data_1GQ5
# 
_entry.id   1GQ5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GQ5         
PDBE  EBI-9025     
WWPDB D_1290009025 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1I92 unspecified 'STRUCTURAL BASIS OF THE NHERF PDZ1-CFTR INTERACTION'                     
PDB 1GQ5 unspecified 'STRUCTURAL DETERMINANTS OF THE NHERF INTERACTION WITH BETA2AR AND PDGFR' 
PDB 1G9O unspecified 'FIRST PDZ DOMAIN OF THE HUMAN NA+/H+ EXCHANGER REGULATORY FACTOR'        
PDB 1LWP unspecified 'BETA PLATELET-DERIVED GROWTH FACTOR RECEPTOR'                            
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GQ5 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2001-11-20 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Karthikeyan, S.' 1 
'Leung, T.'       2 
'Ladias, J.A.A.'  3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Structural Determinants of the Na+/H+ Exchanger Regulatory Factor Interaction with the Beta 2 Adrenergic and Platelet-Derived Growth Factor Receptors
;
J.Biol.Chem. 277 18973 ? 2002 JBCHA3 US 0021-9258 0071 ? 11882663 10.1074/JBC.M201507200 
1       
;Structural Basis of the Na+/H+ Exchanger Regulatory Factor Pdz1 Interaction with the Carboxyl-Terminal Region of the Cystic Fibrosis Transmembrabe Conductance Regulator
;
J.Biol.Chem. 276 19683 ? 2001 JBCHA3 US 0021-9258 0071 ? 11304524 10.1074/JBC.C100154200 
2       
;Crystal Structure of the Pdz1 Domain of Human Na+/ H+ Exchanger Regulatory Factor Provides Insights Into the Mechanism of Carboxyl-Terminal Leucine Recognition by Class I Pdz Domains
;
J.Mol.Biol.  308 963   ? 2001 JMOBAK UK 0022-2836 0070 ? 11352585 10.1006/JMBI.2001.4634 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Karthikeyan, S.' 1  
primary 'Leung, T.'       2  
primary 'Ladias, J.A.A.'  3  
1       'Karthikeyan, S.' 4  
1       'Leung, T.'       5  
1       'Ladias, J.A.A.'  6  
2       'Karthikeyan, S.' 7  
2       'Leung, T.'       8  
2       'Birrane, G.'     9  
2       'Webster, G.'     10 
2       'Ladias, J.A.A.'  11 
# 
_cell.entry_id           1GQ5 
_cell.length_a           50.073 
_cell.length_b           50.073 
_cell.length_c           66.680 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GQ5 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'EZRIN-RADIXIN-MOESIN BINDING PHOSPHOPROTEIN-50' 9948.382 1  ? ? 'PDZ1 DOMAIN, RESIDUES 11-94' ? 
2 non-polymer syn 'CHLORIDE ION'                                   35.453   2  ? ? ?                             ? 
3 water       nat water                                            18.015   55 ? ? ?                             ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'NA+/H+ EXCHANGER REGULATORY FACTOR' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GMLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRL
LVVDPEEDSFL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GMLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRL
LVVDPEEDSFL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  MET n 
1 3  LEU n 
1 4  PRO n 
1 5  ARG n 
1 6  LEU n 
1 7  CYS n 
1 8  CYS n 
1 9  LEU n 
1 10 GLU n 
1 11 LYS n 
1 12 GLY n 
1 13 PRO n 
1 14 ASN n 
1 15 GLY n 
1 16 TYR n 
1 17 GLY n 
1 18 PHE n 
1 19 HIS n 
1 20 LEU n 
1 21 HIS n 
1 22 GLY n 
1 23 GLU n 
1 24 LYS n 
1 25 GLY n 
1 26 LYS n 
1 27 LEU n 
1 28 GLY n 
1 29 GLN n 
1 30 TYR n 
1 31 ILE n 
1 32 ARG n 
1 33 LEU n 
1 34 VAL n 
1 35 GLU n 
1 36 PRO n 
1 37 GLY n 
1 38 SER n 
1 39 PRO n 
1 40 ALA n 
1 41 GLU n 
1 42 LYS n 
1 43 ALA n 
1 44 GLY n 
1 45 LEU n 
1 46 LEU n 
1 47 ALA n 
1 48 GLY n 
1 49 ASP n 
1 50 ARG n 
1 51 LEU n 
1 52 VAL n 
1 53 GLU n 
1 54 VAL n 
1 55 ASN n 
1 56 GLY n 
1 57 GLU n 
1 58 ASN n 
1 59 VAL n 
1 60 GLU n 
1 61 LYS n 
1 62 GLU n 
1 63 THR n 
1 64 HIS n 
1 65 GLN n 
1 66 GLN n 
1 67 VAL n 
1 68 VAL n 
1 69 SER n 
1 70 ARG n 
1 71 ILE n 
1 72 ARG n 
1 73 ALA n 
1 74 ALA n 
1 75 LEU n 
1 76 ASN n 
1 77 ALA n 
1 78 VAL n 
1 79 ARG n 
1 80 LEU n 
1 81 LEU n 
1 82 VAL n 
1 83 VAL n 
1 84 ASP n 
1 85 PRO n 
1 86 GLU n 
1 87 GLU n 
1 88 ASP n 
1 89 SER n 
1 90 PHE n 
1 91 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGEX-2T 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 1GQ5   1 ? ? 1GQ5   ? 
2 UNP O14745 1 ? ? O14745 ? 
3 UNP P09619 1 ? ? P09619 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1GQ5 A 1  ? 2  ? 1GQ5   9    ? 10   ? 9  10 
2 2 1GQ5 A 3  ? 86 ? O14745 11   ? 94   ? 11 94 
3 3 1GQ5 A 87 ? 91 ? P09619 1102 ? 1106 ? 95 99 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1GQ5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.41 
_exptl_crystal.density_percent_sol   49.0 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.60 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'SODIUM ACETATE, SODIUM CHLORIDE, pH 4.60' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           115.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU IMAGE PLATE' 
_diffrn_detector.pdbx_collection_date   2001-07-03 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1GQ5 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             26.400 
_reflns.d_resolution_high            2.200 
_reflns.number_obs                   4966 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.1 
_reflns.pdbx_Rmerge_I_obs            0.09000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.8000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.400 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   85.6 
_reflns_shell.Rmerge_I_obs           0.36000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.900 
_reflns_shell.pdbx_redundancy        2.10 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1GQ5 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     4690 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             26.4 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_obs                          0.225 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.222 
_refine.ls_R_factor_R_free                       0.263 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.4 
_refine.ls_number_reflns_R_free                  268 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               33.1 
_refine.aniso_B[1][1]                            1.37 
_refine.aniso_B[2][2]                            1.37 
_refine.aniso_B[3][3]                            -2.05 
_refine.aniso_B[1][2]                            0.68 
_refine.aniso_B[1][3]                            0.0 
_refine.aniso_B[2][3]                            0.0 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1I92' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.325 
_refine.pdbx_overall_ESU_R_Free                  0.234 
_refine.overall_SU_ML                            0.203 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             8.267 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        682 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             55 
_refine_hist.number_atoms_total               739 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        26.4 
# 
_struct.entry_id                  1GQ5 
_struct.title                     'Structural Determinants of the NHERF Interaction with beta2-AR and PDGFR' 
_struct.pdbx_descriptor           'EZRIN-RADIXIN-MOESIN BINDING PHOSPHOPROTEIN-50' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GQ5 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'SIGNALING PROTEIN, PDZ, BETA2-ADRENERGIC RECEPTOR, PDGFR, NHERF, COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 38 ? GLY A 44 ? SER A 46 GLY A 52 1 ? 7  
HELX_P HELX_P2 2 THR A 63 ? ALA A 74 ? THR A 71 ALA A 82 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ARG A 5  ? GLU A 10 ? ARG A 13 GLU A 18 
AA 2 ALA A 77 ? VAL A 83 ? ALA A 85 VAL A 91 
AA 3 ARG A 50 ? VAL A 54 ? ARG A 58 VAL A 62 
AA 4 GLU A 57 ? ASN A 58 ? GLU A 65 ASN A 66 
AB 1 HIS A 19 ? HIS A 21 ? HIS A 27 HIS A 29 
AB 2 TYR A 30 ? ARG A 32 ? TYR A 38 ARG A 40 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 9  ? N LEU A 17 O VAL A 78 ? O VAL A 86 
AA 2 3 N VAL A 83 ? N VAL A 91 O ARG A 50 ? O ARG A 58 
AA 3 4 N VAL A 54 ? N VAL A 62 O GLU A 57 ? O GLU A 65 
AB 1 2 N HIS A 21 ? N HIS A 29 O TYR A 30 ? O TYR A 38 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL A1100' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL A1101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 LEU A 33 ? LEU A 41   . ? 1_555 ? 
2 AC1 4 ALA A 47 ? ALA A 55   . ? 1_555 ? 
3 AC1 4 HOH D .  ? HOH A 2014 . ? 1_555 ? 
4 AC1 4 HOH D .  ? HOH A 2031 . ? 1_555 ? 
5 AC2 4 ARG A 32 ? ARG A 40   . ? 1_555 ? 
6 AC2 4 VAL A 83 ? VAL A 91   . ? 1_555 ? 
7 AC2 4 ASP A 84 ? ASP A 92   . ? 1_555 ? 
8 AC2 4 HOH D .  ? HOH A 2003 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1GQ5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GQ5 
_atom_sites.fract_transf_matrix[1][1]   0.019971 
_atom_sites.fract_transf_matrix[1][2]   0.011530 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.023060 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014997 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . GLY A 1 1  ? -8.479  35.901 17.743  1.00 46.75 ? 9    GLY A N   1 
ATOM   2   C  CA  . GLY A 1 1  ? -8.020  35.835 19.156  1.00 46.27 ? 9    GLY A CA  1 
ATOM   3   C  C   . GLY A 1 1  ? -6.938  34.796 19.136  1.00 45.35 ? 9    GLY A C   1 
ATOM   4   O  O   . GLY A 1 1  ? -5.923  35.043 18.515  1.00 45.46 ? 9    GLY A O   1 
ATOM   5   N  N   . MET A 1 2  ? -7.168  33.649 19.785  1.00 44.46 ? 10   MET A N   1 
ATOM   6   C  CA  . MET A 1 2  ? -6.228  32.531 19.815  1.00 43.42 ? 10   MET A CA  1 
ATOM   7   C  C   . MET A 1 2  ? -6.475  31.580 18.638  1.00 42.07 ? 10   MET A C   1 
ATOM   8   O  O   . MET A 1 2  ? -5.525  31.039 18.048  1.00 42.30 ? 10   MET A O   1 
ATOM   9   C  CB  . MET A 1 2  ? -6.362  31.758 21.131  1.00 43.85 ? 10   MET A CB  1 
ATOM   10  C  CG  . MET A 1 2  ? -5.695  32.370 22.385  1.00 47.82 ? 10   MET A CG  1 
ATOM   11  S  SD  . MET A 1 2  ? -3.884  32.477 22.422  1.00 51.97 ? 10   MET A SD  1 
ATOM   12  C  CE  . MET A 1 2  ? -3.769  34.128 21.637  1.00 51.42 ? 10   MET A CE  1 
ATOM   13  N  N   . LEU A 1 3  ? -7.748  31.360 18.303  1.00 40.08 ? 11   LEU A N   1 
ATOM   14  C  CA  . LEU A 1 3  ? -8.091  30.425 17.240  1.00 38.13 ? 11   LEU A CA  1 
ATOM   15  C  C   . LEU A 1 3  ? -7.588  30.902 15.900  1.00 36.33 ? 11   LEU A C   1 
ATOM   16  O  O   . LEU A 1 3  ? -7.537  32.082 15.639  1.00 35.04 ? 11   LEU A O   1 
ATOM   17  C  CB  . LEU A 1 3  ? -9.603  30.235 17.148  1.00 38.37 ? 11   LEU A CB  1 
ATOM   18  C  CG  . LEU A 1 3  ? -10.243 29.483 18.320  1.00 40.95 ? 11   LEU A CG  1 
ATOM   19  C  CD1 . LEU A 1 3  ? -11.775 29.456 18.170  1.00 40.16 ? 11   LEU A CD1 1 
ATOM   20  C  CD2 . LEU A 1 3  ? -9.650  28.059 18.461  1.00 40.85 ? 11   LEU A CD2 1 
ATOM   21  N  N   . PRO A 1 4  ? -7.217  29.978 15.041  1.00 35.00 ? 12   PRO A N   1 
ATOM   22  C  CA  . PRO A 1 4  ? -6.835  30.351 13.693  1.00 34.70 ? 12   PRO A CA  1 
ATOM   23  C  C   . PRO A 1 4  ? -8.020  31.002 13.040  1.00 34.44 ? 12   PRO A C   1 
ATOM   24  O  O   . PRO A 1 4  ? -9.177  30.669 13.315  1.00 34.43 ? 12   PRO A O   1 
ATOM   25  C  CB  . PRO A 1 4  ? -6.580  29.019 13.035  1.00 34.10 ? 12   PRO A CB  1 
ATOM   26  C  CG  . PRO A 1 4  ? -6.294  28.152 14.098  1.00 33.74 ? 12   PRO A CG  1 
ATOM   27  C  CD  . PRO A 1 4  ? -7.117  28.533 15.254  1.00 34.63 ? 12   PRO A CD  1 
ATOM   28  N  N   . ARG A 1 5  ? -7.708  31.947 12.177  1.00 34.41 ? 13   ARG A N   1 
ATOM   29  C  CA  . ARG A 1 5  ? -8.686  32.658 11.399  1.00 34.55 ? 13   ARG A CA  1 
ATOM   30  C  C   . ARG A 1 5  ? -9.521  31.662 10.585  1.00 33.66 ? 13   ARG A C   1 
ATOM   31  O  O   . ARG A 1 5  ? -8.966  30.746 9.951   1.00 33.63 ? 13   ARG A O   1 
ATOM   32  C  CB  . ARG A 1 5  ? -7.964  33.650 10.478  1.00 34.53 ? 13   ARG A CB  1 
ATOM   33  C  CG  . ARG A 1 5  ? -8.761  34.055 9.242   1.00 38.02 ? 13   ARG A CG  1 
ATOM   34  C  CD  . ARG A 1 5  ? -8.561  35.528 8.707   1.00 45.16 ? 13   ARG A CD  1 
ATOM   35  N  NE  . ARG A 1 5  ? -8.534  36.579 9.722   1.00 47.41 ? 13   ARG A NE  1 
ATOM   36  C  CZ  . ARG A 1 5  ? -8.484  37.899 9.452   1.00 51.99 ? 13   ARG A CZ  1 
ATOM   37  N  NH1 . ARG A 1 5  ? -8.434  38.356 8.193   1.00 50.15 ? 13   ARG A NH1 1 
ATOM   38  N  NH2 . ARG A 1 5  ? -8.476  38.773 10.450  1.00 52.62 ? 13   ARG A NH2 1 
ATOM   39  N  N   . LEU A 1 6  ? -10.846 31.798 10.648  1.00 32.85 ? 14   LEU A N   1 
ATOM   40  C  CA  . LEU A 1 6  ? -11.709 30.954 9.822   1.00 32.15 ? 14   LEU A CA  1 
ATOM   41  C  C   . LEU A 1 6  ? -12.446 31.837 8.823   1.00 32.16 ? 14   LEU A C   1 
ATOM   42  O  O   . LEU A 1 6  ? -13.173 32.779 9.186   1.00 32.67 ? 14   LEU A O   1 
ATOM   43  C  CB  . LEU A 1 6  ? -12.692 30.111 10.642  1.00 32.33 ? 14   LEU A CB  1 
ATOM   44  C  CG  . LEU A 1 6  ? -13.517 29.112 9.812   1.00 31.13 ? 14   LEU A CG  1 
ATOM   45  C  CD1 . LEU A 1 6  ? -12.626 27.945 9.374   1.00 31.63 ? 14   LEU A CD1 1 
ATOM   46  C  CD2 . LEU A 1 6  ? -14.716 28.540 10.556  1.00 29.38 ? 14   LEU A CD2 1 
ATOM   47  N  N   . CYS A 1 7  ? -12.237 31.529 7.557   1.00 31.42 ? 15   CYS A N   1 
ATOM   48  C  CA  . CYS A 1 7  ? -12.760 32.280 6.417   1.00 31.23 ? 15   CYS A CA  1 
ATOM   49  C  C   . CYS A 1 7  ? -13.869 31.493 5.693   1.00 32.10 ? 15   CYS A C   1 
ATOM   50  O  O   . CYS A 1 7  ? -13.626 30.456 5.075   1.00 31.90 ? 15   CYS A O   1 
ATOM   51  C  CB  . CYS A 1 7  ? -11.612 32.581 5.454   1.00 30.30 ? 15   CYS A CB  1 
ATOM   52  S  SG  . CYS A 1 7  ? -10.286 33.677 6.105   1.00 29.62 ? 15   CYS A SG  1 
ATOM   53  N  N   . CYS A 1 8  ? -15.096 31.976 5.812   1.00 32.58 ? 16   CYS A N   1 
ATOM   54  C  CA  . CYS A 1 8  ? -16.243 31.314 5.219   1.00 33.26 ? 16   CYS A CA  1 
ATOM   55  C  C   . CYS A 1 8  ? -16.706 32.076 3.975   1.00 33.76 ? 16   CYS A C   1 
ATOM   56  O  O   . CYS A 1 8  ? -17.307 33.134 4.061   1.00 32.93 ? 16   CYS A O   1 
ATOM   57  C  CB  . CYS A 1 8  ? -17.371 31.221 6.246   1.00 33.87 ? 16   CYS A CB  1 
ATOM   58  S  SG  . CYS A 1 8  ? -16.865 30.419 7.822   1.00 34.61 ? 16   CYS A SG  1 
ATOM   59  N  N   . LEU A 1 9  ? -16.426 31.531 2.809   1.00 33.69 ? 17   LEU A N   1 
ATOM   60  C  CA  . LEU A 1 9  ? -16.802 32.233 1.605   1.00 34.32 ? 17   LEU A CA  1 
ATOM   61  C  C   . LEU A 1 9  ? -17.940 31.596 0.844   1.00 35.78 ? 17   LEU A C   1 
ATOM   62  O  O   . LEU A 1 9  ? -18.079 30.356 0.800   1.00 35.04 ? 17   LEU A O   1 
ATOM   63  C  CB  . LEU A 1 9  ? -15.598 32.452 0.690   1.00 33.63 ? 17   LEU A CB  1 
ATOM   64  C  CG  . LEU A 1 9  ? -14.235 31.779 0.833   1.00 32.31 ? 17   LEU A CG  1 
ATOM   65  C  CD1 . LEU A 1 9  ? -13.337 32.143 -0.333  1.00 32.47 ? 17   LEU A CD1 1 
ATOM   66  C  CD2 . LEU A 1 9  ? -13.568 32.076 2.159   1.00 29.43 ? 17   LEU A CD2 1 
ATOM   67  N  N   . GLU A 1 10 ? -18.797 32.431 0.280   1.00 38.16 ? 18   GLU A N   1 
ATOM   68  C  CA  . GLU A 1 10 ? -19.909 31.976 -0.549  1.00 40.92 ? 18   GLU A CA  1 
ATOM   69  C  C   . GLU A 1 10 ? -19.434 32.054 -1.968  1.00 39.54 ? 18   GLU A C   1 
ATOM   70  O  O   . GLU A 1 10 ? -18.997 33.096 -2.386  1.00 39.73 ? 18   GLU A O   1 
ATOM   71  C  CB  . GLU A 1 10 ? -21.109 32.930 -0.380  1.00 41.52 ? 18   GLU A CB  1 
ATOM   72  C  CG  . GLU A 1 10 ? -21.827 32.719 0.941   1.00 50.14 ? 18   GLU A CG  1 
ATOM   73  C  CD  . GLU A 1 10 ? -23.297 33.098 0.905   1.00 58.61 ? 18   GLU A CD  1 
ATOM   74  O  OE1 . GLU A 1 10 ? -24.042 32.621 0.018   1.00 60.38 ? 18   GLU A OE1 1 
ATOM   75  O  OE2 . GLU A 1 10 ? -23.696 33.900 1.778   1.00 61.03 ? 18   GLU A OE2 1 
ATOM   76  N  N   . LYS A 1 11 ? -19.518 30.971 -2.714  1.00 40.41 ? 19   LYS A N   1 
ATOM   77  C  CA  . LYS A 1 11 ? -19.087 30.998 -4.113  1.00 41.41 ? 19   LYS A CA  1 
ATOM   78  C  C   . LYS A 1 11 ? -19.853 32.026 -4.953  1.00 42.27 ? 19   LYS A C   1 
ATOM   79  O  O   . LYS A 1 11 ? -21.071 31.969 -5.039  1.00 42.43 ? 19   LYS A O   1 
ATOM   80  C  CB  . LYS A 1 11 ? -19.195 29.616 -4.757  1.00 41.22 ? 19   LYS A CB  1 
ATOM   81  C  CG  . LYS A 1 11 ? -18.241 29.411 -5.962  1.00 41.16 ? 19   LYS A CG  1 
ATOM   82  C  CD  . LYS A 1 11 ? -18.197 27.956 -6.384  1.00 41.34 ? 19   LYS A CD  1 
ATOM   83  C  CE  . LYS A 1 11 ? -16.939 27.648 -7.142  1.00 42.69 ? 19   LYS A CE  1 
ATOM   84  N  NZ  . LYS A 1 11 ? -16.580 26.216 -7.166  1.00 40.43 ? 19   LYS A NZ  1 
ATOM   85  N  N   . GLY A 1 12 ? -19.137 32.954 -5.578  1.00 43.04 ? 20   GLY A N   1 
ATOM   86  C  CA  . GLY A 1 12 ? -19.762 33.934 -6.447  1.00 44.21 ? 20   GLY A CA  1 
ATOM   87  C  C   . GLY A 1 12 ? -19.738 33.528 -7.906  1.00 44.92 ? 20   GLY A C   1 
ATOM   88  O  O   . GLY A 1 12 ? -19.211 32.495 -8.259  1.00 45.12 ? 20   GLY A O   1 
ATOM   89  N  N   . PRO A 1 13 ? -20.330 34.350 -8.757  1.00 46.03 ? 21   PRO A N   1 
ATOM   90  C  CA  . PRO A 1 13 ? -20.384 34.073 -10.192 1.00 46.44 ? 21   PRO A CA  1 
ATOM   91  C  C   . PRO A 1 13 ? -19.009 33.792 -10.755 1.00 46.26 ? 21   PRO A C   1 
ATOM   92  O  O   . PRO A 1 13 ? -18.862 32.875 -11.563 1.00 46.14 ? 21   PRO A O   1 
ATOM   93  C  CB  . PRO A 1 13 ? -20.924 35.385 -10.774 1.00 46.03 ? 21   PRO A CB  1 
ATOM   94  C  CG  . PRO A 1 13 ? -21.753 35.932 -9.678  1.00 47.20 ? 21   PRO A CG  1 
ATOM   95  C  CD  . PRO A 1 13 ? -21.022 35.606 -8.410  1.00 46.41 ? 21   PRO A CD  1 
ATOM   96  N  N   . ASN A 1 14 ? -18.018 34.576 -10.338 1.00 45.89 ? 22   ASN A N   1 
ATOM   97  C  CA  . ASN A 1 14 ? -16.660 34.391 -10.853 1.00 45.71 ? 22   ASN A CA  1 
ATOM   98  C  C   . ASN A 1 14 ? -15.763 33.536 -9.953  1.00 43.77 ? 22   ASN A C   1 
ATOM   99  O  O   . ASN A 1 14 ? -14.582 33.812 -9.818  1.00 43.89 ? 22   ASN A O   1 
ATOM   100 C  CB  . ASN A 1 14 ? -15.998 35.754 -11.156 1.00 46.55 ? 22   ASN A CB  1 
ATOM   101 C  CG  . ASN A 1 14 ? -16.764 36.544 -12.211 1.00 49.96 ? 22   ASN A CG  1 
ATOM   102 O  OD1 . ASN A 1 14 ? -17.618 37.488 -11.772 1.00 50.83 ? 22   ASN A OD1 1 
ATOM   103 N  ND2 . ASN A 1 14 ? -16.624 36.276 -13.407 1.00 51.71 ? 22   ASN A ND2 1 
ATOM   104 N  N   . GLY A 1 15 ? -16.319 32.502 -9.341  1.00 41.75 ? 23   GLY A N   1 
ATOM   105 C  CA  . GLY A 1 15 ? -15.527 31.661 -8.462  1.00 39.35 ? 23   GLY A CA  1 
ATOM   106 C  C   . GLY A 1 15 ? -15.337 32.304 -7.104  1.00 37.00 ? 23   GLY A C   1 
ATOM   107 O  O   . GLY A 1 15 ? -16.141 33.142 -6.698  1.00 37.07 ? 23   GLY A O   1 
ATOM   108 N  N   . TYR A 1 16 ? -14.284 31.901 -6.406  1.00 34.60 ? 24   TYR A N   1 
ATOM   109 C  CA  . TYR A 1 16 ? -14.012 32.383 -5.061  1.00 32.83 ? 24   TYR A CA  1 
ATOM   110 C  C   . TYR A 1 16 ? -13.125 33.615 -5.046  1.00 31.65 ? 24   TYR A C   1 
ATOM   111 O  O   . TYR A 1 16 ? -13.222 34.450 -4.137  1.00 31.45 ? 24   TYR A O   1 
ATOM   112 C  CB  . TYR A 1 16 ? -13.383 31.291 -4.196  1.00 32.30 ? 24   TYR A CB  1 
ATOM   113 C  CG  . TYR A 1 16 ? -14.356 30.211 -3.796  1.00 31.18 ? 24   TYR A CG  1 
ATOM   114 C  CD1 . TYR A 1 16 ? -15.468 30.504 -3.033  1.00 32.07 ? 24   TYR A CD1 1 
ATOM   115 C  CD2 . TYR A 1 16 ? -14.164 28.901 -4.193  1.00 31.50 ? 24   TYR A CD2 1 
ATOM   116 C  CE1 . TYR A 1 16 ? -16.364 29.526 -2.678  1.00 31.53 ? 24   TYR A CE1 1 
ATOM   117 C  CE2 . TYR A 1 16 ? -15.042 27.923 -3.859  1.00 30.62 ? 24   TYR A CE2 1 
ATOM   118 C  CZ  . TYR A 1 16 ? -16.150 28.246 -3.086  1.00 30.48 ? 24   TYR A CZ  1 
ATOM   119 O  OH  . TYR A 1 16 ? -17.034 27.291 -2.734  1.00 24.44 ? 24   TYR A OH  1 
ATOM   120 N  N   . GLY A 1 17 ? -12.236 33.690 -6.029  1.00 30.59 ? 25   GLY A N   1 
ATOM   121 C  CA  . GLY A 1 17 ? -11.354 34.824 -6.183  1.00 29.03 ? 25   GLY A CA  1 
ATOM   122 C  C   . GLY A 1 17 ? -9.977  34.736 -5.593  1.00 28.41 ? 25   GLY A C   1 
ATOM   123 O  O   . GLY A 1 17 ? -9.427  35.741 -5.147  1.00 27.91 ? 25   GLY A O   1 
ATOM   124 N  N   . PHE A 1 18 ? -9.372  33.556 -5.614  1.00 27.35 ? 26   PHE A N   1 
ATOM   125 C  CA  . PHE A 1 18 ? -8.037  33.520 -5.102  1.00 26.50 ? 26   PHE A CA  1 
ATOM   126 C  C   . PHE A 1 18 ? -7.271  32.365 -5.684  1.00 25.94 ? 26   PHE A C   1 
ATOM   127 O  O   . PHE A 1 18 ? -7.834  31.428 -6.164  1.00 25.16 ? 26   PHE A O   1 
ATOM   128 C  CB  . PHE A 1 18 ? -8.077  33.449 -3.579  1.00 26.51 ? 26   PHE A CB  1 
ATOM   129 C  CG  . PHE A 1 18 ? -8.539  32.161 -3.076  1.00 24.90 ? 26   PHE A CG  1 
ATOM   130 C  CD1 . PHE A 1 18 ? -9.898  31.924 -2.913  1.00 24.84 ? 26   PHE A CD1 1 
ATOM   131 C  CD2 . PHE A 1 18 ? -7.641  31.148 -2.831  1.00 21.34 ? 26   PHE A CD2 1 
ATOM   132 C  CE1 . PHE A 1 18 ? -10.348 30.713 -2.447  1.00 24.65 ? 26   PHE A CE1 1 
ATOM   133 C  CE2 . PHE A 1 18 ? -8.097  29.913 -2.381  1.00 23.13 ? 26   PHE A CE2 1 
ATOM   134 C  CZ  . PHE A 1 18 ? -9.466  29.686 -2.198  1.00 22.04 ? 26   PHE A CZ  1 
ATOM   135 N  N   . HIS A 1 19 ? -5.960  32.471 -5.676  1.00 25.95 ? 27   HIS A N   1 
ATOM   136 C  CA  . HIS A 1 19 ? -5.145  31.360 -6.113  1.00 26.34 ? 27   HIS A CA  1 
ATOM   137 C  C   . HIS A 1 19 ? -4.610  30.553 -4.889  1.00 25.92 ? 27   HIS A C   1 
ATOM   138 O  O   . HIS A 1 19 ? -4.505  31.086 -3.766  1.00 23.98 ? 27   HIS A O   1 
ATOM   139 C  CB  . HIS A 1 19 ? -3.996  31.850 -6.988  1.00 26.23 ? 27   HIS A CB  1 
ATOM   140 C  CG  . HIS A 1 19 ? -4.416  32.318 -8.351  1.00 26.80 ? 27   HIS A CG  1 
ATOM   141 N  ND1 . HIS A 1 19 ? -3.882  31.791 -9.509  1.00 25.62 ? 27   HIS A ND1 1 
ATOM   142 C  CD2 . HIS A 1 19 ? -5.281  33.287 -8.743  1.00 25.13 ? 27   HIS A CD2 1 
ATOM   143 C  CE1 . HIS A 1 19 ? -4.424  32.385 -10.554 1.00 25.51 ? 27   HIS A CE1 1 
ATOM   144 N  NE2 . HIS A 1 19 ? -5.283  33.291 -10.117 1.00 26.29 ? 27   HIS A NE2 1 
ATOM   145 N  N   . LEU A 1 20 ? -4.327  29.269 -5.149  1.00 26.18 ? 28   LEU A N   1 
ATOM   146 C  CA  . LEU A 1 20 ? -3.732  28.335 -4.220  1.00 27.33 ? 28   LEU A CA  1 
ATOM   147 C  C   . LEU A 1 20 ? -2.488  27.707 -4.879  1.00 27.93 ? 28   LEU A C   1 
ATOM   148 O  O   . LEU A 1 20 ? -2.505  27.314 -6.050  1.00 26.48 ? 28   LEU A O   1 
ATOM   149 C  CB  . LEU A 1 20 ? -4.716  27.250 -3.875  1.00 27.24 ? 28   LEU A CB  1 
ATOM   150 C  CG  . LEU A 1 20 ? -4.304  26.343 -2.716  1.00 29.32 ? 28   LEU A CG  1 
ATOM   151 C  CD1 . LEU A 1 20 ? -4.408  27.089 -1.345  1.00 28.62 ? 28   LEU A CD1 1 
ATOM   152 C  CD2 . LEU A 1 20 ? -5.183  25.099 -2.704  1.00 29.65 ? 28   LEU A CD2 1 
ATOM   153 N  N   . HIS A 1 21 ? -1.411  27.602 -4.123  1.00 29.78 ? 29   HIS A N   1 
ATOM   154 C  CA  . HIS A 1 21 ? -0.159  27.127 -4.698  1.00 32.29 ? 29   HIS A CA  1 
ATOM   155 C  C   . HIS A 1 21 ? 0.792   26.533 -3.674  1.00 33.74 ? 29   HIS A C   1 
ATOM   156 O  O   . HIS A 1 21 ? 0.809   26.908 -2.508  1.00 33.75 ? 29   HIS A O   1 
ATOM   157 C  CB  . HIS A 1 21 ? 0.545   28.270 -5.417  1.00 32.13 ? 29   HIS A CB  1 
ATOM   158 C  CG  . HIS A 1 21 ? 1.286   29.177 -4.496  1.00 32.67 ? 29   HIS A CG  1 
ATOM   159 N  ND1 . HIS A 1 21 ? 2.625   29.013 -4.220  1.00 32.19 ? 29   HIS A ND1 1 
ATOM   160 C  CD2 . HIS A 1 21 ? 0.883   30.259 -3.789  1.00 33.36 ? 29   HIS A CD2 1 
ATOM   161 C  CE1 . HIS A 1 21 ? 3.017   29.951 -3.380  1.00 32.75 ? 29   HIS A CE1 1 
ATOM   162 N  NE2 . HIS A 1 21 ? 1.984   30.729 -3.111  1.00 35.37 ? 29   HIS A NE2 1 
ATOM   163 N  N   . GLY A 1 22 ? 1.584   25.599 -4.139  1.00 36.11 ? 30   GLY A N   1 
ATOM   164 C  CA  . GLY A 1 22 ? 2.521   24.910 -3.307  1.00 40.59 ? 30   GLY A CA  1 
ATOM   165 C  C   . GLY A 1 22 ? 3.876   25.504 -3.554  1.00 44.45 ? 30   GLY A C   1 
ATOM   166 O  O   . GLY A 1 22 ? 3.997   26.607 -4.105  1.00 44.35 ? 30   GLY A O   1 
ATOM   167 N  N   . GLU A 1 23 ? 4.906   24.779 -3.121  1.00 48.21 ? 31   GLU A N   1 
ATOM   168 C  CA  . GLU A 1 23 ? 6.291   25.227 -3.269  1.00 50.71 ? 31   GLU A CA  1 
ATOM   169 C  C   . GLU A 1 23 ? 7.141   23.978 -3.269  1.00 52.71 ? 31   GLU A C   1 
ATOM   170 O  O   . GLU A 1 23 ? 7.051   23.160 -2.342  1.00 53.24 ? 31   GLU A O   1 
ATOM   171 C  CB  . GLU A 1 23 ? 6.686   26.129 -2.121  1.00 50.69 ? 31   GLU A CB  1 
ATOM   172 N  N   . LYS A 1 24 ? 7.932   23.822 -4.332  1.00 54.90 ? 32   LYS A N   1 
ATOM   173 C  CA  . LYS A 1 24 ? 8.858   22.692 -4.507  1.00 55.98 ? 32   LYS A CA  1 
ATOM   174 C  C   . LYS A 1 24 ? 9.558   22.312 -3.206  1.00 56.70 ? 32   LYS A C   1 
ATOM   175 O  O   . LYS A 1 24 ? 10.060  23.178 -2.477  1.00 56.49 ? 32   LYS A O   1 
ATOM   176 C  CB  . LYS A 1 24 ? 9.888   22.990 -5.612  1.00 56.25 ? 32   LYS A CB  1 
ATOM   177 N  N   . GLY A 1 25 ? 9.556   21.007 -2.921  1.00 57.66 ? 33   GLY A N   1 
ATOM   178 C  CA  . GLY A 1 25 ? 10.168  20.466 -1.720  1.00 58.58 ? 33   GLY A CA  1 
ATOM   179 C  C   . GLY A 1 25 ? 9.300   20.675 -0.488  1.00 59.20 ? 33   GLY A C   1 
ATOM   180 O  O   . GLY A 1 25 ? 8.872   19.708 0.153   1.00 59.60 ? 33   GLY A O   1 
ATOM   181 N  N   . LYS A 1 26 ? 9.043   21.945 -0.160  1.00 59.04 ? 34   LYS A N   1 
ATOM   182 C  CA  . LYS A 1 26 ? 8.240   22.306 0.999   1.00 58.22 ? 34   LYS A CA  1 
ATOM   183 C  C   . LYS A 1 26 ? 6.751   22.114 0.723   1.00 56.97 ? 34   LYS A C   1 
ATOM   184 O  O   . LYS A 1 26 ? 6.086   23.022 0.229   1.00 57.53 ? 34   LYS A O   1 
ATOM   185 C  CB  . LYS A 1 26 ? 8.541   23.759 1.411   1.00 58.71 ? 34   LYS A CB  1 
ATOM   186 N  N   . LEU A 1 27 ? 6.248   20.916 1.034   1.00 54.91 ? 35   LEU A N   1 
ATOM   187 C  CA  . LEU A 1 27 ? 4.828   20.557 0.890   1.00 51.77 ? 35   LEU A CA  1 
ATOM   188 C  C   . LEU A 1 27 ? 3.943   21.503 1.718   1.00 48.76 ? 35   LEU A C   1 
ATOM   189 O  O   . LEU A 1 27 ? 4.384   22.035 2.738   1.00 48.66 ? 35   LEU A O   1 
ATOM   190 C  CB  . LEU A 1 27 ? 4.597   19.110 1.314   1.00 52.78 ? 35   LEU A CB  1 
ATOM   191 C  CG  . LEU A 1 27 ? 3.193   18.529 1.077   1.00 52.54 ? 35   LEU A CG  1 
ATOM   192 C  CD1 . LEU A 1 27 ? 3.182   16.991 1.054   1.00 56.10 ? 35   LEU A CD1 1 
ATOM   193 C  CD2 . LEU A 1 27 ? 2.185   19.035 2.098   1.00 54.10 ? 35   LEU A CD2 1 
ATOM   194 N  N   . GLY A 1 28 ? 2.695   21.696 1.293   1.00 45.56 ? 36   GLY A N   1 
ATOM   195 C  CA  . GLY A 1 28 ? 1.829   22.687 1.920   1.00 40.41 ? 36   GLY A CA  1 
ATOM   196 C  C   . GLY A 1 28 ? 1.290   23.647 0.869   1.00 36.89 ? 36   GLY A C   1 
ATOM   197 O  O   . GLY A 1 28 ? 1.925   23.861 -0.148  1.00 34.96 ? 36   GLY A O   1 
ATOM   198 N  N   . GLN A 1 29 ? 0.086   24.166 1.099   1.00 33.80 ? 37   GLN A N   1 
ATOM   199 C  CA  . GLN A 1 29 ? -0.590  25.029 0.134   1.00 31.33 ? 37   GLN A CA  1 
ATOM   200 C  C   . GLN A 1 29 ? -0.777  26.459 0.684   1.00 30.31 ? 37   GLN A C   1 
ATOM   201 O  O   . GLN A 1 29 ? -1.048  26.658 1.869   1.00 30.09 ? 37   GLN A O   1 
ATOM   202 C  CB  . GLN A 1 29 ? -1.928  24.404 -0.289  1.00 30.95 ? 37   GLN A CB  1 
ATOM   203 C  CG  . GLN A 1 29 ? -1.769  23.095 -1.091  1.00 28.63 ? 37   GLN A CG  1 
ATOM   204 C  CD  . GLN A 1 29 ? -1.065  23.309 -2.431  1.00 27.79 ? 37   GLN A CD  1 
ATOM   205 O  OE1 . GLN A 1 29 ? -1.454  24.183 -3.238  1.00 26.60 ? 37   GLN A OE1 1 
ATOM   206 N  NE2 . GLN A 1 29 ? -0.024  22.540 -2.662  1.00 20.87 ? 37   GLN A NE2 1 
ATOM   207 N  N   . TYR A 1 30 ? -0.689  27.442 -0.183  1.00 28.89 ? 38   TYR A N   1 
ATOM   208 C  CA  . TYR A 1 30 ? -0.784  28.779 0.310   1.00 28.74 ? 38   TYR A CA  1 
ATOM   209 C  C   . TYR A 1 30 ? -1.693  29.730 -0.510  1.00 28.22 ? 38   TYR A C   1 
ATOM   210 O  O   . TYR A 1 30 ? -1.835  29.586 -1.730  1.00 28.30 ? 38   TYR A O   1 
ATOM   211 C  CB  . TYR A 1 30 ? 0.637   29.344 0.402   1.00 29.39 ? 38   TYR A CB  1 
ATOM   212 C  CG  . TYR A 1 30 ? 1.600   28.612 1.338   1.00 29.46 ? 38   TYR A CG  1 
ATOM   213 C  CD1 . TYR A 1 30 ? 2.193   27.401 0.978   1.00 30.13 ? 38   TYR A CD1 1 
ATOM   214 C  CD2 . TYR A 1 30 ? 1.935   29.152 2.578   1.00 30.00 ? 38   TYR A CD2 1 
ATOM   215 C  CE1 . TYR A 1 30 ? 3.098   26.768 1.831   1.00 32.08 ? 38   TYR A CE1 1 
ATOM   216 C  CE2 . TYR A 1 30 ? 2.850   28.527 3.437   1.00 29.11 ? 38   TYR A CE2 1 
ATOM   217 C  CZ  . TYR A 1 30 ? 3.412   27.331 3.062   1.00 31.87 ? 38   TYR A CZ  1 
ATOM   218 O  OH  . TYR A 1 30 ? 4.309   26.703 3.897   1.00 33.97 ? 38   TYR A OH  1 
ATOM   219 N  N   . ILE A 1 31 ? -2.305  30.701 0.152   1.00 27.97 ? 39   ILE A N   1 
ATOM   220 C  CA  . ILE A 1 31 ? -3.216  31.561 -0.552  1.00 27.38 ? 39   ILE A CA  1 
ATOM   221 C  C   . ILE A 1 31 ? -2.363  32.523 -1.301  1.00 28.65 ? 39   ILE A C   1 
ATOM   222 O  O   . ILE A 1 31 ? -1.360  32.976 -0.792  1.00 28.25 ? 39   ILE A O   1 
ATOM   223 C  CB  . ILE A 1 31 ? -4.076  32.366 0.375   1.00 27.52 ? 39   ILE A CB  1 
ATOM   224 C  CG1 . ILE A 1 31 ? -4.846  31.495 1.348   1.00 24.70 ? 39   ILE A CG1 1 
ATOM   225 C  CG2 . ILE A 1 31 ? -4.982  33.284 -0.430  1.00 24.76 ? 39   ILE A CG2 1 
ATOM   226 C  CD1 . ILE A 1 31 ? -5.835  30.438 0.672   1.00 23.47 ? 39   ILE A CD1 1 
ATOM   227 N  N   . ARG A 1 32 ? -2.781  32.855 -2.512  1.00 29.67 ? 40   ARG A N   1 
ATOM   228 C  CA  . ARG A 1 32 ? -2.022  33.762 -3.334  1.00 30.05 ? 40   ARG A CA  1 
ATOM   229 C  C   . ARG A 1 32 ? -2.966  34.599 -4.158  1.00 29.82 ? 40   ARG A C   1 
ATOM   230 O  O   . ARG A 1 32 ? -4.019  34.106 -4.510  1.00 29.97 ? 40   ARG A O   1 
ATOM   231 C  CB  . ARG A 1 32 ? -1.106  32.921 -4.217  1.00 30.42 ? 40   ARG A CB  1 
ATOM   232 C  CG  . ARG A 1 32 ? -0.878  33.421 -5.604  1.00 31.91 ? 40   ARG A CG  1 
ATOM   233 C  CD  . ARG A 1 32 ? -0.017  32.487 -6.451  1.00 34.03 ? 40   ARG A CD  1 
ATOM   234 N  NE  . ARG A 1 32 ? 1.399   32.439 -6.063  1.00 35.72 ? 40   ARG A NE  1 
ATOM   235 C  CZ  . ARG A 1 32 ? 2.310   31.657 -6.645  1.00 33.88 ? 40   ARG A CZ  1 
ATOM   236 N  NH1 . ARG A 1 32 ? 1.955   30.834 -7.617  1.00 32.97 ? 40   ARG A NH1 1 
ATOM   237 N  NH2 . ARG A 1 32 ? 3.567   31.707 -6.255  1.00 32.23 ? 40   ARG A NH2 1 
ATOM   238 N  N   . LEU A 1 33 ? -2.619  35.865 -4.445  1.00 29.28 ? 41   LEU A N   1 
ATOM   239 C  CA  . LEU A 1 33 ? -3.453  36.726 -5.304  1.00 28.32 ? 41   LEU A CA  1 
ATOM   240 C  C   . LEU A 1 33 ? -4.930  36.827 -4.935  1.00 27.83 ? 41   LEU A C   1 
ATOM   241 O  O   . LEU A 1 33 ? -5.781  36.328 -5.665  1.00 28.30 ? 41   LEU A O   1 
ATOM   242 C  CB  . LEU A 1 33 ? -3.410  36.204 -6.754  1.00 28.57 ? 41   LEU A CB  1 
ATOM   243 C  CG  . LEU A 1 33 ? -2.033  36.323 -7.403  1.00 29.68 ? 41   LEU A CG  1 
ATOM   244 C  CD1 . LEU A 1 33 ? -1.951  35.430 -8.653  1.00 29.23 ? 41   LEU A CD1 1 
ATOM   245 C  CD2 . LEU A 1 33 ? -1.823  37.772 -7.745  1.00 27.46 ? 41   LEU A CD2 1 
ATOM   246 N  N   . VAL A 1 34 ? -5.269  37.474 -3.840  1.00 27.22 ? 42   VAL A N   1 
ATOM   247 C  CA  . VAL A 1 34 ? -6.693  37.570 -3.497  1.00 27.36 ? 42   VAL A CA  1 
ATOM   248 C  C   . VAL A 1 34 ? -7.302  38.760 -4.240  1.00 27.41 ? 42   VAL A C   1 
ATOM   249 O  O   . VAL A 1 34 ? -6.830  39.864 -4.083  1.00 27.09 ? 42   VAL A O   1 
ATOM   250 C  CB  . VAL A 1 34 ? -6.874  37.782 -1.976  1.00 26.83 ? 42   VAL A CB  1 
ATOM   251 C  CG1 . VAL A 1 34 ? -8.325  38.008 -1.652  1.00 25.79 ? 42   VAL A CG1 1 
ATOM   252 C  CG2 . VAL A 1 34 ? -6.330  36.586 -1.205  1.00 28.63 ? 42   VAL A CG2 1 
ATOM   253 N  N   . GLU A 1 35 ? -8.348  38.528 -5.025  1.00 28.52 ? 43   GLU A N   1 
ATOM   254 C  CA  . GLU A 1 35 ? -8.998  39.550 -5.858  1.00 29.90 ? 43   GLU A CA  1 
ATOM   255 C  C   . GLU A 1 35 ? -9.785  40.529 -5.037  1.00 29.20 ? 43   GLU A C   1 
ATOM   256 O  O   . GLU A 1 35 ? -10.535 40.111 -4.182  1.00 29.85 ? 43   GLU A O   1 
ATOM   257 C  CB  . GLU A 1 35 ? -9.979  38.862 -6.825  1.00 31.43 ? 43   GLU A CB  1 
ATOM   258 C  CG  . GLU A 1 35 ? -10.635 39.719 -7.908  1.00 35.92 ? 43   GLU A CG  1 
ATOM   259 C  CD  . GLU A 1 35 ? -9.618  40.357 -8.849  1.00 41.61 ? 43   GLU A CD  1 
ATOM   260 O  OE1 . GLU A 1 35 ? -8.893  39.603 -9.532  1.00 46.69 ? 43   GLU A OE1 1 
ATOM   261 O  OE2 . GLU A 1 35 ? -9.507  41.609 -8.893  1.00 43.27 ? 43   GLU A OE2 1 
ATOM   262 N  N   . PRO A 1 36 ? -9.608  41.821 -5.256  1.00 28.65 ? 44   PRO A N   1 
ATOM   263 C  CA  . PRO A 1 36 ? -10.459 42.826 -4.606  1.00 29.15 ? 44   PRO A CA  1 
ATOM   264 C  C   . PRO A 1 36 ? -11.948 42.613 -4.865  1.00 29.19 ? 44   PRO A C   1 
ATOM   265 O  O   . PRO A 1 36 ? -12.375 42.436 -6.004  1.00 28.12 ? 44   PRO A O   1 
ATOM   266 C  CB  . PRO A 1 36 ? -10.030 44.122 -5.283  1.00 28.53 ? 44   PRO A CB  1 
ATOM   267 C  CG  . PRO A 1 36 ? -8.578  43.884 -5.619  1.00 27.91 ? 44   PRO A CG  1 
ATOM   268 C  CD  . PRO A 1 36 ? -8.515  42.445 -6.016  1.00 28.77 ? 44   PRO A CD  1 
ATOM   269 N  N   . GLY A 1 37 ? -12.725 42.661 -3.801  1.00 29.65 ? 45   GLY A N   1 
ATOM   270 C  CA  . GLY A 1 37 ? -14.167 42.666 -3.950  1.00 31.51 ? 45   GLY A CA  1 
ATOM   271 C  C   . GLY A 1 37 ? -14.758 41.288 -4.120  1.00 32.53 ? 45   GLY A C   1 
ATOM   272 O  O   . GLY A 1 37 ? -15.942 41.157 -4.370  1.00 33.77 ? 45   GLY A O   1 
ATOM   273 N  N   . SER A 1 38 ? -13.933 40.260 -3.961  1.00 32.82 ? 46   SER A N   1 
ATOM   274 C  CA  . SER A 1 38 ? -14.388 38.900 -4.107  1.00 32.14 ? 46   SER A CA  1 
ATOM   275 C  C   . SER A 1 38 ? -14.749 38.305 -2.772  1.00 31.53 ? 46   SER A C   1 
ATOM   276 O  O   . SER A 1 38 ? -14.429 38.829 -1.712  1.00 32.22 ? 46   SER A O   1 
ATOM   277 C  CB  . SER A 1 38 ? -13.270 38.064 -4.674  1.00 31.66 ? 46   SER A CB  1 
ATOM   278 O  OG  . SER A 1 38 ? -12.264 38.001 -3.696  1.00 33.27 ? 46   SER A OG  1 
ATOM   279 N  N   . PRO A 1 39 ? -15.441 37.189 -2.825  1.00 31.26 ? 47   PRO A N   1 
ATOM   280 C  CA  . PRO A 1 39 ? -15.770 36.483 -1.597  1.00 30.66 ? 47   PRO A CA  1 
ATOM   281 C  C   . PRO A 1 39 ? -14.516 36.281 -0.795  1.00 30.03 ? 47   PRO A C   1 
ATOM   282 O  O   . PRO A 1 39 ? -14.504 36.617 0.367   1.00 30.35 ? 47   PRO A O   1 
ATOM   283 C  CB  . PRO A 1 39 ? -16.379 35.163 -2.102  1.00 31.01 ? 47   PRO A CB  1 
ATOM   284 C  CG  . PRO A 1 39 ? -16.972 35.510 -3.471  1.00 30.01 ? 47   PRO A CG  1 
ATOM   285 C  CD  . PRO A 1 39 ? -16.020 36.548 -4.034  1.00 30.94 ? 47   PRO A CD  1 
ATOM   286 N  N   . ALA A 1 40 ? -13.457 35.789 -1.409  1.00 29.78 ? 48   ALA A N   1 
ATOM   287 C  CA  . ALA A 1 40 ? -12.226 35.607 -0.684  1.00 29.86 ? 48   ALA A CA  1 
ATOM   288 C  C   . ALA A 1 40 ? -11.850 36.851 0.110   1.00 30.34 ? 48   ALA A C   1 
ATOM   289 O  O   . ALA A 1 40 ? -11.577 36.773 1.311   1.00 29.97 ? 48   ALA A O   1 
ATOM   290 C  CB  . ALA A 1 40 ? -11.096 35.216 -1.605  1.00 29.40 ? 48   ALA A CB  1 
ATOM   291 N  N   . GLU A 1 41 ? -11.811 37.998 -0.544  1.00 30.44 ? 49   GLU A N   1 
ATOM   292 C  CA  . GLU A 1 41 ? -11.407 39.174 0.189   1.00 31.76 ? 49   GLU A CA  1 
ATOM   293 C  C   . GLU A 1 41 ? -12.457 39.505 1.254   1.00 32.54 ? 49   GLU A C   1 
ATOM   294 O  O   . GLU A 1 41 ? -12.113 39.880 2.374   1.00 31.67 ? 49   GLU A O   1 
ATOM   295 C  CB  . GLU A 1 41 ? -11.147 40.366 -0.731  1.00 31.17 ? 49   GLU A CB  1 
ATOM   296 C  CG  . GLU A 1 41 ? -10.831 41.624 0.067   1.00 33.78 ? 49   GLU A CG  1 
ATOM   297 C  CD  . GLU A 1 41 ? -10.645 42.824 -0.813  1.00 35.37 ? 49   GLU A CD  1 
ATOM   298 O  OE1 . GLU A 1 41 ? -11.638 43.301 -1.392  1.00 36.37 ? 49   GLU A OE1 1 
ATOM   299 O  OE2 . GLU A 1 41 ? -9.491  43.258 -0.951  1.00 38.37 ? 49   GLU A OE2 1 
ATOM   300 N  N   . LYS A 1 42 ? -13.735 39.322 0.931   1.00 33.19 ? 50   LYS A N   1 
ATOM   301 C  CA  . LYS A 1 42 ? -14.773 39.646 1.910   1.00 34.48 ? 50   LYS A CA  1 
ATOM   302 C  C   . LYS A 1 42 ? -14.735 38.736 3.128   1.00 34.46 ? 50   LYS A C   1 
ATOM   303 O  O   . LYS A 1 42 ? -15.169 39.104 4.218   1.00 33.09 ? 50   LYS A O   1 
ATOM   304 C  CB  . LYS A 1 42 ? -16.162 39.516 1.290   1.00 34.59 ? 50   LYS A CB  1 
ATOM   305 C  CG  . LYS A 1 42 ? -16.657 40.801 0.689   1.00 38.88 ? 50   LYS A CG  1 
ATOM   306 C  CD  . LYS A 1 42 ? -16.585 40.740 -0.827  1.00 45.09 ? 50   LYS A CD  1 
ATOM   307 C  CE  . LYS A 1 42 ? -17.608 41.714 -1.455  1.00 48.23 ? 50   LYS A CE  1 
ATOM   308 N  NZ  . LYS A 1 42 ? -19.027 41.212 -1.303  1.00 49.37 ? 50   LYS A NZ  1 
ATOM   309 N  N   . ALA A 1 43 ? -14.233 37.520 2.936   1.00 34.66 ? 51   ALA A N   1 
ATOM   310 C  CA  . ALA A 1 43 ? -14.230 36.565 4.047   1.00 33.88 ? 51   ALA A CA  1 
ATOM   311 C  C   . ALA A 1 43 ? -12.989 36.688 4.903   1.00 33.48 ? 51   ALA A C   1 
ATOM   312 O  O   . ALA A 1 43 ? -12.869 35.995 5.917   1.00 33.92 ? 51   ALA A O   1 
ATOM   313 C  CB  . ALA A 1 43 ? -14.374 35.164 3.534   1.00 33.51 ? 51   ALA A CB  1 
ATOM   314 N  N   . GLY A 1 44 ? -12.064 37.558 4.497   1.00 33.06 ? 52   GLY A N   1 
ATOM   315 C  CA  . GLY A 1 44 ? -10.831 37.763 5.255   1.00 32.32 ? 52   GLY A CA  1 
ATOM   316 C  C   . GLY A 1 44 ? -9.551  37.070 4.796   1.00 32.40 ? 52   GLY A C   1 
ATOM   317 O  O   . GLY A 1 44 ? -8.540  37.168 5.493   1.00 33.04 ? 52   GLY A O   1 
ATOM   318 N  N   . LEU A 1 45 ? -9.561  36.371 3.655   1.00 32.00 ? 53   LEU A N   1 
ATOM   319 C  CA  . LEU A 1 45 ? -8.337  35.701 3.151   1.00 31.02 ? 53   LEU A CA  1 
ATOM   320 C  C   . LEU A 1 45 ? -7.229  36.725 2.805   1.00 29.95 ? 53   LEU A C   1 
ATOM   321 O  O   . LEU A 1 45 ? -7.545  37.830 2.393   1.00 31.15 ? 53   LEU A O   1 
ATOM   322 C  CB  . LEU A 1 45 ? -8.628  34.922 1.871   1.00 30.41 ? 53   LEU A CB  1 
ATOM   323 C  CG  . LEU A 1 45 ? -8.983  33.448 1.904   1.00 33.58 ? 53   LEU A CG  1 
ATOM   324 C  CD1 . LEU A 1 45 ? -8.867  32.829 0.500   1.00 31.05 ? 53   LEU A CD1 1 
ATOM   325 C  CD2 . LEU A 1 45 ? -8.158  32.627 2.897   1.00 29.97 ? 53   LEU A CD2 1 
ATOM   326 N  N   . LEU A 1 46 ? -5.965  36.324 2.907   1.00 29.49 ? 54   LEU A N   1 
ATOM   327 C  CA  . LEU A 1 46 ? -4.813  37.179 2.572   1.00 29.05 ? 54   LEU A CA  1 
ATOM   328 C  C   . LEU A 1 46 ? -3.726  36.355 1.890   1.00 29.23 ? 54   LEU A C   1 
ATOM   329 O  O   . LEU A 1 46 ? -3.428  35.239 2.357   1.00 29.08 ? 54   LEU A O   1 
ATOM   330 C  CB  . LEU A 1 46 ? -4.237  37.779 3.846   1.00 27.74 ? 54   LEU A CB  1 
ATOM   331 C  CG  . LEU A 1 46 ? -5.294  38.568 4.606   1.00 28.85 ? 54   LEU A CG  1 
ATOM   332 C  CD1 . LEU A 1 46 ? -4.895  38.846 6.051   1.00 31.61 ? 54   LEU A CD1 1 
ATOM   333 C  CD2 . LEU A 1 46 ? -5.651  39.833 3.889   1.00 30.09 ? 54   LEU A CD2 1 
ATOM   334 N  N   . ALA A 1 47 ? -3.192  36.822 0.762   1.00 28.82 ? 55   ALA A N   1 
ATOM   335 C  CA  . ALA A 1 47 ? -2.096  36.096 0.139   1.00 29.26 ? 55   ALA A CA  1 
ATOM   336 C  C   . ALA A 1 47 ? -1.055  35.953 1.253   1.00 28.97 ? 55   ALA A C   1 
ATOM   337 O  O   . ALA A 1 47 ? -0.997  36.784 2.120   1.00 30.95 ? 55   ALA A O   1 
ATOM   338 C  CB  . ALA A 1 47 ? -1.546  36.854 -1.064  1.00 28.26 ? 55   ALA A CB  1 
ATOM   339 N  N   . GLY A 1 48 ? -0.255  34.898 1.273   1.00 28.88 ? 56   GLY A N   1 
ATOM   340 C  CA  . GLY A 1 48 ? 0.642   34.683 2.396   1.00 29.53 ? 56   GLY A CA  1 
ATOM   341 C  C   . GLY A 1 48 ? 0.042   33.647 3.364   1.00 29.29 ? 56   GLY A C   1 
ATOM   342 O  O   . GLY A 1 48 ? 0.756   32.895 3.996   1.00 29.39 ? 56   GLY A O   1 
ATOM   343 N  N   . ASP A 1 49 ? -1.275  33.588 3.486   1.00 28.89 ? 57   ASP A N   1 
ATOM   344 C  CA  . ASP A 1 49 ? -1.873  32.599 4.407   1.00 28.61 ? 57   ASP A CA  1 
ATOM   345 C  C   . ASP A 1 49 ? -1.576  31.155 4.034   1.00 27.36 ? 57   ASP A C   1 
ATOM   346 O  O   . ASP A 1 49 ? -1.553  30.807 2.860   1.00 27.03 ? 57   ASP A O   1 
ATOM   347 C  CB  . ASP A 1 49 ? -3.389  32.741 4.459   1.00 28.92 ? 57   ASP A CB  1 
ATOM   348 C  CG  . ASP A 1 49 ? -3.848  33.928 5.272   1.00 29.88 ? 57   ASP A CG  1 
ATOM   349 O  OD1 . ASP A 1 49 ? -3.003  34.550 5.921   1.00 27.42 ? 57   ASP A OD1 1 
ATOM   350 O  OD2 . ASP A 1 49 ? -5.045  34.301 5.311   1.00 33.65 ? 57   ASP A OD2 1 
ATOM   351 N  N   . ARG A 1 50 ? -1.336  30.307 5.037   1.00 26.71 ? 58   ARG A N   1 
ATOM   352 C  CA  . ARG A 1 50 ? -1.184  28.866 4.764   1.00 26.30 ? 58   ARG A CA  1 
ATOM   353 C  C   . ARG A 1 50 ? -2.541  28.202 5.027   1.00 25.14 ? 58   ARG A C   1 
ATOM   354 O  O   . ARG A 1 50 ? -3.246  28.589 5.952   1.00 25.05 ? 58   ARG A O   1 
ATOM   355 C  CB  . ARG A 1 50 ? -0.083  28.242 5.625   1.00 25.95 ? 58   ARG A CB  1 
ATOM   356 C  CG  . ARG A 1 50 ? 0.051   26.729 5.463   1.00 29.25 ? 58   ARG A CG  1 
ATOM   357 C  CD  . ARG A 1 50 ? 1.225   26.113 6.239   1.00 32.58 ? 58   ARG A CD  1 
ATOM   358 N  NE  . ARG A 1 50 ? 1.414   24.756 5.757   1.00 38.46 ? 58   ARG A NE  1 
ATOM   359 C  CZ  . ARG A 1 50 ? 2.392   23.932 6.130   1.00 42.75 ? 58   ARG A CZ  1 
ATOM   360 N  NH1 . ARG A 1 50 ? 3.311   24.346 7.008   1.00 45.00 ? 58   ARG A NH1 1 
ATOM   361 N  NH2 . ARG A 1 50 ? 2.436   22.685 5.640   1.00 39.57 ? 58   ARG A NH2 1 
ATOM   362 N  N   . LEU A 1 51 ? -2.929  27.255 4.194   1.00 24.77 ? 59   LEU A N   1 
ATOM   363 C  CA  . LEU A 1 51 ? -4.273  26.643 4.286   1.00 23.35 ? 59   LEU A CA  1 
ATOM   364 C  C   . LEU A 1 51 ? -4.164  25.381 5.129   1.00 23.11 ? 59   LEU A C   1 
ATOM   365 O  O   . LEU A 1 51 ? -3.428  24.485 4.772   1.00 23.59 ? 59   LEU A O   1 
ATOM   366 C  CB  . LEU A 1 51 ? -4.787  26.291 2.872   1.00 22.63 ? 59   LEU A CB  1 
ATOM   367 C  CG  . LEU A 1 51 ? -6.179  25.676 2.713   1.00 21.00 ? 59   LEU A CG  1 
ATOM   368 C  CD1 . LEU A 1 51 ? -7.280  26.570 3.436   1.00 18.11 ? 59   LEU A CD1 1 
ATOM   369 C  CD2 . LEU A 1 51 ? -6.513  25.514 1.251   1.00 23.19 ? 59   LEU A CD2 1 
ATOM   370 N  N   . VAL A 1 52 ? -4.849  25.316 6.258   1.00 22.82 ? 60   VAL A N   1 
ATOM   371 C  CA  . VAL A 1 52 ? -4.766  24.140 7.127   1.00 21.56 ? 60   VAL A CA  1 
ATOM   372 C  C   . VAL A 1 52 ? -5.978  23.206 6.977   1.00 21.67 ? 60   VAL A C   1 
ATOM   373 O  O   . VAL A 1 52 ? -5.858  21.969 7.065   1.00 20.66 ? 60   VAL A O   1 
ATOM   374 C  CB  . VAL A 1 52 ? -4.654  24.576 8.605   1.00 21.78 ? 60   VAL A CB  1 
ATOM   375 C  CG1 . VAL A 1 52 ? -4.706  23.391 9.536   1.00 21.14 ? 60   VAL A CG1 1 
ATOM   376 C  CG2 . VAL A 1 52 ? -3.381  25.386 8.824   1.00 22.28 ? 60   VAL A CG2 1 
ATOM   377 N  N   . GLU A 1 53 ? -7.154  23.788 6.807   1.00 21.48 ? 61   GLU A N   1 
ATOM   378 C  CA  . GLU A 1 53 ? -8.343  22.976 6.656   1.00 22.10 ? 61   GLU A CA  1 
ATOM   379 C  C   . GLU A 1 53 ? -9.269  23.541 5.642   1.00 21.65 ? 61   GLU A C   1 
ATOM   380 O  O   . GLU A 1 53 ? -9.394  24.756 5.513   1.00 20.63 ? 61   GLU A O   1 
ATOM   381 C  CB  . GLU A 1 53 ? -9.107  22.831 7.988   1.00 23.46 ? 61   GLU A CB  1 
ATOM   382 C  CG  . GLU A 1 53 ? -8.411  21.896 8.966   1.00 25.45 ? 61   GLU A CG  1 
ATOM   383 C  CD  . GLU A 1 53 ? -9.184  21.522 10.230  1.00 30.52 ? 61   GLU A CD  1 
ATOM   384 O  OE1 . GLU A 1 53 ? -10.431 21.688 10.290  1.00 27.95 ? 61   GLU A OE1 1 
ATOM   385 O  OE2 . GLU A 1 53 ? -8.514  21.036 11.182  1.00 30.07 ? 61   GLU A OE2 1 
ATOM   386 N  N   . VAL A 1 54 ? -9.929  22.647 4.925   1.00 21.05 ? 62   VAL A N   1 
ATOM   387 C  CA  . VAL A 1 54 ? -10.995 23.036 4.027   1.00 22.37 ? 62   VAL A CA  1 
ATOM   388 C  C   . VAL A 1 54 ? -12.235 22.295 4.504   1.00 23.21 ? 62   VAL A C   1 
ATOM   389 O  O   . VAL A 1 54 ? -12.221 21.077 4.616   1.00 24.07 ? 62   VAL A O   1 
ATOM   390 C  CB  . VAL A 1 54 ? -10.679 22.614 2.573   1.00 23.07 ? 62   VAL A CB  1 
ATOM   391 C  CG1 . VAL A 1 54 ? -11.882 22.833 1.670   1.00 20.72 ? 62   VAL A CG1 1 
ATOM   392 C  CG2 . VAL A 1 54 ? -9.461  23.337 2.050   1.00 22.91 ? 62   VAL A CG2 1 
ATOM   393 N  N   . ASN A 1 55 ? -13.290 23.011 4.836   1.00 24.10 ? 63   ASN A N   1 
ATOM   394 C  CA  . ASN A 1 55 ? -14.503 22.361 5.347   1.00 25.44 ? 63   ASN A CA  1 
ATOM   395 C  C   . ASN A 1 55 ? -14.321 21.304 6.450   1.00 26.22 ? 63   ASN A C   1 
ATOM   396 O  O   . ASN A 1 55 ? -14.972 20.248 6.413   1.00 25.98 ? 63   ASN A O   1 
ATOM   397 C  CB  . ASN A 1 55 ? -15.328 21.770 4.190   1.00 25.82 ? 63   ASN A CB  1 
ATOM   398 C  CG  . ASN A 1 55 ? -15.792 22.837 3.207   1.00 26.92 ? 63   ASN A CG  1 
ATOM   399 O  OD1 . ASN A 1 55 ? -16.009 23.985 3.586   1.00 27.57 ? 63   ASN A OD1 1 
ATOM   400 N  ND2 . ASN A 1 55 ? -15.879 22.475 1.933   1.00 29.74 ? 63   ASN A ND2 1 
ATOM   401 N  N   . GLY A 1 56 ? -13.431 21.564 7.415   1.00 26.91 ? 64   GLY A N   1 
ATOM   402 C  CA  . GLY A 1 56 ? -13.298 20.702 8.579   1.00 27.86 ? 64   GLY A CA  1 
ATOM   403 C  C   . GLY A 1 56 ? -12.401 19.494 8.335   1.00 28.78 ? 64   GLY A C   1 
ATOM   404 O  O   . GLY A 1 56 ? -12.357 18.546 9.131   1.00 29.14 ? 64   GLY A O   1 
ATOM   405 N  N   . GLU A 1 57 ? -11.711 19.497 7.205   1.00 28.00 ? 65   GLU A N   1 
ATOM   406 C  CA  . GLU A 1 57 ? -10.785 18.401 6.924   1.00 28.19 ? 65   GLU A CA  1 
ATOM   407 C  C   . GLU A 1 57 ? -9.331  18.939 6.838   1.00 28.39 ? 65   GLU A C   1 
ATOM   408 O  O   . GLU A 1 57 ? -9.061  19.961 6.222   1.00 29.03 ? 65   GLU A O   1 
ATOM   409 C  CB  . GLU A 1 57 ? -11.219 17.657 5.671   1.00 27.68 ? 65   GLU A CB  1 
ATOM   410 C  CG  . GLU A 1 57 ? -12.558 16.931 5.805   1.00 27.83 ? 65   GLU A CG  1 
ATOM   411 C  CD  . GLU A 1 57 ? -12.571 15.847 6.877   1.00 29.30 ? 65   GLU A CD  1 
ATOM   412 O  OE1 . GLU A 1 57 ? -11.517 15.550 7.475   1.00 27.94 ? 65   GLU A OE1 1 
ATOM   413 O  OE2 . GLU A 1 57 ? -13.656 15.272 7.127   1.00 31.59 ? 65   GLU A OE2 1 
ATOM   414 N  N   . ASN A 1 58 ? -8.402  18.284 7.503   1.00 29.19 ? 66   ASN A N   1 
ATOM   415 C  CA  . ASN A 1 58 ? -6.977  18.715 7.502   1.00 29.21 ? 66   ASN A CA  1 
ATOM   416 C  C   . ASN A 1 58 ? -6.285  18.502 6.152   1.00 28.93 ? 66   ASN A C   1 
ATOM   417 O  O   . ASN A 1 58 ? -6.127  17.368 5.713   1.00 27.68 ? 66   ASN A O   1 
ATOM   418 C  CB  . ASN A 1 58 ? -6.227  17.946 8.605   1.00 29.91 ? 66   ASN A CB  1 
ATOM   419 C  CG  . ASN A 1 58 ? -4.935  18.620 9.033   1.00 31.40 ? 66   ASN A CG  1 
ATOM   420 O  OD1 . ASN A 1 58 ? -4.687  18.827 10.222  1.00 36.55 ? 66   ASN A OD1 1 
ATOM   421 N  ND2 . ASN A 1 58 ? -4.122  18.984 8.071   1.00 23.75 ? 66   ASN A ND2 1 
ATOM   422 N  N   . VAL A 1 59 ? -5.883  19.575 5.480   1.00 28.79 ? 67   VAL A N   1 
ATOM   423 C  CA  . VAL A 1 59 ? -5.181  19.404 4.203   1.00 29.92 ? 67   VAL A CA  1 
ATOM   424 C  C   . VAL A 1 59 ? -3.705  19.848 4.240   1.00 31.30 ? 67   VAL A C   1 
ATOM   425 O  O   . VAL A 1 59 ? -3.131  20.117 3.224   1.00 31.59 ? 67   VAL A O   1 
ATOM   426 C  CB  . VAL A 1 59 ? -5.844  20.193 3.112   1.00 29.56 ? 67   VAL A CB  1 
ATOM   427 C  CG1 . VAL A 1 59 ? -7.198  19.658 2.881   1.00 26.03 ? 67   VAL A CG1 1 
ATOM   428 C  CG2 . VAL A 1 59 ? -5.907  21.702 3.511   1.00 27.74 ? 67   VAL A CG2 1 
ATOM   429 N  N   . GLU A 1 60 ? -3.116  19.937 5.416   1.00 32.59 ? 68   GLU A N   1 
ATOM   430 C  CA  . GLU A 1 60 ? -1.747  20.455 5.571   1.00 34.52 ? 68   GLU A CA  1 
ATOM   431 C  C   . GLU A 1 60 ? -0.697  19.711 4.831   1.00 34.26 ? 68   GLU A C   1 
ATOM   432 O  O   . GLU A 1 60 ? 0.278   20.282 4.437   1.00 34.45 ? 68   GLU A O   1 
ATOM   433 C  CB  . GLU A 1 60 ? -1.313  20.412 7.034   1.00 34.88 ? 68   GLU A CB  1 
ATOM   434 C  CG  . GLU A 1 60 ? -1.938  21.489 7.863   1.00 38.80 ? 68   GLU A CG  1 
ATOM   435 C  CD  . GLU A 1 60 ? -1.108  21.829 9.075   1.00 43.97 ? 68   GLU A CD  1 
ATOM   436 O  OE1 . GLU A 1 60 ? -1.071  21.013 10.021  1.00 48.24 ? 68   GLU A OE1 1 
ATOM   437 O  OE2 . GLU A 1 60 ? -0.509  22.928 9.082   1.00 44.05 ? 68   GLU A OE2 1 
ATOM   438 N  N   . LYS A 1 61 ? -0.877  18.415 4.698   1.00 35.05 ? 69   LYS A N   1 
ATOM   439 C  CA  . LYS A 1 61 ? 0.105   17.596 4.046   1.00 35.26 ? 69   LYS A CA  1 
ATOM   440 C  C   . LYS A 1 61 ? -0.570  16.825 2.918   1.00 35.47 ? 69   LYS A C   1 
ATOM   441 O  O   . LYS A 1 61 ? -0.379  15.606 2.774   1.00 35.86 ? 69   LYS A O   1 
ATOM   442 C  CB  . LYS A 1 61 ? 0.733   16.606 5.080   1.00 37.13 ? 69   LYS A CB  1 
ATOM   443 N  N   . GLU A 1 62 ? -1.399  17.517 2.140   1.00 34.04 ? 70   GLU A N   1 
ATOM   444 C  CA  . GLU A 1 62 ? -2.086  16.859 1.022   1.00 33.13 ? 70   GLU A CA  1 
ATOM   445 C  C   . GLU A 1 62 ? -1.577  17.498 -0.246  1.00 31.82 ? 70   GLU A C   1 
ATOM   446 O  O   . GLU A 1 62 ? -1.142  18.635 -0.206  1.00 31.74 ? 70   GLU A O   1 
ATOM   447 C  CB  . GLU A 1 62 ? -3.622  16.988 1.116   1.00 32.94 ? 70   GLU A CB  1 
ATOM   448 C  CG  . GLU A 1 62 ? -4.281  16.194 2.240   1.00 32.59 ? 70   GLU A CG  1 
ATOM   449 C  CD  . GLU A 1 62 ? -5.592  15.508 1.825   1.00 31.79 ? 70   GLU A CD  1 
ATOM   450 O  OE1 . GLU A 1 62 ? -6.511  16.208 1.341   1.00 31.21 ? 70   GLU A OE1 1 
ATOM   451 O  OE2 . GLU A 1 62 ? -5.692  14.278 1.988   1.00 31.39 ? 70   GLU A OE2 1 
ATOM   452 N  N   . THR A 1 63 ? -1.612  16.795 -1.370  1.00 30.66 ? 71   THR A N   1 
ATOM   453 C  CA  . THR A 1 63 ? -1.103  17.397 -2.594  1.00 29.23 ? 71   THR A CA  1 
ATOM   454 C  C   . THR A 1 63 ? -1.912  18.620 -3.054  1.00 29.86 ? 71   THR A C   1 
ATOM   455 O  O   . THR A 1 63 ? -3.082  18.822 -2.688  1.00 27.01 ? 71   THR A O   1 
ATOM   456 C  CB  . THR A 1 63 ? -1.138  16.431 -3.748  1.00 30.14 ? 71   THR A CB  1 
ATOM   457 O  OG1 . THR A 1 63 ? -2.502  16.069 -4.014  1.00 26.32 ? 71   THR A OG1 1 
ATOM   458 C  CG2 . THR A 1 63 ? -0.353  15.088 -3.450  1.00 30.44 ? 71   THR A CG2 1 
ATOM   459 N  N   . HIS A 1 64 ? -1.284  19.410 -3.920  1.00 30.39 ? 72   HIS A N   1 
ATOM   460 C  CA  . HIS A 1 64 ? -2.001  20.515 -4.555  1.00 30.40 ? 72   HIS A CA  1 
ATOM   461 C  C   . HIS A 1 64 ? -3.310  19.996 -5.164  1.00 30.58 ? 72   HIS A C   1 
ATOM   462 O  O   . HIS A 1 64 ? -4.353  20.639 -5.034  1.00 30.47 ? 72   HIS A O   1 
ATOM   463 C  CB  . HIS A 1 64 ? -1.135  21.172 -5.623  1.00 30.06 ? 72   HIS A CB  1 
ATOM   464 C  CG  . HIS A 1 64 ? -1.819  22.300 -6.339  1.00 32.84 ? 72   HIS A CG  1 
ATOM   465 N  ND1 . HIS A 1 64 ? -2.062  23.525 -5.747  1.00 31.45 ? 72   HIS A ND1 1 
ATOM   466 C  CD2 . HIS A 1 64 ? -2.313  22.381 -7.595  1.00 29.05 ? 72   HIS A CD2 1 
ATOM   467 C  CE1 . HIS A 1 64 ? -2.686  24.300 -6.610  1.00 34.20 ? 72   HIS A CE1 1 
ATOM   468 N  NE2 . HIS A 1 64 ? -2.852  23.629 -7.737  1.00 32.74 ? 72   HIS A NE2 1 
ATOM   469 N  N   . GLN A 1 65 ? -3.267  18.826 -5.806  1.00 30.15 ? 73   GLN A N   1 
ATOM   470 C  CA  . GLN A 1 65 ? -4.444  18.285 -6.502  1.00 30.54 ? 73   GLN A CA  1 
ATOM   471 C  C   . GLN A 1 65 ? -5.571  17.869 -5.541  1.00 29.97 ? 73   GLN A C   1 
ATOM   472 O  O   . GLN A 1 65 ? -6.744  18.119 -5.779  1.00 28.94 ? 73   GLN A O   1 
ATOM   473 C  CB  . GLN A 1 65 ? -4.029  17.087 -7.368  1.00 31.58 ? 73   GLN A CB  1 
ATOM   474 C  CG  . GLN A 1 65 ? -4.692  16.994 -8.728  1.00 35.04 ? 73   GLN A CG  1 
ATOM   475 C  CD  . GLN A 1 65 ? -3.973  15.994 -9.648  1.00 45.21 ? 73   GLN A CD  1 
ATOM   476 O  OE1 . GLN A 1 65 ? -3.833  14.794 -9.305  1.00 45.67 ? 73   GLN A OE1 1 
ATOM   477 N  NE2 . GLN A 1 65 ? -3.505  16.482 -10.814 1.00 46.05 ? 73   GLN A NE2 1 
ATOM   478 N  N   . GLN A 1 66 ? -5.203  17.252 -4.427  1.00 29.36 ? 74   GLN A N   1 
ATOM   479 C  CA  . GLN A 1 66 ? -6.195  16.905 -3.441  1.00 28.57 ? 74   GLN A CA  1 
ATOM   480 C  C   . GLN A 1 66 ? -6.888  18.132 -2.912  1.00 27.67 ? 74   GLN A C   1 
ATOM   481 O  O   . GLN A 1 66 ? -8.115  18.200 -2.821  1.00 27.22 ? 74   GLN A O   1 
ATOM   482 C  CB  . GLN A 1 66 ? -5.540  16.125 -2.303  1.00 29.24 ? 74   GLN A CB  1 
ATOM   483 C  CG  . GLN A 1 66 ? -4.978  14.736 -2.738  1.00 29.89 ? 74   GLN A CG  1 
ATOM   484 C  CD  . GLN A 1 66 ? -4.336  13.958 -1.571  1.00 30.47 ? 74   GLN A CD  1 
ATOM   485 O  OE1 . GLN A 1 66 ? -3.529  14.518 -0.826  1.00 33.42 ? 74   GLN A OE1 1 
ATOM   486 N  NE2 . GLN A 1 66 ? -4.662  12.667 -1.444  1.00 25.66 ? 74   GLN A NE2 1 
ATOM   487 N  N   . VAL A 1 67 ? -6.112  19.126 -2.533  1.00 27.57 ? 75   VAL A N   1 
ATOM   488 C  CA  . VAL A 1 67 ? -6.748  20.273 -1.934  1.00 26.83 ? 75   VAL A CA  1 
ATOM   489 C  C   . VAL A 1 67 ? -7.649  21.034 -2.860  1.00 25.64 ? 75   VAL A C   1 
ATOM   490 O  O   . VAL A 1 67 ? -8.735  21.427 -2.478  1.00 25.59 ? 75   VAL A O   1 
ATOM   491 C  CB  . VAL A 1 67 ? -5.769  21.222 -1.250  1.00 28.23 ? 75   VAL A CB  1 
ATOM   492 C  CG1 . VAL A 1 67 ? -6.570  22.318 -0.513  1.00 25.68 ? 75   VAL A CG1 1 
ATOM   493 C  CG2 . VAL A 1 67 ? -4.878  20.418 -0.248  1.00 27.17 ? 75   VAL A CG2 1 
ATOM   494 N  N   . VAL A 1 68 ? -7.208  21.233 -4.085  1.00 25.97 ? 76   VAL A N   1 
ATOM   495 C  CA  . VAL A 1 68 ? -7.990  21.968 -5.079  1.00 24.68 ? 76   VAL A CA  1 
ATOM   496 C  C   . VAL A 1 68 ? -9.264  21.153 -5.335  1.00 25.15 ? 76   VAL A C   1 
ATOM   497 O  O   . VAL A 1 68 ? -10.357 21.710 -5.416  1.00 22.43 ? 76   VAL A O   1 
ATOM   498 C  CB  . VAL A 1 68 ? -7.148  22.179 -6.413  1.00 24.91 ? 76   VAL A CB  1 
ATOM   499 C  CG1 . VAL A 1 68 ? -7.993  22.550 -7.571  1.00 23.92 ? 76   VAL A CG1 1 
ATOM   500 C  CG2 . VAL A 1 68 ? -6.118  23.259 -6.223  1.00 25.90 ? 76   VAL A CG2 1 
ATOM   501 N  N   . SER A 1 69 ? -9.125  19.832 -5.444  1.00 24.92 ? 77   SER A N   1 
ATOM   502 C  CA  . SER A 1 69 ? -10.317 18.997 -5.662  1.00 26.02 ? 77   SER A CA  1 
ATOM   503 C  C   . SER A 1 69 ? -11.350 19.214 -4.582  1.00 26.98 ? 77   SER A C   1 
ATOM   504 O  O   . SER A 1 69 ? -12.562 19.313 -4.844  1.00 28.04 ? 77   SER A O   1 
ATOM   505 C  CB  . SER A 1 69 ? -9.949  17.518 -5.693  1.00 25.76 ? 77   SER A CB  1 
ATOM   506 O  OG  . SER A 1 69 ? -9.358  17.152 -6.927  1.00 27.32 ? 77   SER A OG  1 
ATOM   507 N  N   . ARG A 1 70 ? -10.887 19.257 -3.337  1.00 27.37 ? 78   ARG A N   1 
ATOM   508 C  CA  . ARG A 1 70 ? -11.820 19.430 -2.249  1.00 26.47 ? 78   ARG A CA  1 
ATOM   509 C  C   . ARG A 1 70 ? -12.514 20.773 -2.348  1.00 27.83 ? 78   ARG A C   1 
ATOM   510 O  O   . ARG A 1 70 ? -13.746 20.855 -2.271  1.00 28.28 ? 78   ARG A O   1 
ATOM   511 C  CB  . ARG A 1 70 ? -11.090 19.360 -0.915  1.00 27.15 ? 78   ARG A CB  1 
ATOM   512 C  CG  . ARG A 1 70 ? -10.534 18.022 -0.548  1.00 24.44 ? 78   ARG A CG  1 
ATOM   513 C  CD  . ARG A 1 70 ? -9.611  18.149 0.623   1.00 24.74 ? 78   ARG A CD  1 
ATOM   514 N  NE  . ARG A 1 70 ? -9.324  16.845 1.172   1.00 25.23 ? 78   ARG A NE  1 
ATOM   515 C  CZ  . ARG A 1 70 ? -10.175 16.150 1.914   1.00 23.81 ? 78   ARG A CZ  1 
ATOM   516 N  NH1 . ARG A 1 70 ? -11.380 16.644 2.241   1.00 21.86 ? 78   ARG A NH1 1 
ATOM   517 N  NH2 . ARG A 1 70 ? -9.820  14.939 2.329   1.00 23.31 ? 78   ARG A NH2 1 
ATOM   518 N  N   . ILE A 1 71 ? -11.723 21.826 -2.525  1.00 27.62 ? 79   ILE A N   1 
ATOM   519 C  CA  . ILE A 1 71 ? -12.285 23.142 -2.587  1.00 28.04 ? 79   ILE A CA  1 
ATOM   520 C  C   . ILE A 1 71 ? -13.302 23.163 -3.685  1.00 29.10 ? 79   ILE A C   1 
ATOM   521 O  O   . ILE A 1 71 ? -14.425 23.596 -3.478  1.00 28.47 ? 79   ILE A O   1 
ATOM   522 C  CB  . ILE A 1 71 ? -11.172 24.166 -2.832  1.00 28.31 ? 79   ILE A CB  1 
ATOM   523 C  CG1 . ILE A 1 71 ? -10.234 24.225 -1.621  1.00 25.33 ? 79   ILE A CG1 1 
ATOM   524 C  CG2 . ILE A 1 71 ? -11.744 25.550 -3.086  1.00 26.33 ? 79   ILE A CG2 1 
ATOM   525 C  CD1 . ILE A 1 71 ? -8.971  25.078 -1.863  1.00 24.53 ? 79   ILE A CD1 1 
ATOM   526 N  N   . ARG A 1 72 ? -12.925 22.644 -4.850  1.00 30.65 ? 80   ARG A N   1 
ATOM   527 C  CA  . ARG A 1 72 ? -13.791 22.712 -5.996  1.00 32.71 ? 80   ARG A CA  1 
ATOM   528 C  C   . ARG A 1 72 ? -15.069 21.881 -5.850  1.00 34.33 ? 80   ARG A C   1 
ATOM   529 O  O   . ARG A 1 72 ? -16.082 22.235 -6.399  1.00 34.30 ? 80   ARG A O   1 
ATOM   530 C  CB  . ARG A 1 72 ? -13.050 22.295 -7.272  1.00 32.83 ? 80   ARG A CB  1 
ATOM   531 C  CG  . ARG A 1 72 ? -12.222 23.377 -7.937  1.00 33.70 ? 80   ARG A CG  1 
ATOM   532 C  CD  . ARG A 1 72 ? -11.623 22.993 -9.323  1.00 32.09 ? 80   ARG A CD  1 
ATOM   533 N  NE  . ARG A 1 72 ? -10.853 24.118 -9.837  1.00 34.12 ? 80   ARG A NE  1 
ATOM   534 C  CZ  . ARG A 1 72 ? -9.706  24.051 -10.518 1.00 33.41 ? 80   ARG A CZ  1 
ATOM   535 N  NH1 . ARG A 1 72 ? -9.139  22.891 -10.826 1.00 29.79 ? 80   ARG A NH1 1 
ATOM   536 N  NH2 . ARG A 1 72 ? -9.135  25.180 -10.890 1.00 34.32 ? 80   ARG A NH2 1 
ATOM   537 N  N   . ALA A 1 73 ? -15.038 20.766 -5.128  1.00 36.12 ? 81   ALA A N   1 
ATOM   538 C  CA  . ALA A 1 73 ? -16.236 19.939 -5.100  1.00 37.54 ? 81   ALA A CA  1 
ATOM   539 C  C   . ALA A 1 73 ? -17.353 20.473 -4.224  1.00 39.04 ? 81   ALA A C   1 
ATOM   540 O  O   . ALA A 1 73 ? -18.526 20.179 -4.469  1.00 38.99 ? 81   ALA A O   1 
ATOM   541 C  CB  . ALA A 1 73 ? -15.907 18.478 -4.749  1.00 37.91 ? 81   ALA A CB  1 
ATOM   542 N  N   . ALA A 1 74 ? -17.009 21.255 -3.202  1.00 40.72 ? 82   ALA A N   1 
ATOM   543 C  CA  . ALA A 1 74 ? -18.052 21.798 -2.330  1.00 41.83 ? 82   ALA A CA  1 
ATOM   544 C  C   . ALA A 1 74 ? -19.038 22.509 -3.228  1.00 42.58 ? 82   ALA A C   1 
ATOM   545 O  O   . ALA A 1 74 ? -18.688 22.974 -4.292  1.00 43.62 ? 82   ALA A O   1 
ATOM   546 C  CB  . ALA A 1 74 ? -17.495 22.739 -1.297  1.00 41.93 ? 82   ALA A CB  1 
ATOM   547 N  N   . LEU A 1 75 ? -20.262 22.645 -2.781  1.00 43.64 ? 83   LEU A N   1 
ATOM   548 C  CA  . LEU A 1 75 ? -21.304 23.140 -3.661  1.00 44.35 ? 83   LEU A CA  1 
ATOM   549 C  C   . LEU A 1 75 ? -21.492 24.646 -3.637  1.00 44.08 ? 83   LEU A C   1 
ATOM   550 O  O   . LEU A 1 75 ? -21.416 25.320 -4.665  1.00 44.57 ? 83   LEU A O   1 
ATOM   551 C  CB  . LEU A 1 75 ? -22.633 22.463 -3.283  1.00 44.69 ? 83   LEU A CB  1 
ATOM   552 C  CG  . LEU A 1 75 ? -22.621 20.948 -3.469  1.00 46.01 ? 83   LEU A CG  1 
ATOM   553 C  CD1 . LEU A 1 75 ? -23.982 20.327 -3.155  1.00 46.74 ? 83   LEU A CD1 1 
ATOM   554 C  CD2 . LEU A 1 75 ? -22.207 20.637 -4.881  1.00 47.57 ? 83   LEU A CD2 1 
ATOM   555 N  N   . ASN A 1 76 ? -21.789 25.156 -2.456  1.00 43.11 ? 84   ASN A N   1 
ATOM   556 C  CA  . ASN A 1 76 ? -22.101 26.560 -2.289  1.00 42.47 ? 84   ASN A CA  1 
ATOM   557 C  C   . ASN A 1 76 ? -21.024 27.387 -1.579  1.00 40.94 ? 84   ASN A C   1 
ATOM   558 O  O   . ASN A 1 76 ? -20.900 28.599 -1.822  1.00 40.49 ? 84   ASN A O   1 
ATOM   559 C  CB  . ASN A 1 76 ? -23.423 26.686 -1.532  1.00 42.79 ? 84   ASN A CB  1 
ATOM   560 C  CG  . ASN A 1 76 ? -24.563 25.952 -2.238  1.00 45.94 ? 84   ASN A CG  1 
ATOM   561 O  OD1 . ASN A 1 76 ? -24.885 26.245 -3.403  1.00 50.73 ? 84   ASN A OD1 1 
ATOM   562 N  ND2 . ASN A 1 76 ? -25.158 24.972 -1.555  1.00 47.33 ? 84   ASN A ND2 1 
ATOM   563 N  N   . ALA A 1 77 ? -20.204 26.728 -0.768  1.00 37.94 ? 85   ALA A N   1 
ATOM   564 C  CA  . ALA A 1 77 ? -19.360 27.459 0.151   1.00 35.38 ? 85   ALA A CA  1 
ATOM   565 C  C   . ALA A 1 77 ? -18.178 26.631 0.577   1.00 34.27 ? 85   ALA A C   1 
ATOM   566 O  O   . ALA A 1 77 ? -18.200 25.420 0.458   1.00 34.06 ? 85   ALA A O   1 
ATOM   567 C  CB  . ALA A 1 77 ? -20.204 27.758 1.382   1.00 34.49 ? 85   ALA A CB  1 
ATOM   568 N  N   . VAL A 1 78 ? -17.145 27.261 1.097   1.00 32.36 ? 86   VAL A N   1 
ATOM   569 C  CA  . VAL A 1 78 ? -16.051 26.497 1.659   1.00 31.24 ? 86   VAL A CA  1 
ATOM   570 C  C   . VAL A 1 78 ? -15.596 27.279 2.879   1.00 30.51 ? 86   VAL A C   1 
ATOM   571 O  O   . VAL A 1 78 ? -15.585 28.530 2.870   1.00 32.06 ? 86   VAL A O   1 
ATOM   572 C  CB  . VAL A 1 78 ? -14.859 26.299 0.671   1.00 31.37 ? 86   VAL A CB  1 
ATOM   573 C  CG1 . VAL A 1 78 ? -15.224 25.448 -0.477  1.00 31.44 ? 86   VAL A CG1 1 
ATOM   574 C  CG2 . VAL A 1 78 ? -14.312 27.674 0.152   1.00 30.47 ? 86   VAL A CG2 1 
ATOM   575 N  N   . ARG A 1 79 ? -15.248 26.562 3.934   1.00 28.19 ? 87   ARG A N   1 
ATOM   576 C  CA  . ARG A 1 79 ? -14.692 27.199 5.119   1.00 27.19 ? 87   ARG A CA  1 
ATOM   577 C  C   . ARG A 1 79 ? -13.210 26.891 5.144   1.00 26.81 ? 87   ARG A C   1 
ATOM   578 O  O   . ARG A 1 79 ? -12.818 25.723 5.199   1.00 27.25 ? 87   ARG A O   1 
ATOM   579 C  CB  . ARG A 1 79 ? -15.392 26.708 6.366   1.00 26.87 ? 87   ARG A CB  1 
ATOM   580 C  CG  . ARG A 1 79 ? -16.885 27.074 6.354   1.00 26.58 ? 87   ARG A CG  1 
ATOM   581 C  CD  . ARG A 1 79 ? -17.608 26.382 7.429   1.00 29.69 ? 87   ARG A CD  1 
ATOM   582 N  NE  . ARG A 1 79 ? -19.008 26.715 7.607   1.00 25.85 ? 87   ARG A NE  1 
ATOM   583 C  CZ  . ARG A 1 79 ? -19.912 25.794 7.868   1.00 29.32 ? 87   ARG A CZ  1 
ATOM   584 N  NH1 . ARG A 1 79 ? -19.494 24.518 7.969   1.00 26.06 ? 87   ARG A NH1 1 
ATOM   585 N  NH2 . ARG A 1 79 ? -21.193 26.135 8.077   1.00 23.96 ? 87   ARG A NH2 1 
ATOM   586 N  N   . LEU A 1 80 ? -12.393 27.936 5.085   1.00 25.81 ? 88   LEU A N   1 
ATOM   587 C  CA  . LEU A 1 80 ? -10.948 27.778 4.971   1.00 26.23 ? 88   LEU A CA  1 
ATOM   588 C  C   . LEU A 1 80 ? -10.280 28.201 6.272   1.00 25.95 ? 88   LEU A C   1 
ATOM   589 O  O   . LEU A 1 80 ? -10.378 29.361 6.685   1.00 27.12 ? 88   LEU A O   1 
ATOM   590 C  CB  . LEU A 1 80 ? -10.401 28.602 3.792   1.00 25.78 ? 88   LEU A CB  1 
ATOM   591 C  CG  . LEU A 1 80 ? -10.992 28.359 2.404   1.00 24.35 ? 88   LEU A CG  1 
ATOM   592 C  CD1 . LEU A 1 80 ? -10.422 29.380 1.412   1.00 26.01 ? 88   LEU A CD1 1 
ATOM   593 C  CD2 . LEU A 1 80 ? -10.701 26.948 1.955   1.00 26.25 ? 88   LEU A CD2 1 
ATOM   594 N  N   . LEU A 1 81 ? -9.634  27.251 6.935   1.00 24.97 ? 89   LEU A N   1 
ATOM   595 C  CA  . LEU A 1 81 ? -8.947  27.531 8.180   1.00 23.95 ? 89   LEU A CA  1 
ATOM   596 C  C   . LEU A 1 81 ? -7.510  27.829 7.811   1.00 23.80 ? 89   LEU A C   1 
ATOM   597 O  O   . LEU A 1 81 ? -6.774  26.953 7.335   1.00 23.41 ? 89   LEU A O   1 
ATOM   598 C  CB  . LEU A 1 81 ? -9.036  26.342 9.163   1.00 22.83 ? 89   LEU A CB  1 
ATOM   599 C  CG  . LEU A 1 81 ? -8.647  26.488 10.653  1.00 23.79 ? 89   LEU A CG  1 
ATOM   600 C  CD1 . LEU A 1 81 ? -9.499  27.503 11.388  1.00 25.58 ? 89   LEU A CD1 1 
ATOM   601 C  CD2 . LEU A 1 81 ? -8.786  25.203 11.379  1.00 21.91 ? 89   LEU A CD2 1 
ATOM   602 N  N   . VAL A 1 82 ? -7.098  29.063 8.072   1.00 24.47 ? 90   VAL A N   1 
ATOM   603 C  CA  . VAL A 1 82 ? -5.748  29.493 7.730   1.00 24.27 ? 90   VAL A CA  1 
ATOM   604 C  C   . VAL A 1 82 ? -4.954  29.997 8.914   1.00 24.84 ? 90   VAL A C   1 
ATOM   605 O  O   . VAL A 1 82 ? -5.523  30.433 9.907   1.00 25.59 ? 90   VAL A O   1 
ATOM   606 C  CB  . VAL A 1 82 ? -5.822  30.618 6.691   1.00 24.88 ? 90   VAL A CB  1 
ATOM   607 C  CG1 . VAL A 1 82 ? -6.467  30.095 5.398   1.00 23.23 ? 90   VAL A CG1 1 
ATOM   608 C  CG2 . VAL A 1 82 ? -6.628  31.805 7.226   1.00 23.67 ? 90   VAL A CG2 1 
ATOM   609 N  N   . VAL A 1 83 ? -3.635  29.965 8.783   1.00 24.64 ? 91   VAL A N   1 
ATOM   610 C  CA  . VAL A 1 83 ? -2.738  30.489 9.800   1.00 25.58 ? 91   VAL A CA  1 
ATOM   611 C  C   . VAL A 1 83 ? -1.697  31.328 9.091   1.00 25.75 ? 91   VAL A C   1 
ATOM   612 O  O   . VAL A 1 83 ? -1.469  31.140 7.887   1.00 25.30 ? 91   VAL A O   1 
ATOM   613 C  CB  . VAL A 1 83 ? -2.032  29.374 10.624  1.00 24.85 ? 91   VAL A CB  1 
ATOM   614 C  CG1 . VAL A 1 83 ? -3.013  28.666 11.441  1.00 25.89 ? 91   VAL A CG1 1 
ATOM   615 C  CG2 . VAL A 1 83 ? -1.270  28.387 9.719   1.00 25.30 ? 91   VAL A CG2 1 
ATOM   616 N  N   . ASP A 1 84 ? -1.052  32.216 9.842   1.00 25.60 ? 92   ASP A N   1 
ATOM   617 C  CA  . ASP A 1 84 ? 0.046   33.019 9.320   1.00 26.89 ? 92   ASP A CA  1 
ATOM   618 C  C   . ASP A 1 84 ? 1.326   32.193 9.561   1.00 26.85 ? 92   ASP A C   1 
ATOM   619 O  O   . ASP A 1 84 ? 1.742   32.001 10.691  1.00 27.51 ? 92   ASP A O   1 
ATOM   620 C  CB  . ASP A 1 84 ? 0.087   34.416 9.982   1.00 26.88 ? 92   ASP A CB  1 
ATOM   621 C  CG  . ASP A 1 84 ? 1.425   35.111 9.795   1.00 27.97 ? 92   ASP A CG  1 
ATOM   622 O  OD1 . ASP A 1 84 ? 2.397   34.428 9.346   1.00 27.91 ? 92   ASP A OD1 1 
ATOM   623 O  OD2 . ASP A 1 84 ? 1.595   36.314 10.095  1.00 29.74 ? 92   ASP A OD2 1 
ATOM   624 N  N   . PRO A 1 85 ? 1.946   31.750 8.480   1.00 28.23 ? 93   PRO A N   1 
ATOM   625 C  CA  . PRO A 1 85 ? 3.116   30.841 8.546   1.00 29.71 ? 93   PRO A CA  1 
ATOM   626 C  C   . PRO A 1 85 ? 4.315   31.336 9.351   1.00 30.78 ? 93   PRO A C   1 
ATOM   627 O  O   . PRO A 1 85 ? 5.153   30.539 9.736   1.00 31.09 ? 93   PRO A O   1 
ATOM   628 C  CB  . PRO A 1 85 ? 3.526   30.696 7.080   1.00 29.02 ? 93   PRO A CB  1 
ATOM   629 C  CG  . PRO A 1 85 ? 2.337   30.928 6.380   1.00 29.30 ? 93   PRO A CG  1 
ATOM   630 C  CD  . PRO A 1 85 ? 1.574   32.042 7.094   1.00 28.51 ? 93   PRO A CD  1 
ATOM   631 N  N   . GLU A 1 86 ? 4.406   32.637 9.574   1.00 32.19 ? 94   GLU A N   1 
ATOM   632 C  CA  . GLU A 1 86 ? 5.486   33.232 10.351  1.00 35.14 ? 94   GLU A CA  1 
ATOM   633 C  C   . GLU A 1 86 ? 5.115   33.108 11.814  1.00 34.46 ? 94   GLU A C   1 
ATOM   634 O  O   . GLU A 1 86 ? 5.938   33.317 12.691  1.00 34.95 ? 94   GLU A O   1 
ATOM   635 C  CB  . GLU A 1 86 ? 5.626   34.723 9.983   1.00 36.23 ? 94   GLU A CB  1 
ATOM   636 C  CG  . GLU A 1 86 ? 6.808   35.503 10.577  1.00 43.86 ? 94   GLU A CG  1 
ATOM   637 C  CD  . GLU A 1 86 ? 6.744   37.026 10.239  1.00 51.32 ? 94   GLU A CD  1 
ATOM   638 O  OE1 . GLU A 1 86 ? 6.764   37.349 9.032   1.00 51.64 ? 94   GLU A OE1 1 
ATOM   639 O  OE2 . GLU A 1 86 ? 6.671   37.905 11.153  1.00 53.10 ? 94   GLU A OE2 1 
ATOM   640 N  N   . GLU A 1 87 ? 3.859   32.792 12.104  1.00 33.33 ? 95   GLU A N   1 
ATOM   641 C  CA  . GLU A 1 87 ? 3.501   32.700 13.506  1.00 32.62 ? 95   GLU A CA  1 
ATOM   642 C  C   . GLU A 1 87 ? 3.063   31.292 13.917  1.00 30.33 ? 95   GLU A C   1 
ATOM   643 O  O   . GLU A 1 87 ? 2.905   31.007 15.097  1.00 29.75 ? 95   GLU A O   1 
ATOM   644 C  CB  . GLU A 1 87 ? 2.440   33.779 13.864  1.00 33.57 ? 95   GLU A CB  1 
ATOM   645 C  CG  . GLU A 1 87 ? 3.034   35.183 14.058  1.00 39.20 ? 95   GLU A CG  1 
ATOM   646 C  CD  . GLU A 1 87 ? 2.053   36.205 14.647  1.00 48.06 ? 95   GLU A CD  1 
ATOM   647 O  OE1 . GLU A 1 87 ? 1.032   36.561 13.972  1.00 47.48 ? 95   GLU A OE1 1 
ATOM   648 O  OE2 . GLU A 1 87 ? 2.318   36.676 15.796  1.00 51.38 ? 95   GLU A OE2 1 
ATOM   649 N  N   . ASP A 1 88 ? 2.862   30.410 12.943  1.00 28.86 ? 96   ASP A N   1 
ATOM   650 C  CA  . ASP A 1 88 ? 2.343   29.059 13.230  1.00 27.65 ? 96   ASP A CA  1 
ATOM   651 C  C   . ASP A 1 88 ? 3.185   27.949 12.634  1.00 26.69 ? 96   ASP A C   1 
ATOM   652 O  O   . ASP A 1 88 ? 3.562   28.020 11.487  1.00 26.86 ? 96   ASP A O   1 
ATOM   653 C  CB  . ASP A 1 88 ? 0.884   28.944 12.695  1.00 27.57 ? 96   ASP A CB  1 
ATOM   654 C  CG  . ASP A 1 88 ? 0.223   27.627 13.055  1.00 26.69 ? 96   ASP A CG  1 
ATOM   655 O  OD1 . ASP A 1 88 ? 0.577   26.568 12.467  1.00 21.83 ? 96   ASP A OD1 1 
ATOM   656 O  OD2 . ASP A 1 88 ? -0.643  27.559 13.946  1.00 28.95 ? 96   ASP A OD2 1 
ATOM   657 N  N   . SER A 1 89 ? 3.455   26.894 13.389  1.00 26.83 ? 97   SER A N   1 
ATOM   658 C  CA  . SER A 1 89 ? 4.123   25.751 12.802  1.00 26.31 ? 97   SER A CA  1 
ATOM   659 C  C   . SER A 1 89 ? 3.485   24.450 13.245  1.00 27.57 ? 97   SER A C   1 
ATOM   660 O  O   . SER A 1 89 ? 2.916   24.359 14.324  1.00 26.77 ? 97   SER A O   1 
ATOM   661 C  CB  . SER A 1 89 ? 5.608   25.760 13.131  1.00 25.17 ? 97   SER A CB  1 
ATOM   662 O  OG  . SER A 1 89 ? 6.189   27.021 12.813  1.00 24.39 ? 97   SER A OG  1 
ATOM   663 N  N   . PHE A 1 90 ? 3.562   23.442 12.389  1.00 28.56 ? 98   PHE A N   1 
ATOM   664 C  CA  . PHE A 1 90 ? 3.082   22.124 12.751  1.00 30.29 ? 98   PHE A CA  1 
ATOM   665 C  C   . PHE A 1 90 ? 4.218   21.323 13.326  1.00 30.11 ? 98   PHE A C   1 
ATOM   666 O  O   . PHE A 1 90 ? 5.346   21.410 12.836  1.00 31.15 ? 98   PHE A O   1 
ATOM   667 C  CB  . PHE A 1 90 ? 2.552   21.374 11.530  1.00 30.97 ? 98   PHE A CB  1 
ATOM   668 C  CG  . PHE A 1 90 ? 2.378   19.899 11.773  1.00 31.70 ? 98   PHE A CG  1 
ATOM   669 C  CD1 . PHE A 1 90 ? 1.275   19.424 12.457  1.00 32.48 ? 98   PHE A CD1 1 
ATOM   670 C  CD2 . PHE A 1 90 ? 3.332   18.988 11.350  1.00 34.42 ? 98   PHE A CD2 1 
ATOM   671 C  CE1 . PHE A 1 90 ? 1.108   18.066 12.707  1.00 32.00 ? 98   PHE A CE1 1 
ATOM   672 C  CE2 . PHE A 1 90 ? 3.167   17.608 11.601  1.00 34.79 ? 98   PHE A CE2 1 
ATOM   673 C  CZ  . PHE A 1 90 ? 2.053   17.156 12.273  1.00 30.98 ? 98   PHE A CZ  1 
ATOM   674 N  N   . LEU A 1 91 ? 3.932   20.499 14.317  1.00 29.32 ? 99   LEU A N   1 
ATOM   675 C  CA  . LEU A 1 91 ? 4.979   19.709 14.927  1.00 28.57 ? 99   LEU A CA  1 
ATOM   676 C  C   . LEU A 1 91 ? 4.603   18.244 15.020  1.00 28.54 ? 99   LEU A C   1 
ATOM   677 O  O   . LEU A 1 91 ? 5.457   17.330 14.987  1.00 26.93 ? 99   LEU A O   1 
ATOM   678 C  CB  . LEU A 1 91 ? 5.303   20.225 16.349  1.00 28.67 ? 99   LEU A CB  1 
ATOM   679 C  CG  . LEU A 1 91 ? 6.211   21.464 16.594  1.00 30.15 ? 99   LEU A CG  1 
ATOM   680 C  CD1 . LEU A 1 91 ? 7.457   21.516 15.697  1.00 26.28 ? 99   LEU A CD1 1 
ATOM   681 C  CD2 . LEU A 1 91 ? 5.477   22.782 16.507  1.00 26.51 ? 99   LEU A CD2 1 
ATOM   682 O  OXT . LEU A 1 91 ? 3.414   17.972 15.202  1.00 29.98 ? 99   LEU A OXT 1 
HETATM 683 CL CL  . CL  B 2 .  ? 0.308   36.632 -4.124  1.00 34.10 ? 1100 CL  A CL  1 
HETATM 684 CL CL  . CL  C 2 .  ? -2.034  32.329 12.753  1.00 33.63 ? 1101 CL  A CL  1 
HETATM 685 O  O   . HOH D 3 .  ? -10.010 32.767 20.368  1.00 31.19 ? 2001 HOH A O   1 
HETATM 686 O  O   . HOH D 3 .  ? -9.490  34.137 15.172  1.00 36.07 ? 2002 HOH A O   1 
HETATM 687 O  O   . HOH D 3 .  ? -4.915  32.826 11.786  1.00 36.72 ? 2003 HOH A O   1 
HETATM 688 O  O   . HOH D 3 .  ? -12.368 34.066 11.964  1.00 30.57 ? 2004 HOH A O   1 
HETATM 689 O  O   . HOH D 3 .  ? -12.864 35.979 9.471   1.00 42.21 ? 2005 HOH A O   1 
HETATM 690 O  O   . HOH D 3 .  ? -19.523 37.592 -6.297  1.00 40.51 ? 2006 HOH A O   1 
HETATM 691 O  O   . HOH D 3 .  ? -17.707 35.152 -7.743  1.00 46.90 ? 2007 HOH A O   1 
HETATM 692 O  O   . HOH D 3 .  ? -16.627 25.161 -4.522  1.00 31.43 ? 2008 HOH A O   1 
HETATM 693 O  O   . HOH D 3 .  ? 4.034   22.732 -1.068  1.00 31.85 ? 2009 HOH A O   1 
HETATM 694 O  O   . HOH D 3 .  ? 0.764   20.696 -0.932  1.00 39.31 ? 2010 HOH A O   1 
HETATM 695 O  O   . HOH D 3 .  ? 1.978   21.923 -4.858  1.00 36.31 ? 2011 HOH A O   1 
HETATM 696 O  O   . HOH D 3 .  ? 5.217   24.558 2.887   1.00 53.83 ? 2012 HOH A O   1 
HETATM 697 O  O   . HOH D 3 .  ? 1.430   32.813 -1.242  1.00 26.55 ? 2013 HOH A O   1 
HETATM 698 O  O   . HOH D 3 .  ? 1.838   34.183 -3.782  1.00 46.18 ? 2014 HOH A O   1 
HETATM 699 O  O   . HOH D 3 .  ? -7.116  35.954 -8.197  1.00 35.63 ? 2015 HOH A O   1 
HETATM 700 O  O   . HOH D 3 .  ? -3.698  39.301 -2.790  1.00 28.00 ? 2016 HOH A O   1 
HETATM 701 O  O   . HOH D 3 .  ? -9.730  45.028 -8.573  1.00 33.57 ? 2017 HOH A O   1 
HETATM 702 O  O   . HOH D 3 .  ? -11.420 43.024 -8.445  1.00 30.08 ? 2018 HOH A O   1 
HETATM 703 O  O   . HOH D 3 .  ? -9.650  36.498 -9.086  1.00 35.50 ? 2019 HOH A O   1 
HETATM 704 O  O   . HOH D 3 .  ? -13.549 45.200 -6.444  1.00 36.17 ? 2020 HOH A O   1 
HETATM 705 O  O   . HOH D 3 .  ? 9.890   28.539 12.367  1.00 36.53 ? 2021 HOH A O   1 
HETATM 706 O  O   . HOH D 3 .  ? -13.741 43.598 -0.276  1.00 43.91 ? 2022 HOH A O   1 
HETATM 707 O  O   . HOH D 3 .  ? -15.317 34.727 7.061   1.00 37.49 ? 2023 HOH A O   1 
HETATM 708 O  O   . HOH D 3 .  ? -6.525  39.990 0.881   1.00 33.61 ? 2024 HOH A O   1 
HETATM 709 O  O   . HOH D 3 .  ? -4.016  39.547 0.064   1.00 17.47 ? 2025 HOH A O   1 
HETATM 710 O  O   . HOH D 3 .  ? -0.527  35.613 6.300   1.00 42.15 ? 2026 HOH A O   1 
HETATM 711 O  O   . HOH D 3 .  ? 3.779   26.927 8.444   1.00 28.94 ? 2027 HOH A O   1 
HETATM 712 O  O   . HOH D 3 .  ? -0.830  23.420 4.111   1.00 43.97 ? 2028 HOH A O   1 
HETATM 713 O  O   . HOH D 3 .  ? -12.349 24.363 10.587  1.00 25.58 ? 2029 HOH A O   1 
HETATM 714 O  O   . HOH D 3 .  ? -12.218 19.367 2.439   1.00 36.80 ? 2030 HOH A O   1 
HETATM 715 O  O   . HOH D 3 .  ? -15.708 18.453 4.143   1.00 31.69 ? 2031 HOH A O   1 
HETATM 716 O  O   . HOH D 3 .  ? -17.775 19.959 6.846   1.00 32.21 ? 2032 HOH A O   1 
HETATM 717 O  O   . HOH D 3 .  ? -17.611 20.522 1.508   1.00 43.73 ? 2033 HOH A O   1 
HETATM 718 O  O   . HOH D 3 .  ? -15.012 19.594 1.203   1.00 29.93 ? 2034 HOH A O   1 
HETATM 719 O  O   . HOH D 3 .  ? -12.737 24.306 7.715   1.00 31.67 ? 2035 HOH A O   1 
HETATM 720 O  O   . HOH D 3 .  ? -15.135 23.953 9.294   1.00 18.29 ? 2036 HOH A O   1 
HETATM 721 O  O   . HOH D 3 .  ? -13.947 13.678 8.895   1.00 19.98 ? 2037 HOH A O   1 
HETATM 722 O  O   . HOH D 3 .  ? -1.729  17.626 10.742  1.00 39.34 ? 2038 HOH A O   1 
HETATM 723 O  O   . HOH D 3 .  ? -8.928  16.135 9.258   1.00 31.24 ? 2039 HOH A O   1 
HETATM 724 O  O   . HOH D 3 .  ? -3.984  15.532 5.731   1.00 43.01 ? 2040 HOH A O   1 
HETATM 725 O  O   . HOH D 3 .  ? -2.819  13.456 -5.625  1.00 38.71 ? 2041 HOH A O   1 
HETATM 726 O  O   . HOH D 3 .  ? 1.536   19.025 -4.231  1.00 30.52 ? 2042 HOH A O   1 
HETATM 727 O  O   . HOH D 3 .  ? -0.880  17.540 -7.370  1.00 26.31 ? 2043 HOH A O   1 
HETATM 728 O  O   . HOH D 3 .  ? -1.548  12.786 0.066   1.00 41.49 ? 2044 HOH A O   1 
HETATM 729 O  O   . HOH D 3 .  ? -13.540 18.217 -7.357  1.00 35.77 ? 2045 HOH A O   1 
HETATM 730 O  O   . HOH D 3 .  ? -11.966 16.857 -8.868  1.00 32.69 ? 2046 HOH A O   1 
HETATM 731 O  O   . HOH D 3 .  ? -10.242 20.029 -10.090 1.00 38.12 ? 2047 HOH A O   1 
HETATM 732 O  O   . HOH D 3 .  ? -11.307 26.644 -9.990  1.00 41.37 ? 2048 HOH A O   1 
HETATM 733 O  O   . HOH D 3 .  ? -20.760 20.768 0.083   1.00 36.99 ? 2049 HOH A O   1 
HETATM 734 O  O   . HOH D 3 .  ? -17.104 22.801 7.405   1.00 34.57 ? 2050 HOH A O   1 
HETATM 735 O  O   . HOH D 3 .  ? -20.653 28.982 6.563   1.00 34.08 ? 2051 HOH A O   1 
HETATM 736 O  O   . HOH D 3 .  ? 8.549   33.015 12.797  1.00 31.14 ? 2052 HOH A O   1 
HETATM 737 O  O   . HOH D 3 .  ? 5.504   28.065 10.013  1.00 28.47 ? 2053 HOH A O   1 
HETATM 738 O  O   . HOH D 3 .  ? 7.290   29.262 11.382  1.00 30.25 ? 2054 HOH A O   1 
HETATM 739 O  O   . HOH D 3 .  ? 4.852   24.256 9.741   1.00 20.37 ? 2055 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  9  9  GLY GLY A . n 
A 1 2  MET 2  10 10 MET MET A . n 
A 1 3  LEU 3  11 11 LEU LEU A . n 
A 1 4  PRO 4  12 12 PRO PRO A . n 
A 1 5  ARG 5  13 13 ARG ARG A . n 
A 1 6  LEU 6  14 14 LEU LEU A . n 
A 1 7  CYS 7  15 15 CYS CYS A . n 
A 1 8  CYS 8  16 16 CYS CYS A . n 
A 1 9  LEU 9  17 17 LEU LEU A . n 
A 1 10 GLU 10 18 18 GLU GLU A . n 
A 1 11 LYS 11 19 19 LYS LYS A . n 
A 1 12 GLY 12 20 20 GLY GLY A . n 
A 1 13 PRO 13 21 21 PRO PRO A . n 
A 1 14 ASN 14 22 22 ASN ASN A . n 
A 1 15 GLY 15 23 23 GLY GLY A . n 
A 1 16 TYR 16 24 24 TYR TYR A . n 
A 1 17 GLY 17 25 25 GLY GLY A . n 
A 1 18 PHE 18 26 26 PHE PHE A . n 
A 1 19 HIS 19 27 27 HIS HIS A . n 
A 1 20 LEU 20 28 28 LEU LEU A . n 
A 1 21 HIS 21 29 29 HIS HIS A . n 
A 1 22 GLY 22 30 30 GLY GLY A . n 
A 1 23 GLU 23 31 31 GLU GLU A . n 
A 1 24 LYS 24 32 32 LYS LYS A . n 
A 1 25 GLY 25 33 33 GLY GLY A . n 
A 1 26 LYS 26 34 34 LYS LYS A . n 
A 1 27 LEU 27 35 35 LEU LEU A . n 
A 1 28 GLY 28 36 36 GLY GLY A . n 
A 1 29 GLN 29 37 37 GLN GLN A . n 
A 1 30 TYR 30 38 38 TYR TYR A . n 
A 1 31 ILE 31 39 39 ILE ILE A . n 
A 1 32 ARG 32 40 40 ARG ARG A . n 
A 1 33 LEU 33 41 41 LEU LEU A . n 
A 1 34 VAL 34 42 42 VAL VAL A . n 
A 1 35 GLU 35 43 43 GLU GLU A . n 
A 1 36 PRO 36 44 44 PRO PRO A . n 
A 1 37 GLY 37 45 45 GLY GLY A . n 
A 1 38 SER 38 46 46 SER SER A . n 
A 1 39 PRO 39 47 47 PRO PRO A . n 
A 1 40 ALA 40 48 48 ALA ALA A . n 
A 1 41 GLU 41 49 49 GLU GLU A . n 
A 1 42 LYS 42 50 50 LYS LYS A . n 
A 1 43 ALA 43 51 51 ALA ALA A . n 
A 1 44 GLY 44 52 52 GLY GLY A . n 
A 1 45 LEU 45 53 53 LEU LEU A . n 
A 1 46 LEU 46 54 54 LEU LEU A . n 
A 1 47 ALA 47 55 55 ALA ALA A . n 
A 1 48 GLY 48 56 56 GLY GLY A . n 
A 1 49 ASP 49 57 57 ASP ASP A . n 
A 1 50 ARG 50 58 58 ARG ARG A . n 
A 1 51 LEU 51 59 59 LEU LEU A . n 
A 1 52 VAL 52 60 60 VAL VAL A . n 
A 1 53 GLU 53 61 61 GLU GLU A . n 
A 1 54 VAL 54 62 62 VAL VAL A . n 
A 1 55 ASN 55 63 63 ASN ASN A . n 
A 1 56 GLY 56 64 64 GLY GLY A . n 
A 1 57 GLU 57 65 65 GLU GLU A . n 
A 1 58 ASN 58 66 66 ASN ASN A . n 
A 1 59 VAL 59 67 67 VAL VAL A . n 
A 1 60 GLU 60 68 68 GLU GLU A . n 
A 1 61 LYS 61 69 69 LYS LYS A . n 
A 1 62 GLU 62 70 70 GLU GLU A . n 
A 1 63 THR 63 71 71 THR THR A . n 
A 1 64 HIS 64 72 72 HIS HIS A . n 
A 1 65 GLN 65 73 73 GLN GLN A . n 
A 1 66 GLN 66 74 74 GLN GLN A . n 
A 1 67 VAL 67 75 75 VAL VAL A . n 
A 1 68 VAL 68 76 76 VAL VAL A . n 
A 1 69 SER 69 77 77 SER SER A . n 
A 1 70 ARG 70 78 78 ARG ARG A . n 
A 1 71 ILE 71 79 79 ILE ILE A . n 
A 1 72 ARG 72 80 80 ARG ARG A . n 
A 1 73 ALA 73 81 81 ALA ALA A . n 
A 1 74 ALA 74 82 82 ALA ALA A . n 
A 1 75 LEU 75 83 83 LEU LEU A . n 
A 1 76 ASN 76 84 84 ASN ASN A . n 
A 1 77 ALA 77 85 85 ALA ALA A . n 
A 1 78 VAL 78 86 86 VAL VAL A . n 
A 1 79 ARG 79 87 87 ARG ARG A . n 
A 1 80 LEU 80 88 88 LEU LEU A . n 
A 1 81 LEU 81 89 89 LEU LEU A . n 
A 1 82 VAL 82 90 90 VAL VAL A . n 
A 1 83 VAL 83 91 91 VAL VAL A . n 
A 1 84 ASP 84 92 92 ASP ASP A . n 
A 1 85 PRO 85 93 93 PRO PRO A . n 
A 1 86 GLU 86 94 94 GLU GLU A . n 
A 1 87 GLU 87 95 95 GLU GLU A . n 
A 1 88 ASP 88 96 96 ASP ASP A . n 
A 1 89 SER 89 97 97 SER SER A . n 
A 1 90 PHE 90 98 98 PHE PHE A . n 
A 1 91 LEU 91 99 99 LEU LEU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CL  1  1100 1100 CL  CL  A . 
C 2 CL  1  1101 1101 CL  CL  A . 
D 3 HOH 1  2001 2001 HOH HOH A . 
D 3 HOH 2  2002 2002 HOH HOH A . 
D 3 HOH 3  2003 2003 HOH HOH A . 
D 3 HOH 4  2004 2004 HOH HOH A . 
D 3 HOH 5  2005 2005 HOH HOH A . 
D 3 HOH 6  2006 2006 HOH HOH A . 
D 3 HOH 7  2007 2007 HOH HOH A . 
D 3 HOH 8  2008 2008 HOH HOH A . 
D 3 HOH 9  2009 2009 HOH HOH A . 
D 3 HOH 10 2010 2010 HOH HOH A . 
D 3 HOH 11 2011 2011 HOH HOH A . 
D 3 HOH 12 2012 2012 HOH HOH A . 
D 3 HOH 13 2013 2013 HOH HOH A . 
D 3 HOH 14 2014 2014 HOH HOH A . 
D 3 HOH 15 2015 2015 HOH HOH A . 
D 3 HOH 16 2016 2016 HOH HOH A . 
D 3 HOH 17 2017 2017 HOH HOH A . 
D 3 HOH 18 2018 2018 HOH HOH A . 
D 3 HOH 19 2019 2019 HOH HOH A . 
D 3 HOH 20 2020 2020 HOH HOH A . 
D 3 HOH 21 2021 2021 HOH HOH A . 
D 3 HOH 22 2022 2022 HOH HOH A . 
D 3 HOH 23 2023 2023 HOH HOH A . 
D 3 HOH 24 2024 2024 HOH HOH A . 
D 3 HOH 25 2025 2025 HOH HOH A . 
D 3 HOH 26 2026 2026 HOH HOH A . 
D 3 HOH 27 2027 2027 HOH HOH A . 
D 3 HOH 28 2028 2028 HOH HOH A . 
D 3 HOH 29 2029 2029 HOH HOH A . 
D 3 HOH 30 2030 2030 HOH HOH A . 
D 3 HOH 31 2031 2031 HOH HOH A . 
D 3 HOH 32 2032 2032 HOH HOH A . 
D 3 HOH 33 2033 2033 HOH HOH A . 
D 3 HOH 34 2034 2034 HOH HOH A . 
D 3 HOH 35 2035 2035 HOH HOH A . 
D 3 HOH 36 2036 2036 HOH HOH A . 
D 3 HOH 37 2037 2037 HOH HOH A . 
D 3 HOH 38 2038 2038 HOH HOH A . 
D 3 HOH 39 2039 2039 HOH HOH A . 
D 3 HOH 40 2040 2040 HOH HOH A . 
D 3 HOH 41 2041 2041 HOH HOH A . 
D 3 HOH 42 2042 2042 HOH HOH A . 
D 3 HOH 43 2043 2043 HOH HOH A . 
D 3 HOH 44 2044 2044 HOH HOH A . 
D 3 HOH 45 2045 2045 HOH HOH A . 
D 3 HOH 46 2046 2046 HOH HOH A . 
D 3 HOH 47 2047 2047 HOH HOH A . 
D 3 HOH 48 2048 2048 HOH HOH A . 
D 3 HOH 49 2049 2049 HOH HOH A . 
D 3 HOH 50 2050 2050 HOH HOH A . 
D 3 HOH 51 2051 2051 HOH HOH A . 
D 3 HOH 52 2052 2052 HOH HOH A . 
D 3 HOH 53 2053 2053 HOH HOH A . 
D 3 HOH 54 2054 2054 HOH HOH A . 
D 3 HOH 55 2055 2055 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-11-14 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
MOLREP    phasing          . ? 4 
# 
_pdbx_entry_details.entry_id             1GQ5 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;RESIDUES 9-10 ARE CLONING ARTIFACTS. THE AMINO ACID RESIDUES
95-99 OF PDZ1 CORRESPOND TO THE CARBOXYL-TERMINAL REGION
1102-1106 OF PDGFR AND SERVE AS A LIGAND FOR A NEIGHBOURING
PDZ1 MOLECULE IN THE CRYSTAL.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 22 ? ? -96.22 37.67  
2 1 LYS A 32 ? ? -39.88 132.23 
3 1 LEU A 41 ? ? 51.37  70.09  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 31 ? CG  ? A GLU 23 CG  
2  1 Y 1 A GLU 31 ? CD  ? A GLU 23 CD  
3  1 Y 1 A GLU 31 ? OE1 ? A GLU 23 OE1 
4  1 Y 1 A GLU 31 ? OE2 ? A GLU 23 OE2 
5  1 Y 1 A LYS 32 ? CG  ? A LYS 24 CG  
6  1 Y 1 A LYS 32 ? CD  ? A LYS 24 CD  
7  1 Y 1 A LYS 32 ? CE  ? A LYS 24 CE  
8  1 Y 1 A LYS 32 ? NZ  ? A LYS 24 NZ  
9  1 Y 1 A LYS 34 ? CG  ? A LYS 26 CG  
10 1 Y 1 A LYS 34 ? CD  ? A LYS 26 CD  
11 1 Y 1 A LYS 34 ? CE  ? A LYS 26 CE  
12 1 Y 1 A LYS 34 ? NZ  ? A LYS 26 NZ  
13 1 Y 1 A LYS 69 ? CG  ? A LYS 61 CG  
14 1 Y 1 A LYS 69 ? CD  ? A LYS 61 CD  
15 1 Y 1 A LYS 69 ? CE  ? A LYS 61 CE  
16 1 Y 1 A LYS 69 ? NZ  ? A LYS 61 NZ  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION' CL  
3 water          HOH 
#