103.064 1.00 53.30  ? 51  VAL D C   1 
ATOM   5884  O O   . VAL D 2 51  ? -12.658 4.155   103.656 1.00 57.62  ? 51  VAL D O   1 
ATOM   5885  C CB  . VAL D 2 51  ? -13.534 5.053   100.994 1.00 54.83  ? 51  VAL D CB  1 
ATOM   5886  C CG1 . VAL D 2 51  ? -14.417 6.102   101.633 1.00 57.90  ? 51  VAL D CG1 1 
ATOM   5887  C CG2 . VAL D 2 51  ? -13.511 5.225   99.493  1.00 48.01  ? 51  VAL D CG2 1 
ATOM   5888  N N   . GLY D 2 52  ? -11.763 6.235   103.687 1.00 47.82  ? 52  GLY D N   1 
ATOM   5889  C CA  . GLY D 2 52  ? -11.810 6.321   105.131 1.00 38.52  ? 52  GLY D CA  1 
ATOM   5890  C C   . GLY D 2 52  ? -10.784 7.265   105.717 1.00 45.46  ? 52  GLY D C   1 
ATOM   5891  O O   . GLY D 2 52  ? -10.369 8.231   105.078 1.00 52.86  ? 52  GLY D O   1 
ATOM   5892  N N   . HIS D 2 53  ? -10.367 6.965   106.943 1.00 55.00  ? 53  HIS D N   1 
ATOM   5893  C CA  . HIS D 2 53  ? -9.392  7.772   107.673 1.00 46.77  ? 53  HIS D CA  1 
ATOM   5894  C C   . HIS D 2 53  ? -7.961  7.493   107.213 1.00 41.83  ? 53  HIS D C   1 
ATOM   5895  O O   . HIS D 2 53  ? -7.579  6.352   107.001 1.00 38.27  ? 53  HIS D O   1 
ATOM   5896  C CB  . HIS D 2 53  ? -9.534  7.497   109.179 1.00 57.54  ? 53  HIS D CB  1 
ATOM   5897  C CG  . HIS D 2 53  ? -8.752  8.437   110.043 1.00 81.11  ? 53  HIS D CG  1 
ATOM   5898  N ND1 . HIS D 2 53  ? -7.393  8.307   110.249 1.00 70.66  ? 53  HIS D ND1 1 
ATOM   5899  C CD2 . HIS D 2 53  ? -9.131  9.547   110.721 1.00 70.85  ? 53  HIS D CD2 1 
ATOM   5900  C CE1 . HIS D 2 53  ? -6.970  9.297   111.015 1.00 66.86  ? 53  HIS D CE1 1 
ATOM   5901  N NE2 . HIS D 2 53  ? -8.004  10.064  111.315 1.00 76.39  ? 53  HIS D NE2 1 
ATOM   5902  N N   . PHE D 2 54  ? -7.179  8.550   107.051 1.00 32.32  ? 54  PHE D N   1 
ATOM   5903  C CA  . PHE D 2 54  ? -5.796  8.435   106.625 1.00 34.42  ? 54  PHE D CA  1 
ATOM   5904  C C   . PHE D 2 54  ? -4.966  7.539   107.576 1.00 62.70  ? 54  PHE D C   1 
ATOM   5905  O O   . PHE D 2 54  ? -4.164  6.697   107.133 1.00 50.29  ? 54  PHE D O   1 
ATOM   5906  C CB  . PHE D 2 54  ? -5.199  9.829   106.559 1.00 39.73  ? 54  PHE D CB  1 
ATOM   5907  C CG  . PHE D 2 54  ? -3.801  9.866   106.054 1.00 59.90  ? 54  PHE D CG  1 
ATOM   5908  C CD1 . PHE D 2 54  ? -3.546  10.050  104.703 1.00 60.18  ? 54  PHE D CD1 1 
ATOM   5909  C CD2 . PHE D 2 54  ? -2.730  9.734   106.931 1.00 49.90  ? 54  PHE D CD2 1 
ATOM   5910  C CE1 . PHE D 2 54  ? -2.244  10.105  104.232 1.00 56.14  ? 54  PHE D CE1 1 
ATOM   5911  C CE2 . PHE D 2 54  ? -1.432  9.788   106.472 1.00 49.47  ? 54  PHE D CE2 1 
ATOM   5912  C CZ  . PHE D 2 54  ? -1.184  9.975   105.118 1.00 66.62  ? 54  PHE D CZ  1 
ATOM   5913  N N   . GLY D 2 55  ? -5.170  7.724   108.880 1.00 54.32  ? 55  GLY D N   1 
ATOM   5914  C CA  . GLY D 2 55  ? -4.446  6.943   109.866 1.00 51.74  ? 55  GLY D CA  1 
ATOM   5915  C C   . GLY D 2 55  ? -4.794  5.487   109.696 1.00 46.02  ? 55  GLY D C   1 
ATOM   5916  O O   . GLY D 2 55  ? -3.935  4.604   109.687 1.00 57.59  ? 55  GLY D O   1 
ATOM   5917  N N   . GLU D 2 56  ? -6.079  5.212   109.592 1.00 50.57  ? 56  GLU D N   1 
ATOM   5918  C CA  . GLU D 2 56  ? -6.468  3.844   109.358 1.00 50.47  ? 56  GLU D CA  1 
ATOM   5919  C C   . GLU D 2 56  ? -6.106  3.752   107.877 1.00 56.14  ? 56  GLU D C   1 
ATOM   5920  O O   . GLU D 2 56  ? -6.008  4.780   107.195 1.00 68.81  ? 56  GLU D O   1 
ATOM   5921  C CB  . GLU D 2 56  ? -7.960  3.672   109.595 1.00 46.07  ? 56  GLU D CB  1 
ATOM   5922  C CG  . GLU D 2 56  ? -8.271  2.461   110.434 1.00 65.77  ? 56  GLU D CG  1 
ATOM   5923  C CD  . GLU D 2 56  ? -9.025  1.416   109.656 1.00 63.11  ? 56  GLU D CD  1 
ATOM   5924  O OE1 . GLU D 2 56  ? -8.509  0.987   108.606 1.00 89.93  ? 56  GLU D OE1 1 
ATOM   5925  O OE2 . GLU D 2 56  ? -10.134 1.029   110.088 1.00 83.68  ? 56  GLU D OE2 1 
ATOM   5926  N N   . GLY D 2 57  ? -5.881  2.564   107.355 1.00 43.28  ? 57  GLY D N   1 
ATOM   5927  C CA  . GLY D 2 57  ? -5.494  2.522   105.958 1.00 63.97  ? 57  GLY D CA  1 
ATOM   5928  C C   . GLY D 2 57  ? -3.982  2.446   105.950 1.00 51.43  ? 57  GLY D C   1 
ATOM   5929  O O   . GLY D 2 57  ? -3.425  1.533   105.346 1.00 49.20  ? 57  GLY D O   1 
ATOM   5930  N N   . MET D 2 58  ? -3.321  3.414   106.594 1.00 47.67  ? 58  MET D N   1 
ATOM   5931  C CA  . MET D 2 58  ? -1.866  3.378   106.722 1.00 50.99  ? 58  MET D CA  1 
ATOM   5932  C C   . MET D 2 58  ? -1.641  2.239   107.707 1.00 48.42  ? 58  MET D C   1 
ATOM   5933  O O   . MET D 2 58  ? -0.805  1.367   107.494 1.00 51.14  ? 58  MET D O   1 
ATOM   5934  C CB  . MET D 2 58  ? -1.309  4.686   107.299 1.00 37.52  ? 58  MET D CB  1 
ATOM   5935  C CG  . MET D 2 58  ? -0.926  5.707   106.246 1.00 51.60  ? 58  MET D CG  1 
ATOM   5936  S SD  . MET D 2 58  ? 0.313   5.093   105.047 1.00 58.57  ? 58  MET D SD  1 
ATOM   5937  C CE  . MET D 2 58  ? -0.720  4.274   103.908 1.00 103.15 ? 58  MET D CE  1 
ATOM   5938  N N   . ARG D 2 59  ? -2.415  2.244   108.784 1.00 46.27  ? 59  ARG D N   1 
ATOM   5939  C CA  . ARG D 2 59  ? -2.322  1.182   109.770 1.00 54.31  ? 59  ARG D CA  1 
ATOM   5940  C C   . ARG D 2 59  ? -2.448  -0.163  109.055 1.00 56.61  ? 59  ARG D C   1 
ATOM   5941  O O   . ARG D 2 59  ? -1.715  -1.103  109.370 1.00 74.68  ? 59  ARG D O   1 
ATOM   5942  C CB  . ARG D 2 59  ? -3.438  1.303   110.823 1.00 50.71  ? 59  ARG D CB  1 
ATOM   5943  C CG  . ARG D 2 59  ? -3.510  0.105   111.783 1.00 55.79  ? 59  ARG D CG  1 
ATOM   5944  C CD  . ARG D 2 59  ? -4.608  0.238   112.827 1.00 51.82  ? 59  ARG D CD  1 
ATOM   5945  N NE  . ARG D 2 59  ? -5.950  0.236   112.248 1.00 71.05  ? 59  ARG D NE  1 
ATOM   5946  C CZ  . ARG D 2 59  ? -6.531  -0.828  111.692 1.00 92.76  ? 59  ARG D CZ  1 
ATOM   5947  N NH1 . ARG D 2 59  ? -5.887  -1.985  111.641 1.00 45.90  ? 59  ARG D NH1 1 
ATOM   5948  N NH2 . ARG D 2 59  ? -7.758  -0.735  111.177 1.00 73.55  ? 59  ARG D NH2 1 
ATOM   5949  N N   . ARG D 2 60  ? -3.360  -0.247  108.082 1.00 64.52  ? 60  ARG D N   1 
ATOM   5950  C CA  . ARG D 2 60  ? -3.580  -1.498  107.350 1.00 58.09  ? 60  ARG D CA  1 
ATOM   5951  C C   . ARG D 2 60  ? -2.502  -1.842  106.331 1.00 47.10  ? 60  ARG D C   1 
ATOM   5952  O O   . ARG D 2 60  ? -2.384  -2.993  105.911 1.00 47.75  ? 60  ARG D O   1 
ATOM   5953  C CB  . ARG D 2 60  ? -4.952  -1.495  106.674 1.00 60.03  ? 60  ARG D CB  1 
ATOM   5954  C CG  . ARG D 2 60  ? -6.095  -1.400  107.653 1.00 56.28  ? 60  ARG D CG  1 
ATOM   5955  C CD  . ARG D 2 60  ? -7.436  -1.608  106.967 1.00 72.19  ? 60  ARG D CD  1 
ATOM   5956  N NE  . ARG D 2 60  ? -8.534  -1.234  107.850 1.00 57.89  ? 60  ARG D NE  1 
ATOM   5957  C CZ  . ARG D 2 60  ? -9.793  -1.615  107.699 1.00 44.54  ? 60  ARG D CZ  1 
ATOM   5958  N NH1 . ARG D 2 60  ? -10.141 -2.397  106.693 1.00 51.93  ? 60  ARG D NH1 1 
ATOM   5959  N NH2 . ARG D 2 60  ? -10.706 -1.205  108.562 1.00 58.63  ? 60  ARG D NH2 1 
ATOM   5960  N N   . LEU D 2 61  ? -1.714  -0.859  105.924 1.00 46.67  ? 61  LEU D N   1 
ATOM   5961  C CA  . LEU D 2 61  ? -0.644  -1.152  104.988 1.00 55.09  ? 61  LEU D CA  1 
ATOM   5962  C C   . LEU D 2 61  ? 0.560   -1.662  105.780 1.00 51.40  ? 61  LEU D C   1 
ATOM   5963  O O   . LEU D 2 61  ? 1.379   -2.429  105.273 1.00 60.89  ? 61  LEU D O   1 
ATOM   5964  C CB  . LEU D 2 61  ? -0.277  0.087   104.170 1.00 41.31  ? 61  LEU D CB  1 
ATOM   5965  C CG  . LEU D 2 61  ? -1.321  0.410   103.099 1.00 50.75  ? 61  LEU D CG  1 
ATOM   5966  C CD1 . LEU D 2 61  ? -0.778  1.485   102.171 1.00 45.24  ? 61  LEU D CD1 1 
ATOM   5967  C CD2 . LEU D 2 61  ? -1.662  -0.849  102.300 1.00 40.64  ? 61  LEU D CD2 1 
ATOM   5968  N N   . ARG D 2 62  ? 0.638   -1.247  107.042 1.00 64.25  ? 62  ARG D N   1 
ATOM   5969  C CA  . ARG D 2 62  ? 1.726   -1.652  107.923 1.00 56.95  ? 62  ARG D CA  1 
ATOM   5970  C C   . ARG D 2 62  ? 1.534   -3.070  108.424 1.00 43.21  ? 62  ARG D C   1 
ATOM   5971  O O   . ARG D 2 62  ? 2.305   -3.949  108.085 1.00 50.58  ? 62  ARG D O   1 
ATOM   5972  C CB  . ARG D 2 62  ? 1.839   -0.703  109.123 1.00 46.04  ? 62  ARG D CB  1 
ATOM   5973  C CG  . ARG D 2 62  ? 2.222   0.729   108.764 1.00 58.07  ? 62  ARG D CG  1 
ATOM   5974  C CD  . ARG D 2 62  ? 2.485   1.552   110.020 1.00 63.89  ? 62  ARG D CD  1 
ATOM   5975  N NE  . ARG D 2 62  ? 1.291   1.724   110.845 1.00 61.35  ? 62  ARG D NE  1 
ATOM   5976  C CZ  . ARG D 2 62  ? 0.455   2.754   110.742 1.00 73.73  ? 62  ARG D CZ  1 
ATOM   5977  N NH1 . ARG D 2 62  ? 0.685   3.707   109.839 1.00 61.93  ? 62  ARG D NH1 1 
ATOM   5978  N NH2 . ARG D 2 62  ? -0.605  2.842   111.547 1.00 55.68  ? 62  ARG D NH2 1 
ATOM   5979  N N   . GLU D 2 63  ? 0.495   -3.290  109.222 1.00 56.34  ? 63  GLU D N   1 
ATOM   5980  C CA  . GLU D 2 63  ? 0.245   -4.614  109.782 1.00 55.82  ? 63  GLU D CA  1 
ATOM   5981  C C   . GLU D 2 63  ? 0.137   -5.731  108.762 1.00 67.01  ? 63  GLU D C   1 
ATOM   5982  O O   . GLU D 2 63  ? 0.475   -6.885  109.062 1.00 63.78  ? 63  GLU D O   1 
ATOM   5983  C CB  . GLU D 2 63  ? -0.996  -4.601  110.681 1.00 49.23  ? 63  GLU D CB  1 
ATOM   5984  C CG  . GLU D 2 63  ? -2.171  -3.830  110.144 1.00 82.36  ? 63  GLU D CG  1 
ATOM   5985  C CD  . GLU D 2 63  ? -3.243  -3.614  111.198 1.00 103.13 ? 63  GLU D CD  1 
ATOM   5986  O OE1 . GLU D 2 63  ? -2.894  -3.221  112.346 1.00 70.31  ? 63  GLU D OE1 1 
ATOM   5987  O OE2 . GLU D 2 63  ? -4.433  -3.833  110.870 1.00 96.27  ? 63  GLU D OE2 1 
ATOM   5988  N N   . ASN D 2 64  ? -0.325  -5.413  107.558 1.00 65.51  ? 64  ASN D N   1 
ATOM   5989  C CA  . ASN D 2 64  ? -0.425  -6.450  106.541 1.00 57.49  ? 64  ASN D CA  1 
ATOM   5990  C C   . ASN D 2 64  ? 0.845   -6.570  105.717 1.00 56.95  ? 64  ASN D C   1 
ATOM   5991  O O   . ASN D 2 64  ? 0.932   -7.395  104.803 1.00 56.23  ? 64  ASN D O   1 
ATOM   5992  C CB  . ASN D 2 64  ? -1.644  -6.225  105.662 1.00 68.39  ? 64  ASN D CB  1 
ATOM   5993  C CG  . ASN D 2 64  ? -2.886  -6.817  106.271 1.00 60.33  ? 64  ASN D CG  1 
ATOM   5994  O OD1 . ASN D 2 64  ? -2.942  -8.027  106.513 1.00 57.96  ? 64  ASN D OD1 1 
ATOM   5995  N ND2 . ASN D 2 64  ? -3.886  -5.974  106.540 1.00 55.98  ? 64  ASN D ND2 1 
ATOM   5996  N N   . ASP D 2 65  ? 1.829   -5.740  106.058 1.00 48.94  ? 65  ASP D N   1 
ATOM   5997  C CA  . ASP D 2 65  ? 3.141   -5.782  105.423 1.00 58.38  ? 65  ASP D CA  1 
ATOM   5998  C C   . ASP D 2 65  ? 3.110   -5.563  103.908 1.00 52.80  ? 65  ASP D C   1 
ATOM   5999  O O   . ASP D 2 65  ? 3.646   -6.371  103.137 1.00 58.62  ? 65  ASP D O   1 
ATOM   6000  C CB  . ASP D 2 65  ? 3.800   -7.132  105.772 1.00 61.88  ? 65  ASP D CB  1 
ATOM   6001  C CG  . ASP D 2 65  ? 5.216   -7.240  105.273 1.00 59.20  ? 65  ASP D CG  1 
ATOM   6002  O OD1 . ASP D 2 65  ? 5.914   -6.206  105.261 1.00 65.09  ? 65  ASP D OD1 1 
ATOM   6003  O OD2 . ASP D 2 65  ? 5.635   -8.355  104.906 1.00 55.18  ? 65  ASP D OD2 1 
ATOM   6004  N N   . LEU D 2 66  ? 2.489   -4.456  103.498 1.00 62.66  ? 66  LEU D N   1 
ATOM   6005  C CA  . LEU D 2 66  ? 2.374   -4.096  102.096 1.00 39.59  ? 66  LEU D CA  1 
ATOM   6006  C C   . LEU D 2 66  ? 3.134   -2.823  101.732 1.00 52.09  ? 66  LEU D C   1 
ATOM   6007  O O   . LEU D 2 66  ? 3.328   -2.530  100.555 1.00 46.90  ? 66  LEU D O   1 
ATOM   6008  C CB  . LEU D 2 66  ? 0.904   -3.946  101.723 1.00 51.59  ? 66  LEU D CB  1 
ATOM   6009  C CG  . LEU D 2 66  ? 0.115   -5.256  101.679 1.00 39.44  ? 66  LEU D CG  1 
ATOM   6010  C CD1 . LEU D 2 66  ? -1.334  -4.978  101.303 1.00 39.02  ? 66  LEU D CD1 1 
ATOM   6011  C CD2 . LEU D 2 66  ? 0.753   -6.181  100.669 1.00 43.99  ? 66  LEU D CD2 1 
ATOM   6012  N N   . ILE D 2 67  ? 3.570   -2.061  102.732 1.00 41.55  ? 67  ILE D N   1 
ATOM   6013  C CA  . ILE D 2 67  ? 4.319   -0.850  102.437 1.00 43.32  ? 67  ILE D CA  1 
ATOM   6014  C C   . ILE D 2 67  ? 5.557   -1.200  101.615 1.00 61.63  ? 67  ILE D C   1 
ATOM   6015  O O   . ILE D 2 67  ? 5.813   -0.569  100.580 1.00 61.82  ? 67  ILE D O   1 
ATOM   6016  C CB  . ILE D 2 67  ? 4.753   -0.112  103.724 1.00 58.75  ? 67  ILE D CB  1 
ATOM   6017  C CG1 . ILE D 2 67  ? 3.524   0.449   104.441 1.00 50.56  ? 67  ILE D CG1 1 
ATOM   6018  C CG2 . ILE D 2 67  ? 5.711   1.027   103.382 1.00 38.75  ? 67  ILE D CG2 1 
ATOM   6019  C CD1 . ILE D 2 67  ? 3.866   1.213   105.696 1.00 63.45  ? 67  ILE D CD1 1 
ATOM   6020  N N   . ASP D 2 68  ? 6.317   -2.202  102.072 1.00 44.45  ? 68  ASP D N   1 
ATOM   6021  C CA  . ASP D 2 68  ? 7.528   -2.649  101.380 1.00 40.93  ? 68  ASP D CA  1 
ATOM   6022  C C   . ASP D 2 68  ? 7.210   -3.194  99.997  1.00 36.78  ? 68  ASP D C   1 
ATOM   6023  O O   . ASP D 2 68  ? 7.941   -2.946  99.050  1.00 45.14  ? 68  ASP D O   1 
ATOM   6024  C CB  . ASP D 2 68  ? 8.256   -3.741  102.180 1.00 65.41  ? 68  ASP D CB  1 
ATOM   6025  C CG  . ASP D 2 68  ? 8.995   -3.199  103.404 1.00 78.28  ? 68  ASP D CG  1 
ATOM   6026  O OD1 . ASP D 2 68  ? 9.815   -2.262  103.251 1.00 75.25  ? 68  ASP D OD1 1 
ATOM   6027  O OD2 . ASP D 2 68  ? 8.764   -3.721  104.518 1.00 58.72  ? 68  ASP D OD2 1 
ATOM   6028  N N   . PHE D 2 69  ? 6.129   -3.961  99.890  1.00 52.88  ? 69  PHE D N   1 
ATOM   6029  C CA  . PHE D 2 69  ? 5.715   -4.520  98.608  1.00 45.18  ? 69  PHE D CA  1 
ATOM   6030  C C   . PHE D 2 69  ? 5.500   -3.365  97.626  1.00 54.15  ? 69  PHE D C   1 
ATOM   6031  O O   . PHE D 2 69  ? 6.001   -3.387  96.504  1.00 54.61  ? 69  PHE D O   1 
ATOM   6032  C CB  . PHE D 2 69  ? 4.414   -5.311  98.765  1.00 49.50  ? 69  PHE D CB  1 
ATOM   6033  C CG  . PHE D 2 69  ? 4.042   -6.104  97.544  1.00 50.78  ? 69  PHE D CG  1 
ATOM   6034  C CD1 . PHE D 2 69  ? 4.862   -7.133  97.092  1.00 44.63  ? 69  PHE D CD1 1 
ATOM   6035  C CD2 . PHE D 2 69  ? 2.882   -5.809  96.829  1.00 57.89  ? 69  PHE D CD2 1 
ATOM   6036  C CE1 . PHE D 2 69  ? 4.535   -7.857  95.944  1.00 58.54  ? 69  PHE D CE1 1 
ATOM   6037  C CE2 . PHE D 2 69  ? 2.546   -6.527  95.681  1.00 48.01  ? 69  PHE D CE2 1 
ATOM   6038  C CZ  . PHE D 2 69  ? 3.374   -7.553  95.237  1.00 53.63  ? 69  PHE D CZ  1 
ATOM   6039  N N   . VAL D 2 70  ? 4.756   -2.353  98.062  1.00 46.38  ? 70  VAL D N   1 
ATOM   6040  C CA  . VAL D 2 70  ? 4.497   -1.190  97.228  1.00 55.67  ? 70  VAL D CA  1 
ATOM   6041  C C   . VAL D 2 70  ? 5.795   -0.537  96.773  1.00 59.77  ? 70  VAL D C   1 
ATOM   6042  O O   . VAL D 2 70  ? 6.029   -0.386  95.577  1.00 60.44  ? 70  VAL D O   1 
ATOM   6043  C CB  . VAL D 2 70  ? 3.669   -0.117  97.976  1.00 62.96  ? 70  VAL D CB  1 
ATOM   6044  C CG1 . VAL D 2 70  ? 3.794   1.227   97.259  1.00 41.46  ? 70  VAL D CG1 1 
ATOM   6045  C CG2 . VAL D 2 70  ? 2.204   -0.556  98.074  1.00 40.23  ? 70  VAL D CG2 1 
ATOM   6046  N N   . ARG D 2 71  ? 6.629   -0.161  97.739  1.00 58.71  ? 71  ARG D N   1 
ATOM   6047  C CA  . ARG D 2 71  ? 7.898   0.513   97.478  1.00 59.81  ? 71  ARG D CA  1 
ATOM   6048  C C   . ARG D 2 71  ? 8.769   -0.159  96.430  1.00 62.50  ? 71  ARG D C   1 
ATOM   6049  O O   . ARG D 2 71  ? 9.639   0.494   95.844  1.00 63.13  ? 71  ARG D O   1 
ATOM   6050  C CB  . ARG D 2 71  ? 8.702   0.645   98.775  1.00 78.39  ? 71  ARG D CB  1 
ATOM   6051  C CG  . ARG D 2 71  ? 9.666   1.838   98.806  1.00 95.33  ? 71  ARG D CG  1 
ATOM   6052  C CD  . ARG D 2 71  ? 8.956   3.068   99.348  1.00 99.79  ? 71  ARG D CD  1 
ATOM   6053  N NE  . ARG D 2 71  ? 8.563   2.887   100.746 1.00 97.63  ? 71  ARG D NE  1 
ATOM   6054  C CZ  . ARG D 2 71  ? 7.577   3.557   101.344 1.00 100.99 ? 71  ARG D CZ  1 
ATOM   6055  N NH1 . ARG D 2 71  ? 6.876   4.454   100.664 1.00 76.08  ? 71  ARG D NH1 1 
ATOM   6056  N NH2 . ARG D 2 71  ? 7.294   3.334   102.625 1.00 64.74  ? 71  ARG D NH2 1 
ATOM   6057  N N   . LYS D 2 72  ? 8.561   -1.454  96.195  1.00 44.66  ? 72  LYS D N   1 
ATOM   6058  C CA  . LYS D 2 72  ? 9.362   -2.156  95.193  1.00 57.13  ? 72  LYS D CA  1 
ATOM   6059  C C   . LYS D 2 72  ? 8.780   -2.016  93.793  1.00 69.93  ? 72  LYS D C   1 
ATOM   6060  O O   . LYS D 2 72  ? 9.462   -2.267  92.787  1.00 64.62  ? 72  LYS D O   1 
ATOM   6061  C CB  . LYS D 2 72  ? 9.490   -3.639  95.535  1.00 55.53  ? 72  LYS D CB  1 
ATOM   6062  C CG  . LYS D 2 72  ? 10.427  -3.926  96.687  1.00 56.08  ? 72  LYS D CG  1 
ATOM   6063  C CD  . LYS D 2 72  ? 10.207  -5.332  97.198  1.00 60.99  ? 72  LYS D CD  1 
ATOM   6064  C CE  . LYS D 2 72  ? 10.937  -5.577  98.518  1.00 72.36  ? 72  LYS D CE  1 
ATOM   6065  N NZ  . LYS D 2 72  ? 10.433  -6.825  99.153  1.00 47.14  ? 72  LYS D NZ  1 
ATOM   6066  N N   . HIS D 2 73  ? 7.507   -1.646  93.715  1.00 69.20  ? 73  HIS D N   1 
ATOM   6067  C CA  . HIS D 2 73  ? 6.897   -1.462  92.415  1.00 44.26  ? 73  HIS D CA  1 
ATOM   6068  C C   . HIS D 2 73  ? 7.444   -0.157  91.877  1.00 54.41  ? 73  HIS D C   1 
ATOM   6069  O O   . HIS D 2 73  ? 7.705   -0.030  90.685  1.00 59.14  ? 73  HIS D O   1 
ATOM   6070  C CB  . HIS D 2 73  ? 5.380   -1.407  92.525  1.00 45.17  ? 73  HIS D CB  1 
ATOM   6071  C CG  . HIS D 2 73  ? 4.736   -2.752  92.625  1.00 36.12  ? 73  HIS D CG  1 
ATOM   6072  N ND1 . HIS D 2 73  ? 4.802   -3.524  93.760  1.00 46.99  ? 73  HIS D ND1 1 
ATOM   6073  C CD2 . HIS D 2 73  ? 4.039   -3.475  91.717  1.00 56.13  ? 73  HIS D CD2 1 
ATOM   6074  C CE1 . HIS D 2 73  ? 4.173   -4.667  93.548  1.00 51.56  ? 73  HIS D CE1 1 
ATOM   6075  N NE2 . HIS D 2 73  ? 3.701   -4.663  92.315  1.00 41.77  ? 73  HIS D NE2 1 
ATOM   6076  N N   . VAL D 2 74  ? 7.647   0.806   92.770  1.00 45.03  ? 74  VAL D N   1 
ATOM   6077  C CA  . VAL D 2 74  ? 8.178   2.095   92.370  1.00 54.84  ? 74  VAL D CA  1 
ATOM   6078  C C   . VAL D 2 74  ? 9.612   1.962   91.871  1.00 51.93  ? 74  VAL D C   1 
ATOM   6079  O O   . VAL D 2 74  ? 9.973   2.537   90.856  1.00 61.84  ? 74  VAL D O   1 
ATOM   6080  C CB  . VAL D 2 74  ? 8.148   3.091   93.544  1.00 55.48  ? 74  VAL D CB  1 
ATOM   6081  C CG1 . VAL D 2 74  ? 8.802   4.418   93.133  1.00 50.69  ? 74  VAL D CG1 1 
ATOM   6082  C CG2 . VAL D 2 74  ? 6.716   3.319   93.983  1.00 69.26  ? 74  VAL D CG2 1 
ATOM   6083  N N   . GLU D 2 75  ? 10.420  1.194   92.597  1.00 67.66  ? 75  GLU D N   1 
ATOM   6084  C CA  . GLU D 2 75  ? 11.831  0.991   92.267  1.00 70.78  ? 75  GLU D CA  1 
ATOM   6085  C C   . GLU D 2 75  ? 12.049  0.105   91.047  1.00 64.60  ? 75  GLU D C   1 
ATOM   6086  O O   . GLU D 2 75  ? 13.086  0.189   90.387  1.00 72.44  ? 75  GLU D O   1 
ATOM   6087  C CB  . GLU D 2 75  ? 12.571  0.404   93.488  1.00 85.11  ? 75  GLU D CB  1 
ATOM   6088  C CG  . GLU D 2 75  ? 12.722  1.397   94.659  1.00 92.24  ? 75  GLU D CG  1 
ATOM   6089  C CD  . GLU D 2 75  ? 12.674  0.743   96.050  1.00 103.15 ? 75  GLU D CD  1 
ATOM   6090  O OE1 . GLU D 2 75  ? 12.683  1.497   97.060  1.00 103.15 ? 75  GLU D OE1 1 
ATOM   6091  O OE2 . GLU D 2 75  ? 12.619  -0.506  96.145  1.00 76.38  ? 75  GLU D OE2 1 
ATOM   6092  N N   . ASP D 2 76  ? 11.071  -0.743  90.746  1.00 63.53  ? 76  ASP D N   1 
ATOM   6093  C CA  . ASP D 2 76  ? 11.165  -1.636  89.593  1.00 50.63  ? 76  ASP D CA  1 
ATOM   6094  C C   . ASP D 2 76  ? 10.407  -0.975  88.441  1.00 54.71  ? 76  ASP D C   1 
ATOM   6095  O O   . ASP D 2 76  ? 10.043  -1.623  87.451  1.00 63.02  ? 76  ASP D O   1 
ATOM   6096  C CB  . ASP D 2 76  ? 10.541  -2.994  89.929  1.00 39.63  ? 76  ASP D CB  1 
ATOM   6097  C CG  . ASP D 2 76  ? 10.808  -4.049  88.861  1.00 66.57  ? 76  ASP D CG  1 
ATOM   6098  O OD1 . ASP D 2 76  ? 10.177  -5.134  88.912  1.00 62.69  ? 76  ASP D OD1 1 
ATOM   6099  O OD2 . ASP D 2 76  ? 11.657  -3.802  87.976  1.00 67.60  ? 76  ASP D OD2 1 
ATOM   6100  N N   . GLU D 2 77  ? 10.185  0.328   88.584  1.00 62.93  ? 77  GLU D N   1 
ATOM   6101  C CA  . GLU D 2 77  ? 9.464   1.113   87.596  1.00 64.71  ? 77  GLU D CA  1 
ATOM   6102  C C   . GLU D 2 77  ? 8.221   0.395   87.109  1.00 60.38  ? 77  GLU D C   1 
ATOM   6103  O O   . GLU D 2 77  ? 8.114   0.024   85.943  1.00 52.08  ? 77  GLU D O   1 
ATOM   6104  C CB  . GLU D 2 77  ? 10.368  1.445   86.418  1.00 86.19  ? 77  GLU D CB  1 
ATOM   6105  C CG  . GLU D 2 77  ? 10.955  2.847   86.478  1.00 88.85  ? 77  GLU D CG  1 
ATOM   6106  C CD  . GLU D 2 77  ? 11.948  3.093   85.362  1.00 103.15 ? 77  GLU D CD  1 
ATOM   6107  O OE1 . GLU D 2 77  ? 12.385  4.259   85.203  1.00 103.15 ? 77  GLU D OE1 1 
ATOM   6108  O OE2 . GLU D 2 77  ? 12.293  2.118   84.646  1.00 91.57  ? 77  GLU D OE2 1 
ATOM   6109  N N   . ARG D 2 78  ? 7.295   0.190   88.036  1.00 57.29  ? 78  ARG D N   1 
ATOM   6110  C CA  . ARG D 2 78  ? 6.019   -0.453  87.764  1.00 58.96  ? 78  ARG D CA  1 
ATOM   6111  C C   . ARG D 2 78  ? 5.003   0.650   88.024  1.00 68.03  ? 78  ARG D C   1 
ATOM   6112  O O   . ARG D 2 78  ? 5.327   1.648   88.690  1.00 58.21  ? 78  ARG D O   1 
ATOM   6113  C CB  . ARG D 2 78  ? 5.782   -1.605  88.745  1.00 59.81  ? 78  ARG D CB  1 
ATOM   6114  C CG  . ARG D 2 78  ? 6.876   -2.649  88.746  1.00 64.14  ? 78  ARG D CG  1 
ATOM   6115  C CD  . ARG D 2 78  ? 6.621   -3.758  87.738  1.00 83.44  ? 78  ARG D CD  1 
ATOM   6116  N NE  . ARG D 2 78  ? 7.649   -4.792  87.834  1.00 59.19  ? 78  ARG D NE  1 
ATOM   6117  C CZ  . ARG D 2 78  ? 7.489   -6.059  87.473  1.00 62.76  ? 78  ARG D CZ  1 
ATOM   6118  N NH1 . ARG D 2 78  ? 6.332   -6.486  86.981  1.00 55.27  ? 78  ARG D NH1 1 
ATOM   6119  N NH2 . ARG D 2 78  ? 8.496   -6.910  87.617  1.00 64.81  ? 78  ARG D NH2 1 
ATOM   6120  N N   . TYR D 2 79  ? 3.786   0.496   87.517  1.00 46.46  ? 79  TYR D N   1 
ATOM   6121  C CA  . TYR D 2 79  ? 2.794   1.527   87.750  1.00 44.04  ? 79  TYR D CA  1 
ATOM   6122  C C   . TYR D 2 79  ? 2.109   1.355   89.088  1.00 36.10  ? 79  TYR D C   1 
ATOM   6123  O O   . TYR D 2 79  ? 1.579   0.294   89.399  1.00 49.84  ? 79  TYR D O   1 
ATOM   6124  C CB  . TYR D 2 79  ? 1.753   1.552   86.631  1.00 43.83  ? 79  TYR D CB  1 
ATOM   6125  C CG  . TYR D 2 79  ? 2.146   2.453   85.500  1.00 46.49  ? 79  TYR D CG  1 
ATOM   6126  C CD1 . TYR D 2 79  ? 3.089   2.047   84.557  1.00 39.78  ? 79  TYR D CD1 1 
ATOM   6127  C CD2 . TYR D 2 79  ? 1.648   3.757   85.420  1.00 55.10  ? 79  TYR D CD2 1 
ATOM   6128  C CE1 . TYR D 2 79  ? 3.535   2.922   83.568  1.00 53.82  ? 79  TYR D CE1 1 
ATOM   6129  C CE2 . TYR D 2 79  ? 2.091   4.643   84.436  1.00 43.02  ? 79  TYR D CE2 1 
ATOM   6130  C CZ  . TYR D 2 79  ? 3.035   4.220   83.517  1.00 53.44  ? 79  TYR D CZ  1 
ATOM   6131  O OH  . TYR D 2 79  ? 3.509   5.098   82.562  1.00 79.74  ? 79  TYR D OH  1 
ATOM   6132  N N   . VAL D 2 80  ? 2.146   2.412   89.888  1.00 48.49  ? 80  VAL D N   1 
ATOM   6133  C CA  . VAL D 2 80  ? 1.501   2.417   91.198  1.00 43.23  ? 80  VAL D CA  1 
ATOM   6134  C C   . VAL D 2 80  ? 0.403   3.469   91.061  1.00 38.03  ? 80  VAL D C   1 
ATOM   6135  O O   . VAL D 2 80  ? 0.670   4.599   90.651  1.00 39.63  ? 80  VAL D O   1 
ATOM   6136  C CB  . VAL D 2 80  ? 2.494   2.843   92.326  1.00 53.02  ? 80  VAL D CB  1 
ATOM   6137  C CG1 . VAL D 2 80  ? 1.878   2.602   93.692  1.00 42.29  ? 80  VAL D CG1 1 
ATOM   6138  C CG2 . VAL D 2 80  ? 3.800   2.080   92.195  1.00 60.43  ? 80  VAL D CG2 1 
ATOM   6139  N N   . VAL D 2 81  ? -0.827  3.099   91.394  1.00 41.33  ? 81  VAL D N   1 
ATOM   6140  C CA  . VAL D 2 81  ? -1.948  4.021   91.268  1.00 37.99  ? 81  VAL D CA  1 
ATOM   6141  C C   . VAL D 2 81  ? -2.861  4.062   92.494  1.00 45.33  ? 81  VAL D C   1 
ATOM   6142  O O   . VAL D 2 81  ? -3.355  3.035   92.958  1.00 41.24  ? 81  VAL D O   1 
ATOM   6143  C CB  . VAL D 2 81  ? -2.807  3.676   90.015  1.00 49.28  ? 81  VAL D CB  1 
ATOM   6144  C CG1 . VAL D 2 81  ? -3.921  4.696   89.852  1.00 40.18  ? 81  VAL D CG1 1 
ATOM   6145  C CG2 . VAL D 2 81  ? -1.932  3.644   88.769  1.00 29.49  ? 81  VAL D CG2 1 
ATOM   6146  N N   . GLY D 2 82  ? -3.081  5.266   93.008  1.00 32.12  ? 82  GLY D N   1 
ATOM   6147  C CA  . GLY D 2 82  ? -3.941  5.436   94.163  1.00 42.33  ? 82  GLY D CA  1 
ATOM   6148  C C   . GLY D 2 82  ? -5.254  6.120   93.817  1.00 33.64  ? 82  GLY D C   1 
ATOM   6149  O O   . GLY D 2 82  ? -5.288  7.029   92.997  1.00 37.69  ? 82  GLY D O   1 
ATOM   6150  N N   . VAL D 2 83  ? -6.329  5.679   94.460  1.00 36.68  ? 83  VAL D N   1 
ATOM   6151  C CA  . VAL D 2 83  ? -7.664  6.221   94.238  1.00 52.14  ? 83  VAL D CA  1 
ATOM   6152  C C   . VAL D 2 83  ? -8.292  6.627   95.571  1.00 42.59  ? 83  VAL D C   1 
ATOM   6153  O O   . VAL D 2 83  ? -8.333  5.826   96.500  1.00 47.32  ? 83  VAL D O   1 
ATOM   6154  C CB  . VAL D 2 83  ? -8.569  5.173   93.559  1.00 40.73  ? 83  VAL D CB  1 
ATOM   6155  C CG1 . VAL D 2 83  ? -9.932  5.763   93.303  1.00 43.73  ? 83  VAL D CG1 1 
ATOM   6156  C CG2 . VAL D 2 83  ? -7.930  4.698   92.255  1.00 39.77  ? 83  VAL D CG2 1 
ATOM   6157  N N   . CYS D 2 84  ? -8.807  7.857   95.624  1.00 52.87  ? 84  CYS D N   1 
ATOM   6158  C CA  . CYS D 2 84  ? -9.417  8.483   96.814  1.00 61.26  ? 84  CYS D CA  1 
ATOM   6159  C C   . CYS D 2 84  ? -8.464  8.421   98.007  1.00 42.62  ? 84  CYS D C   1 
ATOM   6160  O O   . CYS D 2 84  ? -7.514  9.195   98.060  1.00 49.72  ? 84  CYS D O   1 
ATOM   6161  C CB  . CYS D 2 84  ? -10.796 7.880   97.184  1.00 63.35  ? 84  CYS D CB  1 
ATOM   6162  S SG  . CYS D 2 84  ? -11.857 8.993   98.305  1.00 60.88  ? 84  CYS D SG  1 
ATOM   6163  N N   . LEU D 2 85  ? -8.691  7.522   98.958  1.00 52.14  ? 85  LEU D N   1 
ATOM   6164  C CA  . LEU D 2 85  ? -7.781  7.459   100.102 1.00 53.09  ? 85  LEU D CA  1 
ATOM   6165  C C   . LEU D 2 85  ? -6.382  7.045   99.645  1.00 48.99  ? 85  LEU D C   1 
ATOM   6166  O O   . LEU D 2 85  ? -5.379  7.574   100.121 1.00 54.66  ? 85  LEU D O   1 
ATOM   6167  C CB  . LEU D 2 85  ? -8.291  6.484   101.172 1.00 39.34  ? 85  LEU D CB  1 
ATOM   6168  C CG  . LEU D 2 85  ? -7.422  6.483   102.439 1.00 53.08  ? 85  LEU D CG  1 
ATOM   6169  C CD1 . LEU D 2 85  ? -7.305  7.910   102.996 1.00 42.02  ? 85  LEU D CD1 1 
ATOM   6170  C CD2 . LEU D 2 85  ? -8.015  5.552   103.479 1.00 56.79  ? 85  LEU D CD2 1 
ATOM   6171  N N   . GLY D 2 86  ? -6.331  6.104   98.709  1.00 55.37  ? 86  GLY D N   1 
ATOM   6172  C CA  . GLY D 2 86  ? -5.061  5.638   98.187  1.00 46.12  ? 86  GLY D CA  1 
ATOM   6173  C C   . GLY D 2 86  ? -4.197  6.770   97.670  1.00 46.54  ? 86  GLY D C   1 
ATOM   6174  O O   . GLY D 2 86  ? -2.983  6.783   97.893  1.00 41.81  ? 86  GLY D O   1 
ATOM   6175  N N   . MET D 2 87  ? -4.809  7.725   96.973  1.00 43.03  ? 87  MET D N   1 
ATOM   6176  C CA  . MET D 2 87  ? -4.050  8.847   96.445  1.00 27.30  ? 87  MET D CA  1 
ATOM   6177  C C   . MET D 2 87  ? -3.390  9.669   97.553  1.00 52.15  ? 87  MET D C   1 
ATOM   6178  O O   . MET D 2 87  ? -2.244  10.101  97.416  1.00 42.62  ? 87  MET D O   1 
ATOM   6179  C CB  . MET D 2 87  ? -4.933  9.778   95.616  1.00 47.79  ? 87  MET D CB  1 
ATOM   6180  C CG  . MET D 2 87  ? -4.145  10.950  95.064  1.00 44.23  ? 87  MET D CG  1 
ATOM   6181  S SD  . MET D 2 87  ? -5.076  12.204  94.202  1.00 61.83  ? 87  MET D SD  1 
ATOM   6182  C CE  . MET D 2 87  ? -5.021  13.540  95.401  1.00 56.72  ? 87  MET D CE  1 
ATOM   6183  N N   . GLN D 2 88  ? -4.117  9.900   98.640  1.00 39.34  ? 88  GLN D N   1 
ATOM   6184  C CA  . GLN D 2 88  ? -3.580  10.682  99.744  1.00 56.62  ? 88  GLN D CA  1 
ATOM   6185  C C   . GLN D 2 88  ? -2.467  9.929   100.459 1.00 52.18  ? 88  GLN D C   1 
ATOM   6186  O O   . GLN D 2 88  ? -1.560  10.531  101.014 1.00 48.84  ? 88  GLN D O   1 
ATOM   6187  C CB  . GLN D 2 88  ? -4.702  11.045  100.705 1.00 38.14  ? 88  GLN D CB  1 
ATOM   6188  C CG  . GLN D 2 88  ? -5.894  11.576  99.952  1.00 60.80  ? 88  GLN D CG  1 
ATOM   6189  C CD  . GLN D 2 88  ? -6.818  12.415  100.793 1.00 50.52  ? 88  GLN D CD  1 
ATOM   6190  O OE1 . GLN D 2 88  ? -7.274  11.998  101.865 1.00 48.42  ? 88  GLN D OE1 1 
ATOM   6191  N NE2 . GLN D 2 88  ? -7.112  13.614  100.306 1.00 54.40  ? 88  GLN D NE2 1 
ATOM   6192  N N   . LEU D 2 89  ? -2.539  8.606   100.419 1.00 56.60  ? 89  LEU D N   1 
ATOM   6193  C CA  . LEU D 2 89  ? -1.540  7.738   101.029 1.00 49.12  ? 89  LEU D CA  1 
ATOM   6194  C C   . LEU D 2 89  ? -0.186  7.793   100.295 1.00 63.86  ? 89  LEU D C   1 
ATOM   6195  O O   . LEU D 2 89  ? 0.806   7.229   100.767 1.00 77.16  ? 89  LEU D O   1 
ATOM   6196  C CB  . LEU D 2 89  ? -2.065  6.298   101.051 1.00 26.91  ? 89  LEU D CB  1 
ATOM   6197  C CG  . LEU D 2 89  ? -2.782  5.787   102.305 1.00 40.62  ? 89  LEU D CG  1 
ATOM   6198  C CD1 . LEU D 2 89  ? -3.551  6.908   103.007 1.00 60.14  ? 89  LEU D CD1 1 
ATOM   6199  C CD2 . LEU D 2 89  ? -3.687  4.618   101.930 1.00 32.85  ? 89  LEU D CD2 1 
ATOM   6200  N N   . LEU D 2 90  ? -0.141  8.459   99.144  1.00 56.67  ? 90  LEU D N   1 
ATOM   6201  C CA  . LEU D 2 90  ? 1.103   8.583   98.374  1.00 54.52  ? 90  LEU D CA  1 
ATOM   6202  C C   . LEU D 2 90  ? 1.946   9.734   98.938  1.00 52.50  ? 90  LEU D C   1 
ATOM   6203  O O   . LEU D 2 90  ? 3.125   9.879   98.634  1.00 48.01  ? 90  LEU D O   1 
ATOM   6204  C CB  . LEU D 2 90  ? 0.801   8.890   96.898  1.00 40.03  ? 90  LEU D CB  1 
ATOM   6205  C CG  . LEU D 2 90  ? -0.050  7.930   96.068  1.00 40.99  ? 90  LEU D CG  1 
ATOM   6206  C CD1 . LEU D 2 90  ? -0.270  8.522   94.678  1.00 29.96  ? 90  LEU D CD1 1 
ATOM   6207  C CD2 . LEU D 2 90  ? 0.646   6.573   95.990  1.00 43.33  ? 90  LEU D CD2 1 
ATOM   6208  N N   . PHE D 2 91  ? 1.330   10.561  99.762  1.00 48.69  ? 91  PHE D N   1 
ATOM   6209  C CA  . PHE D 2 91  ? 2.055   11.687  100.298 1.00 70.63  ? 91  PHE D CA  1 
ATOM   6210  C C   . PHE D 2 91  ? 2.753   11.449  101.627 1.00 63.05  ? 91  PHE D C   1 
ATOM   6211  O O   . PHE D 2 91  ? 2.645   10.380  102.232 1.00 48.74  ? 91  PHE D O   1 
ATOM   6212  C CB  . PHE D 2 91  ? 1.127   12.904  100.371 1.00 58.74  ? 91  PHE D CB  1 
ATOM   6213  C CG  . PHE D 2 91  ? 0.732   13.435  99.017  1.00 70.51  ? 91  PHE D CG  1 
ATOM   6214  C CD1 . PHE D 2 91  ? -0.302  12.846  98.293  1.00 45.85  ? 91  PHE D CD1 1 
ATOM   6215  C CD2 . PHE D 2 91  ? 1.435   14.492  98.436  1.00 52.32  ? 91  PHE D CD2 1 
ATOM   6216  C CE1 . PHE D 2 91  ? -0.624  13.300  97.015  1.00 50.11  ? 91  PHE D CE1 1 
ATOM   6217  C CE2 . PHE D 2 91  ? 1.119   14.947  97.160  1.00 50.30  ? 91  PHE D CE2 1 
ATOM   6218  C CZ  . PHE D 2 91  ? 0.090   14.352  96.448  1.00 48.01  ? 91  PHE D CZ  1 
ATOM   6219  N N   . GLU D 2 92  ? 3.486   12.471  102.051 1.00 57.17  ? 92  GLU D N   1 
ATOM   6220  C CA  . GLU D 2 92  ? 4.254   12.451  103.290 1.00 66.56  ? 92  GLU D CA  1 
ATOM   6221  C C   . GLU D 2 92  ? 3.406   12.377  104.556 1.00 51.21  ? 92  GLU D C   1 
ATOM   6222  O O   . GLU D 2 92  ? 3.566   11.457  105.346 1.00 63.07  ? 92  GLU D O   1 
ATOM   6223  C CB  . GLU D 2 92  ? 5.164   13.678  103.324 1.00 55.99  ? 92  GLU D CB  1 
ATOM   6224  C CG  . GLU D 2 92  ? 6.063   13.781  102.087 1.00 52.20  ? 92  GLU D CG  1 
ATOM   6225  C CD  . GLU D 2 92  ? 6.755   15.132  101.969 1.00 66.81  ? 92  GLU D CD  1 
ATOM   6226  O OE1 . GLU D 2 92  ? 6.086   16.174  102.198 1.00 90.61  ? 92  GLU D OE1 1 
ATOM   6227  O OE2 . GLU D 2 92  ? 7.961   15.162  101.632 1.00 66.50  ? 92  GLU D OE2 1 
ATOM   6228  N N   . GLU D 2 93  ? 2.505   13.338  104.748 1.00 75.40  ? 93  GLU D N   1 
ATOM   6229  C CA  . GLU D 2 93  ? 1.647   13.359  105.937 1.00 63.98  ? 93  GLU D CA  1 
ATOM   6230  C C   . GLU D 2 93  ? 0.330   14.094  105.707 1.00 60.98  ? 93  GLU D C   1 
ATOM   6231  O O   . GLU D 2 93  ? 0.163   14.756  104.690 1.00 58.08  ? 93  GLU D O   1 
ATOM   6232  C CB  . GLU D 2 93  ? 2.399   13.992  107.116 1.00 75.49  ? 93  GLU D CB  1 
ATOM   6233  C CG  . GLU D 2 93  ? 3.193   15.257  106.775 1.00 85.24  ? 93  GLU D CG  1 
ATOM   6234  C CD  . GLU D 2 93  ? 4.057   15.743  107.950 1.00 103.15 ? 93  GLU D CD  1 
ATOM   6235  O OE1 . GLU D 2 93  ? 3.491   16.072  109.025 1.00 89.80  ? 93  GLU D OE1 1 
ATOM   6236  O OE2 . GLU D 2 93  ? 5.302   15.790  107.798 1.00 79.94  ? 93  GLU D OE2 1 
ATOM   6237  N N   . SER D 2 94  ? -0.594  13.978  106.663 1.00 62.44  ? 94  SER D N   1 
ATOM   6238  C CA  . SER D 2 94  ? -1.912  14.610  106.568 1.00 54.14  ? 94  SER D CA  1 
ATOM   6239  C C   . SER D 2 94  ? -2.398  15.151  107.913 1.00 65.99  ? 94  SER D C   1 
ATOM   6240  O O   . SER D 2 94  ? -1.938  14.713  108.959 1.00 70.04  ? 94  SER D O   1 
ATOM   6241  C CB  . SER D 2 94  ? -2.930  13.589  106.050 1.00 72.61  ? 94  SER D CB  1 
ATOM   6242  O OG  . SER D 2 94  ? -4.254  13.948  106.400 1.00 44.65  ? 94  SER D OG  1 
ATOM   6243  N N   . GLU D 2 95  ? -3.349  16.084  107.880 1.00 60.06  ? 95  GLU D N   1 
ATOM   6244  C CA  . GLU D 2 95  ? -3.899  16.671  109.102 1.00 53.76  ? 95  GLU D CA  1 
ATOM   6245  C C   . GLU D 2 95  ? -4.966  15.775  109.697 1.00 59.76  ? 95  GLU D C   1 
ATOM   6246  O O   . GLU D 2 95  ? -5.324  15.912  110.870 1.00 54.45  ? 95  GLU D O   1 
ATOM   6247  C CB  . GLU D 2 95  ? -4.539  18.018  108.815 1.00 42.29  ? 95  GLU D CB  1 
ATOM   6248  C CG  . GLU D 2 95  ? -3.713  18.906  107.936 1.00 59.87  ? 95  GLU D CG  1 
ATOM   6249  C CD  . GLU D 2 95  ? -4.367  20.244  107.731 1.00 82.34  ? 95  GLU D CD  1 
ATOM   6250  O OE1 . GLU D 2 95  ? -5.613  20.274  107.571 1.00 55.97  ? 95  GLU D OE1 1 
ATOM   6251  O OE2 . GLU D 2 95  ? -3.627  21.253  107.727 1.00 59.07  ? 95  GLU D OE2 1 
ATOM   6252  N N   . GLU D 2 96  ? -5.490  14.875  108.870 1.00 65.26  ? 96  GLU D N   1 
ATOM   6253  C CA  . GLU D 2 96  ? -6.525  13.954  109.302 1.00 55.26  ? 96  GLU D CA  1 
ATOM   6254  C C   . GLU D 2 96  ? -5.986  13.070  110.409 1.00 53.21  ? 96  GLU D C   1 
ATOM   6255  O O   . GLU D 2 96  ? -6.739  12.591  111.259 1.00 52.13  ? 96  GLU D O   1 
ATOM   6256  C CB  . GLU D 2 96  ? -6.998  13.107  108.113 1.00 62.52  ? 96  GLU D CB  1 
ATOM   6257  C CG  . GLU D 2 96  ? -7.833  11.900  108.500 1.00 60.45  ? 96  GLU D CG  1 
ATOM   6258  C CD  . GLU D 2 96  ? -8.672  11.375  107.356 1.00 74.04  ? 96  GLU D CD  1 
ATOM   6259  O OE1 . GLU D 2 96  ? -8.088  11.015  106.307 1.00 48.76  ? 96  GLU D OE1 1 
ATOM   6260  O OE2 . GLU D 2 96  ? -9.919  11.328  107.513 1.00 56.79  ? 96  GLU D OE2 1 
ATOM   6261  N N   . ALA D 2 97  ? -4.670  12.869  110.396 1.00 62.05  ? 97  ALA D N   1 
ATOM   6262  C CA  . ALA D 2 97  ? -4.004  12.037  111.391 1.00 64.90  ? 97  ALA D CA  1 
ATOM   6263  C C   . ALA D 2 97  ? -2.579  12.531  111.664 1.00 71.49  ? 97  ALA D C   1 
ATOM   6264  O O   . ALA D 2 97  ? -1.612  12.005  111.104 1.00 77.31  ? 97  ALA D O   1 
ATOM   6265  C CB  . ALA D 2 97  ? -3.979  10.601  110.910 1.00 69.70  ? 97  ALA D CB  1 
ATOM   6266  N N   . PRO D 2 98  ? -2.434  13.526  112.564 1.00 75.73  ? 98  PRO D N   1 
ATOM   6267  C CA  . PRO D 2 98  ? -1.193  14.186  113.003 1.00 83.79  ? 98  PRO D CA  1 
ATOM   6268  C C   . PRO D 2 98  ? 0.181   13.649  112.530 1.00 89.01  ? 98  PRO D C   1 
ATOM   6269  O O   . PRO D 2 98  ? 0.519   13.695  111.329 1.00 89.98  ? 98  PRO D O   1 
ATOM   6270  C CB  . PRO D 2 98  ? -1.345  14.170  114.515 1.00 70.61  ? 98  PRO D CB  1 
ATOM   6271  C CG  . PRO D 2 98  ? -2.785  14.575  114.650 1.00 72.53  ? 98  PRO D CG  1 
ATOM   6272  C CD  . PRO D 2 98  ? -3.504  13.771  113.552 1.00 64.72  ? 98  PRO D CD  1 
ATOM   6273  N N   . GLY D 2 99  ? 0.979   13.170  113.483 1.00 76.36  ? 99  GLY D N   1 
ATOM   6274  C CA  . GLY D 2 99  ? 2.296   12.647  113.156 1.00 80.04  ? 99  GLY D CA  1 
ATOM   6275  C C   . GLY D 2 99  ? 2.292   11.239  112.585 1.00 78.47  ? 99  GLY D C   1 
ATOM   6276  O O   . GLY D 2 99  ? 3.173   10.431  112.904 1.00 76.14  ? 99  GLY D O   1 
ATOM   6277  N N   . VAL D 2 100 ? 1.296   10.932  111.752 1.00 82.78  ? 100 VAL D N   1 
ATOM   6278  C CA  . VAL D 2 100 ? 1.201   9.609   111.130 1.00 60.95  ? 100 VAL D CA  1 
ATOM   6279  C C   . VAL D 2 100 ? 1.696   9.703   109.692 1.00 66.62  ? 100 VAL D C   1 
ATOM   6280  O O   . VAL D 2 100 ? 1.070   10.358  108.858 1.00 52.35  ? 100 VAL D O   1 
ATOM   6281  C CB  . VAL D 2 100 ? -0.231  9.105   111.086 1.00 63.29  ? 100 VAL D CB  1 
ATOM   6282  C CG1 . VAL D 2 100 ? -0.226  7.615   110.758 1.00 94.89  ? 100 VAL D CG1 1 
ATOM   6283  C CG2 . VAL D 2 100 ? -0.924  9.377   112.398 1.00 54.33  ? 100 VAL D CG2 1 
ATOM   6284  N N   . LYS D 2 101 ? 2.809   9.037   109.405 1.00 46.01  ? 101 LYS D N   1 
ATOM   6285  C CA  . LYS D 2 101 ? 3.389   9.089   108.076 1.00 66.12  ? 101 LYS D CA  1 
ATOM   6286  C C   . LYS D 2 101 ? 2.594   8.347   107.009 1.00 67.03  ? 101 LYS D C   1 
ATOM   6287  O O   . LYS D 2 101 ? 1.778   7.466   107.304 1.00 59.47  ? 101 LYS D O   1 
ATOM   6288  C CB  . LYS D 2 101 ? 4.824   8.551   108.106 1.00 58.13  ? 101 LYS D CB  1 
ATOM   6289  C CG  . LYS D 2 101 ? 5.704   9.194   109.169 1.00 79.38  ? 101 LYS D CG  1 
ATOM   6290  C CD  . LYS D 2 101 ? 5.469   10.708  109.304 1.00 85.59  ? 101 LYS D CD  1 
ATOM   6291  C CE  . LYS D 2 101 ? 5.883   11.495  108.049 1.00 90.20  ? 101 LYS D CE  1 
ATOM   6292  N NZ  . LYS D 2 101 ? 5.619   12.967  108.238 1.00 76.90  ? 101 LYS D NZ  1 
ATOM   6293  N N   . GLY D 2 102 ? 2.834   8.738   105.760 1.00 62.18  ? 102 GLY D N   1 
ATOM   6294  C CA  . GLY D 2 102 ? 2.178   8.106   104.634 1.00 52.41  ? 102 GLY D CA  1 
ATOM   6295  C C   . GLY D 2 102 ? 3.272   7.428   103.837 1.00 65.03  ? 102 GLY D C   1 
ATOM   6296  O O   . GLY D 2 102 ? 4.456   7.632   104.118 1.00 78.97  ? 102 GLY D O   1 
ATOM   6297  N N   . LEU D 2 103 ? 2.895   6.616   102.858 1.00 65.73  ? 103 LEU D N   1 
ATOM   6298  C CA  . LEU D 2 103 ? 3.871   5.928   102.026 1.00 53.02  ? 103 LEU D CA  1 
ATOM   6299  C C   . LEU D 2 103 ? 4.994   6.900   101.713 1.00 58.31  ? 103 LEU D C   1 
ATOM   6300  O O   . LEU D 2 103 ? 6.169   6.524   101.726 1.00 54.52  ? 103 LEU D O   1 
ATOM   6301  C CB  . LEU D 2 103 ? 3.211   5.441   100.735 1.00 48.67  ? 103 LEU D CB  1 
ATOM   6302  C CG  . LEU D 2 103 ? 1.993   4.545   100.976 1.00 56.83  ? 103 LEU D CG  1 
ATOM   6303  C CD1 . LEU D 2 103 ? 1.319   4.222   99.668  1.00 46.92  ? 103 LEU D CD1 1 
ATOM   6304  C CD2 . LEU D 2 103 ? 2.438   3.275   101.690 1.00 51.32  ? 103 LEU D CD2 1 
ATOM   6305  N N   . SER D 2 104 ? 4.615   8.154   101.461 1.00 51.54  ? 104 SER D N   1 
ATOM   6306  C CA  . SER D 2 104 ? 5.557   9.229   101.143 1.00 58.27  ? 104 SER D CA  1 
ATOM   6307  C C   . SER D 2 104 ? 6.275   8.997   99.825  1.00 57.05  ? 104 SER D C   1 
ATOM   6308  O O   . SER D 2 104 ? 7.490   9.158   99.738  1.00 70.88  ? 104 SER D O   1 
ATOM   6309  C CB  . SER D 2 104 ? 6.588   9.383   102.262 1.00 55.27  ? 104 SER D CB  1 
ATOM   6310  O OG  . SER D 2 104 ? 5.948   9.668   103.504 1.00 75.08  ? 104 SER D OG  1 
ATOM   6311  N N   . LEU D 2 105 ? 5.516   8.614   98.801  1.00 61.16  ? 105 LEU D N   1 
ATOM   6312  C CA  . LEU D 2 105 ? 6.065   8.356   97.473  1.00 51.19  ? 105 LEU D CA  1 
ATOM   6313  C C   . LEU D 2 105 ? 6.110   9.618   96.621  1.00 37.50  ? 105 LEU D C   1 
ATOM   6314  O O   . LEU D 2 105 ? 6.663   9.618   95.533  1.00 59.32  ? 105 LEU D O   1 
ATOM   6315  C CB  . LEU D 2 105 ? 5.237   7.290   96.761  1.00 48.00  ? 105 LEU D CB  1 
ATOM   6316  C CG  . LEU D 2 105 ? 5.336   5.866   97.309  1.00 65.22  ? 105 LEU D CG  1 
ATOM   6317  C CD1 . LEU D 2 105 ? 4.191   5.020   96.753  1.00 41.19  ? 105 LEU D CD1 1 
ATOM   6318  C CD2 . LEU D 2 105 ? 6.690   5.267   96.941  1.00 44.31  ? 105 LEU D CD2 1 
ATOM   6319  N N   . ILE D 2 106 ? 5.515   10.692  97.110  1.00 53.16  ? 106 ILE D N   1 
ATOM   6320  C CA  . ILE D 2 106 ? 5.520   11.952  96.380  1.00 54.69  ? 106 ILE D CA  1 
ATOM   6321  C C   . ILE D 2 106 ? 5.630   13.055  97.410  1.00 56.35  ? 106 ILE D C   1 
ATOM   6322  O O   . ILE D 2 106 ? 5.002   12.982  98.460  1.00 63.63  ? 106 ILE D O   1 
ATOM   6323  C CB  . ILE D 2 106 ? 4.213   12.166  95.587  1.00 49.84  ? 106 ILE D CB  1 
ATOM   6324  C CG1 . ILE D 2 106 ? 4.029   11.044  94.557  1.00 51.17  ? 106 ILE D CG1 1 
ATOM   6325  C CG2 . ILE D 2 106 ? 4.241   13.534  94.917  1.00 38.05  ? 106 ILE D CG2 1 
ATOM   6326  C CD1 . ILE D 2 106 ? 2.708   11.107  93.785  1.00 53.61  ? 106 ILE D CD1 1 
ATOM   6327  N N   . GLU D 2 107 ? 6.424   14.078  97.120  1.00 59.58  ? 107 GLU D N   1 
ATOM   6328  C CA  . GLU D 2 107 ? 6.572   15.173  98.072  1.00 71.45  ? 107 GLU D CA  1 
ATOM   6329  C C   . GLU D 2 107 ? 5.306   16.015  98.164  1.00 58.41  ? 107 GLU D C   1 
ATOM   6330  O O   . GLU D 2 107 ? 4.694   16.350  97.150  1.00 56.54  ? 107 GLU D O   1 
ATOM   6331  C CB  . GLU D 2 107 ? 7.766   16.063  97.703  1.00 53.03  ? 107 GLU D CB  1 
ATOM   6332  C CG  . GLU D 2 107 ? 7.964   16.255  96.219  1.00 74.42  ? 107 GLU D CG  1 
ATOM   6333  C CD  . GLU D 2 107 ? 8.492   15.006  95.548  1.00 67.53  ? 107 GLU D CD  1 
ATOM   6334  O OE1 . GLU D 2 107 ? 9.589   14.545  95.931  1.00 69.66  ? 107 GLU D OE1 1 
ATOM   6335  O OE2 . GLU D 2 107 ? 7.814   14.483  94.640  1.00 77.26  ? 107 GLU D OE2 1 
ATOM   6336  N N   . GLY D 2 108 ? 4.931   16.344  99.398  1.00 61.36  ? 108 GLY D N   1 
ATOM   6337  C CA  . GLY D 2 108 ? 3.748   17.139  99.660  1.00 43.17  ? 108 GLY D CA  1 
ATOM   6338  C C   . GLY D 2 108 ? 2.936   16.467  100.750 1.00 59.15  ? 108 GLY D C   1 
ATOM   6339  O O   . GLY D 2 108 ? 3.212   15.307  101.099 1.00 62.95  ? 108 GLY D O   1 
ATOM   6340  N N   . ASN D 2 109 ? 1.951   17.178  101.298 1.00 50.12  ? 109 ASN D N   1 
ATOM   6341  C CA  . ASN D 2 109 ? 1.108   16.608  102.348 1.00 61.21  ? 109 ASN D CA  1 
ATOM   6342  C C   . ASN D 2 109 ? -0.382  16.809  102.078 1.00 52.05  ? 109 ASN D C   1 
ATOM   6343  O O   . ASN D 2 109 ? -0.770  17.416  101.079 1.00 58.43  ? 109 ASN D O   1 
ATOM   6344  C CB  . ASN D 2 109 ? 1.458   17.209  103.705 1.00 54.17  ? 109 ASN D CB  1 
ATOM   6345  C CG  . ASN D 2 109 ? 0.913   18.605  103.871 1.00 81.05  ? 109 ASN D CG  1 
ATOM   6346  O OD1 . ASN D 2 109 ? 1.224   19.503  103.076 1.00 50.86  ? 109 ASN D OD1 1 
ATOM   6347  N ND2 . ASN D 2 109 ? 0.087   18.805  104.911 1.00 80.37  ? 109 ASN D ND2 1 
ATOM   6348  N N   . VAL D 2 110 ? -1.212  16.314  102.991 1.00 49.41  ? 110 VAL D N   1 
ATOM   6349  C CA  . VAL D 2 110 ? -2.653  16.403  102.834 1.00 53.92  ? 110 VAL D CA  1 
ATOM   6350  C C   . VAL D 2 110 ? -3.368  17.354  103.792 1.00 50.89  ? 110 VAL D C   1 
ATOM   6351  O O   . VAL D 2 110 ? -3.327  17.213  105.021 1.00 58.99  ? 110 VAL D O   1 
ATOM   6352  C CB  . VAL D 2 110 ? -3.286  14.987  102.910 1.00 49.82  ? 110 VAL D CB  1 
ATOM   6353  C CG1 . VAL D 2 110 ? -4.804  15.078  102.914 1.00 57.42  ? 110 VAL D CG1 1 
ATOM   6354  C CG2 . VAL D 2 110 ? -2.826  14.169  101.717 1.00 52.54  ? 110 VAL D CG2 1 
ATOM   6355  N N   . VAL D 2 111 ? -4.055  18.306  103.181 1.00 59.65  ? 111 VAL D N   1 
ATOM   6356  C CA  . VAL D 2 111 ? -4.798  19.349  103.867 1.00 56.67  ? 111 VAL D CA  1 
ATOM   6357  C C   . VAL D 2 111 ? -6.313  19.190  103.683 1.00 60.99  ? 111 VAL D C   1 
ATOM   6358  O O   . VAL D 2 111 ? -6.767  18.599  102.708 1.00 67.62  ? 111 VAL D O   1 
ATOM   6359  C CB  . VAL D 2 111 ? -4.349  20.705  103.313 1.00 42.49  ? 111 VAL D CB  1 
ATOM   6360  C CG1 . VAL D 2 111 ? -5.469  21.702  103.379 1.00 52.99  ? 111 VAL D CG1 1 
ATOM   6361  C CG2 . VAL D 2 111 ? -3.132  21.181  104.083 1.00 57.75  ? 111 VAL D CG2 1 
ATOM   6362  N N   . LYS D 2 112 ? -7.091  19.719  104.621 1.00 50.27  ? 112 LYS D N   1 
ATOM   6363  C CA  . LYS D 2 112 ? -8.540  19.646  104.530 1.00 48.00  ? 112 LYS D CA  1 
ATOM   6364  C C   . LYS D 2 112 ? -9.025  20.748  103.587 1.00 55.00  ? 112 LYS D C   1 
ATOM   6365  O O   . LYS D 2 112 ? -8.497  21.857  103.602 1.00 65.31  ? 112 LYS D O   1 
ATOM   6366  C CB  . LYS D 2 112 ? -9.152  19.834  105.920 1.00 56.73  ? 112 LYS D CB  1 
ATOM   6367  C CG  . LYS D 2 112 ? -10.664 19.631  106.010 1.00 47.78  ? 112 LYS D CG  1 
ATOM   6368  C CD  . LYS D 2 112 ? -11.129 19.833  107.441 1.00 54.29  ? 112 LYS D CD  1 
ATOM   6369  C CE  . LYS D 2 112 ? -12.620 19.663  107.578 1.00 56.40  ? 112 LYS D CE  1 
ATOM   6370  N NZ  . LYS D 2 112 ? -13.076 19.981  108.963 1.00 73.72  ? 112 LYS D NZ  1 
ATOM   6371  N N   . LEU D 2 113 ? -10.015 20.434  102.752 1.00 57.91  ? 113 LEU D N   1 
ATOM   6372  C CA  . LEU D 2 113 ? -10.569 21.406  101.809 1.00 51.90  ? 113 LEU D CA  1 
ATOM   6373  C C   . LEU D 2 113 ? -11.019 22.621  102.597 1.00 49.94  ? 113 LEU D C   1 
ATOM   6374  O O   . LEU D 2 113 ? -11.274 22.522  103.790 1.00 47.02  ? 113 LEU D O   1 
ATOM   6375  C CB  . LEU D 2 113 ? -11.758 20.799  101.057 1.00 49.55  ? 113 LEU D CB  1 
ATOM   6376  C CG  . LEU D 2 113 ? -11.414 19.827  99.921  1.00 44.60  ? 113 LEU D CG  1 
ATOM   6377  C CD1 . LEU D 2 113 ? -12.592 18.894  99.668  1.00 44.94  ? 113 LEU D CD1 1 
ATOM   6378  C CD2 . LEU D 2 113 ? -11.053 20.611  98.669  1.00 25.40  ? 113 LEU D CD2 1 
ATOM   6379  N N   . ARG D 2 114 ? -11.133 23.763  101.932 1.00 46.35  ? 114 ARG D N   1 
ATOM   6380  C CA  . ARG D 2 114 ? -11.531 24.982  102.617 1.00 55.00  ? 114 ARG D CA  1 
ATOM   6381  C C   . ARG D 2 114 ? -13.018 25.353  102.569 1.00 54.33  ? 114 ARG D C   1 
ATOM   6382  O O   . ARG D 2 114 ? -13.471 26.197  103.334 1.00 49.63  ? 114 ARG D O   1 
ATOM   6383  C CB  . ARG D 2 114 ? -10.657 26.138  102.118 1.00 50.23  ? 114 ARG D CB  1 
ATOM   6384  C CG  . ARG D 2 114 ? -9.185  25.914  102.469 1.00 64.58  ? 114 ARG D CG  1 
ATOM   6385  C CD  . ARG D 2 114 ? -8.282  27.033  102.011 1.00 85.69  ? 114 ARG D CD  1 
ATOM   6386  N NE  . ARG D 2 114 ? -8.357  27.240  100.568 1.00 90.71  ? 114 ARG D NE  1 
ATOM   6387  C CZ  . ARG D 2 114 ? -7.305  27.243  99.751  1.00 89.96  ? 114 ARG D CZ  1 
ATOM   6388  N NH1 . ARG D 2 114 ? -6.078  27.045  100.236 1.00 79.72  ? 114 ARG D NH1 1 
ATOM   6389  N NH2 . ARG D 2 114 ? -7.479  27.454  98.449  1.00 49.94  ? 114 ARG D NH2 1 
ATOM   6390  N N   . SER D 2 115 ? -13.775 24.711  101.688 1.00 61.02  ? 115 SER D N   1 
ATOM   6391  C CA  . SER D 2 115 ? -15.202 24.982  101.559 1.00 54.70  ? 115 SER D CA  1 
ATOM   6392  C C   . SER D 2 115 ? -15.943 24.841  102.881 1.00 47.69  ? 115 SER D C   1 
ATOM   6393  O O   . SER D 2 115 ? -15.428 24.248  103.819 1.00 51.91  ? 115 SER D O   1 
ATOM   6394  C CB  . SER D 2 115 ? -15.821 24.027  100.537 1.00 54.72  ? 115 SER D CB  1 
ATOM   6395  O OG  . SER D 2 115 ? -17.236 24.079  100.591 1.00 55.20  ? 115 SER D OG  1 
ATOM   6396  N N   . ARG D 2 116 ? -17.153 25.400  102.944 1.00 59.48  ? 116 ARG D N   1 
ATOM   6397  C CA  . ARG D 2 116 ? -17.994 25.318  104.138 1.00 55.57  ? 116 ARG D CA  1 
ATOM   6398  C C   . ARG D 2 116 ? -18.896 24.091  104.048 1.00 65.27  ? 116 ARG D C   1 
ATOM   6399  O O   . ARG D 2 116 ? -19.219 23.488  105.068 1.00 60.40  ? 116 ARG D O   1 
ATOM   6400  C CB  . ARG D 2 116 ? -18.887 26.551  104.275 1.00 78.68  ? 116 ARG D CB  1 
ATOM   6401  C CG  . ARG D 2 116 ? -18.155 27.868  104.345 1.00 77.28  ? 116 ARG D CG  1 
ATOM   6402  C CD  . ARG D 2 116 ? -17.205 27.924  105.516 1.00 78.27  ? 116 ARG D CD  1 
ATOM   6403  N NE  . ARG D 2 116 ? -16.447 29.170  105.450 1.00 103.15 ? 116 ARG D NE  1 
ATOM   6404  C CZ  . ARG D 2 116 ? -16.785 30.298  106.072 1.00 103.15 ? 116 ARG D CZ  1 
ATOM   6405  N NH1 . ARG D 2 116 ? -17.872 30.345  106.839 1.00 85.69  ? 116 ARG D NH1 1 
ATOM   6406  N NH2 . ARG D 2 116 ? -16.051 31.393  105.887 1.00 93.24  ? 116 ARG D NH2 1 
ATOM   6407  N N   . ARG D 2 117 ? -19.332 23.749  102.833 1.00 60.89  ? 117 ARG D N   1 
ATOM   6408  C CA  . ARG D 2 117 ? -20.180 22.563  102.622 1.00 74.16  ? 117 ARG D CA  1 
ATOM   6409  C C   . ARG D 2 117 ? -19.151 21.449  102.734 1.00 78.91  ? 117 ARG D C   1 
ATOM   6410  O O   . ARG D 2 117 ? -18.792 20.793  101.750 1.00 78.15  ? 117 ARG D O   1 
ATOM   6411  C CB  . ARG D 2 117 ? -20.808 22.594  101.217 1.00 73.24  ? 117 ARG D CB  1 
ATOM   6412  C CG  . ARG D 2 117 ? -21.708 21.414  100.856 1.00 64.45  ? 117 ARG D CG  1 
ATOM   6413  C CD  . ARG D 2 117 ? -22.853 21.295  101.817 1.00 44.16  ? 117 ARG D CD  1 
ATOM   6414  N NE  . ARG D 2 117 ? -22.425 20.660  103.056 1.00 61.57  ? 117 ARG D NE  1 
ATOM   6415  C CZ  . ARG D 2 117 ? -22.984 20.870  104.243 1.00 68.62  ? 117 ARG D CZ  1 
ATOM   6416  N NH1 . ARG D 2 117 ? -24.005 21.712  104.369 1.00 48.72  ? 117 ARG D NH1 1 
ATOM   6417  N NH2 . ARG D 2 117 ? -22.517 20.228  105.304 1.00 70.42  ? 117 ARG D NH2 1 
ATOM   6418  N N   . LEU D 2 118 ? -18.683 21.259  103.963 1.00 94.88  ? 118 LEU D N   1 
ATOM   6419  C CA  . LEU D 2 118 ? -17.626 20.311  104.282 1.00 88.12  ? 118 LEU D CA  1 
ATOM   6420  C C   . LEU D 2 118 ? -17.285 19.243  103.291 1.00 71.71  ? 118 LEU D C   1 
ATOM   6421  O O   . LEU D 2 118 ? -16.354 19.446  102.500 1.00 89.11  ? 118 LEU D O   1 
ATOM   6422  C CB  . LEU D 2 118 ? -17.819 19.694  105.679 1.00 103.15 ? 118 LEU D CB  1 
ATOM   6423  C CG  . LEU D 2 118 ? -16.770 20.287  106.647 1.00 103.15 ? 118 LEU D CG  1 
ATOM   6424  C CD1 . LEU D 2 118 ? -17.273 21.673  107.114 1.00 84.24  ? 118 LEU D CD1 1 
ATOM   6425  C CD2 . LEU D 2 118 ? -16.497 19.346  107.837 1.00 71.31  ? 118 LEU D CD2 1 
ATOM   6426  N N   . PRO D 2 119 ? -18.016 18.106  103.286 1.00 68.86  ? 119 PRO D N   1 
ATOM   6427  C CA  . PRO D 2 119 ? -17.662 17.058  102.317 1.00 50.28  ? 119 PRO D CA  1 
ATOM   6428  C C   . PRO D 2 119 ? -17.867 17.484  100.868 1.00 35.58  ? 119 PRO D C   1 
ATOM   6429  O O   . PRO D 2 119 ? -18.933 17.964  100.523 1.00 48.74  ? 119 PRO D O   1 
ATOM   6430  C CB  . PRO D 2 119 ? -18.594 15.894  102.687 1.00 56.33  ? 119 PRO D CB  1 
ATOM   6431  C CG  . PRO D 2 119 ? -19.219 16.299  104.030 1.00 61.56  ? 119 PRO D CG  1 
ATOM   6432  C CD  . PRO D 2 119 ? -19.291 17.783  103.952 1.00 54.09  ? 119 PRO D CD  1 
ATOM   6433  N N   . HIS D 2 120 ? -16.845 17.340  100.030 1.00 39.10  ? 120 HIS D N   1 
ATOM   6434  C CA  . HIS D 2 120 ? -16.995 17.660  98.612  1.00 38.99  ? 120 HIS D CA  1 
ATOM   6435  C C   . HIS D 2 120 ? -17.585 16.365  98.076  1.00 51.21  ? 120 HIS D C   1 
ATOM   6436  O O   . HIS D 2 120 ? -16.888 15.353  98.006  1.00 42.08  ? 120 HIS D O   1 
ATOM   6437  C CB  . HIS D 2 120 ? -15.646 17.909  97.942  1.00 32.56  ? 120 HIS D CB  1 
ATOM   6438  C CG  . HIS D 2 120 ? -15.736 18.105  96.457  1.00 59.65  ? 120 HIS D CG  1 
ATOM   6439  N ND1 . HIS D 2 120 ? -14.841 17.540  95.575  1.00 32.54  ? 120 HIS D ND1 1 
ATOM   6440  C CD2 . HIS D 2 120 ? -16.596 18.833  95.703  1.00 40.03  ? 120 HIS D CD2 1 
ATOM   6441  C CE1 . HIS D 2 120 ? -15.143 17.914  94.345  1.00 36.78  ? 120 HIS D CE1 1 
ATOM   6442  N NE2 . HIS D 2 120 ? -16.203 18.700  94.395  1.00 41.58  ? 120 HIS D NE2 1 
ATOM   6443  N N   . MET D 2 121 ? -18.866 16.392  97.721  1.00 45.40  ? 121 MET D N   1 
ATOM   6444  C CA  . MET D 2 121 ? -19.555 15.204  97.236  1.00 33.25  ? 121 MET D CA  1 
ATOM   6445  C C   . MET D 2 121 ? -20.399 15.510  96.018  1.00 41.68  ? 121 MET D C   1 
ATOM   6446  O O   . MET D 2 121 ? -21.166 16.467  96.022  1.00 50.12  ? 121 MET D O   1 
ATOM   6447  C CB  . MET D 2 121 ? -20.437 14.649  98.351  1.00 35.93  ? 121 MET D CB  1 
ATOM   6448  C CG  . MET D 2 121 ? -21.328 13.478  97.966  1.00 31.16  ? 121 MET D CG  1 
ATOM   6449  S SD  . MET D 2 121 ? -22.348 12.958  99.370  1.00 50.71  ? 121 MET D SD  1 
ATOM   6450  C CE  . MET D 2 121 ? -23.309 14.411  99.680  1.00 40.33  ? 121 MET D CE  1 
ATOM   6451  N N   . GLY D 2 122 ? -20.272 14.684  94.985  1.00 39.71  ? 122 GLY D N   1 
ATOM   6452  C CA  . GLY D 2 122 ? -21.037 14.906  93.770  1.00 41.15  ? 122 GLY D CA  1 
ATOM   6453  C C   . GLY D 2 122 ? -20.169 14.894  92.524  1.00 40.12  ? 122 GLY D C   1 
ATOM   6454  O O   . GLY D 2 122 ? -18.991 14.563  92.591  1.00 32.32  ? 122 GLY D O   1 
ATOM   6455  N N   . TRP D 2 123 ? -20.756 15.236  91.381  1.00 32.55  ? 123 TRP D N   1 
ATOM   6456  C CA  . TRP D 2 123 ? -20.020 15.272  90.121  1.00 33.07  ? 123 TRP D CA  1 
ATOM   6457  C C   . TRP D 2 123 ? -19.371 16.635  89.891  1.00 35.52  ? 123 TRP D C   1 
ATOM   6458  O O   . TRP D 2 123 ? -20.025 17.670  89.998  1.00 41.06  ? 123 TRP D O   1 
ATOM   6459  C CB  . TRP D 2 123 ? -20.945 14.967  88.946  1.00 28.97  ? 123 TRP D CB  1 
ATOM   6460  C CG  . TRP D 2 123 ? -21.515 13.588  88.924  1.00 39.60  ? 123 TRP D CG  1 
ATOM   6461  C CD1 . TRP D 2 123 ? -22.619 13.143  89.592  1.00 33.04  ? 123 TRP D CD1 1 
ATOM   6462  C CD2 . TRP D 2 123 ? -21.036 12.481  88.159  1.00 26.72  ? 123 TRP D CD2 1 
ATOM   6463  N NE1 . TRP D 2 123 ? -22.861 11.832  89.282  1.00 33.17  ? 123 TRP D NE1 1 
ATOM   6464  C CE2 . TRP D 2 123 ? -21.905 11.398  88.404  1.00 35.25  ? 123 TRP D CE2 1 
ATOM   6465  C CE3 . TRP D 2 123 ? -19.958 12.298  87.287  1.00 33.24  ? 123 TRP D CE3 1 
ATOM   6466  C CZ2 . TRP D 2 123 ? -21.730 10.141  87.803  1.00 46.62  ? 123 TRP D CZ2 1 
ATOM   6467  C CZ3 . TRP D 2 123 ? -19.783 11.048  86.690  1.00 32.52  ? 123 TRP D CZ3 1 
ATOM   6468  C CH2 . TRP D 2 123 ? -20.667 9.989   86.953  1.00 27.12  ? 123 TRP D CH2 1 
ATOM   6469  N N   . ASN D 2 124 ? -18.082 16.628  89.567  1.00 39.04  ? 124 ASN D N   1 
ATOM   6470  C CA  . ASN D 2 124 ? -17.346 17.858  89.321  1.00 41.23  ? 124 ASN D CA  1 
ATOM   6471  C C   . ASN D 2 124 ? -16.403 17.618  88.149  1.00 49.72  ? 124 ASN D C   1 
ATOM   6472  O O   . ASN D 2 124 ? -16.013 16.482  87.880  1.00 50.99  ? 124 ASN D O   1 
ATOM   6473  C CB  . ASN D 2 124 ? -16.552 18.275  90.563  1.00 41.83  ? 124 ASN D CB  1 
ATOM   6474  C CG  . ASN D 2 124 ? -16.321 19.773  90.636  1.00 36.30  ? 124 ASN D CG  1 
ATOM   6475  O OD1 . ASN D 2 124 ? -16.112 20.419  89.623  1.00 40.45  ? 124 ASN D OD1 1 
ATOM   6476  N ND2 . ASN D 2 124 ? -16.341 20.325  91.844  1.00 36.77  ? 124 ASN D ND2 1 
ATOM   6477  N N   . GLU D 2 125 ? -16.033 18.702  87.470  1.00 45.68  ? 125 GLU D N   1 
ATOM   6478  C CA  . GLU D 2 125 ? -15.173 18.660  86.295  1.00 39.43  ? 125 GLU D CA  1 
ATOM   6479  C C   . GLU D 2 125 ? -13.702 18.476  86.606  1.00 40.23  ? 125 GLU D C   1 
ATOM   6480  O O   . GLU D 2 125 ? -13.211 18.977  87.607  1.00 55.08  ? 125 GLU D O   1 
ATOM   6481  C CB  . GLU D 2 125 ? -15.387 19.947  85.496  1.00 44.40  ? 125 GLU D CB  1 
ATOM   6482  C CG  . GLU D 2 125 ? -14.753 20.004  84.121  1.00 43.43  ? 125 GLU D CG  1 
ATOM   6483  C CD  . GLU D 2 125 ? -15.226 21.230  83.334  1.00 49.71  ? 125 GLU D CD  1 
ATOM   6484  O OE1 . GLU D 2 125 ? -14.831 21.386  82.164  1.00 58.40  ? 125 GLU D OE1 1 
ATOM   6485  O OE2 . GLU D 2 125 ? -15.997 22.043  83.886  1.00 56.91  ? 125 GLU D OE2 1 
ATOM   6486  N N   . VAL D 2 126 ? -13.002 17.748  85.740  1.00 43.54  ? 126 VAL D N   1 
ATOM   6487  C CA  . VAL D 2 126 ? -11.569 17.509  85.907  1.00 32.34  ? 126 VAL D CA  1 
ATOM   6488  C C   . VAL D 2 126 ? -10.819 17.869  84.637  1.00 41.70  ? 126 VAL D C   1 
ATOM   6489  O O   . VAL D 2 126 ? -11.085 17.317  83.574  1.00 52.45  ? 126 VAL D O   1 
ATOM   6490  C CB  . VAL D 2 126 ? -11.254 16.030  86.256  1.00 41.50  ? 126 VAL D CB  1 
ATOM   6491  C CG1 . VAL D 2 126 ? -9.744  15.790  86.193  1.00 41.09  ? 126 VAL D CG1 1 
ATOM   6492  C CG2 . VAL D 2 126 ? -11.786 15.690  87.645  1.00 26.53  ? 126 VAL D CG2 1 
ATOM   6493  N N   . ILE D 2 127 ? -9.893  18.814  84.748  1.00 45.81  ? 127 ILE D N   1 
ATOM   6494  C CA  . ILE D 2 127 ? -9.101  19.230  83.605  1.00 40.54  ? 127 ILE D CA  1 
ATOM   6495  C C   . ILE D 2 127 ? -7.721  18.627  83.737  1.00 45.17  ? 127 ILE D C   1 
ATOM   6496  O O   . ILE D 2 127 ? -6.992  18.908  84.691  1.00 46.94  ? 127 ILE D O   1 
ATOM   6497  C CB  . ILE D 2 127 ? -8.972  20.759  83.520  1.00 42.04  ? 127 ILE D CB  1 
ATOM   6498  C CG1 . ILE D 2 127 ? -10.203 21.363  82.845  1.00 46.91  ? 127 ILE D CG1 1 
ATOM   6499  C CG2 . ILE D 2 127 ? -7.752  21.120  82.705  1.00 46.18  ? 127 ILE D CG2 1 
ATOM   6500  C CD1 . ILE D 2 127 ? -11.520 20.889  83.381  1.00 47.38  ? 127 ILE D CD1 1 
ATOM   6501  N N   . PHE D 2 128 ? -7.363  17.790  82.774  1.00 44.27  ? 128 PHE D N   1 
ATOM   6502  C CA  . PHE D 2 128 ? -6.070  17.140  82.805  1.00 43.12  ? 128 PHE D CA  1 
ATOM   6503  C C   . PHE D 2 128 ? -4.974  17.883  82.043  1.00 54.00  ? 128 PHE D C   1 
ATOM   6504  O O   . PHE D 2 128 ? -5.235  18.600  81.074  1.00 44.61  ? 128 PHE D O   1 
ATOM   6505  C CB  . PHE D 2 128 ? -6.188  15.710  82.271  1.00 37.23  ? 128 PHE D CB  1 
ATOM   6506  C CG  . PHE D 2 128 ? -6.885  14.763  83.205  1.00 40.67  ? 128 PHE D CG  1 
ATOM   6507  C CD1 . PHE D 2 128 ? -8.189  14.359  82.963  1.00 25.91  ? 128 PHE D CD1 1 
ATOM   6508  C CD2 . PHE D 2 128 ? -6.213  14.232  84.308  1.00 36.60  ? 128 PHE D CD2 1 
ATOM   6509  C CE1 . PHE D 2 128 ? -8.814  13.433  83.800  1.00 35.78  ? 128 PHE D CE1 1 
ATOM   6510  C CE2 . PHE D 2 128 ? -6.830  13.309  85.150  1.00 30.15  ? 128 PHE D CE2 1 
ATOM   6511  C CZ  . PHE D 2 128 ? -8.132  12.906  84.896  1.00 41.05  ? 128 PHE D CZ  1 
ATOM   6512  N N   . LYS D 2 129 ? -3.741  17.715  82.517  1.00 49.19  ? 129 LYS D N   1 
ATOM   6513  C CA  . LYS D 2 129 ? -2.590  18.321  81.878  1.00 35.70  ? 129 LYS D CA  1 
ATOM   6514  C C   . LYS D 2 129 ? -2.454  17.617  80.550  1.00 47.32  ? 129 LYS D C   1 
ATOM   6515  O O   . LYS D 2 129 ? -2.156  18.229  79.536  1.00 51.87  ? 129 LYS D O   1 
ATOM   6516  C CB  . LYS D 2 129 ? -1.319  18.082  82.690  1.00 43.18  ? 129 LYS D CB  1 
ATOM   6517  C CG  . LYS D 2 129 ? -1.050  19.092  83.804  1.00 53.27  ? 129 LYS D CG  1 
ATOM   6518  C CD  . LYS D 2 129 ? 0.358   18.905  84.335  1.00 64.32  ? 129 LYS D CD  1 
ATOM   6519  C CE  . LYS D 2 129 ? 0.905   20.168  84.988  1.00 82.35  ? 129 LYS D CE  1 
ATOM   6520  N NZ  . LYS D 2 129 ? 0.110   20.616  86.164  1.00 61.47  ? 129 LYS D NZ  1 
ATOM   6521  N N   . ASP D 2 130 ? -2.706  16.318  80.568  1.00 47.06  ? 130 ASP D N   1 
ATOM   6522  C CA  . ASP D 2 130 ? -2.591  15.512  79.377  1.00 49.68  ? 130 ASP D CA  1 
ATOM   6523  C C   . ASP D 2 130 ? -3.065  14.080  79.622  1.00 50.05  ? 130 ASP D C   1 
ATOM   6524  O O   . ASP D 2 130 ? -3.580  13.753  80.688  1.00 46.05  ? 130 ASP D O   1 
ATOM   6525  C CB  . ASP D 2 130 ? -1.127  15.488  78.923  1.00 52.53  ? 130 ASP D CB  1 
ATOM   6526  C CG  . ASP D 2 130 ? -0.192  14.853  79.963  1.00 60.51  ? 130 ASP D CG  1 
ATOM   6527  O OD1 . ASP D 2 130 ? 0.703   15.552  80.495  1.00 57.84  ? 130 ASP D OD1 1 
ATOM   6528  O OD2 . ASP D 2 130 ? -0.349  13.650  80.248  1.00 51.13  ? 130 ASP D OD2 1 
ATOM   6529  N N   . THR D 2 131 ? -2.886  13.244  78.605  1.00 49.19  ? 131 THR D N   1 
ATOM   6530  C CA  . THR D 2 131 ? -3.219  11.826  78.658  1.00 47.84  ? 131 THR D CA  1 
ATOM   6531  C C   . THR D 2 131 ? -4.654  11.431  78.981  1.00 53.79  ? 131 THR D C   1 
ATOM   6532  O O   . THR D 2 131 ? -5.327  10.804  78.160  1.00 49.54  ? 131 THR D O   1 
ATOM   6533  C CB  . THR D 2 131 ? -2.286  11.093  79.652  1.00 53.53  ? 131 THR D CB  1 
ATOM   6534  O OG1 . THR D 2 131 ? -0.926  11.439  79.373  1.00 46.45  ? 131 THR D OG1 1 
ATOM   6535  C CG2 . THR D 2 131 ? -2.444  9.574   79.526  1.00 38.70  ? 131 THR D CG2 1 
ATOM   6536  N N   . PHE D 2 132 ? -5.123  11.774  80.173  1.00 35.81  ? 132 PHE D N   1 
ATOM   6537  C CA  . PHE D 2 132 ? -6.469  11.395  80.569  1.00 44.19  ? 132 PHE D CA  1 
ATOM   6538  C C   . PHE D 2 132 ? -7.567  12.309  80.055  1.00 34.23  ? 132 PHE D C   1 
ATOM   6539  O O   . PHE D 2 132 ? -7.325  13.458  79.710  1.00 49.19  ? 132 PHE D O   1 
ATOM   6540  C CB  . PHE D 2 132 ? -6.526  11.231  82.090  1.00 37.91  ? 132 PHE D CB  1 
ATOM   6541  C CG  . PHE D 2 132 ? -5.518  10.250  82.604  1.00 30.45  ? 132 PHE D CG  1 
ATOM   6542  C CD1 . PHE D 2 132 ? -4.248  10.672  82.992  1.00 38.64  ? 132 PHE D CD1 1 
ATOM   6543  C CD2 . PHE D 2 132 ? -5.800  8.887   82.614  1.00 39.78  ? 132 PHE D CD2 1 
ATOM   6544  C CE1 . PHE D 2 132 ? -3.273  9.750   83.378  1.00 42.98  ? 132 PHE D CE1 1 
ATOM   6545  C CE2 . PHE D 2 132 ? -4.829  7.959   83.000  1.00 46.04  ? 132 PHE D CE2 1 
ATOM   6546  C CZ  . PHE D 2 132 ? -3.563  8.398   83.381  1.00 29.17  ? 132 PHE D CZ  1 
ATOM   6547  N N   . PRO D 2 133 ? -8.795  11.788  79.968  1.00 37.71  ? 133 PRO D N   1 
ATOM   6548  C CA  . PRO D 2 133 ? -9.964  12.529  79.481  1.00 40.10  ? 133 PRO D CA  1 
ATOM   6549  C C   . PRO D 2 133 ? -10.692 13.514  80.402  1.00 39.48  ? 133 PRO D C   1 
ATOM   6550  O O   . PRO D 2 133 ? -11.162 13.159  81.474  1.00 36.50  ? 133 PRO D O   1 
ATOM   6551  C CB  . PRO D 2 133 ? -10.887 11.413  78.997  1.00 44.65  ? 133 PRO D CB  1 
ATOM   6552  C CG  . PRO D 2 133 ? -10.596 10.315  79.971  1.00 42.88  ? 133 PRO D CG  1 
ATOM   6553  C CD  . PRO D 2 133 ? -9.090  10.348  80.079  1.00 33.47  ? 133 PRO D CD  1 
ATOM   6554  N N   . ASN D 2 134 ? -10.798 14.756  79.947  1.00 34.66  ? 134 ASN D N   1 
ATOM   6555  C CA  . ASN D 2 134 ? -11.497 15.780  80.694  1.00 41.21  ? 134 ASN D CA  1 
ATOM   6556  C C   . ASN D 2 134 ? -12.953 15.401  80.738  1.00 34.43  ? 134 ASN D C   1 
ATOM   6557  O O   . ASN D 2 134 ? -13.460 14.756  79.818  1.00 50.71  ? 134 ASN D O   1 
ATOM   6558  C CB  . ASN D 2 134 ? -11.403 17.136  80.007  1.00 48.94  ? 134 ASN D CB  1 
ATOM   6559  C CG  . ASN D 2 134 ? -9.991  17.633  79.889  1.00 53.83  ? 134 ASN D CG  1 
ATOM   6560  O OD1 . ASN D 2 134 ? -9.075  17.121  80.536  1.00 42.79  ? 134 ASN D OD1 1 
ATOM   6561  N ND2 . ASN D 2 134 ? -9.806  18.654  79.064  1.00 47.07  ? 134 ASN D ND2 1 
ATOM   6562  N N   . GLY D 2 135 ? -13.627 15.821  81.803  1.00 41.90  ? 135 GLY D N   1 
ATOM   6563  C CA  . GLY D 2 135 ? -15.035 15.525  81.959  1.00 38.48  ? 135 GLY D CA  1 
ATOM   6564  C C   . GLY D 2 135 ? -15.465 15.549  83.410  1.00 39.62  ? 135 GLY D C   1 
ATOM   6565  O O   . GLY D 2 135 ? -14.728 16.018  84.271  1.00 44.94  ? 135 GLY D O   1 
ATOM   6566  N N   . TYR D 2 136 ? -16.663 15.042  83.682  1.00 40.98  ? 136 TYR D N   1 
ATOM   6567  C CA  . TYR D 2 136 ? -17.170 15.014  85.033  1.00 29.35  ? 136 TYR D CA  1 
ATOM   6568  C C   . TYR D 2 136 ? -16.931 13.683  85.715  1.00 47.89  ? 136 TYR D C   1 
ATOM   6569  O O   . TYR D 2 136 ? -17.302 12.639  85.191  1.00 38.43  ? 136 TYR D O   1 
ATOM   6570  C CB  . TYR D 2 136 ? -18.661 15.333  85.049  1.00 38.87  ? 136 TYR D CB  1 
ATOM   6571  C CG  . TYR D 2 136 ? -18.961 16.818  84.991  1.00 60.39  ? 136 TYR D CG  1 
ATOM   6572  C CD1 . TYR D 2 136 ? -18.990 17.499  83.772  1.00 51.96  ? 136 TYR D CD1 1 
ATOM   6573  C CD2 . TYR D 2 136 ? -19.218 17.545  86.162  1.00 40.25  ? 136 TYR D CD2 1 
ATOM   6574  C CE1 . TYR D 2 136 ? -19.270 18.863  83.720  1.00 39.58  ? 136 TYR D CE1 1 
ATOM   6575  C CE2 . TYR D 2 136 ? -19.499 18.901  86.117  1.00 35.05  ? 136 TYR D CE2 1 
ATOM   6576  C CZ  . TYR D 2 136 ? -19.524 19.553  84.894  1.00 51.03  ? 136 TYR D CZ  1 
ATOM   6577  O OH  . TYR D 2 136 ? -19.800 20.893  84.835  1.00 43.28  ? 136 TYR D OH  1 
ATOM   6578  N N   . TYR D 2 137 ? -16.300 13.723  86.886  1.00 38.03  ? 137 TYR D N   1 
ATOM   6579  C CA  . TYR D 2 137 ? -16.038 12.505  87.646  1.00 46.08  ? 137 TYR D CA  1 
ATOM   6580  C C   . TYR D 2 137 ? -16.692 12.662  89.012  1.00 39.40  ? 137 TYR D C   1 
ATOM   6581  O O   . TYR D 2 137 ? -16.843 13.772  89.500  1.00 45.28  ? 137 TYR D O   1 
ATOM   6582  C CB  . TYR D 2 137 ? -14.531 12.252  87.788  1.00 25.39  ? 137 TYR D CB  1 
ATOM   6583  C CG  . TYR D 2 137 ? -13.802 11.970  86.480  1.00 50.13  ? 137 TYR D CG  1 
ATOM   6584  C CD1 . TYR D 2 137 ? -13.407 13.008  85.619  1.00 35.19  ? 137 TYR D CD1 1 
ATOM   6585  C CD2 . TYR D 2 137 ? -13.461 10.667  86.121  1.00 44.00  ? 137 TYR D CD2 1 
ATOM   6586  C CE1 . TYR D 2 137 ? -12.678 12.738  84.444  1.00 39.87  ? 137 TYR D CE1 1 
ATOM   6587  C CE2 . TYR D 2 137 ? -12.740 10.394  84.953  1.00 39.52  ? 137 TYR D CE2 1 
ATOM   6588  C CZ  . TYR D 2 137 ? -12.347 11.425  84.127  1.00 37.54  ? 137 TYR D CZ  1 
ATOM   6589  O OH  . TYR D 2 137 ? -11.592 11.132  83.021  1.00 37.72  ? 137 TYR D OH  1 
ATOM   6590  N N   . TYR D 2 138 ? -17.103 11.551  89.612  1.00 43.38  ? 138 TYR D N   1 
ATOM   6591  C CA  . TYR D 2 138 ? -17.762 11.577  90.913  1.00 31.13  ? 138 TYR D CA  1 
ATOM   6592  C C   . TYR D 2 138 ? -16.788 11.675  92.096  1.00 45.28  ? 138 TYR D C   1 
ATOM   6593  O O   . TYR D 2 138 ? -15.876 10.862  92.218  1.00 34.67  ? 138 TYR D O   1 
ATOM   6594  C CB  . TYR D 2 138 ? -18.627 10.336  91.072  1.00 28.12  ? 138 TYR D CB  1 
ATOM   6595  C CG  . TYR D 2 138 ? -19.556 10.426  92.251  1.00 42.14  ? 138 TYR D CG  1 
ATOM   6596  C CD1 . TYR D 2 138 ? -20.637 11.312  92.242  1.00 25.00  ? 138 TYR D CD1 1 
ATOM   6597  C CD2 . TYR D 2 138 ? -19.352 9.645   93.382  1.00 36.83  ? 138 TYR D CD2 1 
ATOM   6598  C CE1 . TYR D 2 138 ? -21.488 11.416  93.326  1.00 29.17  ? 138 TYR D CE1 1 
ATOM   6599  C CE2 . TYR D 2 138 ? -20.201 9.742   94.477  1.00 50.86  ? 138 TYR D CE2 1 
ATOM   6600  C CZ  . TYR D 2 138 ? -21.266 10.627  94.440  1.00 40.92  ? 138 TYR D CZ  1 
ATOM   6601  O OH  . TYR D 2 138 ? -22.109 10.708  95.514  1.00 47.68  ? 138 TYR D OH  1 
ATOM   6602  N N   . PHE D 2 139 ? -17.009 12.667  92.962  1.00 35.67  ? 139 PHE D N   1 
ATOM   6603  C CA  . PHE D 2 139 ? -16.169 12.920  94.143  1.00 43.54  ? 139 PHE D CA  1 
ATOM   6604  C C   . PHE D 2 139 ? -16.865 12.731  95.493  1.00 35.33  ? 139 PHE D C   1 
ATOM   6605  O O   . PHE D 2 139 ? -18.068 12.938  95.627  1.00 46.80  ? 139 PHE D O   1 
ATOM   6606  C CB  . PHE D 2 139 ? -15.629 14.359  94.148  1.00 30.03  ? 139 PHE D CB  1 
ATOM   6607  C CG  . PHE D 2 139 ? -14.644 14.670  93.060  1.00 51.16  ? 139 PHE D CG  1 
ATOM   6608  C CD1 . PHE D 2 139 ? -15.043 14.729  91.726  1.00 36.94  ? 139 PHE D CD1 1 
ATOM   6609  C CD2 . PHE D 2 139 ? -13.319 14.969  93.378  1.00 31.67  ? 139 PHE D CD2 1 
ATOM   6610  C CE1 . PHE D 2 139 ? -14.140 15.086  90.736  1.00 44.15  ? 139 PHE D CE1 1 
ATOM   6611  C CE2 . PHE D 2 139 ? -12.416 15.327  92.392  1.00 33.47  ? 139 PHE D CE2 1 
ATOM   6612  C CZ  . PHE D 2 139 ? -12.823 15.388  91.070  1.00 38.22  ? 139 PHE D CZ  1 
ATOM   6613  N N   . VAL D 2 140 ? -16.077 12.352  96.492  1.00 44.05  ? 140 VAL D N   1 
ATOM   6614  C CA  . VAL D 2 140 ? -16.543 12.189  97.867  1.00 44.45  ? 140 VAL D CA  1 
ATOM   6615  C C   . VAL D 2 140 ? -15.307 12.196  98.762  1.00 42.43  ? 140 VAL D C   1 
ATOM   6616  O O   . VAL D 2 140 ? -14.716 11.153  99.010  1.00 48.39  ? 140 VAL D O   1 
ATOM   6617  C CB  . VAL D 2 140 ? -17.296 10.862  98.118  1.00 49.08  ? 140 VAL D CB  1 
ATOM   6618  C CG1 . VAL D 2 140 ? -17.967 10.925  99.488  1.00 47.54  ? 140 VAL D CG1 1 
ATOM   6619  C CG2 . VAL D 2 140 ? -18.340 10.613  97.052  1.00 55.77  ? 140 VAL D CG2 1 
ATOM   6620  N N   . HIS D 2 141 ? -14.918 13.376  99.230  1.00 40.73  ? 141 HIS D N   1 
ATOM   6621  C CA  . HIS D 2 141 ? -13.747 13.519  100.079 1.00 35.98  ? 141 HIS D CA  1 
ATOM   6622  C C   . HIS D 2 141 ? -13.781 14.830  100.852 1.00 42.37  ? 141 HIS D C   1 
ATOM   6623  O O   . HIS D 2 141 ? -14.490 15.756  100.479 1.00 48.25  ? 141 HIS D O   1 
ATOM   6624  C CB  . HIS D 2 141 ? -12.470 13.472  99.240  1.00 29.35  ? 141 HIS D CB  1 
ATOM   6625  C CG  . HIS D 2 141 ? -12.323 14.622  98.293  1.00 37.72  ? 141 HIS D CG  1 
ATOM   6626  N ND1 . HIS D 2 141 ? -11.192 15.405  98.245  1.00 41.07  ? 141 HIS D ND1 1 
ATOM   6627  C CD2 . HIS D 2 141 ? -13.155 15.107  97.342  1.00 40.63  ? 141 HIS D CD2 1 
ATOM   6628  C CE1 . HIS D 2 141 ? -11.332 16.323  97.305  1.00 37.54  ? 141 HIS D CE1 1 
ATOM   6629  N NE2 . HIS D 2 141 ? -12.513 16.163  96.743  1.00 35.47  ? 141 HIS D NE2 1 
ATOM   6630  N N   . THR D 2 142 ? -13.006 14.910  101.927 1.00 47.19  ? 142 THR D N   1 
ATOM   6631  C CA  . THR D 2 142 ? -12.955 16.125  102.734 1.00 46.14  ? 142 THR D CA  1 
ATOM   6632  C C   . THR D 2 142 ? -11.585 16.776  102.630 1.00 45.13  ? 142 THR D C   1 
ATOM   6633  O O   . THR D 2 142 ? -11.463 18.004  102.718 1.00 51.42  ? 142 THR D O   1 
ATOM   6634  C CB  . THR D 2 142 ? -13.256 15.827  104.216 1.00 34.39  ? 142 THR D CB  1 
ATOM   6635  O OG1 . THR D 2 142 ? -14.546 15.229  104.323 1.00 47.09  ? 142 THR D OG1 1 
ATOM   6636  C CG2 . THR D 2 142 ? -13.280 17.095  105.018 1.00 63.63  ? 142 THR D CG2 1 
ATOM   6637  N N   . TYR D 2 143 ? -10.566 15.944  102.420 1.00 42.60  ? 143 TYR D N   1 
ATOM   6638  C CA  . TYR D 2 143 ? -9.177  16.394  102.312 1.00 36.04  ? 143 TYR D CA  1 
ATOM   6639  C C   . TYR D 2 143 ? -8.625  16.393  100.881 1.00 49.47  ? 143 TYR D C   1 
ATOM   6640  O O   . TYR D 2 143 ? -9.138  15.698  100.001 1.00 44.10  ? 143 TYR D O   1 
ATOM   6641  C CB  . TYR D 2 143 ? -8.284  15.522  103.196 1.00 44.03  ? 143 TYR D CB  1 
ATOM   6642  C CG  . TYR D 2 143 ? -8.610  15.615  104.665 1.00 36.57  ? 143 TYR D CG  1 
ATOM   6643  C CD1 . TYR D 2 143 ? -9.561  14.777  105.251 1.00 49.60  ? 143 TYR D CD1 1 
ATOM   6644  C CD2 . TYR D 2 143 ? -8.006  16.586  105.460 1.00 55.15  ? 143 TYR D CD2 1 
ATOM   6645  C CE1 . TYR D 2 143 ? -9.909  14.915  106.606 1.00 63.89  ? 143 TYR D CE1 1 
ATOM   6646  C CE2 . TYR D 2 143 ? -8.340  16.736  106.800 1.00 64.93  ? 143 TYR D CE2 1 
ATOM   6647  C CZ  . TYR D 2 143 ? -9.292  15.906  107.369 1.00 76.74  ? 143 TYR D CZ  1 
ATOM   6648  O OH  . TYR D 2 143 ? -9.630  16.106  108.684 1.00 68.31  ? 143 TYR D OH  1 
ATOM   6649  N N   . ARG D 2 144 ? -7.560  17.166  100.676 1.00 39.70  ? 144 ARG D N   1 
ATOM   6650  C CA  . ARG D 2 144 ? -6.899  17.304  99.381  1.00 44.70  ? 144 ARG D CA  1 
ATOM   6651  C C   . ARG D 2 144 ? -5.365  17.236  99.451  1.00 55.01  ? 144 ARG D C   1 
ATOM   6652  O O   . ARG D 2 144 ? -4.752  17.351  100.515 1.00 57.51  ? 144 ARG D O   1 
ATOM   6653  C CB  . ARG D 2 144 ? -7.281  18.641  98.742  1.00 39.53  ? 144 ARG D CB  1 
ATOM   6654  C CG  . ARG D 2 144 ? -7.129  19.806  99.703  1.00 45.03  ? 144 ARG D CG  1 
ATOM   6655  C CD  . ARG D 2 144 ? -6.921  21.107  98.980  1.00 43.10  ? 144 ARG D CD  1 
ATOM   6656  N NE  . ARG D 2 144 ? -5.603  21.145  98.359  1.00 55.59  ? 144 ARG D NE  1 
ATOM   6657  C CZ  . ARG D 2 144 ? -5.126  22.181  97.684  1.00 53.12  ? 144 ARG D CZ  1 
ATOM   6658  N NH1 . ARG D 2 144 ? -5.856  23.278  97.542  1.00 31.31  ? 144 ARG D NH1 1 
ATOM   6659  N NH2 . ARG D 2 144 ? -3.922  22.103  97.132  1.00 51.20  ? 144 ARG D NH2 1 
ATOM   6660  N N   . ALA D 2 145 ? -4.752  17.076  98.290  1.00 54.43  ? 145 ALA D N   1 
ATOM   6661  C CA  . ALA D 2 145 ? -3.310  17.016  98.201  1.00 48.43  ? 145 ALA D CA  1 
ATOM   6662  C C   . ALA D 2 145 ? -2.760  18.411  97.967  1.00 46.20  ? 145 ALA D C   1 
ATOM   6663  O O   . ALA D 2 145 ? -3.441  19.290  97.450  1.00 49.02  ? 145 ALA D O   1 
ATOM   6664  C CB  . ALA D 2 145 ? -2.892  16.095  97.058  1.00 55.65  ? 145 ALA D CB  1 
ATOM   6665  N N   . VAL D 2 146 ? -1.519  18.607  98.377  1.00 57.09  ? 146 VAL D N   1 
ATOM   6666  C CA  . VAL D 2 146 ? -0.837  19.874  98.195  1.00 48.90  ? 146 VAL D CA  1 
ATOM   6667  C C   . VAL D 2 146 ? 0.543   19.476  97.751  1.00 45.91  ? 146 VAL D C   1 
ATOM   6668  O O   . VAL D 2 146 ? 1.329   18.994  98.544  1.00 52.72  ? 146 VAL D O   1 
ATOM   6669  C CB  . VAL D 2 146 ? -0.703  20.661  99.497  1.00 58.63  ? 146 VAL D CB  1 
ATOM   6670  C CG1 . VAL D 2 146 ? 0.009   21.986  99.220  1.00 48.76  ? 146 VAL D CG1 1 
ATOM   6671  C CG2 . VAL D 2 146 ? -2.055  20.899  100.098 1.00 47.14  ? 146 VAL D CG2 1 
ATOM   6672  N N   . CYS D 2 147 ? 0.835   19.654  96.477  1.00 46.21  ? 147 CYS D N   1 
ATOM   6673  C CA  . CYS D 2 147 ? 2.136   19.283  95.982  1.00 47.92  ? 147 CYS D CA  1 
ATOM   6674  C C   . CYS D 2 147 ? 2.560   20.369  95.036  1.00 53.61  ? 147 CYS D C   1 
ATOM   6675  O O   . CYS D 2 147 ? 1.820   21.331  94.827  1.00 52.49  ? 147 CYS D O   1 
ATOM   6676  C CB  . CYS D 2 147 ? 2.054   17.941  95.260  1.00 57.63  ? 147 CYS D CB  1 
ATOM   6677  S SG  . CYS D 2 147 ? 0.812   17.910  93.947  1.00 60.10  ? 147 CYS D SG  1 
ATOM   6678  N N   . GLU D 2 148 ? 3.757   20.215  94.481  1.00 49.73  ? 148 GLU D N   1 
ATOM   6679  C CA  . GLU D 2 148 ? 4.316   21.174  93.541  1.00 46.79  ? 148 GLU D CA  1 
ATOM   6680  C C   . GLU D 2 148 ? 3.576   21.027  92.229  1.00 48.74  ? 148 GLU D C   1 
ATOM   6681  O O   . GLU D 2 148 ? 3.069   19.953  91.920  1.00 56.38  ? 148 GLU D O   1 
ATOM   6682  C CB  . GLU D 2 148 ? 5.808   20.896  93.322  1.00 61.43  ? 148 GLU D CB  1 
ATOM   6683  C CG  . GLU D 2 148 ? 6.698   21.257  94.507  1.00 64.09  ? 148 GLU D CG  1 
ATOM   6684  C CD  . GLU D 2 148 ? 6.732   22.755  94.770  1.00 69.52  ? 148 GLU D CD  1 
ATOM   6685  O OE1 . GLU D 2 148 ? 7.296   23.504  93.936  1.00 65.06  ? 148 GLU D OE1 1 
ATOM   6686  O OE2 . GLU D 2 148 ? 6.189   23.182  95.815  1.00 83.92  ? 148 GLU D OE2 1 
ATOM   6687  N N   . GLU D 2 149 ? 3.517   22.108  91.461  1.00 57.00  ? 149 GLU D N   1 
ATOM   6688  C CA  . GLU D 2 149 ? 2.825   22.092  90.179  1.00 66.96  ? 149 GLU D CA  1 
ATOM   6689  C C   . GLU D 2 149 ? 3.316   20.896  89.354  1.00 55.22  ? 149 GLU D C   1 
ATOM   6690  O O   . GLU D 2 149 ? 2.531   20.176  88.751  1.00 52.66  ? 149 GLU D O   1 
ATOM   6691  C CB  . GLU D 2 149 ? 3.096   23.405  89.431  1.00 60.99  ? 149 GLU D CB  1 
ATOM   6692  C CG  . GLU D 2 149 ? 1.884   24.018  88.726  1.00 71.75  ? 149 GLU D CG  1 
ATOM   6693  C CD  . GLU D 2 149 ? 1.239   23.081  87.723  1.00 67.32  ? 149 GLU D CD  1 
ATOM   6694  O OE1 . GLU D 2 149 ? 1.929   22.162  87.224  1.00 64.05  ? 149 GLU D OE1 1 
ATOM   6695  O OE2 . GLU D 2 149 ? 0.040   23.271  87.421  1.00 71.57  ? 149 GLU D OE2 1 
ATOM   6696  N N   . GLU D 2 150 ? 4.627   20.700  89.342  1.00 59.94  ? 150 GLU D N   1 
ATOM   6697  C CA  . GLU D 2 150 ? 5.259   19.598  88.607  1.00 69.22  ? 150 GLU D CA  1 
ATOM   6698  C C   . GLU D 2 150 ? 4.554   18.243  88.819  1.00 70.27  ? 150 GLU D C   1 
ATOM   6699  O O   . GLU D 2 150 ? 4.607   17.350  87.963  1.00 55.44  ? 150 GLU D O   1 
ATOM   6700  C CB  . GLU D 2 150 ? 6.733   19.510  89.028  1.00 69.14  ? 150 GLU D CB  1 
ATOM   6701  C CG  . GLU D 2 150 ? 7.377   18.135  88.908  1.00 103.15 ? 150 GLU D CG  1 
ATOM   6702  C CD  . GLU D 2 150 ? 8.808   18.105  89.480  1.00 103.15 ? 150 GLU D CD  1 
ATOM   6703  O OE1 . GLU D 2 150 ? 9.073   18.799  90.506  1.00 103.15 ? 150 GLU D OE1 1 
ATOM   6704  O OE2 . GLU D 2 150 ? 9.659   17.369  88.908  1.00 103.15 ? 150 GLU D OE2 1 
ATOM   6705  N N   . HIS D 2 151 ? 3.897   18.094  89.963  1.00 61.90  ? 151 HIS D N   1 
ATOM   6706  C CA  . HIS D 2 151 ? 3.198   16.860  90.258  1.00 54.05  ? 151 HIS D CA  1 
ATOM   6707  C C   . HIS D 2 151 ? 1.686   16.917  89.990  1.00 58.45  ? 151 HIS D C   1 
ATOM   6708  O O   . HIS D 2 151 ? 1.013   15.886  89.981  1.00 42.62  ? 151 HIS D O   1 
ATOM   6709  C CB  . HIS D 2 151 ? 3.477   16.453  91.703  1.00 56.68  ? 151 HIS D CB  1 
ATOM   6710  C CG  . HIS D 2 151 ? 4.917   16.154  91.965  1.00 62.59  ? 151 HIS D CG  1 
ATOM   6711  N ND1 . HIS D 2 151 ? 5.693   15.427  91.087  1.00 71.93  ? 151 HIS D ND1 1 
ATOM   6712  C CD2 . HIS D 2 151 ? 5.725   16.481  93.001  1.00 59.62  ? 151 HIS D CD2 1 
ATOM   6713  C CE1 . HIS D 2 151 ? 6.918   15.321  91.570  1.00 59.57  ? 151 HIS D CE1 1 
ATOM   6714  N NE2 . HIS D 2 151 ? 6.963   15.952  92.730  1.00 60.13  ? 151 HIS D NE2 1 
ATOM   6715  N N   . VAL D 2 152 ? 1.153   18.111  89.769  1.00 42.07  ? 152 VAL D N   1 
ATOM   6716  C CA  . VAL D 2 152 ? -0.269  18.246  89.481  1.00 54.05  ? 152 VAL D CA  1 
ATOM   6717  C C   . VAL D 2 152 ? -0.546  17.682  88.091  1.00 54.70  ? 152 VAL D C   1 
ATOM   6718  O O   . VAL D 2 152 ? 0.102   18.073  87.126  1.00 60.47  ? 152 VAL D O   1 
ATOM   6719  C CB  . VAL D 2 152 ? -0.720  19.719  89.517  1.00 47.27  ? 152 VAL D CB  1 
ATOM   6720  C CG1 . VAL D 2 152 ? -2.149  19.831  89.007  1.00 53.02  ? 152 VAL D CG1 1 
ATOM   6721  C CG2 . VAL D 2 152 ? -0.629  20.259  90.937  1.00 35.44  ? 152 VAL D CG2 1 
ATOM   6722  N N   . LEU D 2 153 ? -1.510  16.767  88.003  1.00 48.79  ? 153 LEU D N   1 
ATOM   6723  C CA  . LEU D 2 153 ? -1.879  16.121  86.744  1.00 38.27  ? 153 LEU D CA  1 
ATOM   6724  C C   . LEU D 2 153 ? -3.320  16.474  86.364  1.00 36.96  ? 153 LEU D C   1 
ATOM   6725  O O   . LEU D 2 153 ? -3.697  16.490  85.194  1.00 43.80  ? 153 LEU D O   1 
ATOM   6726  C CB  . LEU D 2 153 ? -1.762  14.604  86.902  1.00 50.77  ? 153 LEU D CB  1 
ATOM   6727  C CG  . LEU D 2 153 ? -1.652  13.668  85.691  1.00 55.53  ? 153 LEU D CG  1 
ATOM   6728  C CD1 . LEU D 2 153 ? -2.331  12.360  86.058  1.00 29.13  ? 153 LEU D CD1 1 
ATOM   6729  C CD2 . LEU D 2 153 ? -2.300  14.263  84.450  1.00 52.94  ? 153 LEU D CD2 1 
ATOM   6730  N N   . GLY D 2 154 ? -4.128  16.743  87.375  1.00 54.95  ? 154 GLY D N   1 
ATOM   6731  C CA  . GLY D 2 154 ? -5.510  17.073  87.131  1.00 46.84  ? 154 GLY D CA  1 
ATOM   6732  C C   . GLY D 2 154 ? -5.974  18.141  88.085  1.00 49.70  ? 154 GLY D C   1 
ATOM   6733  O O   . GLY D 2 154 ? -5.609  18.146  89.255  1.00 38.60  ? 154 GLY D O   1 
ATOM   6734  N N   . THR D 2 155 ? -6.811  19.028  87.571  1.00 33.96  ? 155 THR D N   1 
ATOM   6735  C CA  . THR D 2 155 ? -7.339  20.142  88.337  1.00 54.04  ? 155 THR D CA  1 
ATOM   6736  C C   . THR D 2 155 ? -8.865  20.158  88.371  1.00 43.63  ? 155 THR D C   1 
ATOM   6737  O O   . THR D 2 155 ? -9.522  19.849  87.383  1.00 56.66  ? 155 THR D O   1 
ATOM   6738  C CB  . THR D 2 155 ? -6.804  21.455  87.734  1.00 51.91  ? 155 THR D CB  1 
ATOM   6739  O OG1 . THR D 2 155 ? -5.414  21.574  88.057  1.00 56.27  ? 155 THR D OG1 1 
ATOM   6740  C CG2 . THR D 2 155 ? -7.567  22.649  88.234  1.00 56.00  ? 155 THR D CG2 1 
ATOM   6741  N N   . THR D 2 156 ? -9.404  20.517  89.530  1.00 42.08  ? 156 THR D N   1 
ATOM   6742  C CA  . THR D 2 156 ? -10.836 20.605  89.780  1.00 34.34  ? 156 THR D CA  1 
ATOM   6743  C C   . THR D 2 156 ? -11.071 21.775  90.723  1.00 46.02  ? 156 THR D C   1 
ATOM   6744  O O   . THR D 2 156 ? -10.230 22.071  91.563  1.00 52.05  ? 156 THR D O   1 
ATOM   6745  C CB  . THR D 2 156 ? -11.361 19.329  90.468  1.00 34.91  ? 156 THR D CB  1 
ATOM   6746  O OG1 . THR D 2 156 ? -11.398 18.262  89.517  1.00 52.19  ? 156 THR D OG1 1 
ATOM   6747  C CG2 . THR D 2 156 ? -12.755 19.554  91.048  1.00 36.21  ? 156 THR D CG2 1 
ATOM   6748  N N   . GLU D 2 157 ? -12.207 22.447  90.587  1.00 49.36  ? 157 GLU D N   1 
ATOM   6749  C CA  . GLU D 2 157 ? -12.502 23.568  91.473  1.00 50.57  ? 157 GLU D CA  1 
ATOM   6750  C C   . GLU D 2 157 ? -13.804 23.312  92.225  1.00 41.63  ? 157 GLU D C   1 
ATOM   6751  O O   . GLU D 2 157 ? -14.799 22.898  91.634  1.00 57.97  ? 157 GLU D O   1 
ATOM   6752  C CB  . GLU D 2 157 ? -12.585 24.881  90.672  1.00 52.49  ? 157 GLU D CB  1 
ATOM   6753  C CG  . GLU D 2 157 ? -13.908 25.153  89.955  1.00 75.16  ? 157 GLU D CG  1 
ATOM   6754  C CD  . GLU D 2 157 ? -14.916 25.893  90.834  1.00 74.04  ? 157 GLU D CD  1 
ATOM   6755  O OE1 . GLU D 2 157 ? -16.054 26.107  90.379  1.00 72.40  ? 157 GLU D OE1 1 
ATOM   6756  O OE2 . GLU D 2 157 ? -14.571 26.262  91.977  1.00 64.00  ? 157 GLU D OE2 1 
ATOM   6757  N N   . TYR D 2 158 ? -13.785 23.533  93.535  1.00 46.55  ? 158 TYR D N   1 
ATOM   6758  C CA  . TYR D 2 158 ? -14.969 23.337  94.361  1.00 49.53  ? 158 TYR D CA  1 
ATOM   6759  C C   . TYR D 2 158 ? -15.193 24.466  95.352  1.00 49.85  ? 158 TYR D C   1 
ATOM   6760  O O   . TYR D 2 158 ? -14.355 24.726  96.215  1.00 49.51  ? 158 TYR D O   1 
ATOM   6761  C CB  . TYR D 2 158 ? -14.897 22.029  95.154  1.00 42.61  ? 158 TYR D CB  1 
ATOM   6762  C CG  . TYR D 2 158 ? -16.028 21.916  96.153  1.00 29.40  ? 158 TYR D CG  1 
ATOM   6763  C CD1 . TYR D 2 158 ? -17.344 22.124  95.750  1.00 58.14  ? 158 TYR D CD1 1 
ATOM   6764  C CD2 . TYR D 2 158 ? -15.796 21.590  97.489  1.00 36.48  ? 158 TYR D CD2 1 
ATOM   6765  C CE1 . TYR D 2 158 ? -18.410 22.009  96.644  1.00 50.86  ? 158 TYR D CE1 1 
ATOM   6766  C CE2 . TYR D 2 158 ? -16.863 21.473  98.394  1.00 28.26  ? 158 TYR D CE2 1 
ATOM   6767  C CZ  . TYR D 2 158 ? -18.168 21.684  97.954  1.00 33.16  ? 158 TYR D CZ  1 
ATOM   6768  O OH  . TYR D 2 158 ? -19.251 21.551  98.789  1.00 38.20  ? 158 TYR D OH  1 
ATOM   6769  N N   . ASP D 2 159 ? -16.349 25.110  95.231  1.00 62.87  ? 159 ASP D N   1 
ATOM   6770  C CA  . ASP D 2 159 ? -16.741 26.207  96.109  1.00 60.51  ? 159 ASP D CA  1 
ATOM   6771  C C   . ASP D 2 159 ? -15.721 27.343  96.082  1.00 53.23  ? 159 ASP D C   1 
ATOM   6772  O O   . ASP D 2 159 ? -15.497 28.010  97.092  1.00 66.39  ? 159 ASP D O   1 
ATOM   6773  C CB  . ASP D 2 159 ? -16.913 25.692  97.542  1.00 59.19  ? 159 ASP D CB  1 
ATOM   6774  C CG  . ASP D 2 159 ? -17.812 26.580  98.385  1.00 58.68  ? 159 ASP D CG  1 
ATOM   6775  O OD1 . ASP D 2 159 ? -17.869 26.360  99.612  1.00 75.75  ? 159 ASP D OD1 1 
ATOM   6776  O OD2 . ASP D 2 159 ? -18.469 27.485  97.831  1.00 60.51  ? 159 ASP D OD2 1 
ATOM   6777  N N   . GLY D 2 160 ? -15.093 27.538  94.928  1.00 52.03  ? 160 GLY D N   1 
ATOM   6778  C CA  . GLY D 2 160 ? -14.122 28.602  94.776  1.00 43.83  ? 160 GLY D CA  1 
ATOM   6779  C C   . GLY D 2 160 ? -12.685 28.227  95.065  1.00 53.85  ? 160 GLY D C   1 
ATOM   6780  O O   . GLY D 2 160 ? -11.821 29.105  95.143  1.00 70.07  ? 160 GLY D O   1 
ATOM   6781  N N   . GLU D 2 161 ? -12.419 26.937  95.232  1.00 50.52  ? 161 GLU D N   1 
ATOM   6782  C CA  . GLU D 2 161 ? -11.066 26.476  95.508  1.00 50.07  ? 161 GLU D CA  1 
ATOM   6783  C C   . GLU D 2 161 ? -10.553 25.485  94.451  1.00 48.24  ? 161 GLU D C   1 
ATOM   6784  O O   . GLU D 2 161 ? -11.159 24.440  94.226  1.00 67.00  ? 161 GLU D O   1 
ATOM   6785  C CB  . GLU D 2 161 ? -11.017 25.827  96.883  1.00 38.59  ? 161 GLU D CB  1 
ATOM   6786  C CG  . GLU D 2 161 ? -9.726  25.084  97.133  1.00 46.90  ? 161 GLU D CG  1 
ATOM   6787  C CD  . GLU D 2 161 ? -9.762  24.319  98.418  1.00 41.24  ? 161 GLU D CD  1 
ATOM   6788  O OE1 . GLU D 2 161 ? -8.756  23.660  98.738  1.00 60.56  ? 161 GLU D OE1 1 
ATOM   6789  O OE2 . GLU D 2 161 ? -10.798 24.380  99.104  1.00 52.27  ? 161 GLU D OE2 1 
ATOM   6790  N N   . ILE D 2 162 ? -9.436  25.815  93.809  1.00 53.54  ? 162 ILE D N   1 
ATOM   6791  C CA  . ILE D 2 162 ? -8.849  24.952  92.786  1.00 48.91  ? 162 ILE D CA  1 
ATOM   6792  C C   . ILE D 2 162 ? -7.800  24.055  93.453  1.00 51.40  ? 162 ILE D C   1 
ATOM   6793  O O   . ILE D 2 162 ? -6.893  24.554  94.104  1.00 53.02  ? 162 ILE D O   1 
ATOM   6794  C CB  . ILE D 2 162 ? -8.190  25.812  91.651  1.00 60.83  ? 162 ILE D CB  1 
ATOM   6795  C CG1 . ILE D 2 162 ? -9.249  26.696  90.990  1.00 49.49  ? 162 ILE D CG1 1 
ATOM   6796  C CG2 . ILE D 2 162 ? -7.575  24.921  90.591  1.00 55.73  ? 162 ILE D CG2 1 
ATOM   6797  C CD1 . ILE D 2 162 ? -8.702  27.607  89.907  1.00 66.49  ? 162 ILE D CD1 1 
ATOM   6798  N N   . PHE D 2 163 ? -7.937  22.738  93.304  1.00 52.88  ? 163 PHE D N   1 
ATOM   6799  C CA  . PHE D 2 163 ? -7.009  21.777  93.910  1.00 46.18  ? 163 PHE D CA  1 
ATOM   6800  C C   . PHE D 2 163 ? -6.686  20.631  92.946  1.00 45.64  ? 163 PHE D C   1 
ATOM   6801  O O   . PHE D 2 163 ? -7.350  20.465  91.922  1.00 53.20  ? 163 PHE D O   1 
ATOM   6802  C CB  . PHE D 2 163 ? -7.622  21.206  95.191  1.00 34.47  ? 163 PHE D CB  1 
ATOM   6803  C CG  . PHE D 2 163 ? -8.799  20.314  94.946  1.00 38.99  ? 163 PHE D CG  1 
ATOM   6804  C CD1 . PHE D 2 163 ? -8.648  18.935  94.906  1.00 50.66  ? 163 PHE D CD1 1 
ATOM   6805  C CD2 . PHE D 2 163 ? -10.059 20.852  94.703  1.00 42.47  ? 163 PHE D CD2 1 
ATOM   6806  C CE1 . PHE D 2 163 ? -9.731  18.106  94.627  1.00 44.64  ? 163 PHE D CE1 1 
ATOM   6807  C CE2 . PHE D 2 163 ? -11.149 20.031  94.422  1.00 33.36  ? 163 PHE D CE2 1 
ATOM   6808  C CZ  . PHE D 2 163 ? -10.985 18.658  94.385  1.00 51.58  ? 163 PHE D CZ  1 
ATOM   6809  N N   . PRO D 2 164 ? -5.663  19.821  93.264  1.00 53.12  ? 164 PRO D N   1 
ATOM   6810  C CA  . PRO D 2 164 ? -5.299  18.702  92.385  1.00 45.19  ? 164 PRO D CA  1 
ATOM   6811  C C   . PRO D 2 164 ? -6.125  17.421  92.577  1.00 40.05  ? 164 PRO D C   1 
ATOM   6812  O O   . PRO D 2 164 ? -5.917  16.660  93.508  1.00 38.25  ? 164 PRO D O   1 
ATOM   6813  C CB  . PRO D 2 164 ? -3.819  18.495  92.688  1.00 51.15  ? 164 PRO D CB  1 
ATOM   6814  C CG  . PRO D 2 164 ? -3.734  18.818  94.155  1.00 56.70  ? 164 PRO D CG  1 
ATOM   6815  C CD  . PRO D 2 164 ? -4.640  20.040  94.305  1.00 49.98  ? 164 PRO D CD  1 
ATOM   6816  N N   . SER D 2 165 ? -7.060  17.191  91.668  1.00 43.25  ? 165 SER D N   1 
ATOM   6817  C CA  . SER D 2 165 ? -7.909  16.011  91.724  1.00 50.94  ? 165 SER D CA  1 
ATOM   6818  C C   . SER D 2 165 ? -7.190  14.802  91.118  1.00 44.88  ? 165 SER D C   1 
ATOM   6819  O O   . SER D 2 165 ? -7.625  13.662  91.262  1.00 45.78  ? 165 SER D O   1 
ATOM   6820  C CB  . SER D 2 165 ? -9.228  16.292  90.993  1.00 39.59  ? 165 SER D CB  1 
ATOM   6821  O OG  . SER D 2 165 ? -9.003  16.879  89.729  1.00 38.55  ? 165 SER D OG  1 
ATOM   6822  N N   . ALA D 2 166 ? -6.083  15.078  90.441  1.00 49.38  ? 166 ALA D N   1 
ATOM   6823  C CA  . ALA D 2 166 ? -5.255  14.055  89.821  1.00 37.83  ? 166 ALA D CA  1 
ATOM   6824  C C   . ALA D 2 166 ? -3.806  14.449  90.063  1.00 45.19  ? 166 ALA D C   1 
ATOM   6825  O O   . ALA D 2 166 ? -3.454  15.632  90.026  1.00 31.78  ? 166 ALA D O   1 
ATOM   6826  C CB  . ALA D 2 166 ? -5.537  13.969  88.333  1.00 42.31  ? 166 ALA D CB  1 
ATOM   6827  N N   . VAL D 2 167 ? -2.968  13.447  90.302  1.00 46.81  ? 167 VAL D N   1 
ATOM   6828  C CA  . VAL D 2 167 ? -1.560  13.687  90.584  1.00 52.05  ? 167 VAL D CA  1 
ATOM   6829  C C   . VAL D 2 167 ? -0.615  12.660  89.947  1.00 54.33  ? 167 VAL D C   1 
ATOM   6830  O O   . VAL D 2 167 ? -0.932  11.465  89.874  1.00 55.65  ? 167 VAL D O   1 
ATOM   6831  C CB  . VAL D 2 167 ? -1.331  13.718  92.114  1.00 49.44  ? 167 VAL D CB  1 
ATOM   6832  C CG1 . VAL D 2 167 ? -1.263  12.292  92.676  1.00 38.52  ? 167 VAL D CG1 1 
ATOM   6833  C CG2 . VAL D 2 167 ? -0.081  14.505  92.424  1.00 66.19  ? 167 VAL D CG2 1 
ATOM   6834  N N   . ARG D 2 168 ? 0.556   13.130  89.514  1.00 50.17  ? 168 ARG D N   1 
ATOM   6835  C CA  . ARG D 2 168 ? 1.540   12.270  88.858  1.00 48.35  ? 168 ARG D CA  1 
ATOM   6836  C C   . ARG D 2 168 ? 3.014   12.583  89.159  1.00 52.64  ? 168 ARG D C   1 
ATOM   6837  O O   . ARG D 2 168 ? 3.410   13.742  89.240  1.00 56.68  ? 168 ARG D O   1 
ATOM   6838  C CB  . ARG D 2 168 ? 1.317   12.324  87.340  1.00 55.65  ? 168 ARG D CB  1 
ATOM   6839  C CG  . ARG D 2 168 ? 2.471   11.788  86.516  1.00 45.83  ? 168 ARG D CG  1 
ATOM   6840  C CD  . ARG D 2 168 ? 2.752   12.723  85.361  1.00 52.18  ? 168 ARG D CD  1 
ATOM   6841  N NE  . ARG D 2 168 ? 2.048   12.329  84.150  1.00 49.91  ? 168 ARG D NE  1 
ATOM   6842  C CZ  . ARG D 2 168 ? 1.642   13.169  83.200  1.00 44.05  ? 168 ARG D CZ  1 
ATOM   6843  N NH1 . ARG D 2 168 ? 1.858   14.472  83.305  1.00 44.92  ? 168 ARG D NH1 1 
ATOM   6844  N NH2 . ARG D 2 168 ? 1.016   12.697  82.134  1.00 51.25  ? 168 ARG D NH2 1 
ATOM   6845  N N   . LYS D 2 169 ? 3.811   11.523  89.295  1.00 54.93  ? 169 LYS D N   1 
ATOM   6846  C CA  . LYS D 2 169 ? 5.249   11.601  89.562  1.00 55.60  ? 169 LYS D CA  1 
ATOM   6847  C C   . LYS D 2 169 ? 5.879   10.336  88.989  1.00 46.86  ? 169 LYS D C   1 
ATOM   6848  O O   . LYS D 2 169 ? 5.962   9.330   89.681  1.00 57.50  ? 169 LYS D O   1 
ATOM   6849  C CB  . LYS D 2 169 ? 5.524   11.656  91.071  1.00 52.26  ? 169 LYS D CB  1 
ATOM   6850  C CG  . LYS D 2 169 ? 7.013   11.680  91.437  1.00 56.86  ? 169 LYS D CG  1 
ATOM   6851  C CD  . LYS D 2 169 ? 7.232   11.835  92.942  1.00 64.10  ? 169 LYS D CD  1 
ATOM   6852  C CE  . LYS D 2 169 ? 8.711   11.967  93.295  1.00 48.81  ? 169 LYS D CE  1 
ATOM   6853  N NZ  . LYS D 2 169 ? 9.489   10.740  92.954  1.00 59.11  ? 169 LYS D NZ  1 
ATOM   6854  N N   . GLY D 2 170 ? 6.328   10.385  87.736  1.00 52.75  ? 170 GLY D N   1 
ATOM   6855  C CA  . GLY D 2 170 ? 6.905   9.205   87.114  1.00 45.06  ? 170 GLY D CA  1 
ATOM   6856  C C   . GLY D 2 170 ? 5.797   8.219   86.761  1.00 63.61  ? 170 GLY D C   1 
ATOM   6857  O O   . GLY D 2 170 ? 4.845   8.589   86.067  1.00 49.36  ? 170 GLY D O   1 
ATOM   6858  N N   . ARG D 2 171 ? 5.915   6.971   87.222  1.00 46.19  ? 171 ARG D N   1 
ATOM   6859  C CA  . ARG D 2 171 ? 4.885   5.959   86.964  1.00 45.12  ? 171 ARG D CA  1 
ATOM   6860  C C   . ARG D 2 171 ? 4.072   5.774   88.242  1.00 35.59  ? 171 ARG D C   1 
ATOM   6861  O O   . ARG D 2 171 ? 3.550   4.693   88.532  1.00 54.34  ? 171 ARG D O   1 
ATOM   6862  C CB  . ARG D 2 171 ? 5.505   4.626   86.526  1.00 41.42  ? 171 ARG D CB  1 
ATOM   6863  C CG  . ARG D 2 171 ? 6.484   4.772   85.393  1.00 41.62  ? 171 ARG D CG  1 
ATOM   6864  C CD  . ARG D 2 171 ? 6.760   3.466   84.673  1.00 44.08  ? 171 ARG D CD  1 
ATOM   6865  N NE  . ARG D 2 171 ? 7.965   3.606   83.860  1.00 82.33  ? 171 ARG D NE  1 
ATOM   6866  C CZ  . ARG D 2 171 ? 8.221   2.923   82.749  1.00 97.75  ? 171 ARG D CZ  1 
ATOM   6867  N NH1 . ARG D 2 171 ? 7.342   2.036   82.296  1.00 75.81  ? 171 ARG D NH1 1 
ATOM   6868  N NH2 . ARG D 2 171 ? 9.366   3.124   82.094  1.00 87.07  ? 171 ARG D NH2 1 
ATOM   6869  N N   . ILE D 2 172 ? 3.995   6.856   89.006  1.00 42.60  ? 172 ILE D N   1 
ATOM   6870  C CA  . ILE D 2 172 ? 3.246   6.901   90.251  1.00 46.75  ? 172 ILE D CA  1 
ATOM   6871  C C   . ILE D 2 172 ? 2.086   7.847   89.936  1.00 45.09  ? 172 ILE D C   1 
ATOM   6872  O O   . ILE D 2 172 ? 2.306   9.019   89.627  1.00 36.56  ? 172 ILE D O   1 
ATOM   6873  C CB  . ILE D 2 172 ? 4.113   7.481   91.407  1.00 41.95  ? 172 ILE D CB  1 
ATOM   6874  C CG1 . ILE D 2 172 ? 5.396   6.658   91.554  1.00 55.90  ? 172 ILE D CG1 1 
ATOM   6875  C CG2 . ILE D 2 172 ? 3.333   7.468   92.712  1.00 44.22  ? 172 ILE D CG2 1 
ATOM   6876  C CD1 . ILE D 2 172 ? 6.342   7.189   92.590  1.00 42.05  ? 172 ILE D CD1 1 
ATOM   6877  N N   . LEU D 2 173 ? 0.862   7.328   89.985  1.00 38.44  ? 173 LEU D N   1 
ATOM   6878  C CA  . LEU D 2 173 ? -0.323  8.126   89.681  1.00 43.14  ? 173 LEU D CA  1 
ATOM   6879  C C   . LEU D 2 173 ? -1.334  8.179   90.832  1.00 40.86  ? 173 LEU D C   1 
ATOM   6880  O O   . LEU D 2 173 ? -1.407  7.268   91.661  1.00 40.78  ? 173 LEU D O   1 
ATOM   6881  C CB  . LEU D 2 173 ? -1.016  7.571   88.430  1.00 37.82  ? 173 LEU D CB  1 
ATOM   6882  C CG  . LEU D 2 173 ? -0.281  7.525   87.081  1.00 53.39  ? 173 LEU D CG  1 
ATOM   6883  C CD1 . LEU D 2 173 ? -1.189  6.878   86.049  1.00 39.70  ? 173 LEU D CD1 1 
ATOM   6884  C CD2 . LEU D 2 173 ? 0.106   8.926   86.627  1.00 34.22  ? 173 LEU D CD2 1 
ATOM   6885  N N   . GLY D 2 174 ? -2.120  9.249   90.868  1.00 43.94  ? 174 GLY D N   1 
ATOM   6886  C CA  . GLY D 2 174 ? -3.129  9.394   91.897  1.00 39.71  ? 174 GLY D CA  1 
ATOM   6887  C C   . GLY D 2 174 ? -4.370  10.120  91.404  1.00 37.33  ? 174 GLY D C   1 
ATOM   6888  O O   . GLY D 2 174 ? -4.281  11.092  90.660  1.00 38.24  ? 174 GLY D O   1 
ATOM   6889  N N   . PHE D 2 175 ? -5.532  9.639   91.824  1.00 37.71  ? 175 PHE D N   1 
ATOM   6890  C CA  . PHE D 2 175 ? -6.802  10.228  91.443  1.00 38.77  ? 175 PHE D CA  1 
ATOM   6891  C C   . PHE D 2 175 ? -7.631  10.412  92.710  1.00 51.54  ? 175 PHE D C   1 
ATOM   6892  O O   . PHE D 2 175 ? -7.777  9.474   93.501  1.00 40.78  ? 175 PHE D O   1 
ATOM   6893  C CB  . PHE D 2 175 ? -7.532  9.320   90.439  1.00 46.24  ? 175 PHE D CB  1 
ATOM   6894  C CG  . PHE D 2 175 ? -6.752  9.069   89.162  1.00 46.48  ? 175 PHE D CG  1 
ATOM   6895  C CD1 . PHE D 2 175 ? -5.877  7.993   89.060  1.00 35.19  ? 175 PHE D CD1 1 
ATOM   6896  C CD2 . PHE D 2 175 ? -6.858  9.940   88.082  1.00 36.65  ? 175 PHE D CD2 1 
ATOM   6897  C CE1 . PHE D 2 175 ? -5.126  7.801   87.905  1.00 43.53  ? 175 PHE D CE1 1 
ATOM   6898  C CE2 . PHE D 2 175 ? -6.110  9.752   86.930  1.00 35.96  ? 175 PHE D CE2 1 
ATOM   6899  C CZ  . PHE D 2 175 ? -5.246  8.688   86.839  1.00 37.57  ? 175 PHE D CZ  1 
ATOM   6900  N N   . GLN D 2 176 ? -8.163  11.619  92.900  1.00 32.92  ? 176 GLN D N   1 
ATOM   6901  C CA  . GLN D 2 176 ? -8.964  11.938  94.080  1.00 39.69  ? 176 GLN D CA  1 
ATOM   6902  C C   . GLN D 2 176 ? -10.428 11.496  93.980  1.00 41.94  ? 176 GLN D C   1 
ATOM   6903  O O   . GLN D 2 176 ? -11.087 11.281  94.995  1.00 40.38  ? 176 GLN D O   1 
ATOM   6904  C CB  . GLN D 2 176 ? -8.884  13.441  94.376  1.00 41.95  ? 176 GLN D CB  1 
ATOM   6905  C CG  . GLN D 2 176 ? -9.619  13.851  95.642  1.00 43.48  ? 176 GLN D CG  1 
ATOM   6906  C CD  . GLN D 2 176 ? -9.080  13.160  96.888  1.00 60.28  ? 176 GLN D CD  1 
ATOM   6907  O OE1 . GLN D 2 176 ? -7.970  13.446  97.331  1.00 45.17  ? 176 GLN D OE1 1 
ATOM   6908  N NE2 . GLN D 2 176 ? -9.865  12.243  97.456  1.00 37.68  ? 176 GLN D NE2 1 
ATOM   6909  N N   . PHE D 2 177 ? -10.921 11.345  92.752  1.00 43.36  ? 177 PHE D N   1 
ATOM   6910  C CA  . PHE D 2 177 ? -12.293 10.915  92.498  1.00 29.48  ? 177 PHE D CA  1 
ATOM   6911  C C   . PHE D 2 177 ? -12.404 9.393   92.354  1.00 34.36  ? 177 PHE D C   1 
ATOM   6912  O O   . PHE D 2 177 ? -11.401 8.692   92.335  1.00 41.82  ? 177 PHE D O   1 
ATOM   6913  C CB  . PHE D 2 177 ? -12.812 11.570  91.213  1.00 62.70  ? 177 PHE D CB  1 
ATOM   6914  C CG  . PHE D 2 177 ? -11.912 11.358  90.009  1.00 50.40  ? 177 PHE D CG  1 
ATOM   6915  C CD1 . PHE D 2 177 ? -10.932 12.290  89.681  1.00 31.02  ? 177 PHE D CD1 1 
ATOM   6916  C CD2 . PHE D 2 177 ? -12.036 10.215  89.218  1.00 40.79  ? 177 PHE D CD2 1 
ATOM   6917  C CE1 . PHE D 2 177 ? -10.086 12.087  88.583  1.00 32.99  ? 177 PHE D CE1 1 
ATOM   6918  C CE2 . PHE D 2 177 ? -11.194 10.011  88.124  1.00 30.20  ? 177 PHE D CE2 1 
ATOM   6919  C CZ  . PHE D 2 177 ? -10.219 10.953  87.811  1.00 34.65  ? 177 PHE D CZ  1 
ATOM   6920  N N   . HIS D 2 178 ? -13.631 8.890   92.249  1.00 33.34  ? 178 HIS D N   1 
ATOM   6921  C CA  . HIS D 2 178 ? -13.866 7.457   92.068  1.00 38.47  ? 178 HIS D CA  1 
ATOM   6922  C C   . HIS D 2 178 ? -14.127 7.174   90.599  1.00 31.64  ? 178 HIS D C   1 
ATOM   6923  O O   . HIS D 2 178 ? -15.244 7.345   90.126  1.00 45.99  ? 178 HIS D O   1 
ATOM   6924  C CB  . HIS D 2 178 ? -15.089 6.987   92.848  1.00 27.22  ? 178 HIS D CB  1 
ATOM   6925  C CG  . HIS D 2 178 ? -15.006 7.246   94.312  1.00 57.63  ? 178 HIS D CG  1 
ATOM   6926  N ND1 . HIS D 2 178 ? -14.207 6.504   95.154  1.00 61.55  ? 178 HIS D ND1 1 
ATOM   6927  C CD2 . HIS D 2 178 ? -15.575 8.205   95.078  1.00 48.50  ? 178 HIS D CD2 1 
ATOM   6928  C CE1 . HIS D 2 178 ? -14.282 7.000   96.375  1.00 76.03  ? 178 HIS D CE1 1 
ATOM   6929  N NE2 . HIS D 2 178 ? -15.106 8.032   96.356  1.00 68.51  ? 178 HIS D NE2 1 
ATOM   6930  N N   . PRO D 2 179 ? -13.109 6.738   89.854  1.00 38.01  ? 179 PRO D N   1 
ATOM   6931  C CA  . PRO D 2 179 ? -13.411 6.472   88.446  1.00 28.05  ? 179 PRO D CA  1 
ATOM   6932  C C   . PRO D 2 179 ? -14.472 5.371   88.251  1.00 34.86  ? 179 PRO D C   1 
ATOM   6933  O O   . PRO D 2 179 ? -15.180 5.373   87.254  1.00 38.38  ? 179 PRO D O   1 
ATOM   6934  C CB  . PRO D 2 179 ? -12.039 6.127   87.855  1.00 41.73  ? 179 PRO D CB  1 
ATOM   6935  C CG  . PRO D 2 179 ? -11.263 5.583   89.027  1.00 47.44  ? 179 PRO D CG  1 
ATOM   6936  C CD  . PRO D 2 179 ? -11.700 6.447   90.184  1.00 47.25  ? 179 PRO D CD  1 
ATOM   6937  N N   . GLU D 2 180 ? -14.597 4.456   89.215  1.00 35.23  ? 180 GLU D N   1 
ATOM   6938  C CA  . GLU D 2 180 ? -15.577 3.362   89.150  1.00 37.78  ? 180 GLU D CA  1 
ATOM   6939  C C   . GLU D 2 180 ? -17.023 3.769   89.403  1.00 44.99  ? 180 GLU D C   1 
ATOM   6940  O O   . GLU D 2 180 ? -17.924 2.927   89.333  1.00 43.84  ? 180 GLU D O   1 
ATOM   6941  C CB  . GLU D 2 180 ? -15.231 2.255   90.148  1.00 39.64  ? 180 GLU D CB  1 
ATOM   6942  C CG  . GLU D 2 180 ? -13.963 2.493   90.930  1.00 64.55  ? 180 GLU D CG  1 
ATOM   6943  C CD  . GLU D 2 180 ? -14.134 3.441   92.087  1.00 34.44  ? 180 GLU D CD  1 
ATOM   6944  O OE1 . GLU D 2 180 ? -14.953 3.139   92.978  1.00 46.24  ? 180 GLU D OE1 1 
ATOM   6945  O OE2 . GLU D 2 180 ? -13.433 4.477   92.106  1.00 57.55  ? 180 GLU D OE2 1 
ATOM   6946  N N   . LYS D 2 181 ? -17.238 5.038   89.735  1.00 29.76  ? 181 LYS D N   1 
ATOM   6947  C CA  . LYS D 2 181 ? -18.580 5.561   89.974  1.00 36.73  ? 181 LYS D CA  1 
ATOM   6948  C C   . LYS D 2 181 ? -18.811 6.705   89.000  1.00 27.23  ? 181 LYS D C   1 
ATOM   6949  O O   . LYS D 2 181 ? -19.804 7.413   89.102  1.00 48.84  ? 181 LYS D O   1 
ATOM   6950  C CB  . LYS D 2 181 ? -18.723 6.100   91.409  1.00 34.05  ? 181 LYS D CB  1 
ATOM   6951  C CG  . LYS D 2 181 ? -18.772 5.049   92.495  1.00 41.27  ? 181 LYS D CG  1 
ATOM   6952  C CD  . LYS D 2 181 ? -20.024 4.188   92.388  1.00 44.85  ? 181 LYS D CD  1 
ATOM   6953  C CE  . LYS D 2 181 ? -20.085 3.173   93.517  1.00 43.13  ? 181 LYS D CE  1 
ATOM   6954  N NZ  . LYS D 2 181 ? -21.399 2.486   93.594  1.00 42.05  ? 181 LYS D NZ  1 
ATOM   6955  N N   . SER D 2 182 ? -17.884 6.871   88.062  1.00 31.73  ? 182 SER D N   1 
ATOM   6956  C CA  . SER D 2 182 ? -17.941 7.950   87.087  1.00 34.13  ? 182 SER D CA  1 
ATOM   6957  C C   . SER D 2 182 ? -18.466 7.567   85.713  1.00 36.29  ? 182 SER D C   1 
ATOM   6958  O O   . SER D 2 182 ? -18.126 8.202   84.717  1.00 36.30  ? 182 SER D O   1 
ATOM   6959  C CB  . SER D 2 182 ? -16.560 8.585   86.940  1.00 35.97  ? 182 SER D CB  1 
ATOM   6960  O OG  . SER D 2 182 ? -16.086 9.056   88.186  1.00 42.84  ? 182 SER D OG  1 
ATOM   6961  N N   . SER D 2 183 ? -19.282 6.520   85.666  1.00 49.33  ? 183 SER D N   1 
ATOM   6962  C CA  . SER D 2 183 ? -19.904 6.069   84.425  1.00 34.45  ? 183 SER D CA  1 
ATOM   6963  C C   . SER D 2 183 ? -18.922 5.809   83.275  1.00 40.08  ? 183 SER D C   1 
ATOM   6964  O O   . SER D 2 183 ? -17.840 5.276   83.486  1.00 41.74  ? 183 SER D O   1 
ATOM   6965  C CB  . SER D 2 183 ? -20.959 7.106   84.010  1.00 45.10  ? 183 SER D CB  1 
ATOM   6966  O OG  . SER D 2 183 ? -21.670 6.707   82.861  1.00 44.54  ? 183 SER D OG  1 
ATOM   6967  N N   . LYS D 2 184 ? -19.315 6.195   82.062  1.00 49.90  ? 184 LYS D N   1 
ATOM   6968  C CA  . LYS D 2 184 ? -18.503 6.004   80.857  1.00 37.79  ? 184 LYS D CA  1 
ATOM   6969  C C   . LYS D 2 184 ? -17.086 6.527   80.977  1.00 42.35  ? 184 LYS D C   1 
ATOM   6970  O O   . LYS D 2 184 ? -16.128 5.765   80.890  1.00 48.65  ? 184 LYS D O   1 
ATOM   6971  C CB  . LYS D 2 184 ? -19.126 6.711   79.646  1.00 48.53  ? 184 LYS D CB  1 
ATOM   6972  C CG  . LYS D 2 184 ? -20.491 6.254   79.209  1.00 56.42  ? 184 LYS D CG  1 
ATOM   6973  C CD  . LYS D 2 184 ? -20.897 7.045   77.963  1.00 63.62  ? 184 LYS D CD  1 
ATOM   6974  C CE  . LYS D 2 184 ? -21.913 6.296   77.123  1.00 56.59  ? 184 LYS D CE  1 
ATOM   6975  N NZ  . LYS D 2 184 ? -23.126 5.943   77.908  1.00 59.02  ? 184 LYS D NZ  1 
ATOM   6976  N N   . ILE D 2 185 ? -16.962 7.842   81.151  1.00 39.22  ? 185 ILE D N   1 
ATOM   6977  C CA  . ILE D 2 185 ? -15.655 8.481   81.239  1.00 31.56  ? 185 ILE D CA  1 
ATOM   6978  C C   . ILE D 2 185 ? -14.765 7.845   82.302  1.00 37.65  ? 185 ILE D C   1 
ATOM   6979  O O   . ILE D 2 185 ? -13.541 7.848   82.171  1.00 43.39  ? 185 ILE D O   1 
ATOM   6980  C CB  . ILE D 2 185 ? -15.777 10.008  81.492  1.00 39.63  ? 185 ILE D CB  1 
ATOM   6981  C CG1 . ILE D 2 185 ? -14.429 10.675  81.210  1.00 36.81  ? 185 ILE D CG1 1 
ATOM   6982  C CG2 . ILE D 2 185 ? -16.229 10.283  82.922  1.00 27.79  ? 185 ILE D CG2 1 
ATOM   6983  C CD1 . ILE D 2 185 ? -14.431 12.181  81.310  1.00 37.02  ? 185 ILE D CD1 1 
ATOM   6984  N N   . GLY D 2 186 ? -15.381 7.289   83.340  1.00 32.82  ? 186 GLY D N   1 
ATOM   6985  C CA  . GLY D 2 186 ? -14.615 6.642   84.381  1.00 38.41  ? 186 GLY D CA  1 
ATOM   6986  C C   . GLY D 2 186 ? -13.971 5.373   83.853  1.00 56.37  ? 186 GLY D C   1 
ATOM   6987  O O   . GLY D 2 186 ? -12.828 5.050   84.181  1.00 42.84  ? 186 GLY D O   1 
ATOM   6988  N N   . ARG D 2 187 ? -14.710 4.653   83.017  1.00 43.22  ? 187 ARG D N   1 
ATOM   6989  C CA  . ARG D 2 187 ? -14.201 3.421   82.445  1.00 48.16  ? 187 ARG D CA  1 
ATOM   6990  C C   . ARG D 2 187 ? -13.085 3.752   81.474  1.00 53.41  ? 187 ARG D C   1 
ATOM   6991  O O   . ARG D 2 187 ? -12.131 2.986   81.317  1.00 42.34  ? 187 ARG D O   1 
ATOM   6992  C CB  . ARG D 2 187 ? -15.319 2.656   81.731  1.00 56.81  ? 187 ARG D CB  1 
ATOM   6993  C CG  . ARG D 2 187 ? -14.834 1.406   80.992  1.00 53.88  ? 187 ARG D CG  1 
ATOM   6994  C CD  . ARG D 2 187 ? -15.964 0.398   80.802  1.00 66.42  ? 187 ARG D CD  1 
ATOM   6995  N NE  . ARG D 2 187 ? -15.499 -0.808  80.122  1.00 73.19  ? 187 ARG D NE  1 
ATOM   6996  C CZ  . ARG D 2 187 ? -15.083 -0.837  78.860  1.00 79.29  ? 187 ARG D CZ  1 
ATOM   6997  N NH1 . ARG D 2 187 ? -15.083 0.287   78.150  1.00 103.15 ? 187 ARG D NH1 1 
ATOM   6998  N NH2 . ARG D 2 187 ? -14.661 -1.974  78.305  1.00 55.65  ? 187 ARG D NH2 1 
ATOM   6999  N N   . LYS D 2 188 ? -13.210 4.907   80.832  1.00 35.22  ? 188 LYS D N   1 
ATOM   7000  C CA  . LYS D 2 188 ? -12.207 5.343   79.882  1.00 45.78  ? 188 LYS D CA  1 
ATOM   7001  C C   . LYS D 2 188 ? -10.926 5.751   80.607  1.00 54.89  ? 188 LYS D C   1 
ATOM   7002  O O   . LYS D 2 188 ? -9.828  5.604   80.066  1.00 52.23  ? 188 LYS D O   1 
ATOM   7003  C CB  . LYS D 2 188 ? -12.717 6.522   79.046  1.00 40.22  ? 188 LYS D CB  1 
ATOM   7004  C CG  . LYS D 2 188 ? -11.684 6.950   78.013  1.00 83.32  ? 188 LYS D CG  1 
ATOM   7005  C CD  . LYS D 2 188 ? -12.079 8.157   77.161  1.00 70.10  ? 188 LYS D CD  1 
ATOM   7006  C CE  . LYS D 2 188 ? -10.947 8.467   76.174  1.00 56.05  ? 188 LYS D CE  1 
ATOM   7007  N NZ  . LYS D 2 188 ? -11.097 9.768   75.455  1.00 61.28  ? 188 LYS D NZ  1 
ATOM   7008  N N   . LEU D 2 189 ? -11.072 6.265   81.829  1.00 42.14  ? 189 LEU D N   1 
ATOM   7009  C CA  . LEU D 2 189 ? -9.923  6.692   82.616  1.00 39.77  ? 189 LEU D CA  1 
ATOM   7010  C C   . LEU D 2 189 ? -9.125  5.447   82.978  1.00 37.12  ? 189 LEU D C   1 
ATOM   7011  O O   . LEU D 2 189 ? -7.901  5.416   82.848  1.00 35.25  ? 189 LEU D O   1 
ATOM   7012  C CB  . LEU D 2 189 ? -10.397 7.409   83.879  1.00 42.29  ? 189 LEU D CB  1 
ATOM   7013  C CG  . LEU D 2 189 ? -9.436  8.082   84.873  1.00 54.99  ? 189 LEU D CG  1 
ATOM   7014  C CD1 . LEU D 2 189 ? -8.519  7.049   85.523  1.00 33.86  ? 189 LEU D CD1 1 
ATOM   7015  C CD2 . LEU D 2 189 ? -8.649  9.162   84.178  1.00 33.26  ? 189 LEU D CD2 1 
ATOM   7016  N N   . LEU D 2 190 ? -9.833  4.415   83.421  1.00 34.09  ? 190 LEU D N   1 
ATOM   7017  C CA  . LEU D 2 190 ? -9.192  3.166   83.800  1.00 49.49  ? 190 LEU D CA  1 
ATOM   7018  C C   . LEU D 2 190 ? -8.464  2.535   82.602  1.00 49.90  ? 190 LEU D C   1 
ATOM   7019  O O   . LEU D 2 190 ? -7.267  2.242   82.693  1.00 41.07  ? 190 LEU D O   1 
ATOM   7020  C CB  . LEU D 2 190 ? -10.233 2.209   84.390  1.00 37.78  ? 190 LEU D CB  1 
ATOM   7021  C CG  . LEU D 2 190 ? -10.916 2.721   85.668  1.00 43.31  ? 190 LEU D CG  1 
ATOM   7022  C CD1 . LEU D 2 190 ? -11.963 1.744   86.112  1.00 30.69  ? 190 LEU D CD1 1 
ATOM   7023  C CD2 . LEU D 2 190 ? -9.897  2.927   86.770  1.00 31.33  ? 190 LEU D CD2 1 
ATOM   7024  N N   . GLU D 2 191 ? -9.174  2.365   81.480  1.00 50.48  ? 191 GLU D N   1 
ATOM   7025  C CA  . GLU D 2 191 ? -8.586  1.788   80.264  1.00 44.62  ? 191 GLU D CA  1 
ATOM   7026  C C   . GLU D 2 191 ? -7.281  2.500   79.944  1.00 35.20  ? 191 GLU D C   1 
ATOM   7027  O O   . GLU D 2 191 ? -6.269  1.863   79.659  1.00 45.54  ? 191 GLU D O   1 
ATOM   7028  C CB  . GLU D 2 191 ? -9.554  1.903   79.066  1.00 42.91  ? 191 GLU D CB  1 
ATOM   7029  C CG  . GLU D 2 191 ? -10.515 0.718   78.889  1.00 42.33  ? 191 GLU D CG  1 
ATOM   7030  C CD  . GLU D 2 191 ? -11.538 0.913   77.747  1.00 85.87  ? 191 GLU D CD  1 
ATOM   7031  O OE1 . GLU D 2 191 ? -11.150 1.331   76.626  1.00 64.52  ? 191 GLU D OE1 1 
ATOM   7032  O OE2 . GLU D 2 191 ? -12.735 0.628   77.968  1.00 50.07  ? 191 GLU D OE2 1 
ATOM   7033  N N   . LYS D 2 192 ? -7.312  3.827   80.005  1.00 43.52  ? 192 LYS D N   1 
ATOM   7034  C CA  . LYS D 2 192 ? -6.129  4.630   79.735  1.00 47.33  ? 192 LYS D CA  1 
ATOM   7035  C C   . LYS D 2 192 ? -4.990  4.339   80.728  1.00 53.79  ? 192 LYS D C   1 
ATOM   7036  O O   . LYS D 2 192 ? -3.823  4.329   80.340  1.00 56.12  ? 192 LYS D O   1 
ATOM   7037  C CB  . LYS D 2 192 ? -6.489  6.117   79.754  1.00 38.37  ? 192 LYS D CB  1 
ATOM   7038  C CG  . LYS D 2 192 ? -5.303  7.029   79.575  1.00 37.75  ? 192 LYS D CG  1 
ATOM   7039  C CD  . LYS D 2 192 ? -4.500  6.666   78.332  1.00 49.86  ? 192 LYS D CD  1 
ATOM   7040  C CE  . LYS D 2 192 ? -5.286  6.906   77.055  1.00 54.30  ? 192 LYS D CE  1 
ATOM   7041  N NZ  . LYS D 2 192 ? -4.414  6.731   75.854  1.00 57.36  ? 192 LYS D NZ  1 
ATOM   7042  N N   . VAL D 2 193 ? -5.321  4.124   82.002  1.00 45.59  ? 193 VAL D N   1 
ATOM   7043  C CA  . VAL D 2 193 ? -4.301  3.806   83.006  1.00 43.80  ? 193 VAL D CA  1 
ATOM   7044  C C   . VAL D 2 193 ? -3.719  2.437   82.627  1.00 43.49  ? 193 VAL D C   1 
ATOM   7045  O O   . VAL D 2 193 ? -2.522  2.217   82.725  1.00 41.56  ? 193 VAL D O   1 
ATOM   7046  C CB  . VAL D 2 193 ? -4.915  3.757   84.440  1.00 54.17  ? 193 VAL D CB  1 
ATOM   7047  C CG1 . VAL D 2 193 ? -3.929  3.189   85.431  1.00 35.13  ? 193 VAL D CG1 1 
ATOM   7048  C CG2 . VAL D 2 193 ? -5.339  5.153   84.865  1.00 44.21  ? 193 VAL D CG2 1 
ATOM   7049  N N   . ILE D 2 194 ? -4.582  1.529   82.176  1.00 43.62  ? 194 ILE D N   1 
ATOM   7050  C CA  . ILE D 2 194 ? -4.152  0.206   81.742  1.00 45.03  ? 194 ILE D CA  1 
ATOM   7051  C C   . ILE D 2 194 ? -3.189  0.360   80.557  1.00 46.24  ? 194 ILE D C   1 
ATOM   7052  O O   . ILE D 2 194 ? -2.183  -0.344  80.458  1.00 50.20  ? 194 ILE D O   1 
ATOM   7053  C CB  . ILE D 2 194 ? -5.370  -0.666  81.317  1.00 38.86  ? 194 ILE D CB  1 
ATOM   7054  C CG1 . ILE D 2 194 ? -6.074  -1.212  82.567  1.00 36.62  ? 194 ILE D CG1 1 
ATOM   7055  C CG2 . ILE D 2 194 ? -4.921  -1.798  80.398  1.00 47.24  ? 194 ILE D CG2 1 
ATOM   7056  C CD1 . ILE D 2 194 ? -7.237  -2.135  82.286  1.00 36.80  ? 194 ILE D CD1 1 
ATOM   7057  N N   . GLU D 2 195 ? -3.505  1.300   79.673  1.00 57.88  ? 195 GLU D N   1 
ATOM   7058  C CA  . GLU D 2 195 ? -2.693  1.578   78.497  1.00 42.74  ? 195 GLU D CA  1 
ATOM   7059  C C   . GLU D 2 195 ? -1.293  2.126   78.825  1.00 52.40  ? 195 GLU D C   1 
ATOM   7060  O O   . GLU D 2 195 ? -0.310  1.710   78.215  1.00 51.11  ? 195 GLU D O   1 
ATOM   7061  C CB  . GLU D 2 195 ? -3.467  2.524   77.574  1.00 41.72  ? 195 GLU D CB  1 
ATOM   7062  C CG  . GLU D 2 195 ? -4.503  1.791   76.712  1.00 56.09  ? 195 GLU D CG  1 
ATOM   7063  C CD  . GLU D 2 195 ? -5.765  2.604   76.406  1.00 43.89  ? 195 GLU D CD  1 
ATOM   7064  O OE1 . GLU D 2 195 ? -5.691  3.844   76.311  1.00 52.45  ? 195 GLU D OE1 1 
ATOM   7065  O OE2 . GLU D 2 195 ? -6.837  1.984   76.240  1.00 57.48  ? 195 GLU D OE2 1 
ATOM   7066  N N   . CYS D 2 196 ? -1.193  3.037   79.789  1.00 48.22  ? 196 CYS D N   1 
ATOM   7067  C CA  . CYS D 2 196 ? 0.107   3.589   80.176  1.00 49.02  ? 196 CYS D CA  1 
ATOM   7068  C C   . CYS D 2 196 ? 1.020   2.487   80.727  1.00 50.07  ? 196 CYS D C   1 
ATOM   7069  O O   . CYS D 2 196 ? 2.213   2.460   80.444  1.00 46.54  ? 196 CYS D O   1 
ATOM   7070  C CB  . CYS D 2 196 ? -0.044  4.671   81.260  1.00 42.97  ? 196 CYS D CB  1 
ATOM   7071  S SG  . CYS D 2 196 ? -0.931  6.195   80.806  1.00 52.70  ? 196 CYS D SG  1 
ATOM   7072  N N   . SER D 2 197 ? 0.454   1.576   81.514  1.00 51.32  ? 197 SER D N   1 
ATOM   7073  C CA  . SER D 2 197 ? 1.262   0.517   82.105  1.00 66.57  ? 197 SER D CA  1 
ATOM   7074  C C   . SER D 2 197 ? 1.607   -0.637  81.177  1.00 67.20  ? 197 SER D C   1 
ATOM   7075  O O   . SER D 2 197 ? 2.070   -1.679  81.635  1.00 69.13  ? 197 SER D O   1 
ATOM   7076  C CB  . SER D 2 197 ? 0.620   -0.012  83.402  1.00 59.13  ? 197 SER D CB  1 
ATOM   7077  O OG  . SER D 2 197 ? -0.729  -0.392  83.241  1.00 65.47  ? 197 SER D OG  1 
ATOM   7078  N N   . LEU D 2 198 ? 1.401   -0.434  79.876  1.00 65.09  ? 198 LEU D N   1 
ATOM   7079  C CA  . LEU D 2 198 ? 1.725   -1.445  78.874  1.00 61.94  ? 198 LEU D CA  1 
ATOM   7080  C C   . LEU D 2 198 ? 3.079   -1.164  78.213  1.00 74.82  ? 198 LEU D C   1 
ATOM   7081  O O   . LEU D 2 198 ? 3.509   -1.931  77.341  1.00 89.62  ? 198 LEU D O   1 
ATOM   7082  C CB  . LEU D 2 198 ? 0.645   -1.502  77.791  1.00 46.33  ? 198 LEU D CB  1 
ATOM   7083  C CG  . LEU D 2 198 ? -0.668  -2.228  78.105  1.00 63.49  ? 198 LEU D CG  1 
ATOM   7084  C CD1 . LEU D 2 198 ? -1.584  -2.124  76.893  1.00 35.90  ? 198 LEU D CD1 1 
ATOM   7085  C CD2 . LEU D 2 198 ? -0.400  -3.694  78.460  1.00 45.25  ? 198 LEU D CD2 1 
ATOM   7086  N N   . SER D 2 199 ? 3.747   -0.082  78.627  1.00 73.18  ? 199 SER D N   1 
ATOM   7087  C CA  . SER D 2 199 ? 5.057   0.303   78.065  1.00 88.44  ? 199 SER D CA  1 
ATOM   7088  C C   . SER D 2 199 ? 6.213   -0.644  78.438  1.00 90.25  ? 199 SER D C   1 
ATOM   7089  O O   . SER D 2 199 ? 6.509   -1.604  77.700  1.00 96.74  ? 199 SER D O   1 
ATOM   7090  C CB  . SER D 2 199 ? 5.423   1.744   78.479  1.00 76.76  ? 199 SER D CB  1 
ATOM   7091  O OG  . SER D 2 199 ? 5.659   1.865   79.876  1.00 82.89  ? 199 SER D OG  1 
ATOM   7092  N N   . ARG D 2 200 ? 6.878   -0.360  79.560  1.00 87.17  ? 200 ARG D N   1 
ATOM   7093  C CA  . ARG D 2 200 ? 7.987   -1.198  80.035  1.00 95.49  ? 200 ARG D CA  1 
ATOM   7094  C C   . ARG D 2 200 ? 7.397   -2.202  81.033  1.00 99.33  ? 200 ARG D C   1 
ATOM   7095  O O   . ARG D 2 200 ? 7.327   -3.413  80.765  1.00 102.03 ? 200 ARG D O   1 
ATOM   7096  C CB  . ARG D 2 200 ? 9.068   -0.328  80.718  1.00 95.50  ? 200 ARG D CB  1 
ATOM   7097  N N   . ARG D 2 201 ? 6.975   -1.687  82.186  1.00 100.98 ? 201 ARG D N   1 
ATOM   7098  C CA  . ARG D 2 201 ? 6.350   -2.502  83.228  1.00 103.15 ? 201 ARG D CA  1 
ATOM   7099  C C   . ARG D 2 201 ? 5.247   -1.643  83.863  1.00 103.15 ? 201 ARG D C   1 
ATOM   7100  O O   . ARG D 2 201 ? 4.089   -2.123  83.958  1.00 103.15 ? 201 ARG D O   1 
ATOM   7101  C CB  . ARG D 2 201 ? 7.392   -2.940  84.286  1.00 60.36  ? 201 ARG D CB  1 
ATOM   7102  O OXT . ARG D 2 201 ? 5.550   -0.487  84.237  1.00 103.15 ? 201 ARG D OXT 1 
ATOM   7103  N N   . MET E 1 1   ? 66.455  -2.623  14.620  1.00 48.15  ? 1   MET E N   1 
ATOM   7104  C CA  . MET E 1 1   ? 65.749  -2.399  15.910  1.00 48.30  ? 1   MET E CA  1 
ATOM   7105  C C   . MET E 1 1   ? 64.620  -1.387  15.738  1.00 62.92  ? 1   MET E C   1 
ATOM   7106  O O   . MET E 1 1   ? 64.757  -0.405  15.007  1.00 53.74  ? 1   MET E O   1 
ATOM   7107  C CB  . MET E 1 1   ? 66.741  -1.885  16.957  1.00 58.21  ? 1   MET E CB  1 
ATOM   7108  C CG  . MET E 1 1   ? 66.148  -1.657  18.349  1.00 91.06  ? 1   MET E CG  1 
ATOM   7109  S SD  . MET E 1 1   ? 67.417  -1.126  19.578  1.00 103.15 ? 1   MET E SD  1 
ATOM   7110  C CE  . MET E 1 1   ? 68.218  -2.760  20.008  1.00 91.15  ? 1   MET E CE  1 
ATOM   7111  N N   . LEU E 1 2   ? 63.503  -1.643  16.409  1.00 65.43  ? 2   LEU E N   1 
ATOM   7112  C CA  . LEU E 1 2   ? 62.346  -0.756  16.360  1.00 57.63  ? 2   LEU E CA  1 
ATOM   7113  C C   . LEU E 1 2   ? 62.762  0.656   16.813  1.00 64.54  ? 2   LEU E C   1 
ATOM   7114  O O   . LEU E 1 2   ? 63.559  0.806   17.742  1.00 75.39  ? 2   LEU E O   1 
ATOM   7115  C CB  . LEU E 1 2   ? 61.245  -1.324  17.261  1.00 54.69  ? 2   LEU E CB  1 
ATOM   7116  C CG  . LEU E 1 2   ? 59.784  -0.972  16.974  1.00 69.32  ? 2   LEU E CG  1 
ATOM   7117  C CD1 . LEU E 1 2   ? 59.461  -1.219  15.485  1.00 53.20  ? 2   LEU E CD1 1 
ATOM   7118  C CD2 . LEU E 1 2   ? 58.892  -1.808  17.882  1.00 39.22  ? 2   LEU E CD2 1 
ATOM   7119  N N   . ALA E 1 3   ? 62.219  1.684   16.163  1.00 66.63  ? 3   ALA E N   1 
ATOM   7120  C CA  . ALA E 1 3   ? 62.553  3.079   16.469  1.00 58.23  ? 3   ALA E CA  1 
ATOM   7121  C C   . ALA E 1 3   ? 61.530  3.834   17.316  1.00 59.99  ? 3   ALA E C   1 
ATOM   7122  O O   . ALA E 1 3   ? 60.333  3.653   17.154  1.00 67.05  ? 3   ALA E O   1 
ATOM   7123  C CB  . ALA E 1 3   ? 62.787  3.833   15.165  1.00 61.03  ? 3   ALA E CB  1 
ATOM   7124  N N   . LYS E 1 4   ? 62.002  4.700   18.211  1.00 58.99  ? 4   LYS E N   1 
ATOM   7125  C CA  . LYS E 1 4   ? 61.091  5.476   19.062  1.00 70.72  ? 4   LYS E CA  1 
ATOM   7126  C C   . LYS E 1 4   ? 60.364  6.532   18.225  1.00 63.40  ? 4   LYS E C   1 
ATOM   7127  O O   . LYS E 1 4   ? 60.975  7.263   17.439  1.00 64.00  ? 4   LYS E O   1 
ATOM   7128  C CB  . LYS E 1 4   ? 61.860  6.140   20.202  1.00 74.49  ? 4   LYS E CB  1 
ATOM   7129  C CG  . LYS E 1 4   ? 62.649  5.158   21.039  1.00 63.48  ? 4   LYS E CG  1 
ATOM   7130  C CD  . LYS E 1 4   ? 61.749  4.153   21.720  1.00 57.50  ? 4   LYS E CD  1 
ATOM   7131  C CE  . LYS E 1 4   ? 62.587  3.043   22.321  1.00 67.20  ? 4   LYS E CE  1 
ATOM   7132  N NZ  . LYS E 1 4   ? 61.771  2.115   23.150  1.00 77.14  ? 4   LYS E NZ  1 
ATOM   7133  N N   . ARG E 1 5   ? 59.058  6.633   18.417  1.00 62.25  ? 5   ARG E N   1 
ATOM   7134  C CA  . ARG E 1 5   ? 58.273  7.549   17.608  1.00 58.58  ? 5   ARG E CA  1 
ATOM   7135  C C   . ARG E 1 5   ? 57.926  8.916   18.163  1.00 64.22  ? 5   ARG E C   1 
ATOM   7136  O O   . ARG E 1 5   ? 57.759  9.088   19.374  1.00 56.92  ? 5   ARG E O   1 
ATOM   7137  C CB  . ARG E 1 5   ? 56.980  6.849   17.188  1.00 53.14  ? 5   ARG E CB  1 
ATOM   7138  C CG  . ARG E 1 5   ? 57.187  5.592   16.355  1.00 40.98  ? 5   ARG E CG  1 
ATOM   7139  C CD  . ARG E 1 5   ? 55.908  4.782   16.276  1.00 54.63  ? 5   ARG E CD  1 
ATOM   7140  N NE  . ARG E 1 5   ? 55.672  3.982   17.477  1.00 53.45  ? 5   ARG E NE  1 
ATOM   7141  C CZ  . ARG E 1 5   ? 54.471  3.763   18.007  1.00 62.13  ? 5   ARG E CZ  1 
ATOM   7142  N NH1 . ARG E 1 5   ? 53.392  4.290   17.453  1.00 53.58  ? 5   ARG E NH1 1 
ATOM   7143  N NH2 . ARG E 1 5   ? 54.342  2.997   19.081  1.00 55.96  ? 5   ARG E NH2 1 
ATOM   7144  N N   . ILE E 1 6   ? 57.812  9.871   17.235  1.00 52.23  ? 6   ILE E N   1 
ATOM   7145  C CA  . ILE E 1 6   ? 57.415  11.253  17.508  1.00 69.07  ? 6   ILE E CA  1 
ATOM   7146  C C   . ILE E 1 6   ? 56.050  11.411  16.795  1.00 71.38  ? 6   ILE E C   1 
ATOM   7147  O O   . ILE E 1 6   ? 55.973  11.431  15.556  1.00 58.69  ? 6   ILE E O   1 
ATOM   7148  C CB  . ILE E 1 6   ? 58.453  12.279  16.926  1.00 73.47  ? 6   ILE E CB  1 
ATOM   7149  C CG1 . ILE E 1 6   ? 59.821  12.073  17.587  1.00 62.50  ? 6   ILE E CG1 1 
ATOM   7150  C CG2 . ILE E 1 6   ? 57.984  13.720  17.164  1.00 62.06  ? 6   ILE E CG2 1 
ATOM   7151  C CD1 . ILE E 1 6   ? 59.778  12.057  19.108  1.00 60.38  ? 6   ILE E CD1 1 
ATOM   7152  N N   . ILE E 1 7   ? 54.973  11.517  17.573  1.00 60.21  ? 7   ILE E N   1 
ATOM   7153  C CA  . ILE E 1 7   ? 53.636  11.618  16.988  1.00 53.74  ? 7   ILE E CA  1 
ATOM   7154  C C   . ILE E 1 7   ? 52.952  12.978  17.138  1.00 55.70  ? 7   ILE E C   1 
ATOM   7155  O O   . ILE E 1 7   ? 53.051  13.632  18.179  1.00 60.15  ? 7   ILE E O   1 
ATOM   7156  C CB  . ILE E 1 7   ? 52.693  10.514  17.583  1.00 48.62  ? 7   ILE E CB  1 
ATOM   7157  C CG1 . ILE E 1 7   ? 53.376  9.136   17.499  1.00 41.99  ? 7   ILE E CG1 1 
ATOM   7158  C CG2 . ILE E 1 7   ? 51.373  10.477  16.821  1.00 49.94  ? 7   ILE E CG2 1 
ATOM   7159  C CD1 . ILE E 1 7   ? 52.605  7.996   18.152  1.00 45.22  ? 7   ILE E CD1 1 
ATOM   7160  N N   . ALA E 1 8   ? 52.250  13.388  16.087  1.00 55.03  ? 8   ALA E N   1 
ATOM   7161  C CA  . ALA E 1 8   ? 51.523  14.650  16.083  1.00 56.80  ? 8   ALA E CA  1 
ATOM   7162  C C   . ALA E 1 8   ? 50.025  14.402  16.244  1.00 62.54  ? 8   ALA E C   1 
ATOM   7163  O O   . ALA E 1 8   ? 49.428  13.621  15.491  1.00 64.16  ? 8   ALA E O   1 
ATOM   7164  C CB  . ALA E 1 8   ? 51.786  15.410  14.781  1.00 47.27  ? 8   ALA E CB  1 
ATOM   7165  N N   . CYS E 1 9   ? 49.427  15.068  17.232  1.00 71.79  ? 9   CYS E N   1 
ATOM   7166  C CA  . CYS E 1 9   ? 47.992  14.967  17.504  1.00 63.88  ? 9   CYS E CA  1 
ATOM   7167  C C   . CYS E 1 9   ? 47.300  16.191  16.921  1.00 62.51  ? 9   CYS E C   1 
ATOM   7168  O O   . CYS E 1 9   ? 47.563  17.302  17.357  1.00 76.66  ? 9   CYS E O   1 
ATOM   7169  C CB  . CYS E 1 9   ? 47.742  14.946  19.009  1.00 62.79  ? 9   CYS E CB  1 
ATOM   7170  S SG  . CYS E 1 9   ? 45.996  14.869  19.488  1.00 79.80  ? 9   CYS E SG  1 
ATOM   7171  N N   . LEU E 1 10  ? 46.413  16.007  15.949  1.00 72.46  ? 10  LEU E N   1 
ATOM   7172  C CA  . LEU E 1 10  ? 45.727  17.158  15.358  1.00 63.67  ? 10  LEU E CA  1 
ATOM   7173  C C   . LEU E 1 10  ? 44.286  17.270  15.860  1.00 67.09  ? 10  LEU E C   1 
ATOM   7174  O O   . LEU E 1 10  ? 43.403  16.524  15.436  1.00 70.29  ? 10  LEU E O   1 
ATOM   7175  C CB  . LEU E 1 10  ? 45.730  17.072  13.823  1.00 59.27  ? 10  LEU E CB  1 
ATOM   7176  C CG  . LEU E 1 10  ? 47.016  16.743  13.052  1.00 71.11  ? 10  LEU E CG  1 
ATOM   7177  C CD1 . LEU E 1 10  ? 46.790  17.098  11.585  1.00 53.77  ? 10  LEU E CD1 1 
ATOM   7178  C CD2 . LEU E 1 10  ? 48.207  17.509  13.602  1.00 57.68  ? 10  LEU E CD2 1 
ATOM   7179  N N   . ASN E 1 11  ? 44.057  18.210  16.769  1.00 67.10  ? 11  ASN E N   1 
ATOM   7180  C CA  . ASN E 1 11  ? 42.735  18.438  17.340  1.00 76.00  ? 11  ASN E CA  1 
ATOM   7181  C C   . ASN E 1 11  ? 41.841  19.079  16.299  1.00 54.90  ? 11  ASN E C   1 
ATOM   7182  O O   . ASN E 1 11  ? 41.979  20.267  16.037  1.00 75.46  ? 11  ASN E O   1 
ATOM   7183  C CB  . ASN E 1 11  ? 42.861  19.356  18.559  1.00 90.53  ? 11  ASN E CB  1 
ATOM   7184  C CG  . ASN E 1 11  ? 43.365  18.619  19.792  1.00 100.91 ? 11  ASN E CG  1 
ATOM   7185  O OD1 . ASN E 1 11  ? 42.585  17.948  20.485  1.00 96.99  ? 11  ASN E OD1 1 
ATOM   7186  N ND2 . ASN E 1 11  ? 44.673  18.723  20.065  1.00 76.61  ? 11  ASN E ND2 1 
ATOM   7187  N N   . VAL E 1 12  ? 40.929  18.303  15.708  1.00 67.92  ? 12  VAL E N   1 
ATOM   7188  C CA  . VAL E 1 12  ? 40.044  18.848  14.677  1.00 62.43  ? 12  VAL E CA  1 
ATOM   7189  C C   . VAL E 1 12  ? 38.626  19.129  15.165  1.00 76.09  ? 12  VAL E C   1 
ATOM   7190  O O   . VAL E 1 12  ? 38.339  19.057  16.361  1.00 86.51  ? 12  VAL E O   1 
ATOM   7191  C CB  . VAL E 1 12  ? 39.970  17.923  13.417  1.00 65.26  ? 12  VAL E CB  1 
ATOM   7192  C CG1 . VAL E 1 12  ? 41.364  17.540  12.976  1.00 56.85  ? 12  VAL E CG1 1 
ATOM   7193  C CG2 . VAL E 1 12  ? 39.139  16.693  13.691  1.00 49.73  ? 12  VAL E CG2 1 
ATOM   7194  N N   . LYS E 1 13  ? 37.741  19.457  14.227  1.00 75.02  ? 13  LYS E N   1 
ATOM   7195  C CA  . LYS E 1 13  ? 36.359  19.774  14.555  1.00 72.14  ? 13  LYS E CA  1 
ATOM   7196  C C   . LYS E 1 13  ? 35.626  20.131  13.275  1.00 65.69  ? 13  LYS E C   1 
ATOM   7197  O O   . LYS E 1 13  ? 35.969  21.118  12.612  1.00 75.57  ? 13  LYS E O   1 
ATOM   7198  C CB  . LYS E 1 13  ? 36.317  20.953  15.535  1.00 50.71  ? 13  LYS E CB  1 
ATOM   7199  C CG  . LYS E 1 13  ? 34.910  21.402  15.965  1.00 84.86  ? 13  LYS E CG  1 
ATOM   7200  C CD  . LYS E 1 13  ? 34.225  22.306  14.926  1.00 79.84  ? 13  LYS E CD  1 
ATOM   7201  C CE  . LYS E 1 13  ? 32.971  22.978  15.524  1.00 100.52 ? 13  LYS E CE  1 
ATOM   7202  N NZ  . LYS E 1 13  ? 32.179  23.765  14.512  1.00 72.76  ? 13  LYS E NZ  1 
ATOM   7203  N N   . ASP E 1 14  ? 34.619  19.328  12.930  1.00 64.55  ? 14  ASP E N   1 
ATOM   7204  C CA  . ASP E 1 14  ? 33.833  19.547  11.718  1.00 65.49  ? 14  ASP E CA  1 
ATOM   7205  C C   . ASP E 1 14  ? 34.654  19.544  10.448  1.00 64.34  ? 14  ASP E C   1 
ATOM   7206  O O   . ASP E 1 14  ? 34.450  20.394  9.585   1.00 64.82  ? 14  ASP E O   1 
ATOM   7207  C CB  . ASP E 1 14  ? 33.067  20.871  11.799  1.00 88.28  ? 14  ASP E CB  1 
ATOM   7208  C CG  . ASP E 1 14  ? 31.760  20.737  12.547  1.00 103.15 ? 14  ASP E CG  1 
ATOM   7209  O OD1 . ASP E 1 14  ? 30.786  20.197  11.963  1.00 67.91  ? 14  ASP E OD1 1 
ATOM   7210  O OD2 . ASP E 1 14  ? 31.711  21.155  13.726  1.00 103.15 ? 14  ASP E OD2 1 
ATOM   7211  N N   . GLY E 1 15  ? 35.588  18.605  10.338  1.00 70.39  ? 15  GLY E N   1 
ATOM   7212  C CA  . GLY E 1 15  ? 36.396  18.522  9.134   1.00 63.84  ? 15  GLY E CA  1 
ATOM   7213  C C   . GLY E 1 15  ? 37.489  19.566  9.059   1.00 62.97  ? 15  GLY E C   1 
ATOM   7214  O O   . GLY E 1 15  ? 38.103  19.761  8.007   1.00 65.99  ? 15  GLY E O   1 
ATOM   7215  N N   . ARG E 1 16  ? 37.744  20.253  10.164  1.00 64.44  ? 16  ARG E N   1 
ATOM   7216  C CA  . ARG E 1 16  ? 38.803  21.253  10.162  1.00 68.32  ? 16  ARG E CA  1 
ATOM   7217  C C   . ARG E 1 16  ? 39.681  21.143  11.400  1.00 58.04  ? 16  ARG E C   1 
ATOM   7218  O O   . ARG E 1 16  ? 39.177  20.966  12.503  1.00 64.34  ? 16  ARG E O   1 
ATOM   7219  C CB  . ARG E 1 16  ? 38.206  22.659  10.067  1.00 77.19  ? 16  ARG E CB  1 
ATOM   7220  C CG  . ARG E 1 16  ? 37.357  22.868  8.819   1.00 79.06  ? 16  ARG E CG  1 
ATOM   7221  C CD  . ARG E 1 16  ? 37.162  24.350  8.522   1.00 94.42  ? 16  ARG E CD  1 
ATOM   7222  N NE  . ARG E 1 16  ? 38.348  25.002  7.949   1.00 80.32  ? 16  ARG E NE  1 
ATOM   7223  C CZ  . ARG E 1 16  ? 38.942  24.637  6.814   1.00 68.82  ? 16  ARG E CZ  1 
ATOM   7224  N NH1 . ARG E 1 16  ? 38.477  23.608  6.115   1.00 61.59  ? 16  ARG E NH1 1 
ATOM   7225  N NH2 . ARG E 1 16  ? 39.987  25.321  6.362   1.00 57.44  ? 16  ARG E NH2 1 
ATOM   7226  N N   . VAL E 1 17  ? 40.994  21.241  11.194  1.00 77.43  ? 17  VAL E N   1 
ATOM   7227  C CA  . VAL E 1 17  ? 41.988  21.170  12.274  1.00 84.85  ? 17  VAL E CA  1 
ATOM   7228  C C   . VAL E 1 17  ? 42.121  22.532  12.932  1.00 86.19  ? 17  VAL E C   1 
ATOM   7229  O O   . VAL E 1 17  ? 43.147  23.195  12.777  1.00 94.63  ? 17  VAL E O   1 
ATOM   7230  C CB  . VAL E 1 17  ? 43.408  20.802  11.750  1.00 94.49  ? 17  VAL E CB  1 
ATOM   7231  C CG1 . VAL E 1 17  ? 43.450  19.341  11.247  1.00 103.15 ? 17  VAL E CG1 1 
ATOM   7232  C CG2 . VAL E 1 17  ? 43.803  21.758  10.620  1.00 76.89  ? 17  VAL E CG2 1 
ATOM   7233  N N   . VAL E 1 18  ? 41.097  22.955  13.662  1.00 87.04  ? 18  VAL E N   1 
ATOM   7234  C CA  . VAL E 1 18  ? 41.137  24.252  14.332  1.00 92.87  ? 18  VAL E CA  1 
ATOM   7235  C C   . VAL E 1 18  ? 41.866  25.266  13.442  1.00 96.98  ? 18  VAL E C   1 
ATOM   7236  O O   . VAL E 1 18  ? 41.711  25.232  12.212  1.00 91.64  ? 18  VAL E O   1 
ATOM   7237  C CB  . VAL E 1 18  ? 41.833  24.138  15.728  1.00 85.73  ? 18  VAL E CB  1 
ATOM   7238  C CG1 . VAL E 1 18  ? 41.098  23.098  16.573  1.00 68.96  ? 18  VAL E CG1 1 
ATOM   7239  C CG2 . VAL E 1 18  ? 43.318  23.755  15.576  1.00 63.35  ? 18  VAL E CG2 1 
ATOM   7240  N N   . LYS E 1 19  ? 42.651  26.155  14.057  1.00 94.64  ? 19  LYS E N   1 
ATOM   7241  C CA  . LYS E 1 19  ? 43.401  27.175  13.319  1.00 94.76  ? 19  LYS E CA  1 
ATOM   7242  C C   . LYS E 1 19  ? 44.535  27.767  14.174  1.00 98.85  ? 19  LYS E C   1 
ATOM   7243  O O   . LYS E 1 19  ? 44.447  27.821  15.414  1.00 90.36  ? 19  LYS E O   1 
ATOM   7244  C CB  . LYS E 1 19  ? 42.459  28.296  12.878  1.00 92.65  ? 19  LYS E CB  1 
ATOM   7245  C CG  . LYS E 1 19  ? 43.018  29.189  11.773  1.00 92.10  ? 19  LYS E CG  1 
ATOM   7246  C CD  . LYS E 1 19  ? 42.902  28.503  10.419  1.00 96.85  ? 19  LYS E CD  1 
ATOM   7247  C CE  . LYS E 1 19  ? 43.075  29.496  9.272   1.00 103.15 ? 19  LYS E CE  1 
ATOM   7248  N NZ  . LYS E 1 19  ? 42.644  28.921  7.941   1.00 81.83  ? 19  LYS E NZ  1 
ATOM   7249  N N   . ASN E 1 22  ? 48.313  30.727  14.212  1.00 93.71  ? 22  ASN E N   1 
ATOM   7250  C CA  . ASN E 1 22  ? 49.047  30.823  12.956  1.00 96.12  ? 22  ASN E CA  1 
ATOM   7251  C C   . ASN E 1 22  ? 48.758  29.617  12.050  1.00 93.17  ? 22  ASN E C   1 
ATOM   7252  O O   . ASN E 1 22  ? 48.039  28.676  12.423  1.00 86.81  ? 22  ASN E O   1 
ATOM   7253  C CB  . ASN E 1 22  ? 50.559  30.936  13.243  1.00 103.15 ? 22  ASN E CB  1 
ATOM   7254  C CG  . ASN E 1 22  ? 51.370  31.426  12.034  1.00 103.15 ? 22  ASN E CG  1 
ATOM   7255  O OD1 . ASN E 1 22  ? 51.720  30.649  11.135  1.00 87.68  ? 22  ASN E OD1 1 
ATOM   7256  N ND2 . ASN E 1 22  ? 51.671  32.725  12.016  1.00 97.42  ? 22  ASN E ND2 1 
ATOM   7257  N N   . PHE E 1 23  ? 49.330  29.666  10.855  1.00 89.74  ? 23  PHE E N   1 
ATOM   7258  C CA  . PHE E 1 23  ? 49.166  28.632  9.847   1.00 93.54  ? 23  PHE E CA  1 
ATOM   7259  C C   . PHE E 1 23  ? 49.944  29.171  8.659   1.00 103.15 ? 23  PHE E C   1 
ATOM   7260  O O   . PHE E 1 23  ? 49.386  29.896  7.821   1.00 103.15 ? 23  PHE E O   1 
ATOM   7261  C CB  . PHE E 1 23  ? 47.720  28.497  9.487   1.00 93.31  ? 23  PHE E CB  1 
ATOM   7262  N N   . GLU E 1 24  ? 51.231  28.834  8.592   1.00 103.15 ? 24  GLU E N   1 
ATOM   7263  C CA  . GLU E 1 24  ? 52.084  29.337  7.517   1.00 103.15 ? 24  GLU E CA  1 
ATOM   7264  C C   . GLU E 1 24  ? 52.553  28.287  6.520   1.00 103.15 ? 24  GLU E C   1 
ATOM   7265  O O   . GLU E 1 24  ? 52.586  27.089  6.827   1.00 89.57  ? 24  GLU E O   1 
ATOM   7266  C CB  . GLU E 1 24  ? 53.312  30.046  8.106   1.00 103.15 ? 24  GLU E CB  1 
ATOM   7267  C CG  . GLU E 1 24  ? 54.134  30.784  7.058   1.00 103.15 ? 24  GLU E CG  1 
ATOM   7268  C CD  . GLU E 1 24  ? 53.282  31.786  6.285   1.00 103.15 ? 24  GLU E CD  1 
ATOM   7269  O OE1 . GLU E 1 24  ? 52.895  32.817  6.886   1.00 92.56  ? 24  GLU E OE1 1 
ATOM   7270  O OE2 . GLU E 1 24  ? 52.995  31.531  5.086   1.00 93.99  ? 24  GLU E OE2 1 
ATOM   7271  N N   . ASN E 1 25  ? 52.928  28.772  5.333   1.00 103.15 ? 25  ASN E N   1 
ATOM   7272  C CA  . ASN E 1 25  ? 53.423  27.946  4.232   1.00 101.73 ? 25  ASN E CA  1 
ATOM   7273  C C   . ASN E 1 25  ? 52.422  26.881  3.778   1.00 103.15 ? 25  ASN E C   1 
ATOM   7274  O O   . ASN E 1 25  ? 52.125  26.776  2.583   1.00 103.15 ? 25  ASN E O   1 
ATOM   7275  C CB  . ASN E 1 25  ? 54.755  27.289  4.623   1.00 73.60  ? 25  ASN E CB  1 
ATOM   7276  N N   . LEU E 1 26  ? 51.901  26.101  4.730   1.00 103.15 ? 26  LEU E N   1 
ATOM   7277  C CA  . LEU E 1 26  ? 50.945  25.034  4.425   1.00 102.14 ? 26  LEU E CA  1 
ATOM   7278  C C   . LEU E 1 26  ? 49.655  25.593  3.807   1.00 103.15 ? 26  LEU E C   1 
ATOM   7279  O O   . LEU E 1 26  ? 48.688  24.850  3.567   1.00 103.15 ? 26  LEU E O   1 
ATOM   7280  C CB  . LEU E 1 26  ? 50.634  24.215  5.692   1.00 78.79  ? 26  LEU E CB  1 
ATOM   7281  C CG  . LEU E 1 26  ? 49.796  24.776  6.847   1.00 71.83  ? 26  LEU E CG  1 
ATOM   7282  C CD1 . LEU E 1 26  ? 48.864  23.675  7.323   1.00 71.78  ? 26  LEU E CD1 1 
ATOM   7283  C CD2 . LEU E 1 26  ? 50.677  25.270  7.994   1.00 85.42  ? 26  LEU E CD2 1 
ATOM   7284  N N   . ARG E 1 27  ? 49.675  26.900  3.530   1.00 103.15 ? 27  ARG E N   1 
ATOM   7285  C CA  . ARG E 1 27  ? 48.554  27.630  2.934   1.00 96.51  ? 27  ARG E CA  1 
ATOM   7286  C C   . ARG E 1 27  ? 47.437  27.798  3.966   1.00 99.80  ? 27  ARG E C   1 
ATOM   7287  O O   . ARG E 1 27  ? 47.524  28.653  4.856   1.00 99.47  ? 27  ARG E O   1 
ATOM   7288  C CB  . ARG E 1 27  ? 48.018  26.891  1.689   1.00 103.15 ? 27  ARG E CB  1 
ATOM   7289  C CG  . ARG E 1 27  ? 49.080  26.214  0.801   1.00 73.57  ? 27  ARG E CG  1 
ATOM   7290  C CD  . ARG E 1 27  ? 48.715  26.326  -0.674  1.00 85.26  ? 27  ARG E CD  1 
ATOM   7291  N NE  . ARG E 1 27  ? 49.251  25.226  -1.478  1.00 100.38 ? 27  ARG E NE  1 
ATOM   7292  C CZ  . ARG E 1 27  ? 48.654  24.038  -1.618  1.00 102.99 ? 27  ARG E CZ  1 
ATOM   7293  N NH1 . ARG E 1 27  ? 47.494  23.796  -1.012  1.00 93.44  ? 27  ARG E NH1 1 
ATOM   7294  N NH2 . ARG E 1 27  ? 49.214  23.088  -2.362  1.00 76.82  ? 27  ARG E NH2 1 
ATOM   7295  N N   . ASP E 1 28  ? 46.401  26.971  3.840   1.00 99.27  ? 28  ASP E N   1 
ATOM   7296  C CA  . ASP E 1 28  ? 45.251  26.982  4.745   1.00 96.31  ? 28  ASP E CA  1 
ATOM   7297  C C   . ASP E 1 28  ? 45.493  26.050  5.951   1.00 95.71  ? 28  ASP E C   1 
ATOM   7298  O O   . ASP E 1 28  ? 45.777  24.855  5.798   1.00 87.92  ? 28  ASP E O   1 
ATOM   7299  C CB  . ASP E 1 28  ? 44.001  26.551  3.969   1.00 74.57  ? 28  ASP E CB  1 
ATOM   7300  C CG  . ASP E 1 28  ? 42.755  26.518  4.827   1.00 86.13  ? 28  ASP E CG  1 
ATOM   7301  O OD1 . ASP E 1 28  ? 42.545  27.474  5.608   1.00 88.96  ? 28  ASP E OD1 1 
ATOM   7302  O OD2 . ASP E 1 28  ? 41.973  25.535  4.705   1.00 94.65  ? 28  ASP E OD2 1 
ATOM   7303  N N   . SER E 1 29  ? 45.406  26.611  7.152   1.00 97.43  ? 29  SER E N   1 
ATOM   7304  C CA  . SER E 1 29  ? 45.617  25.839  8.371   1.00 98.01  ? 29  SER E CA  1 
ATOM   7305  C C   . SER E 1 29  ? 44.579  24.716  8.408   1.00 99.18  ? 29  SER E C   1 
ATOM   7306  O O   . SER E 1 29  ? 44.907  23.559  8.142   1.00 103.15 ? 29  SER E O   1 
ATOM   7307  C CB  . SER E 1 29  ? 45.447  26.742  9.601   1.00 101.63 ? 29  SER E CB  1 
ATOM   7308  O OG  . SER E 1 29  ? 46.121  26.230  10.743  1.00 72.94  ? 29  SER E OG  1 
ATOM   7309  N N   . GLY E 1 30  ? 43.334  25.092  8.721   1.00 94.83  ? 30  GLY E N   1 
ATOM   7310  C CA  . GLY E 1 30  ? 42.200  24.181  8.820   1.00 78.97  ? 30  GLY E CA  1 
ATOM   7311  C C   . GLY E 1 30  ? 42.052  22.974  7.902   1.00 73.18  ? 30  GLY E C   1 
ATOM   7312  O O   . GLY E 1 30  ? 41.079  22.224  8.035   1.00 81.51  ? 30  GLY E O   1 
ATOM   7313  N N   . ASP E 1 31  ? 42.975  22.778  6.969   1.00 54.79  ? 31  ASP E N   1 
ATOM   7314  C CA  . ASP E 1 31  ? 42.905  21.623  6.082   1.00 59.11  ? 31  ASP E CA  1 
ATOM   7315  C C   . ASP E 1 31  ? 43.692  20.479  6.747   1.00 71.99  ? 31  ASP E C   1 
ATOM   7316  O O   . ASP E 1 31  ? 44.926  20.496  6.803   1.00 61.90  ? 31  ASP E O   1 
ATOM   7317  C CB  . ASP E 1 31  ? 43.502  21.980  4.713   1.00 47.84  ? 31  ASP E CB  1 
ATOM   7318  C CG  . ASP E 1 31  ? 43.151  20.967  3.632   1.00 55.16  ? 31  ASP E CG  1 
ATOM   7319  O OD1 . ASP E 1 31  ? 42.061  20.363  3.696   1.00 66.10  ? 31  ASP E OD1 1 
ATOM   7320  O OD2 . ASP E 1 31  ? 43.960  20.790  2.700   1.00 75.59  ? 31  ASP E OD2 1 
ATOM   7321  N N   . PRO E 1 32  ? 42.982  19.477  7.276   1.00 69.04  ? 32  PRO E N   1 
ATOM   7322  C CA  . PRO E 1 32  ? 43.696  18.375  7.919   1.00 78.42  ? 32  PRO E CA  1 
ATOM   7323  C C   . PRO E 1 32  ? 44.593  17.651  6.917   1.00 64.52  ? 32  PRO E C   1 
ATOM   7324  O O   . PRO E 1 32  ? 45.680  17.184  7.256   1.00 62.55  ? 32  PRO E O   1 
ATOM   7325  C CB  . PRO E 1 32  ? 42.558  17.493  8.440   1.00 72.80  ? 32  PRO E CB  1 
ATOM   7326  C CG  . PRO E 1 32  ? 41.522  17.653  7.363   1.00 61.84  ? 32  PRO E CG  1 
ATOM   7327  C CD  . PRO E 1 32  ? 41.547  19.160  7.136   1.00 84.09  ? 32  PRO E CD  1 
ATOM   7328  N N   . VAL E 1 33  ? 44.135  17.581  5.675   1.00 55.89  ? 33  VAL E N   1 
ATOM   7329  C CA  . VAL E 1 33  ? 44.897  16.895  4.646   1.00 60.54  ? 33  VAL E CA  1 
ATOM   7330  C C   . VAL E 1 33  ? 46.206  17.613  4.330   1.00 57.03  ? 33  VAL E C   1 
ATOM   7331  O O   . VAL E 1 33  ? 47.184  16.974  3.946   1.00 71.33  ? 33  VAL E O   1 
ATOM   7332  C CB  . VAL E 1 33  ? 44.052  16.722  3.362   1.00 54.77  ? 33  VAL E CB  1 
ATOM   7333  C CG1 . VAL E 1 33  ? 44.846  15.963  2.292   1.00 45.60  ? 33  VAL E CG1 1 
ATOM   7334  C CG2 . VAL E 1 33  ? 42.773  15.961  3.695   1.00 40.35  ? 33  VAL E CG2 1 
ATOM   7335  N N   . GLU E 1 34  ? 46.243  18.930  4.518   1.00 68.65  ? 34  GLU E N   1 
ATOM   7336  C CA  . GLU E 1 34  ? 47.464  19.688  4.240   1.00 69.05  ? 34  GLU E CA  1 
ATOM   7337  C C   . GLU E 1 34  ? 48.405  19.776  5.440   1.00 51.25  ? 34  GLU E C   1 
ATOM   7338  O O   . GLU E 1 34  ? 49.613  19.826  5.276   1.00 55.89  ? 34  GLU E O   1 
ATOM   7339  C CB  . GLU E 1 34  ? 47.132  21.107  3.755   1.00 75.04  ? 34  GLU E CB  1 
ATOM   7340  C CG  . GLU E 1 34  ? 47.758  21.428  2.396   1.00 88.58  ? 34  GLU E CG  1 
ATOM   7341  C CD  . GLU E 1 34  ? 47.160  20.582  1.275   1.00 80.64  ? 34  GLU E CD  1 
ATOM   7342  O OE1 . GLU E 1 34  ? 45.960  20.771  0.977   1.00 102.98 ? 34  GLU E OE1 1 
ATOM   7343  O OE2 . GLU E 1 34  ? 47.874  19.726  0.695   1.00 64.09  ? 34  GLU E OE2 1 
ATOM   7344  N N   . LEU E 1 35  ? 47.851  19.811  6.643   1.00 52.20  ? 35  LEU E N   1 
ATOM   7345  C CA  . LEU E 1 35  ? 48.680  19.886  7.829   1.00 54.11  ? 35  LEU E CA  1 
ATOM   7346  C C   . LEU E 1 35  ? 49.347  18.527  7.996   1.00 63.79  ? 35  LEU E C   1 
ATOM   7347  O O   . LEU E 1 35  ? 50.532  18.441  8.305   1.00 60.08  ? 35  LEU E O   1 
ATOM   7348  C CB  . LEU E 1 35  ? 47.824  20.199  9.054   1.00 60.07  ? 35  LEU E CB  1 
ATOM   7349  C CG  . LEU E 1 35  ? 48.569  20.591  10.332  1.00 60.02  ? 35  LEU E CG  1 
ATOM   7350  C CD1 . LEU E 1 35  ? 49.288  21.919  10.137  1.00 48.71  ? 35  LEU E CD1 1 
ATOM   7351  C CD2 . LEU E 1 35  ? 47.577  20.692  11.466  1.00 52.49  ? 35  LEU E CD2 1 
ATOM   7352  N N   . GLY E 1 36  ? 48.564  17.473  7.780   1.00 62.78  ? 36  GLY E N   1 
ATOM   7353  C CA  . GLY E 1 36  ? 49.063  16.114  7.890   1.00 59.85  ? 36  GLY E CA  1 
ATOM   7354  C C   . GLY E 1 36  ? 50.147  15.836  6.869   1.00 59.75  ? 36  GLY E C   1 
ATOM   7355  O O   . GLY E 1 36  ? 51.150  15.198  7.182   1.00 49.47  ? 36  GLY E O   1 
ATOM   7356  N N   . LYS E 1 37  ? 49.943  16.298  5.639   1.00 54.58  ? 37  LYS E N   1 
ATOM   7357  C CA  . LYS E 1 37  ? 50.943  16.111  4.595   1.00 46.58  ? 37  LYS E CA  1 
ATOM   7358  C C   . LYS E 1 37  ? 52.166  16.931  4.966   1.00 60.38  ? 37  LYS E C   1 
ATOM   7359  O O   . LYS E 1 37  ? 53.296  16.556  4.644   1.00 74.25  ? 37  LYS E O   1 
ATOM   7360  C CB  . LYS E 1 37  ? 50.414  16.573  3.239   1.00 57.60  ? 37  LYS E CB  1 
ATOM   7361  C CG  . LYS E 1 37  ? 49.596  15.523  2.515   1.00 68.45  ? 37  LYS E CG  1 
ATOM   7362  C CD  . LYS E 1 37  ? 48.881  16.115  1.321   1.00 76.01  ? 37  LYS E CD  1 
ATOM   7363  C CE  . LYS E 1 37  ? 49.837  16.757  0.343   1.00 68.95  ? 37  LYS E CE  1 
ATOM   7364  N NZ  . LYS E 1 37  ? 49.073  17.261  -0.830  1.00 79.07  ? 37  LYS E NZ  1 
ATOM   7365  N N   . PHE E 1 38  ? 51.927  18.056  5.642   1.00 60.97  ? 38  PHE E N   1 
ATOM   7366  C CA  . PHE E 1 38  ? 52.999  18.941  6.093   1.00 62.25  ? 38  PHE E CA  1 
ATOM   7367  C C   . PHE E 1 38  ? 53.913  18.160  7.039   1.00 62.87  ? 38  PHE E C   1 
ATOM   7368  O O   . PHE E 1 38  ? 55.083  17.952  6.737   1.00 45.55  ? 38  PHE E O   1 
ATOM   7369  C CB  . PHE E 1 38  ? 52.405  20.166  6.816   1.00 60.54  ? 38  PHE E CB  1 
ATOM   7370  C CG  . PHE E 1 38  ? 53.434  21.036  7.511   1.00 71.49  ? 38  PHE E CG  1 
ATOM   7371  C CD1 . PHE E 1 38  ? 54.511  21.571  6.806   1.00 84.01  ? 38  PHE E CD1 1 
ATOM   7372  C CD2 . PHE E 1 38  ? 53.303  21.342  8.872   1.00 91.95  ? 38  PHE E CD2 1 
ATOM   7373  C CE1 . PHE E 1 38  ? 55.438  22.398  7.444   1.00 89.79  ? 38  PHE E CE1 1 
ATOM   7374  C CE2 . PHE E 1 38  ? 54.225  22.170  9.525   1.00 65.44  ? 38  PHE E CE2 1 
ATOM   7375  C CZ  . PHE E 1 38  ? 55.290  22.697  8.813   1.00 79.70  ? 38  PHE E CZ  1 
ATOM   7376  N N   . TYR E 1 39  ? 53.353  17.730  8.173   1.00 66.69  ? 39  TYR E N   1 
ATOM   7377  C CA  . TYR E 1 39  ? 54.073  16.969  9.196   1.00 60.21  ? 39  TYR E CA  1 
ATOM   7378  C C   . TYR E 1 39  ? 54.850  15.749  8.685   1.00 57.72  ? 39  TYR E C   1 
ATOM   7379  O O   . TYR E 1 39  ? 55.907  15.419  9.214   1.00 59.13  ? 39  TYR E O   1 
ATOM   7380  C CB  . TYR E 1 39  ? 53.101  16.542  10.293  1.00 56.45  ? 39  TYR E CB  1 
ATOM   7381  C CG  . TYR E 1 39  ? 52.613  17.692  11.142  1.00 63.75  ? 39  TYR E CG  1 
ATOM   7382  C CD1 . TYR E 1 39  ? 53.514  18.520  11.820  1.00 87.28  ? 39  TYR E CD1 1 
ATOM   7383  C CD2 . TYR E 1 39  ? 51.251  17.945  11.294  1.00 72.61  ? 39  TYR E CD2 1 
ATOM   7384  C CE1 . TYR E 1 39  ? 53.063  19.577  12.634  1.00 81.78  ? 39  TYR E CE1 1 
ATOM   7385  C CE2 . TYR E 1 39  ? 50.794  18.991  12.101  1.00 65.43  ? 39  TYR E CE2 1 
ATOM   7386  C CZ  . TYR E 1 39  ? 51.703  19.800  12.766  1.00 68.87  ? 39  TYR E CZ  1 
ATOM   7387  O OH  . TYR E 1 39  ? 51.245  20.834  13.554  1.00 76.47  ? 39  TYR E OH  1 
ATOM   7388  N N   . SER E 1 40  ? 54.331  15.066  7.667   1.00 73.85  ? 40  SER E N   1 
ATOM   7389  C CA  . SER E 1 40  ? 55.046  13.918  7.110   1.00 61.09  ? 40  SER E CA  1 
ATOM   7390  C C   . SER E 1 40  ? 56.320  14.450  6.474   1.00 60.38  ? 40  SER E C   1 
ATOM   7391  O O   . SER E 1 40  ? 57.397  13.891  6.647   1.00 61.82  ? 40  SER E O   1 
ATOM   7392  C CB  . SER E 1 40  ? 54.200  13.216  6.047   1.00 66.85  ? 40  SER E CB  1 
ATOM   7393  O OG  . SER E 1 40  ? 54.998  12.348  5.258   1.00 52.64  ? 40  SER E OG  1 
ATOM   7394  N N   . GLU E 1 41  ? 56.171  15.546  5.733   1.00 70.59  ? 41  GLU E N   1 
ATOM   7395  C CA  . GLU E 1 41  ? 57.274  16.213  5.049   1.00 71.26  ? 41  GLU E CA  1 
ATOM   7396  C C   . GLU E 1 41  ? 58.453  16.521  5.998   1.00 63.43  ? 41  GLU E C   1 
ATOM   7397  O O   . GLU E 1 41  ? 59.603  16.323  5.622   1.00 43.44  ? 41  GLU E O   1 
ATOM   7398  C CB  . GLU E 1 41  ? 56.769  17.525  4.406   1.00 75.06  ? 41  GLU E CB  1 
ATOM   7399  C CG  . GLU E 1 41  ? 56.730  17.570  2.868   1.00 76.80  ? 41  GLU E CG  1 
ATOM   7400  C CD  . GLU E 1 41  ? 56.083  18.862  2.318   1.00 103.15 ? 41  GLU E CD  1 
ATOM   7401  O OE1 . GLU E 1 41  ? 54.889  19.123  2.624   1.00 103.15 ? 41  GLU E OE1 1 
ATOM   7402  O OE2 . GLU E 1 41  ? 56.759  19.618  1.570   1.00 103.15 ? 41  GLU E OE2 1 
ATOM   7403  N N   . ILE E 1 42  ? 58.166  17.002  7.214   1.00 67.01  ? 42  ILE E N   1 
ATOM   7404  C CA  . ILE E 1 42  ? 59.227  17.336  8.176   1.00 72.78  ? 42  ILE E CA  1 
ATOM   7405  C C   . ILE E 1 42  ? 59.877  16.148  8.888   1.00 65.56  ? 42  ILE E C   1 
ATOM   7406  O O   . ILE E 1 42  ? 61.058  16.208  9.247   1.00 72.65  ? 42  ILE E O   1 
ATOM   7407  C CB  . ILE E 1 42  ? 58.759  18.349  9.275   1.00 76.20  ? 42  ILE E CB  1 
ATOM   7408  C CG1 . ILE E 1 42  ? 57.341  18.039  9.743   1.00 87.04  ? 42  ILE E CG1 1 
ATOM   7409  C CG2 . ILE E 1 42  ? 58.867  19.778  8.764   1.00 91.87  ? 42  ILE E CG2 1 
ATOM   7410  C CD1 . ILE E 1 42  ? 56.863  18.990  10.834  1.00 96.56  ? 42  ILE E CD1 1 
ATOM   7411  N N   . GLY E 1 43  ? 59.119  15.079  9.101   1.00 68.90  ? 43  GLY E N   1 
ATOM   7412  C CA  . GLY E 1 43  ? 59.687  13.914  9.749   1.00 58.64  ? 43  GLY E CA  1 
ATOM   7413  C C   . GLY E 1 43  ? 58.835  13.249  10.813  1.00 71.54  ? 43  GLY E C   1 
ATOM   7414  O O   . GLY E 1 43  ? 59.335  12.356  11.506  1.00 60.67  ? 43  GLY E O   1 
ATOM   7415  N N   . ILE E 1 44  ? 57.573  13.672  10.957  1.00 56.03  ? 44  ILE E N   1 
ATOM   7416  C CA  . ILE E 1 44  ? 56.676  13.077  11.948  1.00 52.39  ? 44  ILE E CA  1 
ATOM   7417  C C   . ILE E 1 44  ? 56.458  11.616  11.564  1.00 49.17  ? 44  ILE E C   1 
ATOM   7418  O O   . ILE E 1 44  ? 56.265  11.293  10.392  1.00 60.42  ? 44  ILE E O   1 
ATOM   7419  C CB  . ILE E 1 44  ? 55.305  13.840  12.018  1.00 53.05  ? 44  ILE E CB  1 
ATOM   7420  C CG1 . ILE E 1 44  ? 55.450  15.092  12.884  1.00 53.64  ? 44  ILE E CG1 1 
ATOM   7421  C CG2 . ILE E 1 44  ? 54.225  12.967  12.648  1.00 63.88  ? 44  ILE E CG2 1 
ATOM   7422  C CD1 . ILE E 1 44  ? 55.783  14.779  14.335  1.00 54.09  ? 44  ILE E CD1 1 
ATOM   7423  N N   . ASP E 1 45  ? 56.488  10.738  12.558  1.00 57.69  ? 45  ASP E N   1 
ATOM   7424  C CA  . ASP E 1 45  ? 56.341  9.306   12.333  1.00 58.77  ? 45  ASP E CA  1 
ATOM   7425  C C   . ASP E 1 45  ? 54.900  8.805   12.167  1.00 43.24  ? 45  ASP E C   1 
ATOM   7426  O O   . ASP E 1 45  ? 54.646  7.907   11.372  1.00 48.25  ? 45  ASP E O   1 
ATOM   7427  C CB  . ASP E 1 45  ? 57.036  8.546   13.474  1.00 49.15  ? 45  ASP E CB  1 
ATOM   7428  C CG  . ASP E 1 45  ? 58.484  8.987   13.676  1.00 55.19  ? 45  ASP E CG  1 
ATOM   7429  O OD1 . ASP E 1 45  ? 59.306  8.814   12.750  1.00 49.85  ? 45  ASP E OD1 1 
ATOM   7430  O OD2 . ASP E 1 45  ? 58.796  9.510   14.762  1.00 48.83  ? 45  ASP E OD2 1 
ATOM   7431  N N   . GLU E 1 46  ? 53.967  9.368   12.926  1.00 51.64  ? 46  GLU E N   1 
ATOM   7432  C CA  . GLU E 1 46  ? 52.559  8.982   12.843  1.00 45.42  ? 46  GLU E CA  1 
ATOM   7433  C C   . GLU E 1 46  ? 51.675  10.168  13.144  1.00 52.78  ? 46  GLU E C   1 
ATOM   7434  O O   . GLU E 1 46  ? 52.144  11.231  13.550  1.00 51.91  ? 46  GLU E O   1 
ATOM   7435  C CB  . GLU E 1 46  ? 52.212  7.886   13.847  1.00 57.35  ? 46  GLU E CB  1 
ATOM   7436  C CG  . GLU E 1 46  ? 52.567  6.494   13.419  1.00 81.17  ? 46  GLU E CG  1 
ATOM   7437  C CD  . GLU E 1 46  ? 52.376  5.484   14.537  1.00 70.42  ? 46  GLU E CD  1 
ATOM   7438  O OE1 . GLU E 1 46  ? 51.245  5.369   15.059  1.00 58.93  ? 46  GLU E OE1 1 
ATOM   7439  O OE2 . GLU E 1 46  ? 53.365  4.803   14.887  1.00 67.11  ? 46  GLU E OE2 1 
ATOM   7440  N N   . LEU E 1 47  ? 50.380  9.981   12.959  1.00 49.92  ? 47  LEU E N   1 
ATOM   7441  C CA  . LEU E 1 47  ? 49.455  11.056  13.238  1.00 48.53  ? 47  LEU E CA  1 
ATOM   7442  C C   . LEU E 1 47  ? 48.261  10.533  14.020  1.00 55.57  ? 47  LEU E C   1 
ATOM   7443  O O   . LEU E 1 47  ? 47.893  9.362   13.925  1.00 52.36  ? 47  LEU E O   1 
ATOM   7444  C CB  . LEU E 1 47  ? 48.989  11.721  11.929  1.00 40.61  ? 47  LEU E CB  1 
ATOM   7445  C CG  . LEU E 1 47  ? 50.016  12.482  11.066  1.00 55.16  ? 47  LEU E CG  1 
ATOM   7446  C CD1 . LEU E 1 47  ? 49.342  13.003  9.794   1.00 53.49  ? 47  LEU E CD1 1 
ATOM   7447  C CD2 . LEU E 1 47  ? 50.606  13.646  11.846  1.00 44.13  ? 47  LEU E CD2 1 
ATOM   7448  N N   . VAL E 1 48  ? 47.686  11.409  14.828  1.00 49.98  ? 48  VAL E N   1 
ATOM   7449  C CA  . VAL E 1 48  ? 46.509  11.072  15.597  1.00 49.76  ? 48  VAL E CA  1 
ATOM   7450  C C   . VAL E 1 48  ? 45.562  12.258  15.421  1.00 49.11  ? 48  VAL E C   1 
ATOM   7451  O O   . VAL E 1 48  ? 45.927  13.405  15.680  1.00 59.27  ? 48  VAL E O   1 
ATOM   7452  C CB  . VAL E 1 48  ? 46.816  10.891  17.099  1.00 52.56  ? 48  VAL E CB  1 
ATOM   7453  C CG1 . VAL E 1 48  ? 45.560  10.455  17.824  1.00 59.23  ? 48  VAL E CG1 1 
ATOM   7454  C CG2 . VAL E 1 48  ? 47.908  9.870   17.303  1.00 51.89  ? 48  VAL E CG2 1 
ATOM   7455  N N   . PHE E 1 49  ? 44.358  11.973  14.947  1.00 61.02  ? 49  PHE E N   1 
ATOM   7456  C CA  . PHE E 1 49  ? 43.338  12.985  14.737  1.00 38.04  ? 49  PHE E CA  1 
ATOM   7457  C C   . PHE E 1 49  ? 42.253  12.832  15.803  1.00 63.28  ? 49  PHE E C   1 
ATOM   7458  O O   . PHE E 1 49  ? 41.576  11.803  15.855  1.00 51.29  ? 49  PHE E O   1 
ATOM   7459  C CB  . PHE E 1 49  ? 42.697  12.798  13.369  1.00 37.51  ? 49  PHE E CB  1 
ATOM   7460  C CG  . PHE E 1 49  ? 43.615  13.064  12.215  1.00 59.44  ? 49  PHE E CG  1 
ATOM   7461  C CD1 . PHE E 1 49  ? 43.902  14.364  11.820  1.00 74.71  ? 49  PHE E CD1 1 
ATOM   7462  C CD2 . PHE E 1 49  ? 44.144  12.015  11.477  1.00 55.92  ? 49  PHE E CD2 1 
ATOM   7463  C CE1 . PHE E 1 49  ? 44.702  14.605  10.694  1.00 67.57  ? 49  PHE E CE1 1 
ATOM   7464  C CE2 . PHE E 1 49  ? 44.937  12.251  10.364  1.00 56.62  ? 49  PHE E CE2 1 
ATOM   7465  C CZ  . PHE E 1 49  ? 45.215  13.539  9.971   1.00 43.63  ? 49  PHE E CZ  1 
ATOM   7466  N N   . LEU E 1 50  ? 42.094  13.842  16.658  1.00 63.25  ? 50  LEU E N   1 
ATOM   7467  C CA  . LEU E 1 50  ? 41.058  13.804  17.690  1.00 59.06  ? 50  LEU E CA  1 
ATOM   7468  C C   . LEU E 1 50  ? 39.950  14.799  17.328  1.00 71.75  ? 50  LEU E C   1 
ATOM   7469  O O   . LEU E 1 50  ? 40.137  16.016  17.455  1.00 55.46  ? 50  LEU E O   1 
ATOM   7470  C CB  . LEU E 1 50  ? 41.637  14.149  19.069  1.00 75.75  ? 50  LEU E CB  1 
ATOM   7471  C CG  . LEU E 1 50  ? 42.351  13.049  19.874  1.00 79.27  ? 50  LEU E CG  1 
ATOM   7472  C CD1 . LEU E 1 50  ? 41.496  11.772  19.878  1.00 78.71  ? 50  LEU E CD1 1 
ATOM   7473  C CD2 . LEU E 1 50  ? 43.712  12.761  19.271  1.00 87.16  ? 50  LEU E CD2 1 
ATOM   7474  N N   . ASP E 1 51  ? 38.804  14.276  16.885  1.00 53.61  ? 51  ASP E N   1 
ATOM   7475  C CA  . ASP E 1 51  ? 37.668  15.107  16.474  1.00 64.36  ? 51  ASP E CA  1 
ATOM   7476  C C   . ASP E 1 51  ? 36.664  15.498  17.565  1.00 73.45  ? 51  ASP E C   1 
ATOM   7477  O O   . ASP E 1 51  ? 36.499  14.783  18.565  1.00 79.61  ? 51  ASP E O   1 
ATOM   7478  C CB  . ASP E 1 51  ? 36.922  14.412  15.319  1.00 73.05  ? 51  ASP E CB  1 
ATOM   7479  C CG  . ASP E 1 51  ? 35.514  14.940  15.125  1.00 70.75  ? 51  ASP E CG  1 
ATOM   7480  O OD1 . ASP E 1 51  ? 34.676  14.666  16.005  1.00 76.08  ? 51  ASP E OD1 1 
ATOM   7481  O OD2 . ASP E 1 51  ? 35.244  15.629  14.109  1.00 67.67  ? 51  ASP E OD2 1 
ATOM   7482  N N   . ILE E 1 52  ? 36.008  16.645  17.374  1.00 63.72  ? 52  ILE E N   1 
ATOM   7483  C CA  . ILE E 1 52  ? 34.988  17.112  18.313  1.00 75.19  ? 52  ILE E CA  1 
ATOM   7484  C C   . ILE E 1 52  ? 33.949  18.004  17.653  1.00 69.01  ? 52  ILE E C   1 
ATOM   7485  O O   . ILE E 1 52  ? 33.821  19.183  17.989  1.00 72.21  ? 52  ILE E O   1 
ATOM   7486  C CB  . ILE E 1 52  ? 35.568  17.898  19.517  1.00 75.51  ? 52  ILE E CB  1 
ATOM   7487  C CG1 . ILE E 1 52  ? 36.536  18.972  19.010  1.00 71.25  ? 52  ILE E CG1 1 
ATOM   7488  C CG2 . ILE E 1 52  ? 36.173  16.925  20.540  1.00 67.69  ? 52  ILE E CG2 1 
ATOM   7489  C CD1 . ILE E 1 52  ? 36.874  20.023  20.038  1.00 61.35  ? 52  ILE E CD1 1 
ATOM   7490  N N   . THR E 1 53  ? 33.200  17.435  16.717  1.00 86.38  ? 53  THR E N   1 
ATOM   7491  C CA  . THR E 1 53  ? 32.154  18.188  16.027  1.00 103.15 ? 53  THR E CA  1 
ATOM   7492  C C   . THR E 1 53  ? 31.038  18.491  17.038  1.00 103.15 ? 53  THR E C   1 
ATOM   7493  O O   . THR E 1 53  ? 31.261  18.407  18.261  1.00 103.15 ? 53  THR E O   1 
ATOM   7494  C CB  . THR E 1 53  ? 31.573  17.370  14.851  1.00 103.15 ? 53  THR E CB  1 
ATOM   7495  O OG1 . THR E 1 53  ? 32.641  16.957  13.981  1.00 103.15 ? 53  THR E OG1 1 
ATOM   7496  C CG2 . THR E 1 53  ? 30.570  18.212  14.060  1.00 103.15 ? 53  THR E CG2 1 
ATOM   7497  N N   . ALA E 1 54  ? 29.854  18.861  16.546  1.00 98.66  ? 54  ALA E N   1 
ATOM   7498  C CA  . ALA E 1 54  ? 28.727  19.124  17.431  1.00 96.60  ? 54  ALA E CA  1 
ATOM   7499  C C   . ALA E 1 54  ? 28.051  17.766  17.640  1.00 94.37  ? 54  ALA E C   1 
ATOM   7500  O O   . ALA E 1 54  ? 26.820  17.667  17.796  1.00 97.70  ? 54  ALA E O   1 
ATOM   7501  C CB  . ALA E 1 54  ? 27.752  20.132  16.791  1.00 96.35  ? 54  ALA E CB  1 
ATOM   7502  N N   . SER E 1 55  ? 28.883  16.725  17.633  1.00 87.92  ? 55  SER E N   1 
ATOM   7503  C CA  . SER E 1 55  ? 28.460  15.337  17.820  1.00 90.13  ? 55  SER E CA  1 
ATOM   7504  C C   . SER E 1 55  ? 27.289  14.897  16.942  1.00 85.52  ? 55  SER E C   1 
ATOM   7505  O O   . SER E 1 55  ? 26.951  13.707  16.893  1.00 78.21  ? 55  SER E O   1 
ATOM   7506  C CB  . SER E 1 55  ? 28.146  15.072  19.301  1.00 99.25  ? 55  SER E CB  1 
ATOM   7507  O OG  . SER E 1 55  ? 29.332  15.155  20.095  1.00 102.85 ? 55  SER E OG  1 
ATOM   7508  N N   . VAL E 1 56  ? 26.672  15.846  16.244  1.00 70.30  ? 56  VAL E N   1 
ATOM   7509  C CA  . VAL E 1 56  ? 25.559  15.517  15.361  1.00 83.56  ? 56  VAL E CA  1 
ATOM   7510  C C   . VAL E 1 56  ? 26.132  15.452  13.952  1.00 82.17  ? 56  VAL E C   1 
ATOM   7511  O O   . VAL E 1 56  ? 25.417  15.235  12.979  1.00 71.70  ? 56  VAL E O   1 
ATOM   7512  C CB  . VAL E 1 56  ? 24.456  16.600  15.388  1.00 80.73  ? 56  VAL E CB  1 
ATOM   7513  C CG1 . VAL E 1 56  ? 23.867  16.730  16.794  1.00 84.35  ? 56  VAL E CG1 1 
ATOM   7514  C CG2 . VAL E 1 56  ? 25.034  17.924  14.907  1.00 88.45  ? 56  VAL E CG2 1 
ATOM   7515  N N   . GLU E 1 57  ? 27.442  15.640  13.868  1.00 87.88  ? 57  GLU E N   1 
ATOM   7516  C CA  . GLU E 1 57  ? 28.142  15.623  12.596  1.00 91.40  ? 57  GLU E CA  1 
ATOM   7517  C C   . GLU E 1 57  ? 29.464  14.905  12.787  1.00 85.74  ? 57  GLU E C   1 
ATOM   7518  O O   . GLU E 1 57  ? 30.232  14.720  11.837  1.00 75.76  ? 57  GLU E O   1 
ATOM   7519  C CB  . GLU E 1 57  ? 28.370  17.060  12.145  1.00 103.15 ? 57  GLU E CB  1 
ATOM   7520  C CG  . GLU E 1 57  ? 27.088  17.880  12.204  1.00 99.19  ? 57  GLU E CG  1 
ATOM   7521  C CD  . GLU E 1 57  ? 26.055  17.381  11.210  1.00 98.12  ? 57  GLU E CD  1 
ATOM   7522  O OE1 . GLU E 1 57  ? 25.935  16.146  11.055  1.00 76.77  ? 57  GLU E OE1 1 
ATOM   7523  O OE2 . GLU E 1 57  ? 25.366  18.224  10.586  1.00 101.56 ? 57  GLU E OE2 1 
ATOM   7524  N N   . LYS E 1 58  ? 29.713  14.515  14.038  1.00 77.05  ? 58  LYS E N   1 
ATOM   7525  C CA  . LYS E 1 58  ? 30.920  13.797  14.417  1.00 76.29  ? 58  LYS E CA  1 
ATOM   7526  C C   . LYS E 1 58  ? 31.101  12.597  13.489  1.00 83.73  ? 58  LYS E C   1 
ATOM   7527  O O   . LYS E 1 58  ? 32.166  12.420  12.894  1.00 82.42  ? 58  LYS E O   1 
ATOM   7528  C CB  . LYS E 1 58  ? 30.798  13.329  15.867  1.00 73.31  ? 58  LYS E CB  1 
ATOM   7529  C CG  . LYS E 1 58  ? 32.018  12.593  16.405  1.00 80.56  ? 58  LYS E CG  1 
ATOM   7530  C CD  . LYS E 1 58  ? 31.858  12.271  17.889  1.00 81.11  ? 58  LYS E CD  1 
ATOM   7531  C CE  . LYS E 1 58  ? 31.637  13.537  18.695  1.00 78.69  ? 58  LYS E CE  1 
ATOM   7532  N NZ  . LYS E 1 58  ? 31.577  13.293  20.169  1.00 90.43  ? 58  LYS E NZ  1 
ATOM   7533  N N   . ARG E 1 59  ? 30.047  11.794  13.351  1.00 74.81  ? 59  ARG E N   1 
ATOM   7534  C CA  . ARG E 1 59  ? 30.079  10.610  12.504  1.00 62.33  ? 59  ARG E CA  1 
ATOM   7535  C C   . ARG E 1 59  ? 30.389  10.909  11.044  1.00 71.17  ? 59  ARG E C   1 
ATOM   7536  O O   . ARG E 1 59  ? 31.346  10.371  10.493  1.00 72.90  ? 59  ARG E O   1 
ATOM   7537  C CB  . ARG E 1 59  ? 28.736  9.893   12.547  1.00 77.20  ? 59  ARG E CB  1 
ATOM   7538  C CG  . ARG E 1 59  ? 28.841  8.396   12.426  1.00 57.64  ? 59  ARG E CG  1 
ATOM   7539  C CD  . ARG E 1 59  ? 29.126  7.806   13.794  1.00 65.54  ? 59  ARG E CD  1 
ATOM   7540  N NE  . ARG E 1 59  ? 28.947  6.356   13.826  1.00 87.47  ? 59  ARG E NE  1 
ATOM   7541  C CZ  . ARG E 1 59  ? 27.879  5.720   13.341  1.00 93.64  ? 59  ARG E CZ  1 
ATOM   7542  N NH1 . ARG E 1 59  ? 26.890  6.405   12.775  1.00 82.78  ? 59  ARG E NH1 1 
ATOM   7543  N NH2 . ARG E 1 59  ? 27.790  4.396   13.443  1.00 89.60  ? 59  ARG E NH2 1 
ATOM   7544  N N   . LYS E 1 60  ? 29.563  11.749  10.416  1.00 64.91  ? 60  LYS E N   1 
ATOM   7545  C CA  . LYS E 1 60  ? 29.734  12.080  9.002   1.00 55.23  ? 60  LYS E CA  1 
ATOM   7546  C C   . LYS E 1 60  ? 31.013  12.831  8.698   1.00 62.91  ? 60  LYS E C   1 
ATOM   7547  O O   . LYS E 1 60  ? 31.637  12.586  7.666   1.00 69.34  ? 60  LYS E O   1 
ATOM   7548  C CB  . LYS E 1 60  ? 28.547  12.884  8.498   1.00 66.59  ? 60  LYS E CB  1 
ATOM   7549  N N   . THR E 1 61  ? 31.394  13.750  9.583   1.00 55.94  ? 61  THR E N   1 
ATOM   7550  C CA  . THR E 1 61  ? 32.602  14.544  9.394   1.00 56.28  ? 61  THR E CA  1 
ATOM   7551  C C   . THR E 1 61  ? 33.878  13.701  9.552   1.00 61.49  ? 61  THR E C   1 
ATOM   7552  O O   . THR E 1 61  ? 34.808  13.845  8.759   1.00 66.62  ? 61  THR E O   1 
ATOM   7553  C CB  . THR E 1 61  ? 32.648  15.739  10.384  1.00 48.35  ? 61  THR E CB  1 
ATOM   7554  O OG1 . THR E 1 61  ? 33.247  16.869  9.741   1.00 52.22  ? 61  THR E OG1 1 
ATOM   7555  C CG2 . THR E 1 61  ? 33.486  15.394  11.619  1.00 69.76  ? 61  THR E CG2 1 
ATOM   7556  N N   . MET E 1 62  ? 33.919  12.824  10.562  1.00 66.13  ? 62  MET E N   1 
ATOM   7557  C CA  . MET E 1 62  ? 35.094  11.964  10.793  1.00 54.58  ? 62  MET E CA  1 
ATOM   7558  C C   . MET E 1 62  ? 35.379  11.156  9.547   1.00 52.17  ? 62  MET E C   1 
ATOM   7559  O O   . MET E 1 62  ? 36.455  11.260  8.964   1.00 55.15  ? 62  MET E O   1 
ATOM   7560  C CB  . MET E 1 62  ? 34.868  11.005  11.969  1.00 49.01  ? 62  MET E CB  1 
ATOM   7561  C CG  . MET E 1 62  ? 35.008  11.649  13.347  1.00 85.24  ? 62  MET E CG  1 
ATOM   7562  S SD  . MET E 1 62  ? 34.101  10.744  14.661  1.00 89.87  ? 62  MET E SD  1 
ATOM   7563  C CE  . MET E 1 62  ? 35.291  9.397   15.010  1.00 86.67  ? 62  MET E CE  1 
ATOM   7564  N N   . LEU E 1 63  ? 34.398  10.355  9.145   1.00 45.26  ? 63  LEU E N   1 
ATOM   7565  C CA  . LEU E 1 63  ? 34.513  9.525   7.953   1.00 58.74  ? 63  LEU E CA  1 
ATOM   7566  C C   . LEU E 1 63  ? 34.975  10.313  6.722   1.00 57.48  ? 63  LEU E C   1 
ATOM   7567  O O   . LEU E 1 63  ? 35.776  9.817   5.930   1.00 62.44  ? 63  LEU E O   1 
ATOM   7568  C CB  . LEU E 1 63  ? 33.165  8.857   7.658   1.00 56.51  ? 63  LEU E CB  1 
ATOM   7569  C CG  . LEU E 1 63  ? 32.841  7.613   8.484   1.00 67.65  ? 63  LEU E CG  1 
ATOM   7570  C CD1 . LEU E 1 63  ? 31.343  7.347   8.514   1.00 62.50  ? 63  LEU E CD1 1 
ATOM   7571  C CD2 . LEU E 1 63  ? 33.593  6.439   7.895   1.00 51.92  ? 63  LEU E CD2 1 
ATOM   7572  N N   . GLU E 1 64  ? 34.472  11.537  6.563   1.00 73.66  ? 64  GLU E N   1 
ATOM   7573  C CA  . GLU E 1 64  ? 34.838  12.363  5.408   1.00 59.84  ? 64  GLU E CA  1 
ATOM   7574  C C   . GLU E 1 64  ? 36.283  12.766  5.559   1.00 45.24  ? 64  GLU E C   1 
ATOM   7575  O O   . GLU E 1 64  ? 37.038  12.763  4.595   1.00 41.07  ? 64  GLU E O   1 
ATOM   7576  C CB  . GLU E 1 64  ? 33.950  13.619  5.320   1.00 80.24  ? 64  GLU E CB  1 
ATOM   7577  C CG  . GLU E 1 64  ? 33.959  14.292  3.942   1.00 83.44  ? 64  GLU E CG  1 
ATOM   7578  C CD  . GLU E 1 64  ? 32.913  15.410  3.788   1.00 100.19 ? 64  GLU E CD  1 
ATOM   7579  O OE1 . GLU E 1 64  ? 31.793  15.296  4.353   1.00 75.76  ? 64  GLU E OE1 1 
ATOM   7580  O OE2 . GLU E 1 64  ? 33.208  16.398  3.077   1.00 87.08  ? 64  GLU E OE2 1 
ATOM   7581  N N   . LEU E 1 65  ? 36.658  13.112  6.788   1.00 60.96  ? 65  LEU E N   1 
ATOM   7582  C CA  . LEU E 1 65  ? 38.027  13.502  7.094   1.00 57.99  ? 65  LEU E CA  1 
ATOM   7583  C C   . LEU E 1 65  ? 38.969  12.309  6.891   1.00 67.21  ? 65  LEU E C   1 
ATOM   7584  O O   . LEU E 1 65  ? 40.065  12.466  6.353   1.00 71.59  ? 65  LEU E O   1 
ATOM   7585  C CB  . LEU E 1 65  ? 38.120  14.016  8.531   1.00 57.63  ? 65  LEU E CB  1 
ATOM   7586  C CG  . LEU E 1 65  ? 39.498  14.393  9.092   1.00 51.85  ? 65  LEU E CG  1 
ATOM   7587  C CD1 . LEU E 1 65  ? 39.333  15.431  10.183  1.00 67.35  ? 65  LEU E CD1 1 
ATOM   7588  C CD2 . LEU E 1 65  ? 40.201  13.161  9.645   1.00 65.14  ? 65  LEU E CD2 1 
ATOM   7589  N N   . VAL E 1 66  ? 38.544  11.112  7.292   1.00 58.75  ? 66  VAL E N   1 
ATOM   7590  C CA  . VAL E 1 66  ? 39.400  9.937   7.113   1.00 64.64  ? 66  VAL E CA  1 
ATOM   7591  C C   . VAL E 1 66  ? 39.609  9.613   5.634   1.00 61.93  ? 66  VAL E C   1 
ATOM   7592  O O   . VAL E 1 66  ? 40.725  9.337   5.194   1.00 47.70  ? 66  VAL E O   1 
ATOM   7593  C CB  . VAL E 1 66  ? 38.828  8.686   7.835   1.00 63.25  ? 66  VAL E CB  1 
ATOM   7594  C CG1 . VAL E 1 66  ? 39.476  7.407   7.289   1.00 58.38  ? 66  VAL E CG1 1 
ATOM   7595  C CG2 . VAL E 1 66  ? 39.110  8.789   9.314   1.00 38.81  ? 66  VAL E CG2 1 
ATOM   7596  N N   . GLU E 1 67  ? 38.534  9.651   4.861   1.00 61.94  ? 67  GLU E N   1 
ATOM   7597  C CA  . GLU E 1 67  ? 38.675  9.358   3.457   1.00 52.79  ? 67  GLU E CA  1 
ATOM   7598  C C   . GLU E 1 67  ? 39.450  10.479  2.761   1.00 62.35  ? 67  GLU E C   1 
ATOM   7599  O O   . GLU E 1 67  ? 39.953  10.309  1.652   1.00 57.98  ? 67  GLU E O   1 
ATOM   7600  C CB  . GLU E 1 67  ? 37.305  9.149   2.827   1.00 56.80  ? 67  GLU E CB  1 
ATOM   7601  C CG  . GLU E 1 67  ? 37.381  8.338   1.550   1.00 81.78  ? 67  GLU E CG  1 
ATOM   7602  C CD  . GLU E 1 67  ? 37.017  9.156   0.333   1.00 94.76  ? 67  GLU E CD  1 
ATOM   7603  O OE1 . GLU E 1 67  ? 37.583  8.894   -0.758  1.00 91.54  ? 67  GLU E OE1 1 
ATOM   7604  O OE2 . GLU E 1 67  ? 36.153  10.054  0.471   1.00 81.28  ? 67  GLU E OE2 1 
ATOM   7605  N N   . LYS E 1 68  ? 39.572  11.625  3.419   1.00 61.39  ? 68  LYS E N   1 
ATOM   7606  C CA  . LYS E 1 68  ? 40.320  12.723  2.817   1.00 63.84  ? 68  LYS E CA  1 
ATOM   7607  C C   . LYS E 1 68  ? 41.797  12.596  3.115   1.00 44.51  ? 68  LYS E C   1 
ATOM   7608  O O   . LYS E 1 68  ? 42.643  12.895  2.273   1.00 56.47  ? 68  LYS E O   1 
ATOM   7609  C CB  . LYS E 1 68  ? 39.797  14.077  3.297   1.00 50.89  ? 68  LYS E CB  1 
ATOM   7610  C CG  . LYS E 1 68  ? 38.690  14.612  2.417   1.00 57.27  ? 68  LYS E CG  1 
ATOM   7611  C CD  . LYS E 1 68  ? 39.161  14.650  0.965   1.00 92.41  ? 68  LYS E CD  1 
ATOM   7612  C CE  . LYS E 1 68  ? 38.026  14.987  -0.011  1.00 77.37  ? 68  LYS E CE  1 
ATOM   7613  N NZ  . LYS E 1 68  ? 38.351  14.533  -1.414  1.00 93.85  ? 68  LYS E NZ  1 
ATOM   7614  N N   . VAL E 1 69  ? 42.105  12.146  4.320   1.00 56.82  ? 69  VAL E N   1 
ATOM   7615  C CA  . VAL E 1 69  ? 43.490  11.963  4.725   1.00 52.58  ? 69  VAL E CA  1 
ATOM   7616  C C   . VAL E 1 69  ? 44.042  10.714  4.035   1.00 55.02  ? 69  VAL E C   1 
ATOM   7617  O O   . VAL E 1 69  ? 45.115  10.738  3.416   1.00 50.15  ? 69  VAL E O   1 
ATOM   7618  C CB  . VAL E 1 69  ? 43.580  11.809  6.255   1.00 43.06  ? 69  VAL E CB  1 
ATOM   7619  C CG1 . VAL E 1 69  ? 44.996  11.490  6.682   1.00 54.32  ? 69  VAL E CG1 1 
ATOM   7620  C CG2 . VAL E 1 69  ? 43.124  13.088  6.917   1.00 40.34  ? 69  VAL E CG2 1 
ATOM   7621  N N   . ALA E 1 70  ? 43.265  9.639   4.113   1.00 57.17  ? 70  ALA E N   1 
ATOM   7622  C CA  . ALA E 1 70  ? 43.633  8.356   3.541   1.00 49.86  ? 70  ALA E CA  1 
ATOM   7623  C C   . ALA E 1 70  ? 44.039  8.384   2.078   1.00 44.75  ? 70  ALA E C   1 
ATOM   7624  O O   . ALA E 1 70  ? 44.835  7.551   1.655   1.00 58.35  ? 70  ALA E O   1 
ATOM   7625  C CB  . ALA E 1 70  ? 42.502  7.359   3.737   1.00 51.73  ? 70  ALA E CB  1 
ATOM   7626  N N   . GLU E 1 71  ? 43.509  9.319   1.295   1.00 54.98  ? 71  GLU E N   1 
ATOM   7627  C CA  . GLU E 1 71  ? 43.877  9.342   -0.115  1.00 52.34  ? 71  GLU E CA  1 
ATOM   7628  C C   . GLU E 1 71  ? 45.170  10.090  -0.418  1.00 45.83  ? 71  GLU E C   1 
ATOM   7629  O O   . GLU E 1 71  ? 45.701  9.967   -1.510  1.00 55.41  ? 71  GLU E O   1 
ATOM   7630  C CB  . GLU E 1 71  ? 42.718  9.881   -0.990  1.00 63.97  ? 71  GLU E CB  1 
ATOM   7631  C CG  . GLU E 1 71  ? 42.206  11.284  -0.671  1.00 77.71  ? 71  GLU E CG  1 
ATOM   7632  C CD  . GLU E 1 71  ? 40.995  11.705  -1.543  1.00 103.15 ? 71  GLU E CD  1 
ATOM   7633  O OE1 . GLU E 1 71  ? 39.954  10.990  -1.543  1.00 71.00  ? 71  GLU E OE1 1 
ATOM   7634  O OE2 . GLU E 1 71  ? 41.080  12.762  -2.223  1.00 84.57  ? 71  GLU E OE2 1 
ATOM   7635  N N   . GLN E 1 72  ? 45.694  10.837  0.549   1.00 57.85  ? 72  GLN E N   1 
ATOM   7636  C CA  . GLN E 1 72  ? 46.922  11.586  0.313   1.00 60.16  ? 72  GLN E CA  1 
ATOM   7637  C C   . GLN E 1 72  ? 48.097  11.407  1.277   1.00 60.04  ? 72  GLN E C   1 
ATOM   7638  O O   . GLN E 1 72  ? 49.211  11.799  0.937   1.00 62.08  ? 72  GLN E O   1 
ATOM   7639  C CB  . GLN E 1 72  ? 46.612  13.080  0.207   1.00 48.92  ? 72  GLN E CB  1 
ATOM   7640  C CG  . GLN E 1 72  ? 45.924  13.481  -1.085  1.00 64.16  ? 72  GLN E CG  1 
ATOM   7641  C CD  . GLN E 1 72  ? 46.233  14.923  -1.473  1.00 72.21  ? 72  GLN E CD  1 
ATOM   7642  O OE1 . GLN E 1 72  ? 45.553  15.860  -1.051  1.00 61.21  ? 72  GLN E OE1 1 
ATOM   7643  N NE2 . GLN E 1 72  ? 47.282  15.102  -2.269  1.00 63.59  ? 72  GLN E NE2 1 
ATOM   7644  N N   . ILE E 1 73  ? 47.883  10.843  2.465   1.00 51.72  ? 73  ILE E N   1 
ATOM   7645  C CA  . ILE E 1 73  ? 49.005  10.673  3.398   1.00 58.29  ? 73  ILE E CA  1 
ATOM   7646  C C   . ILE E 1 73  ? 49.851  9.422   3.142   1.00 44.59  ? 73  ILE E C   1 
ATOM   7647  O O   . ILE E 1 73  ? 49.340  8.391   2.709   1.00 52.45  ? 73  ILE E O   1 
ATOM   7648  C CB  . ILE E 1 73  ? 48.538  10.650  4.872   1.00 49.52  ? 73  ILE E CB  1 
ATOM   7649  C CG1 . ILE E 1 73  ? 47.313  9.749   5.030   1.00 64.92  ? 73  ILE E CG1 1 
ATOM   7650  C CG2 . ILE E 1 73  ? 48.246  12.051  5.341   1.00 73.90  ? 73  ILE E CG2 1 
ATOM   7651  C CD1 . ILE E 1 73  ? 47.595  8.274   4.845   1.00 58.79  ? 73  ILE E CD1 1 
ATOM   7652  N N   . ASP E 1 74  ? 51.153  9.524   3.393   1.00 42.39  ? 74  ASP E N   1 
ATOM   7653  C CA  . ASP E 1 74  ? 52.033  8.388   3.192   1.00 44.14  ? 74  ASP E CA  1 
ATOM   7654  C C   . ASP E 1 74  ? 52.548  7.772   4.500   1.00 39.22  ? 74  ASP E C   1 
ATOM   7655  O O   . ASP E 1 74  ? 53.393  6.892   4.470   1.00 54.71  ? 74  ASP E O   1 
ATOM   7656  C CB  . ASP E 1 74  ? 53.197  8.768   2.270   1.00 44.16  ? 74  ASP E CB  1 
ATOM   7657  C CG  . ASP E 1 74  ? 53.918  10.027  2.719   1.00 59.75  ? 74  ASP E CG  1 
ATOM   7658  O OD1 . ASP E 1 74  ? 53.554  10.583  3.785   1.00 59.37  ? 74  ASP E OD1 1 
ATOM   7659  O OD2 . ASP E 1 74  ? 54.849  10.461  2.001   1.00 64.63  ? 74  ASP E OD2 1 
ATOM   7660  N N   . ILE E 1 75  ? 52.029  8.238   5.635   1.00 45.79  ? 75  ILE E N   1 
ATOM   7661  C CA  . ILE E 1 75  ? 52.399  7.716   6.951   1.00 36.70  ? 75  ILE E CA  1 
ATOM   7662  C C   . ILE E 1 75  ? 51.131  7.303   7.697   1.00 44.76  ? 75  ILE E C   1 
ATOM   7663  O O   . ILE E 1 75  ? 50.041  7.764   7.391   1.00 43.67  ? 75  ILE E O   1 
ATOM   7664  C CB  . ILE E 1 75  ? 53.124  8.761   7.844   1.00 58.52  ? 75  ILE E CB  1 
ATOM   7665  C CG1 . ILE E 1 75  ? 52.270  10.033  7.960   1.00 51.46  ? 75  ILE E CG1 1 
ATOM   7666  C CG2 . ILE E 1 75  ? 54.506  9.045   7.313   1.00 45.56  ? 75  ILE E CG2 1 
ATOM   7667  C CD1 . ILE E 1 75  ? 52.704  10.964  9.072   1.00 46.04  ? 75  ILE E CD1 1 
ATOM   7668  N N   . PRO E 1 76  ? 51.268  6.433   8.702   1.00 43.93  ? 76  PRO E N   1 
ATOM   7669  C CA  . PRO E 1 76  ? 50.148  5.942   9.509   1.00 45.84  ? 76  PRO E CA  1 
ATOM   7670  C C   . PRO E 1 76  ? 49.466  6.987   10.371  1.00 31.21  ? 76  PRO E C   1 
ATOM   7671  O O   . PRO E 1 76  ? 50.115  7.844   10.948  1.00 46.65  ? 76  PRO E O   1 
ATOM   7672  C CB  . PRO E 1 76  ? 50.794  4.851   10.352  1.00 39.52  ? 76  PRO E CB  1 
ATOM   7673  C CG  . PRO E 1 76  ? 51.869  4.343   9.450   1.00 50.24  ? 76  PRO E CG  1 
ATOM   7674  C CD  . PRO E 1 76  ? 52.465  5.613   8.939   1.00 53.14  ? 76  PRO E CD  1 
ATOM   7675  N N   . PHE E 1 77  ? 48.151  6.917   10.461  1.00 33.58  ? 77  PHE E N   1 
ATOM   7676  C CA  . PHE E 1 77  ? 47.427  7.860   11.298  1.00 45.57  ? 77  PHE E CA  1 
ATOM   7677  C C   . PHE E 1 77  ? 46.311  7.163   12.057  1.00 43.02  ? 77  PHE E C   1 
ATOM   7678  O O   . PHE E 1 77  ? 45.705  6.203   11.584  1.00 39.82  ? 77  PHE E O   1 
ATOM   7679  C CB  . PHE E 1 77  ? 46.855  9.029   10.470  1.00 58.80  ? 77  PHE E CB  1 
ATOM   7680  C CG  . PHE E 1 77  ? 45.779  8.627   9.504   1.00 43.25  ? 77  PHE E CG  1 
ATOM   7681  C CD1 . PHE E 1 77  ? 46.081  7.876   8.375   1.00 49.93  ? 77  PHE E CD1 1 
ATOM   7682  C CD2 . PHE E 1 77  ? 44.458  9.004   9.723   1.00 49.11  ? 77  PHE E CD2 1 
ATOM   7683  C CE1 . PHE E 1 77  ? 45.089  7.508   7.479   1.00 37.26  ? 77  PHE E CE1 1 
ATOM   7684  C CE2 . PHE E 1 77  ? 43.457  8.638   8.831   1.00 42.05  ? 77  PHE E CE2 1 
ATOM   7685  C CZ  . PHE E 1 77  ? 43.777  7.888   7.704   1.00 49.24  ? 77  PHE E CZ  1 
ATOM   7686  N N   . THR E 1 78  ? 46.053  7.664   13.250  1.00 48.36  ? 78  THR E N   1 
ATOM   7687  C CA  . THR E 1 78  ? 45.026  7.117   14.117  1.00 45.28  ? 78  THR E CA  1 
ATOM   7688  C C   . THR E 1 78  ? 43.925  8.160   14.235  1.00 57.08  ? 78  THR E C   1 
ATOM   7689  O O   . THR E 1 78  ? 44.200  9.354   14.159  1.00 52.42  ? 78  THR E O   1 
ATOM   7690  C CB  . THR E 1 78  ? 45.619  6.834   15.518  1.00 55.17  ? 78  THR E CB  1 
ATOM   7691  O OG1 . THR E 1 78  ? 46.679  5.875   15.396  1.00 47.74  ? 78  THR E OG1 1 
ATOM   7692  C CG2 . THR E 1 78  ? 44.561  6.319   16.467  1.00 32.85  ? 78  THR E CG2 1 
ATOM   7693  N N   . VAL E 1 79  ? 42.684  7.716   14.405  1.00 51.93  ? 79  VAL E N   1 
ATOM   7694  C CA  . VAL E 1 79  ? 41.571  8.642   14.561  1.00 57.56  ? 79  VAL E CA  1 
ATOM   7695  C C   . VAL E 1 79  ? 40.854  8.323   15.863  1.00 61.47  ? 79  VAL E C   1 
ATOM   7696  O O   . VAL E 1 79  ? 40.434  7.190   16.081  1.00 69.68  ? 79  VAL E O   1 
ATOM   7697  C CB  . VAL E 1 79  ? 40.581  8.553   13.375  1.00 58.01  ? 79  VAL E CB  1 
ATOM   7698  C CG1 . VAL E 1 79  ? 41.302  8.907   12.098  1.00 73.09  ? 79  VAL E CG1 1 
ATOM   7699  C CG2 . VAL E 1 79  ? 39.993  7.152   13.265  1.00 72.82  ? 79  VAL E CG2 1 
ATOM   7700  N N   . GLY E 1 80  ? 40.719  9.320   16.731  1.00 53.33  ? 80  GLY E N   1 
ATOM   7701  C CA  . GLY E 1 80  ? 40.062  9.085   18.000  1.00 67.97  ? 80  GLY E CA  1 
ATOM   7702  C C   . GLY E 1 80  ? 39.140  10.197  18.458  1.00 78.31  ? 80  GLY E C   1 
ATOM   7703  O O   . GLY E 1 80  ? 38.963  11.204  17.765  1.00 64.69  ? 80  GLY E O   1 
ATOM   7704  N N   . GLY E 1 81  ? 38.552  9.998   19.637  1.00 69.73  ? 81  GLY E N   1 
ATOM   7705  C CA  . GLY E 1 81  ? 37.641  10.977  20.203  1.00 72.27  ? 81  GLY E CA  1 
ATOM   7706  C C   . GLY E 1 81  ? 36.214  10.855  19.706  1.00 57.60  ? 81  GLY E C   1 
ATOM   7707  O O   . GLY E 1 81  ? 35.924  11.177  18.560  1.00 61.42  ? 81  GLY E O   1 
ATOM   7708  N N   . GLY E 1 82  ? 35.320  10.378  20.564  1.00 61.80  ? 82  GLY E N   1 
ATOM   7709  C CA  . GLY E 1 82  ? 33.923  10.255  20.175  1.00 66.43  ? 82  GLY E CA  1 
ATOM   7710  C C   . GLY E 1 82  ? 33.502  8.980   19.461  1.00 56.72  ? 82  GLY E C   1 
ATOM   7711  O O   . GLY E 1 82  ? 32.538  8.987   18.702  1.00 62.92  ? 82  GLY E O   1 
ATOM   7712  N N   . ILE E 1 83  ? 34.229  7.892   19.691  1.00 71.77  ? 83  ILE E N   1 
ATOM   7713  C CA  . ILE E 1 83  ? 33.908  6.593   19.097  1.00 75.84  ? 83  ILE E CA  1 
ATOM   7714  C C   . ILE E 1 83  ? 33.594  5.659   20.266  1.00 81.41  ? 83  ILE E C   1 
ATOM   7715  O O   . ILE E 1 83  ? 34.490  5.240   21.009  1.00 86.26  ? 83  ILE E O   1 
ATOM   7716  C CB  . ILE E 1 83  ? 35.094  6.007   18.309  1.00 63.53  ? 83  ILE E CB  1 
ATOM   7717  C CG1 . ILE E 1 83  ? 35.542  6.984   17.228  1.00 65.01  ? 83  ILE E CG1 1 
ATOM   7718  C CG2 . ILE E 1 83  ? 34.683  4.682   17.679  1.00 64.56  ? 83  ILE E CG2 1 
ATOM   7719  C CD1 . ILE E 1 83  ? 36.729  6.479   16.405  1.00 78.96  ? 83  ILE E CD1 1 
ATOM   7720  N N   . HIS E 1 84  ? 32.322  5.324   20.428  1.00 86.90  ? 84  HIS E N   1 
ATOM   7721  C CA  . HIS E 1 84  ? 31.913  4.476   21.546  1.00 87.42  ? 84  HIS E CA  1 
ATOM   7722  C C   . HIS E 1 84  ? 31.584  3.003   21.245  1.00 82.63  ? 84  HIS E C   1 
ATOM   7723  O O   . HIS E 1 84  ? 31.494  2.190   22.180  1.00 74.60  ? 84  HIS E O   1 
ATOM   7724  C CB  . HIS E 1 84  ? 30.706  5.118   22.229  1.00 70.29  ? 84  HIS E CB  1 
ATOM   7725  C CG  . HIS E 1 84  ? 30.780  6.608   22.292  1.00 68.72  ? 84  HIS E CG  1 
ATOM   7726  N ND1 . HIS E 1 84  ? 31.748  7.277   23.011  1.00 88.52  ? 84  HIS E ND1 1 
ATOM   7727  C CD2 . HIS E 1 84  ? 30.023  7.562   21.700  1.00 89.46  ? 84  HIS E CD2 1 
ATOM   7728  C CE1 . HIS E 1 84  ? 31.585  8.580   22.858  1.00 66.45  ? 84  HIS E CE1 1 
ATOM   7729  N NE2 . HIS E 1 84  ? 30.544  8.779   22.067  1.00 85.79  ? 84  HIS E NE2 1 
ATOM   7730  N N   . ASP E 1 85  ? 31.404  2.655   19.969  1.00 81.47  ? 85  ASP E N   1 
ATOM   7731  C CA  . ASP E 1 85  ? 31.035  1.277   19.611  1.00 85.17  ? 85  ASP E CA  1 
ATOM   7732  C C   . ASP E 1 85  ? 31.657  0.746   18.319  1.00 86.82  ? 85  ASP E C   1 
ATOM   7733  O O   . ASP E 1 85  ? 32.073  1.524   17.455  1.00 97.45  ? 85  ASP E O   1 
ATOM   7734  C CB  . ASP E 1 85  ? 29.522  1.183   19.494  1.00 53.17  ? 85  ASP E CB  1 
ATOM   7735  C CG  . ASP E 1 85  ? 28.939  2.330   18.691  1.00 75.52  ? 85  ASP E CG  1 
ATOM   7736  O OD1 . ASP E 1 85  ? 29.588  2.764   17.704  1.00 70.55  ? 85  ASP E OD1 1 
ATOM   7737  O OD2 . ASP E 1 85  ? 27.830  2.795   19.042  1.00 73.06  ? 85  ASP E OD2 1 
ATOM   7738  N N   . PHE E 1 86  ? 31.686  -0.584  18.191  1.00 80.02  ? 86  PHE E N   1 
ATOM   7739  C CA  . PHE E 1 86  ? 32.258  -1.266  17.023  1.00 66.79  ? 86  PHE E CA  1 
ATOM   7740  C C   . PHE E 1 86  ? 31.872  -0.700  15.652  1.00 66.42  ? 86  PHE E C   1 
ATOM   7741  O O   . PHE E 1 86  ? 32.723  -0.573  14.767  1.00 61.06  ? 86  PHE E O   1 
ATOM   7742  C CB  . PHE E 1 86  ? 31.887  -2.749  17.047  1.00 52.54  ? 86  PHE E CB  1 
ATOM   7743  C CG  . PHE E 1 86  ? 32.264  -3.489  15.784  1.00 75.35  ? 86  PHE E CG  1 
ATOM   7744  C CD1 . PHE E 1 86  ? 33.492  -4.144  15.679  1.00 66.32  ? 86  PHE E CD1 1 
ATOM   7745  C CD2 . PHE E 1 86  ? 31.411  -3.493  14.682  1.00 48.38  ? 86  PHE E CD2 1 
ATOM   7746  C CE1 . PHE E 1 86  ? 33.866  -4.787  14.497  1.00 59.26  ? 86  PHE E CE1 1 
ATOM   7747  C CE2 . PHE E 1 86  ? 31.782  -4.136  13.491  1.00 75.33  ? 86  PHE E CE2 1 
ATOM   7748  C CZ  . PHE E 1 86  ? 33.011  -4.782  13.402  1.00 56.00  ? 86  PHE E CZ  1 
ATOM   7749  N N   . GLU E 1 87  ? 30.593  -0.400  15.455  1.00 58.10  ? 87  GLU E N   1 
ATOM   7750  C CA  . GLU E 1 87  ? 30.157  0.133   14.171  1.00 54.32  ? 87  GLU E CA  1 
ATOM   7751  C C   . GLU E 1 87  ? 31.001  1.338   13.766  1.00 58.46  ? 87  GLU E C   1 
ATOM   7752  O O   . GLU E 1 87  ? 31.634  1.332   12.705  1.00 73.27  ? 87  GLU E O   1 
ATOM   7753  C CB  . GLU E 1 87  ? 28.672  0.534   14.217  1.00 87.48  ? 87  GLU E CB  1 
ATOM   7754  C CG  . GLU E 1 87  ? 27.674  -0.611  13.962  1.00 88.25  ? 87  GLU E CG  1 
ATOM   7755  C CD  . GLU E 1 87  ? 27.505  -1.537  15.160  1.00 98.01  ? 87  GLU E CD  1 
ATOM   7756  O OE1 . GLU E 1 87  ? 27.065  -1.043  16.223  1.00 98.49  ? 87  GLU E OE1 1 
ATOM   7757  O OE2 . GLU E 1 87  ? 27.812  -2.751  15.045  1.00 99.68  ? 87  GLU E OE2 1 
ATOM   7758  N N   . THR E 1 88  ? 31.019  2.366   14.613  1.00 71.13  ? 88  THR E N   1 
ATOM   7759  C CA  . THR E 1 88  ? 31.787  3.570   14.327  1.00 55.81  ? 88  THR E CA  1 
ATOM   7760  C C   . THR E 1 88  ? 33.273  3.263   14.197  1.00 65.02  ? 88  THR E C   1 
ATOM   7761  O O   . THR E 1 88  ? 33.969  3.901   13.412  1.00 63.10  ? 88  THR E O   1 
ATOM   7762  C CB  . THR E 1 88  ? 31.592  4.636   15.415  1.00 54.99  ? 88  THR E CB  1 
ATOM   7763  O OG1 . THR E 1 88  ? 30.192  4.848   15.624  1.00 64.81  ? 88  THR E OG1 1 
ATOM   7764  C CG2 . THR E 1 88  ? 32.226  5.955   14.984  1.00 53.99  ? 88  THR E CG2 1 
ATOM   7765  N N   . ALA E 1 89  ? 33.757  2.278   14.953  1.00 62.59  ? 89  ALA E N   1 
ATOM   7766  C CA  . ALA E 1 89  ? 35.170  1.889   14.902  1.00 41.65  ? 89  ALA E CA  1 
ATOM   7767  C C   . ALA E 1 89  ? 35.473  1.173   13.599  1.00 48.24  ? 89  ALA E C   1 
ATOM   7768  O O   . ALA E 1 89  ? 36.514  1.407   12.979  1.00 51.08  ? 89  ALA E O   1 
ATOM   7769  C CB  . ALA E 1 89  ? 35.522  0.987   16.084  1.00 44.75  ? 89  ALA E CB  1 
ATOM   7770  N N   . SER E 1 90  ? 34.558  0.298   13.194  1.00 49.02  ? 90  SER E N   1 
ATOM   7771  C CA  . SER E 1 90  ? 34.700  -0.465  11.957  1.00 61.54  ? 90  SER E CA  1 
ATOM   7772  C C   . SER E 1 90  ? 34.538  0.450   10.754  1.00 63.25  ? 90  SER E C   1 
ATOM   7773  O O   . SER E 1 90  ? 35.167  0.261   9.716   1.00 71.02  ? 90  SER E O   1 
ATOM   7774  C CB  . SER E 1 90  ? 33.644  -1.570  11.898  1.00 59.05  ? 90  SER E CB  1 
ATOM   7775  O OG  . SER E 1 90  ? 33.590  -2.139  10.607  1.00 57.18  ? 90  SER E OG  1 
ATOM   7776  N N   . GLU E 1 91  ? 33.687  1.452   10.916  1.00 70.23  ? 91  GLU E N   1 
ATOM   7777  C CA  . GLU E 1 91  ? 33.404  2.415   9.864   1.00 58.43  ? 91  GLU E CA  1 
ATOM   7778  C C   . GLU E 1 91  ? 34.640  3.219   9.469   1.00 61.40  ? 91  GLU E C   1 
ATOM   7779  O O   . GLU E 1 91  ? 34.908  3.418   8.285   1.00 61.12  ? 91  GLU E O   1 
ATOM   7780  C CB  . GLU E 1 91  ? 32.315  3.365   10.356  1.00 70.84  ? 91  GLU E CB  1 
ATOM   7781  C CG  . GLU E 1 91  ? 31.465  3.990   9.286   1.00 68.84  ? 91  GLU E CG  1 
ATOM   7782  C CD  . GLU E 1 91  ? 29.992  3.841   9.614   1.00 95.49  ? 91  GLU E CD  1 
ATOM   7783  O OE1 . GLU E 1 91  ? 29.469  2.713   9.427   1.00 91.62  ? 91  GLU E OE1 1 
ATOM   7784  O OE2 . GLU E 1 91  ? 29.365  4.833   10.072  1.00 69.57  ? 91  GLU E OE2 1 
ATOM   7785  N N   . LEU E 1 92  ? 35.385  3.692   10.464  1.00 58.04  ? 92  LEU E N   1 
ATOM   7786  C CA  . LEU E 1 92  ? 36.579  4.492   10.205  1.00 59.93  ? 92  LEU E CA  1 
ATOM   7787  C C   . LEU E 1 92  ? 37.763  3.686   9.684   1.00 52.58  ? 92  LEU E C   1 
ATOM   7788  O O   . LEU E 1 92  ? 38.557  4.192   8.892   1.00 56.60  ? 92  LEU E O   1 
ATOM   7789  C CB  . LEU E 1 92  ? 36.996  5.260   11.464  1.00 57.43  ? 92  LEU E CB  1 
ATOM   7790  C CG  . LEU E 1 92  ? 35.977  6.261   12.026  1.00 81.70  ? 92  LEU E CG  1 
ATOM   7791  C CD1 . LEU E 1 92  ? 36.707  7.241   12.938  1.00 94.00  ? 92  LEU E CD1 1 
ATOM   7792  C CD2 . LEU E 1 92  ? 35.283  7.028   10.892  1.00 80.57  ? 92  LEU E CD2 1 
ATOM   7793  N N   . ILE E 1 93  ? 37.892  2.439   10.121  1.00 50.70  ? 93  ILE E N   1 
ATOM   7794  C CA  . ILE E 1 93  ? 38.999  1.622   9.645   1.00 53.77  ? 93  ILE E CA  1 
ATOM   7795  C C   . ILE E 1 93  ? 38.774  1.241   8.190   1.00 50.17  ? 93  ILE E C   1 
ATOM   7796  O O   . ILE E 1 93  ? 39.678  1.338   7.375   1.00 55.74  ? 93  ILE E O   1 
ATOM   7797  C CB  . ILE E 1 93  ? 39.162  0.315   10.442  1.00 49.53  ? 93  ILE E CB  1 
ATOM   7798  C CG1 . ILE E 1 93  ? 39.271  0.602   11.938  1.00 64.73  ? 93  ILE E CG1 1 
ATOM   7799  C CG2 . ILE E 1 93  ? 40.431  -0.388  10.005  1.00 53.01  ? 93  ILE E CG2 1 
ATOM   7800  C CD1 . ILE E 1 93  ? 39.407  -0.670  12.794  1.00 74.50  ? 93  ILE E CD1 1 
ATOM   7801  N N   . LEU E 1 94  ? 37.559  0.815   7.866   1.00 53.47  ? 94  LEU E N   1 
ATOM   7802  C CA  . LEU E 1 94  ? 37.251  0.409   6.500   1.00 57.36  ? 94  LEU E CA  1 
ATOM   7803  C C   . LEU E 1 94  ? 37.361  1.558   5.521   1.00 62.31  ? 94  LEU E C   1 
ATOM   7804  O O   . LEU E 1 94  ? 37.588  1.349   4.330   1.00 64.72  ? 94  LEU E O   1 
ATOM   7805  C CB  . LEU E 1 94  ? 35.856  -0.214  6.430   1.00 55.72  ? 94  LEU E CB  1 
ATOM   7806  C CG  . LEU E 1 94  ? 35.782  -1.531  7.204   1.00 57.18  ? 94  LEU E CG  1 
ATOM   7807  C CD1 . LEU E 1 94  ? 34.476  -2.240  6.917   1.00 67.42  ? 94  LEU E CD1 1 
ATOM   7808  C CD2 . LEU E 1 94  ? 36.948  -2.414  6.783   1.00 54.62  ? 94  LEU E CD2 1 
ATOM   7809  N N   . ARG E 1 95  ? 37.219  2.772   6.039   1.00 70.39  ? 95  ARG E N   1 
ATOM   7810  C CA  . ARG E 1 95  ? 37.301  3.966   5.227   1.00 49.93  ? 95  ARG E CA  1 
ATOM   7811  C C   . ARG E 1 95  ? 38.749  4.359   4.959   1.00 47.58  ? 95  ARG E C   1 
ATOM   7812  O O   . ARG E 1 95  ? 39.019  5.114   4.033   1.00 56.24  ? 95  ARG E O   1 
ATOM   7813  C CB  . ARG E 1 95  ? 36.550  5.114   5.919   1.00 69.63  ? 95  ARG E CB  1 
ATOM   7814  C CG  . ARG E 1 95  ? 36.465  6.398   5.107   1.00 63.28  ? 95  ARG E CG  1 
ATOM   7815  C CD  . ARG E 1 95  ? 35.998  6.132   3.682   1.00 53.55  ? 95  ARG E CD  1 
ATOM   7816  N NE  . ARG E 1 95  ? 34.645  6.620   3.409   1.00 79.93  ? 95  ARG E NE  1 
ATOM   7817  C CZ  . ARG E 1 95  ? 33.547  6.166   4.006   1.00 78.65  ? 95  ARG E CZ  1 
ATOM   7818  N NH1 . ARG E 1 95  ? 33.641  5.210   4.923   1.00 84.48  ? 95  ARG E NH1 1 
ATOM   7819  N NH2 . ARG E 1 95  ? 32.357  6.654   3.671   1.00 59.81  ? 95  ARG E NH2 1 
ATOM   7820  N N   . GLY E 1 96  ? 39.684  3.855   5.758   1.00 48.24  ? 96  GLY E N   1 
ATOM   7821  C CA  . GLY E 1 96  ? 41.074  4.208   5.525   1.00 49.68  ? 96  GLY E CA  1 
ATOM   7822  C C   . GLY E 1 96  ? 41.981  4.462   6.719   1.00 45.64  ? 96  GLY E C   1 
ATOM   7823  O O   . GLY E 1 96  ? 43.198  4.525   6.554   1.00 54.21  ? 96  GLY E O   1 
ATOM   7824  N N   . ALA E 1 97  ? 41.423  4.614   7.913   1.00 40.12  ? 97  ALA E N   1 
ATOM   7825  C CA  . ALA E 1 97  ? 42.254  4.857   9.087   1.00 52.22  ? 97  ALA E CA  1 
ATOM   7826  C C   . ALA E 1 97  ? 43.024  3.589   9.502   1.00 51.30  ? 97  ALA E C   1 
ATOM   7827  O O   . ALA E 1 97  ? 42.474  2.497   9.500   1.00 58.91  ? 97  ALA E O   1 
ATOM   7828  C CB  . ALA E 1 97  ? 41.390  5.357   10.242  1.00 61.34  ? 97  ALA E CB  1 
ATOM   7829  N N   . ASP E 1 98  ? 44.299  3.747   9.847   1.00 57.70  ? 98  ASP E N   1 
ATOM   7830  C CA  . ASP E 1 98  ? 45.146  2.626   10.267  1.00 58.60  ? 98  ASP E CA  1 
ATOM   7831  C C   . ASP E 1 98  ? 44.781  2.089   11.647  1.00 53.48  ? 98  ASP E C   1 
ATOM   7832  O O   . ASP E 1 98  ? 44.791  0.882   11.875  1.00 45.12  ? 98  ASP E O   1 
ATOM   7833  C CB  . ASP E 1 98  ? 46.616  3.053   10.258  1.00 58.97  ? 98  ASP E CB  1 
ATOM   7834  C CG  . ASP E 1 98  ? 47.112  3.359   8.862   1.00 44.35  ? 98  ASP E CG  1 
ATOM   7835  O OD1 . ASP E 1 98  ? 47.065  2.442   8.021   1.00 62.85  ? 98  ASP E OD1 1 
ATOM   7836  O OD2 . ASP E 1 98  ? 47.538  4.501   8.601   1.00 53.46  ? 98  ASP E OD2 1 
ATOM   7837  N N   . LYS E 1 99  ? 44.467  2.996   12.563  1.00 56.60  ? 99  LYS E N   1 
ATOM   7838  C CA  . LYS E 1 99  ? 44.089  2.617   13.916  1.00 51.35  ? 99  LYS E CA  1 
ATOM   7839  C C   . LYS E 1 99  ? 42.931  3.510   14.371  1.00 60.57  ? 99  LYS E C   1 
ATOM   7840  O O   . LYS E 1 99  ? 42.599  4.494   13.702  1.00 53.90  ? 99  LYS E O   1 
ATOM   7841  C CB  . LYS E 1 99  ? 45.278  2.799   14.861  1.00 54.10  ? 99  LYS E CB  1 
ATOM   7842  C CG  . LYS E 1 99  ? 46.598  2.280   14.323  1.00 51.19  ? 99  LYS E CG  1 
ATOM   7843  C CD  . LYS E 1 99  ? 47.738  2.586   15.274  1.00 46.92  ? 99  LYS E CD  1 
ATOM   7844  C CE  . LYS E 1 99  ? 49.059  2.101   14.699  1.00 71.08  ? 99  LYS E CE  1 
ATOM   7845  N NZ  . LYS E 1 99  ? 50.243  2.326   15.595  1.00 70.63  ? 99  LYS E NZ  1 
ATOM   7846  N N   . VAL E 1 100 ? 42.303  3.149   15.489  1.00 52.98  ? 100 VAL E N   1 
ATOM   7847  C CA  . VAL E 1 100 ? 41.213  3.938   16.051  1.00 46.72  ? 100 VAL E CA  1 
ATOM   7848  C C   . VAL E 1 100 ? 41.568  4.076   17.510  1.00 58.00  ? 100 VAL E C   1 
ATOM   7849  O O   . VAL E 1 100 ? 42.253  3.212   18.067  1.00 61.71  ? 100 VAL E O   1 
ATOM   7850  C CB  . VAL E 1 100 ? 39.833  3.235   15.982  1.00 41.38  ? 100 VAL E CB  1 
ATOM   7851  C CG1 . VAL E 1 100 ? 39.606  2.652   14.611  1.00 58.29  ? 100 VAL E CG1 1 
ATOM   7852  C CG2 . VAL E 1 100 ? 39.729  2.166   17.057  1.00 49.14  ? 100 VAL E CG2 1 
ATOM   7853  N N   . SER E 1 101 ? 41.108  5.156   18.126  1.00 61.75  ? 101 SER E N   1 
ATOM   7854  C CA  . SER E 1 101 ? 41.369  5.393   19.532  1.00 58.02  ? 101 SER E CA  1 
ATOM   7855  C C   . SER E 1 101 ? 40.052  5.318   20.282  1.00 59.70  ? 101 SER E C   1 
ATOM   7856  O O   . SER E 1 101 ? 39.019  5.769   19.790  1.00 67.55  ? 101 SER E O   1 
ATOM   7857  C CB  . SER E 1 101 ? 42.005  6.770   19.727  1.00 77.48  ? 101 SER E CB  1 
ATOM   7858  O OG  . SER E 1 101 ? 42.566  6.890   21.025  1.00 84.59  ? 101 SER E OG  1 
ATOM   7859  N N   . ILE E 1 102 ? 40.097  4.728   21.470  1.00 74.13  ? 102 ILE E N   1 
ATOM   7860  C CA  . ILE E 1 102 ? 38.921  4.572   22.328  1.00 66.83  ? 102 ILE E CA  1 
ATOM   7861  C C   . ILE E 1 102 ? 39.345  4.851   23.779  1.00 67.03  ? 102 ILE E C   1 
ATOM   7862  O O   . ILE E 1 102 ? 40.495  4.590   24.160  1.00 70.79  ? 102 ILE E O   1 
ATOM   7863  C CB  . ILE E 1 102 ? 38.327  3.149   22.183  1.00 57.41  ? 102 ILE E CB  1 
ATOM   7864  C CG1 . ILE E 1 102 ? 39.388  2.093   22.511  1.00 61.47  ? 102 ILE E CG1 1 
ATOM   7865  C CG2 . ILE E 1 102 ? 37.806  2.957   20.766  1.00 50.62  ? 102 ILE E CG2 1 
ATOM   7866  C CD1 . ILE E 1 102 ? 38.929  0.662   22.304  1.00 56.34  ? 102 ILE E CD1 1 
ATOM   7867  N N   . ASN E 1 103 ? 38.430  5.387   24.584  1.00 66.47  ? 103 ASN E N   1 
ATOM   7868  C CA  . ASN E 1 103 ? 38.764  5.749   25.963  1.00 58.86  ? 103 ASN E CA  1 
ATOM   7869  C C   . ASN E 1 103 ? 37.595  5.591   26.928  1.00 72.82  ? 103 ASN E C   1 
ATOM   7870  O O   . ASN E 1 103 ? 37.525  4.623   27.696  1.00 84.78  ? 103 ASN E O   1 
ATOM   7871  C CB  . ASN E 1 103 ? 39.239  7.200   25.984  1.00 83.79  ? 103 ASN E CB  1 
ATOM   7872  C CG  . ASN E 1 103 ? 39.475  7.721   27.382  1.00 86.37  ? 103 ASN E CG  1 
ATOM   7873  O OD1 . ASN E 1 103 ? 39.457  8.934   27.610  1.00 100.80 ? 103 ASN E OD1 1 
ATOM   7874  N ND2 . ASN E 1 103 ? 39.711  6.814   28.327  1.00 94.55  ? 103 ASN E ND2 1 
ATOM   7875  N N   . THR E 1 104 ? 36.693  6.570   26.903  1.00 71.47  ? 104 THR E N   1 
ATOM   7876  C CA  . THR E 1 104 ? 35.511  6.557   27.748  1.00 57.47  ? 104 THR E CA  1 
ATOM   7877  C C   . THR E 1 104 ? 34.695  5.300   27.443  1.00 69.38  ? 104 THR E C   1 
ATOM   7878  O O   . THR E 1 104 ? 34.330  4.553   28.353  1.00 74.72  ? 104 THR E O   1 
ATOM   7879  C CB  . THR E 1 104 ? 34.659  7.834   27.507  1.00 64.90  ? 104 THR E CB  1 
ATOM   7880  O OG1 . THR E 1 104 ? 35.274  8.945   28.178  1.00 58.42  ? 104 THR E OG1 1 
ATOM   7881  C CG2 . THR E 1 104 ? 33.234  7.652   28.015  1.00 63.88  ? 104 THR E CG2 1 
ATOM   7882  N N   . ALA E 1 105 ? 34.430  5.049   26.165  1.00 65.96  ? 105 ALA E N   1 
ATOM   7883  C CA  . ALA E 1 105 ? 33.655  3.868   25.781  1.00 70.36  ? 105 ALA E CA  1 
ATOM   7884  C C   . ALA E 1 105 ? 34.364  2.558   26.148  1.00 57.84  ? 105 ALA E C   1 
ATOM   7885  O O   . ALA E 1 105 ? 33.709  1.583   26.496  1.00 64.20  ? 105 ALA E O   1 
ATOM   7886  C CB  . ALA E 1 105 ? 33.355  3.897   24.294  1.00 61.42  ? 105 ALA E CB  1 
ATOM   7887  N N   . ALA E 1 106 ? 35.691  2.531   26.073  1.00 59.10  ? 106 ALA E N   1 
ATOM   7888  C CA  . ALA E 1 106 ? 36.435  1.317   26.420  1.00 70.38  ? 106 ALA E CA  1 
ATOM   7889  C C   . ALA E 1 106 ? 36.286  1.013   27.914  1.00 77.34  ? 106 ALA E C   1 
ATOM   7890  O O   . ALA E 1 106 ? 35.938  -0.106  28.296  1.00 79.74  ? 106 ALA E O   1 
ATOM   7891  C CB  . ALA E 1 106 ? 37.895  1.476   26.066  1.00 82.12  ? 106 ALA E CB  1 
ATOM   7892  N N   . VAL E 1 107 ? 36.556  2.014   28.751  1.00 78.72  ? 107 VAL E N   1 
ATOM   7893  C CA  . VAL E 1 107 ? 36.419  1.881   30.203  1.00 70.55  ? 107 VAL E CA  1 
ATOM   7894  C C   . VAL E 1 107 ? 35.029  1.357   30.564  1.00 72.90  ? 107 VAL E C   1 
ATOM   7895  O O   . VAL E 1 107 ? 34.898  0.406   31.339  1.00 73.99  ? 107 VAL E O   1 
ATOM   7896  C CB  . VAL E 1 107 ? 36.588  3.241   30.932  1.00 65.55  ? 107 VAL E CB  1 
ATOM   7897  C CG1 . VAL E 1 107 ? 36.248  3.077   32.422  1.00 49.43  ? 107 VAL E CG1 1 
ATOM   7898  C CG2 . VAL E 1 107 ? 38.004  3.765   30.760  1.00 65.94  ? 107 VAL E CG2 1 
ATOM   7899  N N   . GLU E 1 108 ? 33.992  1.994   30.020  1.00 69.74  ? 108 GLU E N   1 
ATOM   7900  C CA  . GLU E 1 108 ? 32.626  1.575   30.314  1.00 75.92  ? 108 GLU E CA  1 
ATOM   7901  C C   . GLU E 1 108 ? 32.344  0.200   29.696  1.00 73.94  ? 108 GLU E C   1 
ATOM   7902  O O   . GLU E 1 108 ? 31.693  -0.640  30.319  1.00 86.87  ? 108 GLU E O   1 
ATOM   7903  C CB  . GLU E 1 108 ? 31.598  2.619   29.806  1.00 72.80  ? 108 GLU E CB  1 
ATOM   7904  C CG  . GLU E 1 108 ? 31.700  4.044   30.418  1.00 46.36  ? 108 GLU E CG  1 
ATOM   7905  C CD  . GLU E 1 108 ? 30.511  4.953   30.028  1.00 86.86  ? 108 GLU E CD  1 
ATOM   7906  O OE1 . GLU E 1 108 ? 30.105  4.955   28.837  1.00 92.04  ? 108 GLU E OE1 1 
ATOM   7907  O OE2 . GLU E 1 108 ? 29.975  5.676   30.903  1.00 87.75  ? 108 GLU E OE2 1 
ATOM   7908  N N   . ASN E 1 109 ? 32.842  -0.039  28.483  1.00 82.09  ? 109 ASN E N   1 
ATOM   7909  C CA  . ASN E 1 109 ? 32.627  -1.329  27.818  1.00 75.38  ? 109 ASN E CA  1 
ATOM   7910  C C   . ASN E 1 109 ? 33.932  -1.983  27.358  1.00 70.58  ? 109 ASN E C   1 
ATOM   7911  O O   . ASN E 1 109 ? 34.397  -1.773  26.240  1.00 76.37  ? 109 ASN E O   1 
ATOM   7912  C CB  . ASN E 1 109 ? 31.676  -1.160  26.624  1.00 77.15  ? 109 ASN E CB  1 
ATOM   7913  C CG  . ASN E 1 109 ? 31.173  -2.492  26.075  1.00 76.95  ? 109 ASN E CG  1 
ATOM   7914  O OD1 . ASN E 1 109 ? 30.261  -2.527  25.245  1.00 79.83  ? 109 ASN E OD1 1 
ATOM   7915  N ND2 . ASN E 1 109 ? 31.773  -3.595  26.533  1.00 73.45  ? 109 ASN E ND2 1 
ATOM   7916  N N   . PRO E 1 110 ? 34.549  -2.779  28.236  1.00 74.59  ? 110 PRO E N   1 
ATOM   7917  C CA  . PRO E 1 110 ? 35.800  -3.459  27.904  1.00 56.36  ? 110 PRO E CA  1 
ATOM   7918  C C   . PRO E 1 110 ? 35.692  -4.428  26.732  1.00 62.57  ? 110 PRO E C   1 
ATOM   7919  O O   . PRO E 1 110 ? 36.691  -4.751  26.089  1.00 75.79  ? 110 PRO E O   1 
ATOM   7920  C CB  . PRO E 1 110 ? 36.153  -4.159  29.209  1.00 76.91  ? 110 PRO E CB  1 
ATOM   7921  C CG  . PRO E 1 110 ? 35.683  -3.168  30.242  1.00 70.43  ? 110 PRO E CG  1 
ATOM   7922  C CD  . PRO E 1 110 ? 34.319  -2.789  29.694  1.00 63.35  ? 110 PRO E CD  1 
ATOM   7923  N N   . SER E 1 111 ? 34.486  -4.901  26.451  1.00 67.61  ? 111 SER E N   1 
ATOM   7924  C CA  . SER E 1 111 ? 34.288  -5.841  25.344  1.00 73.12  ? 111 SER E CA  1 
ATOM   7925  C C   . SER E 1 111 ? 34.716  -5.204  24.015  1.00 77.95  ? 111 SER E C   1 
ATOM   7926  O O   . SER E 1 111 ? 35.317  -5.864  23.154  1.00 63.69  ? 111 SER E O   1 
ATOM   7927  C CB  . SER E 1 111 ? 32.814  -6.258  25.253  1.00 62.60  ? 111 SER E CB  1 
ATOM   7928  O OG  . SER E 1 111 ? 32.296  -6.627  26.530  1.00 81.30  ? 111 SER E OG  1 
ATOM   7929  N N   . LEU E 1 112 ? 34.411  -3.914  23.873  1.00 81.95  ? 112 LEU E N   1 
ATOM   7930  C CA  . LEU E 1 112 ? 34.713  -3.144  22.662  1.00 80.90  ? 112 LEU E CA  1 
ATOM   7931  C C   . LEU E 1 112 ? 36.131  -3.342  22.106  1.00 80.29  ? 112 LEU E C   1 
ATOM   7932  O O   . LEU E 1 112 ? 36.315  -3.541  20.910  1.00 58.83  ? 112 LEU E O   1 
ATOM   7933  C CB  . LEU E 1 112 ? 34.470  -1.663  22.929  1.00 63.38  ? 112 LEU E CB  1 
ATOM   7934  C CG  . LEU E 1 112 ? 34.546  -0.818  21.668  1.00 61.91  ? 112 LEU E CG  1 
ATOM   7935  C CD1 . LEU E 1 112 ? 33.585  -1.372  20.622  1.00 52.74  ? 112 LEU E CD1 1 
ATOM   7936  C CD2 . LEU E 1 112 ? 34.207  0.614   22.015  1.00 70.09  ? 112 LEU E CD2 1 
ATOM   7937  N N   . ILE E 1 113 ? 37.128  -3.262  22.981  1.00 78.34  ? 113 ILE E N   1 
ATOM   7938  C CA  . ILE E 1 113 ? 38.515  -3.457  22.575  1.00 72.92  ? 113 ILE E CA  1 
ATOM   7939  C C   . ILE E 1 113 ? 38.531  -4.748  21.784  1.00 78.70  ? 113 ILE E C   1 
ATOM   7940  O O   . ILE E 1 113 ? 38.986  -4.802  20.638  1.00 81.31  ? 113 ILE E O   1 
ATOM   7941  C CB  . ILE E 1 113 ? 39.433  -3.627  23.806  1.00 74.93  ? 113 ILE E CB  1 
ATOM   7942  C CG1 . ILE E 1 113 ? 39.522  -2.305  24.574  1.00 64.05  ? 113 ILE E CG1 1 
ATOM   7943  C CG2 . ILE E 1 113 ? 40.809  -4.112  23.376  1.00 52.90  ? 113 ILE E CG2 1 
ATOM   7944  C CD1 . ILE E 1 113 ? 38.188  -1.764  24.989  1.00 50.22  ? 113 ILE E CD1 1 
ATOM   7945  N N   . THR E 1 114 ? 38.007  -5.786  22.418  1.00 77.85  ? 114 THR E N   1 
ATOM   7946  C CA  . THR E 1 114 ? 37.935  -7.104  21.824  1.00 74.67  ? 114 THR E CA  1 
ATOM   7947  C C   . THR E 1 114 ? 37.150  -7.062  20.529  1.00 53.70  ? 114 THR E C   1 
ATOM   7948  O O   . THR E 1 114 ? 37.673  -7.395  19.472  1.00 61.30  ? 114 THR E O   1 
ATOM   7949  C CB  . THR E 1 114 ? 37.303  -8.089  22.826  1.00 73.66  ? 114 THR E CB  1 
ATOM   7950  O OG1 . THR E 1 114 ? 38.242  -8.326  23.882  1.00 87.22  ? 114 THR E OG1 1 
ATOM   7951  C CG2 . THR E 1 114 ? 36.933  -9.399  22.162  1.00 58.48  ? 114 THR E CG2 1 
ATOM   7952  N N   . GLN E 1 115 ? 35.900  -6.634  20.609  1.00 61.91  ? 115 GLN E N   1 
ATOM   7953  C CA  . GLN E 1 115 ? 35.049  -6.544  19.419  1.00 75.34  ? 115 GLN E CA  1 
ATOM   7954  C C   . GLN E 1 115 ? 35.809  -5.932  18.230  1.00 73.91  ? 115 GLN E C   1 
ATOM   7955  O O   . GLN E 1 115 ? 35.840  -6.502  17.130  1.00 75.56  ? 115 GLN E O   1 
ATOM   7956  C CB  . GLN E 1 115 ? 33.811  -5.704  19.730  1.00 60.14  ? 115 GLN E CB  1 
ATOM   7957  C CG  . GLN E 1 115 ? 32.677  -5.890  18.755  1.00 79.07  ? 115 GLN E CG  1 
ATOM   7958  C CD  . GLN E 1 115 ? 31.449  -5.093  19.159  1.00 87.42  ? 115 GLN E CD  1 
ATOM   7959  O OE1 . GLN E 1 115 ? 31.345  -4.633  20.302  1.00 87.83  ? 115 GLN E OE1 1 
ATOM   7960  N NE2 . GLN E 1 115 ? 30.505  -4.933  18.228  1.00 80.14  ? 115 GLN E NE2 1 
ATOM   7961  N N   . ILE E 1 116 ? 36.433  -4.779  18.459  1.00 66.11  ? 116 ILE E N   1 
ATOM   7962  C CA  . ILE E 1 116 ? 37.201  -4.107  17.415  1.00 60.72  ? 116 ILE E CA  1 
ATOM   7963  C C   . ILE E 1 116 ? 38.386  -4.963  16.957  1.00 72.15  ? 116 ILE E C   1 
ATOM   7964  O O   . ILE E 1 116 ? 38.447  -5.412  15.809  1.00 54.38  ? 116 ILE E O   1 
ATOM   7965  C CB  . ILE E 1 116 ? 37.739  -2.744  17.911  1.00 44.22  ? 116 ILE E CB  1 
ATOM   7966  C CG1 . ILE E 1 116 ? 36.584  -1.776  18.163  1.00 44.51  ? 116 ILE E CG1 1 
ATOM   7967  C CG2 . ILE E 1 116 ? 38.683  -2.156  16.888  1.00 61.51  ? 116 ILE E CG2 1 
ATOM   7968  C CD1 . ILE E 1 116 ? 37.033  -0.417  18.613  1.00 48.70  ? 116 ILE E CD1 1 
ATOM   7969  N N   . ALA E 1 117 ? 39.322  -5.199  17.872  1.00 69.40  ? 117 ALA E N   1 
ATOM   7970  C CA  . ALA E 1 117 ? 40.522  -5.975  17.575  1.00 70.99  ? 117 ALA E CA  1 
ATOM   7971  C C   . ALA E 1 117 ? 40.250  -7.386  17.072  1.00 66.49  ? 117 ALA E C   1 
ATOM   7972  O O   . ALA E 1 117 ? 41.132  -8.017  16.497  1.00 73.14  ? 117 ALA E O   1 
ATOM   7973  C CB  . ALA E 1 117 ? 41.431  -6.032  18.821  1.00 74.93  ? 117 ALA E CB  1 
ATOM   7974  N N   . GLN E 1 118 ? 39.037  -7.881  17.285  1.00 69.73  ? 118 GLN E N   1 
ATOM   7975  C CA  . GLN E 1 118 ? 38.687  -9.226  16.850  1.00 66.45  ? 118 GLN E CA  1 
ATOM   7976  C C   . GLN E 1 118 ? 38.646  -9.340  15.336  1.00 71.91  ? 118 GLN E C   1 
ATOM   7977  O O   . GLN E 1 118 ? 39.138  -10.322 14.775  1.00 67.57  ? 118 GLN E O   1 
ATOM   7978  C CB  . GLN E 1 118 ? 37.331  -9.651  17.442  1.00 79.04  ? 118 GLN E CB  1 
ATOM   7979  C CG  . GLN E 1 118 ? 37.448  -10.751 18.507  1.00 85.31  ? 118 GLN E CG  1 
ATOM   7980  C CD  . GLN E 1 118 ? 36.178  -10.949 19.339  1.00 87.90  ? 118 GLN E CD  1 
ATOM   7981  O OE1 . GLN E 1 118 ? 36.142  -11.808 20.223  1.00 81.86  ? 118 GLN E OE1 1 
ATOM   7982  N NE2 . GLN E 1 118 ? 35.136  -10.154 19.064  1.00 97.66  ? 118 GLN E NE2 1 
ATOM   7983  N N   . THR E 1 119 ? 38.053  -8.336  14.690  1.00 72.63  ? 119 THR E N   1 
ATOM   7984  C CA  . THR E 1 119 ? 37.915  -8.283  13.233  1.00 67.56  ? 119 THR E CA  1 
ATOM   7985  C C   . THR E 1 119 ? 39.166  -7.737  12.529  1.00 78.39  ? 119 THR E C   1 
ATOM   7986  O O   . THR E 1 119 ? 39.735  -8.370  11.635  1.00 70.53  ? 119 THR E O   1 
ATOM   7987  C CB  . THR E 1 119 ? 36.743  -7.358  12.826  1.00 62.97  ? 119 THR E CB  1 
ATOM   7988  O OG1 . THR E 1 119 ? 35.514  -7.862  13.363  1.00 67.88  ? 119 THR E OG1 1 
ATOM   7989  C CG2 . THR E 1 119 ? 36.643  -7.254  11.308  1.00 59.39  ? 119 THR E CG2 1 
ATOM   7990  N N   . PHE E 1 120 ? 39.578  -6.546  12.947  1.00 79.18  ? 120 PHE E N   1 
ATOM   7991  C CA  . PHE E 1 120 ? 40.712  -5.851  12.353  1.00 67.49  ? 120 PHE E CA  1 
ATOM   7992  C C   . PHE E 1 120 ? 42.065  -6.102  13.009  1.00 69.44  ? 120 PHE E C   1 
ATOM   7993  O O   . PHE E 1 120 ? 43.088  -5.648  12.490  1.00 57.94  ? 120 PHE E O   1 
ATOM   7994  C CB  . PHE E 1 120 ? 40.428  -4.356  12.366  1.00 62.89  ? 120 PHE E CB  1 
ATOM   7995  C CG  . PHE E 1 120 ? 39.074  -3.991  11.835  1.00 58.01  ? 120 PHE E CG  1 
ATOM   7996  C CD1 . PHE E 1 120 ? 38.876  -3.791  10.478  1.00 46.44  ? 120 PHE E CD1 1 
ATOM   7997  C CD2 . PHE E 1 120 ? 37.997  -3.823  12.704  1.00 62.13  ? 120 PHE E CD2 1 
ATOM   7998  C CE1 . PHE E 1 120 ? 37.614  -3.419  9.989   1.00 79.21  ? 120 PHE E CE1 1 
ATOM   7999  C CE2 . PHE E 1 120 ? 36.733  -3.452  12.226  1.00 68.03  ? 120 PHE E CE2 1 
ATOM   8000  C CZ  . PHE E 1 120 ? 36.542  -3.249  10.869  1.00 39.96  ? 120 PHE E CZ  1 
ATOM   8001  N N   . GLY E 1 121 ? 42.076  -6.806  14.140  1.00 64.36  ? 121 GLY E N   1 
ATOM   8002  C CA  . GLY E 1 121 ? 43.333  -7.080  14.820  1.00 53.28  ? 121 GLY E CA  1 
ATOM   8003  C C   . GLY E 1 121 ? 43.741  -6.007  15.819  1.00 52.71  ? 121 GLY E C   1 
ATOM   8004  O O   . GLY E 1 121 ? 43.441  -4.823  15.649  1.00 63.82  ? 121 GLY E O   1 
ATOM   8005  N N   . SER E 1 122 ? 44.448  -6.423  16.862  1.00 53.10  ? 122 SER E N   1 
ATOM   8006  C CA  . SER E 1 122 ? 44.894  -5.510  17.904  1.00 64.28  ? 122 SER E CA  1 
ATOM   8007  C C   . SER E 1 122 ? 45.676  -4.290  17.395  1.00 67.55  ? 122 SER E C   1 
ATOM   8008  O O   . SER E 1 122 ? 45.599  -3.209  17.985  1.00 43.29  ? 122 SER E O   1 
ATOM   8009  C CB  . SER E 1 122 ? 45.732  -6.272  18.934  1.00 70.06  ? 122 SER E CB  1 
ATOM   8010  O OG  . SER E 1 122 ? 46.940  -6.744  18.374  1.00 73.53  ? 122 SER E OG  1 
ATOM   8011  N N   . GLN E 1 123 ? 46.424  -4.451  16.306  1.00 54.16  ? 123 GLN E N   1 
ATOM   8012  C CA  . GLN E 1 123 ? 47.186  -3.328  15.780  1.00 51.77  ? 123 GLN E CA  1 
ATOM   8013  C C   . GLN E 1 123 ? 46.264  -2.262  15.209  1.00 54.94  ? 123 GLN E C   1 
ATOM   8014  O O   . GLN E 1 123 ? 46.722  -1.199  14.793  1.00 69.34  ? 123 GLN E O   1 
ATOM   8015  C CB  . GLN E 1 123 ? 48.133  -3.778  14.681  1.00 38.31  ? 123 GLN E CB  1 
ATOM   8016  C CG  . GLN E 1 123 ? 47.441  -4.281  13.410  1.00 53.16  ? 123 GLN E CG  1 
ATOM   8017  C CD  . GLN E 1 123 ? 47.101  -5.758  13.477  1.00 85.04  ? 123 GLN E CD  1 
ATOM   8018  O OE1 . GLN E 1 123 ? 47.172  -6.469  12.469  1.00 79.82  ? 123 GLN E OE1 1 
ATOM   8019  N NE2 . GLN E 1 123 ? 46.731  -6.230  14.665  1.00 69.48  ? 123 GLN E NE2 1 
ATOM   8020  N N   . ALA E 1 124 ? 44.969  -2.550  15.178  1.00 55.88  ? 124 ALA E N   1 
ATOM   8021  C CA  . ALA E 1 124 ? 44.002  -1.611  14.626  1.00 53.68  ? 124 ALA E CA  1 
ATOM   8022  C C   . ALA E 1 124 ? 43.336  -0.788  15.714  1.00 63.33  ? 124 ALA E C   1 
ATOM   8023  O O   . ALA E 1 124 ? 42.550  0.119   15.427  1.00 61.49  ? 124 ALA E O   1 
ATOM   8024  C CB  . ALA E 1 124 ? 42.942  -2.366  13.826  1.00 64.55  ? 124 ALA E CB  1 
ATOM   8025  N N   . VAL E 1 125 ? 43.658  -1.097  16.963  1.00 47.10  ? 125 VAL E N   1 
ATOM   8026  C CA  . VAL E 1 125 ? 43.058  -0.387  18.072  1.00 52.63  ? 125 VAL E CA  1 
ATOM   8027  C C   . VAL E 1 125 ? 44.060  0.142   19.105  1.00 63.61  ? 125 VAL E C   1 
ATOM   8028  O O   . VAL E 1 125 ? 44.999  -0.552  19.488  1.00 49.50  ? 125 VAL E O   1 
ATOM   8029  C CB  . VAL E 1 125 ? 42.044  -1.297  18.783  1.00 66.52  ? 125 VAL E CB  1 
ATOM   8030  C CG1 . VAL E 1 125 ? 42.699  -2.609  19.130  1.00 71.54  ? 125 VAL E CG1 1 
ATOM   8031  C CG2 . VAL E 1 125 ? 41.517  -0.615  20.051  1.00 91.02  ? 125 VAL E CG2 1 
ATOM   8032  N N   . VAL E 1 126 ? 43.858  1.389   19.530  1.00 62.91  ? 126 VAL E N   1 
ATOM   8033  C CA  . VAL E 1 126 ? 44.698  2.007   20.553  1.00 56.56  ? 126 VAL E CA  1 
ATOM   8034  C C   . VAL E 1 126 ? 43.752  2.395   21.695  1.00 68.55  ? 126 VAL E C   1 
ATOM   8035  O O   . VAL E 1 126 ? 42.621  2.819   21.451  1.00 50.42  ? 126 VAL E O   1 
ATOM   8036  C CB  . VAL E 1 126 ? 45.439  3.283   20.037  1.00 55.43  ? 126 VAL E CB  1 
ATOM   8037  C CG1 . VAL E 1 126 ? 46.222  2.969   18.773  1.00 45.24  ? 126 VAL E CG1 1 
ATOM   8038  C CG2 . VAL E 1 126 ? 44.448  4.408   19.778  1.00 67.77  ? 126 VAL E CG2 1 
ATOM   8039  N N   . VAL E 1 127 ? 44.198  2.227   22.940  1.00 66.57  ? 127 VAL E N   1 
ATOM   8040  C CA  . VAL E 1 127 ? 43.371  2.576   24.086  1.00 62.57  ? 127 VAL E CA  1 
ATOM   8041  C C   . VAL E 1 127 ? 43.958  3.760   24.838  1.00 64.42  ? 127 VAL E C   1 
ATOM   8042  O O   . VAL E 1 127 ? 45.010  3.654   25.474  1.00 54.86  ? 127 VAL E O   1 
ATOM   8043  C CB  . VAL E 1 127 ? 43.211  1.384   25.052  1.00 69.18  ? 127 VAL E CB  1 
ATOM   8044  C CG1 . VAL E 1 127 ? 42.447  1.823   26.293  1.00 56.34  ? 127 VAL E CG1 1 
ATOM   8045  C CG2 . VAL E 1 127 ? 42.475  0.242   24.347  1.00 73.95  ? 127 VAL E CG2 1 
ATOM   8046  N N   . ALA E 1 128 ? 43.261  4.891   24.750  1.00 66.79  ? 128 ALA E N   1 
ATOM   8047  C CA  . ALA E 1 128 ? 43.679  6.126   25.403  1.00 62.30  ? 128 ALA E CA  1 
ATOM   8048  C C   . ALA E 1 128 ? 43.353  6.085   26.892  1.00 57.64  ? 128 ALA E C   1 
ATOM   8049  O O   . ALA E 1 128 ? 42.217  5.821   27.279  1.00 51.04  ? 128 ALA E O   1 
ATOM   8050  C CB  . ALA E 1 128 ? 42.984  7.326   24.745  1.00 39.41  ? 128 ALA E CB  1 
ATOM   8051  N N   . ILE E 1 129 ? 44.369  6.351   27.711  1.00 64.65  ? 129 ILE E N   1 
ATOM   8052  C CA  . ILE E 1 129 ? 44.246  6.363   29.168  1.00 69.02  ? 129 ILE E CA  1 
ATOM   8053  C C   . ILE E 1 129 ? 44.558  7.737   29.766  1.00 54.84  ? 129 ILE E C   1 
ATOM   8054  O O   . ILE E 1 129 ? 45.689  8.215   29.694  1.00 70.14  ? 129 ILE E O   1 
ATOM   8055  C CB  . ILE E 1 129 ? 45.210  5.338   29.826  1.00 73.87  ? 129 ILE E CB  1 
ATOM   8056  C CG1 . ILE E 1 129 ? 44.894  3.922   29.338  1.00 84.35  ? 129 ILE E CG1 1 
ATOM   8057  C CG2 . ILE E 1 129 ? 45.090  5.410   31.342  1.00 86.50  ? 129 ILE E CG2 1 
ATOM   8058  C CD1 . ILE E 1 129 ? 43.450  3.520   29.530  1.00 55.98  ? 129 ILE E CD1 1 
ATOM   8059  N N   . ASP E 1 130 ? 43.545  8.369   30.345  1.00 65.66  ? 130 ASP E N   1 
ATOM   8060  C CA  . ASP E 1 130 ? 43.703  9.674   30.993  1.00 71.81  ? 130 ASP E CA  1 
ATOM   8061  C C   . ASP E 1 130 ? 43.739  9.412   32.501  1.00 70.12  ? 130 ASP E C   1 
ATOM   8062  O O   . ASP E 1 130 ? 42.823  8.787   33.035  1.00 81.02  ? 130 ASP E O   1 
ATOM   8063  C CB  . ASP E 1 130 ? 42.509  10.569  30.664  1.00 73.25  ? 130 ASP E CB  1 
ATOM   8064  C CG  . ASP E 1 130 ? 42.323  10.761  29.179  1.00 81.87  ? 130 ASP E CG  1 
ATOM   8065  O OD1 . ASP E 1 130 ? 43.214  11.382  28.547  1.00 79.55  ? 130 ASP E OD1 1 
ATOM   8066  O OD2 . ASP E 1 130 ? 41.291  10.284  28.651  1.00 87.15  ? 130 ASP E OD2 1 
ATOM   8067  N N   . ALA E 1 131 ? 44.769  9.882   33.197  1.00 77.76  ? 131 ALA E N   1 
ATOM   8068  C CA  . ALA E 1 131 ? 44.853  9.616   34.637  1.00 89.07  ? 131 ALA E CA  1 
ATOM   8069  C C   . ALA E 1 131 ? 45.775  10.543  35.434  1.00 79.76  ? 131 ALA E C   1 
ATOM   8070  O O   . ALA E 1 131 ? 46.697  11.138  34.878  1.00 81.09  ? 131 ALA E O   1 
ATOM   8071  C CB  . ALA E 1 131 ? 45.290  8.157   34.850  1.00 97.10  ? 131 ALA E CB  1 
ATOM   8072  N N   . LYS E 1 132 ? 45.515  10.654  36.740  1.00 78.06  ? 132 LYS E N   1 
ATOM   8073  C CA  . LYS E 1 132 ? 46.342  11.476  37.630  1.00 69.58  ? 132 LYS E CA  1 
ATOM   8074  C C   . LYS E 1 132 ? 46.441  10.906  39.048  1.00 85.81  ? 132 LYS E C   1 
ATOM   8075  O O   . LYS E 1 132 ? 45.980  9.790   39.321  1.00 68.26  ? 132 LYS E O   1 
ATOM   8076  C CB  . LYS E 1 132 ? 45.836  12.921  37.694  1.00 76.24  ? 132 LYS E CB  1 
ATOM   8077  C CG  . LYS E 1 132 ? 44.491  13.130  38.380  1.00 81.19  ? 132 LYS E CG  1 
ATOM   8078  C CD  . LYS E 1 132 ? 44.101  14.629  38.387  1.00 84.38  ? 132 LYS E CD  1 
ATOM   8079  C CE  . LYS E 1 132 ? 45.088  15.476  39.201  1.00 92.02  ? 132 LYS E CE  1 
ATOM   8080  N NZ  . LYS E 1 132 ? 44.631  16.889  39.498  1.00 77.81  ? 132 LYS E NZ  1 
ATOM   8081  N N   . ARG E 1 133 ? 47.034  11.696  39.946  1.00 86.81  ? 133 ARG E N   1 
ATOM   8082  C CA  . ARG E 1 133 ? 47.255  11.298  41.340  1.00 86.68  ? 133 ARG E CA  1 
ATOM   8083  C C   . ARG E 1 133 ? 46.115  11.620  42.308  1.00 90.10  ? 133 ARG E C   1 
ATOM   8084  O O   . ARG E 1 133 ? 46.271  12.460  43.206  1.00 93.77  ? 133 ARG E O   1 
ATOM   8085  C CB  . ARG E 1 133 ? 48.537  11.954  41.840  1.00 92.10  ? 133 ARG E CB  1 
ATOM   8086  C CG  . ARG E 1 133 ? 49.673  11.852  40.843  1.00 97.08  ? 133 ARG E CG  1 
ATOM   8087  C CD  . ARG E 1 133 ? 50.904  12.646  41.275  1.00 86.46  ? 133 ARG E CD  1 
ATOM   8088  N NE  . ARG E 1 133 ? 51.949  12.569  40.253  1.00 94.52  ? 133 ARG E NE  1 
ATOM   8089  C CZ  . ARG E 1 133 ? 51.804  13.021  39.010  1.00 103.15 ? 133 ARG E CZ  1 
ATOM   8090  N NH1 . ARG E 1 133 ? 50.654  13.586  38.638  1.00 89.05  ? 133 ARG E NH1 1 
ATOM   8091  N NH2 . ARG E 1 133 ? 52.805  12.908  38.141  1.00 91.65  ? 133 ARG E NH2 1 
ATOM   8092  N N   . VAL E 1 134 ? 44.989  10.929  42.143  1.00 81.86  ? 134 VAL E N   1 
ATOM   8093  C CA  . VAL E 1 134 ? 43.815  11.134  42.992  1.00 94.09  ? 134 VAL E CA  1 
ATOM   8094  C C   . VAL E 1 134 ? 43.883  10.283  44.258  1.00 100.36 ? 134 VAL E C   1 
ATOM   8095  O O   . VAL E 1 134 ? 43.754  9.052   44.207  1.00 94.75  ? 134 VAL E O   1 
ATOM   8096  C CB  . VAL E 1 134 ? 42.515  10.776  42.241  1.00 103.15 ? 134 VAL E CB  1 
ATOM   8097  C CG1 . VAL E 1 134 ? 41.297  11.063  43.120  1.00 73.40  ? 134 VAL E CG1 1 
ATOM   8098  C CG2 . VAL E 1 134 ? 42.452  11.560  40.933  1.00 103.15 ? 134 VAL E CG2 1 
ATOM   8099  N N   . ASP E 1 135 ? 44.080  10.952  45.394  1.00 103.15 ? 135 ASP E N   1 
ATOM   8100  C CA  . ASP E 1 135 ? 44.182  10.272  46.682  1.00 103.15 ? 135 ASP E CA  1 
ATOM   8101  C C   . ASP E 1 135 ? 45.562  9.618   46.815  1.00 102.19 ? 135 ASP E C   1 
ATOM   8102  O O   . ASP E 1 135 ? 45.738  8.671   47.592  1.00 93.81  ? 135 ASP E O   1 
ATOM   8103  C CB  . ASP E 1 135 ? 43.100  9.197   46.790  1.00 103.15 ? 135 ASP E CB  1 
ATOM   8104  C CG  . ASP E 1 135 ? 42.728  8.888   48.217  1.00 97.01  ? 135 ASP E CG  1 
ATOM   8105  O OD1 . ASP E 1 135 ? 41.974  7.913   48.421  1.00 103.15 ? 135 ASP E OD1 1 
ATOM   8106  O OD2 . ASP E 1 135 ? 43.176  9.625   49.126  1.00 103.15 ? 135 ASP E OD2 1 
ATOM   8107  N N   . GLY E 1 136 ? 46.536  10.121  46.055  1.00 101.07 ? 136 GLY E N   1 
ATOM   8108  C CA  . GLY E 1 136 ? 47.877  9.555   46.111  1.00 103.15 ? 136 GLY E CA  1 
ATOM   8109  C C   . GLY E 1 136 ? 48.137  8.461   45.080  1.00 103.11 ? 136 GLY E C   1 
ATOM   8110  O O   . GLY E 1 136 ? 49.257  8.333   44.570  1.00 103.15 ? 136 GLY E O   1 
ATOM   8111  N N   . GLU E 1 137 ? 47.111  7.667   44.774  1.00 93.96  ? 137 GLU E N   1 
ATOM   8112  C CA  . GLU E 1 137 ? 47.242  6.592   43.790  1.00 96.18  ? 137 GLU E CA  1 
ATOM   8113  C C   . GLU E 1 137 ? 47.173  7.098   42.350  1.00 91.15  ? 137 GLU E C   1 
ATOM   8114  O O   . GLU E 1 137 ? 47.305  8.301   42.066  1.00 90.98  ? 137 GLU E O   1 
ATOM   8115  C CB  . GLU E 1 137 ? 46.122  5.564   43.956  1.00 102.84 ? 137 GLU E CB  1 
ATOM   8116  C CG  . GLU E 1 137 ? 46.239  4.636   45.148  1.00 103.15 ? 137 GLU E CG  1 
ATOM   8117  C CD  . GLU E 1 137 ? 45.291  3.445   45.009  1.00 103.15 ? 137 GLU E CD  1 
ATOM   8118  O OE1 . GLU E 1 137 ? 44.051  3.664   45.019  1.00 98.99  ? 137 GLU E OE1 1 
ATOM   8119  O OE2 . GLU E 1 137 ? 45.790  2.295   44.875  1.00 103.15 ? 137 GLU E OE2 1 
ATOM   8120  N N   . PHE E 1 138 ? 46.963  6.148   41.442  1.00 90.99  ? 138 PHE E N   1 
ATOM   8121  C CA  . PHE E 1 138 ? 46.825  6.457   40.023  1.00 79.80  ? 138 PHE E CA  1 
ATOM   8122  C C   . PHE E 1 138 ? 45.443  6.045   39.580  1.00 72.01  ? 138 PHE E C   1 
ATOM   8123  O O   . PHE E 1 138 ? 45.154  4.848   39.415  1.00 59.45  ? 138 PHE E O   1 
ATOM   8124  C CB  . PHE E 1 138 ? 47.890  5.742   39.199  1.00 72.52  ? 138 PHE E CB  1 
ATOM   8125  C CG  . PHE E 1 138 ? 49.098  6.583   38.949  1.00 67.76  ? 138 PHE E CG  1 
ATOM   8126  C CD1 . PHE E 1 138 ? 49.062  7.954   39.198  1.00 76.04  ? 138 PHE E CD1 1 
ATOM   8127  C CD2 . PHE E 1 138 ? 50.263  6.025   38.456  1.00 78.85  ? 138 PHE E CD2 1 
ATOM   8128  C CE1 . PHE E 1 138 ? 50.176  8.761   38.960  1.00 90.70  ? 138 PHE E CE1 1 
ATOM   8129  C CE2 . PHE E 1 138 ? 51.387  6.827   38.213  1.00 103.15 ? 138 PHE E CE2 1 
ATOM   8130  C CZ  . PHE E 1 138 ? 51.343  8.198   38.467  1.00 82.40  ? 138 PHE E CZ  1 
ATOM   8131  N N   . MET E 1 139 ? 44.586  7.053   39.421  1.00 77.46  ? 139 MET E N   1 
ATOM   8132  C CA  . MET E 1 139 ? 43.199  6.841   39.025  1.00 81.00  ? 139 MET E CA  1 
ATOM   8133  C C   . MET E 1 139 ? 42.939  7.147   37.560  1.00 85.39  ? 139 MET E C   1 
ATOM   8134  O O   . MET E 1 139 ? 43.508  8.088   36.984  1.00 75.31  ? 139 MET E O   1 
ATOM   8135  C CB  . MET E 1 139 ? 42.275  7.689   39.902  1.00 95.85  ? 139 MET E CB  1 
ATOM   8136  C CG  . MET E 1 139 ? 41.617  6.920   41.052  1.00 96.50  ? 139 MET E CG  1 
ATOM   8137  S SD  . MET E 1 139 ? 42.720  5.685   41.756  1.00 95.93  ? 139 MET E SD  1 
ATOM   8138  C CE  . MET E 1 139 ? 43.141  6.458   43.379  1.00 103.15 ? 139 MET E CE  1 
ATOM   8139  N N   . VAL E 1 140 ? 42.057  6.344   36.974  1.00 88.89  ? 140 VAL E N   1 
ATOM   8140  C CA  . VAL E 1 140 ? 41.672  6.457   35.571  1.00 76.15  ? 140 VAL E CA  1 
ATOM   8141  C C   . VAL E 1 140 ? 40.479  7.376   35.420  1.00 75.57  ? 140 VAL E C   1 
ATOM   8142  O O   . VAL E 1 140 ? 39.521  7.290   36.185  1.00 83.75  ? 140 VAL E O   1 
ATOM   8143  C CB  . VAL E 1 140 ? 41.313  5.065   34.989  1.00 79.11  ? 140 VAL E CB  1 
ATOM   8144  C CG1 . VAL E 1 140 ? 40.359  5.213   33.810  1.00 67.95  ? 140 VAL E CG1 1 
ATOM   8145  C CG2 . VAL E 1 140 ? 42.584  4.349   34.549  1.00 58.17  ? 140 VAL E CG2 1 
ATOM   8146  N N   . PHE E 1 141 ? 40.525  8.245   34.417  1.00 78.44  ? 141 PHE E N   1 
ATOM   8147  C CA  . PHE E 1 141 ? 39.428  9.182   34.191  1.00 70.56  ? 141 PHE E CA  1 
ATOM   8148  C C   . PHE E 1 141 ? 38.742  9.044   32.850  1.00 71.31  ? 141 PHE E C   1 
ATOM   8149  O O   . PHE E 1 141 ? 39.394  8.874   31.814  1.00 88.77  ? 141 PHE E O   1 
ATOM   8150  C CB  . PHE E 1 141 ? 39.922  10.616  34.332  1.00 65.51  ? 141 PHE E CB  1 
ATOM   8151  C CG  . PHE E 1 141 ? 40.196  11.021  35.744  1.00 88.75  ? 141 PHE E CG  1 
ATOM   8152  C CD1 . PHE E 1 141 ? 41.127  10.323  36.519  1.00 89.05  ? 141 PHE E CD1 1 
ATOM   8153  C CD2 . PHE E 1 141 ? 39.528  12.106  36.306  1.00 101.54 ? 141 PHE E CD2 1 
ATOM   8154  C CE1 . PHE E 1 141 ? 41.388  10.701  37.827  1.00 79.38  ? 141 PHE E CE1 1 
ATOM   8155  C CE2 . PHE E 1 141 ? 39.782  12.497  37.622  1.00 88.17  ? 141 PHE E CE2 1 
ATOM   8156  C CZ  . PHE E 1 141 ? 40.713  11.792  38.380  1.00 91.46  ? 141 PHE E CZ  1 
ATOM   8157  N N   . THR E 1 142 ? 37.418  9.121   32.880  1.00 62.81  ? 142 THR E N   1 
ATOM   8158  C CA  . THR E 1 142 ? 36.628  9.052   31.669  1.00 62.85  ? 142 THR E CA  1 
ATOM   8159  C C   . THR E 1 142 ? 36.341  10.507  31.291  1.00 72.86  ? 142 THR E C   1 
ATOM   8160  O O   . THR E 1 142 ? 37.113  11.399  31.649  1.00 66.40  ? 142 THR E O   1 
ATOM   8161  C CB  . THR E 1 142 ? 35.308  8.273   31.911  1.00 77.40  ? 142 THR E CB  1 
ATOM   8162  O OG1 . THR E 1 142 ? 35.174  7.971   33.308  1.00 74.39  ? 142 THR E OG1 1 
ATOM   8163  C CG2 . THR E 1 142 ? 35.306  6.967   31.126  1.00 42.35  ? 142 THR E CG2 1 
ATOM   8164  N N   . TYR E 1 143 ? 35.239  10.734  30.578  1.00 73.17  ? 143 TYR E N   1 
ATOM   8165  C CA  . TYR E 1 143 ? 34.815  12.064  30.120  1.00 72.96  ? 143 TYR E CA  1 
ATOM   8166  C C   . TYR E 1 143 ? 35.846  13.191  30.165  1.00 66.68  ? 143 TYR E C   1 
ATOM   8167  O O   . TYR E 1 143 ? 35.740  14.120  30.974  1.00 74.62  ? 143 TYR E O   1 
ATOM   8168  C CB  . TYR E 1 143 ? 33.562  12.485  30.879  1.00 73.40  ? 143 TYR E CB  1 
ATOM   8169  C CG  . TYR E 1 143 ? 32.400  11.548  30.647  1.00 46.89  ? 143 TYR E CG  1 
ATOM   8170  C CD1 . TYR E 1 143 ? 31.626  11.635  29.497  1.00 62.12  ? 143 TYR E CD1 1 
ATOM   8171  C CD2 . TYR E 1 143 ? 32.100  10.551  31.564  1.00 61.57  ? 143 TYR E CD2 1 
ATOM   8172  C CE1 . TYR E 1 143 ? 30.567  10.744  29.264  1.00 43.80  ? 143 TYR E CE1 1 
ATOM   8173  C CE2 . TYR E 1 143 ? 31.055  9.653   31.342  1.00 61.02  ? 143 TYR E CE2 1 
ATOM   8174  C CZ  . TYR E 1 143 ? 30.290  9.756   30.195  1.00 69.36  ? 143 TYR E CZ  1 
ATOM   8175  O OH  . TYR E 1 143 ? 29.240  8.876   30.004  1.00 90.05  ? 143 TYR E OH  1 
ATOM   8176  N N   . SER E 1 144 ? 36.829  13.101  29.272  1.00 66.52  ? 144 SER E N   1 
ATOM   8177  C CA  . SER E 1 144 ? 37.913  14.082  29.146  1.00 65.09  ? 144 SER E CA  1 
ATOM   8178  C C   . SER E 1 144 ? 38.740  14.319  30.396  1.00 72.15  ? 144 SER E C   1 
ATOM   8179  O O   . SER E 1 144 ? 39.127  15.456  30.694  1.00 70.20  ? 144 SER E O   1 
ATOM   8180  C CB  . SER E 1 144 ? 37.379  15.422  28.630  1.00 72.70  ? 144 SER E CB  1 
ATOM   8181  O OG  . SER E 1 144 ? 37.606  15.540  27.231  1.00 73.27  ? 144 SER E OG  1 
ATOM   8182  N N   . GLY E 1 145 ? 39.030  13.231  31.109  1.00 83.41  ? 145 GLY E N   1 
ATOM   8183  C CA  . GLY E 1 145 ? 39.832  13.303  32.326  1.00 84.74  ? 145 GLY E CA  1 
ATOM   8184  C C   . GLY E 1 145 ? 39.126  14.047  33.437  1.00 85.59  ? 145 GLY E C   1 
ATOM   8185  O O   . GLY E 1 145 ? 39.762  14.613  34.329  1.00 80.01  ? 145 GLY E O   1 
ATOM   8186  N N   . LYS E 1 146 ? 37.800  14.037  33.401  1.00 75.94  ? 146 LYS E N   1 
ATOM   8187  C CA  . LYS E 1 146 ? 37.044  14.761  34.404  1.00 80.03  ? 146 LYS E CA  1 
ATOM   8188  C C   . LYS E 1 146 ? 36.130  13.909  35.275  1.00 78.43  ? 146 LYS E C   1 
ATOM   8189  O O   . LYS E 1 146 ? 35.222  14.425  35.923  1.00 88.30  ? 146 LYS E O   1 
ATOM   8190  C CB  . LYS E 1 146 ? 36.252  15.869  33.712  1.00 56.37  ? 146 LYS E CB  1 
ATOM   8191  C CG  . LYS E 1 146 ? 37.138  16.974  33.157  1.00 48.53  ? 146 LYS E CG  1 
ATOM   8192  C CD  . LYS E 1 146 ? 36.334  17.924  32.273  1.00 88.51  ? 146 LYS E CD  1 
ATOM   8193  C CE  . LYS E 1 146 ? 37.063  19.242  32.021  1.00 78.20  ? 146 LYS E CE  1 
ATOM   8194  N NZ  . LYS E 1 146 ? 36.965  20.185  33.195  1.00 86.00  ? 146 LYS E NZ  1 
ATOM   8195  N N   . LYS E 1 147 ? 36.376  12.607  35.313  1.00 76.91  ? 147 LYS E N   1 
ATOM   8196  C CA  . LYS E 1 147 ? 35.550  11.731  36.129  1.00 71.70  ? 147 LYS E CA  1 
ATOM   8197  C C   . LYS E 1 147 ? 36.383  10.587  36.670  1.00 68.66  ? 147 LYS E C   1 
ATOM   8198  O O   . LYS E 1 147 ? 36.993  9.833   35.909  1.00 77.70  ? 147 LYS E O   1 
ATOM   8199  C CB  . LYS E 1 147 ? 34.383  11.182  35.309  1.00 57.43  ? 147 LYS E CB  1 
ATOM   8200  C CG  . LYS E 1 147 ? 33.352  10.465  36.131  1.00 58.00  ? 147 LYS E CG  1 
ATOM   8201  C CD  . LYS E 1 147 ? 32.158  10.054  35.289  1.00 75.33  ? 147 LYS E CD  1 
ATOM   8202  C CE  . LYS E 1 147 ? 31.008  9.565   36.163  1.00 64.50  ? 147 LYS E CE  1 
ATOM   8203  N NZ  . LYS E 1 147 ? 29.928  8.906   35.365  1.00 62.56  ? 147 LYS E NZ  1 
ATOM   8204  N N   . ASN E 1 148 ? 36.415  10.471  37.992  1.00 75.70  ? 148 ASN E N   1 
ATOM   8205  C CA  . ASN E 1 148 ? 37.172  9.421   38.648  1.00 59.08  ? 148 ASN E CA  1 
ATOM   8206  C C   . ASN E 1 148 ? 36.439  8.103   38.451  1.00 75.10  ? 148 ASN E C   1 
ATOM   8207  O O   . ASN E 1 148 ? 35.229  8.028   38.680  1.00 74.32  ? 148 ASN E O   1 
ATOM   8208  C CB  . ASN E 1 148 ? 37.287  9.730   40.135  1.00 67.20  ? 148 ASN E CB  1 
ATOM   8209  C CG  . ASN E 1 148 ? 38.473  9.052   40.771  1.00 74.71  ? 148 ASN E CG  1 
ATOM   8210  O OD1 . ASN E 1 148 ? 38.870  9.390   41.888  1.00 79.10  ? 148 ASN E OD1 1 
ATOM   8211  N ND2 . ASN E 1 148 ? 39.053  8.087   40.061  1.00 80.76  ? 148 ASN E ND2 1 
ATOM   8212  N N   . THR E 1 149 ? 37.155  7.063   38.030  1.00 75.81  ? 149 THR E N   1 
ATOM   8213  C CA  . THR E 1 149 ? 36.511  5.764   37.807  1.00 78.67  ? 149 THR E CA  1 
ATOM   8214  C C   . THR E 1 149 ? 36.637  4.765   38.962  1.00 79.19  ? 149 THR E C   1 
ATOM   8215  O O   . THR E 1 149 ? 36.034  3.689   38.928  1.00 73.59  ? 149 THR E O   1 
ATOM   8216  C CB  . THR E 1 149 ? 37.042  5.084   36.512  1.00 81.98  ? 149 THR E CB  1 
ATOM   8217  O OG1 . THR E 1 149 ? 38.462  5.261   36.424  1.00 88.53  ? 149 THR E OG1 1 
ATOM   8218  C CG2 . THR E 1 149 ? 36.378  5.673   35.278  1.00 62.84  ? 149 THR E CG2 1 
ATOM   8219  N N   . GLY E 1 150 ? 37.411  5.111   39.988  1.00 92.27  ? 150 GLY E N   1 
ATOM   8220  C CA  . GLY E 1 150 ? 37.588  4.198   41.111  1.00 92.11  ? 150 GLY E CA  1 
ATOM   8221  C C   . GLY E 1 150 ? 38.427  3.034   40.633  1.00 85.16  ? 150 GLY E C   1 
ATOM   8222  O O   . GLY E 1 150 ? 38.751  2.103   41.380  1.00 94.23  ? 150 GLY E O   1 
ATOM   8223  N N   . ILE E 1 151 ? 38.776  3.112   39.355  1.00 81.41  ? 151 ILE E N   1 
ATOM   8224  C CA  . ILE E 1 151 ? 39.574  2.105   38.692  1.00 67.76  ? 151 ILE E CA  1 
ATOM   8225  C C   . ILE E 1 151 ? 41.042  2.516   38.785  1.00 84.72  ? 151 ILE E C   1 
ATOM   8226  O O   . ILE E 1 151 ? 41.420  3.631   38.409  1.00 70.80  ? 151 ILE E O   1 
ATOM   8227  C CB  . ILE E 1 151 ? 39.180  1.982   37.203  1.00 58.94  ? 151 ILE E CB  1 
ATOM   8228  C CG1 . ILE E 1 151 ? 37.684  1.674   37.083  1.00 54.01  ? 151 ILE E CG1 1 
ATOM   8229  C CG2 . ILE E 1 151 ? 40.048  0.925   36.524  1.00 69.37  ? 151 ILE E CG2 1 
ATOM   8230  C CD1 . ILE E 1 151 ? 37.240  1.264   35.680  1.00 80.48  ? 151 ILE E CD1 1 
ATOM   8231  N N   . LEU E 1 152 ? 41.869  1.614   39.296  1.00 82.21  ? 152 LEU E N   1 
ATOM   8232  C CA  . LEU E 1 152 ? 43.276  1.913   39.412  1.00 89.32  ? 152 LEU E CA  1 
ATOM   8233  C C   . LEU E 1 152 ? 43.902  1.890   38.015  1.00 92.92  ? 152 LEU E C   1 
ATOM   8234  O O   . LEU E 1 152 ? 43.512  1.089   37.158  1.00 82.25  ? 152 LEU E O   1 
ATOM   8235  C CB  . LEU E 1 152 ? 43.965  0.891   40.329  1.00 93.34  ? 152 LEU E CB  1 
ATOM   8236  C CG  . LEU E 1 152 ? 43.678  0.960   41.834  1.00 91.35  ? 152 LEU E CG  1 
ATOM   8237  C CD1 . LEU E 1 152 ? 42.369  0.243   42.154  1.00 78.29  ? 152 LEU E CD1 1 
ATOM   8238  C CD2 . LEU E 1 152 ? 44.832  0.313   42.591  1.00 94.66  ? 152 LEU E CD2 1 
ATOM   8239  N N   . LEU E 1 153 ? 44.853  2.790   37.788  1.00 87.83  ? 153 LEU E N   1 
ATOM   8240  C CA  . LEU E 1 153 ? 45.549  2.860   36.514  1.00 92.22  ? 153 LEU E CA  1 
ATOM   8241  C C   . LEU E 1 153 ? 46.333  1.566   36.424  1.00 96.29  ? 153 LEU E C   1 
ATOM   8242  O O   . LEU E 1 153 ? 46.800  1.168   35.344  1.00 97.17  ? 153 LEU E O   1 
ATOM   8243  C CB  . LEU E 1 153 ? 46.533  4.044   36.494  1.00 85.58  ? 153 LEU E CB  1 
ATOM   8244  C CG  . LEU E 1 153 ? 47.599  3.983   35.390  1.00 78.71  ? 153 LEU E CG  1 
ATOM   8245  C CD1 . LEU E 1 153 ? 46.902  4.000   34.025  1.00 73.78  ? 153 LEU E CD1 1 
ATOM   8246  C CD2 . LEU E 1 153 ? 48.579  5.142   35.518  1.00 66.82  ? 153 LEU E CD2 1 
ATOM   8247  N N   . ARG E 1 154 ? 46.474  0.919   37.579  1.00 97.40  ? 154 ARG E N   1 
ATOM   8248  C CA  . ARG E 1 154 ? 47.222  -0.329  37.692  1.00 98.18  ? 154 ARG E CA  1 
ATOM   8249  C C   . ARG E 1 154 ? 46.428  -1.522  37.167  1.00 93.16  ? 154 ARG E C   1 
ATOM   8250  O O   . ARG E 1 154 ? 46.999  -2.417  36.542  1.00 98.51  ? 154 ARG E O   1 
ATOM   8251  C CB  . ARG E 1 154 ? 47.634  -0.546  39.146  1.00 96.26  ? 154 ARG E CB  1 
ATOM   8252  C CG  . ARG E 1 154 ? 48.650  -1.656  39.354  1.00 99.66  ? 154 ARG E CG  1 
ATOM   8253  C CD  . ARG E 1 154 ? 49.321  -1.457  40.713  1.00 97.26  ? 154 ARG E CD  1 
ATOM   8254  N NE  . ARG E 1 154 ? 48.340  -0.989  41.689  1.00 103.15 ? 154 ARG E NE  1 
ATOM   8255  C CZ  . ARG E 1 154 ? 48.609  -0.694  42.956  1.00 103.15 ? 154 ARG E CZ  1 
ATOM   8256  N NH1 . ARG E 1 154 ? 49.849  -0.816  43.424  1.00 99.44  ? 154 ARG E NH1 1 
ATOM   8257  N NH2 . ARG E 1 154 ? 47.629  -0.283  43.755  1.00 103.15 ? 154 ARG E NH2 1 
ATOM   8258  N N   . ASP E 1 155 ? 45.124  -1.552  37.432  1.00 85.95  ? 155 ASP E N   1 
ATOM   8259  C CA  . ASP E 1 155 ? 44.298  -2.627  36.909  1.00 86.08  ? 155 ASP E CA  1 
ATOM   8260  C C   . ASP E 1 155 ? 44.202  -2.374  35.410  1.00 87.79  ? 155 ASP E C   1 
ATOM   8261  O O   . ASP E 1 155 ? 44.964  -2.945  34.627  1.00 94.72  ? 155 ASP E O   1 
ATOM   8262  C CB  . ASP E 1 155 ? 42.895  -2.593  37.523  1.00 89.36  ? 155 ASP E CB  1 
ATOM   8263  C CG  . ASP E 1 155 ? 42.853  -3.196  38.909  1.00 84.03  ? 155 ASP E CG  1 
ATOM   8264  O OD1 . ASP E 1 155 ? 43.015  -4.433  39.024  1.00 84.21  ? 155 ASP E OD1 1 
ATOM   8265  O OD2 . ASP E 1 155 ? 42.662  -2.433  39.884  1.00 85.84  ? 155 ASP E OD2 1 
ATOM   8266  N N   . TRP E 1 156 ? 43.262  -1.500  35.038  1.00 85.65  ? 156 TRP E N   1 
ATOM   8267  C CA  . TRP E 1 156 ? 42.991  -1.098  33.654  1.00 75.57  ? 156 TRP E CA  1 
ATOM   8268  C C   . TRP E 1 156 ? 43.985  -1.606  32.630  1.00 64.52  ? 156 TRP E C   1 
ATOM   8269  O O   . TRP E 1 156 ? 43.677  -2.491  31.836  1.00 66.87  ? 156 TRP E O   1 
ATOM   8270  C CB  . TRP E 1 156 ? 42.958  0.426   33.548  1.00 83.85  ? 156 TRP E CB  1 
ATOM   8271  C CG  . TRP E 1 156 ? 42.132  0.941   32.401  1.00 76.73  ? 156 TRP E CG  1 
ATOM   8272  C CD1 . TRP E 1 156 ? 42.075  2.225   31.965  1.00 75.88  ? 156 TRP E CD1 1 
ATOM   8273  C CD2 . TRP E 1 156 ? 41.178  0.204   31.607  1.00 64.40  ? 156 TRP E CD2 1 
ATOM   8274  N NE1 . TRP E 1 156 ? 41.145  2.347   30.958  1.00 91.39  ? 156 TRP E NE1 1 
ATOM   8275  C CE2 . TRP E 1 156 ? 40.579  1.123   30.718  1.00 73.50  ? 156 TRP E CE2 1 
ATOM   8276  C CE3 . TRP E 1 156 ? 40.773  -1.135  31.564  1.00 74.46  ? 156 TRP E CE3 1 
ATOM   8277  C CZ2 . TRP E 1 156 ? 39.594  0.748   29.794  1.00 53.84  ? 156 TRP E CZ2 1 
ATOM   8278  C CZ3 . TRP E 1 156 ? 39.790  -1.510  30.641  1.00 71.70  ? 156 TRP E CZ3 1 
ATOM   8279  C CH2 . TRP E 1 156 ? 39.214  -0.566  29.771  1.00 60.68  ? 156 TRP E CH2 1 
ATOM   8280  N N   . VAL E 1 157 ? 45.173  -1.013  32.639  1.00 56.03  ? 157 VAL E N   1 
ATOM   8281  C CA  . VAL E 1 157 ? 46.222  -1.412  31.711  1.00 72.68  ? 157 VAL E CA  1 
ATOM   8282  C C   . VAL E 1 157 ? 46.226  -2.940  31.579  1.00 82.07  ? 157 VAL E C   1 
ATOM   8283  O O   . VAL E 1 157 ? 45.815  -3.483  30.544  1.00 85.01  ? 157 VAL E O   1 
ATOM   8284  C CB  . VAL E 1 157 ? 47.612  -0.942  32.200  1.00 72.02  ? 157 VAL E CB  1 
ATOM   8285  C CG1 . VAL E 1 157 ? 48.650  -1.212  31.143  1.00 66.62  ? 157 VAL E CG1 1 
ATOM   8286  C CG2 . VAL E 1 157 ? 47.573  0.539   32.536  1.00 66.87  ? 157 VAL E CG2 1 
ATOM   8287  N N   . VAL E 1 158 ? 46.669  -3.633  32.631  1.00 84.57  ? 158 VAL E N   1 
ATOM   8288  C CA  . VAL E 1 158 ? 46.712  -5.093  32.599  1.00 75.14  ? 158 VAL E CA  1 
ATOM   8289  C C   . VAL E 1 158 ? 45.465  -5.663  31.934  1.00 77.48  ? 158 VAL E C   1 
ATOM   8290  O O   . VAL E 1 158 ? 45.554  -6.582  31.121  1.00 86.83  ? 158 VAL E O   1 
ATOM   8291  C CB  . VAL E 1 158 ? 46.844  -5.692  34.011  1.00 81.10  ? 158 VAL E CB  1 
ATOM   8292  C CG1 . VAL E 1 158 ? 46.560  -7.197  33.965  1.00 67.94  ? 158 VAL E CG1 1 
ATOM   8293  C CG2 . VAL E 1 158 ? 48.257  -5.427  34.555  1.00 70.08  ? 158 VAL E CG2 1 
ATOM   8294  N N   . GLU E 1 159 ? 44.299  -5.126  32.274  1.00 76.21  ? 159 GLU E N   1 
ATOM   8295  C CA  . GLU E 1 159 ? 43.069  -5.617  31.661  1.00 72.82  ? 159 GLU E CA  1 
ATOM   8296  C C   . GLU E 1 159 ? 43.189  -5.343  30.161  1.00 77.76  ? 159 GLU E C   1 
ATOM   8297  O O   . GLU E 1 159 ? 43.274  -6.277  29.354  1.00 74.04  ? 159 GLU E O   1 
ATOM   8298  C CB  . GLU E 1 159 ? 41.847  -4.888  32.225  1.00 61.97  ? 159 GLU E CB  1 
ATOM   8299  C CG  . GLU E 1 159 ? 40.528  -5.448  31.697  1.00 84.09  ? 159 GLU E CG  1 
ATOM   8300  C CD  . GLU E 1 159 ? 40.232  -6.847  32.228  1.00 103.15 ? 159 GLU E CD  1 
ATOM   8301  O OE1 . GLU E 1 159 ? 39.866  -6.979  33.429  1.00 92.30  ? 159 GLU E OE1 1 
ATOM   8302  O OE2 . GLU E 1 159 ? 40.374  -7.818  31.443  1.00 103.15 ? 159 GLU E OE2 1 
ATOM   8303  N N   . VAL E 1 160 ? 43.206  -4.052  29.813  1.00 80.24  ? 160 VAL E N   1 
ATOM   8304  C CA  . VAL E 1 160 ? 43.334  -3.573  28.435  1.00 75.93  ? 160 VAL E CA  1 
ATOM   8305  C C   . VAL E 1 160 ? 43.950  -4.608  27.491  1.00 80.04  ? 160 VAL E C   1 
ATOM   8306  O O   . VAL E 1 160 ? 43.313  -5.051  26.527  1.00 76.73  ? 160 VAL E O   1 
ATOM   8307  C CB  . VAL E 1 160 ? 44.203  -2.289  28.400  1.00 83.48  ? 160 VAL E CB  1 
ATOM   8308  C CG1 . VAL E 1 160 ? 44.804  -2.087  27.018  1.00 82.37  ? 160 VAL E CG1 1 
ATOM   8309  C CG2 . VAL E 1 160 ? 43.364  -1.079  28.793  1.00 57.63  ? 160 VAL E CG2 1 
ATOM   8310  N N   . GLU E 1 161 ? 45.191  -4.994  27.780  1.00 81.75  ? 161 GLU E N   1 
ATOM   8311  C CA  . GLU E 1 161 ? 45.901  -5.967  26.956  1.00 80.01  ? 161 GLU E CA  1 
ATOM   8312  C C   . GLU E 1 161 ? 45.148  -7.282  26.789  1.00 82.90  ? 161 GLU E C   1 
ATOM   8313  O O   . GLU E 1 161 ? 45.117  -7.873  25.694  1.00 77.22  ? 161 GLU E O   1 
ATOM   8314  C CB  . GLU E 1 161 ? 47.277  -6.234  27.548  1.00 83.70  ? 161 GLU E CB  1 
ATOM   8315  C CG  . GLU E 1 161 ? 48.028  -7.356  26.857  1.00 83.11  ? 161 GLU E CG  1 
ATOM   8316  C CD  . GLU E 1 161 ? 49.525  -7.199  26.985  1.00 90.03  ? 161 GLU E CD  1 
ATOM   8317  O OE1 . GLU E 1 161 ? 49.973  -6.607  27.997  1.00 80.18  ? 161 GLU E OE1 1 
ATOM   8318  O OE2 . GLU E 1 161 ? 50.253  -7.672  26.076  1.00 97.89  ? 161 GLU E OE2 1 
ATOM   8319  N N   . LYS E 1 162 ? 44.542  -7.741  27.877  1.00 83.15  ? 162 LYS E N   1 
ATOM   8320  C CA  . LYS E 1 162 ? 43.781  -8.989  27.849  1.00 83.04  ? 162 LYS E CA  1 
ATOM   8321  C C   . LYS E 1 162 ? 42.660  -8.908  26.830  1.00 75.97  ? 162 LYS E C   1 
ATOM   8322  O O   . LYS E 1 162 ? 42.253  -9.923  26.263  1.00 70.41  ? 162 LYS E O   1 
ATOM   8323  C CB  . LYS E 1 162 ? 43.175  -9.289  29.232  1.00 81.43  ? 162 LYS E CB  1 
ATOM   8324  C CG  . LYS E 1 162 ? 41.960  -10.223 29.175  1.00 94.45  ? 162 LYS E CG  1 
ATOM   8325  C CD  . LYS E 1 162 ? 41.404  -10.588 30.555  1.00 99.83  ? 162 LYS E CD  1 
ATOM   8326  C CE  . LYS E 1 162 ? 42.289  -11.605 31.299  1.00 79.27  ? 162 LYS E CE  1 
ATOM   8327  N NZ  . LYS E 1 162 ? 41.686  -11.996 32.617  1.00 63.26  ? 162 LYS E NZ  1 
ATOM   8328  N N   . ARG E 1 163 ? 42.166  -7.694  26.594  1.00 79.18  ? 163 ARG E N   1 
ATOM   8329  C CA  . ARG E 1 163 ? 41.049  -7.498  25.670  1.00 69.79  ? 163 ARG E CA  1 
ATOM   8330  C C   . ARG E 1 163 ? 41.451  -7.313  24.208  1.00 66.96  ? 163 ARG E C   1 
ATOM   8331  O O   . ARG E 1 163 ? 40.609  -7.445  23.309  1.00 62.46  ? 163 ARG E O   1 
ATOM   8332  C CB  . ARG E 1 163 ? 40.203  -6.311  26.143  1.00 91.49  ? 163 ARG E CB  1 
ATOM   8333  C CG  . ARG E 1 163 ? 39.614  -6.470  27.549  1.00 56.53  ? 163 ARG E CG  1 
ATOM   8334  C CD  . ARG E 1 163 ? 38.358  -7.347  27.545  1.00 89.52  ? 163 ARG E CD  1 
ATOM   8335  N NE  . ARG E 1 163 ? 37.766  -7.464  28.879  1.00 86.23  ? 163 ARG E NE  1 
ATOM   8336  C CZ  . ARG E 1 163 ? 36.480  -7.728  29.109  1.00 86.69  ? 163 ARG E CZ  1 
ATOM   8337  N NH1 . ARG E 1 163 ? 35.640  -7.907  28.097  1.00 85.45  ? 163 ARG E NH1 1 
ATOM   8338  N NH2 . ARG E 1 163 ? 36.025  -7.796  30.355  1.00 85.07  ? 163 ARG E NH2 1 
ATOM   8339  N N   . GLY E 1 164 ? 42.723  -6.997  23.966  1.00 61.45  ? 164 GLY E N   1 
ATOM   8340  C CA  . GLY E 1 164 ? 43.177  -6.822  22.594  1.00 65.90  ? 164 GLY E CA  1 
ATOM   8341  C C   . GLY E 1 164 ? 44.011  -5.594  22.257  1.00 67.72  ? 164 GLY E C   1 
ATOM   8342  O O   . GLY E 1 164 ? 44.893  -5.661  21.404  1.00 58.19  ? 164 GLY E O   1 
ATOM   8343  N N   . ALA E 1 165 ? 43.743  -4.471  22.918  1.00 75.20  ? 165 ALA E N   1 
ATOM   8344  C CA  . ALA E 1 165 ? 44.463  -3.217  22.653  1.00 71.82  ? 165 ALA E CA  1 
ATOM   8345  C C   . ALA E 1 165 ? 45.888  -3.407  22.142  1.00 68.18  ? 165 ALA E C   1 
ATOM   8346  O O   . ALA E 1 165 ? 46.698  -4.093  22.771  1.00 69.11  ? 165 ALA E O   1 
ATOM   8347  C CB  . ALA E 1 165 ? 44.476  -2.363  23.897  1.00 58.23  ? 165 ALA E CB  1 
ATOM   8348  N N   . GLY E 1 166 ? 46.185  -2.793  20.999  1.00 62.15  ? 166 GLY E N   1 
ATOM   8349  C CA  . GLY E 1 166 ? 47.509  -2.905  20.411  1.00 50.32  ? 166 GLY E CA  1 
ATOM   8350  C C   . GLY E 1 166 ? 48.477  -1.871  20.953  1.00 53.22  ? 166 GLY E C   1 
ATOM   8351  O O   . GLY E 1 166 ? 49.691  -2.052  20.921  1.00 46.87  ? 166 GLY E O   1 
ATOM   8352  N N   . GLU E 1 167 ? 47.929  -0.768  21.440  1.00 50.36  ? 167 GLU E N   1 
ATOM   8353  C CA  . GLU E 1 167 ? 48.750  0.282   22.001  1.00 60.89  ? 167 GLU E CA  1 
ATOM   8354  C C   . GLU E 1 167 ? 48.018  0.998   23.103  1.00 65.30  ? 167 GLU E C   1 
ATOM   8355  O O   . GLU E 1 167 ? 46.799  0.881   23.230  1.00 68.91  ? 167 GLU E O   1 
ATOM   8356  C CB  . GLU E 1 167 ? 49.132  1.300   20.938  1.00 65.54  ? 167 GLU E CB  1 
ATOM   8357  C CG  . GLU E 1 167 ? 50.489  1.080   20.302  1.00 101.86 ? 167 GLU E CG  1 
ATOM   8358  C CD  . GLU E 1 167 ? 50.762  2.098   19.212  1.00 82.74  ? 167 GLU E CD  1 
ATOM   8359  O OE1 . GLU E 1 167 ? 49.985  2.122   18.229  1.00 70.96  ? 167 GLU E OE1 1 
ATOM   8360  O OE2 . GLU E 1 167 ? 51.743  2.870   19.339  1.00 84.70  ? 167 GLU E OE2 1 
ATOM   8361  N N   . ILE E 1 168 ? 48.778  1.753   23.891  1.00 68.68  ? 168 ILE E N   1 
ATOM   8362  C CA  . ILE E 1 168 ? 48.228  2.533   24.981  1.00 62.77  ? 168 ILE E CA  1 
ATOM   8363  C C   . ILE E 1 168 ? 48.667  3.972   24.796  1.00 61.30  ? 168 ILE E C   1 
ATOM   8364  O O   . ILE E 1 168 ? 49.855  4.272   24.898  1.00 60.74  ? 168 ILE E O   1 
ATOM   8365  C CB  . ILE E 1 168 ? 48.762  2.073   26.345  1.00 81.11  ? 168 ILE E CB  1 
ATOM   8366  C CG1 . ILE E 1 168 ? 48.488  0.584   26.558  1.00 81.64  ? 168 ILE E CG1 1 
ATOM   8367  C CG2 . ILE E 1 168 ? 48.114  2.890   27.446  1.00 81.43  ? 168 ILE E CG2 1 
ATOM   8368  C CD1 . ILE E 1 168 ? 48.934  0.088   27.916  1.00 70.70  ? 168 ILE E CD1 1 
ATOM   8369  N N   . LEU E 1 169 ? 47.715  4.857   24.512  1.00 62.07  ? 169 LEU E N   1 
ATOM   8370  C CA  . LEU E 1 169 ? 48.029  6.275   24.352  1.00 73.98  ? 169 LEU E CA  1 
ATOM   8371  C C   . LEU E 1 169 ? 47.864  6.883   25.766  1.00 86.27  ? 169 LEU E C   1 
ATOM   8372  O O   . LEU E 1 169 ? 46.730  7.041   26.244  1.00 81.39  ? 169 LEU E O   1 
ATOM   8373  C CB  . LEU E 1 169 ? 47.050  6.918   23.362  1.00 74.58  ? 169 LEU E CB  1 
ATOM   8374  C CG  . LEU E 1 169 ? 47.511  8.155   22.575  1.00 80.96  ? 169 LEU E CG  1 
ATOM   8375  C CD1 . LEU E 1 169 ? 46.382  8.651   21.665  1.00 68.70  ? 169 LEU E CD1 1 
ATOM   8376  C CD2 . LEU E 1 169 ? 47.941  9.254   23.552  1.00 54.76  ? 169 LEU E CD2 1 
ATOM   8377  N N   . LEU E 1 170 ? 48.984  7.223   26.422  1.00 83.20  ? 170 LEU E N   1 
ATOM   8378  C CA  . LEU E 1 170 ? 48.951  7.759   27.792  1.00 76.45  ? 170 LEU E CA  1 
ATOM   8379  C C   . LEU E 1 170 ? 49.071  9.269   28.049  1.00 68.49  ? 170 LEU E C   1 
ATOM   8380  O O   . LEU E 1 170 ? 50.152  9.856   27.950  1.00 66.04  ? 170 LEU E O   1 
ATOM   8381  C CB  . LEU E 1 170 ? 50.000  7.064   28.651  1.00 58.88  ? 170 LEU E CB  1 
ATOM   8382  C CG  . LEU E 1 170 ? 49.689  7.374   30.108  1.00 69.09  ? 170 LEU E CG  1 
ATOM   8383  C CD1 . LEU E 1 170 ? 48.345  6.747   30.446  1.00 82.73  ? 170 LEU E CD1 1 
ATOM   8384  C CD2 . LEU E 1 170 ? 50.760  6.829   31.016  1.00 91.61  ? 170 LEU E CD2 1 
ATOM   8385  N N   . THR E 1 171 ? 47.957  9.871   28.450  1.00 65.27  ? 171 THR E N   1 
ATOM   8386  C CA  . THR E 1 171 ? 47.901  11.299  28.733  1.00 76.57  ? 171 THR E CA  1 
ATOM   8387  C C   . THR E 1 171 ? 47.935  11.545  30.245  1.00 71.80  ? 171 THR E C   1 
ATOM   8388  O O   . THR E 1 171 ? 47.193  10.919  30.996  1.00 74.24  ? 171 THR E O   1 
ATOM   8389  C CB  . THR E 1 171 ? 46.581  11.926  28.135  1.00 95.47  ? 171 THR E CB  1 
ATOM   8390  O OG1 . THR E 1 171 ? 46.664  11.978  26.698  1.00 79.91  ? 171 THR E OG1 1 
ATOM   8391  C CG2 . THR E 1 171 ? 46.340  13.329  28.684  1.00 92.90  ? 171 THR E CG2 1 
ATOM   8392  N N   . SER E 1 172 ? 48.816  12.441  30.686  1.00 86.22  ? 172 SER E N   1 
ATOM   8393  C CA  . SER E 1 172 ? 48.916  12.812  32.103  1.00 82.19  ? 172 SER E CA  1 
ATOM   8394  C C   . SER E 1 172 ? 48.029  14.025  32.266  1.00 86.51  ? 172 SER E C   1 
ATOM   8395  O O   . SER E 1 172 ? 48.226  15.027  31.577  1.00 84.70  ? 172 SER E O   1 
ATOM   8396  C CB  . SER E 1 172 ? 50.336  13.219  32.467  1.00 102.21 ? 172 SER E CB  1 
ATOM   8397  O OG  . SER E 1 172 ? 50.334  14.183  33.515  1.00 98.58  ? 172 SER E OG  1 
ATOM   8398  N N   . ILE E 1 173 ? 47.066  13.952  33.176  1.00 90.30  ? 173 ILE E N   1 
ATOM   8399  C CA  . ILE E 1 173 ? 46.145  15.069  33.367  1.00 84.18  ? 173 ILE E CA  1 
ATOM   8400  C C   . ILE E 1 173 ? 46.741  16.265  34.101  1.00 87.82  ? 173 ILE E C   1 
ATOM   8401  O O   . ILE E 1 173 ? 46.199  17.365  34.021  1.00 87.23  ? 173 ILE E O   1 
ATOM   8402  C CB  . ILE E 1 173 ? 44.888  14.628  34.114  1.00 67.27  ? 173 ILE E CB  1 
ATOM   8403  C CG1 . ILE E 1 173 ? 44.442  13.257  33.609  1.00 72.93  ? 173 ILE E CG1 1 
ATOM   8404  C CG2 . ILE E 1 173 ? 43.772  15.639  33.875  1.00 69.51  ? 173 ILE E CG2 1 
ATOM   8405  C CD1 . ILE E 1 173 ? 43.253  12.700  34.353  1.00 71.70  ? 173 ILE E CD1 1 
ATOM   8406  N N   . ASP E 1 174 ? 47.844  16.065  34.819  1.00 95.22  ? 174 ASP E N   1 
ATOM   8407  C CA  . ASP E 1 174 ? 48.476  17.185  35.538  1.00 100.99 ? 174 ASP E CA  1 
ATOM   8408  C C   . ASP E 1 174 ? 49.418  17.946  34.619  1.00 99.21  ? 174 ASP E C   1 
ATOM   8409  O O   . ASP E 1 174 ? 49.894  19.031  34.974  1.00 97.79  ? 174 ASP E O   1 
ATOM   8410  C CB  . ASP E 1 174 ? 49.289  16.700  36.756  1.00 103.15 ? 174 ASP E CB  1 
ATOM   8411  C CG  . ASP E 1 174 ? 48.445  16.573  38.029  1.00 103.15 ? 174 ASP E CG  1 
ATOM   8412  O OD1 . ASP E 1 174 ? 47.687  17.532  38.338  1.00 92.74  ? 174 ASP E OD1 1 
ATOM   8413  O OD2 . ASP E 1 174 ? 48.559  15.525  38.726  1.00 81.91  ? 174 ASP E OD2 1 
ATOM   8414  N N   . ARG E 1 175 ? 49.685  17.384  33.439  1.00 99.04  ? 175 ARG E N   1 
ATOM   8415  C CA  . ARG E 1 175 ? 50.608  18.009  32.500  1.00 85.44  ? 175 ARG E CA  1 
ATOM   8416  C C   . ARG E 1 175 ? 50.037  18.519  31.170  1.00 88.09  ? 175 ARG E C   1 
ATOM   8417  O O   . ARG E 1 175 ? 50.530  19.516  30.635  1.00 75.60  ? 175 ARG E O   1 
ATOM   8418  C CB  . ARG E 1 175 ? 51.763  17.046  32.207  1.00 89.61  ? 175 ARG E CB  1 
ATOM   8419  C CG  . ARG E 1 175 ? 52.422  16.422  33.437  1.00 83.14  ? 175 ARG E CG  1 
ATOM   8420  C CD  . ARG E 1 175 ? 52.695  17.447  34.528  1.00 87.59  ? 175 ARG E CD  1 
ATOM   8421  N NE  . ARG E 1 175 ? 53.759  17.017  35.438  1.00 78.70  ? 175 ARG E NE  1 
ATOM   8422  C CZ  . ARG E 1 175 ? 55.042  17.310  35.259  1.00 98.12  ? 175 ARG E CZ  1 
ATOM   8423  N NH1 . ARG E 1 175 ? 55.399  18.037  34.202  1.00 99.98  ? 175 ARG E NH1 1 
ATOM   8424  N NH2 . ARG E 1 175 ? 55.964  16.881  36.125  1.00 63.44  ? 175 ARG E NH2 1 
ATOM   8425  N N   . ASP E 1 176 ? 49.025  17.847  30.621  1.00 88.29  ? 176 ASP E N   1 
ATOM   8426  C CA  . ASP E 1 176 ? 48.456  18.278  29.329  1.00 91.87  ? 176 ASP E CA  1 
ATOM   8427  C C   . ASP E 1 176 ? 48.308  19.803  29.304  1.00 86.91  ? 176 ASP E C   1 
ATOM   8428  O O   . ASP E 1 176 ? 47.483  20.367  30.030  1.00 90.13  ? 176 ASP E O   1 
ATOM   8429  C CB  . ASP E 1 176 ? 47.085  17.627  29.085  1.00 69.09  ? 176 ASP E CB  1 
ATOM   8430  C CG  . ASP E 1 176 ? 46.803  17.375  27.598  1.00 79.24  ? 176 ASP E CG  1 
ATOM   8431  O OD1 . ASP E 1 176 ? 47.487  17.952  26.710  1.00 85.64  ? 176 ASP E OD1 1 
ATOM   8432  O OD2 . ASP E 1 176 ? 45.874  16.590  27.316  1.00 92.46  ? 176 ASP E OD2 1 
ATOM   8433  N N   . GLY E 1 177 ? 49.115  20.463  28.475  1.00 80.73  ? 177 GLY E N   1 
ATOM   8434  C CA  . GLY E 1 177 ? 49.065  21.914  28.389  1.00 77.25  ? 177 GLY E CA  1 
ATOM   8435  C C   . GLY E 1 177 ? 50.173  22.617  29.166  1.00 82.58  ? 177 GLY E C   1 
ATOM   8436  O O   . GLY E 1 177 ? 50.907  23.433  28.603  1.00 82.25  ? 177 GLY E O   1 
ATOM   8437  N N   . THR E 1 178 ? 50.306  22.300  30.453  1.00 78.60  ? 178 THR E N   1 
ATOM   8438  C CA  . THR E 1 178 ? 51.329  22.920  31.304  1.00 89.23  ? 178 THR E CA  1 
ATOM   8439  C C   . THR E 1 178 ? 52.575  23.344  30.530  1.00 94.41  ? 178 THR E C   1 
ATOM   8440  O O   . THR E 1 178 ? 53.101  24.436  30.746  1.00 99.72  ? 178 THR E O   1 
ATOM   8441  C CB  . THR E 1 178 ? 51.821  21.963  32.449  1.00 94.41  ? 178 THR E CB  1 
ATOM   8442  O OG1 . THR E 1 178 ? 52.702  20.963  31.908  1.00 64.93  ? 178 THR E OG1 1 
ATOM   8443  C CG2 . THR E 1 178 ? 50.640  21.280  33.137  1.00 98.62  ? 178 THR E CG2 1 
ATOM   8444  N N   . LYS E 1 179 ? 53.040  22.469  29.636  1.00 93.71  ? 179 LYS E N   1 
ATOM   8445  C CA  . LYS E 1 179 ? 54.246  22.704  28.842  1.00 85.20  ? 179 LYS E CA  1 
ATOM   8446  C C   . LYS E 1 179 ? 55.458  22.549  29.769  1.00 86.76  ? 179 LYS E C   1 
ATOM   8447  O O   . LYS E 1 179 ? 56.564  23.014  29.464  1.00 84.42  ? 179 LYS E O   1 
ATOM   8448  C CB  . LYS E 1 179 ? 54.208  24.102  28.206  1.00 84.81  ? 179 LYS E CB  1 
ATOM   8449  C CG  . LYS E 1 179 ? 53.090  24.273  27.188  1.00 73.41  ? 179 LYS E CG  1 
ATOM   8450  C CD  . LYS E 1 179 ? 52.819  25.735  26.852  1.00 92.40  ? 179 LYS E CD  1 
ATOM   8451  C CE  . LYS E 1 179 ? 51.785  25.871  25.734  1.00 82.21  ? 179 LYS E CE  1 
ATOM   8452  N NZ  . LYS E 1 179 ? 52.278  25.277  24.452  1.00 69.89  ? 179 LYS E NZ  1 
ATOM   8453  N N   . SER E 1 180 ? 55.237  21.866  30.891  1.00 84.89  ? 180 SER E N   1 
ATOM   8454  C CA  . SER E 1 180 ? 56.278  21.635  31.896  1.00 95.80  ? 180 SER E CA  1 
ATOM   8455  C C   . SER E 1 180 ? 57.059  20.324  31.691  1.00 101.50 ? 180 SER E C   1 
ATOM   8456  O O   . SER E 1 180 ? 57.960  19.992  32.485  1.00 103.15 ? 180 SER E O   1 
ATOM   8457  C CB  . SER E 1 180 ? 55.650  21.625  33.297  1.00 94.00  ? 180 SER E CB  1 
ATOM   8458  O OG  . SER E 1 180 ? 54.819  20.481  33.474  1.00 90.79  ? 180 SER E OG  1 
ATOM   8459  N N   . GLY E 1 181 ? 56.717  19.582  30.638  1.00 96.35  ? 181 GLY E N   1 
ATOM   8460  C CA  . GLY E 1 181 ? 57.394  18.326  30.373  1.00 91.29  ? 181 GLY E CA  1 
ATOM   8461  C C   . GLY E 1 181 ? 56.452  17.138  30.362  1.00 96.82  ? 181 GLY E C   1 
ATOM   8462  O O   . GLY E 1 181 ? 55.229  17.306  30.325  1.00 94.42  ? 181 GLY E O   1 
ATOM   8463  N N   . TYR E 1 182 ? 57.023  15.934  30.394  1.00 90.54  ? 182 TYR E N   1 
ATOM   8464  C CA  . TYR E 1 182 ? 56.235  14.706  30.388  1.00 92.68  ? 182 TYR E CA  1 
ATOM   8465  C C   . TYR E 1 182 ? 56.169  14.091  31.792  1.00 89.34  ? 182 TYR E C   1 
ATOM   8466  O O   . TYR E 1 182 ? 57.143  14.155  32.552  1.00 89.47  ? 182 TYR E O   1 
ATOM   8467  C CB  . TYR E 1 182 ? 56.830  13.702  29.379  1.00 100.62 ? 182 TYR E CB  1 
ATOM   8468  C CG  . TYR E 1 182 ? 56.360  13.900  27.930  1.00 96.36  ? 182 TYR E CG  1 
ATOM   8469  C CD1 . TYR E 1 182 ? 55.001  13.857  27.605  1.00 86.78  ? 182 TYR E CD1 1 
ATOM   8470  C CD2 . TYR E 1 182 ? 57.273  14.101  26.887  1.00 84.04  ? 182 TYR E CD2 1 
ATOM   8471  C CE1 . TYR E 1 182 ? 54.553  14.009  26.278  1.00 61.50  ? 182 TYR E CE1 1 
ATOM   8472  C CE2 . TYR E 1 182 ? 56.831  14.256  25.547  1.00 83.58  ? 182 TYR E CE2 1 
ATOM   8473  C CZ  . TYR E 1 182 ? 55.467  14.210  25.257  1.00 77.38  ? 182 TYR E CZ  1 
ATOM   8474  O OH  . TYR E 1 182 ? 55.007  14.393  23.961  1.00 60.73  ? 182 TYR E OH  1 
ATOM   8475  N N   . ASP E 1 183 ? 55.018  13.504  32.121  1.00 81.62  ? 183 ASP E N   1 
ATOM   8476  C CA  . ASP E 1 183 ? 54.762  12.881  33.429  1.00 81.07  ? 183 ASP E CA  1 
ATOM   8477  C C   . ASP E 1 183 ? 55.676  11.673  33.614  1.00 84.58  ? 183 ASP E C   1 
ATOM   8478  O O   . ASP E 1 183 ? 55.204  10.569  33.945  1.00 83.45  ? 183 ASP E O   1 
ATOM   8479  C CB  . ASP E 1 183 ? 53.295  12.415  33.491  1.00 103.15 ? 183 ASP E CB  1 
ATOM   8480  C CG  . ASP E 1 183 ? 52.736  12.345  34.918  1.00 102.99 ? 183 ASP E CG  1 
ATOM   8481  O OD1 . ASP E 1 183 ? 53.474  11.935  35.846  1.00 103.15 ? 183 ASP E OD1 1 
ATOM   8482  O OD2 . ASP E 1 183 ? 51.541  12.686  35.104  1.00 81.46  ? 183 ASP E OD2 1 
ATOM   8483  N N   . THR E 1 184 ? 56.976  11.879  33.411  1.00 76.43  ? 184 THR E N   1 
ATOM   8484  C CA  . THR E 1 184 ? 57.941  10.792  33.524  1.00 74.65  ? 184 THR E CA  1 
ATOM   8485  C C   . THR E 1 184 ? 57.611  9.804   34.633  1.00 76.54  ? 184 THR E C   1 
ATOM   8486  O O   . THR E 1 184 ? 57.716  8.587   34.432  1.00 78.99  ? 184 THR E O   1 
ATOM   8487  C CB  . THR E 1 184 ? 59.377  11.317  33.746  1.00 74.66  ? 184 THR E CB  1 
ATOM   8488  O OG1 . THR E 1 184 ? 59.414  12.132  34.925  1.00 97.28  ? 184 THR E OG1 1 
ATOM   8489  C CG2 . THR E 1 184 ? 59.846  12.131  32.541  1.00 71.81  ? 184 THR E CG2 1 
ATOM   8490  N N   . GLU E 1 185 ? 57.197  10.306  35.795  1.00 78.80  ? 185 GLU E N   1 
ATOM   8491  C CA  . GLU E 1 185 ? 56.888  9.399   36.902  1.00 91.39  ? 185 GLU E CA  1 
ATOM   8492  C C   . GLU E 1 185 ? 55.838  8.365   36.520  1.00 85.39  ? 185 GLU E C   1 
ATOM   8493  O O   . GLU E 1 185 ? 56.073  7.156   36.627  1.00 89.01  ? 185 GLU E O   1 
ATOM   8494  C CB  . GLU E 1 185 ? 56.396  10.153  38.151  1.00 103.15 ? 185 GLU E CB  1 
ATOM   8495  C CG  . GLU E 1 185 ? 56.188  9.193   39.347  1.00 103.15 ? 185 GLU E CG  1 
ATOM   8496  C CD  . GLU E 1 185 ? 55.449  9.805   40.539  1.00 103.15 ? 185 GLU E CD  1 
ATOM   8497  O OE1 . GLU E 1 185 ? 54.329  10.350  40.356  1.00 103.15 ? 185 GLU E OE1 1 
ATOM   8498  O OE2 . GLU E 1 185 ? 55.988  9.721   41.667  1.00 94.62  ? 185 GLU E OE2 1 
ATOM   8499  N N   . MET E 1 186 ? 54.680  8.852   36.090  1.00 85.31  ? 186 MET E N   1 
ATOM   8500  C CA  . MET E 1 186 ? 53.563  8.000   35.692  1.00 86.46  ? 186 MET E CA  1 
ATOM   8501  C C   . MET E 1 186 ? 53.946  7.001   34.592  1.00 89.45  ? 186 MET E C   1 
ATOM   8502  O O   . MET E 1 186 ? 53.327  5.934   34.454  1.00 76.84  ? 186 MET E O   1 
ATOM   8503  C CB  . MET E 1 186 ? 52.404  8.887   35.221  1.00 96.88  ? 186 MET E CB  1 
ATOM   8504  C CG  . MET E 1 186 ? 51.234  8.161   34.555  1.00 70.41  ? 186 MET E CG  1 
ATOM   8505  S SD  . MET E 1 186 ? 50.019  9.421   34.053  1.00 99.25  ? 186 MET E SD  1 
ATOM   8506  C CE  . MET E 1 186 ? 48.674  8.370   33.271  1.00 53.77  ? 186 MET E CE  1 
ATOM   8507  N N   . ILE E 1 187 ? 54.955  7.350   33.803  1.00 74.45  ? 187 ILE E N   1 
ATOM   8508  C CA  . ILE E 1 187 ? 55.397  6.464   32.736  1.00 86.31  ? 187 ILE E CA  1 
ATOM   8509  C C   . ILE E 1 187 ? 55.901  5.179   33.404  1.00 91.59  ? 187 ILE E C   1 
ATOM   8510  O O   . ILE E 1 187 ? 55.160  4.180   33.484  1.00 78.83  ? 187 ILE E O   1 
ATOM   8511  C CB  . ILE E 1 187 ? 56.525  7.129   31.894  1.00 89.15  ? 187 ILE E CB  1 
ATOM   8512  C CG1 . ILE E 1 187 ? 55.998  8.415   31.235  1.00 72.20  ? 187 ILE E CG1 1 
ATOM   8513  C CG2 . ILE E 1 187 ? 57.015  6.170   30.830  1.00 66.93  ? 187 ILE E CG2 1 
ATOM   8514  C CD1 . ILE E 1 187 ? 57.043  9.172   30.423  1.00 68.33  ? 187 ILE E CD1 1 
ATOM   8515  N N   . ARG E 1 188 ? 57.150  5.228   33.890  1.00 97.24  ? 188 ARG E N   1 
ATOM   8516  C CA  . ARG E 1 188 ? 57.805  4.117   34.600  1.00 89.62  ? 188 ARG E CA  1 
ATOM   8517  C C   . ARG E 1 188 ? 56.738  3.236   35.262  1.00 92.81  ? 188 ARG E C   1 
ATOM   8518  O O   . ARG E 1 188 ? 56.762  1.999   35.176  1.00 87.45  ? 188 ARG E O   1 
ATOM   8519  C CB  . ARG E 1 188 ? 58.713  4.669   35.709  1.00 74.05  ? 188 ARG E CB  1 
ATOM   8520  C CG  . ARG E 1 188 ? 59.508  5.907   35.351  1.00 89.73  ? 188 ARG E CG  1 
ATOM   8521  C CD  . ARG E 1 188 ? 60.229  6.468   36.599  1.00 103.15 ? 188 ARG E CD  1 
ATOM   8522  N NE  . ARG E 1 188 ? 61.068  7.640   36.321  1.00 102.87 ? 188 ARG E NE  1 
ATOM   8523  C CZ  . ARG E 1 188 ? 62.191  7.604   35.610  1.00 99.50  ? 188 ARG E CZ  1 
ATOM   8524  N NH1 . ARG E 1 188 ? 62.615  6.452   35.099  1.00 91.35  ? 188 ARG E NH1 1 
ATOM   8525  N NH2 . ARG E 1 188 ? 62.901  8.711   35.421  1.00 83.16  ? 188 ARG E NH2 1 
ATOM   8526  N N   . PHE E 1 189 ? 55.808  3.901   35.940  1.00 80.19  ? 189 PHE E N   1 
ATOM   8527  C CA  . PHE E 1 189 ? 54.731  3.209   36.618  1.00 90.97  ? 189 PHE E CA  1 
ATOM   8528  C C   . PHE E 1 189 ? 54.199  2.083   35.737  1.00 89.23  ? 189 PHE E C   1 
ATOM   8529  O O   . PHE E 1 189 ? 54.524  0.903   35.948  1.00 85.85  ? 189 PHE E O   1 
ATOM   8530  C CB  . PHE E 1 189 ? 53.592  4.182   36.940  1.00 79.28  ? 189 PHE E CB  1 
ATOM   8531  C CG  . PHE E 1 189 ? 52.565  3.614   37.885  1.00 75.94  ? 189 PHE E CG  1 
ATOM   8532  C CD1 . PHE E 1 189 ? 52.598  3.928   39.241  1.00 80.53  ? 189 PHE E CD1 1 
ATOM   8533  C CD2 . PHE E 1 189 ? 51.590  2.735   37.428  1.00 69.15  ? 189 PHE E CD2 1 
ATOM   8534  C CE1 . PHE E 1 189 ? 51.673  3.373   40.128  1.00 69.63  ? 189 PHE E CE1 1 
ATOM   8535  C CE2 . PHE E 1 189 ? 50.671  2.179   38.305  1.00 97.24  ? 189 PHE E CE2 1 
ATOM   8536  C CZ  . PHE E 1 189 ? 50.713  2.499   39.659  1.00 79.38  ? 189 PHE E CZ  1 
ATOM   8537  N N   . VAL E 1 190 ? 53.396  2.473   34.743  1.00 93.92  ? 190 VAL E N   1 
ATOM   8538  C CA  . VAL E 1 190 ? 52.755  1.543   33.803  1.00 87.92  ? 190 VAL E CA  1 
ATOM   8539  C C   . VAL E 1 190 ? 53.712  0.682   32.978  1.00 84.05  ? 190 VAL E C   1 
ATOM   8540  O O   . VAL E 1 190 ? 53.348  -0.415  32.562  1.00 87.16  ? 190 VAL E O   1 
ATOM   8541  C CB  . VAL E 1 190 ? 51.836  2.296   32.803  1.00 81.80  ? 190 VAL E CB  1 
ATOM   8542  C CG1 . VAL E 1 190 ? 50.876  1.312   32.139  1.00 69.60  ? 190 VAL E CG1 1 
ATOM   8543  C CG2 . VAL E 1 190 ? 51.069  3.392   33.518  1.00 78.09  ? 190 VAL E CG2 1 
ATOM   8544  N N   . ARG E 1 191 ? 54.924  1.173   32.740  1.00 76.50  ? 191 ARG E N   1 
ATOM   8545  C CA  . ARG E 1 191 ? 55.894  0.425   31.946  1.00 77.35  ? 191 ARG E CA  1 
ATOM   8546  C C   . ARG E 1 191 ? 55.937  -1.081  32.274  1.00 78.05  ? 191 ARG E C   1 
ATOM   8547  O O   . ARG E 1 191 ? 55.485  -1.892  31.462  1.00 79.05  ? 191 ARG E O   1 
ATOM   8548  C CB  . ARG E 1 191 ? 57.287  1.064   32.083  1.00 75.50  ? 191 ARG E CB  1 
ATOM   8549  C CG  . ARG E 1 191 ? 58.341  0.557   31.098  1.00 84.56  ? 191 ARG E CG  1 
ATOM   8550  C CD  . ARG E 1 191 ? 57.924  0.790   29.640  1.00 84.19  ? 191 ARG E CD  1 
ATOM   8551  N NE  . ARG E 1 191 ? 56.855  -0.127  29.242  1.00 91.29  ? 191 ARG E NE  1 
ATOM   8552  C CZ  . ARG E 1 191 ? 56.322  -0.190  28.028  1.00 46.86  ? 191 ARG E CZ  1 
ATOM   8553  N NH1 . ARG E 1 191 ? 56.747  0.618   27.070  1.00 73.95  ? 191 ARG E NH1 1 
ATOM   8554  N NH2 . ARG E 1 191 ? 55.377  -1.079  27.770  1.00 63.90  ? 191 ARG E NH2 1 
ATOM   8555  N N   . PRO E 1 192 ? 56.446  -1.480  33.467  1.00 85.57  ? 192 PRO E N   1 
ATOM   8556  C CA  . PRO E 1 192 ? 56.488  -2.921  33.771  1.00 85.56  ? 192 PRO E CA  1 
ATOM   8557  C C   . PRO E 1 192 ? 55.162  -3.656  33.999  1.00 80.92  ? 192 PRO E C   1 
ATOM   8558  O O   . PRO E 1 192 ? 55.143  -4.706  34.648  1.00 85.17  ? 192 PRO E O   1 
ATOM   8559  C CB  . PRO E 1 192 ? 57.405  -2.992  34.999  1.00 84.94  ? 192 PRO E CB  1 
ATOM   8560  C CG  . PRO E 1 192 ? 57.167  -1.684  35.674  1.00 86.11  ? 192 PRO E CG  1 
ATOM   8561  C CD  . PRO E 1 192 ? 57.160  -0.716  34.514  1.00 84.48  ? 192 PRO E CD  1 
ATOM   8562  N N   . LEU E 1 193 ? 54.063  -3.137  33.455  1.00 82.44  ? 193 LEU E N   1 
ATOM   8563  C CA  . LEU E 1 193 ? 52.766  -3.789  33.646  1.00 82.57  ? 193 LEU E CA  1 
ATOM   8564  C C   . LEU E 1 193 ? 52.105  -4.259  32.341  1.00 92.57  ? 193 LEU E C   1 
ATOM   8565  O O   . LEU E 1 193 ? 51.020  -4.881  32.362  1.00 88.27  ? 193 LEU E O   1 
ATOM   8566  C CB  . LEU E 1 193 ? 51.828  -2.852  34.420  1.00 86.81  ? 193 LEU E CB  1 
ATOM   8567  C CG  . LEU E 1 193 ? 52.272  -2.523  35.859  1.00 93.12  ? 193 LEU E CG  1 
ATOM   8568  C CD1 . LEU E 1 193 ? 51.634  -1.215  36.312  1.00 66.47  ? 193 LEU E CD1 1 
ATOM   8569  C CD2 . LEU E 1 193 ? 51.924  -3.686  36.805  1.00 62.83  ? 193 LEU E CD2 1 
ATOM   8570  N N   . THR E 1 194 ? 52.763  -3.970  31.216  1.00 81.59  ? 194 THR E N   1 
ATOM   8571  C CA  . THR E 1 194 ? 52.275  -4.377  29.901  1.00 70.50  ? 194 THR E CA  1 
ATOM   8572  C C   . THR E 1 194 ? 53.425  -4.347  28.900  1.00 76.70  ? 194 THR E C   1 
ATOM   8573  O O   . THR E 1 194 ? 54.429  -3.652  29.110  1.00 73.38  ? 194 THR E O   1 
ATOM   8574  C CB  . THR E 1 194 ? 51.153  -3.434  29.381  1.00 90.74  ? 194 THR E CB  1 
ATOM   8575  O OG1 . THR E 1 194 ? 50.720  -3.876  28.084  1.00 75.24  ? 194 THR E OG1 1 
ATOM   8576  C CG2 . THR E 1 194 ? 51.667  -1.987  29.270  1.00 54.55  ? 194 THR E CG2 1 
ATOM   8577  N N   . THR E 1 195 ? 53.285  -5.101  27.813  1.00 80.59  ? 195 THR E N   1 
ATOM   8578  C CA  . THR E 1 195 ? 54.320  -5.129  26.784  1.00 84.09  ? 195 THR E CA  1 
ATOM   8579  C C   . THR E 1 195 ? 53.854  -4.334  25.567  1.00 86.62  ? 195 THR E C   1 
ATOM   8580  O O   . THR E 1 195 ? 54.645  -4.081  24.641  1.00 88.19  ? 195 THR E O   1 
ATOM   8581  C CB  . THR E 1 195 ? 54.623  -6.557  26.329  1.00 91.68  ? 195 THR E CB  1 
ATOM   8582  O OG1 . THR E 1 195 ? 53.560  -7.020  25.481  1.00 76.10  ? 195 THR E OG1 1 
ATOM   8583  C CG2 . THR E 1 195 ? 54.758  -7.479  27.548  1.00 88.70  ? 195 THR E CG2 1 
ATOM   8584  N N   . LEU E 1 196 ? 52.567  -3.961  25.566  1.00 81.96  ? 196 LEU E N   1 
ATOM   8585  C CA  . LEU E 1 196 ? 51.985  -3.170  24.487  1.00 57.49  ? 196 LEU E CA  1 
ATOM   8586  C C   . LEU E 1 196 ? 52.800  -1.899  24.415  1.00 72.72  ? 196 LEU E C   1 
ATOM   8587  O O   . LEU E 1 196 ? 53.377  -1.472  25.428  1.00 71.70  ? 196 LEU E O   1 
ATOM   8588  C CB  . LEU E 1 196 ? 50.544  -2.801  24.807  1.00 60.66  ? 196 LEU E CB  1 
ATOM   8589  C CG  . LEU E 1 196 ? 49.573  -3.953  25.047  1.00 67.43  ? 196 LEU E CG  1 
ATOM   8590  C CD1 . LEU E 1 196 ? 48.191  -3.396  25.306  1.00 57.25  ? 196 LEU E CD1 1 
ATOM   8591  C CD2 . LEU E 1 196 ? 49.557  -4.876  23.843  1.00 77.07  ? 196 LEU E CD2 1 
ATOM   8592  N N   . PRO E 1 197 ? 52.876  -1.273  23.226  1.00 68.53  ? 197 PRO E N   1 
ATOM   8593  C CA  . PRO E 1 197 ? 53.653  -0.030  23.096  1.00 73.72  ? 197 PRO E CA  1 
ATOM   8594  C C   . PRO E 1 197 ? 52.953  1.103   23.852  1.00 70.38  ? 197 PRO E C   1 
ATOM   8595  O O   . PRO E 1 197 ? 51.723  1.122   23.942  1.00 72.34  ? 197 PRO E O   1 
ATOM   8596  C CB  . PRO E 1 197 ? 53.676  0.221   21.581  1.00 55.35  ? 197 PRO E CB  1 
ATOM   8597  C CG  . PRO E 1 197 ? 53.454  -1.140  20.987  1.00 71.93  ? 197 PRO E CG  1 
ATOM   8598  C CD  . PRO E 1 197 ? 52.414  -1.744  21.909  1.00 78.36  ? 197 PRO E CD  1 
ATOM   8599  N N   . ILE E 1 198 ? 53.730  2.041   24.393  1.00 69.18  ? 198 ILE E N   1 
ATOM   8600  C CA  . ILE E 1 198 ? 53.173  3.164   25.142  1.00 59.65  ? 198 ILE E CA  1 
ATOM   8601  C C   . ILE E 1 198 ? 53.507  4.499   24.498  1.00 69.13  ? 198 ILE E C   1 
ATOM   8602  O O   . ILE E 1 198 ? 54.674  4.777   24.189  1.00 76.41  ? 198 ILE E O   1 
ATOM   8603  C CB  . ILE E 1 198 ? 53.716  3.205   26.580  1.00 73.73  ? 198 ILE E CB  1 
ATOM   8604  C CG1 . ILE E 1 198 ? 53.099  2.086   27.415  1.00 73.79  ? 198 ILE E CG1 1 
ATOM   8605  C CG2 . ILE E 1 198 ? 53.413  4.563   27.210  1.00 72.39  ? 198 ILE E CG2 1 
ATOM   8606  C CD1 . ILE E 1 198 ? 53.686  1.998   28.826  1.00 79.77  ? 198 ILE E CD1 1 
ATOM   8607  N N   . ILE E 1 199 ? 52.491  5.335   24.315  1.00 62.66  ? 199 ILE E N   1 
ATOM   8608  C CA  . ILE E 1 199 ? 52.703  6.646   23.730  1.00 64.44  ? 199 ILE E CA  1 
ATOM   8609  C C   . ILE E 1 199 ? 52.592  7.678   24.842  1.00 67.75  ? 199 ILE E C   1 
ATOM   8610  O O   . ILE E 1 199 ? 51.491  7.960   25.321  1.00 51.92  ? 199 ILE E O   1 
ATOM   8611  C CB  . ILE E 1 199 ? 51.640  6.976   22.670  1.00 68.65  ? 199 ILE E CB  1 
ATOM   8612  C CG1 . ILE E 1 199 ? 51.668  5.935   21.548  1.00 60.53  ? 199 ILE E CG1 1 
ATOM   8613  C CG2 . ILE E 1 199 ? 51.892  8.369   22.128  1.00 56.99  ? 199 ILE E CG2 1 
ATOM   8614  C CD1 . ILE E 1 199 ? 50.402  5.888   20.718  1.00 41.09  ? 199 ILE E CD1 1 
ATOM   8615  N N   . ALA E 1 200 ? 53.729  8.227   25.264  1.00 61.13  ? 200 ALA E N   1 
ATOM   8616  C CA  . ALA E 1 200 ? 53.735  9.236   26.321  1.00 52.96  ? 200 ALA E CA  1 
ATOM   8617  C C   . ALA E 1 200 ? 53.045  10.478  25.771  1.00 66.18  ? 200 ALA E C   1 
ATOM   8618  O O   . ALA E 1 200 ? 53.474  11.021  24.748  1.00 62.90  ? 200 ALA E O   1 
ATOM   8619  C CB  . ALA E 1 200 ? 55.161  9.558   26.713  1.00 73.54  ? 200 ALA E CB  1 
ATOM   8620  N N   . SER E 1 201 ? 51.993  10.944  26.446  1.00 62.95  ? 201 SER E N   1 
ATOM   8621  C CA  . SER E 1 201 ? 51.250  12.106  25.956  1.00 75.07  ? 201 SER E CA  1 
ATOM   8622  C C   . SER E 1 201 ? 51.013  13.295  26.901  1.00 83.85  ? 201 SER E C   1 
ATOM   8623  O O   . SER E 1 201 ? 50.926  13.140  28.121  1.00 80.47  ? 201 SER E O   1 
ATOM   8624  C CB  . SER E 1 201 ? 49.894  11.637  25.404  1.00 59.69  ? 201 SER E CB  1 
ATOM   8625  O OG  . SER E 1 201 ? 49.051  12.734  25.069  1.00 71.03  ? 201 SER E OG  1 
ATOM   8626  N N   . GLY E 1 202 ? 50.904  14.482  26.299  1.00 90.43  ? 202 GLY E N   1 
ATOM   8627  C CA  . GLY E 1 202 ? 50.625  15.710  27.034  1.00 93.88  ? 202 GLY E CA  1 
ATOM   8628  C C   . GLY E 1 202 ? 51.667  16.318  27.964  1.00 91.78  ? 202 GLY E C   1 
ATOM   8629  O O   . GLY E 1 202 ? 52.190  15.653  28.865  1.00 90.19  ? 202 GLY E O   1 
ATOM   8630  N N   . GLY E 1 203 ? 51.956  17.601  27.754  1.00 88.37  ? 203 GLY E N   1 
ATOM   8631  C CA  . GLY E 1 203 ? 52.913  18.284  28.602  1.00 83.48  ? 203 GLY E CA  1 
ATOM   8632  C C   . GLY E 1 203 ? 54.214  18.659  27.926  1.00 85.80  ? 203 GLY E C   1 
ATOM   8633  O O   . GLY E 1 203 ? 55.089  19.245  28.563  1.00 94.76  ? 203 GLY E O   1 
ATOM   8634  N N   . ALA E 1 204 ? 54.352  18.341  26.642  1.00 86.93  ? 204 ALA E N   1 
ATOM   8635  C CA  . ALA E 1 204 ? 55.586  18.650  25.927  1.00 87.90  ? 204 ALA E CA  1 
ATOM   8636  C C   . ALA E 1 204 ? 55.823  20.160  25.851  1.00 91.84  ? 204 ALA E C   1 
ATOM   8637  O O   . ALA E 1 204 ? 54.862  20.942  25.827  1.00 92.87  ? 204 ALA E O   1 
ATOM   8638  C CB  . ALA E 1 204 ? 55.543  18.043  24.523  1.00 81.35  ? 204 ALA E CB  1 
ATOM   8639  N N   . GLY E 1 205 ? 57.100  20.558  25.813  1.00 88.18  ? 205 GLY E N   1 
ATOM   8640  C CA  . GLY E 1 205 ? 57.461  21.973  25.744  1.00 84.89  ? 205 GLY E CA  1 
ATOM   8641  C C   . GLY E 1 205 ? 58.758  22.273  24.991  1.00 82.73  ? 205 GLY E C   1 
ATOM   8642  O O   . GLY E 1 205 ? 58.925  23.379  24.470  1.00 72.25  ? 205 GLY E O   1 
ATOM   8643  N N   . LYS E 1 206 ? 59.675  21.300  24.943  1.00 78.69  ? 206 LYS E N   1 
ATOM   8644  C CA  . LYS E 1 206 ? 60.959  21.444  24.240  1.00 81.38  ? 206 LYS E CA  1 
ATOM   8645  C C   . LYS E 1 206 ? 61.684  20.111  24.031  1.00 81.57  ? 206 LYS E C   1 
ATOM   8646  O O   . LYS E 1 206 ? 61.345  19.092  24.654  1.00 72.23  ? 206 LYS E O   1 
ATOM   8647  C CB  . LYS E 1 206 ? 61.910  22.385  24.998  1.00 98.73  ? 206 LYS E CB  1 
ATOM   8648  C CG  . LYS E 1 206 ? 62.147  22.013  26.451  1.00 86.30  ? 206 LYS E CG  1 
ATOM   8649  C CD  . LYS E 1 206 ? 63.237  22.883  27.081  1.00 99.83  ? 206 LYS E CD  1 
ATOM   8650  C CE  . LYS E 1 206 ? 63.016  23.044  28.588  1.00 92.20  ? 206 LYS E CE  1 
ATOM   8651  N NZ  . LYS E 1 206 ? 62.507  21.785  29.202  1.00 74.22  ? 206 LYS E NZ  1 
ATOM   8652  N N   . MET E 1 207 ? 62.699  20.139  23.167  1.00 70.70  ? 207 MET E N   1 
ATOM   8653  C CA  . MET E 1 207 ? 63.492  18.955  22.859  1.00 68.36  ? 207 MET E CA  1 
ATOM   8654  C C   . MET E 1 207 ? 64.109  18.376  24.131  1.00 76.07  ? 207 MET E C   1 
ATOM   8655  O O   . MET E 1 207 ? 64.930  17.455  24.082  1.00 77.56  ? 207 MET E O   1 
ATOM   8656  C CB  . MET E 1 207 ? 64.592  19.324  21.864  1.00 60.62  ? 207 MET E CB  1 
ATOM   8657  C CG  . MET E 1 207 ? 64.065  20.065  20.651  1.00 70.75  ? 207 MET E CG  1 
ATOM   8658  S SD  . MET E 1 207 ? 65.357  20.459  19.435  1.00 96.79  ? 207 MET E SD  1 
ATOM   8659  C CE  . MET E 1 207 ? 64.913  22.190  19.002  1.00 64.21  ? 207 MET E CE  1 
ATOM   8660  N N   . GLU E 1 208 ? 63.700  18.929  25.267  1.00 81.49  ? 208 GLU E N   1 
ATOM   8661  C CA  . GLU E 1 208 ? 64.193  18.513  26.574  1.00 90.84  ? 208 GLU E CA  1 
ATOM   8662  C C   . GLU E 1 208 ? 63.220  17.515  27.190  1.00 89.32  ? 208 GLU E C   1 
ATOM   8663  O O   . GLU E 1 208 ? 63.625  16.524  27.819  1.00 87.57  ? 208 GLU E O   1 
ATOM   8664  C CB  . GLU E 1 208 ? 64.312  19.742  27.491  1.00 97.12  ? 208 GLU E CB  1 
ATOM   8665  C CG  . GLU E 1 208 ? 65.327  19.609  28.625  1.00 102.48 ? 208 GLU E CG  1 
ATOM   8666  C CD  . GLU E 1 208 ? 66.747  19.404  28.106  1.00 102.54 ? 208 GLU E CD  1 
ATOM   8667  O OE1 . GLU E 1 208 ? 67.135  20.108  27.142  1.00 103.15 ? 208 GLU E OE1 1 
ATOM   8668  O OE2 . GLU E 1 208 ? 67.475  18.550  28.666  1.00 88.26  ? 208 GLU E OE2 1 
ATOM   8669  N N   . HIS E 1 209 ? 61.932  17.782  26.999  1.00 84.85  ? 209 HIS E N   1 
ATOM   8670  C CA  . HIS E 1 209 ? 60.883  16.933  27.542  1.00 89.56  ? 209 HIS E CA  1 
ATOM   8671  C C   . HIS E 1 209 ? 60.733  15.578  26.865  1.00 90.81  ? 209 HIS E C   1 
ATOM   8672  O O   . HIS E 1 209 ? 60.275  14.614  27.493  1.00 88.87  ? 209 HIS E O   1 
ATOM   8673  C CB  . HIS E 1 209 ? 59.568  17.704  27.513  1.00 92.36  ? 209 HIS E CB  1 
ATOM   8674  C CG  . HIS E 1 209 ? 59.588  18.923  28.379  1.00 92.90  ? 209 HIS E CG  1 
ATOM   8675  N ND1 . HIS E 1 209 ? 58.642  19.923  28.290  1.00 100.05 ? 209 HIS E ND1 1 
ATOM   8676  C CD2 . HIS E 1 209 ? 60.436  19.292  29.370  1.00 80.46  ? 209 HIS E CD2 1 
ATOM   8677  C CE1 . HIS E 1 209 ? 58.909  20.857  29.188  1.00 103.15 ? 209 HIS E CE1 1 
ATOM   8678  N NE2 . HIS E 1 209 ? 59.992  20.497  29.856  1.00 103.15 ? 209 HIS E NE2 1 
ATOM   8679  N N   . PHE E 1 210 ? 61.105  15.491  25.589  1.00 91.82  ? 210 PHE E N   1 
ATOM   8680  C CA  . PHE E 1 210 ? 61.018  14.209  24.891  1.00 85.65  ? 210 PHE E CA  1 
ATOM   8681  C C   . PHE E 1 210 ? 62.188  13.355  25.374  1.00 80.56  ? 210 PHE E C   1 
ATOM   8682  O O   . PHE E 1 210 ? 61.992  12.251  25.887  1.00 62.82  ? 210 PHE E O   1 
ATOM   8683  C CB  . PHE E 1 210 ? 61.083  14.397  23.368  1.00 74.52  ? 210 PHE E CB  1 
ATOM   8684  C CG  . PHE E 1 210 ? 59.839  15.012  22.773  1.00 57.47  ? 210 PHE E CG  1 
ATOM   8685  C CD1 . PHE E 1 210 ? 59.397  16.269  23.179  1.00 69.22  ? 210 PHE E CD1 1 
ATOM   8686  C CD2 . PHE E 1 210 ? 59.123  14.345  21.786  1.00 79.11  ? 210 PHE E CD2 1 
ATOM   8687  C CE1 . PHE E 1 210 ? 58.253  16.857  22.606  1.00 90.84  ? 210 PHE E CE1 1 
ATOM   8688  C CE2 . PHE E 1 210 ? 57.969  14.921  21.198  1.00 79.43  ? 210 PHE E CE2 1 
ATOM   8689  C CZ  . PHE E 1 210 ? 57.538  16.178  21.611  1.00 83.16  ? 210 PHE E CZ  1 
ATOM   8690  N N   . LEU E 1 211 ? 63.400  13.886  25.219  1.00 87.23  ? 211 LEU E N   1 
ATOM   8691  C CA  . LEU E 1 211 ? 64.616  13.196  25.656  1.00 95.90  ? 211 LEU E CA  1 
ATOM   8692  C C   . LEU E 1 211 ? 64.415  12.553  27.023  1.00 92.17  ? 211 LEU E C   1 
ATOM   8693  O O   . LEU E 1 211 ? 64.950  11.478  27.291  1.00 91.52  ? 211 LEU E O   1 
ATOM   8694  C CB  . LEU E 1 211 ? 65.789  14.177  25.759  1.00 103.02 ? 211 LEU E CB  1 
ATOM   8695  C CG  . LEU E 1 211 ? 67.123  13.544  26.175  1.00 88.56  ? 211 LEU E CG  1 
ATOM   8696  C CD1 . LEU E 1 211 ? 67.677  12.775  24.985  1.00 88.26  ? 211 LEU E CD1 1 
ATOM   8697  C CD2 . LEU E 1 211 ? 68.119  14.616  26.623  1.00 69.63  ? 211 LEU E CD2 1 
ATOM   8698  N N   . GLU E 1 212 ? 63.641  13.223  27.880  1.00 95.60  ? 212 GLU E N   1 
ATOM   8699  C CA  . GLU E 1 212 ? 63.367  12.735  29.238  1.00 98.17  ? 212 GLU E CA  1 
ATOM   8700  C C   . GLU E 1 212 ? 62.277  11.647  29.263  1.00 86.94  ? 212 GLU E C   1 
ATOM   8701  O O   . GLU E 1 212 ? 62.178  10.858  30.201  1.00 83.53  ? 212 GLU E O   1 
ATOM   8702  C CB  . GLU E 1 212 ? 62.969  13.923  30.142  1.00 103.15 ? 212 GLU E CB  1 
ATOM   8703  C CG  . GLU E 1 212 ? 64.059  15.003  30.217  1.00 103.15 ? 212 GLU E CG  1 
ATOM   8704  C CD  . GLU E 1 212 ? 63.712  16.216  31.092  1.00 103.15 ? 212 GLU E CD  1 
ATOM   8705  O OE1 . GLU E 1 212 ? 64.615  17.072  31.259  1.00 90.23  ? 212 GLU E OE1 1 
ATOM   8706  O OE2 . GLU E 1 212 ? 62.565  16.327  31.605  1.00 103.15 ? 212 GLU E OE2 1 
ATOM   8707  N N   . ALA E 1 213 ? 61.458  11.615  28.221  1.00 100.83 ? 213 ALA E N   1 
ATOM   8708  C CA  . ALA E 1 213 ? 60.384  10.626  28.123  1.00 98.84  ? 213 ALA E CA  1 
ATOM   8709  C C   . ALA E 1 213 ? 61.018  9.259   27.933  1.00 100.47 ? 213 ALA E C   1 
ATOM   8710  O O   . ALA E 1 213 ? 61.299  8.552   28.905  1.00 103.15 ? 213 ALA E O   1 
ATOM   8711  C CB  . ALA E 1 213 ? 59.479  10.949  26.940  1.00 71.65  ? 213 ALA E CB  1 
ATOM   8712  N N   . PHE E 1 214 ? 61.256  8.916   26.669  1.00 95.84  ? 214 PHE E N   1 
ATOM   8713  C CA  . PHE E 1 214 ? 61.848  7.642   26.288  1.00 93.81  ? 214 PHE E CA  1 
ATOM   8714  C C   . PHE E 1 214 ? 62.628  6.972   27.408  1.00 91.51  ? 214 PHE E C   1 
ATOM   8715  O O   . PHE E 1 214 ? 62.405  5.790   27.690  1.00 88.81  ? 214 PHE E O   1 
ATOM   8716  C CB  . PHE E 1 214 ? 62.708  7.839   25.040  1.00 82.84  ? 214 PHE E CB  1 
ATOM   8717  C CG  . PHE E 1 214 ? 61.946  8.454   23.899  1.00 92.33  ? 214 PHE E CG  1 
ATOM   8718  C CD1 . PHE E 1 214 ? 60.750  7.882   23.460  1.00 87.28  ? 214 PHE E CD1 1 
ATOM   8719  C CD2 . PHE E 1 214 ? 62.371  9.639   23.311  1.00 95.97  ? 214 PHE E CD2 1 
ATOM   8720  C CE1 . PHE E 1 214 ? 59.986  8.488   22.455  1.00 68.19  ? 214 PHE E CE1 1 
ATOM   8721  C CE2 . PHE E 1 214 ? 61.611  10.253  22.303  1.00 82.41  ? 214 PHE E CE2 1 
ATOM   8722  C CZ  . PHE E 1 214 ? 60.416  9.672   21.880  1.00 65.41  ? 214 PHE E CZ  1 
ATOM   8723  N N   . LEU E 1 215 ? 63.519  7.708   28.069  1.00 90.34  ? 215 LEU E N   1 
ATOM   8724  C CA  . LEU E 1 215 ? 64.265  7.102   29.174  1.00 88.27  ? 215 LEU E CA  1 
ATOM   8725  C C   . LEU E 1 215 ? 63.260  6.389   30.089  1.00 88.83  ? 215 LEU E C   1 
ATOM   8726  O O   . LEU E 1 215 ? 63.418  5.205   30.405  1.00 93.51  ? 215 LEU E O   1 
ATOM   8727  C CB  . LEU E 1 215 ? 65.015  8.162   29.979  1.00 69.92  ? 215 LEU E CB  1 
ATOM   8728  C CG  . LEU E 1 215 ? 65.864  9.185   29.219  1.00 92.08  ? 215 LEU E CG  1 
ATOM   8729  C CD1 . LEU E 1 215 ? 66.871  9.794   30.199  1.00 75.60  ? 215 LEU E CD1 1 
ATOM   8730  C CD2 . LEU E 1 215 ? 66.586  8.532   28.045  1.00 89.02  ? 215 LEU E CD2 1 
ATOM   8731  N N   . ALA E 1 216 ? 62.215  7.103   30.492  1.00 79.72  ? 216 ALA E N   1 
ATOM   8732  C CA  . ALA E 1 216 ? 61.197  6.525   31.362  1.00 77.96  ? 216 ALA E CA  1 
ATOM   8733  C C   . ALA E 1 216 ? 60.518  5.321   30.710  1.00 83.75  ? 216 ALA E C   1 
ATOM   8734  O O   . ALA E 1 216 ? 59.633  4.691   31.307  1.00 86.73  ? 216 ALA E O   1 
ATOM   8735  C CB  . ALA E 1 216 ? 60.164  7.576   31.728  1.00 84.71  ? 216 ALA E CB  1 
ATOM   8736  N N   . GLY E 1 217 ? 60.921  5.010   29.478  1.00 84.03  ? 217 GLY E N   1 
ATOM   8737  C CA  . GLY E 1 217 ? 60.357  3.858   28.790  1.00 82.56  ? 217 GLY E CA  1 
ATOM   8738  C C   . GLY E 1 217 ? 59.107  4.139   27.983  1.00 82.09  ? 217 GLY E C   1 
ATOM   8739  O O   . GLY E 1 217 ? 58.040  3.575   28.247  1.00 74.83  ? 217 GLY E O   1 
ATOM   8740  N N   . ALA E 1 218 ? 59.235  5.019   26.997  1.00 83.27  ? 218 ALA E N   1 
ATOM   8741  C CA  . ALA E 1 218 ? 58.107  5.354   26.139  1.00 82.71  ? 218 ALA E CA  1 
ATOM   8742  C C   . ALA E 1 218 ? 58.449  4.928   24.724  1.00 85.99  ? 218 ALA E C   1 
ATOM   8743  O O   . ALA E 1 218 ? 59.578  5.136   24.263  1.00 81.62  ? 218 ALA E O   1 
ATOM   8744  C CB  . ALA E 1 218 ? 57.836  6.841   26.180  1.00 92.97  ? 218 ALA E CB  1 
ATOM   8745  N N   . ASP E 1 219 ? 57.479  4.325   24.039  1.00 75.08  ? 219 ASP E N   1 
ATOM   8746  C CA  . ASP E 1 219 ? 57.694  3.876   22.672  1.00 70.25  ? 219 ASP E CA  1 
ATOM   8747  C C   . ASP E 1 219 ? 57.333  4.995   21.675  1.00 79.75  ? 219 ASP E C   1 
ATOM   8748  O O   . ASP E 1 219 ? 57.430  4.815   20.452  1.00 84.02  ? 219 ASP E O   1 
ATOM   8749  C CB  . ASP E 1 219 ? 56.865  2.613   22.408  1.00 56.66  ? 219 ASP E CB  1 
ATOM   8750  C CG  . ASP E 1 219 ? 57.182  1.481   23.399  1.00 91.65  ? 219 ASP E CG  1 
ATOM   8751  O OD1 . ASP E 1 219 ? 58.374  1.090   23.510  1.00 74.32  ? 219 ASP E OD1 1 
ATOM   8752  O OD2 . ASP E 1 219 ? 56.243  0.976   24.069  1.00 80.10  ? 219 ASP E OD2 1 
ATOM   8753  N N   . ALA E 1 220 ? 56.932  6.153   22.204  1.00 68.62  ? 220 ALA E N   1 
ATOM   8754  C CA  . ALA E 1 220 ? 56.565  7.293   21.367  1.00 69.19  ? 220 ALA E CA  1 
ATOM   8755  C C   . ALA E 1 220 ? 56.155  8.517   22.176  1.00 64.45  ? 220 ALA E C   1 
ATOM   8756  O O   . ALA E 1 220 ? 55.604  8.401   23.270  1.00 74.85  ? 220 ALA E O   1 
ATOM   8757  C CB  . ALA E 1 220 ? 55.432  6.906   20.417  1.00 53.37  ? 220 ALA E CB  1 
ATOM   8758  N N   . ALA E 1 221 ? 56.414  9.693   21.618  1.00 57.89  ? 221 ALA E N   1 
ATOM   8759  C CA  . ALA E 1 221 ? 56.066  10.943  22.273  1.00 57.62  ? 221 ALA E CA  1 
ATOM   8760  C C   . ALA E 1 221 ? 54.992  11.678  21.464  1.00 61.56  ? 221 ALA E C   1 
ATOM   8761  O O   . ALA E 1 221 ? 55.227  12.083  20.323  1.00 61.07  ? 221 ALA E O   1 
ATOM   8762  C CB  . ALA E 1 221 ? 57.314  11.807  22.413  1.00 60.87  ? 221 ALA E CB  1 
ATOM   8763  N N   . LEU E 1 222 ? 53.814  11.844  22.056  1.00 57.06  ? 222 LEU E N   1 
ATOM   8764  C CA  . LEU E 1 222 ? 52.700  12.520  21.382  1.00 75.29  ? 222 LEU E CA  1 
ATOM   8765  C C   . LEU E 1 222 ? 52.553  13.986  21.791  1.00 72.19  ? 222 LEU E C   1 
ATOM   8766  O O   . LEU E 1 222 ? 52.342  14.276  22.969  1.00 76.75  ? 222 LEU E O   1 
ATOM   8767  C CB  . LEU E 1 222 ? 51.387  11.795  21.686  1.00 74.05  ? 222 LEU E CB  1 
ATOM   8768  C CG  . LEU E 1 222 ? 50.115  12.585  21.361  1.00 78.94  ? 222 LEU E CG  1 
ATOM   8769  C CD1 . LEU E 1 222 ? 50.068  12.908  19.888  1.00 54.63  ? 222 LEU E CD1 1 
ATOM   8770  C CD2 . LEU E 1 222 ? 48.900  11.767  21.767  1.00 84.27  ? 222 LEU E CD2 1 
ATOM   8771  N N   . ALA E 1 223 ? 52.639  14.905  20.832  1.00 52.97  ? 223 ALA E N   1 
ATOM   8772  C CA  . ALA E 1 223 ? 52.513  16.314  21.181  1.00 66.11  ? 223 ALA E CA  1 
ATOM   8773  C C   . ALA E 1 223 ? 51.437  17.102  20.442  1.00 71.63  ? 223 ALA E C   1 
ATOM   8774  O O   . ALA E 1 223 ? 51.158  16.875  19.255  1.00 63.34  ? 223 ALA E O   1 
ATOM   8775  C CB  . ALA E 1 223 ? 53.856  17.012  21.024  1.00 66.99  ? 223 ALA E CB  1 
ATOM   8776  N N   . ALA E 1 224 ? 50.838  18.041  21.167  1.00 72.54  ? 224 ALA E N   1 
ATOM   8777  C CA  . ALA E 1 224 ? 49.806  18.904  20.612  1.00 90.21  ? 224 ALA E CA  1 
ATOM   8778  C C   . ALA E 1 224 ? 50.325  20.344  20.566  1.00 94.81  ? 224 ALA E C   1 
ATOM   8779  O O   . ALA E 1 224 ? 50.767  20.830  19.511  1.00 86.90  ? 224 ALA E O   1 
ATOM   8780  C CB  . ALA E 1 224 ? 48.539  18.829  21.470  1.00 92.66  ? 224 ALA E CB  1 
ATOM   8781  N N   . SER E 1 225 ? 50.258  21.012  21.720  1.00 94.52  ? 225 SER E N   1 
ATOM   8782  C CA  . SER E 1 225 ? 50.703  22.401  21.883  1.00 81.80  ? 225 SER E CA  1 
ATOM   8783  C C   . SER E 1 225 ? 51.902  22.800  21.008  1.00 77.20  ? 225 SER E C   1 
ATOM   8784  O O   . SER E 1 225 ? 51.761  23.562  20.041  1.00 62.91  ? 225 SER E O   1 
ATOM   8785  C CB  . SER E 1 225 ? 51.052  22.660  23.359  1.00 88.19  ? 225 SER E CB  1 
ATOM   8786  O OG  . SER E 1 225 ? 49.946  22.404  24.225  1.00 76.18  ? 225 SER E OG  1 
ATOM   8787  N N   . VAL E 1 226 ? 53.071  22.255  21.341  1.00 63.25  ? 226 VAL E N   1 
ATOM   8788  C CA  . VAL E 1 226 ? 54.319  22.570  20.647  1.00 71.03  ? 226 VAL E CA  1 
ATOM   8789  C C   . VAL E 1 226 ? 54.413  22.471  19.132  1.00 77.42  ? 226 VAL E C   1 
ATOM   8790  O O   . VAL E 1 226 ? 55.180  23.219  18.522  1.00 75.52  ? 226 VAL E O   1 
ATOM   8791  C CB  . VAL E 1 226 ? 55.484  21.733  21.188  1.00 80.35  ? 226 VAL E CB  1 
ATOM   8792  C CG1 . VAL E 1 226 ? 55.765  22.095  22.631  1.00 81.26  ? 226 VAL E CG1 1 
ATOM   8793  C CG2 . VAL E 1 226 ? 55.157  20.250  21.051  1.00 81.68  ? 226 VAL E CG2 1 
ATOM   8794  N N   . PHE E 1 227 ? 53.676  21.560  18.506  1.00 81.47  ? 227 PHE E N   1 
ATOM   8795  C CA  . PHE E 1 227 ? 53.810  21.433  17.057  1.00 72.67  ? 227 PHE E CA  1 
ATOM   8796  C C   . PHE E 1 227 ? 53.041  22.455  16.224  1.00 85.95  ? 227 PHE E C   1 
ATOM   8797  O O   . PHE E 1 227 ? 53.341  22.648  15.038  1.00 53.18  ? 227 PHE E O   1 
ATOM   8798  C CB  . PHE E 1 227 ? 53.474  20.005  16.628  1.00 82.81  ? 227 PHE E CB  1 
ATOM   8799  C CG  . PHE E 1 227 ? 54.554  19.009  16.971  1.00 82.82  ? 227 PHE E CG  1 
ATOM   8800  C CD1 . PHE E 1 227 ? 55.879  19.249  16.603  1.00 65.59  ? 227 PHE E CD1 1 
ATOM   8801  C CD2 . PHE E 1 227 ? 54.254  17.839  17.671  1.00 84.11  ? 227 PHE E CD2 1 
ATOM   8802  C CE1 . PHE E 1 227 ? 56.891  18.337  16.932  1.00 71.79  ? 227 PHE E CE1 1 
ATOM   8803  C CE2 . PHE E 1 227 ? 55.259  16.919  18.005  1.00 68.44  ? 227 PHE E CE2 1 
ATOM   8804  C CZ  . PHE E 1 227 ? 56.579  17.169  17.636  1.00 70.39  ? 227 PHE E CZ  1 
ATOM   8805  N N   . HIS E 1 228 ? 52.069  23.123  16.846  1.00 81.89  ? 228 HIS E N   1 
ATOM   8806  C CA  . HIS E 1 228 ? 51.291  24.155  16.143  1.00 95.58  ? 228 HIS E CA  1 
ATOM   8807  C C   . HIS E 1 228 ? 52.022  25.508  16.223  1.00 100.47 ? 228 HIS E C   1 
ATOM   8808  O O   . HIS E 1 228 ? 52.533  26.017  15.217  1.00 90.93  ? 228 HIS E O   1 
ATOM   8809  C CB  . HIS E 1 228 ? 49.901  24.279  16.767  1.00 93.59  ? 228 HIS E CB  1 
ATOM   8810  C CG  . HIS E 1 228 ? 49.126  22.999  16.758  1.00 103.15 ? 228 HIS E CG  1 
ATOM   8811  N ND1 . HIS E 1 228 ? 47.859  22.891  17.296  1.00 103.15 ? 228 HIS E ND1 1 
ATOM   8812  C CD2 . HIS E 1 228 ? 49.444  21.765  16.291  1.00 97.12  ? 228 HIS E CD2 1 
ATOM   8813  C CE1 . HIS E 1 228 ? 47.431  21.646  17.162  1.00 103.15 ? 228 HIS E CE1 1 
ATOM   8814  N NE2 . HIS E 1 228 ? 48.373  20.942  16.555  1.00 103.15 ? 228 HIS E NE2 1 
ATOM   8815  N N   . PHE E 1 229 ? 52.066  26.074  17.430  1.00 101.87 ? 229 PHE E N   1 
ATOM   8816  C CA  . PHE E 1 229 ? 52.740  27.350  17.693  1.00 101.22 ? 229 PHE E CA  1 
ATOM   8817  C C   . PHE E 1 229 ? 54.090  27.437  16.966  1.00 103.15 ? 229 PHE E C   1 
ATOM   8818  O O   . PHE E 1 229 ? 54.475  28.513  16.478  1.00 103.15 ? 229 PHE E O   1 
ATOM   8819  C CB  . PHE E 1 229 ? 52.977  27.509  19.202  1.00 95.17  ? 229 PHE E CB  1 
ATOM   8820  C CG  . PHE E 1 229 ? 51.711  27.612  20.014  1.00 95.22  ? 229 PHE E CG  1 
ATOM   8821  C CD1 . PHE E 1 229 ? 50.619  26.792  19.745  1.00 84.04  ? 229 PHE E CD1 1 
ATOM   8822  C CD2 . PHE E 1 229 ? 51.619  28.522  21.064  1.00 103.15 ? 229 PHE E CD2 1 
ATOM   8823  C CE1 . PHE E 1 229 ? 49.450  26.876  20.514  1.00 98.79  ? 229 PHE E CE1 1 
ATOM   8824  C CE2 . PHE E 1 229 ? 50.461  28.615  21.837  1.00 85.97  ? 229 PHE E CE2 1 
ATOM   8825  C CZ  . PHE E 1 229 ? 49.375  27.792  21.562  1.00 87.05  ? 229 PHE E CZ  1 
ATOM   8826  N N   . ARG E 1 230 ? 54.786  26.293  16.907  1.00 100.36 ? 230 ARG E N   1 
ATOM   8827  C CA  . ARG E 1 230 ? 56.110  26.127  16.275  1.00 92.78  ? 230 ARG E CA  1 
ATOM   8828  C C   . ARG E 1 230 ? 57.215  26.080  17.328  1.00 87.37  ? 230 ARG E C   1 
ATOM   8829  O O   . ARG E 1 230 ? 58.407  26.243  17.028  1.00 75.07  ? 230 ARG E O   1 
ATOM   8830  C CB  . ARG E 1 230 ? 56.383  27.235  15.247  1.00 89.08  ? 230 ARG E CB  1 
ATOM   8831  C CG  . ARG E 1 230 ? 55.805  26.912  13.874  1.00 89.08  ? 230 ARG E CG  1 
ATOM   8832  C CD  . ARG E 1 230 ? 56.616  25.795  13.189  1.00 81.11  ? 230 ARG E CD  1 
ATOM   8833  N NE  . ARG E 1 230 ? 55.912  25.247  12.032  1.00 82.40  ? 230 ARG E NE  1 
ATOM   8834  C CZ  . ARG E 1 230 ? 55.404  25.981  11.039  1.00 103.15 ? 230 ARG E CZ  1 
ATOM   8835  N NH1 . ARG E 1 230 ? 55.525  27.308  11.052  1.00 92.69  ? 230 ARG E NH1 1 
ATOM   8836  N NH2 . ARG E 1 230 ? 54.752  25.389  10.039  1.00 90.76  ? 230 ARG E NH2 1 
ATOM   8837  N N   . GLU E 1 231 ? 56.783  25.829  18.561  1.00 81.58  ? 231 GLU E N   1 
ATOM   8838  C CA  . GLU E 1 231 ? 57.657  25.730  19.718  1.00 84.99  ? 231 GLU E CA  1 
ATOM   8839  C C   . GLU E 1 231 ? 58.775  24.701  19.537  1.00 89.06  ? 231 GLU E C   1 
ATOM   8840  O O   . GLU E 1 231 ? 59.841  24.834  20.140  1.00 89.96  ? 231 GLU E O   1 
ATOM   8841  C CB  . GLU E 1 231 ? 56.830  25.386  20.965  1.00 94.00  ? 231 GLU E CB  1 
ATOM   8842  C CG  . GLU E 1 231 ? 55.684  26.367  21.240  1.00 90.83  ? 231 GLU E CG  1 
ATOM   8843  C CD  . GLU E 1 231 ? 55.202  26.321  22.683  1.00 103.15 ? 231 GLU E CD  1 
ATOM   8844  O OE1 . GLU E 1 231 ? 54.313  25.495  23.025  1.00 79.08  ? 231 GLU E OE1 1 
ATOM   8845  O OE2 . GLU E 1 231 ? 55.741  27.120  23.482  1.00 103.15 ? 231 GLU E OE2 1 
ATOM   8846  N N   . ILE E 1 232 ? 58.541  23.679  18.713  1.00 88.45  ? 232 ILE E N   1 
ATOM   8847  C CA  . ILE E 1 232 ? 59.559  22.653  18.471  1.00 84.00  ? 232 ILE E CA  1 
ATOM   8848  C C   . ILE E 1 232 ? 59.646  22.203  17.019  1.00 69.73  ? 232 ILE E C   1 
ATOM   8849  O O   . ILE E 1 232 ? 58.660  21.769  16.418  1.00 82.75  ? 232 ILE E O   1 
ATOM   8850  C CB  . ILE E 1 232 ? 59.320  21.357  19.307  1.00 88.11  ? 232 ILE E CB  1 
ATOM   8851  C CG1 . ILE E 1 232 ? 59.212  21.677  20.802  1.00 89.26  ? 232 ILE E CG1 1 
ATOM   8852  C CG2 . ILE E 1 232 ? 60.473  20.382  19.071  1.00 85.60  ? 232 ILE E CG2 1 
ATOM   8853  C CD1 . ILE E 1 232 ? 58.616  20.525  21.629  1.00 99.29  ? 232 ILE E CD1 1 
ATOM   8854  N N   . ASP E 1 233 ? 60.839  22.296  16.460  1.00 70.09  ? 233 ASP E N   1 
ATOM   8855  C CA  . ASP E 1 233 ? 61.063  21.856  15.099  1.00 75.96  ? 233 ASP E CA  1 
ATOM   8856  C C   . ASP E 1 233 ? 61.208  20.343  15.242  1.00 93.95  ? 233 ASP E C   1 
ATOM   8857  O O   . ASP E 1 233 ? 61.804  19.851  16.226  1.00 86.69  ? 233 ASP E O   1 
ATOM   8858  C CB  . ASP E 1 233 ? 62.363  22.457  14.555  1.00 96.54  ? 233 ASP E CB  1 
ATOM   8859  C CG  . ASP E 1 233 ? 62.516  22.272  13.056  1.00 103.15 ? 233 ASP E CG  1 
ATOM   8860  O OD1 . ASP E 1 233 ? 61.829  23.007  12.302  1.00 103.15 ? 233 ASP E OD1 1 
ATOM   8861  O OD2 . ASP E 1 233 ? 63.319  21.397  12.635  1.00 88.40  ? 233 ASP E OD2 1 
ATOM   8862  N N   . VAL E 1 234 ? 60.664  19.603  14.275  1.00 95.77  ? 234 VAL E N   1 
ATOM   8863  C CA  . VAL E 1 234 ? 60.721  18.140  14.303  1.00 87.73  ? 234 VAL E CA  1 
ATOM   8864  C C   . VAL E 1 234 ? 62.072  17.602  13.820  1.00 86.99  ? 234 VAL E C   1 
ATOM   8865  O O   . VAL E 1 234 ? 62.667  16.725  14.452  1.00 82.38  ? 234 VAL E O   1 
ATOM   8866  C CB  . VAL E 1 234 ? 59.590  17.531  13.430  1.00 85.51  ? 234 VAL E CB  1 
ATOM   8867  C CG1 . VAL E 1 234 ? 59.665  16.007  13.457  1.00 86.29  ? 234 VAL E CG1 1 
ATOM   8868  C CG2 . VAL E 1 234 ? 58.234  18.016  13.932  1.00 59.18  ? 234 VAL E CG2 1 
ATOM   8869  N N   . ARG E 1 235 ? 62.550  18.126  12.697  1.00 78.82  ? 235 ARG E N   1 
ATOM   8870  C CA  . ARG E 1 235 ? 63.829  17.696  12.144  1.00 88.45  ? 235 ARG E CA  1 
ATOM   8871  C C   . ARG E 1 235 ? 64.939  17.796  13.209  1.00 92.37  ? 235 ARG E C   1 
ATOM   8872  O O   . ARG E 1 235 ? 65.622  16.808  13.516  1.00 83.03  ? 235 ARG E O   1 
ATOM   8873  C CB  . ARG E 1 235 ? 64.176  18.569  10.934  1.00 70.78  ? 235 ARG E CB  1 
ATOM   8874  C CG  . ARG E 1 235 ? 64.632  17.778  9.729   1.00 75.74  ? 235 ARG E CG  1 
ATOM   8875  C CD  . ARG E 1 235 ? 65.932  17.053  10.020  1.00 89.75  ? 235 ARG E CD  1 
ATOM   8876  N NE  . ARG E 1 235 ? 66.385  16.256  8.884   1.00 61.31  ? 235 ARG E NE  1 
ATOM   8877  C CZ  . ARG E 1 235 ? 67.586  15.698  8.806   1.00 85.43  ? 235 ARG E CZ  1 
ATOM   8878  N NH1 . ARG E 1 235 ? 68.454  15.859  9.801   1.00 90.09  ? 235 ARG E NH1 1 
ATOM   8879  N NH2 . ARG E 1 235 ? 67.918  14.973  7.743   1.00 93.12  ? 235 ARG E NH2 1 
ATOM   8880  N N   . GLU E 1 236 ? 65.095  18.999  13.766  1.00 87.98  ? 236 GLU E N   1 
ATOM   8881  C CA  . GLU E 1 236 ? 66.088  19.288  14.796  1.00 88.32  ? 236 GLU E CA  1 
ATOM   8882  C C   . GLU E 1 236 ? 66.002  18.241  15.895  1.00 91.92  ? 236 GLU E C   1 
ATOM   8883  O O   . GLU E 1 236 ? 66.927  17.441  16.121  1.00 91.35  ? 236 GLU E O   1 
ATOM   8884  C CB  . GLU E 1 236 ? 65.801  20.665  15.406  1.00 93.57  ? 236 GLU E CB  1 
ATOM   8885  C CG  . GLU E 1 236 ? 65.877  21.845  14.440  1.00 77.69  ? 236 GLU E CG  1 
ATOM   8886  C CD  . GLU E 1 236 ? 67.277  22.421  14.331  1.00 92.82  ? 236 GLU E CD  1 
ATOM   8887  O OE1 . GLU E 1 236 ? 68.172  21.748  13.764  1.00 67.88  ? 236 GLU E OE1 1 
ATOM   8888  O OE2 . GLU E 1 236 ? 67.485  23.552  14.827  1.00 90.90  ? 236 GLU E OE2 1 
ATOM   8889  N N   . LEU E 1 237 ? 64.862  18.276  16.576  1.00 84.75  ? 237 LEU E N   1 
ATOM   8890  C CA  . LEU E 1 237 ? 64.546  17.385  17.673  1.00 61.74  ? 237 LEU E CA  1 
ATOM   8891  C C   . LEU E 1 237 ? 64.959  15.941  17.411  1.00 78.28  ? 237 LEU E C   1 
ATOM   8892  O O   . LEU E 1 237 ? 65.005  15.130  18.341  1.00 77.47  ? 237 LEU E O   1 
ATOM   8893  C CB  . LEU E 1 237 ? 63.048  17.474  17.942  1.00 67.94  ? 237 LEU E CB  1 
ATOM   8894  C CG  . LEU E 1 237 ? 62.395  16.548  18.960  1.00 74.56  ? 237 LEU E CG  1 
ATOM   8895  C CD1 . LEU E 1 237 ? 62.996  16.758  20.341  1.00 61.40  ? 237 LEU E CD1 1 
ATOM   8896  C CD2 . LEU E 1 237 ? 60.901  16.831  18.970  1.00 88.14  ? 237 LEU E CD2 1 
ATOM   8897  N N   . LYS E 1 238 ? 65.268  15.611  16.156  1.00 72.75  ? 238 LYS E N   1 
ATOM   8898  C CA  . LYS E 1 238 ? 65.667  14.251  15.820  1.00 82.12  ? 238 LYS E CA  1 
ATOM   8899  C C   . LYS E 1 238 ? 67.055  13.839  16.339  1.00 86.98  ? 238 LYS E C   1 
ATOM   8900  O O   . LYS E 1 238 ? 67.153  13.342  17.461  1.00 75.98  ? 238 LYS E O   1 
ATOM   8901  C CB  . LYS E 1 238 ? 65.555  14.042  14.315  1.00 89.69  ? 238 LYS E CB  1 
ATOM   8902  C CG  . LYS E 1 238 ? 64.091  13.965  13.832  1.00 85.40  ? 238 LYS E CG  1 
ATOM   8903  C CD  . LYS E 1 238 ? 63.353  12.757  14.433  1.00 81.48  ? 238 LYS E CD  1 
ATOM   8904  C CE  . LYS E 1 238 ? 61.929  12.623  13.886  1.00 78.48  ? 238 LYS E CE  1 
ATOM   8905  N NZ  . LYS E 1 238 ? 61.503  11.197  13.623  1.00 58.88  ? 238 LYS E NZ  1 
ATOM   8906  N N   . GLU E 1 239 ? 68.122  14.026  15.561  1.00 85.19  ? 239 GLU E N   1 
ATOM   8907  C CA  . GLU E 1 239 ? 69.459  13.638  16.053  1.00 96.96  ? 239 GLU E CA  1 
ATOM   8908  C C   . GLU E 1 239 ? 69.702  14.109  17.501  1.00 98.44  ? 239 GLU E C   1 
ATOM   8909  O O   . GLU E 1 239 ? 70.416  13.450  18.268  1.00 91.78  ? 239 GLU E O   1 
ATOM   8910  C CB  . GLU E 1 239 ? 70.567  14.181  15.133  1.00 94.22  ? 239 GLU E CB  1 
ATOM   8911  C CG  . GLU E 1 239 ? 70.381  15.629  14.677  1.00 98.11  ? 239 GLU E CG  1 
ATOM   8912  C CD  . GLU E 1 239 ? 70.823  15.832  13.226  1.00 103.15 ? 239 GLU E CD  1 
ATOM   8913  O OE1 . GLU E 1 239 ? 70.431  16.858  12.609  1.00 103.15 ? 239 GLU E OE1 1 
ATOM   8914  O OE2 . GLU E 1 239 ? 71.563  14.958  12.703  1.00 98.70  ? 239 GLU E OE2 1 
ATOM   8915  N N   . TYR E 1 240 ? 69.102  15.242  17.869  1.00 93.97  ? 240 TYR E N   1 
ATOM   8916  C CA  . TYR E 1 240 ? 69.221  15.779  19.224  1.00 89.23  ? 240 TYR E CA  1 
ATOM   8917  C C   . TYR E 1 240 ? 68.798  14.721  20.248  1.00 95.38  ? 240 TYR E C   1 
ATOM   8918  O O   . TYR E 1 240 ? 69.104  14.845  21.446  1.00 98.57  ? 240 TYR E O   1 
ATOM   8919  C CB  . TYR E 1 240 ? 68.317  17.003  19.388  1.00 87.25  ? 240 TYR E CB  1 
ATOM   8920  C CG  . TYR E 1 240 ? 68.278  17.551  20.800  1.00 92.13  ? 240 TYR E CG  1 
ATOM   8921  C CD1 . TYR E 1 240 ? 69.059  18.648  21.169  1.00 93.42  ? 240 TYR E CD1 1 
ATOM   8922  C CD2 . TYR E 1 240 ? 67.495  16.940  21.782  1.00 79.02  ? 240 TYR E CD2 1 
ATOM   8923  C CE1 . TYR E 1 240 ? 69.056  19.118  22.488  1.00 101.63 ? 240 TYR E CE1 1 
ATOM   8924  C CE2 . TYR E 1 240 ? 67.490  17.388  23.094  1.00 77.67  ? 240 TYR E CE2 1 
ATOM   8925  C CZ  . TYR E 1 240 ? 68.268  18.477  23.450  1.00 100.39 ? 240 TYR E CZ  1 
ATOM   8926  O OH  . TYR E 1 240 ? 68.265  18.916  24.768  1.00 92.62  ? 240 TYR E OH  1 
ATOM   8927  N N   . LEU E 1 241 ? 68.074  13.698  19.787  1.00 97.95  ? 241 LEU E N   1 
ATOM   8928  C CA  . LEU E 1 241 ? 67.606  12.615  20.666  1.00 94.61  ? 241 LEU E CA  1 
ATOM   8929  C C   . LEU E 1 241 ? 68.326  11.294  20.398  1.00 97.91  ? 241 LEU E C   1 
ATOM   8930  O O   . LEU E 1 241 ? 68.215  10.338  21.186  1.00 93.74  ? 241 LEU E O   1 
ATOM   8931  C CB  . LEU E 1 241 ? 66.089  12.407  20.522  1.00 88.29  ? 241 LEU E CB  1 
ATOM   8932  C CG  . LEU E 1 241 ? 65.190  13.335  21.339  1.00 88.40  ? 241 LEU E CG  1 
ATOM   8933  C CD1 . LEU E 1 241 ? 65.541  14.759  21.010  1.00 93.44  ? 241 LEU E CD1 1 
ATOM   8934  C CD2 . LEU E 1 241 ? 63.721  13.068  21.032  1.00 89.05  ? 241 LEU E CD2 1 
ATOM   8935  N N   . LYS E 1 242 ? 69.032  11.226  19.273  1.00 83.12  ? 242 LYS E N   1 
ATOM   8936  C CA  . LYS E 1 242 ? 69.792  10.028  18.942  1.00 92.69  ? 242 LYS E CA  1 
ATOM   8937  C C   . LYS E 1 242 ? 71.185  10.321  19.476  1.00 98.64  ? 242 LYS E C   1 
ATOM   8938  O O   . LYS E 1 242 ? 71.835  9.465   20.095  1.00 99.06  ? 242 LYS E O   1 
ATOM   8939  C CB  . LYS E 1 242 ? 69.860  9.817   17.429  1.00 83.11  ? 242 LYS E CB  1 
ATOM   8940  C CG  . LYS E 1 242 ? 71.109  9.081   16.995  1.00 83.03  ? 242 LYS E CG  1 
ATOM   8941  C CD  . LYS E 1 242 ? 71.208  7.720   17.655  1.00 62.53  ? 242 LYS E CD  1 
ATOM   8942  C CE  . LYS E 1 242 ? 70.516  6.688   16.794  1.00 88.96  ? 242 LYS E CE  1 
ATOM   8943  N NZ  . LYS E 1 242 ? 71.116  6.705   15.417  1.00 72.78  ? 242 LYS E NZ  1 
ATOM   8944  N N   . LYS E 1 243 ? 71.624  11.552  19.216  1.00 97.08  ? 243 LYS E N   1 
ATOM   8945  C CA  . LYS E 1 243 ? 72.913  12.049  19.659  1.00 99.60  ? 243 LYS E CA  1 
ATOM   8946  C C   . LYS E 1 243 ? 72.807  12.132  21.182  1.00 94.48  ? 243 LYS E C   1 
ATOM   8947  O O   . LYS E 1 243 ? 73.522  12.899  21.830  1.00 100.86 ? 243 LYS E O   1 
ATOM   8948  C CB  . LYS E 1 243 ? 73.167  13.445  19.049  1.00 103.15 ? 243 LYS E CB  1 
ATOM   8949  C CG  . LYS E 1 243 ? 74.538  14.079  19.363  1.00 103.15 ? 243 LYS E CG  1 
ATOM   8950  C CD  . LYS E 1 243 ? 74.675  15.474  18.697  1.00 103.15 ? 243 LYS E CD  1 
ATOM   8951  C CE  . LYS E 1 243 ? 76.062  16.097  18.920  1.00 93.28  ? 243 LYS E CE  1 
ATOM   8952  N NZ  . LYS E 1 243 ? 76.337  16.413  20.364  1.00 86.09  ? 243 LYS E NZ  1 
ATOM   8953  N N   . HIS E 1 244 ? 71.891  11.337  21.734  1.00 80.81  ? 244 HIS E N   1 
ATOM   8954  C CA  . HIS E 1 244 ? 71.639  11.284  23.162  1.00 71.23  ? 244 HIS E CA  1 
ATOM   8955  C C   . HIS E 1 244 ? 71.250  9.862   23.539  1.00 79.32  ? 244 HIS E C   1 
ATOM   8956  O O   . HIS E 1 244 ? 70.537  9.630   24.527  1.00 76.66  ? 244 HIS E O   1 
ATOM   8957  C CB  . HIS E 1 244 ? 70.522  12.260  23.543  1.00 63.02  ? 244 HIS E CB  1 
ATOM   8958  C CG  . HIS E 1 244 ? 70.996  13.668  23.752  1.00 87.59  ? 244 HIS E CG  1 
ATOM   8959  N ND1 . HIS E 1 244 ? 71.795  14.332  22.842  1.00 82.24  ? 244 HIS E ND1 1 
ATOM   8960  C CD2 . HIS E 1 244 ? 70.782  14.540  24.770  1.00 71.88  ? 244 HIS E CD2 1 
ATOM   8961  C CE1 . HIS E 1 244 ? 72.053  15.550  23.289  1.00 72.82  ? 244 HIS E CE1 1 
ATOM   8962  N NE2 . HIS E 1 244 ? 71.450  15.702  24.456  1.00 75.49  ? 244 HIS E NE2 1 
ATOM   8963  N N   . GLY E 1 245 ? 71.726  8.915   22.736  1.00 81.11  ? 245 GLY E N   1 
ATOM   8964  C CA  . GLY E 1 245 ? 71.453  7.506   22.984  1.00 91.85  ? 245 GLY E CA  1 
ATOM   8965  C C   . GLY E 1 245 ? 70.238  6.872   22.310  1.00 92.81  ? 245 GLY E C   1 
ATOM   8966  O O   . GLY E 1 245 ? 70.336  5.760   21.778  1.00 84.72  ? 245 GLY E O   1 
ATOM   8967  N N   . VAL E 1 246 ? 69.100  7.570   22.327  1.00 95.98  ? 246 VAL E N   1 
ATOM   8968  C CA  . VAL E 1 246 ? 67.845  7.055   21.747  1.00 103.15 ? 246 VAL E CA  1 
ATOM   8969  C C   . VAL E 1 246 ? 67.835  6.631   20.258  1.00 101.32 ? 246 VAL E C   1 
ATOM   8970  O O   . VAL E 1 246 ? 68.537  7.206   19.418  1.00 90.66  ? 246 VAL E O   1 
ATOM   8971  C CB  . VAL E 1 246 ? 66.692  8.071   21.959  1.00 103.15 ? 246 VAL E CB  1 
ATOM   8972  C CG1 . VAL E 1 246 ? 65.357  7.372   21.770  1.00 103.15 ? 246 VAL E CG1 1 
ATOM   8973  C CG2 . VAL E 1 246 ? 66.781  8.685   23.353  1.00 103.15 ? 246 VAL E CG2 1 
ATOM   8974  N N   . ASN E 1 247 ? 67.014  5.623   19.949  1.00 94.02  ? 247 ASN E N   1 
ATOM   8975  C CA  . ASN E 1 247 ? 66.877  5.090   18.582  1.00 89.60  ? 247 ASN E CA  1 
ATOM   8976  C C   . ASN E 1 247 ? 65.749  5.818   17.849  1.00 90.84  ? 247 ASN E C   1 
ATOM   8977  O O   . ASN E 1 247 ? 64.576  5.449   17.971  1.00 89.42  ? 247 ASN E O   1 
ATOM   8978  C CB  . ASN E 1 247 ? 66.568  3.592   18.655  1.00 87.29  ? 247 ASN E CB  1 
ATOM   8979  C CG  . ASN E 1 247 ? 66.442  2.945   17.287  1.00 87.21  ? 247 ASN E CG  1 
ATOM   8980  O OD1 . ASN E 1 247 ? 67.383  2.938   16.494  1.00 59.12  ? 247 ASN E OD1 1 
ATOM   8981  N ND2 . ASN E 1 247 ? 65.267  2.384   17.010  1.00 93.69  ? 247 ASN E ND2 1 
ATOM   8982  N N   . VAL E 1 248 ? 66.102  6.845   17.075  1.00 94.29  ? 248 VAL E N   1 
ATOM   8983  C CA  . VAL E 1 248 ? 65.105  7.651   16.358  1.00 86.66  ? 248 VAL E CA  1 
ATOM   8984  C C   . VAL E 1 248 ? 65.175  7.592   14.829  1.00 83.86  ? 248 VAL E C   1 
ATOM   8985  O O   . VAL E 1 248 ? 66.226  7.829   14.243  1.00 92.77  ? 248 VAL E O   1 
ATOM   8986  C CB  . VAL E 1 248 ? 65.234  9.128   16.785  1.00 84.88  ? 248 VAL E CB  1 
ATOM   8987  C CG1 . VAL E 1 248 ? 64.783  9.302   18.229  1.00 64.29  ? 248 VAL E CG1 1 
ATOM   8988  C CG2 . VAL E 1 248 ? 66.687  9.571   16.650  1.00 76.91  ? 248 VAL E CG2 1 
ATOM   8989  N N   . ARG E 1 249 ? 64.047  7.292   14.189  1.00 82.72  ? 249 ARG E N   1 
ATOM   8990  C CA  . ARG E 1 249 ? 63.966  7.216   12.725  1.00 72.69  ? 249 ARG E CA  1 
ATOM   8991  C C   . ARG E 1 249 ? 64.646  8.432   12.110  1.00 72.55  ? 249 ARG E C   1 
ATOM   8992  O O   . ARG E 1 249 ? 63.984  9.421   11.768  1.00 80.19  ? 249 ARG E O   1 
ATOM   8993  C CB  . ARG E 1 249 ? 62.494  7.191   12.288  1.00 83.35  ? 249 ARG E CB  1 
ATOM   8994  C CG  . ARG E 1 249 ? 62.259  7.032   10.776  1.00 76.47  ? 249 ARG E CG  1 
ATOM   8995  C CD  . ARG E 1 249 ? 60.757  7.028   10.433  1.00 72.76  ? 249 ARG E CD  1 
ATOM   8996  N NE  . ARG E 1 249 ? 60.149  8.364   10.434  1.00 60.87  ? 249 ARG E NE  1 
ATOM   8997  C CZ  . ARG E 1 249 ? 59.984  9.114   9.347   1.00 51.98  ? 249 ARG E CZ  1 
ATOM   8998  N NH1 . ARG E 1 249 ? 60.375  8.670   8.156   1.00 42.53  ? 249 ARG E NH1 1 
ATOM   8999  N NH2 . ARG E 1 249 ? 59.428  10.311  9.451   1.00 43.66  ? 249 ARG E NH2 1 
ATOM   9000  N N   . LEU E 1 250 ? 65.962  8.365   11.952  1.00 64.24  ? 250 LEU E N   1 
ATOM   9001  C CA  . LEU E 1 250 ? 66.696  9.506   11.402  1.00 81.22  ? 250 LEU E CA  1 
ATOM   9002  C C   . LEU E 1 250 ? 66.978  9.370   9.909   1.00 84.20  ? 250 LEU E C   1 
ATOM   9003  O O   . LEU E 1 250 ? 67.742  8.490   9.493   1.00 84.53  ? 250 LEU E O   1 
ATOM   9004  C CB  . LEU E 1 250 ? 68.028  9.692   12.157  1.00 80.09  ? 250 LEU E CB  1 
ATOM   9005  C CG  . LEU E 1 250 ? 68.742  11.047  12.049  1.00 78.10  ? 250 LEU E CG  1 
ATOM   9006  C CD1 . LEU E 1 250 ? 67.965  12.099  12.852  1.00 101.04 ? 250 LEU E CD1 1 
ATOM   9007  C CD2 . LEU E 1 250 ? 70.165  10.934  12.591  1.00 86.19  ? 250 LEU E CD2 1 
ATOM   9008  N N   . GLU E 1 251 ? 66.380  10.244  9.100   1.00 80.40  ? 251 GLU E N   1 
ATOM   9009  C CA  . GLU E 1 251 ? 66.620  10.182  7.669   1.00 91.37  ? 251 GLU E CA  1 
ATOM   9010  C C   . GLU E 1 251 ? 66.414  11.465  6.867   1.00 98.24  ? 251 GLU E C   1 
ATOM   9011  O O   . GLU E 1 251 ? 65.602  12.348  7.215   1.00 88.44  ? 251 GLU E O   1 
ATOM   9012  C CB  . GLU E 1 251 ? 65.788  9.060   7.048   1.00 100.95 ? 251 GLU E CB  1 
ATOM   9013  C CG  . GLU E 1 251 ? 66.247  7.676   7.466   1.00 99.04  ? 251 GLU E CG  1 
ATOM   9014  C CD  . GLU E 1 251 ? 65.346  6.585   6.950   1.00 81.92  ? 251 GLU E CD  1 
ATOM   9015  O OE1 . GLU E 1 251 ? 65.116  6.550   5.719   1.00 92.40  ? 251 GLU E OE1 1 
ATOM   9016  O OE2 . GLU E 1 251 ? 64.877  5.766   7.775   1.00 80.07  ? 251 GLU E OE2 1 
ATOM   9017  N N   . GLY E 1 252 ? 67.169  11.525  5.773   1.00 97.17  ? 252 GLY E N   1 
ATOM   9018  C CA  . GLY E 1 252 ? 67.142  12.644  4.857   1.00 92.28  ? 252 GLY E CA  1 
ATOM   9019  C C   . GLY E 1 252 ? 68.165  12.354  3.775   1.00 92.53  ? 252 GLY E C   1 
ATOM   9020  O O   . GLY E 1 252 ? 68.141  11.282  3.144   1.00 84.00  ? 252 GLY E O   1 
ATOM   9021  N N   . LEU E 1 253 ? 69.076  13.305  3.573   1.00 98.03  ? 253 LEU E N   1 
ATOM   9022  C CA  . LEU E 1 253 ? 70.135  13.188  2.566   1.00 98.28  ? 253 LEU E CA  1 
ATOM   9023  C C   . LEU E 1 253 ? 71.248  12.230  3.026   1.00 99.79  ? 253 LEU E C   1 
ATOM   9024  O O   . LEU E 1 253 ? 71.423  12.089  4.262   1.00 103.15 ? 253 LEU E O   1 
ATOM   9025  C CB  . LEU E 1 253 ? 70.729  14.581  2.280   1.00 89.61  ? 253 LEU E CB  1 
ATOM   9026  C CG  . LEU E 1 253 ? 70.158  15.796  3.038   1.00 102.20 ? 253 LEU E CG  1 
ATOM   9027  C CD1 . LEU E 1 253 ? 70.415  15.650  4.549   1.00 71.22  ? 253 LEU E CD1 1 
ATOM   9028  C CD2 . LEU E 1 253 ? 70.803  17.092  2.508   1.00 90.22  ? 253 LEU E CD2 1 
ATOM   9029  O OXT . LEU E 1 253 ? 71.943  11.641  2.155   1.00 71.40  ? 253 LEU E OXT 1 
ATOM   9030  N N   . MET F 2 1   ? 54.471  2.431   -19.662 1.00 58.07  ? 1   MET F N   1 
ATOM   9031  C CA  . MET F 2 1   ? 54.612  1.509   -18.497 1.00 56.98  ? 1   MET F CA  1 
ATOM   9032  C C   . MET F 2 1   ? 53.238  1.029   -18.027 1.00 60.38  ? 1   MET F C   1 
ATOM   9033  O O   . MET F 2 1   ? 52.385  1.827   -17.625 1.00 62.14  ? 1   MET F O   1 
ATOM   9034  C CB  . MET F 2 1   ? 55.348  2.217   -17.352 1.00 61.98  ? 1   MET F CB  1 
ATOM   9035  C CG  . MET F 2 1   ? 56.622  1.502   -16.856 1.00 96.09  ? 1   MET F CG  1 
ATOM   9036  S SD  . MET F 2 1   ? 56.381  0.126   -15.661 1.00 60.28  ? 1   MET F SD  1 
ATOM   9037  C CE  . MET F 2 1   ? 56.296  1.040   -14.150 1.00 86.81  ? 1   MET F CE  1 
ATOM   9038  N N   . ARG F 2 2   ? 53.037  -0.282  -18.073 1.00 49.26  ? 2   ARG F N   1 
ATOM   9039  C CA  . ARG F 2 2   ? 51.779  -0.892  -17.678 1.00 43.33  ? 2   ARG F CA  1 
ATOM   9040  C C   . ARG F 2 2   ? 51.941  -1.548  -16.305 1.00 56.10  ? 2   ARG F C   1 
ATOM   9041  O O   . ARG F 2 2   ? 52.737  -2.471  -16.133 1.00 50.40  ? 2   ARG F O   1 
ATOM   9042  C CB  . ARG F 2 2   ? 51.406  -1.906  -18.750 1.00 40.95  ? 2   ARG F CB  1 
ATOM   9043  C CG  . ARG F 2 2   ? 50.091  -2.613  -18.614 1.00 57.14  ? 2   ARG F CG  1 
ATOM   9044  C CD  . ARG F 2 2   ? 49.913  -3.486  -19.864 1.00 71.59  ? 2   ARG F CD  1 
ATOM   9045  N NE  . ARG F 2 2   ? 49.012  -4.612  -19.658 1.00 56.80  ? 2   ARG F NE  1 
ATOM   9046  C CZ  . ARG F 2 2   ? 47.737  -4.475  -19.322 1.00 82.20  ? 2   ARG F CZ  1 
ATOM   9047  N NH1 . ARG F 2 2   ? 47.226  -3.257  -19.154 1.00 55.83  ? 2   ARG F NH1 1 
ATOM   9048  N NH2 . ARG F 2 2   ? 46.973  -5.553  -19.163 1.00 60.30  ? 2   ARG F NH2 1 
ATOM   9049  N N   . ILE F 2 3   ? 51.184  -1.060  -15.328 1.00 44.07  ? 3   ILE F N   1 
ATOM   9050  C CA  . ILE F 2 3   ? 51.266  -1.572  -13.972 1.00 36.29  ? 3   ILE F CA  1 
ATOM   9051  C C   . ILE F 2 3   ? 49.957  -2.136  -13.441 1.00 41.98  ? 3   ILE F C   1 
ATOM   9052  O O   . ILE F 2 3   ? 48.908  -1.514  -13.562 1.00 47.50  ? 3   ILE F O   1 
ATOM   9053  C CB  . ILE F 2 3   ? 51.714  -0.468  -13.015 1.00 41.85  ? 3   ILE F CB  1 
ATOM   9054  C CG1 . ILE F 2 3   ? 53.017  0.148   -13.498 1.00 40.48  ? 3   ILE F CG1 1 
ATOM   9055  C CG2 . ILE F 2 3   ? 51.864  -1.022  -11.624 1.00 52.24  ? 3   ILE F CG2 1 
ATOM   9056  C CD1 . ILE F 2 3   ? 53.398  1.377   -12.718 1.00 50.32  ? 3   ILE F CD1 1 
ATOM   9057  N N   . GLY F 2 4   ? 50.031  -3.314  -12.834 1.00 50.16  ? 4   GLY F N   1 
ATOM   9058  C CA  . GLY F 2 4   ? 48.848  -3.936  -12.265 1.00 45.64  ? 4   GLY F CA  1 
ATOM   9059  C C   . GLY F 2 4   ? 48.980  -4.136  -10.760 1.00 40.21  ? 4   GLY F C   1 
ATOM   9060  O O   . GLY F 2 4   ? 50.074  -4.367  -10.259 1.00 49.84  ? 4   GLY F O   1 
ATOM   9061  N N   . ILE F 2 5   ? 47.866  -4.037  -10.041 1.00 43.29  ? 5   ILE F N   1 
ATOM   9062  C CA  . ILE F 2 5   ? 47.830  -4.224  -8.590  1.00 39.65  ? 5   ILE F CA  1 
ATOM   9063  C C   . ILE F 2 5   ? 46.606  -5.096  -8.256  1.00 55.63  ? 5   ILE F C   1 
ATOM   9064  O O   . ILE F 2 5   ? 45.465  -4.646  -8.419  1.00 49.59  ? 5   ILE F O   1 
ATOM   9065  C CB  . ILE F 2 5   ? 47.702  -2.857  -7.850  1.00 36.44  ? 5   ILE F CB  1 
ATOM   9066  C CG1 . ILE F 2 5   ? 48.889  -1.957  -8.193  1.00 41.42  ? 5   ILE F CG1 1 
ATOM   9067  C CG2 . ILE F 2 5   ? 47.662  -3.075  -6.361  1.00 27.66  ? 5   ILE F CG2 1 
ATOM   9068  C CD1 . ILE F 2 5   ? 48.849  -0.603  -7.538  1.00 37.68  ? 5   ILE F CD1 1 
ATOM   9069  N N   . ILE F 2 6   ? 46.831  -6.339  -7.815  1.00 54.62  ? 6   ILE F N   1 
ATOM   9070  C CA  . ILE F 2 6   ? 45.724  -7.245  -7.476  1.00 45.71  ? 6   ILE F CA  1 
ATOM   9071  C C   . ILE F 2 6   ? 44.940  -6.567  -6.370  1.00 45.06  ? 6   ILE F C   1 
ATOM   9072  O O   . ILE F 2 6   ? 45.493  -6.250  -5.318  1.00 49.37  ? 6   ILE F O   1 
ATOM   9073  C CB  . ILE F 2 6   ? 46.233  -8.649  -7.008  1.00 54.68  ? 6   ILE F CB  1 
ATOM   9074  C CG1 . ILE F 2 6   ? 46.752  -9.441  -8.211  1.00 49.75  ? 6   ILE F CG1 1 
ATOM   9075  C CG2 . ILE F 2 6   ? 45.101  -9.458  -6.394  1.00 36.75  ? 6   ILE F CG2 1 
ATOM   9076  C CD1 . ILE F 2 6   ? 47.818  -8.750  -8.993  1.00 50.89  ? 6   ILE F CD1 1 
ATOM   9077  N N   . SER F 2 7   ? 43.652  -6.343  -6.624  1.00 45.10  ? 7   SER F N   1 
ATOM   9078  C CA  . SER F 2 7   ? 42.781  -5.635  -5.689  1.00 51.61  ? 7   SER F CA  1 
ATOM   9079  C C   . SER F 2 7   ? 41.820  -6.510  -4.901  1.00 44.93  ? 7   SER F C   1 
ATOM   9080  O O   . SER F 2 7   ? 41.100  -6.015  -4.025  1.00 57.51  ? 7   SER F O   1 
ATOM   9081  C CB  . SER F 2 7   ? 41.977  -4.580  -6.455  1.00 54.44  ? 7   SER F CB  1 
ATOM   9082  O OG  . SER F 2 7   ? 41.205  -5.185  -7.484  1.00 45.31  ? 7   SER F OG  1 
ATOM   9083  N N   . VAL F 2 8   ? 41.826  -7.799  -5.228  1.00 56.19  ? 8   VAL F N   1 
ATOM   9084  C CA  . VAL F 2 8   ? 40.975  -8.818  -4.621  1.00 37.04  ? 8   VAL F CA  1 
ATOM   9085  C C   . VAL F 2 8   ? 41.326  -9.077  -3.172  1.00 51.38  ? 8   VAL F C   1 
ATOM   9086  O O   . VAL F 2 8   ? 40.481  -8.953  -2.284  1.00 52.49  ? 8   VAL F O   1 
ATOM   9087  C CB  . VAL F 2 8   ? 41.128  -10.152 -5.374  1.00 53.70  ? 8   VAL F CB  1 
ATOM   9088  C CG1 . VAL F 2 8   ? 40.152  -11.179 -4.845  1.00 76.03  ? 8   VAL F CG1 1 
ATOM   9089  C CG2 . VAL F 2 8   ? 40.922  -9.930  -6.852  1.00 46.28  ? 8   VAL F CG2 1 
ATOM   9090  N N   . GLY F 2 9   ? 42.587  -9.462  -2.966  1.00 80.31  ? 9   GLY F N   1 
ATOM   9091  C CA  . GLY F 2 9   ? 43.124  -9.789  -1.648  1.00 60.59  ? 9   GLY F CA  1 
ATOM   9092  C C   . GLY F 2 9   ? 42.538  -9.050  -0.466  1.00 58.01  ? 9   GLY F C   1 
ATOM   9093  O O   . GLY F 2 9   ? 42.145  -7.890  -0.592  1.00 54.02  ? 9   GLY F O   1 
ATOM   9094  N N   . PRO F 2 10  ? 42.467  -9.709  0.706   1.00 47.74  ? 10  PRO F N   1 
ATOM   9095  C CA  . PRO F 2 10  ? 41.928  -9.123  1.935   1.00 41.25  ? 10  PRO F CA  1 
ATOM   9096  C C   . PRO F 2 10  ? 42.821  -7.991  2.413   1.00 45.70  ? 10  PRO F C   1 
ATOM   9097  O O   . PRO F 2 10  ? 44.016  -7.959  2.106   1.00 48.85  ? 10  PRO F O   1 
ATOM   9098  C CB  . PRO F 2 10  ? 41.931  -10.296 2.900   1.00 46.42  ? 10  PRO F CB  1 
ATOM   9099  C CG  . PRO F 2 10  ? 43.149  -11.064 2.462   1.00 54.85  ? 10  PRO F CG  1 
ATOM   9100  C CD  . PRO F 2 10  ? 42.995  -11.061 0.962   1.00 54.14  ? 10  PRO F CD  1 
ATOM   9101  N N   . GLY F 2 11  ? 42.245  -7.065  3.169   1.00 44.66  ? 11  GLY F N   1 
ATOM   9102  C CA  . GLY F 2 11  ? 43.026  -5.946  3.659   1.00 51.02  ? 11  GLY F CA  1 
ATOM   9103  C C   . GLY F 2 11  ? 42.927  -4.741  2.750   1.00 54.52  ? 11  GLY F C   1 
ATOM   9104  O O   . GLY F 2 11  ? 42.396  -4.846  1.643   1.00 36.68  ? 11  GLY F O   1 
ATOM   9105  N N   . ASN F 2 12  ? 43.433  -3.602  3.224   1.00 51.31  ? 12  ASN F N   1 
ATOM   9106  C CA  . ASN F 2 12  ? 43.402  -2.361  2.462   1.00 41.04  ? 12  ASN F CA  1 
ATOM   9107  C C   . ASN F 2 12  ? 44.464  -2.429  1.390   1.00 40.03  ? 12  ASN F C   1 
ATOM   9108  O O   . ASN F 2 12  ? 45.659  -2.488  1.682   1.00 58.95  ? 12  ASN F O   1 
ATOM   9109  C CB  . ASN F 2 12  ? 43.678  -1.153  3.356   1.00 38.29  ? 12  ASN F CB  1 
ATOM   9110  C CG  . ASN F 2 12  ? 43.396  0.178   2.652   1.00 50.08  ? 12  ASN F CG  1 
ATOM   9111  O OD1 . ASN F 2 12  ? 43.836  0.408   1.525   1.00 46.03  ? 12  ASN F OD1 1 
ATOM   9112  N ND2 . ASN F 2 12  ? 42.668  1.060   3.326   1.00 45.61  ? 12  ASN F ND2 1 
ATOM   9113  N N   . ILE F 2 13  ? 44.020  -2.404  0.146   1.00 47.22  ? 13  ILE F N   1 
ATOM   9114  C CA  . ILE F 2 13  ? 44.921  -2.475  -0.983  1.00 48.19  ? 13  ILE F CA  1 
ATOM   9115  C C   . ILE F 2 13  ? 44.975  -1.157  -1.743  1.00 44.00  ? 13  ILE F C   1 
ATOM   9116  O O   . ILE F 2 13  ? 45.765  -1.016  -2.665  1.00 49.24  ? 13  ILE F O   1 
ATOM   9117  C CB  . ILE F 2 13  ? 44.484  -3.610  -1.939  1.00 60.53  ? 13  ILE F CB  1 
ATOM   9118  C CG1 . ILE F 2 13  ? 43.188  -3.241  -2.662  1.00 49.45  ? 13  ILE F CG1 1 
ATOM   9119  C CG2 . ILE F 2 13  ? 44.238  -4.884  -1.145  1.00 63.84  ? 13  ILE F CG2 1 
ATOM   9120  C CD1 . ILE F 2 13  ? 43.393  -2.421  -3.908  1.00 35.32  ? 13  ILE F CD1 1 
ATOM   9121  N N   . MET F 2 14  ? 44.139  -0.197  -1.359  1.00 37.23  ? 14  MET F N   1 
ATOM   9122  C CA  . MET F 2 14  ? 44.118  1.093   -2.037  1.00 46.72  ? 14  MET F CA  1 
ATOM   9123  C C   . MET F 2 14  ? 45.205  2.062   -1.568  1.00 47.14  ? 14  MET F C   1 
ATOM   9124  O O   . MET F 2 14  ? 45.508  3.027   -2.256  1.00 53.30  ? 14  MET F O   1 
ATOM   9125  C CB  . MET F 2 14  ? 42.737  1.750   -1.900  1.00 50.52  ? 14  MET F CB  1 
ATOM   9126  C CG  . MET F 2 14  ? 41.612  1.054   -2.679  1.00 61.91  ? 14  MET F CG  1 
ATOM   9127  S SD  . MET F 2 14  ? 41.660  1.270   -4.497  1.00 63.93  ? 14  MET F SD  1 
ATOM   9128  C CE  . MET F 2 14  ? 41.397  3.087   -4.588  1.00 56.53  ? 14  MET F CE  1 
ATOM   9129  N N   . ASN F 2 15  ? 45.795  1.843   -0.400  1.00 46.29  ? 15  ASN F N   1 
ATOM   9130  C CA  . ASN F 2 15  ? 46.863  2.754   0.002   1.00 39.56  ? 15  ASN F CA  1 
ATOM   9131  C C   . ASN F 2 15  ? 48.022  2.549   -0.970  1.00 37.52  ? 15  ASN F C   1 
ATOM   9132  O O   . ASN F 2 15  ? 48.638  3.506   -1.422  1.00 45.83  ? 15  ASN F O   1 
ATOM   9133  C CB  . ASN F 2 15  ? 47.347  2.485   1.431   1.00 35.59  ? 15  ASN F CB  1 
ATOM   9134  C CG  . ASN F 2 15  ? 46.332  2.880   2.476   1.00 40.35  ? 15  ASN F CG  1 
ATOM   9135  O OD1 . ASN F 2 15  ? 45.762  3.964   2.425   1.00 42.44  ? 15  ASN F OD1 1 
ATOM   9136  N ND2 . ASN F 2 15  ? 46.111  2.002   3.440   1.00 49.29  ? 15  ASN F ND2 1 
ATOM   9137  N N   . LEU F 2 16  ? 48.308  1.291   -1.296  1.00 36.71  ? 16  LEU F N   1 
ATOM   9138  C CA  . LEU F 2 16  ? 49.390  0.973   -2.215  1.00 42.61  ? 16  LEU F CA  1 
ATOM   9139  C C   . LEU F 2 16  ? 49.102  1.559   -3.594  1.00 50.12  ? 16  LEU F C   1 
ATOM   9140  O O   . LEU F 2 16  ? 49.993  2.085   -4.257  1.00 42.00  ? 16  LEU F O   1 
ATOM   9141  C CB  . LEU F 2 16  ? 49.577  -0.537  -2.313  1.00 31.57  ? 16  LEU F CB  1 
ATOM   9142  C CG  . LEU F 2 16  ? 50.680  -1.028  -3.261  1.00 54.79  ? 16  LEU F CG  1 
ATOM   9143  C CD1 . LEU F 2 16  ? 52.024  -0.418  -2.879  1.00 29.34  ? 16  LEU F CD1 1 
ATOM   9144  C CD2 . LEU F 2 16  ? 50.740  -2.551  -3.219  1.00 37.93  ? 16  LEU F CD2 1 
ATOM   9145  N N   . TYR F 2 17  ? 47.850  1.459   -4.019  1.00 46.67  ? 17  TYR F N   1 
ATOM   9146  C CA  . TYR F 2 17  ? 47.434  1.998   -5.305  1.00 49.26  ? 17  TYR F CA  1 
ATOM   9147  C C   . TYR F 2 17  ? 47.822  3.475   -5.405  1.00 34.17  ? 17  TYR F C   1 
ATOM   9148  O O   . TYR F 2 17  ? 48.494  3.901   -6.351  1.00 38.62  ? 17  TYR F O   1 
ATOM   9149  C CB  . TYR F 2 17  ? 45.919  1.862   -5.463  1.00 40.66  ? 17  TYR F CB  1 
ATOM   9150  C CG  . TYR F 2 17  ? 45.387  2.586   -6.670  1.00 54.99  ? 17  TYR F CG  1 
ATOM   9151  C CD1 . TYR F 2 17  ? 45.493  2.035   -7.941  1.00 69.16  ? 17  TYR F CD1 1 
ATOM   9152  C CD2 . TYR F 2 17  ? 44.831  3.857   -6.551  1.00 55.07  ? 17  TYR F CD2 1 
ATOM   9153  C CE1 . TYR F 2 17  ? 45.062  2.732   -9.066  1.00 60.58  ? 17  TYR F CE1 1 
ATOM   9154  C CE2 . TYR F 2 17  ? 44.401  4.560   -7.667  1.00 64.11  ? 17  TYR F CE2 1 
ATOM   9155  C CZ  . TYR F 2 17  ? 44.521  3.994   -8.923  1.00 59.11  ? 17  TYR F CZ  1 
ATOM   9156  O OH  . TYR F 2 17  ? 44.125  4.705   -10.034 1.00 60.12  ? 17  TYR F OH  1 
ATOM   9157  N N   . ARG F 2 18  ? 47.397  4.252   -4.417  1.00 36.58  ? 18  ARG F N   1 
ATOM   9158  C CA  . ARG F 2 18  ? 47.685  5.672   -4.407  1.00 48.37  ? 18  ARG F CA  1 
ATOM   9159  C C   . ARG F 2 18  ? 49.166  5.921   -4.276  1.00 39.13  ? 18  ARG F C   1 
ATOM   9160  O O   . ARG F 2 18  ? 49.693  6.865   -4.849  1.00 54.07  ? 18  ARG F O   1 
ATOM   9161  C CB  . ARG F 2 18  ? 46.934  6.349   -3.273  1.00 59.45  ? 18  ARG F CB  1 
ATOM   9162  C CG  . ARG F 2 18  ? 45.432  6.333   -3.463  1.00 36.27  ? 18  ARG F CG  1 
ATOM   9163  C CD  . ARG F 2 18  ? 44.759  6.627   -2.151  1.00 46.91  ? 18  ARG F CD  1 
ATOM   9164  N NE  . ARG F 2 18  ? 43.429  6.041   -2.089  1.00 63.82  ? 18  ARG F NE  1 
ATOM   9165  C CZ  . ARG F 2 18  ? 42.856  5.606   -0.971  1.00 65.74  ? 18  ARG F CZ  1 
ATOM   9166  N NH1 . ARG F 2 18  ? 43.506  5.689   0.188   1.00 52.18  ? 18  ARG F NH1 1 
ATOM   9167  N NH2 . ARG F 2 18  ? 41.632  5.087   -1.015  1.00 79.42  ? 18  ARG F NH2 1 
ATOM   9168  N N   . GLY F 2 19  ? 49.830  5.067   -3.511  1.00 47.08  ? 19  GLY F N   1 
ATOM   9169  C CA  . GLY F 2 19  ? 51.260  5.190   -3.326  1.00 33.31  ? 19  GLY F CA  1 
ATOM   9170  C C   . GLY F 2 19  ? 51.992  4.918   -4.624  1.00 38.44  ? 19  GLY F C   1 
ATOM   9171  O O   . GLY F 2 19  ? 52.954  5.605   -4.951  1.00 39.60  ? 19  GLY F O   1 
ATOM   9172  N N   . VAL F 2 20  ? 51.534  3.912   -5.365  1.00 42.97  ? 20  VAL F N   1 
ATOM   9173  C CA  . VAL F 2 20  ? 52.141  3.557   -6.641  1.00 32.72  ? 20  VAL F CA  1 
ATOM   9174  C C   . VAL F 2 20  ? 51.936  4.698   -7.626  1.00 38.93  ? 20  VAL F C   1 
ATOM   9175  O O   . VAL F 2 20  ? 52.828  5.011   -8.406  1.00 48.98  ? 20  VAL F O   1 
ATOM   9176  C CB  . VAL F 2 20  ? 51.525  2.257   -7.228  1.00 54.79  ? 20  VAL F CB  1 
ATOM   9177  C CG1 . VAL F 2 20  ? 52.014  2.039   -8.657  1.00 27.81  ? 20  VAL F CG1 1 
ATOM   9178  C CG2 . VAL F 2 20  ? 51.898  1.058   -6.352  1.00 31.92  ? 20  VAL F CG2 1 
ATOM   9179  N N   . LYS F 2 21  ? 50.763  5.323   -7.592  1.00 50.66  ? 21  LYS F N   1 
ATOM   9180  C CA  . LYS F 2 21  ? 50.502  6.436   -8.489  1.00 48.04  ? 21  LYS F CA  1 
ATOM   9181  C C   . LYS F 2 21  ? 51.380  7.630   -8.113  1.00 39.23  ? 21  LYS F C   1 
ATOM   9182  O O   . LYS F 2 21  ? 52.018  8.238   -8.968  1.00 51.94  ? 21  LYS F O   1 
ATOM   9183  C CB  . LYS F 2 21  ? 49.022  6.844   -8.458  1.00 66.92  ? 21  LYS F CB  1 
ATOM   9184  C CG  . LYS F 2 21  ? 48.661  7.816   -9.578  1.00 58.56  ? 21  LYS F CG  1 
ATOM   9185  C CD  . LYS F 2 21  ? 47.170  8.076   -9.704  1.00 87.84  ? 21  LYS F CD  1 
ATOM   9186  C CE  . LYS F 2 21  ? 46.888  9.072   -10.854 1.00 98.80  ? 21  LYS F CE  1 
ATOM   9187  N NZ  . LYS F 2 21  ? 45.419  9.339   -11.090 1.00 71.02  ? 21  LYS F NZ  1 
ATOM   9188  N N   . ARG F 2 22  ? 51.422  7.979   -6.839  1.00 40.20  ? 22  ARG F N   1 
ATOM   9189  C CA  . ARG F 2 22  ? 52.268  9.087   -6.457  1.00 35.33  ? 22  ARG F CA  1 
ATOM   9190  C C   . ARG F 2 22  ? 53.715  8.879   -6.943  1.00 57.19  ? 22  ARG F C   1 
ATOM   9191  O O   . ARG F 2 22  ? 54.374  9.824   -7.379  1.00 57.83  ? 22  ARG F O   1 
ATOM   9192  C CB  . ARG F 2 22  ? 52.239  9.286   -4.941  1.00 55.01  ? 22  ARG F CB  1 
ATOM   9193  C CG  . ARG F 2 22  ? 50.965  9.943   -4.437  1.00 45.24  ? 22  ARG F CG  1 
ATOM   9194  C CD  . ARG F 2 22  ? 51.132  10.472  -3.019  1.00 52.64  ? 22  ARG F CD  1 
ATOM   9195  N NE  . ARG F 2 22  ? 50.539  9.599   -1.997  1.00 74.73  ? 22  ARG F NE  1 
ATOM   9196  C CZ  . ARG F 2 22  ? 51.010  8.401   -1.665  1.00 83.72  ? 22  ARG F CZ  1 
ATOM   9197  N NH1 . ARG F 2 22  ? 52.088  7.918   -2.273  1.00 91.37  ? 22  ARG F NH1 1 
ATOM   9198  N NH2 . ARG F 2 22  ? 50.412  7.691   -0.721  1.00 51.95  ? 22  ARG F NH2 1 
ATOM   9199  N N   . ALA F 2 23  ? 54.205  7.643   -6.893  1.00 47.57  ? 23  ALA F N   1 
ATOM   9200  C CA  . ALA F 2 23  ? 55.572  7.357   -7.312  1.00 49.18  ? 23  ALA F CA  1 
ATOM   9201  C C   . ALA F 2 23  ? 55.778  7.310   -8.829  1.00 46.67  ? 23  ALA F C   1 
ATOM   9202  O O   . ALA F 2 23  ? 56.908  7.403   -9.308  1.00 48.23  ? 23  ALA F O   1 
ATOM   9203  C CB  . ALA F 2 23  ? 56.036  6.057   -6.687  1.00 40.56  ? 23  ALA F CB  1 
ATOM   9204  N N   . SER F 2 24  ? 54.700  7.143   -9.584  1.00 46.84  ? 24  SER F N   1 
ATOM   9205  C CA  . SER F 2 24  ? 54.814  7.105   -11.037 1.00 42.88  ? 24  SER F CA  1 
ATOM   9206  C C   . SER F 2 24  ? 54.637  8.501   -11.664 1.00 47.96  ? 24  SER F C   1 
ATOM   9207  O O   . SER F 2 24  ? 54.855  8.681   -12.854 1.00 49.59  ? 24  SER F O   1 
ATOM   9208  C CB  . SER F 2 24  ? 53.799  6.117   -11.628 1.00 45.36  ? 24  SER F CB  1 
ATOM   9209  O OG  . SER F 2 24  ? 52.466  6.438   -11.272 1.00 56.62  ? 24  SER F OG  1 
ATOM   9210  N N   . GLU F 2 25  ? 54.265  9.479   -10.837 1.00 49.71  ? 25  GLU F N   1 
ATOM   9211  C CA  . GLU F 2 25  ? 54.051  10.867  -11.257 1.00 52.18  ? 25  GLU F CA  1 
ATOM   9212  C C   . GLU F 2 25  ? 55.016  11.367  -12.323 1.00 62.85  ? 25  GLU F C   1 
ATOM   9213  O O   . GLU F 2 25  ? 54.587  11.794  -13.402 1.00 54.35  ? 25  GLU F O   1 
ATOM   9214  C CB  . GLU F 2 25  ? 54.163  11.817  -10.061 1.00 51.66  ? 25  GLU F CB  1 
ATOM   9215  C CG  . GLU F 2 25  ? 52.926  11.959  -9.207  1.00 69.85  ? 25  GLU F CG  1 
ATOM   9216  C CD  . GLU F 2 25  ? 53.156  12.876  -8.003  1.00 98.06  ? 25  GLU F CD  1 
ATOM   9217  O OE1 . GLU F 2 25  ? 54.111  13.702  -8.052  1.00 70.50  ? 25  GLU F OE1 1 
ATOM   9218  O OE2 . GLU F 2 25  ? 52.375  12.781  -7.017  1.00 63.38  ? 25  GLU F OE2 1 
ATOM   9219  N N   . ASN F 2 26  ? 56.310  11.315  -11.997 1.00 50.56  ? 26  ASN F N   1 
ATOM   9220  C CA  . ASN F 2 26  ? 57.382  11.792  -12.870 1.00 47.80  ? 26  ASN F CA  1 
ATOM   9221  C C   . ASN F 2 26  ? 57.758  10.864  -14.022 1.00 48.15  ? 26  ASN F C   1 
ATOM   9222  O O   . ASN F 2 26  ? 58.747  11.098  -14.717 1.00 48.40  ? 26  ASN F O   1 
ATOM   9223  C CB  . ASN F 2 26  ? 58.639  12.092  -12.040 1.00 57.51  ? 26  ASN F CB  1 
ATOM   9224  C CG  . ASN F 2 26  ? 58.382  13.077  -10.903 1.00 31.83  ? 26  ASN F CG  1 
ATOM   9225  O OD1 . ASN F 2 26  ? 57.854  14.163  -11.117 1.00 86.68  ? 26  ASN F OD1 1 
ATOM   9226  N ND2 . ASN F 2 26  ? 58.768  12.700  -9.689  1.00 65.44  ? 26  ASN F ND2 1 
ATOM   9227  N N   . PHE F 2 27  ? 56.987  9.807   -14.229 1.00 44.18  ? 27  PHE F N   1 
ATOM   9228  C CA  . PHE F 2 27  ? 57.291  8.902   -15.328 1.00 46.18  ? 27  PHE F CA  1 
ATOM   9229  C C   . PHE F 2 27  ? 56.323  9.101   -16.480 1.00 50.60  ? 27  PHE F C   1 
ATOM   9230  O O   . PHE F 2 27  ? 55.299  9.762   -16.339 1.00 52.04  ? 27  PHE F O   1 
ATOM   9231  C CB  . PHE F 2 27  ? 57.277  7.444   -14.850 1.00 56.57  ? 27  PHE F CB  1 
ATOM   9232  C CG  . PHE F 2 27  ? 58.380  7.116   -13.879 1.00 53.70  ? 27  PHE F CG  1 
ATOM   9233  C CD1 . PHE F 2 27  ? 58.315  7.548   -12.557 1.00 56.41  ? 27  PHE F CD1 1 
ATOM   9234  C CD2 . PHE F 2 27  ? 59.498  6.399   -14.295 1.00 58.45  ? 27  PHE F CD2 1 
ATOM   9235  C CE1 . PHE F 2 27  ? 59.348  7.270   -11.661 1.00 49.82  ? 27  PHE F CE1 1 
ATOM   9236  C CE2 . PHE F 2 27  ? 60.530  6.118   -13.411 1.00 55.95  ? 27  PHE F CE2 1 
ATOM   9237  C CZ  . PHE F 2 27  ? 60.453  6.557   -12.087 1.00 50.87  ? 27  PHE F CZ  1 
ATOM   9238  N N   . GLU F 2 28  ? 56.650  8.531   -17.629 1.00 47.47  ? 28  GLU F N   1 
ATOM   9239  C CA  . GLU F 2 28  ? 55.804  8.685   -18.797 1.00 46.74  ? 28  GLU F CA  1 
ATOM   9240  C C   . GLU F 2 28  ? 55.120  7.409   -19.261 1.00 56.73  ? 28  GLU F C   1 
ATOM   9241  O O   . GLU F 2 28  ? 55.582  6.296   -18.987 1.00 62.97  ? 28  GLU F O   1 
ATOM   9242  C CB  . GLU F 2 28  ? 56.626  9.248   -19.942 1.00 52.14  ? 28  GLU F CB  1 
ATOM   9243  C CG  . GLU F 2 28  ? 57.369  10.511  -19.599 1.00 54.85  ? 28  GLU F CG  1 
ATOM   9244  C CD  . GLU F 2 28  ? 57.218  11.534  -20.683 1.00 53.68  ? 28  GLU F CD  1 
ATOM   9245  O OE1 . GLU F 2 28  ? 57.340  11.148  -21.864 1.00 69.99  ? 28  GLU F OE1 1 
ATOM   9246  O OE2 . GLU F 2 28  ? 56.974  12.715  -20.367 1.00 73.93  ? 28  GLU F OE2 1 
ATOM   9247  N N   . ASP F 2 29  ? 54.019  7.585   -19.983 1.00 44.80  ? 29  ASP F N   1 
ATOM   9248  C CA  . ASP F 2 29  ? 53.256  6.468   -20.512 1.00 45.33  ? 29  ASP F CA  1 
ATOM   9249  C C   . ASP F 2 29  ? 52.876  5.521   -19.373 1.00 63.92  ? 29  ASP F C   1 
ATOM   9250  O O   . ASP F 2 29  ? 52.783  4.302   -19.578 1.00 53.75  ? 29  ASP F O   1 
ATOM   9251  C CB  . ASP F 2 29  ? 54.086  5.694   -21.554 1.00 85.32  ? 29  ASP F CB  1 
ATOM   9252  C CG  . ASP F 2 29  ? 55.019  6.602   -22.394 1.00 103.15 ? 29  ASP F CG  1 
ATOM   9253  O OD1 . ASP F 2 29  ? 54.735  7.828   -22.520 1.00 103.15 ? 29  ASP F OD1 1 
ATOM   9254  O OD2 . ASP F 2 29  ? 56.029  6.077   -22.945 1.00 72.96  ? 29  ASP F OD2 1 
ATOM   9255  N N   . VAL F 2 30  ? 52.643  6.081   -18.183 1.00 61.62  ? 30  VAL F N   1 
ATOM   9256  C CA  . VAL F 2 30  ? 52.306  5.279   -17.000 1.00 56.40  ? 30  VAL F CA  1 
ATOM   9257  C C   . VAL F 2 30  ? 50.851  4.867   -16.878 1.00 48.01  ? 30  VAL F C   1 
ATOM   9258  O O   . VAL F 2 30  ? 49.957  5.709   -16.785 1.00 59.20  ? 30  VAL F O   1 
ATOM   9259  C CB  . VAL F 2 30  ? 52.689  6.005   -15.692 1.00 65.11  ? 30  VAL F CB  1 
ATOM   9260  C CG1 . VAL F 2 30  ? 52.323  5.130   -14.496 1.00 75.50  ? 30  VAL F CG1 1 
ATOM   9261  C CG2 . VAL F 2 30  ? 54.192  6.315   -15.680 1.00 75.20  ? 30  VAL F CG2 1 
ATOM   9262  N N   . SER F 2 31  ? 50.631  3.559   -16.835 1.00 51.41  ? 31  SER F N   1 
ATOM   9263  C CA  . SER F 2 31  ? 49.292  2.993   -16.726 1.00 43.21  ? 31  SER F CA  1 
ATOM   9264  C C   . SER F 2 31  ? 49.132  2.099   -15.487 1.00 52.55  ? 31  SER F C   1 
ATOM   9265  O O   . SER F 2 31  ? 49.729  1.025   -15.410 1.00 51.36  ? 31  SER F O   1 
ATOM   9266  C CB  . SER F 2 31  ? 48.989  2.186   -17.988 1.00 43.42  ? 31  SER F CB  1 
ATOM   9267  O OG  . SER F 2 31  ? 47.678  1.659   -17.954 1.00 64.83  ? 31  SER F OG  1 
ATOM   9268  N N   . ILE F 2 32  ? 48.322  2.540   -14.526 1.00 40.36  ? 32  ILE F N   1 
ATOM   9269  C CA  . ILE F 2 32  ? 48.096  1.767   -13.308 1.00 52.47  ? 32  ILE F CA  1 
ATOM   9270  C C   . ILE F 2 32  ? 46.658  1.241   -13.196 1.00 50.23  ? 32  ILE F C   1 
ATOM   9271  O O   . ILE F 2 32  ? 45.699  2.002   -13.078 1.00 50.34  ? 32  ILE F O   1 
ATOM   9272  C CB  . ILE F 2 32  ? 48.419  2.603   -12.050 1.00 55.97  ? 32  ILE F CB  1 
ATOM   9273  C CG1 . ILE F 2 32  ? 49.791  3.264   -12.206 1.00 48.86  ? 32  ILE F CG1 1 
ATOM   9274  C CG2 . ILE F 2 32  ? 48.408  1.701   -10.810 1.00 39.57  ? 32  ILE F CG2 1 
ATOM   9275  C CD1 . ILE F 2 32  ? 50.137  4.218   -11.097 1.00 52.88  ? 32  ILE F CD1 1 
ATOM   9276  N N   . GLU F 2 33  ? 46.525  -0.078  -13.205 1.00 52.25  ? 33  GLU F N   1 
ATOM   9277  C CA  . GLU F 2 33  ? 45.220  -0.714  -13.127 1.00 44.95  ? 33  GLU F CA  1 
ATOM   9278  C C   . GLU F 2 33  ? 45.031  -1.612  -11.906 1.00 50.06  ? 33  GLU F C   1 
ATOM   9279  O O   . GLU F 2 33  ? 45.980  -2.204  -11.393 1.00 36.70  ? 33  GLU F O   1 
ATOM   9280  C CB  . GLU F 2 33  ? 44.987  -1.541  -14.396 1.00 49.55  ? 33  GLU F CB  1 
ATOM   9281  C CG  . GLU F 2 33  ? 44.755  -0.701  -15.649 1.00 58.84  ? 33  GLU F CG  1 
ATOM   9282  C CD  . GLU F 2 33  ? 44.932  -1.489  -16.942 1.00 69.61  ? 33  GLU F CD  1 
ATOM   9283  O OE1 . GLU F 2 33  ? 44.586  -2.697  -16.971 1.00 47.92  ? 33  GLU F OE1 1 
ATOM   9284  O OE2 . GLU F 2 33  ? 45.407  -0.884  -17.931 1.00 60.71  ? 33  GLU F OE2 1 
ATOM   9285  N N   . LEU F 2 34  ? 43.789  -1.689  -11.438 1.00 47.23  ? 34  LEU F N   1 
ATOM   9286  C CA  . LEU F 2 34  ? 43.441  -2.561  -10.325 1.00 40.07  ? 34  LEU F CA  1 
ATOM   9287  C C   . LEU F 2 34  ? 43.001  -3.884  -10.975 1.00 52.71  ? 34  LEU F C   1 
ATOM   9288  O O   . LEU F 2 34  ? 42.090  -3.904  -11.812 1.00 52.32  ? 34  LEU F O   1 
ATOM   9289  C CB  . LEU F 2 34  ? 42.315  -1.949  -9.497  1.00 30.56  ? 34  LEU F CB  1 
ATOM   9290  C CG  . LEU F 2 34  ? 42.715  -0.680  -8.753  1.00 45.61  ? 34  LEU F CG  1 
ATOM   9291  C CD1 . LEU F 2 34  ? 41.481  0.025   -8.241  1.00 43.72  ? 34  LEU F CD1 1 
ATOM   9292  C CD2 . LEU F 2 34  ? 43.652  -1.033  -7.610  1.00 33.24  ? 34  LEU F CD2 1 
ATOM   9293  N N   . VAL F 2 35  ? 43.674  -4.971  -10.603 1.00 37.93  ? 35  VAL F N   1 
ATOM   9294  C CA  . VAL F 2 35  ? 43.409  -6.287  -11.165 1.00 39.26  ? 35  VAL F CA  1 
ATOM   9295  C C   . VAL F 2 35  ? 42.560  -7.198  -10.290 1.00 49.02  ? 35  VAL F C   1 
ATOM   9296  O O   . VAL F 2 35  ? 42.900  -7.471  -9.135  1.00 56.55  ? 35  VAL F O   1 
ATOM   9297  C CB  . VAL F 2 35  ? 44.739  -7.019  -11.466 1.00 47.32  ? 35  VAL F CB  1 
ATOM   9298  C CG1 . VAL F 2 35  ? 44.480  -8.298  -12.241 1.00 43.17  ? 35  VAL F CG1 1 
ATOM   9299  C CG2 . VAL F 2 35  ? 45.672  -6.097  -12.237 1.00 44.20  ? 35  VAL F CG2 1 
ATOM   9300  N N   . GLU F 2 36  ? 41.458  -7.676  -10.857 1.00 54.50  ? 36  GLU F N   1 
ATOM   9301  C CA  . GLU F 2 36  ? 40.567  -8.590  -10.152 1.00 54.66  ? 36  GLU F CA  1 
ATOM   9302  C C   . GLU F 2 36  ? 40.436  -9.898  -10.917 1.00 45.58  ? 36  GLU F C   1 
ATOM   9303  O O   . GLU F 2 36  ? 39.834  -10.846 -10.423 1.00 60.96  ? 36  GLU F O   1 
ATOM   9304  C CB  . GLU F 2 36  ? 39.169  -8.003  -9.997  1.00 54.90  ? 36  GLU F CB  1 
ATOM   9305  C CG  . GLU F 2 36  ? 39.062  -6.771  -9.131  1.00 93.37  ? 36  GLU F CG  1 
ATOM   9306  C CD  . GLU F 2 36  ? 37.603  -6.437  -8.831  1.00 103.15 ? 36  GLU F CD  1 
ATOM   9307  O OE1 . GLU F 2 36  ? 36.768  -6.543  -9.770  1.00 75.30  ? 36  GLU F OE1 1 
ATOM   9308  O OE2 . GLU F 2 36  ? 37.294  -6.076  -7.664  1.00 103.15 ? 36  GLU F OE2 1 
ATOM   9309  N N   . SER F 2 37  ? 40.983  -9.944  -12.127 1.00 46.40  ? 37  SER F N   1 
ATOM   9310  C CA  . SER F 2 37  ? 40.905  -11.153 -12.945 1.00 59.62  ? 37  SER F CA  1 
ATOM   9311  C C   . SER F 2 37  ? 41.896  -11.061 -14.094 1.00 52.68  ? 37  SER F C   1 
ATOM   9312  O O   . SER F 2 37  ? 42.340  -9.973  -14.452 1.00 59.69  ? 37  SER F O   1 
ATOM   9313  C CB  . SER F 2 37  ? 39.489  -11.336 -13.505 1.00 52.01  ? 37  SER F CB  1 
ATOM   9314  O OG  . SER F 2 37  ? 39.192  -10.331 -14.453 1.00 59.91  ? 37  SER F OG  1 
ATOM   9315  N N   . PRO F 2 38  ? 42.247  -12.207 -14.696 1.00 64.46  ? 38  PRO F N   1 
ATOM   9316  C CA  . PRO F 2 38  ? 43.199  -12.233 -15.809 1.00 51.00  ? 38  PRO F CA  1 
ATOM   9317  C C   . PRO F 2 38  ? 42.912  -11.175 -16.863 1.00 59.23  ? 38  PRO F C   1 
ATOM   9318  O O   . PRO F 2 38  ? 41.761  -10.817 -17.111 1.00 58.89  ? 38  PRO F O   1 
ATOM   9319  C CB  . PRO F 2 38  ? 43.057  -13.657 -16.353 1.00 68.97  ? 38  PRO F CB  1 
ATOM   9320  C CG  . PRO F 2 38  ? 42.749  -14.445 -15.120 1.00 50.33  ? 38  PRO F CG  1 
ATOM   9321  C CD  . PRO F 2 38  ? 41.720  -13.560 -14.429 1.00 56.95  ? 38  PRO F CD  1 
ATOM   9322  N N   . ARG F 2 39  ? 43.979  -10.677 -17.471 1.00 50.60  ? 39  ARG F N   1 
ATOM   9323  C CA  . ARG F 2 39  ? 43.881  -9.661  -18.502 1.00 47.46  ? 39  ARG F CA  1 
ATOM   9324  C C   . ARG F 2 39  ? 44.690  -10.153 -19.685 1.00 49.28  ? 39  ARG F C   1 
ATOM   9325  O O   . ARG F 2 39  ? 45.818  -10.606 -19.521 1.00 67.48  ? 39  ARG F O   1 
ATOM   9326  C CB  . ARG F 2 39  ? 44.448  -8.343  -17.985 1.00 62.04  ? 39  ARG F CB  1 
ATOM   9327  C CG  . ARG F 2 39  ? 43.783  -7.881  -16.710 1.00 51.39  ? 39  ARG F CG  1 
ATOM   9328  C CD  . ARG F 2 39  ? 42.348  -7.469  -16.982 1.00 66.68  ? 39  ARG F CD  1 
ATOM   9329  N NE  . ARG F 2 39  ? 42.297  -6.207  -17.709 1.00 46.40  ? 39  ARG F NE  1 
ATOM   9330  C CZ  . ARG F 2 39  ? 41.339  -5.305  -17.550 1.00 54.65  ? 39  ARG F CZ  1 
ATOM   9331  N NH1 . ARG F 2 39  ? 40.357  -5.537  -16.693 1.00 48.63  ? 39  ARG F NH1 1 
ATOM   9332  N NH2 . ARG F 2 39  ? 41.375  -4.164  -18.229 1.00 51.00  ? 39  ARG F NH2 1 
ATOM   9333  N N   . ASN F 2 40  ? 44.098  -10.077 -20.870 1.00 60.82  ? 40  ASN F N   1 
ATOM   9334  C CA  . ASN F 2 40  ? 44.735  -10.525 -22.104 1.00 69.21  ? 40  ASN F CA  1 
ATOM   9335  C C   . ASN F 2 40  ? 46.225  -10.183 -22.121 1.00 52.74  ? 40  ASN F C   1 
ATOM   9336  O O   . ASN F 2 40  ? 47.047  -11.029 -22.448 1.00 49.19  ? 40  ASN F O   1 
ATOM   9337  C CB  . ASN F 2 40  ? 44.008  -9.898  -23.306 1.00 69.18  ? 40  ASN F CB  1 
ATOM   9338  C CG  . ASN F 2 40  ? 44.359  -10.561 -24.630 1.00 66.28  ? 40  ASN F CG  1 
ATOM   9339  O OD1 . ASN F 2 40  ? 45.360  -10.218 -25.268 1.00 54.28  ? 40  ASN F OD1 1 
ATOM   9340  N ND2 . ASN F 2 40  ? 43.529  -11.518 -25.053 1.00 51.52  ? 40  ASN F ND2 1 
ATOM   9341  N N   . ASP F 2 41  ? 46.575  -8.958  -21.741 1.00 45.83  ? 41  ASP F N   1 
ATOM   9342  C CA  . ASP F 2 41  ? 47.980  -8.555  -21.729 1.00 59.12  ? 41  ASP F CA  1 
ATOM   9343  C C   . ASP F 2 41  ? 48.637  -8.560  -20.348 1.00 57.56  ? 41  ASP F C   1 
ATOM   9344  O O   . ASP F 2 41  ? 48.100  -7.997  -19.394 1.00 52.87  ? 41  ASP F O   1 
ATOM   9345  C CB  . ASP F 2 41  ? 48.122  -7.167  -22.329 1.00 46.10  ? 41  ASP F CB  1 
ATOM   9346  C CG  . ASP F 2 41  ? 47.404  -7.040  -23.647 1.00 80.43  ? 41  ASP F CG  1 
ATOM   9347  O OD1 . ASP F 2 41  ? 47.541  -7.966  -24.483 1.00 70.02  ? 41  ASP F OD1 1 
ATOM   9348  O OD2 . ASP F 2 41  ? 46.711  -6.018  -23.848 1.00 68.15  ? 41  ASP F OD2 1 
ATOM   9349  N N   . LEU F 2 42  ? 49.803  -9.194  -20.248 1.00 46.87  ? 42  LEU F N   1 
ATOM   9350  C CA  . LEU F 2 42  ? 50.529  -9.231  -18.984 1.00 58.45  ? 42  LEU F CA  1 
ATOM   9351  C C   . LEU F 2 42  ? 51.010  -7.810  -18.729 1.00 53.93  ? 42  LEU F C   1 
ATOM   9352  O O   . LEU F 2 42  ? 51.213  -7.039  -19.678 1.00 63.17  ? 42  LEU F O   1 
ATOM   9353  C CB  . LEU F 2 42  ? 51.755  -10.137 -19.079 1.00 49.94  ? 42  LEU F CB  1 
ATOM   9354  C CG  . LEU F 2 42  ? 51.643  -11.564 -19.588 1.00 47.46  ? 42  LEU F CG  1 
ATOM   9355  C CD1 . LEU F 2 42  ? 53.041  -12.109 -19.779 1.00 59.95  ? 42  LEU F CD1 1 
ATOM   9356  C CD2 . LEU F 2 42  ? 50.871  -12.423 -18.631 1.00 61.83  ? 42  LEU F CD2 1 
ATOM   9357  N N   . TYR F 2 43  ? 51.194  -7.464  -17.461 1.00 44.57  ? 43  TYR F N   1 
ATOM   9358  C CA  . TYR F 2 43  ? 51.677  -6.134  -17.104 1.00 44.09  ? 43  TYR F CA  1 
ATOM   9359  C C   . TYR F 2 43  ? 53.208  -6.104  -17.089 1.00 46.72  ? 43  TYR F C   1 
ATOM   9360  O O   . TYR F 2 43  ? 53.861  -7.137  -17.182 1.00 47.38  ? 43  TYR F O   1 
ATOM   9361  C CB  . TYR F 2 43  ? 51.152  -5.718  -15.721 1.00 47.68  ? 43  TYR F CB  1 
ATOM   9362  C CG  . TYR F 2 43  ? 49.653  -5.564  -15.652 1.00 48.86  ? 43  TYR F CG  1 
ATOM   9363  C CD1 . TYR F 2 43  ? 48.828  -6.672  -15.446 1.00 45.61  ? 43  TYR F CD1 1 
ATOM   9364  C CD2 . TYR F 2 43  ? 49.056  -4.320  -15.843 1.00 50.06  ? 43  TYR F CD2 1 
ATOM   9365  C CE1 . TYR F 2 43  ? 47.449  -6.548  -15.435 1.00 49.54  ? 43  TYR F CE1 1 
ATOM   9366  C CE2 . TYR F 2 43  ? 47.669  -4.182  -15.839 1.00 42.00  ? 43  TYR F CE2 1 
ATOM   9367  C CZ  . TYR F 2 43  ? 46.873  -5.301  -15.635 1.00 44.43  ? 43  TYR F CZ  1 
ATOM   9368  O OH  . TYR F 2 43  ? 45.504  -5.179  -15.645 1.00 45.64  ? 43  TYR F OH  1 
ATOM   9369  N N   . ASP F 2 44  ? 53.774  -4.909  -16.986 1.00 43.80  ? 44  ASP F N   1 
ATOM   9370  C CA  . ASP F 2 44  ? 55.223  -4.767  -16.928 1.00 53.69  ? 44  ASP F CA  1 
ATOM   9371  C C   . ASP F 2 44  ? 55.640  -4.950  -15.466 1.00 58.98  ? 44  ASP F C   1 
ATOM   9372  O O   . ASP F 2 44  ? 56.685  -5.540  -15.170 1.00 62.53  ? 44  ASP F O   1 
ATOM   9373  C CB  . ASP F 2 44  ? 55.662  -3.373  -17.410 1.00 41.68  ? 44  ASP F CB  1 
ATOM   9374  C CG  . ASP F 2 44  ? 55.249  -3.085  -18.842 1.00 57.93  ? 44  ASP F CG  1 
ATOM   9375  O OD1 . ASP F 2 44  ? 55.315  -4.005  -19.685 1.00 61.15  ? 44  ASP F OD1 1 
ATOM   9376  O OD2 . ASP F 2 44  ? 54.869  -1.928  -19.131 1.00 74.44  ? 44  ASP F OD2 1 
ATOM   9377  N N   . LEU F 2 45  ? 54.796  -4.433  -14.574 1.00 47.29  ? 45  LEU F N   1 
ATOM   9378  C CA  . LEU F 2 45  ? 55.001  -4.475  -13.127 1.00 56.37  ? 45  LEU F CA  1 
ATOM   9379  C C   . LEU F 2 45  ? 53.689  -4.953  -12.510 1.00 39.98  ? 45  LEU F C   1 
ATOM   9380  O O   . LEU F 2 45  ? 52.669  -4.289  -12.628 1.00 49.53  ? 45  LEU F O   1 
ATOM   9381  C CB  . LEU F 2 45  ? 55.325  -3.071  -12.595 1.00 34.23  ? 45  LEU F CB  1 
ATOM   9382  C CG  . LEU F 2 45  ? 56.368  -2.847  -11.495 1.00 47.17  ? 45  LEU F CG  1 
ATOM   9383  C CD1 . LEU F 2 45  ? 56.124  -1.491  -10.848 1.00 31.77  ? 45  LEU F CD1 1 
ATOM   9384  C CD2 . LEU F 2 45  ? 56.292  -3.940  -10.442 1.00 45.72  ? 45  LEU F CD2 1 
ATOM   9385  N N   . LEU F 2 46  ? 53.713  -6.107  -11.861 1.00 48.84  ? 46  LEU F N   1 
ATOM   9386  C CA  . LEU F 2 46  ? 52.509  -6.643  -11.245 1.00 47.53  ? 46  LEU F CA  1 
ATOM   9387  C C   . LEU F 2 46  ? 52.702  -6.801  -9.741  1.00 47.62  ? 46  LEU F C   1 
ATOM   9388  O O   . LEU F 2 46  ? 53.580  -7.540  -9.313  1.00 55.37  ? 46  LEU F O   1 
ATOM   9389  C CB  . LEU F 2 46  ? 52.156  -8.000  -11.876 1.00 34.96  ? 46  LEU F CB  1 
ATOM   9390  C CG  . LEU F 2 46  ? 50.937  -8.729  -11.294 1.00 51.29  ? 46  LEU F CG  1 
ATOM   9391  C CD1 . LEU F 2 46  ? 49.670  -7.886  -11.476 1.00 33.84  ? 46  LEU F CD1 1 
ATOM   9392  C CD2 . LEU F 2 46  ? 50.787  -10.078 -11.964 1.00 44.07  ? 46  LEU F CD2 1 
ATOM   9393  N N   . PHE F 2 47  ? 51.877  -6.111  -8.951  1.00 45.77  ? 47  PHE F N   1 
ATOM   9394  C CA  . PHE F 2 47  ? 51.944  -6.177  -7.485  1.00 40.17  ? 47  PHE F CA  1 
ATOM   9395  C C   . PHE F 2 47  ? 50.942  -7.159  -6.870  1.00 46.13  ? 47  PHE F C   1 
ATOM   9396  O O   . PHE F 2 47  ? 49.808  -7.286  -7.331  1.00 48.54  ? 47  PHE F O   1 
ATOM   9397  C CB  . PHE F 2 47  ? 51.671  -4.807  -6.845  1.00 39.12  ? 47  PHE F CB  1 
ATOM   9398  C CG  . PHE F 2 47  ? 52.732  -3.773  -7.095  1.00 36.46  ? 47  PHE F CG  1 
ATOM   9399  C CD1 . PHE F 2 47  ? 52.805  -3.106  -8.311  1.00 38.04  ? 47  PHE F CD1 1 
ATOM   9400  C CD2 . PHE F 2 47  ? 53.643  -3.445  -6.095  1.00 46.72  ? 47  PHE F CD2 1 
ATOM   9401  C CE1 . PHE F 2 47  ? 53.757  -2.130  -8.531  1.00 33.42  ? 47  PHE F CE1 1 
ATOM   9402  C CE2 . PHE F 2 47  ? 54.609  -2.465  -6.304  1.00 39.79  ? 47  PHE F CE2 1 
ATOM   9403  C CZ  . PHE F 2 47  ? 54.663  -1.805  -7.528  1.00 46.09  ? 47  PHE F CZ  1 
ATOM   9404  N N   . ILE F 2 48  ? 51.368  -7.843  -5.816  1.00 47.48  ? 48  ILE F N   1 
ATOM   9405  C CA  . ILE F 2 48  ? 50.506  -8.773  -5.106  1.00 42.21  ? 48  ILE F CA  1 
ATOM   9406  C C   . ILE F 2 48  ? 50.558  -8.296  -3.666  1.00 50.46  ? 48  ILE F C   1 
ATOM   9407  O O   . ILE F 2 48  ? 51.458  -8.685  -2.915  1.00 57.40  ? 48  ILE F O   1 
ATOM   9408  C CB  . ILE F 2 48  ? 51.034  -10.210 -5.138  1.00 48.11  ? 48  ILE F CB  1 
ATOM   9409  C CG1 . ILE F 2 48  ? 51.381  -10.627 -6.565  1.00 46.32  ? 48  ILE F CG1 1 
ATOM   9410  C CG2 . ILE F 2 48  ? 49.983  -11.148 -4.561  1.00 49.26  ? 48  ILE F CG2 1 
ATOM   9411  C CD1 . ILE F 2 48  ? 51.940  -12.046 -6.651  1.00 44.51  ? 48  ILE F CD1 1 
ATOM   9412  N N   . PRO F 2 49  ? 49.607  -7.429  -3.267  1.00 45.50  ? 49  PRO F N   1 
ATOM   9413  C CA  . PRO F 2 49  ? 49.496  -6.856  -1.925  1.00 37.55  ? 49  PRO F CA  1 
ATOM   9414  C C   . PRO F 2 49  ? 48.613  -7.670  -0.991  1.00 35.13  ? 49  PRO F C   1 
ATOM   9415  O O   . PRO F 2 49  ? 48.479  -8.875  -1.157  1.00 43.33  ? 49  PRO F O   1 
ATOM   9416  C CB  . PRO F 2 49  ? 48.908  -5.487  -2.210  1.00 39.85  ? 49  PRO F CB  1 
ATOM   9417  C CG  . PRO F 2 49  ? 47.930  -5.803  -3.269  1.00 39.40  ? 49  PRO F CG  1 
ATOM   9418  C CD  . PRO F 2 49  ? 48.658  -6.769  -4.182  1.00 40.28  ? 49  PRO F CD  1 
ATOM   9419  N N   . GLY F 2 50  ? 48.010  -6.993  -0.015  1.00 34.27  ? 50  GLY F N   1 
ATOM   9420  C CA  . GLY F 2 50  ? 47.130  -7.655  0.932   1.00 42.22  ? 50  GLY F CA  1 
ATOM   9421  C C   . GLY F 2 50  ? 47.598  -7.633  2.382   1.00 49.80  ? 50  GLY F C   1 
ATOM   9422  O O   . GLY F 2 50  ? 48.791  -7.524  2.660   1.00 47.89  ? 50  GLY F O   1 
ATOM   9423  N N   . VAL F 2 51  ? 46.649  -7.721  3.309   1.00 45.25  ? 51  VAL F N   1 
ATOM   9424  C CA  . VAL F 2 51  ? 46.957  -7.732  4.732   1.00 47.09  ? 51  VAL F CA  1 
ATOM   9425  C C   . VAL F 2 51  ? 46.028  -8.733  5.390   1.00 55.14  ? 51  VAL F C   1 
ATOM   9426  O O   . VAL F 2 51  ? 44.811  -8.672  5.206   1.00 45.02  ? 51  VAL F O   1 
ATOM   9427  C CB  . VAL F 2 51  ? 46.752  -6.337  5.389   1.00 52.01  ? 51  VAL F CB  1 
ATOM   9428  C CG1 . VAL F 2 51  ? 46.849  -6.444  6.903   1.00 45.55  ? 51  VAL F CG1 1 
ATOM   9429  C CG2 . VAL F 2 51  ? 47.803  -5.364  4.883   1.00 48.96  ? 51  VAL F CG2 1 
ATOM   9430  N N   . GLY F 2 52  ? 46.605  -9.668  6.141   1.00 58.98  ? 52  GLY F N   1 
ATOM   9431  C CA  . GLY F 2 52  ? 45.784  -10.661 6.808   1.00 59.53  ? 52  GLY F CA  1 
ATOM   9432  C C   . GLY F 2 52  ? 46.273  -12.092 6.721   1.00 49.11  ? 52  GLY F C   1 
ATOM   9433  O O   . GLY F 2 52  ? 47.459  -12.357 6.583   1.00 59.10  ? 52  GLY F O   1 
ATOM   9434  N N   . HIS F 2 53  ? 45.315  -13.006 6.778   1.00 54.73  ? 53  HIS F N   1 
ATOM   9435  C CA  . HIS F 2 53  ? 45.533  -14.451 6.756   1.00 46.06  ? 53  HIS F CA  1 
ATOM   9436  C C   . HIS F 2 53  ? 46.037  -15.033 5.442   1.00 47.14  ? 53  HIS F C   1 
ATOM   9437  O O   . HIS F 2 53  ? 45.471  -14.783 4.382   1.00 57.29  ? 53  HIS F O   1 
ATOM   9438  C CB  . HIS F 2 53  ? 44.217  -15.131 7.150   1.00 52.96  ? 53  HIS F CB  1 
ATOM   9439  C CG  . HIS F 2 53  ? 44.374  -16.518 7.687   1.00 69.30  ? 53  HIS F CG  1 
ATOM   9440  N ND1 . HIS F 2 53  ? 44.812  -17.574 6.916   1.00 84.79  ? 53  HIS F ND1 1 
ATOM   9441  C CD2 . HIS F 2 53  ? 44.101  -17.033 8.910   1.00 60.96  ? 53  HIS F CD2 1 
ATOM   9442  C CE1 . HIS F 2 53  ? 44.797  -18.681 7.639   1.00 79.95  ? 53  HIS F CE1 1 
ATOM   9443  N NE2 . HIS F 2 53  ? 44.368  -18.379 8.853   1.00 75.47  ? 53  HIS F NE2 1 
ATOM   9444  N N   . PHE F 2 54  ? 47.102  -15.827 5.527   1.00 57.52  ? 54  PHE F N   1 
ATOM   9445  C CA  . PHE F 2 54  ? 47.705  -16.488 4.368   1.00 47.96  ? 54  PHE F CA  1 
ATOM   9446  C C   . PHE F 2 54  ? 46.665  -17.397 3.683   1.00 59.31  ? 54  PHE F C   1 
ATOM   9447  O O   . PHE F 2 54  ? 46.699  -17.584 2.455   1.00 57.83  ? 54  PHE F O   1 
ATOM   9448  C CB  . PHE F 2 54  ? 48.914  -17.313 4.846   1.00 63.21  ? 54  PHE F CB  1 
ATOM   9449  C CG  . PHE F 2 54  ? 49.621  -18.083 3.753   1.00 46.49  ? 54  PHE F CG  1 
ATOM   9450  C CD1 . PHE F 2 54  ? 50.773  -17.583 3.167   1.00 50.35  ? 54  PHE F CD1 1 
ATOM   9451  C CD2 . PHE F 2 54  ? 49.138  -19.323 3.328   1.00 79.65  ? 54  PHE F CD2 1 
ATOM   9452  C CE1 . PHE F 2 54  ? 51.443  -18.304 2.171   1.00 52.15  ? 54  PHE F CE1 1 
ATOM   9453  C CE2 . PHE F 2 54  ? 49.793  -20.052 2.336   1.00 55.25  ? 54  PHE F CE2 1 
ATOM   9454  C CZ  . PHE F 2 54  ? 50.952  -19.539 1.755   1.00 50.50  ? 54  PHE F CZ  1 
ATOM   9455  N N   . GLY F 2 55  ? 45.758  -17.958 4.494   1.00 65.45  ? 55  GLY F N   1 
ATOM   9456  C CA  . GLY F 2 55  ? 44.701  -18.839 4.004   1.00 55.32  ? 55  GLY F CA  1 
ATOM   9457  C C   . GLY F 2 55  ? 43.815  -18.059 3.066   1.00 54.08  ? 55  GLY F C   1 
ATOM   9458  O O   . GLY F 2 55  ? 43.545  -18.509 1.959   1.00 43.38  ? 55  GLY F O   1 
ATOM   9459  N N   . GLU F 2 56  ? 43.331  -16.907 3.535   1.00 57.24  ? 56  GLU F N   1 
ATOM   9460  C CA  . GLU F 2 56  ? 42.550  -15.996 2.695   1.00 65.51  ? 56  GLU F CA  1 
ATOM   9461  C C   . GLU F 2 56  ? 43.647  -15.481 1.772   1.00 70.65  ? 56  GLU F C   1 
ATOM   9462  O O   . GLU F 2 56  ? 44.821  -15.821 1.955   1.00 83.43  ? 56  GLU F O   1 
ATOM   9463  C CB  . GLU F 2 56  ? 42.016  -14.808 3.497   1.00 55.95  ? 56  GLU F CB  1 
ATOM   9464  C CG  . GLU F 2 56  ? 40.693  -15.042 4.163   1.00 71.30  ? 56  GLU F CG  1 
ATOM   9465  C CD  . GLU F 2 56  ? 39.551  -15.081 3.172   1.00 60.31  ? 56  GLU F CD  1 
ATOM   9466  O OE1 . GLU F 2 56  ? 38.719  -16.003 3.264   1.00 67.40  ? 56  GLU F OE1 1 
ATOM   9467  O OE2 . GLU F 2 56  ? 39.482  -14.188 2.308   1.00 68.11  ? 56  GLU F OE2 1 
ATOM   9468  N N   . GLY F 2 57  ? 43.306  -14.653 0.799   1.00 74.19  ? 57  GLY F N   1 
ATOM   9469  C CA  . GLY F 2 57  ? 44.357  -14.165 -0.076  1.00 69.32  ? 57  GLY F CA  1 
ATOM   9470  C C   . GLY F 2 57  ? 44.717  -15.249 -1.074  1.00 77.75  ? 57  GLY F C   1 
ATOM   9471  O O   . GLY F 2 57  ? 44.691  -15.012 -2.286  1.00 76.57  ? 57  GLY F O   1 
ATOM   9472  N N   . MET F 2 58  ? 45.082  -16.431 -0.579  1.00 67.06  ? 58  MET F N   1 
ATOM   9473  C CA  . MET F 2 58  ? 45.382  -17.545 -1.471  1.00 63.47  ? 58  MET F CA  1 
ATOM   9474  C C   . MET F 2 58  ? 44.017  -18.011 -1.993  1.00 64.93  ? 58  MET F C   1 
ATOM   9475  O O   . MET F 2 58  ? 43.880  -18.385 -3.161  1.00 51.34  ? 58  MET F O   1 
ATOM   9476  C CB  . MET F 2 58  ? 46.098  -18.681 -0.724  1.00 44.31  ? 58  MET F CB  1 
ATOM   9477  C CG  . MET F 2 58  ? 47.591  -18.433 -0.509  1.00 72.61  ? 58  MET F CG  1 
ATOM   9478  S SD  . MET F 2 58  ? 48.649  -18.594 -2.007  1.00 56.56  ? 58  MET F SD  1 
ATOM   9479  C CE  . MET F 2 58  ? 48.550  -17.026 -2.719  1.00 95.82  ? 58  MET F CE  1 
ATOM   9480  N N   . ARG F 2 59  ? 43.011  -17.965 -1.119  1.00 48.12  ? 59  ARG F N   1 
ATOM   9481  C CA  . ARG F 2 59  ? 41.661  -18.343 -1.504  1.00 51.84  ? 59  ARG F CA  1 
ATOM   9482  C C   . ARG F 2 59  ? 41.186  -17.318 -2.527  1.00 57.04  ? 59  ARG F C   1 
ATOM   9483  O O   . ARG F 2 59  ? 40.747  -17.672 -3.626  1.00 60.39  ? 59  ARG F O   1 
ATOM   9484  C CB  . ARG F 2 59  ? 40.706  -18.338 -0.299  1.00 43.67  ? 59  ARG F CB  1 
ATOM   9485  C CG  . ARG F 2 59  ? 39.238  -18.616 -0.691  1.00 66.71  ? 59  ARG F CG  1 
ATOM   9486  C CD  . ARG F 2 59  ? 38.241  -18.463 0.465   1.00 45.00  ? 59  ARG F CD  1 
ATOM   9487  N NE  . ARG F 2 59  ? 38.149  -17.088 0.962   1.00 85.77  ? 59  ARG F NE  1 
ATOM   9488  C CZ  . ARG F 2 59  ? 37.491  -16.093 0.361   1.00 91.45  ? 59  ARG F CZ  1 
ATOM   9489  N NH1 . ARG F 2 59  ? 36.838  -16.296 -0.785  1.00 63.29  ? 59  ARG F NH1 1 
ATOM   9490  N NH2 . ARG F 2 59  ? 37.492  -14.879 0.907   1.00 76.40  ? 59  ARG F NH2 1 
ATOM   9491  N N   . ARG F 2 60  ? 41.280  -16.041 -2.167  1.00 56.05  ? 60  ARG F N   1 
ATOM   9492  C CA  . ARG F 2 60  ? 40.852  -14.976 -3.066  1.00 46.36  ? 60  ARG F CA  1 
ATOM   9493  C C   . ARG F 2 60  ? 41.629  -14.965 -4.365  1.00 46.09  ? 60  ARG F C   1 
ATOM   9494  O O   . ARG F 2 60  ? 41.168  -14.402 -5.348  1.00 54.31  ? 60  ARG F O   1 
ATOM   9495  C CB  . ARG F 2 60  ? 40.976  -13.617 -2.390  1.00 50.12  ? 60  ARG F CB  1 
ATOM   9496  C CG  . ARG F 2 60  ? 40.142  -13.513 -1.144  1.00 48.90  ? 60  ARG F CG  1 
ATOM   9497  C CD  . ARG F 2 60  ? 39.983  -12.089 -0.705  1.00 55.35  ? 60  ARG F CD  1 
ATOM   9498  N NE  . ARG F 2 60  ? 39.335  -12.006 0.600   1.00 49.37  ? 60  ARG F NE  1 
ATOM   9499  C CZ  . ARG F 2 60  ? 38.808  -10.892 1.093   1.00 50.18  ? 60  ARG F CZ  1 
ATOM   9500  N NH1 . ARG F 2 60  ? 38.849  -9.771  0.384   1.00 50.08  ? 60  ARG F NH1 1 
ATOM   9501  N NH2 . ARG F 2 60  ? 38.250  -10.895 2.293   1.00 47.91  ? 60  ARG F NH2 1 
ATOM   9502  N N   . LEU F 2 61  ? 42.804  -15.582 -4.381  1.00 50.67  ? 61  LEU F N   1 
ATOM   9503  C CA  . LEU F 2 61  ? 43.589  -15.612 -5.607  1.00 52.31  ? 61  LEU F CA  1 
ATOM   9504  C C   . LEU F 2 61  ? 43.212  -16.820 -6.445  1.00 60.32  ? 61  LEU F C   1 
ATOM   9505  O O   . LEU F 2 61  ? 43.452  -16.836 -7.653  1.00 68.76  ? 61  LEU F O   1 
ATOM   9506  C CB  . LEU F 2 61  ? 45.096  -15.652 -5.317  1.00 49.04  ? 61  LEU F CB  1 
ATOM   9507  C CG  . LEU F 2 61  ? 45.827  -14.425 -4.754  1.00 59.26  ? 61  LEU F CG  1 
ATOM   9508  C CD1 . LEU F 2 61  ? 47.327  -14.710 -4.792  1.00 47.07  ? 61  LEU F CD1 1 
ATOM   9509  C CD2 . LEU F 2 61  ? 45.510  -13.158 -5.555  1.00 55.51  ? 61  LEU F CD2 1 
ATOM   9510  N N   . ARG F 2 62  ? 42.627  -17.832 -5.804  1.00 73.47  ? 62  ARG F N   1 
ATOM   9511  C CA  . ARG F 2 62  ? 42.216  -19.055 -6.501  1.00 60.77  ? 62  ARG F CA  1 
ATOM   9512  C C   . ARG F 2 62  ? 40.848  -18.894 -7.147  1.00 53.63  ? 62  ARG F C   1 
ATOM   9513  O O   . ARG F 2 62  ? 40.654  -19.296 -8.298  1.00 63.71  ? 62  ARG F O   1 
ATOM   9514  C CB  . ARG F 2 62  ? 42.169  -20.256 -5.539  1.00 58.57  ? 62  ARG F CB  1 
ATOM   9515  C CG  . ARG F 2 62  ? 43.515  -20.711 -4.986  1.00 63.88  ? 62  ARG F CG  1 
ATOM   9516  C CD  . ARG F 2 62  ? 43.448  -22.159 -4.467  1.00 63.12  ? 62  ARG F CD  1 
ATOM   9517  N NE  . ARG F 2 62  ? 42.435  -22.363 -3.423  1.00 78.12  ? 62  ARG F NE  1 
ATOM   9518  C CZ  . ARG F 2 62  ? 42.610  -22.105 -2.122  1.00 93.97  ? 62  ARG F CZ  1 
ATOM   9519  N NH1 . ARG F 2 62  ? 43.772  -21.623 -1.674  1.00 49.31  ? 62  ARG F NH1 1 
ATOM   9520  N NH2 . ARG F 2 62  ? 41.619  -22.341 -1.259  1.00 69.61  ? 62  ARG F NH2 1 
ATOM   9521  N N   . GLU F 2 63  ? 39.909  -18.313 -6.399  1.00 54.13  ? 63  GLU F N   1 
ATOM   9522  C CA  . GLU F 2 63  ? 38.531  -18.083 -6.858  1.00 49.17  ? 63  GLU F CA  1 
ATOM   9523  C C   . GLU F 2 63  ? 38.375  -17.013 -7.932  1.00 59.88  ? 63  GLU F C   1 
ATOM   9524  O O   . GLU F 2 63  ? 37.275  -16.788 -8.443  1.00 66.32  ? 63  GLU F O   1 
ATOM   9525  C CB  . GLU F 2 63  ? 37.636  -17.706 -5.670  1.00 50.85  ? 63  GLU F CB  1 
ATOM   9526  C CG  . GLU F 2 63  ? 37.146  -18.880 -4.839  1.00 70.58  ? 63  GLU F CG  1 
ATOM   9527  C CD  . GLU F 2 63  ? 36.749  -18.460 -3.438  1.00 81.04  ? 63  GLU F CD  1 
ATOM   9528  O OE1 . GLU F 2 63  ? 35.910  -19.146 -2.815  1.00 63.99  ? 63  GLU F OE1 1 
ATOM   9529  O OE2 . GLU F 2 63  ? 37.297  -17.440 -2.955  1.00 103.15 ? 63  GLU F OE2 1 
ATOM   9530  N N   . ASN F 2 64  ? 39.466  -16.335 -8.252  1.00 59.85  ? 64  ASN F N   1 
ATOM   9531  C CA  . ASN F 2 64  ? 39.445  -15.298 -9.268  1.00 57.66  ? 64  ASN F CA  1 
ATOM   9532  C C   . ASN F 2 64  ? 40.356  -15.727 -10.407 1.00 63.93  ? 64  ASN F C   1 
ATOM   9533  O O   . ASN F 2 64  ? 40.531  -15.006 -11.386 1.00 70.29  ? 64  ASN F O   1 
ATOM   9534  C CB  . ASN F 2 64  ? 39.895  -13.960 -8.672  1.00 44.95  ? 64  ASN F CB  1 
ATOM   9535  C CG  . ASN F 2 64  ? 38.832  -13.336 -7.784  1.00 50.67  ? 64  ASN F CG  1 
ATOM   9536  O OD1 . ASN F 2 64  ? 37.961  -12.604 -8.259  1.00 63.75  ? 64  ASN F OD1 1 
ATOM   9537  N ND2 . ASN F 2 64  ? 38.889  -13.634 -6.490  1.00 53.17  ? 64  ASN F ND2 1 
ATOM   9538  N N   . ASP F 2 65  ? 40.933  -16.917 -10.268 1.00 67.46  ? 65  ASP F N   1 
ATOM   9539  C CA  . ASP F 2 65  ? 41.804  -17.487 -11.292 1.00 71.69  ? 65  ASP F CA  1 
ATOM   9540  C C   . ASP F 2 65  ? 42.988  -16.557 -11.623 1.00 69.49  ? 65  ASP F C   1 
ATOM   9541  O O   . ASP F 2 65  ? 43.279  -16.276 -12.786 1.00 57.01  ? 65  ASP F O   1 
ATOM   9542  C CB  . ASP F 2 65  ? 40.957  -17.791 -12.549 1.00 54.54  ? 65  ASP F CB  1 
ATOM   9543  C CG  . ASP F 2 65  ? 41.494  -18.976 -13.365 1.00 89.70  ? 65  ASP F CG  1 
ATOM   9544  O OD1 . ASP F 2 65  ? 41.795  -20.057 -12.781 1.00 72.49  ? 65  ASP F OD1 1 
ATOM   9545  O OD2 . ASP F 2 65  ? 41.599  -18.827 -14.603 1.00 73.70  ? 65  ASP F OD2 1 
ATOM   9546  N N   . LEU F 2 66  ? 43.676  -16.086 -10.589 1.00 60.28  ? 66  LEU F N   1 
ATOM   9547  C CA  . LEU F 2 66  ? 44.816  -15.202 -10.798 1.00 64.71  ? 66  LEU F CA  1 
ATOM   9548  C C   . LEU F 2 66  ? 46.146  -15.944 -10.675 1.00 61.57  ? 66  LEU F C   1 
ATOM   9549  O O   . LEU F 2 66  ? 47.190  -15.427 -11.093 1.00 66.75  ? 66  LEU F O   1 
ATOM   9550  C CB  . LEU F 2 66  ? 44.775  -14.039 -9.801  1.00 53.53  ? 66  LEU F CB  1 
ATOM   9551  C CG  . LEU F 2 66  ? 43.596  -13.076 -9.964  1.00 56.30  ? 66  LEU F CG  1 
ATOM   9552  C CD1 . LEU F 2 66  ? 43.489  -12.147 -8.752  1.00 29.15  ? 66  LEU F CD1 1 
ATOM   9553  C CD2 . LEU F 2 66  ? 43.775  -12.298 -11.273 1.00 39.29  ? 66  LEU F CD2 1 
ATOM   9554  N N   . ILE F 2 67  ? 46.101  -17.147 -10.100 1.00 59.41  ? 67  ILE F N   1 
ATOM   9555  C CA  . ILE F 2 67  ? 47.300  -17.969 -9.922  1.00 54.44  ? 67  ILE F CA  1 
ATOM   9556  C C   . ILE F 2 67  ? 48.018  -18.196 -11.250 1.00 53.08  ? 67  ILE F C   1 
ATOM   9557  O O   . ILE F 2 67  ? 49.226  -17.947 -11.365 1.00 59.12  ? 67  ILE F O   1 
ATOM   9558  C CB  . ILE F 2 67  ? 46.961  -19.354 -9.299  1.00 65.38  ? 67  ILE F CB  1 
ATOM   9559  C CG1 . ILE F 2 67  ? 46.363  -19.174 -7.900  1.00 56.71  ? 67  ILE F CG1 1 
ATOM   9560  C CG2 . ILE F 2 67  ? 48.220  -20.209 -9.224  1.00 47.78  ? 67  ILE F CG2 1 
ATOM   9561  C CD1 . ILE F 2 67  ? 46.030  -20.474 -7.207  1.00 50.04  ? 67  ILE F CD1 1 
ATOM   9562  N N   . ASP F 2 68  ? 47.274  -18.669 -12.247 1.00 44.42  ? 68  ASP F N   1 
ATOM   9563  C CA  . ASP F 2 68  ? 47.843  -18.918 -13.567 1.00 51.67  ? 68  ASP F CA  1 
ATOM   9564  C C   . ASP F 2 68  ? 48.383  -17.633 -14.183 1.00 58.68  ? 68  ASP F C   1 
ATOM   9565  O O   . ASP F 2 68  ? 49.447  -17.631 -14.811 1.00 58.24  ? 68  ASP F O   1 
ATOM   9566  C CB  . ASP F 2 68  ? 46.784  -19.542 -14.480 1.00 63.36  ? 68  ASP F CB  1 
ATOM   9567  C CG  . ASP F 2 68  ? 46.573  -21.020 -14.186 1.00 84.68  ? 68  ASP F CG  1 
ATOM   9568  O OD1 . ASP F 2 68  ? 47.483  -21.821 -14.515 1.00 103.15 ? 68  ASP F OD1 1 
ATOM   9569  O OD2 . ASP F 2 68  ? 45.521  -21.381 -13.609 1.00 75.77  ? 68  ASP F OD2 1 
ATOM   9570  N N   . PHE F 2 69  ? 47.639  -16.544 -13.982 1.00 65.01  ? 69  PHE F N   1 
ATOM   9571  C CA  . PHE F 2 69  ? 47.992  -15.225 -14.492 1.00 47.76  ? 69  PHE F CA  1 
ATOM   9572  C C   . PHE F 2 69  ? 49.324  -14.780 -13.896 1.00 54.88  ? 69  PHE F C   1 
ATOM   9573  O O   . PHE F 2 69  ? 50.283  -14.559 -14.629 1.00 65.72  ? 69  PHE F O   1 
ATOM   9574  C CB  . PHE F 2 69  ? 46.879  -14.220 -14.144 1.00 47.49  ? 69  PHE F CB  1 
ATOM   9575  C CG  . PHE F 2 69  ? 47.012  -12.893 -14.848 1.00 56.52  ? 69  PHE F CG  1 
ATOM   9576  C CD1 . PHE F 2 69  ? 47.002  -12.826 -16.240 1.00 52.01  ? 69  PHE F CD1 1 
ATOM   9577  C CD2 . PHE F 2 69  ? 47.190  -11.719 -14.120 1.00 44.87  ? 69  PHE F CD2 1 
ATOM   9578  C CE1 . PHE F 2 69  ? 47.175  -11.613 -16.897 1.00 68.06  ? 69  PHE F CE1 1 
ATOM   9579  C CE2 . PHE F 2 69  ? 47.363  -10.500 -14.763 1.00 53.79  ? 69  PHE F CE2 1 
ATOM   9580  C CZ  . PHE F 2 69  ? 47.357  -10.443 -16.158 1.00 68.30  ? 69  PHE F CZ  1 
ATOM   9581  N N   . VAL F 2 70  ? 49.377  -14.654 -12.571 1.00 50.50  ? 70  VAL F N   1 
ATOM   9582  C CA  . VAL F 2 70  ? 50.604  -14.253 -11.884 1.00 56.26  ? 70  VAL F CA  1 
ATOM   9583  C C   . VAL F 2 70  ? 51.739  -15.115 -12.404 1.00 64.36  ? 70  VAL F C   1 
ATOM   9584  O O   . VAL F 2 70  ? 52.798  -14.624 -12.796 1.00 59.10  ? 70  VAL F O   1 
ATOM   9585  C CB  . VAL F 2 70  ? 50.499  -14.483 -10.356 1.00 53.94  ? 70  VAL F CB  1 
ATOM   9586  C CG1 . VAL F 2 70  ? 51.888  -14.446 -9.724  1.00 45.07  ? 70  VAL F CG1 1 
ATOM   9587  C CG2 . VAL F 2 70  ? 49.604  -13.430 -9.731  1.00 45.72  ? 70  VAL F CG2 1 
ATOM   9588  N N   . ARG F 2 71  ? 51.491  -16.418 -12.395 1.00 57.42  ? 71  ARG F N   1 
ATOM   9589  C CA  . ARG F 2 71  ? 52.458  -17.393 -12.846 1.00 47.52  ? 71  ARG F CA  1 
ATOM   9590  C C   . ARG F 2 71  ? 53.055  -17.037 -14.193 1.00 66.51  ? 71  ARG F C   1 
ATOM   9591  O O   . ARG F 2 71  ? 54.278  -17.058 -14.363 1.00 67.23  ? 71  ARG F O   1 
ATOM   9592  C CB  . ARG F 2 71  ? 51.791  -18.756 -12.944 1.00 56.93  ? 71  ARG F CB  1 
ATOM   9593  C CG  . ARG F 2 71  ? 52.687  -19.848 -13.471 1.00 65.60  ? 71  ARG F CG  1 
ATOM   9594  C CD  . ARG F 2 71  ? 53.284  -20.630 -12.319 1.00 101.56 ? 71  ARG F CD  1 
ATOM   9595  N NE  . ARG F 2 71  ? 52.271  -21.037 -11.346 1.00 55.63  ? 71  ARG F NE  1 
ATOM   9596  C CZ  . ARG F 2 71  ? 52.546  -21.730 -10.244 1.00 102.29 ? 71  ARG F CZ  1 
ATOM   9597  N NH1 . ARG F 2 71  ? 53.806  -22.099 -9.985  1.00 92.22  ? 71  ARG F NH1 1 
ATOM   9598  N NH2 . ARG F 2 71  ? 51.573  -22.037 -9.387  1.00 75.54  ? 71  ARG F NH2 1 
ATOM   9599  N N   . LYS F 2 72  ? 52.189  -16.716 -15.149 1.00 53.02  ? 72  LYS F N   1 
ATOM   9600  C CA  . LYS F 2 72  ? 52.626  -16.382 -16.497 1.00 58.47  ? 72  LYS F CA  1 
ATOM   9601  C C   . LYS F 2 72  ? 53.573  -15.181 -16.555 1.00 55.96  ? 72  LYS F C   1 
ATOM   9602  O O   . LYS F 2 72  ? 54.344  -15.046 -17.512 1.00 52.26  ? 72  LYS F O   1 
ATOM   9603  C CB  . LYS F 2 72  ? 51.401  -16.138 -17.392 1.00 77.31  ? 72  LYS F CB  1 
ATOM   9604  C CG  . LYS F 2 72  ? 51.656  -16.290 -18.888 1.00 60.46  ? 72  LYS F CG  1 
ATOM   9605  C CD  . LYS F 2 72  ? 50.341  -16.142 -19.644 1.00 89.42  ? 72  LYS F CD  1 
ATOM   9606  C CE  . LYS F 2 72  ? 49.337  -17.218 -19.211 1.00 85.25  ? 72  LYS F CE  1 
ATOM   9607  N NZ  . LYS F 2 72  ? 47.926  -16.818 -19.446 1.00 75.44  ? 72  LYS F NZ  1 
ATOM   9608  N N   . HIS F 2 73  ? 53.524  -14.316 -15.541 1.00 44.67  ? 73  HIS F N   1 
ATOM   9609  C CA  . HIS F 2 73  ? 54.407  -13.144 -15.510 1.00 58.92  ? 73  HIS F CA  1 
ATOM   9610  C C   . HIS F 2 73  ? 55.856  -13.528 -15.202 1.00 59.72  ? 73  HIS F C   1 
ATOM   9611  O O   . HIS F 2 73  ? 56.801  -12.970 -15.770 1.00 55.25  ? 73  HIS F O   1 
ATOM   9612  C CB  . HIS F 2 73  ? 53.936  -12.114 -14.474 1.00 45.85  ? 73  HIS F CB  1 
ATOM   9613  C CG  . HIS F 2 73  ? 52.803  -11.252 -14.938 1.00 57.36  ? 73  HIS F CG  1 
ATOM   9614  N ND1 . HIS F 2 73  ? 51.486  -11.657 -14.888 1.00 44.00  ? 73  HIS F ND1 1 
ATOM   9615  C CD2 . HIS F 2 73  ? 52.794  -10.008 -15.472 1.00 51.24  ? 73  HIS F CD2 1 
ATOM   9616  C CE1 . HIS F 2 73  ? 50.716  -10.698 -15.369 1.00 51.94  ? 73  HIS F CE1 1 
ATOM   9617  N NE2 . HIS F 2 73  ? 51.485  -9.688  -15.731 1.00 37.16  ? 73  HIS F NE2 1 
ATOM   9618  N N   . VAL F 2 74  ? 56.028  -14.468 -14.279 1.00 66.35  ? 74  VAL F N   1 
ATOM   9619  C CA  . VAL F 2 74  ? 57.357  -14.934 -13.917 1.00 64.17  ? 74  VAL F CA  1 
ATOM   9620  C C   . VAL F 2 74  ? 57.966  -15.494 -15.202 1.00 80.99  ? 74  VAL F C   1 
ATOM   9621  O O   . VAL F 2 74  ? 59.055  -15.067 -15.621 1.00 68.59  ? 74  VAL F O   1 
ATOM   9622  C CB  . VAL F 2 74  ? 57.290  -16.045 -12.834 1.00 46.33  ? 74  VAL F CB  1 
ATOM   9623  C CG1 . VAL F 2 74  ? 58.642  -16.719 -12.693 1.00 59.08  ? 74  VAL F CG1 1 
ATOM   9624  C CG2 . VAL F 2 74  ? 56.863  -15.446 -11.496 1.00 57.56  ? 74  VAL F CG2 1 
ATOM   9625  N N   . GLU F 2 75  ? 57.246  -16.427 -15.835 1.00 56.14  ? 75  GLU F N   1 
ATOM   9626  C CA  . GLU F 2 75  ? 57.708  -17.039 -17.079 1.00 67.06  ? 75  GLU F CA  1 
ATOM   9627  C C   . GLU F 2 75  ? 58.095  -15.976 -18.102 1.00 72.18  ? 75  GLU F C   1 
ATOM   9628  O O   . GLU F 2 75  ? 59.243  -15.935 -18.547 1.00 73.97  ? 75  GLU F O   1 
ATOM   9629  C CB  . GLU F 2 75  ? 56.623  -17.928 -17.697 1.00 77.16  ? 75  GLU F CB  1 
ATOM   9630  C CG  . GLU F 2 75  ? 56.036  -18.949 -16.759 1.00 98.18  ? 75  GLU F CG  1 
ATOM   9631  C CD  . GLU F 2 75  ? 54.744  -19.532 -17.293 1.00 103.15 ? 75  GLU F CD  1 
ATOM   9632  O OE1 . GLU F 2 75  ? 53.998  -20.146 -16.487 1.00 103.15 ? 75  GLU F OE1 1 
ATOM   9633  O OE2 . GLU F 2 75  ? 54.479  -19.373 -18.516 1.00 103.15 ? 75  GLU F OE2 1 
ATOM   9634  N N   . ASP F 2 76  ? 57.150  -15.115 -18.477 1.00 66.77  ? 76  ASP F N   1 
ATOM   9635  C CA  . ASP F 2 76  ? 57.461  -14.084 -19.468 1.00 69.73  ? 76  ASP F CA  1 
ATOM   9636  C C   . ASP F 2 76  ? 58.357  -12.950 -18.974 1.00 48.24  ? 76  ASP F C   1 
ATOM   9637  O O   . ASP F 2 76  ? 58.383  -11.876 -19.558 1.00 48.46  ? 76  ASP F O   1 
ATOM   9638  C CB  . ASP F 2 76  ? 56.189  -13.487 -20.071 1.00 74.87  ? 76  ASP F CB  1 
ATOM   9639  C CG  . ASP F 2 76  ? 56.463  -12.758 -21.386 1.00 91.68  ? 76  ASP F CG  1 
ATOM   9640  O OD1 . ASP F 2 76  ? 55.653  -11.883 -21.771 1.00 103.15 ? 76  ASP F OD1 1 
ATOM   9641  O OD2 . ASP F 2 76  ? 57.488  -13.064 -22.044 1.00 79.89  ? 76  ASP F OD2 1 
ATOM   9642  N N   . GLU F 2 77  ? 59.081  -13.190 -17.889 1.00 60.12  ? 77  GLU F N   1 
ATOM   9643  C CA  . GLU F 2 77  ? 60.016  -12.206 -17.355 1.00 64.93  ? 77  GLU F CA  1 
ATOM   9644  C C   . GLU F 2 77  ? 59.486  -10.805 -17.031 1.00 66.23  ? 77  GLU F C   1 
ATOM   9645  O O   . GLU F 2 77  ? 60.158  -9.807  -17.306 1.00 55.41  ? 77  GLU F O   1 
ATOM   9646  C CB  . GLU F 2 77  ? 61.212  -12.090 -18.313 1.00 73.31  ? 77  GLU F CB  1 
ATOM   9647  C CG  . GLU F 2 77  ? 62.069  -13.346 -18.362 1.00 85.42  ? 77  GLU F CG  1 
ATOM   9648  C CD  . GLU F 2 77  ? 62.796  -13.511 -19.682 1.00 96.06  ? 77  GLU F CD  1 
ATOM   9649  O OE1 . GLU F 2 77  ? 63.596  -12.617 -20.053 1.00 90.60  ? 77  GLU F OE1 1 
ATOM   9650  O OE2 . GLU F 2 77  ? 62.559  -14.547 -20.352 1.00 103.15 ? 77  GLU F OE2 1 
ATOM   9651  N N   . ARG F 2 78  ? 58.293  -10.722 -16.448 1.00 66.35  ? 78  ARG F N   1 
ATOM   9652  C CA  . ARG F 2 78  ? 57.734  -9.421  -16.065 1.00 55.55  ? 78  ARG F CA  1 
ATOM   9653  C C   . ARG F 2 78  ? 58.067  -9.315  -14.583 1.00 61.33  ? 78  ARG F C   1 
ATOM   9654  O O   . ARG F 2 78  ? 58.331  -10.344 -13.951 1.00 59.88  ? 78  ARG F O   1 
ATOM   9655  C CB  . ARG F 2 78  ? 56.207  -9.400  -16.261 1.00 49.29  ? 78  ARG F CB  1 
ATOM   9656  C CG  . ARG F 2 78  ? 55.728  -9.755  -17.686 1.00 41.66  ? 78  ARG F CG  1 
ATOM   9657  C CD  . ARG F 2 78  ? 56.210  -8.717  -18.686 1.00 47.85  ? 78  ARG F CD  1 
ATOM   9658  N NE  . ARG F 2 78  ? 55.872  -9.047  -20.065 1.00 64.82  ? 78  ARG F NE  1 
ATOM   9659  C CZ  . ARG F 2 78  ? 55.017  -8.356  -20.814 1.00 71.15  ? 78  ARG F CZ  1 
ATOM   9660  N NH1 . ARG F 2 78  ? 54.397  -7.287  -20.321 1.00 58.07  ? 78  ARG F NH1 1 
ATOM   9661  N NH2 . ARG F 2 78  ? 54.796  -8.723  -22.068 1.00 61.16  ? 78  ARG F NH2 1 
ATOM   9662  N N   . TYR F 2 79  ? 58.074  -8.104  -14.025 1.00 56.82  ? 79  TYR F N   1 
ATOM   9663  C CA  . TYR F 2 79  ? 58.376  -7.947  -12.603 1.00 42.66  ? 79  TYR F CA  1 
ATOM   9664  C C   . TYR F 2 79  ? 57.152  -8.203  -11.726 1.00 51.07  ? 79  TYR F C   1 
ATOM   9665  O O   . TYR F 2 79  ? 56.054  -7.731  -12.020 1.00 55.23  ? 79  TYR F O   1 
ATOM   9666  C CB  . TYR F 2 79  ? 58.907  -6.547  -12.295 1.00 46.16  ? 79  TYR F CB  1 
ATOM   9667  C CG  . TYR F 2 79  ? 60.400  -6.365  -12.496 1.00 61.63  ? 79  TYR F CG  1 
ATOM   9668  C CD1 . TYR F 2 79  ? 60.959  -6.318  -13.773 1.00 50.84  ? 79  TYR F CD1 1 
ATOM   9669  C CD2 . TYR F 2 79  ? 61.255  -6.233  -11.399 1.00 72.23  ? 79  TYR F CD2 1 
ATOM   9670  C CE1 . TYR F 2 79  ? 62.325  -6.145  -13.954 1.00 53.08  ? 79  TYR F CE1 1 
ATOM   9671  C CE2 . TYR F 2 79  ? 62.631  -6.060  -11.569 1.00 50.42  ? 79  TYR F CE2 1 
ATOM   9672  C CZ  . TYR F 2 79  ? 63.159  -6.017  -12.845 1.00 71.68  ? 79  TYR F CZ  1 
ATOM   9673  O OH  . TYR F 2 79  ? 64.524  -5.851  -13.010 1.00 84.13  ? 79  TYR F OH  1 
ATOM   9674  N N   . VAL F 2 80  ? 57.355  -8.966  -10.655 1.00 46.76  ? 80  VAL F N   1 
ATOM   9675  C CA  . VAL F 2 80  ? 56.301  -9.272  -9.694  1.00 41.10  ? 80  VAL F CA  1 
ATOM   9676  C C   . VAL F 2 80  ? 56.816  -8.831  -8.333  1.00 47.39  ? 80  VAL F C   1 
ATOM   9677  O O   . VAL F 2 80  ? 57.947  -9.150  -7.957  1.00 54.28  ? 80  VAL F O   1 
ATOM   9678  C CB  . VAL F 2 80  ? 55.990  -10.766 -9.617  1.00 36.45  ? 80  VAL F CB  1 
ATOM   9679  C CG1 . VAL F 2 80  ? 54.953  -11.004 -8.551  1.00 34.75  ? 80  VAL F CG1 1 
ATOM   9680  C CG2 . VAL F 2 80  ? 55.483  -11.268 -10.948 1.00 38.36  ? 80  VAL F CG2 1 
ATOM   9681  N N   . VAL F 2 81  ? 55.982  -8.104  -7.599  1.00 40.92  ? 81  VAL F N   1 
ATOM   9682  C CA  . VAL F 2 81  ? 56.366  -7.599  -6.293  1.00 36.67  ? 81  VAL F CA  1 
ATOM   9683  C C   . VAL F 2 81  ? 55.307  -7.842  -5.210  1.00 49.13  ? 81  VAL F C   1 
ATOM   9684  O O   . VAL F 2 81  ? 54.197  -7.313  -5.277  1.00 52.51  ? 81  VAL F O   1 
ATOM   9685  C CB  . VAL F 2 81  ? 56.665  -6.087  -6.381  1.00 31.60  ? 81  VAL F CB  1 
ATOM   9686  C CG1 . VAL F 2 81  ? 57.301  -5.609  -5.096  1.00 35.36  ? 81  VAL F CG1 1 
ATOM   9687  C CG2 . VAL F 2 81  ? 57.574  -5.803  -7.568  1.00 30.52  ? 81  VAL F CG2 1 
ATOM   9688  N N   . GLY F 2 82  ? 55.644  -8.644  -4.207  1.00 43.91  ? 82  GLY F N   1 
ATOM   9689  C CA  . GLY F 2 82  ? 54.692  -8.893  -3.137  1.00 35.88  ? 82  GLY F CA  1 
ATOM   9690  C C   . GLY F 2 82  ? 54.847  -7.847  -2.054  1.00 25.79  ? 82  GLY F C   1 
ATOM   9691  O O   . GLY F 2 82  ? 55.965  -7.382  -1.811  1.00 48.69  ? 82  GLY F O   1 
ATOM   9692  N N   . VAL F 2 83  ? 53.746  -7.471  -1.408  1.00 37.51  ? 83  VAL F N   1 
ATOM   9693  C CA  . VAL F 2 83  ? 53.772  -6.469  -0.337  1.00 34.10  ? 83  VAL F CA  1 
ATOM   9694  C C   . VAL F 2 83  ? 53.023  -7.028  0.871   1.00 45.54  ? 83  VAL F C   1 
ATOM   9695  O O   . VAL F 2 83  ? 51.916  -7.534  0.736   1.00 52.24  ? 83  VAL F O   1 
ATOM   9696  C CB  . VAL F 2 83  ? 53.135  -5.147  -0.814  1.00 60.14  ? 83  VAL F CB  1 
ATOM   9697  C CG1 . VAL F 2 83  ? 53.068  -4.139  0.326   1.00 37.84  ? 83  VAL F CG1 1 
ATOM   9698  C CG2 . VAL F 2 83  ? 53.954  -4.581  -1.972  1.00 48.75  ? 83  VAL F CG2 1 
ATOM   9699  N N   . CYS F 2 84  ? 53.631  -6.909  2.050   1.00 54.29  ? 84  CYS F N   1 
ATOM   9700  C CA  . CYS F 2 84  ? 53.096  -7.465  3.299   1.00 47.30  ? 84  CYS F CA  1 
ATOM   9701  C C   . CYS F 2 84  ? 52.635  -8.913  3.047   1.00 50.75  ? 84  CYS F C   1 
ATOM   9702  O O   . CYS F 2 84  ? 53.456  -9.762  2.712   1.00 45.54  ? 84  CYS F O   1 
ATOM   9703  C CB  . CYS F 2 84  ? 51.959  -6.616  3.895   1.00 48.30  ? 84  CYS F CB  1 
ATOM   9704  S SG  . CYS F 2 84  ? 51.596  -7.001  5.700   1.00 74.67  ? 84  CYS F SG  1 
ATOM   9705  N N   . LEU F 2 85  ? 51.349  -9.208  3.199   1.00 38.76  ? 85  LEU F N   1 
ATOM   9706  C CA  . LEU F 2 85  ? 50.886  -10.575 2.972   1.00 40.76  ? 85  LEU F CA  1 
ATOM   9707  C C   . LEU F 2 85  ? 51.264  -11.040 1.579   1.00 50.83  ? 85  LEU F C   1 
ATOM   9708  O O   . LEU F 2 85  ? 51.393  -12.238 1.322   1.00 53.28  ? 85  LEU F O   1 
ATOM   9709  C CB  . LEU F 2 85  ? 49.368  -10.679 3.126   1.00 51.96  ? 85  LEU F CB  1 
ATOM   9710  C CG  . LEU F 2 85  ? 48.793  -12.075 2.864   1.00 53.41  ? 85  LEU F CG  1 
ATOM   9711  C CD1 . LEU F 2 85  ? 49.276  -13.049 3.943   1.00 47.50  ? 85  LEU F CD1 1 
ATOM   9712  C CD2 . LEU F 2 85  ? 47.276  -12.008 2.853   1.00 46.94  ? 85  LEU F CD2 1 
ATOM   9713  N N   . GLY F 2 86  ? 51.433  -10.083 0.677   1.00 45.36  ? 86  GLY F N   1 
ATOM   9714  C CA  . GLY F 2 86  ? 51.783  -10.412 -0.689  1.00 46.55  ? 86  GLY F CA  1 
ATOM   9715  C C   . GLY F 2 86  ? 53.128  -11.087 -0.837  1.00 40.34  ? 86  GLY F C   1 
ATOM   9716  O O   . GLY F 2 86  ? 53.307  -11.923 -1.709  1.00 42.59  ? 86  GLY F O   1 
ATOM   9717  N N   . MET F 2 87  ? 54.079  -10.714 0.009   1.00 47.85  ? 87  MET F N   1 
ATOM   9718  C CA  . MET F 2 87  ? 55.410  -11.304 -0.034  1.00 53.42  ? 87  MET F CA  1 
ATOM   9719  C C   . MET F 2 87  ? 55.410  -12.760 0.475   1.00 54.79  ? 87  MET F C   1 
ATOM   9720  O O   . MET F 2 87  ? 56.159  -13.592 -0.022  1.00 47.38  ? 87  MET F O   1 
ATOM   9721  C CB  . MET F 2 87  ? 56.376  -10.471 0.803   1.00 44.82  ? 87  MET F CB  1 
ATOM   9722  C CG  . MET F 2 87  ? 57.800  -10.959 0.730   1.00 54.45  ? 87  MET F CG  1 
ATOM   9723  S SD  . MET F 2 87  ? 58.902  -10.125 1.874   1.00 62.15  ? 87  MET F SD  1 
ATOM   9724  C CE  . MET F 2 87  ? 59.382  -11.541 2.918   1.00 55.16  ? 87  MET F CE  1 
ATOM   9725  N N   . GLN F 2 88  ? 54.556  -13.057 1.456   1.00 49.07  ? 88  GLN F N   1 
ATOM   9726  C CA  . GLN F 2 88  ? 54.464  -14.399 2.035   1.00 50.42  ? 88  GLN F CA  1 
ATOM   9727  C C   . GLN F 2 88  ? 53.820  -15.438 1.112   1.00 59.94  ? 88  GLN F C   1 
ATOM   9728  O O   . GLN F 2 88  ? 54.047  -16.633 1.272   1.00 59.96  ? 88  GLN F O   1 
ATOM   9729  C CB  . GLN F 2 88  ? 53.693  -14.347 3.356   1.00 32.26  ? 88  GLN F CB  1 
ATOM   9730  C CG  . GLN F 2 88  ? 54.070  -13.155 4.190   1.00 48.30  ? 88  GLN F CG  1 
ATOM   9731  C CD  . GLN F 2 88  ? 53.650  -13.265 5.630   1.00 43.87  ? 88  GLN F CD  1 
ATOM   9732  O OE1 . GLN F 2 88  ? 52.481  -13.501 5.945   1.00 57.63  ? 88  GLN F OE1 1 
ATOM   9733  N NE2 . GLN F 2 88  ? 54.609  -13.078 6.527   1.00 65.34  ? 88  GLN F NE2 1 
ATOM   9734  N N   . LEU F 2 89  ? 53.022  -14.986 0.149   1.00 49.42  ? 89  LEU F N   1 
ATOM   9735  C CA  . LEU F 2 89  ? 52.359  -15.906 -0.774  1.00 48.66  ? 89  LEU F CA  1 
ATOM   9736  C C   . LEU F 2 89  ? 53.299  -16.404 -1.858  1.00 34.42  ? 89  LEU F C   1 
ATOM   9737  O O   . LEU F 2 89  ? 53.059  -17.422 -2.485  1.00 49.22  ? 89  LEU F O   1 
ATOM   9738  C CB  . LEU F 2 89  ? 51.152  -15.224 -1.403  1.00 50.72  ? 89  LEU F CB  1 
ATOM   9739  C CG  . LEU F 2 89  ? 49.957  -15.105 -0.466  1.00 60.30  ? 89  LEU F CG  1 
ATOM   9740  C CD1 . LEU F 2 89  ? 50.399  -14.807 0.965   1.00 76.56  ? 89  LEU F CD1 1 
ATOM   9741  C CD2 . LEU F 2 89  ? 49.043  -14.018 -1.008  1.00 57.46  ? 89  LEU F CD2 1 
ATOM   9742  N N   . LEU F 2 90  ? 54.373  -15.672 -2.080  1.00 48.60  ? 90  LEU F N   1 
ATOM   9743  C CA  . LEU F 2 90  ? 55.352  -16.067 -3.073  1.00 57.18  ? 90  LEU F CA  1 
ATOM   9744  C C   . LEU F 2 90  ? 55.977  -17.418 -2.650  1.00 67.10  ? 90  LEU F C   1 
ATOM   9745  O O   . LEU F 2 90  ? 56.338  -18.253 -3.496  1.00 65.13  ? 90  LEU F O   1 
ATOM   9746  C CB  . LEU F 2 90  ? 56.439  -14.986 -3.175  1.00 52.91  ? 90  LEU F CB  1 
ATOM   9747  C CG  . LEU F 2 90  ? 56.011  -13.546 -3.508  1.00 44.05  ? 90  LEU F CG  1 
ATOM   9748  C CD1 . LEU F 2 90  ? 57.226  -12.630 -3.457  1.00 35.34  ? 90  LEU F CD1 1 
ATOM   9749  C CD2 . LEU F 2 90  ? 55.355  -13.501 -4.894  1.00 32.54  ? 90  LEU F CD2 1 
ATOM   9750  N N   . PHE F 2 91  ? 56.087  -17.634 -1.339  1.00 57.01  ? 91  PHE F N   1 
ATOM   9751  C CA  . PHE F 2 91  ? 56.678  -18.868 -0.838  1.00 71.26  ? 91  PHE F CA  1 
ATOM   9752  C C   . PHE F 2 91  ? 55.762  -20.085 -0.894  1.00 65.43  ? 91  PHE F C   1 
ATOM   9753  O O   . PHE F 2 91  ? 54.565  -19.967 -1.170  1.00 55.84  ? 91  PHE F O   1 
ATOM   9754  C CB  . PHE F 2 91  ? 57.243  -18.652 0.578   1.00 60.19  ? 91  PHE F CB  1 
ATOM   9755  C CG  . PHE F 2 91  ? 58.366  -17.645 0.618   1.00 47.05  ? 91  PHE F CG  1 
ATOM   9756  C CD1 . PHE F 2 91  ? 58.107  -16.298 0.859   1.00 40.26  ? 91  PHE F CD1 1 
ATOM   9757  C CD2 . PHE F 2 91  ? 59.667  -18.031 0.322   1.00 38.67  ? 91  PHE F CD2 1 
ATOM   9758  C CE1 . PHE F 2 91  ? 59.123  -15.356 0.801   1.00 45.80  ? 91  PHE F CE1 1 
ATOM   9759  C CE2 . PHE F 2 91  ? 60.698  -17.094 0.258   1.00 36.85  ? 91  PHE F CE2 1 
ATOM   9760  C CZ  . PHE F 2 91  ? 60.427  -15.755 0.495   1.00 58.90  ? 91  PHE F CZ  1 
ATOM   9761  N N   . GLU F 2 92  ? 56.360  -21.251 -0.645  1.00 73.70  ? 92  GLU F N   1 
ATOM   9762  C CA  . GLU F 2 92  ? 55.684  -22.551 -0.701  1.00 69.67  ? 92  GLU F CA  1 
ATOM   9763  C C   . GLU F 2 92  ? 54.467  -22.776 0.187   1.00 67.03  ? 92  GLU F C   1 
ATOM   9764  O O   . GLU F 2 92  ? 53.397  -23.132 -0.320  1.00 57.23  ? 92  GLU F O   1 
ATOM   9765  C CB  . GLU F 2 92  ? 56.712  -23.665 -0.464  1.00 76.91  ? 92  GLU F CB  1 
ATOM   9766  C CG  . GLU F 2 92  ? 57.577  -23.956 -1.699  1.00 82.27  ? 92  GLU F CG  1 
ATOM   9767  C CD  . GLU F 2 92  ? 58.900  -24.621 -1.356  1.00 68.01  ? 92  GLU F CD  1 
ATOM   9768  O OE1 . GLU F 2 92  ? 58.926  -25.459 -0.432  1.00 73.05  ? 92  GLU F OE1 1 
ATOM   9769  O OE2 . GLU F 2 92  ? 59.914  -24.307 -2.017  1.00 71.90  ? 92  GLU F OE2 1 
ATOM   9770  N N   . GLU F 2 93  ? 54.631  -22.579 1.495   1.00 55.54  ? 93  GLU F N   1 
ATOM   9771  C CA  . GLU F 2 93  ? 53.546  -22.777 2.458   1.00 55.00  ? 93  GLU F CA  1 
ATOM   9772  C C   . GLU F 2 93  ? 53.715  -21.893 3.688   1.00 59.63  ? 93  GLU F C   1 
ATOM   9773  O O   . GLU F 2 93  ? 54.755  -21.254 3.881   1.00 56.79  ? 93  GLU F O   1 
ATOM   9774  C CB  . GLU F 2 93  ? 53.504  -24.234 2.890   1.00 58.74  ? 93  GLU F CB  1 
ATOM   9775  C CG  . GLU F 2 93  ? 54.880  -24.778 3.177   1.00 84.27  ? 93  GLU F CG  1 
ATOM   9776  C CD  . GLU F 2 93  ? 54.863  -26.025 4.042   1.00 89.91  ? 93  GLU F CD  1 
ATOM   9777  O OE1 . GLU F 2 93  ? 54.131  -26.034 5.058   1.00 73.51  ? 93  GLU F OE1 1 
ATOM   9778  O OE2 . GLU F 2 93  ? 55.600  -26.983 3.712   1.00 73.35  ? 93  GLU F OE2 1 
ATOM   9779  N N   . SER F 2 94  ? 52.697  -21.858 4.535   1.00 54.94  ? 94  SER F N   1 
ATOM   9780  C CA  . SER F 2 94  ? 52.783  -21.021 5.714   1.00 54.64  ? 94  SER F CA  1 
ATOM   9781  C C   . SER F 2 94  ? 52.279  -21.669 6.977   1.00 46.62  ? 94  SER F C   1 
ATOM   9782  O O   . SER F 2 94  ? 51.249  -22.325 6.991   1.00 57.01  ? 94  SER F O   1 
ATOM   9783  C CB  . SER F 2 94  ? 52.011  -19.711 5.500   1.00 54.22  ? 94  SER F CB  1 
ATOM   9784  O OG  . SER F 2 94  ? 52.016  -18.900 6.677   1.00 48.35  ? 94  SER F OG  1 
ATOM   9785  N N   . GLU F 2 95  ? 53.010  -21.428 8.052   1.00 58.19  ? 95  GLU F N   1 
ATOM   9786  C CA  . GLU F 2 95  ? 52.669  -21.941 9.365   1.00 61.92  ? 95  GLU F CA  1 
ATOM   9787  C C   . GLU F 2 95  ? 51.307  -21.420 9.840   1.00 59.11  ? 95  GLU F C   1 
ATOM   9788  O O   . GLU F 2 95  ? 50.694  -22.017 10.720  1.00 72.91  ? 95  GLU F O   1 
ATOM   9789  C CB  . GLU F 2 95  ? 53.776  -21.543 10.343  1.00 74.98  ? 95  GLU F CB  1 
ATOM   9790  C CG  . GLU F 2 95  ? 53.537  -21.875 11.812  1.00 90.25  ? 95  GLU F CG  1 
ATOM   9791  C CD  . GLU F 2 95  ? 54.512  -21.146 12.728  1.00 91.40  ? 95  GLU F CD  1 
ATOM   9792  O OE1 . GLU F 2 95  ? 54.051  -20.536 13.723  1.00 77.89  ? 95  GLU F OE1 1 
ATOM   9793  O OE2 . GLU F 2 95  ? 55.735  -21.178 12.449  1.00 87.30  ? 95  GLU F OE2 1 
ATOM   9794  N N   . GLU F 2 96  ? 50.818  -20.326 9.256   1.00 62.09  ? 96  GLU F N   1 
ATOM   9795  C CA  . GLU F 2 96  ? 49.522  -19.766 9.663   1.00 54.53  ? 96  GLU F CA  1 
ATOM   9796  C C   . GLU F 2 96  ? 48.318  -20.462 9.014   1.00 50.26  ? 96  GLU F C   1 
ATOM   9797  O O   . GLU F 2 96  ? 47.196  -20.357 9.508   1.00 53.50  ? 96  GLU F O   1 
ATOM   9798  C CB  . GLU F 2 96  ? 49.463  -18.264 9.353   1.00 53.06  ? 96  GLU F CB  1 
ATOM   9799  C CG  . GLU F 2 96  ? 48.057  -17.653 9.475   1.00 54.89  ? 96  GLU F CG  1 
ATOM   9800  C CD  . GLU F 2 96  ? 48.008  -16.187 9.075   1.00 76.74  ? 96  GLU F CD  1 
ATOM   9801  O OE1 . GLU F 2 96  ? 48.758  -15.796 8.153   1.00 58.58  ? 96  GLU F OE1 1 
ATOM   9802  O OE2 . GLU F 2 96  ? 47.213  -15.428 9.671   1.00 55.47  ? 96  GLU F OE2 1 
ATOM   9803  N N   . ALA F 2 97  ? 48.548  -21.149 7.899   1.00 49.97  ? 97  ALA F N   1 
ATOM   9804  C CA  . ALA F 2 97  ? 47.482  -21.877 7.198   1.00 68.31  ? 97  ALA F CA  1 
ATOM   9805  C C   . ALA F 2 97  ? 48.032  -23.281 6.951   1.00 77.08  ? 97  ALA F C   1 
ATOM   9806  O O   . ALA F 2 97  ? 48.579  -23.571 5.875   1.00 77.68  ? 97  ALA F O   1 
ATOM   9807  C CB  . ALA F 2 97  ? 47.146  -21.200 5.872   1.00 63.24  ? 97  ALA F CB  1 
ATOM   9808  N N   . PRO F 2 98  ? 47.883  -24.171 7.951   1.00 85.95  ? 98  PRO F N   1 
ATOM   9809  C CA  . PRO F 2 98  ? 48.344  -25.566 7.947   1.00 77.33  ? 98  PRO F CA  1 
ATOM   9810  C C   . PRO F 2 98  ? 48.420  -26.286 6.612   1.00 72.68  ? 98  PRO F C   1 
ATOM   9811  O O   . PRO F 2 98  ? 49.517  -26.617 6.153   1.00 65.95  ? 98  PRO F O   1 
ATOM   9812  C CB  . PRO F 2 98  ? 47.397  -26.257 8.944   1.00 95.12  ? 98  PRO F CB  1 
ATOM   9813  C CG  . PRO F 2 98  ? 46.211  -25.287 9.067   1.00 87.92  ? 98  PRO F CG  1 
ATOM   9814  C CD  . PRO F 2 98  ? 46.913  -23.963 9.042   1.00 82.75  ? 98  PRO F CD  1 
ATOM   9815  N N   . GLY F 2 99  ? 47.273  -26.511 5.976   1.00 52.17  ? 99  GLY F N   1 
ATOM   9816  C CA  . GLY F 2 99  ? 47.288  -27.231 4.717   1.00 65.49  ? 99  GLY F CA  1 
ATOM   9817  C C   . GLY F 2 99  ? 47.687  -26.480 3.460   1.00 78.80  ? 99  GLY F C   1 
ATOM   9818  O O   . GLY F 2 99  ? 48.477  -26.988 2.645   1.00 82.99  ? 99  GLY F O   1 
ATOM   9819  N N   . VAL F 2 100 ? 47.160  -25.263 3.314   1.00 83.22  ? 100 VAL F N   1 
ATOM   9820  C CA  . VAL F 2 100 ? 47.377  -24.433 2.131   1.00 57.85  ? 100 VAL F CA  1 
ATOM   9821  C C   . VAL F 2 100 ? 48.789  -24.294 1.582   1.00 69.24  ? 100 VAL F C   1 
ATOM   9822  O O   . VAL F 2 100 ? 49.758  -24.119 2.322   1.00 81.24  ? 100 VAL F O   1 
ATOM   9823  C CB  . VAL F 2 100 ? 46.808  -23.026 2.358   1.00 66.38  ? 100 VAL F CB  1 
ATOM   9824  C CG1 . VAL F 2 100 ? 46.796  -22.240 1.039   1.00 46.15  ? 100 VAL F CG1 1 
ATOM   9825  C CG2 . VAL F 2 100 ? 45.408  -23.140 2.941   1.00 60.10  ? 100 VAL F CG2 1 
ATOM   9826  N N   . LYS F 2 101 ? 48.889  -24.380 0.261   1.00 51.06  ? 101 LYS F N   1 
ATOM   9827  C CA  . LYS F 2 101 ? 50.158  -24.235 -0.432  1.00 68.93  ? 101 LYS F CA  1 
ATOM   9828  C C   . LYS F 2 101 ? 50.132  -22.903 -1.200  1.00 60.98  ? 101 LYS F C   1 
ATOM   9829  O O   . LYS F 2 101 ? 49.177  -22.601 -1.915  1.00 56.67  ? 101 LYS F O   1 
ATOM   9830  C CB  . LYS F 2 101 ? 50.369  -25.412 -1.399  1.00 83.05  ? 101 LYS F CB  1 
ATOM   9831  C CG  . LYS F 2 101 ? 50.533  -26.796 -0.707  1.00 101.41 ? 101 LYS F CG  1 
ATOM   9832  C CD  . LYS F 2 101 ? 51.914  -26.987 -0.039  1.00 88.08  ? 101 LYS F CD  1 
ATOM   9833  C CE  . LYS F 2 101 ? 53.051  -27.024 -1.074  1.00 77.35  ? 101 LYS F CE  1 
ATOM   9834  N NZ  . LYS F 2 101 ? 54.402  -27.138 -0.446  1.00 77.87  ? 101 LYS F NZ  1 
ATOM   9835  N N   . GLY F 2 102 ? 51.185  -22.111 -1.049  1.00 49.26  ? 102 GLY F N   1 
ATOM   9836  C CA  . GLY F 2 102 ? 51.234  -20.827 -1.716  1.00 55.81  ? 102 GLY F CA  1 
ATOM   9837  C C   . GLY F 2 102 ? 51.574  -20.900 -3.186  1.00 55.89  ? 102 GLY F C   1 
ATOM   9838  O O   . GLY F 2 102 ? 51.489  -21.954 -3.805  1.00 61.30  ? 102 GLY F O   1 
ATOM   9839  N N   . LEU F 2 103 ? 51.963  -19.760 -3.748  1.00 70.46  ? 103 LEU F N   1 
ATOM   9840  C CA  . LEU F 2 103 ? 52.329  -19.666 -5.156  1.00 59.13  ? 103 LEU F CA  1 
ATOM   9841  C C   . LEU F 2 103 ? 53.607  -20.471 -5.369  1.00 57.00  ? 103 LEU F C   1 
ATOM   9842  O O   . LEU F 2 103 ? 53.781  -21.136 -6.392  1.00 74.58  ? 103 LEU F O   1 
ATOM   9843  C CB  . LEU F 2 103 ? 52.557  -18.192 -5.525  1.00 51.46  ? 103 LEU F CB  1 
ATOM   9844  C CG  . LEU F 2 103 ? 51.387  -17.222 -5.303  1.00 46.43  ? 103 LEU F CG  1 
ATOM   9845  C CD1 . LEU F 2 103 ? 51.908  -15.806 -5.077  1.00 44.49  ? 103 LEU F CD1 1 
ATOM   9846  C CD2 . LEU F 2 103 ? 50.451  -17.272 -6.489  1.00 36.47  ? 103 LEU F CD2 1 
ATOM   9847  N N   . SER F 2 104 ? 54.505  -20.401 -4.393  1.00 73.93  ? 104 SER F N   1 
ATOM   9848  C CA  . SER F 2 104 ? 55.774  -21.118 -4.468  1.00 76.81  ? 104 SER F CA  1 
ATOM   9849  C C   . SER F 2 104 ? 56.692  -20.558 -5.541  1.00 67.73  ? 104 SER F C   1 
ATOM   9850  O O   . SER F 2 104 ? 57.474  -21.304 -6.138  1.00 76.77  ? 104 SER F O   1 
ATOM   9851  C CB  . SER F 2 104 ? 55.527  -22.605 -4.740  1.00 62.03  ? 104 SER F CB  1 
ATOM   9852  O OG  . SER F 2 104 ? 54.755  -23.177 -3.694  1.00 84.04  ? 104 SER F OG  1 
ATOM   9853  N N   . LEU F 2 105 ? 56.599  -19.257 -5.803  1.00 62.17  ? 105 LEU F N   1 
ATOM   9854  C CA  . LEU F 2 105 ? 57.469  -18.658 -6.814  1.00 74.87  ? 105 LEU F CA  1 
ATOM   9855  C C   . LEU F 2 105 ? 58.872  -18.594 -6.252  1.00 63.70  ? 105 LEU F C   1 
ATOM   9856  O O   . LEU F 2 105 ? 59.846  -18.514 -7.000  1.00 76.59  ? 105 LEU F O   1 
ATOM   9857  C CB  . LEU F 2 105 ? 56.990  -17.255 -7.205  1.00 51.19  ? 105 LEU F CB  1 
ATOM   9858  C CG  . LEU F 2 105 ? 55.593  -17.289 -7.823  1.00 57.74  ? 105 LEU F CG  1 
ATOM   9859  C CD1 . LEU F 2 105 ? 55.158  -15.893 -8.271  1.00 55.31  ? 105 LEU F CD1 1 
ATOM   9860  C CD2 . LEU F 2 105 ? 55.614  -18.262 -8.987  1.00 49.36  ? 105 LEU F CD2 1 
ATOM   9861  N N   . ILE F 2 106 ? 58.969  -18.623 -4.926  1.00 65.50  ? 106 ILE F N   1 
ATOM   9862  C CA  . ILE F 2 106 ? 60.269  -18.603 -4.250  1.00 67.49  ? 106 ILE F CA  1 
ATOM   9863  C C   . ILE F 2 106 ? 60.398  -19.715 -3.196  1.00 71.01  ? 106 ILE F C   1 
ATOM   9864  O O   . ILE F 2 106 ? 59.487  -19.970 -2.406  1.00 56.89  ? 106 ILE F O   1 
ATOM   9865  C CB  . ILE F 2 106 ? 60.551  -17.256 -3.560  1.00 58.24  ? 106 ILE F CB  1 
ATOM   9866  C CG1 . ILE F 2 106 ? 60.342  -16.103 -4.548  1.00 48.62  ? 106 ILE F CG1 1 
ATOM   9867  C CG2 . ILE F 2 106 ? 61.983  -17.254 -3.032  1.00 57.01  ? 106 ILE F CG2 1 
ATOM   9868  C CD1 . ILE F 2 106 ? 60.703  -14.741 -3.999  1.00 38.95  ? 106 ILE F CD1 1 
ATOM   9869  N N   . GLU F 2 107 ? 61.555  -20.365 -3.204  1.00 68.42  ? 107 GLU F N   1 
ATOM   9870  C CA  . GLU F 2 107 ? 61.883  -21.456 -2.296  1.00 57.82  ? 107 GLU F CA  1 
ATOM   9871  C C   . GLU F 2 107 ? 61.942  -20.996 -0.830  1.00 56.27  ? 107 GLU F C   1 
ATOM   9872  O O   . GLU F 2 107 ? 62.721  -20.115 -0.470  1.00 58.71  ? 107 GLU F O   1 
ATOM   9873  C CB  . GLU F 2 107 ? 63.222  -22.030 -2.737  1.00 59.10  ? 107 GLU F CB  1 
ATOM   9874  C CG  . GLU F 2 107 ? 63.711  -21.412 -4.057  1.00 84.66  ? 107 GLU F CG  1 
ATOM   9875  C CD  . GLU F 2 107 ? 63.162  -22.106 -5.300  1.00 86.93  ? 107 GLU F CD  1 
ATOM   9876  O OE1 . GLU F 2 107 ? 63.751  -23.144 -5.695  1.00 87.95  ? 107 GLU F OE1 1 
ATOM   9877  O OE2 . GLU F 2 107 ? 62.150  -21.622 -5.878  1.00 68.93  ? 107 GLU F OE2 1 
ATOM   9878  N N   . GLY F 2 108 ? 61.117  -21.598 0.013   1.00 40.53  ? 108 GLY F N   1 
ATOM   9879  C CA  . GLY F 2 108 ? 61.101  -21.221 1.411   1.00 35.74  ? 108 GLY F CA  1 
ATOM   9880  C C   . GLY F 2 108 ? 59.701  -21.321 1.973   1.00 40.17  ? 108 GLY F C   1 
ATOM   9881  O O   . GLY F 2 108 ? 58.786  -21.774 1.285   1.00 51.60  ? 108 GLY F O   1 
ATOM   9882  N N   . ASN F 2 109 ? 59.522  -20.913 3.223   1.00 46.75  ? 109 ASN F N   1 
ATOM   9883  C CA  . ASN F 2 109 ? 58.203  -20.963 3.855   1.00 52.32  ? 109 ASN F CA  1 
ATOM   9884  C C   . ASN F 2 109 ? 58.050  -19.837 4.861   1.00 46.68  ? 109 ASN F C   1 
ATOM   9885  O O   . ASN F 2 109 ? 59.001  -19.096 5.118   1.00 54.05  ? 109 ASN F O   1 
ATOM   9886  C CB  . ASN F 2 109 ? 57.985  -22.318 4.529   1.00 49.29  ? 109 ASN F CB  1 
ATOM   9887  C CG  . ASN F 2 109 ? 59.273  -22.923 5.052   1.00 76.27  ? 109 ASN F CG  1 
ATOM   9888  O OD1 . ASN F 2 109 ? 59.647  -24.038 4.666   1.00 72.86  ? 109 ASN F OD1 1 
ATOM   9889  N ND2 . ASN F 2 109 ? 59.962  -22.195 5.929   1.00 41.17  ? 109 ASN F ND2 1 
ATOM   9890  N N   . VAL F 2 110 ? 56.859  -19.703 5.432   1.00 49.72  ? 110 VAL F N   1 
ATOM   9891  C CA  . VAL F 2 110 ? 56.605  -18.628 6.394   1.00 41.86  ? 110 VAL F CA  1 
ATOM   9892  C C   . VAL F 2 110 ? 56.334  -19.119 7.809   1.00 49.98  ? 110 VAL F C   1 
ATOM   9893  O O   . VAL F 2 110 ? 55.374  -19.851 8.066   1.00 45.37  ? 110 VAL F O   1 
ATOM   9894  C CB  . VAL F 2 110 ? 55.400  -17.746 5.949   1.00 40.95  ? 110 VAL F CB  1 
ATOM   9895  C CG1 . VAL F 2 110 ? 55.218  -16.585 6.913   1.00 44.65  ? 110 VAL F CG1 1 
ATOM   9896  C CG2 . VAL F 2 110 ? 55.618  -17.237 4.531   1.00 45.62  ? 110 VAL F CG2 1 
ATOM   9897  N N   . VAL F 2 111 ? 57.182  -18.696 8.731   1.00 47.04  ? 111 VAL F N   1 
ATOM   9898  C CA  . VAL F 2 111 ? 57.030  -19.082 10.123  1.00 52.35  ? 111 VAL F CA  1 
ATOM   9899  C C   . VAL F 2 111 ? 56.761  -17.829 10.955  1.00 50.49  ? 111 VAL F C   1 
ATOM   9900  O O   . VAL F 2 111 ? 57.068  -16.715 10.532  1.00 54.37  ? 111 VAL F O   1 
ATOM   9901  C CB  . VAL F 2 111 ? 58.309  -19.828 10.636  1.00 53.43  ? 111 VAL F CB  1 
ATOM   9902  C CG1 . VAL F 2 111 ? 58.630  -20.983 9.701   1.00 43.14  ? 111 VAL F CG1 1 
ATOM   9903  C CG2 . VAL F 2 111 ? 59.513  -18.883 10.713  1.00 44.40  ? 111 VAL F CG2 1 
ATOM   9904  N N   . LYS F 2 112 ? 56.174  -18.008 12.128  1.00 40.74  ? 112 LYS F N   1 
ATOM   9905  C CA  . LYS F 2 112 ? 55.887  -16.879 13.006  1.00 52.86  ? 112 LYS F CA  1 
ATOM   9906  C C   . LYS F 2 112 ? 57.168  -16.322 13.642  1.00 59.35  ? 112 LYS F C   1 
ATOM   9907  O O   . LYS F 2 112 ? 58.131  -17.061 13.865  1.00 60.38  ? 112 LYS F O   1 
ATOM   9908  C CB  . LYS F 2 112 ? 54.910  -17.333 14.082  1.00 56.23  ? 112 LYS F CB  1 
ATOM   9909  C CG  . LYS F 2 112 ? 54.746  -16.402 15.251  1.00 51.36  ? 112 LYS F CG  1 
ATOM   9910  C CD  . LYS F 2 112 ? 53.922  -17.087 16.353  1.00 61.71  ? 112 LYS F CD  1 
ATOM   9911  C CE  . LYS F 2 112 ? 52.418  -17.092 16.078  1.00 59.06  ? 112 LYS F CE  1 
ATOM   9912  N NZ  . LYS F 2 112 ? 52.021  -17.963 14.930  1.00 82.27  ? 112 LYS F NZ  1 
ATOM   9913  N N   . LEU F 2 113 ? 57.192  -15.015 13.901  1.00 66.60  ? 113 LEU F N   1 
ATOM   9914  C CA  . LEU F 2 113 ? 58.357  -14.376 14.524  1.00 61.37  ? 113 LEU F CA  1 
ATOM   9915  C C   . LEU F 2 113 ? 58.455  -14.905 15.950  1.00 60.38  ? 113 LEU F C   1 
ATOM   9916  O O   . LEU F 2 113 ? 57.437  -15.192 16.582  1.00 46.08  ? 113 LEU F O   1 
ATOM   9917  C CB  . LEU F 2 113 ? 58.201  -12.840 14.558  1.00 75.79  ? 113 LEU F CB  1 
ATOM   9918  C CG  . LEU F 2 113 ? 58.260  -11.990 13.269  1.00 67.65  ? 113 LEU F CG  1 
ATOM   9919  C CD1 . LEU F 2 113 ? 57.656  -10.610 13.516  1.00 34.71  ? 113 LEU F CD1 1 
ATOM   9920  C CD2 . LEU F 2 113 ? 59.703  -11.862 12.798  1.00 49.42  ? 113 LEU F CD2 1 
ATOM   9921  N N   . ARG F 2 114 ? 59.679  -15.031 16.453  1.00 62.60  ? 114 ARG F N   1 
ATOM   9922  C CA  . ARG F 2 114 ? 59.900  -15.540 17.808  1.00 69.72  ? 114 ARG F CA  1 
ATOM   9923  C C   . ARG F 2 114 ? 59.627  -14.544 18.940  1.00 66.56  ? 114 ARG F C   1 
ATOM   9924  O O   . ARG F 2 114 ? 59.312  -14.953 20.063  1.00 68.96  ? 114 ARG F O   1 
ATOM   9925  C CB  . ARG F 2 114 ? 61.321  -16.114 17.935  1.00 59.68  ? 114 ARG F CB  1 
ATOM   9926  C CG  . ARG F 2 114 ? 61.457  -17.556 17.390  1.00 87.65  ? 114 ARG F CG  1 
ATOM   9927  C CD  . ARG F 2 114 ? 60.276  -18.448 17.866  1.00 103.15 ? 114 ARG F CD  1 
ATOM   9928  N NE  . ARG F 2 114 ? 60.322  -19.828 17.364  1.00 103.15 ? 114 ARG F NE  1 
ATOM   9929  C CZ  . ARG F 2 114 ? 59.357  -20.738 17.555  1.00 103.15 ? 114 ARG F CZ  1 
ATOM   9930  N NH1 . ARG F 2 114 ? 58.257  -20.422 18.240  1.00 103.15 ? 114 ARG F NH1 1 
ATOM   9931  N NH2 . ARG F 2 114 ? 59.486  -21.974 17.064  1.00 97.96  ? 114 ARG F NH2 1 
ATOM   9932  N N   . SER F 2 115 ? 59.736  -13.250 18.646  1.00 59.81  ? 115 SER F N   1 
ATOM   9933  C CA  . SER F 2 115 ? 59.480  -12.204 19.631  1.00 48.67  ? 115 SER F CA  1 
ATOM   9934  C C   . SER F 2 115 ? 58.258  -12.543 20.478  1.00 55.86  ? 115 SER F C   1 
ATOM   9935  O O   . SER F 2 115 ? 57.430  -13.339 20.065  1.00 65.84  ? 115 SER F O   1 
ATOM   9936  C CB  . SER F 2 115 ? 59.241  -10.874 18.908  1.00 59.82  ? 115 SER F CB  1 
ATOM   9937  O OG  . SER F 2 115 ? 58.792  -9.857  19.794  1.00 49.27  ? 115 SER F OG  1 
ATOM   9938  N N   . ARG F 2 116 ? 58.146  -11.958 21.668  1.00 64.23  ? 116 ARG F N   1 
ATOM   9939  C CA  . ARG F 2 116 ? 56.977  -12.222 22.501  1.00 59.16  ? 116 ARG F CA  1 
ATOM   9940  C C   . ARG F 2 116 ? 55.985  -11.078 22.318  1.00 78.69  ? 116 ARG F C   1 
ATOM   9941  O O   . ARG F 2 116 ? 54.863  -11.117 22.843  1.00 79.93  ? 116 ARG F O   1 
ATOM   9942  C CB  . ARG F 2 116 ? 57.364  -12.386 23.977  1.00 81.66  ? 116 ARG F CB  1 
ATOM   9943  C CG  . ARG F 2 116 ? 58.207  -13.644 24.249  1.00 75.83  ? 116 ARG F CG  1 
ATOM   9944  C CD  . ARG F 2 116 ? 58.548  -13.808 25.733  1.00 103.15 ? 116 ARG F CD  1 
ATOM   9945  N NE  . ARG F 2 116 ? 57.425  -14.297 26.544  1.00 90.96  ? 116 ARG F NE  1 
ATOM   9946  C CZ  . ARG F 2 116 ? 56.893  -15.516 26.439  1.00 88.30  ? 116 ARG F CZ  1 
ATOM   9947  N NH1 . ARG F 2 116 ? 57.378  -16.388 25.554  1.00 102.10 ? 116 ARG F NH1 1 
ATOM   9948  N NH2 . ARG F 2 116 ? 55.865  -15.863 27.211  1.00 90.13  ? 116 ARG F NH2 1 
ATOM   9949  N N   . ARG F 2 117 ? 56.415  -10.057 21.574  1.00 82.68  ? 117 ARG F N   1 
ATOM   9950  C CA  . ARG F 2 117 ? 55.563  -8.902  21.248  1.00 88.90  ? 117 ARG F CA  1 
ATOM   9951  C C   . ARG F 2 117 ? 55.284  -9.100  19.763  1.00 81.10  ? 117 ARG F C   1 
ATOM   9952  O O   . ARG F 2 117 ? 55.405  -8.186  18.947  1.00 76.83  ? 117 ARG F O   1 
ATOM   9953  C CB  . ARG F 2 117 ? 56.302  -7.576  21.452  1.00 79.98  ? 117 ARG F CB  1 
ATOM   9954  C CG  . ARG F 2 117 ? 55.374  -6.366  21.410  1.00 90.76  ? 117 ARG F CG  1 
ATOM   9955  C CD  . ARG F 2 117 ? 54.475  -6.328  22.636  1.00 59.30  ? 117 ARG F CD  1 
ATOM   9956  N NE  . ARG F 2 117 ? 53.075  -6.108  22.289  1.00 103.15 ? 117 ARG F NE  1 
ATOM   9957  C CZ  . ARG F 2 117 ? 52.305  -7.004  21.670  1.00 103.15 ? 117 ARG F CZ  1 
ATOM   9958  N NH1 . ARG F 2 117 ? 52.806  -8.189  21.330  1.00 85.94  ? 117 ARG F NH1 1 
ATOM   9959  N NH2 . ARG F 2 117 ? 51.033  -6.714  21.391  1.00 88.67  ? 117 ARG F NH2 1 
ATOM   9960  N N   . LEU F 2 118 ? 54.917  -10.338 19.453  1.00 92.13  ? 118 LEU F N   1 
ATOM   9961  C CA  . LEU F 2 118 ? 54.657  -10.826 18.112  1.00 78.86  ? 118 LEU F CA  1 
ATOM   9962  C C   . LEU F 2 118 ? 54.098  -9.890  17.076  1.00 82.50  ? 118 LEU F C   1 
ATOM   9963  O O   . LEU F 2 118 ? 54.471  -9.999  15.906  1.00 103.15 ? 118 LEU F O   1 
ATOM   9964  C CB  . LEU F 2 118 ? 53.799  -12.072 18.188  1.00 65.93  ? 118 LEU F CB  1 
ATOM   9965  C CG  . LEU F 2 118 ? 54.005  -13.001 16.999  1.00 78.68  ? 118 LEU F CG  1 
ATOM   9966  C CD1 . LEU F 2 118 ? 55.455  -12.993 16.518  1.00 49.97  ? 118 LEU F CD1 1 
ATOM   9967  C CD2 . LEU F 2 118 ? 53.573  -14.371 17.434  1.00 68.48  ? 118 LEU F CD2 1 
ATOM   9968  N N   . PRO F 2 119 ? 53.170  -8.988  17.452  1.00 75.70  ? 119 PRO F N   1 
ATOM   9969  C CA  . PRO F 2 119 ? 52.699  -8.107  16.369  1.00 50.78  ? 119 PRO F CA  1 
ATOM   9970  C C   . PRO F 2 119 ? 53.792  -7.075  16.033  1.00 39.81  ? 119 PRO F C   1 
ATOM   9971  O O   . PRO F 2 119 ? 53.826  -5.994  16.613  1.00 46.66  ? 119 PRO F O   1 
ATOM   9972  C CB  . PRO F 2 119 ? 51.450  -7.461  16.960  1.00 37.50  ? 119 PRO F CB  1 
ATOM   9973  C CG  . PRO F 2 119 ? 50.988  -8.468  17.989  1.00 62.09  ? 119 PRO F CG  1 
ATOM   9974  C CD  . PRO F 2 119 ? 52.268  -8.941  18.613  1.00 39.50  ? 119 PRO F CD  1 
ATOM   9975  N N   . HIS F 2 120 ? 54.707  -7.416  15.126  1.00 43.57  ? 120 HIS F N   1 
ATOM   9976  C CA  . HIS F 2 120 ? 55.768  -6.471  14.756  1.00 50.83  ? 120 HIS F CA  1 
ATOM   9977  C C   . HIS F 2 120 ? 55.111  -5.247  14.101  1.00 55.84  ? 120 HIS F C   1 
ATOM   9978  O O   . HIS F 2 120 ? 54.696  -5.306  12.943  1.00 56.31  ? 120 HIS F O   1 
ATOM   9979  C CB  . HIS F 2 120 ? 56.754  -7.099  13.765  1.00 52.52  ? 120 HIS F CB  1 
ATOM   9980  C CG  . HIS F 2 120 ? 57.938  -6.230  13.457  1.00 37.59  ? 120 HIS F CG  1 
ATOM   9981  N ND1 . HIS F 2 120 ? 58.569  -6.234  12.231  1.00 35.10  ? 120 HIS F ND1 1 
ATOM   9982  C CD2 . HIS F 2 120 ? 58.624  -5.353  14.227  1.00 47.04  ? 120 HIS F CD2 1 
ATOM   9983  C CE1 . HIS F 2 120 ? 59.591  -5.398  12.258  1.00 37.67  ? 120 HIS F CE1 1 
ATOM   9984  N NE2 . HIS F 2 120 ? 59.648  -4.851  13.458  1.00 44.89  ? 120 HIS F NE2 1 
ATOM   9985  N N   . MET F 2 121 ? 55.029  -4.147  14.842  1.00 47.68  ? 121 MET F N   1 
ATOM   9986  C CA  . MET F 2 121 ? 54.398  -2.931  14.349  1.00 42.79  ? 121 MET F CA  1 
ATOM   9987  C C   . MET F 2 121 ? 55.251  -1.694  14.622  1.00 55.38  ? 121 MET F C   1 
ATOM   9988  O O   . MET F 2 121 ? 55.554  -1.386  15.772  1.00 51.30  ? 121 MET F O   1 
ATOM   9989  C CB  . MET F 2 121 ? 53.019  -2.794  15.003  1.00 33.28  ? 121 MET F CB  1 
ATOM   9990  C CG  . MET F 2 121 ? 52.313  -1.468  14.792  1.00 62.84  ? 121 MET F CG  1 
ATOM   9991  S SD  . MET F 2 121 ? 50.596  -1.530  15.365  1.00 61.51  ? 121 MET F SD  1 
ATOM   9992  C CE  . MET F 2 121 ? 50.845  -1.714  17.161  1.00 69.50  ? 121 MET F CE  1 
ATOM   9993  N N   . GLY F 2 122 ? 55.645  -0.991  13.564  1.00 45.36  ? 122 GLY F N   1 
ATOM   9994  C CA  . GLY F 2 122 ? 56.453  0.197   13.757  1.00 42.05  ? 122 GLY F CA  1 
ATOM   9995  C C   . GLY F 2 122 ? 57.470  0.457   12.671  1.00 35.01  ? 122 GLY F C   1 
ATOM   9996  O O   . GLY F 2 122 ? 57.488  -0.230  11.660  1.00 49.49  ? 122 GLY F O   1 
ATOM   9997  N N   . TRP F 2 123 ? 58.307  1.470   12.873  1.00 41.60  ? 123 TRP F N   1 
ATOM   9998  C CA  . TRP F 2 123 ? 59.344  1.821   11.910  1.00 37.32  ? 123 TRP F CA  1 
ATOM   9999  C C   . TRP F 2 123 ? 60.612  1.067   12.273  1.00 42.76  ? 123 TRP F C   1 
ATOM   10000 O O   . TRP F 2 123 ? 61.179  1.264   13.345  1.00 55.39  ? 123 TRP F O   1 
ATOM   10001 C CB  . TRP F 2 123 ? 59.639  3.324   11.936  1.00 27.27  ? 123 TRP F CB  1 
ATOM   10002 C CG  . TRP F 2 123 ? 58.484  4.213   11.542  1.00 51.87  ? 123 TRP F CG  1 
ATOM   10003 C CD1 . TRP F 2 123 ? 57.458  4.627   12.343  1.00 66.93  ? 123 TRP F CD1 1 
ATOM   10004 C CD2 . TRP F 2 123 ? 58.252  4.812   10.256  1.00 34.63  ? 123 TRP F CD2 1 
ATOM   10005 N NE1 . TRP F 2 123 ? 56.610  5.448   11.641  1.00 46.50  ? 123 TRP F NE1 1 
ATOM   10006 C CE2 . TRP F 2 123 ? 57.073  5.579   10.358  1.00 47.00  ? 123 TRP F CE2 1 
ATOM   10007 C CE3 . TRP F 2 123 ? 58.928  4.777   9.029   1.00 47.52  ? 123 TRP F CE3 1 
ATOM   10008 C CZ2 . TRP F 2 123 ? 56.553  6.307   9.280   1.00 38.55  ? 123 TRP F CZ2 1 
ATOM   10009 C CZ3 . TRP F 2 123 ? 58.412  5.503   7.957   1.00 38.19  ? 123 TRP F CZ3 1 
ATOM   10010 C CH2 . TRP F 2 123 ? 57.236  6.258   8.094   1.00 34.27  ? 123 TRP F CH2 1 
ATOM   10011 N N   . ASN F 2 124 ? 61.057  0.196   11.382  1.00 49.76  ? 124 ASN F N   1 
ATOM   10012 C CA  . ASN F 2 124 ? 62.260  -0.580  11.632  1.00 51.14  ? 124 ASN F CA  1 
ATOM   10013 C C   . ASN F 2 124 ? 63.259  -0.263  10.526  1.00 47.83  ? 124 ASN F C   1 
ATOM   10014 O O   . ASN F 2 124 ? 62.930  0.441   9.578   1.00 54.44  ? 124 ASN F O   1 
ATOM   10015 C CB  . ASN F 2 124 ? 61.925  -2.079  11.647  1.00 63.25  ? 124 ASN F CB  1 
ATOM   10016 C CG  . ASN F 2 124 ? 62.816  -2.866  12.591  1.00 56.70  ? 124 ASN F CG  1 
ATOM   10017 O OD1 . ASN F 2 124 ? 64.009  -2.614  12.676  1.00 57.91  ? 124 ASN F OD1 1 
ATOM   10018 N ND2 . ASN F 2 124 ? 62.236  -3.835  13.294  1.00 75.82  ? 124 ASN F ND2 1 
ATOM   10019 N N   . GLU F 2 125 ? 64.476  -0.780  10.634  1.00 53.39  ? 125 GLU F N   1 
ATOM   10020 C CA  . GLU F 2 125 ? 65.476  -0.499  9.617   1.00 54.77  ? 125 GLU F CA  1 
ATOM   10021 C C   . GLU F 2 125 ? 65.726  -1.667  8.684   1.00 59.36  ? 125 GLU F C   1 
ATOM   10022 O O   . GLU F 2 125 ? 65.707  -2.823  9.108   1.00 61.00  ? 125 GLU F O   1 
ATOM   10023 C CB  . GLU F 2 125 ? 66.808  -0.108  10.255  1.00 54.04  ? 125 GLU F CB  1 
ATOM   10024 C CG  . GLU F 2 125 ? 67.854  0.295   9.216   1.00 75.20  ? 125 GLU F CG  1 
ATOM   10025 C CD  . GLU F 2 125 ? 69.247  0.458   9.794   1.00 82.49  ? 125 GLU F CD  1 
ATOM   10026 O OE1 . GLU F 2 125 ? 70.038  1.228   9.202   1.00 81.23  ? 125 GLU F OE1 1 
ATOM   10027 O OE2 . GLU F 2 125 ? 69.551  -0.188  10.824  1.00 79.54  ? 125 GLU F OE2 1 
ATOM   10028 N N   . VAL F 2 126 ? 65.976  -1.348  7.416   1.00 60.75  ? 126 VAL F N   1 
ATOM   10029 C CA  . VAL F 2 126 ? 66.271  -2.358  6.400   1.00 59.46  ? 126 VAL F CA  1 
ATOM   10030 C C   . VAL F 2 126 ? 67.670  -2.130  5.808   1.00 56.75  ? 126 VAL F C   1 
ATOM   10031 O O   . VAL F 2 126 ? 68.160  -1.009  5.755   1.00 53.60  ? 126 VAL F O   1 
ATOM   10032 C CB  . VAL F 2 126 ? 65.249  -2.311  5.235   1.00 41.95  ? 126 VAL F CB  1 
ATOM   10033 C CG1 . VAL F 2 126 ? 65.595  -3.353  4.205   1.00 35.46  ? 126 VAL F CG1 1 
ATOM   10034 C CG2 . VAL F 2 126 ? 63.849  -2.526  5.758   1.00 48.20  ? 126 VAL F CG2 1 
ATOM   10035 N N   . ILE F 2 127 ? 68.300  -3.210  5.360   1.00 64.76  ? 127 ILE F N   1 
ATOM   10036 C CA  . ILE F 2 127 ? 69.622  -3.151  4.755   1.00 48.29  ? 127 ILE F CA  1 
ATOM   10037 C C   . ILE F 2 127 ? 69.600  -4.021  3.515   1.00 57.52  ? 127 ILE F C   1 
ATOM   10038 O O   . ILE F 2 127 ? 69.637  -5.255  3.600   1.00 72.12  ? 127 ILE F O   1 
ATOM   10039 C CB  . ILE F 2 127 ? 70.711  -3.655  5.724   1.00 65.33  ? 127 ILE F CB  1 
ATOM   10040 C CG1 . ILE F 2 127 ? 71.011  -2.563  6.761   1.00 51.25  ? 127 ILE F CG1 1 
ATOM   10041 C CG2 . ILE F 2 127 ? 71.971  -4.038  4.949   1.00 62.20  ? 127 ILE F CG2 1 
ATOM   10042 C CD1 . ILE F 2 127 ? 72.046  -2.956  7.788   1.00 93.85  ? 127 ILE F CD1 1 
ATOM   10043 N N   . PHE F 2 128 ? 69.533  -3.373  2.358   1.00 59.78  ? 128 PHE F N   1 
ATOM   10044 C CA  . PHE F 2 128 ? 69.474  -4.105  1.105   1.00 68.39  ? 128 PHE F CA  1 
ATOM   10045 C C   . PHE F 2 128 ? 70.852  -4.515  0.612   1.00 55.63  ? 128 PHE F C   1 
ATOM   10046 O O   . PHE F 2 128 ? 71.834  -3.785  0.763   1.00 51.16  ? 128 PHE F O   1 
ATOM   10047 C CB  . PHE F 2 128 ? 68.754  -3.273  0.027   1.00 60.74  ? 128 PHE F CB  1 
ATOM   10048 C CG  . PHE F 2 128 ? 67.345  -2.872  0.400   1.00 57.31  ? 128 PHE F CG  1 
ATOM   10049 C CD1 . PHE F 2 128 ? 67.106  -1.746  1.186   1.00 55.46  ? 128 PHE F CD1 1 
ATOM   10050 C CD2 . PHE F 2 128 ? 66.254  -3.616  -0.041  1.00 44.49  ? 128 PHE F CD2 1 
ATOM   10051 C CE1 . PHE F 2 128 ? 65.799  -1.365  1.525   1.00 48.87  ? 128 PHE F CE1 1 
ATOM   10052 C CE2 . PHE F 2 128 ? 64.947  -3.243  0.292   1.00 63.02  ? 128 PHE F CE2 1 
ATOM   10053 C CZ  . PHE F 2 128 ? 64.721  -2.115  1.076   1.00 40.56  ? 128 PHE F CZ  1 
ATOM   10054 N N   . LYS F 2 129 ? 70.924  -5.706  0.036   1.00 64.33  ? 129 LYS F N   1 
ATOM   10055 C CA  . LYS F 2 129 ? 72.184  -6.179  -0.496  1.00 68.80  ? 129 LYS F CA  1 
ATOM   10056 C C   . LYS F 2 129 ? 72.625  -5.106  -1.463  1.00 75.43  ? 129 LYS F C   1 
ATOM   10057 O O   . LYS F 2 129 ? 73.792  -4.684  -1.467  1.00 77.22  ? 129 LYS F O   1 
ATOM   10058 C CB  . LYS F 2 129 ? 71.995  -7.481  -1.269  1.00 63.41  ? 129 LYS F CB  1 
ATOM   10059 C CG  . LYS F 2 129 ? 72.069  -8.739  -0.425  1.00 55.63  ? 129 LYS F CG  1 
ATOM   10060 C CD  . LYS F 2 129 ? 71.998  -9.983  -1.297  1.00 58.80  ? 129 LYS F CD  1 
ATOM   10061 C CE  . LYS F 2 129 ? 72.412  -11.202 -0.500  1.00 63.70  ? 129 LYS F CE  1 
ATOM   10062 N NZ  . LYS F 2 129 ? 71.843  -11.140 0.880   1.00 71.81  ? 129 LYS F NZ  1 
ATOM   10063 N N   . ASP F 2 130 ? 71.658  -4.642  -2.254  1.00 75.29  ? 130 ASP F N   1 
ATOM   10064 C CA  . ASP F 2 130 ? 71.914  -3.652  -3.284  1.00 65.43  ? 130 ASP F CA  1 
ATOM   10065 C C   . ASP F 2 130 ? 70.653  -2.894  -3.715  1.00 66.70  ? 130 ASP F C   1 
ATOM   10066 O O   . ASP F 2 130 ? 69.682  -2.809  -2.970  1.00 71.27  ? 130 ASP F O   1 
ATOM   10067 C CB  . ASP F 2 130 ? 72.515  -4.380  -4.490  1.00 51.69  ? 130 ASP F CB  1 
ATOM   10068 C CG  . ASP F 2 130 ? 71.682  -5.594  -4.916  1.00 56.52  ? 130 ASP F CG  1 
ATOM   10069 O OD1 . ASP F 2 130 ? 71.677  -6.629  -4.202  1.00 69.97  ? 130 ASP F OD1 1 
ATOM   10070 O OD2 . ASP F 2 130 ? 71.014  -5.508  -5.966  1.00 69.87  ? 130 ASP F OD2 1 
ATOM   10071 N N   . THR F 2 131 ? 70.705  -2.344  -4.927  1.00 63.20  ? 131 THR F N   1 
ATOM   10072 C CA  . THR F 2 131 ? 69.611  -1.606  -5.562  1.00 64.11  ? 131 THR F CA  1 
ATOM   10073 C C   . THR F 2 131 ? 68.835  -0.552  -4.771  1.00 59.54  ? 131 THR F C   1 
ATOM   10074 O O   . THR F 2 131 ? 69.026  0.650   -4.968  1.00 65.63  ? 131 THR F O   1 
ATOM   10075 C CB  . THR F 2 131 ? 68.565  -2.582  -6.154  1.00 66.67  ? 131 THR F CB  1 
ATOM   10076 O OG1 . THR F 2 131 ? 69.181  -3.407  -7.153  1.00 78.74  ? 131 THR F OG1 1 
ATOM   10077 C CG2 . THR F 2 131 ? 67.424  -1.809  -6.790  1.00 51.32  ? 131 THR F CG2 1 
ATOM   10078 N N   . PHE F 2 132 ? 67.950  -1.017  -3.894  1.00 55.43  ? 132 PHE F N   1 
ATOM   10079 C CA  . PHE F 2 132 ? 67.087  -0.151  -3.102  1.00 51.32  ? 132 PHE F CA  1 
ATOM   10080 C C   . PHE F 2 132 ? 67.798  0.593   -1.995  1.00 51.88  ? 132 PHE F C   1 
ATOM   10081 O O   . PHE F 2 132 ? 68.921  0.248   -1.637  1.00 74.23  ? 132 PHE F O   1 
ATOM   10082 C CB  . PHE F 2 132 ? 65.921  -0.981  -2.576  1.00 38.17  ? 132 PHE F CB  1 
ATOM   10083 C CG  . PHE F 2 132 ? 65.277  -1.820  -3.647  1.00 59.79  ? 132 PHE F CG  1 
ATOM   10084 C CD1 . PHE F 2 132 ? 65.717  -3.120  -3.893  1.00 45.65  ? 132 PHE F CD1 1 
ATOM   10085 C CD2 . PHE F 2 132 ? 64.303  -1.279  -4.480  1.00 45.18  ? 132 PHE F CD2 1 
ATOM   10086 C CE1 . PHE F 2 132 ? 65.201  -3.858  -4.953  1.00 53.93  ? 132 PHE F CE1 1 
ATOM   10087 C CE2 . PHE F 2 132 ? 63.785  -2.009  -5.541  1.00 44.34  ? 132 PHE F CE2 1 
ATOM   10088 C CZ  . PHE F 2 132 ? 64.236  -3.302  -5.781  1.00 46.51  ? 132 PHE F CZ  1 
ATOM   10089 N N   . PRO F 2 133 ? 67.154  1.637   -1.438  1.00 56.65  ? 133 PRO F N   1 
ATOM   10090 C CA  . PRO F 2 133 ? 67.715  2.467   -0.364  1.00 53.53  ? 133 PRO F CA  1 
ATOM   10091 C C   . PRO F 2 133 ? 67.481  2.010   1.067   1.00 54.57  ? 133 PRO F C   1 
ATOM   10092 O O   . PRO F 2 133 ? 66.397  1.541   1.421   1.00 59.72  ? 133 PRO F O   1 
ATOM   10093 C CB  . PRO F 2 133 ? 67.080  3.820   -0.627  1.00 45.84  ? 133 PRO F CB  1 
ATOM   10094 C CG  . PRO F 2 133 ? 65.690  3.415   -1.048  1.00 53.74  ? 133 PRO F CG  1 
ATOM   10095 C CD  . PRO F 2 133 ? 65.923  2.246   -1.974  1.00 55.68  ? 133 PRO F CD  1 
ATOM   10096 N N   . ASN F 2 134 ? 68.501  2.186   1.893   1.00 50.34  ? 134 ASN F N   1 
ATOM   10097 C CA  . ASN F 2 134 ? 68.419  1.800   3.285   1.00 56.21  ? 134 ASN F CA  1 
ATOM   10098 C C   . ASN F 2 134 ? 67.807  2.865   4.162   1.00 50.22  ? 134 ASN F C   1 
ATOM   10099 O O   . ASN F 2 134 ? 67.978  4.060   3.929   1.00 59.71  ? 134 ASN F O   1 
ATOM   10100 C CB  . ASN F 2 134 ? 69.801  1.455   3.814   1.00 57.10  ? 134 ASN F CB  1 
ATOM   10101 C CG  . ASN F 2 134 ? 70.336  0.187   3.218   1.00 54.87  ? 134 ASN F CG  1 
ATOM   10102 O OD1 . ASN F 2 134 ? 70.097  -0.108  2.049   1.00 71.19  ? 134 ASN F OD1 1 
ATOM   10103 N ND2 . ASN F 2 134 ? 71.076  -0.575  4.013   1.00 100.58 ? 134 ASN F ND2 1 
ATOM   10104 N N   . GLY F 2 135 ? 67.098  2.411   5.185   1.00 46.58  ? 135 GLY F N   1 
ATOM   10105 C CA  . GLY F 2 135 ? 66.454  3.320   6.107   1.00 47.13  ? 135 GLY F CA  1 
ATOM   10106 C C   . GLY F 2 135 ? 65.320  2.606   6.810   1.00 47.70  ? 135 GLY F C   1 
ATOM   10107 O O   . GLY F 2 135 ? 65.200  1.387   6.725   1.00 52.22  ? 135 GLY F O   1 
ATOM   10108 N N   . TYR F 2 136 ? 64.487  3.370   7.502   1.00 45.43  ? 136 TYR F N   1 
ATOM   10109 C CA  . TYR F 2 136 ? 63.359  2.816   8.229   1.00 55.65  ? 136 TYR F CA  1 
ATOM   10110 C C   . TYR F 2 136 ? 62.081  2.768   7.392   1.00 54.55  ? 136 TYR F C   1 
ATOM   10111 O O   . TYR F 2 136 ? 61.740  3.721   6.695   1.00 66.35  ? 136 TYR F O   1 
ATOM   10112 C CB  . TYR F 2 136 ? 63.108  3.639   9.498   1.00 50.02  ? 136 TYR F CB  1 
ATOM   10113 C CG  . TYR F 2 136 ? 64.199  3.521   10.541  1.00 48.01  ? 136 TYR F CG  1 
ATOM   10114 C CD1 . TYR F 2 136 ? 65.505  3.934   10.274  1.00 56.80  ? 136 TYR F CD1 1 
ATOM   10115 C CD2 . TYR F 2 136 ? 63.928  2.967   11.789  1.00 62.36  ? 136 TYR F CD2 1 
ATOM   10116 C CE1 . TYR F 2 136 ? 66.509  3.789   11.227  1.00 52.21  ? 136 TYR F CE1 1 
ATOM   10117 C CE2 . TYR F 2 136 ? 64.920  2.821   12.742  1.00 67.77  ? 136 TYR F CE2 1 
ATOM   10118 C CZ  . TYR F 2 136 ? 66.205  3.229   12.459  1.00 53.04  ? 136 TYR F CZ  1 
ATOM   10119 O OH  . TYR F 2 136 ? 67.177  3.053   13.416  1.00 72.47  ? 136 TYR F OH  1 
ATOM   10120 N N   . TYR F 2 137 ? 61.379  1.648   7.461   1.00 59.66  ? 137 TYR F N   1 
ATOM   10121 C CA  . TYR F 2 137 ? 60.122  1.482   6.741   1.00 50.90  ? 137 TYR F CA  1 
ATOM   10122 C C   . TYR F 2 137 ? 59.096  0.997   7.749   1.00 53.44  ? 137 TYR F C   1 
ATOM   10123 O O   . TYR F 2 137 ? 59.451  0.347   8.737   1.00 49.87  ? 137 TYR F O   1 
ATOM   10124 C CB  . TYR F 2 137 ? 60.264  0.467   5.610   1.00 34.29  ? 137 TYR F CB  1 
ATOM   10125 C CG  . TYR F 2 137 ? 61.210  0.883   4.509   1.00 49.84  ? 137 TYR F CG  1 
ATOM   10126 C CD1 . TYR F 2 137 ? 62.597  0.793   4.667   1.00 44.44  ? 137 TYR F CD1 1 
ATOM   10127 C CD2 . TYR F 2 137 ? 60.719  1.324   3.284   1.00 44.17  ? 137 TYR F CD2 1 
ATOM   10128 C CE1 . TYR F 2 137 ? 63.460  1.122   3.619   1.00 43.01  ? 137 TYR F CE1 1 
ATOM   10129 C CE2 . TYR F 2 137 ? 61.566  1.652   2.241   1.00 33.00  ? 137 TYR F CE2 1 
ATOM   10130 C CZ  . TYR F 2 137 ? 62.925  1.545   2.403   1.00 57.51  ? 137 TYR F CZ  1 
ATOM   10131 O OH  . TYR F 2 137 ? 63.734  1.809   1.322   1.00 47.78  ? 137 TYR F OH  1 
ATOM   10132 N N   . TYR F 2 138 ? 57.830  1.316   7.506   1.00 42.46  ? 138 TYR F N   1 
ATOM   10133 C CA  . TYR F 2 138 ? 56.770  0.935   8.429   1.00 42.34  ? 138 TYR F CA  1 
ATOM   10134 C C   . TYR F 2 138 ? 56.376  -0.528  8.261   1.00 49.66  ? 138 TYR F C   1 
ATOM   10135 O O   . TYR F 2 138 ? 56.068  -0.972  7.155   1.00 44.53  ? 138 TYR F O   1 
ATOM   10136 C CB  . TYR F 2 138 ? 55.555  1.851   8.244   1.00 31.31  ? 138 TYR F CB  1 
ATOM   10137 C CG  . TYR F 2 138 ? 54.540  1.717   9.349   1.00 37.08  ? 138 TYR F CG  1 
ATOM   10138 C CD1 . TYR F 2 138 ? 54.853  2.095   10.650  1.00 29.95  ? 138 TYR F CD1 1 
ATOM   10139 C CD2 . TYR F 2 138 ? 53.292  1.145   9.109   1.00 39.74  ? 138 TYR F CD2 1 
ATOM   10140 C CE1 . TYR F 2 138 ? 53.955  1.899   11.690  1.00 36.70  ? 138 TYR F CE1 1 
ATOM   10141 C CE2 . TYR F 2 138 ? 52.389  0.948   10.137  1.00 39.21  ? 138 TYR F CE2 1 
ATOM   10142 C CZ  . TYR F 2 138 ? 52.731  1.325   11.424  1.00 39.42  ? 138 TYR F CZ  1 
ATOM   10143 O OH  . TYR F 2 138 ? 51.851  1.112   12.448  1.00 56.82  ? 138 TYR F OH  1 
ATOM   10144 N N   . PHE F 2 139 ? 56.400  -1.265  9.374   1.00 43.89  ? 139 PHE F N   1 
ATOM   10145 C CA  . PHE F 2 139 ? 56.069  -2.700  9.403   1.00 57.01  ? 139 PHE F CA  1 
ATOM   10146 C C   . PHE F 2 139 ? 54.803  -3.025  10.201  1.00 38.28  ? 139 PHE F C   1 
ATOM   10147 O O   . PHE F 2 139 ? 54.484  -2.369  11.188  1.00 40.95  ? 139 PHE F O   1 
ATOM   10148 C CB  . PHE F 2 139 ? 57.208  -3.528  10.047  1.00 48.96  ? 139 PHE F CB  1 
ATOM   10149 C CG  . PHE F 2 139 ? 58.463  -3.633  9.222   1.00 43.84  ? 139 PHE F CG  1 
ATOM   10150 C CD1 . PHE F 2 139 ? 59.412  -2.615  9.230   1.00 37.38  ? 139 PHE F CD1 1 
ATOM   10151 C CD2 . PHE F 2 139 ? 58.713  -4.772  8.463   1.00 44.01  ? 139 PHE F CD2 1 
ATOM   10152 C CE1 . PHE F 2 139 ? 60.589  -2.737  8.498   1.00 60.38  ? 139 PHE F CE1 1 
ATOM   10153 C CE2 . PHE F 2 139 ? 59.890  -4.900  7.724   1.00 50.33  ? 139 PHE F CE2 1 
ATOM   10154 C CZ  . PHE F 2 139 ? 60.827  -3.884  7.742   1.00 35.07  ? 139 PHE F CZ  1 
ATOM   10155 N N   . VAL F 2 140 ? 54.104  -4.067  9.772   1.00 47.02  ? 140 VAL F N   1 
ATOM   10156 C CA  . VAL F 2 140 ? 52.915  -4.543  10.465  1.00 45.93  ? 140 VAL F CA  1 
ATOM   10157 C C   . VAL F 2 140 ? 52.725  -6.001  10.060  1.00 55.34  ? 140 VAL F C   1 
ATOM   10158 O O   . VAL F 2 140 ? 52.079  -6.300  9.059   1.00 58.31  ? 140 VAL F O   1 
ATOM   10159 C CB  . VAL F 2 140 ? 51.628  -3.764  10.095  1.00 55.96  ? 140 VAL F CB  1 
ATOM   10160 C CG1 . VAL F 2 140 ? 50.500  -4.206  11.006  1.00 62.27  ? 140 VAL F CG1 1 
ATOM   10161 C CG2 . VAL F 2 140 ? 51.828  -2.272  10.240  1.00 51.38  ? 140 VAL F CG2 1 
ATOM   10162 N N   . HIS F 2 141 ? 53.297  -6.913  10.837  1.00 53.91  ? 141 HIS F N   1 
ATOM   10163 C CA  . HIS F 2 141 ? 53.173  -8.330  10.523  1.00 59.40  ? 141 HIS F CA  1 
ATOM   10164 C C   . HIS F 2 141 ? 53.499  -9.238  11.695  1.00 58.45  ? 141 HIS F C   1 
ATOM   10165 O O   . HIS F 2 141 ? 54.182  -8.841  12.642  1.00 52.86  ? 141 HIS F O   1 
ATOM   10166 C CB  . HIS F 2 141 ? 54.092  -8.696  9.364   1.00 53.91  ? 141 HIS F CB  1 
ATOM   10167 C CG  . HIS F 2 141 ? 55.543  -8.557  9.688   1.00 36.80  ? 141 HIS F CG  1 
ATOM   10168 N ND1 . HIS F 2 141 ? 56.460  -9.554  9.435   1.00 45.08  ? 141 HIS F ND1 1 
ATOM   10169 C CD2 . HIS F 2 141 ? 56.241  -7.529  10.224  1.00 50.72  ? 141 HIS F CD2 1 
ATOM   10170 C CE1 . HIS F 2 141 ? 57.663  -9.144  9.798   1.00 36.08  ? 141 HIS F CE1 1 
ATOM   10171 N NE2 . HIS F 2 141 ? 57.558  -7.919  10.280  1.00 36.55  ? 141 HIS F NE2 1 
ATOM   10172 N N   . THR F 2 142 ? 53.010  -10.472 11.599  1.00 67.05  ? 142 THR F N   1 
ATOM   10173 C CA  . THR F 2 142 ? 53.216  -11.490 12.620  1.00 56.86  ? 142 THR F CA  1 
ATOM   10174 C C   . THR F 2 142 ? 54.071  -12.638 12.093  1.00 62.12  ? 142 THR F C   1 
ATOM   10175 O O   . THR F 2 142 ? 54.692  -13.367 12.871  1.00 69.90  ? 142 THR F O   1 
ATOM   10176 C CB  . THR F 2 142 ? 51.875  -12.043 13.124  1.00 62.84  ? 142 THR F CB  1 
ATOM   10177 O OG1 . THR F 2 142 ? 51.202  -11.027 13.878  1.00 43.83  ? 142 THR F OG1 1 
ATOM   10178 C CG2 . THR F 2 142 ? 52.093  -13.273 14.010  1.00 52.55  ? 142 THR F CG2 1 
ATOM   10179 N N   . TYR F 2 143 ? 54.113  -12.806 10.779  1.00 37.25  ? 143 TYR F N   1 
ATOM   10180 C CA  . TYR F 2 143 ? 54.923  -13.867 10.211  1.00 38.94  ? 143 TYR F CA  1 
ATOM   10181 C C   . TYR F 2 143 ? 56.043  -13.323 9.348   1.00 39.23  ? 143 TYR F C   1 
ATOM   10182 O O   . TYR F 2 143 ? 56.077  -12.141 9.029   1.00 56.05  ? 143 TYR F O   1 
ATOM   10183 C CB  . TYR F 2 143 ? 54.050  -14.841 9.430   1.00 34.28  ? 143 TYR F CB  1 
ATOM   10184 C CG  . TYR F 2 143 ? 52.994  -15.457 10.308  1.00 56.85  ? 143 TYR F CG  1 
ATOM   10185 C CD1 . TYR F 2 143 ? 51.895  -14.712 10.725  1.00 44.00  ? 143 TYR F CD1 1 
ATOM   10186 C CD2 . TYR F 2 143 ? 53.121  -16.768 10.777  1.00 42.84  ? 143 TYR F CD2 1 
ATOM   10187 C CE1 . TYR F 2 143 ? 50.945  -15.253 11.590  1.00 63.07  ? 143 TYR F CE1 1 
ATOM   10188 C CE2 . TYR F 2 143 ? 52.178  -17.321 11.648  1.00 41.32  ? 143 TYR F CE2 1 
ATOM   10189 C CZ  . TYR F 2 143 ? 51.092  -16.558 12.051  1.00 72.68  ? 143 TYR F CZ  1 
ATOM   10190 O OH  . TYR F 2 143 ? 50.149  -17.081 12.918  1.00 72.56  ? 143 TYR F OH  1 
ATOM   10191 N N   . ARG F 2 144 ? 56.980  -14.189 8.994   1.00 50.74  ? 144 ARG F N   1 
ATOM   10192 C CA  . ARG F 2 144 ? 58.119  -13.794 8.180   1.00 54.55  ? 144 ARG F CA  1 
ATOM   10193 C C   . ARG F 2 144 ? 58.512  -14.932 7.251   1.00 54.21  ? 144 ARG F C   1 
ATOM   10194 O O   . ARG F 2 144 ? 58.024  -16.056 7.382   1.00 52.64  ? 144 ARG F O   1 
ATOM   10195 C CB  . ARG F 2 144 ? 59.304  -13.423 9.080   1.00 55.72  ? 144 ARG F CB  1 
ATOM   10196 C CG  . ARG F 2 144 ? 59.386  -14.264 10.352  1.00 81.09  ? 144 ARG F CG  1 
ATOM   10197 C CD  . ARG F 2 144 ? 60.817  -14.526 10.785  1.00 45.18  ? 144 ARG F CD  1 
ATOM   10198 N NE  . ARG F 2 144 ? 61.505  -15.417 9.859   1.00 45.37  ? 144 ARG F NE  1 
ATOM   10199 C CZ  . ARG F 2 144 ? 62.813  -15.670 9.887   1.00 49.13  ? 144 ARG F CZ  1 
ATOM   10200 N NH1 . ARG F 2 144 ? 63.594  -15.101 10.801  1.00 47.99  ? 144 ARG F NH1 1 
ATOM   10201 N NH2 . ARG F 2 144 ? 63.349  -16.479 8.985   1.00 44.24  ? 144 ARG F NH2 1 
ATOM   10202 N N   . ALA F 2 145 ? 59.402  -14.636 6.314   1.00 56.14  ? 145 ALA F N   1 
ATOM   10203 C CA  . ALA F 2 145 ? 59.852  -15.643 5.369   1.00 53.17  ? 145 ALA F CA  1 
ATOM   10204 C C   . ALA F 2 145 ? 61.160  -16.312 5.795   1.00 56.55  ? 145 ALA F C   1 
ATOM   10205 O O   . ALA F 2 145 ? 61.985  -15.719 6.498   1.00 45.38  ? 145 ALA F O   1 
ATOM   10206 C CB  . ALA F 2 145 ? 60.011  -15.027 3.994   1.00 42.16  ? 145 ALA F CB  1 
ATOM   10207 N N   . VAL F 2 146 ? 61.324  -17.554 5.349   1.00 52.76  ? 146 VAL F N   1 
ATOM   10208 C CA  . VAL F 2 146 ? 62.506  -18.360 5.632   1.00 51.50  ? 146 VAL F CA  1 
ATOM   10209 C C   . VAL F 2 146 ? 63.069  -18.793 4.283   1.00 48.36  ? 146 VAL F C   1 
ATOM   10210 O O   . VAL F 2 146 ? 62.393  -19.467 3.513   1.00 52.46  ? 146 VAL F O   1 
ATOM   10211 C CB  . VAL F 2 146 ? 62.130  -19.614 6.448   1.00 75.86  ? 146 VAL F CB  1 
ATOM   10212 C CG1 . VAL F 2 146 ? 63.390  -20.394 6.820   1.00 94.23  ? 146 VAL F CG1 1 
ATOM   10213 C CG2 . VAL F 2 146 ? 61.358  -19.207 7.698   1.00 57.90  ? 146 VAL F CG2 1 
ATOM   10214 N N   . CYS F 2 147 ? 64.304  -18.408 3.988   1.00 43.96  ? 147 CYS F N   1 
ATOM   10215 C CA  . CYS F 2 147 ? 64.877  -18.769 2.699   1.00 62.29  ? 147 CYS F CA  1 
ATOM   10216 C C   . CYS F 2 147 ? 66.403  -18.703 2.621   1.00 51.65  ? 147 CYS F C   1 
ATOM   10217 O O   . CYS F 2 147 ? 67.060  -18.038 3.433   1.00 65.86  ? 147 CYS F O   1 
ATOM   10218 C CB  . CYS F 2 147 ? 64.273  -17.870 1.612   1.00 51.36  ? 147 CYS F CB  1 
ATOM   10219 S SG  . CYS F 2 147 ? 64.618  -16.118 1.870   1.00 55.25  ? 147 CYS F SG  1 
ATOM   10220 N N   . GLU F 2 148 ? 66.949  -19.390 1.616   1.00 65.40  ? 148 GLU F N   1 
ATOM   10221 C CA  . GLU F 2 148 ? 68.393  -19.443 1.386   1.00 66.47  ? 148 GLU F CA  1 
ATOM   10222 C C   . GLU F 2 148 ? 68.901  -18.034 1.142   1.00 64.22  ? 148 GLU F C   1 
ATOM   10223 O O   . GLU F 2 148 ? 68.327  -17.288 0.352   1.00 61.65  ? 148 GLU F O   1 
ATOM   10224 C CB  . GLU F 2 148 ? 68.740  -20.311 0.161   1.00 75.63  ? 148 GLU F CB  1 
ATOM   10225 C CG  . GLU F 2 148 ? 67.865  -21.559 -0.058  1.00 94.51  ? 148 GLU F CG  1 
ATOM   10226 C CD  . GLU F 2 148 ? 67.881  -22.543 1.106   1.00 100.07 ? 148 GLU F CD  1 
ATOM   10227 O OE1 . GLU F 2 148 ? 68.957  -23.133 1.387   1.00 103.15 ? 148 GLU F OE1 1 
ATOM   10228 O OE2 . GLU F 2 148 ? 66.809  -22.731 1.734   1.00 85.78  ? 148 GLU F OE2 1 
ATOM   10229 N N   . GLU F 2 149 ? 69.981  -17.684 1.834   1.00 71.37  ? 149 GLU F N   1 
ATOM   10230 C CA  . GLU F 2 149 ? 70.607  -16.376 1.737   1.00 55.31  ? 149 GLU F CA  1 
ATOM   10231 C C   . GLU F 2 149 ? 70.724  -15.854 0.300   1.00 58.86  ? 149 GLU F C   1 
ATOM   10232 O O   . GLU F 2 149 ? 70.981  -14.672 0.073   1.00 52.97  ? 149 GLU F O   1 
ATOM   10233 C CB  . GLU F 2 149 ? 71.981  -16.460 2.375   1.00 74.27  ? 149 GLU F CB  1 
ATOM   10234 C CG  . GLU F 2 149 ? 72.228  -15.422 3.451   1.00 68.93  ? 149 GLU F CG  1 
ATOM   10235 C CD  . GLU F 2 149 ? 72.506  -14.085 2.854   1.00 87.75  ? 149 GLU F CD  1 
ATOM   10236 O OE1 . GLU F 2 149 ? 73.235  -14.060 1.834   1.00 96.46  ? 149 GLU F OE1 1 
ATOM   10237 O OE2 . GLU F 2 149 ? 72.013  -13.069 3.404   1.00 88.38  ? 149 GLU F OE2 1 
ATOM   10238 N N   . GLU F 2 150 ? 70.539  -16.750 -0.660  1.00 53.63  ? 150 GLU F N   1 
ATOM   10239 C CA  . GLU F 2 150 ? 70.615  -16.406 -2.071  1.00 62.81  ? 150 GLU F CA  1 
ATOM   10240 C C   . GLU F 2 150 ? 69.423  -15.528 -2.468  1.00 70.73  ? 150 GLU F C   1 
ATOM   10241 O O   . GLU F 2 150 ? 69.493  -14.740 -3.414  1.00 54.44  ? 150 GLU F O   1 
ATOM   10242 C CB  . GLU F 2 150 ? 70.617  -17.685 -2.914  1.00 51.03  ? 150 GLU F CB  1 
ATOM   10243 C CG  . GLU F 2 150 ? 70.475  -17.439 -4.405  1.00 85.72  ? 150 GLU F CG  1 
ATOM   10244 C CD  . GLU F 2 150 ? 70.107  -18.694 -5.181  1.00 94.62  ? 150 GLU F CD  1 
ATOM   10245 O OE1 . GLU F 2 150 ? 69.364  -19.552 -4.628  1.00 87.98  ? 150 GLU F OE1 1 
ATOM   10246 O OE2 . GLU F 2 150 ? 70.547  -18.804 -6.349  1.00 78.75  ? 150 GLU F OE2 1 
ATOM   10247 N N   . HIS F 2 151 ? 68.334  -15.674 -1.725  1.00 62.57  ? 151 HIS F N   1 
ATOM   10248 C CA  . HIS F 2 151 ? 67.126  -14.924 -1.993  1.00 58.76  ? 151 HIS F CA  1 
ATOM   10249 C C   . HIS F 2 151 ? 66.899  -13.731 -1.071  1.00 56.14  ? 151 HIS F C   1 
ATOM   10250 O O   . HIS F 2 151 ? 65.993  -12.941 -1.305  1.00 69.13  ? 151 HIS F O   1 
ATOM   10251 C CB  . HIS F 2 151 ? 65.925  -15.858 -1.923  1.00 54.41  ? 151 HIS F CB  1 
ATOM   10252 C CG  . HIS F 2 151 ? 65.943  -16.932 -2.957  1.00 42.76  ? 151 HIS F CG  1 
ATOM   10253 N ND1 . HIS F 2 151 ? 66.486  -16.745 -4.209  1.00 60.72  ? 151 HIS F ND1 1 
ATOM   10254 C CD2 . HIS F 2 151 ? 65.433  -18.186 -2.951  1.00 54.78  ? 151 HIS F CD2 1 
ATOM   10255 C CE1 . HIS F 2 151 ? 66.308  -17.838 -4.931  1.00 55.67  ? 151 HIS F CE1 1 
ATOM   10256 N NE2 . HIS F 2 151 ? 65.669  -18.727 -4.190  1.00 59.16  ? 151 HIS F NE2 1 
ATOM   10257 N N   . VAL F 2 152 ? 67.705  -13.590 -0.024  1.00 61.84  ? 152 VAL F N   1 
ATOM   10258 C CA  . VAL F 2 152 ? 67.522  -12.465 0.880   1.00 42.85  ? 152 VAL F CA  1 
ATOM   10259 C C   . VAL F 2 152 ? 67.974  -11.225 0.114   1.00 67.52  ? 152 VAL F C   1 
ATOM   10260 O O   . VAL F 2 152 ? 68.987  -11.257 -0.584  1.00 47.42  ? 152 VAL F O   1 
ATOM   10261 C CB  . VAL F 2 152 ? 68.373  -12.608 2.174   1.00 76.50  ? 152 VAL F CB  1 
ATOM   10262 C CG1 . VAL F 2 152 ? 68.011  -11.489 3.158   1.00 53.94  ? 152 VAL F CG1 1 
ATOM   10263 C CG2 . VAL F 2 152 ? 68.142  -13.984 2.827   1.00 66.44  ? 152 VAL F CG2 1 
ATOM   10264 N N   . LEU F 2 153 ? 67.205  -10.143 0.238   1.00 65.84  ? 153 LEU F N   1 
ATOM   10265 C CA  . LEU F 2 153 ? 67.501  -8.882  -0.433  1.00 49.93  ? 153 LEU F CA  1 
ATOM   10266 C C   . LEU F 2 153 ? 67.644  -7.772  0.602   1.00 54.32  ? 153 LEU F C   1 
ATOM   10267 O O   . LEU F 2 153 ? 68.420  -6.829  0.424   1.00 44.94  ? 153 LEU F O   1 
ATOM   10268 C CB  . LEU F 2 153 ? 66.372  -8.533  -1.412  1.00 48.91  ? 153 LEU F CB  1 
ATOM   10269 C CG  . LEU F 2 153 ? 66.262  -7.070  -1.861  1.00 49.51  ? 153 LEU F CG  1 
ATOM   10270 C CD1 . LEU F 2 153 ? 67.557  -6.633  -2.524  1.00 54.67  ? 153 LEU F CD1 1 
ATOM   10271 C CD2 . LEU F 2 153 ? 65.098  -6.903  -2.813  1.00 47.47  ? 153 LEU F CD2 1 
ATOM   10272 N N   . GLY F 2 154 ? 66.881  -7.889  1.681   1.00 38.89  ? 154 GLY F N   1 
ATOM   10273 C CA  . GLY F 2 154 ? 66.935  -6.888  2.719   1.00 43.30  ? 154 GLY F CA  1 
ATOM   10274 C C   . GLY F 2 154 ? 66.832  -7.538  4.074   1.00 50.28  ? 154 GLY F C   1 
ATOM   10275 O O   . GLY F 2 154 ? 66.169  -8.565  4.221   1.00 47.05  ? 154 GLY F O   1 
ATOM   10276 N N   . THR F 2 155 ? 67.462  -6.924  5.072   1.00 47.86  ? 155 THR F N   1 
ATOM   10277 C CA  . THR F 2 155 ? 67.458  -7.474  6.418   1.00 50.55  ? 155 THR F CA  1 
ATOM   10278 C C   . THR F 2 155 ? 66.993  -6.514  7.504   1.00 44.97  ? 155 THR F C   1 
ATOM   10279 O O   . THR F 2 155 ? 67.349  -5.343  7.495   1.00 47.46  ? 155 THR F O   1 
ATOM   10280 C CB  . THR F 2 155 ? 68.876  -7.982  6.775   1.00 49.74  ? 155 THR F CB  1 
ATOM   10281 O OG1 . THR F 2 155 ? 69.133  -9.189  6.045   1.00 62.19  ? 155 THR F OG1 1 
ATOM   10282 C CG2 . THR F 2 155 ? 69.013  -8.236  8.273   1.00 49.86  ? 155 THR F CG2 1 
ATOM   10283 N N   . THR F 2 156 ? 66.217  -7.038  8.449   1.00 42.71  ? 156 THR F N   1 
ATOM   10284 C CA  . THR F 2 156 ? 65.704  -6.269  9.574   1.00 43.70  ? 156 THR F CA  1 
ATOM   10285 C C   . THR F 2 156 ? 65.815  -7.083  10.875  1.00 59.78  ? 156 THR F C   1 
ATOM   10286 O O   . THR F 2 156 ? 65.822  -8.315  10.838  1.00 72.39  ? 156 THR F O   1 
ATOM   10287 C CB  . THR F 2 156 ? 64.228  -5.877  9.318   1.00 57.61  ? 156 THR F CB  1 
ATOM   10288 O OG1 . THR F 2 156 ? 64.191  -4.718  8.479   1.00 56.89  ? 156 THR F OG1 1 
ATOM   10289 C CG2 . THR F 2 156 ? 63.491  -5.593  10.612  1.00 39.44  ? 156 THR F CG2 1 
ATOM   10290 N N   . GLU F 2 157 ? 65.915  -6.406  12.021  1.00 67.33  ? 157 GLU F N   1 
ATOM   10291 C CA  . GLU F 2 157 ? 65.997  -7.112  13.301  1.00 51.93  ? 157 GLU F CA  1 
ATOM   10292 C C   . GLU F 2 157 ? 64.961  -6.636  14.311  1.00 45.53  ? 157 GLU F C   1 
ATOM   10293 O O   . GLU F 2 157 ? 64.893  -5.458  14.646  1.00 51.78  ? 157 GLU F O   1 
ATOM   10294 C CB  . GLU F 2 157 ? 67.401  -6.988  13.907  1.00 68.11  ? 157 GLU F CB  1 
ATOM   10295 C CG  . GLU F 2 157 ? 67.708  -5.664  14.600  1.00 78.77  ? 157 GLU F CG  1 
ATOM   10296 C CD  . GLU F 2 157 ? 67.235  -5.624  16.051  1.00 103.15 ? 157 GLU F CD  1 
ATOM   10297 O OE1 . GLU F 2 157 ? 67.467  -4.592  16.726  1.00 82.33  ? 157 GLU F OE1 1 
ATOM   10298 O OE2 . GLU F 2 157 ? 66.635  -6.623  16.516  1.00 91.40  ? 157 GLU F OE2 1 
ATOM   10299 N N   . TYR F 2 158 ? 64.144  -7.570  14.786  1.00 57.53  ? 158 TYR F N   1 
ATOM   10300 C CA  . TYR F 2 158 ? 63.113  -7.266  15.769  1.00 49.23  ? 158 TYR F CA  1 
ATOM   10301 C C   . TYR F 2 158 ? 63.274  -8.217  16.942  1.00 51.08  ? 158 TYR F C   1 
ATOM   10302 O O   . TYR F 2 158 ? 63.286  -9.431  16.765  1.00 60.25  ? 158 TYR F O   1 
ATOM   10303 C CB  . TYR F 2 158 ? 61.717  -7.420  15.155  1.00 45.41  ? 158 TYR F CB  1 
ATOM   10304 C CG  . TYR F 2 158 ? 60.605  -7.175  16.139  1.00 32.08  ? 158 TYR F CG  1 
ATOM   10305 C CD1 . TYR F 2 158 ? 60.571  -6.010  16.905  1.00 39.87  ? 158 TYR F CD1 1 
ATOM   10306 C CD2 . TYR F 2 158 ? 59.591  -8.104  16.308  1.00 31.84  ? 158 TYR F CD2 1 
ATOM   10307 C CE1 . TYR F 2 158 ? 59.543  -5.779  17.822  1.00 38.57  ? 158 TYR F CE1 1 
ATOM   10308 C CE2 . TYR F 2 158 ? 58.563  -7.890  17.219  1.00 36.26  ? 158 TYR F CE2 1 
ATOM   10309 C CZ  . TYR F 2 158 ? 58.539  -6.726  17.976  1.00 37.67  ? 158 TYR F CZ  1 
ATOM   10310 O OH  . TYR F 2 158 ? 57.517  -6.519  18.883  1.00 42.72  ? 158 TYR F OH  1 
ATOM   10311 N N   . ASP F 2 159 ? 63.399  -7.651  18.141  1.00 77.89  ? 159 ASP F N   1 
ATOM   10312 C CA  . ASP F 2 159 ? 63.590  -8.428  19.362  1.00 67.91  ? 159 ASP F CA  1 
ATOM   10313 C C   . ASP F 2 159 ? 64.735  -9.432  19.172  1.00 76.40  ? 159 ASP F C   1 
ATOM   10314 O O   . ASP F 2 159 ? 64.554  -10.653 19.257  1.00 57.49  ? 159 ASP F O   1 
ATOM   10315 C CB  . ASP F 2 159 ? 62.301  -9.160  19.729  1.00 87.32  ? 159 ASP F CB  1 
ATOM   10316 C CG  . ASP F 2 159 ? 61.860  -8.884  21.154  1.00 67.24  ? 159 ASP F CG  1 
ATOM   10317 O OD1 . ASP F 2 159 ? 60.972  -9.611  21.655  1.00 93.81  ? 159 ASP F OD1 1 
ATOM   10318 O OD2 . ASP F 2 159 ? 62.393  -7.932  21.774  1.00 95.61  ? 159 ASP F OD2 1 
ATOM   10319 N N   . GLY F 2 160 ? 65.916  -8.904  18.885  1.00 62.21  ? 160 GLY F N   1 
ATOM   10320 C CA  . GLY F 2 160 ? 67.068  -9.762  18.697  1.00 68.85  ? 160 GLY F CA  1 
ATOM   10321 C C   . GLY F 2 160 ? 66.993  -10.699 17.508  1.00 64.05  ? 160 GLY F C   1 
ATOM   10322 O O   . GLY F 2 160 ? 67.986  -11.346 17.171  1.00 61.70  ? 160 GLY F O   1 
ATOM   10323 N N   . GLU F 2 161 ? 65.835  -10.772 16.856  1.00 74.18  ? 161 GLU F N   1 
ATOM   10324 C CA  . GLU F 2 161 ? 65.708  -11.661 15.707  1.00 74.55  ? 161 GLU F CA  1 
ATOM   10325 C C   . GLU F 2 161 ? 66.071  -10.986 14.386  1.00 75.16  ? 161 GLU F C   1 
ATOM   10326 O O   . GLU F 2 161 ? 65.925  -9.770  14.225  1.00 74.28  ? 161 GLU F O   1 
ATOM   10327 C CB  . GLU F 2 161 ? 64.293  -12.235 15.613  1.00 39.04  ? 161 GLU F CB  1 
ATOM   10328 C CG  . GLU F 2 161 ? 64.207  -13.376 14.619  1.00 53.05  ? 161 GLU F CG  1 
ATOM   10329 C CD  . GLU F 2 161 ? 62.840  -14.028 14.580  1.00 58.85  ? 161 GLU F CD  1 
ATOM   10330 O OE1 . GLU F 2 161 ? 62.664  -14.991 13.800  1.00 58.43  ? 161 GLU F OE1 1 
ATOM   10331 O OE2 . GLU F 2 161 ? 61.943  -13.577 15.327  1.00 53.83  ? 161 GLU F OE2 1 
ATOM   10332 N N   . ILE F 2 162 ? 66.563  -11.785 13.444  1.00 72.88  ? 162 ILE F N   1 
ATOM   10333 C CA  . ILE F 2 162 ? 66.934  -11.283 12.129  1.00 66.24  ? 162 ILE F CA  1 
ATOM   10334 C C   . ILE F 2 162 ? 66.229  -12.125 11.077  1.00 73.93  ? 162 ILE F C   1 
ATOM   10335 O O   . ILE F 2 162 ? 66.198  -13.360 11.183  1.00 64.22  ? 162 ILE F O   1 
ATOM   10336 C CB  . ILE F 2 162 ? 68.436  -11.350 11.916  1.00 61.18  ? 162 ILE F CB  1 
ATOM   10337 C CG1 . ILE F 2 162 ? 69.110  -10.204 12.677  1.00 58.25  ? 162 ILE F CG1 1 
ATOM   10338 C CG2 . ILE F 2 162 ? 68.748  -11.293 10.434  1.00 81.86  ? 162 ILE F CG2 1 
ATOM   10339 C CD1 . ILE F 2 162 ? 70.596  -10.376 12.816  1.00 47.92  ? 162 ILE F CD1 1 
ATOM   10340 N N   . PHE F 2 163 ? 65.670  -11.446 10.068  1.00 66.95  ? 163 PHE F N   1 
ATOM   10341 C CA  . PHE F 2 163 ? 64.915  -12.098 8.995   1.00 65.43  ? 163 PHE F CA  1 
ATOM   10342 C C   . PHE F 2 163 ? 64.886  -11.261 7.708   1.00 56.50  ? 163 PHE F C   1 
ATOM   10343 O O   . PHE F 2 163 ? 65.161  -10.056 7.726   1.00 61.60  ? 163 PHE F O   1 
ATOM   10344 C CB  . PHE F 2 163 ? 63.475  -12.334 9.469   1.00 63.30  ? 163 PHE F CB  1 
ATOM   10345 C CG  . PHE F 2 163 ? 62.723  -11.064 9.781   1.00 54.47  ? 163 PHE F CG  1 
ATOM   10346 C CD1 . PHE F 2 163 ? 62.117  -10.330 8.770   1.00 69.02  ? 163 PHE F CD1 1 
ATOM   10347 C CD2 . PHE F 2 163 ? 62.653  -10.584 11.079  1.00 78.62  ? 163 PHE F CD2 1 
ATOM   10348 C CE1 . PHE F 2 163 ? 61.456  -9.140  9.044   1.00 45.59  ? 163 PHE F CE1 1 
ATOM   10349 C CE2 . PHE F 2 163 ? 61.994  -9.389  11.364  1.00 76.78  ? 163 PHE F CE2 1 
ATOM   10350 C CZ  . PHE F 2 163 ? 61.395  -8.668  10.336  1.00 62.79  ? 163 PHE F CZ  1 
ATOM   10351 N N   . PRO F 2 164 ? 64.538  -11.891 6.576   1.00 49.88  ? 164 PRO F N   1 
ATOM   10352 C CA  . PRO F 2 164 ? 64.487  -11.145 5.312   1.00 59.53  ? 164 PRO F CA  1 
ATOM   10353 C C   . PRO F 2 164 ? 63.297  -10.206 5.253   1.00 47.34  ? 164 PRO F C   1 
ATOM   10354 O O   . PRO F 2 164 ? 62.170  -10.653 5.086   1.00 52.26  ? 164 PRO F O   1 
ATOM   10355 C CB  . PRO F 2 164 ? 64.385  -12.246 4.262   1.00 48.85  ? 164 PRO F CB  1 
ATOM   10356 C CG  . PRO F 2 164 ? 63.608  -13.305 4.969   1.00 57.49  ? 164 PRO F CG  1 
ATOM   10357 C CD  . PRO F 2 164 ? 64.238  -13.316 6.357   1.00 45.50  ? 164 PRO F CD  1 
ATOM   10358 N N   . SER F 2 165 ? 63.547  -8.912  5.410   1.00 46.49  ? 165 SER F N   1 
ATOM   10359 C CA  . SER F 2 165 ? 62.475  -7.928  5.338   1.00 43.44  ? 165 SER F CA  1 
ATOM   10360 C C   . SER F 2 165 ? 62.275  -7.570  3.860   1.00 40.48  ? 165 SER F C   1 
ATOM   10361 O O   . SER F 2 165 ? 61.447  -6.743  3.514   1.00 56.49  ? 165 SER F O   1 
ATOM   10362 C CB  . SER F 2 165 ? 62.819  -6.685  6.189   1.00 54.35  ? 165 SER F CB  1 
ATOM   10363 O OG  . SER F 2 165 ? 64.062  -6.102  5.827   1.00 41.67  ? 165 SER F OG  1 
ATOM   10364 N N   . ALA F 2 166 ? 63.052  -8.222  2.998   1.00 43.41  ? 166 ALA F N   1 
ATOM   10365 C CA  . ALA F 2 166 ? 62.987  -8.050  1.546   1.00 49.68  ? 166 ALA F CA  1 
ATOM   10366 C C   . ALA F 2 166 ? 63.539  -9.331  0.948   1.00 56.16  ? 166 ALA F C   1 
ATOM   10367 O O   . ALA F 2 166 ? 64.494  -9.902  1.475   1.00 59.57  ? 166 ALA F O   1 
ATOM   10368 C CB  . ALA F 2 166 ? 63.834  -6.867  1.095   1.00 45.92  ? 166 ALA F CB  1 
ATOM   10369 N N   . VAL F 2 167 ? 62.946  -9.772  -0.157  1.00 55.77  ? 167 VAL F N   1 
ATOM   10370 C CA  . VAL F 2 167 ? 63.364  -10.997 -0.825  1.00 44.69  ? 167 VAL F CA  1 
ATOM   10371 C C   . VAL F 2 167 ? 63.463  -10.771 -2.341  1.00 60.48  ? 167 VAL F C   1 
ATOM   10372 O O   . VAL F 2 167 ? 62.968  -9.759  -2.848  1.00 63.23  ? 167 VAL F O   1 
ATOM   10373 C CB  . VAL F 2 167 ? 62.353  -12.119 -0.493  1.00 56.30  ? 167 VAL F CB  1 
ATOM   10374 C CG1 . VAL F 2 167 ? 62.099  -13.006 -1.701  1.00 61.57  ? 167 VAL F CG1 1 
ATOM   10375 C CG2 . VAL F 2 167 ? 62.877  -12.943 0.683   1.00 54.00  ? 167 VAL F CG2 1 
ATOM   10376 N N   . ARG F 2 168 ? 64.100  -11.697 -3.058  1.00 41.10  ? 168 ARG F N   1 
ATOM   10377 C CA  . ARG F 2 168 ? 64.245  -11.569 -4.507  1.00 48.04  ? 168 ARG F CA  1 
ATOM   10378 C C   . ARG F 2 168 ? 64.742  -12.806 -5.255  1.00 61.39  ? 168 ARG F C   1 
ATOM   10379 O O   . ARG F 2 168 ? 65.720  -13.443 -4.857  1.00 69.75  ? 168 ARG F O   1 
ATOM   10380 C CB  . ARG F 2 168 ? 65.192  -10.426 -4.846  1.00 42.35  ? 168 ARG F CB  1 
ATOM   10381 C CG  . ARG F 2 168 ? 65.641  -10.463 -6.289  1.00 42.86  ? 168 ARG F CG  1 
ATOM   10382 C CD  . ARG F 2 168 ? 67.132  -10.230 -6.380  1.00 64.23  ? 168 ARG F CD  1 
ATOM   10383 N NE  . ARG F 2 168 ? 67.475  -8.817  -6.426  1.00 48.31  ? 168 ARG F NE  1 
ATOM   10384 C CZ  . ARG F 2 168 ? 68.675  -8.340  -6.113  1.00 74.57  ? 168 ARG F CZ  1 
ATOM   10385 N NH1 . ARG F 2 168 ? 69.632  -9.171  -5.720  1.00 46.62  ? 168 ARG F NH1 1 
ATOM   10386 N NH2 . ARG F 2 168 ? 68.924  -7.039  -6.219  1.00 45.11  ? 168 ARG F NH2 1 
ATOM   10387 N N   . LYS F 2 169 ? 64.071  -13.127 -6.355  1.00 57.30  ? 169 LYS F N   1 
ATOM   10388 C CA  . LYS F 2 169 ? 64.457  -14.246 -7.194  1.00 54.55  ? 169 LYS F CA  1 
ATOM   10389 C C   . LYS F 2 169 ? 64.257  -13.877 -8.667  1.00 63.97  ? 169 LYS F C   1 
ATOM   10390 O O   . LYS F 2 169 ? 63.182  -14.107 -9.250  1.00 62.87  ? 169 LYS F O   1 
ATOM   10391 C CB  . LYS F 2 169 ? 63.651  -15.507 -6.860  1.00 57.73  ? 169 LYS F CB  1 
ATOM   10392 C CG  . LYS F 2 169 ? 64.191  -16.737 -7.595  1.00 38.89  ? 169 LYS F CG  1 
ATOM   10393 C CD  . LYS F 2 169 ? 63.379  -17.981 -7.338  1.00 43.83  ? 169 LYS F CD  1 
ATOM   10394 C CE  . LYS F 2 169 ? 63.898  -19.149 -8.161  1.00 61.90  ? 169 LYS F CE  1 
ATOM   10395 N NZ  . LYS F 2 169 ? 63.156  -20.412 -7.854  1.00 74.81  ? 169 LYS F NZ  1 
ATOM   10396 N N   . GLY F 2 170 ? 65.310  -13.328 -9.269  1.00 59.35  ? 170 GLY F N   1 
ATOM   10397 C CA  . GLY F 2 170 ? 65.245  -12.911 -10.661 1.00 72.07  ? 170 GLY F CA  1 
ATOM   10398 C C   . GLY F 2 170 ? 64.502  -11.590 -10.712 1.00 75.74  ? 170 GLY F C   1 
ATOM   10399 O O   . GLY F 2 170 ? 64.990  -10.565 -10.195 1.00 72.50  ? 170 GLY F O   1 
ATOM   10400 N N   . ARG F 2 171 ? 63.318  -11.609 -11.319 1.00 70.78  ? 171 ARG F N   1 
ATOM   10401 C CA  . ARG F 2 171 ? 62.494  -10.409 -11.403 1.00 62.13  ? 171 ARG F CA  1 
ATOM   10402 C C   . ARG F 2 171 ? 61.301  -10.561 -10.463 1.00 63.06  ? 171 ARG F C   1 
ATOM   10403 O O   . ARG F 2 171 ? 60.243  -9.966  -10.656 1.00 54.27  ? 171 ARG F O   1 
ATOM   10404 C CB  . ARG F 2 171 ? 62.034  -10.165 -12.843 1.00 47.57  ? 171 ARG F CB  1 
ATOM   10405 C CG  . ARG F 2 171 ? 63.198  -9.975  -13.805 1.00 72.02  ? 171 ARG F CG  1 
ATOM   10406 C CD  . ARG F 2 171 ? 62.800  -9.275  -15.103 1.00 81.42  ? 171 ARG F CD  1 
ATOM   10407 N NE  . ARG F 2 171 ? 63.967  -9.065  -15.964 1.00 98.63  ? 171 ARG F NE  1 
ATOM   10408 C CZ  . ARG F 2 171 ? 64.530  -10.014 -16.715 1.00 103.15 ? 171 ARG F CZ  1 
ATOM   10409 N NH1 . ARG F 2 171 ? 64.026  -11.245 -16.723 1.00 85.04  ? 171 ARG F NH1 1 
ATOM   10410 N NH2 . ARG F 2 171 ? 65.611  -9.741  -17.442 1.00 98.02  ? 171 ARG F NH2 1 
ATOM   10411 N N   . ILE F 2 172 ? 61.476  -11.390 -9.444  1.00 56.86  ? 172 ILE F N   1 
ATOM   10412 C CA  . ILE F 2 172 ? 60.436  -11.574 -8.457  1.00 42.68  ? 172 ILE F CA  1 
ATOM   10413 C C   . ILE F 2 172 ? 60.956  -10.880 -7.208  1.00 59.24  ? 172 ILE F C   1 
ATOM   10414 O O   . ILE F 2 172 ? 62.018  -11.242 -6.702  1.00 49.61  ? 172 ILE F O   1 
ATOM   10415 C CB  . ILE F 2 172 ? 60.204  -13.047 -8.151  1.00 45.69  ? 172 ILE F CB  1 
ATOM   10416 C CG1 . ILE F 2 172 ? 59.931  -13.804 -9.448  1.00 46.45  ? 172 ILE F CG1 1 
ATOM   10417 C CG2 . ILE F 2 172 ? 59.022  -13.194 -7.189  1.00 41.54  ? 172 ILE F CG2 1 
ATOM   10418 C CD1 . ILE F 2 172 ? 59.786  -15.304 -9.257  1.00 53.55  ? 172 ILE F CD1 1 
ATOM   10419 N N   . LEU F 2 173 ? 60.233  -9.860  -6.743  1.00 54.56  ? 173 LEU F N   1 
ATOM   10420 C CA  . LEU F 2 173 ? 60.627  -9.129  -5.544  1.00 39.83  ? 173 LEU F CA  1 
ATOM   10421 C C   . LEU F 2 173 ? 59.569  -9.286  -4.456  1.00 47.02  ? 173 LEU F C   1 
ATOM   10422 O O   . LEU F 2 173 ? 58.442  -9.710  -4.720  1.00 39.80  ? 173 LEU F O   1 
ATOM   10423 C CB  . LEU F 2 173 ? 60.827  -7.649  -5.854  1.00 49.70  ? 173 LEU F CB  1 
ATOM   10424 C CG  . LEU F 2 173 ? 61.916  -7.325  -6.876  1.00 53.04  ? 173 LEU F CG  1 
ATOM   10425 C CD1 . LEU F 2 173 ? 61.987  -5.828  -7.087  1.00 54.86  ? 173 LEU F CD1 1 
ATOM   10426 C CD2 . LEU F 2 173 ? 63.248  -7.863  -6.395  1.00 55.94  ? 173 LEU F CD2 1 
ATOM   10427 N N   . GLY F 2 174 ? 59.949  -8.943  -3.228  1.00 49.14  ? 174 GLY F N   1 
ATOM   10428 C CA  . GLY F 2 174 ? 59.048  -9.054  -2.098  1.00 35.48  ? 174 GLY F CA  1 
ATOM   10429 C C   . GLY F 2 174 ? 59.479  -8.098  -1.003  1.00 53.77  ? 174 GLY F C   1 
ATOM   10430 O O   . GLY F 2 174 ? 60.670  -7.860  -0.783  1.00 51.89  ? 174 GLY F O   1 
ATOM   10431 N N   . PHE F 2 175 ? 58.504  -7.518  -0.323  1.00 47.53  ? 175 PHE F N   1 
ATOM   10432 C CA  . PHE F 2 175 ? 58.809  -6.591  0.750   1.00 42.58  ? 175 PHE F CA  1 
ATOM   10433 C C   . PHE F 2 175 ? 57.824  -6.880  1.864   1.00 44.83  ? 175 PHE F C   1 
ATOM   10434 O O   . PHE F 2 175 ? 56.621  -6.957  1.638   1.00 47.62  ? 175 PHE F O   1 
ATOM   10435 C CB  . PHE F 2 175 ? 58.694  -5.141  0.264   1.00 46.91  ? 175 PHE F CB  1 
ATOM   10436 C CG  . PHE F 2 175 ? 59.614  -4.808  -0.877  1.00 49.41  ? 175 PHE F CG  1 
ATOM   10437 C CD1 . PHE F 2 175 ? 59.194  -4.960  -2.194  1.00 31.49  ? 175 PHE F CD1 1 
ATOM   10438 C CD2 . PHE F 2 175 ? 60.915  -4.376  -0.634  1.00 41.06  ? 175 PHE F CD2 1 
ATOM   10439 C CE1 . PHE F 2 175 ? 60.055  -4.691  -3.257  1.00 36.64  ? 175 PHE F CE1 1 
ATOM   10440 C CE2 . PHE F 2 175 ? 61.786  -4.106  -1.691  1.00 39.13  ? 175 PHE F CE2 1 
ATOM   10441 C CZ  . PHE F 2 175 ? 61.352  -4.265  -3.007  1.00 34.47  ? 175 PHE F CZ  1 
ATOM   10442 N N   . GLN F 2 176 ? 58.342  -7.063  3.068   1.00 47.05  ? 176 GLN F N   1 
ATOM   10443 C CA  . GLN F 2 176 ? 57.490  -7.383  4.196   1.00 52.10  ? 176 GLN F CA  1 
ATOM   10444 C C   . GLN F 2 176 ? 56.789  -6.154  4.747   1.00 43.90  ? 176 GLN F C   1 
ATOM   10445 O O   . GLN F 2 176 ? 55.681  -6.246  5.270   1.00 56.47  ? 176 GLN F O   1 
ATOM   10446 C CB  . GLN F 2 176 ? 58.320  -8.070  5.298   1.00 49.08  ? 176 GLN F CB  1 
ATOM   10447 C CG  . GLN F 2 176 ? 57.493  -8.565  6.468   1.00 41.19  ? 176 GLN F CG  1 
ATOM   10448 C CD  . GLN F 2 176 ? 56.474  -9.597  6.055   1.00 45.46  ? 176 GLN F CD  1 
ATOM   10449 O OE1 . GLN F 2 176 ? 56.820  -10.726 5.717   1.00 49.44  ? 176 GLN F OE1 1 
ATOM   10450 N NE2 . GLN F 2 176 ? 55.209  -9.213  6.072   1.00 44.84  ? 176 GLN F NE2 1 
ATOM   10451 N N   . PHE F 2 177 ? 57.435  -5.002  4.619   1.00 48.89  ? 177 PHE F N   1 
ATOM   10452 C CA  . PHE F 2 177 ? 56.878  -3.752  5.125   1.00 52.88  ? 177 PHE F CA  1 
ATOM   10453 C C   . PHE F 2 177 ? 55.927  -3.077  4.130   1.00 41.93  ? 177 PHE F C   1 
ATOM   10454 O O   . PHE F 2 177 ? 55.765  -3.544  3.006   1.00 45.86  ? 177 PHE F O   1 
ATOM   10455 C CB  . PHE F 2 177 ? 58.017  -2.790  5.490   1.00 50.12  ? 177 PHE F CB  1 
ATOM   10456 C CG  . PHE F 2 177 ? 58.998  -2.562  4.374   1.00 44.62  ? 177 PHE F CG  1 
ATOM   10457 C CD1 . PHE F 2 177 ? 60.083  -3.410  4.201   1.00 35.28  ? 177 PHE F CD1 1 
ATOM   10458 C CD2 . PHE F 2 177 ? 58.821  -1.516  3.475   1.00 50.67  ? 177 PHE F CD2 1 
ATOM   10459 C CE1 . PHE F 2 177 ? 60.976  -3.227  3.158   1.00 41.59  ? 177 PHE F CE1 1 
ATOM   10460 C CE2 . PHE F 2 177 ? 59.714  -1.328  2.422   1.00 57.63  ? 177 PHE F CE2 1 
ATOM   10461 C CZ  . PHE F 2 177 ? 60.793  -2.187  2.267   1.00 53.31  ? 177 PHE F CZ  1 
ATOM   10462 N N   . HIS F 2 178 ? 55.304  -1.984  4.571   1.00 45.85  ? 178 HIS F N   1 
ATOM   10463 C CA  . HIS F 2 178 ? 54.363  -1.192  3.770   1.00 38.71  ? 178 HIS F CA  1 
ATOM   10464 C C   . HIS F 2 178 ? 55.047  0.053   3.193   1.00 36.97  ? 178 HIS F C   1 
ATOM   10465 O O   . HIS F 2 178 ? 55.122  1.082   3.858   1.00 39.56  ? 178 HIS F O   1 
ATOM   10466 C CB  . HIS F 2 178 ? 53.182  -0.700  4.624   1.00 35.31  ? 178 HIS F CB  1 
ATOM   10467 C CG  . HIS F 2 178 ? 52.192  -1.759  4.999   1.00 63.65  ? 178 HIS F CG  1 
ATOM   10468 N ND1 . HIS F 2 178 ? 51.793  -2.754  4.132   1.00 74.56  ? 178 HIS F ND1 1 
ATOM   10469 C CD2 . HIS F 2 178 ? 51.463  -1.931  6.127   1.00 58.66  ? 178 HIS F CD2 1 
ATOM   10470 C CE1 . HIS F 2 178 ? 50.862  -3.493  4.711   1.00 73.17  ? 178 HIS F CE1 1 
ATOM   10471 N NE2 . HIS F 2 178 ? 50.643  -3.013  5.922   1.00 66.54  ? 178 HIS F NE2 1 
ATOM   10472 N N   . PRO F 2 179 ? 55.544  -0.013  1.949   1.00 30.11  ? 179 PRO F N   1 
ATOM   10473 C CA  . PRO F 2 179 ? 56.182  1.206   1.452   1.00 45.49  ? 179 PRO F CA  1 
ATOM   10474 C C   . PRO F 2 179 ? 55.234  2.418   1.335   1.00 51.21  ? 179 PRO F C   1 
ATOM   10475 O O   . PRO F 2 179 ? 55.690  3.556   1.411   1.00 54.97  ? 179 PRO F O   1 
ATOM   10476 C CB  . PRO F 2 179 ? 56.792  0.762   0.120   1.00 28.18  ? 179 PRO F CB  1 
ATOM   10477 C CG  . PRO F 2 179 ? 55.938  -0.370  -0.302  1.00 50.12  ? 179 PRO F CG  1 
ATOM   10478 C CD  . PRO F 2 179 ? 55.633  -1.105  0.970   1.00 32.70  ? 179 PRO F CD  1 
ATOM   10479 N N   . GLU F 2 180 ? 53.929  2.177   1.195   1.00 40.94  ? 180 GLU F N   1 
ATOM   10480 C CA  . GLU F 2 180 ? 52.944  3.266   1.091   1.00 43.81  ? 180 GLU F CA  1 
ATOM   10481 C C   . GLU F 2 180 ? 52.780  4.028   2.397   1.00 37.55  ? 180 GLU F C   1 
ATOM   10482 O O   . GLU F 2 180 ? 52.262  5.135   2.402   1.00 38.85  ? 180 GLU F O   1 
ATOM   10483 C CB  . GLU F 2 180 ? 51.543  2.764   0.705   1.00 42.52  ? 180 GLU F CB  1 
ATOM   10484 C CG  . GLU F 2 180 ? 51.442  1.324   0.282   1.00 73.65  ? 180 GLU F CG  1 
ATOM   10485 C CD  . GLU F 2 180 ? 51.825  0.342   1.380   1.00 51.93  ? 180 GLU F CD  1 
ATOM   10486 O OE1 . GLU F 2 180 ? 51.070  0.168   2.350   1.00 38.99  ? 180 GLU F OE1 1 
ATOM   10487 O OE2 . GLU F 2 180 ? 52.900  -0.259  1.258   1.00 51.34  ? 180 GLU F OE2 1 
ATOM   10488 N N   . LYS F 2 181 ? 53.197  3.416   3.499   1.00 33.43  ? 181 LYS F N   1 
ATOM   10489 C CA  . LYS F 2 181 ? 53.092  4.036   4.816   1.00 32.48  ? 181 LYS F CA  1 
ATOM   10490 C C   . LYS F 2 181 ? 54.469  4.414   5.327   1.00 34.29  ? 181 LYS F C   1 
ATOM   10491 O O   . LYS F 2 181 ? 54.623  4.708   6.498   1.00 41.26  ? 181 LYS F O   1 
ATOM   10492 C CB  . LYS F 2 181 ? 52.462  3.062   5.825   1.00 34.96  ? 181 LYS F CB  1 
ATOM   10493 C CG  . LYS F 2 181 ? 51.013  2.732   5.591   1.00 41.33  ? 181 LYS F CG  1 
ATOM   10494 C CD  . LYS F 2 181 ? 50.157  3.952   5.826   1.00 54.42  ? 181 LYS F CD  1 
ATOM   10495 C CE  . LYS F 2 181 ? 48.713  3.706   5.430   1.00 46.78  ? 181 LYS F CE  1 
ATOM   10496 N NZ  . LYS F 2 181 ? 47.955  4.977   5.554   1.00 44.54  ? 181 LYS F NZ  1 
ATOM   10497 N N   . SER F 2 182 ? 55.461  4.409   4.447   1.00 35.53  ? 182 SER F N   1 
ATOM   10498 C CA  . SER F 2 182 ? 56.831  4.694   4.846   1.00 47.71  ? 182 SER F CA  1 
ATOM   10499 C C   . SER F 2 182 ? 57.415  6.004   4.333   1.00 55.48  ? 182 SER F C   1 
ATOM   10500 O O   . SER F 2 182 ? 58.546  6.023   3.843   1.00 40.19  ? 182 SER F O   1 
ATOM   10501 C CB  . SER F 2 182 ? 57.745  3.538   4.408   1.00 55.57  ? 182 SER F CB  1 
ATOM   10502 O OG  . SER F 2 182 ? 57.170  2.282   4.716   1.00 44.77  ? 182 SER F OG  1 
ATOM   10503 N N   . SER F 2 183 ? 56.643  7.084   4.448   1.00 50.71  ? 183 SER F N   1 
ATOM   10504 C CA  . SER F 2 183 ? 57.062  8.425   4.018   1.00 42.81  ? 183 SER F CA  1 
ATOM   10505 C C   . SER F 2 183 ? 57.826  8.488   2.674   1.00 31.20  ? 183 SER F C   1 
ATOM   10506 O O   . SER F 2 183 ? 57.574  7.693   1.768   1.00 40.61  ? 183 SER F O   1 
ATOM   10507 C CB  . SER F 2 183 ? 57.885  9.076   5.142   1.00 48.60  ? 183 SER F CB  1 
ATOM   10508 O OG  . SER F 2 183 ? 57.927  10.483  5.014   1.00 58.99  ? 183 SER F OG  1 
ATOM   10509 N N   . LYS F 2 184 ? 58.767  9.425   2.556   1.00 44.12  ? 184 LYS F N   1 
ATOM   10510 C CA  . LYS F 2 184 ? 59.529  9.615   1.312   1.00 45.94  ? 184 LYS F CA  1 
ATOM   10511 C C   . LYS F 2 184 ? 60.439  8.475   0.915   1.00 47.46  ? 184 LYS F C   1 
ATOM   10512 O O   . LYS F 2 184 ? 60.603  8.187   -0.277  1.00 50.86  ? 184 LYS F O   1 
ATOM   10513 C CB  . LYS F 2 184 ? 60.335  10.919  1.376   1.00 48.81  ? 184 LYS F CB  1 
ATOM   10514 C CG  . LYS F 2 184 ? 60.826  11.283  2.755   1.00 47.13  ? 184 LYS F CG  1 
ATOM   10515 C CD  . LYS F 2 184 ? 61.535  12.631  2.760   1.00 89.75  ? 184 LYS F CD  1 
ATOM   10516 C CE  . LYS F 2 184 ? 60.574  13.792  2.501   1.00 83.74  ? 184 LYS F CE  1 
ATOM   10517 N NZ  . LYS F 2 184 ? 61.276  15.116  2.462   1.00 75.79  ? 184 LYS F NZ  1 
ATOM   10518 N N   . ILE F 2 185 ? 61.041  7.833   1.910   1.00 53.27  ? 185 ILE F N   1 
ATOM   10519 C CA  . ILE F 2 185 ? 61.918  6.703   1.655   1.00 40.49  ? 185 ILE F CA  1 
ATOM   10520 C C   . ILE F 2 185 ? 61.074  5.599   1.011   1.00 45.64  ? 185 ILE F C   1 
ATOM   10521 O O   . ILE F 2 185 ? 61.557  4.830   0.185   1.00 54.76  ? 185 ILE F O   1 
ATOM   10522 C CB  . ILE F 2 185 ? 62.584  6.211   2.980   1.00 52.13  ? 185 ILE F CB  1 
ATOM   10523 C CG1 . ILE F 2 185 ? 63.958  5.625   2.678   1.00 54.68  ? 185 ILE F CG1 1 
ATOM   10524 C CG2 . ILE F 2 185 ? 61.736  5.166   3.672   1.00 46.90  ? 185 ILE F CG2 1 
ATOM   10525 C CD1 . ILE F 2 185 ? 63.940  4.520   1.678   1.00 62.22  ? 185 ILE F CD1 1 
ATOM   10526 N N   . GLY F 2 186 ? 59.800  5.540   1.376   1.00 33.43  ? 186 GLY F N   1 
ATOM   10527 C CA  . GLY F 2 186 ? 58.923  4.542   0.791   1.00 54.53  ? 186 GLY F CA  1 
ATOM   10528 C C   . GLY F 2 186 ? 58.632  4.862   -0.667  1.00 42.60  ? 186 GLY F C   1 
ATOM   10529 O O   . GLY F 2 186 ? 58.604  3.972   -1.515  1.00 49.32  ? 186 GLY F O   1 
ATOM   10530 N N   . ARG F 2 187 ? 58.401  6.138   -0.952  1.00 40.43  ? 187 ARG F N   1 
ATOM   10531 C CA  . ARG F 2 187 ? 58.140  6.575   -2.309  1.00 40.97  ? 187 ARG F CA  1 
ATOM   10532 C C   . ARG F 2 187 ? 59.354  6.244   -3.171  1.00 40.95  ? 187 ARG F C   1 
ATOM   10533 O O   . ARG F 2 187 ? 59.226  5.681   -4.261  1.00 49.49  ? 187 ARG F O   1 
ATOM   10534 C CB  . ARG F 2 187 ? 57.881  8.084   -2.345  1.00 43.06  ? 187 ARG F CB  1 
ATOM   10535 C CG  . ARG F 2 187 ? 57.558  8.638   -3.747  1.00 57.51  ? 187 ARG F CG  1 
ATOM   10536 C CD  . ARG F 2 187 ? 57.187  10.118  -3.676  1.00 65.01  ? 187 ARG F CD  1 
ATOM   10537 N NE  . ARG F 2 187 ? 56.695  10.662  -4.942  1.00 69.74  ? 187 ARG F NE  1 
ATOM   10538 C CZ  . ARG F 2 187 ? 57.460  10.955  -5.993  1.00 89.54  ? 187 ARG F CZ  1 
ATOM   10539 N NH1 . ARG F 2 187 ? 58.775  10.760  -5.949  1.00 84.97  ? 187 ARG F NH1 1 
ATOM   10540 N NH2 . ARG F 2 187 ? 56.911  11.466  -7.090  1.00 81.25  ? 187 ARG F NH2 1 
ATOM   10541 N N   . LYS F 2 188 ? 60.538  6.580   -2.670  1.00 46.14  ? 188 LYS F N   1 
ATOM   10542 C CA  . LYS F 2 188 ? 61.750  6.314   -3.425  1.00 47.95  ? 188 LYS F CA  1 
ATOM   10543 C C   . LYS F 2 188 ? 61.959  4.823   -3.627  1.00 48.63  ? 188 LYS F C   1 
ATOM   10544 O O   . LYS F 2 188 ? 62.664  4.411   -4.539  1.00 58.93  ? 188 LYS F O   1 
ATOM   10545 C CB  . LYS F 2 188 ? 62.971  6.929   -2.739  1.00 49.82  ? 188 LYS F CB  1 
ATOM   10546 C CG  . LYS F 2 188 ? 64.207  6.875   -3.618  1.00 65.02  ? 188 LYS F CG  1 
ATOM   10547 C CD  . LYS F 2 188 ? 65.302  7.815   -3.136  1.00 90.95  ? 188 LYS F CD  1 
ATOM   10548 C CE  . LYS F 2 188 ? 66.515  7.750   -4.077  1.00 103.15 ? 188 LYS F CE  1 
ATOM   10549 N NZ  . LYS F 2 188 ? 67.563  8.794   -3.798  1.00 70.78  ? 188 LYS F NZ  1 
ATOM   10550 N N   . LEU F 2 189 ? 61.341  4.012   -2.776  1.00 49.30  ? 189 LEU F N   1 
ATOM   10551 C CA  . LEU F 2 189 ? 61.459  2.564   -2.912  1.00 59.80  ? 189 LEU F CA  1 
ATOM   10552 C C   . LEU F 2 189 ? 60.581  2.127   -4.085  1.00 28.91  ? 189 LEU F C   1 
ATOM   10553 O O   . LEU F 2 189 ? 61.028  1.432   -4.995  1.00 47.29  ? 189 LEU F O   1 
ATOM   10554 C CB  . LEU F 2 189 ? 61.015  1.863   -1.609  1.00 50.17  ? 189 LEU F CB  1 
ATOM   10555 C CG  . LEU F 2 189 ? 60.973  0.330   -1.477  1.00 48.27  ? 189 LEU F CG  1 
ATOM   10556 C CD1 . LEU F 2 189 ? 59.975  -0.264  -2.445  1.00 30.06  ? 189 LEU F CD1 1 
ATOM   10557 C CD2 . LEU F 2 189 ? 62.348  -0.244  -1.709  1.00 44.81  ? 189 LEU F CD2 1 
ATOM   10558 N N   . LEU F 2 190 ? 59.326  2.548   -4.056  1.00 42.03  ? 190 LEU F N   1 
ATOM   10559 C CA  . LEU F 2 190 ? 58.389  2.201   -5.118  1.00 52.76  ? 190 LEU F CA  1 
ATOM   10560 C C   . LEU F 2 190 ? 58.860  2.776   -6.456  1.00 45.79  ? 190 LEU F C   1 
ATOM   10561 O O   . LEU F 2 190 ? 58.545  2.242   -7.516  1.00 41.72  ? 190 LEU F O   1 
ATOM   10562 C CB  . LEU F 2 190 ? 56.986  2.692   -4.746  1.00 39.12  ? 190 LEU F CB  1 
ATOM   10563 C CG  . LEU F 2 190 ? 56.344  1.876   -3.608  1.00 40.03  ? 190 LEU F CG  1 
ATOM   10564 C CD1 . LEU F 2 190 ? 55.082  2.562   -3.074  1.00 34.72  ? 190 LEU F CD1 1 
ATOM   10565 C CD2 . LEU F 2 190 ? 56.025  0.485   -4.121  1.00 28.43  ? 190 LEU F CD2 1 
ATOM   10566 N N   . GLU F 2 191 ? 59.643  3.849   -6.389  1.00 43.37  ? 191 GLU F N   1 
ATOM   10567 C CA  . GLU F 2 191 ? 60.201  4.480   -7.582  1.00 47.67  ? 191 GLU F CA  1 
ATOM   10568 C C   . GLU F 2 191 ? 61.257  3.572   -8.197  1.00 47.33  ? 191 GLU F C   1 
ATOM   10569 O O   . GLU F 2 191 ? 61.218  3.257   -9.392  1.00 46.66  ? 191 GLU F O   1 
ATOM   10570 C CB  . GLU F 2 191 ? 60.860  5.799   -7.219  1.00 43.82  ? 191 GLU F CB  1 
ATOM   10571 C CG  . GLU F 2 191 ? 60.076  7.035   -7.578  1.00 54.09  ? 191 GLU F CG  1 
ATOM   10572 C CD  . GLU F 2 191 ? 60.905  8.279   -7.333  1.00 69.74  ? 191 GLU F CD  1 
ATOM   10573 O OE1 . GLU F 2 191 ? 62.111  8.261   -7.691  1.00 78.97  ? 191 GLU F OE1 1 
ATOM   10574 O OE2 . GLU F 2 191 ? 60.363  9.263   -6.789  1.00 53.40  ? 191 GLU F OE2 1 
ATOM   10575 N N   . LYS F 2 192 ? 62.204  3.150   -7.363  1.00 52.46  ? 192 LYS F N   1 
ATOM   10576 C CA  . LYS F 2 192 ? 63.267  2.276   -7.816  1.00 29.70  ? 192 LYS F CA  1 
ATOM   10577 C C   . LYS F 2 192 ? 62.719  0.928   -8.250  1.00 35.10  ? 192 LYS F C   1 
ATOM   10578 O O   . LYS F 2 192 ? 63.372  0.216   -9.010  1.00 47.58  ? 192 LYS F O   1 
ATOM   10579 C CB  . LYS F 2 192 ? 64.329  2.103   -6.734  1.00 57.70  ? 192 LYS F CB  1 
ATOM   10580 C CG  . LYS F 2 192 ? 65.726  2.536   -7.190  1.00 61.66  ? 192 LYS F CG  1 
ATOM   10581 C CD  . LYS F 2 192 ? 66.156  1.768   -8.429  1.00 44.52  ? 192 LYS F CD  1 
ATOM   10582 C CE  . LYS F 2 192 ? 67.552  2.159   -8.894  1.00 81.78  ? 192 LYS F CE  1 
ATOM   10583 N NZ  . LYS F 2 192 ? 67.709  3.612   -9.203  1.00 63.09  ? 192 LYS F NZ  1 
ATOM   10584 N N   . VAL F 2 193 ? 61.530  0.570   -7.766  1.00 46.08  ? 193 VAL F N   1 
ATOM   10585 C CA  . VAL F 2 193 ? 60.911  -0.679  -8.184  1.00 32.24  ? 193 VAL F CA  1 
ATOM   10586 C C   . VAL F 2 193 ? 60.422  -0.445  -9.615  1.00 41.75  ? 193 VAL F C   1 
ATOM   10587 O O   . VAL F 2 193 ? 60.613  -1.288  -10.476 1.00 49.26  ? 193 VAL F O   1 
ATOM   10588 C CB  . VAL F 2 193 ? 59.719  -1.076  -7.282  1.00 43.11  ? 193 VAL F CB  1 
ATOM   10589 C CG1 . VAL F 2 193 ? 58.936  -2.206  -7.913  1.00 32.06  ? 193 VAL F CG1 1 
ATOM   10590 C CG2 . VAL F 2 193 ? 60.215  -1.524  -5.933  1.00 42.52  ? 193 VAL F CG2 1 
ATOM   10591 N N   . ILE F 2 194 ? 59.805  0.710   -9.873  1.00 53.90  ? 194 ILE F N   1 
ATOM   10592 C CA  . ILE F 2 194 ? 59.324  1.038   -11.220 1.00 44.50  ? 194 ILE F CA  1 
ATOM   10593 C C   . ILE F 2 194 ? 60.498  1.142   -12.206 1.00 40.41  ? 194 ILE F C   1 
ATOM   10594 O O   . ILE F 2 194 ? 60.434  0.616   -13.317 1.00 30.51  ? 194 ILE F O   1 
ATOM   10595 C CB  . ILE F 2 194 ? 58.525  2.375   -11.227 1.00 58.63  ? 194 ILE F CB  1 
ATOM   10596 C CG1 . ILE F 2 194 ? 57.159  2.167   -10.567 1.00 52.06  ? 194 ILE F CG1 1 
ATOM   10597 C CG2 . ILE F 2 194 ? 58.359  2.898   -12.649 1.00 31.26  ? 194 ILE F CG2 1 
ATOM   10598 C CD1 . ILE F 2 194 ? 56.484  3.455   -10.185 1.00 33.80  ? 194 ILE F CD1 1 
ATOM   10599 N N   . GLU F 2 195 ? 61.565  1.817   -11.786 1.00 38.45  ? 195 GLU F N   1 
ATOM   10600 C CA  . GLU F 2 195 ? 62.755  1.974   -12.614 1.00 33.74  ? 195 GLU F CA  1 
ATOM   10601 C C   . GLU F 2 195 ? 63.348  0.621   -13.026 1.00 60.72  ? 195 GLU F C   1 
ATOM   10602 O O   . GLU F 2 195 ? 63.853  0.476   -14.144 1.00 59.14  ? 195 GLU F O   1 
ATOM   10603 C CB  . GLU F 2 195 ? 63.799  2.802   -11.864 1.00 45.08  ? 195 GLU F CB  1 
ATOM   10604 C CG  . GLU F 2 195 ? 63.270  4.160   -11.467 1.00 32.92  ? 195 GLU F CG  1 
ATOM   10605 C CD  . GLU F 2 195 ? 64.266  4.992   -10.700 1.00 59.91  ? 195 GLU F CD  1 
ATOM   10606 O OE1 . GLU F 2 195 ? 65.204  4.415   -10.107 1.00 53.73  ? 195 GLU F OE1 1 
ATOM   10607 O OE2 . GLU F 2 195 ? 64.095  6.231   -10.670 1.00 47.99  ? 195 GLU F OE2 1 
ATOM   10608 N N   . CYS F 2 196 ? 63.276  -0.372  -12.137 1.00 39.83  ? 196 CYS F N   1 
ATOM   10609 C CA  . CYS F 2 196 ? 63.801  -1.697  -12.439 1.00 44.41  ? 196 CYS F CA  1 
ATOM   10610 C C   . CYS F 2 196 ? 62.991  -2.399  -13.528 1.00 52.69  ? 196 CYS F C   1 
ATOM   10611 O O   . CYS F 2 196 ? 63.559  -3.001  -14.443 1.00 62.08  ? 196 CYS F O   1 
ATOM   10612 C CB  . CYS F 2 196 ? 63.798  -2.593  -11.192 1.00 53.09  ? 196 CYS F CB  1 
ATOM   10613 S SG  . CYS F 2 196 ? 64.915  -2.134  -9.858  1.00 61.72  ? 196 CYS F SG  1 
ATOM   10614 N N   . SER F 2 197 ? 61.667  -2.336  -13.425 1.00 55.93  ? 197 SER F N   1 
ATOM   10615 C CA  . SER F 2 197 ? 60.800  -2.995  -14.400 1.00 67.99  ? 197 SER F CA  1 
ATOM   10616 C C   . SER F 2 197 ? 60.741  -2.301  -15.744 1.00 62.62  ? 197 SER F C   1 
ATOM   10617 O O   . SER F 2 197 ? 59.979  -2.721  -16.617 1.00 78.39  ? 197 SER F O   1 
ATOM   10618 C CB  . SER F 2 197 ? 59.386  -3.131  -13.854 1.00 44.49  ? 197 SER F CB  1 
ATOM   10619 O OG  . SER F 2 197 ? 58.895  -1.863  -13.495 1.00 71.72  ? 197 SER F OG  1 
ATOM   10620 N N   . LEU F 2 198 ? 61.508  -1.225  -15.902 1.00 61.96  ? 198 LEU F N   1 
ATOM   10621 C CA  . LEU F 2 198 ? 61.561  -0.508  -17.177 1.00 71.87  ? 198 LEU F CA  1 
ATOM   10622 C C   . LEU F 2 198 ? 62.653  -1.211  -17.966 1.00 78.14  ? 198 LEU F C   1 
ATOM   10623 O O   . LEU F 2 198 ? 62.668  -1.189  -19.202 1.00 82.33  ? 198 LEU F O   1 
ATOM   10624 C CB  . LEU F 2 198 ? 61.937  0.972   -16.977 1.00 56.16  ? 198 LEU F CB  1 
ATOM   10625 C CG  . LEU F 2 198 ? 60.803  1.931   -16.602 1.00 47.26  ? 198 LEU F CG  1 
ATOM   10626 C CD1 . LEU F 2 198 ? 61.349  3.281   -16.205 1.00 37.04  ? 198 LEU F CD1 1 
ATOM   10627 C CD2 . LEU F 2 198 ? 59.856  2.052   -17.777 1.00 48.22  ? 198 LEU F CD2 1 
ATOM   10628 N N   . SER F 2 199 ? 63.560  -1.844  -17.218 1.00 93.23  ? 199 SER F N   1 
ATOM   10629 C CA  . SER F 2 199 ? 64.696  -2.592  -17.769 1.00 101.70 ? 199 SER F CA  1 
ATOM   10630 C C   . SER F 2 199 ? 64.234  -3.620  -18.793 1.00 103.15 ? 199 SER F C   1 
ATOM   10631 O O   . SER F 2 199 ? 63.132  -3.512  -19.353 1.00 103.15 ? 199 SER F O   1 
ATOM   10632 C CB  . SER F 2 199 ? 65.476  -3.299  -16.635 1.00 78.73  ? 199 SER F CB  1 
ATOM   10633 N N   . ARG F 2 200 ? 65.070  -4.630  -19.025 1.00 103.15 ? 200 ARG F N   1 
ATOM   10634 C CA  . ARG F 2 200 ? 64.746  -5.664  -20.004 1.00 103.15 ? 200 ARG F CA  1 
ATOM   10635 C C   . ARG F 2 200 ? 63.657  -6.644  -19.564 1.00 103.15 ? 200 ARG F C   1 
ATOM   10636 O O   . ARG F 2 200 ? 63.787  -7.335  -18.535 1.00 103.15 ? 200 ARG F O   1 
ATOM   10637 C CB  . ARG F 2 200 ? 65.986  -6.423  -20.361 1.00 67.03  ? 200 ARG F CB  1 
ATOM   10638 N N   . ARG F 2 201 ? 62.593  -6.702  -20.362 1.00 100.69 ? 201 ARG F N   1 
ATOM   10639 C CA  . ARG F 2 201 ? 61.466  -7.600  -20.114 1.00 102.51 ? 201 ARG F CA  1 
ATOM   10640 C C   . ARG F 2 201 ? 60.751  -7.342  -18.782 1.00 103.15 ? 201 ARG F C   1 
ATOM   10641 O O   . ARG F 2 201 ? 59.493  -7.199  -18.825 1.00 103.15 ? 201 ARG F O   1 
ATOM   10642 C CB  . ARG F 2 201 ? 61.933  -9.059  -20.199 1.00 70.84  ? 201 ARG F CB  1 
ATOM   10643 O OXT . ARG F 2 201 ? 61.437  -7.301  -17.716 1.00 103.15 ? 201 ARG F OXT 1 
HETATM 10644 P P   . PO4 G 3 .   ? 1.633   2.820   67.428  1.00 53.43  ? 301 PO4 A P   1 
HETATM 10645 O O1  . PO4 G 3 .   ? 0.469   1.896   67.427  1.00 52.55  ? 301 PO4 A O1  1 
HETATM 10646 O O2  . PO4 G 3 .   ? 1.802   3.400   68.790  1.00 73.69  ? 301 PO4 A O2  1 
HETATM 10647 O O3  . PO4 G 3 .   ? 2.862   2.076   67.051  1.00 70.91  ? 301 PO4 A O3  1 
HETATM 10648 O O4  . PO4 G 3 .   ? 1.400   3.916   66.449  1.00 79.18  ? 301 PO4 A O4  1 
HETATM 10649 P P   . PO4 H 3 .   ? 8.120   -10.250 59.190  1.00 103.15 ? 302 PO4 A P   1 
HETATM 10650 O O1  . PO4 H 3 .   ? 7.255   -11.480 59.203  1.00 81.92  ? 302 PO4 A O1  1 
HETATM 10651 O O2  . PO4 H 3 .   ? 9.092   -10.311 60.337  1.00 102.21 ? 302 PO4 A O2  1 
HETATM 10652 O O3  . PO4 H 3 .   ? 8.872   -10.186 57.904  1.00 93.75  ? 302 PO4 A O3  1 
HETATM 10653 O O4  . PO4 H 3 .   ? 7.259   -9.027  59.332  1.00 94.45  ? 302 PO4 A O4  1 
HETATM 10654 P P   . PO4 I 3 .   ? -42.926 10.734  90.348  1.00 69.74  ? 301 PO4 C P   1 
HETATM 10655 O O1  . PO4 I 3 .   ? -43.689 9.491   90.020  1.00 88.54  ? 301 PO4 C O1  1 
HETATM 10656 O O2  . PO4 I 3 .   ? -43.889 11.868  90.530  1.00 64.76  ? 301 PO4 C O2  1 
HETATM 10657 O O3  . PO4 I 3 .   ? -42.154 10.523  91.607  1.00 62.53  ? 301 PO4 C O3  1 
HETATM 10658 O O4  . PO4 I 3 .   ? -41.987 11.052  89.240  1.00 59.06  ? 301 PO4 C O4  1 
HETATM 10659 P P   . PO4 J 3 .   ? -39.235 4.886   105.906 1.00 77.33  ? 302 PO4 C P   1 
HETATM 10660 O O1  . PO4 J 3 .   ? -39.980 3.622   105.597 1.00 86.69  ? 302 PO4 C O1  1 
HETATM 10661 O O2  . PO4 J 3 .   ? -40.182 5.920   106.415 1.00 62.82  ? 302 PO4 C O2  1 
HETATM 10662 O O3  . PO4 J 3 .   ? -38.196 4.607   106.948 1.00 90.94  ? 302 PO4 C O3  1 
HETATM 10663 O O4  . PO4 J 3 .   ? -38.572 5.382   104.667 1.00 92.87  ? 302 PO4 C O4  1 
HETATM 10664 P P   . PO4 K 3 .   ? -22.679 -1.093  83.077  1.00 93.94  ? 303 PO4 C P   1 
HETATM 10665 O O1  . PO4 K 3 .   ? -23.616 -1.514  81.990  1.00 96.08  ? 303 PO4 C O1  1 
HETATM 10666 O O2  . PO4 K 3 .   ? -22.211 -2.303  83.826  1.00 85.47  ? 303 PO4 C O2  1 
HETATM 10667 O O3  . PO4 K 3 .   ? -21.505 -0.395  82.478  1.00 96.29  ? 303 PO4 C O3  1 
HETATM 10668 O O4  . PO4 K 3 .   ? -23.389 -0.160  84.017  1.00 95.38  ? 303 PO4 C O4  1 
HETATM 10669 P P   . PO4 L 3 .   ? 36.094  9.811   24.187  1.00 80.63  ? 301 PO4 E P   1 
HETATM 10670 O O1  . PO4 L 3 .   ? 35.538  8.562   23.573  1.00 66.80  ? 301 PO4 E O1  1 
HETATM 10671 O O2  . PO4 L 3 .   ? 35.268  10.982  23.771  1.00 103.15 ? 301 PO4 E O2  1 
HETATM 10672 O O3  . PO4 L 3 .   ? 36.065  9.690   25.671  1.00 68.49  ? 301 PO4 E O3  1 
HETATM 10673 O O4  . PO4 L 3 .   ? 37.495  10.013  23.728  1.00 66.65  ? 301 PO4 E O4  1 
HETATM 10674 O O   . HOH M 4 .   ? -2.399  20.826  59.437  1.00 57.86  ? 401 HOH A O   1 
HETATM 10675 O O   . HOH M 4 .   ? 1.091   -1.560  38.999  1.00 58.30  ? 402 HOH A O   1 
HETATM 10676 O O   . HOH M 4 .   ? 19.168  -10.056 51.600  1.00 48.85  ? 403 HOH A O   1 
HETATM 10677 O O   . HOH M 4 .   ? 5.093   18.432  71.199  1.00 60.40  ? 404 HOH A O   1 
HETATM 10678 O O   . HOH M 4 .   ? 3.565   -21.187 52.395  1.00 58.40  ? 405 HOH A O   1 
HETATM 10679 O O   . HOH M 4 .   ? -2.662  -9.735  70.069  1.00 50.63  ? 406 HOH A O   1 
HETATM 10680 O O   . HOH M 4 .   ? 24.797  11.622  51.147  1.00 66.17  ? 407 HOH A O   1 
HETATM 10681 O O   . HOH M 4 .   ? -1.562  -8.293  56.382  1.00 52.21  ? 408 HOH A O   1 
HETATM 10682 O O   . HOH M 4 .   ? 12.855  -20.120 35.473  1.00 70.27  ? 409 HOH A O   1 
HETATM 10683 O O   . HOH M 4 .   ? -6.175  -16.177 49.985  1.00 36.46  ? 410 HOH A O   1 
HETATM 10684 O O   . HOH M 4 .   ? 2.895   -6.182  71.364  1.00 52.90  ? 411 HOH A O   1 
HETATM 10685 O O   . HOH M 4 .   ? 10.953  -20.714 48.057  1.00 36.48  ? 412 HOH A O   1 
HETATM 10686 O O   . HOH M 4 .   ? -13.916 -8.706  69.538  1.00 51.88  ? 413 HOH A O   1 
HETATM 10687 O O   . HOH M 4 .   ? -2.272  7.242   47.874  1.00 54.15  ? 414 HOH A O   1 
HETATM 10688 O O   . HOH M 4 .   ? 0.111   -2.496  60.345  1.00 49.20  ? 415 HOH A O   1 
HETATM 10689 O O   . HOH M 4 .   ? 8.848   2.461   78.242  1.00 72.72  ? 416 HOH A O   1 
HETATM 10690 O O   . HOH M 4 .   ? -4.451  -16.304 55.155  1.00 46.73  ? 417 HOH A O   1 
HETATM 10691 O O   . HOH M 4 .   ? -7.584  9.118   51.121  1.00 45.54  ? 418 HOH A O   1 
HETATM 10692 O O   . HOH M 4 .   ? -0.243  -17.390 52.631  1.00 50.84  ? 419 HOH A O   1 
HETATM 10693 O O   . HOH M 4 .   ? 20.418  11.616  51.101  1.00 53.04  ? 420 HOH A O   1 
HETATM 10694 O O   . HOH M 4 .   ? 6.190   -9.990  56.376  1.00 41.45  ? 421 HOH A O   1 
HETATM 10695 O O   . HOH M 4 .   ? 5.299   4.535   47.608  1.00 41.66  ? 422 HOH A O   1 
HETATM 10696 O O   . HOH M 4 .   ? 7.185   13.785  53.181  1.00 53.39  ? 423 HOH A O   1 
HETATM 10697 O O   . HOH M 4 .   ? 6.830   10.314  69.331  1.00 47.80  ? 424 HOH A O   1 
HETATM 10698 O O   . HOH M 4 .   ? 3.060   5.527   64.984  1.00 46.01  ? 425 HOH A O   1 
HETATM 10699 O O   . HOH M 4 .   ? 9.802   -4.006  42.712  1.00 43.97  ? 426 HOH A O   1 
HETATM 10700 O O   . HOH M 4 .   ? -17.147 -1.540  63.536  1.00 54.10  ? 427 HOH A O   1 
HETATM 10701 O O   . HOH M 4 .   ? 17.112  -0.539  45.701  1.00 50.96  ? 428 HOH A O   1 
HETATM 10702 O O   . HOH M 4 .   ? 8.560   -21.909 43.038  1.00 43.16  ? 429 HOH A O   1 
HETATM 10703 O O   . HOH M 4 .   ? 2.984   -0.680  44.422  1.00 46.39  ? 430 HOH A O   1 
HETATM 10704 O O   . HOH M 4 .   ? 1.409   -15.455 51.293  1.00 37.23  ? 431 HOH A O   1 
HETATM 10705 O O   . HOH M 4 .   ? 2.711   4.367   47.898  1.00 43.57  ? 432 HOH A O   1 
HETATM 10706 O O   . HOH M 4 .   ? 3.333   -18.156 35.758  1.00 39.20  ? 433 HOH A O   1 
HETATM 10707 O O   . HOH M 4 .   ? -4.507  -1.117  64.380  1.00 40.00  ? 434 HOH A O   1 
HETATM 10708 O O   . HOH M 4 .   ? -0.030  -11.163 56.642  1.00 42.05  ? 435 HOH A O   1 
HETATM 10709 O O   . HOH M 4 .   ? -1.579  -2.089  67.323  1.00 52.32  ? 436 HOH A O   1 
HETATM 10710 O O   . HOH M 4 .   ? 24.098  -11.457 56.141  1.00 58.94  ? 437 HOH A O   1 
HETATM 10711 O O   . HOH M 4 .   ? 15.476  -17.884 48.849  1.00 52.74  ? 438 HOH A O   1 
HETATM 10712 O O   . HOH M 4 .   ? -7.046  2.175   71.134  1.00 58.15  ? 439 HOH A O   1 
HETATM 10713 O O   . HOH M 4 .   ? -11.016 -16.759 58.553  1.00 59.11  ? 440 HOH A O   1 
HETATM 10714 O O   . HOH M 4 .   ? 0.973   -16.707 65.521  1.00 71.47  ? 441 HOH A O   1 
HETATM 10715 O O   . HOH M 4 .   ? 15.272  -6.358  58.739  1.00 63.64  ? 442 HOH A O   1 
HETATM 10716 O O   . HOH M 4 .   ? -16.391 5.443   57.205  1.00 57.83  ? 443 HOH A O   1 
HETATM 10717 O O   . HOH M 4 .   ? 17.483  16.673  56.693  1.00 48.31  ? 444 HOH A O   1 
HETATM 10718 O O   . HOH M 4 .   ? -10.468 -12.365 45.725  1.00 46.32  ? 445 HOH A O   1 
HETATM 10719 O O   . HOH M 4 .   ? 1.050   -9.913  33.879  1.00 63.51  ? 446 HOH A O   1 
HETATM 10720 O O   . HOH M 4 .   ? 0.555   -12.703 38.539  1.00 58.76  ? 447 HOH A O   1 
HETATM 10721 O O   . HOH M 4 .   ? 19.844  -8.662  45.215  1.00 56.12  ? 448 HOH A O   1 
HETATM 10722 O O   . HOH M 4 .   ? -18.945 -6.559  52.003  1.00 64.07  ? 449 HOH A O   1 
HETATM 10723 O O   . HOH M 4 .   ? 9.338   -2.169  65.916  1.00 47.81  ? 450 HOH A O   1 
HETATM 10724 O O   . HOH M 4 .   ? -4.926  1.794   62.722  1.00 41.77  ? 451 HOH A O   1 
HETATM 10725 O O   . HOH M 4 .   ? 20.082  -13.244 37.804  1.00 64.77  ? 452 HOH A O   1 
HETATM 10726 O O   . HOH M 4 .   ? 18.261  1.059   40.705  1.00 69.25  ? 453 HOH A O   1 
HETATM 10727 O O   . HOH M 4 .   ? 9.488   -23.033 36.877  1.00 54.19  ? 454 HOH A O   1 
HETATM 10728 O O   . HOH M 4 .   ? 7.912   20.635  62.930  1.00 54.96  ? 455 HOH A O   1 
HETATM 10729 O O   . HOH M 4 .   ? 24.922  7.972   59.306  1.00 67.75  ? 456 HOH A O   1 
HETATM 10730 O O   . HOH M 4 .   ? 1.600   -6.848  38.804  1.00 42.12  ? 457 HOH A O   1 
HETATM 10731 O O   . HOH M 4 .   ? 14.731  -16.115 40.094  1.00 52.69  ? 458 HOH A O   1 
HETATM 10732 O O   . HOH M 4 .   ? 12.659  -18.466 49.052  1.00 43.95  ? 459 HOH A O   1 
HETATM 10733 O O   . HOH M 4 .   ? -13.546 4.983   52.011  1.00 65.22  ? 460 HOH A O   1 
HETATM 10734 O O   . HOH M 4 .   ? 5.548   2.641   53.506  1.00 50.62  ? 461 HOH A O   1 
HETATM 10735 O O   . HOH M 4 .   ? -10.775 -9.839  71.665  1.00 53.99  ? 462 HOH A O   1 
HETATM 10736 O O   . HOH M 4 .   ? 2.742   2.797   63.027  1.00 55.01  ? 463 HOH A O   1 
HETATM 10737 O O   . HOH M 4 .   ? -14.050 -6.847  59.469  1.00 44.36  ? 464 HOH A O   1 
HETATM 10738 O O   . HOH M 4 .   ? 12.635  18.973  62.583  1.00 46.79  ? 465 HOH A O   1 
HETATM 10739 O O   . HOH M 4 .   ? -4.131  1.152   44.227  1.00 50.99  ? 466 HOH A O   1 
HETATM 10740 O O   . HOH M 4 .   ? 1.379   1.693   45.254  1.00 56.05  ? 467 HOH A O   1 
HETATM 10741 O O   . HOH M 4 .   ? 6.032   -13.396 32.095  1.00 47.22  ? 468 HOH A O   1 
HETATM 10742 O O   . HOH M 4 .   ? 5.154   -9.661  34.625  1.00 69.75  ? 469 HOH A O   1 
HETATM 10743 O O   . HOH M 4 .   ? 9.886   -20.585 38.719  1.00 36.69  ? 470 HOH A O   1 
HETATM 10744 O O   . HOH M 4 .   ? -7.305  -9.931  43.938  1.00 58.86  ? 471 HOH A O   1 
HETATM 10745 O O   . HOH M 4 .   ? 5.350   -3.044  32.356  1.00 52.75  ? 472 HOH A O   1 
HETATM 10746 O O   . HOH M 4 .   ? 20.224  -13.680 40.380  1.00 59.89  ? 473 HOH A O   1 
HETATM 10747 O O   . HOH M 4 .   ? 4.432   1.085   30.316  1.00 52.80  ? 474 HOH A O   1 
HETATM 10748 O O   . HOH M 4 .   ? 16.286  5.131   76.852  1.00 67.67  ? 475 HOH A O   1 
HETATM 10749 O O   . HOH M 4 .   ? 9.351   10.524  67.912  1.00 49.92  ? 476 HOH A O   1 
HETATM 10750 O O   . HOH M 4 .   ? -1.071  5.955   73.016  1.00 57.79  ? 477 HOH A O   1 
HETATM 10751 O O   . HOH M 4 .   ? -11.951 -12.960 52.552  1.00 48.72  ? 478 HOH A O   1 
HETATM 10752 O O   . HOH M 4 .   ? -0.689  -8.984  38.312  1.00 58.18  ? 479 HOH A O   1 
HETATM 10753 O O   . HOH M 4 .   ? 26.294  -5.063  47.987  1.00 57.11  ? 480 HOH A O   1 
HETATM 10754 O O   . HOH M 4 .   ? 27.205  -1.333  52.801  1.00 63.73  ? 481 HOH A O   1 
HETATM 10755 O O   . HOH M 4 .   ? -0.219  1.765   37.427  1.00 59.63  ? 482 HOH A O   1 
HETATM 10756 O O   . HOH M 4 .   ? 10.395  -12.660 33.215  1.00 42.13  ? 483 HOH A O   1 
HETATM 10757 O O   . HOH M 4 .   ? 14.635  19.345  60.854  1.00 54.83  ? 484 HOH A O   1 
HETATM 10758 O O   . HOH M 4 .   ? -5.898  -18.135 59.727  1.00 62.16  ? 485 HOH A O   1 
HETATM 10759 O O   . HOH M 4 .   ? -6.889  -14.337 42.201  1.00 45.42  ? 486 HOH A O   1 
HETATM 10760 O O   . HOH M 4 .   ? 3.320   -7.373  34.294  1.00 44.86  ? 487 HOH A O   1 
HETATM 10761 O O   . HOH M 4 .   ? 15.798  -19.731 53.702  1.00 64.84  ? 488 HOH A O   1 
HETATM 10762 O O   . HOH M 4 .   ? 22.678  -15.500 45.738  1.00 56.64  ? 489 HOH A O   1 
HETATM 10763 O O   . HOH M 4 .   ? 9.297   -1.538  74.245  1.00 57.03  ? 490 HOH A O   1 
HETATM 10764 O O   . HOH M 4 .   ? 21.473  -8.189  73.159  1.00 61.99  ? 491 HOH A O   1 
HETATM 10765 O O   . HOH M 4 .   ? 24.497  -14.116 73.160  1.00 59.88  ? 492 HOH A O   1 
HETATM 10766 O O   . HOH M 4 .   ? -6.509  -17.636 62.262  1.00 59.06  ? 493 HOH A O   1 
HETATM 10767 O O   . HOH M 4 .   ? -7.655  8.514   74.203  1.00 60.14  ? 494 HOH A O   1 
HETATM 10768 O O   . HOH M 4 .   ? 3.077   0.369   63.628  1.00 45.66  ? 495 HOH A O   1 
HETATM 10769 O O   . HOH M 4 .   ? 16.623  -3.100  31.793  1.00 61.82  ? 496 HOH A O   1 
HETATM 10770 O O   . HOH M 4 .   ? 1.892   -6.775  66.658  1.00 57.48  ? 497 HOH A O   1 
HETATM 10771 O O   . HOH M 4 .   ? 6.325   8.972   73.409  1.00 56.52  ? 498 HOH A O   1 
HETATM 10772 O O   . HOH M 4 .   ? 0.669   19.554  50.020  1.00 57.54  ? 499 HOH A O   1 
HETATM 10773 O O   . HOH M 4 .   ? 0.748   -6.505  35.131  1.00 57.66  ? 500 HOH A O   1 
HETATM 10774 O O   . HOH M 4 .   ? 3.633   23.370  52.971  1.00 61.17  ? 501 HOH A O   1 
HETATM 10775 O O   . HOH M 4 .   ? -1.134  -7.644  36.204  1.00 69.22  ? 502 HOH A O   1 
HETATM 10776 O O   . HOH M 4 .   ? -13.219 -14.825 58.182  1.00 51.08  ? 503 HOH A O   1 
HETATM 10777 O O   . HOH M 4 .   ? -12.018 -17.397 61.150  1.00 69.33  ? 504 HOH A O   1 
HETATM 10778 O O   . HOH M 4 .   ? 10.513  20.537  62.764  1.00 58.78  ? 505 HOH A O   1 
HETATM 10779 O O   . HOH M 4 .   ? -2.218  2.863   44.167  1.00 55.39  ? 506 HOH A O   1 
HETATM 10780 O O   . HOH M 4 .   ? -16.443 -6.600  50.194  1.00 49.29  ? 507 HOH A O   1 
HETATM 10781 O O   . HOH M 4 .   ? 10.635  -6.083  68.212  1.00 56.48  ? 508 HOH A O   1 
HETATM 10782 O O   . HOH M 4 .   ? 16.663  20.413  55.997  1.00 51.52  ? 509 HOH A O   1 
HETATM 10783 O O   . HOH M 4 .   ? 12.496  -19.238 39.500  1.00 57.60  ? 510 HOH A O   1 
HETATM 10784 O O   . HOH M 4 .   ? 22.658  -16.024 48.008  1.00 60.03  ? 511 HOH A O   1 
HETATM 10785 O O   . HOH M 4 .   ? 17.231  -4.089  76.262  1.00 64.34  ? 512 HOH A O   1 
HETATM 10786 O O   . HOH M 4 .   ? 24.008  -10.717 59.193  1.00 54.40  ? 513 HOH A O   1 
HETATM 10787 O O   . HOH M 4 .   ? 15.712  -6.861  32.031  1.00 57.96  ? 514 HOH A O   1 
HETATM 10788 O O   . HOH M 4 .   ? -15.391 -13.674 56.130  1.00 64.00  ? 515 HOH A O   1 
HETATM 10789 O O   . HOH M 4 .   ? -9.289  -6.635  43.110  1.00 61.15  ? 516 HOH A O   1 
HETATM 10790 O O   . HOH M 4 .   ? 23.091  23.681  58.692  1.00 54.01  ? 517 HOH A O   1 
HETATM 10791 O O   . HOH N 4 .   ? 5.009   20.662  49.800  1.00 54.46  ? 301 HOH B O   1 
HETATM 10792 O O   . HOH N 4 .   ? 21.098  37.105  47.015  1.00 60.50  ? 302 HOH B O   1 
HETATM 10793 O O   . HOH N 4 .   ? 5.019   3.829   32.849  1.00 63.79  ? 303 HOH B O   1 
HETATM 10794 O O   . HOH N 4 .   ? 19.518  28.234  28.492  1.00 56.40  ? 304 HOH B O   1 
HETATM 10795 O O   . HOH N 4 .   ? 13.076  25.309  47.161  1.00 50.89  ? 305 HOH B O   1 
HETATM 10796 O O   . HOH N 4 .   ? 27.055  24.372  32.124  1.00 50.46  ? 306 HOH B O   1 
HETATM 10797 O O   . HOH N 4 .   ? 29.755  10.623  40.894  1.00 58.29  ? 307 HOH B O   1 
HETATM 10798 O O   . HOH N 4 .   ? 11.874  15.607  54.169  1.00 58.00  ? 308 HOH B O   1 
HETATM 10799 O O   . HOH N 4 .   ? 7.626   22.994  52.297  1.00 53.48  ? 309 HOH B O   1 
HETATM 10800 O O   . HOH N 4 .   ? 26.096  30.697  49.147  1.00 55.42  ? 310 HOH B O   1 
HETATM 10801 O O   . HOH N 4 .   ? 17.315  42.135  35.475  1.00 58.13  ? 311 HOH B O   1 
HETATM 10802 O O   . HOH N 4 .   ? 16.839  5.249   25.760  1.00 60.07  ? 312 HOH B O   1 
HETATM 10803 O O   . HOH N 4 .   ? -0.785  31.742  28.092  1.00 77.12  ? 313 HOH B O   1 
HETATM 10804 O O   . HOH N 4 .   ? 7.156   13.386  42.191  1.00 56.73  ? 314 HOH B O   1 
HETATM 10805 O O   . HOH N 4 .   ? 1.043   22.224  39.722  1.00 44.54  ? 315 HOH B O   1 
HETATM 10806 O O   . HOH N 4 .   ? 8.018   34.770  30.859  1.00 66.83  ? 316 HOH B O   1 
HETATM 10807 O O   . HOH N 4 .   ? 15.630  1.660   39.546  1.00 53.27  ? 317 HOH B O   1 
HETATM 10808 O O   . HOH N 4 .   ? 5.686   1.647   42.998  1.00 43.21  ? 318 HOH B O   1 
HETATM 10809 O O   . HOH N 4 .   ? 5.481   15.565  34.073  1.00 51.35  ? 319 HOH B O   1 
HETATM 10810 O O   . HOH N 4 .   ? 19.552  8.227   43.926  1.00 32.60  ? 320 HOH B O   1 
HETATM 10811 O O   . HOH N 4 .   ? 12.222  25.811  43.883  1.00 49.01  ? 321 HOH B O   1 
HETATM 10812 O O   . HOH N 4 .   ? 2.146   20.114  41.989  1.00 44.56  ? 322 HOH B O   1 
HETATM 10813 O O   . HOH N 4 .   ? 7.015   1.965   29.833  1.00 60.29  ? 323 HOH B O   1 
HETATM 10814 O O   . HOH N 4 .   ? 8.737   17.399  50.367  1.00 51.00  ? 324 HOH B O   1 
HETATM 10815 O O   . HOH N 4 .   ? 15.584  0.126   36.222  1.00 56.88  ? 325 HOH B O   1 
HETATM 10816 O O   . HOH N 4 .   ? 1.625   17.719  41.788  1.00 47.92  ? 326 HOH B O   1 
HETATM 10817 O O   . HOH N 4 .   ? 25.397  22.606  52.716  1.00 61.27  ? 327 HOH B O   1 
HETATM 10818 O O   . HOH N 4 .   ? -8.376  5.800   36.662  1.00 59.89  ? 328 HOH B O   1 
HETATM 10819 O O   . HOH N 4 .   ? 21.718  28.933  24.758  1.00 55.38  ? 329 HOH B O   1 
HETATM 10820 O O   . HOH N 4 .   ? 3.145   33.171  30.301  1.00 49.83  ? 330 HOH B O   1 
HETATM 10821 O O   . HOH N 4 .   ? 30.503  15.608  27.830  1.00 60.76  ? 331 HOH B O   1 
HETATM 10822 O O   . HOH N 4 .   ? 18.157  11.592  49.001  1.00 50.76  ? 332 HOH B O   1 
HETATM 10823 O O   . HOH N 4 .   ? 6.317   19.753  18.535  1.00 73.60  ? 333 HOH B O   1 
HETATM 10824 O O   . HOH N 4 .   ? 15.070  0.174   28.084  1.00 53.20  ? 334 HOH B O   1 
HETATM 10825 O O   . HOH N 4 .   ? 20.820  18.117  26.037  1.00 63.61  ? 335 HOH B O   1 
HETATM 10826 O O   . HOH N 4 .   ? 2.838   -1.484  29.957  1.00 57.61  ? 336 HOH B O   1 
HETATM 10827 O O   . HOH N 4 .   ? 13.003  17.730  44.818  1.00 52.16  ? 337 HOH B O   1 
HETATM 10828 O O   . HOH N 4 .   ? 14.496  38.093  32.313  1.00 72.88  ? 338 HOH B O   1 
HETATM 10829 O O   . HOH N 4 .   ? 24.358  17.070  54.041  1.00 64.54  ? 339 HOH B O   1 
HETATM 10830 O O   . HOH N 4 .   ? 6.158   15.704  16.572  1.00 66.41  ? 340 HOH B O   1 
HETATM 10831 O O   . HOH N 4 .   ? 33.152  32.721  39.258  1.00 62.06  ? 341 HOH B O   1 
HETATM 10832 O O   . HOH N 4 .   ? -6.838  19.372  44.661  1.00 60.06  ? 342 HOH B O   1 
HETATM 10833 O O   . HOH N 4 .   ? 5.787   20.521  52.431  1.00 61.93  ? 343 HOH B O   1 
HETATM 10834 O O   . HOH N 4 .   ? 8.032   14.214  48.297  1.00 61.60  ? 344 HOH B O   1 
HETATM 10835 O O   . HOH N 4 .   ? 27.386  20.855  54.730  1.00 61.07  ? 345 HOH B O   1 
HETATM 10836 O O   . HOH N 4 .   ? -6.094  2.198   41.131  1.00 70.01  ? 346 HOH B O   1 
HETATM 10837 O O   . HOH N 4 .   ? 26.764  23.779  54.511  1.00 58.00  ? 347 HOH B O   1 
HETATM 10838 O O   . HOH N 4 .   ? -1.605  0.904   40.042  1.00 68.18  ? 348 HOH B O   1 
HETATM 10839 O O   . HOH N 4 .   ? 23.041  21.707  55.485  1.00 50.38  ? 349 HOH B O   1 
HETATM 10840 O O   . HOH O 4 .   ? -18.700 2.238   83.092  1.00 46.31  ? 401 HOH C O   1 
HETATM 10841 O O   . HOH O 4 .   ? -20.140 -2.772  90.351  1.00 47.95  ? 402 HOH C O   1 
HETATM 10842 O O   . HOH O 4 .   ? -28.368 10.995  96.601  1.00 47.78  ? 403 HOH C O   1 
HETATM 10843 O O   . HOH O 4 .   ? -35.164 3.945   105.404 1.00 54.50  ? 404 HOH C O   1 
HETATM 10844 O O   . HOH O 4 .   ? -42.193 28.143  92.904  1.00 43.23  ? 405 HOH C O   1 
HETATM 10845 O O   . HOH O 4 .   ? -55.814 21.814  105.761 1.00 63.28  ? 406 HOH C O   1 
HETATM 10846 O O   . HOH O 4 .   ? -24.041 12.578  95.492  1.00 42.81  ? 407 HOH C O   1 
HETATM 10847 O O   . HOH O 4 .   ? -25.468 17.733  108.505 1.00 59.67  ? 408 HOH C O   1 
HETATM 10848 O O   . HOH O 4 .   ? -43.232 9.252   105.421 1.00 50.83  ? 409 HOH C O   1 
HETATM 10849 O O   . HOH O 4 .   ? -20.498 0.643   100.244 1.00 48.70  ? 410 HOH C O   1 
HETATM 10850 O O   . HOH O 4 .   ? -41.792 11.346  86.739  1.00 55.42  ? 411 HOH C O   1 
HETATM 10851 O O   . HOH O 4 .   ? -23.965 8.599   77.807  1.00 64.92  ? 412 HOH C O   1 
HETATM 10852 O O   . HOH O 4 .   ? -29.493 2.817   116.173 1.00 59.90  ? 413 HOH C O   1 
HETATM 10853 O O   . HOH O 4 .   ? -24.897 7.863   83.685  1.00 47.01  ? 414 HOH C O   1 
HETATM 10854 O O   . HOH O 4 .   ? -27.213 13.466  118.217 1.00 61.76  ? 415 HOH C O   1 
HETATM 10855 O O   . HOH O 4 .   ? -38.969 29.257  104.515 1.00 54.44  ? 416 HOH C O   1 
HETATM 10856 O O   . HOH O 4 .   ? -26.478 16.351  85.462  1.00 45.75  ? 417 HOH C O   1 
HETATM 10857 O O   . HOH O 4 .   ? -42.365 6.778   104.847 1.00 40.86  ? 418 HOH C O   1 
HETATM 10858 O O   . HOH O 4 .   ? -31.764 -5.059  105.204 1.00 52.32  ? 419 HOH C O   1 
HETATM 10859 O O   . HOH O 4 .   ? -40.624 3.032   90.276  1.00 63.06  ? 420 HOH C O   1 
HETATM 10860 O O   . HOH O 4 .   ? -45.061 23.318  86.409  1.00 51.02  ? 421 HOH C O   1 
HETATM 10861 O O   . HOH O 4 .   ? -25.882 18.374  92.574  1.00 38.25  ? 422 HOH C O   1 
HETATM 10862 O O   . HOH O 4 .   ? -23.071 16.796  91.493  1.00 29.92  ? 423 HOH C O   1 
HETATM 10863 O O   . HOH O 4 .   ? -48.518 26.849  103.346 1.00 56.39  ? 424 HOH C O   1 
HETATM 10864 O O   . HOH O 4 .   ? -46.824 9.217   97.899  1.00 76.10  ? 425 HOH C O   1 
HETATM 10865 O O   . HOH O 4 .   ? -32.463 30.679  78.750  1.00 41.76  ? 426 HOH C O   1 
HETATM 10866 O O   . HOH O 4 .   ? -42.193 18.244  94.348  1.00 45.27  ? 427 HOH C O   1 
HETATM 10867 O O   . HOH O 4 .   ? -38.083 12.508  107.530 1.00 45.48  ? 428 HOH C O   1 
HETATM 10868 O O   . HOH O 4 .   ? -33.188 21.807  115.160 1.00 70.79  ? 429 HOH C O   1 
HETATM 10869 O O   . HOH O 4 .   ? -21.903 9.139   81.277  1.00 44.03  ? 430 HOH C O   1 
HETATM 10870 O O   . HOH O 4 .   ? -40.966 12.640  106.194 1.00 39.24  ? 431 HOH C O   1 
HETATM 10871 O O   . HOH O 4 .   ? -43.440 23.973  107.965 1.00 45.89  ? 432 HOH C O   1 
HETATM 10872 O O   . HOH O 4 .   ? -47.551 16.889  82.173  1.00 62.95  ? 433 HOH C O   1 
HETATM 10873 O O   . HOH O 4 .   ? -24.428 14.757  97.044  1.00 52.92  ? 434 HOH C O   1 
HETATM 10874 O O   . HOH O 4 .   ? -23.313 17.390  103.127 1.00 63.99  ? 435 HOH C O   1 
HETATM 10875 O O   . HOH O 4 .   ? -45.689 24.605  94.218  1.00 39.48  ? 436 HOH C O   1 
HETATM 10876 O O   . HOH O 4 .   ? -40.247 18.584  96.551  1.00 54.85  ? 437 HOH C O   1 
HETATM 10877 O O   . HOH O 4 .   ? -27.065 22.864  75.688  1.00 53.39  ? 438 HOH C O   1 
HETATM 10878 O O   . HOH O 4 .   ? -41.949 19.371  77.012  1.00 46.74  ? 439 HOH C O   1 
HETATM 10879 O O   . HOH O 4 .   ? -34.014 8.902   72.201  1.00 56.27  ? 440 HOH C O   1 
HETATM 10880 O O   . HOH O 4 .   ? -41.587 21.892  88.366  1.00 41.37  ? 441 HOH C O   1 
HETATM 10881 O O   . HOH O 4 .   ? -31.097 18.543  118.954 1.00 62.21  ? 442 HOH C O   1 
HETATM 10882 O O   . HOH O 4 .   ? -36.964 14.820  76.108  1.00 56.77  ? 443 HOH C O   1 
HETATM 10883 O O   . HOH O 4 .   ? -36.156 30.420  98.498  1.00 48.65  ? 444 HOH C O   1 
HETATM 10884 O O   . HOH O 4 .   ? -38.202 -10.334 97.609  1.00 48.07  ? 445 HOH C O   1 
HETATM 10885 O O   . HOH O 4 .   ? -47.540 7.965   86.120  1.00 54.94  ? 446 HOH C O   1 
HETATM 10886 O O   . HOH O 4 .   ? -32.982 11.850  119.854 1.00 53.77  ? 447 HOH C O   1 
HETATM 10887 O O   . HOH O 4 .   ? -32.728 19.304  74.003  1.00 53.03  ? 448 HOH C O   1 
HETATM 10888 O O   . HOH O 4 .   ? -28.676 27.641  101.534 1.00 57.60  ? 449 HOH C O   1 
HETATM 10889 O O   . HOH O 4 .   ? -43.357 4.019   100.877 1.00 59.16  ? 450 HOH C O   1 
HETATM 10890 O O   . HOH O 4 .   ? -46.950 22.461  84.052  1.00 45.01  ? 451 HOH C O   1 
HETATM 10891 O O   . HOH O 4 .   ? -40.625 13.561  90.155  1.00 51.95  ? 452 HOH C O   1 
HETATM 10892 O O   . HOH O 4 .   ? -34.104 8.607   78.481  1.00 60.47  ? 453 HOH C O   1 
HETATM 10893 O O   . HOH O 4 .   ? -18.834 24.024  93.024  1.00 59.53  ? 454 HOH C O   1 
HETATM 10894 O O   . HOH O 4 .   ? -25.892 11.896  101.512 1.00 47.61  ? 455 HOH C O   1 
HETATM 10895 O O   . HOH O 4 .   ? -30.667 9.455   77.326  1.00 48.17  ? 456 HOH C O   1 
HETATM 10896 O O   . HOH O 4 .   ? -25.273 26.505  81.732  1.00 53.49  ? 457 HOH C O   1 
HETATM 10897 O O   . HOH O 4 .   ? -18.291 14.195  81.195  1.00 38.40  ? 458 HOH C O   1 
HETATM 10898 O O   . HOH O 4 .   ? -19.937 11.094  67.404  1.00 62.14  ? 459 HOH C O   1 
HETATM 10899 O O   . HOH O 4 .   ? -35.690 25.599  74.323  1.00 45.17  ? 460 HOH C O   1 
HETATM 10900 O O   . HOH O 4 .   ? -36.105 7.394   79.820  1.00 51.18  ? 461 HOH C O   1 
HETATM 10901 O O   . HOH O 4 .   ? -40.817 16.736  78.132  1.00 44.51  ? 462 HOH C O   1 
HETATM 10902 O O   . HOH O 4 .   ? -27.010 30.579  84.222  1.00 49.18  ? 463 HOH C O   1 
HETATM 10903 O O   . HOH O 4 .   ? -34.723 29.494  96.501  1.00 44.15  ? 464 HOH C O   1 
HETATM 10904 O O   . HOH O 4 .   ? -23.419 26.309  83.581  1.00 55.40  ? 465 HOH C O   1 
HETATM 10905 O O   . HOH O 4 .   ? -20.366 5.639   116.331 1.00 60.88  ? 466 HOH C O   1 
HETATM 10906 O O   . HOH O 4 .   ? -42.359 1.099   85.947  1.00 72.52  ? 467 HOH C O   1 
HETATM 10907 O O   . HOH O 4 .   ? -53.572 15.754  108.560 1.00 57.61  ? 468 HOH C O   1 
HETATM 10908 O O   . HOH O 4 .   ? -38.687 21.811  75.477  1.00 53.47  ? 469 HOH C O   1 
HETATM 10909 O O   . HOH O 4 .   ? -18.568 -1.330  81.366  1.00 51.57  ? 470 HOH C O   1 
HETATM 10910 O O   . HOH O 4 .   ? -24.858 18.684  95.777  1.00 54.58  ? 471 HOH C O   1 
HETATM 10911 O O   . HOH O 4 .   ? -19.423 16.292  71.909  1.00 57.93  ? 472 HOH C O   1 
HETATM 10912 O O   . HOH O 4 .   ? -42.115 29.543  99.765  1.00 67.70  ? 473 HOH C O   1 
HETATM 10913 O O   . HOH O 4 .   ? -40.441 9.081   95.079  1.00 56.26  ? 474 HOH C O   1 
HETATM 10914 O O   . HOH O 4 .   ? -30.875 11.782  71.872  1.00 61.97  ? 475 HOH C O   1 
HETATM 10915 O O   . HOH O 4 .   ? -33.064 6.457   74.426  1.00 67.07  ? 476 HOH C O   1 
HETATM 10916 O O   . HOH O 4 .   ? -32.392 22.121  74.037  1.00 37.76  ? 477 HOH C O   1 
HETATM 10917 O O   . HOH O 4 .   ? -44.186 2.945   85.262  1.00 60.28  ? 478 HOH C O   1 
HETATM 10918 O O   . HOH O 4 .   ? -15.932 8.279   107.249 1.00 72.41  ? 479 HOH C O   1 
HETATM 10919 O O   . HOH O 4 .   ? -50.780 29.021  110.594 1.00 64.16  ? 480 HOH C O   1 
HETATM 10920 O O   . HOH O 4 .   ? -17.790 14.356  107.182 1.00 59.20  ? 481 HOH C O   1 
HETATM 10921 O O   . HOH O 4 .   ? -46.289 -4.397  81.915  1.00 66.23  ? 482 HOH C O   1 
HETATM 10922 O O   . HOH O 4 .   ? -29.218 9.275   74.057  1.00 69.05  ? 483 HOH C O   1 
HETATM 10923 O O   . HOH O 4 .   ? -35.311 -9.135  84.127  1.00 55.64  ? 484 HOH C O   1 
HETATM 10924 O O   . HOH O 4 .   ? -32.049 28.962  95.807  1.00 65.78  ? 485 HOH C O   1 
HETATM 10925 O O   . HOH O 4 .   ? -50.251 18.000  114.766 1.00 57.59  ? 486 HOH C O   1 
HETATM 10926 O O   . HOH O 4 .   ? -23.277 15.415  114.978 1.00 52.96  ? 487 HOH C O   1 
HETATM 10927 O O   . HOH O 4 .   ? -35.174 19.696  72.811  1.00 67.28  ? 488 HOH C O   1 
HETATM 10928 O O   . HOH O 4 .   ? -19.116 2.207   80.179  1.00 52.36  ? 489 HOH C O   1 
HETATM 10929 O O   . HOH O 4 .   ? -44.692 18.892  76.541  1.00 55.92  ? 490 HOH C O   1 
HETATM 10930 O O   . HOH O 4 .   ? -31.202 17.952  72.429  1.00 55.15  ? 491 HOH C O   1 
HETATM 10931 O O   . HOH O 4 .   ? -34.499 7.392   122.057 1.00 56.86  ? 492 HOH C O   1 
HETATM 10932 O O   . HOH O 4 .   ? -35.854 33.976  96.174  1.00 57.55  ? 493 HOH C O   1 
HETATM 10933 O O   . HOH O 4 .   ? -30.349 28.726  88.026  1.00 58.33  ? 494 HOH C O   1 
HETATM 10934 O O   . HOH O 4 .   ? -31.787 24.823  115.706 1.00 65.38  ? 495 HOH C O   1 
HETATM 10935 O O   . HOH O 4 .   ? -20.536 14.086  113.082 1.00 59.96  ? 496 HOH C O   1 
HETATM 10936 O O   . HOH O 4 .   ? -14.462 9.295   109.299 1.00 57.08  ? 497 HOH C O   1 
HETATM 10937 O O   . HOH O 4 .   ? -18.964 20.264  77.719  1.00 59.24  ? 498 HOH C O   1 
HETATM 10938 O O   . HOH P 4 .   ? -8.717  -8.770  73.153  1.00 60.18  ? 301 HOH D O   1 
HETATM 10939 O O   . HOH P 4 .   ? -16.051 3.145   95.188  1.00 53.77  ? 302 HOH D O   1 
HETATM 10940 O O   . HOH P 4 .   ? -9.834  15.268  77.724  1.00 47.95  ? 303 HOH D O   1 
HETATM 10941 O O   . HOH P 4 .   ? -21.308 21.746  83.055  1.00 53.53  ? 304 HOH D O   1 
HETATM 10942 O O   . HOH P 4 .   ? -6.615  12.567  105.025 1.00 53.40  ? 305 HOH D O   1 
HETATM 10943 O O   . HOH P 4 .   ? 4.997   18.210  95.505  1.00 56.42  ? 306 HOH D O   1 
HETATM 10944 O O   . HOH P 4 .   ? -11.301 4.911   108.035 1.00 43.81  ? 307 HOH D O   1 
HETATM 10945 O O   . HOH P 4 .   ? -11.983 -3.218  77.947  1.00 64.61  ? 308 HOH D O   1 
HETATM 10946 O O   . HOH P 4 .   ? -12.094 12.118  75.573  1.00 48.08  ? 309 HOH D O   1 
HETATM 10947 O O   . HOH P 4 .   ? -12.469 -3.327  106.177 1.00 63.24  ? 310 HOH D O   1 
HETATM 10948 O O   . HOH P 4 .   ? -14.574 0.517   95.570  1.00 54.53  ? 311 HOH D O   1 
HETATM 10949 O O   . HOH P 4 .   ? 6.829   3.513   89.744  1.00 60.47  ? 312 HOH D O   1 
HETATM 10950 O O   . HOH P 4 .   ? 10.723  -1.217  101.020 1.00 56.89  ? 313 HOH D O   1 
HETATM 10951 O O   . HOH P 4 .   ? -6.172  -11.988 97.833  1.00 53.25  ? 314 HOH D O   1 
HETATM 10952 O O   . HOH P 4 .   ? -2.657  -12.020 72.958  1.00 59.76  ? 315 HOH D O   1 
HETATM 10953 O O   . HOH P 4 .   ? 8.671   -6.403  104.245 1.00 57.03  ? 316 HOH D O   1 
HETATM 10954 O O   . HOH P 4 .   ? -21.858 -6.914  95.000  1.00 48.84  ? 317 HOH D O   1 
HETATM 10955 O O   . HOH P 4 .   ? 6.504   18.854  102.656 1.00 67.69  ? 318 HOH D O   1 
HETATM 10956 O O   . HOH P 4 .   ? -15.950 -3.631  75.161  1.00 64.89  ? 319 HOH D O   1 
HETATM 10957 O O   . HOH P 4 .   ? 14.167  0.545   85.921  1.00 60.61  ? 320 HOH D O   1 
HETATM 10958 O O   . HOH P 4 .   ? -17.685 22.429  86.040  1.00 50.16  ? 321 HOH D O   1 
HETATM 10959 O O   . HOH P 4 .   ? -19.062 9.626   81.413  1.00 48.80  ? 322 HOH D O   1 
HETATM 10960 O O   . HOH P 4 .   ? -14.668 0.722   84.387  1.00 39.37  ? 323 HOH D O   1 
HETATM 10961 O O   . HOH P 4 .   ? -17.252 3.694   85.691  1.00 40.61  ? 324 HOH D O   1 
HETATM 10962 O O   . HOH P 4 .   ? 13.072  3.959   95.823  1.00 65.18  ? 325 HOH D O   1 
HETATM 10963 O O   . HOH P 4 .   ? -9.704  11.279  104.053 1.00 52.15  ? 326 HOH D O   1 
HETATM 10964 O O   . HOH P 4 .   ? -23.524 17.078  94.626  1.00 57.28  ? 327 HOH D O   1 
HETATM 10965 O O   . HOH P 4 .   ? -10.655 13.135  102.206 1.00 48.14  ? 328 HOH D O   1 
HETATM 10966 O O   . HOH P 4 .   ? 5.452   -3.525  104.474 1.00 59.40  ? 329 HOH D O   1 
HETATM 10967 O O   . HOH P 4 .   ? 7.849   5.512   88.691  1.00 57.19  ? 330 HOH D O   1 
HETATM 10968 O O   . HOH P 4 .   ? -20.677 18.915  98.465  1.00 43.46  ? 331 HOH D O   1 
HETATM 10969 O O   . HOH P 4 .   ? -17.939 -8.877  92.812  1.00 50.42  ? 332 HOH D O   1 
HETATM 10970 O O   . HOH P 4 .   ? 3.856   15.101  85.303  1.00 70.28  ? 333 HOH D O   1 
HETATM 10971 O O   . HOH P 4 .   ? -13.596 26.607  98.779  1.00 57.92  ? 334 HOH D O   1 
HETATM 10972 O O   . HOH P 4 .   ? -16.348 2.852   101.790 1.00 57.85  ? 335 HOH D O   1 
HETATM 10973 O O   . HOH P 4 .   ? -7.527  -1.438  100.145 1.00 43.63  ? 336 HOH D O   1 
HETATM 10974 O O   . HOH P 4 .   ? -0.299  17.987  107.696 1.00 68.27  ? 337 HOH D O   1 
HETATM 10975 O O   . HOH P 4 .   ? -16.158 1.131   86.358  1.00 44.33  ? 338 HOH D O   1 
HETATM 10976 O O   . HOH P 4 .   ? -6.925  16.071  96.538  1.00 47.33  ? 339 HOH D O   1 
HETATM 10977 O O   . HOH P 4 .   ? -19.004 12.149  82.844  1.00 31.52  ? 340 HOH D O   1 
HETATM 10978 O O   . HOH P 4 .   ? -7.671  -10.456 98.959  1.00 48.32  ? 341 HOH D O   1 
HETATM 10979 O O   . HOH P 4 .   ? 8.455   7.769   90.022  1.00 61.37  ? 342 HOH D O   1 
HETATM 10980 O O   . HOH P 4 .   ? -11.029 -10.732 76.899  1.00 64.76  ? 343 HOH D O   1 
HETATM 10981 O O   . HOH P 4 .   ? -2.870  14.375  75.783  1.00 56.09  ? 344 HOH D O   1 
HETATM 10982 O O   . HOH P 4 .   ? -12.279 -3.247  102.797 1.00 51.43  ? 345 HOH D O   1 
HETATM 10983 O O   . HOH P 4 .   ? -8.446  9.488   77.049  1.00 52.49  ? 346 HOH D O   1 
HETATM 10984 O O   . HOH P 4 .   ? -8.897  5.320   77.114  1.00 69.56  ? 347 HOH D O   1 
HETATM 10985 O O   . HOH P 4 .   ? -9.624  29.433  97.318  1.00 45.46  ? 348 HOH D O   1 
HETATM 10986 O O   . HOH P 4 .   ? -5.710  0.337   100.354 1.00 39.30  ? 349 HOH D O   1 
HETATM 10987 O O   . HOH P 4 .   ? -8.387  -12.220 93.964  1.00 59.50  ? 350 HOH D O   1 
HETATM 10988 O O   . HOH P 4 .   ? 6.288   -6.793  101.347 1.00 59.90  ? 351 HOH D O   1 
HETATM 10989 O O   . HOH P 4 .   ? -7.784  6.622   112.932 1.00 64.37  ? 352 HOH D O   1 
HETATM 10990 O O   . HOH P 4 .   ? -3.494  25.376  101.109 1.00 55.44  ? 353 HOH D O   1 
HETATM 10991 O O   . HOH P 4 .   ? -24.540 3.688   76.112  1.00 64.70  ? 354 HOH D O   1 
HETATM 10992 O O   . HOH P 4 .   ? -13.136 0.392   107.156 1.00 61.45  ? 355 HOH D O   1 
HETATM 10993 O O   . HOH P 4 .   ? -5.847  -8.300  105.105 1.00 60.35  ? 356 HOH D O   1 
HETATM 10994 O O   . HOH P 4 .   ? -22.960 17.944  98.336  1.00 50.43  ? 357 HOH D O   1 
HETATM 10995 O O   . HOH P 4 .   ? 0.348   -12.962 104.649 1.00 58.89  ? 358 HOH D O   1 
HETATM 10996 O O   . HOH P 4 .   ? -12.713 19.693  77.856  1.00 62.23  ? 359 HOH D O   1 
HETATM 10997 O O   . HOH P 4 .   ? -14.760 18.935  79.928  1.00 56.24  ? 360 HOH D O   1 
HETATM 10998 O O   . HOH P 4 .   ? -21.825 25.708  103.972 1.00 74.28  ? 361 HOH D O   1 
HETATM 10999 O O   . HOH P 4 .   ? 14.904  -2.413  91.559  1.00 56.67  ? 362 HOH D O   1 
HETATM 11000 O O   . HOH P 4 .   ? -10.038 10.449  100.367 1.00 64.89  ? 363 HOH D O   1 
HETATM 11001 O O   . HOH P 4 .   ? -16.645 -7.183  86.781  1.00 54.55  ? 364 HOH D O   1 
HETATM 11002 O O   . HOH P 4 .   ? 1.229   24.692  91.542  1.00 54.76  ? 365 HOH D O   1 
HETATM 11003 O O   . HOH P 4 .   ? -6.364  16.829  78.310  1.00 64.10  ? 366 HOH D O   1 
HETATM 11004 O O   . HOH P 4 .   ? 1.768   16.542  113.176 1.00 56.89  ? 367 HOH D O   1 
HETATM 11005 O O   . HOH P 4 .   ? -13.808 22.855  86.545  1.00 57.63  ? 368 HOH D O   1 
HETATM 11006 O O   . HOH P 4 .   ? -6.010  4.113   113.018 1.00 59.53  ? 369 HOH D O   1 
HETATM 11007 O O   . HOH P 4 .   ? -18.668 10.130  78.739  1.00 56.32  ? 370 HOH D O   1 
HETATM 11008 O O   . HOH P 4 .   ? 0.440   -8.840  75.311  1.00 78.23  ? 371 HOH D O   1 
HETATM 11009 O O   . HOH P 4 .   ? 1.193   13.067  117.260 1.00 68.18  ? 372 HOH D O   1 
HETATM 11010 O O   . HOH P 4 .   ? -10.203 23.632  87.487  1.00 62.13  ? 373 HOH D O   1 
HETATM 11011 O O   . HOH P 4 .   ? -4.761  6.354   113.066 1.00 53.20  ? 374 HOH D O   1 
HETATM 11012 O O   . HOH P 4 .   ? 6.458   8.851   82.526  1.00 55.26  ? 375 HOH D O   1 
HETATM 11013 O O   . HOH P 4 .   ? -0.776  -0.434  114.493 1.00 61.54  ? 376 HOH D O   1 
HETATM 11014 O O   . HOH P 4 .   ? -10.117 -12.477 82.176  1.00 68.41  ? 377 HOH D O   1 
HETATM 11015 O O   . HOH P 4 .   ? 10.212  9.944   86.054  1.00 63.24  ? 378 HOH D O   1 
HETATM 11016 O O   . HOH P 4 .   ? -15.869 17.338  77.295  1.00 63.30  ? 379 HOH D O   1 
HETATM 11017 O O   . HOH P 4 .   ? -12.402 -12.232 94.491  1.00 67.65  ? 380 HOH D O   1 
HETATM 11018 O O   . HOH P 4 .   ? -6.756  20.112  112.149 1.00 67.43  ? 381 HOH D O   1 
HETATM 11019 O O   . HOH P 4 .   ? 2.910   6.366   77.813  1.00 52.16  ? 382 HOH D O   1 
HETATM 11020 O O   . HOH P 4 .   ? -11.995 -14.728 93.622  1.00 75.26  ? 383 HOH D O   1 
HETATM 11021 O O   . HOH P 4 .   ? -17.577 -10.324 96.970  1.00 56.79  ? 384 HOH D O   1 
HETATM 11022 O O   . HOH Q 4 .   ? 62.829  14.527  33.282  1.00 62.60  ? 401 HOH E O   1 
HETATM 11023 O O   . HOH Q 4 .   ? 57.882  17.936  34.377  1.00 64.24  ? 402 HOH E O   1 
HETATM 11024 O O   . HOH Q 4 .   ? 53.497  28.658  11.580  1.00 63.01  ? 403 HOH E O   1 
HETATM 11025 O O   . HOH Q 4 .   ? 66.931  -3.067  12.188  1.00 48.38  ? 404 HOH E O   1 
HETATM 11026 O O   . HOH Q 4 .   ? 55.277  9.618   -0.339  1.00 55.89  ? 405 HOH E O   1 
HETATM 11027 O O   . HOH Q 4 .   ? 57.539  -1.301  23.559  1.00 64.47  ? 406 HOH E O   1 
HETATM 11028 O O   . HOH Q 4 .   ? 57.665  11.887  8.198   1.00 49.11  ? 407 HOH E O   1 
HETATM 11029 O O   . HOH Q 4 .   ? 53.309  13.729  30.209  1.00 58.52  ? 408 HOH E O   1 
HETATM 11030 O O   . HOH Q 4 .   ? 31.095  7.090   17.693  1.00 92.48  ? 409 HOH E O   1 
HETATM 11031 O O   . HOH Q 4 .   ? 63.072  11.888  6.823   1.00 79.79  ? 410 HOH E O   1 
HETATM 11032 O O   . HOH Q 4 .   ? 44.803  -0.458  9.645   1.00 51.77  ? 411 HOH E O   1 
HETATM 11033 O O   . HOH Q 4 .   ? 56.101  12.046  0.340   1.00 74.22  ? 412 HOH E O   1 
HETATM 11034 O O   . HOH Q 4 .   ? 27.985  6.978   9.452   1.00 61.35  ? 413 HOH E O   1 
HETATM 11035 O O   . HOH Q 4 .   ? 58.173  2.886   15.873  1.00 41.87  ? 414 HOH E O   1 
HETATM 11036 O O   . HOH Q 4 .   ? 44.774  18.912  -0.457  1.00 69.95  ? 415 HOH E O   1 
HETATM 11037 O O   . HOH Q 4 .   ? 47.286  -8.514  20.339  1.00 60.21  ? 416 HOH E O   1 
HETATM 11038 O O   . HOH Q 4 .   ? 47.573  -5.410  9.985   1.00 68.01  ? 417 HOH E O   1 
HETATM 11039 O O   . HOH Q 4 .   ? 61.234  0.024   21.427  1.00 50.86  ? 418 HOH E O   1 
HETATM 11040 O O   . HOH Q 4 .   ? 42.243  14.510  -0.372  1.00 46.97  ? 419 HOH E O   1 
HETATM 11041 O O   . HOH Q 4 .   ? 51.083  26.619  -3.119  1.00 59.18  ? 420 HOH E O   1 
HETATM 11042 O O   . HOH Q 4 .   ? 40.171  26.859  9.132   1.00 59.50  ? 421 HOH E O   1 
HETATM 11043 O O   . HOH Q 4 .   ? 48.827  0.211   8.765   1.00 69.13  ? 422 HOH E O   1 
HETATM 11044 O O   . HOH Q 4 .   ? 54.919  26.710  30.240  1.00 61.39  ? 423 HOH E O   1 
HETATM 11045 O O   . HOH Q 4 .   ? 40.806  4.037   1.912   1.00 57.66  ? 424 HOH E O   1 
HETATM 11046 O O   . HOH Q 4 .   ? 29.279  0.197   22.725  1.00 60.20  ? 425 HOH E O   1 
HETATM 11047 O O   . HOH Q 4 .   ? 31.657  5.923   11.809  1.00 59.78  ? 426 HOH E O   1 
HETATM 11048 O O   . HOH Q 4 .   ? 27.772  19.874  9.539   1.00 63.60  ? 427 HOH E O   1 
HETATM 11049 O O   . HOH Q 4 .   ? 50.360  19.318  24.789  1.00 58.51  ? 428 HOH E O   1 
HETATM 11050 O O   . HOH Q 4 .   ? 61.265  20.460  32.816  1.00 56.27  ? 429 HOH E O   1 
HETATM 11051 O O   . HOH Q 4 .   ? 25.682  8.602   10.721  1.00 83.46  ? 430 HOH E O   1 
HETATM 11052 O O   . HOH Q 4 .   ? 61.798  9.689   5.359   1.00 64.29  ? 431 HOH E O   1 
HETATM 11053 O O   . HOH Q 4 .   ? 32.072  -10.014 20.330  1.00 61.02  ? 432 HOH E O   1 
HETATM 11054 O O   . HOH Q 4 .   ? 63.175  24.408  19.985  1.00 51.91  ? 433 HOH E O   1 
HETATM 11055 O O   . HOH Q 4 .   ? 39.074  18.572  27.010  1.00 68.52  ? 434 HOH E O   1 
HETATM 11056 O O   . HOH Q 4 .   ? 32.612  8.097   12.868  1.00 60.03  ? 435 HOH E O   1 
HETATM 11057 O O   . HOH Q 4 .   ? 60.629  18.275  35.112  1.00 56.95  ? 436 HOH E O   1 
HETATM 11058 O O   . HOH Q 4 .   ? 39.583  11.706  48.990  1.00 67.99  ? 437 HOH E O   1 
HETATM 11059 O O   . HOH Q 4 .   ? 69.020  9.961   28.522  1.00 64.50  ? 438 HOH E O   1 
HETATM 11060 O O   . HOH Q 4 .   ? 63.377  19.654  8.082   1.00 60.79  ? 439 HOH E O   1 
HETATM 11061 O O   . HOH Q 4 .   ? 76.720  11.254  24.579  1.00 73.25  ? 440 HOH E O   1 
HETATM 11062 O O   . HOH R 4 .   ? 59.391  -4.991  -16.306 1.00 66.28  ? 301 HOH F O   1 
HETATM 11063 O O   . HOH R 4 .   ? 65.410  -0.173  -15.827 1.00 54.62  ? 302 HOH F O   1 
HETATM 11064 O O   . HOH R 4 .   ? 57.780  9.607   -9.632  1.00 53.12  ? 303 HOH F O   1 
HETATM 11065 O O   . HOH R 4 .   ? 59.119  11.760  -23.448 1.00 43.66  ? 304 HOH F O   1 
HETATM 11066 O O   . HOH R 4 .   ? 51.566  -5.010  19.620  1.00 62.07  ? 305 HOH F O   1 
HETATM 11067 O O   . HOH R 4 .   ? 44.866  -17.244 -14.480 1.00 51.43  ? 306 HOH F O   1 
HETATM 11068 O O   . HOH R 4 .   ? 54.310  -5.041  7.457   1.00 38.68  ? 307 HOH F O   1 
HETATM 11069 O O   . HOH R 4 .   ? 57.976  -26.370 3.046   1.00 69.93  ? 308 HOH F O   1 
HETATM 11070 O O   . HOH R 4 .   ? 39.241  -3.801  -8.405  1.00 46.60  ? 309 HOH F O   1 
HETATM 11071 O O   . HOH R 4 .   ? 69.331  -2.723  11.268  1.00 58.91  ? 310 HOH F O   1 
HETATM 11072 O O   . HOH R 4 .   ? 59.890  -22.659 -6.589  1.00 67.59  ? 311 HOH F O   1 
HETATM 11073 O O   . HOH R 4 .   ? 49.095  5.321   0.381   1.00 43.61  ? 312 HOH F O   1 
HETATM 11074 O O   . HOH R 4 .   ? 51.385  2.058   -20.031 1.00 66.29  ? 313 HOH F O   1 
HETATM 11075 O O   . HOH R 4 .   ? 45.023  -7.765  -3.212  1.00 45.27  ? 314 HOH F O   1 
HETATM 11076 O O   . HOH R 4 .   ? 48.953  -13.361 9.167   1.00 62.91  ? 315 HOH F O   1 
HETATM 11077 O O   . HOH R 4 .   ? 49.979  -8.442  23.101  1.00 59.82  ? 316 HOH F O   1 
HETATM 11078 O O   . HOH R 4 .   ? 42.564  -8.229  6.548   1.00 48.00  ? 317 HOH F O   1 
HETATM 11079 O O   . HOH R 4 .   ? 61.207  -11.243 16.433  1.00 60.55  ? 318 HOH F O   1 
HETATM 11080 O O   . HOH R 4 .   ? 53.193  0.677   -21.272 1.00 52.69  ? 319 HOH F O   1 
HETATM 11081 O O   . HOH R 4 .   ? 51.155  -16.337 6.764   1.00 46.65  ? 320 HOH F O   1 
HETATM 11082 O O   . HOH R 4 .   ? 55.248  6.247   1.448   1.00 47.19  ? 321 HOH F O   1 
HETATM 11083 O O   . HOH R 4 .   ? 65.419  -19.713 -0.657  1.00 54.69  ? 322 HOH F O   1 
HETATM 11084 O O   . HOH R 4 .   ? 51.429  -10.547 21.831  1.00 49.92  ? 323 HOH F O   1 
HETATM 11085 O O   . HOH R 4 .   ? 64.756  5.198   -6.194  1.00 53.24  ? 324 HOH F O   1 
HETATM 11086 O O   . HOH R 4 .   ? 42.604  -20.944 0.954   1.00 70.90  ? 325 HOH F O   1 
HETATM 11087 O O   . HOH R 4 .   ? 46.937  -10.059 -3.214  1.00 42.34  ? 326 HOH F O   1 
HETATM 11088 O O   . HOH R 4 .   ? 54.787  6.792   -3.144  1.00 44.64  ? 327 HOH F O   1 
HETATM 11089 O O   . HOH R 4 .   ? 41.692  -0.134  -12.560 1.00 60.51  ? 328 HOH F O   1 
HETATM 11090 O O   . HOH R 4 .   ? 68.489  5.722   -7.416  1.00 56.42  ? 329 HOH F O   1 
HETATM 11091 O O   . HOH R 4 .   ? 63.116  -14.597 -23.177 1.00 59.74  ? 330 HOH F O   1 
HETATM 11092 O O   . HOH R 4 .   ? 52.067  -11.517 9.073   1.00 44.17  ? 331 HOH F O   1 
HETATM 11093 O O   . HOH R 4 .   ? 53.767  6.236   -0.599  1.00 50.92  ? 332 HOH F O   1 
HETATM 11094 O O   . HOH R 4 .   ? 61.988  6.620   6.765   1.00 48.38  ? 333 HOH F O   1 
HETATM 11095 O O   . HOH R 4 .   ? 51.120  -20.424 -16.059 1.00 63.39  ? 334 HOH F O   1 
HETATM 11096 O O   . HOH R 4 .   ? 55.283  15.218  -5.821  1.00 55.57  ? 335 HOH F O   1 
HETATM 11097 O O   . HOH R 4 .   ? 54.993  -1.942  18.610  1.00 61.54  ? 336 HOH F O   1 
HETATM 11098 O O   . HOH R 4 .   ? 70.104  -3.597  -9.967  1.00 70.85  ? 337 HOH F O   1 
HETATM 11099 O O   . HOH R 4 .   ? 40.477  1.120   1.293   1.00 70.41  ? 338 HOH F O   1 
HETATM 11100 O O   . HOH R 4 .   ? 47.860  9.070   -5.716  1.00 47.59  ? 339 HOH F O   1 
HETATM 11101 O O   . HOH R 4 .   ? 59.714  -11.549 6.597   1.00 51.78  ? 340 HOH F O   1 
HETATM 11102 O O   . HOH R 4 .   ? 45.232  -12.057 -1.778  1.00 50.14  ? 341 HOH F O   1 
HETATM 11103 O O   . HOH R 4 .   ? 43.974  1.729   -18.576 1.00 56.16  ? 342 HOH F O   1 
HETATM 11104 O O   . HOH R 4 .   ? 67.549  -5.564  -8.644  1.00 57.41  ? 343 HOH F O   1 
HETATM 1110